data_6XXD
# 
_entry.id   6XXD 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.325 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6XXD         
WWPDB D_1292106453 
EMDB  EMD-10647    
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        'CryoEM structure of the Type IV pilin PilA4 from Thermus thermophilus' 
_pdbx_database_related.db_id          EMD-10647 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6XXD 
_pdbx_database_status.recvd_initial_deposition_date   2020-01-27 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Neuhaus, A.'  1 0000-0003-0477-3281 
'Gold, V.A.M.' 2 0000-0002-6908-0745 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            11 
_citation.language                  ? 
_citation.page_first                2231 
_citation.page_last                 2231 
_citation.title                     'Cryo-electron microscopy reveals two distinct type IV pili assembled by the same bacterium.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-020-15650-w 
_citation.pdbx_database_id_PubMed   32376942 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Neuhaus, A.'  1  ? 
primary 'Selvaraj, M.' 2  ? 
primary 'Salzer, R.'   3  ? 
primary 'Langer, J.D.' 4  ? 
primary 'Kruse, K.'    5  ? 
primary 'Kirchner, L.' 6  ? 
primary 'Sanders, K.'  7  ? 
primary 'Daum, B.'     8  ? 
primary 'Averhoff, B.' 9  ? 
primary 'Gold, V.A.M.' 10 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 nat 
_entity.pdbx_description           PilA 
_entity.formula_weight             13251.123 
_entity.pdbx_number_of_molecules   16 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    
'Sequence corresponds to the mature protein. The first 6 residues are removed by prepilin peptidase.' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;FTLIELLIVIAIIAILAAVLIPNLLAARKRANDTVVTAYLNDAVKFQEMYQIDNNSYTSNQAALISLGLKSTPANVTFSI
VSASANSYCMIAGHSGGTVWFAATPDKGVYKTNTAVTSSQPESCP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;FTLIELLIVIAIIAILAAVLIPNLLAARKRANDTVVTAYLNDAVKFQEMYQIDNNSYTSNQAALISLGLKSTPANVTFSI
VSASANSYCMIAGHSGGTVWFAATPDKGVYKTNTAVTSSQPESCP
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PHE n 
1 2   THR n 
1 3   LEU n 
1 4   ILE n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   ILE n 
1 9   VAL n 
1 10  ILE n 
1 11  ALA n 
1 12  ILE n 
1 13  ILE n 
1 14  ALA n 
1 15  ILE n 
1 16  LEU n 
1 17  ALA n 
1 18  ALA n 
1 19  VAL n 
1 20  LEU n 
1 21  ILE n 
1 22  PRO n 
1 23  ASN n 
1 24  LEU n 
1 25  LEU n 
1 26  ALA n 
1 27  ALA n 
1 28  ARG n 
1 29  LYS n 
1 30  ARG n 
1 31  ALA n 
1 32  ASN n 
1 33  ASP n 
1 34  THR n 
1 35  VAL n 
1 36  VAL n 
1 37  THR n 
1 38  ALA n 
1 39  TYR n 
1 40  LEU n 
1 41  ASN n 
1 42  ASP n 
1 43  ALA n 
1 44  VAL n 
1 45  LYS n 
1 46  PHE n 
1 47  GLN n 
1 48  GLU n 
1 49  MET n 
1 50  TYR n 
1 51  GLN n 
1 52  ILE n 
1 53  ASP n 
1 54  ASN n 
1 55  ASN n 
1 56  SER n 
1 57  TYR n 
1 58  THR n 
1 59  SER n 
1 60  ASN n 
1 61  GLN n 
1 62  ALA n 
1 63  ALA n 
1 64  LEU n 
1 65  ILE n 
1 66  SER n 
1 67  LEU n 
1 68  GLY n 
1 69  LEU n 
1 70  LYS n 
1 71  SER n 
1 72  THR n 
1 73  PRO n 
1 74  ALA n 
1 75  ASN n 
1 76  VAL n 
1 77  THR n 
1 78  PHE n 
1 79  SER n 
1 80  ILE n 
1 81  VAL n 
1 82  SER n 
1 83  ALA n 
1 84  SER n 
1 85  ALA n 
1 86  ASN n 
1 87  SER n 
1 88  TYR n 
1 89  CYS n 
1 90  MET n 
1 91  ILE n 
1 92  ALA n 
1 93  GLY n 
1 94  HIS n 
1 95  SER n 
1 96  GLY n 
1 97  GLY n 
1 98  THR n 
1 99  VAL n 
1 100 TRP n 
1 101 PHE n 
1 102 ALA n 
1 103 ALA n 
1 104 THR n 
1 105 PRO n 
1 106 ASP n 
1 107 LYS n 
1 108 GLY n 
1 109 VAL n 
1 110 TYR n 
1 111 LYS n 
1 112 THR n 
1 113 ASN n 
1 114 THR n 
1 115 ALA n 
1 116 VAL n 
1 117 THR n 
1 118 SER n 
1 119 SER n 
1 120 GLN n 
1 121 PRO n 
1 122 GLU n 
1 123 SER n 
1 124 CYS n 
1 125 PRO n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           1 
_entity_src_nat.pdbx_end_seq_num           125 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039)' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      262724 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q72JC0_THET2 
_struct_ref.pdbx_db_accession          Q72JC0 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;FTLIELLIVIAIIAILAAVLIPNLLAARKRANDTVVTAYLNDAVKFQEMYQIDNNSYTSNQAALISLGLKSTPANVTFSI
VSASANSYCMIAGHSGGTVWFAATPDKGVYKTNTAVTSSQPESCP
;
_struct_ref.pdbx_align_begin           7 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6XXD A 1 ? 125 ? Q72JC0 7 ? 131 ? 1 125 
2  1 6XXD B 1 ? 125 ? Q72JC0 7 ? 131 ? 1 125 
3  1 6XXD C 1 ? 125 ? Q72JC0 7 ? 131 ? 1 125 
4  1 6XXD D 1 ? 125 ? Q72JC0 7 ? 131 ? 1 125 
5  1 6XXD E 1 ? 125 ? Q72JC0 7 ? 131 ? 1 125 
6  1 6XXD F 1 ? 125 ? Q72JC0 7 ? 131 ? 1 125 
7  1 6XXD G 1 ? 125 ? Q72JC0 7 ? 131 ? 1 125 
8  1 6XXD H 1 ? 125 ? Q72JC0 7 ? 131 ? 1 125 
9  1 6XXD I 1 ? 125 ? Q72JC0 7 ? 131 ? 1 125 
10 1 6XXD J 1 ? 125 ? Q72JC0 7 ? 131 ? 1 125 
11 1 6XXD K 1 ? 125 ? Q72JC0 7 ? 131 ? 1 125 
12 1 6XXD L 1 ? 125 ? Q72JC0 7 ? 131 ? 1 125 
13 1 6XXD M 1 ? 125 ? Q72JC0 7 ? 131 ? 1 125 
14 1 6XXD N 1 ? 125 ? Q72JC0 7 ? 131 ? 1 125 
15 1 6XXD O 1 ? 125 ? Q72JC0 7 ? 131 ? 1 125 
16 1 6XXD P 1 ? 125 ? Q72JC0 7 ? 131 ? 1 125 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6XXD 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_struct.entry_id                     6XXD 
_struct.title                        'CryoEM structure of the type IV pilin PilA4 from Thermus thermophilus' 
_struct.pdbx_descriptor              PilA 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6XXD 
_struct_keywords.text            'Type IV pilin glycosylation twitching motility, CELL ADHESION' 
_struct_keywords.pdbx_keywords   'CELL ADHESION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 1 ? 
H N N 1 ? 
I N N 1 ? 
J N N 1 ? 
K N N 1 ? 
L N N 1 ? 
M N N 1 ? 
N N N 1 ? 
O N N 1 ? 
P N N 1 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR A 2  ? LEU A 20 ? THR A 2  LEU A 20 1 ? 19 
HELX_P HELX_P2  AA2 ASN A 23 ? ASN A 55 ? ASN A 23 ASN A 55 1 ? 33 
HELX_P HELX_P3  AA3 ASN A 60 ? GLY A 68 ? ASN A 60 GLY A 68 1 ? 9  
HELX_P HELX_P4  AA4 THR B 2  ? LEU B 20 ? THR B 2  LEU B 20 1 ? 19 
HELX_P HELX_P5  AA5 ASN B 23 ? ASN B 55 ? ASN B 23 ASN B 55 1 ? 33 
HELX_P HELX_P6  AA6 ASN B 60 ? GLY B 68 ? ASN B 60 GLY B 68 1 ? 9  
HELX_P HELX_P7  AA7 THR C 2  ? LEU C 20 ? THR C 2  LEU C 20 1 ? 19 
HELX_P HELX_P8  AA8 ASN C 23 ? ASN C 55 ? ASN C 23 ASN C 55 1 ? 33 
HELX_P HELX_P9  AA9 ASN C 60 ? GLY C 68 ? ASN C 60 GLY C 68 1 ? 9  
HELX_P HELX_P10 AB1 THR D 2  ? LEU D 20 ? THR D 2  LEU D 20 1 ? 19 
HELX_P HELX_P11 AB2 ASN D 23 ? ASN D 55 ? ASN D 23 ASN D 55 1 ? 33 
HELX_P HELX_P12 AB3 ASN D 60 ? GLY D 68 ? ASN D 60 GLY D 68 1 ? 9  
HELX_P HELX_P13 AB4 THR E 2  ? LEU E 20 ? THR E 2  LEU E 20 1 ? 19 
HELX_P HELX_P14 AB5 ASN E 23 ? ASN E 55 ? ASN E 23 ASN E 55 1 ? 33 
HELX_P HELX_P15 AB6 ASN E 60 ? GLY E 68 ? ASN E 60 GLY E 68 1 ? 9  
HELX_P HELX_P16 AB7 THR F 2  ? LEU F 20 ? THR F 2  LEU F 20 1 ? 19 
HELX_P HELX_P17 AB8 ASN F 23 ? ASN F 55 ? ASN F 23 ASN F 55 1 ? 33 
HELX_P HELX_P18 AB9 ASN F 60 ? GLY F 68 ? ASN F 60 GLY F 68 1 ? 9  
HELX_P HELX_P19 AC1 THR G 2  ? LEU G 20 ? THR G 2  LEU G 20 1 ? 19 
HELX_P HELX_P20 AC2 ASN G 23 ? ASN G 55 ? ASN G 23 ASN G 55 1 ? 33 
HELX_P HELX_P21 AC3 ASN G 60 ? GLY G 68 ? ASN G 60 GLY G 68 1 ? 9  
HELX_P HELX_P22 AC4 THR H 2  ? LEU H 20 ? THR H 2  LEU H 20 1 ? 19 
HELX_P HELX_P23 AC5 ASN H 23 ? ASN H 55 ? ASN H 23 ASN H 55 1 ? 33 
HELX_P HELX_P24 AC6 ASN H 60 ? GLY H 68 ? ASN H 60 GLY H 68 1 ? 9  
HELX_P HELX_P25 AC7 THR I 2  ? LEU I 20 ? THR I 2  LEU I 20 1 ? 19 
HELX_P HELX_P26 AC8 ASN I 23 ? ASN I 55 ? ASN I 23 ASN I 55 1 ? 33 
HELX_P HELX_P27 AC9 ASN I 60 ? GLY I 68 ? ASN I 60 GLY I 68 1 ? 9  
HELX_P HELX_P28 AD1 THR J 2  ? LEU J 20 ? THR J 2  LEU J 20 1 ? 19 
HELX_P HELX_P29 AD2 ASN J 23 ? ASN J 55 ? ASN J 23 ASN J 55 1 ? 33 
HELX_P HELX_P30 AD3 ASN J 60 ? GLY J 68 ? ASN J 60 GLY J 68 1 ? 9  
HELX_P HELX_P31 AD4 THR K 2  ? LEU K 20 ? THR K 2  LEU K 20 1 ? 19 
HELX_P HELX_P32 AD5 ASN K 23 ? ASN K 55 ? ASN K 23 ASN K 55 1 ? 33 
HELX_P HELX_P33 AD6 ASN K 60 ? GLY K 68 ? ASN K 60 GLY K 68 1 ? 9  
HELX_P HELX_P34 AD7 THR L 2  ? LEU L 20 ? THR L 2  LEU L 20 1 ? 19 
HELX_P HELX_P35 AD8 ASN L 23 ? ASN L 55 ? ASN L 23 ASN L 55 1 ? 33 
HELX_P HELX_P36 AD9 ASN L 60 ? GLY L 68 ? ASN L 60 GLY L 68 1 ? 9  
HELX_P HELX_P37 AE1 THR M 2  ? LEU M 20 ? THR M 2  LEU M 20 1 ? 19 
HELX_P HELX_P38 AE2 ASN M 23 ? ASN M 55 ? ASN M 23 ASN M 55 1 ? 33 
HELX_P HELX_P39 AE3 ASN M 60 ? GLY M 68 ? ASN M 60 GLY M 68 1 ? 9  
HELX_P HELX_P40 AE4 THR N 2  ? LEU N 20 ? THR N 2  LEU N 20 1 ? 19 
HELX_P HELX_P41 AE5 ASN N 23 ? ASN N 55 ? ASN N 23 ASN N 55 1 ? 33 
HELX_P HELX_P42 AE6 ASN N 60 ? GLY N 68 ? ASN N 60 GLY N 68 1 ? 9  
HELX_P HELX_P43 AE7 THR O 2  ? LEU O 20 ? THR O 2  LEU O 20 1 ? 19 
HELX_P HELX_P44 AE8 ASN O 23 ? ASN O 55 ? ASN O 23 ASN O 55 1 ? 33 
HELX_P HELX_P45 AE9 ASN O 60 ? GLY O 68 ? ASN O 60 GLY O 68 1 ? 9  
HELX_P HELX_P46 AF1 THR P 2  ? LEU P 20 ? THR P 2  LEU P 20 1 ? 19 
HELX_P HELX_P47 AF2 ASN P 23 ? ASN P 55 ? ASN P 23 ASN P 55 1 ? 33 
HELX_P HELX_P48 AF3 ASN P 60 ? GLY P 68 ? ASN P 60 GLY P 68 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 89 SG ? ? ? 1_555 A CYS 124 SG ? ? A CYS 89 A CYS 124 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf2  disulf ? ? B CYS 89 SG ? ? ? 1_555 B CYS 124 SG ? ? B CYS 89 B CYS 124 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf3  disulf ? ? C CYS 89 SG ? ? ? 1_555 C CYS 124 SG ? ? C CYS 89 C CYS 124 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf4  disulf ? ? D CYS 89 SG ? ? ? 1_555 D CYS 124 SG ? ? D CYS 89 D CYS 124 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf5  disulf ? ? E CYS 89 SG ? ? ? 1_555 E CYS 124 SG ? ? E CYS 89 E CYS 124 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf6  disulf ? ? F CYS 89 SG ? ? ? 1_555 F CYS 124 SG ? ? F CYS 89 F CYS 124 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf7  disulf ? ? G CYS 89 SG ? ? ? 1_555 G CYS 124 SG ? ? G CYS 89 G CYS 124 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf8  disulf ? ? H CYS 89 SG ? ? ? 1_555 H CYS 124 SG ? ? H CYS 89 H CYS 124 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf9  disulf ? ? I CYS 89 SG ? ? ? 1_555 I CYS 124 SG ? ? I CYS 89 I CYS 124 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf10 disulf ? ? J CYS 89 SG ? ? ? 1_555 J CYS 124 SG ? ? J CYS 89 J CYS 124 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf11 disulf ? ? K CYS 89 SG ? ? ? 1_555 K CYS 124 SG ? ? K CYS 89 K CYS 124 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf12 disulf ? ? L CYS 89 SG ? ? ? 1_555 L CYS 124 SG ? ? L CYS 89 L CYS 124 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf13 disulf ? ? M CYS 89 SG ? ? ? 1_555 M CYS 124 SG ? ? M CYS 89 M CYS 124 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf14 disulf ? ? N CYS 89 SG ? ? ? 1_555 N CYS 124 SG ? ? N CYS 89 N CYS 124 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf15 disulf ? ? O CYS 89 SG ? ? ? 1_555 O CYS 124 SG ? ? O CYS 89 O CYS 124 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf16 disulf ? ? P CYS 89 SG ? ? ? 1_555 P CYS 124 SG ? ? P CYS 89 P CYS 124 1_555 ? ? ? ? ? ? ? 2.034 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
AB2 ? 2 ? 
AB3 ? 2 ? 
AB4 ? 2 ? 
AB5 ? 2 ? 
AB6 ? 2 ? 
AB7 ? 2 ? 
AB8 ? 2 ? 
AB9 ? 2 ? 
AC1 ? 2 ? 
AC2 ? 2 ? 
AC3 ? 2 ? 
AC4 ? 2 ? 
AC5 ? 2 ? 
AC6 ? 2 ? 
AC7 ? 2 ? 
AC8 ? 2 ? 
AC9 ? 2 ? 
AD1 ? 2 ? 
AD2 ? 2 ? 
AD3 ? 2 ? 
AD4 ? 2 ? 
AD5 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD5 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 SER A 79  ? SER A 82  ? SER A 79  SER A 82  
AA1 2 CYS A 89  ? ILE A 91  ? CYS A 89  ILE A 91  
AA2 1 VAL A 99  ? THR A 104 ? VAL A 99  THR A 104 
AA2 2 GLY A 108 ? ALA A 115 ? GLY A 108 ALA A 115 
AA3 1 SER B 79  ? SER B 82  ? SER B 79  SER B 82  
AA3 2 CYS B 89  ? ILE B 91  ? CYS B 89  ILE B 91  
AA4 1 VAL B 99  ? THR B 104 ? VAL B 99  THR B 104 
AA4 2 GLY B 108 ? ALA B 115 ? GLY B 108 ALA B 115 
AA5 1 SER C 79  ? SER C 82  ? SER C 79  SER C 82  
AA5 2 CYS C 89  ? ILE C 91  ? CYS C 89  ILE C 91  
AA6 1 VAL C 99  ? THR C 104 ? VAL C 99  THR C 104 
AA6 2 GLY C 108 ? ALA C 115 ? GLY C 108 ALA C 115 
AA7 1 SER D 79  ? SER D 82  ? SER D 79  SER D 82  
AA7 2 CYS D 89  ? ILE D 91  ? CYS D 89  ILE D 91  
AA8 1 VAL D 99  ? THR D 104 ? VAL D 99  THR D 104 
AA8 2 GLY D 108 ? ALA D 115 ? GLY D 108 ALA D 115 
AA9 1 SER E 79  ? SER E 82  ? SER E 79  SER E 82  
AA9 2 CYS E 89  ? ILE E 91  ? CYS E 89  ILE E 91  
AB1 1 VAL E 99  ? THR E 104 ? VAL E 99  THR E 104 
AB1 2 GLY E 108 ? ALA E 115 ? GLY E 108 ALA E 115 
AB2 1 SER F 79  ? SER F 82  ? SER F 79  SER F 82  
AB2 2 CYS F 89  ? ILE F 91  ? CYS F 89  ILE F 91  
AB3 1 VAL F 99  ? THR F 104 ? VAL F 99  THR F 104 
AB3 2 GLY F 108 ? ALA F 115 ? GLY F 108 ALA F 115 
AB4 1 SER G 79  ? SER G 82  ? SER G 79  SER G 82  
AB4 2 CYS G 89  ? ILE G 91  ? CYS G 89  ILE G 91  
AB5 1 VAL G 99  ? THR G 104 ? VAL G 99  THR G 104 
AB5 2 GLY G 108 ? ALA G 115 ? GLY G 108 ALA G 115 
AB6 1 SER H 79  ? SER H 82  ? SER H 79  SER H 82  
AB6 2 CYS H 89  ? ILE H 91  ? CYS H 89  ILE H 91  
AB7 1 VAL H 99  ? THR H 104 ? VAL H 99  THR H 104 
AB7 2 GLY H 108 ? ALA H 115 ? GLY H 108 ALA H 115 
AB8 1 SER I 79  ? SER I 82  ? SER I 79  SER I 82  
AB8 2 CYS I 89  ? ILE I 91  ? CYS I 89  ILE I 91  
AB9 1 VAL I 99  ? THR I 104 ? VAL I 99  THR I 104 
AB9 2 GLY I 108 ? ALA I 115 ? GLY I 108 ALA I 115 
AC1 1 SER J 79  ? SER J 82  ? SER J 79  SER J 82  
AC1 2 CYS J 89  ? ILE J 91  ? CYS J 89  ILE J 91  
AC2 1 VAL J 99  ? THR J 104 ? VAL J 99  THR J 104 
AC2 2 GLY J 108 ? ALA J 115 ? GLY J 108 ALA J 115 
AC3 1 SER K 79  ? SER K 82  ? SER K 79  SER K 82  
AC3 2 CYS K 89  ? ILE K 91  ? CYS K 89  ILE K 91  
AC4 1 VAL K 99  ? THR K 104 ? VAL K 99  THR K 104 
AC4 2 GLY K 108 ? ALA K 115 ? GLY K 108 ALA K 115 
AC5 1 SER L 79  ? SER L 82  ? SER L 79  SER L 82  
AC5 2 CYS L 89  ? ILE L 91  ? CYS L 89  ILE L 91  
AC6 1 VAL L 99  ? THR L 104 ? VAL L 99  THR L 104 
AC6 2 GLY L 108 ? ALA L 115 ? GLY L 108 ALA L 115 
AC7 1 SER M 79  ? SER M 82  ? SER M 79  SER M 82  
AC7 2 CYS M 89  ? ILE M 91  ? CYS M 89  ILE M 91  
AC8 1 VAL M 99  ? THR M 104 ? VAL M 99  THR M 104 
AC8 2 GLY M 108 ? ALA M 115 ? GLY M 108 ALA M 115 
AC9 1 SER N 79  ? SER N 82  ? SER N 79  SER N 82  
AC9 2 CYS N 89  ? ILE N 91  ? CYS N 89  ILE N 91  
AD1 1 VAL N 99  ? THR N 104 ? VAL N 99  THR N 104 
AD1 2 GLY N 108 ? ALA N 115 ? GLY N 108 ALA N 115 
AD2 1 SER O 79  ? SER O 82  ? SER O 79  SER O 82  
AD2 2 CYS O 89  ? ILE O 91  ? CYS O 89  ILE O 91  
AD3 1 VAL O 99  ? THR O 104 ? VAL O 99  THR O 104 
AD3 2 GLY O 108 ? ALA O 115 ? GLY O 108 ALA O 115 
AD4 1 SER P 79  ? SER P 82  ? SER P 79  SER P 82  
AD4 2 CYS P 89  ? ILE P 91  ? CYS P 89  ILE P 91  
AD5 1 VAL P 99  ? THR P 104 ? VAL P 99  THR P 104 
AD5 2 GLY P 108 ? ALA P 115 ? GLY P 108 ALA P 115 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 81  ? N VAL A 81  O CYS A 89  ? O CYS A 89  
AA2 1 2 N TRP A 100 ? N TRP A 100 O THR A 112 ? O THR A 112 
AA3 1 2 N VAL B 81  ? N VAL B 81  O CYS B 89  ? O CYS B 89  
AA4 1 2 N TRP B 100 ? N TRP B 100 O THR B 112 ? O THR B 112 
AA5 1 2 N VAL C 81  ? N VAL C 81  O CYS C 89  ? O CYS C 89  
AA6 1 2 N TRP C 100 ? N TRP C 100 O THR C 112 ? O THR C 112 
AA7 1 2 N VAL D 81  ? N VAL D 81  O CYS D 89  ? O CYS D 89  
AA8 1 2 N TRP D 100 ? N TRP D 100 O THR D 112 ? O THR D 112 
AA9 1 2 N VAL E 81  ? N VAL E 81  O CYS E 89  ? O CYS E 89  
AB1 1 2 N TRP E 100 ? N TRP E 100 O THR E 112 ? O THR E 112 
AB2 1 2 N VAL F 81  ? N VAL F 81  O CYS F 89  ? O CYS F 89  
AB3 1 2 N TRP F 100 ? N TRP F 100 O THR F 112 ? O THR F 112 
AB4 1 2 N VAL G 81  ? N VAL G 81  O CYS G 89  ? O CYS G 89  
AB5 1 2 N TRP G 100 ? N TRP G 100 O THR G 112 ? O THR G 112 
AB6 1 2 N VAL H 81  ? N VAL H 81  O CYS H 89  ? O CYS H 89  
AB7 1 2 N TRP H 100 ? N TRP H 100 O THR H 112 ? O THR H 112 
AB8 1 2 N VAL I 81  ? N VAL I 81  O CYS I 89  ? O CYS I 89  
AB9 1 2 N TRP I 100 ? N TRP I 100 O THR I 112 ? O THR I 112 
AC1 1 2 N VAL J 81  ? N VAL J 81  O CYS J 89  ? O CYS J 89  
AC2 1 2 N TRP J 100 ? N TRP J 100 O THR J 112 ? O THR J 112 
AC3 1 2 N VAL K 81  ? N VAL K 81  O CYS K 89  ? O CYS K 89  
AC4 1 2 N TRP K 100 ? N TRP K 100 O THR K 112 ? O THR K 112 
AC5 1 2 N VAL L 81  ? N VAL L 81  O CYS L 89  ? O CYS L 89  
AC6 1 2 N TRP L 100 ? N TRP L 100 O THR L 112 ? O THR L 112 
AC7 1 2 N VAL M 81  ? N VAL M 81  O CYS M 89  ? O CYS M 89  
AC8 1 2 N TRP M 100 ? N TRP M 100 O THR M 112 ? O THR M 112 
AC9 1 2 N VAL N 81  ? N VAL N 81  O CYS N 89  ? O CYS N 89  
AD1 1 2 N TRP N 100 ? N TRP N 100 O THR N 112 ? O THR N 112 
AD2 1 2 N VAL O 81  ? N VAL O 81  O CYS O 89  ? O CYS O 89  
AD3 1 2 N TRP O 100 ? N TRP O 100 O THR O 112 ? O THR O 112 
AD4 1 2 N VAL P 81  ? N VAL P 81  O CYS P 89  ? O CYS P 89  
AD5 1 2 N TRP P 100 ? N TRP P 100 O THR P 112 ? O THR P 112 
# 
_atom_sites.entry_id                    6XXD 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N   . PHE A 1 1   ? 79.862  84.462  121.325 1.00 65.53 ? 1   PHE A N   1 
ATOM 2     C CA  . PHE A 1 1   ? 80.942  84.175  120.337 1.00 65.24 ? 1   PHE A CA  1 
ATOM 3     C C   . PHE A 1 1   ? 82.059  83.369  121.013 1.00 64.19 ? 1   PHE A C   1 
ATOM 4     O O   . PHE A 1 1   ? 82.939  83.934  121.671 1.00 64.28 ? 1   PHE A O   1 
ATOM 5     C CB  . PHE A 1 1   ? 81.478  85.487  119.740 1.00 66.00 ? 1   PHE A CB  1 
ATOM 6     C CG  . PHE A 1 1   ? 82.078  85.340  118.365 1.00 66.66 ? 1   PHE A CG  1 
ATOM 7     C CD1 . PHE A 1 1   ? 83.189  84.527  118.150 1.00 66.87 ? 1   PHE A CD1 1 
ATOM 8     C CD2 . PHE A 1 1   ? 81.542  86.031  117.280 1.00 67.09 ? 1   PHE A CD2 1 
ATOM 9     C CE1 . PHE A 1 1   ? 83.743  84.398  116.886 1.00 67.09 ? 1   PHE A CE1 1 
ATOM 10    C CE2 . PHE A 1 1   ? 82.096  85.903  116.015 1.00 67.25 ? 1   PHE A CE2 1 
ATOM 11    C CZ  . PHE A 1 1   ? 83.198  85.087  115.817 1.00 67.25 ? 1   PHE A CZ  1 
ATOM 12    N N   . THR A 1 2   ? 82.015  82.048  120.839 1.00 62.81 ? 2   THR A N   1 
ATOM 13    C CA  . THR A 1 2   ? 82.973  81.135  121.472 1.00 61.68 ? 2   THR A CA  1 
ATOM 14    C C   . THR A 1 2   ? 84.270  81.027  120.671 1.00 60.37 ? 2   THR A C   1 
ATOM 15    O O   . THR A 1 2   ? 84.360  81.515  119.542 1.00 60.21 ? 2   THR A O   1 
ATOM 16    C CB  . THR A 1 2   ? 82.378  79.716  121.620 1.00 61.85 ? 2   THR A CB  1 
ATOM 17    O OG1 . THR A 1 2   ? 81.978  79.224  120.336 1.00 61.94 ? 2   THR A OG1 1 
ATOM 18    C CG2 . THR A 1 2   ? 81.173  79.718  122.552 1.00 61.91 ? 2   THR A CG2 1 
ATOM 19    N N   . LEU A 1 3   ? 85.267  80.382  121.274 1.00 59.31 ? 3   LEU A N   1 
ATOM 20    C CA  . LEU A 1 3   ? 86.519  80.049  120.590 1.00 58.56 ? 3   LEU A CA  1 
ATOM 21    C C   . LEU A 1 3   ? 86.309  78.903  119.598 1.00 57.74 ? 3   LEU A C   1 
ATOM 22    O O   . LEU A 1 3   ? 86.881  78.919  118.509 1.00 57.87 ? 3   LEU A O   1 
ATOM 23    C CB  . LEU A 1 3   ? 87.609  79.676  121.603 1.00 58.65 ? 3   LEU A CB  1 
ATOM 24    C CG  . LEU A 1 3   ? 89.027  79.417  121.075 1.00 58.84 ? 3   LEU A CG  1 
ATOM 25    C CD1 . LEU A 1 3   ? 89.617  80.660  120.425 1.00 58.83 ? 3   LEU A CD1 1 
ATOM 26    C CD2 . LEU A 1 3   ? 89.919  78.928  122.206 1.00 59.00 ? 3   LEU A CD2 1 
ATOM 27    N N   . ILE A 1 4   ? 85.505  77.912  119.989 1.00 56.84 ? 4   ILE A N   1 
ATOM 28    C CA  . ILE A 1 4   ? 85.146  76.787  119.105 1.00 56.10 ? 4   ILE A CA  1 
ATOM 29    C C   . ILE A 1 4   ? 84.390  77.226  117.839 1.00 55.55 ? 4   ILE A C   1 
ATOM 30    O O   . ILE A 1 4   ? 84.594  76.646  116.770 1.00 55.56 ? 4   ILE A O   1 
ATOM 31    C CB  . ILE A 1 4   ? 84.360  75.675  119.869 1.00 56.16 ? 4   ILE A CB  1 
ATOM 32    C CG1 . ILE A 1 4   ? 84.161  74.414  119.010 1.00 56.20 ? 4   ILE A CG1 1 
ATOM 33    C CG2 . ILE A 1 4   ? 82.996  76.159  120.352 1.00 56.30 ? 4   ILE A CG2 1 
ATOM 34    C CD1 . ILE A 1 4   ? 85.437  73.785  118.497 1.00 56.15 ? 4   ILE A CD1 1 
ATOM 35    N N   . GLU A 1 5   ? 83.528  78.237  117.964 1.00 55.12 ? 5   GLU A N   1 
ATOM 36    C CA  . GLU A 1 5   ? 82.824  78.811  116.807 1.00 54.70 ? 5   GLU A CA  1 
ATOM 37    C C   . GLU A 1 5   ? 83.784  79.558  115.876 1.00 54.01 ? 5   GLU A C   1 
ATOM 38    O O   . GLU A 1 5   ? 83.579  79.574  114.664 1.00 54.13 ? 5   GLU A O   1 
ATOM 39    C CB  . GLU A 1 5   ? 81.686  79.734  117.265 1.00 54.98 ? 5   GLU A CB  1 
ATOM 40    C CG  . GLU A 1 5   ? 80.822  80.298  116.140 1.00 55.44 ? 5   GLU A CG  1 
ATOM 41    C CD  . GLU A 1 5   ? 81.222  81.703  115.714 1.00 55.80 ? 5   GLU A CD  1 
ATOM 42    O OE1 . GLU A 1 5   ? 81.128  82.629  116.548 1.00 55.97 ? 5   GLU A OE1 1 
ATOM 43    O OE2 . GLU A 1 5   ? 81.619  81.883  114.543 1.00 55.93 ? 5   GLU A OE2 1 
ATOM 44    N N   . LEU A 1 6   ? 84.814  80.182  116.445 1.00 53.26 ? 6   LEU A N   1 
ATOM 45    C CA  . LEU A 1 6   ? 85.886  80.800  115.661 1.00 52.82 ? 6   LEU A CA  1 
ATOM 46    C C   . LEU A 1 6   ? 86.817  79.749  115.054 1.00 52.17 ? 6   LEU A C   1 
ATOM 47    O O   . LEU A 1 6   ? 87.265  79.895  113.917 1.00 52.30 ? 6   LEU A O   1 
ATOM 48    C CB  . LEU A 1 6   ? 86.701  81.757  116.538 1.00 53.07 ? 6   LEU A CB  1 
ATOM 49    C CG  . LEU A 1 6   ? 87.714  82.694  115.866 1.00 53.25 ? 6   LEU A CG  1 
ATOM 50    C CD1 . LEU A 1 6   ? 87.048  83.634  114.865 1.00 53.35 ? 6   LEU A CD1 1 
ATOM 51    C CD2 . LEU A 1 6   ? 88.484  83.477  116.926 1.00 53.36 ? 6   LEU A CD2 1 
ATOM 52    N N   . LEU A 1 7   ? 87.105  78.701  115.826 1.00 51.68 ? 7   LEU A N   1 
ATOM 53    C CA  . LEU A 1 7   ? 88.027  77.634  115.422 1.00 51.18 ? 7   LEU A CA  1 
ATOM 54    C C   . LEU A 1 7   ? 87.513  76.814  114.238 1.00 50.46 ? 7   LEU A C   1 
ATOM 55    O O   . LEU A 1 7   ? 88.288  76.484  113.338 1.00 50.55 ? 7   LEU A O   1 
ATOM 56    C CB  . LEU A 1 7   ? 88.311  76.713  116.614 1.00 51.54 ? 7   LEU A CB  1 
ATOM 57    C CG  . LEU A 1 7   ? 89.308  75.562  116.453 1.00 52.00 ? 7   LEU A CG  1 
ATOM 58    C CD1 . LEU A 1 7   ? 90.655  76.050  115.939 1.00 52.25 ? 7   LEU A CD1 1 
ATOM 59    C CD2 . LEU A 1 7   ? 89.465  74.848  117.788 1.00 52.11 ? 7   LEU A CD2 1 
ATOM 60    N N   . ILE A 1 8   ? 86.221  76.479  114.251 1.00 49.67 ? 8   ILE A N   1 
ATOM 61    C CA  . ILE A 1 8   ? 85.591  75.779  113.119 1.00 48.95 ? 8   ILE A CA  1 
ATOM 62    C C   . ILE A 1 8   ? 85.519  76.655  111.861 1.00 48.10 ? 8   ILE A C   1 
ATOM 63    O O   . ILE A 1 8   ? 85.650  76.142  110.754 1.00 48.25 ? 8   ILE A O   1 
ATOM 64    C CB  . ILE A 1 8   ? 84.191  75.200  113.474 1.00 49.08 ? 8   ILE A CB  1 
ATOM 65    C CG1 . ILE A 1 8   ? 83.744  74.189  112.404 1.00 49.31 ? 8   ILE A CG1 1 
ATOM 66    C CG2 . ILE A 1 8   ? 83.151  76.303  113.652 1.00 49.12 ? 8   ILE A CG2 1 
ATOM 67    C CD1 . ILE A 1 8   ? 82.583  73.307  112.814 1.00 49.49 ? 8   ILE A CD1 1 
ATOM 68    N N   . VAL A 1 9   ? 85.322  77.963  112.035 1.00 47.27 ? 9   VAL A N   1 
ATOM 69    C CA  . VAL A 1 9   ? 85.348  78.917  110.914 1.00 46.73 ? 9   VAL A CA  1 
ATOM 70    C C   . VAL A 1 9   ? 86.741  78.978  110.267 1.00 46.19 ? 9   VAL A C   1 
ATOM 71    O O   . VAL A 1 9   ? 86.848  79.067  109.044 1.00 46.23 ? 9   VAL A O   1 
ATOM 72    C CB  . VAL A 1 9   ? 84.870  80.327  111.354 1.00 46.84 ? 9   VAL A CB  1 
ATOM 73    C CG1 . VAL A 1 9   ? 85.182  81.394  110.308 1.00 46.95 ? 9   VAL A CG1 1 
ATOM 74    C CG2 . VAL A 1 9   ? 83.374  80.306  111.640 1.00 46.91 ? 9   VAL A CG2 1 
ATOM 75    N N   . ILE A 1 10  ? 87.789  78.926  111.089 1.00 45.60 ? 10  ILE A N   1 
ATOM 76    C CA  . ILE A 1 10  ? 89.172  78.850  110.596 1.00 45.28 ? 10  ILE A CA  1 
ATOM 77    C C   . ILE A 1 10  ? 89.413  77.531  109.842 1.00 44.89 ? 10  ILE A C   1 
ATOM 78    O O   . ILE A 1 10  ? 90.114  77.516  108.828 1.00 44.97 ? 10  ILE A O   1 
ATOM 79    C CB  . ILE A 1 10  ? 90.198  79.025  111.750 1.00 45.46 ? 10  ILE A CB  1 
ATOM 80    C CG1 . ILE A 1 10  ? 90.125  80.451  112.318 1.00 45.68 ? 10  ILE A CG1 1 
ATOM 81    C CG2 . ILE A 1 10  ? 91.627  78.740  111.284 1.00 45.52 ? 10  ILE A CG2 1 
ATOM 82    C CD1 . ILE A 1 10  ? 90.669  80.588  113.725 1.00 45.81 ? 10  ILE A CD1 1 
ATOM 83    N N   . ALA A 1 11  ? 88.829  76.441  110.340 1.00 44.53 ? 11  ALA A N   1 
ATOM 84    C CA  . ALA A 1 11  ? 88.928  75.125  109.695 1.00 44.37 ? 11  ALA A CA  1 
ATOM 85    C C   . ALA A 1 11  ? 88.261  75.071  108.316 1.00 44.14 ? 11  ALA A C   1 
ATOM 86    O O   . ALA A 1 11  ? 88.808  74.468  107.392 1.00 44.27 ? 11  ALA A O   1 
ATOM 87    C CB  . ALA A 1 11  ? 88.347  74.044  110.597 1.00 44.52 ? 11  ALA A CB  1 
ATOM 88    N N   . ILE A 1 12  ? 87.090  75.696  108.188 1.00 43.94 ? 12  ILE A N   1 
ATOM 89    C CA  . ILE A 1 12  ? 86.347  75.725  106.917 1.00 43.88 ? 12  ILE A CA  1 
ATOM 90    C C   . ILE A 1 12  ? 87.032  76.624  105.875 1.00 43.93 ? 12  ILE A C   1 
ATOM 91    O O   . ILE A 1 12  ? 87.023  76.298  104.687 1.00 44.27 ? 12  ILE A O   1 
ATOM 92    C CB  . ILE A 1 12  ? 84.868  76.152  107.126 1.00 43.83 ? 12  ILE A CB  1 
ATOM 93    C CG1 . ILE A 1 12  ? 84.121  75.143  108.018 1.00 44.06 ? 12  ILE A CG1 1 
ATOM 94    C CG2 . ILE A 1 12  ? 84.130  76.323  105.797 1.00 43.85 ? 12  ILE A CG2 1 
ATOM 95    C CD1 . ILE A 1 12  ? 84.069  73.718  107.502 1.00 44.26 ? 12  ILE A CD1 1 
ATOM 96    N N   . ILE A 1 13  ? 87.625  77.736  106.314 1.00 43.69 ? 13  ILE A N   1 
ATOM 97    C CA  . ILE A 1 13  ? 88.389  78.624  105.419 1.00 43.60 ? 13  ILE A CA  1 
ATOM 98    C C   . ILE A 1 13  ? 89.573  77.883  104.775 1.00 43.55 ? 13  ILE A C   1 
ATOM 99    O O   . ILE A 1 13  ? 89.865  78.093  103.596 1.00 43.61 ? 13  ILE A O   1 
ATOM 100   C CB  . ILE A 1 13  ? 88.865  79.909  106.152 1.00 43.76 ? 13  ILE A CB  1 
ATOM 101   C CG1 . ILE A 1 13  ? 87.665  80.803  106.491 1.00 43.92 ? 13  ILE A CG1 1 
ATOM 102   C CG2 . ILE A 1 13  ? 89.858  80.713  105.307 1.00 43.84 ? 13  ILE A CG2 1 
ATOM 103   C CD1 . ILE A 1 13  ? 87.910  81.760  107.639 1.00 44.05 ? 13  ILE A CD1 1 
ATOM 104   N N   . ALA A 1 14  ? 90.240  77.023  105.546 1.00 43.61 ? 14  ALA A N   1 
ATOM 105   C CA  . ALA A 1 14  ? 91.327  76.180  105.031 1.00 43.68 ? 14  ALA A CA  1 
ATOM 106   C C   . ALA A 1 14  ? 90.852  75.180  103.971 1.00 43.73 ? 14  ALA A C   1 
ATOM 107   O O   . ALA A 1 14  ? 91.576  74.903  103.011 1.00 43.84 ? 14  ALA A O   1 
ATOM 108   C CB  . ALA A 1 14  ? 92.012  75.443  106.174 1.00 43.75 ? 14  ALA A CB  1 
ATOM 109   N N   . ILE A 1 15  ? 89.644  74.645  104.154 1.00 43.74 ? 15  ILE A N   1 
ATOM 110   C CA  . ILE A 1 15  ? 89.035  73.712  103.197 1.00 43.83 ? 15  ILE A CA  1 
ATOM 111   C C   . ILE A 1 15  ? 88.609  74.440  101.920 1.00 43.79 ? 15  ILE A C   1 
ATOM 112   O O   . ILE A 1 15  ? 88.918  73.988  100.815 1.00 43.92 ? 15  ILE A O   1 
ATOM 113   C CB  . ILE A 1 15  ? 87.819  72.972  103.813 1.00 44.00 ? 15  ILE A CB  1 
ATOM 114   C CG1 . ILE A 1 15  ? 88.266  72.095  104.992 1.00 44.22 ? 15  ILE A CG1 1 
ATOM 115   C CG2 . ILE A 1 15  ? 87.112  72.104  102.772 1.00 44.10 ? 15  ILE A CG2 1 
ATOM 116   C CD1 . ILE A 1 15  ? 87.149  71.714  105.941 1.00 44.27 ? 15  ILE A CD1 1 
ATOM 117   N N   . LEU A 1 16  ? 87.893  75.552  102.082 1.00 43.76 ? 16  LEU A N   1 
ATOM 118   C CA  . LEU A 1 16  ? 87.423  76.361  100.944 1.00 43.77 ? 16  LEU A CA  1 
ATOM 119   C C   . LEU A 1 16  ? 88.565  76.984  100.129 1.00 43.68 ? 16  LEU A C   1 
ATOM 120   O O   . LEU A 1 16  ? 88.454  77.104  98.908  1.00 43.80 ? 16  LEU A O   1 
ATOM 121   C CB  . LEU A 1 16  ? 86.439  77.453  101.406 1.00 43.94 ? 16  LEU A CB  1 
ATOM 122   C CG  . LEU A 1 16  ? 84.952  77.076  101.478 1.00 44.26 ? 16  LEU A CG  1 
ATOM 123   C CD1 . LEU A 1 16  ? 84.707  75.721  102.133 1.00 44.40 ? 16  LEU A CD1 1 
ATOM 124   C CD2 . LEU A 1 16  ? 84.170  78.168  102.197 1.00 44.39 ? 16  LEU A CD2 1 
ATOM 125   N N   . ALA A 1 17  ? 89.648  77.374  100.801 1.00 43.48 ? 17  ALA A N   1 
ATOM 126   C CA  . ALA A 1 17  ? 90.829  77.937  100.129 1.00 43.36 ? 17  ALA A CA  1 
ATOM 127   C C   . ALA A 1 17  ? 91.576  76.923  99.252  1.00 43.29 ? 17  ALA A C   1 
ATOM 128   O O   . ALA A 1 17  ? 92.261  77.315  98.305  1.00 43.40 ? 17  ALA A O   1 
ATOM 129   C CB  . ALA A 1 17  ? 91.784  78.542  101.150 1.00 43.38 ? 17  ALA A CB  1 
ATOM 130   N N   . ALA A 1 18  ? 91.456  75.635  99.575  1.00 43.01 ? 18  ALA A N   1 
ATOM 131   C CA  . ALA A 1 18  ? 92.080  74.569  98.790  1.00 42.88 ? 18  ALA A CA  1 
ATOM 132   C C   . ALA A 1 18  ? 91.241  74.203  97.567  1.00 42.74 ? 18  ALA A C   1 
ATOM 133   O O   . ALA A 1 18  ? 91.741  74.221  96.440  1.00 42.83 ? 18  ALA A O   1 
ATOM 134   C CB  . ALA A 1 18  ? 92.302  73.339  99.658  1.00 42.97 ? 18  ALA A CB  1 
ATOM 135   N N   . VAL A 1 19  ? 89.970  73.882  97.800  1.00 42.61 ? 19  VAL A N   1 
ATOM 136   C CA  . VAL A 1 19  ? 89.096  73.320  96.754  1.00 42.61 ? 19  VAL A CA  1 
ATOM 137   C C   . VAL A 1 19  ? 88.602  74.331  95.710  1.00 42.56 ? 19  VAL A C   1 
ATOM 138   O O   . VAL A 1 19  ? 88.535  74.003  94.523  1.00 42.66 ? 19  VAL A O   1 
ATOM 139   C CB  . VAL A 1 19  ? 87.880  72.552  97.347  1.00 42.69 ? 19  VAL A CB  1 
ATOM 140   C CG1 . VAL A 1 19  ? 88.350  71.467  98.310  1.00 42.75 ? 19  VAL A CG1 1 
ATOM 141   C CG2 . VAL A 1 19  ? 86.874  73.487  98.019  1.00 42.69 ? 19  VAL A CG2 1 
ATOM 142   N N   . LEU A 1 20  ? 88.267  75.546  96.144  1.00 42.47 ? 20  LEU A N   1 
ATOM 143   C CA  . LEU A 1 20  ? 87.660  76.551  95.255  1.00 42.47 ? 20  LEU A CA  1 
ATOM 144   C C   . LEU A 1 20  ? 88.655  77.230  94.305  1.00 42.21 ? 20  LEU A C   1 
ATOM 145   O O   . LEU A 1 20  ? 88.245  77.763  93.270  1.00 42.16 ? 20  LEU A O   1 
ATOM 146   C CB  . LEU A 1 20  ? 86.916  77.613  96.070  1.00 42.79 ? 20  LEU A CB  1 
ATOM 147   C CG  . LEU A 1 20  ? 85.801  77.121  97.001  1.00 43.17 ? 20  LEU A CG  1 
ATOM 148   C CD1 . LEU A 1 20  ? 85.272  78.270  97.842  1.00 43.27 ? 20  LEU A CD1 1 
ATOM 149   C CD2 . LEU A 1 20  ? 84.671  76.477  96.210  1.00 43.25 ? 20  LEU A CD2 1 
ATOM 150   N N   . ILE A 1 21  ? 89.943  77.218  94.654  1.00 41.85 ? 21  ILE A N   1 
ATOM 151   C CA  . ILE A 1 21  ? 90.995  77.783  93.800  1.00 41.51 ? 21  ILE A CA  1 
ATOM 152   C C   . ILE A 1 21  ? 91.224  76.795  92.644  1.00 41.13 ? 21  ILE A C   1 
ATOM 153   O O   . ILE A 1 21  ? 91.638  75.660  92.887  1.00 41.33 ? 21  ILE A O   1 
ATOM 154   C CB  . ILE A 1 21  ? 92.312  78.038  94.588  1.00 41.75 ? 21  ILE A CB  1 
ATOM 155   C CG1 . ILE A 1 21  ? 92.237  79.340  95.408  1.00 41.94 ? 21  ILE A CG1 1 
ATOM 156   C CG2 . ILE A 1 21  ? 93.516  78.164  93.656  1.00 41.83 ? 21  ILE A CG2 1 
ATOM 157   C CD1 . ILE A 1 21  ? 91.004  79.533  96.270  1.00 42.01 ? 21  ILE A CD1 1 
ATOM 158   N N   . PRO A 1 22  ? 90.958  77.220  91.389  1.00 40.49 ? 22  PRO A N   1 
ATOM 159   C CA  . PRO A 1 22  ? 91.057  76.301  90.253  1.00 40.05 ? 22  PRO A CA  1 
ATOM 160   C C   . PRO A 1 22  ? 92.494  76.064  89.785  1.00 39.58 ? 22  PRO A C   1 
ATOM 161   O O   . PRO A 1 22  ? 93.418  76.746  90.238  1.00 39.64 ? 22  PRO A O   1 
ATOM 162   C CB  . PRO A 1 22  ? 90.264  77.023  89.165  1.00 40.17 ? 22  PRO A CB  1 
ATOM 163   C CG  . PRO A 1 22  ? 90.509  78.464  89.447  1.00 40.35 ? 22  PRO A CG  1 
ATOM 164   C CD  . PRO A 1 22  ? 90.618  78.586  90.944  1.00 40.46 ? 22  PRO A CD  1 
ATOM 165   N N   . ASN A 1 23  ? 92.661  75.100  88.880  1.00 38.96 ? 23  ASN A N   1 
ATOM 166   C CA  . ASN A 1 23  ? 93.957  74.817  88.264  1.00 38.42 ? 23  ASN A CA  1 
ATOM 167   C C   . ASN A 1 23  ? 94.274  75.926  87.258  1.00 38.17 ? 23  ASN A C   1 
ATOM 168   O O   . ASN A 1 23  ? 93.680  75.985  86.178  1.00 38.30 ? 23  ASN A O   1 
ATOM 169   C CB  . ASN A 1 23  ? 93.941  73.440  87.584  1.00 38.26 ? 23  ASN A CB  1 
ATOM 170   C CG  . ASN A 1 23  ? 95.331  72.951  87.204  1.00 38.22 ? 23  ASN A CG  1 
ATOM 171   O OD1 . ASN A 1 23  ? 96.090  73.648  86.532  1.00 38.19 ? 23  ASN A OD1 1 
ATOM 172   N ND2 . ASN A 1 23  ? 95.664  71.737  87.626  1.00 38.32 ? 23  ASN A ND2 1 
ATOM 173   N N   . LEU A 1 24  ? 95.203  76.806  87.629  1.00 37.77 ? 24  LEU A N   1 
ATOM 174   C CA  . LEU A 1 24  ? 95.564  77.958  86.802  1.00 37.53 ? 24  LEU A CA  1 
ATOM 175   C C   . LEU A 1 24  ? 96.439  77.556  85.616  1.00 37.24 ? 24  LEU A C   1 
ATOM 176   O O   . LEU A 1 24  ? 96.180  77.980  84.491  1.00 37.38 ? 24  LEU A O   1 
ATOM 177   C CB  . LEU A 1 24  ? 96.280  79.025  87.638  1.00 37.66 ? 24  LEU A CB  1 
ATOM 178   C CG  . LEU A 1 24  ? 95.500  79.615  88.820  1.00 37.78 ? 24  LEU A CG  1 
ATOM 179   C CD1 . LEU A 1 24  ? 96.425  80.420  89.720  1.00 37.90 ? 24  LEU A CD1 1 
ATOM 180   C CD2 . LEU A 1 24  ? 94.338  80.478  88.350  1.00 37.72 ? 24  LEU A CD2 1 
ATOM 181   N N   . LEU A 1 25  ? 97.461  76.736  85.873  1.00 36.76 ? 25  LEU A N   1 
ATOM 182   C CA  . LEU A 1 25  ? 98.424  76.319  84.844  1.00 36.40 ? 25  LEU A CA  1 
ATOM 183   C C   . LEU A 1 25  ? 97.758  75.631  83.655  1.00 35.85 ? 25  LEU A C   1 
ATOM 184   O O   . LEU A 1 25  ? 98.108  75.902  82.507  1.00 35.80 ? 25  LEU A O   1 
ATOM 185   C CB  . LEU A 1 25  ? 99.490  75.387  85.439  1.00 36.59 ? 25  LEU A CB  1 
ATOM 186   C CG  . LEU A 1 25  ? 100.648 74.953  84.527  1.00 36.81 ? 25  LEU A CG  1 
ATOM 187   C CD1 . LEU A 1 25  ? 101.489 76.149  84.104  1.00 36.91 ? 25  LEU A CD1 1 
ATOM 188   C CD2 . LEU A 1 25  ? 101.514 73.908  85.214  1.00 36.92 ? 25  LEU A CD2 1 
ATOM 189   N N   . ALA A 1 26  ? 96.805  74.746  83.942  1.00 35.52 ? 26  ALA A N   1 
ATOM 190   C CA  . ALA A 1 26  ? 96.069  74.024  82.902  1.00 35.27 ? 26  ALA A CA  1 
ATOM 191   C C   . ALA A 1 26  ? 95.165  74.953  82.087  1.00 34.96 ? 26  ALA A C   1 
ATOM 192   O O   . ALA A 1 26  ? 95.071  74.813  80.867  1.00 34.98 ? 26  ALA A O   1 
ATOM 193   C CB  . ALA A 1 26  ? 95.257  72.887  83.512  1.00 35.29 ? 26  ALA A CB  1 
ATOM 194   N N   . ALA A 1 27  ? 94.512  75.898  82.763  1.00 34.79 ? 27  ALA A N   1 
ATOM 195   C CA  . ALA A 1 27  ? 93.647  76.886  82.103  1.00 34.77 ? 27  ALA A CA  1 
ATOM 196   C C   . ALA A 1 27  ? 94.399  77.767  81.098  1.00 34.60 ? 27  ALA A C   1 
ATOM 197   O O   . ALA A 1 27  ? 93.862  78.091  80.038  1.00 34.63 ? 27  ALA A O   1 
ATOM 198   C CB  . ALA A 1 27  ? 92.950  77.756  83.141  1.00 34.88 ? 27  ALA A CB  1 
ATOM 199   N N   . ARG A 1 28  ? 95.632  78.147  81.437  1.00 34.46 ? 28  ARG A N   1 
ATOM 200   C CA  . ARG A 1 28  ? 96.464  78.977  80.557  1.00 34.32 ? 28  ARG A CA  1 
ATOM 201   C C   . ARG A 1 28  ? 96.992  78.223  79.331  1.00 34.16 ? 28  ARG A C   1 
ATOM 202   O O   . ARG A 1 28  ? 97.129  78.823  78.265  1.00 34.28 ? 28  ARG A O   1 
ATOM 203   C CB  . ARG A 1 28  ? 97.635  79.595  81.328  1.00 34.46 ? 28  ARG A CB  1 
ATOM 204   C CG  . ARG A 1 28  ? 97.212  80.537  82.446  1.00 34.64 ? 28  ARG A CG  1 
ATOM 205   C CD  . ARG A 1 28  ? 98.319  81.507  82.830  1.00 34.76 ? 28  ARG A CD  1 
ATOM 206   N NE  . ARG A 1 28  ? 98.341  82.688  81.966  1.00 34.86 ? 28  ARG A NE  1 
ATOM 207   C CZ  . ARG A 1 28  ? 97.486  83.714  82.035  1.00 35.08 ? 28  ARG A CZ  1 
ATOM 208   N NH1 . ARG A 1 28  ? 97.617  84.732  81.189  1.00 35.19 ? 28  ARG A NH1 1 
ATOM 209   N NH2 . ARG A 1 28  ? 96.497  83.738  82.932  1.00 35.14 ? 28  ARG A NH2 1 
ATOM 210   N N   . LYS A 1 29  ? 97.295  76.930  79.484  1.00 34.02 ? 29  LYS A N   1 
ATOM 211   C CA  . LYS A 1 29  ? 97.777  76.089  78.369  1.00 33.92 ? 29  LYS A CA  1 
ATOM 212   C C   . LYS A 1 29  ? 96.878  76.146  77.130  1.00 33.86 ? 29  LYS A C   1 
ATOM 213   O O   . LYS A 1 29  ? 97.376  76.246  76.008  1.00 34.02 ? 29  LYS A O   1 
ATOM 214   C CB  . LYS A 1 29  ? 97.930  74.620  78.795  1.00 33.96 ? 29  LYS A CB  1 
ATOM 215   C CG  . LYS A 1 29  ? 99.201  74.298  79.564  1.00 34.05 ? 29  LYS A CG  1 
ATOM 216   C CD  . LYS A 1 29  ? 99.439  72.795  79.603  1.00 34.19 ? 29  LYS A CD  1 
ATOM 217   C CE  . LYS A 1 29  ? 100.629 72.423  80.475  1.00 34.36 ? 29  LYS A CE  1 
ATOM 218   N NZ  . LYS A 1 29  ? 100.297 72.391  81.928  1.00 34.43 ? 29  LYS A NZ  1 
ATOM 219   N N   . ARG A 1 30  ? 95.565  76.085  77.345  1.00 33.59 ? 30  ARG A N   1 
ATOM 220   C CA  . ARG A 1 30  ? 94.592  76.094  76.246  1.00 33.40 ? 30  ARG A CA  1 
ATOM 221   C C   . ARG A 1 30  ? 94.426  77.491  75.650  1.00 33.27 ? 30  ARG A C   1 
ATOM 222   O O   . ARG A 1 30  ? 94.200  77.629  74.446  1.00 33.42 ? 30  ARG A O   1 
ATOM 223   C CB  . ARG A 1 30  ? 93.233  75.556  76.709  1.00 33.43 ? 30  ARG A CB  1 
ATOM 224   C CG  . ARG A 1 30  ? 93.262  74.176  77.359  1.00 33.49 ? 30  ARG A CG  1 
ATOM 225   C CD  . ARG A 1 30  ? 93.805  73.086  76.442  1.00 33.56 ? 30  ARG A CD  1 
ATOM 226   N NE  . ARG A 1 30  ? 94.002  71.816  77.143  1.00 33.57 ? 30  ARG A NE  1 
ATOM 227   C CZ  . ARG A 1 30  ? 94.444  70.691  76.576  1.00 33.63 ? 30  ARG A CZ  1 
ATOM 228   N NH1 . ARG A 1 30  ? 94.747  70.648  75.278  1.00 33.65 ? 30  ARG A NH1 1 
ATOM 229   N NH2 . ARG A 1 30  ? 94.585  69.593  77.315  1.00 33.67 ? 30  ARG A NH2 1 
ATOM 230   N N   . ALA A 1 31  ? 94.525  78.516  76.495  1.00 32.98 ? 31  ALA A N   1 
ATOM 231   C CA  . ALA A 1 31  ? 94.556  79.906  76.035  1.00 32.87 ? 31  ALA A CA  1 
ATOM 232   C C   . ALA A 1 31  ? 95.824  80.205  75.233  1.00 32.84 ? 31  ALA A C   1 
ATOM 233   O O   . ALA A 1 31  ? 95.777  80.954  74.257  1.00 32.95 ? 31  ALA A O   1 
ATOM 234   C CB  . ALA A 1 31  ? 94.446  80.856  77.216  1.00 32.90 ? 31  ALA A CB  1 
ATOM 235   N N   . ASN A 1 32  ? 96.947  79.626  75.657  1.00 32.86 ? 32  ASN A N   1 
ATOM 236   C CA  . ASN A 1 32  ? 98.217  79.733  74.927  1.00 32.92 ? 32  ASN A CA  1 
ATOM 237   C C   . ASN A 1 32  ? 98.175  79.043  73.558  1.00 33.12 ? 32  ASN A C   1 
ATOM 238   O O   . ASN A 1 32  ? 98.809  79.515  72.611  1.00 33.24 ? 32  ASN A O   1 
ATOM 239   C CB  . ASN A 1 32  ? 99.376  79.156  75.756  1.00 32.83 ? 32  ASN A CB  1 
ATOM 240   C CG  . ASN A 1 32  ? 99.737  80.018  76.960  1.00 32.76 ? 32  ASN A CG  1 
ATOM 241   O OD1 . ASN A 1 32  ? 99.701  81.246  76.880  1.00 32.77 ? 32  ASN A OD1 1 
ATOM 242   N ND2 . ASN A 1 32  ? 100.080 79.384  78.076  1.00 32.81 ? 32  ASN A ND2 1 
ATOM 243   N N   . ASP A 1 33  ? 97.444  77.931  73.463  1.00 33.25 ? 33  ASP A N   1 
ATOM 244   C CA  . ASP A 1 33  ? 97.220  77.249  72.178  1.00 33.42 ? 33  ASP A CA  1 
ATOM 245   C C   . ASP A 1 33  ? 96.392  78.100  71.215  1.00 33.48 ? 33  ASP A C   1 
ATOM 246   O O   . ASP A 1 33  ? 96.633  78.079  70.006  1.00 33.61 ? 33  ASP A O   1 
ATOM 247   C CB  . ASP A 1 33  ? 96.522  75.898  72.384  1.00 33.64 ? 33  ASP A CB  1 
ATOM 248   C CG  . ASP A 1 33  ? 97.385  74.883  73.122  1.00 33.90 ? 33  ASP A CG  1 
ATOM 249   O OD1 . ASP A 1 33  ? 98.617  75.078  73.234  1.00 33.97 ? 33  ASP A OD1 1 
ATOM 250   O OD2 . ASP A 1 33  ? 96.820  73.875  73.596  1.00 34.02 ? 33  ASP A OD2 1 
ATOM 251   N N   . THR A 1 34  ? 95.416  78.832  71.754  1.00 33.41 ? 34  THR A N   1 
ATOM 252   C CA  . THR A 1 34  ? 94.600  79.760  70.964  1.00 33.36 ? 34  THR A CA  1 
ATOM 253   C C   . THR A 1 34  ? 95.433  80.902  70.371  1.00 33.33 ? 34  THR A C   1 
ATOM 254   O O   . THR A 1 34  ? 95.165  81.340  69.254  1.00 33.44 ? 34  THR A O   1 
ATOM 255   C CB  . THR A 1 34  ? 93.454  80.366  71.808  1.00 33.50 ? 34  THR A CB  1 
ATOM 256   O OG1 . THR A 1 34  ? 92.798  79.329  72.547  1.00 33.50 ? 34  THR A OG1 1 
ATOM 257   C CG2 . THR A 1 34  ? 92.433  81.081  70.923  1.00 33.60 ? 34  THR A CG2 1 
ATOM 258   N N   . VAL A 1 35  ? 96.432  81.371  71.120  1.00 33.30 ? 35  VAL A N   1 
ATOM 259   C CA  . VAL A 1 35  ? 97.355  82.416  70.649  1.00 33.32 ? 35  VAL A CA  1 
ATOM 260   C C   . VAL A 1 35  ? 98.225  81.898  69.497  1.00 33.25 ? 35  VAL A C   1 
ATOM 261   O O   . VAL A 1 35  ? 98.451  82.615  68.520  1.00 33.36 ? 35  VAL A O   1 
ATOM 262   C CB  . VAL A 1 35  ? 98.251  82.951  71.798  1.00 33.52 ? 35  VAL A CB  1 
ATOM 263   C CG1 . VAL A 1 35  ? 99.341  83.891  71.279  1.00 33.63 ? 35  VAL A CG1 1 
ATOM 264   C CG2 . VAL A 1 35  ? 97.409  83.667  72.846  1.00 33.60 ? 35  VAL A CG2 1 
ATOM 265   N N   . VAL A 1 36  ? 98.704  80.661  69.624  1.00 33.13 ? 36  VAL A N   1 
ATOM 266   C CA  . VAL A 1 36  ? 99.522  80.022  68.587  1.00 33.03 ? 36  VAL A CA  1 
ATOM 267   C C   . VAL A 1 36  ? 98.683  79.709  67.344  1.00 33.02 ? 36  VAL A C   1 
ATOM 268   O O   . VAL A 1 36  ? 99.132  79.937  66.219  1.00 33.10 ? 36  VAL A O   1 
ATOM 269   C CB  . VAL A 1 36  ? 100.201 78.730  69.110  1.00 33.02 ? 36  VAL A CB  1 
ATOM 270   C CG1 . VAL A 1 36  ? 100.897 77.969  67.984  1.00 33.08 ? 36  VAL A CG1 1 
ATOM 271   C CG2 . VAL A 1 36  ? 101.200 79.058  70.211  1.00 33.01 ? 36  VAL A CG2 1 
ATOM 272   N N   . THR A 1 37  ? 97.478  79.182  67.557  1.00 33.06 ? 37  THR A N   1 
ATOM 273   C CA  . THR A 1 37  ? 96.550  78.878  66.463  1.00 33.11 ? 37  THR A CA  1 
ATOM 274   C C   . THR A 1 37  ? 96.091  80.144  65.733  1.00 33.10 ? 37  THR A C   1 
ATOM 275   O O   . THR A 1 37  ? 95.979  80.140  64.507  1.00 33.26 ? 37  THR A O   1 
ATOM 276   C CB  . THR A 1 37  ? 95.309  78.107  66.969  1.00 33.23 ? 37  THR A CB  1 
ATOM 277   O OG1 . THR A 1 37  ? 95.728  76.959  67.719  1.00 33.31 ? 37  THR A OG1 1 
ATOM 278   C CG2 . THR A 1 37  ? 94.424  77.652  65.804  1.00 33.28 ? 37  THR A CG2 1 
ATOM 279   N N   . ALA A 1 38  ? 95.832  81.212  66.487  1.00 33.05 ? 38  ALA A N   1 
ATOM 280   C CA  . ALA A 1 38  ? 95.431  82.501  65.909  1.00 33.10 ? 38  ALA A CA  1 
ATOM 281   C C   . ALA A 1 38  ? 96.547  83.144  65.089  1.00 33.09 ? 38  ALA A C   1 
ATOM 282   O O   . ALA A 1 38  ? 96.291  83.664  64.003  1.00 33.10 ? 38  ALA A O   1 
ATOM 283   C CB  . ALA A 1 38  ? 94.969  83.458  67.000  1.00 33.16 ? 38  ALA A CB  1 
ATOM 284   N N   . TYR A 1 39  ? 97.773  83.107  65.612  1.00 33.22 ? 39  TYR A N   1 
ATOM 285   C CA  . TYR A 1 39  ? 98.932  83.687  64.923  1.00 33.27 ? 39  TYR A CA  1 
ATOM 286   C C   . TYR A 1 39  ? 99.293  82.921  63.648  1.00 33.48 ? 39  TYR A C   1 
ATOM 287   O O   . TYR A 1 39  ? 99.674  83.535  62.649  1.00 33.64 ? 39  TYR A O   1 
ATOM 288   C CB  . TYR A 1 39  ? 100.150 83.762  65.848  1.00 33.19 ? 39  TYR A CB  1 
ATOM 289   C CG  . TYR A 1 39  ? 101.249 84.651  65.309  1.00 33.27 ? 39  TYR A CG  1 
ATOM 290   C CD1 . TYR A 1 39  ? 101.174 86.039  65.434  1.00 33.33 ? 39  TYR A CD1 1 
ATOM 291   C CD2 . TYR A 1 39  ? 102.361 84.109  64.661  1.00 33.35 ? 39  TYR A CD2 1 
ATOM 292   C CE1 . TYR A 1 39  ? 102.175 86.861  64.935  1.00 33.32 ? 39  TYR A CE1 1 
ATOM 293   C CE2 . TYR A 1 39  ? 103.368 84.924  64.160  1.00 33.36 ? 39  TYR A CE2 1 
ATOM 294   C CZ  . TYR A 1 39  ? 103.272 86.298  64.299  1.00 33.36 ? 39  TYR A CZ  1 
ATOM 295   O OH  . TYR A 1 39  ? 104.268 87.108  63.805  1.00 33.46 ? 39  TYR A OH  1 
ATOM 296   N N   . LEU A 1 40  ? 99.182  81.594  63.689  1.00 33.68 ? 40  LEU A N   1 
ATOM 297   C CA  . LEU A 1 40  ? 99.352  80.759  62.491  1.00 33.88 ? 40  LEU A CA  1 
ATOM 298   C C   . LEU A 1 40  ? 98.218  80.964  61.485  1.00 34.31 ? 40  LEU A C   1 
ATOM 299   O O   . LEU A 1 40  ? 98.460  80.967  60.279  1.00 34.49 ? 40  LEU A O   1 
ATOM 300   C CB  . LEU A 1 40  ? 99.460  79.275  62.857  1.00 33.80 ? 40  LEU A CB  1 
ATOM 301   C CG  . LEU A 1 40  ? 100.759 78.838  63.539  1.00 33.73 ? 40  LEU A CG  1 
ATOM 302   C CD1 . LEU A 1 40  ? 100.591 77.454  64.137  1.00 33.66 ? 40  LEU A CD1 1 
ATOM 303   C CD2 . LEU A 1 40  ? 101.932 78.858  62.569  1.00 33.70 ? 40  LEU A CD2 1 
ATOM 304   N N   . ASN A 1 41  ? 96.991  81.128  61.984  1.00 34.79 ? 41  ASN A N   1 
ATOM 305   C CA  . ASN A 1 41  ? 95.837  81.450  61.133  1.00 35.15 ? 41  ASN A CA  1 
ATOM 306   C C   . ASN A 1 41  ? 96.012  82.812  60.451  1.00 35.40 ? 41  ASN A C   1 
ATOM 307   O O   . ASN A 1 41  ? 95.646  82.972  59.286  1.00 35.49 ? 41  ASN A O   1 
ATOM 308   C CB  . ASN A 1 41  ? 94.536  81.426  61.948  1.00 35.34 ? 41  ASN A CB  1 
ATOM 309   C CG  . ASN A 1 41  ? 93.295  81.596  61.086  1.00 35.61 ? 41  ASN A CG  1 
ATOM 310   O OD1 . ASN A 1 41  ? 93.168  80.983  60.025  1.00 35.79 ? 41  ASN A OD1 1 
ATOM 311   N ND2 . ASN A 1 41  ? 92.365  82.426  61.547  1.00 35.71 ? 41  ASN A ND2 1 
ATOM 312   N N   . ASP A 1 42  ? 96.567  83.780  61.182  1.00 35.76 ? 42  ASP A N   1 
ATOM 313   C CA  . ASP A 1 42  ? 96.936  85.082  60.609  1.00 36.04 ? 42  ASP A CA  1 
ATOM 314   C C   . ASP A 1 42  ? 98.121  84.960  59.648  1.00 36.01 ? 42  ASP A C   1 
ATOM 315   O O   . ASP A 1 42  ? 98.130  85.599  58.597  1.00 36.17 ? 42  ASP A O   1 
ATOM 316   C CB  . ASP A 1 42  ? 97.269  86.100  61.711  1.00 36.32 ? 42  ASP A CB  1 
ATOM 317   C CG  . ASP A 1 42  ? 96.055  86.488  62.549  1.00 36.66 ? 42  ASP A CG  1 
ATOM 318   O OD1 . ASP A 1 42  ? 94.942  86.622  61.992  1.00 36.82 ? 42  ASP A OD1 1 
ATOM 319   O OD2 . ASP A 1 42  ? 96.218  86.670  63.775  1.00 36.78 ? 42  ASP A OD2 1 
ATOM 320   N N   . ALA A 1 43  ? 99.111  84.145  60.014  1.00 35.92 ? 43  ALA A N   1 
ATOM 321   C CA  . ALA A 1 43  ? 100.287 83.900  59.167  1.00 35.94 ? 43  ALA A CA  1 
ATOM 322   C C   . ALA A 1 43  ? 99.927  83.289  57.811  1.00 36.00 ? 43  ALA A C   1 
ATOM 323   O O   . ALA A 1 43  ? 100.546 83.622  56.802  1.00 36.16 ? 43  ALA A O   1 
ATOM 324   C CB  . ALA A 1 43  ? 101.289 83.012  59.891  1.00 35.95 ? 43  ALA A CB  1 
ATOM 325   N N   . VAL A 1 44  ? 98.935  82.399  57.798  1.00 36.18 ? 44  VAL A N   1 
ATOM 326   C CA  . VAL A 1 44  ? 98.427  81.794  56.557  1.00 36.35 ? 44  VAL A CA  1 
ATOM 327   C C   . VAL A 1 44  ? 97.784  82.842  55.635  1.00 36.53 ? 44  VAL A C   1 
ATOM 328   O O   . VAL A 1 44  ? 97.927  82.758  54.414  1.00 36.62 ? 44  VAL A O   1 
ATOM 329   C CB  . VAL A 1 44  ? 97.435  80.633  56.860  1.00 36.45 ? 44  VAL A CB  1 
ATOM 330   C CG1 . VAL A 1 44  ? 96.690  80.171  55.608  1.00 36.57 ? 44  VAL A CG1 1 
ATOM 331   C CG2 . VAL A 1 44  ? 98.168  79.455  57.500  1.00 36.45 ? 44  VAL A CG2 1 
ATOM 332   N N   . LYS A 1 45  ? 97.086  83.819  56.218  1.00 36.84 ? 45  LYS A N   1 
ATOM 333   C CA  . LYS A 1 45  ? 96.446  84.892  55.443  1.00 37.12 ? 45  LYS A CA  1 
ATOM 334   C C   . LYS A 1 45  ? 97.467  85.782  54.737  1.00 37.00 ? 45  LYS A C   1 
ATOM 335   O O   . LYS A 1 45  ? 97.346  86.035  53.538  1.00 37.15 ? 45  LYS A O   1 
ATOM 336   C CB  . LYS A 1 45  ? 95.532  85.747  56.331  1.00 37.49 ? 45  LYS A CB  1 
ATOM 337   C CG  . LYS A 1 45  ? 94.304  85.012  56.848  1.00 37.82 ? 45  LYS A CG  1 
ATOM 338   C CD  . LYS A 1 45  ? 93.648  85.748  58.006  1.00 38.10 ? 45  LYS A CD  1 
ATOM 339   C CE  . LYS A 1 45  ? 92.527  84.923  58.622  1.00 38.33 ? 45  LYS A CE  1 
ATOM 340   N NZ  . LYS A 1 45  ? 91.954  85.559  59.841  1.00 38.49 ? 45  LYS A NZ  1 
ATOM 341   N N   . PHE A 1 46  ? 98.469  86.246  55.480  1.00 36.90 ? 46  PHE A N   1 
ATOM 342   C CA  . PHE A 1 46  ? 99.524  87.101  54.915  1.00 36.84 ? 46  PHE A CA  1 
ATOM 343   C C   . PHE A 1 46  ? 100.501 86.361  53.990  1.00 36.81 ? 46  PHE A C   1 
ATOM 344   O O   . PHE A 1 46  ? 101.211 87.003  53.214  1.00 36.96 ? 46  PHE A O   1 
ATOM 345   C CB  . PHE A 1 46  ? 100.274 87.851  56.022  1.00 36.83 ? 46  PHE A CB  1 
ATOM 346   C CG  . PHE A 1 46  ? 99.484  88.980  56.618  1.00 36.90 ? 46  PHE A CG  1 
ATOM 347   C CD1 . PHE A 1 46  ? 99.382  90.195  55.950  1.00 37.06 ? 46  PHE A CD1 1 
ATOM 348   C CD2 . PHE A 1 46  ? 98.823  88.828  57.832  1.00 36.99 ? 46  PHE A CD2 1 
ATOM 349   C CE1 . PHE A 1 46  ? 98.644  91.241  56.485  1.00 37.14 ? 46  PHE A CE1 1 
ATOM 350   C CE2 . PHE A 1 46  ? 98.086  89.871  58.376  1.00 37.16 ? 46  PHE A CE2 1 
ATOM 351   C CZ  . PHE A 1 46  ? 97.994  91.080  57.700  1.00 37.19 ? 46  PHE A CZ  1 
ATOM 352   N N   . GLN A 1 47  ? 100.544 85.030  54.077  1.00 36.77 ? 47  GLN A N   1 
ATOM 353   C CA  . GLN A 1 47  ? 101.240 84.208  53.077  1.00 36.82 ? 47  GLN A CA  1 
ATOM 354   C C   . GLN A 1 47  ? 100.506 84.242  51.732  1.00 37.07 ? 47  GLN A C   1 
ATOM 355   O O   . GLN A 1 47  ? 101.145 84.313  50.680  1.00 37.28 ? 47  GLN A O   1 
ATOM 356   C CB  . GLN A 1 47  ? 101.400 82.757  53.552  1.00 36.79 ? 47  GLN A CB  1 
ATOM 357   C CG  . GLN A 1 47  ? 102.514 82.552  54.572  1.00 36.85 ? 47  GLN A CG  1 
ATOM 358   C CD  . GLN A 1 47  ? 103.883 82.354  53.941  1.00 36.98 ? 47  GLN A CD  1 
ATOM 359   O OE1 . GLN A 1 47  ? 104.204 82.955  52.916  1.00 37.07 ? 47  GLN A OE1 1 
ATOM 360   N NE2 . GLN A 1 47  ? 104.700 81.512  54.562  1.00 37.07 ? 47  GLN A NE2 1 
ATOM 361   N N   . GLU A 1 48  ? 99.174  84.183  51.775  1.00 37.41 ? 48  GLU A N   1 
ATOM 362   C CA  . GLU A 1 48  ? 98.342  84.308  50.569  1.00 37.74 ? 48  GLU A CA  1 
ATOM 363   C C   . GLU A 1 48  ? 98.378  85.718  49.970  1.00 37.83 ? 48  GLU A C   1 
ATOM 364   O O   . GLU A 1 48  ? 98.261  85.872  48.755  1.00 38.01 ? 48  GLU A O   1 
ATOM 365   C CB  . GLU A 1 48  ? 96.888  83.904  50.857  1.00 38.07 ? 48  GLU A CB  1 
ATOM 366   C CG  . GLU A 1 48  ? 96.692  82.430  51.196  1.00 38.39 ? 48  GLU A CG  1 
ATOM 367   C CD  . GLU A 1 48  ? 96.879  81.502  50.005  1.00 38.68 ? 48  GLU A CD  1 
ATOM 368   O OE1 . GLU A 1 48  ? 96.315  81.779  48.923  1.00 38.76 ? 48  GLU A OE1 1 
ATOM 369   O OE2 . GLU A 1 48  ? 97.585  80.480  50.153  1.00 38.77 ? 48  GLU A OE2 1 
ATOM 370   N N   . MET A 1 49  ? 98.526  86.737  50.818  1.00 37.94 ? 49  MET A N   1 
ATOM 371   C CA  . MET A 1 49  ? 98.673  88.124  50.350  1.00 38.06 ? 49  MET A CA  1 
ATOM 372   C C   . MET A 1 49  ? 100.016 88.369  49.655  1.00 37.98 ? 49  MET A C   1 
ATOM 373   O O   . MET A 1 49  ? 100.082 89.140  48.696  1.00 38.26 ? 49  MET A O   1 
ATOM 374   C CB  . MET A 1 49  ? 98.493  89.113  51.504  1.00 38.24 ? 49  MET A CB  1 
ATOM 375   C CG  . MET A 1 49  ? 97.062  89.192  52.008  1.00 38.47 ? 49  MET A CG  1 
ATOM 376   S SD  . MET A 1 49  ? 96.861  90.222  53.473  1.00 38.86 ? 49  MET A SD  1 
ATOM 377   C CE  . MET A 1 49  ? 97.356  91.820  52.834  1.00 38.96 ? 49  MET A CE  1 
ATOM 378   N N   . TYR A 1 50  ? 101.074 87.724  50.143  1.00 37.79 ? 50  TYR A N   1 
ATOM 379   C CA  . TYR A 1 50  ? 102.385 87.767  49.486  1.00 37.80 ? 50  TYR A CA  1 
ATOM 380   C C   . TYR A 1 50  ? 102.379 86.983  48.167  1.00 38.04 ? 50  TYR A C   1 
ATOM 381   O O   . TYR A 1 50  ? 103.097 87.340  47.229  1.00 38.25 ? 50  TYR A O   1 
ATOM 382   C CB  . TYR A 1 50  ? 103.472 87.222  50.416  1.00 37.76 ? 50  TYR A CB  1 
ATOM 383   C CG  . TYR A 1 50  ? 104.880 87.591  50.005  1.00 37.79 ? 50  TYR A CG  1 
ATOM 384   C CD1 . TYR A 1 50  ? 105.615 86.778  49.142  1.00 37.66 ? 50  TYR A CD1 1 
ATOM 385   C CD2 . TYR A 1 50  ? 105.491 88.745  50.498  1.00 37.87 ? 50  TYR A CD2 1 
ATOM 386   C CE1 . TYR A 1 50  ? 106.910 87.109  48.771  1.00 37.67 ? 50  TYR A CE1 1 
ATOM 387   C CE2 . TYR A 1 50  ? 106.786 89.085  50.132  1.00 37.85 ? 50  TYR A CE2 1 
ATOM 388   C CZ  . TYR A 1 50  ? 107.493 88.264  49.269  1.00 37.80 ? 50  TYR A CZ  1 
ATOM 389   O OH  . TYR A 1 50  ? 108.776 88.596  48.902  1.00 37.98 ? 50  TYR A OH  1 
ATOM 390   N N   . GLN A 1 51  ? 101.582 85.916  48.111  1.00 38.31 ? 51  GLN A N   1 
ATOM 391   C CA  . GLN A 1 51  ? 101.375 85.137  46.883  1.00 38.55 ? 51  GLN A CA  1 
ATOM 392   C C   . GLN A 1 51  ? 100.693 85.957  45.777  1.00 38.78 ? 51  GLN A C   1 
ATOM 393   O O   . GLN A 1 51  ? 100.957 85.737  44.594  1.00 38.94 ? 51  GLN A O   1 
ATOM 394   C CB  . GLN A 1 51  ? 100.557 83.872  47.190  1.00 38.73 ? 51  GLN A CB  1 
ATOM 395   C CG  . GLN A 1 51  ? 100.442 82.857  46.057  1.00 38.88 ? 51  GLN A CG  1 
ATOM 396   C CD  . GLN A 1 51  ? 101.755 82.177  45.719  1.00 38.88 ? 51  GLN A CD  1 
ATOM 397   O OE1 . GLN A 1 51  ? 102.478 81.722  46.603  1.00 38.93 ? 51  GLN A OE1 1 
ATOM 398   N NE2 . GLN A 1 51  ? 102.057 82.085  44.430  1.00 38.97 ? 51  GLN A NE2 1 
ATOM 399   N N   . ILE A 1 52  ? 99.816  86.885  46.163  1.00 38.96 ? 52  ILE A N   1 
ATOM 400   C CA  . ILE A 1 52  ? 99.182  87.812  45.214  1.00 39.19 ? 52  ILE A CA  1 
ATOM 401   C C   . ILE A 1 52  ? 100.213 88.779  44.617  1.00 39.35 ? 52  ILE A C   1 
ATOM 402   O O   . ILE A 1 52  ? 100.197 89.038  43.411  1.00 39.50 ? 52  ILE A O   1 
ATOM 403   C CB  . ILE A 1 52  ? 98.014  88.596  45.870  1.00 39.24 ? 52  ILE A CB  1 
ATOM 404   C CG1 . ILE A 1 52  ? 96.864  87.641  46.220  1.00 39.33 ? 52  ILE A CG1 1 
ATOM 405   C CG2 . ILE A 1 52  ? 97.491  89.703  44.952  1.00 39.29 ? 52  ILE A CG2 1 
ATOM 406   C CD1 . ILE A 1 52  ? 95.930  88.152  47.299  1.00 39.33 ? 52  ILE A CD1 1 
ATOM 407   N N   . ASP A 1 53  ? 101.106 89.297  45.461  1.00 39.54 ? 53  ASP A N   1 
ATOM 408   C CA  . ASP A 1 53  ? 102.106 90.281  45.035  1.00 39.77 ? 53  ASP A CA  1 
ATOM 409   C C   . ASP A 1 53  ? 103.252 89.647  44.248  1.00 39.75 ? 53  ASP A C   1 
ATOM 410   O O   . ASP A 1 53  ? 103.479 89.996  43.087  1.00 39.95 ? 53  ASP A O   1 
ATOM 411   C CB  . ASP A 1 53  ? 102.672 91.032  46.248  1.00 40.03 ? 53  ASP A CB  1 
ATOM 412   C CG  . ASP A 1 53  ? 101.619 91.850  46.979  1.00 40.34 ? 53  ASP A CG  1 
ATOM 413   O OD1 . ASP A 1 53  ? 100.410 91.623  46.755  1.00 40.49 ? 53  ASP A OD1 1 
ATOM 414   O OD2 . ASP A 1 53  ? 102.003 92.722  47.788  1.00 40.58 ? 53  ASP A OD2 1 
ATOM 415   N N   . ASN A 1 54  ? 103.955 88.711  44.884  1.00 39.52 ? 54  ASN A N   1 
ATOM 416   C CA  . ASN A 1 54  ? 105.220 88.173  44.362  1.00 39.56 ? 54  ASN A CA  1 
ATOM 417   C C   . ASN A 1 54  ? 105.118 86.839  43.606  1.00 39.43 ? 54  ASN A C   1 
ATOM 418   O O   . ASN A 1 54  ? 106.099 86.420  42.987  1.00 39.61 ? 54  ASN A O   1 
ATOM 419   C CB  . ASN A 1 54  ? 106.224 88.017  45.510  1.00 39.76 ? 54  ASN A CB  1 
ATOM 420   C CG  . ASN A 1 54  ? 106.587 89.342  46.156  1.00 39.96 ? 54  ASN A CG  1 
ATOM 421   O OD1 . ASN A 1 54  ? 107.647 89.905  45.888  1.00 40.17 ? 54  ASN A OD1 1 
ATOM 422   N ND2 . ASN A 1 54  ? 105.705 89.845  47.013  1.00 40.00 ? 54  ASN A ND2 1 
ATOM 423   N N   . ASN A 1 55  ? 103.955 86.181  43.658  1.00 39.07 ? 55  ASN A N   1 
ATOM 424   C CA  . ASN A 1 55  ? 103.753 84.841  43.074  1.00 38.83 ? 55  ASN A CA  1 
ATOM 425   C C   . ASN A 1 55  ? 104.679 83.784  43.698  1.00 38.56 ? 55  ASN A C   1 
ATOM 426   O O   . ASN A 1 55  ? 105.244 82.941  42.998  1.00 38.71 ? 55  ASN A O   1 
ATOM 427   C CB  . ASN A 1 55  ? 103.895 84.867  41.541  1.00 39.00 ? 55  ASN A CB  1 
ATOM 428   C CG  . ASN A 1 55  ? 103.074 85.967  40.889  1.00 39.27 ? 55  ASN A CG  1 
ATOM 429   O OD1 . ASN A 1 55  ? 103.562 86.685  40.018  1.00 39.50 ? 55  ASN A OD1 1 
ATOM 430   N ND2 . ASN A 1 55  ? 101.820 86.104  41.311  1.00 39.40 ? 55  ASN A ND2 1 
ATOM 431   N N   . SER A 1 56  ? 104.815 83.844  45.022  1.00 38.22 ? 56  SER A N   1 
ATOM 432   C CA  . SER A 1 56  ? 105.629 82.892  45.787  1.00 37.99 ? 56  SER A CA  1 
ATOM 433   C C   . SER A 1 56  ? 105.273 82.968  47.274  1.00 37.53 ? 56  SER A C   1 
ATOM 434   O O   . SER A 1 56  ? 104.430 83.774  47.672  1.00 37.69 ? 56  SER A O   1 
ATOM 435   C CB  . SER A 1 56  ? 107.120 83.184  45.592  1.00 38.25 ? 56  SER A CB  1 
ATOM 436   O OG  . SER A 1 56  ? 107.923 82.192  46.211  1.00 38.43 ? 56  SER A OG  1 
ATOM 437   N N   . TYR A 1 57  ? 105.904 82.115  48.081  1.00 36.99 ? 57  TYR A N   1 
ATOM 438   C CA  . TYR A 1 57  ? 105.740 82.136  49.539  1.00 36.72 ? 57  TYR A CA  1 
ATOM 439   C C   . TYR A 1 57  ? 107.037 82.570  50.226  1.00 36.67 ? 57  TYR A C   1 
ATOM 440   O O   . TYR A 1 57  ? 108.133 82.326  49.717  1.00 36.63 ? 57  TYR A O   1 
ATOM 441   C CB  . TYR A 1 57  ? 105.295 80.766  50.052  1.00 36.60 ? 57  TYR A CB  1 
ATOM 442   C CG  . TYR A 1 57  ? 103.872 80.407  49.678  1.00 36.53 ? 57  TYR A CG  1 
ATOM 443   C CD1 . TYR A 1 57  ? 102.789 81.062  50.268  1.00 36.47 ? 57  TYR A CD1 1 
ATOM 444   C CD2 . TYR A 1 57  ? 103.601 79.407  48.742  1.00 36.51 ? 57  TYR A CD2 1 
ATOM 445   C CE1 . TYR A 1 57  ? 101.481 80.738  49.933  1.00 36.34 ? 57  TYR A CE1 1 
ATOM 446   C CE2 . TYR A 1 57  ? 102.295 79.075  48.402  1.00 36.42 ? 57  TYR A CE2 1 
ATOM 447   C CZ  . TYR A 1 57  ? 101.240 79.743  48.999  1.00 36.34 ? 57  TYR A CZ  1 
ATOM 448   O OH  . TYR A 1 57  ? 99.946  79.419  48.667  1.00 36.45 ? 57  TYR A OH  1 
ATOM 449   N N   . THR A 1 58  ? 106.891 83.204  51.388  1.00 36.59 ? 58  THR A N   1 
ATOM 450   C CA  . THR A 1 58  ? 108.008 83.818  52.102  1.00 36.53 ? 58  THR A CA  1 
ATOM 451   C C   . THR A 1 58  ? 108.743 82.827  52.997  1.00 36.66 ? 58  THR A C   1 
ATOM 452   O O   . THR A 1 58  ? 108.113 82.079  53.746  1.00 36.84 ? 58  THR A O   1 
ATOM 453   C CB  . THR A 1 58  ? 107.523 84.969  53.002  1.00 36.65 ? 58  THR A CB  1 
ATOM 454   O OG1 . THR A 1 58  ? 106.524 84.483  53.909  1.00 36.58 ? 58  THR A OG1 1 
ATOM 455   C CG2 . THR A 1 58  ? 106.935 86.080  52.167  1.00 36.74 ? 58  THR A CG2 1 
ATOM 456   N N   . SER A 1 59  ? 110.072 82.842  52.918  1.00 36.78 ? 59  SER A N   1 
ATOM 457   C CA  . SER A 1 59  ? 110.921 82.111  53.855  1.00 36.85 ? 59  SER A CA  1 
ATOM 458   C C   . SER A 1 59  ? 111.114 82.933  55.132  1.00 36.82 ? 59  SER A C   1 
ATOM 459   O O   . SER A 1 59  ? 111.014 82.395  56.233  1.00 36.81 ? 59  SER A O   1 
ATOM 460   C CB  . SER A 1 59  ? 112.278 81.799  53.219  1.00 37.11 ? 59  SER A CB  1 
ATOM 461   O OG  . SER A 1 59  ? 113.036 80.919  54.033  1.00 37.24 ? 59  SER A OG  1 
ATOM 462   N N   . ASN A 1 60  ? 111.393 84.227  54.972  1.00 36.97 ? 60  ASN A N   1 
ATOM 463   C CA  . ASN A 1 60  ? 111.602 85.137  56.111  1.00 37.22 ? 60  ASN A CA  1 
ATOM 464   C C   . ASN A 1 60  ? 110.285 85.675  56.686  1.00 37.20 ? 60  ASN A C   1 
ATOM 465   O O   . ASN A 1 60  ? 109.291 85.811  55.970  1.00 37.13 ? 60  ASN A O   1 
ATOM 466   C CB  . ASN A 1 60  ? 112.534 86.301  55.727  1.00 37.35 ? 60  ASN A CB  1 
ATOM 467   C CG  . ASN A 1 60  ? 111.903 87.275  54.743  1.00 37.43 ? 60  ASN A CG  1 
ATOM 468   O OD1 . ASN A 1 60  ? 111.145 86.881  53.855  1.00 37.43 ? 60  ASN A OD1 1 
ATOM 469   N ND2 . ASN A 1 60  ? 112.227 88.554  54.892  1.00 37.57 ? 60  ASN A ND2 1 
ATOM 470   N N   . GLN A 1 61  ? 110.303 85.982  57.982  1.00 37.16 ? 61  GLN A N   1 
ATOM 471   C CA  . GLN A 1 61  ? 109.134 86.511  58.692  1.00 37.02 ? 61  GLN A CA  1 
ATOM 472   C C   . GLN A 1 61  ? 108.915 88.001  58.416  1.00 36.99 ? 61  GLN A C   1 
ATOM 473   O O   . GLN A 1 61  ? 107.770 88.454  58.363  1.00 37.14 ? 61  GLN A O   1 
ATOM 474   C CB  . GLN A 1 61  ? 109.282 86.285  60.200  1.00 37.12 ? 61  GLN A CB  1 
ATOM 475   C CG  . GLN A 1 61  ? 107.994 86.472  60.993  1.00 37.21 ? 61  GLN A CG  1 
ATOM 476   C CD  . GLN A 1 61  ? 108.205 86.403  62.495  1.00 37.24 ? 61  GLN A CD  1 
ATOM 477   O OE1 . GLN A 1 61  ? 109.154 85.784  62.980  1.00 37.27 ? 61  GLN A OE1 1 
ATOM 478   N NE2 . GLN A 1 61  ? 107.309 87.037  63.242  1.00 37.32 ? 61  GLN A NE2 1 
ATOM 479   N N   . ALA A 1 62  ? 110.007 88.752  58.255  1.00 36.96 ? 62  ALA A N   1 
ATOM 480   C CA  . ALA A 1 62  ? 109.952 90.203  58.010  1.00 36.85 ? 62  ALA A CA  1 
ATOM 481   C C   . ALA A 1 62  ? 109.144 90.602  56.769  1.00 36.78 ? 62  ALA A C   1 
ATOM 482   O O   . ALA A 1 62  ? 108.571 91.693  56.730  1.00 36.92 ? 62  ALA A O   1 
ATOM 483   C CB  . ALA A 1 62  ? 111.361 90.774  57.915  1.00 36.91 ? 62  ALA A CB  1 
ATOM 484   N N   . ALA A 1 63  ? 109.111 89.727  55.763  1.00 36.84 ? 63  ALA A N   1 
ATOM 485   C CA  . ALA A 1 63  ? 108.279 89.928  54.573  1.00 36.91 ? 63  ALA A CA  1 
ATOM 486   C C   . ALA A 1 63  ? 106.786 89.898  54.907  1.00 36.82 ? 63  ALA A C   1 
ATOM 487   O O   . ALA A 1 63  ? 106.023 90.720  54.400  1.00 36.91 ? 63  ALA A O   1 
ATOM 488   C CB  . ALA A 1 63  ? 108.602 88.883  53.514  1.00 37.01 ? 63  ALA A CB  1 
ATOM 489   N N   . LEU A 1 64  ? 106.381 88.955  55.759  1.00 36.89 ? 64  LEU A N   1 
ATOM 490   C CA  . LEU A 1 64  ? 104.988 88.853  56.214  1.00 37.01 ? 64  LEU A CA  1 
ATOM 491   C C   . LEU A 1 64  ? 104.582 90.018  57.123  1.00 37.02 ? 64  LEU A C   1 
ATOM 492   O O   . LEU A 1 64  ? 103.438 90.474  57.068  1.00 37.07 ? 64  LEU A O   1 
ATOM 493   C CB  . LEU A 1 64  ? 104.746 87.528  56.949  1.00 37.12 ? 64  LEU A CB  1 
ATOM 494   C CG  . LEU A 1 64  ? 104.960 86.234  56.158  1.00 37.29 ? 64  LEU A CG  1 
ATOM 495   C CD1 . LEU A 1 64  ? 104.840 85.027  57.077  1.00 37.40 ? 64  LEU A CD1 1 
ATOM 496   C CD2 . LEU A 1 64  ? 103.978 86.127  55.001  1.00 37.32 ? 64  LEU A CD2 1 
ATOM 497   N N   . ILE A 1 65  ? 105.518 90.485  57.951  1.00 37.10 ? 65  ILE A N   1 
ATOM 498   C CA  . ILE A 1 65  ? 105.272 91.610  58.866  1.00 37.16 ? 65  ILE A CA  1 
ATOM 499   C C   . ILE A 1 65  ? 105.124 92.930  58.096  1.00 37.20 ? 65  ILE A C   1 
ATOM 500   O O   . ILE A 1 65  ? 104.308 93.776  58.470  1.00 37.29 ? 65  ILE A O   1 
ATOM 501   C CB  . ILE A 1 65  ? 106.382 91.729  59.946  1.00 37.23 ? 65  ILE A CB  1 
ATOM 502   C CG1 . ILE A 1 65  ? 106.407 90.475  60.834  1.00 37.33 ? 65  ILE A CG1 1 
ATOM 503   C CG2 . ILE A 1 65  ? 106.176 92.966  60.821  1.00 37.26 ? 65  ILE A CG2 1 
ATOM 504   C CD1 . ILE A 1 65  ? 107.677 90.309  61.643  1.00 37.48 ? 65  ILE A CD1 1 
ATOM 505   N N   . SER A 1 66  ? 105.907 93.097  57.029  1.00 37.26 ? 66  SER A N   1 
ATOM 506   C CA  . SER A 1 66  ? 105.834 94.291  56.176  1.00 37.39 ? 66  SER A CA  1 
ATOM 507   C C   . SER A 1 66  ? 104.473 94.455  55.489  1.00 37.52 ? 66  SER A C   1 
ATOM 508   O O   . SER A 1 66  ? 103.991 95.579  55.328  1.00 37.55 ? 66  SER A O   1 
ATOM 509   C CB  . SER A 1 66  ? 106.947 94.266  55.122  1.00 37.37 ? 66  SER A CB  1 
ATOM 510   O OG  . SER A 1 66  ? 107.008 95.490  54.409  1.00 37.36 ? 66  SER A OG  1 
ATOM 511   N N   . LEU A 1 67  ? 103.865 93.338  55.085  1.00 37.78 ? 67  LEU A N   1 
ATOM 512   C CA  . LEU A 1 67  ? 102.523 93.349  54.480  1.00 38.04 ? 67  LEU A CA  1 
ATOM 513   C C   . LEU A 1 67  ? 101.410 93.758  55.454  1.00 38.13 ? 67  LEU A C   1 
ATOM 514   O O   . LEU A 1 67  ? 100.421 94.363  55.033  1.00 38.34 ? 67  LEU A O   1 
ATOM 515   C CB  . LEU A 1 67  ? 102.183 91.991  53.836  1.00 38.16 ? 67  LEU A CB  1 
ATOM 516   C CG  . LEU A 1 67  ? 102.502 91.851  52.344  1.00 38.40 ? 67  LEU A CG  1 
ATOM 517   C CD1 . LEU A 1 67  ? 103.993 91.956  52.051  1.00 38.45 ? 67  LEU A CD1 1 
ATOM 518   C CD2 . LEU A 1 67  ? 101.954 90.534  51.818  1.00 38.59 ? 67  LEU A CD2 1 
ATOM 519   N N   . GLY A 1 68  ? 101.572 93.438  56.740  1.00 37.98 ? 68  GLY A N   1 
ATOM 520   C CA  . GLY A 1 68  ? 100.552 93.748  57.752  1.00 37.88 ? 68  GLY A CA  1 
ATOM 521   C C   . GLY A 1 68  ? 100.502 92.879  59.001  1.00 37.72 ? 68  GLY A C   1 
ATOM 522   O O   . GLY A 1 68  ? 99.941  93.307  60.013  1.00 37.88 ? 68  GLY A O   1 
ATOM 523   N N   . LEU A 1 69  ? 101.050 91.661  58.938  1.00 37.46 ? 69  LEU A N   1 
ATOM 524   C CA  . LEU A 1 69  ? 101.092 90.749  60.094  1.00 37.38 ? 69  LEU A CA  1 
ATOM 525   C C   . LEU A 1 69  ? 101.771 91.385  61.309  1.00 37.38 ? 69  LEU A C   1 
ATOM 526   O O   . LEU A 1 69  ? 102.710 92.172  61.166  1.00 37.44 ? 69  LEU A O   1 
ATOM 527   C CB  . LEU A 1 69  ? 101.819 89.446  59.730  1.00 37.38 ? 69  LEU A CB  1 
ATOM 528   C CG  . LEU A 1 69  ? 101.848 88.302  60.753  1.00 37.33 ? 69  LEU A CG  1 
ATOM 529   C CD1 . LEU A 1 69  ? 100.457 87.753  61.032  1.00 37.36 ? 69  LEU A CD1 1 
ATOM 530   C CD2 . LEU A 1 69  ? 102.763 87.189  60.265  1.00 37.37 ? 69  LEU A CD2 1 
ATOM 531   N N   . LYS A 1 70  ? 101.289 91.034  62.500  1.00 37.37 ? 70  LYS A N   1 
ATOM 532   C CA  . LYS A 1 70  ? 101.840 91.554  63.753  1.00 37.30 ? 70  LYS A CA  1 
ATOM 533   C C   . LYS A 1 70  ? 103.183 90.905  64.077  1.00 37.09 ? 70  LYS A C   1 
ATOM 534   O O   . LYS A 1 70  ? 103.571 89.909  63.460  1.00 37.05 ? 70  LYS A O   1 
ATOM 535   C CB  . LYS A 1 70  ? 100.868 91.313  64.914  1.00 37.51 ? 70  LYS A CB  1 
ATOM 536   C CG  . LYS A 1 70  ? 99.523  92.005  64.764  1.00 37.82 ? 70  LYS A CG  1 
ATOM 537   C CD  . LYS A 1 70  ? 98.695  91.870  66.033  1.00 38.07 ? 70  LYS A CD  1 
ATOM 538   C CE  . LYS A 1 70  ? 97.358  92.587  65.916  1.00 38.26 ? 70  LYS A CE  1 
ATOM 539   N NZ  . LYS A 1 70  ? 96.457  91.965  64.904  1.00 38.34 ? 70  LYS A NZ  1 
ATOM 540   N N   . SER A 1 71  ? 103.886 91.480  65.051  1.00 36.84 ? 71  SER A N   1 
ATOM 541   C CA  . SER A 1 71  ? 105.127 90.897  65.567  1.00 36.56 ? 71  SER A CA  1 
ATOM 542   C C   . SER A 1 71  ? 104.825 89.601  66.315  1.00 36.24 ? 71  SER A C   1 
ATOM 543   O O   . SER A 1 71  ? 103.684 89.364  66.726  1.00 36.23 ? 71  SER A O   1 
ATOM 544   C CB  . SER A 1 71  ? 105.839 91.882  66.496  1.00 36.59 ? 71  SER A CB  1 
ATOM 545   O OG  . SER A 1 71  ? 106.148 93.089  65.821  1.00 36.60 ? 71  SER A OG  1 
ATOM 546   N N   . THR A 1 72  ? 105.849 88.765  66.487  1.00 35.94 ? 72  THR A N   1 
ATOM 547   C CA  . THR A 1 72  ? 105.698 87.475  67.165  1.00 35.78 ? 72  THR A CA  1 
ATOM 548   C C   . THR A 1 72  ? 105.184 87.693  68.595  1.00 35.65 ? 72  THR A C   1 
ATOM 549   O O   . THR A 1 72  ? 105.694 88.575  69.292  1.00 35.81 ? 72  THR A O   1 
ATOM 550   C CB  . THR A 1 72  ? 107.031 86.702  67.220  1.00 35.87 ? 72  THR A CB  1 
ATOM 551   O OG1 . THR A 1 72  ? 107.628 86.673  65.917  1.00 35.93 ? 72  THR A OG1 1 
ATOM 552   C CG2 . THR A 1 72  ? 106.814 85.270  67.705  1.00 35.94 ? 72  THR A CG2 1 
ATOM 553   N N   . PRO A 1 73  ? 104.172 86.908  69.037  1.00 35.35 ? 73  PRO A N   1 
ATOM 554   C CA  . PRO A 1 73  ? 103.626 87.138  70.385  1.00 35.35 ? 73  PRO A CA  1 
ATOM 555   C C   . PRO A 1 73  ? 104.593 86.782  71.517  1.00 35.42 ? 73  PRO A C   1 
ATOM 556   O O   . PRO A 1 73  ? 105.602 86.107  71.288  1.00 35.51 ? 73  PRO A O   1 
ATOM 557   C CB  . PRO A 1 73  ? 102.386 86.230  70.438  1.00 35.35 ? 73  PRO A CB  1 
ATOM 558   C CG  . PRO A 1 73  ? 102.140 85.782  69.041  1.00 35.32 ? 73  PRO A CG  1 
ATOM 559   C CD  . PRO A 1 73  ? 103.465 85.808  68.355  1.00 35.28 ? 73  PRO A CD  1 
ATOM 560   N N   . ALA A 1 74  ? 104.272 87.240  72.724  1.00 35.52 ? 74  ALA A N   1 
ATOM 561   C CA  . ALA A 1 74  ? 105.114 87.012  73.899  1.00 35.57 ? 74  ALA A CA  1 
ATOM 562   C C   . ALA A 1 74  ? 105.131 85.530  74.267  1.00 35.42 ? 74  ALA A C   1 
ATOM 563   O O   . ALA A 1 74  ? 104.075 84.897  74.347  1.00 35.50 ? 74  ALA A O   1 
ATOM 564   C CB  . ALA A 1 74  ? 104.625 87.843  75.076  1.00 35.68 ? 74  ALA A CB  1 
ATOM 565   N N   . ASN A 1 75  ? 106.335 84.995  74.480  1.00 35.20 ? 75  ASN A N   1 
ATOM 566   C CA  . ASN A 1 75  ? 106.555 83.577  74.796  1.00 35.04 ? 75  ASN A CA  1 
ATOM 567   C C   . ASN A 1 75  ? 106.049 82.632  73.692  1.00 34.83 ? 75  ASN A C   1 
ATOM 568   O O   . ASN A 1 75  ? 105.474 81.579  73.982  1.00 34.81 ? 75  ASN A O   1 
ATOM 569   C CB  . ASN A 1 75  ? 105.933 83.215  76.156  1.00 35.14 ? 75  ASN A CB  1 
ATOM 570   C CG  . ASN A 1 75  ? 106.324 84.182  77.261  1.00 35.37 ? 75  ASN A CG  1 
ATOM 571   O OD1 . ASN A 1 75  ? 107.425 84.735  77.260  1.00 35.52 ? 75  ASN A OD1 1 
ATOM 572   N ND2 . ASN A 1 75  ? 105.421 84.384  78.213  1.00 35.47 ? 75  ASN A ND2 1 
ATOM 573   N N   . VAL A 1 76  ? 106.271 83.023  72.436  1.00 34.65 ? 76  VAL A N   1 
ATOM 574   C CA  . VAL A 1 76  ? 105.916 82.214  71.261  1.00 34.49 ? 76  VAL A CA  1 
ATOM 575   C C   . VAL A 1 76  ? 107.118 82.156  70.319  1.00 34.47 ? 76  VAL A C   1 
ATOM 576   O O   . VAL A 1 76  ? 107.750 83.179  70.047  1.00 34.47 ? 76  VAL A O   1 
ATOM 577   C CB  . VAL A 1 76  ? 104.690 82.792  70.515  1.00 34.35 ? 76  VAL A CB  1 
ATOM 578   C CG1 . VAL A 1 76  ? 104.408 82.016  69.228  1.00 34.32 ? 76  VAL A CG1 1 
ATOM 579   C CG2 . VAL A 1 76  ? 103.467 82.777  71.418  1.00 34.40 ? 76  VAL A CG2 1 
ATOM 580   N N   . THR A 1 77  ? 107.414 80.954  69.824  1.00 34.42 ? 77  THR A N   1 
ATOM 581   C CA  . THR A 1 77  ? 108.551 80.710  68.936  1.00 34.40 ? 77  THR A CA  1 
ATOM 582   C C   . THR A 1 77  ? 108.067 80.366  67.529  1.00 34.33 ? 77  THR A C   1 
ATOM 583   O O   . THR A 1 77  ? 108.026 79.197  67.137  1.00 34.35 ? 77  THR A O   1 
ATOM 584   C CB  . THR A 1 77  ? 109.440 79.574  69.477  1.00 34.48 ? 77  THR A CB  1 
ATOM 585   O OG1 . THR A 1 77  ? 108.642 78.409  69.713  1.00 34.42 ? 77  THR A OG1 1 
ATOM 586   C CG2 . THR A 1 77  ? 110.110 79.995  70.776  1.00 34.60 ? 77  THR A CG2 1 
ATOM 587   N N   . PHE A 1 78  ? 107.692 81.404  66.784  1.00 34.32 ? 78  PHE A N   1 
ATOM 588   C CA  . PHE A 1 78  ? 107.302 81.269  65.380  1.00 34.26 ? 78  PHE A CA  1 
ATOM 589   C C   . PHE A 1 78  ? 108.553 81.075  64.524  1.00 34.03 ? 78  PHE A C   1 
ATOM 590   O O   . PHE A 1 78  ? 109.571 81.732  64.750  1.00 34.15 ? 78  PHE A O   1 
ATOM 591   C CB  . PHE A 1 78  ? 106.533 82.514  64.919  1.00 34.49 ? 78  PHE A CB  1 
ATOM 592   C CG  . PHE A 1 78  ? 106.086 82.462  63.483  1.00 34.68 ? 78  PHE A CG  1 
ATOM 593   C CD1 . PHE A 1 78  ? 104.921 81.790  63.127  1.00 34.79 ? 78  PHE A CD1 1 
ATOM 594   C CD2 . PHE A 1 78  ? 106.823 83.096  62.485  1.00 34.80 ? 78  PHE A CD2 1 
ATOM 595   C CE1 . PHE A 1 78  ? 104.505 81.743  61.803  1.00 34.94 ? 78  PHE A CE1 1 
ATOM 596   C CE2 . PHE A 1 78  ? 106.412 83.053  61.161  1.00 34.93 ? 78  PHE A CE2 1 
ATOM 597   C CZ  . PHE A 1 78  ? 105.251 82.376  60.818  1.00 34.99 ? 78  PHE A CZ  1 
ATOM 598   N N   . SER A 1 79  ? 108.466 80.173  63.548  1.00 33.69 ? 79  SER A N   1 
ATOM 599   C CA  . SER A 1 79  ? 109.605 79.842  62.690  1.00 33.53 ? 79  SER A CA  1 
ATOM 600   C C   . SER A 1 79  ? 109.151 79.133  61.413  1.00 33.30 ? 79  SER A C   1 
ATOM 601   O O   . SER A 1 79  ? 108.635 78.016  61.471  1.00 33.36 ? 79  SER A O   1 
ATOM 602   C CB  . SER A 1 79  ? 110.593 78.955  63.452  1.00 33.61 ? 79  SER A CB  1 
ATOM 603   O OG  . SER A 1 79  ? 111.700 78.593  62.643  1.00 33.71 ? 79  SER A OG  1 
ATOM 604   N N   . ILE A 1 80  ? 109.357 79.784  60.269  1.00 33.07 ? 80  ILE A N   1 
ATOM 605   C CA  . ILE A 1 80  ? 109.009 79.208  58.969  1.00 32.89 ? 80  ILE A CA  1 
ATOM 606   C C   . ILE A 1 80  ? 110.116 78.233  58.569  1.00 32.77 ? 80  ILE A C   1 
ATOM 607   O O   . ILE A 1 80  ? 111.284 78.617  58.483  1.00 32.79 ? 80  ILE A O   1 
ATOM 608   C CB  . ILE A 1 80  ? 108.838 80.294  57.879  1.00 32.91 ? 80  ILE A CB  1 
ATOM 609   C CG1 . ILE A 1 80  ? 107.726 81.281  58.270  1.00 32.96 ? 80  ILE A CG1 1 
ATOM 610   C CG2 . ILE A 1 80  ? 108.534 79.654  56.523  1.00 32.94 ? 80  ILE A CG2 1 
ATOM 611   C CD1 . ILE A 1 80  ? 107.691 82.550  57.444  1.00 33.00 ? 80  ILE A CD1 1 
ATOM 612   N N   . VAL A 1 81  ? 109.738 76.976  58.331  1.00 32.73 ? 81  VAL A N   1 
ATOM 613   C CA  . VAL A 1 81  ? 110.687 75.917  57.976  1.00 32.76 ? 81  VAL A CA  1 
ATOM 614   C C   . VAL A 1 81  ? 111.193 76.123  56.553  1.00 32.87 ? 81  VAL A C   1 
ATOM 615   O O   . VAL A 1 81  ? 112.398 76.250  56.325  1.00 32.99 ? 81  VAL A O   1 
ATOM 616   C CB  . VAL A 1 81  ? 110.043 74.515  58.110  1.00 32.81 ? 81  VAL A CB  1 
ATOM 617   C CG1 . VAL A 1 81  ? 110.936 73.424  57.521  1.00 32.88 ? 81  VAL A CG1 1 
ATOM 618   C CG2 . VAL A 1 81  ? 109.729 74.216  59.569  1.00 32.82 ? 81  VAL A CG2 1 
ATOM 619   N N   . SER A 1 82  ? 110.258 76.143  55.608  1.00 32.95 ? 82  SER A N   1 
ATOM 620   C CA  . SER A 1 82  ? 110.573 76.312  54.190  1.00 33.10 ? 82  SER A CA  1 
ATOM 621   C C   . SER A 1 82  ? 109.380 76.882  53.434  1.00 33.16 ? 82  SER A C   1 
ATOM 622   O O   . SER A 1 82  ? 108.241 76.797  53.900  1.00 33.23 ? 82  SER A O   1 
ATOM 623   C CB  . SER A 1 82  ? 110.993 74.974  53.576  1.00 33.14 ? 82  SER A CB  1 
ATOM 624   O OG  . SER A 1 82  ? 109.991 73.987  53.762  1.00 33.18 ? 82  SER A OG  1 
ATOM 625   N N   . ALA A 1 83  ? 109.657 77.464  52.271  1.00 33.30 ? 83  ALA A N   1 
ATOM 626   C CA  . ALA A 1 83  ? 108.625 78.088  51.446  1.00 33.46 ? 83  ALA A CA  1 
ATOM 627   C C   . ALA A 1 83  ? 109.031 78.111  49.975  1.00 33.71 ? 83  ALA A C   1 
ATOM 628   O O   . ALA A 1 83  ? 109.737 79.017  49.528  1.00 33.85 ? 83  ALA A O   1 
ATOM 629   C CB  . ALA A 1 83  ? 108.340 79.497  51.944  1.00 33.47 ? 83  ALA A CB  1 
ATOM 630   N N   . SER A 1 84  ? 108.578 77.101  49.234  1.00 34.04 ? 84  SER A N   1 
ATOM 631   C CA  . SER A 1 84  ? 108.774 77.036  47.786  1.00 34.33 ? 84  SER A CA  1 
ATOM 632   C C   . SER A 1 84  ? 107.771 77.953  47.082  1.00 34.53 ? 84  SER A C   1 
ATOM 633   O O   . SER A 1 84  ? 106.960 78.615  47.735  1.00 34.55 ? 84  SER A O   1 
ATOM 634   C CB  . SER A 1 84  ? 108.627 75.591  47.295  1.00 34.48 ? 84  SER A CB  1 
ATOM 635   O OG  . SER A 1 84  ? 107.298 75.120  47.450  1.00 34.54 ? 84  SER A OG  1 
ATOM 636   N N   . ALA A 1 85  ? 107.834 77.994  45.753  1.00 35.05 ? 85  ALA A N   1 
ATOM 637   C CA  . ALA A 1 85  ? 106.930 78.821  44.948  1.00 35.50 ? 85  ALA A CA  1 
ATOM 638   C C   . ALA A 1 85  ? 105.445 78.503  45.168  1.00 35.79 ? 85  ALA A C   1 
ATOM 639   O O   . ALA A 1 85  ? 104.620 79.418  45.206  1.00 35.91 ? 85  ALA A O   1 
ATOM 640   C CB  . ALA A 1 85  ? 107.275 78.693  43.470  1.00 35.61 ? 85  ALA A CB  1 
ATOM 641   N N   . ASN A 1 86  ? 105.120 77.217  45.313  1.00 36.15 ? 86  ASN A N   1 
ATOM 642   C CA  . ASN A 1 86  ? 103.729 76.757  45.440  1.00 36.49 ? 86  ASN A CA  1 
ATOM 643   C C   . ASN A 1 86  ? 103.446 75.952  46.724  1.00 36.55 ? 86  ASN A C   1 
ATOM 644   O O   . ASN A 1 86  ? 102.521 75.135  46.749  1.00 36.63 ? 86  ASN A O   1 
ATOM 645   C CB  . ASN A 1 86  ? 103.349 75.927  44.206  1.00 36.84 ? 86  ASN A CB  1 
ATOM 646   C CG  . ASN A 1 86  ? 103.533 76.692  42.906  1.00 37.16 ? 86  ASN A CG  1 
ATOM 647   O OD1 . ASN A 1 86  ? 104.650 77.047  42.534  1.00 37.25 ? 86  ASN A OD1 1 
ATOM 648   N ND2 . ASN A 1 86  ? 102.432 76.937  42.202  1.00 37.45 ? 86  ASN A ND2 1 
ATOM 649   N N   . SER A 1 87  ? 104.224 76.186  47.783  1.00 36.55 ? 87  SER A N   1 
ATOM 650   C CA  . SER A 1 87  ? 103.981 75.546  49.086  1.00 36.52 ? 87  SER A CA  1 
ATOM 651   C C   . SER A 1 87  ? 104.685 76.274  50.232  1.00 36.58 ? 87  SER A C   1 
ATOM 652   O O   . SER A 1 87  ? 105.505 77.168  50.007  1.00 36.60 ? 87  SER A O   1 
ATOM 653   C CB  . SER A 1 87  ? 104.436 74.081  49.061  1.00 36.53 ? 87  SER A CB  1 
ATOM 654   O OG  . SER A 1 87  ? 104.055 73.408  50.249  1.00 36.60 ? 87  SER A OG  1 
ATOM 655   N N   . TYR A 1 88  ? 104.349 75.880  51.460  1.00 36.69 ? 88  TYR A N   1 
ATOM 656   C CA  . TYR A 1 88  ? 105.013 76.392  52.665  1.00 36.75 ? 88  TYR A CA  1 
ATOM 657   C C   . TYR A 1 88  ? 104.833 75.469  53.870  1.00 37.06 ? 88  TYR A C   1 
ATOM 658   O O   . TYR A 1 88  ? 103.953 74.606  53.881  1.00 37.14 ? 88  TYR A O   1 
ATOM 659   C CB  . TYR A 1 88  ? 104.518 77.805  53.004  1.00 36.59 ? 88  TYR A CB  1 
ATOM 660   C CG  . TYR A 1 88  ? 103.031 77.909  53.278  1.00 36.51 ? 88  TYR A CG  1 
ATOM 661   C CD1 . TYR A 1 88  ? 102.519 77.708  54.561  1.00 36.43 ? 88  TYR A CD1 1 
ATOM 662   C CD2 . TYR A 1 88  ? 102.134 78.224  52.256  1.00 36.53 ? 88  TYR A CD2 1 
ATOM 663   C CE1 . TYR A 1 88  ? 101.159 77.804  54.817  1.00 36.37 ? 88  TYR A CE1 1 
ATOM 664   C CE2 . TYR A 1 88  ? 100.771 78.325  52.504  1.00 36.49 ? 88  TYR A CE2 1 
ATOM 665   C CZ  . TYR A 1 88  ? 100.288 78.115  53.785  1.00 36.40 ? 88  TYR A CZ  1 
ATOM 666   O OH  . TYR A 1 88  ? 98.940  78.213  54.034  1.00 36.43 ? 88  TYR A OH  1 
ATOM 667   N N   . CYS A 1 89  ? 105.683 75.668  54.876  1.00 37.62 ? 89  CYS A N   1 
ATOM 668   C CA  . CYS A 1 89  ? 105.620 74.931  56.141  1.00 38.04 ? 89  CYS A CA  1 
ATOM 669   C C   . CYS A 1 89  ? 106.046 75.860  57.278  1.00 37.48 ? 89  CYS A C   1 
ATOM 670   O O   . CYS A 1 89  ? 107.180 76.343  57.289  1.00 37.51 ? 89  CYS A O   1 
ATOM 671   C CB  . CYS A 1 89  ? 106.528 73.701  56.089  1.00 39.02 ? 89  CYS A CB  1 
ATOM 672   S SG  . CYS A 1 89  ? 106.567 72.725  57.613  1.00 40.38 ? 89  CYS A SG  1 
ATOM 673   N N   . MET A 1 90  ? 105.136 76.099  58.225  1.00 36.81 ? 90  MET A N   1 
ATOM 674   C CA  . MET A 1 90  ? 105.364 77.029  59.332  1.00 36.33 ? 90  MET A CA  1 
ATOM 675   C C   . MET A 1 90  ? 105.043 76.361  60.669  1.00 35.96 ? 90  MET A C   1 
ATOM 676   O O   . MET A 1 90  ? 103.879 76.079  60.966  1.00 35.94 ? 90  MET A O   1 
ATOM 677   C CB  . MET A 1 90  ? 104.506 78.288  59.155  1.00 36.33 ? 90  MET A CB  1 
ATOM 678   C CG  . MET A 1 90  ? 104.620 78.939  57.786  1.00 36.32 ? 90  MET A CG  1 
ATOM 679   S SD  . MET A 1 90  ? 103.843 80.565  57.711  1.00 36.31 ? 90  MET A SD  1 
ATOM 680   C CE  . MET A 1 90  ? 102.124 80.139  57.980  1.00 36.30 ? 90  MET A CE  1 
ATOM 681   N N   . ILE A 1 91  ? 106.084 76.101  61.461  1.00 35.57 ? 91  ILE A N   1 
ATOM 682   C CA  . ILE A 1 91  ? 105.941 75.556  62.812  1.00 35.27 ? 91  ILE A CA  1 
ATOM 683   C C   . ILE A 1 91  ? 105.908 76.712  63.815  1.00 34.97 ? 91  ILE A C   1 
ATOM 684   O O   . ILE A 1 91  ? 106.641 77.692  63.666  1.00 35.06 ? 91  ILE A O   1 
ATOM 685   C CB  . ILE A 1 91  ? 107.108 74.604  63.169  1.00 35.34 ? 91  ILE A CB  1 
ATOM 686   C CG1 . ILE A 1 91  ? 107.258 73.489  62.118  1.00 35.48 ? 91  ILE A CG1 1 
ATOM 687   C CG2 . ILE A 1 91  ? 106.928 74.017  64.569  1.00 35.37 ? 91  ILE A CG2 1 
ATOM 688   C CD1 . ILE A 1 91  ? 106.055 72.577  61.966  1.00 35.54 ? 91  ILE A CD1 1 
ATOM 689   N N   . ALA A 1 92  ? 105.052 76.589  64.828  1.00 34.64 ? 92  ALA A N   1 
ATOM 690   C CA  . ALA A 1 92  ? 104.964 77.575  65.908  1.00 34.42 ? 92  ALA A CA  1 
ATOM 691   C C   . ALA A 1 92  ? 104.399 76.944  67.177  1.00 34.21 ? 92  ALA A C   1 
ATOM 692   O O   . ALA A 1 92  ? 103.612 75.995  67.112  1.00 34.13 ? 92  ALA A O   1 
ATOM 693   C CB  . ALA A 1 92  ? 104.108 78.758  65.478  1.00 34.49 ? 92  ALA A CB  1 
ATOM 694   N N   . GLY A 1 93  ? 104.804 77.481  68.326  1.00 34.02 ? 93  GLY A N   1 
ATOM 695   C CA  . GLY A 1 93  ? 104.379 76.957  69.622  1.00 33.89 ? 93  GLY A CA  1 
ATOM 696   C C   . GLY A 1 93  ? 104.663 77.900  70.777  1.00 33.77 ? 93  GLY A C   1 
ATOM 697   O O   . GLY A 1 93  ? 105.591 78.709  70.715  1.00 33.83 ? 93  GLY A O   1 
ATOM 698   N N   . HIS A 1 94  ? 103.856 77.781  71.829  1.00 33.62 ? 94  HIS A N   1 
ATOM 699   C CA  . HIS A 1 94  ? 104.012 78.573  73.047  1.00 33.49 ? 94  HIS A CA  1 
ATOM 700   C C   . HIS A 1 94  ? 104.902 77.795  74.017  1.00 33.50 ? 94  HIS A C   1 
ATOM 701   O O   . HIS A 1 94  ? 104.920 76.562  73.993  1.00 33.61 ? 94  HIS A O   1 
ATOM 702   C CB  . HIS A 1 94  ? 102.640 78.845  73.675  1.00 33.42 ? 94  HIS A CB  1 
ATOM 703   C CG  . HIS A 1 94  ? 102.572 80.112  74.469  1.00 33.39 ? 94  HIS A CG  1 
ATOM 704   N ND1 . HIS A 1 94  ? 102.022 81.274  73.973  1.00 33.41 ? 94  HIS A ND1 1 
ATOM 705   C CD2 . HIS A 1 94  ? 103.010 80.406  75.716  1.00 33.38 ? 94  HIS A CD2 1 
ATOM 706   C CE1 . HIS A 1 94  ? 102.112 82.226  74.886  1.00 33.44 ? 94  HIS A CE1 1 
ATOM 707   N NE2 . HIS A 1 94  ? 102.706 81.724  75.954  1.00 33.41 ? 94  HIS A NE2 1 
ATOM 708   N N   . SER A 1 95  ? 105.637 78.515  74.863  1.00 33.42 ? 95  SER A N   1 
ATOM 709   C CA  . SER A 1 95  ? 106.567 77.891  75.812  1.00 33.30 ? 95  SER A CA  1 
ATOM 710   C C   . SER A 1 95  ? 105.834 77.065  76.869  1.00 33.15 ? 95  SER A C   1 
ATOM 711   O O   . SER A 1 95  ? 106.244 75.944  77.176  1.00 33.23 ? 95  SER A O   1 
ATOM 712   C CB  . SER A 1 95  ? 107.450 78.945  76.487  1.00 33.39 ? 95  SER A CB  1 
ATOM 713   O OG  . SER A 1 95  ? 106.672 79.868  77.225  1.00 33.47 ? 95  SER A OG  1 
ATOM 714   N N   . GLY A 1 96  ? 104.756 77.631  77.417  1.00 32.96 ? 96  GLY A N   1 
ATOM 715   C CA  . GLY A 1 96  ? 103.856 76.919  78.330  1.00 32.84 ? 96  GLY A CA  1 
ATOM 716   C C   . GLY A 1 96  ? 102.543 76.537  77.673  1.00 32.59 ? 96  GLY A C   1 
ATOM 717   O O   . GLY A 1 96  ? 101.470 76.811  78.216  1.00 32.56 ? 96  GLY A O   1 
ATOM 718   N N   . GLY A 1 97  ? 102.633 75.905  76.503  1.00 32.33 ? 97  GLY A N   1 
ATOM 719   C CA  . GLY A 1 97  ? 101.471 75.393  75.776  1.00 32.11 ? 97  GLY A CA  1 
ATOM 720   C C   . GLY A 1 97  ? 101.337 73.894  75.966  1.00 31.91 ? 97  GLY A C   1 
ATOM 721   O O   . GLY A 1 97  ? 101.781 73.349  76.981  1.00 31.98 ? 97  GLY A O   1 
ATOM 722   N N   . THR A 1 98  ? 100.724 73.234  74.984  1.00 31.56 ? 98  THR A N   1 
ATOM 723   C CA  . THR A 1 98  ? 100.541 71.781  74.993  1.00 31.30 ? 98  THR A CA  1 
ATOM 724   C C   . THR A 1 98  ? 101.480 71.106  73.998  1.00 31.00 ? 98  THR A C   1 
ATOM 725   O O   . THR A 1 98  ? 102.303 70.271  74.381  1.00 31.05 ? 98  THR A O   1 
ATOM 726   C CB  . THR A 1 98  ? 99.088  71.401  74.656  1.00 31.35 ? 98  THR A CB  1 
ATOM 727   O OG1 . THR A 1 98  ? 98.725  71.955  73.385  1.00 31.30 ? 98  THR A OG1 1 
ATOM 728   C CG2 . THR A 1 98  ? 98.142  71.922  75.727  1.00 31.42 ? 98  THR A CG2 1 
ATOM 729   N N   . VAL A 1 99  ? 101.345 71.475  72.725  1.00 30.61 ? 99  VAL A N   1 
ATOM 730   C CA  . VAL A 1 99  ? 102.148 70.909  71.633  1.00 30.35 ? 99  VAL A CA  1 
ATOM 731   C C   . VAL A 1 99  ? 102.458 71.963  70.569  1.00 30.06 ? 99  VAL A C   1 
ATOM 732   O O   . VAL A 1 99  ? 101.869 73.046  70.564  1.00 30.16 ? 99  VAL A O   1 
ATOM 733   C CB  . VAL A 1 99  ? 101.434 69.707  70.963  1.00 30.45 ? 99  VAL A CB  1 
ATOM 734   C CG1 . VAL A 1 99  ? 101.503 68.473  71.851  1.00 30.52 ? 99  VAL A CG1 1 
ATOM 735   C CG2 . VAL A 1 99  ? 99.985  70.038  70.619  1.00 30.52 ? 99  VAL A CG2 1 
ATOM 736   N N   . TRP A 1 100 ? 103.388 71.632  69.676  1.00 29.73 ? 100 TRP A N   1 
ATOM 737   C CA  . TRP A 1 100 ? 103.715 72.488  68.533  1.00 29.57 ? 100 TRP A CA  1 
ATOM 738   C C   . TRP A 1 100 ? 102.599 72.427  67.493  1.00 29.76 ? 100 TRP A C   1 
ATOM 739   O O   . TRP A 1 100 ? 101.957 71.387  67.324  1.00 29.91 ? 100 TRP A O   1 
ATOM 740   C CB  . TRP A 1 100 ? 105.035 72.059  67.887  1.00 29.37 ? 100 TRP A CB  1 
ATOM 741   C CG  . TRP A 1 100 ? 106.230 72.270  68.759  1.00 29.17 ? 100 TRP A CG  1 
ATOM 742   C CD1 . TRP A 1 100 ? 106.738 71.399  69.677  1.00 29.08 ? 100 TRP A CD1 1 
ATOM 743   C CD2 . TRP A 1 100 ? 107.074 73.424  68.789  1.00 28.95 ? 100 TRP A CD2 1 
ATOM 744   N NE1 . TRP A 1 100 ? 107.847 71.940  70.281  1.00 28.98 ? 100 TRP A NE1 1 
ATOM 745   C CE2 . TRP A 1 100 ? 108.075 73.183  69.756  1.00 28.90 ? 100 TRP A CE2 1 
ATOM 746   C CE3 . TRP A 1 100 ? 107.081 74.641  68.095  1.00 28.91 ? 100 TRP A CE3 1 
ATOM 747   C CZ2 . TRP A 1 100 ? 109.077 74.116  70.047  1.00 28.93 ? 100 TRP A CZ2 1 
ATOM 748   C CZ3 . TRP A 1 100 ? 108.077 75.570  68.385  1.00 28.95 ? 100 TRP A CZ3 1 
ATOM 749   C CH2 . TRP A 1 100 ? 109.062 75.299  69.354  1.00 28.96 ? 100 TRP A CH2 1 
ATOM 750   N N   . PHE A 1 101 ? 102.380 73.546  66.806  1.00 29.96 ? 101 PHE A N   1 
ATOM 751   C CA  . PHE A 1 101 ? 101.360 73.657  65.765  1.00 30.13 ? 101 PHE A CA  1 
ATOM 752   C C   . PHE A 1 101 ? 102.028 73.917  64.419  1.00 30.19 ? 101 PHE A C   1 
ATOM 753   O O   . PHE A 1 101 ? 102.811 74.858  64.289  1.00 30.31 ? 101 PHE A O   1 
ATOM 754   C CB  . PHE A 1 101 ? 100.401 74.808  66.077  1.00 30.32 ? 101 PHE A CB  1 
ATOM 755   C CG  . PHE A 1 101 ? 99.450  74.529  67.208  1.00 30.39 ? 101 PHE A CG  1 
ATOM 756   C CD1 . PHE A 1 101 ? 99.891  74.542  68.528  1.00 30.53 ? 101 PHE A CD1 1 
ATOM 757   C CD2 . PHE A 1 101 ? 98.102  74.278  66.958  1.00 30.42 ? 101 PHE A CD2 1 
ATOM 758   C CE1 . PHE A 1 101 ? 99.013  74.293  69.574  1.00 30.59 ? 101 PHE A CE1 1 
ATOM 759   C CE2 . PHE A 1 101 ? 97.220  74.031  67.999  1.00 30.54 ? 101 PHE A CE2 1 
ATOM 760   C CZ  . PHE A 1 101 ? 97.676  74.037  69.309  1.00 30.60 ? 101 PHE A CZ  1 
ATOM 761   N N   . ALA A 1 102 ? 101.716 73.077  63.432  1.00 30.37 ? 102 ALA A N   1 
ATOM 762   C CA  . ALA A 1 102 ? 102.189 73.259  62.058  1.00 30.57 ? 102 ALA A CA  1 
ATOM 763   C C   . ALA A 1 102 ? 101.188 74.090  61.261  1.00 30.78 ? 102 ALA A C   1 
ATOM 764   O O   . ALA A 1 102 ? 100.084 74.372  61.736  1.00 30.81 ? 102 ALA A O   1 
ATOM 765   C CB  . ALA A 1 102 ? 102.402 71.909  61.392  1.00 30.60 ? 102 ALA A CB  1 
ATOM 766   N N   . ALA A 1 103 ? 101.583 74.480  60.051  1.00 31.11 ? 103 ALA A N   1 
ATOM 767   C CA  . ALA A 1 103 ? 100.726 75.277  59.170  1.00 31.41 ? 103 ALA A CA  1 
ATOM 768   C C   . ALA A 1 103 ? 101.172 75.175  57.708  1.00 31.72 ? 103 ALA A C   1 
ATOM 769   O O   . ALA A 1 103 ? 102.141 75.821  57.301  1.00 31.76 ? 103 ALA A O   1 
ATOM 770   C CB  . ALA A 1 103 ? 100.706 76.729  59.625  1.00 31.43 ? 103 ALA A CB  1 
ATOM 771   N N   . THR A 1 104 ? 100.457 74.352  56.941  1.00 32.08 ? 104 THR A N   1 
ATOM 772   C CA  . THR A 1 104 ? 100.708 74.147  55.511  1.00 32.34 ? 104 THR A CA  1 
ATOM 773   C C   . THR A 1 104 ? 99.445  74.535  54.735  1.00 32.69 ? 104 THR A C   1 
ATOM 774   O O   . THR A 1 104 ? 98.372  74.645  55.337  1.00 32.83 ? 104 THR A O   1 
ATOM 775   C CB  . THR A 1 104 ? 101.066 72.671  55.222  1.00 32.41 ? 104 THR A CB  1 
ATOM 776   O OG1 . THR A 1 104 ? 99.891  71.854  55.298  1.00 32.45 ? 104 THR A OG1 1 
ATOM 777   C CG2 . THR A 1 104 ? 102.096 72.158  56.216  1.00 32.50 ? 104 THR A CG2 1 
ATOM 778   N N   . PRO A 1 105 ? 99.556  74.747  53.404  1.00 33.13 ? 105 PRO A N   1 
ATOM 779   C CA  . PRO A 1 105 ? 98.356  75.129  52.644  1.00 33.45 ? 105 PRO A CA  1 
ATOM 780   C C   . PRO A 1 105 ? 97.338  73.997  52.461  1.00 33.95 ? 105 PRO A C   1 
ATOM 781   O O   . PRO A 1 105 ? 96.135  74.247  52.561  1.00 34.10 ? 105 PRO A O   1 
ATOM 782   C CB  . PRO A 1 105 ? 98.907  75.605  51.291  1.00 33.34 ? 105 PRO A CB  1 
ATOM 783   C CG  . PRO A 1 105 ? 100.312 75.134  51.213  1.00 33.31 ? 105 PRO A CG  1 
ATOM 784   C CD  . PRO A 1 105 ? 100.750 74.616  52.548  1.00 33.23 ? 105 PRO A CD  1 
ATOM 785   N N   . ASP A 1 106 ? 97.812  72.777  52.202  1.00 34.61 ? 106 ASP A N   1 
ATOM 786   C CA  . ASP A 1 106 ? 96.920  71.629  51.972  1.00 35.22 ? 106 ASP A CA  1 
ATOM 787   C C   . ASP A 1 106 ? 96.194  71.141  53.235  1.00 35.56 ? 106 ASP A C   1 
ATOM 788   O O   . ASP A 1 106 ? 95.000  70.838  53.176  1.00 35.76 ? 106 ASP A O   1 
ATOM 789   C CB  . ASP A 1 106 ? 97.657  70.467  51.276  1.00 35.53 ? 106 ASP A CB  1 
ATOM 790   C CG  . ASP A 1 106 ? 98.736  69.830  52.145  1.00 35.77 ? 106 ASP A CG  1 
ATOM 791   O OD1 . ASP A 1 106 ? 99.365  70.547  52.954  1.00 35.93 ? 106 ASP A OD1 1 
ATOM 792   O OD2 . ASP A 1 106 ? 98.959  68.608  52.009  1.00 35.86 ? 106 ASP A OD2 1 
ATOM 793   N N   . LYS A 1 107 ? 96.906  71.077  54.360  1.00 35.96 ? 107 LYS A N   1 
ATOM 794   C CA  . LYS A 1 107 ? 96.340  70.593  55.629  1.00 36.36 ? 107 LYS A CA  1 
ATOM 795   C C   . LYS A 1 107 ? 95.810  71.707  56.540  1.00 36.64 ? 107 LYS A C   1 
ATOM 796   O O   . LYS A 1 107 ? 95.112  71.420  57.515  1.00 36.62 ? 107 LYS A O   1 
ATOM 797   C CB  . LYS A 1 107 ? 97.377  69.763  56.392  1.00 36.45 ? 107 LYS A CB  1 
ATOM 798   C CG  . LYS A 1 107 ? 97.824  68.506  55.663  1.00 36.66 ? 107 LYS A CG  1 
ATOM 799   C CD  . LYS A 1 107 ? 98.895  67.748  56.433  1.00 36.88 ? 107 LYS A CD  1 
ATOM 800   C CE  . LYS A 1 107 ? 98.320  67.002  57.628  1.00 37.03 ? 107 LYS A CE  1 
ATOM 801   N NZ  . LYS A 1 107 ? 99.351  66.177  58.317  1.00 37.12 ? 107 LYS A NZ  1 
ATOM 802   N N   . GLY A 1 108 ? 96.137  72.963  56.231  1.00 37.06 ? 108 GLY A N   1 
ATOM 803   C CA  . GLY A 1 108 ? 95.753  74.100  57.070  1.00 37.38 ? 108 GLY A CA  1 
ATOM 804   C C   . GLY A 1 108 ? 96.601  74.167  58.326  1.00 37.66 ? 108 GLY A C   1 
ATOM 805   O O   . GLY A 1 108 ? 97.716  73.645  58.353  1.00 37.75 ? 108 GLY A O   1 
ATOM 806   N N   . VAL A 1 109 ? 96.068  74.816  59.360  1.00 38.04 ? 109 VAL A N   1 
ATOM 807   C CA  . VAL A 1 109 ? 96.733  74.908  60.662  1.00 38.33 ? 109 VAL A CA  1 
ATOM 808   C C   . VAL A 1 109 ? 96.281  73.729  61.525  1.00 38.62 ? 109 VAL A C   1 
ATOM 809   O O   . VAL A 1 109 ? 95.094  73.609  61.836  1.00 38.77 ? 109 VAL A O   1 
ATOM 810   C CB  . VAL A 1 109 ? 96.406  76.238  61.378  1.00 38.50 ? 109 VAL A CB  1 
ATOM 811   C CG1 . VAL A 1 109 ? 97.120  76.322  62.726  1.00 38.57 ? 109 VAL A CG1 1 
ATOM 812   C CG2 . VAL A 1 109 ? 96.778  77.425  60.493  1.00 38.56 ? 109 VAL A CG2 1 
ATOM 813   N N   . TYR A 1 110 ? 97.227  72.866  61.897  1.00 38.99 ? 110 TYR A N   1 
ATOM 814   C CA  . TYR A 1 110 ? 96.954  71.694  62.738  1.00 39.35 ? 110 TYR A CA  1 
ATOM 815   C C   . TYR A 1 110 ? 98.041  71.506  63.793  1.00 39.82 ? 110 TYR A C   1 
ATOM 816   O O   . TYR A 1 110 ? 99.100  72.137  63.723  1.00 40.04 ? 110 TYR A O   1 
ATOM 817   C CB  . TYR A 1 110 ? 96.828  70.430  61.878  1.00 39.25 ? 110 TYR A CB  1 
ATOM 818   C CG  . TYR A 1 110 ? 98.078  70.068  61.101  1.00 39.14 ? 110 TYR A CG  1 
ATOM 819   C CD1 . TYR A 1 110 ? 98.350  70.658  59.867  1.00 39.13 ? 110 TYR A CD1 1 
ATOM 820   C CD2 . TYR A 1 110 ? 98.983  69.127  61.595  1.00 39.09 ? 110 TYR A CD2 1 
ATOM 821   C CE1 . TYR A 1 110 ? 99.491  70.329  59.150  1.00 39.07 ? 110 TYR A CE1 1 
ATOM 822   C CE2 . TYR A 1 110 ? 100.128 68.790  60.884  1.00 39.10 ? 110 TYR A CE2 1 
ATOM 823   C CZ  . TYR A 1 110 ? 100.377 69.394  59.662  1.00 39.11 ? 110 TYR A CZ  1 
ATOM 824   O OH  . TYR A 1 110 ? 101.507 69.068  58.952  1.00 39.19 ? 110 TYR A OH  1 
ATOM 825   N N   . LYS A 1 111 ? 97.768  70.628  64.758  1.00 40.42 ? 111 LYS A N   1 
ATOM 826   C CA  . LYS A 1 111 ? 98.689  70.359  65.870  1.00 41.05 ? 111 LYS A CA  1 
ATOM 827   C C   . LYS A 1 111 ? 99.382  69.007  65.702  1.00 41.38 ? 111 LYS A C   1 
ATOM 828   O O   . LYS A 1 111 ? 98.761  68.035  65.267  1.00 41.54 ? 111 LYS A O   1 
ATOM 829   C CB  . LYS A 1 111 ? 97.969  70.442  67.224  1.00 41.42 ? 111 LYS A CB  1 
ATOM 830   C CG  . LYS A 1 111 ? 96.904  69.386  67.497  1.00 41.67 ? 111 LYS A CG  1 
ATOM 831   C CD  . LYS A 1 111 ? 96.259  69.619  68.852  1.00 41.99 ? 111 LYS A CD  1 
ATOM 832   C CE  . LYS A 1 111 ? 95.182  68.585  69.146  1.00 42.27 ? 111 LYS A CE  1 
ATOM 833   N NZ  . LYS A 1 111 ? 94.532  68.785  70.473  1.00 42.33 ? 111 LYS A NZ  1 
ATOM 834   N N   . THR A 1 112 ? 100.667 68.962  66.058  1.00 41.76 ? 112 THR A N   1 
ATOM 835   C CA  . THR A 1 112 ? 101.494 67.755  65.923  1.00 42.19 ? 112 THR A CA  1 
ATOM 836   C C   . THR A 1 112 ? 101.673 67.044  67.267  1.00 42.42 ? 112 THR A C   1 
ATOM 837   O O   . THR A 1 112 ? 101.294 67.568  68.316  1.00 42.41 ? 112 THR A O   1 
ATOM 838   C CB  . THR A 1 112 ? 102.871 68.071  65.281  1.00 42.41 ? 112 THR A CB  1 
ATOM 839   O OG1 . THR A 1 112 ? 103.594 66.852  65.055  1.00 42.63 ? 112 THR A OG1 1 
ATOM 840   C CG2 . THR A 1 112 ? 103.724 69.025  66.144  1.00 42.32 ? 112 THR A CG2 1 
ATOM 841   N N   . ASN A 1 113 ? 102.259 65.849  67.216  1.00 42.76 ? 113 ASN A N   1 
ATOM 842   C CA  . ASN A 1 113 ? 102.492 65.032  68.413  1.00 43.05 ? 113 ASN A CA  1 
ATOM 843   C C   . ASN A 1 113 ? 103.650 65.527  69.289  1.00 43.07 ? 113 ASN A C   1 
ATOM 844   O O   . ASN A 1 113 ? 103.729 65.156  70.463  1.00 43.14 ? 113 ASN A O   1 
ATOM 845   C CB  . ASN A 1 113 ? 102.742 63.568  68.022  1.00 43.32 ? 113 ASN A CB  1 
ATOM 846   C CG  . ASN A 1 113 ? 101.541 62.926  67.347  1.00 43.69 ? 113 ASN A CG  1 
ATOM 847   O OD1 . ASN A 1 113 ? 100.586 63.603  66.963  1.00 43.88 ? 113 ASN A OD1 1 
ATOM 848   N ND2 . ASN A 1 113 ? 101.589 61.607  67.196  1.00 43.95 ? 113 ASN A ND2 1 
ATOM 849   N N   . THR A 1 114 ? 104.542 66.346  68.727  1.00 42.95 ? 114 THR A N   1 
ATOM 850   C CA  . THR A 1 114 ? 105.706 66.860  69.455  1.00 42.92 ? 114 THR A CA  1 
ATOM 851   C C   . THR A 1 114 ? 105.288 67.847  70.548  1.00 42.75 ? 114 THR A C   1 
ATOM 852   O O   . THR A 1 114 ? 104.466 68.732  70.308  1.00 42.67 ? 114 THR A O   1 
ATOM 853   C CB  . THR A 1 114 ? 106.703 67.560  68.505  1.00 43.06 ? 114 THR A CB  1 
ATOM 854   O OG1 . THR A 1 114 ? 106.980 66.710  67.384  1.00 43.18 ? 114 THR A OG1 1 
ATOM 855   C CG2 . THR A 1 114 ? 108.012 67.891  69.223  1.00 43.11 ? 114 THR A CG2 1 
ATOM 856   N N   . ALA A 1 115 ? 105.865 67.685  71.739  1.00 42.77 ? 115 ALA A N   1 
ATOM 857   C CA  . ALA A 1 115 ? 105.541 68.521  72.898  1.00 42.75 ? 115 ALA A CA  1 
ATOM 858   C C   . ALA A 1 115 ? 106.361 69.808  72.904  1.00 42.74 ? 115 ALA A C   1 
ATOM 859   O O   . ALA A 1 115 ? 107.455 69.862  72.337  1.00 42.81 ? 115 ALA A O   1 
ATOM 860   C CB  . ALA A 1 115 ? 105.775 67.749  74.187  1.00 42.91 ? 115 ALA A CB  1 
ATOM 861   N N   . VAL A 1 116 ? 105.823 70.835  73.560  1.00 42.90 ? 116 VAL A N   1 
ATOM 862   C CA  . VAL A 1 116 ? 106.495 72.141  73.669  1.00 43.05 ? 116 VAL A CA  1 
ATOM 863   C C   . VAL A 1 116 ? 107.747 72.095  74.555  1.00 43.55 ? 116 VAL A C   1 
ATOM 864   O O   . VAL A 1 116 ? 108.664 72.900  74.371  1.00 43.76 ? 116 VAL A O   1 
ATOM 865   C CB  . VAL A 1 116 ? 105.551 73.263  74.174  1.00 42.93 ? 116 VAL A CB  1 
ATOM 866   C CG1 . VAL A 1 116 ? 104.356 73.422  73.238  1.00 42.89 ? 116 VAL A CG1 1 
ATOM 867   C CG2 . VAL A 1 116 ? 105.112 73.034  75.621  1.00 42.98 ? 116 VAL A CG2 1 
ATOM 868   N N   . THR A 1 117 ? 107.773 71.169  75.515  1.00 43.94 ? 117 THR A N   1 
ATOM 869   C CA  . THR A 1 117 ? 108.972 70.905  76.320  1.00 44.22 ? 117 THR A CA  1 
ATOM 870   C C   . THR A 1 117 ? 110.097 70.309  75.471  1.00 44.30 ? 117 THR A C   1 
ATOM 871   O O   . THR A 1 117 ? 111.269 70.635  75.676  1.00 44.49 ? 117 THR A O   1 
ATOM 872   C CB  . THR A 1 117 ? 108.673 69.951  77.495  1.00 44.54 ? 117 THR A CB  1 
ATOM 873   O OG1 . THR A 1 117 ? 108.043 68.760  77.003  1.00 44.68 ? 117 THR A OG1 1 
ATOM 874   C CG2 . THR A 1 117 ? 107.763 70.622  78.516  1.00 44.67 ? 117 THR A CG2 1 
ATOM 875   N N   . SER A 1 118 ? 109.735 69.438  74.527  1.00 44.37 ? 118 SER A N   1 
ATOM 876   C CA  . SER A 1 118 ? 110.688 68.886  73.557  1.00 44.50 ? 118 SER A CA  1 
ATOM 877   C C   . SER A 1 118 ? 111.084 69.930  72.512  1.00 44.49 ? 118 SER A C   1 
ATOM 878   O O   . SER A 1 118 ? 110.467 70.995  72.417  1.00 44.41 ? 118 SER A O   1 
ATOM 879   C CB  . SER A 1 118 ? 110.097 67.656  72.861  1.00 44.61 ? 118 SER A CB  1 
ATOM 880   O OG  . SER A 1 118 ? 109.721 66.667  73.805  1.00 44.73 ? 118 SER A OG  1 
ATOM 881   N N   . SER A 1 119 ? 112.109 69.607  71.723  1.00 44.65 ? 119 SER A N   1 
ATOM 882   C CA  . SER A 1 119 ? 112.652 70.532  70.721  1.00 44.77 ? 119 SER A CA  1 
ATOM 883   C C   . SER A 1 119 ? 111.697 70.756  69.548  1.00 44.88 ? 119 SER A C   1 
ATOM 884   O O   . SER A 1 119 ? 110.746 69.994  69.348  1.00 44.83 ? 119 SER A O   1 
ATOM 885   C CB  . SER A 1 119 ? 113.998 70.023  70.198  1.00 44.90 ? 119 SER A CB  1 
ATOM 886   O OG  . SER A 1 119 ? 114.626 70.990  69.372  1.00 44.99 ? 119 SER A OG  1 
ATOM 887   N N   . GLN A 1 120 ? 111.971 71.809  68.778  1.00 44.97 ? 120 GLN A N   1 
ATOM 888   C CA  . GLN A 1 120 ? 111.124 72.207  67.651  1.00 45.08 ? 120 GLN A CA  1 
ATOM 889   C C   . GLN A 1 120 ? 111.183 71.167  66.525  1.00 45.31 ? 120 GLN A C   1 
ATOM 890   O O   . GLN A 1 120 ? 112.271 70.682  66.201  1.00 45.67 ? 120 GLN A O   1 
ATOM 891   C CB  . GLN A 1 120 ? 111.564 73.574  67.115  1.00 45.05 ? 120 GLN A CB  1 
ATOM 892   C CG  . GLN A 1 120 ? 110.645 74.171  66.057  1.00 45.09 ? 120 GLN A CG  1 
ATOM 893   C CD  . GLN A 1 120 ? 111.094 75.548  65.603  1.00 45.21 ? 120 GLN A CD  1 
ATOM 894   O OE1 . GLN A 1 120 ? 111.348 76.434  66.420  1.00 45.22 ? 120 GLN A OE1 1 
ATOM 895   N NE2 . GLN A 1 120 ? 111.189 75.737  64.291  1.00 45.29 ? 120 GLN A NE2 1 
ATOM 896   N N   . PRO A 1 121 ? 110.018 70.806  65.939  1.00 45.40 ? 121 PRO A N   1 
ATOM 897   C CA  . PRO A 1 121 ? 110.006 69.936  64.756  1.00 45.55 ? 121 PRO A CA  1 
ATOM 898   C C   . PRO A 1 121 ? 110.769 70.524  63.566  1.00 45.58 ? 121 PRO A C   1 
ATOM 899   O O   . PRO A 1 121 ? 110.609 71.707  63.258  1.00 45.53 ? 121 PRO A O   1 
ATOM 900   C CB  . PRO A 1 121 ? 108.516 69.816  64.421  1.00 45.56 ? 121 PRO A CB  1 
ATOM 901   C CG  . PRO A 1 121 ? 107.823 70.013  65.718  1.00 45.48 ? 121 PRO A CG  1 
ATOM 902   C CD  . PRO A 1 121 ? 108.660 70.990  66.490  1.00 45.42 ? 121 PRO A CD  1 
ATOM 903   N N   . GLU A 1 122 ? 111.591 69.697  62.920  1.00 45.76 ? 122 GLU A N   1 
ATOM 904   C CA  . GLU A 1 122 ? 112.394 70.126  61.768  1.00 45.90 ? 122 GLU A CA  1 
ATOM 905   C C   . GLU A 1 122 ? 111.524 70.397  60.545  1.00 45.50 ? 122 GLU A C   1 
ATOM 906   O O   . GLU A 1 122 ? 111.731 71.390  59.848  1.00 45.42 ? 122 GLU A O   1 
ATOM 907   C CB  . GLU A 1 122 ? 113.459 69.076  61.423  1.00 46.32 ? 122 GLU A CB  1 
ATOM 908   C CG  . GLU A 1 122 ? 114.531 68.880  62.491  1.00 46.56 ? 122 GLU A CG  1 
ATOM 909   C CD  . GLU A 1 122 ? 115.417 70.100  62.706  1.00 46.77 ? 122 GLU A CD  1 
ATOM 910   O OE1 . GLU A 1 122 ? 115.541 70.941  61.789  1.00 46.76 ? 122 GLU A OE1 1 
ATOM 911   O OE2 . GLU A 1 122 ? 116.001 70.215  63.805  1.00 46.96 ? 122 GLU A OE2 1 
ATOM 912   N N   . SER A 1 123 ? 110.566 69.505  60.289  1.00 45.20 ? 123 SER A N   1 
ATOM 913   C CA  . SER A 1 123 ? 109.583 69.674  59.216  1.00 45.03 ? 123 SER A CA  1 
ATOM 914   C C   . SER A 1 123 ? 108.200 69.223  59.683  1.00 44.61 ? 123 SER A C   1 
ATOM 915   O O   . SER A 1 123 ? 108.080 68.338  60.533  1.00 44.74 ? 123 SER A O   1 
ATOM 916   C CB  . SER A 1 123 ? 110.001 68.872  57.981  1.00 45.23 ? 123 SER A CB  1 
ATOM 917   O OG  . SER A 1 123 ? 109.121 69.108  56.895  1.00 45.30 ? 123 SER A OG  1 
ATOM 918   N N   . CYS A 1 124 ? 107.165 69.840  59.116  1.00 44.10 ? 124 CYS A N   1 
ATOM 919   C CA  . CYS A 1 124 ? 105.776 69.540  59.474  1.00 43.87 ? 124 CYS A CA  1 
ATOM 920   C C   . CYS A 1 124 ? 105.355 68.156  58.950  1.00 44.47 ? 124 CYS A C   1 
ATOM 921   O O   . CYS A 1 124 ? 105.865 67.718  57.916  1.00 44.77 ? 124 CYS A O   1 
ATOM 922   C CB  . CYS A 1 124 ? 104.836 70.622  58.928  1.00 43.10 ? 124 CYS A CB  1 
ATOM 923   S SG  . CYS A 1 124 ? 105.252 71.212  57.268  1.00 42.51 ? 124 CYS A SG  1 
ATOM 924   N N   . PRO A 1 125 ? 104.435 67.462  59.662  1.00 44.93 ? 125 PRO A N   1 
ATOM 925   C CA  . PRO A 1 125 ? 103.957 66.153  59.175  1.00 45.17 ? 125 PRO A CA  1 
ATOM 926   C C   . PRO A 1 125 ? 103.158 66.209  57.867  1.00 45.54 ? 125 PRO A C   1 
ATOM 927   O O   . PRO A 1 125 ? 102.927 65.178  57.233  1.00 45.78 ? 125 PRO A O   1 
ATOM 928   C CB  . PRO A 1 125 ? 103.058 65.653  60.317  1.00 45.17 ? 125 PRO A CB  1 
ATOM 929   C CG  . PRO A 1 125 ? 103.491 66.412  61.518  1.00 45.13 ? 125 PRO A CG  1 
ATOM 930   C CD  . PRO A 1 125 ? 103.915 67.755  61.013  1.00 45.02 ? 125 PRO A CD  1 
ATOM 931   O OXT . PRO A 1 125 ? 102.724 67.268  57.409  1.00 45.77 ? 125 PRO A OXT 1 
ATOM 932   N N   . PHE B 1 1   ? 82.158  80.180  56.526  1.00 65.53 ? 1   PHE B N   1 
ATOM 933   C CA  . PHE B 1 1   ? 82.734  81.138  55.539  1.00 65.24 ? 1   PHE B CA  1 
ATOM 934   C C   . PHE B 1 1   ? 83.819  81.986  56.215  1.00 64.19 ? 1   PHE B C   1 
ATOM 935   O O   . PHE B 1 1   ? 83.521  82.988  56.872  1.00 64.28 ? 1   PHE B O   1 
ATOM 936   C CB  . PHE B 1 1   ? 81.622  82.018  54.942  1.00 66.00 ? 1   PHE B CB  1 
ATOM 937   C CG  . PHE B 1 1   ? 81.930  82.553  53.566  1.00 66.66 ? 1   PHE B CG  1 
ATOM 938   C CD1 . PHE B 1 1   ? 83.020  83.394  53.352  1.00 66.87 ? 1   PHE B CD1 1 
ATOM 939   C CD2 . PHE B 1 1   ? 81.117  82.231  52.482  1.00 67.09 ? 1   PHE B CD2 1 
ATOM 940   C CE1 . PHE B 1 1   ? 83.298  83.890  52.088  1.00 67.09 ? 1   PHE B CE1 1 
ATOM 941   C CE2 . PHE B 1 1   ? 81.393  82.727  51.217  1.00 67.25 ? 1   PHE B CE2 1 
ATOM 942   C CZ  . PHE B 1 1   ? 82.484  83.558  51.019  1.00 67.25 ? 1   PHE B CZ  1 
ATOM 943   N N   . THR B 1 2   ? 85.075  81.576  56.040  1.00 62.81 ? 2   THR B N   1 
ATOM 944   C CA  . THR B 1 2   ? 86.219  82.242  56.672  1.00 61.68 ? 2   THR B CA  1 
ATOM 945   C C   . THR B 1 2   ? 86.683  83.458  55.872  1.00 60.37 ? 2   THR B C   1 
ATOM 946   O O   . THR B 1 2   ? 86.239  83.680  54.743  1.00 60.21 ? 2   THR B O   1 
ATOM 947   C CB  . THR B 1 2   ? 87.417  81.275  56.821  1.00 61.85 ? 2   THR B CB  1 
ATOM 948   O OG1 . THR B 1 2   ? 87.777  80.754  55.536  1.00 61.94 ? 2   THR B OG1 1 
ATOM 949   C CG2 . THR B 1 2   ? 87.079  80.119  57.752  1.00 61.91 ? 2   THR B CG2 1 
ATOM 950   N N   . LEU B 1 3   ? 87.581  84.236  56.474  1.00 59.31 ? 3   LEU B N   1 
ATOM 951   C CA  . LEU B 1 3   ? 88.248  85.346  55.790  1.00 58.56 ? 3   LEU B CA  1 
ATOM 952   C C   . LEU B 1 3   ? 89.290  84.825  54.798  1.00 57.74 ? 3   LEU B C   1 
ATOM 953   O O   . LEU B 1 3   ? 89.434  85.379  53.709  1.00 57.87 ? 3   LEU B O   1 
ATOM 954   C CB  . LEU B 1 3   ? 88.911  86.289  56.803  1.00 58.65 ? 3   LEU B CB  1 
ATOM 955   C CG  . LEU B 1 3   ? 89.554  87.578  56.275  1.00 58.84 ? 3   LEU B CG  1 
ATOM 956   C CD1 . LEU B 1 3   ? 88.524  88.491  55.626  1.00 58.83 ? 3   LEU B CD1 1 
ATOM 957   C CD2 . LEU B 1 3   ? 90.272  88.300  57.407  1.00 59.00 ? 3   LEU B CD2 1 
ATOM 958   N N   . ILE B 1 4   ? 90.019  83.777  55.188  1.00 56.84 ? 4   ILE B N   1 
ATOM 959   C CA  . ILE B 1 4   ? 90.999  83.119  54.305  1.00 56.10 ? 4   ILE B CA  1 
ATOM 960   C C   . ILE B 1 4   ? 90.367  82.516  53.038  1.00 55.55 ? 4   ILE B C   1 
ATOM 961   O O   . ILE B 1 4   ? 90.980  82.550  51.969  1.00 55.56 ? 4   ILE B O   1 
ATOM 962   C CB  . ILE B 1 4   ? 91.849  82.055  55.068  1.00 56.16 ? 4   ILE B CB  1 
ATOM 963   C CG1 . ILE B 1 4   ? 93.004  81.513  54.208  1.00 56.20 ? 4   ILE B CG1 1 
ATOM 964   C CG2 . ILE B 1 4   ? 91.005  80.880  55.551  1.00 56.30 ? 4   ILE B CG2 1 
ATOM 965   C CD1 . ILE B 1 4   ? 93.964  82.563  53.696  1.00 56.15 ? 4   ILE B CD1 1 
ATOM 966   N N   . GLU B 1 5   ? 89.156  81.969  53.163  1.00 55.12 ? 5   GLU B N   1 
ATOM 967   C CA  . GLU B 1 5   ? 88.408  81.452  52.007  1.00 54.70 ? 5   GLU B CA  1 
ATOM 968   C C   . GLU B 1 5   ? 87.958  82.583  51.076  1.00 54.01 ? 5   GLU B C   1 
ATOM 969   O O   . GLU B 1 5   ? 87.886  82.391  49.864  1.00 54.13 ? 5   GLU B O   1 
ATOM 970   C CB  . GLU B 1 5   ? 87.205  80.616  52.465  1.00 54.98 ? 5   GLU B CB  1 
ATOM 971   C CG  . GLU B 1 5   ? 86.423  79.944  51.340  1.00 55.44 ? 5   GLU B CG  1 
ATOM 972   C CD  . GLU B 1 5   ? 85.185  80.719  50.915  1.00 55.80 ? 5   GLU B CD  1 
ATOM 973   O OE1 . GLU B 1 5   ? 84.269  80.886  51.749  1.00 55.97 ? 5   GLU B OE1 1 
ATOM 974   O OE2 . GLU B 1 5   ? 85.121  81.150  49.744  1.00 55.93 ? 5   GLU B OE2 1 
ATOM 975   N N   . LEU B 1 6   ? 87.645  83.745  51.646  1.00 53.26 ? 6   LEU B N   1 
ATOM 976   C CA  . LEU B 1 6   ? 87.349  84.947  50.861  1.00 52.82 ? 6   LEU B CA  1 
ATOM 977   C C   . LEU B 1 6   ? 88.618  85.549  50.255  1.00 52.17 ? 6   LEU B C   1 
ATOM 978   O O   . LEU B 1 6   ? 88.602  86.021  49.118  1.00 52.30 ? 6   LEU B O   1 
ATOM 979   C CB  . LEU B 1 6   ? 86.657  85.996  51.739  1.00 53.07 ? 6   LEU B CB  1 
ATOM 980   C CG  . LEU B 1 6   ? 86.040  87.230  51.067  1.00 53.25 ? 6   LEU B CG  1 
ATOM 981   C CD1 . LEU B 1 6   ? 84.951  86.852  50.066  1.00 53.35 ? 6   LEU B CD1 1 
ATOM 982   C CD2 . LEU B 1 6   ? 85.502  88.187  52.128  1.00 53.36 ? 6   LEU B CD2 1 
ATOM 983   N N   . LEU B 1 7   ? 89.705  85.534  51.026  1.00 51.68 ? 7   LEU B N   1 
ATOM 984   C CA  . LEU B 1 7   ? 90.986  86.122  50.621  1.00 51.18 ? 7   LEU B CA  1 
ATOM 985   C C   . LEU B 1 7   ? 91.630  85.401  49.438  1.00 50.46 ? 7   LEU B C   1 
ATOM 986   O O   . LEU B 1 7   ? 92.163  86.054  48.537  1.00 50.55 ? 7   LEU B O   1 
ATOM 987   C CB  . LEU B 1 7   ? 91.950  86.139  51.813  1.00 51.54 ? 7   LEU B CB  1 
ATOM 988   C CG  . LEU B 1 7   ? 93.334  86.777  51.652  1.00 52.00 ? 7   LEU B CG  1 
ATOM 989   C CD1 . LEU B 1 7   ? 93.240  88.206  51.138  1.00 52.25 ? 7   LEU B CD1 1 
ATOM 990   C CD2 . LEU B 1 7   ? 94.063  86.728  52.987  1.00 52.11 ? 7   LEU B CD2 1 
ATOM 991   N N   . ILE B 1 8   ? 91.593  84.067  49.450  1.00 49.67 ? 8   ILE B N   1 
ATOM 992   C CA  . ILE B 1 8   ? 92.090  83.267  48.318  1.00 48.95 ? 8   ILE B CA  1 
ATOM 993   C C   . ILE B 1 8   ? 91.228  83.441  47.061  1.00 48.10 ? 8   ILE B C   1 
ATOM 994   O O   . ILE B 1 8   ? 91.757  83.425  45.954  1.00 48.25 ? 8   ILE B O   1 
ATOM 995   C CB  . ILE B 1 8   ? 92.256  81.761  48.673  1.00 49.08 ? 8   ILE B CB  1 
ATOM 996   C CG1 . ILE B 1 8   ? 93.102  81.051  47.602  1.00 49.31 ? 8   ILE B CG1 1 
ATOM 997   C CG2 . ILE B 1 8   ? 90.907  81.070  48.852  1.00 49.12 ? 8   ILE B CG2 1 
ATOM 998   C CD1 . ILE B 1 8   ? 93.627  79.690  48.012  1.00 49.49 ? 8   ILE B CD1 1 
ATOM 999   N N   . VAL B 1 9   ? 89.916  83.617  47.235  1.00 47.27 ? 9   VAL B N   1 
ATOM 1000  C CA  . VAL B 1 9   ? 89.007  83.907  46.114  1.00 46.73 ? 9   VAL B CA  1 
ATOM 1001  C C   . VAL B 1 9   ? 89.336  85.262  45.467  1.00 46.19 ? 9   VAL B C   1 
ATOM 1002  O O   . VAL B 1 9   ? 89.280  85.390  44.244  1.00 46.23 ? 9   VAL B O   1 
ATOM 1003  C CB  . VAL B 1 9   ? 87.520  83.840  46.555  1.00 46.84 ? 9   VAL B CB  1 
ATOM 1004  C CG1 . VAL B 1 9   ? 86.582  84.437  45.508  1.00 46.95 ? 9   VAL B CG1 1 
ATOM 1005  C CG2 . VAL B 1 9   ? 87.124  82.397  46.840  1.00 46.91 ? 9   VAL B CG2 1 
ATOM 1006  N N   . ILE B 1 10  ? 89.678  86.254  46.289  1.00 45.60 ? 10  ILE B N   1 
ATOM 1007  C CA  . ILE B 1 10  ? 90.136  87.562  45.796  1.00 45.28 ? 10  ILE B CA  1 
ATOM 1008  C C   . ILE B 1 10  ? 91.470  87.426  45.042  1.00 44.89 ? 10  ILE B C   1 
ATOM 1009  O O   . ILE B 1 10  ? 91.679  88.095  44.028  1.00 44.97 ? 10  ILE B O   1 
ATOM 1010  C CB  . ILE B 1 10  ? 90.254  88.595  46.950  1.00 45.46 ? 10  ILE B CB  1 
ATOM 1011  C CG1 . ILE B 1 10  ? 88.864  88.922  47.518  1.00 45.68 ? 10  ILE B CG1 1 
ATOM 1012  C CG2 . ILE B 1 10  ? 90.925  89.888  46.484  1.00 45.52 ? 10  ILE B CG2 1 
ATOM 1013  C CD1 . ILE B 1 10  ? 88.884  89.483  48.926  1.00 45.81 ? 10  ILE B CD1 1 
ATOM 1014  N N   . ALA B 1 11  ? 92.354  86.562  45.539  1.00 44.53 ? 11  ALA B N   1 
ATOM 1015  C CA  . ALA B 1 11  ? 93.645  86.291  44.894  1.00 44.37 ? 11  ALA B CA  1 
ATOM 1016  C C   . ALA B 1 11  ? 93.512  85.635  43.515  1.00 44.14 ? 11  ALA B C   1 
ATOM 1017  O O   . ALA B 1 11  ? 94.242  85.992  42.590  1.00 44.27 ? 11  ALA B O   1 
ATOM 1018  C CB  . ALA B 1 11  ? 94.522  85.431  45.796  1.00 44.52 ? 11  ALA B CB  1 
ATOM 1019  N N   . ILE B 1 12  ? 92.585  84.684  43.387  1.00 43.94 ? 12  ILE B N   1 
ATOM 1020  C CA  . ILE B 1 12  ? 92.350  83.979  42.116  1.00 43.88 ? 12  ILE B CA  1 
ATOM 1021  C C   . ILE B 1 12  ? 91.677  84.887  41.074  1.00 43.93 ? 12  ILE B C   1 
ATOM 1022  O O   . ILE B 1 12  ? 91.987  84.788  39.886  1.00 44.27 ? 12  ILE B O   1 
ATOM 1023  C CB  . ILE B 1 12  ? 91.528  82.677  42.325  1.00 43.83 ? 12  ILE B CB  1 
ATOM 1024  C CG1 . ILE B 1 12  ? 92.290  81.679  43.217  1.00 44.06 ? 12  ILE B CG1 1 
ATOM 1025  C CG2 . ILE B 1 12  ? 91.158  82.016  40.996  1.00 43.85 ? 12  ILE B CG2 1 
ATOM 1026  C CD1 . ILE B 1 12  ? 93.644  81.233  42.700  1.00 44.26 ? 12  ILE B CD1 1 
ATOM 1027  N N   . ILE B 1 13  ? 90.775  85.766  41.514  1.00 43.69 ? 13  ILE B N   1 
ATOM 1028  C CA  . ILE B 1 13  ? 90.134  86.747  40.619  1.00 43.60 ? 13  ILE B CA  1 
ATOM 1029  C C   . ILE B 1 13  ? 91.175  87.678  39.975  1.00 43.55 ? 13  ILE B C   1 
ATOM 1030  O O   . ILE B 1 13  ? 91.054  88.017  38.796  1.00 43.61 ? 13  ILE B O   1 
ATOM 1031  C CB  . ILE B 1 13  ? 89.032  87.562  41.352  1.00 43.76 ? 13  ILE B CB  1 
ATOM 1032  C CG1 . ILE B 1 13  ? 87.839  86.658  41.691  1.00 43.92 ? 13  ILE B CG1 1 
ATOM 1033  C CG2 . ILE B 1 13  ? 88.536  88.739  40.507  1.00 43.84 ? 13  ILE B CG2 1 
ATOM 1034  C CD1 . ILE B 1 13  ? 86.989  87.160  42.840  1.00 44.05 ? 13  ILE B CD1 1 
ATOM 1035  N N   . ALA B 1 14  ? 92.186  88.079  40.746  1.00 43.61 ? 14  ALA B N   1 
ATOM 1036  C CA  . ALA B 1 14  ? 93.299  88.889  40.230  1.00 43.68 ? 14  ALA B CA  1 
ATOM 1037  C C   . ALA B 1 14  ? 94.126  88.154  39.170  1.00 43.73 ? 14  ALA B C   1 
ATOM 1038  O O   . ALA B 1 14  ? 94.593  88.773  38.210  1.00 43.84 ? 14  ALA B O   1 
ATOM 1039  C CB  . ALA B 1 14  ? 94.198  89.342  41.373  1.00 43.75 ? 14  ALA B CB  1 
ATOM 1040  N N   . ILE B 1 15  ? 94.304  86.845  39.353  1.00 43.74 ? 15  ILE B N   1 
ATOM 1041  C CA  . ILE B 1 15  ? 95.031  86.001  38.395  1.00 43.83 ? 15  ILE B CA  1 
ATOM 1042  C C   . ILE B 1 15  ? 94.212  85.794  37.118  1.00 43.79 ? 15  ILE B C   1 
ATOM 1043  O O   . ILE B 1 15  ? 94.732  85.965  36.013  1.00 43.92 ? 15  ILE B O   1 
ATOM 1044  C CB  . ILE B 1 15  ? 95.403  84.627  39.011  1.00 44.00 ? 15  ILE B CB  1 
ATOM 1045  C CG1 . ILE B 1 15  ? 96.370  84.812  40.190  1.00 44.22 ? 15  ILE B CG1 1 
ATOM 1046  C CG2 . ILE B 1 15  ? 96.039  83.707  37.970  1.00 44.10 ? 15  ILE B CG2 1 
ATOM 1047  C CD1 . ILE B 1 15  ? 96.425  83.633  41.139  1.00 44.27 ? 15  ILE B CD1 1 
ATOM 1048  N N   . LEU B 1 16  ? 92.945  85.416  37.281  1.00 43.76 ? 16  LEU B N   1 
ATOM 1049  C CA  . LEU B 1 16  ? 92.037  85.190  36.144  1.00 43.77 ? 16  LEU B CA  1 
ATOM 1050  C C   . LEU B 1 16  ? 91.756  86.460  35.328  1.00 43.68 ? 16  LEU B C   1 
ATOM 1051  O O   . LEU B 1 16  ? 91.610  86.387  34.107  1.00 43.80 ? 16  LEU B O   1 
ATOM 1052  C CB  . LEU B 1 16  ? 90.714  84.549  36.605  1.00 43.94 ? 16  LEU B CB  1 
ATOM 1053  C CG  . LEU B 1 16  ? 90.663  83.015  36.678  1.00 44.26 ? 16  LEU B CG  1 
ATOM 1054  C CD1 . LEU B 1 16  ? 91.896  82.403  37.332  1.00 44.40 ? 16  LEU B CD1 1 
ATOM 1055  C CD2 . LEU B 1 16  ? 89.397  82.568  37.397  1.00 44.39 ? 16  LEU B CD2 1 
ATOM 1056  N N   . ALA B 1 17  ? 91.683  87.609  36.001  1.00 43.48 ? 17  ALA B N   1 
ATOM 1057  C CA  . ALA B 1 17  ? 91.471  88.900  35.329  1.00 43.36 ? 17  ALA B CA  1 
ATOM 1058  C C   . ALA B 1 17  ? 92.653  89.336  34.452  1.00 43.29 ? 17  ALA B C   1 
ATOM 1059  O O   . ALA B 1 17  ? 92.467  90.103  33.505  1.00 43.40 ? 17  ALA B O   1 
ATOM 1060  C CB  . ALA B 1 17  ? 91.156  89.985  36.350  1.00 43.38 ? 17  ALA B CB  1 
ATOM 1061  N N   . ALA B 1 18  ? 93.857  88.862  34.774  1.00 43.01 ? 18  ALA B N   1 
ATOM 1062  C CA  . ALA B 1 18  ? 95.054  89.165  33.989  1.00 42.88 ? 18  ALA B CA  1 
ATOM 1063  C C   . ALA B 1 18  ? 95.171  88.257  32.765  1.00 42.74 ? 18  ALA B C   1 
ATOM 1064  O O   . ALA B 1 18  ? 95.293  88.742  31.639  1.00 42.83 ? 18  ALA B O   1 
ATOM 1065  C CB  . ALA B 1 18  ? 96.297  89.035  34.857  1.00 42.97 ? 18  ALA B CB  1 
ATOM 1066  N N   . VAL B 1 19  ? 95.126  86.946  32.999  1.00 42.61 ? 19  VAL B N   1 
ATOM 1067  C CA  . VAL B 1 19  ? 95.422  85.951  31.952  1.00 42.61 ? 19  VAL B CA  1 
ATOM 1068  C C   . VAL B 1 19  ? 94.314  85.758  30.908  1.00 42.56 ? 19  VAL B C   1 
ATOM 1069  O O   . VAL B 1 19  ? 94.609  85.603  29.721  1.00 42.66 ? 19  VAL B O   1 
ATOM 1070  C CB  . VAL B 1 19  ? 95.822  84.569  32.545  1.00 42.69 ? 19  VAL B CB  1 
ATOM 1071  C CG1 . VAL B 1 19  ? 96.995  84.719  33.508  1.00 42.75 ? 19  VAL B CG1 1 
ATOM 1072  C CG2 . VAL B 1 19  ? 94.644  83.863  33.217  1.00 42.69 ? 19  VAL B CG2 1 
ATOM 1073  N N   . LEU B 1 20  ? 93.053  85.774  31.343  1.00 42.47 ? 20  LEU B N   1 
ATOM 1074  C CA  . LEU B 1 20  ? 91.919  85.472  30.455  1.00 42.47 ? 20  LEU B CA  1 
ATOM 1075  C C   . LEU B 1 20  ? 91.543  86.616  29.504  1.00 42.21 ? 20  LEU B C   1 
ATOM 1076  O O   . LEU B 1 20  ? 90.917  86.370  28.469  1.00 42.16 ? 20  LEU B O   1 
ATOM 1077  C CB  . LEU B 1 20  ? 90.692  85.052  31.270  1.00 42.79 ? 20  LEU B CB  1 
ATOM 1078  C CG  . LEU B 1 20  ? 90.855  83.844  32.200  1.00 43.17 ? 20  LEU B CG  1 
ATOM 1079  C CD1 . LEU B 1 20  ? 89.603  83.655  33.042  1.00 43.27 ? 20  LEU B CD1 1 
ATOM 1080  C CD2 . LEU B 1 20  ? 91.158  82.579  31.409  1.00 43.25 ? 20  LEU B CD2 1 
ATOM 1081  N N   . ILE B 1 21  ? 91.913  87.849  29.854  1.00 41.85 ? 21  ILE B N   1 
ATOM 1082  C CA  . ILE B 1 21  ? 91.663  89.017  29.000  1.00 41.51 ? 21  ILE B CA  1 
ATOM 1083  C C   . ILE B 1 21  ? 92.675  88.962  27.843  1.00 41.13 ? 21  ILE B C   1 
ATOM 1084  O O   . ILE B 1 21  ? 93.881  89.044  28.086  1.00 41.33 ? 21  ILE B O   1 
ATOM 1085  C CB  . ILE B 1 21  ? 91.785  90.353  29.788  1.00 41.75 ? 21  ILE B CB  1 
ATOM 1086  C CG1 . ILE B 1 21  ? 90.514  90.644  30.609  1.00 41.94 ? 21  ILE B CG1 1 
ATOM 1087  C CG2 . ILE B 1 21  ? 91.999  91.545  28.856  1.00 41.83 ? 21  ILE B CG2 1 
ATOM 1088  C CD1 . ILE B 1 21  ? 89.986  89.513  31.470  1.00 42.01 ? 21  ILE B CD1 1 
ATOM 1089  N N   . PRO B 1 22  ? 92.193  88.825  26.588  1.00 40.49 ? 22  PRO B N   1 
ATOM 1090  C CA  . PRO B 1 22  ? 93.103  88.665  25.452  1.00 40.05 ? 22  PRO B CA  1 
ATOM 1091  C C   . PRO B 1 22  ? 93.730  89.979  24.985  1.00 39.58 ? 22  PRO B C   1 
ATOM 1092  O O   . PRO B 1 22  ? 93.333  91.056  25.437  1.00 39.64 ? 22  PRO B O   1 
ATOM 1093  C CB  . PRO B 1 22  ? 92.188  88.104  24.365  1.00 40.17 ? 22  PRO B CB  1 
ATOM 1094  C CG  . PRO B 1 22  ? 90.873  88.741  24.647  1.00 40.35 ? 22  PRO B CG  1 
ATOM 1095  C CD  . PRO B 1 22  ? 90.786  88.879  26.144  1.00 40.46 ? 22  PRO B CD  1 
ATOM 1096  N N   . ASN B 1 23  ? 94.703  89.871  24.079  1.00 38.96 ? 23  ASN B N   1 
ATOM 1097  C CA  . ASN B 1 23  ? 95.335  91.038  23.463  1.00 38.42 ? 23  ASN B CA  1 
ATOM 1098  C C   . ASN B 1 23  ? 94.358  91.651  22.457  1.00 38.17 ? 23  ASN B C   1 
ATOM 1099  O O   . ASN B 1 23  ? 94.136  91.097  21.377  1.00 38.30 ? 23  ASN B O   1 
ATOM 1100  C CB  . ASN B 1 23  ? 96.653  90.639  22.782  1.00 38.26 ? 23  ASN B CB  1 
ATOM 1101  C CG  . ASN B 1 23  ? 97.509  91.838  22.403  1.00 38.22 ? 23  ASN B CG  1 
ATOM 1102  O OD1 . ASN B 1 23  ? 97.050  92.761  21.730  1.00 38.19 ? 23  ASN B OD1 1 
ATOM 1103  N ND2 . ASN B 1 23  ? 98.768  91.820  22.824  1.00 38.32 ? 23  ASN B ND2 1 
ATOM 1104  N N   . LEU B 1 24  ? 93.771  92.788  22.829  1.00 37.77 ? 24  LEU B N   1 
ATOM 1105  C CA  . LEU B 1 24  ? 92.765  93.455  22.002  1.00 37.53 ? 24  LEU B CA  1 
ATOM 1106  C C   . LEU B 1 24  ? 93.394  94.184  20.816  1.00 37.24 ? 24  LEU B C   1 
ATOM 1107  O O   . LEU B 1 24  ? 92.914  94.053  19.691  1.00 37.38 ? 24  LEU B O   1 
ATOM 1108  C CB  . LEU B 1 24  ? 91.939  94.440  22.838  1.00 37.66 ? 24  LEU B CB  1 
ATOM 1109  C CG  . LEU B 1 24  ? 91.156  93.855  24.020  1.00 37.78 ? 24  LEU B CG  1 
ATOM 1110  C CD1 . LEU B 1 24  ? 90.641  94.967  24.921  1.00 37.90 ? 24  LEU B CD1 1 
ATOM 1111  C CD2 . LEU B 1 24  ? 90.004  92.978  23.551  1.00 37.72 ? 24  LEU B CD2 1 
ATOM 1112  N N   . LEU B 1 25  ? 94.466  94.937  21.073  1.00 36.76 ? 25  LEU B N   1 
ATOM 1113  C CA  . LEU B 1 25  ? 95.134  95.747  20.043  1.00 36.40 ? 25  LEU B CA  1 
ATOM 1114  C C   . LEU B 1 25  ? 95.609  94.915  18.855  1.00 35.85 ? 25  LEU B C   1 
ATOM 1115  O O   . LEU B 1 25  ? 95.446  95.327  17.706  1.00 35.80 ? 25  LEU B O   1 
ATOM 1116  C CB  . LEU B 1 25  ? 96.327  96.511  20.639  1.00 36.59 ? 25  LEU B CB  1 
ATOM 1117  C CG  . LEU B 1 25  ? 97.065  97.502  19.726  1.00 36.81 ? 25  LEU B CG  1 
ATOM 1118  C CD1 . LEU B 1 25  ? 96.150  98.643  19.304  1.00 36.91 ? 25  LEU B CD1 1 
ATOM 1119  C CD2 . LEU B 1 25  ? 98.310  98.043  20.413  1.00 36.92 ? 25  LEU B CD2 1 
ATOM 1120  N N   . ALA B 1 26  ? 96.194  93.754  19.141  1.00 35.52 ? 26  ALA B N   1 
ATOM 1121  C CA  . ALA B 1 26  ? 96.683  92.846  18.100  1.00 35.27 ? 26  ALA B CA  1 
ATOM 1122  C C   . ALA B 1 26  ? 95.539  92.236  17.286  1.00 34.96 ? 26  ALA B C   1 
ATOM 1123  O O   . ALA B 1 26  ? 95.646  92.107  16.066  1.00 34.98 ? 26  ALA B O   1 
ATOM 1124  C CB  . ALA B 1 26  ? 97.549  91.750  18.711  1.00 35.29 ? 26  ALA B CB  1 
ATOM 1125  N N   . ALA B 1 27  ? 94.450  91.872  17.962  1.00 34.79 ? 27  ALA B N   1 
ATOM 1126  C CA  . ALA B 1 27  ? 93.260  91.317  17.302  1.00 34.77 ? 27  ALA B CA  1 
ATOM 1127  C C   . ALA B 1 27  ? 92.622  92.284  16.298  1.00 34.60 ? 27  ALA B C   1 
ATOM 1128  O O   . ALA B 1 27  ? 92.162  91.858  15.238  1.00 34.63 ? 27  ALA B O   1 
ATOM 1129  C CB  . ALA B 1 27  ? 92.230  90.889  18.340  1.00 34.88 ? 27  ALA B CB  1 
ATOM 1130  N N   . ARG B 1 28  ? 92.600  93.574  16.637  1.00 34.46 ? 28  ARG B N   1 
ATOM 1131  C CA  . ARG B 1 28  ? 92.034  94.604  15.757  1.00 34.32 ? 28  ARG B CA  1 
ATOM 1132  C C   . ARG B 1 28  ? 92.905  94.902  14.531  1.00 34.16 ? 28  ARG B C   1 
ATOM 1133  O O   . ARG B 1 28  ? 92.366  95.200  13.466  1.00 34.28 ? 28  ARG B O   1 
ATOM 1134  C CB  . ARG B 1 28  ? 91.767  95.901  16.528  1.00 34.46 ? 28  ARG B CB  1 
ATOM 1135  C CG  . ARG B 1 28  ? 90.745  95.757  17.646  1.00 34.64 ? 28  ARG B CG  1 
ATOM 1136  C CD  . ARG B 1 28  ? 90.121  97.090  18.031  1.00 34.76 ? 28  ARG B CD  1 
ATOM 1137  N NE  . ARG B 1 28  ? 88.993  97.440  17.168  1.00 34.86 ? 28  ARG B NE  1 
ATOM 1138  C CZ  . ARG B 1 28  ? 87.770  96.904  17.237  1.00 35.08 ? 28  ARG B CZ  1 
ATOM 1139  N NH1 . ARG B 1 28  ? 86.828  97.312  16.391  1.00 35.19 ? 28  ARG B NH1 1 
ATOM 1140  N NH2 . ARG B 1 28  ? 87.472  95.961  18.134  1.00 35.14 ? 28  ARG B NH2 1 
ATOM 1141  N N   . LYS B 1 29  ? 94.231  94.832  14.684  1.00 34.02 ? 29  LYS B N   1 
ATOM 1142  C CA  . LYS B 1 29  ? 95.173  95.062  13.568  1.00 33.92 ? 29  LYS B CA  1 
ATOM 1143  C C   . LYS B 1 29  ? 94.868  94.215  12.330  1.00 33.86 ? 29  LYS B C   1 
ATOM 1144  O O   . LYS B 1 29  ? 94.910  94.721  11.208  1.00 34.02 ? 29  LYS B O   1 
ATOM 1145  C CB  . LYS B 1 29  ? 96.627  94.800  13.995  1.00 33.96 ? 29  LYS B CB  1 
ATOM 1146  C CG  . LYS B 1 29  ? 97.290  95.931  14.763  1.00 34.05 ? 29  LYS B CG  1 
ATOM 1147  C CD  . LYS B 1 29  ? 98.800  95.741  14.802  1.00 34.19 ? 29  LYS B CD  1 
ATOM 1148  C CE  . LYS B 1 29  ? 99.488  96.781  15.674  1.00 34.36 ? 29  LYS B CE  1 
ATOM 1149  N NZ  . LYS B 1 29  ? 99.428  96.453  17.127  1.00 34.43 ? 29  LYS B NZ  1 
ATOM 1150  N N   . ARG B 1 30  ? 94.562  92.936  12.544  1.00 33.59 ? 30  ARG B N   1 
ATOM 1151  C CA  . ARG B 1 30  ? 94.281  92.004  11.446  1.00 33.40 ? 30  ARG B CA  1 
ATOM 1152  C C   . ARG B 1 30  ? 92.893  92.234  10.850  1.00 33.27 ? 30  ARG B C   1 
ATOM 1153  O O   . ARG B 1 30  ? 92.698  92.055  9.646   1.00 33.42 ? 30  ARG B O   1 
ATOM 1154  C CB  . ARG B 1 30  ? 94.420  90.549  11.908  1.00 33.43 ? 30  ARG B CB  1 
ATOM 1155  C CG  . ARG B 1 30  ? 95.754  90.192  12.557  1.00 33.49 ? 30  ARG B CG  1 
ATOM 1156  C CD  . ARG B 1 30  ? 96.952  90.411  11.640  1.00 33.56 ? 30  ARG B CD  1 
ATOM 1157  N NE  . ARG B 1 30  ? 98.227  90.246  12.341  1.00 33.57 ? 30  ARG B NE  1 
ATOM 1158  C CZ  . ARG B 1 30  ? 99.430  90.359  11.774  1.00 33.63 ? 30  ARG B CZ  1 
ATOM 1159  N NH1 . ARG B 1 30  ? 99.555  90.637  10.476  1.00 33.65 ? 30  ARG B NH1 1 
ATOM 1160  N NH2 . ARG B 1 30  ? 100.524 90.188  12.512  1.00 33.67 ? 30  ARG B NH2 1 
ATOM 1161  N N   . ALA B 1 31  ? 91.937  92.614  11.695  1.00 32.98 ? 31  ALA B N   1 
ATOM 1162  C CA  . ALA B 1 31  ? 90.610  93.031  11.236  1.00 32.87 ? 31  ALA B CA  1 
ATOM 1163  C C   . ALA B 1 31  ? 90.675  94.332  10.434  1.00 32.84 ? 31  ALA B C   1 
ATOM 1164  O O   . ALA B 1 31  ? 89.942  94.495  9.458   1.00 32.95 ? 31  ALA B O   1 
ATOM 1165  C CB  . ALA B 1 31  ? 89.667  93.189  12.417  1.00 32.90 ? 31  ALA B CB  1 
ATOM 1166  N N   . ASN B 1 32  ? 91.544  95.249  10.858  1.00 32.86 ? 32  ASN B N   1 
ATOM 1167  C CA  . ASN B 1 32  ? 91.795  96.499  10.128  1.00 32.92 ? 32  ASN B CA  1 
ATOM 1168  C C   . ASN B 1 32  ? 92.445  96.267  8.758   1.00 33.12 ? 32  ASN B C   1 
ATOM 1169  O O   . ASN B 1 32  ? 92.168  97.007  7.812   1.00 33.24 ? 32  ASN B O   1 
ATOM 1170  C CB  . ASN B 1 32  ? 92.671  97.452  10.957  1.00 32.83 ? 32  ASN B CB  1 
ATOM 1171  C CG  . ASN B 1 32  ? 91.945  98.038  12.160  1.00 32.76 ? 32  ASN B CG  1 
ATOM 1172  O OD1 . ASN B 1 32  ? 90.756  98.346  12.082  1.00 32.77 ? 32  ASN B OD1 1 
ATOM 1173  N ND2 . ASN B 1 32  ? 92.650  98.192  13.276  1.00 32.81 ? 32  ASN B ND2 1 
ATOM 1174  N N   . ASP B 1 33  ? 93.310  95.255  8.663   1.00 33.25 ? 33  ASP B N   1 
ATOM 1175  C CA  . ASP B 1 33  ? 93.903  94.850  7.378   1.00 33.42 ? 33  ASP B CA  1 
ATOM 1176  C C   . ASP B 1 33  ? 92.854  94.291  6.415   1.00 33.48 ? 33  ASP B C   1 
ATOM 1177  O O   . ASP B 1 33  ? 92.942  94.518  5.206   1.00 33.61 ? 33  ASP B O   1 
ATOM 1178  C CB  . ASP B 1 33  ? 95.006  93.804  7.583   1.00 33.64 ? 33  ASP B CB  1 
ATOM 1179  C CG  . ASP B 1 33  ? 96.221  94.351  8.321   1.00 33.90 ? 33  ASP B CG  1 
ATOM 1180  O OD1 . ASP B 1 33  ? 96.377  95.587  8.433   1.00 33.97 ? 33  ASP B OD1 1 
ATOM 1181  O OD2 . ASP B 1 33  ? 97.032  93.527  8.795   1.00 34.02 ? 33  ASP B OD2 1 
ATOM 1182  N N   . THR B 1 34  ? 91.880  93.558  6.954   1.00 33.41 ? 34  THR B N   1 
ATOM 1183  C CA  . THR B 1 34  ? 90.761  93.033  6.165   1.00 33.36 ? 34  THR B CA  1 
ATOM 1184  C C   . THR B 1 34  ? 89.896  94.150  5.572   1.00 33.33 ? 34  THR B C   1 
ATOM 1185  O O   . THR B 1 34  ? 89.400  94.015  4.455   1.00 33.44 ? 34  THR B O   1 
ATOM 1186  C CB  . THR B 1 34  ? 89.861  92.101  7.009   1.00 33.50 ? 34  THR B CB  1 
ATOM 1187  O OG1 . THR B 1 34  ? 90.674  91.181  7.747   1.00 33.50 ? 34  THR B OG1 1 
ATOM 1188  C CG2 . THR B 1 34  ? 88.889  91.319  6.123   1.00 33.60 ? 34  THR B CG2 1 
ATOM 1189  N N   . VAL B 1 35  ? 89.724  95.241  6.321   1.00 33.30 ? 35  VAL B N   1 
ATOM 1190  C CA  . VAL B 1 35  ? 88.977  96.418  5.850   1.00 33.32 ? 35  VAL B CA  1 
ATOM 1191  C C   . VAL B 1 35  ? 89.715  97.109  4.698   1.00 33.25 ? 35  VAL B C   1 
ATOM 1192  O O   . VAL B 1 35  ? 89.090  97.526  3.722   1.00 33.36 ? 35  VAL B O   1 
ATOM 1193  C CB  . VAL B 1 35  ? 88.712  97.427  7.000   1.00 33.52 ? 35  VAL B CB  1 
ATOM 1194  C CG1 . VAL B 1 35  ? 88.113  98.735  6.481   1.00 33.63 ? 35  VAL B CG1 1 
ATOM 1195  C CG2 . VAL B 1 35  ? 87.790  96.817  8.048   1.00 33.60 ? 35  VAL B CG2 1 
ATOM 1196  N N   . VAL B 1 36  ? 91.038  97.225  4.825   1.00 33.13 ? 36  VAL B N   1 
ATOM 1197  C CA  . VAL B 1 36  ? 91.879  97.834  3.787   1.00 33.03 ? 36  VAL B CA  1 
ATOM 1198  C C   . VAL B 1 36  ? 91.945  96.941  2.545   1.00 33.02 ? 36  VAL B C   1 
ATOM 1199  O O   . VAL B 1 36  ? 91.851  97.436  1.420   1.00 33.10 ? 36  VAL B O   1 
ATOM 1200  C CB  . VAL B 1 36  ? 93.309  98.126  4.310   1.00 33.02 ? 36  VAL B CB  1 
ATOM 1201  C CG1 . VAL B 1 36  ? 94.233  98.583  3.184   1.00 33.08 ? 36  VAL B CG1 1 
ATOM 1202  C CG2 . VAL B 1 36  ? 93.272  99.177  5.412   1.00 33.01 ? 36  VAL B CG2 1 
ATOM 1203  N N   . THR B 1 37  ? 92.116  95.636  2.757   1.00 33.06 ? 37  THR B N   1 
ATOM 1204  C CA  . THR B 1 37  ? 92.150  94.660  1.663   1.00 33.11 ? 37  THR B CA  1 
ATOM 1205  C C   . THR B 1 37  ? 90.806  94.572  0.934   1.00 33.10 ? 37  THR B C   1 
ATOM 1206  O O   . THR B 1 37  ? 90.778  94.464  -0.292  1.00 33.26 ? 37  THR B O   1 
ATOM 1207  C CB  . THR B 1 37  ? 92.545  93.254  2.169   1.00 33.23 ? 37  THR B CB  1 
ATOM 1208  O OG1 . THR B 1 37  ? 93.764  93.336  2.918   1.00 33.31 ? 37  THR B OG1 1 
ATOM 1209  C CG2 . THR B 1 37  ? 92.735  92.278  1.004   1.00 33.28 ? 37  THR B CG2 1 
ATOM 1210  N N   . ALA B 1 38  ? 89.708  94.620  1.688   1.00 33.05 ? 38  ALA B N   1 
ATOM 1211  C CA  . ALA B 1 38  ? 88.359  94.594  1.110   1.00 33.10 ? 38  ALA B CA  1 
ATOM 1212  C C   . ALA B 1 38  ? 88.051  95.845  0.291   1.00 33.09 ? 38  ALA B C   1 
ATOM 1213  O O   . ALA B 1 38  ? 87.479  95.744  -0.795  1.00 33.10 ? 38  ALA B O   1 
ATOM 1214  C CB  . ALA B 1 38  ? 87.311  94.416  2.201   1.00 33.16 ? 38  ALA B CB  1 
ATOM 1215  N N   . TYR B 1 39  ? 88.427  97.012  0.814   1.00 33.22 ? 39  TYR B N   1 
ATOM 1216  C CA  . TYR B 1 39  ? 88.193  98.287  0.124   1.00 33.27 ? 39  TYR B CA  1 
ATOM 1217  C C   . TYR B 1 39  ? 89.029  98.421  -1.151  1.00 33.48 ? 39  TYR B C   1 
ATOM 1218  O O   . TYR B 1 39  ? 88.545  98.957  -2.149  1.00 33.64 ? 39  TYR B O   1 
ATOM 1219  C CB  . TYR B 1 39  ? 88.460  99.477  1.050   1.00 33.19 ? 39  TYR B CB  1 
ATOM 1220  C CG  . TYR B 1 39  ? 87.912  100.781 0.511   1.00 33.27 ? 39  TYR B CG  1 
ATOM 1221  C CD1 . TYR B 1 39  ? 86.558  101.095 0.636   1.00 33.33 ? 39  TYR B CD1 1 
ATOM 1222  C CD2 . TYR B 1 39  ? 88.742  101.698 -0.137  1.00 33.35 ? 39  TYR B CD2 1 
ATOM 1223  C CE1 . TYR B 1 39  ? 86.047  102.286 0.138   1.00 33.32 ? 39  TYR B CE1 1 
ATOM 1224  C CE2 . TYR B 1 39  ? 88.239  102.892 -0.637  1.00 33.36 ? 39  TYR B CE2 1 
ATOM 1225  C CZ  . TYR B 1 39  ? 86.893  103.182 -0.498  1.00 33.36 ? 39  TYR B CZ  1 
ATOM 1226  O OH  . TYR B 1 39  ? 86.392  104.364 -0.992  1.00 33.46 ? 39  TYR B OH  1 
ATOM 1227  N N   . LEU B 1 40  ? 90.273  97.944  -1.109  1.00 33.68 ? 40  LEU B N   1 
ATOM 1228  C CA  . LEU B 1 40  ? 91.121  97.876  -2.308  1.00 33.88 ? 40  LEU B CA  1 
ATOM 1229  C C   . LEU B 1 40  ? 90.609  96.843  -3.314  1.00 34.31 ? 40  LEU B C   1 
ATOM 1230  O O   . LEU B 1 40  ? 90.673  97.077  -4.520  1.00 34.49 ? 40  LEU B O   1 
ATOM 1231  C CB  . LEU B 1 40  ? 92.577  97.566  -1.942  1.00 33.80 ? 40  LEU B CB  1 
ATOM 1232  C CG  . LEU B 1 40  ? 93.358  98.692  -1.261  1.00 33.73 ? 40  LEU B CG  1 
ATOM 1233  C CD1 . LEU B 1 40  ? 94.642  98.146  -0.663  1.00 33.66 ? 40  LEU B CD1 1 
ATOM 1234  C CD2 . LEU B 1 40  ? 93.666  99.825  -2.230  1.00 33.70 ? 40  LEU B CD2 1 
ATOM 1235  N N   . ASN B 1 41  ? 90.110  95.710  -2.815  1.00 34.79 ? 41  ASN B N   1 
ATOM 1236  C CA  . ASN B 1 41  ? 89.479  94.693  -3.666  1.00 35.15 ? 41  ASN B CA  1 
ATOM 1237  C C   . ASN B 1 41  ? 88.219  95.239  -4.347  1.00 35.40 ? 41  ASN B C   1 
ATOM 1238  O O   . ASN B 1 41  ? 87.964  94.933  -5.512  1.00 35.49 ? 41  ASN B O   1 
ATOM 1239  C CB  . ASN B 1 41  ? 89.140  93.436  -2.851  1.00 35.34 ? 41  ASN B CB  1 
ATOM 1240  C CG  . ASN B 1 41  ? 88.632  92.291  -3.713  1.00 35.61 ? 41  ASN B CG  1 
ATOM 1241  O OD1 . ASN B 1 41  ? 89.185  91.999  -4.774  1.00 35.79 ? 41  ASN B OD1 1 
ATOM 1242  N ND2 . ASN B 1 41  ? 87.576  91.629  -3.252  1.00 35.71 ? 41  ASN B ND2 1 
ATOM 1243  N N   . ASP B 1 42  ? 87.444  96.041  -3.617  1.00 35.76 ? 42  ASP B N   1 
ATOM 1244  C CA  . ASP B 1 42  ? 86.296  96.758  -4.189  1.00 36.04 ? 42  ASP B CA  1 
ATOM 1245  C C   . ASP B 1 42  ? 86.743  97.863  -5.150  1.00 36.01 ? 42  ASP B C   1 
ATOM 1246  O O   . ASP B 1 42  ? 86.131  98.050  -6.200  1.00 36.17 ? 42  ASP B O   1 
ATOM 1247  C CB  . ASP B 1 42  ? 85.411  97.361  -3.087  1.00 36.32 ? 42  ASP B CB  1 
ATOM 1248  C CG  . ASP B 1 42  ? 84.701  96.303  -2.248  1.00 36.66 ? 42  ASP B CG  1 
ATOM 1249  O OD1 . ASP B 1 42  ? 84.262  95.272  -2.805  1.00 36.82 ? 42  ASP B OD1 1 
ATOM 1250  O OD2 . ASP B 1 42  ? 84.573  96.511  -1.023  1.00 36.78 ? 42  ASP B OD2 1 
ATOM 1251  N N   . ALA B 1 43  ? 87.802  98.587  -4.784  1.00 35.92 ? 43  ALA B N   1 
ATOM 1252  C CA  . ALA B 1 43  ? 88.363  99.648  -5.631  1.00 35.94 ? 43  ALA B CA  1 
ATOM 1253  C C   . ALA B 1 43  ? 88.850  99.133  -6.987  1.00 36.00 ? 43  ALA B C   1 
ATOM 1254  O O   . ALA B 1 43  ? 88.702  99.820  -7.996  1.00 36.16 ? 43  ALA B O   1 
ATOM 1255  C CB  . ALA B 1 43  ? 89.496  100.364 -4.907  1.00 35.95 ? 43  ALA B CB  1 
ATOM 1256  N N   . VAL B 1 44  ? 89.429  97.932  -7.000  1.00 36.18 ? 44  VAL B N   1 
ATOM 1257  C CA  . VAL B 1 44  ? 89.868  97.276  -8.242  1.00 36.35 ? 44  VAL B CA  1 
ATOM 1258  C C   . VAL B 1 44  ? 88.682  96.950  -9.163  1.00 36.53 ? 44  VAL B C   1 
ATOM 1259  O O   . VAL B 1 44  ? 88.803  97.064  -10.384 1.00 36.62 ? 44  VAL B O   1 
ATOM 1260  C CB  . VAL B 1 44  ? 90.707  96.000  -7.939  1.00 36.45 ? 44  VAL B CB  1 
ATOM 1261  C CG1 . VAL B 1 44  ? 90.943  95.156  -9.191  1.00 36.57 ? 44  VAL B CG1 1 
ATOM 1262  C CG2 . VAL B 1 44  ? 92.043  96.377  -7.300  1.00 36.45 ? 44  VAL B CG2 1 
ATOM 1263  N N   . LYS B 1 45  ? 87.550  96.551  -8.580  1.00 36.84 ? 45  LYS B N   1 
ATOM 1264  C CA  . LYS B 1 45  ? 86.341  96.235  -9.355  1.00 37.12 ? 45  LYS B CA  1 
ATOM 1265  C C   . LYS B 1 45  ? 85.770  97.464  -10.061 1.00 37.00 ? 45  LYS B C   1 
ATOM 1266  O O   . LYS B 1 45  ? 85.493  97.418  -11.259 1.00 37.15 ? 45  LYS B O   1 
ATOM 1267  C CB  . LYS B 1 45  ? 85.266  95.596  -8.466  1.00 37.49 ? 45  LYS B CB  1 
ATOM 1268  C CG  . LYS B 1 45  ? 85.630  94.211  -7.950  1.00 37.82 ? 45  LYS B CG  1 
ATOM 1269  C CD  . LYS B 1 45  ? 84.741  93.786  -6.791  1.00 38.10 ? 45  LYS B CD  1 
ATOM 1270  C CE  . LYS B 1 45  ? 85.222  92.480  -6.176  1.00 38.33 ? 45  LYS B CE  1 
ATOM 1271  N NZ  . LYS B 1 45  ? 84.452  92.106  -4.957  1.00 38.49 ? 45  LYS B NZ  1 
ATOM 1272  N N   . PHE B 1 46  ? 85.604  98.556  -9.317  1.00 36.90 ? 46  PHE B N   1 
ATOM 1273  C CA  . PHE B 1 46  ? 85.076  99.807  -9.882  1.00 36.84 ? 46  PHE B CA  1 
ATOM 1274  C C   . PHE B 1 46  ? 86.058  100.540 -10.807 1.00 36.81 ? 46  PHE B C   1 
ATOM 1275  O O   . PHE B 1 46  ? 85.639  101.401 -11.583 1.00 36.96 ? 46  PHE B O   1 
ATOM 1276  C CB  . PHE B 1 46  ? 84.565  100.736 -8.775  1.00 36.83 ? 46  PHE B CB  1 
ATOM 1277  C CG  . PHE B 1 46  ? 83.261  100.291 -8.178  1.00 36.90 ? 46  PHE B CG  1 
ATOM 1278  C CD1 . PHE B 1 46  ? 82.065  100.531 -8.846  1.00 37.06 ? 46  PHE B CD1 1 
ATOM 1279  C CD2 . PHE B 1 46  ? 83.222  99.614  -6.965  1.00 36.99 ? 46  PHE B CD2 1 
ATOM 1280  C CE1 . PHE B 1 46  ? 80.855  100.113 -8.311  1.00 37.14 ? 46  PHE B CE1 1 
ATOM 1281  C CE2 . PHE B 1 46  ? 82.016  99.196  -6.421  1.00 37.16 ? 46  PHE B CE2 1 
ATOM 1282  C CZ  . PHE B 1 46  ? 80.829  99.444  -7.096  1.00 37.19 ? 46  PHE B CZ  1 
ATOM 1283  N N   . GLN B 1 47  ? 87.348  100.211 -10.720 1.00 36.77 ? 47  GLN B N   1 
ATOM 1284  C CA  . GLN B 1 47  ? 88.331  100.650 -11.721 1.00 36.82 ? 47  GLN B CA  1 
ATOM 1285  C C   . GLN B 1 47  ? 88.095  99.955  -13.066 1.00 37.07 ? 47  GLN B C   1 
ATOM 1286  O O   . GLN B 1 47  ? 88.204  100.588 -14.117 1.00 37.28 ? 47  GLN B O   1 
ATOM 1287  C CB  . GLN B 1 47  ? 89.770  100.400 -11.246 1.00 36.79 ? 47  GLN B CB  1 
ATOM 1288  C CG  . GLN B 1 47  ? 90.277  101.412 -10.226 1.00 36.85 ? 47  GLN B CG  1 
ATOM 1289  C CD  . GLN B 1 47  ? 90.848  102.672 -10.857 1.00 36.98 ? 47  GLN B CD  1 
ATOM 1290  O OE1 . GLN B 1 47  ? 90.359  103.148 -11.883 1.00 37.07 ? 47  GLN B OE1 1 
ATOM 1291  N NE2 . GLN B 1 47  ? 91.885  103.223 -10.237 1.00 37.07 ? 47  GLN B NE2 1 
ATOM 1292  N N   . GLU B 1 48  ? 87.780  98.659  -13.023 1.00 37.41 ? 48  GLU B N   1 
ATOM 1293  C CA  . GLU B 1 48  ? 87.429  97.894  -14.229 1.00 37.74 ? 48  GLU B CA  1 
ATOM 1294  C C   . GLU B 1 48  ? 86.084  98.322  -14.827 1.00 37.83 ? 48  GLU B C   1 
ATOM 1295  O O   . GLU B 1 48  ? 85.903  98.252  -16.042 1.00 38.01 ? 48  GLU B O   1 
ATOM 1296  C CB  . GLU B 1 48  ? 87.412  96.386  -13.941 1.00 38.07 ? 48  GLU B CB  1 
ATOM 1297  C CG  . GLU B 1 48  ? 88.773  95.787  -13.602 1.00 38.39 ? 48  GLU B CG  1 
ATOM 1298  C CD  . GLU B 1 48  ? 89.717  95.709  -14.794 1.00 38.68 ? 48  GLU B CD  1 
ATOM 1299  O OE1 . GLU B 1 48  ? 89.292  95.244  -15.876 1.00 38.76 ? 48  GLU B OE1 1 
ATOM 1300  O OE2 . GLU B 1 48  ? 90.895  96.102  -14.646 1.00 38.77 ? 48  GLU B OE2 1 
ATOM 1301  N N   . MET B 1 49  ? 85.146  98.747  -13.980 1.00 37.94 ? 49  MET B N   1 
ATOM 1302  C CA  . MET B 1 49  ? 83.855  99.275  -14.447 1.00 38.06 ? 49  MET B CA  1 
ATOM 1303  C C   . MET B 1 49  ? 83.993  100.633 -15.141 1.00 37.98 ? 49  MET B C   1 
ATOM 1304  O O   . MET B 1 49  ? 83.271  100.911 -16.100 1.00 38.26 ? 49  MET B O   1 
ATOM 1305  C CB  . MET B 1 49  ? 82.855  99.377  -13.293 1.00 38.24 ? 49  MET B CB  1 
ATOM 1306  C CG  . MET B 1 49  ? 82.381  98.024  -12.788 1.00 38.47 ? 49  MET B CG  1 
ATOM 1307  S SD  . MET B 1 49  ? 81.336  98.118  -11.323 1.00 38.86 ? 49  MET B SD  1 
ATOM 1308  C CE  . MET B 1 49  ? 79.940  99.038  -11.961 1.00 38.96 ? 49  MET B CE  1 
ATOM 1309  N N   . TYR B 1 50  ? 84.907  101.469 -14.654 1.00 37.79 ? 50  TYR B N   1 
ATOM 1310  C CA  . TYR B 1 50  ? 85.231  102.741 -15.311 1.00 37.80 ? 50  TYR B CA  1 
ATOM 1311  C C   . TYR B 1 50  ? 85.982  102.517 -16.630 1.00 38.04 ? 50  TYR B C   1 
ATOM 1312  O O   . TYR B 1 50  ? 85.838  103.306 -17.567 1.00 38.25 ? 50  TYR B O   1 
ATOM 1313  C CB  . TYR B 1 50  ? 86.057  103.633 -14.381 1.00 37.76 ? 50  TYR B CB  1 
ATOM 1314  C CG  . TYR B 1 50  ? 86.095  105.089 -14.792 1.00 37.79 ? 50  TYR B CG  1 
ATOM 1315  C CD1 . TYR B 1 50  ? 87.080  105.568 -15.656 1.00 37.66 ? 50  TYR B CD1 1 
ATOM 1316  C CD2 . TYR B 1 50  ? 85.156  105.996 -14.299 1.00 37.87 ? 50  TYR B CD2 1 
ATOM 1317  C CE1 . TYR B 1 50  ? 87.122  106.904 -16.026 1.00 37.67 ? 50  TYR B CE1 1 
ATOM 1318  C CE2 . TYR B 1 50  ? 85.190  107.335 -14.664 1.00 37.85 ? 50  TYR B CE2 1 
ATOM 1319  C CZ  . TYR B 1 50  ? 86.175  107.785 -15.527 1.00 37.80 ? 50  TYR B CZ  1 
ATOM 1320  O OH  . TYR B 1 50  ? 86.213  109.110 -15.894 1.00 37.98 ? 50  TYR B OH  1 
ATOM 1321  N N   . GLN B 1 51  ? 86.784  101.455 -16.687 1.00 38.31 ? 51  GLN B N   1 
ATOM 1322  C CA  . GLN B 1 51  ? 87.475  101.039 -17.915 1.00 38.55 ? 51  GLN B CA  1 
ATOM 1323  C C   . GLN B 1 51  ? 86.498  100.612 -19.020 1.00 38.78 ? 51  GLN B C   1 
ATOM 1324  O O   . GLN B 1 51  ? 86.781  100.805 -20.203 1.00 38.94 ? 51  GLN B O   1 
ATOM 1325  C CB  . GLN B 1 51  ? 88.463  99.901  -17.608 1.00 38.73 ? 51  GLN B CB  1 
ATOM 1326  C CG  . GLN B 1 51  ? 89.405  99.508  -18.741 1.00 38.88 ? 51  GLN B CG  1 
ATOM 1327  C CD  . GLN B 1 51  ? 90.423  100.580 -19.080 1.00 38.88 ? 51  GLN B CD  1 
ATOM 1328  O OE1 . GLN B 1 51  ? 91.062  101.148 -18.196 1.00 38.93 ? 51  GLN B OE1 1 
ATOM 1329  N NE2 . GLN B 1 51  ? 90.596  100.845 -20.369 1.00 38.97 ? 51  GLN B NE2 1 
ATOM 1330  N N   . ILE B 1 52  ? 85.362  100.028 -18.634 1.00 38.96 ? 52  ILE B N   1 
ATOM 1331  C CA  . ILE B 1 52  ? 84.295  99.677  -19.583 1.00 39.19 ? 52  ILE B CA  1 
ATOM 1332  C C   . ILE B 1 52  ? 83.653  100.937 -20.179 1.00 39.35 ? 52  ILE B C   1 
ATOM 1333  O O   . ILE B 1 52  ? 83.400  100.994 -21.385 1.00 39.50 ? 52  ILE B O   1 
ATOM 1334  C CB  . ILE B 1 52  ? 83.217  98.773  -18.926 1.00 39.24 ? 52  ILE B CB  1 
ATOM 1335  C CG1 . ILE B 1 52  ? 83.815  97.403  -18.577 1.00 39.33 ? 52  ILE B CG1 1 
ATOM 1336  C CG2 . ILE B 1 52  ? 82.008  98.580  -19.844 1.00 39.29 ? 52  ILE B CG2 1 
ATOM 1337  C CD1 . ILE B 1 52  ? 83.064  96.649  -17.498 1.00 39.33 ? 52  ILE B CD1 1 
ATOM 1338  N N   . ASP B 1 53  ? 83.404  101.938 -19.336 1.00 39.54 ? 53  ASP B N   1 
ATOM 1339  C CA  . ASP B 1 53  ? 82.737  103.173 -19.761 1.00 39.77 ? 53  ASP B CA  1 
ATOM 1340  C C   . ASP B 1 53  ? 83.664  104.097 -20.549 1.00 39.75 ? 53  ASP B C   1 
ATOM 1341  O O   . ASP B 1 53  ? 83.392  104.412 -21.709 1.00 39.95 ? 53  ASP B O   1 
ATOM 1342  C CB  . ASP B 1 53  ? 82.174  103.925 -18.548 1.00 40.03 ? 53  ASP B CB  1 
ATOM 1343  C CG  . ASP B 1 53  ? 81.095  103.141 -17.816 1.00 40.34 ? 53  ASP B CG  1 
ATOM 1344  O OD1 . ASP B 1 53  ? 80.977  101.918 -18.041 1.00 40.49 ? 53  ASP B OD1 1 
ATOM 1345  O OD2 . ASP B 1 53  ? 80.365  103.753 -17.007 1.00 40.58 ? 53  ASP B OD2 1 
ATOM 1346  N N   . ASN B 1 54  ? 84.759  104.512 -19.913 1.00 39.52 ? 54  ASN B N   1 
ATOM 1347  C CA  . ASN B 1 54  ? 85.629  105.577 -20.434 1.00 39.56 ? 54  ASN B CA  1 
ATOM 1348  C C   . ASN B 1 54  ? 86.881  105.108 -21.191 1.00 39.43 ? 54  ASN B C   1 
ATOM 1349  O O   . ASN B 1 54  ? 87.556  105.934 -21.810 1.00 39.61 ? 54  ASN B O   1 
ATOM 1350  C CB  . ASN B 1 54  ? 86.058  106.498 -19.287 1.00 39.76 ? 54  ASN B CB  1 
ATOM 1351  C CG  . ASN B 1 54  ? 84.887  107.215 -18.640 1.00 39.96 ? 54  ASN B CG  1 
ATOM 1352  O OD1 . ASN B 1 54  ? 84.641  108.391 -18.908 1.00 40.17 ? 54  ASN B OD1 1 
ATOM 1353  N ND2 . ASN B 1 54  ? 84.158  106.508 -17.783 1.00 40.00 ? 54  ASN B ND2 1 
ATOM 1354  N N   . ASN B 1 55  ? 87.189  103.808 -21.140 1.00 39.07 ? 55  ASN B N   1 
ATOM 1355  C CA  . ASN B 1 55  ? 88.420  103.241 -21.724 1.00 38.83 ? 55  ASN B CA  1 
ATOM 1356  C C   . ASN B 1 55  ? 89.693  103.836 -21.100 1.00 38.56 ? 55  ASN B C   1 
ATOM 1357  O O   . ASN B 1 55  ? 90.660  104.144 -21.800 1.00 38.71 ? 55  ASN B O   1 
ATOM 1358  C CB  . ASN B 1 55  ? 88.435  103.385 -23.257 1.00 39.00 ? 55  ASN B CB  1 
ATOM 1359  C CG  . ASN B 1 55  ? 87.149  102.903 -23.908 1.00 39.27 ? 55  ASN B CG  1 
ATOM 1360  O OD1 . ASN B 1 55  ? 86.595  103.572 -24.780 1.00 39.50 ? 55  ASN B OD1 1 
ATOM 1361  N ND2 . ASN B 1 55  ? 86.668  101.736 -23.486 1.00 39.40 ? 55  ASN B ND2 1 
ATOM 1362  N N   . SER B 1 56  ? 89.674  103.984 -19.776 1.00 38.22 ? 56  SER B N   1 
ATOM 1363  C CA  . SER B 1 56  ? 90.815  104.500 -19.011 1.00 37.99 ? 56  SER B CA  1 
ATOM 1364  C C   . SER B 1 56  ? 90.643  104.180 -17.524 1.00 37.53 ? 56  SER B C   1 
ATOM 1365  O O   . SER B 1 56  ? 89.634  103.594 -17.126 1.00 37.69 ? 56  SER B O   1 
ATOM 1366  C CB  . SER B 1 56  ? 90.950  106.014 -19.206 1.00 38.25 ? 56  SER B CB  1 
ATOM 1367  O OG  . SER B 1 56  ? 92.126  106.508 -18.587 1.00 38.43 ? 56  SER B OG  1 
ATOM 1368  N N   . TYR B 1 57  ? 91.638  104.548 -16.717 1.00 36.99 ? 57  TYR B N   1 
ATOM 1369  C CA  . TYR B 1 57  ? 91.573  104.396 -15.259 1.00 36.72 ? 57  TYR B CA  1 
ATOM 1370  C C   . TYR B 1 57  ? 91.517  105.762 -14.572 1.00 36.67 ? 57  TYR B C   1 
ATOM 1371  O O   . TYR B 1 57  ? 92.056  106.748 -15.081 1.00 36.63 ? 57  TYR B O   1 
ATOM 1372  C CB  . TYR B 1 57  ? 92.765  103.588 -14.747 1.00 36.60 ? 57  TYR B CB  1 
ATOM 1373  C CG  . TYR B 1 57  ? 92.714  102.121 -15.121 1.00 36.53 ? 57  TYR B CG  1 
ATOM 1374  C CD1 . TYR B 1 57  ? 91.783  101.263 -14.531 1.00 36.47 ? 57  TYR B CD1 1 
ATOM 1375  C CD2 . TYR B 1 57  ? 93.598  101.582 -16.057 1.00 36.51 ? 57  TYR B CD2 1 
ATOM 1376  C CE1 . TYR B 1 57  ? 91.730  99.916  -14.866 1.00 36.34 ? 57  TYR B CE1 1 
ATOM 1377  C CE2 . TYR B 1 57  ? 93.554  100.236 -16.398 1.00 36.42 ? 57  TYR B CE2 1 
ATOM 1378  C CZ  . TYR B 1 57  ? 92.619  99.408  -15.800 1.00 36.34 ? 57  TYR B CZ  1 
ATOM 1379  O OH  . TYR B 1 57  ? 92.569  98.075  -16.133 1.00 36.45 ? 57  TYR B OH  1 
ATOM 1380  N N   . THR B 1 58  ? 90.868  105.799 -13.410 1.00 36.59 ? 58  THR B N   1 
ATOM 1381  C CA  . THR B 1 58  ? 90.589  107.043 -12.696 1.00 36.53 ? 58  THR B CA  1 
ATOM 1382  C C   . THR B 1 58  ? 91.746  107.472 -11.802 1.00 36.66 ? 58  THR B C   1 
ATOM 1383  O O   . THR B 1 58  ? 92.290  106.659 -11.052 1.00 36.84 ? 58  THR B O   1 
ATOM 1384  C CB  . THR B 1 58  ? 89.349  106.896 -11.795 1.00 36.65 ? 58  THR B CB  1 
ATOM 1385  O OG1 . THR B 1 58  ? 89.538  105.801 -10.889 1.00 36.58 ? 58  THR B OG1 1 
ATOM 1386  C CG2 . THR B 1 58  ? 88.118  106.641 -12.630 1.00 36.74 ? 58  THR B CG2 1 
ATOM 1387  N N   . SER B 1 59  ? 92.101  108.753 -11.880 1.00 36.78 ? 59  SER B N   1 
ATOM 1388  C CA  . SER B 1 59  ? 93.040  109.365 -10.943 1.00 36.85 ? 59  SER B CA  1 
ATOM 1389  C C   . SER B 1 59  ? 92.305  109.779 -9.667  1.00 36.82 ? 59  SER B C   1 
ATOM 1390  O O   . SER B 1 59  ? 92.794  109.533 -8.565  1.00 36.81 ? 59  SER B O   1 
ATOM 1391  C CB  . SER B 1 59  ? 93.717  110.582 -11.579 1.00 37.11 ? 59  SER B CB  1 
ATOM 1392  O OG  . SER B 1 59  ? 94.773  111.064 -10.765 1.00 37.24 ? 59  SER B OG  1 
ATOM 1393  N N   . ASN B 1 60  ? 91.139  110.407 -9.826  1.00 36.97 ? 60  ASN B N   1 
ATOM 1394  C CA  . ASN B 1 60  ? 90.324  110.861 -8.687  1.00 37.22 ? 60  ASN B CA  1 
ATOM 1395  C C   . ASN B 1 60  ? 89.441  109.746 -8.111  1.00 37.20 ? 60  ASN B C   1 
ATOM 1396  O O   . ASN B 1 60  ? 89.033  108.829 -8.827  1.00 37.13 ? 60  ASN B O   1 
ATOM 1397  C CB  . ASN B 1 60  ? 89.465  112.080 -9.070  1.00 37.35 ? 60  ASN B CB  1 
ATOM 1398  C CG  . ASN B 1 60  ? 88.354  111.745 -10.054 1.00 37.43 ? 60  ASN B CG  1 
ATOM 1399  O OD1 . ASN B 1 60  ? 88.521  110.908 -10.942 1.00 37.43 ? 60  ASN B OD1 1 
ATOM 1400  N ND2 . ASN B 1 60  ? 87.215  112.412 -9.904  1.00 37.57 ? 60  ASN B ND2 1 
ATOM 1401  N N   . GLN B 1 61  ? 89.152  109.848 -6.815  1.00 37.16 ? 61  GLN B N   1 
ATOM 1402  C CA  . GLN B 1 61  ? 88.318  108.873 -6.105  1.00 37.02 ? 61  GLN B CA  1 
ATOM 1403  C C   . GLN B 1 61  ? 86.826  109.076 -6.381  1.00 36.99 ? 61  GLN B C   1 
ATOM 1404  O O   . GLN B 1 61  ? 86.072  108.103 -6.434  1.00 37.14 ? 61  GLN B O   1 
ATOM 1405  C CB  . GLN B 1 61  ? 88.577  108.952 -4.597  1.00 37.12 ? 61  GLN B CB  1 
ATOM 1406  C CG  . GLN B 1 61  ? 88.039  107.767 -3.804  1.00 37.21 ? 61  GLN B CG  1 
ATOM 1407  C CD  . GLN B 1 61  ? 88.164  107.950 -2.303  1.00 37.24 ? 61  GLN B CD  1 
ATOM 1408  O OE1 . GLN B 1 61  ? 89.023  108.689 -1.817  1.00 37.27 ? 61  GLN B OE1 1 
ATOM 1409  N NE2 . GLN B 1 61  ? 87.306  107.266 -1.555  1.00 37.32 ? 61  GLN B NE2 1 
ATOM 1410  N N   . ALA B 1 62  ? 86.408  110.334 -6.541  1.00 36.96 ? 62  ALA B N   1 
ATOM 1411  C CA  . ALA B 1 62  ? 84.999  110.686 -6.786  1.00 36.85 ? 62  ALA B CA  1 
ATOM 1412  C C   . ALA B 1 62  ? 84.390  110.021 -8.027  1.00 36.78 ? 62  ALA B C   1 
ATOM 1413  O O   . ALA B 1 62  ? 83.183  109.775 -8.065  1.00 36.92 ? 62  ALA B O   1 
ATOM 1414  C CB  . ALA B 1 62  ? 84.843  112.198 -6.881  1.00 36.91 ? 62  ALA B CB  1 
ATOM 1415  N N   . ALA B 1 63  ? 85.221  109.746 -9.033  1.00 36.84 ? 63  ALA B N   1 
ATOM 1416  C CA  . ALA B 1 63  ? 84.797  109.002 -10.223 1.00 36.91 ? 63  ALA B CA  1 
ATOM 1417  C C   . ALA B 1 63  ? 84.410  107.560 -9.889  1.00 36.82 ? 63  ALA B C   1 
ATOM 1418  O O   . ALA B 1 63  ? 83.408  107.056 -10.396 1.00 36.91 ? 63  ALA B O   1 
ATOM 1419  C CB  . ALA B 1 63  ? 85.890  109.022 -11.282 1.00 37.01 ? 63  ALA B CB  1 
ATOM 1420  N N   . LEU B 1 64  ? 85.203  106.909 -9.037  1.00 36.89 ? 64  LEU B N   1 
ATOM 1421  C CA  . LEU B 1 64  ? 84.914  105.542 -8.582  1.00 37.01 ? 64  LEU B CA  1 
ATOM 1422  C C   . LEU B 1 64  ? 83.683  105.476 -7.673  1.00 37.02 ? 64  LEU B C   1 
ATOM 1423  O O   . LEU B 1 64  ? 82.926  104.505 -7.728  1.00 37.07 ? 64  LEU B O   1 
ATOM 1424  C CB  . LEU B 1 64  ? 86.119  104.941 -7.848  1.00 37.12 ? 64  LEU B CB  1 
ATOM 1425  C CG  . LEU B 1 64  ? 87.422  104.787 -8.639  1.00 37.29 ? 64  LEU B CG  1 
ATOM 1426  C CD1 . LEU B 1 64  ? 88.548  104.335 -7.721  1.00 37.40 ? 64  LEU B CD1 1 
ATOM 1427  C CD2 . LEU B 1 64  ? 87.251  103.814 -9.797  1.00 37.32 ? 64  LEU B CD2 1 
ATOM 1428  N N   . ILE B 1 65  ? 83.494  106.506 -6.845  1.00 37.10 ? 65  ILE B N   1 
ATOM 1429  C CA  . ILE B 1 65  ? 82.346  106.582 -5.930  1.00 37.16 ? 65  ILE B CA  1 
ATOM 1430  C C   . ILE B 1 65  ? 81.037  106.808 -6.699  1.00 37.20 ? 65  ILE B C   1 
ATOM 1431  O O   . ILE B 1 65  ? 79.997  106.259 -6.325  1.00 37.29 ? 65  ILE B O   1 
ATOM 1432  C CB  . ILE B 1 65  ? 82.541  107.681 -4.849  1.00 37.23 ? 65  ILE B CB  1 
ATOM 1433  C CG1 . ILE B 1 65  ? 83.752  107.356 -3.962  1.00 37.33 ? 65  ILE B CG1 1 
ATOM 1434  C CG2 . ILE B 1 65  ? 81.295  107.828 -3.974  1.00 37.26 ? 65  ILE B CG2 1 
ATOM 1435  C CD1 . ILE B 1 65  ? 84.265  108.530 -3.153  1.00 37.48 ? 65  ILE B CD1 1 
ATOM 1436  N N   . SER B 1 66  ? 81.094  107.606 -7.766  1.00 37.26 ? 66  SER B N   1 
ATOM 1437  C CA  . SER B 1 66  ? 79.926  107.868 -8.619  1.00 37.39 ? 66  SER B CA  1 
ATOM 1438  C C   . SER B 1 66  ? 79.390  106.606 -9.306  1.00 37.52 ? 66  SER B C   1 
ATOM 1439  O O   . SER B 1 66  ? 78.177  106.457 -9.466  1.00 37.55 ? 66  SER B O   1 
ATOM 1440  C CB  . SER B 1 66  ? 80.259  108.930 -9.673  1.00 37.37 ? 66  SER B CB  1 
ATOM 1441  O OG  . SER B 1 66  ? 79.101  109.330 -10.386 1.00 37.36 ? 66  SER B OG  1 
ATOM 1442  N N   . LEU B 1 67  ? 80.294  105.712 -9.710  1.00 37.78 ? 67  LEU B N   1 
ATOM 1443  C CA  . LEU B 1 67  ? 79.909  104.426 -10.315 1.00 38.04 ? 67  LEU B CA  1 
ATOM 1444  C C   . LEU B 1 67  ? 79.207  103.471 -9.341  1.00 38.13 ? 67  LEU B C   1 
ATOM 1445  O O   . LEU B 1 67  ? 78.350  102.689 -9.762  1.00 38.34 ? 67  LEU B O   1 
ATOM 1446  C CB  . LEU B 1 67  ? 81.119  103.722 -10.959 1.00 38.16 ? 67  LEU B CB  1 
ATOM 1447  C CG  . LEU B 1 67  ? 81.342  103.990 -12.452 1.00 38.40 ? 67  LEU B CG  1 
ATOM 1448  C CD1 . LEU B 1 67  ? 81.656  105.450 -12.744 1.00 38.45 ? 67  LEU B CD1 1 
ATOM 1449  C CD2 . LEU B 1 67  ? 82.454  103.096 -12.978 1.00 38.59 ? 67  LEU B CD2 1 
ATOM 1450  N N   . GLY B 1 68  ? 79.560  103.537 -8.055  1.00 37.98 ? 68  GLY B N   1 
ATOM 1451  C CA  . GLY B 1 68  ? 78.978  102.643 -7.043  1.00 37.88 ? 68  GLY B CA  1 
ATOM 1452  C C   . GLY B 1 68  ? 79.799  102.354 -5.795  1.00 37.72 ? 68  GLY B C   1 
ATOM 1453  O O   . GLY B 1 68  ? 79.233  101.934 -4.783  1.00 37.88 ? 68  GLY B O   1 
ATOM 1454  N N   . LEU B 1 69  ? 81.122  102.542 -5.858  1.00 37.46 ? 69  LEU B N   1 
ATOM 1455  C CA  . LEU B 1 69  ? 82.009  102.327 -4.702  1.00 37.38 ? 69  LEU B CA  1 
ATOM 1456  C C   . LEU B 1 69  ? 81.588  103.157 -3.487  1.00 37.38 ? 69  LEU B C   1 
ATOM 1457  O O   . LEU B 1 69  ? 81.094  104.278 -3.630  1.00 37.44 ? 69  LEU B O   1 
ATOM 1458  C CB  . LEU B 1 69  ? 83.463  102.663 -5.066  1.00 37.38 ? 69  LEU B CB  1 
ATOM 1459  C CG  . LEU B 1 69  ? 84.571  102.373 -4.044  1.00 37.33 ? 69  LEU B CG  1 
ATOM 1460  C CD1 . LEU B 1 69  ? 84.711  100.884 -3.764  1.00 37.36 ? 69  LEU B CD1 1 
ATOM 1461  C CD2 . LEU B 1 69  ? 85.894  102.941 -4.532  1.00 37.37 ? 69  LEU B CD2 1 
ATOM 1462  N N   . LYS B 1 70  ? 81.792  102.596 -2.296  1.00 37.37 ? 70  LYS B N   1 
ATOM 1463  C CA  . LYS B 1 70  ? 81.446  103.270 -1.042  1.00 37.30 ? 70  LYS B CA  1 
ATOM 1464  C C   . LYS B 1 70  ? 82.443  104.379 -0.719  1.00 37.09 ? 70  LYS B C   1 
ATOM 1465  O O   . LYS B 1 70  ? 83.508  104.474 -1.336  1.00 37.05 ? 70  LYS B O   1 
ATOM 1466  C CB  . LYS B 1 70  ? 81.407  102.269 0.118   1.00 37.51 ? 70  LYS B CB  1 
ATOM 1467  C CG  . LYS B 1 70  ? 80.368  101.170 -0.031  1.00 37.82 ? 70  LYS B CG  1 
ATOM 1468  C CD  . LYS B 1 70  ? 80.268  100.336 1.237   1.00 38.07 ? 70  LYS B CD  1 
ATOM 1469  C CE  . LYS B 1 70  ? 79.207  99.252  1.121   1.00 38.26 ? 70  LYS B CE  1 
ATOM 1470  N NZ  . LYS B 1 70  ? 79.553  98.214  0.108   1.00 38.34 ? 70  LYS B NZ  1 
ATOM 1471  N N   . SER B 1 71  ? 82.086  105.214 0.255   1.00 36.84 ? 71  SER B N   1 
ATOM 1472  C CA  . SER B 1 71  ? 82.992  106.243 0.771   1.00 36.56 ? 71  SER B CA  1 
ATOM 1473  C C   . SER B 1 71  ? 84.154  105.593 1.519   1.00 36.24 ? 71  SER B C   1 
ATOM 1474  O O   . SER B 1 71  ? 84.063  104.431 1.930   1.00 36.23 ? 71  SER B O   1 
ATOM 1475  C CB  . SER B 1 71  ? 82.244  107.202 1.700   1.00 36.59 ? 71  SER B CB  1 
ATOM 1476  O OG  . SER B 1 71  ? 81.171  107.835 1.026   1.00 36.60 ? 71  SER B OG  1 
ATOM 1477  N N   . THR B 1 72  ? 85.241  106.344 1.690   1.00 35.94 ? 72  THR B N   1 
ATOM 1478  C CA  . THR B 1 72  ? 86.438  105.840 2.368   1.00 35.78 ? 72  THR B CA  1 
ATOM 1479  C C   . THR B 1 72  ? 86.086  105.406 3.799   1.00 35.65 ? 72  THR B C   1 
ATOM 1480  O O   . THR B 1 72  ? 85.381  106.142 4.495   1.00 35.81 ? 72  THR B O   1 
ATOM 1481  C CB  . THR B 1 72  ? 87.552  106.905 2.423   1.00 35.87 ? 72  THR B CB  1 
ATOM 1482  O OG1 . THR B 1 72  ? 87.745  107.470 1.120   1.00 35.93 ? 72  THR B OG1 1 
ATOM 1483  C CG2 . THR B 1 72  ? 88.867  106.298 2.907   1.00 35.94 ? 72  THR B CG2 1 
ATOM 1484  N N   . PRO B 1 73  ? 86.558  104.216 4.240   1.00 35.35 ? 73  PRO B N   1 
ATOM 1485  C CA  . PRO B 1 73  ? 86.186  103.756 5.588   1.00 35.35 ? 73  PRO B CA  1 
ATOM 1486  C C   . PRO B 1 73  ? 86.798  104.585 6.720   1.00 35.42 ? 73  PRO B C   1 
ATOM 1487  O O   . PRO B 1 73  ? 87.726  105.366 6.491   1.00 35.51 ? 73  PRO B O   1 
ATOM 1488  C CB  . PRO B 1 73  ? 86.714  102.312 5.641   1.00 35.35 ? 73  PRO B CB  1 
ATOM 1489  C CG  . PRO B 1 73  ? 87.075  101.951 4.244   1.00 35.32 ? 73  PRO B CG  1 
ATOM 1490  C CD  . PRO B 1 73  ? 87.418  103.231 3.557   1.00 35.28 ? 73  PRO B CD  1 
ATOM 1491  N N   . ALA B 1 74  ? 86.269  104.404 7.927   1.00 35.52 ? 74  ALA B N   1 
ATOM 1492  C CA  . ALA B 1 74  ? 86.723  105.149 9.102   1.00 35.57 ? 74  ALA B CA  1 
ATOM 1493  C C   . ALA B 1 74  ? 88.151  104.752 9.470   1.00 35.42 ? 74  ALA B C   1 
ATOM 1494  O O   . ALA B 1 74  ? 88.465  103.562 9.549   1.00 35.50 ? 74  ALA B O   1 
ATOM 1495  C CB  . ALA B 1 74  ? 85.788  104.911 10.279  1.00 35.68 ? 74  ALA B CB  1 
ATOM 1496  N N   . ASN B 1 75  ? 89.000  105.760 9.682   1.00 35.20 ? 75  ASN B N   1 
ATOM 1497  C CA  . ASN B 1 75  ? 90.423  105.577 9.998   1.00 35.04 ? 75  ASN B CA  1 
ATOM 1498  C C   . ASN B 1 75  ? 91.189  104.828 8.894   1.00 34.83 ? 75  ASN B C   1 
ATOM 1499  O O   . ASN B 1 75  ? 92.041  103.983 9.183   1.00 34.81 ? 75  ASN B O   1 
ATOM 1500  C CB  . ASN B 1 75  ? 90.597  104.879 11.358  1.00 35.14 ? 75  ASN B CB  1 
ATOM 1501  C CG  . ASN B 1 75  ? 89.779  105.524 12.463  1.00 35.37 ? 75  ASN B CG  1 
ATOM 1502  O OD1 . ASN B 1 75  ? 89.553  106.735 12.462  1.00 35.52 ? 75  ASN B OD1 1 
ATOM 1503  N ND2 . ASN B 1 75  ? 89.333  104.713 13.415  1.00 35.47 ? 75  ASN B ND2 1 
ATOM 1504  N N   . VAL B 1 76  ? 90.875  105.150 7.637   1.00 34.65 ? 76  VAL B N   1 
ATOM 1505  C CA  . VAL B 1 76  ? 91.554  104.585 6.463   1.00 34.49 ? 76  VAL B CA  1 
ATOM 1506  C C   . VAL B 1 76  ? 91.943  105.723 5.520   1.00 34.47 ? 76  VAL B C   1 
ATOM 1507  O O   . VAL B 1 76  ? 91.136  106.615 5.249   1.00 34.47 ? 76  VAL B O   1 
ATOM 1508  C CB  . VAL B 1 76  ? 90.657  103.568 5.717   1.00 34.35 ? 76  VAL B CB  1 
ATOM 1509  C CG1 . VAL B 1 76  ? 91.323  103.081 4.429   1.00 34.32 ? 76  VAL B CG1 1 
ATOM 1510  C CG2 . VAL B 1 76  ? 90.331  102.389 6.620   1.00 34.40 ? 76  VAL B CG2 1 
ATOM 1511  N N   . THR B 1 77  ? 93.180  105.673 5.025   1.00 34.42 ? 77  THR B N   1 
ATOM 1512  C CA  . THR B 1 77  ? 93.730  106.697 4.137   1.00 34.40 ? 77  THR B CA  1 
ATOM 1513  C C   . THR B 1 77  ? 93.926  106.137 2.730   1.00 34.33 ? 77  THR B C   1 
ATOM 1514  O O   . THR B 1 77  ? 95.037  105.772 2.338   1.00 34.35 ? 77  THR B O   1 
ATOM 1515  C CB  . THR B 1 77  ? 95.069  107.235 4.677   1.00 34.48 ? 77  THR B CB  1 
ATOM 1516  O OG1 . THR B 1 77  ? 95.966  106.144 4.914   1.00 34.42 ? 77  THR B OG1 1 
ATOM 1517  C CG2 . THR B 1 77  ? 94.852  107.996 5.977   1.00 34.60 ? 77  THR B CG2 1 
ATOM 1518  N N   . PHE B 1 78  ? 92.825  106.065 1.985   1.00 34.32 ? 78  PHE B N   1 
ATOM 1519  C CA  . PHE B 1 78  ? 92.845  105.654 0.581   1.00 34.26 ? 78  PHE B CA  1 
ATOM 1520  C C   . PHE B 1 78  ? 93.379  106.800 -0.274  1.00 34.03 ? 78  PHE B C   1 
ATOM 1521  O O   . PHE B 1 78  ? 93.031  107.962 -0.049  1.00 34.15 ? 78  PHE B O   1 
ATOM 1522  C CB  . PHE B 1 78  ? 91.435  105.262 0.120   1.00 34.49 ? 78  PHE B CB  1 
ATOM 1523  C CG  . PHE B 1 78  ? 91.360  104.818 -1.315  1.00 34.68 ? 78  PHE B CG  1 
ATOM 1524  C CD1 . PHE B 1 78  ? 91.682  103.512 -1.672  1.00 34.79 ? 78  PHE B CD1 1 
ATOM 1525  C CD2 . PHE B 1 78  ? 90.956  105.702 -2.313  1.00 34.80 ? 78  PHE B CD2 1 
ATOM 1526  C CE1 . PHE B 1 78  ? 91.610  103.099 -2.996  1.00 34.94 ? 78  PHE B CE1 1 
ATOM 1527  C CE2 . PHE B 1 78  ? 90.883  105.295 -3.638  1.00 34.93 ? 78  PHE B CE2 1 
ATOM 1528  C CZ  . PHE B 1 78  ? 91.209  103.992 -3.980  1.00 34.99 ? 78  PHE B CZ  1 
ATOM 1529  N N   . SER B 1 79  ? 94.221  106.466 -1.251  1.00 33.69 ? 79  SER B N   1 
ATOM 1530  C CA  . SER B 1 79  ? 94.855  107.468 -2.109  1.00 33.53 ? 79  SER B CA  1 
ATOM 1531  C C   . SER B 1 79  ? 95.410  106.835 -3.386  1.00 33.30 ? 79  SER B C   1 
ATOM 1532  O O   . SER B 1 79  ? 96.339  106.028 -3.328  1.00 33.36 ? 79  SER B O   1 
ATOM 1533  C CB  . SER B 1 79  ? 95.983  108.171 -1.347  1.00 33.61 ? 79  SER B CB  1 
ATOM 1534  O OG  . SER B 1 79  ? 96.638  109.133 -2.157  1.00 33.71 ? 79  SER B OG  1 
ATOM 1535  N N   . ILE B 1 80  ? 94.842  107.214 -4.530  1.00 33.07 ? 80  ILE B N   1 
ATOM 1536  C CA  . ILE B 1 80  ? 95.298  106.720 -5.830  1.00 32.89 ? 80  ILE B CA  1 
ATOM 1537  C C   . ILE B 1 80  ? 96.542  107.512 -6.231  1.00 32.77 ? 80  ILE B C   1 
ATOM 1538  O O   . ILE B 1 80  ? 96.498  108.741 -6.316  1.00 32.79 ? 80  ILE B O   1 
ATOM 1539  C CB  . ILE B 1 80  ? 94.207  106.858 -6.920  1.00 32.91 ? 80  ILE B CB  1 
ATOM 1540  C CG1 . ILE B 1 80  ? 92.949  106.065 -6.529  1.00 32.96 ? 80  ILE B CG1 1 
ATOM 1541  C CG2 . ILE B 1 80  ? 94.736  106.388 -8.276  1.00 32.94 ? 80  ILE B CG2 1 
ATOM 1542  C CD1 . ILE B 1 80  ? 91.720  106.385 -7.354  1.00 33.00 ? 80  ILE B CD1 1 
ATOM 1543  N N   . VAL B 1 81  ? 97.644  106.800 -6.469  1.00 32.73 ? 81  VAL B N   1 
ATOM 1544  C CA  . VAL B 1 81  ? 98.925  107.416 -6.824  1.00 32.76 ? 81  VAL B CA  1 
ATOM 1545  C C   . VAL B 1 81  ? 98.868  107.959 -8.247  1.00 32.87 ? 81  VAL B C   1 
ATOM 1546  O O   . VAL B 1 81  ? 99.082  109.153 -8.475  1.00 32.99 ? 81  VAL B O   1 
ATOM 1547  C CB  . VAL B 1 81  ? 100.093 106.407 -6.691  1.00 32.81 ? 81  VAL B CB  1 
ATOM 1548  C CG1 . VAL B 1 81  ? 101.389 106.961 -7.280  1.00 32.88 ? 81  VAL B CG1 1 
ATOM 1549  C CG2 . VAL B 1 81  ? 100.293 106.023 -5.231  1.00 32.82 ? 81  VAL B CG2 1 
ATOM 1550  N N   . SER B 1 82  ? 98.589  107.068 -9.192  1.00 32.95 ? 82  SER B N   1 
ATOM 1551  C CA  . SER B 1 82  ? 98.514  107.417 -10.610 1.00 33.10 ? 82  SER B CA  1 
ATOM 1552  C C   . SER B 1 82  ? 97.633  106.430 -11.366 1.00 33.16 ? 82  SER B C   1 
ATOM 1553  O O   . SER B 1 82  ? 97.399  105.312 -10.900 1.00 33.23 ? 82  SER B O   1 
ATOM 1554  C CB  . SER B 1 82  ? 99.915  107.448 -11.225 1.00 33.14 ? 82  SER B CB  1 
ATOM 1555  O OG  . SER B 1 82  ? 100.584 106.211 -11.038 1.00 33.18 ? 82  SER B OG  1 
ATOM 1556  N N   . ALA B 1 83  ? 97.151  106.858 -12.529 1.00 33.30 ? 83  ALA B N   1 
ATOM 1557  C CA  . ALA B 1 83  ? 96.264  106.040 -13.353 1.00 33.46 ? 83  ALA B CA  1 
ATOM 1558  C C   . ALA B 1 83  ? 96.355  106.436 -14.824 1.00 33.71 ? 83  ALA B C   1 
ATOM 1559  O O   . ALA B 1 83  ? 95.681  107.367 -15.272 1.00 33.85 ? 83  ALA B O   1 
ATOM 1560  C CB  . ALA B 1 83  ? 94.832  106.158 -12.855 1.00 33.47 ? 83  ALA B CB  1 
ATOM 1561  N N   . SER B 1 84  ? 97.199  105.721 -15.566 1.00 34.04 ? 84  SER B N   1 
ATOM 1562  C CA  . SER B 1 84  ? 97.315  105.891 -17.014 1.00 34.33 ? 84  SER B CA  1 
ATOM 1563  C C   . SER B 1 84  ? 96.155  105.183 -17.718 1.00 34.53 ? 84  SER B C   1 
ATOM 1564  O O   . SER B 1 84  ? 95.294  104.588 -17.065 1.00 34.55 ? 84  SER B O   1 
ATOM 1565  C CB  . SER B 1 84  ? 98.663  105.348 -17.505 1.00 34.48 ? 84  SER B CB  1 
ATOM 1566  O OG  . SER B 1 84  ? 98.745  103.941 -17.350 1.00 34.54 ? 84  SER B OG  1 
ATOM 1567  N N   . ALA B 1 85  ? 96.133  105.255 -19.047 1.00 35.05 ? 85  ALA B N   1 
ATOM 1568  C CA  . ALA B 1 85  ? 95.087  104.617 -19.852 1.00 35.50 ? 85  ALA B CA  1 
ATOM 1569  C C   . ALA B 1 85  ? 94.979  103.102 -19.632 1.00 35.79 ? 85  ALA B C   1 
ATOM 1570  O O   . ALA B 1 85  ? 93.870  102.565 -19.594 1.00 35.91 ? 85  ALA B O   1 
ATOM 1571  C CB  . ALA B 1 85  ? 95.306  104.913 -21.330 1.00 35.61 ? 85  ALA B CB  1 
ATOM 1572  N N   . ASN B 1 86  ? 96.124  102.432 -19.487 1.00 36.15 ? 86  ASN B N   1 
ATOM 1573  C CA  . ASN B 1 86  ? 96.179  100.967 -19.360 1.00 36.49 ? 86  ASN B CA  1 
ATOM 1574  C C   . ASN B 1 86  ? 96.874  100.472 -18.077 1.00 36.55 ? 86  ASN B C   1 
ATOM 1575  O O   . ASN B 1 86  ? 97.401  99.356  -18.051 1.00 36.63 ? 86  ASN B O   1 
ATOM 1576  C CB  . ASN B 1 86  ? 96.870  100.372 -20.595 1.00 36.84 ? 86  ASN B CB  1 
ATOM 1577  C CG  . ASN B 1 86  ? 96.186  100.762 -21.894 1.00 37.16 ? 86  ASN B CG  1 
ATOM 1578  O OD1 . ASN B 1 86  ? 96.155  101.934 -22.266 1.00 37.25 ? 86  ASN B OD1 1 
ATOM 1579  N ND2 . ASN B 1 86  ? 95.644  99.773  -22.599 1.00 37.45 ? 86  ASN B ND2 1 
ATOM 1580  N N   . SER B 1 87  ? 96.866  101.284 -17.017 1.00 36.55 ? 87  SER B N   1 
ATOM 1581  C CA  . SER B 1 87  ? 97.413  100.873 -15.714 1.00 36.52 ? 87  SER B CA  1 
ATOM 1582  C C   . SER B 1 87  ? 96.910  101.751 -14.568 1.00 36.58 ? 87  SER B C   1 
ATOM 1583  O O   . SER B 1 87  ? 96.280  102.788 -14.793 1.00 36.60 ? 87  SER B O   1 
ATOM 1584  C CB  . SER B 1 87  ? 98.947  100.902 -15.740 1.00 36.53 ? 87  SER B CB  1 
ATOM 1585  O OG  . SER B 1 87  ? 99.488  100.349 -14.552 1.00 36.60 ? 87  SER B OG  1 
ATOM 1586  N N   . TYR B 1 88  ? 97.195  101.319 -13.340 1.00 36.69 ? 88  TYR B N   1 
ATOM 1587  C CA  . TYR B 1 88  ? 96.888  102.099 -12.136 1.00 36.75 ? 88  TYR B CA  1 
ATOM 1588  C C   . TYR B 1 88  ? 97.725  101.669 -10.930 1.00 37.06 ? 88  TYR B C   1 
ATOM 1589  O O   . TYR B 1 88  ? 98.310  100.584 -10.920 1.00 37.14 ? 88  TYR B O   1 
ATOM 1590  C CB  . TYR B 1 88  ? 95.394  102.017 -11.795 1.00 36.59 ? 88  TYR B CB  1 
ATOM 1591  C CG  . TYR B 1 88  ? 94.880  100.617 -11.522 1.00 36.51 ? 88  TYR B CG  1 
ATOM 1592  C CD1 . TYR B 1 88  ? 94.932  100.069 -10.239 1.00 36.43 ? 88  TYR B CD1 1 
ATOM 1593  C CD2 . TYR B 1 88  ? 94.327  99.843  -12.543 1.00 36.53 ? 88  TYR B CD2 1 
ATOM 1594  C CE1 . TYR B 1 88  ? 94.460  98.790  -9.983  1.00 36.37 ? 88  TYR B CE1 1 
ATOM 1595  C CE2 . TYR B 1 88  ? 93.851  98.562  -12.296 1.00 36.49 ? 88  TYR B CE2 1 
ATOM 1596  C CZ  . TYR B 1 88  ? 93.919  98.040  -11.015 1.00 36.40 ? 88  TYR B CZ  1 
ATOM 1597  O OH  . TYR B 1 88  ? 93.450  96.772  -10.766 1.00 36.43 ? 88  TYR B OH  1 
ATOM 1598  N N   . CYS B 1 89  ? 97.771  102.541 -9.925  1.00 37.62 ? 89  CYS B N   1 
ATOM 1599  C CA  . CYS B 1 89  ? 98.462  102.275 -8.660  1.00 38.04 ? 89  CYS B CA  1 
ATOM 1600  C C   . CYS B 1 89  ? 97.689  102.943 -7.522  1.00 37.48 ? 89  CYS B C   1 
ATOM 1601  O O   . CYS B 1 89  ? 97.540  104.166 -7.511  1.00 37.51 ? 89  CYS B O   1 
ATOM 1602  C CB  . CYS B 1 89  ? 99.896  102.805 -8.712  1.00 39.02 ? 89  CYS B CB  1 
ATOM 1603  S SG  . CYS B 1 89  ? 100.845 102.570 -7.188  1.00 40.38 ? 89  CYS B SG  1 
ATOM 1604  N N   . MET B 1 90  ? 97.206  102.135 -6.576  1.00 36.81 ? 90  MET B N   1 
ATOM 1605  C CA  . MET B 1 90  ? 96.376  102.613 -5.468  1.00 36.33 ? 90  MET B CA  1 
ATOM 1606  C C   . MET B 1 90  ? 96.929  102.118 -4.132  1.00 35.96 ? 90  MET B C   1 
ATOM 1607  O O   . MET B 1 90  ? 96.876  100.922 -3.834  1.00 35.94 ? 90  MET B O   1 
ATOM 1608  C CB  . MET B 1 90  ? 94.929  102.139 -5.644  1.00 36.33 ? 90  MET B CB  1 
ATOM 1609  C CG  . MET B 1 90  ? 94.334  102.430 -7.014  1.00 36.32 ? 90  MET B CG  1 
ATOM 1610  S SD  . MET B 1 90  ? 92.557  102.135 -7.088  1.00 36.31 ? 90  MET B SD  1 
ATOM 1611  C CE  . MET B 1 90  ? 92.487  100.366 -6.820  1.00 36.30 ? 90  MET B CE  1 
ATOM 1612  N N   . ILE B 1 91  ? 97.469  103.046 -3.339  1.00 35.57 ? 91  ILE B N   1 
ATOM 1613  C CA  . ILE B 1 91  ? 97.952  102.756 -1.989  1.00 35.27 ? 91  ILE B CA  1 
ATOM 1614  C C   . ILE B 1 91  ? 96.833  103.046 -0.985  1.00 34.97 ? 91  ILE B C   1 
ATOM 1615  O O   . ILE B 1 91  ? 96.096  104.024 -1.133  1.00 35.06 ? 91  ILE B O   1 
ATOM 1616  C CB  . ILE B 1 91  ? 99.192  103.613 -1.631  1.00 35.34 ? 91  ILE B CB  1 
ATOM 1617  C CG1 . ILE B 1 91  ? 100.305 103.446 -2.683  1.00 35.48 ? 91  ILE B CG1 1 
ATOM 1618  C CG2 . ILE B 1 91  ? 99.706  103.276 -0.232  1.00 35.37 ? 91  ILE B CG2 1 
ATOM 1619  C CD1 . ILE B 1 91  ? 100.845 102.037 -2.836  1.00 35.54 ? 91  ILE B CD1 1 
ATOM 1620  N N   . ALA B 1 92  ? 96.713  102.190 0.027   1.00 34.64 ? 92  ALA B N   1 
ATOM 1621  C CA  . ALA B 1 92  ? 95.742  102.380 1.108   1.00 34.42 ? 92  ALA B CA  1 
ATOM 1622  C C   . ALA B 1 92  ? 96.192  101.661 2.377   1.00 34.21 ? 92  ALA B C   1 
ATOM 1623  O O   . ALA B 1 92  ? 96.884  100.642 2.312   1.00 34.13 ? 92  ALA B O   1 
ATOM 1624  C CB  . ALA B 1 92  ? 94.368  101.887 0.679   1.00 34.49 ? 92  ALA B CB  1 
ATOM 1625  N N   . GLY B 1 93  ? 95.789  102.199 3.526   1.00 34.02 ? 93  GLY B N   1 
ATOM 1626  C CA  . GLY B 1 93  ? 96.174  101.645 4.822   1.00 33.89 ? 93  GLY B CA  1 
ATOM 1627  C C   . GLY B 1 93  ? 95.348  102.180 5.977   1.00 33.77 ? 93  GLY B C   1 
ATOM 1628  O O   . GLY B 1 93  ? 94.829  103.297 5.915   1.00 33.83 ? 93  GLY B O   1 
ATOM 1629  N N   . HIS B 1 94  ? 95.238  101.372 7.029   1.00 33.62 ? 94  HIS B N   1 
ATOM 1630  C CA  . HIS B 1 94  ? 94.521  101.742 8.248   1.00 33.49 ? 94  HIS B CA  1 
ATOM 1631  C C   . HIS B 1 94  ? 95.516  102.380 9.217   1.00 33.50 ? 94  HIS B C   1 
ATOM 1632  O O   . HIS B 1 94  ? 96.706  102.055 9.192   1.00 33.61 ? 94  HIS B O   1 
ATOM 1633  C CB  . HIS B 1 94  ? 93.878  100.500 8.875   1.00 33.42 ? 94  HIS B CB  1 
ATOM 1634  C CG  . HIS B 1 94  ? 92.642  100.787 9.670   1.00 33.39 ? 94  HIS B CG  1 
ATOM 1635  N ND1 . HIS B 1 94  ? 91.372  100.582 9.175   1.00 33.41 ? 94  HIS B ND1 1 
ATOM 1636  C CD2 . HIS B 1 94  ? 92.482  101.289 10.917  1.00 33.38 ? 94  HIS B CD2 1 
ATOM 1637  C CE1 . HIS B 1 94  ? 90.485  100.932 10.088  1.00 33.44 ? 94  HIS B CE1 1 
ATOM 1638  N NE2 . HIS B 1 94  ? 91.133  101.362 11.155  1.00 33.41 ? 94  HIS B NE2 1 
ATOM 1639  N N   . SER B 1 95  ? 95.029  103.286 10.063  1.00 33.42 ? 95  SER B N   1 
ATOM 1640  C CA  . SER B 1 95  ? 95.888  104.006 11.013  1.00 33.30 ? 95  SER B CA  1 
ATOM 1641  C C   . SER B 1 95  ? 96.478  103.072 12.069  1.00 33.15 ? 95  SER B C   1 
ATOM 1642  O O   . SER B 1 95  ? 97.669  103.154 12.376  1.00 33.23 ? 95  SER B O   1 
ATOM 1643  C CB  . SER B 1 95  ? 95.121  105.147 11.687  1.00 33.39 ? 95  SER B CB  1 
ATOM 1644  O OG  . SER B 1 95  ? 94.018  104.657 12.426  1.00 33.47 ? 95  SER B OG  1 
ATOM 1645  N N   . GLY B 1 96  ? 95.634  102.195 12.617  1.00 32.96 ? 96  GLY B N   1 
ATOM 1646  C CA  . GLY B 1 96  ? 96.068  101.132 13.530  1.00 32.84 ? 96  GLY B CA  1 
ATOM 1647  C C   . GLY B 1 96  ? 96.069  99.764  12.872  1.00 32.59 ? 96  GLY B C   1 
ATOM 1648  O O   . GLY B 1 96  ? 95.507  98.810  13.416  1.00 32.56 ? 96  GLY B O   1 
ATOM 1649  N N   . GLY B 1 97  ? 96.701  99.675  11.702  1.00 32.33 ? 97  GLY B N   1 
ATOM 1650  C CA  . GLY B 1 97  ? 96.869  98.416  10.975  1.00 32.11 ? 97  GLY B CA  1 
ATOM 1651  C C   . GLY B 1 97  ? 98.272  97.870  11.165  1.00 31.91 ? 97  GLY B C   1 
ATOM 1652  O O   . GLY B 1 97  ? 98.919  98.145  12.180  1.00 31.98 ? 97  GLY B O   1 
ATOM 1653  N N   . THR B 1 98  ? 98.735  97.098  10.182  1.00 31.56 ? 98  THR B N   1 
ATOM 1654  C CA  . THR B 1 98  ? 100.080 96.518  10.192  1.00 31.30 ? 98  THR B CA  1 
ATOM 1655  C C   . THR B 1 98  ? 100.989 97.232  9.196   1.00 31.00 ? 98  THR B C   1 
ATOM 1656  O O   . THR B 1 98  ? 102.020 97.790  9.579   1.00 31.05 ? 98  THR B O   1 
ATOM 1657  C CB  . THR B 1 98  ? 100.040 95.017  9.854   1.00 31.35 ? 98  THR B CB  1 
ATOM 1658  O OG1 . THR B 1 98  ? 99.406  94.823  8.583   1.00 31.30 ? 98  THR B OG1 1 
ATOM 1659  C CG2 . THR B 1 98  ? 99.276  94.253  10.926  1.00 31.42 ? 98  THR B CG2 1 
ATOM 1660  N N   . VAL B 1 99  ? 100.596 97.205  7.923   1.00 30.61 ? 99  VAL B N   1 
ATOM 1661  C CA  . VAL B 1 99  ? 101.363 97.819  6.831   1.00 30.35 ? 99  VAL B CA  1 
ATOM 1662  C C   . VAL B 1 99  ? 100.437 98.411  5.768   1.00 30.06 ? 99  VAL B C   1 
ATOM 1663  O O   . VAL B 1 99  ? 99.232  98.146  5.763   1.00 30.16 ? 99  VAL B O   1 
ATOM 1664  C CB  . VAL B 1 99  ? 102.319 96.799  6.160   1.00 30.45 ? 99  VAL B CB  1 
ATOM 1665  C CG1 . VAL B 1 99  ? 103.524 96.522  7.048   1.00 30.52 ? 99  VAL B CG1 1 
ATOM 1666  C CG2 . VAL B 1 99  ? 101.597 95.499  5.817   1.00 30.52 ? 99  VAL B CG2 1 
ATOM 1667  N N   . TRP B 1 100 ? 101.013 99.212  4.874   1.00 29.73 ? 100 TRP B N   1 
ATOM 1668  C CA  . TRP B 1 100 ? 100.282 99.764  3.731   1.00 29.57 ? 100 TRP B CA  1 
ATOM 1669  C C   . TRP B 1 100 ? 100.030 98.676  2.692   1.00 29.76 ? 100 TRP B C   1 
ATOM 1670  O O   . TRP B 1 100 ? 100.849 97.769  2.522   1.00 29.91 ? 100 TRP B O   1 
ATOM 1671  C CB  . TRP B 1 100 ? 101.061 100.912 3.086   1.00 29.37 ? 100 TRP B CB  1 
ATOM 1672  C CG  . TRP B 1 100 ? 101.191 102.119 3.957   1.00 29.17 ? 100 TRP B CG  1 
ATOM 1673  C CD1 . TRP B 1 100 ? 102.170 102.364 4.875   1.00 29.08 ? 100 TRP B CD1 1 
ATOM 1674  C CD2 . TRP B 1 100 ? 100.317 103.251 3.988   1.00 28.95 ? 100 TRP B CD2 1 
ATOM 1675  N NE1 . TRP B 1 100 ? 101.958 103.580 5.480   1.00 28.98 ? 100 TRP B NE1 1 
ATOM 1676  C CE2 . TRP B 1 100 ? 100.828 104.146 4.954   1.00 28.90 ? 100 TRP B CE2 1 
ATOM 1677  C CE3 . TRP B 1 100 ? 99.150  103.597 3.295   1.00 28.91 ? 100 TRP B CE3 1 
ATOM 1678  C CZ2 . TRP B 1 100 ? 100.211 105.367 5.246   1.00 28.93 ? 100 TRP B CZ2 1 
ATOM 1679  C CZ3 . TRP B 1 100 ? 98.535  104.812 3.584   1.00 28.95 ? 100 TRP B CZ3 1 
ATOM 1680  C CH2 . TRP B 1 100 ? 99.070  105.681 4.554   1.00 28.96 ? 100 TRP B CH2 1 
ATOM 1681  N N   . PHE B 1 101 ? 98.894  98.777  2.005   1.00 29.96 ? 101 PHE B N   1 
ATOM 1682  C CA  . PHE B 1 101 ? 98.502  97.828  0.964   1.00 30.13 ? 101 PHE B CA  1 
ATOM 1683  C C   . PHE B 1 101 ? 98.439  98.541  -0.382  1.00 30.19 ? 101 PHE B C   1 
ATOM 1684  O O   . PHE B 1 101 ? 97.753  99.556  -0.512  1.00 30.31 ? 101 PHE B O   1 
ATOM 1685  C CB  . PHE B 1 101 ? 97.131  97.227  1.276   1.00 30.32 ? 101 PHE B CB  1 
ATOM 1686  C CG  . PHE B 1 101 ? 97.134  96.236  2.407   1.00 30.39 ? 101 PHE B CG  1 
ATOM 1687  C CD1 . PHE B 1 101 ? 97.244  96.663  3.727   1.00 30.53 ? 101 PHE B CD1 1 
ATOM 1688  C CD2 . PHE B 1 101 ? 97.000  94.871  2.156   1.00 30.42 ? 101 PHE B CD2 1 
ATOM 1689  C CE1 . PHE B 1 101 ? 97.239  95.750  4.773   1.00 30.59 ? 101 PHE B CE1 1 
ATOM 1690  C CE2 . PHE B 1 101 ? 96.992  93.955  3.198   1.00 30.54 ? 101 PHE B CE2 1 
ATOM 1691  C CZ  . PHE B 1 101 ? 97.113  94.395  4.508   1.00 30.60 ? 101 PHE B CZ  1 
ATOM 1692  N N   . ALA B 1 102 ? 99.158  98.008  -1.369  1.00 30.37 ? 102 ALA B N   1 
ATOM 1693  C CA  . ALA B 1 102 ? 99.115  98.513  -2.743  1.00 30.57 ? 102 ALA B CA  1 
ATOM 1694  C C   . ALA B 1 102 ? 98.038  97.784  -3.540  1.00 30.78 ? 102 ALA B C   1 
ATOM 1695  O O   . ALA B 1 102 ? 97.459  96.802  -3.065  1.00 30.81 ? 102 ALA B O   1 
ATOM 1696  C CB  . ALA B 1 102 ? 100.470 98.343  -3.409  1.00 30.60 ? 102 ALA B CB  1 
ATOM 1697  N N   . ALA B 1 103 ? 97.772  98.272  -4.750  1.00 31.11 ? 103 ALA B N   1 
ATOM 1698  C CA  . ALA B 1 103 ? 96.769  97.670  -5.631  1.00 31.41 ? 103 ALA B CA  1 
ATOM 1699  C C   . ALA B 1 103 ? 96.990  98.071  -7.093  1.00 31.72 ? 103 ALA B C   1 
ATOM 1700  O O   . ALA B 1 103 ? 96.639  99.181  -7.499  1.00 31.76 ? 103 ALA B O   1 
ATOM 1701  C CB  . ALA B 1 103 ? 95.368  98.055  -5.175  1.00 31.43 ? 103 ALA B CB  1 
ATOM 1702  N N   . THR B 1 104 ? 97.581  97.155  -7.860  1.00 32.08 ? 104 THR B N   1 
ATOM 1703  C CA  . THR B 1 104 ? 97.848  97.339  -9.290  1.00 32.34 ? 104 THR B CA  1 
ATOM 1704  C C   . THR B 1 104 ? 97.123  96.233  -10.066 1.00 32.69 ? 104 THR B C   1 
ATOM 1705  O O   . THR B 1 104 ? 96.719  95.233  -9.464  1.00 32.83 ? 104 THR B O   1 
ATOM 1706  C CB  . THR B 1 104 ? 99.365  97.272  -9.580  1.00 32.41 ? 104 THR B CB  1 
ATOM 1707  O OG1 . THR B 1 104 ? 99.823  95.916  -9.504  1.00 32.45 ? 104 THR B OG1 1 
ATOM 1708  C CG2 . THR B 1 104 ? 100.145 98.118  -8.586  1.00 32.50 ? 104 THR B CG2 1 
ATOM 1709  N N   . PRO B 1 105 ? 96.951  96.400  -11.397 1.00 33.13 ? 105 PRO B N   1 
ATOM 1710  C CA  . PRO B 1 105 ? 96.249  95.354  -12.157 1.00 33.45 ? 105 PRO B CA  1 
ATOM 1711  C C   . PRO B 1 105 ? 97.053  94.060  -12.340 1.00 33.95 ? 105 PRO B C   1 
ATOM 1712  O O   . PRO B 1 105 ? 96.478  92.975  -12.240 1.00 34.10 ? 105 PRO B O   1 
ATOM 1713  C CB  . PRO B 1 105 ? 95.945  96.015  -13.510 1.00 33.34 ? 105 PRO B CB  1 
ATOM 1714  C CG  . PRO B 1 105 ? 96.788  97.234  -13.588 1.00 33.31 ? 105 PRO B CG  1 
ATOM 1715  C CD  . PRO B 1 105 ? 97.408  97.510  -12.253 1.00 33.23 ? 105 PRO B CD  1 
ATOM 1716  N N   . ASP B 1 106 ? 98.357  94.177  -12.599 1.00 34.61 ? 106 ASP B N   1 
ATOM 1717  C CA  . ASP B 1 106 ? 99.211  93.000  -12.830 1.00 35.22 ? 106 ASP B CA  1 
ATOM 1718  C C   . ASP B 1 106 ? 99.478  92.167  -11.568 1.00 35.56 ? 106 ASP B C   1 
ATOM 1719  O O   . ASP B 1 106 ? 99.437  90.936  -11.626 1.00 35.76 ? 106 ASP B O   1 
ATOM 1720  C CB  . ASP B 1 106 ? 100.532 93.385  -13.526 1.00 35.53 ? 106 ASP B CB  1 
ATOM 1721  C CG  . ASP B 1 106 ? 101.445 94.244  -12.658 1.00 35.77 ? 106 ASP B CG  1 
ATOM 1722  O OD1 . ASP B 1 106 ? 100.931 95.047  -11.848 1.00 35.93 ? 106 ASP B OD1 1 
ATOM 1723  O OD2 . ASP B 1 106 ? 102.680 94.117  -12.794 1.00 35.86 ? 106 ASP B OD2 1 
ATOM 1724  N N   . LYS B 1 107 ? 99.738  92.833  -10.442 1.00 35.96 ? 107 LYS B N   1 
ATOM 1725  C CA  . LYS B 1 107 ? 100.046 92.154  -9.174  1.00 36.36 ? 107 LYS B CA  1 
ATOM 1726  C C   . LYS B 1 107 ? 98.829  91.955  -8.261  1.00 36.64 ? 107 LYS B C   1 
ATOM 1727  O O   . LYS B 1 107 ? 98.911  91.205  -7.287  1.00 36.62 ? 107 LYS B O   1 
ATOM 1728  C CB  . LYS B 1 107 ? 101.131 92.920  -8.411  1.00 36.45 ? 107 LYS B CB  1 
ATOM 1729  C CG  . LYS B 1 107 ? 102.463 92.999  -9.140  1.00 36.66 ? 107 LYS B CG  1 
ATOM 1730  C CD  . LYS B 1 107 ? 103.489 93.816  -8.370  1.00 36.88 ? 107 LYS B CD  1 
ATOM 1731  C CE  . LYS B 1 107 ? 104.046 93.057  -7.175  1.00 37.03 ? 107 LYS B CE  1 
ATOM 1732  N NZ  . LYS B 1 107 ? 105.126 93.817  -6.487  1.00 37.12 ? 107 LYS B NZ  1 
ATOM 1733  N N   . GLY B 1 108 ? 97.713  92.619  -8.571  1.00 37.06 ? 108 GLY B N   1 
ATOM 1734  C CA  . GLY B 1 108 ? 96.515  92.566  -7.732  1.00 37.38 ? 108 GLY B CA  1 
ATOM 1735  C C   . GLY B 1 108 ? 96.686  93.399  -6.475  1.00 37.66 ? 108 GLY B C   1 
ATOM 1736  O O   . GLY B 1 108 ? 97.498  94.325  -6.448  1.00 37.75 ? 108 GLY B O   1 
ATOM 1737  N N   . VAL B 1 109 ? 95.915  93.068  -5.441  1.00 38.04 ? 109 VAL B N   1 
ATOM 1738  C CA  . VAL B 1 109 ? 96.012  93.732  -4.139  1.00 38.33 ? 109 VAL B CA  1 
ATOM 1739  C C   . VAL B 1 109 ? 97.019  92.969  -3.277  1.00 38.62 ? 109 VAL B C   1 
ATOM 1740  O O   . VAL B 1 109 ? 96.804  91.797  -2.965  1.00 38.77 ? 109 VAL B O   1 
ATOM 1741  C CB  . VAL B 1 109 ? 94.643  93.788  -3.423  1.00 38.50 ? 109 VAL B CB  1 
ATOM 1742  C CG1 . VAL B 1 109 ? 94.762  94.497  -2.074  1.00 38.57 ? 109 VAL B CG1 1 
ATOM 1743  C CG2 . VAL B 1 109 ? 93.607  94.476  -4.307  1.00 38.56 ? 109 VAL B CG2 1 
ATOM 1744  N N   . TYR B 1 110 ? 98.111  93.639  -2.904  1.00 38.99 ? 110 TYR B N   1 
ATOM 1745  C CA  . TYR B 1 110 ? 99.162  93.050  -2.064  1.00 39.35 ? 110 TYR B CA  1 
ATOM 1746  C C   . TYR B 1 110 ? 99.644  94.041  -1.009  1.00 39.82 ? 110 TYR B C   1 
ATOM 1747  O O   . TYR B 1 110 ? 99.333  95.234  -1.079  1.00 40.04 ? 110 TYR B O   1 
ATOM 1748  C CB  . TYR B 1 110 ? 100.340 92.577  -2.925  1.00 39.25 ? 110 TYR B CB  1 
ATOM 1749  C CG  . TYR B 1 110 ? 101.035 93.677  -3.701  1.00 39.14 ? 110 TYR B CG  1 
ATOM 1750  C CD1 . TYR B 1 110 ? 100.544 94.103  -4.935  1.00 39.13 ? 110 TYR B CD1 1 
ATOM 1751  C CD2 . TYR B 1 110 ? 102.191 94.285  -3.208  1.00 39.09 ? 110 TYR B CD2 1 
ATOM 1752  C CE1 . TYR B 1 110 ? 101.177 95.107  -5.652  1.00 39.07 ? 110 TYR B CE1 1 
ATOM 1753  C CE2 . TYR B 1 110 ? 102.833 95.291  -3.919  1.00 39.10 ? 110 TYR B CE2 1 
ATOM 1754  C CZ  . TYR B 1 110 ? 102.322 95.697  -5.140  1.00 39.11 ? 110 TYR B CZ  1 
ATOM 1755  O OH  . TYR B 1 110 ? 102.950 96.693  -5.851  1.00 39.19 ? 110 TYR B OH  1 
ATOM 1756  N N   . LYS B 1 111 ? 100.412 93.535  -0.044  1.00 40.42 ? 111 LYS B N   1 
ATOM 1757  C CA  . LYS B 1 111 ? 100.927 94.345  1.067   1.00 41.05 ? 111 LYS B CA  1 
ATOM 1758  C C   . LYS B 1 111 ? 102.419 94.634  0.899   1.00 41.38 ? 111 LYS B C   1 
ATOM 1759  O O   . LYS B 1 111 ? 103.179 93.767  0.464   1.00 41.54 ? 111 LYS B O   1 
ATOM 1760  C CB  . LYS B 1 111 ? 100.647 93.676  2.422   1.00 41.42 ? 111 LYS B CB  1 
ATOM 1761  C CG  . LYS B 1 111 ? 101.365 92.359  2.694   1.00 41.67 ? 111 LYS B CG  1 
ATOM 1762  C CD  . LYS B 1 111 ? 100.962 91.804  4.050   1.00 41.99 ? 111 LYS B CD  1 
ATOM 1763  C CE  . LYS B 1 111 ? 101.656 90.482  4.343   1.00 42.27 ? 111 LYS B CE  1 
ATOM 1764  N NZ  . LYS B 1 111 ? 101.283 89.913  5.670   1.00 42.33 ? 111 LYS B NZ  1 
ATOM 1765  N N   . THR B 1 112 ? 102.819 95.856  1.256   1.00 41.76 ? 112 THR B N   1 
ATOM 1766  C CA  . THR B 1 112 ? 104.209 96.314  1.120   1.00 42.19 ? 112 THR B CA  1 
ATOM 1767  C C   . THR B 1 112 ? 104.942 96.288  2.463   1.00 42.42 ? 112 THR B C   1 
ATOM 1768  O O   . THR B 1 112 ? 104.333 96.070  3.513   1.00 42.41 ? 112 THR B O   1 
ATOM 1769  C CB  . THR B 1 112 ? 104.288 97.725  0.478   1.00 42.41 ? 112 THR B CB  1 
ATOM 1770  O OG1 . THR B 1 112 ? 105.660 98.080  0.252   1.00 42.63 ? 112 THR B OG1 1 
ATOM 1771  C CG2 . THR B 1 112 ? 103.610 98.810  1.341   1.00 42.32 ? 112 THR B CG2 1 
ATOM 1772  N N   . ASN B 1 113 ? 106.253 96.519  2.412   1.00 42.76 ? 113 ASN B N   1 
ATOM 1773  C CA  . ASN B 1 113 ? 107.103 96.514  3.609   1.00 43.05 ? 113 ASN B CA  1 
ATOM 1774  C C   . ASN B 1 113 ? 106.950 97.764  4.486   1.00 43.07 ? 113 ASN B C   1 
ATOM 1775  O O   . ASN B 1 113 ? 107.329 97.737  5.660   1.00 43.14 ? 113 ASN B O   1 
ATOM 1776  C CB  . ASN B 1 113 ? 108.578 96.347  3.218   1.00 43.32 ? 113 ASN B CB  1 
ATOM 1777  C CG  . ASN B 1 113 ? 108.861 95.015  2.543   1.00 43.69 ? 113 ASN B CG  1 
ATOM 1778  O OD1 . ASN B 1 113 ? 107.944 94.286  2.159   1.00 43.88 ? 113 ASN B OD1 1 
ATOM 1779  N ND2 . ASN B 1 113 ? 110.141 94.694  2.391   1.00 43.95 ? 113 ASN B ND2 1 
ATOM 1780  N N   . THR B 1 114 ? 106.411 98.849  3.923   1.00 42.95 ? 114 THR B N   1 
ATOM 1781  C CA  . THR B 1 114 ? 106.242 100.110 4.652   1.00 42.92 ? 114 THR B CA  1 
ATOM 1782  C C   . THR B 1 114 ? 105.178 99.983  5.745   1.00 42.75 ? 114 THR B C   1 
ATOM 1783  O O   . THR B 1 114 ? 104.099 99.440  5.505   1.00 42.67 ? 114 THR B O   1 
ATOM 1784  C CB  . THR B 1 114 ? 105.847 101.263 3.702   1.00 43.06 ? 114 THR B CB  1 
ATOM 1785  O OG1 . THR B 1 114 ? 106.740 101.292 2.581   1.00 43.18 ? 114 THR B OG1 1 
ATOM 1786  C CG2 . THR B 1 114 ? 105.893 102.612 4.421   1.00 43.11 ? 114 THR B CG2 1 
ATOM 1787  N N   . ALA B 1 115 ? 105.494 100.492 6.936   1.00 42.77 ? 115 ALA B N   1 
ATOM 1788  C CA  . ALA B 1 115 ? 104.601 100.413 8.096   1.00 42.75 ? 115 ALA B CA  1 
ATOM 1789  C C   . ALA B 1 115 ? 103.593 101.559 8.101   1.00 42.74 ? 115 ALA B C   1 
ATOM 1790  O O   . ALA B 1 115 ? 103.846 102.625 7.535   1.00 42.81 ? 115 ALA B O   1 
ATOM 1791  C CB  . ALA B 1 115 ? 105.409 100.423 9.384   1.00 42.91 ? 115 ALA B CB  1 
ATOM 1792  N N   . VAL B 1 116 ? 102.458 101.328 8.758   1.00 42.90 ? 116 VAL B N   1 
ATOM 1793  C CA  . VAL B 1 116 ? 101.390 102.337 8.867   1.00 43.05 ? 116 VAL B CA  1 
ATOM 1794  C C   . VAL B 1 116 ? 101.783 103.527 9.754   1.00 43.55 ? 116 VAL B C   1 
ATOM 1795  O O   . VAL B 1 116 ? 101.265 104.632 9.570   1.00 43.76 ? 116 VAL B O   1 
ATOM 1796  C CB  . VAL B 1 116 ? 100.050 101.742 9.372   1.00 42.93 ? 116 VAL B CB  1 
ATOM 1797  C CG1 . VAL B 1 116 ? 99.565  100.639 8.437   1.00 42.89 ? 116 VAL B CG1 1 
ATOM 1798  C CG2 . VAL B 1 116 ? 100.148 101.257 10.820  1.00 42.98 ? 116 VAL B CG2 1 
ATOM 1799  N N   . THR B 1 117 ? 102.680 103.294 10.714  1.00 43.94 ? 117 THR B N   1 
ATOM 1800  C CA  . THR B 1 117 ? 103.267 104.372 11.518  1.00 44.22 ? 117 THR B CA  1 
ATOM 1801  C C   . THR B 1 117 ? 104.153 105.287 10.669  1.00 44.30 ? 117 THR B C   1 
ATOM 1802  O O   . THR B 1 117 ? 104.166 106.503 10.874  1.00 44.49 ? 117 THR B O   1 
ATOM 1803  C CB  . THR B 1 117 ? 104.101 103.819 12.693  1.00 44.54 ? 117 THR B CB  1 
ATOM 1804  O OG1 . THR B 1 117 ? 105.069 102.883 12.201  1.00 44.68 ? 117 THR B OG1 1 
ATOM 1805  C CG2 . THR B 1 117 ? 103.204 103.132 13.714  1.00 44.67 ? 117 THR B CG2 1 
ATOM 1806  N N   . SER B 1 118 ? 104.888 104.697 9.725   1.00 44.37 ? 118 SER B N   1 
ATOM 1807  C CA  . SER B 1 118 ? 105.683 105.459 8.755   1.00 44.50 ? 118 SER B CA  1 
ATOM 1808  C C   . SER B 1 118 ? 104.791 106.129 7.710   1.00 44.49 ? 118 SER B C   1 
ATOM 1809  O O   . SER B 1 118 ? 103.596 105.834 7.616   1.00 44.41 ? 118 SER B O   1 
ATOM 1810  C CB  . SER B 1 118 ? 106.700 104.548 8.058   1.00 44.61 ? 118 SER B CB  1 
ATOM 1811  O OG  . SER B 1 118 ? 107.545 103.912 9.002   1.00 44.73 ? 118 SER B OG  1 
ATOM 1812  N N   . SER B 1 119 ? 105.386 107.024 6.921   1.00 44.65 ? 119 SER B N   1 
ATOM 1813  C CA  . SER B 1 119 ? 104.649 107.804 5.920   1.00 44.77 ? 119 SER B CA  1 
ATOM 1814  C C   . SER B 1 119 ? 104.167 106.949 4.746   1.00 44.88 ? 119 SER B C   1 
ATOM 1815  O O   . SER B 1 119 ? 104.634 105.823 4.546   1.00 44.83 ? 119 SER B O   1 
ATOM 1816  C CB  . SER B 1 119 ? 105.512 108.955 5.396   1.00 44.90 ? 119 SER B CB  1 
ATOM 1817  O OG  . SER B 1 119 ? 104.757 109.827 4.571   1.00 44.99 ? 119 SER B OG  1 
ATOM 1818  N N   . GLN B 1 120 ? 103.232 107.505 3.977   1.00 44.97 ? 120 GLN B N   1 
ATOM 1819  C CA  . GLN B 1 120 ? 102.613 106.802 2.849   1.00 45.08 ? 120 GLN B CA  1 
ATOM 1820  C C   . GLN B 1 120 ? 103.628 106.570 1.723   1.00 45.31 ? 120 GLN B C   1 
ATOM 1821  O O   . GLN B 1 120 ? 104.396 107.479 1.399   1.00 45.67 ? 120 GLN B O   1 
ATOM 1822  C CB  . GLN B 1 120 ? 101.422 107.606 2.314   1.00 45.05 ? 120 GLN B CB  1 
ATOM 1823  C CG  . GLN B 1 120 ? 100.594 106.889 1.256   1.00 45.09 ? 120 GLN B CG  1 
ATOM 1824  C CD  . GLN B 1 120 ? 99.395  107.704 0.803   1.00 45.21 ? 120 GLN B CD  1 
ATOM 1825  O OE1 . GLN B 1 120 ? 98.616  108.194 1.620   1.00 45.22 ? 120 GLN B OE1 1 
ATOM 1826  N NE2 . GLN B 1 120 ? 99.240  107.848 -0.509  1.00 45.29 ? 120 GLN B NE2 1 
ATOM 1827  N N   . PRO B 1 121 ? 103.651 105.350 1.137   1.00 45.40 ? 121 PRO B N   1 
ATOM 1828  C CA  . PRO B 1 121 ? 104.483 105.097 -0.046  1.00 45.55 ? 121 PRO B CA  1 
ATOM 1829  C C   . PRO B 1 121 ? 104.130 105.994 -1.236  1.00 45.58 ? 121 PRO B C   1 
ATOM 1830  O O   . PRO B 1 121 ? 102.949 106.169 -1.544  1.00 45.53 ? 121 PRO B O   1 
ATOM 1831  C CB  . PRO B 1 121 ? 104.183 103.632 -0.382  1.00 45.56 ? 121 PRO B CB  1 
ATOM 1832  C CG  . PRO B 1 121 ? 103.802 103.021 0.916   1.00 45.48 ? 121 PRO B CG  1 
ATOM 1833  C CD  . PRO B 1 121 ? 103.096 104.097 1.688   1.00 45.42 ? 121 PRO B CD  1 
ATOM 1834  N N   . GLU B 1 122 ? 105.153 106.552 -1.882  1.00 45.76 ? 122 GLU B N   1 
ATOM 1835  C CA  . GLU B 1 122 ? 104.964 107.443 -3.034  1.00 45.90 ? 122 GLU B CA  1 
ATOM 1836  C C   . GLU B 1 122 ? 104.461 106.683 -4.257  1.00 45.50 ? 122 GLU B C   1 
ATOM 1837  O O   . GLU B 1 122 ? 103.565 107.159 -4.954  1.00 45.42 ? 122 GLU B O   1 
ATOM 1838  C CB  . GLU B 1 122 ? 106.269 108.175 -3.380  1.00 46.32 ? 122 GLU B CB  1 
ATOM 1839  C CG  . GLU B 1 122 ? 106.756 109.149 -2.311  1.00 46.56 ? 122 GLU B CG  1 
ATOM 1840  C CD  . GLU B 1 122 ? 105.830 110.340 -2.095  1.00 46.77 ? 122 GLU B CD  1 
ATOM 1841  O OE1 . GLU B 1 122 ? 105.057 110.693 -3.013  1.00 46.76 ? 122 GLU B OE1 1 
ATOM 1842  O OE2 . GLU B 1 122 ? 105.882 110.933 -0.997  1.00 46.96 ? 122 GLU B OE2 1 
ATOM 1843  N N   . SER B 1 123 ? 105.051 105.516 -4.513  1.00 45.20 ? 123 SER B N   1 
ATOM 1844  C CA  . SER B 1 123 ? 104.615 104.618 -5.586  1.00 45.03 ? 123 SER B CA  1 
ATOM 1845  C C   . SER B 1 123 ? 104.663 103.165 -5.119  1.00 44.61 ? 123 SER B C   1 
ATOM 1846  O O   . SER B 1 123 ? 105.481 102.802 -4.269  1.00 44.74 ? 123 SER B O   1 
ATOM 1847  C CB  . SER B 1 123 ? 105.501 104.796 -6.821  1.00 45.23 ? 123 SER B CB  1 
ATOM 1848  O OG  . SER B 1 123 ? 105.029 104.017 -7.908  1.00 45.30 ? 123 SER B OG  1 
ATOM 1849  N N   . CYS B 1 124 ? 103.783 102.342 -5.686  1.00 44.10 ? 124 CYS B N   1 
ATOM 1850  C CA  . CYS B 1 124 ? 103.684 100.924 -5.328  1.00 43.87 ? 124 CYS B CA  1 
ATOM 1851  C C   . CYS B 1 124 ? 104.896 100.135 -5.853  1.00 44.47 ? 124 CYS B C   1 
ATOM 1852  O O   . CYS B 1 124 ? 105.459 100.503 -6.887  1.00 44.77 ? 124 CYS B O   1 
ATOM 1853  C CB  . CYS B 1 124 ? 102.383 100.322 -5.874  1.00 43.10 ? 124 CYS B CB  1 
ATOM 1854  S SG  . CYS B 1 124 ? 101.932 100.886 -7.533  1.00 42.51 ? 124 CYS B SG  1 
ATOM 1855  N N   . PRO B 1 125 ? 105.307 99.058  -5.141  1.00 44.93 ? 125 PRO B N   1 
ATOM 1856  C CA  . PRO B 1 125 ? 106.431 98.235  -5.628  1.00 45.17 ? 125 PRO B CA  1 
ATOM 1857  C C   . PRO B 1 125 ? 106.154 97.483  -6.936  1.00 45.54 ? 125 PRO B C   1 
ATOM 1858  O O   . PRO B 1 125 ? 107.081 96.974  -7.571  1.00 45.78 ? 125 PRO B O   1 
ATOM 1859  C CB  . PRO B 1 125 ? 106.661 97.232  -4.487  1.00 45.17 ? 125 PRO B CB  1 
ATOM 1860  C CG  . PRO B 1 125 ? 106.053 97.858  -3.285  1.00 45.13 ? 125 PRO B CG  1 
ATOM 1861  C CD  . PRO B 1 125 ? 104.881 98.640  -3.790  1.00 45.02 ? 125 PRO B CD  1 
ATOM 1862  O OXT . PRO B 1 125 ? 105.016 97.360  -7.394  1.00 45.77 ? 125 PRO B OXT 1 
ATOM 1863  N N   . PHE C 1 1   ? 87.529  82.265  65.786  1.00 65.53 ? 1   PHE C N   1 
ATOM 1864  C CA  . PHE C 1 1   ? 86.549  82.802  64.798  1.00 65.24 ? 1   PHE C CA  1 
ATOM 1865  C C   . PHE C 1 1   ? 85.657  83.851  65.474  1.00 64.19 ? 1   PHE C C   1 
ATOM 1866  O O   . PHE C 1 1   ? 84.668  83.513  66.132  1.00 64.28 ? 1   PHE C O   1 
ATOM 1867  C CB  . PHE C 1 1   ? 85.715  81.656  64.201  1.00 66.00 ? 1   PHE C CB  1 
ATOM 1868  C CG  . PHE C 1 1   ? 85.168  81.942  62.825  1.00 66.66 ? 1   PHE C CG  1 
ATOM 1869  C CD1 . PHE C 1 1   ? 84.284  82.998  62.611  1.00 66.87 ? 1   PHE C CD1 1 
ATOM 1870  C CD2 . PHE C 1 1   ? 85.523  81.144  61.741  1.00 67.09 ? 1   PHE C CD2 1 
ATOM 1871  C CE1 . PHE C 1 1   ? 83.777  83.256  61.347  1.00 67.09 ? 1   PHE C CE1 1 
ATOM 1872  C CE2 . PHE C 1 1   ? 85.017  81.400  60.475  1.00 67.25 ? 1   PHE C CE2 1 
ATOM 1873  C CZ  . PHE C 1 1   ? 84.142  82.457  60.278  1.00 67.25 ? 1   PHE C CZ  1 
ATOM 1874  N N   . THR C 1 2   ? 86.016  85.124  65.301  1.00 62.81 ? 2   THR C N   1 
ATOM 1875  C CA  . THR C 1 2   ? 85.304  86.239  65.933  1.00 61.68 ? 2   THR C CA  1 
ATOM 1876  C C   . THR C 1 2   ? 84.071  86.654  65.132  1.00 60.37 ? 2   THR C C   1 
ATOM 1877  O O   . THR C 1 2   ? 83.867  86.202  64.003  1.00 60.21 ? 2   THR C O   1 
ATOM 1878  C CB  . THR C 1 2   ? 86.221  87.475  66.082  1.00 61.85 ? 2   THR C CB  1 
ATOM 1879  O OG1 . THR C 1 2   ? 86.728  87.857  64.798  1.00 61.94 ? 2   THR C OG1 1 
ATOM 1880  C CG2 . THR C 1 2   ? 87.390  87.184  67.014  1.00 61.91 ? 2   THR C CG2 1 
ATOM 1881  N N   . LEU C 1 3   ? 83.257  87.519  65.735  1.00 59.31 ? 3   LEU C N   1 
ATOM 1882  C CA  . LEU C 1 3   ? 82.121  88.142  65.051  1.00 58.56 ? 3   LEU C CA  1 
ATOM 1883  C C   . LEU C 1 3   ? 82.599  89.204  64.059  1.00 57.74 ? 3   LEU C C   1 
ATOM 1884  O O   . LEU C 1 3   ? 82.040  89.326  62.970  1.00 57.87 ? 3   LEU C O   1 
ATOM 1885  C CB  . LEU C 1 3   ? 81.152  88.765  66.063  1.00 58.65 ? 3   LEU C CB  1 
ATOM 1886  C CG  . LEU C 1 3   ? 79.837  89.356  65.536  1.00 58.84 ? 3   LEU C CG  1 
ATOM 1887  C CD1 . LEU C 1 3   ? 78.967  88.290  64.886  1.00 58.83 ? 3   LEU C CD1 1 
ATOM 1888  C CD2 . LEU C 1 3   ? 79.087  90.043  66.667  1.00 59.00 ? 3   LEU C CD2 1 
ATOM 1889  N N   . ILE C 1 4   ? 83.617  89.975  64.450  1.00 56.84 ? 4   ILE C N   1 
ATOM 1890  C CA  . ILE C 1 4   ? 84.234  90.981  63.567  1.00 56.10 ? 4   ILE C CA  1 
ATOM 1891  C C   . ILE C 1 4   ? 84.864  90.374  62.301  1.00 55.55 ? 4   ILE C C   1 
ATOM 1892  O O   . ILE C 1 4   ? 84.805  90.986  61.232  1.00 55.56 ? 4   ILE C O   1 
ATOM 1893  C CB  . ILE C 1 4   ? 85.263  91.873  64.331  1.00 56.16 ? 4   ILE C CB  1 
ATOM 1894  C CG1 . ILE C 1 4   ? 85.759  93.049  63.472  1.00 56.20 ? 4   ILE C CG1 1 
ATOM 1895  C CG2 . ILE C 1 4   ? 86.471  91.077  64.815  1.00 56.30 ? 4   ILE C CG2 1 
ATOM 1896  C CD1 . ILE C 1 4   ? 84.670  93.966  62.960  1.00 56.15 ? 4   ILE C CD1 1 
ATOM 1897  N N   . GLU C 1 5   ? 85.458  89.186  62.426  1.00 55.12 ? 5   GLU C N   1 
ATOM 1898  C CA  . GLU C 1 5   ? 86.006  88.460  61.269  1.00 54.70 ? 5   GLU C CA  1 
ATOM 1899  C C   . GLU C 1 5   ? 84.895  87.965  60.337  1.00 54.01 ? 5   GLU C C   1 
ATOM 1900  O O   . GLU C 1 5   ? 85.090  87.902  59.125  1.00 54.13 ? 5   GLU C O   1 
ATOM 1901  C CB  . GLU C 1 5   ? 86.890  87.292  61.727  1.00 54.98 ? 5   GLU C CB  1 
ATOM 1902  C CG  . GLU C 1 5   ? 87.594  86.538  60.602  1.00 55.44 ? 5   GLU C CG  1 
ATOM 1903  C CD  . GLU C 1 5   ? 86.870  85.270  60.175  1.00 55.80 ? 5   GLU C CD  1 
ATOM 1904  O OE1 . GLU C 1 5   ? 86.739  84.348  61.009  1.00 55.97 ? 5   GLU C OE1 1 
ATOM 1905  O OE2 . GLU C 1 5   ? 86.441  85.190  59.005  1.00 55.93 ? 5   GLU C OE2 1 
ATOM 1906  N N   . LEU C 1 6   ? 83.746  87.606  60.907  1.00 53.26 ? 6   LEU C N   1 
ATOM 1907  C CA  . LEU C 1 6   ? 82.557  87.262  60.122  1.00 52.82 ? 6   LEU C CA  1 
ATOM 1908  C C   . LEU C 1 6   ? 81.905  88.505  59.515  1.00 52.17 ? 6   LEU C C   1 
ATOM 1909  O O   . LEU C 1 6   ? 81.434  88.471  58.378  1.00 52.30 ? 6   LEU C O   1 
ATOM 1910  C CB  . LEU C 1 6   ? 81.537  86.528  60.999  1.00 53.07 ? 6   LEU C CB  1 
ATOM 1911  C CG  . LEU C 1 6   ? 80.329  85.861  60.326  1.00 53.25 ? 6   LEU C CG  1 
ATOM 1912  C CD1 . LEU C 1 6   ? 80.751  84.789  59.325  1.00 53.35 ? 6   LEU C CD1 1 
ATOM 1913  C CD2 . LEU C 1 6   ? 79.394  85.284  61.386  1.00 53.36 ? 6   LEU C CD2 1 
ATOM 1914  N N   . LEU C 1 7   ? 81.875  89.592  60.287  1.00 51.68 ? 7   LEU C N   1 
ATOM 1915  C CA  . LEU C 1 7   ? 81.235  90.848  59.883  1.00 51.18 ? 7   LEU C CA  1 
ATOM 1916  C C   . LEU C 1 7   ? 81.931  91.522  58.700  1.00 50.46 ? 7   LEU C C   1 
ATOM 1917  O O   . LEU C 1 7   ? 81.257  92.028  57.799  1.00 50.55 ? 7   LEU C O   1 
ATOM 1918  C CB  . LEU C 1 7   ? 81.180  91.810  61.075  1.00 51.54 ? 7   LEU C CB  1 
ATOM 1919  C CG  . LEU C 1 7   ? 80.486  93.167  60.914  1.00 52.00 ? 7   LEU C CG  1 
ATOM 1920  C CD1 . LEU C 1 7   ? 79.062  93.015  60.400  1.00 52.25 ? 7   LEU C CD1 1 
ATOM 1921  C CD2 . LEU C 1 7   ? 80.505  93.897  62.250  1.00 52.11 ? 7   LEU C CD2 1 
ATOM 1922  N N   . ILE C 1 8   ? 83.265  91.538  58.713  1.00 49.67 ? 8   ILE C N   1 
ATOM 1923  C CA  . ILE C 1 8   ? 84.045  92.067  57.581  1.00 48.95 ? 8   ILE C CA  1 
ATOM 1924  C C   . ILE C 1 8   ? 83.905  91.200  56.323  1.00 48.10 ? 8   ILE C C   1 
ATOM 1925  O O   . ILE C 1 8   ? 83.900  91.730  55.216  1.00 48.25 ? 8   ILE C O   1 
ATOM 1926  C CB  . ILE C 1 8   ? 85.542  92.295  57.936  1.00 49.08 ? 8   ILE C CB  1 
ATOM 1927  C CG1 . ILE C 1 8   ? 86.218  93.169  56.866  1.00 49.31 ? 8   ILE C CG1 1 
ATOM 1928  C CG2 . ILE C 1 8   ? 86.288  90.975  58.115  1.00 49.12 ? 8   ILE C CG2 1 
ATOM 1929  C CD1 . ILE C 1 8   ? 87.557  93.748  57.277  1.00 49.49 ? 8   ILE C CD1 1 
ATOM 1930  N N   . VAL C 1 9   ? 83.783  89.882  56.497  1.00 47.27 ? 9   VAL C N   1 
ATOM 1931  C CA  . VAL C 1 9   ? 83.530  88.962  55.375  1.00 46.73 ? 9   VAL C CA  1 
ATOM 1932  C C   . VAL C 1 9   ? 82.164  89.236  54.728  1.00 46.19 ? 9   VAL C C   1 
ATOM 1933  O O   . VAL C 1 9   ? 82.038  89.176  53.505  1.00 46.23 ? 9   VAL C O   1 
ATOM 1934  C CB  . VAL C 1 9   ? 83.657  87.479  55.816  1.00 46.84 ? 9   VAL C CB  1 
ATOM 1935  C CG1 . VAL C 1 9   ? 83.100  86.518  54.769  1.00 46.95 ? 9   VAL C CG1 1 
ATOM 1936  C CG2 . VAL C 1 9   ? 85.115  87.142  56.101  1.00 46.91 ? 9   VAL C CG2 1 
ATOM 1937  N N   . ILE C 1 10  ? 81.158  89.538  55.550  1.00 45.60 ? 10  ILE C N   1 
ATOM 1938  C CA  . ILE C 1 10  ? 79.833  89.942  55.057  1.00 45.28 ? 10  ILE C CA  1 
ATOM 1939  C C   . ILE C 1 10  ? 79.915  91.281  54.303  1.00 44.89 ? 10  ILE C C   1 
ATOM 1940  O O   . ILE C 1 10  ? 79.238  91.463  53.289  1.00 44.97 ? 10  ILE C O   1 
ATOM 1941  C CB  . ILE C 1 10  ? 78.795  90.018  56.210  1.00 45.46 ? 10  ILE C CB  1 
ATOM 1942  C CG1 . ILE C 1 10  ? 78.525  88.616  56.778  1.00 45.68 ? 10  ILE C CG1 1 
ATOM 1943  C CG2 . ILE C 1 10  ? 77.476  90.636  55.745  1.00 45.52 ? 10  ILE C CG2 1 
ATOM 1944  C CD1 . ILE C 1 10  ? 77.963  88.612  58.185  1.00 45.81 ? 10  ILE C CD1 1 
ATOM 1945  N N   . ALA C 1 11  ? 80.743  92.200  54.801  1.00 44.53 ? 11  ALA C N   1 
ATOM 1946  C CA  . ALA C 1 11  ? 80.961  93.501  54.156  1.00 44.37 ? 11  ALA C CA  1 
ATOM 1947  C C   . ALA C 1 11  ? 81.622  93.395  52.778  1.00 44.14 ? 11  ALA C C   1 
ATOM 1948  O O   . ALA C 1 11  ? 81.236  94.111  51.853  1.00 44.27 ? 11  ALA C O   1 
ATOM 1949  C CB  . ALA C 1 11  ? 81.784  94.411  55.059  1.00 44.52 ? 11  ALA C CB  1 
ATOM 1950  N N   . ILE C 1 12  ? 82.610  92.507  52.650  1.00 43.94 ? 12  ILE C N   1 
ATOM 1951  C CA  . ILE C 1 12  ? 83.324  92.301  51.379  1.00 43.88 ? 12  ILE C CA  1 
ATOM 1952  C C   . ILE C 1 12  ? 82.444  91.592  50.337  1.00 43.93 ? 12  ILE C C   1 
ATOM 1953  O O   . ILE C 1 12  ? 82.531  91.907  49.149  1.00 44.27 ? 12  ILE C O   1 
ATOM 1954  C CB  . ILE C 1 12  ? 84.658  91.533  51.588  1.00 43.83 ? 12  ILE C CB  1 
ATOM 1955  C CG1 . ILE C 1 12  ? 85.625  92.334  52.480  1.00 44.06 ? 12  ILE C CG1 1 
ATOM 1956  C CG2 . ILE C 1 12  ? 85.335  91.191  50.259  1.00 43.85 ? 12  ILE C CG2 1 
ATOM 1957  C CD1 . ILE C 1 12  ? 86.016  93.705  51.964  1.00 44.26 ? 12  ILE C CD1 1 
ATOM 1958  N N   . ILE C 1 13  ? 81.602  90.655  50.776  1.00 43.69 ? 13  ILE C N   1 
ATOM 1959  C CA  . ILE C 1 13  ? 80.649  89.976  49.880  1.00 43.60 ? 13  ILE C CA  1 
ATOM 1960  C C   . ILE C 1 13  ? 79.676  90.978  49.236  1.00 43.55 ? 13  ILE C C   1 
ATOM 1961  O O   . ILE C 1 13  ? 79.343  90.845  48.057  1.00 43.61 ? 13  ILE C O   1 
ATOM 1962  C CB  . ILE C 1 13  ? 79.879  88.842  50.613  1.00 43.76 ? 13  ILE C CB  1 
ATOM 1963  C CG1 . ILE C 1 13  ? 80.831  87.686  50.951  1.00 43.92 ? 13  ILE C CG1 1 
ATOM 1964  C CG2 . ILE C 1 13  ? 78.723  88.299  49.767  1.00 43.84 ? 13  ILE C CG2 1 
ATOM 1965  C CD1 . ILE C 1 13  ? 80.363  86.815  52.099  1.00 44.05 ? 13  ILE C CD1 1 
ATOM 1966  N N   . ALA C 1 14  ? 79.235  91.972  50.008  1.00 43.61 ? 14  ALA C N   1 
ATOM 1967  C CA  . ALA C 1 14  ? 78.381  93.052  49.492  1.00 43.68 ? 14  ALA C CA  1 
ATOM 1968  C C   . ALA C 1 14  ? 79.081  93.908  48.432  1.00 43.73 ? 14  ALA C C   1 
ATOM 1969  O O   . ALA C 1 14  ? 78.445  94.351  47.472  1.00 43.84 ? 14  ALA C O   1 
ATOM 1970  C CB  . ALA C 1 14  ? 77.891  93.931  50.635  1.00 43.75 ? 14  ALA C CB  1 
ATOM 1971  N N   . ILE C 1 15  ? 80.382  94.139  48.616  1.00 43.74 ? 15  ILE C N   1 
ATOM 1972  C CA  . ILE C 1 15  ? 81.196  94.900  47.659  1.00 43.83 ? 15  ILE C CA  1 
ATOM 1973  C C   . ILE C 1 15  ? 81.437  94.091  46.381  1.00 43.79 ? 15  ILE C C   1 
ATOM 1974  O O   . ILE C 1 15  ? 81.245  94.604  45.277  1.00 43.92 ? 15  ILE C O   1 
ATOM 1975  C CB  . ILE C 1 15  ? 82.554  95.327  48.275  1.00 44.00 ? 15  ILE C CB  1 
ATOM 1976  C CG1 . ILE C 1 15  ? 82.329  96.286  49.455  1.00 44.22 ? 15  ILE C CG1 1 
ATOM 1977  C CG2 . ILE C 1 15  ? 83.448  96.001  47.234  1.00 44.10 ? 15  ILE C CG2 1 
ATOM 1978  C CD1 . ILE C 1 15  ? 83.505  96.388  50.403  1.00 44.27 ? 15  ILE C CD1 1 
ATOM 1979  N N   . LEU C 1 16  ? 81.865  92.840  46.544  1.00 43.76 ? 16  LEU C N   1 
ATOM 1980  C CA  . LEU C 1 16  ? 82.129  91.942  45.406  1.00 43.77 ? 16  LEU C CA  1 
ATOM 1981  C C   . LEU C 1 16  ? 80.871  91.611  44.590  1.00 43.68 ? 16  LEU C C   1 
ATOM 1982  O O   . LEU C 1 16  ? 80.951  91.468  43.369  1.00 43.80 ? 16  LEU C O   1 
ATOM 1983  C CB  . LEU C 1 16  ? 82.823  90.646  45.867  1.00 43.94 ? 16  LEU C CB  1 
ATOM 1984  C CG  . LEU C 1 16  ? 84.358  90.657  45.940  1.00 44.26 ? 16  LEU C CG  1 
ATOM 1985  C CD1 . LEU C 1 16  ? 84.918  91.914  46.595  1.00 44.40 ? 16  LEU C CD1 1 
ATOM 1986  C CD2 . LEU C 1 16  ? 84.855  89.410  46.659  1.00 44.39 ? 16  LEU C CD2 1 
ATOM 1987  N N   . ALA C 1 17  ? 79.726  91.491  45.262  1.00 43.48 ? 17  ALA C N   1 
ATOM 1988  C CA  . ALA C 1 17  ? 78.445  91.227  44.590  1.00 43.36 ? 17  ALA C CA  1 
ATOM 1989  C C   . ALA C 1 17  ? 77.962  92.391  43.713  1.00 43.29 ? 17  ALA C C   1 
ATOM 1990  O O   . ALA C 1 17  ? 77.203  92.174  42.766  1.00 43.40 ? 17  ALA C O   1 
ATOM 1991  C CB  . ALA C 1 17  ? 77.373  90.867  45.611  1.00 43.38 ? 17  ALA C CB  1 
ATOM 1992  N N   . ALA C 1 18  ? 78.386  93.612  44.036  1.00 43.01 ? 18  ALA C N   1 
ATOM 1993  C CA  . ALA C 1 18  ? 78.036  94.797  43.251  1.00 42.88 ? 18  ALA C CA  1 
ATOM 1994  C C   . ALA C 1 18  ? 78.938  94.951  42.028  1.00 42.74 ? 18  ALA C C   1 
ATOM 1995  O O   . ALA C 1 18  ? 78.449  95.054  40.901  1.00 42.83 ? 18  ALA C O   1 
ATOM 1996  C CB  . ALA C 1 18  ? 78.114  96.044  44.120  1.00 42.97 ? 18  ALA C CB  1 
ATOM 1997  N N   . VAL C 1 19  ? 80.249  94.959  42.262  1.00 42.61 ? 19  VAL C N   1 
ATOM 1998  C CA  . VAL C 1 19  ? 81.232  95.296  41.216  1.00 42.61 ? 19  VAL C CA  1 
ATOM 1999  C C   . VAL C 1 19  ? 81.470  94.196  40.171  1.00 42.56 ? 19  VAL C C   1 
ATOM 2000  O O   . VAL C 1 19  ? 81.614  94.499  38.984  1.00 42.66 ? 19  VAL C O   1 
ATOM 2001  C CB  . VAL C 1 19  ? 82.597  95.751  41.810  1.00 42.69 ? 19  VAL C CB  1 
ATOM 2002  C CG1 . VAL C 1 19  ? 82.399  96.916  42.773  1.00 42.75 ? 19  VAL C CG1 1 
ATOM 2003  C CG2 . VAL C 1 19  ? 83.350  94.602  42.481  1.00 42.69 ? 19  VAL C CG2 1 
ATOM 2004  N N   . LEU C 1 20  ? 81.505  92.936  40.605  1.00 42.47 ? 20  LEU C N   1 
ATOM 2005  C CA  . LEU C 1 20  ? 81.854  91.815  39.717  1.00 42.47 ? 20  LEU C CA  1 
ATOM 2006  C C   . LEU C 1 20  ? 80.726  91.394  38.766  1.00 42.21 ? 20  LEU C C   1 
ATOM 2007  O O   . LEU C 1 20  ? 80.997  90.779  37.731  1.00 42.16 ? 20  LEU C O   1 
ATOM 2008  C CB  . LEU C 1 20  ? 82.323  90.606  40.532  1.00 42.79 ? 20  LEU C CB  1 
ATOM 2009  C CG  . LEU C 1 20  ? 83.522  90.818  41.462  1.00 43.17 ? 20  LEU C CG  1 
ATOM 2010  C CD1 . LEU C 1 20  ? 83.762  89.574  42.304  1.00 43.27 ? 20  LEU C CD1 1 
ATOM 2011  C CD2 . LEU C 1 20  ? 84.774  91.172  40.672  1.00 43.25 ? 20  LEU C CD2 1 
ATOM 2012  N N   . ILE C 1 21  ? 79.478  91.714  39.115  1.00 41.85 ? 21  ILE C N   1 
ATOM 2013  C CA  . ILE C 1 21  ? 78.322  91.417  38.261  1.00 41.51 ? 21  ILE C CA  1 
ATOM 2014  C C   . ILE C 1 21  ? 78.336  92.431  37.105  1.00 41.13 ? 21  ILE C C   1 
ATOM 2015  O O   . ILE C 1 21  ? 78.205  93.632  37.348  1.00 41.33 ? 21  ILE C O   1 
ATOM 2016  C CB  . ILE C 1 21  ? 76.982  91.484  39.049  1.00 41.75 ? 21  ILE C CB  1 
ATOM 2017  C CG1 . ILE C 1 21  ? 76.743  90.202  39.869  1.00 41.94 ? 21  ILE C CG1 1 
ATOM 2018  C CG2 . ILE C 1 21  ? 75.782  91.650  38.116  1.00 41.83 ? 21  ILE C CG2 1 
ATOM 2019  C CD1 . ILE C 1 21  ? 77.894  89.720  40.730  1.00 42.01 ? 21  ILE C CD1 1 
ATOM 2020  N N   . PRO C 1 22  ? 78.493  91.955  35.850  1.00 40.49 ? 22  PRO C N   1 
ATOM 2021  C CA  . PRO C 1 22  ? 78.616  92.872  34.714  1.00 40.05 ? 22  PRO C CA  1 
ATOM 2022  C C   . PRO C 1 22  ? 77.278  93.445  34.246  1.00 39.58 ? 22  PRO C C   1 
ATOM 2023  O O   . PRO C 1 22  ? 76.218  93.004  34.698  1.00 39.64 ? 22  PRO C O   1 
ATOM 2024  C CB  . PRO C 1 22  ? 79.214  91.981  33.627  1.00 40.17 ? 22  PRO C CB  1 
ATOM 2025  C CG  . PRO C 1 22  ? 78.631  90.641  33.907  1.00 40.35 ? 22  PRO C CG  1 
ATOM 2026  C CD  . PRO C 1 22  ? 78.496  90.547  35.404  1.00 40.46 ? 22  PRO C CD  1 
ATOM 2027  N N   . ASN C 1 23  ? 77.347  94.422  33.341  1.00 38.96 ? 23  ASN C N   1 
ATOM 2028  C CA  . ASN C 1 23  ? 76.156  95.006  32.725  1.00 38.42 ? 23  ASN C CA  1 
ATOM 2029  C C   . ASN C 1 23  ? 75.583  94.006  31.719  1.00 38.17 ? 23  ASN C C   1 
ATOM 2030  O O   . ASN C 1 23  ? 76.146  93.807  30.639  1.00 38.30 ? 23  ASN C O   1 
ATOM 2031  C CB  . ASN C 1 23  ? 76.501  96.340  32.045  1.00 38.26 ? 23  ASN C CB  1 
ATOM 2032  C CG  . ASN C 1 23  ? 75.268  97.147  31.665  1.00 38.22 ? 23  ASN C CG  1 
ATOM 2033  O OD1 . ASN C 1 23  ? 74.365  96.652  30.993  1.00 38.19 ? 23  ASN C OD1 1 
ATOM 2034  N ND2 . ASN C 1 23  ? 75.235  98.405  32.088  1.00 38.32 ? 23  ASN C ND2 1 
ATOM 2035  N N   . LEU C 1 24  ? 74.471  93.373  32.090  1.00 37.77 ? 24  LEU C N   1 
ATOM 2036  C CA  . LEU C 1 24  ? 73.845  92.341  31.262  1.00 37.53 ? 24  LEU C CA  1 
ATOM 2037  C C   . LEU C 1 24  ? 73.092  92.941  30.076  1.00 37.24 ? 24  LEU C C   1 
ATOM 2038  O O   . LEU C 1 24  ? 73.242  92.467  28.951  1.00 37.38 ? 24  LEU C O   1 
ATOM 2039  C CB  . LEU C 1 24  ? 72.894  91.476  32.098  1.00 37.66 ? 24  LEU C CB  1 
ATOM 2040  C CG  . LEU C 1 24  ? 73.510  90.717  33.280  1.00 37.78 ? 24  LEU C CG  1 
ATOM 2041  C CD1 . LEU C 1 24  ? 72.419  90.156  34.180  1.00 37.90 ? 24  LEU C CD1 1 
ATOM 2042  C CD2 . LEU C 1 24  ? 74.433  89.601  32.810  1.00 37.72 ? 24  LEU C CD2 1 
ATOM 2043  N N   . LEU C 1 25  ? 72.296  93.981  30.334  1.00 36.76 ? 25  LEU C N   1 
ATOM 2044  C CA  . LEU C 1 25  ? 71.460  94.617  29.304  1.00 36.40 ? 25  LEU C CA  1 
ATOM 2045  C C   . LEU C 1 25  ? 72.272  95.126  28.116  1.00 35.85 ? 25  LEU C C   1 
ATOM 2046  O O   . LEU C 1 25  ? 71.867  94.947  26.967  1.00 35.80 ? 25  LEU C O   1 
ATOM 2047  C CB  . LEU C 1 25  ? 70.648  95.777  29.899  1.00 36.59 ? 25  LEU C CB  1 
ATOM 2048  C CG  . LEU C 1 25  ? 69.628  96.475  28.987  1.00 36.81 ? 25  LEU C CG  1 
ATOM 2049  C CD1 . LEU C 1 25  ? 68.525  95.515  28.564  1.00 36.91 ? 25  LEU C CD1 1 
ATOM 2050  C CD2 . LEU C 1 25  ? 69.036  97.697  29.674  1.00 36.92 ? 25  LEU C CD2 1 
ATOM 2051  N N   . ALA C 1 26  ? 73.409  95.757  28.403  1.00 35.52 ? 26  ALA C N   1 
ATOM 2052  C CA  . ALA C 1 26  ? 74.296  96.283  27.363  1.00 35.27 ? 26  ALA C CA  1 
ATOM 2053  C C   . ALA C 1 26  ? 74.952  95.164  26.548  1.00 34.96 ? 26  ALA C C   1 
ATOM 2054  O O   . ALA C 1 26  ? 75.077  95.278  25.328  1.00 34.98 ? 26  ALA C O   1 
ATOM 2055  C CB  . ALA C 1 26  ? 75.356  97.192  27.973  1.00 35.29 ? 26  ALA C CB  1 
ATOM 2056  N N   . ALA C 1 27  ? 75.360  94.091  27.224  1.00 34.79 ? 27  ALA C N   1 
ATOM 2057  C CA  . ALA C 1 27  ? 75.963  92.924  26.563  1.00 34.77 ? 27  ALA C CA  1 
ATOM 2058  C C   . ALA C 1 27  ? 75.023  92.249  25.559  1.00 34.60 ? 27  ALA C C   1 
ATOM 2059  O O   . ALA C 1 27  ? 75.467  91.806  24.498  1.00 34.63 ? 27  ALA C O   1 
ATOM 2060  C CB  . ALA C 1 27  ? 76.432  91.913  27.601  1.00 34.88 ? 27  ALA C CB  1 
ATOM 2061  N N   . ARG C 1 28  ? 73.734  92.174  25.897  1.00 34.46 ? 28  ARG C N   1 
ATOM 2062  C CA  . ARG C 1 28  ? 72.728  91.568  25.017  1.00 34.32 ? 28  ARG C CA  1 
ATOM 2063  C C   . ARG C 1 28  ? 72.396  92.426  23.791  1.00 34.16 ? 28  ARG C C   1 
ATOM 2064  O O   . ARG C 1 28  ? 72.120  91.876  22.725  1.00 34.28 ? 28  ARG C O   1 
ATOM 2065  C CB  . ARG C 1 28  ? 71.443  91.247  25.787  1.00 34.46 ? 28  ARG C CB  1 
ATOM 2066  C CG  . ARG C 1 28  ? 71.628  90.232  26.905  1.00 34.64 ? 28  ARG C CG  1 
ATOM 2067  C CD  . ARG C 1 28  ? 70.321  89.554  27.289  1.00 34.76 ? 28  ARG C CD  1 
ATOM 2068  N NE  . ARG C 1 28  ? 70.018  88.413  26.425  1.00 34.86 ? 28  ARG C NE  1 
ATOM 2069  C CZ  . ARG C 1 28  ? 70.603  87.213  26.494  1.00 35.08 ? 28  ARG C CZ  1 
ATOM 2070  N NH1 . ARG C 1 28  ? 70.233  86.256  25.647  1.00 35.19 ? 28  ARG C NH1 1 
ATOM 2071  N NH2 . ARG C 1 28  ? 71.557  86.953  27.391  1.00 35.14 ? 28  ARG C NH2 1 
ATOM 2072  N N   . LYS C 1 29  ? 72.412  93.754  23.944  1.00 34.02 ? 29  LYS C N   1 
ATOM 2073  C CA  . LYS C 1 29  ? 72.145  94.686  22.829  1.00 33.92 ? 29  LYS C CA  1 
ATOM 2074  C C   . LYS C 1 29  ? 73.004  94.417  21.590  1.00 33.86 ? 29  LYS C C   1 
ATOM 2075  O O   . LYS C 1 29  ? 72.497  94.438  20.469  1.00 34.02 ? 29  LYS C O   1 
ATOM 2076  C CB  . LYS C 1 29  ? 72.348  96.149  23.256  1.00 33.96 ? 29  LYS C CB  1 
ATOM 2077  C CG  . LYS C 1 29  ? 71.190  96.765  24.024  1.00 34.05 ? 29  LYS C CG  1 
ATOM 2078  C CD  . LYS C 1 29  ? 71.319  98.282  24.064  1.00 34.19 ? 29  LYS C CD  1 
ATOM 2079  C CE  . LYS C 1 29  ? 70.252  98.927  24.936  1.00 34.36 ? 29  LYS C CE  1 
ATOM 2080  N NZ  . LYS C 1 29  ? 70.581  98.879  26.389  1.00 34.43 ? 29  LYS C NZ  1 
ATOM 2081  N N   . ARG C 1 30  ? 74.293  94.162  21.805  1.00 33.59 ? 30  ARG C N   1 
ATOM 2082  C CA  . ARG C 1 30  ? 75.237  93.920  20.707  1.00 33.40 ? 30  ARG C CA  1 
ATOM 2083  C C   . ARG C 1 30  ? 75.064  92.524  20.111  1.00 33.27 ? 30  ARG C C   1 
ATOM 2084  O O   . ARG C 1 30  ? 75.251  92.336  18.907  1.00 33.42 ? 30  ARG C O   1 
ATOM 2085  C CB  . ARG C 1 30  ? 76.685  94.118  21.170  1.00 33.43 ? 30  ARG C CB  1 
ATOM 2086  C CG  . ARG C 1 30  ? 76.987  95.464  21.820  1.00 33.49 ? 30  ARG C CG  1 
ATOM 2087  C CD  . ARG C 1 30  ? 76.720  96.652  20.903  1.00 33.56 ? 30  ARG C CD  1 
ATOM 2088  N NE  . ARG C 1 30  ? 76.833  97.933  21.604  1.00 33.57 ? 30  ARG C NE  1 
ATOM 2089  C CZ  . ARG C 1 30  ? 76.672  99.131  21.038  1.00 33.63 ? 30  ARG C CZ  1 
ATOM 2090  N NH1 . ARG C 1 30  ? 76.389  99.245  19.740  1.00 33.65 ? 30  ARG C NH1 1 
ATOM 2091  N NH2 . ARG C 1 30  ? 76.797  100.231 21.777  1.00 33.67 ? 30  ARG C NH2 1 
ATOM 2092  N N   . ALA C 1 31  ? 74.722  91.552  20.955  1.00 32.98 ? 31  ALA C N   1 
ATOM 2093  C CA  . ALA C 1 31  ? 74.360  90.210  20.495  1.00 32.87 ? 31  ALA C CA  1 
ATOM 2094  C C   . ALA C 1 31  ? 73.057  90.223  19.693  1.00 32.84 ? 31  ALA C C   1 
ATOM 2095  O O   . ALA C 1 31  ? 72.924  89.484  18.716  1.00 32.95 ? 31  ALA C O   1 
ATOM 2096  C CB  . ALA C 1 31  ? 74.239  89.261  21.676  1.00 32.90 ? 31  ALA C CB  1 
ATOM 2097  N N   . ASN C 1 32  ? 72.105  91.054  20.117  1.00 32.86 ? 32  ASN C N   1 
ATOM 2098  C CA  . ASN C 1 32  ? 70.846  91.254  19.386  1.00 32.92 ? 32  ASN C CA  1 
ATOM 2099  C C   . ASN C 1 32  ? 71.053  91.914  18.017  1.00 33.12 ? 32  ASN C C   1 
ATOM 2100  O O   . ASN C 1 32  ? 70.324  91.607  17.070  1.00 33.24 ? 32  ASN C O   1 
ATOM 2101  C CB  . ASN C 1 32  ? 69.859  92.091  20.216  1.00 32.83 ? 32  ASN C CB  1 
ATOM 2102  C CG  . ASN C 1 32  ? 69.302  91.340  21.419  1.00 32.76 ? 32  ASN C CG  1 
ATOM 2103  O OD1 . ASN C 1 32  ? 69.043  90.139  21.338  1.00 32.77 ? 32  ASN C OD1 1 
ATOM 2104  N ND2 . ASN C 1 32  ? 69.119  92.037  22.535  1.00 32.81 ? 32  ASN C ND2 1 
ATOM 2105  N N   . ASP C 1 33  ? 72.028  92.819  17.922  1.00 33.25 ? 33  ASP C N   1 
ATOM 2106  C CA  . ASP C 1 33  ? 72.409  93.428  16.638  1.00 33.42 ? 33  ASP C CA  1 
ATOM 2107  C C   . ASP C 1 33  ? 73.010  92.404  15.675  1.00 33.48 ? 33  ASP C C   1 
ATOM 2108  O O   . ASP C 1 33  ? 72.781  92.482  14.466  1.00 33.61 ? 33  ASP C O   1 
ATOM 2109  C CB  . ASP C 1 33  ? 73.410  94.573  16.844  1.00 33.64 ? 33  ASP C CB  1 
ATOM 2110  C CG  . ASP C 1 33  ? 72.814  95.764  17.583  1.00 33.90 ? 33  ASP C CG  1 
ATOM 2111  O OD1 . ASP C 1 33  ? 71.572  95.870  17.694  1.00 33.97 ? 33  ASP C OD1 1 
ATOM 2112  O OD2 . ASP C 1 33  ? 73.604  96.608  18.057  1.00 34.02 ? 33  ASP C OD2 1 
ATOM 2113  N N   . THR C 1 34  ? 73.782  91.459  16.214  1.00 33.41 ? 34  THR C N   1 
ATOM 2114  C CA  . THR C 1 34  ? 74.353  90.363  15.424  1.00 33.36 ? 34  THR C CA  1 
ATOM 2115  C C   . THR C 1 34  ? 73.271  89.453  14.830  1.00 33.33 ? 34  THR C C   1 
ATOM 2116  O O   . THR C 1 34  ? 73.427  88.965  13.713  1.00 33.44 ? 34  THR C O   1 
ATOM 2117  C CB  . THR C 1 34  ? 75.320  89.501  16.268  1.00 33.50 ? 34  THR C CB  1 
ATOM 2118  O OG1 . THR C 1 34  ? 76.206  90.351  17.007  1.00 33.50 ? 34  THR C OG1 1 
ATOM 2119  C CG2 . THR C 1 34  ? 76.141  88.562  15.383  1.00 33.60 ? 34  THR C CG2 1 
ATOM 2120  N N   . VAL C 1 35  ? 72.189  89.237  15.580  1.00 33.30 ? 35  VAL C N   1 
ATOM 2121  C CA  . VAL C 1 35  ? 71.043  88.444  15.108  1.00 33.32 ? 35  VAL C CA  1 
ATOM 2122  C C   . VAL C 1 35  ? 70.322  89.154  13.956  1.00 33.25 ? 35  VAL C C   1 
ATOM 2123  O O   . VAL C 1 35  ? 69.931  88.512  12.979  1.00 33.36 ? 35  VAL C O   1 
ATOM 2124  C CB  . VAL C 1 35  ? 70.044  88.138  16.257  1.00 33.52 ? 35  VAL C CB  1 
ATOM 2125  C CG1 . VAL C 1 35  ? 68.762  87.486  15.737  1.00 33.63 ? 35  VAL C CG1 1 
ATOM 2126  C CG2 . VAL C 1 35  ? 70.691  87.241  17.305  1.00 33.60 ? 35  VAL C CG2 1 
ATOM 2127  N N   . VAL C 1 36  ? 70.153  90.470  14.083  1.00 33.13 ? 36  VAL C N   1 
ATOM 2128  C CA  . VAL C 1 36  ? 69.511  91.287  13.046  1.00 33.03 ? 36  VAL C CA  1 
ATOM 2129  C C   . VAL C 1 36  ? 70.401  91.390  11.803  1.00 33.02 ? 36  VAL C C   1 
ATOM 2130  O O   . VAL C 1 36  ? 69.911  91.276  10.679  1.00 33.10 ? 36  VAL C O   1 
ATOM 2131  C CB  . VAL C 1 36  ? 69.161  92.704  13.569  1.00 33.02 ? 36  VAL C CB  1 
ATOM 2132  C CG1 . VAL C 1 36  ? 68.668  93.609  12.443  1.00 33.08 ? 36  VAL C CG1 1 
ATOM 2133  C CG2 . VAL C 1 36  ? 68.112  92.623  14.670  1.00 33.01 ? 36  VAL C CG2 1 
ATOM 2134  N N   . THR C 1 37  ? 71.698  91.614  12.016  1.00 33.06 ? 37  THR C N   1 
ATOM 2135  C CA  . THR C 1 37  ? 72.672  91.687  10.923  1.00 33.11 ? 37  THR C CA  1 
ATOM 2136  C C   . THR C 1 37  ? 72.815  90.348  10.193  1.00 33.10 ? 37  THR C C   1 
ATOM 2137  O O   . THR C 1 37  ? 72.924  90.325  8.967   1.00 33.26 ? 37  THR C O   1 
ATOM 2138  C CB  . THR C 1 37  ? 74.060  92.139  11.429  1.00 33.23 ? 37  THR C CB  1 
ATOM 2139  O OG1 . THR C 1 37  ? 73.929  93.353  12.179  1.00 33.31 ? 37  THR C OG1 1 
ATOM 2140  C CG2 . THR C 1 37  ? 75.029  92.369  10.265  1.00 33.28 ? 37  THR C CG2 1 
ATOM 2141  N N   . ALA C 1 38  ? 72.810  89.249  10.946  1.00 33.05 ? 38  ALA C N   1 
ATOM 2142  C CA  . ALA C 1 38  ? 72.892  87.902  10.368  1.00 33.10 ? 38  ALA C CA  1 
ATOM 2143  C C   . ALA C 1 38  ? 71.654  87.544  9.548   1.00 33.09 ? 38  ALA C C   1 
ATOM 2144  O O   . ALA C 1 38  ? 71.778  86.978  8.462   1.00 33.10 ? 38  ALA C O   1 
ATOM 2145  C CB  . ALA C 1 38  ? 73.111  86.861  11.459  1.00 33.16 ? 38  ALA C CB  1 
ATOM 2146  N N   . TYR C 1 39  ? 70.473  87.873  10.071  1.00 33.22 ? 39  TYR C N   1 
ATOM 2147  C CA  . TYR C 1 39  ? 69.209  87.587  9.381   1.00 33.27 ? 39  TYR C CA  1 
ATOM 2148  C C   . TYR C 1 39  ? 69.041  88.417  8.106   1.00 33.48 ? 39  TYR C C   1 
ATOM 2149  O O   . TYR C 1 39  ? 68.525  87.913  7.107   1.00 33.64 ? 39  TYR C O   1 
ATOM 2150  C CB  . TYR C 1 39  ? 68.008  87.805  10.306  1.00 33.19 ? 39  TYR C CB  1 
ATOM 2151  C CG  . TYR C 1 39  ? 66.728  87.206  9.766   1.00 33.27 ? 39  TYR C CG  1 
ATOM 2152  C CD1 . TYR C 1 39  ? 66.469  85.840  9.891   1.00 33.33 ? 39  TYR C CD1 1 
ATOM 2153  C CD2 . TYR C 1 39  ? 65.779  87.997  9.119   1.00 33.35 ? 39  TYR C CD2 1 
ATOM 2154  C CE1 . TYR C 1 39  ? 65.300  85.281  9.392   1.00 33.32 ? 39  TYR C CE1 1 
ATOM 2155  C CE2 . TYR C 1 39  ? 64.606  87.447  8.618   1.00 33.36 ? 39  TYR C CE2 1 
ATOM 2156  C CZ  . TYR C 1 39  ? 64.371  86.090  8.757   1.00 33.36 ? 39  TYR C CZ  1 
ATOM 2157  O OH  . TYR C 1 39  ? 63.210  85.542  8.262   1.00 33.46 ? 39  TYR C OH  1 
ATOM 2158  N N   . LEU C 1 40  ? 69.467  89.680  8.148   1.00 33.68 ? 40  LEU C N   1 
ATOM 2159  C CA  . LEU C 1 40  ? 69.502  90.531  6.950   1.00 33.88 ? 40  LEU C CA  1 
ATOM 2160  C C   . LEU C 1 40  ? 70.554  90.061  5.944   1.00 34.31 ? 40  LEU C C   1 
ATOM 2161  O O   . LEU C 1 40  ? 70.318  90.116  4.738   1.00 34.49 ? 40  LEU C O   1 
ATOM 2162  C CB  . LEU C 1 40  ? 69.752  91.998  7.317   1.00 33.80 ? 40  LEU C CB  1 
ATOM 2163  C CG  . LEU C 1 40  ? 68.595  92.732  7.998   1.00 33.73 ? 40  LEU C CG  1 
ATOM 2164  C CD1 . LEU C 1 40  ? 69.089  94.037  8.596   1.00 33.66 ? 40  LEU C CD1 1 
ATOM 2165  C CD2 . LEU C 1 40  ? 67.451  92.994  7.028   1.00 33.70 ? 40  LEU C CD2 1 
ATOM 2166  N N   . ASN C 1 41  ? 71.706  89.609  6.443   1.00 34.79 ? 41  ASN C N   1 
ATOM 2167  C CA  . ASN C 1 41  ? 72.749  89.020  5.592   1.00 35.15 ? 41  ASN C CA  1 
ATOM 2168  C C   . ASN C 1 41  ? 72.254  87.739  4.910   1.00 35.40 ? 41  ASN C C   1 
ATOM 2169  O O   . ASN C 1 41  ? 72.571  87.497  3.745   1.00 35.49 ? 41  ASN C O   1 
ATOM 2170  C CB  . ASN C 1 41  ? 74.018  88.732  6.407   1.00 35.34 ? 41  ASN C CB  1 
ATOM 2171  C CG  . ASN C 1 41  ? 75.183  88.270  5.546   1.00 35.61 ? 41  ASN C CG  1 
ATOM 2172  O OD1 . ASN C 1 41  ? 75.453  88.835  4.485   1.00 35.79 ? 41  ASN C OD1 1 
ATOM 2173  N ND2 . ASN C 1 41  ? 75.888  87.242  6.006   1.00 35.71 ? 41  ASN C ND2 1 
ATOM 2174  N N   . ASP C 1 42  ? 71.484  86.932  5.640   1.00 35.76 ? 42  ASP C N   1 
ATOM 2175  C CA  . ASP C 1 42  ? 70.814  85.756  5.067   1.00 36.04 ? 42  ASP C CA  1 
ATOM 2176  C C   . ASP C 1 42  ? 69.693  86.158  4.107   1.00 36.01 ? 42  ASP C C   1 
ATOM 2177  O O   . ASP C 1 42  ? 69.531  85.540  3.055   1.00 36.17 ? 42  ASP C O   1 
ATOM 2178  C CB  . ASP C 1 42  ? 70.247  84.847  6.169   1.00 36.32 ? 42  ASP C CB  1 
ATOM 2179  C CG  . ASP C 1 42  ? 71.333  84.180  7.008   1.00 36.66 ? 42  ASP C CG  1 
ATOM 2180  O OD1 . ASP C 1 42  ? 72.381  83.783  6.450   1.00 36.82 ? 42  ASP C OD1 1 
ATOM 2181  O OD2 . ASP C 1 42  ? 71.130  84.042  8.233   1.00 36.78 ? 42  ASP C OD2 1 
ATOM 2182  N N   . ALA C 1 43  ? 68.927  87.186  4.472   1.00 35.92 ? 43  ALA C N   1 
ATOM 2183  C CA  . ALA C 1 43  ? 67.843  87.705  3.625   1.00 35.94 ? 43  ALA C CA  1 
ATOM 2184  C C   . ALA C 1 43  ? 68.339  88.213  2.269   1.00 36.00 ? 43  ALA C C   1 
ATOM 2185  O O   . ALA C 1 43  ? 67.658  88.038  1.260   1.00 36.16 ? 43  ALA C O   1 
ATOM 2186  C CB  . ALA C 1 43  ? 67.082  88.807  4.350   1.00 35.95 ? 43  ALA C CB  1 
ATOM 2187  N N   . VAL C 1 44  ? 69.515  88.840  2.257   1.00 36.18 ? 44  VAL C N   1 
ATOM 2188  C CA  . VAL C 1 44  ? 70.153  89.306  1.016   1.00 36.35 ? 44  VAL C CA  1 
ATOM 2189  C C   . VAL C 1 44  ? 70.528  88.135  0.094   1.00 36.53 ? 44  VAL C C   1 
ATOM 2190  O O   . VAL C 1 44  ? 70.409  88.251  -1.127  1.00 36.62 ? 44  VAL C O   1 
ATOM 2191  C CB  . VAL C 1 44  ? 71.394  90.196  1.319   1.00 36.45 ? 44  VAL C CB  1 
ATOM 2192  C CG1 . VAL C 1 44  ? 72.228  90.466  0.068   1.00 36.57 ? 44  VAL C CG1 1 
ATOM 2193  C CG2 . VAL C 1 44  ? 70.964  91.515  1.959   1.00 36.45 ? 44  VAL C CG2 1 
ATOM 2194  N N   . LYS C 1 45  ? 70.971  87.019  0.676   1.00 36.84 ? 45  LYS C N   1 
ATOM 2195  C CA  . LYS C 1 45  ? 71.337  85.824  -0.099  1.00 37.12 ? 45  LYS C CA  1 
ATOM 2196  C C   . LYS C 1 45  ? 70.132  85.204  -0.805  1.00 37.00 ? 45  LYS C C   1 
ATOM 2197  O O   . LYS C 1 45  ? 70.189  84.930  -2.004  1.00 37.15 ? 45  LYS C O   1 
ATOM 2198  C CB  . LYS C 1 45  ? 72.019  84.775  0.790   1.00 37.49 ? 45  LYS C CB  1 
ATOM 2199  C CG  . LYS C 1 45  ? 73.387  85.196  1.307   1.00 37.82 ? 45  LYS C CG  1 
ATOM 2200  C CD  . LYS C 1 45  ? 73.848  84.324  2.465   1.00 38.10 ? 45  LYS C CD  1 
ATOM 2201  C CE  . LYS C 1 45  ? 75.133  84.856  3.081   1.00 38.33 ? 45  LYS C CE  1 
ATOM 2202  N NZ  . LYS C 1 45  ? 75.538  84.102  4.300   1.00 38.49 ? 45  LYS C NZ  1 
ATOM 2203  N N   . PHE C 1 46  ? 69.048  84.993  -0.062  1.00 36.90 ? 46  PHE C N   1 
ATOM 2204  C CA  . PHE C 1 46  ? 67.820  84.416  -0.627  1.00 36.84 ? 46  PHE C CA  1 
ATOM 2205  C C   . PHE C 1 46  ? 67.048  85.368  -1.552  1.00 36.81 ? 46  PHE C C   1 
ATOM 2206  O O   . PHE C 1 46  ? 66.205  84.914  -2.329  1.00 36.96 ? 46  PHE C O   1 
ATOM 2207  C CB  . PHE C 1 46  ? 66.911  83.867  0.480   1.00 36.83 ? 46  PHE C CB  1 
ATOM 2208  C CG  . PHE C 1 46  ? 67.409  82.582  1.075   1.00 36.90 ? 46  PHE C CG  1 
ATOM 2209  C CD1 . PHE C 1 46  ? 67.217  81.377  0.407   1.00 37.06 ? 46  PHE C CD1 1 
ATOM 2210  C CD2 . PHE C 1 46  ? 68.086  82.570  2.289   1.00 36.99 ? 46  PHE C CD2 1 
ATOM 2211  C CE1 . PHE C 1 46  ? 67.684  80.185  0.942   1.00 37.14 ? 46  PHE C CE1 1 
ATOM 2212  C CE2 . PHE C 1 46  ? 68.552  81.381  2.833   1.00 37.16 ? 46  PHE C CE2 1 
ATOM 2213  C CZ  . PHE C 1 46  ? 68.353  80.186  2.157   1.00 37.19 ? 46  PHE C CZ  1 
ATOM 2214  N N   . GLN C 1 47  ? 67.324  86.670  -1.465  1.00 36.77 ? 47  GLN C N   1 
ATOM 2215  C CA  . GLN C 1 47  ? 66.846  87.635  -2.466  1.00 36.82 ? 47  GLN C CA  1 
ATOM 2216  C C   . GLN C 1 47  ? 67.550  87.427  -3.810  1.00 37.07 ? 47  GLN C C   1 
ATOM 2217  O O   . GLN C 1 47  ? 66.913  87.511  -4.862  1.00 37.28 ? 47  GLN C O   1 
ATOM 2218  C CB  . GLN C 1 47  ? 67.036  89.082  -1.989  1.00 36.79 ? 47  GLN C CB  1 
ATOM 2219  C CG  . GLN C 1 47  ? 66.004  89.548  -0.970  1.00 36.85 ? 47  GLN C CG  1 
ATOM 2220  C CD  . GLN C 1 47  ? 64.723  90.068  -1.601  1.00 36.98 ? 47  GLN C CD  1 
ATOM 2221  O OE1 . GLN C 1 47  ? 64.267  89.560  -2.627  1.00 37.07 ? 47  GLN C OE1 1 
ATOM 2222  N NE2 . GLN C 1 47  ? 64.130  91.081  -0.980  1.00 37.07 ? 47  GLN C NE2 1 
ATOM 2223  N N   . GLU C 1 48  ? 68.857  87.165  -3.767  1.00 37.41 ? 48  GLU C N   1 
ATOM 2224  C CA  . GLU C 1 48  ? 69.636  86.846  -4.972  1.00 37.74 ? 48  GLU C CA  1 
ATOM 2225  C C   . GLU C 1 48  ? 69.264  85.486  -5.571  1.00 37.83 ? 48  GLU C C   1 
ATOM 2226  O O   . GLU C 1 48  ? 69.341  85.308  -6.787  1.00 38.01 ? 48  GLU C O   1 
ATOM 2227  C CB  . GLU C 1 48  ? 71.144  86.890  -4.685  1.00 38.07 ? 48  GLU C CB  1 
ATOM 2228  C CG  . GLU C 1 48  ? 71.687  88.275  -4.344  1.00 38.39 ? 48  GLU C CG  1 
ATOM 2229  C CD  . GLU C 1 48  ? 71.727  89.221  -5.536  1.00 38.68 ? 48  GLU C CD  1 
ATOM 2230  O OE1 . GLU C 1 48  ? 72.209  88.816  -6.617  1.00 38.76 ? 48  GLU C OE1 1 
ATOM 2231  O OE2 . GLU C 1 48  ? 71.287  90.382  -5.388  1.00 38.77 ? 48  GLU C OE2 1 
ATOM 2232  N N   . MET C 1 49  ? 68.876  84.531  -4.725  1.00 37.94 ? 49  MET C N   1 
ATOM 2233  C CA  . MET C 1 49  ? 68.402  83.219  -5.193  1.00 38.06 ? 49  MET C CA  1 
ATOM 2234  C C   . MET C 1 49  ? 67.039  83.302  -5.887  1.00 37.98 ? 49  MET C C   1 
ATOM 2235  O O   . MET C 1 49  ? 66.791  82.570  -6.847  1.00 38.26 ? 49  MET C O   1 
ATOM 2236  C CB  . MET C 1 49  ? 68.340  82.216  -4.039  1.00 38.24 ? 49  MET C CB  1 
ATOM 2237  C CG  . MET C 1 49  ? 69.710  81.797  -3.534  1.00 38.47 ? 49  MET C CG  1 
ATOM 2238  S SD  . MET C 1 49  ? 69.659  80.748  -2.070  1.00 38.86 ? 49  MET C SD  1 
ATOM 2239  C CE  . MET C 1 49  ? 68.796  79.316  -2.709  1.00 38.96 ? 49  MET C CE  1 
ATOM 2240  N N   . TYR C 1 50  ? 66.167  84.182  -5.400  1.00 37.79 ? 50  TYR C N   1 
ATOM 2241  C CA  . TYR C 1 50  ? 64.883  84.454  -6.057  1.00 37.80 ? 50  TYR C CA  1 
ATOM 2242  C C   . TYR C 1 50  ? 65.076  85.214  -7.376  1.00 38.04 ? 50  TYR C C   1 
ATOM 2243  O O   . TYR C 1 50  ? 64.294  85.039  -8.313  1.00 38.25 ? 50  TYR C O   1 
ATOM 2244  C CB  . TYR C 1 50  ? 63.958  85.243  -5.127  1.00 37.76 ? 50  TYR C CB  1 
ATOM 2245  C CG  . TYR C 1 50  ? 62.502  85.222  -5.538  1.00 37.79 ? 50  TYR C CG  1 
ATOM 2246  C CD1 . TYR C 1 50  ? 61.984  86.187  -6.402  1.00 37.66 ? 50  TYR C CD1 1 
ATOM 2247  C CD2 . TYR C 1 50  ? 61.633  84.247  -5.046  1.00 37.87 ? 50  TYR C CD2 1 
ATOM 2248  C CE1 . TYR C 1 50  ? 60.647  86.175  -6.772  1.00 37.67 ? 50  TYR C CE1 1 
ATOM 2249  C CE2 . TYR C 1 50  ? 60.294  84.227  -5.412  1.00 37.85 ? 50  TYR C CE2 1 
ATOM 2250  C CZ  . TYR C 1 50  ? 59.805  85.193  -6.274  1.00 37.80 ? 50  TYR C CZ  1 
ATOM 2251  O OH  . TYR C 1 50  ? 58.479  85.177  -6.642  1.00 37.98 ? 50  TYR C OH  1 
ATOM 2252  N N   . GLN C 1 51  ? 66.106  86.059  -7.432  1.00 38.31 ? 51  GLN C N   1 
ATOM 2253  C CA  . GLN C 1 51  ? 66.493  86.767  -8.660  1.00 38.55 ? 51  GLN C CA  1 
ATOM 2254  C C   . GLN C 1 51  ? 66.960  85.808  -9.765  1.00 38.78 ? 51  GLN C C   1 
ATOM 2255  O O   . GLN C 1 51  ? 66.756  86.084  -10.948 1.00 38.94 ? 51  GLN C O   1 
ATOM 2256  C CB  . GLN C 1 51  ? 67.590  87.799  -8.352  1.00 38.73 ? 51  GLN C CB  1 
ATOM 2257  C CG  . GLN C 1 51  ? 67.945  88.757  -9.485  1.00 38.88 ? 51  GLN C CG  1 
ATOM 2258  C CD  . GLN C 1 51  ? 66.832  89.731  -9.823  1.00 38.88 ? 51  GLN C CD  1 
ATOM 2259  O OE1 . GLN C 1 51  ? 66.239  90.346  -8.939  1.00 38.93 ? 51  GLN C OE1 1 
ATOM 2260  N NE2 . GLN C 1 51  ? 66.561  89.894  -11.112 1.00 38.97 ? 51  GLN C NE2 1 
ATOM 2261  N N   . ILE C 1 52  ? 67.589  84.697  -9.379  1.00 38.96 ? 52  ILE C N   1 
ATOM 2262  C CA  . ILE C 1 52  ? 67.983  83.645  -10.329 1.00 39.19 ? 52  ILE C CA  1 
ATOM 2263  C C   . ILE C 1 52  ? 66.750  82.952  -10.925 1.00 39.35 ? 52  ILE C C   1 
ATOM 2264  O O   . ILE C 1 52  ? 66.705  82.698  -12.131 1.00 39.50 ? 52  ILE C O   1 
ATOM 2265  C CB  . ILE C 1 52  ? 68.930  82.604  -9.672  1.00 39.24 ? 52  ILE C CB  1 
ATOM 2266  C CG1 . ILE C 1 52  ? 70.274  83.257  -9.322  1.00 39.33 ? 52  ILE C CG1 1 
ATOM 2267  C CG2 . ILE C 1 52  ? 69.172  81.404  -10.590 1.00 39.29 ? 52  ILE C CG2 1 
ATOM 2268  C CD1 . ILE C 1 52  ? 71.059  82.537  -8.243  1.00 39.33 ? 52  ILE C CD1 1 
ATOM 2269  N N   . ASP C 1 53  ? 65.760  82.663  -10.082 1.00 39.54 ? 53  ASP C N   1 
ATOM 2270  C CA  . ASP C 1 53  ? 64.553  81.947  -10.508 1.00 39.77 ? 53  ASP C CA  1 
ATOM 2271  C C   . ASP C 1 53  ? 63.593  82.836  -11.296 1.00 39.75 ? 53  ASP C C   1 
ATOM 2272  O O   . ASP C 1 53  ? 63.289  82.552  -12.457 1.00 39.95 ? 53  ASP C O   1 
ATOM 2273  C CB  . ASP C 1 53  ? 63.824  81.353  -9.296  1.00 40.03 ? 53  ASP C CB  1 
ATOM 2274  C CG  . ASP C 1 53  ? 64.651  80.306  -8.564  1.00 40.34 ? 53  ASP C CG  1 
ATOM 2275  O OD1 . ASP C 1 53  ? 65.879  80.238  -8.789  1.00 40.49 ? 53  ASP C OD1 1 
ATOM 2276  O OD2 . ASP C 1 53  ? 64.069  79.552  -7.755  1.00 40.58 ? 53  ASP C OD2 1 
ATOM 2277  N N   . ASN C 1 54  ? 63.133  83.913  -10.659 1.00 39.52 ? 54  ASN C N   1 
ATOM 2278  C CA  . ASN C 1 54  ? 62.035  84.739  -11.181 1.00 39.56 ? 54  ASN C CA  1 
ATOM 2279  C C   . ASN C 1 54  ? 62.452  86.010  -11.937 1.00 39.43 ? 54  ASN C C   1 
ATOM 2280  O O   . ASN C 1 54  ? 61.600  86.651  -12.556 1.00 39.61 ? 54  ASN C O   1 
ATOM 2281  C CB  . ASN C 1 54  ? 61.096  85.130  -10.034 1.00 39.76 ? 54  ASN C CB  1 
ATOM 2282  C CG  . ASN C 1 54  ? 60.428  83.930  -9.388  1.00 39.96 ? 54  ASN C CG  1 
ATOM 2283  O OD1 . ASN C 1 54  ? 59.263  83.637  -9.657  1.00 40.17 ? 54  ASN C OD1 1 
ATOM 2284  N ND2 . ASN C 1 54  ? 61.163  83.231  -8.531  1.00 40.00 ? 54  ASN C ND2 1 
ATOM 2285  N N   . ASN C 1 55  ? 63.739  86.370  -11.885 1.00 39.07 ? 55  ASN C N   1 
ATOM 2286  C CA  . ASN C 1 55  ? 64.256  87.624  -12.469 1.00 38.83 ? 55  ASN C CA  1 
ATOM 2287  C C   . ASN C 1 55  ? 63.609  88.871  -11.845 1.00 38.56 ? 55  ASN C C   1 
ATOM 2288  O O   . ASN C 1 55  ? 63.262  89.825  -12.544 1.00 38.71 ? 55  ASN C O   1 
ATOM 2289  C CB  . ASN C 1 55  ? 64.112  87.633  -14.002 1.00 39.00 ? 55  ASN C CB  1 
ATOM 2290  C CG  . ASN C 1 55  ? 64.646  86.368  -14.653 1.00 39.27 ? 55  ASN C CG  1 
ATOM 2291  O OD1 . ASN C 1 55  ? 64.000  85.788  -15.525 1.00 39.50 ? 55  ASN C OD1 1 
ATOM 2292  N ND2 . ASN C 1 55  ? 65.831  85.935  -14.232 1.00 39.40 ? 55  ASN C ND2 1 
ATOM 2293  N N   . SER C 1 56  ? 63.462  88.845  -10.520 1.00 38.22 ? 56  SER C N   1 
ATOM 2294  C CA  . SER C 1 56  ? 62.900  89.964  -9.755  1.00 37.99 ? 56  SER C CA  1 
ATOM 2295  C C   . SER C 1 56  ? 63.227  89.805  -8.268  1.00 37.53 ? 56  SER C C   1 
ATOM 2296  O O   . SER C 1 56  ? 63.852  88.820  -7.871  1.00 37.69 ? 56  SER C O   1 
ATOM 2297  C CB  . SER C 1 56  ? 61.382  90.037  -9.951  1.00 38.25 ? 56  SER C CB  1 
ATOM 2298  O OG  . SER C 1 56  ? 60.840  91.192  -9.331  1.00 38.43 ? 56  SER C OG  1 
ATOM 2299  N N   . TYR C 1 57  ? 62.818  90.783  -7.461  1.00 36.99 ? 57  TYR C N   1 
ATOM 2300  C CA  . TYR C 1 57  ? 62.972  90.724  -6.003  1.00 36.72 ? 57  TYR C CA  1 
ATOM 2301  C C   . TYR C 1 57  ? 61.609  90.613  -5.317  1.00 36.67 ? 57  TYR C C   1 
ATOM 2302  O O   . TYR C 1 57  ? 60.603  91.112  -5.825  1.00 36.63 ? 57  TYR C O   1 
ATOM 2303  C CB  . TYR C 1 57  ? 63.732  91.948  -5.490  1.00 36.60 ? 57  TYR C CB  1 
ATOM 2304  C CG  . TYR C 1 57  ? 65.200  91.956  -5.863  1.00 36.53 ? 57  TYR C CG  1 
ATOM 2305  C CD1 . TYR C 1 57  ? 66.094  91.061  -5.274  1.00 36.47 ? 57  TYR C CD1 1 
ATOM 2306  C CD2 . TYR C 1 57  ? 65.702  92.862  -6.799  1.00 36.51 ? 57  TYR C CD2 1 
ATOM 2307  C CE1 . TYR C 1 57  ? 67.442  91.062  -5.608  1.00 36.34 ? 57  TYR C CE1 1 
ATOM 2308  C CE2 . TYR C 1 57  ? 67.049  92.872  -7.140  1.00 36.42 ? 57  TYR C CE2 1 
ATOM 2309  C CZ  . TYR C 1 57  ? 67.914  91.972  -6.542  1.00 36.34 ? 57  TYR C CZ  1 
ATOM 2310  O OH  . TYR C 1 57  ? 69.248  91.976  -6.874  1.00 36.45 ? 57  TYR C OH  1 
ATOM 2311  N N   . THR C 1 58  ? 61.599  89.962  -4.155  1.00 36.59 ? 58  THR C N   1 
ATOM 2312  C CA  . THR C 1 58  ? 60.367  89.633  -3.441  1.00 36.53 ? 58  THR C CA  1 
ATOM 2313  C C   . THR C 1 58  ? 59.891  90.770  -2.546  1.00 36.66 ? 58  THR C C   1 
ATOM 2314  O O   . THR C 1 58  ? 60.680  91.346  -1.796  1.00 36.84 ? 58  THR C O   1 
ATOM 2315  C CB  . THR C 1 58  ? 60.563  88.399  -2.541  1.00 36.65 ? 58  THR C CB  1 
ATOM 2316  O OG1 . THR C 1 58  ? 61.649  88.632  -1.634  1.00 36.58 ? 58  THR C OG1 1 
ATOM 2317  C CG2 . THR C 1 58  ? 60.869  87.180  -3.376  1.00 36.74 ? 58  THR C CG2 1 
ATOM 2318  N N   . SER C 1 59  ? 58.596  91.074  -2.625  1.00 36.78 ? 59  SER C N   1 
ATOM 2319  C CA  . SER C 1 59  ? 57.946  91.987  -1.688  1.00 36.85 ? 59  SER C CA  1 
ATOM 2320  C C   . SER C 1 59  ? 57.562  91.235  -0.412  1.00 36.82 ? 59  SER C C   1 
ATOM 2321  O O   . SER C 1 59  ? 57.788  91.733  0.690   1.00 36.81 ? 59  SER C O   1 
ATOM 2322  C CB  . SER C 1 59  ? 56.703  92.614  -2.324  1.00 37.11 ? 59  SER C CB  1 
ATOM 2323  O OG  . SER C 1 59  ? 56.178  93.650  -1.510  1.00 37.24 ? 59  SER C OG  1 
ATOM 2324  N N   . ASN C 1 60  ? 56.982  90.044  -0.572  1.00 36.97 ? 60  ASN C N   1 
ATOM 2325  C CA  . ASN C 1 60  ? 56.562  89.211  0.567   1.00 37.22 ? 60  ASN C CA  1 
ATOM 2326  C C   . ASN C 1 60  ? 57.711  88.374  1.143   1.00 37.20 ? 60  ASN C C   1 
ATOM 2327  O O   . ASN C 1 60  ? 58.644  88.003  0.426   1.00 37.13 ? 60  ASN C O   1 
ATOM 2328  C CB  . ASN C 1 60  ? 55.378  88.304  0.183   1.00 37.35 ? 60  ASN C CB  1 
ATOM 2329  C CG  . ASN C 1 60  ? 55.758  87.207  -0.801  1.00 37.43 ? 60  ASN C CG  1 
ATOM 2330  O OD1 . ASN C 1 60  ? 56.588  87.409  -1.689  1.00 37.43 ? 60  ASN C OD1 1 
ATOM 2331  N ND2 . ASN C 1 60  ? 55.138  86.042  -0.652  1.00 37.57 ? 60  ASN C ND2 1 
ATOM 2332  N N   . GLN C 1 61  ? 57.620  88.080  2.439   1.00 37.16 ? 61  GLN C N   1 
ATOM 2333  C CA  . GLN C 1 61  ? 58.628  87.286  3.148   1.00 37.02 ? 61  GLN C CA  1 
ATOM 2334  C C   . GLN C 1 61  ? 58.485  85.787  2.872   1.00 36.99 ? 61  GLN C C   1 
ATOM 2335  O O   . GLN C 1 61  ? 59.488  85.073  2.819   1.00 37.14 ? 61  GLN C O   1 
ATOM 2336  C CB  . GLN C 1 61  ? 58.538  87.541  4.656   1.00 37.12 ? 61  GLN C CB  1 
ATOM 2337  C CG  . GLN C 1 61  ? 59.744  87.051  5.450   1.00 37.21 ? 61  GLN C CG  1 
ATOM 2338  C CD  . GLN C 1 61  ? 59.556  87.168  6.951   1.00 37.24 ? 61  GLN C CD  1 
ATOM 2339  O OE1 . GLN C 1 61  ? 58.783  87.996  7.436   1.00 37.27 ? 61  GLN C OE1 1 
ATOM 2340  N NE2 . GLN C 1 61  ? 60.274  86.338  7.699   1.00 37.32 ? 61  GLN C NE2 1 
ATOM 2341  N N   . ALA C 1 62  ? 57.245  85.319  2.711   1.00 36.96 ? 62  ALA C N   1 
ATOM 2342  C CA  . ALA C 1 62  ? 56.952  83.897  2.465   1.00 36.85 ? 62  ALA C CA  1 
ATOM 2343  C C   . ALA C 1 62  ? 57.641  83.316  1.225   1.00 36.78 ? 62  ALA C C   1 
ATOM 2344  O O   . ALA C 1 62  ? 57.936  82.120  1.185   1.00 36.92 ? 62  ALA C O   1 
ATOM 2345  C CB  . ALA C 1 62  ? 55.447  83.679  2.370   1.00 36.91 ? 62  ALA C CB  1 
ATOM 2346  N N   . ALA C 1 63  ? 57.882  84.158  0.219   1.00 36.84 ? 63  ALA C N   1 
ATOM 2347  C CA  . ALA C 1 63  ? 58.643  83.765  -0.971  1.00 36.91 ? 63  ALA C CA  1 
ATOM 2348  C C   . ALA C 1 63  ? 60.100  83.437  -0.637  1.00 36.82 ? 63  ALA C C   1 
ATOM 2349  O O   . ALA C 1 63  ? 60.644  82.456  -1.144  1.00 36.91 ? 63  ALA C O   1 
ATOM 2350  C CB  . ALA C 1 63  ? 58.579  84.856  -2.030  1.00 37.01 ? 63  ALA C CB  1 
ATOM 2351  N N   . LEU C 1 64  ? 60.718  84.255  0.215   1.00 36.89 ? 64  LEU C N   1 
ATOM 2352  C CA  . LEU C 1 64  ? 62.095  84.021  0.671   1.00 37.01 ? 64  LEU C CA  1 
ATOM 2353  C C   . LEU C 1 64  ? 62.210  82.793  1.580   1.00 37.02 ? 64  LEU C C   1 
ATOM 2354  O O   . LEU C 1 64  ? 63.211  82.076  1.524   1.00 37.07 ? 64  LEU C O   1 
ATOM 2355  C CB  . LEU C 1 64  ? 62.647  85.249  1.406   1.00 37.12 ? 64  LEU C CB  1 
ATOM 2356  C CG  . LEU C 1 64  ? 62.748  86.557  0.615   1.00 37.29 ? 64  LEU C CG  1 
ATOM 2357  C CD1 . LEU C 1 64  ? 63.153  87.700  1.534   1.00 37.40 ? 64  LEU C CD1 1 
ATOM 2358  C CD2 . LEU C 1 64  ? 63.727  86.427  -0.542  1.00 37.32 ? 64  LEU C CD2 1 
ATOM 2359  N N   . ILE C 1 65  ? 61.189  82.563  2.407   1.00 37.10 ? 65  ILE C N   1 
ATOM 2360  C CA  . ILE C 1 65  ? 61.159  81.412  3.322   1.00 37.16 ? 65  ILE C CA  1 
ATOM 2361  C C   . ILE C 1 65  ? 60.987  80.095  2.551   1.00 37.20 ? 65  ILE C C   1 
ATOM 2362  O O   . ILE C 1 65  ? 61.577  79.078  2.926   1.00 37.29 ? 65  ILE C O   1 
ATOM 2363  C CB  . ILE C 1 65  ? 60.052  81.561  4.402   1.00 37.23 ? 65  ILE C CB  1 
ATOM 2364  C CG1 . ILE C 1 65  ? 60.328  82.785  5.290   1.00 37.33 ? 65  ILE C CG1 1 
ATOM 2365  C CG2 . ILE C 1 65  ? 59.956  80.311  5.277   1.00 37.26 ? 65  ILE C CG2 1 
ATOM 2366  C CD1 . ILE C 1 65  ? 59.134  83.249  6.098   1.00 37.48 ? 65  ILE C CD1 1 
ATOM 2367  N N   . SER C 1 66  ? 60.187  80.120  1.485   1.00 37.26 ? 66  SER C N   1 
ATOM 2368  C CA  . SER C 1 66  ? 59.972  78.943  0.631   1.00 37.39 ? 66  SER C CA  1 
ATOM 2369  C C   . SER C 1 66  ? 61.255  78.459  -0.056  1.00 37.52 ? 66  SER C C   1 
ATOM 2370  O O   . SER C 1 66  ? 61.454  77.252  -0.216  1.00 37.55 ? 66  SER C O   1 
ATOM 2371  C CB  . SER C 1 66  ? 58.898  79.233  -0.423  1.00 37.37 ? 66  SER C CB  1 
ATOM 2372  O OG  . SER C 1 66  ? 58.546  78.060  -1.137  1.00 37.36 ? 66  SER C OG  1 
ATOM 2373  N N   . LEU C 1 67  ? 62.112  79.398  -0.459  1.00 37.78 ? 67  LEU C N   1 
ATOM 2374  C CA  . LEU C 1 67  ? 63.414  79.066  -1.064  1.00 38.04 ? 67  LEU C CA  1 
ATOM 2375  C C   . LEU C 1 67  ? 64.396  78.403  -0.090  1.00 38.13 ? 67  LEU C C   1 
ATOM 2376  O O   . LEU C 1 67  ? 65.212  77.578  -0.511  1.00 38.34 ? 67  LEU C O   1 
ATOM 2377  C CB  . LEU C 1 67  ? 64.068  80.303  -1.707  1.00 38.16 ? 67  LEU C CB  1 
ATOM 2378  C CG  . LEU C 1 67  ? 63.792  80.516  -3.200  1.00 38.40 ? 67  LEU C CG  1 
ATOM 2379  C CD1 . LEU C 1 67  ? 62.320  80.771  -3.493  1.00 38.45 ? 67  LEU C CD1 1 
ATOM 2380  C CD2 . LEU C 1 67  ? 64.640  81.664  -3.725  1.00 38.59 ? 67  LEU C CD2 1 
ATOM 2381  N N   . GLY C 1 68  ? 64.315  78.752  1.196   1.00 37.98 ? 68  GLY C N   1 
ATOM 2382  C CA  . GLY C 1 68  ? 65.231  78.207  2.208   1.00 37.88 ? 68  GLY C CA  1 
ATOM 2383  C C   . GLY C 1 68  ? 65.487  79.038  3.457   1.00 37.72 ? 68  GLY C C   1 
ATOM 2384  O O   . GLY C 1 68  ? 65.929  78.489  4.469   1.00 37.88 ? 68  GLY C O   1 
ATOM 2385  N N   . LEU C 1 69  ? 65.246  80.352  3.394   1.00 37.46 ? 69  LEU C N   1 
ATOM 2386  C CA  . LEU C 1 69  ? 65.424  81.247  4.551   1.00 37.38 ? 69  LEU C CA  1 
ATOM 2387  C C   . LEU C 1 69  ? 64.612  80.792  5.766   1.00 37.38 ? 69  LEU C C   1 
ATOM 2388  O O   . LEU C 1 69  ? 63.512  80.253  5.622   1.00 37.44 ? 69  LEU C O   1 
ATOM 2389  C CB  . LEU C 1 69  ? 65.029  82.686  4.187   1.00 37.38 ? 69  LEU C CB  1 
ATOM 2390  C CG  . LEU C 1 69  ? 65.274  83.804  5.210   1.00 37.33 ? 69  LEU C CG  1 
ATOM 2391  C CD1 . LEU C 1 69  ? 66.756  84.005  5.490   1.00 37.36 ? 69  LEU C CD1 1 
ATOM 2392  C CD2 . LEU C 1 69  ? 64.653  85.104  4.722   1.00 37.37 ? 69  LEU C CD2 1 
ATOM 2393  N N   . LYS C 1 70  ? 65.163  81.018  6.957   1.00 37.37 ? 70  LYS C N   1 
ATOM 2394  C CA  . LYS C 1 70  ? 64.504  80.644  8.210   1.00 37.30 ? 70  LYS C CA  1 
ATOM 2395  C C   . LYS C 1 70  ? 63.355  81.596  8.533   1.00 37.09 ? 70  LYS C C   1 
ATOM 2396  O O   . LYS C 1 70  ? 63.217  82.656  7.916   1.00 37.05 ? 70  LYS C O   1 
ATOM 2397  C CB  . LYS C 1 70  ? 65.505  80.646  9.370   1.00 37.51 ? 70  LYS C CB  1 
ATOM 2398  C CG  . LYS C 1 70  ? 66.645  79.652  9.221   1.00 37.82 ? 70  LYS C CG  1 
ATOM 2399  C CD  . LYS C 1 70  ? 67.482  79.585  10.490  1.00 38.07 ? 70  LYS C CD  1 
ATOM 2400  C CE  . LYS C 1 70  ? 68.609  78.569  10.373  1.00 38.26 ? 70  LYS C CE  1 
ATOM 2401  N NZ  . LYS C 1 70  ? 69.632  78.957  9.361   1.00 38.34 ? 70  LYS C NZ  1 
ATOM 2402  N N   . SER C 1 71  ? 62.535  81.205  9.507   1.00 36.84 ? 71  SER C N   1 
ATOM 2403  C CA  . SER C 1 71  ? 61.469  82.068  10.023  1.00 36.56 ? 71  SER C CA  1 
ATOM 2404  C C   . SER C 1 71  ? 62.072  83.254  10.772  1.00 36.24 ? 71  SER C C   1 
ATOM 2405  O O   . SER C 1 71  ? 63.236  83.211  11.182  1.00 36.23 ? 71  SER C O   1 
ATOM 2406  C CB  . SER C 1 71  ? 60.541  81.282  10.952  1.00 36.59 ? 71  SER C CB  1 
ATOM 2407  O OG  . SER C 1 71  ? 59.953  80.184  10.277  1.00 36.60 ? 71  SER C OG  1 
ATOM 2408  N N   . THR C 1 72  ? 61.277  84.310  10.943  1.00 35.94 ? 72  THR C N   1 
ATOM 2409  C CA  . THR C 1 72  ? 61.732  85.527  11.621  1.00 35.78 ? 72  THR C CA  1 
ATOM 2410  C C   . THR C 1 72  ? 62.179  85.192  13.052  1.00 35.65 ? 72  THR C C   1 
ATOM 2411  O O   . THR C 1 72  ? 61.473  84.457  13.748  1.00 35.81 ? 72  THR C O   1 
ATOM 2412  C CB  . THR C 1 72  ? 60.623  86.597  11.677  1.00 35.87 ? 72  THR C CB  1 
ATOM 2413  O OG1 . THR C 1 72  ? 60.051  86.768  10.374  1.00 35.93 ? 72  THR C OG1 1 
ATOM 2414  C CG2 . THR C 1 72  ? 61.176  87.935  12.162  1.00 35.94 ? 72  THR C CG2 1 
ATOM 2415  N N   . PRO C 1 73  ? 63.350  85.712  13.494  1.00 35.35 ? 73  PRO C N   1 
ATOM 2416  C CA  . PRO C 1 73  ? 63.824  85.358  14.842  1.00 35.35 ? 73  PRO C CA  1 
ATOM 2417  C C   . PRO C 1 73  ? 62.970  85.935  15.974  1.00 35.42 ? 73  PRO C C   1 
ATOM 2418  O O   . PRO C 1 73  ? 62.153  86.831  15.745  1.00 35.51 ? 73  PRO C O   1 
ATOM 2419  C CB  . PRO C 1 73  ? 65.246  85.944  14.896  1.00 35.35 ? 73  PRO C CB  1 
ATOM 2420  C CG  . PRO C 1 73  ? 65.592  86.319  13.499  1.00 35.32 ? 73  PRO C CG  1 
ATOM 2421  C CD  . PRO C 1 73  ? 64.299  86.611  12.812  1.00 35.28 ? 73  PRO C CD  1 
ATOM 2422  N N   . ALA C 1 74  ? 63.173  85.413  17.181  1.00 35.52 ? 74  ALA C N   1 
ATOM 2423  C CA  . ALA C 1 74  ? 62.409  85.836  18.356  1.00 35.57 ? 74  ALA C CA  1 
ATOM 2424  C C   . ALA C 1 74  ? 62.747  87.279  18.724  1.00 35.42 ? 74  ALA C C   1 
ATOM 2425  O O   . ALA C 1 74  ? 63.924  87.641  18.804  1.00 35.50 ? 74  ALA C O   1 
ATOM 2426  C CB  . ALA C 1 74  ? 62.684  84.912  19.533  1.00 35.68 ? 74  ALA C CB  1 
ATOM 2427  N N   . ASN C 1 75  ? 61.706  88.086  18.937  1.00 35.20 ? 75  ASN C N   1 
ATOM 2428  C CA  . ASN C 1 75  ? 61.832  89.516  19.253  1.00 35.04 ? 75  ASN C CA  1 
ATOM 2429  C C   . ASN C 1 75  ? 62.549  90.312  18.150  1.00 34.83 ? 75  ASN C C   1 
ATOM 2430  O O   . ASN C 1 75  ? 63.359  91.197  18.440  1.00 34.81 ? 75  ASN C O   1 
ATOM 2431  C CB  . ASN C 1 75  ? 62.522  89.718  20.614  1.00 35.14 ? 75  ASN C CB  1 
ATOM 2432  C CG  . ASN C 1 75  ? 61.910  88.873  21.718  1.00 35.37 ? 75  ASN C CG  1 
ATOM 2433  O OD1 . ASN C 1 75  ? 60.709  88.599  21.717  1.00 35.52 ? 75  ASN C OD1 1 
ATOM 2434  N ND2 . ASN C 1 75  ? 62.738  88.460  22.671  1.00 35.47 ? 75  ASN C ND2 1 
ATOM 2435  N N   . VAL C 1 76  ? 62.240  89.986  16.893  1.00 34.65 ? 76  VAL C N   1 
ATOM 2436  C CA  . VAL C 1 76  ? 62.778  90.687  15.719  1.00 34.49 ? 76  VAL C CA  1 
ATOM 2437  C C   . VAL C 1 76  ? 61.626  91.030  14.776  1.00 34.47 ? 76  VAL C C   1 
ATOM 2438  O O   . VAL C 1 76  ? 60.767  90.188  14.504  1.00 34.47 ? 76  VAL C O   1 
ATOM 2439  C CB  . VAL C 1 76  ? 63.830  89.833  14.973  1.00 34.35 ? 76  VAL C CB  1 
ATOM 2440  C CG1 . VAL C 1 76  ? 64.290  90.519  13.686  1.00 34.32 ? 76  VAL C CG1 1 
ATOM 2441  C CG2 . VAL C 1 76  ? 65.022  89.554  15.876  1.00 34.40 ? 76  VAL C CG2 1 
ATOM 2442  N N   . THR C 1 77  ? 61.625  92.269  14.282  1.00 34.42 ? 77  THR C N   1 
ATOM 2443  C CA  . THR C 1 77  ? 60.580  92.777  13.394  1.00 34.40 ? 77  THR C CA  1 
ATOM 2444  C C   . THR C 1 77  ? 61.132  92.996  11.987  1.00 34.33 ? 77  THR C C   1 
ATOM 2445  O O   . THR C 1 77  ? 61.452  94.121  11.595  1.00 34.35 ? 77  THR C O   1 
ATOM 2446  C CB  . THR C 1 77  ? 59.988  94.093  13.934  1.00 34.48 ? 77  THR C CB  1 
ATOM 2447  O OG1 . THR C 1 77  ? 61.042  95.033  14.171  1.00 34.42 ? 77  THR C OG1 1 
ATOM 2448  C CG2 . THR C 1 77  ? 59.236  93.844  15.233  1.00 34.60 ? 77  THR C CG2 1 
ATOM 2449  N N   . PHE C 1 78  ? 61.249  91.899  11.242  1.00 34.32 ? 78  PHE C N   1 
ATOM 2450  C CA  . PHE C 1 78  ? 61.659  91.937  9.838   1.00 34.26 ? 78  PHE C CA  1 
ATOM 2451  C C   . PHE C 1 78  ? 60.492  92.425  8.982   1.00 34.03 ? 78  PHE C C   1 
ATOM 2452  O O   . PHE C 1 78  ? 59.346  92.030  9.207   1.00 34.15 ? 78  PHE C O   1 
ATOM 2453  C CB  . PHE C 1 78  ? 62.108  90.544  9.376   1.00 34.49 ? 78  PHE C CB  1 
ATOM 2454  C CG  . PHE C 1 78  ? 62.556  90.488  7.941   1.00 34.68 ? 78  PHE C CG  1 
ATOM 2455  C CD1 . PHE C 1 78  ? 63.847  90.862  7.585   1.00 34.79 ? 78  PHE C CD1 1 
ATOM 2456  C CD2 . PHE C 1 78  ? 61.688  90.049  6.942   1.00 34.80 ? 78  PHE C CD2 1 
ATOM 2457  C CE1 . PHE C 1 78  ? 64.263  90.808  6.261   1.00 34.94 ? 78  PHE C CE1 1 
ATOM 2458  C CE2 . PHE C 1 78  ? 62.098  89.992  5.618   1.00 34.93 ? 78  PHE C CE2 1 
ATOM 2459  C CZ  . PHE C 1 78  ? 63.387  90.372  5.276   1.00 34.99 ? 78  PHE C CZ  1 
ATOM 2460  N N   . SER C 1 79  ? 60.792  93.280  8.006   1.00 33.69 ? 79  SER C N   1 
ATOM 2461  C CA  . SER C 1 79  ? 59.766  93.873  7.147   1.00 33.53 ? 79  SER C CA  1 
ATOM 2462  C C   . SER C 1 79  ? 60.376  94.454  5.871   1.00 33.30 ? 79  SER C C   1 
ATOM 2463  O O   . SER C 1 79  ? 61.145  95.415  5.929   1.00 33.36 ? 79  SER C O   1 
ATOM 2464  C CB  . SER C 1 79  ? 59.018  94.971  7.910   1.00 33.61 ? 79  SER C CB  1 
ATOM 2465  O OG  . SER C 1 79  ? 58.030  95.587  7.100   1.00 33.71 ? 79  SER C OG  1 
ATOM 2466  N N   . ILE C 1 80  ? 60.021  93.871  4.726   1.00 33.07 ? 80  ILE C N   1 
ATOM 2467  C CA  . ILE C 1 80  ? 60.496  94.347  3.427   1.00 32.89 ? 80  ILE C CA  1 
ATOM 2468  C C   . ILE C 1 80  ? 59.655  95.559  3.027   1.00 32.77 ? 80  ILE C C   1 
ATOM 2469  O O   . ILE C 1 80  ? 58.429  95.465  2.941   1.00 32.79 ? 80  ILE C O   1 
ATOM 2470  C CB  . ILE C 1 80  ? 60.403  93.252  2.337   1.00 32.91 ? 80  ILE C CB  1 
ATOM 2471  C CG1 . ILE C 1 80  ? 61.246  92.028  2.728   1.00 32.96 ? 80  ILE C CG1 1 
ATOM 2472  C CG2 . ILE C 1 80  ? 60.851  93.801  0.981   1.00 32.94 ? 80  ILE C CG2 1 
ATOM 2473  C CD1 . ILE C 1 80  ? 60.977  90.787  1.901   1.00 33.00 ? 80  ILE C CD1 1 
ATOM 2474  N N   . VAL C 1 81  ? 60.322  96.689  2.789   1.00 32.73 ? 81  VAL C N   1 
ATOM 2475  C CA  . VAL C 1 81  ? 59.654  97.944  2.434   1.00 32.76 ? 81  VAL C CA  1 
ATOM 2476  C C   . VAL C 1 81  ? 59.114  97.866  1.011   1.00 32.87 ? 81  VAL C C   1 
ATOM 2477  O O   . VAL C 1 81  ? 57.913  98.031  0.783   1.00 32.99 ? 81  VAL C O   1 
ATOM 2478  C CB  . VAL C 1 81  ? 60.615  99.152  2.568   1.00 32.81 ? 81  VAL C CB  1 
ATOM 2479  C CG1 . VAL C 1 81  ? 60.009  100.425 1.980   1.00 32.88 ? 81  VAL C CG1 1 
ATOM 2480  C CG2 . VAL C 1 81  ? 60.991  99.366  4.028   1.00 32.82 ? 81  VAL C CG2 1 
ATOM 2481  N N   . SER C 1 82  ? 60.017  97.623  0.066   1.00 32.95 ? 82  SER C N   1 
ATOM 2482  C CA  . SER C 1 82  ? 59.671  97.535  -1.352  1.00 33.10 ? 82  SER C CA  1 
ATOM 2483  C C   . SER C 1 82  ? 60.693  96.695  -2.107  1.00 33.16 ? 82  SER C C   1 
ATOM 2484  O O   . SER C 1 82  ? 61.820  96.506  -1.642  1.00 33.23 ? 82  SER C O   1 
ATOM 2485  C CB  . SER C 1 82  ? 59.584  98.934  -1.966  1.00 33.14 ? 82  SER C CB  1 
ATOM 2486  O OG  . SER C 1 82  ? 60.792  99.652  -1.779  1.00 33.18 ? 82  SER C OG  1 
ATOM 2487  N N   . ALA C 1 83  ? 60.286  96.197  -3.271  1.00 33.30 ? 83  ALA C N   1 
ATOM 2488  C CA  . ALA C 1 83  ? 61.139  95.344  -4.096  1.00 33.46 ? 83  ALA C CA  1 
ATOM 2489  C C   . ALA C 1 83  ? 60.740  95.419  -5.567  1.00 33.71 ? 83  ALA C C   1 
ATOM 2490  O O   . ALA C 1 83  ? 59.837  94.708  -6.014  1.00 33.85 ? 83  ALA C O   1 
ATOM 2491  C CB  . ALA C 1 83  ? 61.079  93.908  -3.598  1.00 33.47 ? 83  ALA C CB  1 
ATOM 2492  N N   . SER C 1 84  ? 61.420  96.292  -6.308  1.00 34.04 ? 84  SER C N   1 
ATOM 2493  C CA  . SER C 1 84  ? 61.246  96.401  -7.755  1.00 34.33 ? 84  SER C CA  1 
ATOM 2494  C C   . SER C 1 84  ? 62.001  95.272  -8.460  1.00 34.53 ? 84  SER C C   1 
ATOM 2495  O O   . SER C 1 84  ? 62.630  94.435  -7.807  1.00 34.55 ? 84  SER C O   1 
ATOM 2496  C CB  . SER C 1 84  ? 61.734  97.770  -8.246  1.00 34.48 ? 84  SER C CB  1 
ATOM 2497  O OG  . SER C 1 84  ? 63.137  97.909  -8.091  1.00 34.54 ? 84  SER C OG  1 
ATOM 2498  N N   . ALA C 1 85  ? 61.930  95.247  -9.789  1.00 35.05 ? 85  ALA C N   1 
ATOM 2499  C CA  . ALA C 1 85  ? 62.611  94.228  -10.594 1.00 35.50 ? 85  ALA C CA  1 
ATOM 2500  C C   . ALA C 1 85  ? 64.128  94.182  -10.374 1.00 35.79 ? 85  ALA C C   1 
ATOM 2501  O O   . ALA C 1 85  ? 64.710  93.096  -10.336 1.00 35.91 ? 85  ALA C O   1 
ATOM 2502  C CB  . ALA C 1 85  ? 62.306  94.435  -12.072 1.00 35.61 ? 85  ALA C CB  1 
ATOM 2503  N N   . ASN C 1 86  ? 64.751  95.353  -10.228 1.00 36.15 ? 86  ASN C N   1 
ATOM 2504  C CA  . ASN C 1 86  ? 66.212  95.467  -10.101 1.00 36.49 ? 86  ASN C CA  1 
ATOM 2505  C C   . ASN C 1 86  ? 66.679  96.180  -8.817  1.00 36.55 ? 86  ASN C C   1 
ATOM 2506  O O   . ASN C 1 86  ? 67.773  96.752  -8.791  1.00 36.63 ? 86  ASN C O   1 
ATOM 2507  C CB  . ASN C 1 86  ? 66.780  96.182  -11.335 1.00 36.84 ? 86  ASN C CB  1 
ATOM 2508  C CG  . ASN C 1 86  ? 66.419  95.483  -12.635 1.00 37.16 ? 86  ASN C CG  1 
ATOM 2509  O OD1 . ASN C 1 86  ? 65.249  95.405  -13.007 1.00 37.25 ? 86  ASN C OD1 1 
ATOM 2510  N ND2 . ASN C 1 86  ? 67.429  94.983  -13.339 1.00 37.45 ? 86  ASN C ND2 1 
ATOM 2511  N N   . SER C 1 87  ? 65.868  96.139  -7.758  1.00 36.55 ? 87  SER C N   1 
ATOM 2512  C CA  . SER C 1 87  ? 66.256  96.702  -6.455  1.00 36.52 ? 87  SER C CA  1 
ATOM 2513  C C   . SER C 1 87  ? 65.398  96.164  -5.308  1.00 36.58 ? 87  SER C C   1 
ATOM 2514  O O   . SER C 1 87  ? 64.388  95.492  -5.534  1.00 36.60 ? 87  SER C O   1 
ATOM 2515  C CB  . SER C 1 87  ? 66.164  98.233  -6.479  1.00 36.53 ? 87  SER C CB  1 
ATOM 2516  O OG  . SER C 1 87  ? 66.695  98.796  -5.291  1.00 36.60 ? 87  SER C OG  1 
ATOM 2517  N N   . TYR C 1 88  ? 65.819  96.465  -4.081  1.00 36.69 ? 88  TYR C N   1 
ATOM 2518  C CA  . TYR C 1 88  ? 65.051  96.127  -2.876  1.00 36.75 ? 88  TYR C CA  1 
ATOM 2519  C C   . TYR C 1 88  ? 65.446  96.979  -1.670  1.00 37.06 ? 88  TYR C C   1 
ATOM 2520  O O   . TYR C 1 88  ? 66.507  97.608  -1.659  1.00 37.14 ? 88  TYR C O   1 
ATOM 2521  C CB  . TYR C 1 88  ? 65.194  94.636  -2.537  1.00 36.59 ? 88  TYR C CB  1 
ATOM 2522  C CG  . TYR C 1 88  ? 66.613  94.180  -2.263  1.00 36.51 ? 88  TYR C CG  1 
ATOM 2523  C CD1 . TYR C 1 88  ? 67.158  94.253  -0.980  1.00 36.43 ? 88  TYR C CD1 1 
ATOM 2524  C CD2 . TYR C 1 88  ? 67.409  93.659  -3.284  1.00 36.53 ? 88  TYR C CD2 1 
ATOM 2525  C CE1 . TYR C 1 88  ? 68.455  93.833  -0.724  1.00 36.37 ? 88  TYR C CE1 1 
ATOM 2526  C CE2 . TYR C 1 88  ? 68.708  93.235  -3.037  1.00 36.49 ? 88  TYR C CE2 1 
ATOM 2527  C CZ  . TYR C 1 88  ? 69.227  93.324  -1.756  1.00 36.40 ? 88  TYR C CZ  1 
ATOM 2528  O OH  . TYR C 1 88  ? 70.512  92.907  -1.506  1.00 36.43 ? 88  TYR C OH  1 
ATOM 2529  N N   . CYS C 1 89  ? 64.573  96.990  -0.665  1.00 37.62 ? 89  CYS C N   1 
ATOM 2530  C CA  . CYS C 1 89  ? 64.811  97.690  0.600   1.00 38.04 ? 89  CYS C CA  1 
ATOM 2531  C C   . CYS C 1 89  ? 64.174  96.890  1.737   1.00 37.48 ? 89  CYS C C   1 
ATOM 2532  O O   . CYS C 1 89  ? 62.958  96.692  1.748   1.00 37.51 ? 89  CYS C O   1 
ATOM 2533  C CB  . CYS C 1 89  ? 64.223  99.102  0.548   1.00 39.02 ? 89  CYS C CB  1 
ATOM 2534  S SG  . CYS C 1 89  ? 64.418  100.058 2.073   1.00 40.38 ? 89  CYS C SG  1 
ATOM 2535  N N   . MET C 1 90  ? 65.000  96.440  2.684   1.00 36.81 ? 90  MET C N   1 
ATOM 2536  C CA  . MET C 1 90  ? 64.556  95.591  3.791   1.00 36.33 ? 90  MET C CA  1 
ATOM 2537  C C   . MET C 1 90  ? 65.028  96.163  5.128   1.00 35.96 ? 90  MET C C   1 
ATOM 2538  O O   . MET C 1 90  ? 66.225  96.158  5.425   1.00 35.94 ? 90  MET C O   1 
ATOM 2539  C CB  . MET C 1 90  ? 65.089  94.164  3.614   1.00 36.33 ? 90  MET C CB  1 
ATOM 2540  C CG  . MET C 1 90  ? 64.822  93.559  2.244   1.00 36.32 ? 90  MET C CG  1 
ATOM 2541  S SD  . MET C 1 90  ? 65.189  91.795  2.170   1.00 36.31 ? 90  MET C SD  1 
ATOM 2542  C CE  . MET C 1 90  ? 66.959  91.797  2.438   1.00 36.30 ? 90  MET C CE  1 
ATOM 2543  N N   . ILE C 1 91  ? 64.079  96.664  5.920   1.00 35.57 ? 91  ILE C N   1 
ATOM 2544  C CA  . ILE C 1 91  ? 64.348  97.159  7.271   1.00 35.27 ? 91  ILE C CA  1 
ATOM 2545  C C   . ILE C 1 91  ? 64.103  96.028  8.274   1.00 34.97 ? 91  ILE C C   1 
ATOM 2546  O O   . ILE C 1 91  ? 63.157  95.252  8.125   1.00 35.06 ? 91  ILE C O   1 
ATOM 2547  C CB  . ILE C 1 91  ? 63.442  98.363  7.628   1.00 35.34 ? 91  ILE C CB  1 
ATOM 2548  C CG1 . ILE C 1 91  ? 63.564  99.481  6.578   1.00 35.48 ? 91  ILE C CG1 1 
ATOM 2549  C CG2 . ILE C 1 91  ? 63.758  98.889  9.028   1.00 35.37 ? 91  ILE C CG2 1 
ATOM 2550  C CD1 . ILE C 1 91  ? 64.950  100.079 6.425   1.00 35.54 ? 91  ILE C CD1 1 
ATOM 2551  N N   . ALA C 1 92  ? 64.963  95.943  9.287   1.00 34.64 ? 92  ALA C N   1 
ATOM 2552  C CA  . ALA C 1 92  ? 64.813  94.964  10.366  1.00 34.42 ? 92  ALA C CA  1 
ATOM 2553  C C   . ALA C 1 92  ? 65.513  95.441  11.636  1.00 34.21 ? 92  ALA C C   1 
ATOM 2554  O O   . ALA C 1 92  ? 66.503  96.175  11.571  1.00 34.13 ? 92  ALA C O   1 
ATOM 2555  C CB  . ALA C 1 92  ? 65.362  93.611  9.937   1.00 34.49 ? 92  ALA C CB  1 
ATOM 2556  N N   . GLY C 1 93  ? 64.991  95.017  12.784  1.00 34.02 ? 93  GLY C N   1 
ATOM 2557  C CA  . GLY C 1 93  ? 65.529  95.424  14.081  1.00 33.89 ? 93  GLY C CA  1 
ATOM 2558  C C   . GLY C 1 93  ? 65.027  94.576  15.235  1.00 33.77 ? 93  GLY C C   1 
ATOM 2559  O O   . GLY C 1 93  ? 63.933  94.012  15.173  1.00 33.83 ? 93  GLY C O   1 
ATOM 2560  N N   . HIS C 1 94  ? 65.839  94.499  16.288  1.00 33.62 ? 94  HIS C N   1 
ATOM 2561  C CA  . HIS C 1 94  ? 65.498  93.766  17.506  1.00 33.49 ? 94  HIS C CA  1 
ATOM 2562  C C   . HIS C 1 94  ? 64.819  94.735  18.475  1.00 33.50 ? 94  HIS C C   1 
ATOM 2563  O O   . HIS C 1 94  ? 65.096  95.936  18.452  1.00 33.61 ? 94  HIS C O   1 
ATOM 2564  C CB  . HIS C 1 94  ? 66.765  93.174  18.134  1.00 33.42 ? 94  HIS C CB  1 
ATOM 2565  C CG  . HIS C 1 94  ? 66.527  91.927  18.927  1.00 33.39 ? 94  HIS C CG  1 
ATOM 2566  N ND1 . HIS C 1 94  ? 66.782  90.667  18.429  1.00 33.41 ? 94  HIS C ND1 1 
ATOM 2567  C CD2 . HIS C 1 94  ? 66.030  91.745  20.173  1.00 33.38 ? 94  HIS C CD2 1 
ATOM 2568  C CE1 . HIS C 1 94  ? 66.465  89.765  19.340  1.00 33.44 ? 94  HIS C CE1 1 
ATOM 2569  N NE2 . HIS C 1 94  ? 66.009  90.393  20.408  1.00 33.41 ? 94  HIS C NE2 1 
ATOM 2570  N N   . SER C 1 95  ? 63.934  94.211  19.321  1.00 33.42 ? 95  SER C N   1 
ATOM 2571  C CA  . SER C 1 95  ? 63.179  95.040  20.271  1.00 33.30 ? 95  SER C CA  1 
ATOM 2572  C C   . SER C 1 95  ? 64.089  95.666  21.328  1.00 33.15 ? 95  SER C C   1 
ATOM 2573  O O   . SER C 1 95  ? 63.958  96.852  21.635  1.00 33.23 ? 95  SER C O   1 
ATOM 2574  C CB  . SER C 1 95  ? 62.070  94.226  20.945  1.00 33.39 ? 95  SER C CB  1 
ATOM 2575  O OG  . SER C 1 95  ? 62.605  93.144  21.684  1.00 33.47 ? 95  SER C OG  1 
ATOM 2576  N N   . GLY C 1 96  ? 64.999  94.858  21.875  1.00 32.96 ? 96  GLY C N   1 
ATOM 2577  C CA  . GLY C 1 96  ? 66.043  95.334  22.789  1.00 32.84 ? 96  GLY C CA  1 
ATOM 2578  C C   . GLY C 1 96  ? 67.410  95.391  22.132  1.00 32.59 ? 96  GLY C C   1 
ATOM 2579  O O   . GLY C 1 96  ? 68.386  94.868  22.676  1.00 32.56 ? 96  GLY C O   1 
ATOM 2580  N N   . GLY C 1 97  ? 67.474  96.027  20.962  1.00 32.33 ? 97  GLY C N   1 
ATOM 2581  C CA  . GLY C 1 97  ? 68.725  96.246  20.236  1.00 32.11 ? 97  GLY C CA  1 
ATOM 2582  C C   . GLY C 1 97  ? 69.214  97.670  20.426  1.00 31.91 ? 97  GLY C C   1 
ATOM 2583  O O   . GLY C 1 97  ? 68.913  98.305  21.441  1.00 31.98 ? 97  GLY C O   1 
ATOM 2584  N N   . THR C 1 98  ? 69.966  98.164  19.444  1.00 31.56 ? 98  THR C N   1 
ATOM 2585  C CA  . THR C 1 98  ? 70.491  99.531  19.454  1.00 31.30 ? 98  THR C CA  1 
ATOM 2586  C C   . THR C 1 98  ? 69.742  100.411 18.458  1.00 31.00 ? 98  THR C C   1 
ATOM 2587  O O   . THR C 1 98  ? 69.143  101.419 18.842  1.00 31.05 ? 98  THR C O   1 
ATOM 2588  C CB  . THR C 1 98  ? 71.994  99.553  19.117  1.00 31.35 ? 98  THR C CB  1 
ATOM 2589  O OG1 . THR C 1 98  ? 72.213  98.928  17.846  1.00 31.30 ? 98  THR C OG1 1 
ATOM 2590  C CG2 . THR C 1 98  ? 72.787  98.820  20.188  1.00 31.42 ? 98  THR C CG2 1 
ATOM 2591  N N   . VAL C 1 99  ? 69.785  100.021 17.185  1.00 30.61 ? 99  VAL C N   1 
ATOM 2592  C CA  . VAL C 1 99  ? 69.141  100.762 16.094  1.00 30.35 ? 99  VAL C CA  1 
ATOM 2593  C C   . VAL C 1 99  ? 68.587  99.814  15.030  1.00 30.06 ? 99  VAL C C   1 
ATOM 2594  O O   . VAL C 1 99  ? 68.901  98.621  15.024  1.00 30.16 ? 99  VAL C O   1 
ATOM 2595  C CB  . VAL C 1 99  ? 70.121  101.759 15.424  1.00 30.45 ? 99  VAL C CB  1 
ATOM 2596  C CG1 . VAL C 1 99  ? 70.349  102.974 16.312  1.00 30.52 ? 99  VAL C CG1 1 
ATOM 2597  C CG2 . VAL C 1 99  ? 71.449  101.091 15.080  1.00 30.52 ? 99  VAL C CG2 1 
ATOM 2598  N N   . TRP C 1 100 ? 67.764  100.357 14.136  1.00 29.73 ? 100 TRP C N   1 
ATOM 2599  C CA  . TRP C 1 100 ? 67.242  99.605  12.993  1.00 29.57 ? 100 TRP C CA  1 
ATOM 2600  C C   . TRP C 1 100 ? 68.340  99.398  11.953  1.00 29.76 ? 100 TRP C C   1 
ATOM 2601  O O   . TRP C 1 100 ? 69.212  100.253 11.784  1.00 29.91 ? 100 TRP C O   1 
ATOM 2602  C CB  . TRP C 1 100 ? 66.063  100.337 12.347  1.00 29.37 ? 100 TRP C CB  1 
ATOM 2603  C CG  . TRP C 1 100 ? 64.853  100.418 13.218  1.00 29.17 ? 100 TRP C CG  1 
ATOM 2604  C CD1 . TRP C 1 100 ? 64.567  101.385 14.137  1.00 29.08 ? 100 TRP C CD1 1 
ATOM 2605  C CD2 . TRP C 1 100 ? 63.756  99.499  13.249  1.00 28.95 ? 100 TRP C CD2 1 
ATOM 2606  N NE1 . TRP C 1 100 ? 63.361  101.124 14.741  1.00 28.98 ? 100 TRP C NE1 1 
ATOM 2607  C CE2 . TRP C 1 100 ? 62.842  99.972  14.215  1.00 28.90 ? 100 TRP C CE2 1 
ATOM 2608  C CE3 . TRP C 1 100 ? 63.459  98.319  12.554  1.00 28.91 ? 100 TRP C CE3 1 
ATOM 2609  C CZ2 . TRP C 1 100 ? 61.646  99.306  14.506  1.00 28.93 ? 100 TRP C CZ2 1 
ATOM 2610  C CZ3 . TRP C 1 100 ? 62.269  97.655  12.844  1.00 28.95 ? 100 TRP C CZ3 1 
ATOM 2611  C CH2 . TRP C 1 100 ? 61.378  98.154  13.813  1.00 28.96 ? 100 TRP C CH2 1 
ATOM 2612  N N   . PHE C 1 101 ? 68.285  98.258  11.266  1.00 29.96 ? 101 PHE C N   1 
ATOM 2613  C CA  . PHE C 1 101 ? 69.250  97.906  10.225  1.00 30.13 ? 101 PHE C CA  1 
ATOM 2614  C C   . PHE C 1 101 ? 68.539  97.815  8.879   1.00 30.19 ? 101 PHE C C   1 
ATOM 2615  O O   . PHE C 1 101 ? 67.554  97.088  8.748   1.00 30.31 ? 101 PHE C O   1 
ATOM 2616  C CB  . PHE C 1 101 ? 69.905  96.560  10.537  1.00 30.32 ? 101 PHE C CB  1 
ATOM 2617  C CG  . PHE C 1 101 ? 70.895  96.603  11.668  1.00 30.39 ? 101 PHE C CG  1 
ATOM 2618  C CD1 . PHE C 1 101 ? 70.464  96.695  12.988  1.00 30.53 ? 101 PHE C CD1 1 
ATOM 2619  C CD2 . PHE C 1 101 ? 72.264  96.525  11.418  1.00 30.42 ? 101 PHE C CD2 1 
ATOM 2620  C CE1 . PHE C 1 101 ? 71.376  96.727  14.034  1.00 30.59 ? 101 PHE C CE1 1 
ATOM 2621  C CE2 . PHE C 1 101 ? 73.179  96.553  12.460  1.00 30.54 ? 101 PHE C CE2 1 
ATOM 2622  C CZ  . PHE C 1 101 ? 72.735  96.656  13.770  1.00 30.60 ? 101 PHE C CZ  1 
ATOM 2623  N N   . ALA C 1 102 ? 69.043  98.555  7.892   1.00 30.37 ? 102 ALA C N   1 
ATOM 2624  C CA  . ALA C 1 102 ? 68.541  98.492  6.518   1.00 30.57 ? 102 ALA C CA  1 
ATOM 2625  C C   . ALA C 1 102 ? 69.314  97.446  5.721   1.00 30.78 ? 102 ALA C C   1 
ATOM 2626  O O   . ALA C 1 102 ? 70.318  96.908  6.197   1.00 30.81 ? 102 ALA C O   1 
ATOM 2627  C CB  . ALA C 1 102 ? 68.656  99.854  5.853   1.00 30.60 ? 102 ALA C CB  1 
ATOM 2628  N N   . ALA C 1 103 ? 68.837  97.162  4.511   1.00 31.11 ? 103 ALA C N   1 
ATOM 2629  C CA  . ALA C 1 103 ? 69.479  96.183  3.630   1.00 31.41 ? 103 ALA C CA  1 
ATOM 2630  C C   . ALA C 1 103 ? 69.070  96.389  2.168   1.00 31.72 ? 103 ALA C C   1 
ATOM 2631  O O   . ALA C 1 103 ? 67.975  95.994  1.761   1.00 31.76 ? 103 ALA C O   1 
ATOM 2632  C CB  . ALA C 1 103 ? 69.152  94.769  4.084   1.00 31.43 ? 103 ALA C CB  1 
ATOM 2633  N N   . THR C 1 104 ? 69.961  97.017  1.401   1.00 32.08 ? 104 THR C N   1 
ATOM 2634  C CA  . THR C 1 104 ? 69.768  97.277  -0.029  1.00 32.34 ? 104 THR C CA  1 
ATOM 2635  C C   . THR C 1 104 ? 70.902  96.598  -0.805  1.00 32.69 ? 104 THR C C   1 
ATOM 2636  O O   . THR C 1 104 ? 71.917  96.234  -0.203  1.00 32.83 ? 104 THR C O   1 
ATOM 2637  C CB  . THR C 1 104 ? 69.773  98.796  -0.318  1.00 32.41 ? 104 THR C CB  1 
ATOM 2638  O OG1 . THR C 1 104 ? 71.109  99.308  -0.241  1.00 32.45 ? 104 THR C OG1 1 
ATOM 2639  C CG2 . THR C 1 104 ? 68.896  99.540  0.676   1.00 32.50 ? 104 THR C CG2 1 
ATOM 2640  N N   . PRO C 1 105 ? 70.743  96.419  -2.136  1.00 33.13 ? 105 PRO C N   1 
ATOM 2641  C CA  . PRO C 1 105 ? 71.817  95.761  -2.896  1.00 33.45 ? 105 PRO C CA  1 
ATOM 2642  C C   . PRO C 1 105 ? 73.076  96.617  -3.078  1.00 33.95 ? 105 PRO C C   1 
ATOM 2643  O O   . PRO C 1 105 ? 74.184  96.086  -2.979  1.00 34.10 ? 105 PRO C O   1 
ATOM 2644  C CB  . PRO C 1 105 ? 71.169  95.431  -4.249  1.00 33.34 ? 105 PRO C CB  1 
ATOM 2645  C CG  . PRO C 1 105 ? 69.917  96.225  -4.327  1.00 33.31 ? 105 PRO C CG  1 
ATOM 2646  C CD  . PRO C 1 105 ? 69.615  96.832  -2.992  1.00 33.23 ? 105 PRO C CD  1 
ATOM 2647  N N   . ASP C 1 106 ? 72.907  97.915  -3.337  1.00 34.61 ? 106 ASP C N   1 
ATOM 2648  C CA  . ASP C 1 106 ? 74.049  98.816  -3.567  1.00 35.22 ? 106 ASP C CA  1 
ATOM 2649  C C   . ASP C 1 106 ? 74.870  99.116  -2.304  1.00 35.56 ? 106 ASP C C   1 
ATOM 2650  O O   . ASP C 1 106 ? 76.102  99.125  -2.362  1.00 35.76 ? 106 ASP C O   1 
ATOM 2651  C CB  . ASP C 1 106 ? 73.610  100.121 -4.263  1.00 35.53 ? 106 ASP C CB  1 
ATOM 2652  C CG  . ASP C 1 106 ? 72.715  100.998 -3.394  1.00 35.77 ? 106 ASP C CG  1 
ATOM 2653  O OD1 . ASP C 1 106 ? 71.933  100.451 -2.585  1.00 35.93 ? 106 ASP C OD1 1 
ATOM 2654  O OD2 . ASP C 1 106 ? 72.792  102.238 -3.530  1.00 35.86 ? 106 ASP C OD2 1 
ATOM 2655  N N   . LYS C 1 107 ? 74.194  99.348  -1.179  1.00 35.96 ? 107 LYS C N   1 
ATOM 2656  C CA  . LYS C 1 107 ? 74.859  99.683  0.090   1.00 36.36 ? 107 LYS C CA  1 
ATOM 2657  C C   . LYS C 1 107 ? 75.107  98.475  1.002   1.00 36.64 ? 107 LYS C C   1 
ATOM 2658  O O   . LYS C 1 107 ? 75.853  98.586  1.977   1.00 36.62 ? 107 LYS C O   1 
ATOM 2659  C CB  . LYS C 1 107 ? 74.050  100.736 0.853   1.00 36.45 ? 107 LYS C CB  1 
ATOM 2660  C CG  . LYS C 1 107 ? 73.917  102.064 0.125   1.00 36.66 ? 107 LYS C CG  1 
ATOM 2661  C CD  . LYS C 1 107 ? 73.058  103.056 0.895   1.00 36.88 ? 107 LYS C CD  1 
ATOM 2662  C CE  . LYS C 1 107 ? 73.794  103.643 2.090   1.00 37.03 ? 107 LYS C CE  1 
ATOM 2663  N NZ  . LYS C 1 107 ? 72.991  104.691 2.778   1.00 37.12 ? 107 LYS C NZ  1 
ATOM 2664  N N   . GLY C 1 108 ? 74.489  97.333  0.692   1.00 37.06 ? 108 GLY C N   1 
ATOM 2665  C CA  . GLY C 1 108 ? 74.590  96.137  1.530   1.00 37.38 ? 108 GLY C CA  1 
ATOM 2666  C C   . GLY C 1 108 ? 73.750  96.274  2.787   1.00 37.66 ? 108 GLY C C   1 
ATOM 2667  O O   . GLY C 1 108 ? 72.792  97.048  2.814   1.00 37.75 ? 108 GLY C O   1 
ATOM 2668  N N   . VAL C 1 109 ? 74.112  95.517  3.820   1.00 38.04 ? 109 VAL C N   1 
ATOM 2669  C CA  . VAL C 1 109 ? 73.444  95.586  5.123   1.00 38.33 ? 109 VAL C CA  1 
ATOM 2670  C C   . VAL C 1 109 ? 74.165  96.623  5.986   1.00 38.62 ? 109 VAL C C   1 
ATOM 2671  O O   . VAL C 1 109 ? 75.346  96.455  6.297   1.00 38.77 ? 109 VAL C O   1 
ATOM 2672  C CB  . VAL C 1 109 ? 73.443  94.216  5.838   1.00 38.50 ? 109 VAL C CB  1 
ATOM 2673  C CG1 . VAL C 1 109 ? 72.730  94.305  7.186   1.00 38.57 ? 109 VAL C CG1 1 
ATOM 2674  C CG2 . VAL C 1 109 ? 72.798  93.153  4.953   1.00 38.56 ? 109 VAL C CG2 1 
ATOM 2675  N N   . TYR C 1 110 ? 73.452  97.687  6.358   1.00 38.99 ? 110 TYR C N   1 
ATOM 2676  C CA  . TYR C 1 110 ? 73.998  98.760  7.199   1.00 39.35 ? 110 TYR C CA  1 
ATOM 2677  C C   . TYR C 1 110 ? 72.987  99.202  8.254   1.00 39.82 ? 110 TYR C C   1 
ATOM 2678  O O   . TYR C 1 110 ? 71.808  98.843  8.184   1.00 40.04 ? 110 TYR C O   1 
ATOM 2679  C CB  . TYR C 1 110 ? 74.423  99.957  6.339   1.00 39.25 ? 110 TYR C CB  1 
ATOM 2680  C CG  . TYR C 1 110 ? 73.296  100.607 5.563   1.00 39.14 ? 110 TYR C CG  1 
ATOM 2681  C CD1 . TYR C 1 110 ? 72.891  100.100 4.329   1.00 39.13 ? 110 TYR C CD1 1 
ATOM 2682  C CD2 . TYR C 1 110 ? 72.642  101.738 6.056   1.00 39.09 ? 110 TYR C CD2 1 
ATOM 2683  C CE1 . TYR C 1 110 ? 71.861  100.692 3.611   1.00 39.07 ? 110 TYR C CE1 1 
ATOM 2684  C CE2 . TYR C 1 110 ? 71.611  102.338 5.345   1.00 39.10 ? 110 TYR C CE2 1 
ATOM 2685  C CZ  . TYR C 1 110 ? 71.225  101.812 4.123   1.00 39.11 ? 110 TYR C CZ  1 
ATOM 2686  O OH  . TYR C 1 110 ? 70.205  102.399 3.413   1.00 39.19 ? 110 TYR C OH  1 
ATOM 2687  N N   . LYS C 1 111 ? 73.462  99.989  9.219   1.00 40.42 ? 111 LYS C N   1 
ATOM 2688  C CA  . LYS C 1 111 ? 72.632  100.470 10.331  1.00 41.05 ? 111 LYS C CA  1 
ATOM 2689  C C   . LYS C 1 111 ? 72.282  101.949 10.163  1.00 41.38 ? 111 LYS C C   1 
ATOM 2690  O O   . LYS C 1 111 ? 73.118  102.744 9.729   1.00 41.54 ? 111 LYS C O   1 
ATOM 2691  C CB  . LYS C 1 111 ? 73.311  100.217 11.686  1.00 41.42 ? 111 LYS C CB  1 
ATOM 2692  C CG  . LYS C 1 111 ? 74.597  100.988 11.958  1.00 41.67 ? 111 LYS C CG  1 
ATOM 2693  C CD  . LYS C 1 111 ? 75.168  100.607 13.314  1.00 41.99 ? 111 LYS C CD  1 
ATOM 2694  C CE  . LYS C 1 111 ? 76.460  101.354 13.608  1.00 42.27 ? 111 LYS C CE  1 
ATOM 2695  N NZ  . LYS C 1 111 ? 77.044  101.003 14.935  1.00 42.33 ? 111 LYS C NZ  1 
ATOM 2696  N N   . THR C 1 112 ? 71.045  102.299 10.519  1.00 41.76 ? 112 THR C N   1 
ATOM 2697  C CA  . THR C 1 112 ? 70.531  103.669 10.384  1.00 42.19 ? 112 THR C CA  1 
ATOM 2698  C C   . THR C 1 112 ? 70.527  104.403 11.728  1.00 42.42 ? 112 THR C C   1 
ATOM 2699  O O   . THR C 1 112 ? 70.769  103.803 12.778  1.00 42.41 ? 112 THR C O   1 
ATOM 2700  C CB  . THR C 1 112 ? 69.118  103.692 9.742   1.00 42.41 ? 112 THR C CB  1 
ATOM 2701  O OG1 . THR C 1 112 ? 68.708  105.048 9.517   1.00 42.63 ? 112 THR C OG1 1 
ATOM 2702  C CG2 . THR C 1 112 ? 68.062  102.970 10.604  1.00 42.32 ? 112 THR C CG2 1 
ATOM 2703  N N   . ASN C 1 113 ? 70.243  105.703 11.677  1.00 42.76 ? 113 ASN C N   1 
ATOM 2704  C CA  . ASN C 1 113 ? 70.213  106.552 12.874  1.00 43.05 ? 113 ASN C CA  1 
ATOM 2705  C C   . ASN C 1 113 ? 68.970  106.348 13.751  1.00 43.07 ? 113 ASN C C   1 
ATOM 2706  O O   . ASN C 1 113 ? 68.981  106.727 14.925  1.00 43.14 ? 113 ASN C O   1 
ATOM 2707  C CB  . ASN C 1 113 ? 70.320  108.033 12.484  1.00 43.32 ? 113 ASN C CB  1 
ATOM 2708  C CG  . ASN C 1 113 ? 71.640  108.369 11.810  1.00 43.69 ? 113 ASN C CG  1 
ATOM 2709  O OD1 . ASN C 1 113 ? 72.406  107.483 11.425  1.00 43.88 ? 113 ASN C OD1 1 
ATOM 2710  N ND2 . ASN C 1 113 ? 71.909  109.662 11.659  1.00 43.95 ? 113 ASN C ND2 1 
ATOM 2711  N N   . THR C 1 114 ? 67.908  105.766 13.188  1.00 42.95 ? 114 THR C N   1 
ATOM 2712  C CA  . THR C 1 114 ? 66.655  105.545 13.916  1.00 42.92 ? 114 THR C CA  1 
ATOM 2713  C C   . THR C 1 114 ? 66.824  104.487 15.009  1.00 42.75 ? 114 THR C C   1 
ATOM 2714  O O   . THR C 1 114 ? 67.411  103.431 14.769  1.00 42.67 ? 114 THR C O   1 
ATOM 2715  C CB  . THR C 1 114 ? 65.519  105.104 12.965  1.00 43.06 ? 114 THR C CB  1 
ATOM 2716  O OG1 . THR C 1 114 ? 65.454  105.996 11.844  1.00 43.18 ? 114 THR C OG1 1 
ATOM 2717  C CG2 . THR C 1 114 ? 64.169  105.096 13.684  1.00 43.11 ? 114 THR C CG2 1 
ATOM 2718  N N   . ALA C 1 115 ? 66.302  104.782 16.200  1.00 42.77 ? 115 ALA C N   1 
ATOM 2719  C CA  . ALA C 1 115 ? 66.417  103.892 17.359  1.00 42.75 ? 115 ALA C CA  1 
ATOM 2720  C C   . ALA C 1 115 ? 65.313  102.839 17.364  1.00 42.74 ? 115 ALA C C   1 
ATOM 2721  O O   . ALA C 1 115 ? 64.238  103.049 16.797  1.00 42.81 ? 115 ALA C O   1 
ATOM 2722  C CB  . ALA C 1 115 ? 66.374  104.698 18.648  1.00 42.91 ? 115 ALA C CB  1 
ATOM 2723  N N   . VAL C 1 116 ? 65.590  101.713 18.020  1.00 42.90 ? 116 VAL C N   1 
ATOM 2724  C CA  . VAL C 1 116 ? 64.624  100.606 18.129  1.00 43.05 ? 116 VAL C CA  1 
ATOM 2725  C C   . VAL C 1 116 ? 63.420  100.949 19.015  1.00 43.55 ? 116 VAL C C   1 
ATOM 2726  O O   . VAL C 1 116 ? 62.337  100.387 18.830  1.00 43.76 ? 116 VAL C O   1 
ATOM 2727  C CB  . VAL C 1 116 ? 65.273  99.290  18.633  1.00 42.93 ? 116 VAL C CB  1 
ATOM 2728  C CG1 . VAL C 1 116 ? 66.395  98.850  17.698  1.00 42.89 ? 116 VAL C CG1 1 
ATOM 2729  C CG2 . VAL C 1 116 ? 65.754  99.408  20.081  1.00 42.98 ? 116 VAL C CG2 1 
ATOM 2730  N N   . THR C 1 117 ? 63.616  101.855 19.975  1.00 43.94 ? 117 THR C N   1 
ATOM 2731  C CA  . THR C 1 117 ? 62.515  102.397 20.779  1.00 44.22 ? 117 THR C CA  1 
ATOM 2732  C C   . THR C 1 117 ? 61.565  103.246 19.931  1.00 44.30 ? 117 THR C C   1 
ATOM 2733  O O   . THR C 1 117 ? 60.349  103.209 20.135  1.00 44.49 ? 117 THR C O   1 
ATOM 2734  C CB  . THR C 1 117 ? 63.033  103.253 21.954  1.00 44.54 ? 117 THR C CB  1 
ATOM 2735  O OG1 . THR C 1 117 ? 63.929  104.258 21.463  1.00 44.68 ? 117 THR C OG1 1 
ATOM 2736  C CG2 . THR C 1 117 ? 63.756  102.383 22.976  1.00 44.67 ? 117 THR C CG2 1 
ATOM 2737  N N   . SER C 1 118 ? 62.125  104.005 18.987  1.00 44.37 ? 118 SER C N   1 
ATOM 2738  C CA  . SER C 1 118 ? 61.332  104.769 18.017  1.00 44.50 ? 118 SER C CA  1 
ATOM 2739  C C   . SER C 1 118 ? 60.698  103.850 16.971  1.00 44.49 ? 118 SER C C   1 
ATOM 2740  O O   . SER C 1 118 ? 61.042  102.668 16.877  1.00 44.41 ? 118 SER C O   1 
ATOM 2741  C CB  . SER C 1 118 ? 62.200  105.822 17.321  1.00 44.61 ? 118 SER C CB  1 
ATOM 2742  O OG  . SER C 1 118 ? 62.801  106.692 18.265  1.00 44.73 ? 118 SER C OG  1 
ATOM 2743  N N   . SER C 1 119 ? 59.780  104.409 16.182  1.00 44.65 ? 119 SER C N   1 
ATOM 2744  C CA  . SER C 1 119 ? 59.031  103.641 15.180  1.00 44.77 ? 119 SER C CA  1 
ATOM 2745  C C   . SER C 1 119 ? 59.905  103.195 14.007  1.00 44.88 ? 119 SER C C   1 
ATOM 2746  O O   . SER C 1 119 ? 61.011  103.707 13.807  1.00 44.83 ? 119 SER C O   1 
ATOM 2747  C CB  . SER C 1 119 ? 57.847  104.457 14.657  1.00 44.90 ? 119 SER C CB  1 
ATOM 2748  O OG  . SER C 1 119 ? 57.006  103.668 13.831  1.00 44.99 ? 119 SER C OG  1 
ATOM 2749  N N   . GLN C 1 120 ? 59.388  102.239 13.237  1.00 44.97 ? 120 GLN C N   1 
ATOM 2750  C CA  . GLN C 1 120 ? 60.115  101.650 12.110  1.00 45.08 ? 120 GLN C CA  1 
ATOM 2751  C C   . GLN C 1 120 ? 60.307  102.674 10.984  1.00 45.31 ? 120 GLN C C   1 
ATOM 2752  O O   . GLN C 1 120 ? 59.367  103.404 10.660  1.00 45.67 ? 120 GLN C O   1 
ATOM 2753  C CB  . GLN C 1 120 ? 59.361  100.427 11.574  1.00 45.05 ? 120 GLN C CB  1 
ATOM 2754  C CG  . GLN C 1 120 ? 60.111  99.629  10.515  1.00 45.09 ? 120 GLN C CG  1 
ATOM 2755  C CD  . GLN C 1 120 ? 59.345  98.399  10.061  1.00 45.21 ? 120 GLN C CD  1 
ATOM 2756  O OE1 . GLN C 1 120 ? 58.887  97.599  10.878  1.00 45.22 ? 120 GLN C OE1 1 
ATOM 2757  N NE2 . GLN C 1 120 ? 59.208  98.238  8.749   1.00 45.29 ? 120 GLN C NE2 1 
ATOM 2758  N N   . PRO C 1 121 ? 61.525  102.746 10.399  1.00 45.40 ? 121 PRO C N   1 
ATOM 2759  C CA  . PRO C 1 121 ? 61.745  103.588 9.216   1.00 45.55 ? 121 PRO C CA  1 
ATOM 2760  C C   . PRO C 1 121 ? 60.863  103.200 8.025   1.00 45.58 ? 121 PRO C C   1 
ATOM 2761  O O   . PRO C 1 121 ? 60.736  102.013 7.717   1.00 45.53 ? 121 PRO C O   1 
ATOM 2762  C CB  . PRO C 1 121 ? 63.220  103.348 8.880   1.00 45.56 ? 121 PRO C CB  1 
ATOM 2763  C CG  . PRO C 1 121 ? 63.846  102.991 10.178  1.00 45.48 ? 121 PRO C CG  1 
ATOM 2764  C CD  . PRO C 1 121 ? 62.799  102.242 10.949  1.00 45.42 ? 121 PRO C CD  1 
ATOM 2765  N N   . GLU C 1 122 ? 60.264  104.199 7.379   1.00 45.76 ? 122 GLU C N   1 
ATOM 2766  C CA  . GLU C 1 122 ? 59.382  103.975 6.227   1.00 45.90 ? 122 GLU C CA  1 
ATOM 2767  C C   . GLU C 1 122 ? 60.162  103.504 5.004   1.00 45.50 ? 122 GLU C C   1 
ATOM 2768  O O   . GLU C 1 122 ? 59.723  102.590 4.307   1.00 45.42 ? 122 GLU C O   1 
ATOM 2769  C CB  . GLU C 1 122 ? 58.598  105.249 5.882   1.00 46.32 ? 122 GLU C CB  1 
ATOM 2770  C CG  . GLU C 1 122 ? 57.604  105.696 6.950   1.00 46.56 ? 122 GLU C CG  1 
ATOM 2771  C CD  . GLU C 1 122 ? 56.452  104.723 7.165   1.00 46.77 ? 122 GLU C CD  1 
ATOM 2772  O OE1 . GLU C 1 122 ? 56.131  103.936 6.247   1.00 46.76 ? 122 GLU C OE1 1 
ATOM 2773  O OE2 . GLU C 1 122 ? 55.857  104.750 8.263   1.00 46.96 ? 122 GLU C OE2 1 
ATOM 2774  N N   . SER C 1 123 ? 61.304  104.141 4.749   1.00 45.20 ? 123 SER C N   1 
ATOM 2775  C CA  . SER C 1 123 ? 62.219  103.742 3.676   1.00 45.03 ? 123 SER C CA  1 
ATOM 2776  C C   . SER C 1 123 ? 63.669  103.849 4.143   1.00 44.61 ? 123 SER C C   1 
ATOM 2777  O O   . SER C 1 123 ? 63.998  104.680 4.994   1.00 44.74 ? 123 SER C O   1 
ATOM 2778  C CB  . SER C 1 123 ? 62.006  104.621 2.441   1.00 45.23 ? 123 SER C CB  1 
ATOM 2779  O OG  . SER C 1 123 ? 62.803  104.181 1.355   1.00 45.30 ? 123 SER C OG  1 
ATOM 2780  N N   . CYS C 1 124 ? 64.527  103.003 3.576   1.00 44.10 ? 124 CYS C N   1 
ATOM 2781  C CA  . CYS C 1 124 ? 65.948  102.962 3.935   1.00 43.87 ? 124 CYS C CA  1 
ATOM 2782  C C   . CYS C 1 124 ? 66.687  104.204 3.411   1.00 44.47 ? 124 CYS C C   1 
ATOM 2783  O O   . CYS C 1 124 ? 66.297  104.752 2.377   1.00 44.77 ? 124 CYS C O   1 
ATOM 2784  C CB  . CYS C 1 124 ? 66.602  101.686 3.388   1.00 43.10 ? 124 CYS C CB  1 
ATOM 2785  S SG  . CYS C 1 124 ? 66.057  101.213 1.728   1.00 42.51 ? 124 CYS C SG  1 
ATOM 2786  N N   . PRO C 1 125 ? 67.747  104.659 4.123   1.00 44.93 ? 125 PRO C N   1 
ATOM 2787  C CA  . PRO C 1 125 ? 68.524  105.815 3.637   1.00 45.17 ? 125 PRO C CA  1 
ATOM 2788  C C   . PRO C 1 125 ? 69.287  105.569 2.329   1.00 45.54 ? 125 PRO C C   1 
ATOM 2789  O O   . PRO C 1 125 ? 69.758  106.516 1.695   1.00 45.78 ? 125 PRO C O   1 
ATOM 2790  C CB  . PRO C 1 125 ? 69.516  106.085 4.779   1.00 45.17 ? 125 PRO C CB  1 
ATOM 2791  C CG  . PRO C 1 125 ? 68.914  105.452 5.980   1.00 45.13 ? 125 PRO C CG  1 
ATOM 2792  C CD  . PRO C 1 125 ? 68.181  104.249 5.473   1.00 45.02 ? 125 PRO C CD  1 
ATOM 2793  O OXT . PRO C 1 125 ? 69.455  104.438 1.870   1.00 45.77 ? 125 PRO C OXT 1 
ATOM 2794  N N   . PHE D 1 1   ? 85.230  87.643  75.036  1.00 65.53 ? 1   PHE D N   1 
ATOM 2795  C CA  . PHE D 1 1   ? 84.732  86.642  74.049  1.00 65.24 ? 1   PHE D CA  1 
ATOM 2796  C C   . PHE D 1 1   ? 83.720  85.709  74.725  1.00 64.19 ? 1   PHE D C   1 
ATOM 2797  O O   . PHE D 1 1   ? 84.098  84.734  75.383  1.00 64.28 ? 1   PHE D O   1 
ATOM 2798  C CB  . PHE D 1 1   ? 85.911  85.854  73.452  1.00 66.00 ? 1   PHE D CB  1 
ATOM 2799  C CG  . PHE D 1 1   ? 85.648  85.296  72.077  1.00 66.66 ? 1   PHE D CG  1 
ATOM 2800  C CD1 . PHE D 1 1   ? 84.629  84.369  71.862  1.00 66.87 ? 1   PHE D CD1 1 
ATOM 2801  C CD2 . PHE D 1 1   ? 86.432  85.682  70.993  1.00 67.09 ? 1   PHE D CD2 1 
ATOM 2802  C CE1 . PHE D 1 1   ? 84.392  83.852  70.599  1.00 67.09 ? 1   PHE D CE1 1 
ATOM 2803  C CE2 . PHE D 1 1   ? 86.196  85.165  69.727  1.00 67.25 ? 1   PHE D CE2 1 
ATOM 2804  C CZ  . PHE D 1 1   ? 85.176  84.248  69.530  1.00 67.25 ? 1   PHE D CZ  1 
ATOM 2805  N N   . THR D 1 2   ? 82.434  86.015  74.551  1.00 62.81 ? 2   THR D N   1 
ATOM 2806  C CA  . THR D 1 2   ? 81.348  85.260  75.184  1.00 61.68 ? 2   THR D CA  1 
ATOM 2807  C C   . THR D 1 2   ? 80.984  84.010  74.383  1.00 60.37 ? 2   THR D C   1 
ATOM 2808  O O   . THR D 1 2   ? 81.444  83.824  73.255  1.00 60.21 ? 2   THR D O   1 
ATOM 2809  C CB  . THR D 1 2   ? 80.076  86.126  75.332  1.00 61.85 ? 2   THR D CB  1 
ATOM 2810  O OG1 . THR D 1 2   ? 79.675  86.616  74.048  1.00 61.94 ? 2   THR D OG1 1 
ATOM 2811  C CG2 . THR D 1 2   ? 80.319  87.306  76.263  1.00 61.91 ? 2   THR D CG2 1 
ATOM 2812  N N   . LEU D 1 3   ? 80.152  83.162  74.986  1.00 59.31 ? 3   LEU D N   1 
ATOM 2813  C CA  . LEU D 1 3   ? 79.576  82.002  74.303  1.00 58.56 ? 3   LEU D CA  1 
ATOM 2814  C C   . LEU D 1 3   ? 78.496  82.436  73.310  1.00 57.74 ? 3   LEU D C   1 
ATOM 2815  O O   . LEU D 1 3   ? 78.396  81.872  72.222  1.00 57.87 ? 3   LEU D O   1 
ATOM 2816  C CB  . LEU D 1 3   ? 78.992  81.009  75.316  1.00 58.65 ? 3   LEU D CB  1 
ATOM 2817  C CG  . LEU D 1 3   ? 78.455  79.671  74.788  1.00 58.84 ? 3   LEU D CG  1 
ATOM 2818  C CD1 . LEU D 1 3   ? 79.556  78.844  74.139  1.00 58.83 ? 3   LEU D CD1 1 
ATOM 2819  C CD2 . LEU D 1 3   ? 77.799  78.894  75.920  1.00 59.00 ? 3   LEU D CD2 1 
ATOM 2820  N N   . ILE D 1 4   ? 77.684  83.422  73.701  1.00 56.84 ? 4   ILE D N   1 
ATOM 2821  C CA  . ILE D 1 4   ? 76.654  83.998  72.817  1.00 56.10 ? 4   ILE D CA  1 
ATOM 2822  C C   . ILE D 1 4   ? 77.235  84.651  71.551  1.00 55.55 ? 4   ILE D C   1 
ATOM 2823  O O   . ILE D 1 4   ? 76.626  84.567  70.482  1.00 55.56 ? 4   ILE D O   1 
ATOM 2824  C CB  . ILE D 1 4   ? 75.721  84.990  73.580  1.00 56.16 ? 4   ILE D CB  1 
ATOM 2825  C CG1 . ILE D 1 4   ? 74.526  85.437  72.721  1.00 56.20 ? 4   ILE D CG1 1 
ATOM 2826  C CG2 . ILE D 1 4   ? 76.468  86.230  74.064  1.00 56.30 ? 4   ILE D CG2 1 
ATOM 2827  C CD1 . ILE D 1 4   ? 73.654  84.312  72.209  1.00 56.15 ? 4   ILE D CD1 1 
ATOM 2828  N N   . GLU D 1 5   ? 78.398  85.293  71.675  1.00 55.12 ? 5   GLU D N   1 
ATOM 2829  C CA  . GLU D 1 5   ? 79.102  85.869  70.519  1.00 54.70 ? 5   GLU D CA  1 
ATOM 2830  C C   . GLU D 1 5   ? 79.642  84.778  69.588  1.00 54.01 ? 5   GLU D C   1 
ATOM 2831  O O   . GLU D 1 5   ? 79.698  84.975  68.376  1.00 54.13 ? 5   GLU D O   1 
ATOM 2832  C CB  . GLU D 1 5   ? 80.233  86.799  70.976  1.00 54.98 ? 5   GLU D CB  1 
ATOM 2833  C CG  . GLU D 1 5   ? 80.958  87.533  69.851  1.00 55.44 ? 5   GLU D CG  1 
ATOM 2834  C CD  . GLU D 1 5   ? 82.255  86.860  69.426  1.00 55.80 ? 5   GLU D CD  1 
ATOM 2835  O OE1 . GLU D 1 5   ? 83.181  86.768  70.260  1.00 55.97 ? 5   GLU D OE1 1 
ATOM 2836  O OE2 . GLU D 1 5   ? 82.352  86.435  68.255  1.00 55.93 ? 5   GLU D OE2 1 
ATOM 2837  N N   . LEU D 1 6   ? 80.047  83.645  70.158  1.00 53.26 ? 6   LEU D N   1 
ATOM 2838  C CA  . LEU D 1 6   ? 80.439  82.470  69.374  1.00 52.82 ? 6   LEU D CA  1 
ATOM 2839  C C   . LEU D 1 6   ? 79.223  81.768  68.767  1.00 52.17 ? 6   LEU D C   1 
ATOM 2840  O O   . LEU D 1 6   ? 79.277  81.299  67.630  1.00 52.30 ? 6   LEU D O   1 
ATOM 2841  C CB  . LEU D 1 6   ? 81.214  81.481  70.251  1.00 53.07 ? 6   LEU D CB  1 
ATOM 2842  C CG  . LEU D 1 6   ? 81.929  80.301  69.579  1.00 53.25 ? 6   LEU D CG  1 
ATOM 2843  C CD1 . LEU D 1 6   ? 82.983  80.765  68.578  1.00 53.35 ? 6   LEU D CD1 1 
ATOM 2844  C CD2 . LEU D 1 6   ? 82.542  79.390  70.640  1.00 53.36 ? 6   LEU D CD2 1 
ATOM 2845  N N   . LEU D 1 7   ? 78.138  81.695  69.539  1.00 51.68 ? 7   LEU D N   1 
ATOM 2846  C CA  . LEU D 1 7   ? 76.909  81.005  69.134  1.00 51.18 ? 7   LEU D CA  1 
ATOM 2847  C C   . LEU D 1 7   ? 76.208  81.672  67.951  1.00 50.46 ? 7   LEU D C   1 
ATOM 2848  O O   . LEU D 1 7   ? 75.730  80.978  67.050  1.00 50.55 ? 7   LEU D O   1 
ATOM 2849  C CB  . LEU D 1 7   ? 75.949  80.911  70.326  1.00 51.54 ? 7   LEU D CB  1 
ATOM 2850  C CG  . LEU D 1 7   ? 74.622  80.163  70.166  1.00 52.00 ? 7   LEU D CG  1 
ATOM 2851  C CD1 . LEU D 1 7   ? 74.832  78.746  69.652  1.00 52.25 ? 7   LEU D CD1 1 
ATOM 2852  C CD2 . LEU D 1 7   ? 73.892  80.153  71.501  1.00 52.11 ? 7   LEU D CD2 1 
ATOM 2853  N N   . ILE D 1 8   ? 76.138  83.004  67.963  1.00 49.67 ? 8   ILE D N   1 
ATOM 2854  C CA  . ILE D 1 8   ? 75.578  83.761  66.831  1.00 48.95 ? 8   ILE D CA  1 
ATOM 2855  C C   . ILE D 1 8   ? 76.451  83.657  65.573  1.00 48.10 ? 8   ILE D C   1 
ATOM 2856  O O   . ILE D 1 8   ? 75.922  83.630  64.466  1.00 48.25 ? 8   ILE D O   1 
ATOM 2857  C CB  . ILE D 1 8   ? 75.290  85.249  67.185  1.00 49.08 ? 8   ILE D CB  1 
ATOM 2858  C CG1 . ILE D 1 8   ? 74.389  85.888  66.115  1.00 49.31 ? 8   ILE D CG1 1 
ATOM 2859  C CG2 . ILE D 1 8   ? 76.579  86.047  67.364  1.00 49.12 ? 8   ILE D CG2 1 
ATOM 2860  C CD1 . ILE D 1 8   ? 73.757  87.203  66.525  1.00 49.49 ? 8   ILE D CD1 1 
ATOM 2861  N N   . VAL D 1 9   ? 77.772  83.588  65.748  1.00 47.27 ? 9   VAL D N   1 
ATOM 2862  C CA  . VAL D 1 9   ? 78.702  83.372  64.626  1.00 46.73 ? 9   VAL D CA  1 
ATOM 2863  C C   . VAL D 1 9   ? 78.484  81.995  63.980  1.00 46.19 ? 9   VAL D C   1 
ATOM 2864  O O   . VAL D 1 9   ? 78.549  81.872  62.757  1.00 46.23 ? 9   VAL D O   1 
ATOM 2865  C CB  . VAL D 1 9   ? 80.178  83.559  65.067  1.00 46.84 ? 9   VAL D CB  1 
ATOM 2866  C CG1 . VAL D 1 9   ? 81.161  83.040  64.020  1.00 46.95 ? 9   VAL D CG1 1 
ATOM 2867  C CG2 . VAL D 1 9   ? 80.457  85.029  65.352  1.00 46.91 ? 9   VAL D CG2 1 
ATOM 2868  N N   . ILE D 1 10  ? 78.223  80.978  64.801  1.00 45.60 ? 10  ILE D N   1 
ATOM 2869  C CA  . ILE D 1 10  ? 77.872  79.638  64.309  1.00 45.28 ? 10  ILE D CA  1 
ATOM 2870  C C   . ILE D 1 10  ? 76.531  79.666  63.555  1.00 44.89 ? 10  ILE D C   1 
ATOM 2871  O O   . ILE D 1 10  ? 76.377  78.981  62.542  1.00 44.97 ? 10  ILE D O   1 
ATOM 2872  C CB  . ILE D 1 10  ? 77.838  78.599  65.463  1.00 45.46 ? 10  ILE D CB  1 
ATOM 2873  C CG1 . ILE D 1 10  ? 79.250  78.386  66.031  1.00 45.68 ? 10  ILE D CG1 1 
ATOM 2874  C CG2 . ILE D 1 10  ? 77.274  77.255  64.998  1.00 45.52 ? 10  ILE D CG2 1 
ATOM 2875  C CD1 . ILE D 1 10  ? 79.276  77.825  67.439  1.00 45.81 ? 10  ILE D CD1 1 
ATOM 2876  N N   . ALA D 1 11  ? 75.580  80.456  64.053  1.00 44.53 ? 11  ALA D N   1 
ATOM 2877  C CA  . ALA D 1 11  ? 74.271  80.621  63.408  1.00 44.37 ? 11  ALA D CA  1 
ATOM 2878  C C   . ALA D 1 11  ? 74.351  81.285  62.029  1.00 44.14 ? 11  ALA D C   1 
ATOM 2879  O O   . ALA D 1 11  ? 73.651  80.870  61.104  1.00 44.27 ? 11  ALA D O   1 
ATOM 2880  C CB  . ALA D 1 11  ? 73.328  81.407  64.310  1.00 44.52 ? 11  ALA D CB  1 
ATOM 2881  N N   . ILE D 1 12  ? 75.198  82.308  61.900  1.00 43.94 ? 12  ILE D N   1 
ATOM 2882  C CA  . ILE D 1 12  ? 75.375  83.029  60.629  1.00 43.88 ? 12  ILE D CA  1 
ATOM 2883  C C   . ILE D 1 12  ? 76.119  82.178  59.587  1.00 43.93 ? 12  ILE D C   1 
ATOM 2884  O O   . ILE D 1 12  ? 75.802  82.252  58.399  1.00 44.27 ? 12  ILE D O   1 
ATOM 2885  C CB  . ILE D 1 12  ? 76.089  84.394  60.838  1.00 43.83 ? 12  ILE D CB  1 
ATOM 2886  C CG1 . ILE D 1 12  ? 75.249  85.327  61.729  1.00 44.06 ? 12  ILE D CG1 1 
ATOM 2887  C CG2 . ILE D 1 12  ? 76.404  85.082  59.508  1.00 43.85 ? 12  ILE D CG2 1 
ATOM 2888  C CD1 . ILE D 1 12  ? 73.863  85.662  61.213  1.00 44.26 ? 12  ILE D CD1 1 
ATOM 2889  N N   . ILE D 1 13  ? 77.089  81.375  60.027  1.00 43.69 ? 13  ILE D N   1 
ATOM 2890  C CA  . ILE D 1 13  ? 77.807  80.449  59.132  1.00 43.60 ? 13  ILE D CA  1 
ATOM 2891  C C   . ILE D 1 13  ? 76.845  79.437  58.489  1.00 43.55 ? 13  ILE D C   1 
ATOM 2892  O O   . ILE D 1 13  ? 76.992  79.108  57.310  1.00 43.61 ? 13  ILE D O   1 
ATOM 2893  C CB  . ILE D 1 13  ? 78.971  79.726  59.865  1.00 43.76 ? 13  ILE D CB  1 
ATOM 2894  C CG1 . ILE D 1 13  ? 80.088  80.724  60.204  1.00 43.92 ? 13  ILE D CG1 1 
ATOM 2895  C CG2 . ILE D 1 13  ? 79.560  78.593  59.020  1.00 43.84 ? 13  ILE D CG2 1 
ATOM 2896  C CD1 . ILE D 1 13  ? 80.976  80.292  61.352  1.00 44.05 ? 13  ILE D CD1 1 
ATOM 2897  N N   . ALA D 1 14  ? 75.869  78.956  59.260  1.00 43.61 ? 14  ALA D N   1 
ATOM 2898  C CA  . ALA D 1 14  ? 74.825  78.059  58.744  1.00 43.68 ? 14  ALA D CA  1 
ATOM 2899  C C   . ALA D 1 14  ? 73.941  78.723  57.684  1.00 43.73 ? 14  ALA D C   1 
ATOM 2900  O O   . ALA D 1 14  ? 73.525  78.069  56.724  1.00 43.84 ? 14  ALA D O   1 
ATOM 2901  C CB  . ALA D 1 14  ? 73.966  77.535  59.888  1.00 43.75 ? 14  ALA D CB  1 
ATOM 2902  N N   . ILE D 1 15  ? 73.658  80.014  57.867  1.00 43.74 ? 15  ILE D N   1 
ATOM 2903  C CA  . ILE D 1 15  ? 72.865  80.796  56.909  1.00 43.83 ? 15  ILE D CA  1 
ATOM 2904  C C   . ILE D 1 15  ? 73.665  81.068  55.632  1.00 43.79 ? 15  ILE D C   1 
ATOM 2905  O O   . ILE D 1 15  ? 73.160  80.856  54.527  1.00 43.92 ? 15  ILE D O   1 
ATOM 2906  C CB  . ILE D 1 15  ? 72.384  82.136  57.525  1.00 44.00 ? 15  ILE D CB  1 
ATOM 2907  C CG1 . ILE D 1 15  ? 71.434  81.873  58.704  1.00 44.22 ? 15  ILE D CG1 1 
ATOM 2908  C CG2 . ILE D 1 15  ? 71.674  83.002  56.484  1.00 44.10 ? 15  ILE D CG2 1 
ATOM 2909  C CD1 . ILE D 1 15  ? 71.284  83.044  59.653  1.00 44.27 ? 15  ILE D CD1 1 
ATOM 2910  N N   . LEU D 1 16  ? 74.897  81.548  55.795  1.00 43.76 ? 16  LEU D N   1 
ATOM 2911  C CA  . LEU D 1 16  ? 75.783  81.847  54.657  1.00 43.77 ? 16  LEU D CA  1 
ATOM 2912  C C   . LEU D 1 16  ? 76.165  80.603  53.842  1.00 43.68 ? 16  LEU D C   1 
ATOM 2913  O O   . LEU D 1 16  ? 76.305  80.688  52.621  1.00 43.80 ? 16  LEU D O   1 
ATOM 2914  C CB  . LEU D 1 16  ? 77.050  82.592  55.118  1.00 43.94 ? 16  LEU D CB  1 
ATOM 2915  C CG  . LEU D 1 16  ? 76.977  84.126  55.190  1.00 44.26 ? 16  LEU D CG  1 
ATOM 2916  C CD1 . LEU D 1 16  ? 75.698  84.636  55.845  1.00 44.40 ? 16  LEU D CD1 1 
ATOM 2917  C CD2 . LEU D 1 16  ? 78.203  84.674  55.909  1.00 44.39 ? 16  LEU D CD2 1 
ATOM 2918  N N   . ALA D 1 17  ? 76.332  79.464  54.514  1.00 43.48 ? 17  ALA D N   1 
ATOM 2919  C CA  . ALA D 1 17  ? 76.647  78.194  53.842  1.00 43.36 ? 17  ALA D CA  1 
ATOM 2920  C C   . ALA D 1 17  ? 75.504  77.664  52.966  1.00 43.29 ? 17  ALA D C   1 
ATOM 2921  O O   . ALA D 1 17  ? 75.752  76.914  52.019  1.00 43.40 ? 17  ALA D O   1 
ATOM 2922  C CB  . ALA D 1 17  ? 77.050  77.138  54.864  1.00 43.38 ? 17  ALA D CB  1 
ATOM 2923  N N   . ALA D 1 18  ? 74.266  78.039  53.288  1.00 43.01 ? 18  ALA D N   1 
ATOM 2924  C CA  . ALA D 1 18  ? 73.097  77.640  52.504  1.00 42.88 ? 18  ALA D CA  1 
ATOM 2925  C C   . ALA D 1 18  ? 72.907  78.535  51.280  1.00 42.74 ? 18  ALA D C   1 
ATOM 2926  O O   . ALA D 1 18  ? 72.824  78.042  50.153  1.00 42.83 ? 18  ALA D O   1 
ATOM 2927  C CB  . ALA D 1 18  ? 71.847  77.669  53.371  1.00 42.97 ? 18  ALA D CB  1 
ATOM 2928  N N   . VAL D 1 19  ? 72.846  79.845  51.513  1.00 42.61 ? 19  VAL D N   1 
ATOM 2929  C CA  . VAL D 1 19  ? 72.470  80.813  50.466  1.00 42.61 ? 19  VAL D CA  1 
ATOM 2930  C C   . VAL D 1 19  ? 73.559  81.095  49.422  1.00 42.56 ? 19  VAL D C   1 
ATOM 2931  O O   . VAL D 1 19  ? 73.251  81.226  48.235  1.00 42.66 ? 19  VAL D O   1 
ATOM 2932  C CB  . VAL D 1 19  ? 71.960  82.158  51.059  1.00 42.69 ? 19  VAL D CB  1 
ATOM 2933  C CG1 . VAL D 1 19  ? 70.803  81.915  52.022  1.00 42.75 ? 19  VAL D CG1 1 
ATOM 2934  C CG2 . VAL D 1 19  ? 73.077  82.957  51.731  1.00 42.69 ? 19  VAL D CG2 1 
ATOM 2935  N N   . LEU D 1 20  ? 74.817  81.181  49.856  1.00 42.47 ? 20  LEU D N   1 
ATOM 2936  C CA  . LEU D 1 20  ? 75.923  81.574  48.968  1.00 42.47 ? 20  LEU D CA  1 
ATOM 2937  C C   . LEU D 1 20  ? 76.389  80.464  48.018  1.00 42.21 ? 20  LEU D C   1 
ATOM 2938  O O   . LEU D 1 20  ? 76.993  80.759  46.983  1.00 42.16 ? 20  LEU D O   1 
ATOM 2939  C CB  . LEU D 1 20  ? 77.112  82.092  49.783  1.00 42.79 ? 20  LEU D CB  1 
ATOM 2940  C CG  . LEU D 1 20  ? 76.852  83.282  50.713  1.00 43.17 ? 20  LEU D CG  1 
ATOM 2941  C CD1 . LEU D 1 20  ? 78.084  83.572  51.555  1.00 43.27 ? 20  LEU D CD1 1 
ATOM 2942  C CD2 . LEU D 1 20  ? 76.447  84.518  49.922  1.00 43.25 ? 20  LEU D CD2 1 
ATOM 2943  N N   . ILE D 1 21  ? 76.120  79.205  48.368  1.00 41.85 ? 21  ILE D N   1 
ATOM 2944  C CA  . ILE D 1 21  ? 76.464  78.061  47.513  1.00 41.51 ? 21  ILE D CA  1 
ATOM 2945  C C   . ILE D 1 21  ? 75.451  78.033  46.357  1.00 41.13 ? 21  ILE D C   1 
ATOM 2946  O O   . ILE D 1 21  ? 74.255  77.854  46.600  1.00 41.33 ? 21  ILE D O   1 
ATOM 2947  C CB  . ILE D 1 21  ? 76.450  76.719  48.302  1.00 41.75 ? 21  ILE D CB  1 
ATOM 2948  C CG1 . ILE D 1 21  ? 77.741  76.533  49.123  1.00 41.94 ? 21  ILE D CG1 1 
ATOM 2949  C CG2 . ILE D 1 21  ? 76.334  75.514  47.370  1.00 41.83 ? 21  ILE D CG2 1 
ATOM 2950  C CD1 . ILE D 1 21  ? 78.176  77.703  49.984  1.00 42.01 ? 21  ILE D CD1 1 
ATOM 2951  N N   . PRO D 1 22  ? 75.920  78.208  45.102  1.00 40.49 ? 22  PRO D N   1 
ATOM 2952  C CA  . PRO D 1 22  ? 74.999  78.294  43.966  1.00 40.05 ? 22  PRO D CA  1 
ATOM 2953  C C   . PRO D 1 22  ? 74.480  76.934  43.499  1.00 39.58 ? 22  PRO D C   1 
ATOM 2954  O O   . PRO D 1 22  ? 74.964  75.892  43.952  1.00 39.64 ? 22  PRO D O   1 
ATOM 2955  C CB  . PRO D 1 22  ? 75.866  78.927  42.879  1.00 40.17 ? 22  PRO D CB  1 
ATOM 2956  C CG  . PRO D 1 22  ? 77.228  78.399  43.160  1.00 40.35 ? 22  PRO D CG  1 
ATOM 2957  C CD  . PRO D 1 22  ? 77.327  78.268  44.657  1.00 40.46 ? 22  PRO D CD  1 
ATOM 2958  N N   . ASN D 1 23  ? 73.502  76.962  42.594  1.00 38.96 ? 23  ASN D N   1 
ATOM 2959  C CA  . ASN D 1 23  ? 72.966  75.749  41.978  1.00 38.42 ? 23  ASN D CA  1 
ATOM 2960  C C   . ASN D 1 23  ? 73.989  75.216  40.972  1.00 38.17 ? 23  ASN D C   1 
ATOM 2961  O O   . ASN D 1 23  ? 74.166  75.786  39.892  1.00 38.30 ? 23  ASN D O   1 
ATOM 2962  C CB  . ASN D 1 23  ? 71.620  76.039  41.298  1.00 38.26 ? 23  ASN D CB  1 
ATOM 2963  C CG  . ASN D 1 23  ? 70.864  74.775  40.918  1.00 38.22 ? 23  ASN D CG  1 
ATOM 2964  O OD1 . ASN D 1 23  ? 71.395  73.891  40.246  1.00 38.19 ? 23  ASN D OD1 1 
ATOM 2965  N ND2 . ASN D 1 23  ? 69.607  74.691  41.340  1.00 38.32 ? 23  ASN D ND2 1 
ATOM 2966  N N   . LEU D 1 24  ? 74.667  74.130  41.344  1.00 37.77 ? 24  LEU D N   1 
ATOM 2967  C CA  . LEU D 1 24  ? 75.723  73.546  40.517  1.00 37.53 ? 24  LEU D CA  1 
ATOM 2968  C C   . LEU D 1 24  ? 75.155  72.769  39.331  1.00 37.24 ? 24  LEU D C   1 
ATOM 2969  O O   . LEU D 1 24  ? 75.622  72.938  38.206  1.00 37.38 ? 24  LEU D O   1 
ATOM 2970  C CB  . LEU D 1 24  ? 76.626  72.632  41.353  1.00 37.66 ? 24  LEU D CB  1 
ATOM 2971  C CG  . LEU D 1 24  ? 77.359  73.278  42.535  1.00 37.78 ? 24  LEU D CG  1 
ATOM 2972  C CD1 . LEU D 1 24  ? 77.963  72.212  43.436  1.00 37.90 ? 24  LEU D CD1 1 
ATOM 2973  C CD2 . LEU D 1 24  ? 78.437  74.245  42.065  1.00 37.72 ? 24  LEU D CD2 1 
ATOM 2974  N N   . LEU D 1 25  ? 74.148  71.932  39.589  1.00 36.76 ? 25  LEU D N   1 
ATOM 2975  C CA  . LEU D 1 25  ? 73.546  71.070  38.559  1.00 36.40 ? 25  LEU D CA  1 
ATOM 2976  C C   . LEU D 1 25  ? 73.005  71.860  37.371  1.00 35.85 ? 25  LEU D C   1 
ATOM 2977  O O   . LEU D 1 25  ? 73.201  71.463  36.222  1.00 35.80 ? 25  LEU D O   1 
ATOM 2978  C CB  . LEU D 1 25  ? 72.420  70.213  39.155  1.00 36.59 ? 25  LEU D CB  1 
ATOM 2979  C CG  . LEU D 1 25  ? 71.764  69.164  38.243  1.00 36.81 ? 25  LEU D CG  1 
ATOM 2980  C CD1 . LEU D 1 25  ? 72.768  68.102  37.820  1.00 36.91 ? 25  LEU D CD1 1 
ATOM 2981  C CD2 . LEU D 1 25  ? 70.566  68.525  38.930  1.00 36.92 ? 25  LEU D CD2 1 
ATOM 2982  N N   . ALA D 1 26  ? 72.329  72.971  37.657  1.00 35.52 ? 26  ALA D N   1 
ATOM 2983  C CA  . ALA D 1 26  ? 71.767  73.836  36.616  1.00 35.27 ? 26  ALA D CA  1 
ATOM 2984  C C   . ALA D 1 26  ? 72.859  74.536  35.802  1.00 34.96 ? 26  ALA D C   1 
ATOM 2985  O O   . ALA D 1 26  ? 72.741  74.656  34.582  1.00 34.98 ? 26  ALA D O   1 
ATOM 2986  C CB  . ALA D 1 26  ? 70.816  74.859  37.226  1.00 35.29 ? 26  ALA D CB  1 
ATOM 2987  N N   . ALA D 1 27  ? 73.915  74.988  36.478  1.00 34.79 ? 27  ALA D N   1 
ATOM 2988  C CA  . ALA D 1 27  ? 75.056  75.637  35.817  1.00 34.77 ? 27  ALA D CA  1 
ATOM 2989  C C   . ALA D 1 27  ? 75.769  74.724  34.813  1.00 34.60 ? 27  ALA D C   1 
ATOM 2990  O O   . ALA D 1 27  ? 76.194  75.186  33.753  1.00 34.63 ? 27  ALA D O   1 
ATOM 2991  C CB  . ALA D 1 27  ? 76.047  76.147  36.855  1.00 34.88 ? 27  ALA D CB  1 
ATOM 2992  N N   . ARG D 1 28  ? 75.895  73.440  35.152  1.00 34.46 ? 28  ARG D N   1 
ATOM 2993  C CA  . ARG D 1 28  ? 76.543  72.459  34.273  1.00 34.32 ? 28  ARG D CA  1 
ATOM 2994  C C   . ARG D 1 28  ? 75.699  72.091  33.047  1.00 34.16 ? 28  ARG D C   1 
ATOM 2995  O O   . ARG D 1 28  ? 76.259  71.838  31.981  1.00 34.28 ? 28  ARG D O   1 
ATOM 2996  C CB  . ARG D 1 28  ? 76.914  71.188  35.043  1.00 34.46 ? 28  ARG D CB  1 
ATOM 2997  C CG  . ARG D 1 28  ? 77.921  71.415  36.161  1.00 34.64 ? 28  ARG D CG  1 
ATOM 2998  C CD  . ARG D 1 28  ? 78.651  70.136  36.546  1.00 34.76 ? 28  ARG D CD  1 
ATOM 2999  N NE  . ARG D 1 28  ? 79.804  69.879  35.683  1.00 34.86 ? 28  ARG D NE  1 
ATOM 3000  C CZ  . ARG D 1 28  ? 80.979  70.512  35.751  1.00 35.08 ? 28  ARG D CZ  1 
ATOM 3001  N NH1 . ARG D 1 28  ? 81.951  70.181  34.905  1.00 35.19 ? 28  ARG D NH1 1 
ATOM 3002  N NH2 . ARG D 1 28  ? 81.201  71.476  36.649  1.00 35.14 ? 28  ARG D NH2 1 
ATOM 3003  N N   . LYS D 1 29  ? 74.371  72.054  33.200  1.00 34.02 ? 29  LYS D N   1 
ATOM 3004  C CA  . LYS D 1 29  ? 73.451  71.749  32.084  1.00 33.92 ? 29  LYS D CA  1 
ATOM 3005  C C   . LYS D 1 29  ? 73.686  72.617  30.845  1.00 33.86 ? 29  LYS D C   1 
ATOM 3006  O O   . LYS D 1 29  ? 73.685  72.109  29.724  1.00 34.02 ? 29  LYS D O   1 
ATOM 3007  C CB  . LYS D 1 29  ? 71.981  71.893  32.511  1.00 33.96 ? 29  LYS D CB  1 
ATOM 3008  C CG  . LYS D 1 29  ? 71.412  70.711  33.279  1.00 34.05 ? 29  LYS D CG  1 
ATOM 3009  C CD  . LYS D 1 29  ? 69.891  70.779  33.318  1.00 34.19 ? 29  LYS D CD  1 
ATOM 3010  C CE  . LYS D 1 29  ? 69.289  69.687  34.191  1.00 34.36 ? 29  LYS D CE  1 
ATOM 3011  N NZ  . LYS D 1 29  ? 69.323  70.019  35.644  1.00 34.43 ? 29  LYS D NZ  1 
ATOM 3012  N N   . ARG D 1 30  ? 73.888  73.916  31.059  1.00 33.59 ? 30  ARG D N   1 
ATOM 3013  C CA  . ARG D 1 30  ? 74.092  74.868  29.961  1.00 33.40 ? 30  ARG D CA  1 
ATOM 3014  C C   . ARG D 1 30  ? 75.494  74.751  29.365  1.00 33.27 ? 30  ARG D C   1 
ATOM 3015  O O   . ARG D 1 30  ? 75.674  74.945  28.161  1.00 33.42 ? 30  ARG D O   1 
ATOM 3016  C CB  . ARG D 1 30  ? 73.836  76.307  30.423  1.00 33.43 ? 30  ARG D CB  1 
ATOM 3017  C CG  . ARG D 1 30  ? 72.478  76.555  31.072  1.00 33.49 ? 30  ARG D CG  1 
ATOM 3018  C CD  . ARG D 1 30  ? 71.302  76.240  30.155  1.00 33.56 ? 30  ARG D CD  1 
ATOM 3019  N NE  . ARG D 1 30  ? 70.018  76.301  30.856  1.00 33.57 ? 30  ARG D NE  1 
ATOM 3020  C CZ  . ARG D 1 30  ? 68.827  76.092  30.289  1.00 33.63 ? 30  ARG D CZ  1 
ATOM 3021  N NH1 . ARG D 1 30  ? 68.725  75.804  28.992  1.00 33.65 ? 30  ARG D NH1 1 
ATOM 3022  N NH2 . ARG D 1 30  ? 67.723  76.173  31.028  1.00 33.67 ? 30  ARG D NH2 1 
ATOM 3023  N N   . ALA D 1 31  ? 76.478  74.450  30.210  1.00 32.98 ? 31  ALA D N   1 
ATOM 3024  C CA  . ALA D 1 31  ? 77.834  74.142  29.750  1.00 32.87 ? 31  ALA D CA  1 
ATOM 3025  C C   . ALA D 1 31  ? 77.874  72.839  28.948  1.00 32.84 ? 31  ALA D C   1 
ATOM 3026  O O   . ALA D 1 31  ? 78.618  72.735  27.972  1.00 32.95 ? 31  ALA D O   1 
ATOM 3027  C CB  . ALA D 1 31  ? 78.787  74.060  30.931  1.00 32.90 ? 31  ALA D CB  1 
ATOM 3028  N N   . ASN D 1 32  ? 77.082  71.855  29.373  1.00 32.86 ? 32  ASN D N   1 
ATOM 3029  C CA  . ASN D 1 32  ? 76.934  70.588  28.643  1.00 32.92 ? 32  ASN D CA  1 
ATOM 3030  C C   . ASN D 1 32  ? 76.266  70.767  27.274  1.00 33.12 ? 32  ASN D C   1 
ATOM 3031  O O   . ASN D 1 32  ? 76.602  70.051  26.327  1.00 33.24 ? 32  ASN D O   1 
ATOM 3032  C CB  . ASN D 1 32  ? 76.137  69.568  29.473  1.00 32.83 ? 32  ASN D CB  1 
ATOM 3033  C CG  . ASN D 1 32  ? 76.909  69.043  30.676  1.00 32.76 ? 32  ASN D CG  1 
ATOM 3034  O OD1 . ASN D 1 32  ? 78.119  68.832  30.596  1.00 32.77 ? 32  ASN D OD1 1 
ATOM 3035  N ND2 . ASN D 1 32  ? 76.219  68.833  31.793  1.00 32.81 ? 32  ASN D ND2 1 
ATOM 3036  N N   . ASP D 1 33  ? 75.323  71.705  27.178  1.00 33.25 ? 33  ASP D N   1 
ATOM 3037  C CA  . ASP D 1 33  ? 74.699  72.061  25.894  1.00 33.42 ? 33  ASP D CA  1 
ATOM 3038  C C   . ASP D 1 33  ? 75.698  72.702  24.930  1.00 33.48 ? 33  ASP D C   1 
ATOM 3039  O O   . ASP D 1 33  ? 75.629  72.470  23.721  1.00 33.61 ? 33  ASP D O   1 
ATOM 3040  C CB  . ASP D 1 33  ? 73.514  73.015  26.099  1.00 33.64 ? 33  ASP D CB  1 
ATOM 3041  C CG  . ASP D 1 33  ? 72.348  72.372  26.837  1.00 33.90 ? 33  ASP D CG  1 
ATOM 3042  O OD1 . ASP D 1 33  ? 72.292  71.126  26.949  1.00 33.97 ? 33  ASP D OD1 1 
ATOM 3043  O OD2 . ASP D 1 33  ? 71.473  73.127  27.311  1.00 34.02 ? 33  ASP D OD2 1 
ATOM 3044  N N   . THR D 1 34  ? 76.610  73.512  25.469  1.00 33.41 ? 34  THR D N   1 
ATOM 3045  C CA  . THR D 1 34  ? 77.683  74.126  24.679  1.00 33.36 ? 34  THR D CA  1 
ATOM 3046  C C   . THR D 1 34  ? 78.636  73.082  24.086  1.00 33.33 ? 34  THR D C   1 
ATOM 3047  O O   . THR D 1 34  ? 79.118  73.257  22.969  1.00 33.44 ? 34  THR D O   1 
ATOM 3048  C CB  . THR D 1 34  ? 78.505  75.128  25.523  1.00 33.50 ? 34  THR D CB  1 
ATOM 3049  O OG1 . THR D 1 34  ? 77.620  75.979  26.261  1.00 33.50 ? 34  THR D OG1 1 
ATOM 3050  C CG2 . THR D 1 34  ? 79.410  75.986  24.637  1.00 33.60 ? 34  THR D CG2 1 
ATOM 3051  N N   . VAL D 1 35  ? 78.895  72.009  24.836  1.00 33.30 ? 35  VAL D N   1 
ATOM 3052  C CA  . VAL D 1 35  ? 79.735  70.897  24.365  1.00 33.32 ? 35  VAL D CA  1 
ATOM 3053  C C   . VAL D 1 35  ? 79.054  70.147  23.213  1.00 33.25 ? 35  VAL D C   1 
ATOM 3054  O O   . VAL D 1 35  ? 79.711  69.782  22.237  1.00 33.36 ? 35  VAL D O   1 
ATOM 3055  C CB  . VAL D 1 35  ? 80.080  69.912  25.515  1.00 33.52 ? 35  VAL D CB  1 
ATOM 3056  C CG1 . VAL D 1 35  ? 80.783  68.656  24.996  1.00 33.63 ? 35  VAL D CG1 1 
ATOM 3057  C CG2 . VAL D 1 35  ? 80.950  70.594  26.562  1.00 33.60 ? 35  VAL D CG2 1 
ATOM 3058  N N   . VAL D 1 36  ? 77.746  69.925  23.340  1.00 33.13 ? 36  VAL D N   1 
ATOM 3059  C CA  . VAL D 1 36  ? 76.956  69.250  22.303  1.00 33.03 ? 36  VAL D CA  1 
ATOM 3060  C C   . VAL D 1 36  ? 76.817  70.134  21.060  1.00 33.02 ? 36  VAL D C   1 
ATOM 3061  O O   . VAL D 1 36  ? 76.952  69.648  19.936  1.00 33.10 ? 36  VAL D O   1 
ATOM 3062  C CB  . VAL D 1 36  ? 75.555  68.843  22.826  1.00 33.02 ? 36  VAL D CB  1 
ATOM 3063  C CG1 . VAL D 1 36  ? 74.670  68.313  21.700  1.00 33.08 ? 36  VAL D CG1 1 
ATOM 3064  C CG2 . VAL D 1 36  ? 75.677  67.799  23.928  1.00 33.01 ? 36  VAL D CG2 1 
ATOM 3065  N N   . THR D 1 37  ? 76.542  71.421  21.272  1.00 33.06 ? 37  THR D N   1 
ATOM 3066  C CA  . THR D 1 37  ? 76.429  72.391  20.179  1.00 33.11 ? 37  THR D CA  1 
ATOM 3067  C C   . THR D 1 37  ? 77.761  72.587  19.448  1.00 33.10 ? 37  THR D C   1 
ATOM 3068  O O   . THR D 1 37  ? 77.780  72.697  18.222  1.00 33.26 ? 37  THR D O   1 
ATOM 3069  C CB  . THR D 1 37  ? 75.921  73.760  20.684  1.00 33.23 ? 37  THR D CB  1 
ATOM 3070  O OG1 . THR D 1 37  ? 74.713  73.580  21.434  1.00 33.31 ? 37  THR D OG1 1 
ATOM 3071  C CG2 . THR D 1 37  ? 75.653  74.718  19.519  1.00 33.28 ? 37  THR D CG2 1 
ATOM 3072  N N   . ALA D 1 38  ? 78.860  72.628  20.203  1.00 33.05 ? 38  ALA D N   1 
ATOM 3073  C CA  . ALA D 1 38  ? 80.203  72.763  19.625  1.00 33.10 ? 38  ALA D CA  1 
ATOM 3074  C C   . ALA D 1 38  ? 80.610  71.541  18.805  1.00 33.09 ? 38  ALA D C   1 
ATOM 3075  O O   . ALA D 1 38  ? 81.171  71.687  17.719  1.00 33.10 ? 38  ALA D O   1 
ATOM 3076  C CB  . ALA D 1 38  ? 81.233  73.025  20.715  1.00 33.16 ? 38  ALA D CB  1 
ATOM 3077  N N   . TYR D 1 39  ? 80.329  70.347  19.328  1.00 33.22 ? 39  TYR D N   1 
ATOM 3078  C CA  . TYR D 1 39  ? 80.666  69.096  18.639  1.00 33.27 ? 39  TYR D CA  1 
ATOM 3079  C C   . TYR D 1 39  ? 79.844  68.894  17.364  1.00 33.48 ? 39  TYR D C   1 
ATOM 3080  O O   . TYR D 1 39  ? 80.369  68.398  16.366  1.00 33.64 ? 39  TYR D O   1 
ATOM 3081  C CB  . TYR D 1 39  ? 80.496  67.888  19.565  1.00 33.19 ? 39  TYR D CB  1 
ATOM 3082  C CG  . TYR D 1 39  ? 81.147  66.633  19.026  1.00 33.27 ? 39  TYR D CG  1 
ATOM 3083  C CD1 . TYR D 1 39  ? 82.522  66.429  19.151  1.00 33.33 ? 39  TYR D CD1 1 
ATOM 3084  C CD2 . TYR D 1 39  ? 80.395  65.652  18.379  1.00 33.35 ? 39  TYR D CD2 1 
ATOM 3085  C CE1 . TYR D 1 39  ? 83.129  65.284  18.653  1.00 33.32 ? 39  TYR D CE1 1 
ATOM 3086  C CE2 . TYR D 1 39  ? 80.992  64.502  17.879  1.00 33.36 ? 39  TYR D CE2 1 
ATOM 3087  C CZ  . TYR D 1 39  ? 82.357  64.321  18.018  1.00 33.36 ? 39  TYR D CZ  1 
ATOM 3088  O OH  . TYR D 1 39  ? 82.952  63.183  17.524  1.00 33.46 ? 39  TYR D OH  1 
ATOM 3089  N N   . LEU D 1 40  ? 78.565  69.269  17.406  1.00 33.68 ? 40  LEU D N   1 
ATOM 3090  C CA  . LEU D 1 40  ? 77.714  69.268  16.208  1.00 33.88 ? 40  LEU D CA  1 
ATOM 3091  C C   . LEU D 1 40  ? 78.141  70.338  15.201  1.00 34.31 ? 40  LEU D C   1 
ATOM 3092  O O   . LEU D 1 40  ? 78.095  70.100  13.995  1.00 34.49 ? 40  LEU D O   1 
ATOM 3093  C CB  . LEU D 1 40  ? 76.238  69.459  16.574  1.00 33.80 ? 40  LEU D CB  1 
ATOM 3094  C CG  . LEU D 1 40  ? 75.550  68.273  17.255  1.00 33.73 ? 40  LEU D CG  1 
ATOM 3095  C CD1 . LEU D 1 40  ? 74.227  68.715  17.853  1.00 33.66 ? 40  LEU D CD1 1 
ATOM 3096  C CD2 . LEU D 1 40  ? 75.335  67.119  16.286  1.00 33.70 ? 40  LEU D CD2 1 
ATOM 3097  N N   . ASN D 1 41  ? 78.546  71.508  15.699  1.00 34.79 ? 41  ASN D N   1 
ATOM 3098  C CA  . ASN D 1 41  ? 79.093  72.573  14.849  1.00 35.15 ? 41  ASN D CA  1 
ATOM 3099  C C   . ASN D 1 41  ? 80.392  72.130  14.167  1.00 35.40 ? 41  ASN D C   1 
ATOM 3100  O O   . ASN D 1 41  ? 80.622  72.456  13.002  1.00 35.49 ? 41  ASN D O   1 
ATOM 3101  C CB  . ASN D 1 41  ? 79.329  73.853  15.663  1.00 35.34 ? 41  ASN D CB  1 
ATOM 3102  C CG  . ASN D 1 41  ? 79.743  75.036  14.801  1.00 35.61 ? 41  ASN D CG  1 
ATOM 3103  O OD1 . ASN D 1 41  ? 79.168  75.282  13.740  1.00 35.79 ? 41  ASN D OD1 1 
ATOM 3104  N ND2 . ASN D 1 41  ? 80.742  75.781  15.261  1.00 35.71 ? 41  ASN D ND2 1 
ATOM 3105  N N   . ASP D 1 42  ? 81.230  71.393  14.898  1.00 35.76 ? 42  ASP D N   1 
ATOM 3106  C CA  . ASP D 1 42  ? 82.432  70.772  14.325  1.00 36.04 ? 42  ASP D CA  1 
ATOM 3107  C C   . ASP D 1 42  ? 82.076  69.634  13.365  1.00 36.01 ? 42  ASP D C   1 
ATOM 3108  O O   . ASP D 1 42  ? 82.700  69.497  12.314  1.00 36.17 ? 42  ASP D O   1 
ATOM 3109  C CB  . ASP D 1 42  ? 83.363  70.242  15.428  1.00 36.32 ? 42  ASP D CB  1 
ATOM 3110  C CG  . ASP D 1 42  ? 83.985  71.355  16.266  1.00 36.66 ? 42  ASP D CG  1 
ATOM 3111  O OD1 . ASP D 1 42  ? 84.339  72.418  15.708  1.00 36.82 ? 42  ASP D OD1 1 
ATOM 3112  O OD2 . ASP D 1 42  ? 84.130  71.158  17.491  1.00 36.78 ? 42  ASP D OD2 1 
ATOM 3113  N N   . ALA D 1 43  ? 81.079  68.828  13.730  1.00 35.92 ? 43  ALA D N   1 
ATOM 3114  C CA  . ALA D 1 43  ? 80.605  67.724  12.884  1.00 35.94 ? 43  ALA D CA  1 
ATOM 3115  C C   . ALA D 1 43  ? 80.078  68.198  11.528  1.00 36.00 ? 43  ALA D C   1 
ATOM 3116  O O   . ALA D 1 43  ? 80.281  67.524  10.519  1.00 36.16 ? 43  ALA D O   1 
ATOM 3117  C CB  . ALA D 1 43  ? 79.534  66.919  13.609  1.00 35.95 ? 43  ALA D CB  1 
ATOM 3118  N N   . VAL D 1 44  ? 79.404  69.347  11.515  1.00 36.18 ? 44  VAL D N   1 
ATOM 3119  C CA  . VAL D 1 44  ? 78.913  69.966  10.273  1.00 36.35 ? 44  VAL D CA  1 
ATOM 3120  C C   . VAL D 1 44  ? 80.068  70.387  9.351   1.00 36.53 ? 44  VAL D C   1 
ATOM 3121  O O   . VAL D 1 44  ? 79.957  70.263  8.130   1.00 36.62 ? 44  VAL D O   1 
ATOM 3122  C CB  . VAL D 1 44  ? 77.973  71.170  10.576  1.00 36.45 ? 44  VAL D CB  1 
ATOM 3123  C CG1 . VAL D 1 44  ? 77.670  71.992  9.324   1.00 36.57 ? 44  VAL D CG1 1 
ATOM 3124  C CG2 . VAL D 1 44  ? 76.673  70.687  11.216  1.00 36.45 ? 44  VAL D CG2 1 
ATOM 3125  N N   . LYS D 1 45  ? 81.165  70.876  9.934   1.00 36.84 ? 45  LYS D N   1 
ATOM 3126  C CA  . LYS D 1 45  ? 82.344  71.288  9.159   1.00 37.12 ? 45  LYS D CA  1 
ATOM 3127  C C   . LYS D 1 45  ? 83.013  70.109  8.454   1.00 37.00 ? 45  LYS D C   1 
ATOM 3128  O O   . LYS D 1 45  ? 83.284  70.177  7.255   1.00 37.15 ? 45  LYS D O   1 
ATOM 3129  C CB  . LYS D 1 45  ? 83.364  72.013  10.047  1.00 37.49 ? 45  LYS D CB  1 
ATOM 3130  C CG  . LYS D 1 45  ? 82.889  73.363  10.563  1.00 37.82 ? 45  LYS D CG  1 
ATOM 3131  C CD  . LYS D 1 45  ? 83.741  73.860  11.722  1.00 38.10 ? 45  LYS D CD  1 
ATOM 3132  C CE  . LYS D 1 45  ? 83.157  75.122  12.337  1.00 38.33 ? 45  LYS D CE  1 
ATOM 3133  N NZ  . LYS D 1 45  ? 83.894  75.558  13.556  1.00 38.49 ? 45  LYS D NZ  1 
ATOM 3134  N N   . PHE D 1 46  ? 83.267  69.035  9.197   1.00 36.90 ? 46  PHE D N   1 
ATOM 3135  C CA  . PHE D 1 46  ? 83.893  67.831  8.632   1.00 36.84 ? 46  PHE D CA  1 
ATOM 3136  C C   . PHE D 1 46  ? 82.974  67.020  7.708   1.00 36.81 ? 46  PHE D C   1 
ATOM 3137  O O   . PHE D 1 46  ? 83.461  66.196  6.931   1.00 36.96 ? 46  PHE D O   1 
ATOM 3138  C CB  . PHE D 1 46  ? 84.478  66.946  9.740   1.00 36.83 ? 46  PHE D CB  1 
ATOM 3139  C CG  . PHE D 1 46  ? 85.742  67.495  10.336  1.00 36.90 ? 46  PHE D CG  1 
ATOM 3140  C CD1 . PHE D 1 46  ? 86.953  67.352  9.668   1.00 37.06 ? 46  PHE D CD1 1 
ATOM 3141  C CD2 . PHE D 1 46  ? 85.726  68.173  11.549  1.00 36.99 ? 46  PHE D CD2 1 
ATOM 3142  C CE1 . PHE D 1 46  ? 88.126  67.867  10.203  1.00 37.14 ? 46  PHE D CE1 1 
ATOM 3143  C CE2 . PHE D 1 46  ? 86.895  68.687  12.093  1.00 37.16 ? 46  PHE D CE2 1 
ATOM 3144  C CZ  . PHE D 1 46  ? 88.097  68.536  11.417  1.00 37.19 ? 46  PHE D CZ  1 
ATOM 3145  N N   . GLN D 1 47  ? 81.661  67.244  7.795   1.00 36.77 ? 47  GLN D N   1 
ATOM 3146  C CA  . GLN D 1 47  ? 80.717  66.727  6.794   1.00 36.82 ? 47  GLN D CA  1 
ATOM 3147  C C   . GLN D 1 47  ? 80.896  67.438  5.449   1.00 37.07 ? 47  GLN D C   1 
ATOM 3148  O O   . GLN D 1 47  ? 80.838  66.798  4.398   1.00 37.28 ? 47  GLN D O   1 
ATOM 3149  C CB  . GLN D 1 47  ? 79.263  66.859  7.270   1.00 36.79 ? 47  GLN D CB  1 
ATOM 3150  C CG  . GLN D 1 47  ? 78.839  65.810  8.289   1.00 36.85 ? 47  GLN D CG  1 
ATOM 3151  C CD  . GLN D 1 47  ? 78.372  64.508  7.659   1.00 36.98 ? 47  GLN D CD  1 
ATOM 3152  O OE1 . GLN D 1 47  ? 78.897  64.072  6.634   1.00 37.07 ? 47  GLN D OE1 1 
ATOM 3153  N NE2 . GLN D 1 47  ? 77.383  63.875  8.280   1.00 37.07 ? 47  GLN D NE2 1 
ATOM 3154  N N   . GLU D 1 48  ? 81.105  68.755  5.491   1.00 37.41 ? 48  GLU D N   1 
ATOM 3155  C CA  . GLU D 1 48  ? 81.393  69.546  4.286   1.00 37.74 ? 48  GLU D CA  1 
ATOM 3156  C C   . GLU D 1 48  ? 82.767  69.228  3.687   1.00 37.83 ? 48  GLU D C   1 
ATOM 3157  O O   . GLU D 1 48  ? 82.942  69.312  2.472   1.00 38.01 ? 48  GLU D O   1 
ATOM 3158  C CB  . GLU D 1 48  ? 81.287  71.051  4.573   1.00 38.07 ? 48  GLU D CB  1 
ATOM 3159  C CG  . GLU D 1 48  ? 79.883  71.537  4.912   1.00 38.39 ? 48  GLU D CG  1 
ATOM 3160  C CD  . GLU D 1 48  ? 78.936  71.539  3.720   1.00 38.68 ? 48  GLU D CD  1 
ATOM 3161  O OE1 . GLU D 1 48  ? 79.321  72.036  2.639   1.00 38.76 ? 48  GLU D OE1 1 
ATOM 3162  O OE2 . GLU D 1 48  ? 77.793  71.052  3.869   1.00 38.77 ? 48  GLU D OE2 1 
ATOM 3163  N N   . MET D 1 49  ? 83.737  68.880  4.535   1.00 37.94 ? 49  MET D N   1 
ATOM 3164  C CA  . MET D 1 49  ? 85.067  68.459  4.067   1.00 38.06 ? 49  MET D CA  1 
ATOM 3165  C C   . MET D 1 49  ? 85.039  67.094  3.373   1.00 37.98 ? 49  MET D C   1 
ATOM 3166  O O   . MET D 1 49  ? 85.781  66.874  2.414   1.00 38.26 ? 49  MET D O   1 
ATOM 3167  C CB  . MET D 1 49  ? 86.072  68.438  5.221   1.00 38.24 ? 49  MET D CB  1 
ATOM 3168  C CG  . MET D 1 49  ? 86.435  69.825  5.725   1.00 38.47 ? 49  MET D CG  1 
ATOM 3169  S SD  . MET D 1 49  ? 87.484  69.816  7.190   1.00 38.86 ? 49  MET D SD  1 
ATOM 3170  C CE  . MET D 1 49  ? 88.951  69.012  6.552   1.00 38.96 ? 49  MET D CE  1 
ATOM 3171  N N   . TYR D 1 50  ? 84.195  66.186  3.860   1.00 37.79 ? 50  TYR D N   1 
ATOM 3172  C CA  . TYR D 1 50  ? 83.975  64.893  3.204   1.00 37.80 ? 50  TYR D CA  1 
ATOM 3173  C C   . TYR D 1 50  ? 83.208  65.054  1.885   1.00 38.04 ? 50  TYR D C   1 
ATOM 3174  O O   . TYR D 1 50  ? 83.415  64.279  0.948   1.00 38.25 ? 50  TYR D O   1 
ATOM 3175  C CB  . TYR D 1 50  ? 83.224  63.937  4.134   1.00 37.76 ? 50  TYR D CB  1 
ATOM 3176  C CG  . TYR D 1 50  ? 83.304  62.483  3.724   1.00 37.79 ? 50  TYR D CG  1 
ATOM 3177  C CD1 . TYR D 1 50  ? 82.361  61.925  2.860   1.00 37.66 ? 50  TYR D CD1 1 
ATOM 3178  C CD2 . TYR D 1 50  ? 84.313  61.654  4.217   1.00 37.87 ? 50  TYR D CD2 1 
ATOM 3179  C CE1 . TYR D 1 50  ? 82.427  60.590  2.490   1.00 37.67 ? 50  TYR D CE1 1 
ATOM 3180  C CE2 . TYR D 1 50  ? 84.388  60.317  3.852   1.00 37.85 ? 50  TYR D CE2 1 
ATOM 3181  C CZ  . TYR D 1 50  ? 83.442  59.788  2.989   1.00 37.80 ? 50  TYR D CZ  1 
ATOM 3182  O OH  . TYR D 1 50  ? 83.511  58.464  2.622   1.00 37.98 ? 50  TYR D OH  1 
ATOM 3183  N N   . GLN D 1 51  ? 82.322  66.049  1.828   1.00 38.31 ? 51  GLN D N   1 
ATOM 3184  C CA  . GLN D 1 51  ? 81.600  66.406  0.600   1.00 38.55 ? 51  GLN D CA  1 
ATOM 3185  C C   . GLN D 1 51  ? 82.540  66.911  -0.505  1.00 38.78 ? 51  GLN D C   1 
ATOM 3186  O O   . GLN D 1 51  ? 82.272  66.695  -1.688  1.00 38.94 ? 51  GLN D O   1 
ATOM 3187  C CB  . GLN D 1 51  ? 80.524  67.461  0.907   1.00 38.73 ? 51  GLN D CB  1 
ATOM 3188  C CG  . GLN D 1 51  ? 79.553  67.776  -0.226  1.00 38.88 ? 51  GLN D CG  1 
ATOM 3189  C CD  . GLN D 1 51  ? 78.624  66.625  -0.564  1.00 38.88 ? 51  GLN D CD  1 
ATOM 3190  O OE1 . GLN D 1 51  ? 78.034  66.008  0.320   1.00 38.93 ? 51  GLN D OE1 1 
ATOM 3191  N NE2 . GLN D 1 51  ? 78.474  66.347  -1.853  1.00 38.97 ? 51  GLN D NE2 1 
ATOM 3192  N N   . ILE D 1 52  ? 83.624  67.585  -0.120  1.00 38.96 ? 52  ILE D N   1 
ATOM 3193  C CA  . ILE D 1 52  ? 84.659  68.021  -1.069  1.00 39.19 ? 52  ILE D CA  1 
ATOM 3194  C C   . ILE D 1 52  ? 85.401  66.817  -1.665  1.00 39.35 ? 52  ILE D C   1 
ATOM 3195  O O   . ILE D 1 52  ? 85.658  66.781  -2.871  1.00 39.50 ? 52  ILE D O   1 
ATOM 3196  C CB  . ILE D 1 52  ? 85.661  69.009  -0.412  1.00 39.24 ? 52  ILE D CB  1 
ATOM 3197  C CG1 . ILE D 1 52  ? 84.955  70.326  -0.063  1.00 39.33 ? 52  ILE D CG1 1 
ATOM 3198  C CG2 . ILE D 1 52  ? 86.850  69.299  -1.331  1.00 39.29 ? 52  ILE D CG2 1 
ATOM 3199  C CD1 . ILE D 1 52  ? 85.642  71.140  1.015   1.00 39.33 ? 52  ILE D CD1 1 
ATOM 3200  N N   . ASP D 1 53  ? 85.730  65.839  -0.821  1.00 39.54 ? 53  ASP D N   1 
ATOM 3201  C CA  . ASP D 1 53  ? 86.494  64.662  -1.246  1.00 39.77 ? 53  ASP D CA  1 
ATOM 3202  C C   . ASP D 1 53  ? 85.645  63.666  -2.034  1.00 39.75 ? 53  ASP D C   1 
ATOM 3203  O O   . ASP D 1 53  ? 85.941  63.374  -3.194  1.00 39.95 ? 53  ASP D O   1 
ATOM 3204  C CB  . ASP D 1 53  ? 87.117  63.958  -0.034  1.00 40.03 ? 53  ASP D CB  1 
ATOM 3205  C CG  . ASP D 1 53  ? 88.130  64.827  0.698   1.00 40.34 ? 53  ASP D CG  1 
ATOM 3206  O OD1 . ASP D 1 53  ? 88.148  66.056  0.473   1.00 40.49 ? 53  ASP D OD1 1 
ATOM 3207  O OD2 . ASP D 1 53  ? 88.907  64.276  1.507   1.00 40.58 ? 53  ASP D OD2 1 
ATOM 3208  N N   . ASN D 1 54  ? 84.587  63.164  -1.397  1.00 39.52 ? 54  ASN D N   1 
ATOM 3209  C CA  . ASN D 1 54  ? 83.807  62.032  -1.919  1.00 39.56 ? 54  ASN D CA  1 
ATOM 3210  C C   . ASN D 1 54  ? 82.520  62.398  -2.675  1.00 39.43 ? 54  ASN D C   1 
ATOM 3211  O O   . ASN D 1 54  ? 81.915  61.521  -3.294  1.00 39.61 ? 54  ASN D O   1 
ATOM 3212  C CB  . ASN D 1 54  ? 83.454  61.080  -0.771  1.00 39.76 ? 54  ASN D CB  1 
ATOM 3213  C CG  . ASN D 1 54  ? 84.679  60.460  -0.124  1.00 39.96 ? 54  ASN D CG  1 
ATOM 3214  O OD1 . ASN D 1 54  ? 85.020  59.308  -0.393  1.00 40.17 ? 54  ASN D OD1 1 
ATOM 3215  N ND2 . ASN D 1 54  ? 85.348  61.224  0.732   1.00 40.00 ? 54  ASN D ND2 1 
ATOM 3216  N N   . ASN D 1 55  ? 82.108  63.669  -2.624  1.00 39.07 ? 55  ASN D N   1 
ATOM 3217  C CA  . ASN D 1 55  ? 80.835  64.135  -3.208  1.00 38.83 ? 55  ASN D CA  1 
ATOM 3218  C C   . ASN D 1 55  ? 79.615  63.439  -2.584  1.00 38.56 ? 55  ASN D C   1 
ATOM 3219  O O   . ASN D 1 55  ? 78.676  63.053  -3.284  1.00 38.71 ? 55  ASN D O   1 
ATOM 3220  C CB  . ASN D 1 55  ? 80.832  63.990  -4.741  1.00 39.00 ? 55  ASN D CB  1 
ATOM 3221  C CG  . ASN D 1 55  ? 82.074  64.574  -5.392  1.00 39.27 ? 55  ASN D CG  1 
ATOM 3222  O OD1 . ASN D 1 55  ? 82.681  63.952  -6.264  1.00 39.50 ? 55  ASN D OD1 1 
ATOM 3223  N ND2 . ASN D 1 55  ? 82.460  65.776  -4.971  1.00 39.40 ? 55  ASN D ND2 1 
ATOM 3224  N N   . SER D 1 56  ? 79.646  63.293  -1.260  1.00 38.22 ? 56  SER D N   1 
ATOM 3225  C CA  . SER D 1 56  ? 78.551  62.687  -0.494  1.00 37.99 ? 56  SER D CA  1 
ATOM 3226  C C   . SER D 1 56  ? 78.697  63.020  0.992   1.00 37.53 ? 56  SER D C   1 
ATOM 3227  O O   . SER D 1 56  ? 79.655  63.685  1.390   1.00 37.69 ? 56  SER D O   1 
ATOM 3228  C CB  . SER D 1 56  ? 78.539  61.167  -0.689  1.00 38.25 ? 56  SER D CB  1 
ATOM 3229  O OG  . SER D 1 56  ? 77.407  60.579  -0.070  1.00 38.43 ? 56  SER D OG  1 
ATOM 3230  N N   . TYR D 1 57  ? 77.735  62.573  1.800   1.00 36.99 ? 57  TYR D N   1 
ATOM 3231  C CA  . TYR D 1 57  ? 77.788  62.729  3.258   1.00 36.72 ? 57  TYR D CA  1 
ATOM 3232  C C   . TYR D 1 57  ? 77.954  61.373  3.945   1.00 36.67 ? 57  TYR D C   1 
ATOM 3233  O O   . TYR D 1 57  ? 77.496  60.347  3.436   1.00 36.63 ? 57  TYR D O   1 
ATOM 3234  C CB  . TYR D 1 57  ? 76.534  63.439  3.770   1.00 36.60 ? 57  TYR D CB  1 
ATOM 3235  C CG  . TYR D 1 57  ? 76.467  64.906  3.396   1.00 36.53 ? 57  TYR D CG  1 
ATOM 3236  C CD1 . TYR D 1 57  ? 77.325  65.836  3.985   1.00 36.47 ? 57  TYR D CD1 1 
ATOM 3237  C CD2 . TYR D 1 57  ? 75.541  65.371  2.460   1.00 36.51 ? 57  TYR D CD2 1 
ATOM 3238  C CE1 . TYR D 1 57  ? 77.269  67.182  3.650   1.00 36.34 ? 57  TYR D CE1 1 
ATOM 3239  C CE2 . TYR D 1 57  ? 75.477  66.716  2.119   1.00 36.42 ? 57  TYR D CE2 1 
ATOM 3240  C CZ  . TYR D 1 57  ? 76.341  67.617  2.716   1.00 36.34 ? 57  TYR D CZ  1 
ATOM 3241  O OH  . TYR D 1 57  ? 76.283  68.950  2.383   1.00 36.45 ? 57  TYR D OH  1 
ATOM 3242  N N   . THR D 1 58  ? 78.604  61.389  5.107   1.00 36.59 ? 58  THR D N   1 
ATOM 3243  C CA  . THR D 1 58  ? 78.983  60.172  5.821   1.00 36.53 ? 58  THR D CA  1 
ATOM 3244  C C   . THR D 1 58  ? 77.865  59.651  6.716   1.00 36.66 ? 58  THR D C   1 
ATOM 3245  O O   . THR D 1 58  ? 77.257  60.417  7.465   1.00 36.84 ? 58  THR D O   1 
ATOM 3246  C CB  . THR D 1 58  ? 80.207  60.418  6.721   1.00 36.65 ? 58  THR D CB  1 
ATOM 3247  O OG1 . THR D 1 58  ? 79.931  61.494  7.628   1.00 36.58 ? 58  THR D OG1 1 
ATOM 3248  C CG2 . THR D 1 58  ? 81.413  60.772  5.886   1.00 36.74 ? 58  THR D CG2 1 
ATOM 3249  N N   . SER D 1 59  ? 77.614  58.345  6.638   1.00 36.78 ? 59  SER D N   1 
ATOM 3250  C CA  . SER D 1 59  ? 76.728  57.659  7.575   1.00 36.85 ? 59  SER D CA  1 
ATOM 3251  C C   . SER D 1 59  ? 77.495  57.307  8.851   1.00 36.82 ? 59  SER D C   1 
ATOM 3252  O O   . SER D 1 59  ? 76.987  57.513  9.953   1.00 36.81 ? 59  SER D O   1 
ATOM 3253  C CB  . SER D 1 59  ? 76.152  56.392  6.939   1.00 37.11 ? 59  SER D CB  1 
ATOM 3254  O OG  . SER D 1 59  ? 75.138  55.825  7.753   1.00 37.24 ? 59  SER D OG  1 
ATOM 3255  N N   . ASN D 1 60  ? 78.707  56.775  8.692   1.00 36.97 ? 60  ASN D N   1 
ATOM 3256  C CA  . ASN D 1 60  ? 79.557  56.389  9.831   1.00 37.22 ? 60  ASN D CA  1 
ATOM 3257  C C   . ASN D 1 60  ? 80.347  57.572  10.406  1.00 37.20 ? 60  ASN D C   1 
ATOM 3258  O O   . ASN D 1 60  ? 80.679  58.519  9.690   1.00 37.13 ? 60  ASN D O   1 
ATOM 3259  C CB  . ASN D 1 60  ? 80.511  55.242  9.448   1.00 37.35 ? 60  ASN D CB  1 
ATOM 3260  C CG  . ASN D 1 60  ? 81.591  55.666  8.464   1.00 37.43 ? 60  ASN D CG  1 
ATOM 3261  O OD1 . ASN D 1 60  ? 81.357  56.487  7.575   1.00 37.43 ? 60  ASN D OD1 1 
ATOM 3262  N ND2 . ASN D 1 60  ? 82.781  55.093  8.613   1.00 37.57 ? 60  ASN D ND2 1 
ATOM 3263  N N   . GLN D 1 61  ? 80.644  57.493  11.703  1.00 37.16 ? 61  GLN D N   1 
ATOM 3264  C CA  . GLN D 1 61  ? 81.396  58.533  12.412  1.00 37.02 ? 61  GLN D CA  1 
ATOM 3265  C C   . GLN D 1 61  ? 82.899  58.451  12.136  1.00 36.99 ? 61  GLN D C   1 
ATOM 3266  O O   . GLN D 1 61  ? 83.572  59.481  12.082  1.00 37.14 ? 61  GLN D O   1 
ATOM 3267  C CB  . GLN D 1 61  ? 81.145  58.433  13.920  1.00 37.12 ? 61  GLN D CB  1 
ATOM 3268  C CG  . GLN D 1 61  ? 81.585  59.658  14.713  1.00 37.21 ? 61  GLN D CG  1 
ATOM 3269  C CD  . GLN D 1 61  ? 81.476  59.466  16.214  1.00 37.24 ? 61  GLN D CD  1 
ATOM 3270  O OE1 . GLN D 1 61  ? 80.679  58.660  16.700  1.00 37.27 ? 61  GLN D OE1 1 
ATOM 3271  N NE2 . GLN D 1 61  ? 82.276  60.217  16.962  1.00 37.32 ? 61  GLN D NE2 1 
ATOM 3272  N N   . ALA D 1 62  ? 83.418  57.230  11.976  1.00 36.96 ? 62  ALA D N   1 
ATOM 3273  C CA  . ALA D 1 62  ? 84.850  56.994  11.730  1.00 36.85 ? 62  ALA D CA  1 
ATOM 3274  C C   . ALA D 1 62  ? 85.403  57.706  10.490  1.00 36.78 ? 62  ALA D C   1 
ATOM 3275  O O   . ALA D 1 62  ? 86.586  58.049  10.451  1.00 36.92 ? 62  ALA D O   1 
ATOM 3276  C CB  . ALA D 1 62  ? 85.129  55.500  11.636  1.00 36.91 ? 62  ALA D CB  1 
ATOM 3277  N N   . ALA D 1 63  ? 84.552  57.912  9.483   1.00 36.84 ? 63  ALA D N   1 
ATOM 3278  C CA  . ALA D 1 63  ? 84.915  58.687  8.293   1.00 36.91 ? 63  ALA D CA  1 
ATOM 3279  C C   . ALA D 1 63  ? 85.184  60.157  8.627   1.00 36.82 ? 63  ALA D C   1 
ATOM 3280  O O   . ALA D 1 63  ? 86.142  60.740  8.120   1.00 36.91 ? 63  ALA D O   1 
ATOM 3281  C CB  . ALA D 1 63  ? 83.827  58.579  7.234   1.00 37.01 ? 63  ALA D CB  1 
ATOM 3282  N N   . LEU D 1 64  ? 84.341  60.742  9.478   1.00 36.89 ? 64  LEU D N   1 
ATOM 3283  C CA  . LEU D 1 64  ? 84.519  62.127  9.933   1.00 37.01 ? 64  LEU D CA  1 
ATOM 3284  C C   . LEU D 1 64  ? 85.741  62.293  10.842  1.00 37.02 ? 64  LEU D C   1 
ATOM 3285  O O   . LEU D 1 64  ? 86.417  63.322  10.787  1.00 37.07 ? 64  LEU D O   1 
ATOM 3286  C CB  . LEU D 1 64  ? 83.269  62.629  10.668  1.00 37.12 ? 64  LEU D CB  1 
ATOM 3287  C CG  . LEU D 1 64  ? 81.958  62.677  9.877   1.00 37.29 ? 64  LEU D CG  1 
ATOM 3288  C CD1 . LEU D 1 64  ? 80.800  63.036  10.796  1.00 37.40 ? 64  LEU D CD1 1 
ATOM 3289  C CD2 . LEU D 1 64  ? 82.049  63.661  8.719   1.00 37.32 ? 64  LEU D CD2 1 
ATOM 3290  N N   . ILE D 1 65  ? 86.012  61.282  11.670  1.00 37.10 ? 65  ILE D N   1 
ATOM 3291  C CA  . ILE D 1 65  ? 87.163  61.299  12.585  1.00 37.16 ? 65  ILE D CA  1 
ATOM 3292  C C   . ILE D 1 65  ? 88.486  61.180  11.815  1.00 37.20 ? 65  ILE D C   1 
ATOM 3293  O O   . ILE D 1 65  ? 89.478  61.810  12.190  1.00 37.29 ? 65  ILE D O   1 
ATOM 3294  C CB  . ILE D 1 65  ? 87.058  60.188  13.666  1.00 37.23 ? 65  ILE D CB  1 
ATOM 3295  C CG1 . ILE D 1 65  ? 85.824  60.414  14.554  1.00 37.33 ? 65  ILE D CG1 1 
ATOM 3296  C CG2 . ILE D 1 65  ? 88.312  60.143  14.541  1.00 37.26 ? 65  ILE D CG2 1 
ATOM 3297  C CD1 . ILE D 1 65  ? 85.408  59.203  15.363  1.00 37.48 ? 65  ILE D CD1 1 
ATOM 3298  N N   . SER D 1 66  ? 88.494  60.379  10.749  1.00 37.26 ? 66  SER D N   1 
ATOM 3299  C CA  . SER D 1 66  ? 89.678  60.212  9.896   1.00 37.39 ? 66  SER D CA  1 
ATOM 3300  C C   . SER D 1 66  ? 90.111  61.513  9.208   1.00 37.52 ? 66  SER D C   1 
ATOM 3301  O O   . SER D 1 66  ? 91.308  61.760  9.048   1.00 37.55 ? 66  SER D O   1 
ATOM 3302  C CB  . SER D 1 66  ? 89.432  59.126  8.842   1.00 37.37 ? 66  SER D CB  1 
ATOM 3303  O OG  . SER D 1 66  ? 90.619  58.821  8.129   1.00 37.36 ? 66  SER D OG  1 
ATOM 3304  N N   . LEU D 1 67  ? 89.138  62.331  8.805   1.00 37.78 ? 67  LEU D N   1 
ATOM 3305  C CA  . LEU D 1 67  ? 89.417  63.644  8.199   1.00 38.04 ? 67  LEU D CA  1 
ATOM 3306  C C   . LEU D 1 67  ? 90.040  64.653  9.173   1.00 38.13 ? 67  LEU D C   1 
ATOM 3307  O O   . LEU D 1 67  ? 90.831  65.501  8.751   1.00 38.34 ? 67  LEU D O   1 
ATOM 3308  C CB  . LEU D 1 67  ? 88.154  64.248  7.555   1.00 38.16 ? 67  LEU D CB  1 
ATOM 3309  C CG  . LEU D 1 67  ? 87.953  63.963  6.062   1.00 38.40 ? 67  LEU D CG  1 
ATOM 3310  C CD1 . LEU D 1 67  ? 87.758  62.481  5.770   1.00 38.45 ? 67  LEU D CD1 1 
ATOM 3311  C CD2 . LEU D 1 67  ? 86.772  64.763  5.537   1.00 38.59 ? 67  LEU D CD2 1 
ATOM 3312  N N   . GLY D 1 68  ? 89.694  64.559  10.459  1.00 37.98 ? 68  GLY D N   1 
ATOM 3313  C CA  . GLY D 1 68  ? 90.201  65.497  11.470  1.00 37.88 ? 68  GLY D CA  1 
ATOM 3314  C C   . GLY D 1 68  ? 89.360  65.719  12.719  1.00 37.72 ? 68  GLY D C   1 
ATOM 3315  O O   . GLY D 1 68  ? 89.891  66.184  13.731  1.00 37.88 ? 68  GLY D O   1 
ATOM 3316  N N   . LEU D 1 69  ? 88.057  65.425  12.656  1.00 37.46 ? 69  LEU D N   1 
ATOM 3317  C CA  . LEU D 1 69  ? 87.155  65.567  13.812  1.00 37.38 ? 69  LEU D CA  1 
ATOM 3318  C C   . LEU D 1 69  ? 87.642  64.775  15.028  1.00 37.38 ? 69  LEU D C   1 
ATOM 3319  O O   . LEU D 1 69  ? 88.226  63.698  14.885  1.00 37.44 ? 69  LEU D O   1 
ATOM 3320  C CB  . LEU D 1 69  ? 85.733  65.115  13.448  1.00 37.38 ? 69  LEU D CB  1 
ATOM 3321  C CG  . LEU D 1 69  ? 84.606  65.315  14.471  1.00 37.33 ? 69  LEU D CG  1 
ATOM 3322  C CD1 . LEU D 1 69  ? 84.346  66.788  14.750  1.00 37.36 ? 69  LEU D CD1 1 
ATOM 3323  C CD2 . LEU D 1 69  ? 83.332  64.641  13.984  1.00 37.37 ? 69  LEU D CD2 1 
ATOM 3324  N N   . LYS D 1 70  ? 87.394  65.318  16.218  1.00 37.37 ? 70  LYS D N   1 
ATOM 3325  C CA  . LYS D 1 70  ? 87.794  64.674  17.472  1.00 37.30 ? 70  LYS D CA  1 
ATOM 3326  C C   . LYS D 1 70  ? 86.889  63.488  17.796  1.00 37.09 ? 70  LYS D C   1 
ATOM 3327  O O   . LYS D 1 70  ? 85.836  63.307  17.179  1.00 37.05 ? 70  LYS D O   1 
ATOM 3328  C CB  . LYS D 1 70  ? 87.752  65.675  18.632  1.00 37.51 ? 70  LYS D CB  1 
ATOM 3329  C CG  . LYS D 1 70  ? 88.698  66.855  18.482  1.00 37.82 ? 70  LYS D CG  1 
ATOM 3330  C CD  . LYS D 1 70  ? 88.731  67.694  19.751  1.00 38.07 ? 70  LYS D CD  1 
ATOM 3331  C CE  . LYS D 1 70  ? 89.701  68.861  19.634  1.00 38.26 ? 70  LYS D CE  1 
ATOM 3332  N NZ  . LYS D 1 70  ? 89.272  69.867  18.621  1.00 38.34 ? 70  LYS D NZ  1 
ATOM 3333  N N   . SER D 1 71  ? 87.313  62.685  18.770  1.00 36.84 ? 71  SER D N   1 
ATOM 3334  C CA  . SER D 1 71  ? 86.494  61.586  19.286  1.00 36.56 ? 71  SER D CA  1 
ATOM 3335  C C   . SER D 1 71  ? 85.283  62.140  20.034  1.00 36.24 ? 71  SER D C   1 
ATOM 3336  O O   . SER D 1 71  ? 85.279  63.306  20.445  1.00 36.23 ? 71  SER D O   1 
ATOM 3337  C CB  . SER D 1 71  ? 87.316  60.691  20.216  1.00 36.59 ? 71  SER D CB  1 
ATOM 3338  O OG  . SER D 1 71  ? 88.437  60.147  19.541  1.00 36.60 ? 71  SER D OG  1 
ATOM 3339  N N   . THR D 1 72  ? 84.260  61.304  20.206  1.00 35.94 ? 72  THR D N   1 
ATOM 3340  C CA  . THR D 1 72  ? 83.026  61.710  20.884  1.00 35.78 ? 72  THR D CA  1 
ATOM 3341  C C   . THR D 1 72  ? 83.342  62.170  22.314  1.00 35.65 ? 72  THR D C   1 
ATOM 3342  O O   . THR D 1 72  ? 84.105  61.495  23.011  1.00 35.81 ? 72  THR D O   1 
ATOM 3343  C CB  . THR D 1 72  ? 82.002  60.558  20.939  1.00 35.87 ? 72  THR D CB  1 
ATOM 3344  O OG1 . THR D 1 72  ? 81.855  59.979  19.637  1.00 35.93 ? 72  THR D OG1 1 
ATOM 3345  C CG2 . THR D 1 72  ? 80.642  61.057  21.424  1.00 35.94 ? 72  THR D CG2 1 
ATOM 3346  N N   . PRO D 1 73  ? 82.776  63.319  22.755  1.00 35.35 ? 73  PRO D N   1 
ATOM 3347  C CA  . PRO D 1 73  ? 83.109  63.808  24.103  1.00 35.35 ? 73  PRO D CA  1 
ATOM 3348  C C   . PRO D 1 73  ? 82.567  62.932  25.236  1.00 35.42 ? 73  PRO D C   1 
ATOM 3349  O O   . PRO D 1 73  ? 81.705  62.079  25.007  1.00 35.51 ? 73  PRO D O   1 
ATOM 3350  C CB  . PRO D 1 73  ? 82.467  65.205  24.156  1.00 35.35 ? 73  PRO D CB  1 
ATOM 3351  C CG  . PRO D 1 73  ? 82.078  65.535  22.759  1.00 35.32 ? 73  PRO D CG  1 
ATOM 3352  C CD  . PRO D 1 73  ? 81.839  64.231  22.073  1.00 35.28 ? 73  PRO D CD  1 
ATOM 3353  N N   . ALA D 1 74  ? 83.080  63.156  26.443  1.00 35.52 ? 74  ALA D N   1 
ATOM 3354  C CA  . ALA D 1 74  ? 82.688  62.377  27.618  1.00 35.57 ? 74  ALA D CA  1 
ATOM 3355  C C   . ALA D 1 74  ? 81.233  62.657  27.986  1.00 35.42 ? 74  ALA D C   1 
ATOM 3356  O O   . ALA D 1 74  ? 80.824  63.818  28.065  1.00 35.50 ? 74  ALA D O   1 
ATOM 3357  C CB  . ALA D 1 74  ? 83.601  62.690  28.795  1.00 35.68 ? 74  ALA D CB  1 
ATOM 3358  N N   . ASN D 1 75  ? 80.468  61.583  28.199  1.00 35.20 ? 75  ASN D N   1 
ATOM 3359  C CA  . ASN D 1 75  ? 79.035  61.651  28.514  1.00 35.04 ? 75  ASN D CA  1 
ATOM 3360  C C   . ASN D 1 75  ? 78.210  62.335  27.411  1.00 34.83 ? 75  ASN D C   1 
ATOM 3361  O O   . ASN D 1 75  ? 77.293  63.109  27.700  1.00 34.81 ? 75  ASN D O   1 
ATOM 3362  C CB  . ASN D 1 75  ? 78.805  62.333  29.875  1.00 35.14 ? 75  ASN D CB  1 
ATOM 3363  C CG  . ASN D 1 75  ? 79.673  61.757  30.979  1.00 35.37 ? 75  ASN D CG  1 
ATOM 3364  O OD1 . ASN D 1 75  ? 79.996  60.568  30.979  1.00 35.52 ? 75  ASN D OD1 1 
ATOM 3365  N ND2 . ASN D 1 75  ? 80.052  62.602  31.932  1.00 35.47 ? 75  ASN D ND2 1 
ATOM 3366  N N   . VAL D 1 76  ? 78.549  62.039  26.154  1.00 34.65 ? 76  VAL D N   1 
ATOM 3367  C CA  . VAL D 1 76  ? 77.827  62.548  24.980  1.00 34.49 ? 76  VAL D CA  1 
ATOM 3368  C C   . VAL D 1 76  ? 77.531  61.382  24.038  1.00 34.47 ? 76  VAL D C   1 
ATOM 3369  O O   . VAL D 1 76  ? 78.407  60.558  23.766  1.00 34.47 ? 76  VAL D O   1 
ATOM 3370  C CB  . VAL D 1 76  ? 78.638  63.634  24.233  1.00 34.35 ? 76  VAL D CB  1 
ATOM 3371  C CG1 . VAL D 1 76  ? 77.935  64.065  22.946  1.00 34.32 ? 76  VAL D CG1 1 
ATOM 3372  C CG2 . VAL D 1 76  ? 78.868  64.835  25.136  1.00 34.40 ? 76  VAL D CG2 1 
ATOM 3373  N N   . THR D 1 77  ? 76.293  61.332  23.543  1.00 34.42 ? 77  THR D N   1 
ATOM 3374  C CA  . THR D 1 77  ? 75.828  60.266  22.655  1.00 34.40 ? 77  THR D CA  1 
ATOM 3375  C C   . THR D 1 77  ? 75.587  60.808  21.248  1.00 34.33 ? 77  THR D C   1 
ATOM 3376  O O   . THR D 1 77  ? 74.450  61.082  20.856  1.00 34.35 ? 77  THR D O   1 
ATOM 3377  C CB  . THR D 1 77  ? 74.537  59.622  23.196  1.00 34.48 ? 77  THR D CB  1 
ATOM 3378  O OG1 . THR D 1 77  ? 73.555  60.637  23.432  1.00 34.42 ? 77  THR D OG1 1 
ATOM 3379  C CG2 . THR D 1 77  ? 74.815  58.881  24.495  1.00 34.60 ? 77  THR D CG2 1 
ATOM 3380  N N   . PHE D 1 78  ? 76.679  60.969  20.503  1.00 34.32 ? 78  PHE D N   1 
ATOM 3381  C CA  . PHE D 1 78  ? 76.625  61.377  19.098  1.00 34.26 ? 78  PHE D CA  1 
ATOM 3382  C C   . PHE D 1 78  ? 76.185  60.190  18.243  1.00 34.03 ? 78  PHE D C   1 
ATOM 3383  O O   . PHE D 1 78  ? 76.626  59.061  18.469  1.00 34.15 ? 78  PHE D O   1 
ATOM 3384  C CB  . PHE D 1 78  ? 77.999  61.881  18.637  1.00 34.49 ? 78  PHE D CB  1 
ATOM 3385  C CG  . PHE D 1 78  ? 78.037  62.330  17.202  1.00 34.68 ? 78  PHE D CG  1 
ATOM 3386  C CD1 . PHE D 1 78  ? 77.611  63.605  16.845  1.00 34.79 ? 78  PHE D CD1 1 
ATOM 3387  C CD2 . PHE D 1 78  ? 78.511  61.481  16.204  1.00 34.80 ? 78  PHE D CD2 1 
ATOM 3388  C CE1 . PHE D 1 78  ? 77.649  64.022  15.521  1.00 34.94 ? 78  PHE D CE1 1 
ATOM 3389  C CE2 . PHE D 1 78  ? 78.551  61.892  14.879  1.00 34.93 ? 78  PHE D CE2 1 
ATOM 3390  C CZ  . PHE D 1 78  ? 78.120  63.164  14.536  1.00 34.99 ? 78  PHE D CZ  1 
ATOM 3391  N N   . SER D 1 79  ? 75.318  60.455  17.267  1.00 33.69 ? 79  SER D N   1 
ATOM 3392  C CA  . SER D 1 79  ? 74.767  59.405  16.409  1.00 33.53 ? 79  SER D CA  1 
ATOM 3393  C C   . SER D 1 79  ? 74.163  59.991  15.132  1.00 33.30 ? 79  SER D C   1 
ATOM 3394  O O   . SER D 1 79  ? 73.171  60.720  15.190  1.00 33.36 ? 79  SER D O   1 
ATOM 3395  C CB  . SER D 1 79  ? 73.700  58.614  17.171  1.00 33.61 ? 79  SER D CB  1 
ATOM 3396  O OG  . SER D 1 79  ? 73.125  57.601  16.362  1.00 33.71 ? 79  SER D OG  1 
ATOM 3397  N N   . ILE D 1 80  ? 74.760  59.659  13.988  1.00 33.07 ? 80  ILE D N   1 
ATOM 3398  C CA  . ILE D 1 80  ? 74.265  60.114  12.688  1.00 32.89 ? 80  ILE D CA  1 
ATOM 3399  C C   . ILE D 1 80  ? 73.088  59.224  12.288  1.00 32.77 ? 80  ILE D C   1 
ATOM 3400  O O   . ILE D 1 80  ? 73.232  58.003  12.203  1.00 32.79 ? 80  ILE D O   1 
ATOM 3401  C CB  . ILE D 1 80  ? 75.363  60.064  11.598  1.00 32.91 ? 80  ILE D CB  1 
ATOM 3402  C CG1 . ILE D 1 80  ? 76.553  60.957  11.989  1.00 32.96 ? 80  ILE D CG1 1 
ATOM 3403  C CG2 . ILE D 1 80  ? 74.797  60.490  10.242  1.00 32.94 ? 80  ILE D CG2 1 
ATOM 3404  C CD1 . ILE D 1 80  ? 77.803  60.737  11.163  1.00 33.00 ? 80  ILE D CD1 1 
ATOM 3405  N N   . VAL D 1 81  ? 71.933  59.845  12.049  1.00 32.73 ? 81  VAL D N   1 
ATOM 3406  C CA  . VAL D 1 81  ? 70.705  59.127  11.695  1.00 32.76 ? 81  VAL D CA  1 
ATOM 3407  C C   . VAL D 1 81  ? 70.806  58.590  10.272  1.00 32.87 ? 81  VAL D C   1 
ATOM 3408  O O   . VAL D 1 81  ? 70.690  57.383  10.044  1.00 32.99 ? 81  VAL D O   1 
ATOM 3409  C CB  . VAL D 1 81  ? 69.460  60.038  11.828  1.00 32.81 ? 81  VAL D CB  1 
ATOM 3410  C CG1 . VAL D 1 81  ? 68.213  59.381  11.239  1.00 32.88 ? 81  VAL D CG1 1 
ATOM 3411  C CG2 . VAL D 1 81  ? 69.230  60.406  13.288  1.00 32.82 ? 81  VAL D CG2 1 
ATOM 3412  N N   . SER D 1 82  ? 71.012  59.501  9.326   1.00 32.95 ? 82  SER D N   1 
ATOM 3413  C CA  . SER D 1 82  ? 71.115  59.159  7.909   1.00 33.10 ? 82  SER D CA  1 
ATOM 3414  C C   . SER D 1 82  ? 71.912  60.213  7.153   1.00 33.16 ? 82  SER D C   1 
ATOM 3415  O O   . SER D 1 82  ? 72.056  61.347  7.618   1.00 33.23 ? 82  SER D O   1 
ATOM 3416  C CB  . SER D 1 82  ? 69.721  59.015  7.295   1.00 33.14 ? 82  SER D CB  1 
ATOM 3417  O OG  . SER D 1 82  ? 68.954  60.193  7.481   1.00 33.18 ? 82  SER D OG  1 
ATOM 3418  N N   . ALA D 1 83  ? 72.427  59.826  5.989   1.00 33.30 ? 83  ALA D N   1 
ATOM 3419  C CA  . ALA D 1 83  ? 73.245  60.712  5.165   1.00 33.46 ? 83  ALA D CA  1 
ATOM 3420  C C   . ALA D 1 83  ? 73.186  60.310  3.694   1.00 33.71 ? 83  ALA D C   1 
ATOM 3421  O O   . ALA D 1 83  ? 73.933  59.436  3.247   1.00 33.85 ? 83  ALA D O   1 
ATOM 3422  C CB  . ALA D 1 83  ? 74.682  60.710  5.663   1.00 33.47 ? 83  ALA D CB  1 
ATOM 3423  N N   . SER D 1 84  ? 72.287  60.954  2.953   1.00 34.04 ? 84  SER D N   1 
ATOM 3424  C CA  . SER D 1 84  ? 72.185  60.775  1.505   1.00 34.33 ? 84  SER D CA  1 
ATOM 3425  C C   . SER D 1 84  ? 73.283  61.575  0.800   1.00 34.53 ? 84  SER D C   1 
ATOM 3426  O O   . SER D 1 84  ? 74.094  62.237  1.453   1.00 34.55 ? 84  SER D O   1 
ATOM 3427  C CB  . SER D 1 84  ? 70.798  61.207  1.013   1.00 34.48 ? 84  SER D CB  1 
ATOM 3428  O OG  . SER D 1 84  ? 70.602  62.603  1.168   1.00 34.54 ? 84  SER D OG  1 
ATOM 3429  N N   . ALA D 1 85  ? 73.311  61.504  -0.529  1.00 35.05 ? 85  ALA D N   1 
ATOM 3430  C CA  . ALA D 1 85  ? 74.302  62.225  -1.334  1.00 35.50 ? 85  ALA D CA  1 
ATOM 3431  C C   . ALA D 1 85  ? 74.287  63.743  -1.114  1.00 35.79 ? 85  ALA D C   1 
ATOM 3432  O O   . ALA D 1 85  ? 75.349  64.368  -1.077  1.00 35.91 ? 85  ALA D O   1 
ATOM 3433  C CB  . ALA D 1 85  ? 74.108  61.912  -2.812  1.00 35.61 ? 85  ALA D CB  1 
ATOM 3434  N N   . ASN D 1 86  ? 73.092  64.318  -0.970  1.00 36.15 ? 86  ASN D N   1 
ATOM 3435  C CA  . ASN D 1 86  ? 72.919  65.774  -0.843  1.00 36.49 ? 86  ASN D CA  1 
ATOM 3436  C C   . ASN D 1 86  ? 72.186  66.212  0.441   1.00 36.55 ? 86  ASN D C   1 
ATOM 3437  O O   . ASN D 1 86  ? 71.571  67.282  0.466   1.00 36.63 ? 86  ASN D O   1 
ATOM 3438  C CB  . ASN D 1 86  ? 72.182  66.311  -2.077  1.00 36.84 ? 86  ASN D CB  1 
ATOM 3439  C CG  . ASN D 1 86  ? 72.895  65.978  -3.377  1.00 37.16 ? 86  ASN D CG  1 
ATOM 3440  O OD1 . ASN D 1 86  ? 73.020  64.812  -3.748  1.00 37.25 ? 86  ASN D OD1 1 
ATOM 3441  N ND2 . ASN D 1 86  ? 73.354  67.007  -4.082  1.00 37.45 ? 86  ASN D ND2 1 
ATOM 3442  N N   . SER D 1 87  ? 72.260  65.403  1.500   1.00 36.55 ? 87  SER D N   1 
ATOM 3443  C CA  . SER D 1 87  ? 71.682  65.769  2.803   1.00 36.52 ? 87  SER D CA  1 
ATOM 3444  C C   . SER D 1 87  ? 72.254  64.935  3.950   1.00 36.58 ? 87  SER D C   1 
ATOM 3445  O O   . SER D 1 87  ? 72.966  63.952  3.724   1.00 36.60 ? 87  SER D O   1 
ATOM 3446  C CB  . SER D 1 87  ? 70.156  65.616  2.778   1.00 36.53 ? 87  SER D CB  1 
ATOM 3447  O OG  . SER D 1 87  ? 69.572  66.124  3.966   1.00 36.60 ? 87  SER D OG  1 
ATOM 3448  N N   . TYR D 1 88  ? 71.936  65.343  5.177   1.00 36.69 ? 88  TYR D N   1 
ATOM 3449  C CA  . TYR D 1 88  ? 72.305  64.590  6.382   1.00 36.75 ? 88  TYR D CA  1 
ATOM 3450  C C   . TYR D 1 88  ? 71.436  64.951  7.588   1.00 37.06 ? 88  TYR D C   1 
ATOM 3451  O O   . TYR D 1 88  ? 70.766  65.986  7.598   1.00 37.14 ? 88  TYR D O   1 
ATOM 3452  C CB  . TYR D 1 88  ? 73.788  64.793  6.722   1.00 36.59 ? 88  TYR D CB  1 
ATOM 3453  C CG  . TYR D 1 88  ? 74.187  66.230  6.995   1.00 36.51 ? 88  TYR D CG  1 
ATOM 3454  C CD1 . TYR D 1 88  ? 74.091  66.772  8.277   1.00 36.43 ? 88  TYR D CD1 1 
ATOM 3455  C CD2 . TYR D 1 88  ? 74.675  67.046  5.973   1.00 36.53 ? 88  TYR D CD2 1 
ATOM 3456  C CE1 . TYR D 1 88  ? 74.458  68.085  8.534   1.00 36.37 ? 88  TYR D CE1 1 
ATOM 3457  C CE2 . TYR D 1 88  ? 75.046  68.361  6.220   1.00 36.49 ? 88  TYR D CE2 1 
ATOM 3458  C CZ  . TYR D 1 88  ? 74.936  68.876  7.501   1.00 36.40 ? 88  TYR D CZ  1 
ATOM 3459  O OH  . TYR D 1 88  ? 75.301  70.178  7.750   1.00 36.43 ? 88  TYR D OH  1 
ATOM 3460  N N   . CYS D 1 89  ? 71.461  64.079  8.593   1.00 37.62 ? 89  CYS D N   1 
ATOM 3461  C CA  . CYS D 1 89  ? 70.752  64.289  9.858   1.00 38.04 ? 89  CYS D CA  1 
ATOM 3462  C C   . CYS D 1 89  ? 71.576  63.685  10.996  1.00 37.48 ? 89  CYS D C   1 
ATOM 3463  O O   . CYS D 1 89  ? 71.823  62.478  11.007  1.00 37.51 ? 89  CYS D O   1 
ATOM 3464  C CB  . CYS D 1 89  ? 69.365  63.644  9.806   1.00 39.02 ? 89  CYS D CB  1 
ATOM 3465  S SG  . CYS D 1 89  ? 68.400  63.802  11.330  1.00 40.38 ? 89  CYS D SG  1 
ATOM 3466  N N   . MET D 1 90  ? 71.992  64.530  11.942  1.00 36.81 ? 90  MET D N   1 
ATOM 3467  C CA  . MET D 1 90  ? 72.858  64.121  13.049  1.00 36.33 ? 90  MET D CA  1 
ATOM 3468  C C   . MET D 1 90  ? 72.267  64.570  14.386  1.00 35.96 ? 90  MET D C   1 
ATOM 3469  O O   . MET D 1 90  ? 72.224  65.766  14.683  1.00 35.94 ? 90  MET D O   1 
ATOM 3470  C CB  . MET D 1 90  ? 74.262  64.711  12.873  1.00 36.33 ? 90  MET D CB  1 
ATOM 3471  C CG  . MET D 1 90  ? 74.878  64.468  11.503  1.00 36.32 ? 90  MET D CG  1 
ATOM 3472  S SD  . MET D 1 90  ? 76.626  64.905  11.429  1.00 36.31 ? 90  MET D SD  1 
ATOM 3473  C CE  . MET D 1 90  ? 76.552  66.674  11.697  1.00 36.30 ? 90  MET D CE  1 
ATOM 3474  N N   . ILE D 1 91  ? 71.805  63.602  15.179  1.00 35.57 ? 91  ILE D N   1 
ATOM 3475  C CA  . ILE D 1 91  ? 71.299  63.851  16.529  1.00 35.27 ? 91  ILE D CA  1 
ATOM 3476  C C   . ILE D 1 91  ? 72.439  63.653  17.533  1.00 34.97 ? 91  ILE D C   1 
ATOM 3477  O O   . ILE D 1 91  ? 73.252  62.738  17.384  1.00 35.06 ? 91  ILE D O   1 
ATOM 3478  C CB  . ILE D 1 91  ? 70.133  62.898  16.887  1.00 35.34 ? 91  ILE D CB  1 
ATOM 3479  C CG1 . ILE D 1 91  ? 69.010  62.973  15.836  1.00 35.48 ? 91  ILE D CG1 1 
ATOM 3480  C CG2 . ILE D 1 91  ? 69.594  63.192  18.287  1.00 35.37 ? 91  ILE D CG2 1 
ATOM 3481  C CD1 . ILE D 1 91  ? 68.358  64.334  15.683  1.00 35.54 ? 91  ILE D CD1 1 
ATOM 3482  N N   . ALA D 1 92  ? 72.489  64.516  18.545  1.00 34.64 ? 92  ALA D N   1 
ATOM 3483  C CA  . ALA D 1 92  ? 73.473  64.406  19.625  1.00 34.42 ? 92  ALA D CA  1 
ATOM 3484  C C   . ALA D 1 92  ? 72.967  65.086  20.895  1.00 34.21 ? 92  ALA D C   1 
ATOM 3485  O O   . ALA D 1 92  ? 72.194  66.046  20.829  1.00 34.13 ? 92  ALA D O   1 
ATOM 3486  C CB  . ALA D 1 92  ? 74.802  65.008  19.196  1.00 34.49 ? 92  ALA D CB  1 
ATOM 3487  N N   . GLY D 1 93  ? 73.411  64.582  22.043  1.00 34.02 ? 93  GLY D N   1 
ATOM 3488  C CA  . GLY D 1 93  ? 72.983  65.104  23.340  1.00 33.89 ? 93  GLY D CA  1 
ATOM 3489  C C   . GLY D 1 93  ? 73.850  64.638  24.494  1.00 33.77 ? 93  GLY D C   1 
ATOM 3490  O O   . GLY D 1 93  ? 74.458  63.567  24.433  1.00 33.83 ? 93  GLY D O   1 
ATOM 3491  N N   . HIS D 1 94  ? 73.894  65.452  25.546  1.00 33.62 ? 94  HIS D N   1 
ATOM 3492  C CA  . HIS D 1 94  ? 74.640  65.142  26.765  1.00 33.49 ? 94  HIS D CA  1 
ATOM 3493  C C   . HIS D 1 94  ? 73.699  64.425  27.734  1.00 33.50 ? 94  HIS D C   1 
ATOM 3494  O O   . HIS D 1 94  ? 72.488  64.653  27.710  1.00 33.61 ? 94  HIS D O   1 
ATOM 3495  C CB  . HIS D 1 94  ? 75.180  66.432  27.392  1.00 33.42 ? 94  HIS D CB  1 
ATOM 3496  C CG  . HIS D 1 94  ? 76.435  66.246  28.186  1.00 33.39 ? 94  HIS D CG  1 
ATOM 3497  N ND1 . HIS D 1 94  ? 77.683  66.553  27.690  1.00 33.41 ? 94  HIS D ND1 1 
ATOM 3498  C CD2 . HIS D 1 94  ? 76.636  65.759  29.433  1.00 33.38 ? 94  HIS D CD2 1 
ATOM 3499  C CE1 . HIS D 1 94  ? 78.598  66.275  28.603  1.00 33.44 ? 94  HIS D CE1 1 
ATOM 3500  N NE2 . HIS D 1 94  ? 77.988  65.795  29.671  1.00 33.41 ? 94  HIS D NE2 1 
ATOM 3501  N N   . SER D 1 95  ? 74.258  63.562  28.581  1.00 33.42 ? 95  SER D N   1 
ATOM 3502  C CA  . SER D 1 95  ? 73.460  62.775  29.530  1.00 33.30 ? 95  SER D CA  1 
ATOM 3503  C C   . SER D 1 95  ? 72.797  63.659  30.587  1.00 33.15 ? 95  SER D C   1 
ATOM 3504  O O   . SER D 1 95  ? 71.617  63.481  30.894  1.00 33.23 ? 95  SER D O   1 
ATOM 3505  C CB  . SER D 1 95  ? 74.318  61.700  30.205  1.00 33.39 ? 95  SER D CB  1 
ATOM 3506  O OG  . SER D 1 95  ? 75.377  62.278  30.944  1.00 33.47 ? 95  SER D OG  1 
ATOM 3507  N N   . GLY D 1 96  ? 73.568  64.602  31.134  1.00 32.96 ? 96  GLY D N   1 
ATOM 3508  C CA  . GLY D 1 96  ? 73.050  65.626  32.047  1.00 32.84 ? 96  GLY D CA  1 
ATOM 3509  C C   . GLY D 1 96  ? 72.938  66.989  31.389  1.00 32.59 ? 96  GLY D C   1 
ATOM 3510  O O   . GLY D 1 96  ? 73.421  67.986  31.933  1.00 32.56 ? 96  GLY D O   1 
ATOM 3511  N N   . GLY D 1 97  ? 72.300  67.026  30.219  1.00 32.33 ? 97  GLY D N   1 
ATOM 3512  C CA  . GLY D 1 97  ? 72.031  68.267  29.492  1.00 32.11 ? 97  GLY D CA  1 
ATOM 3513  C C   . GLY D 1 97  ? 70.589  68.698  29.682  1.00 31.91 ? 97  GLY D C   1 
ATOM 3514  O O   . GLY D 1 97  ? 69.966  68.372  30.697  1.00 31.98 ? 97  GLY D O   1 
ATOM 3515  N N   . THR D 1 98  ? 70.064  69.430  28.699  1.00 31.56 ? 98  THR D N   1 
ATOM 3516  C CA  . THR D 1 98  ? 68.677  69.899  28.709  1.00 31.30 ? 98  THR D CA  1 
ATOM 3517  C C   . THR D 1 98  ? 67.828  69.114  27.713  1.00 31.00 ? 98  THR D C   1 
ATOM 3518  O O   . THR D 1 98  ? 66.846  68.475  28.097  1.00 31.05 ? 98  THR D O   1 
ATOM 3519  C CB  . THR D 1 98  ? 68.595  71.399  28.371  1.00 31.35 ? 98  THR D CB  1 
ATOM 3520  O OG1 . THR D 1 98  ? 69.211  71.644  27.100  1.00 31.30 ? 98  THR D OG1 1 
ATOM 3521  C CG2 . THR D 1 98  ? 69.295  72.222  29.442  1.00 31.42 ? 98  THR D CG2 1 
ATOM 3522  N N   . VAL D 1 99  ? 68.217  69.173  26.440  1.00 30.61 ? 99  VAL D N   1 
ATOM 3523  C CA  . VAL D 1 99  ? 67.502  68.499  25.349  1.00 30.35 ? 99  VAL D CA  1 
ATOM 3524  C C   . VAL D 1 99  ? 68.473  67.983  24.285  1.00 30.06 ? 99  VAL D C   1 
ATOM 3525  O O   . VAL D 1 99  ? 69.653  68.345  24.280  1.00 30.16 ? 99  VAL D O   1 
ATOM 3526  C CB  . VAL D 1 99  ? 66.467  69.438  24.678  1.00 30.45 ? 99  VAL D CB  1 
ATOM 3527  C CG1 . VAL D 1 99  ? 65.244  69.617  25.566  1.00 30.52 ? 99  VAL D CG1 1 
ATOM 3528  C CG2 . VAL D 1 99  ? 67.081  70.792  24.334  1.00 30.52 ? 99  VAL D CG2 1 
ATOM 3529  N N   . TRP D 1 100 ? 67.964  67.138  23.392  1.00 29.73 ? 100 TRP D N   1 
ATOM 3530  C CA  . TRP D 1 100 ? 68.737  66.647  22.249  1.00 29.57 ? 100 TRP D CA  1 
ATOM 3531  C C   . TRP D 1 100 ? 68.900  67.752  21.209  1.00 29.76 ? 100 TRP D C   1 
ATOM 3532  O O   . TRP D 1 100 ? 68.010  68.589  21.040  1.00 29.91 ? 100 TRP D O   1 
ATOM 3533  C CB  . TRP D 1 100 ? 68.053  65.439  21.604  1.00 29.37 ? 100 TRP D CB  1 
ATOM 3534  C CG  . TRP D 1 100 ? 68.021  64.226  22.476  1.00 29.17 ? 100 TRP D CG  1 
ATOM 3535  C CD1 . TRP D 1 100 ? 67.066  63.902  23.394  1.00 29.08 ? 100 TRP D CD1 1 
ATOM 3536  C CD2 . TRP D 1 100 ? 68.984  63.168  22.507  1.00 28.95 ? 100 TRP D CD2 1 
ATOM 3537  N NE1 . TRP D 1 100 ? 67.375  62.708  23.999  1.00 28.98 ? 100 TRP D NE1 1 
ATOM 3538  C CE2 . TRP D 1 100 ? 68.547  62.236  23.473  1.00 28.90 ? 100 TRP D CE2 1 
ATOM 3539  C CE3 . TRP D 1 100 ? 70.175  62.918  21.813  1.00 28.91 ? 100 TRP D CE3 1 
ATOM 3540  C CZ2 . TRP D 1 100 ? 69.261  61.068  23.765  1.00 28.93 ? 100 TRP D CZ2 1 
ATOM 3541  C CZ3 . TRP D 1 100 ? 70.886  61.757  22.103  1.00 28.95 ? 100 TRP D CZ3 1 
ATOM 3542  C CH2 . TRP D 1 100 ? 70.423  60.847  23.072  1.00 28.96 ? 100 TRP D CH2 1 
ATOM 3543  N N   . PHE D 1 101 ? 70.040  67.743  20.522  1.00 29.96 ? 101 PHE D N   1 
ATOM 3544  C CA  . PHE D 1 101 ? 70.353  68.720  19.481  1.00 30.13 ? 101 PHE D CA  1 
ATOM 3545  C C   . PHE D 1 101 ? 70.474  68.013  18.135  1.00 30.19 ? 101 PHE D C   1 
ATOM 3546  O O   . PHE D 1 101 ? 71.240  67.058  18.005  1.00 30.31 ? 101 PHE D O   1 
ATOM 3547  C CB  . PHE D 1 101 ? 71.672  69.430  19.792  1.00 30.32 ? 101 PHE D CB  1 
ATOM 3548  C CG  . PHE D 1 101 ? 71.589  70.417  20.924  1.00 30.39 ? 101 PHE D CG  1 
ATOM 3549  C CD1 . PHE D 1 101 ? 71.514  69.983  22.244  1.00 30.53 ? 101 PHE D CD1 1 
ATOM 3550  C CD2 . PHE D 1 101 ? 71.612  71.788  20.673  1.00 30.42 ? 101 PHE D CD2 1 
ATOM 3551  C CE1 . PHE D 1 101 ? 71.445  70.894  23.289  1.00 30.59 ? 101 PHE D CE1 1 
ATOM 3552  C CE2 . PHE D 1 101 ? 71.546  72.702  21.714  1.00 30.54 ? 101 PHE D CE2 1 
ATOM 3553  C CZ  . PHE D 1 101 ? 71.461  72.255  23.024  1.00 30.60 ? 101 PHE D CZ  1 
ATOM 3554  N N   . ALA D 1 102 ? 69.714  68.486  17.148  1.00 30.37 ? 102 ALA D N   1 
ATOM 3555  C CA  . ALA D 1 102 ? 69.797  67.986  15.774  1.00 30.57 ? 102 ALA D CA  1 
ATOM 3556  C C   . ALA D 1 102 ? 70.812  68.800  14.977  1.00 30.78 ? 102 ALA D C   1 
ATOM 3557  O O   . ALA D 1 102 ? 71.309  69.826  15.452  1.00 30.81 ? 102 ALA D O   1 
ATOM 3558  C CB  . ALA D 1 102 ? 68.433  68.046  15.108  1.00 30.60 ? 102 ALA D CB  1 
ATOM 3559  N N   . ALA D 1 103 ? 71.116  68.335  13.767  1.00 31.11 ? 103 ALA D N   1 
ATOM 3560  C CA  . ALA D 1 103 ? 72.067  69.016  12.886  1.00 31.41 ? 103 ALA D CA  1 
ATOM 3561  C C   . ALA D 1 103 ? 71.879  68.598  11.424  1.00 31.72 ? 103 ALA D C   1 
ATOM 3562  O O   . ALA D 1 103 ? 72.318  67.520  11.018  1.00 31.76 ? 103 ALA D O   1 
ATOM 3563  C CB  . ALA D 1 103 ? 73.494  68.746  13.341  1.00 31.43 ? 103 ALA D CB  1 
ATOM 3564  N N   . THR D 1 104 ? 71.215  69.463  10.656  1.00 32.08 ? 104 THR D N   1 
ATOM 3565  C CA  . THR D 1 104 ? 70.964  69.258  9.226   1.00 32.34 ? 104 THR D CA  1 
ATOM 3566  C C   . THR D 1 104 ? 71.597  70.418  8.451   1.00 32.69 ? 104 THR D C   1 
ATOM 3567  O O   . THR D 1 104 ? 71.919  71.448  9.052   1.00 32.83 ? 104 THR D O   1 
ATOM 3568  C CB  . THR D 1 104 ? 69.446  69.202  8.937   1.00 32.41 ? 104 THR D CB  1 
ATOM 3569  O OG1 . THR D 1 104 ? 68.881  70.517  9.013   1.00 32.45 ? 104 THR D OG1 1 
ATOM 3570  C CG2 . THR D 1 104 ? 68.738  68.295  9.932   1.00 32.50 ? 104 THR D CG2 1 
ATOM 3571  N N   . PRO D 1 105 ? 71.782  70.266  7.120   1.00 33.13 ? 105 PRO D N   1 
ATOM 3572  C CA  . PRO D 1 105 ? 72.397  71.365  6.359   1.00 33.45 ? 105 PRO D CA  1 
ATOM 3573  C C   . PRO D 1 105 ? 71.490  72.589  6.176   1.00 33.95 ? 105 PRO D C   1 
ATOM 3574  O O   . PRO D 1 105 ? 71.976  73.718  6.275   1.00 34.10 ? 105 PRO D O   1 
ATOM 3575  C CB  . PRO D 1 105 ? 72.753  70.731  5.007   1.00 33.34 ? 105 PRO D CB  1 
ATOM 3576  C CG  . PRO D 1 105 ? 72.011  69.448  4.928   1.00 33.31 ? 105 PRO D CG  1 
ATOM 3577  C CD  . PRO D 1 105 ? 71.416  69.122  6.264   1.00 33.23 ? 105 PRO D CD  1 
ATOM 3578  N N   . ASP D 1 106 ? 70.201  72.368  5.917   1.00 34.61 ? 106 ASP D N   1 
ATOM 3579  C CA  . ASP D 1 106 ? 69.254  73.471  5.686   1.00 35.22 ? 106 ASP D CA  1 
ATOM 3580  C C   . ASP D 1 106 ? 68.921  74.281  6.949   1.00 35.56 ? 106 ASP D C   1 
ATOM 3581  O O   . ASP D 1 106 ? 68.862  75.511  6.890   1.00 35.76 ? 106 ASP D O   1 
ATOM 3582  C CB  . ASP D 1 106 ? 67.968  72.981  4.991   1.00 35.53 ? 106 ASP D CB  1 
ATOM 3583  C CG  . ASP D 1 106 ? 67.128  72.051  5.859   1.00 35.77 ? 106 ASP D CG  1 
ATOM 3584  O OD1 . ASP D 1 106 ? 67.705  71.292  6.669   1.00 35.93 ? 106 ASP D OD1 1 
ATOM 3585  O OD2 . ASP D 1 106 ? 65.886  72.077  5.723   1.00 35.86 ? 106 ASP D OD2 1 
ATOM 3586  N N   . LYS D 1 107 ? 68.716  73.596  8.074   1.00 35.96 ? 107 LYS D N   1 
ATOM 3587  C CA  . LYS D 1 107 ? 68.354  74.248  9.343   1.00 36.36 ? 107 LYS D CA  1 
ATOM 3588  C C   . LYS D 1 107 ? 69.551  74.545  10.255  1.00 36.64 ? 107 LYS D C   1 
ATOM 3589  O O   . LYS D 1 107 ? 69.409  75.286  11.229  1.00 36.62 ? 107 LYS D O   1 
ATOM 3590  C CB  . LYS D 1 107 ? 67.334  73.397  10.106  1.00 36.45 ? 107 LYS D CB  1 
ATOM 3591  C CG  . LYS D 1 107 ? 66.013  73.210  9.377   1.00 36.66 ? 107 LYS D CG  1 
ATOM 3592  C CD  . LYS D 1 107 ? 65.057  72.313  10.148  1.00 36.88 ? 107 LYS D CD  1 
ATOM 3593  C CE  . LYS D 1 107 ? 64.440  73.025  11.342  1.00 37.03 ? 107 LYS D CE  1 
ATOM 3594  N NZ  . LYS D 1 107 ? 63.425  72.181  12.031  1.00 37.12 ? 107 LYS D NZ  1 
ATOM 3595  N N   . GLY D 1 108 ? 70.717  73.974  9.945   1.00 37.06 ? 108 GLY D N   1 
ATOM 3596  C CA  . GLY D 1 108 ? 71.907  74.123  10.784  1.00 37.38 ? 108 GLY D CA  1 
ATOM 3597  C C   . GLY D 1 108 ? 71.804  73.279  12.041  1.00 37.66 ? 108 GLY D C   1 
ATOM 3598  O O   . GLY D 1 108 ? 71.070  72.291  12.068  1.00 37.75 ? 108 GLY D O   1 
ATOM 3599  N N   . VAL D 1 109 ? 72.546  73.672  13.074  1.00 38.04 ? 109 VAL D N   1 
ATOM 3600  C CA  . VAL D 1 109 ? 72.503  73.003  14.377  1.00 38.33 ? 109 VAL D CA  1 
ATOM 3601  C C   . VAL D 1 109 ? 71.438  73.681  15.239  1.00 38.62 ? 109 VAL D C   1 
ATOM 3602  O O   . VAL D 1 109 ? 71.558  74.868  15.550  1.00 38.77 ? 109 VAL D O   1 
ATOM 3603  C CB  . VAL D 1 109 ? 73.872  73.057  15.093  1.00 38.50 ? 109 VAL D CB  1 
ATOM 3604  C CG1 . VAL D 1 109 ? 73.812  72.341  16.441  1.00 38.57 ? 109 VAL D CG1 1 
ATOM 3605  C CG2 . VAL D 1 109 ? 74.961  72.455  14.208  1.00 38.56 ? 109 VAL D CG2 1 
ATOM 3606  N N   . TYR D 1 110 ? 70.404  72.926  15.612  1.00 38.99 ? 110 TYR D N   1 
ATOM 3607  C CA  . TYR D 1 110 ? 69.309  73.428  16.452  1.00 39.35 ? 110 TYR D CA  1 
ATOM 3608  C C   . TYR D 1 110 ? 68.909  72.401  17.508  1.00 39.82 ? 110 TYR D C   1 
ATOM 3609  O O   . TYR D 1 110 ? 69.315  71.238  17.438  1.00 40.04 ? 110 TYR D O   1 
ATOM 3610  C CB  . TYR D 1 110 ? 68.096  73.804  15.592  1.00 39.25 ? 110 TYR D CB  1 
ATOM 3611  C CG  . TYR D 1 110 ? 67.492  72.651  14.816  1.00 39.14 ? 110 TYR D CG  1 
ATOM 3612  C CD1 . TYR D 1 110 ? 68.016  72.266  13.582  1.00 39.13 ? 110 TYR D CD1 1 
ATOM 3613  C CD2 . TYR D 1 110 ? 66.389  71.952  15.309  1.00 39.09 ? 110 TYR D CD2 1 
ATOM 3614  C CE1 . TYR D 1 110 ? 67.466  71.214  12.865  1.00 39.07 ? 110 TYR D CE1 1 
ATOM 3615  C CE2 . TYR D 1 110 ? 65.831  70.897  14.599  1.00 39.10 ? 110 TYR D CE2 1 
ATOM 3616  C CZ  . TYR D 1 110 ? 66.373  70.533  13.377  1.00 39.11 ? 110 TYR D CZ  1 
ATOM 3617  O OH  . TYR D 1 110 ? 65.827  69.490  12.667  1.00 39.19 ? 110 TYR D OH  1 
ATOM 3618  N N   . LYS D 1 111 ? 68.103  72.844  18.473  1.00 40.42 ? 111 LYS D N   1 
ATOM 3619  C CA  . LYS D 1 111 ? 67.655  71.996  19.584  1.00 41.05 ? 111 LYS D CA  1 
ATOM 3620  C C   . LYS D 1 111 ? 66.192  71.586  19.416  1.00 41.38 ? 111 LYS D C   1 
ATOM 3621  O O   . LYS D 1 111 ? 65.363  72.389  18.982  1.00 41.54 ? 111 LYS D O   1 
ATOM 3622  C CB  . LYS D 1 111 ? 67.880  72.685  20.939  1.00 41.42 ? 111 LYS D CB  1 
ATOM 3623  C CG  . LYS D 1 111 ? 67.058  73.939  21.211  1.00 41.67 ? 111 LYS D CG  1 
ATOM 3624  C CD  . LYS D 1 111 ? 67.415  74.525  22.566  1.00 41.99 ? 111 LYS D CD  1 
ATOM 3625  C CE  . LYS D 1 111 ? 66.616  75.787  22.859  1.00 42.27 ? 111 LYS D CE  1 
ATOM 3626  N NZ  . LYS D 1 111 ? 66.943  76.385  24.186  1.00 42.33 ? 111 LYS D NZ  1 
ATOM 3627  N N   . THR D 1 112 ? 65.891  70.336  19.773  1.00 41.76 ? 112 THR D N   1 
ATOM 3628  C CA  . THR D 1 112 ? 64.543  69.768  19.638  1.00 42.19 ? 112 THR D CA  1 
ATOM 3629  C C   . THR D 1 112 ? 63.810  69.734  20.982  1.00 42.42 ? 112 THR D C   1 
ATOM 3630  O O   . THR D 1 112 ? 64.400  70.001  22.032  1.00 42.41 ? 112 THR D O   1 
ATOM 3631  C CB  . THR D 1 112 ? 64.578  68.354  18.997  1.00 42.41 ? 112 THR D CB  1 
ATOM 3632  O OG1 . THR D 1 112 ? 63.239  67.890  18.771  1.00 42.63 ? 112 THR D OG1 1 
ATOM 3633  C CG2 . THR D 1 112 ? 65.342  67.328  19.860  1.00 42.32 ? 112 THR D CG2 1 
ATOM 3634  N N   . ASN D 1 113 ? 62.523  69.398  20.931  1.00 42.76 ? 113 ASN D N   1 
ATOM 3635  C CA  . ASN D 1 113 ? 61.675  69.334  22.128  1.00 43.05 ? 113 ASN D CA  1 
ATOM 3636  C C   . ASN D 1 113 ? 61.929  68.101  23.005  1.00 43.07 ? 113 ASN D C   1 
ATOM 3637  O O   . ASN D 1 113 ? 61.550  68.098  24.179  1.00 43.14 ? 113 ASN D O   1 
ATOM 3638  C CB  . ASN D 1 113 ? 60.191  69.381  21.737  1.00 43.32 ? 113 ASN D CB  1 
ATOM 3639  C CG  . ASN D 1 113 ? 59.802  70.686  21.062  1.00 43.69 ? 113 ASN D CG  1 
ATOM 3640  O OD1 . ASN D 1 113 ? 60.657  71.487  20.677  1.00 43.88 ? 113 ASN D OD1 1 
ATOM 3641  N ND2 . ASN D 1 113 ? 58.500  70.903  20.911  1.00 43.95 ? 113 ASN D ND2 1 
ATOM 3642  N N   . THR D 1 114 ? 62.553  67.064  22.443  1.00 42.95 ? 114 THR D N   1 
ATOM 3643  C CA  . THR D 1 114 ? 62.825  65.820  23.171  1.00 42.92 ? 114 THR D CA  1 
ATOM 3644  C C   . THR D 1 114 ? 63.875  66.033  24.264  1.00 42.75 ? 114 THR D C   1 
ATOM 3645  O O   . THR D 1 114 ? 64.906  66.661  24.024  1.00 42.67 ? 114 THR D O   1 
ATOM 3646  C CB  . THR D 1 114 ? 63.311  64.703  22.221  1.00 43.06 ? 114 THR D CB  1 
ATOM 3647  O OG1 . THR D 1 114 ? 62.423  64.602  21.100  1.00 43.18 ? 114 THR D OG1 1 
ATOM 3648  C CG2 . THR D 1 114 ? 63.374  63.354  22.940  1.00 43.11 ? 114 THR D CG2 1 
ATOM 3649  N N   . ALA D 1 115 ? 63.601  65.500  25.456  1.00 42.77 ? 115 ALA D N   1 
ATOM 3650  C CA  . ALA D 1 115 ? 64.485  65.651  26.615  1.00 42.75 ? 115 ALA D CA  1 
ATOM 3651  C C   . ALA D 1 115 ? 65.582  64.591  26.620  1.00 42.74 ? 115 ALA D C   1 
ATOM 3652  O O   . ALA D 1 115 ? 65.416  63.508  26.054  1.00 42.81 ? 115 ALA D O   1 
ATOM 3653  C CB  . ALA D 1 115 ? 63.681  65.576  27.904  1.00 42.91 ? 115 ALA D CB  1 
ATOM 3654  N N   . VAL D 1 116 ? 66.696  64.913  27.276  1.00 42.90 ? 116 VAL D N   1 
ATOM 3655  C CA  . VAL D 1 116 ? 67.841  63.993  27.386  1.00 43.05 ? 116 VAL D CA  1 
ATOM 3656  C C   . VAL D 1 116 ? 67.546  62.776  28.273  1.00 43.55 ? 116 VAL D C   1 
ATOM 3657  O O   . VAL D 1 116 ? 68.152  61.717  28.089  1.00 43.76 ? 116 VAL D O   1 
ATOM 3658  C CB  . VAL D 1 116 ? 69.129  64.695  27.891  1.00 42.93 ? 116 VAL D CB  1 
ATOM 3659  C CG1 . VAL D 1 116 ? 69.523  65.833  26.955  1.00 42.89 ? 116 VAL D CG1 1 
ATOM 3660  C CG2 . VAL D 1 116 ? 68.992  65.171  29.338  1.00 42.98 ? 116 VAL D CG2 1 
ATOM 3661  N N   . THR D 1 117 ? 66.633  62.936  29.233  1.00 43.94 ? 117 THR D N   1 
ATOM 3662  C CA  . THR D 1 117 ? 66.136  61.814  30.038  1.00 44.22 ? 117 THR D CA  1 
ATOM 3663  C C   . THR D 1 117 ? 65.326  60.830  29.189  1.00 44.30 ? 117 THR D C   1 
ATOM 3664  O O   . THR D 1 117 ? 65.412  59.617  29.394  1.00 44.49 ? 117 THR D O   1 
ATOM 3665  C CB  . THR D 1 117 ? 65.260  62.298  31.212  1.00 44.54 ? 117 THR D CB  1 
ATOM 3666  O OG1 . THR D 1 117 ? 64.219  63.152  30.720  1.00 44.68 ? 117 THR D OG1 1 
ATOM 3667  C CG2 . THR D 1 117 ? 66.099  63.056  32.234  1.00 44.67 ? 117 THR D CG2 1 
ATOM 3668  N N   . SER D 1 118 ? 64.546  61.358  28.245  1.00 44.37 ? 118 SER D N   1 
ATOM 3669  C CA  . SER D 1 118 ? 63.815  60.535  27.275  1.00 44.50 ? 118 SER D CA  1 
ATOM 3670  C C   . SER D 1 118 ? 64.758  59.938  26.230  1.00 44.49 ? 118 SER D C   1 
ATOM 3671  O O   . SER D 1 118 ? 65.926  60.330  26.136  1.00 44.41 ? 118 SER D O   1 
ATOM 3672  C CB  . SER D 1 118 ? 62.727  61.360  26.579  1.00 44.61 ? 118 SER D CB  1 
ATOM 3673  O OG  . SER D 1 118 ? 61.834  61.926  27.522  1.00 44.73 ? 118 SER D OG  1 
ATOM 3674  N N   . SER D 1 119 ? 64.238  58.998  25.441  1.00 44.65 ? 119 SER D N   1 
ATOM 3675  C CA  . SER D 1 119 ? 65.035  58.281  24.440  1.00 44.77 ? 119 SER D CA  1 
ATOM 3676  C C   . SER D 1 119 ? 65.445  59.171  23.266  1.00 44.88 ? 119 SER D C   1 
ATOM 3677  O O   . SER D 1 119 ? 64.889  60.255  23.066  1.00 44.83 ? 119 SER D O   1 
ATOM 3678  C CB  . SER D 1 119 ? 64.267  57.064  23.917  1.00 44.90 ? 119 SER D CB  1 
ATOM 3679  O OG  . SER D 1 119 ? 65.090  56.255  23.091  1.00 44.99 ? 119 SER D OG  1 
ATOM 3680  N N   . GLN D 1 120 ? 66.422  58.693  22.497  1.00 44.97 ? 120 GLN D N   1 
ATOM 3681  C CA  . GLN D 1 120 ? 66.982  59.443  21.369  1.00 45.08 ? 120 GLN D CA  1 
ATOM 3682  C C   . GLN D 1 120 ? 65.951  59.592  20.243  1.00 45.31 ? 120 GLN D C   1 
ATOM 3683  O O   . GLN D 1 120 ? 65.259  58.623  19.920  1.00 45.67 ? 120 GLN D O   1 
ATOM 3684  C CB  . GLN D 1 120 ? 68.234  58.738  20.834  1.00 45.05 ? 120 GLN D CB  1 
ATOM 3685  C CG  . GLN D 1 120 ? 69.002  59.519  19.775  1.00 45.09 ? 120 GLN D CG  1 
ATOM 3686  C CD  . GLN D 1 120 ? 70.262  58.804  19.322  1.00 45.21 ? 120 GLN D CD  1 
ATOM 3687  O OE1 . GLN D 1 120 ? 71.079  58.378  20.139  1.00 45.22 ? 120 GLN D OE1 1 
ATOM 3688  N NE2 . GLN D 1 120 ? 70.428  58.673  18.010  1.00 45.29 ? 120 GLN D NE2 1 
ATOM 3689  N N   . PRO D 1 121 ? 65.830  60.806  19.657  1.00 45.40 ? 121 PRO D N   1 
ATOM 3690  C CA  . PRO D 1 121 ? 64.980  60.991  18.474  1.00 45.55 ? 121 PRO D CA  1 
ATOM 3691  C C   . PRO D 1 121 ? 65.404  60.125  17.284  1.00 45.58 ? 121 PRO D C   1 
ATOM 3692  O O   . PRO D 1 121 ? 66.595  60.046  16.976  1.00 45.53 ? 121 PRO D O   1 
ATOM 3693  C CB  . PRO D 1 121 ? 65.160  62.475  18.138  1.00 45.56 ? 121 PRO D CB  1 
ATOM 3694  C CG  . PRO D 1 121 ? 65.491  63.115  19.436  1.00 45.48 ? 121 PRO D CG  1 
ATOM 3695  C CD  . PRO D 1 121 ? 66.282  62.100  20.207  1.00 45.42 ? 121 PRO D CD  1 
ATOM 3696  N N   . GLU D 1 122 ? 64.429  59.486  16.638  1.00 45.76 ? 122 GLU D N   1 
ATOM 3697  C CA  . GLU D 1 122 ? 64.689  58.613  15.487  1.00 45.90 ? 122 GLU D CA  1 
ATOM 3698  C C   . GLU D 1 122 ? 65.129  59.411  14.263  1.00 45.50 ? 122 GLU D C   1 
ATOM 3699  O O   . GLU D 1 122 ? 66.060  59.009  13.567  1.00 45.42 ? 122 GLU D O   1 
ATOM 3700  C CB  . GLU D 1 122 ? 63.448  57.778  15.141  1.00 46.32 ? 122 GLU D CB  1 
ATOM 3701  C CG  . GLU D 1 122 ? 63.042  56.768  16.210  1.00 46.56 ? 122 GLU D CG  1 
ATOM 3702  C CD  . GLU D 1 122 ? 64.061  55.655  16.426  1.00 46.77 ? 122 GLU D CD  1 
ATOM 3703  O OE1 . GLU D 1 122 ? 64.860  55.366  15.508  1.00 46.76 ? 122 GLU D OE1 1 
ATOM 3704  O OE2 . GLU D 1 122 ? 64.057  55.061  17.524  1.00 46.96 ? 122 GLU D OE2 1 
ATOM 3705  N N   . SER D 1 123 ? 64.446  60.527  14.007  1.00 45.20 ? 123 SER D N   1 
ATOM 3706  C CA  . SER D 1 123 ? 64.808  61.456  12.934  1.00 45.03 ? 123 SER D CA  1 
ATOM 3707  C C   . SER D 1 123 ? 64.643  62.901  13.401  1.00 44.61 ? 123 SER D C   1 
ATOM 3708  O O   . SER D 1 123 ? 63.799  63.196  14.250  1.00 44.74 ? 123 SER D O   1 
ATOM 3709  C CB  . SER D 1 123 ? 63.939  61.207  11.699  1.00 45.23 ? 123 SER D CB  1 
ATOM 3710  O OG  . SER D 1 123 ? 64.347  62.021  10.612  1.00 45.30 ? 123 SER D OG  1 
ATOM 3711  N N   . CYS D 1 124 ? 65.454  63.792  12.833  1.00 44.10 ? 124 CYS D N   1 
ATOM 3712  C CA  . CYS D 1 124 ? 65.437  65.213  13.191  1.00 43.87 ? 124 CYS D CA  1 
ATOM 3713  C C   . CYS D 1 124 ? 64.166  65.902  12.666  1.00 44.47 ? 124 CYS D C   1 
ATOM 3714  O O   . CYS D 1 124 ? 63.634  65.490  11.633  1.00 44.77 ? 124 CYS D O   1 
ATOM 3715  C CB  . CYS D 1 124 ? 66.686  65.918  12.645  1.00 43.10 ? 124 CYS D CB  1 
ATOM 3716  S SG  . CYS D 1 124 ? 67.180  65.392  10.985  1.00 42.51 ? 124 CYS D SG  1 
ATOM 3717  N N   . PRO D 1 125 ? 63.669  66.943  13.378  1.00 44.93 ? 125 PRO D N   1 
ATOM 3718  C CA  . PRO D 1 125 ? 62.482  67.672  12.891  1.00 45.17 ? 125 PRO D CA  1 
ATOM 3719  C C   . PRO D 1 125 ? 62.697  68.443  11.583  1.00 45.54 ? 125 PRO D C   1 
ATOM 3720  O O   . PRO D 1 125 ? 61.732  68.876  10.948  1.00 45.78 ? 125 PRO D O   1 
ATOM 3721  C CB  . PRO D 1 125 ? 62.172  68.653  14.032  1.00 45.17 ? 125 PRO D CB  1 
ATOM 3722  C CG  . PRO D 1 125 ? 62.829  68.078  15.234  1.00 45.13 ? 125 PRO D CG  1 
ATOM 3723  C CD  . PRO D 1 125 ? 64.060  67.394  14.728  1.00 45.02 ? 125 PRO D CD  1 
ATOM 3724  O OXT . PRO D 1 125 ? 63.821  68.657  11.124  1.00 45.77 ? 125 PRO D OXT 1 
ATOM 3725  N N   . PHE E 1 1   ? 80.015  85.095  84.295  1.00 65.53 ? 1   PHE E N   1 
ATOM 3726  C CA  . PHE E 1 1   ? 81.035  84.638  83.307  1.00 65.24 ? 1   PHE E CA  1 
ATOM 3727  C C   . PHE E 1 1   ? 82.008  83.664  83.984  1.00 64.19 ? 1   PHE E C   1 
ATOM 3728  O O   . PHE E 1 1   ? 82.967  84.081  84.641  1.00 64.28 ? 1   PHE E O   1 
ATOM 3729  C CB  . PHE E 1 1   ? 81.774  85.848  82.710  1.00 66.00 ? 1   PHE E CB  1 
ATOM 3730  C CG  . PHE E 1 1   ? 82.342  85.607  81.335  1.00 66.66 ? 1   PHE E CG  1 
ATOM 3731  C CD1 . PHE E 1 1   ? 83.309  84.626  81.120  1.00 66.87 ? 1   PHE E CD1 1 
ATOM 3732  C CD2 . PHE E 1 1   ? 81.924  86.374  80.250  1.00 67.09 ? 1   PHE E CD2 1 
ATOM 3733  C CE1 . PHE E 1 1   ? 83.835  84.410  79.856  1.00 67.09 ? 1   PHE E CE1 1 
ATOM 3734  C CE2 . PHE E 1 1   ? 82.450  86.159  78.985  1.00 67.25 ? 1   PHE E CE2 1 
ATOM 3735  C CZ  . PHE E 1 1   ? 83.407  85.177  78.787  1.00 67.25 ? 1   PHE E CZ  1 
ATOM 3736  N N   . THR E 1 2   ? 81.754  82.367  83.810  1.00 62.81 ? 2   THR E N   1 
ATOM 3737  C CA  . THR E 1 2   ? 82.553  81.313  84.443  1.00 61.68 ? 2   THR E CA  1 
ATOM 3738  C C   . THR E 1 2   ? 83.816  80.999  83.642  1.00 60.37 ? 2   THR E C   1 
ATOM 3739  O O   . THR E 1 2   ? 83.983  81.466  82.513  1.00 60.21 ? 2   THR E O   1 
ATOM 3740  C CB  . THR E 1 2   ? 81.739  80.007  84.591  1.00 61.85 ? 2   THR E CB  1 
ATOM 3741  O OG1 . THR E 1 2   ? 81.265  79.586  83.307  1.00 61.94 ? 2   THR E OG1 1 
ATOM 3742  C CG2 . THR E 1 2   ? 80.550  80.202  85.523  1.00 61.91 ? 2   THR E CG2 1 
ATOM 3743  N N   . LEU E 1 3   ? 84.697  80.202  84.245  1.00 59.31 ? 3   LEU E N   1 
ATOM 3744  C CA  . LEU E 1 3   ? 85.879  79.673  83.561  1.00 58.56 ? 3   LEU E CA  1 
ATOM 3745  C C   . LEU E 1 3   ? 85.489  78.576  82.569  1.00 57.74 ? 3   LEU E C   1 
ATOM 3746  O O   . LEU E 1 3   ? 86.056  78.499  81.480  1.00 57.87 ? 3   LEU E O   1 
ATOM 3747  C CB  . LEU E 1 3   ? 86.896  79.130  84.574  1.00 58.65 ? 3   LEU E CB  1 
ATOM 3748  C CG  . LEU E 1 3   ? 88.254  78.648  84.046  1.00 58.84 ? 3   LEU E CG  1 
ATOM 3749  C CD1 . LEU E 1 3   ? 89.035  79.781  83.396  1.00 58.83 ? 3   LEU E CD1 1 
ATOM 3750  C CD2 . LEU E 1 3   ? 89.057  78.023  85.178  1.00 59.00 ? 3   LEU E CD2 1 
ATOM 3751  N N   . ILE E 1 4   ? 84.537  77.725  82.960  1.00 56.84 ? 4   ILE E N   1 
ATOM 3752  C CA  . ILE E 1 4   ? 84.002  76.673  82.077  1.00 56.10 ? 4   ILE E CA  1 
ATOM 3753  C C   . ILE E 1 4   ? 83.326  77.227  80.811  1.00 55.55 ? 4   ILE E C   1 
ATOM 3754  O O   . ILE E 1 4   ? 83.434  76.621  79.742  1.00 55.56 ? 4   ILE E O   1 
ATOM 3755  C CB  . ILE E 1 4   ? 83.049  75.701  82.841  1.00 56.16 ? 4   ILE E CB  1 
ATOM 3756  C CG1 . ILE E 1 4   ? 82.650  74.488  81.982  1.00 56.20 ? 4   ILE E CG1 1 
ATOM 3757  C CG2 . ILE E 1 4   ? 81.780  76.397  83.324  1.00 56.30 ? 4   ILE E CG2 1 
ATOM 3758  C CD1 . ILE E 1 4   ? 83.809  73.662  81.469  1.00 56.15 ? 4   ILE E CD1 1 
ATOM 3759  N N   . GLU E 1 5   ? 82.638  78.363  80.935  1.00 55.12 ? 5   GLU E N   1 
ATOM 3760  C CA  . GLU E 1 5   ? 82.034  79.042  79.779  1.00 54.70 ? 5   GLU E CA  1 
ATOM 3761  C C   . GLU E 1 5   ? 83.101  79.625  78.847  1.00 54.01 ? 5   GLU E C   1 
ATOM 3762  O O   . GLU E 1 5   ? 82.902  79.673  77.635  1.00 54.13 ? 5   GLU E O   1 
ATOM 3763  C CB  . GLU E 1 5   ? 81.058  80.135  80.236  1.00 54.98 ? 5   GLU E CB  1 
ATOM 3764  C CG  . GLU E 1 5   ? 80.296  80.830  79.111  1.00 55.44 ? 5   GLU E CG  1 
ATOM 3765  C CD  . GLU E 1 5   ? 80.915  82.152  78.685  1.00 55.80 ? 5   GLU E CD  1 
ATOM 3766  O OE1 . GLU E 1 5   ? 80.971  83.082  79.519  1.00 55.97 ? 5   GLU E OE1 1 
ATOM 3767  O OE2 . GLU E 1 5   ? 81.336  82.267  77.514  1.00 55.93 ? 5   GLU E OE2 1 
ATOM 3768  N N   . LEU E 1 6   ? 84.217  80.076  79.416  1.00 53.26 ? 6   LEU E N   1 
ATOM 3769  C CA  . LEU E 1 6   ? 85.375  80.515  78.632  1.00 52.82 ? 6   LEU E CA  1 
ATOM 3770  C C   . LEU E 1 6   ? 86.125  79.329  78.025  1.00 52.17 ? 6   LEU E C   1 
ATOM 3771  O O   . LEU E 1 6   ? 86.592  79.401  76.888  1.00 52.30 ? 6   LEU E O   1 
ATOM 3772  C CB  . LEU E 1 6   ? 86.332  81.330  79.509  1.00 53.07 ? 6   LEU E CB  1 
ATOM 3773  C CG  . LEU E 1 6   ? 87.483  82.092  78.836  1.00 53.25 ? 6   LEU E CG  1 
ATOM 3774  C CD1 . LEU E 1 6   ? 86.975  83.126  77.835  1.00 53.35 ? 6   LEU E CD1 1 
ATOM 3775  C CD2 . LEU E 1 6   ? 88.368  82.742  79.897  1.00 53.36 ? 6   LEU E CD2 1 
ATOM 3776  N N   . LEU E 1 7   ? 86.242  78.248  78.798  1.00 51.68 ? 7   LEU E N   1 
ATOM 3777  C CA  . LEU E 1 7   ? 86.981  77.048  78.393  1.00 51.18 ? 7   LEU E CA  1 
ATOM 3778  C C   . LEU E 1 7   ? 86.343  76.320  77.210  1.00 50.46 ? 7   LEU E C   1 
ATOM 3779  O O   . LEU E 1 7   ? 87.055  75.870  76.309  1.00 50.55 ? 7   LEU E O   1 
ATOM 3780  C CB  . LEU E 1 7   ? 87.114  76.093  79.585  1.00 51.54 ? 7   LEU E CB  1 
ATOM 3781  C CG  . LEU E 1 7   ? 87.915  74.797  79.425  1.00 52.00 ? 7   LEU E CG  1 
ATOM 3782  C CD1 . LEU E 1 7   ? 89.322  75.063  78.910  1.00 52.25 ? 7   LEU E CD1 1 
ATOM 3783  C CD2 . LEU E 1 7   ? 87.955  74.068  80.760  1.00 52.11 ? 7   LEU E CD2 1 
ATOM 3784  N N   . ILE E 1 8   ? 85.015  76.196  77.222  1.00 49.67 ? 8   ILE E N   1 
ATOM 3785  C CA  . ILE E 1 8   ? 84.280  75.605  76.091  1.00 48.95 ? 8   ILE E CA  1 
ATOM 3786  C C   . ILE E 1 8   ? 84.349  76.482  74.833  1.00 48.10 ? 8   ILE E C   1 
ATOM 3787  O O   . ILE E 1 8   ? 84.397  75.954  73.726  1.00 48.25 ? 8   ILE E O   1 
ATOM 3788  C CB  . ILE E 1 8   ? 82.806  75.258  76.446  1.00 49.08 ? 8   ILE E CB  1 
ATOM 3789  C CG1 . ILE E 1 8   ? 82.203  74.332  75.376  1.00 49.31 ? 8   ILE E CG1 1 
ATOM 3790  C CG2 . ILE E 1 8   ? 81.956  76.513  76.624  1.00 49.12 ? 8   ILE E CG2 1 
ATOM 3791  C CD1 . ILE E 1 8   ? 80.915  73.647  75.786  1.00 49.49 ? 8   ILE E CD1 1 
ATOM 3792  N N   . VAL E 1 9   ? 84.364  77.804  75.007  1.00 47.27 ? 9   VAL E N   1 
ATOM 3793  C CA  . VAL E 1 9   ? 84.543  78.742  73.885  1.00 46.73 ? 9   VAL E CA  1 
ATOM 3794  C C   . VAL E 1 9   ? 85.927  78.579  73.238  1.00 46.19 ? 9   VAL E C   1 
ATOM 3795  O O   . VAL E 1 9   ? 86.047  78.650  72.015  1.00 46.23 ? 9   VAL E O   1 
ATOM 3796  C CB  . VAL E 1 9   ? 84.296  80.210  74.325  1.00 46.84 ? 9   VAL E CB  1 
ATOM 3797  C CG1 . VAL E 1 9   ? 84.775  81.213  73.278  1.00 46.95 ? 9   VAL E CG1 1 
ATOM 3798  C CG2 . VAL E 1 9   ? 82.816  80.429  74.611  1.00 46.91 ? 9   VAL E CG2 1 
ATOM 3799  N N   . ILE E 1 10  ? 86.953  78.360  74.060  1.00 45.60 ? 10  ILE E N   1 
ATOM 3800  C CA  . ILE E 1 10  ? 88.307  78.064  73.567  1.00 45.28 ? 10  ILE E CA  1 
ATOM 3801  C C   . ILE E 1 10  ? 88.333  76.723  72.814  1.00 44.89 ? 10  ILE E C   1 
ATOM 3802  O O   . ILE E 1 10  ? 89.023  76.596  71.800  1.00 44.97 ? 10  ILE E O   1 
ATOM 3803  C CB  . ILE E 1 10  ? 89.347  78.072  74.721  1.00 45.46 ? 10  ILE E CB  1 
ATOM 3804  C CG1 . ILE E 1 10  ? 89.503  79.491  75.289  1.00 45.68 ? 10  ILE E CG1 1 
ATOM 3805  C CG2 . ILE E 1 10  ? 90.712  77.562  74.255  1.00 45.52 ? 10  ILE E CG2 1 
ATOM 3806  C CD1 . ILE E 1 10  ? 90.062  79.540  76.696  1.00 45.81 ? 10  ILE E CD1 1 
ATOM 3807  N N   . ALA E 1 11  ? 87.582  75.740  73.311  1.00 44.53 ? 11  ALA E N   1 
ATOM 3808  C CA  . ALA E 1 11  ? 87.470  74.426  72.667  1.00 44.37 ? 11  ALA E CA  1 
ATOM 3809  C C   . ALA E 1 11  ? 86.802  74.478  71.288  1.00 44.14 ? 11  ALA E C   1 
ATOM 3810  O O   . ALA E 1 11  ? 87.245  73.795  70.364  1.00 44.27 ? 11  ALA E O   1 
ATOM 3811  C CB  . ALA E 1 11  ? 86.723  73.452  73.570  1.00 44.52 ? 11  ALA E CB  1 
ATOM 3812  N N   . ILE E 1 12  ? 85.746  75.283  71.160  1.00 43.94 ? 12  ILE E N   1 
ATOM 3813  C CA  . ILE E 1 12  ? 85.018  75.430  69.889  1.00 43.88 ? 12  ILE E CA  1 
ATOM 3814  C C   . ILE E 1 12  ? 85.838  76.208  68.847  1.00 43.93 ? 12  ILE E C   1 
ATOM 3815  O O   . ILE E 1 12  ? 85.777  75.888  67.659  1.00 44.27 ? 12  ILE E O   1 
ATOM 3816  C CB  . ILE E 1 12  ? 83.626  76.088  70.098  1.00 43.83 ? 12  ILE E CB  1 
ATOM 3817  C CG1 . ILE E 1 12  ? 82.727  75.212  70.990  1.00 44.06 ? 12  ILE E CG1 1 
ATOM 3818  C CG2 . ILE E 1 12  ? 82.925  76.375  68.769  1.00 43.85 ? 12  ILE E CG2 1 
ATOM 3819  C CD1 . ILE E 1 12  ? 82.448  73.814  70.474  1.00 44.26 ? 12  ILE E CD1 1 
ATOM 3820  N N   . ILE E 1 13  ? 86.601  77.210  69.286  1.00 43.69 ? 13  ILE E N   1 
ATOM 3821  C CA  . ILE E 1 13  ? 87.497  77.964  68.390  1.00 43.60 ? 13  ILE E CA  1 
ATOM 3822  C C   . ILE E 1 13  ? 88.548  77.044  67.747  1.00 43.55 ? 13  ILE E C   1 
ATOM 3823  O O   . ILE E 1 13  ? 88.869  77.204  66.568  1.00 43.61 ? 13  ILE E O   1 
ATOM 3824  C CB  . ILE E 1 13  ? 88.173  79.157  69.123  1.00 43.76 ? 13  ILE E CB  1 
ATOM 3825  C CG1 . ILE E 1 13  ? 87.131  80.232  69.461  1.00 43.92 ? 13  ILE E CG1 1 
ATOM 3826  C CG2 . ILE E 1 13  ? 89.281  79.791  68.277  1.00 43.84 ? 13  ILE E CG2 1 
ATOM 3827  C CD1 . ILE E 1 13  ? 87.527  81.137  70.609  1.00 44.05 ? 13  ILE E CD1 1 
ATOM 3828  N N   . ALA E 1 14  ? 89.068  76.088  68.518  1.00 43.61 ? 14  ALA E N   1 
ATOM 3829  C CA  . ALA E 1 14  ? 90.006  75.082  68.003  1.00 43.68 ? 14  ALA E CA  1 
ATOM 3830  C C   . ALA E 1 14  ? 89.377  74.171  66.942  1.00 43.73 ? 14  ALA E C   1 
ATOM 3831  O O   . ALA E 1 14  ? 90.048  73.782  65.983  1.00 43.84 ? 14  ALA E O   1 
ATOM 3832  C CB  . ALA E 1 14  ? 90.565  74.245  69.146  1.00 43.75 ? 14  ALA E CB  1 
ATOM 3833  N N   . ILE E 1 15  ? 88.099  73.836  67.126  1.00 43.74 ? 15  ILE E N   1 
ATOM 3834  C CA  . ILE E 1 15  ? 87.349  73.012  66.169  1.00 43.83 ? 15  ILE E CA  1 
ATOM 3835  C C   . ILE E 1 15  ? 87.045  73.799  64.892  1.00 43.79 ? 15  ILE E C   1 
ATOM 3836  O O   . ILE E 1 15  ? 87.277  73.303  63.787  1.00 43.92 ? 15  ILE E O   1 
ATOM 3837  C CB  . ILE E 1 15  ? 86.030  72.477  66.785  1.00 44.00 ? 15  ILE E CB  1 
ATOM 3838  C CG1 . ILE E 1 15  ? 86.331  71.539  67.965  1.00 44.22 ? 15  ILE E CG1 1 
ATOM 3839  C CG2 . ILE E 1 15  ? 85.194  71.733  65.744  1.00 44.10 ? 15  ILE E CG2 1 
ATOM 3840  C CD1 . ILE E 1 15  ? 85.168  71.342  68.913  1.00 44.27 ? 15  ILE E CD1 1 
ATOM 3841  N N   . LEU E 1 16  ? 86.516  75.011  65.054  1.00 43.76 ? 16  LEU E N   1 
ATOM 3842  C CA  . LEU E 1 16  ? 86.181  75.885  63.916  1.00 43.77 ? 16  LEU E CA  1 
ATOM 3843  C C   . LEU E 1 16  ? 87.408  76.316  63.100  1.00 43.68 ? 16  LEU E C   1 
ATOM 3844  O O   . LEU E 1 16  ? 87.317  76.453  61.879  1.00 43.80 ? 16  LEU E O   1 
ATOM 3845  C CB  . LEU E 1 16  ? 85.385  77.121  64.377  1.00 43.94 ? 16  LEU E CB  1 
ATOM 3846  C CG  . LEU E 1 16  ? 83.856  76.985  64.450  1.00 44.26 ? 16  LEU E CG  1 
ATOM 3847  C CD1 . LEU E 1 16  ? 83.398  75.687  65.105  1.00 44.40 ? 16  LEU E CD1 1 
ATOM 3848  C CD2 . LEU E 1 16  ? 83.259  78.189  65.168  1.00 44.39 ? 16  LEU E CD2 1 
ATOM 3849  N N   . ALA E 1 17  ? 88.540  76.529  63.773  1.00 43.48 ? 17  ALA E N   1 
ATOM 3850  C CA  . ALA E 1 17  ? 89.796  76.895  63.100  1.00 43.36 ? 17  ALA E CA  1 
ATOM 3851  C C   . ALA E 1 17  ? 90.371  75.774  62.224  1.00 43.29 ? 17  ALA E C   1 
ATOM 3852  O O   . ALA E 1 17  ? 91.110  76.051  61.277  1.00 43.40 ? 17  ALA E O   1 
ATOM 3853  C CB  . ALA E 1 17  ? 90.835  77.340  64.121  1.00 43.38 ? 17  ALA E CB  1 
ATOM 3854  N N   . ALA E 1 18  ? 90.046  74.522  62.547  1.00 43.01 ? 18  ALA E N   1 
ATOM 3855  C CA  . ALA E 1 18  ? 90.492  73.370  61.762  1.00 42.88 ? 18  ALA E CA  1 
ATOM 3856  C C   . ALA E 1 18  ? 89.605  73.143  60.539  1.00 42.74 ? 18  ALA E C   1 
ATOM 3857  O O   . ALA E 1 18  ? 90.101  73.080  59.412  1.00 42.83 ? 18  ALA E O   1 
ATOM 3858  C CB  . ALA E 1 18  ? 90.514  72.120  62.630  1.00 42.97 ? 18  ALA E CB  1 
ATOM 3859  N N   . VAL E 1 19  ? 88.298  73.029  60.772  1.00 42.61 ? 19  VAL E N   1 
ATOM 3860  C CA  . VAL E 1 19  ? 87.346  72.614  59.726  1.00 42.61 ? 19  VAL E CA  1 
ATOM 3861  C C   . VAL E 1 19  ? 87.020  73.691  58.682  1.00 42.56 ? 19  VAL E C   1 
ATOM 3862  O O   . VAL E 1 19  ? 86.902  73.378  57.495  1.00 42.66 ? 19  VAL E O   1 
ATOM 3863  C CB  . VAL E 1 19  ? 86.023  72.051  60.320  1.00 42.69 ? 19  VAL E CB  1 
ATOM 3864  C CG1 . VAL E 1 19  ? 86.313  70.905  61.283  1.00 42.75 ? 19  VAL E CG1 1 
ATOM 3865  C CG2 . VAL E 1 19  ? 85.180  73.135  60.991  1.00 42.69 ? 19  VAL E CG2 1 
ATOM 3866  N N   . LEU E 1 20  ? 86.884  74.945  59.115  1.00 42.47 ? 20  LEU E N   1 
ATOM 3867  C CA  . LEU E 1 20  ? 86.446  76.033  58.227  1.00 42.47 ? 20  LEU E CA  1 
ATOM 3868  C C   . LEU E 1 20  ? 87.536  76.544  57.276  1.00 42.21 ? 20  LEU E C   1 
ATOM 3869  O O   . LEU E 1 20  ? 87.217  77.135  56.241  1.00 42.16 ? 20  LEU E O   1 
ATOM 3870  C CB  . LEU E 1 20  ? 85.881  77.201  59.042  1.00 42.79 ? 20  LEU E CB  1 
ATOM 3871  C CG  . LEU E 1 20  ? 84.702  76.893  59.972  1.00 43.17 ? 20  LEU E CG  1 
ATOM 3872  C CD1 . LEU E 1 20  ? 84.363  78.113  60.814  1.00 43.27 ? 20  LEU E CD1 1 
ATOM 3873  C CD2 . LEU E 1 20  ? 83.483  76.439  59.182  1.00 43.25 ? 20  LEU E CD2 1 
ATOM 3874  N N   . ILE E 1 21  ? 88.805  76.326  57.626  1.00 41.85 ? 21  ILE E N   1 
ATOM 3875  C CA  . ILE E 1 21  ? 89.934  76.715  56.771  1.00 41.51 ? 21  ILE E CA  1 
ATOM 3876  C C   . ILE E 1 21  ? 90.002  75.704  55.615  1.00 41.13 ? 21  ILE E C   1 
ATOM 3877  O O   . ILE E 1 21  ? 90.230  74.517  55.859  1.00 41.33 ? 21  ILE E O   1 
ATOM 3878  C CB  . ILE E 1 21  ? 91.275  76.757  57.560  1.00 41.75 ? 21  ILE E CB  1 
ATOM 3879  C CG1 . ILE E 1 21  ? 91.410  78.054  58.380  1.00 41.94 ? 21  ILE E CG1 1 
ATOM 3880  C CG2 . ILE E 1 21  ? 92.484  76.688  56.627  1.00 41.83 ? 21  ILE E CG2 1 
ATOM 3881  C CD1 . ILE E 1 21  ? 90.224  78.442  59.241  1.00 42.01 ? 21  ILE E CD1 1 
ATOM 3882  N N   . PRO E 1 22  ? 89.808  76.165  54.360  1.00 40.49 ? 22  PRO E N   1 
ATOM 3883  C CA  . PRO E 1 22  ? 89.759  75.242  53.224  1.00 40.05 ? 22  PRO E CA  1 
ATOM 3884  C C   . PRO E 1 22  ? 91.139  74.778  52.757  1.00 39.58 ? 22  PRO E C   1 
ATOM 3885  O O   . PRO E 1 22  ? 92.160  75.303  53.209  1.00 39.64 ? 22  PRO E O   1 
ATOM 3886  C CB  . PRO E 1 22  ? 89.091  76.082  52.137  1.00 40.17 ? 22  PRO E CB  1 
ATOM 3887  C CG  . PRO E 1 22  ? 89.564  77.464  52.418  1.00 40.35 ? 22  PRO E CG  1 
ATOM 3888  C CD  . PRO E 1 22  ? 89.691  77.568  53.915  1.00 40.46 ? 22  PRO E CD  1 
ATOM 3889  N N   . ASN E 1 23  ? 91.150  73.799  51.852  1.00 38.96 ? 23  ASN E N   1 
ATOM 3890  C CA  . ASN E 1 23  ? 92.384  73.313  51.236  1.00 38.42 ? 23  ASN E CA  1 
ATOM 3891  C C   . ASN E 1 23  ? 92.874  74.356  50.230  1.00 38.17 ? 23  ASN E C   1 
ATOM 3892  O O   . ASN E 1 23  ? 92.297  74.509  49.150  1.00 38.30 ? 23  ASN E O   1 
ATOM 3893  C CB  . ASN E 1 23  ? 92.148  71.956  50.556  1.00 38.26 ? 23  ASN E CB  1 
ATOM 3894  C CG  . ASN E 1 23  ? 93.441  71.251  50.177  1.00 38.22 ? 23  ASN E CG  1 
ATOM 3895  O OD1 . ASN E 1 23  ? 94.302  71.818  49.504  1.00 38.19 ? 23  ASN E OD1 1 
ATOM 3896  N ND2 . ASN E 1 23  ? 93.576  69.999  50.599  1.00 38.32 ? 23  ASN E ND2 1 
ATOM 3897  N N   . LEU E 1 24  ? 93.932  75.077  50.601  1.00 37.77 ? 24  LEU E N   1 
ATOM 3898  C CA  . LEU E 1 24  ? 94.472  76.156  49.773  1.00 37.53 ? 24  LEU E CA  1 
ATOM 3899  C C   . LEU E 1 24  ? 95.272  75.619  48.587  1.00 37.24 ? 24  LEU E C   1 
ATOM 3900  O O   . LEU E 1 24  ? 95.084  76.079  47.462  1.00 37.38 ? 24  LEU E O   1 
ATOM 3901  C CB  . LEU E 1 24  ? 95.350  77.095  50.609  1.00 37.66 ? 24  LEU E CB  1 
ATOM 3902  C CG  . LEU E 1 24  ? 94.675  77.802  51.791  1.00 37.78 ? 24  LEU E CG  1 
ATOM 3903  C CD1 . LEU E 1 24  ? 95.716  78.449  52.691  1.00 37.90 ? 24  LEU E CD1 1 
ATOM 3904  C CD2 . LEU E 1 24  ? 93.665  78.840  51.321  1.00 37.72 ? 24  LEU E CD2 1 
ATOM 3905  N N   . LEU E 1 25  ? 96.149  74.646  48.845  1.00 36.76 ? 25  LEU E N   1 
ATOM 3906  C CA  . LEU E 1 25  ? 97.034  74.080  47.815  1.00 36.40 ? 25  LEU E CA  1 
ATOM 3907  C C   . LEU E 1 25  ? 96.266  73.507  46.627  1.00 35.85 ? 25  LEU E C   1 
ATOM 3908  O O   . LEU E 1 25  ? 96.654  73.718  45.478  1.00 35.80 ? 25  LEU E O   1 
ATOM 3909  C CB  . LEU E 1 25  ? 97.936  72.989  48.411  1.00 36.59 ? 25  LEU E CB  1 
ATOM 3910  C CG  . LEU E 1 25  ? 99.010  72.376  47.498  1.00 36.81 ? 25  LEU E CG  1 
ATOM 3911  C CD1 . LEU E 1 25  ? 100.031 73.422  47.076  1.00 36.91 ? 25  LEU E CD1 1 
ATOM 3912  C CD2 . LEU E 1 25  ? 99.698  71.206  48.186  1.00 36.92 ? 25  LEU E CD2 1 
ATOM 3913  N N   . ALA E 1 26  ? 95.183  72.787  46.914  1.00 35.52 ? 26  ALA E N   1 
ATOM 3914  C CA  . ALA E 1 26  ? 94.341  72.191  45.874  1.00 35.27 ? 26  ALA E CA  1 
ATOM 3915  C C   . ALA E 1 26  ? 93.597  73.253  45.059  1.00 34.96 ? 26  ALA E C   1 
ATOM 3916  O O   . ALA E 1 26  ? 93.482  73.129  43.839  1.00 34.98 ? 26  ALA E O   1 
ATOM 3917  C CB  . ALA E 1 26  ? 93.358  71.198  46.485  1.00 35.29 ? 26  ALA E CB  1 
ATOM 3918  N N   . ALA E 1 27  ? 93.104  74.290  45.735  1.00 34.79 ? 27  ALA E N   1 
ATOM 3919  C CA  . ALA E 1 27  ? 92.409  75.404  45.074  1.00 34.77 ? 27  ALA E CA  1 
ATOM 3920  C C   . ALA E 1 27  ? 93.292  76.153  44.070  1.00 34.60 ? 27  ALA E C   1 
ATOM 3921  O O   . ALA E 1 27  ? 92.813  76.558  43.009  1.00 34.63 ? 27  ALA E O   1 
ATOM 3922  C CB  . ALA E 1 27  ? 91.860  76.374  46.112  1.00 34.88 ? 27  ALA E CB  1 
ATOM 3923  N N   . ARG E 1 28  ? 94.570  76.331  44.408  1.00 34.46 ? 28  ARG E N   1 
ATOM 3924  C CA  . ARG E 1 28  ? 95.524  77.017  43.528  1.00 34.32 ? 28  ARG E CA  1 
ATOM 3925  C C   . ARG E 1 28  ? 95.925  76.188  42.303  1.00 34.16 ? 28  ARG E C   1 
ATOM 3926  O O   . ARG E 1 28  ? 96.155  76.758  41.237  1.00 34.28 ? 28  ARG E O   1 
ATOM 3927  C CB  . ARG E 1 28  ? 96.779  77.440  44.299  1.00 34.46 ? 28  ARG E CB  1 
ATOM 3928  C CG  . ARG E 1 28  ? 96.512  78.437  45.416  1.00 34.64 ? 28  ARG E CG  1 
ATOM 3929  C CD  . ARG E 1 28  ? 97.760  79.218  45.801  1.00 34.76 ? 28  ARG E CD  1 
ATOM 3930  N NE  . ARG E 1 28  ? 97.971  80.380  44.937  1.00 34.86 ? 28  ARG E NE  1 
ATOM 3931  C CZ  . ARG E 1 28  ? 97.290  81.529  45.005  1.00 35.08 ? 28  ARG E CZ  1 
ATOM 3932  N NH1 . ARG E 1 28  ? 97.582  82.513  44.159  1.00 35.19 ? 28  ARG E NH1 1 
ATOM 3933  N NH2 . ARG E 1 28  ? 96.319  81.711  45.903  1.00 35.14 ? 28  ARG E NH2 1 
ATOM 3934  N N   . LYS E 1 29  ? 96.016  74.863  42.456  1.00 34.02 ? 29  LYS E N   1 
ATOM 3935  C CA  . LYS E 1 29  ? 96.358  73.956  41.340  1.00 33.92 ? 29  LYS E CA  1 
ATOM 3936  C C   . LYS E 1 29  ? 95.480  74.155  40.102  1.00 33.86 ? 29  LYS E C   1 
ATOM 3937  O O   . LYS E 1 29  ? 95.987  74.174  38.980  1.00 34.02 ? 29  LYS E O   1 
ATOM 3938  C CB  . LYS E 1 29  ? 96.273  72.481  41.767  1.00 33.96 ? 29  LYS E CB  1 
ATOM 3939  C CG  . LYS E 1 29  ? 97.477  71.960  42.536  1.00 34.05 ? 29  LYS E CG  1 
ATOM 3940  C CD  . LYS E 1 29  ? 97.471  70.438  42.575  1.00 34.19 ? 29  LYS E CD  1 
ATOM 3941  C CE  . LYS E 1 29  ? 98.586  69.881  43.448  1.00 34.36 ? 29  LYS E CE  1 
ATOM 3942  N NZ  . LYS E 1 29  ? 98.254  69.902  44.901  1.00 34.43 ? 29  LYS E NZ  1 
ATOM 3943  N N   . ARG E 1 30  ? 94.174  74.305  40.316  1.00 33.59 ? 30  ARG E N   1 
ATOM 3944  C CA  . ARG E 1 30  ? 93.214  74.470  39.218  1.00 33.40 ? 30  ARG E CA  1 
ATOM 3945  C C   . ARG E 1 30  ? 93.274  75.875  38.622  1.00 33.27 ? 30  ARG E C   1 
ATOM 3946  O O   . ARG E 1 30  ? 93.072  76.047  37.418  1.00 33.42 ? 30  ARG E O   1 
ATOM 3947  C CB  . ARG E 1 30  ? 91.787  74.156  39.680  1.00 33.43 ? 30  ARG E CB  1 
ATOM 3948  C CG  . ARG E 1 30  ? 91.594  72.789  40.331  1.00 33.49 ? 30  ARG E CG  1 
ATOM 3949  C CD  . ARG E 1 30  ? 91.956  71.626  39.414  1.00 33.56 ? 30  ARG E CD  1 
ATOM 3950  N NE  . ARG E 1 30  ? 91.947  70.341  40.115  1.00 33.57 ? 30  ARG E NE  1 
ATOM 3951  C CZ  . ARG E 1 30  ? 92.204  69.160  39.548  1.00 33.63 ? 30  ARG E CZ  1 
ATOM 3952  N NH1 . ARG E 1 30  ? 92.496  69.069  38.251  1.00 33.65 ? 30  ARG E NH1 1 
ATOM 3953  N NH2 . ARG E 1 30  ? 92.168  68.054  40.288  1.00 33.67 ? 30  ARG E NH2 1 
ATOM 3954  N N   . ALA E 1 31  ? 93.536  76.871  39.467  1.00 32.98 ? 31  ALA E N   1 
ATOM 3955  C CA  . ALA E 1 31  ? 93.789  78.238  39.006  1.00 32.87 ? 31  ALA E CA  1 
ATOM 3956  C C   . ALA E 1 31  ? 95.088  78.331  38.204  1.00 32.84 ? 31  ALA E C   1 
ATOM 3957  O O   . ALA E 1 31  ? 95.162  79.078  37.228  1.00 32.95 ? 31  ALA E O   1 
ATOM 3958  C CB  . ALA E 1 31  ? 93.832  79.194  40.187  1.00 32.90 ? 31  ALA E CB  1 
ATOM 3959  N N   . ASN E 1 32  ? 96.104  77.579  38.628  1.00 32.86 ? 32  ASN E N   1 
ATOM 3960  C CA  . ASN E 1 32  ? 97.375  77.482  37.898  1.00 32.92 ? 32  ASN E CA  1 
ATOM 3961  C C   . ASN E 1 32  ? 97.223  76.807  36.529  1.00 33.12 ? 32  ASN E C   1 
ATOM 3962  O O   . ASN E 1 32  ? 97.924  77.172  35.582  1.00 33.24 ? 32  ASN E O   1 
ATOM 3963  C CB  . ASN E 1 32  ? 98.427  76.727  38.727  1.00 32.83 ? 32  ASN E CB  1 
ATOM 3964  C CG  . ASN E 1 32  ? 98.921  77.520  39.931  1.00 32.76 ? 32  ASN E CG  1 
ATOM 3965  O OD1 . ASN E 1 32  ? 99.082  78.738  39.852  1.00 32.77 ? 32  ASN E OD1 1 
ATOM 3966  N ND2 . ASN E 1 32  ? 99.158  76.838  41.047  1.00 32.81 ? 32  ASN E ND2 1 
ATOM 3967  N N   . ASP E 1 33  ? 96.324  75.826  36.434  1.00 33.25 ? 33  ASP E N   1 
ATOM 3968  C CA  . ASP E 1 33  ? 95.993  75.188  35.150  1.00 33.42 ? 33  ASP E CA  1 
ATOM 3969  C C   . ASP E 1 33  ? 95.312  76.161  34.186  1.00 33.48 ? 33  ASP E C   1 
ATOM 3970  O O   . ASP E 1 33  ? 95.546  76.101  32.977  1.00 33.61 ? 33  ASP E O   1 
ATOM 3971  C CB  . ASP E 1 33  ? 95.088  73.966  35.356  1.00 33.64 ? 33  ASP E CB  1 
ATOM 3972  C CG  . ASP E 1 33  ? 95.778  72.827  36.094  1.00 33.90 ? 33  ASP E CG  1 
ATOM 3973  O OD1 . ASP E 1 33  ? 97.024  72.822  36.206  1.00 33.97 ? 33  ASP E OD1 1 
ATOM 3974  O OD2 . ASP E 1 33  ? 95.058  71.922  36.568  1.00 34.02 ? 33  ASP E OD2 1 
ATOM 3975  N N   . THR E 1 34  ? 94.466  77.040  34.725  1.00 33.41 ? 34  THR E N   1 
ATOM 3976  C CA  . THR E 1 34  ? 93.809  78.087  33.935  1.00 33.36 ? 34  THR E CA  1 
ATOM 3977  C C   . THR E 1 34  ? 94.813  79.080  33.342  1.00 33.33 ? 34  THR E C   1 
ATOM 3978  O O   . THR E 1 34  ? 94.619  79.555  32.225  1.00 33.44 ? 34  THR E O   1 
ATOM 3979  C CB  . THR E 1 34  ? 92.775  78.868  34.779  1.00 33.50 ? 34  THR E CB  1 
ATOM 3980  O OG1 . THR E 1 34  ? 91.961  77.949  35.518  1.00 33.50 ? 34  THR E OG1 1 
ATOM 3981  C CG2 . THR E 1 34  ? 91.881  79.737  33.893  1.00 33.60 ? 34  THR E CG2 1 
ATOM 3982  N N   . VAL E 1 35  ? 95.875  79.383  34.091  1.00 33.30 ? 35  VAL E N   1 
ATOM 3983  C CA  . VAL E 1 35  ? 96.953  80.267  33.619  1.00 33.32 ? 35  VAL E CA  1 
ATOM 3984  C C   . VAL E 1 35  ? 97.729  79.617  32.468  1.00 33.25 ? 35  VAL E C   1 
ATOM 3985  O O   . VAL E 1 35  ? 98.067  80.288  31.491  1.00 33.36 ? 35  VAL E O   1 
ATOM 3986  C CB  . VAL E 1 35  ? 97.923  80.652  34.769  1.00 33.52 ? 35  VAL E CB  1 
ATOM 3987  C CG1 . VAL E 1 35  ? 99.149  81.405  34.249  1.00 33.63 ? 35  VAL E CG1 1 
ATOM 3988  C CG2 . VAL E 1 35  ? 97.206  81.494  35.816  1.00 33.60 ? 35  VAL E CG2 1 
ATOM 3989  N N   . VAL E 1 36  ? 98.004  78.319  32.595  1.00 33.13 ? 36  VAL E N   1 
ATOM 3990  C CA  . VAL E 1 36  ? 98.709  77.557  31.557  1.00 33.03 ? 36  VAL E CA  1 
ATOM 3991  C C   . VAL E 1 36  ? 97.831  77.382  30.315  1.00 33.02 ? 36  VAL E C   1 
ATOM 3992  O O   . VAL E 1 36  ? 98.311  77.535  29.190  1.00 33.10 ? 36  VAL E O   1 
ATOM 3993  C CB  . VAL E 1 36  ? 99.173  76.173  32.081  1.00 33.02 ? 36  VAL E CB  1 
ATOM 3994  C CG1 . VAL E 1 36  ? 99.738  75.310  30.955  1.00 33.08 ? 36  VAL E CG1 1 
ATOM 3995  C CG2 . VAL E 1 36  ? 100.212 76.337  33.182  1.00 33.01 ? 36  VAL E CG2 1 
ATOM 3996  N N   . THR E 1 37  ? 96.556  77.054  30.528  1.00 33.06 ? 37  THR E N   1 
ATOM 3997  C CA  . THR E 1 37  ? 95.592  76.903  29.434  1.00 33.11 ? 37  THR E CA  1 
ATOM 3998  C C   . THR E 1 37  ? 95.341  78.225  28.704  1.00 33.10 ? 37  THR E C   1 
ATOM 3999  O O   . THR E 1 37  ? 95.231  78.239  27.478  1.00 33.26 ? 37  THR E O   1 
ATOM 4000  C CB  . THR E 1 37  ? 94.244  76.340  29.940  1.00 33.23 ? 37  THR E CB  1 
ATOM 4001  O OG1 . THR E 1 37  ? 94.473  75.140  30.690  1.00 33.31 ? 37  THR E OG1 1 
ATOM 4002  C CG2 . THR E 1 37  ? 93.298  76.032  28.776  1.00 33.28 ? 37  THR E CG2 1 
ATOM 4003  N N   . ALA E 1 38  ? 95.257  79.322  29.458  1.00 33.05 ? 38  ALA E N   1 
ATOM 4004  C CA  . ALA E 1 38  ? 95.067  80.658  28.879  1.00 33.10 ? 38  ALA E CA  1 
ATOM 4005  C C   . ALA E 1 38  ? 96.272  81.114  28.060  1.00 33.09 ? 38  ALA E C   1 
ATOM 4006  O O   . ALA E 1 38  ? 96.103  81.669  26.974  1.00 33.10 ? 38  ALA E O   1 
ATOM 4007  C CB  . ALA E 1 38  ? 94.764  81.677  29.970  1.00 33.16 ? 38  ALA E CB  1 
ATOM 4008  N N   . TYR E 1 39  ? 97.476  80.882  28.582  1.00 33.22 ? 39  TYR E N   1 
ATOM 4009  C CA  . TYR E 1 39  ? 98.713  81.268  27.893  1.00 33.27 ? 39  TYR E CA  1 
ATOM 4010  C C   . TYR E 1 39  ? 98.947  80.455  26.618  1.00 33.48 ? 39  TYR E C   1 
ATOM 4011  O O   . TYR E 1 39  ? 99.421  80.999  25.619  1.00 33.64 ? 39  TYR E O   1 
ATOM 4012  C CB  . TYR E 1 39  ? 99.927  81.148  28.818  1.00 33.19 ? 39  TYR E CB  1 
ATOM 4013  C CG  . TYR E 1 39  ? 101.154 81.849  28.279  1.00 33.27 ? 39  TYR E CG  1 
ATOM 4014  C CD1 . TYR E 1 39  ? 101.302 83.231  28.403  1.00 33.33 ? 39  TYR E CD1 1 
ATOM 4015  C CD2 . TYR E 1 39  ? 102.165 81.136  27.631  1.00 33.35 ? 39  TYR E CD2 1 
ATOM 4016  C CE1 . TYR E 1 39  ? 102.422 83.883  27.905  1.00 33.32 ? 39  TYR E CE1 1 
ATOM 4017  C CE2 . TYR E 1 39  ? 103.290 81.779  27.130  1.00 33.36 ? 39  TYR E CE2 1 
ATOM 4018  C CZ  . TYR E 1 39  ? 103.414 83.151  27.269  1.00 33.36 ? 39  TYR E CZ  1 
ATOM 4019  O OH  . TYR E 1 39  ? 104.527 83.791  26.775  1.00 33.46 ? 39  TYR E OH  1 
ATOM 4020  N N   . LEU E 1 40  ? 98.624  79.162  26.660  1.00 33.68 ? 40  LEU E N   1 
ATOM 4021  C CA  . LEU E 1 40  ? 98.659  78.311  25.462  1.00 33.88 ? 40  LEU E CA  1 
ATOM 4022  C C   . LEU E 1 40  ? 97.572  78.694  24.456  1.00 34.31 ? 40  LEU E C   1 
ATOM 4023  O O   . LEU E 1 40  ? 97.812  78.658  23.250  1.00 34.49 ? 40  LEU E O   1 
ATOM 4024  C CB  . LEU E 1 40  ? 98.528  76.829  25.829  1.00 33.80 ? 40  LEU E CB  1 
ATOM 4025  C CG  . LEU E 1 40  ? 99.740  76.190  26.510  1.00 33.73 ? 40  LEU E CG  1 
ATOM 4026  C CD1 . LEU E 1 40  ? 99.353  74.850  27.108  1.00 33.66 ? 40  LEU E CD1 1 
ATOM 4027  C CD2 . LEU E 1 40  ? 100.902 76.021  25.541  1.00 33.70 ? 40  LEU E CD2 1 
ATOM 4028  N N   . ASN E 1 41  ? 96.387  79.052  24.954  1.00 34.79 ? 41  ASN E N   1 
ATOM 4029  C CA  . ASN E 1 41  ? 95.300  79.555  24.104  1.00 35.15 ? 41  ASN E CA  1 
ATOM 4030  C C   . ASN E 1 41  ? 95.690  80.871  23.422  1.00 35.40 ? 41  ASN E C   1 
ATOM 4031  O O   . ASN E 1 41  ? 95.355  81.087  22.257  1.00 35.49 ? 41  ASN E O   1 
ATOM 4032  C CB  . ASN E 1 41  ? 94.012  79.739  24.918  1.00 35.34 ? 41  ASN E CB  1 
ATOM 4033  C CG  . ASN E 1 41  ? 92.813  80.105  24.057  1.00 35.61 ? 41  ASN E CG  1 
ATOM 4034  O OD1 . ASN E 1 41  ? 92.591  79.521  22.996  1.00 35.79 ? 41  ASN E OD1 1 
ATOM 4035  N ND2 . ASN E 1 41  ? 92.028  81.074  24.517  1.00 35.71 ? 41  ASN E ND2 1 
ATOM 4036  N N   . ASP E 1 42  ? 96.393  81.738  24.152  1.00 35.76 ? 42  ASP E N   1 
ATOM 4037  C CA  . ASP E 1 42  ? 96.965  82.964  23.579  1.00 36.04 ? 42  ASP E CA  1 
ATOM 4038  C C   . ASP E 1 42  ? 98.116  82.654  22.618  1.00 36.01 ? 42  ASP E C   1 
ATOM 4039  O O   . ASP E 1 42  ? 98.227  83.283  21.567  1.00 36.17 ? 42  ASP E O   1 
ATOM 4040  C CB  . ASP E 1 42  ? 97.457  83.916  24.681  1.00 36.32 ? 42  ASP E CB  1 
ATOM 4041  C CG  . ASP E 1 42  ? 96.321  84.493  25.519  1.00 36.66 ? 42  ASP E CG  1 
ATOM 4042  O OD1 . ASP E 1 42  ? 95.244  84.804  24.962  1.00 36.82 ? 42  ASP E OD1 1 
ATOM 4043  O OD2 . ASP E 1 42  ? 96.512  84.647  26.744  1.00 36.78 ? 42  ASP E OD2 1 
ATOM 4044  N N   . ALA E 1 43  ? 98.962  81.691  22.984  1.00 35.92 ? 43  ALA E N   1 
ATOM 4045  C CA  . ALA E 1 43  ? 100.084 81.261  22.137  1.00 35.94 ? 43  ALA E CA  1 
ATOM 4046  C C   . ALA E 1 43  ? 99.631  80.715  20.781  1.00 36.00 ? 43  ALA E C   1 
ATOM 4047  O O   . ALA E 1 43  ? 100.296 80.945  19.772  1.00 36.16 ? 43  ALA E O   1 
ATOM 4048  C CB  . ALA E 1 43  ? 100.931 80.224  22.862  1.00 35.95 ? 43  ALA E CB  1 
ATOM 4049  N N   . VAL E 1 44  ? 98.510  79.996  20.769  1.00 36.18 ? 44  VAL E N   1 
ATOM 4050  C CA  . VAL E 1 44  ? 97.911  79.479  19.528  1.00 36.35 ? 44  VAL E CA  1 
ATOM 4051  C C   . VAL E 1 44  ? 97.444  80.616  18.605  1.00 36.53 ? 44  VAL E C   1 
ATOM 4052  O O   . VAL E 1 44  ? 97.572  80.510  17.384  1.00 36.62 ? 44  VAL E O   1 
ATOM 4053  C CB  . VAL E 1 44  ? 96.746  78.492  19.831  1.00 36.45 ? 44  VAL E CB  1 
ATOM 4054  C CG1 . VAL E 1 44  ? 95.937  78.155  18.579  1.00 36.57 ? 44  VAL E CG1 1 
ATOM 4055  C CG2 . VAL E 1 44  ? 97.282  77.212  20.471  1.00 36.45 ? 44  VAL E CG2 1 
ATOM 4056  N N   . LYS E 1 45  ? 96.911  81.692  19.188  1.00 36.84 ? 45  LYS E N   1 
ATOM 4057  C CA  . LYS E 1 45  ? 96.451  82.854  18.413  1.00 37.12 ? 45  LYS E CA  1 
ATOM 4058  C C   . LYS E 1 45  ? 97.602  83.569  17.707  1.00 37.00 ? 45  LYS E C   1 
ATOM 4059  O O   . LYS E 1 45  ? 97.522  83.838  16.508  1.00 37.15 ? 45  LYS E O   1 
ATOM 4060  C CB  . LYS E 1 45  ? 95.686  83.844  19.301  1.00 37.49 ? 45  LYS E CB  1 
ATOM 4061  C CG  . LYS E 1 45  ? 94.356  83.315  19.818  1.00 37.82 ? 45  LYS E CG  1 
ATOM 4062  C CD  . LYS E 1 45  ? 93.826  84.147  20.976  1.00 38.10 ? 45  LYS E CD  1 
ATOM 4063  C CE  . LYS E 1 45  ? 92.588  83.512  21.592  1.00 38.33 ? 45  LYS E CE  1 
ATOM 4064  N NZ  . LYS E 1 45  ? 92.124  84.232  22.811  1.00 38.49 ? 45  LYS E NZ  1 
ATOM 4065  N N   . PHE E 1 46  ? 98.665  83.867  18.450  1.00 36.90 ? 46  PHE E N   1 
ATOM 4066  C CA  . PHE E 1 46  ? 99.843  84.542  17.885  1.00 36.84 ? 46  PHE E CA  1 
ATOM 4067  C C   . PHE E 1 46  ? 100.689 83.655  16.960  1.00 36.81 ? 46  PHE E C   1 
ATOM 4068  O O   . PHE E 1 46  ? 101.493 84.175  16.183  1.00 36.96 ? 46  PHE E O   1 
ATOM 4069  C CB  . PHE E 1 46  ? 100.704 85.162  18.992  1.00 36.83 ? 46  PHE E CB  1 
ATOM 4070  C CG  . PHE E 1 46  ? 100.104 86.403  19.587  1.00 36.90 ? 46  PHE E CG  1 
ATOM 4071  C CD1 . PHE E 1 46  ? 100.198 87.619  18.919  1.00 37.06 ? 46  PHE E CD1 1 
ATOM 4072  C CD2 . PHE E 1 46  ? 99.428  86.360  20.801  1.00 36.99 ? 46  PHE E CD2 1 
ATOM 4073  C CE1 . PHE E 1 46  ? 99.637  88.769  19.454  1.00 37.14 ? 46  PHE E CE1 1 
ATOM 4074  C CE2 . PHE E 1 46  ? 98.867  87.507  21.345  1.00 37.16 ? 46  PHE E CE2 1 
ATOM 4075  C CZ  . PHE E 1 46  ? 98.970  88.715  20.669  1.00 37.19 ? 46  PHE E CZ  1 
ATOM 4076  N N   . GLN E 1 47  ? 100.519 82.335  17.047  1.00 36.77 ? 47  GLN E N   1 
ATOM 4077  C CA  . GLN E 1 47  ? 101.074 81.412  16.047  1.00 36.82 ? 47  GLN E CA  1 
ATOM 4078  C C   . GLN E 1 47  ? 100.355 81.562  14.702  1.00 37.07 ? 47  GLN E C   1 
ATOM 4079  O O   . GLN E 1 47  ? 100.997 81.530  13.651  1.00 37.28 ? 47  GLN E O   1 
ATOM 4080  C CB  . GLN E 1 47  ? 101.000 79.954  16.523  1.00 36.79 ? 47  GLN E CB  1 
ATOM 4081  C CG  . GLN E 1 47  ? 102.066 79.573  17.542  1.00 36.85 ? 47  GLN E CG  1 
ATOM 4082  C CD  . GLN E 1 47  ? 103.386 79.158  16.912  1.00 36.98 ? 47  GLN E CD  1 
ATOM 4083  O OE1 . GLN E 1 47  ? 103.799 79.701  15.886  1.00 37.07 ? 47  GLN E OE1 1 
ATOM 4084  N NE2 . GLN E 1 47  ? 104.058 78.196  17.532  1.00 37.07 ? 47  GLN E NE2 1 
ATOM 4085  N N   . GLU E 1 48  ? 99.031  81.717  14.745  1.00 37.41 ? 48  GLU E N   1 
ATOM 4086  C CA  . GLU E 1 48  ? 98.229  81.973  13.539  1.00 37.74 ? 48  GLU E CA  1 
ATOM 4087  C C   . GLU E 1 48  ? 98.490  83.359  12.940  1.00 37.83 ? 48  GLU E C   1 
ATOM 4088  O O   . GLU E 1 48  ? 98.399  83.530  11.725  1.00 38.01 ? 48  GLU E O   1 
ATOM 4089  C CB  . GLU E 1 48  ? 96.729  81.807  13.827  1.00 38.07 ? 48  GLU E CB  1 
ATOM 4090  C CG  . GLU E 1 48  ? 96.300  80.383  14.167  1.00 38.39 ? 48  GLU E CG  1 
ATOM 4091  C CD  . GLU E 1 48  ? 96.336  79.437  12.975  1.00 38.68 ? 48  GLU E CD  1 
ATOM 4092  O OE1 . GLU E 1 48  ? 95.824  79.801  11.894  1.00 38.76 ? 48  GLU E OE1 1 
ATOM 4093  O OE2 . GLU E 1 48  ? 96.869  78.315  13.124  1.00 38.77 ? 48  GLU E OE2 1 
ATOM 4094  N N   . MET E 1 49  ? 98.800  84.342  13.787  1.00 37.94 ? 49  MET E N   1 
ATOM 4095  C CA  . MET E 1 49  ? 99.167  85.687  13.319  1.00 38.06 ? 49  MET E CA  1 
ATOM 4096  C C   . MET E 1 49  ? 100.531 85.714  12.625  1.00 37.98 ? 49  MET E C   1 
ATOM 4097  O O   . MET E 1 49  ? 100.720 86.465  11.666  1.00 38.26 ? 49  MET E O   1 
ATOM 4098  C CB  . MET E 1 49  ? 99.147  86.693  14.473  1.00 38.24 ? 49  MET E CB  1 
ATOM 4099  C CG  . MET E 1 49  ? 97.747  87.000  14.977  1.00 38.47 ? 49  MET E CG  1 
ATOM 4100  S SD  . MET E 1 49  ? 97.713  88.049  16.442  1.00 38.86 ? 49  MET E SD  1 
ATOM 4101  C CE  . MET E 1 49  ? 98.458  89.546  15.803  1.00 38.96 ? 49  MET E CE  1 
ATOM 4102  N N   . TYR E 1 50  ? 101.472 84.908  13.112  1.00 37.79 ? 50  TYR E N   1 
ATOM 4103  C CA  . TYR E 1 50  ? 102.774 84.741  12.456  1.00 37.80 ? 50  TYR E CA  1 
ATOM 4104  C C   . TYR E 1 50  ? 102.643 83.968  11.137  1.00 38.04 ? 50  TYR E C   1 
ATOM 4105  O O   . TYR E 1 50  ? 103.408 84.205  10.199  1.00 38.25 ? 50  TYR E O   1 
ATOM 4106  C CB  . TYR E 1 50  ? 103.759 84.028  13.385  1.00 37.76 ? 50  TYR E CB  1 
ATOM 4107  C CG  . TYR E 1 50  ? 105.209 84.167  12.975  1.00 37.79 ? 50  TYR E CG  1 
ATOM 4108  C CD1 . TYR E 1 50  ? 105.803 83.247  12.111  1.00 37.66 ? 50  TYR E CD1 1 
ATOM 4109  C CD2 . TYR E 1 50  ? 105.996 85.209  13.467  1.00 37.87 ? 50  TYR E CD2 1 
ATOM 4110  C CE1 . TYR E 1 50  ? 107.135 83.367  11.741  1.00 37.67 ? 50  TYR E CE1 1 
ATOM 4111  C CE2 . TYR E 1 50  ? 107.329 85.338  13.101  1.00 37.85 ? 50  TYR E CE2 1 
ATOM 4112  C CZ  . TYR E 1 50  ? 107.895 84.414  12.239  1.00 37.80 ? 50  TYR E CZ  1 
ATOM 4113  O OH  . TYR E 1 50  ? 109.215 84.537  11.871  1.00 37.98 ? 50  TYR E OH  1 
ATOM 4114  N N   . GLN E 1 51  ? 101.685 83.042  11.081  1.00 38.31 ? 51  GLN E N   1 
ATOM 4115  C CA  . GLN E 1 51  ? 101.356 82.305  9.853   1.00 38.55 ? 51  GLN E CA  1 
ATOM 4116  C C   . GLN E 1 51  ? 100.814 83.224  8.747   1.00 38.78 ? 51  GLN E C   1 
ATOM 4117  O O   . GLN E 1 51  ? 101.039 82.965  7.564   1.00 38.94 ? 51  GLN E O   1 
ATOM 4118  C CB  . GLN E 1 51  ? 100.345 81.188  10.160  1.00 38.73 ? 51  GLN E CB  1 
ATOM 4119  C CG  . GLN E 1 51  ? 100.070 80.204  9.028   1.00 38.88 ? 51  GLN E CG  1 
ATOM 4120  C CD  . GLN E 1 51  ? 101.257 79.323  8.689   1.00 38.88 ? 51  GLN E CD  1 
ATOM 4121  O OE1 . GLN E 1 51  ? 101.898 78.758  9.573   1.00 38.93 ? 51  GLN E OE1 1 
ATOM 4122  N NE2 . GLN E 1 51  ? 101.541 79.183  7.400   1.00 38.97 ? 51  GLN E NE2 1 
ATOM 4123  N N   . ILE E 1 52  ? 100.097 84.280  9.133   1.00 38.96 ? 52  ILE E N   1 
ATOM 4124  C CA  . ILE E 1 52  ? 99.619  85.297  8.183   1.00 39.19 ? 52  ILE E CA  1 
ATOM 4125  C C   . ILE E 1 52  ? 100.792 86.087  7.587   1.00 39.35 ? 52  ILE E C   1 
ATOM 4126  O O   . ILE E 1 52  ? 100.817 86.344  6.381   1.00 39.50 ? 52  ILE E O   1 
ATOM 4127  C CB  . ILE E 1 52  ? 98.591  86.258  8.840   1.00 39.24 ? 52  ILE E CB  1 
ATOM 4128  C CG1 . ILE E 1 52  ? 97.304  85.499  9.189   1.00 39.33 ? 52  ILE E CG1 1 
ATOM 4129  C CG2 . ILE E 1 52  ? 98.253  87.434  7.922   1.00 39.29 ? 52  ILE E CG2 1 
ATOM 4130  C CD1 . ILE E 1 52  ? 96.464  86.153  10.268  1.00 39.33 ? 52  ILE E CD1 1 
ATOM 4131  N N   . ASP E 1 53  ? 101.756 86.455  8.430   1.00 39.54 ? 53  ASP E N   1 
ATOM 4132  C CA  . ASP E 1 53  ? 102.901 87.266  8.004   1.00 39.77 ? 53  ASP E CA  1 
ATOM 4133  C C   . ASP E 1 53  ? 103.930 86.457  7.217   1.00 39.75 ? 53  ASP E C   1 
ATOM 4134  O O   . ASP E 1 53  ? 104.210 86.765  6.056   1.00 39.95 ? 53  ASP E O   1 
ATOM 4135  C CB  . ASP E 1 53  ? 103.579 87.917  9.216   1.00 40.03 ? 53  ASP E CB  1 
ATOM 4136  C CG  . ASP E 1 53  ? 102.670 88.894  9.948   1.00 40.34 ? 53  ASP E CG  1 
ATOM 4137  O OD1 . ASP E 1 53  ? 101.441 88.862  9.723   1.00 40.49 ? 53  ASP E OD1 1 
ATOM 4138  O OD2 . ASP E 1 53  ? 103.190 89.692  10.757  1.00 40.58 ? 53  ASP E OD2 1 
ATOM 4139  N N   . ASN E 1 54  ? 104.475 85.421  7.853   1.00 39.52 ? 54  ASN E N   1 
ATOM 4140  C CA  . ASN E 1 54  ? 105.636 84.686  7.332   1.00 39.56 ? 54  ASN E CA  1 
ATOM 4141  C C   . ASN E 1 54  ? 105.323 83.386  6.576   1.00 39.43 ? 54  ASN E C   1 
ATOM 4142  O O   . ASN E 1 54  ? 106.224 82.816  5.956   1.00 39.61 ? 54  ASN E O   1 
ATOM 4143  C CB  . ASN E 1 54  ? 106.603 84.373  8.479   1.00 39.76 ? 54  ASN E CB  1 
ATOM 4144  C CG  . ASN E 1 54  ? 107.173 85.622  9.125   1.00 39.96 ? 54  ASN E CG  1 
ATOM 4145  O OD1 . ASN E 1 54  ? 108.310 86.009  8.857   1.00 40.17 ? 54  ASN E OD1 1 
ATOM 4146  N ND2 . ASN E 1 54  ? 106.383 86.260  9.982   1.00 40.00 ? 54  ASN E ND2 1 
ATOM 4147  N N   . ASN E 1 55  ? 104.070 82.923  6.628   1.00 39.07 ? 55  ASN E N   1 
ATOM 4148  C CA  . ASN E 1 55  ? 103.655 81.632  6.044   1.00 38.83 ? 55  ASN E CA  1 
ATOM 4149  C C   . ASN E 1 55  ? 104.401 80.441  6.668   1.00 38.56 ? 55  ASN E C   1 
ATOM 4150  O O   . ASN E 1 55  ? 104.823 79.518  5.968   1.00 38.71 ? 55  ASN E O   1 
ATOM 4151  C CB  . ASN E 1 55  ? 103.800 81.634  4.511   1.00 39.00 ? 55  ASN E CB  1 
ATOM 4152  C CG  . ASN E 1 55  ? 103.166 82.852  3.859   1.00 39.27 ? 55  ASN E CG  1 
ATOM 4153  O OD1 . ASN E 1 55  ? 103.762 83.483  2.987   1.00 39.50 ? 55  ASN E OD1 1 
ATOM 4154  N ND2 . ASN E 1 55  ? 101.950 83.188  4.281   1.00 39.40 ? 55  ASN E ND2 1 
ATOM 4155  N N   . SER E 1 56  ? 104.545 80.479  7.992   1.00 38.22 ? 56  SER E N   1 
ATOM 4156  C CA  . SER E 1 56  ? 105.196 79.409  8.758   1.00 37.99 ? 56  SER E CA  1 
ATOM 4157  C C   . SER E 1 56  ? 104.857 79.541  10.244  1.00 37.53 ? 56  SER E C   1 
ATOM 4158  O O   . SER E 1 56  ? 104.154 80.472  10.642  1.00 37.69 ? 56  SER E O   1 
ATOM 4159  C CB  . SER E 1 56  ? 106.715 79.458  8.562   1.00 38.25 ? 56  SER E CB  1 
ATOM 4160  O OG  . SER E 1 56  ? 107.348 78.351  9.182   1.00 38.43 ? 56  SER E OG  1 
ATOM 4161  N N   . TYR E 1 57  ? 105.343 78.599  11.052  1.00 36.99 ? 57  TYR E N   1 
ATOM 4162  C CA  . TYR E 1 57  ? 105.185 78.646  12.510  1.00 36.72 ? 57  TYR E CA  1 
ATOM 4163  C C   . TYR E 1 57  ? 106.534 78.866  13.196  1.00 36.67 ? 57  TYR E C   1 
ATOM 4164  O O   . TYR E 1 57  ? 107.577 78.450  12.688  1.00 36.63 ? 57  TYR E O   1 
ATOM 4165  C CB  . TYR E 1 57  ? 104.526 77.364  13.023  1.00 36.60 ? 57  TYR E CB  1 
ATOM 4166  C CG  . TYR E 1 57  ? 103.064 77.238  12.649  1.00 36.53 ? 57  TYR E CG  1 
ATOM 4167  C CD1 . TYR E 1 57  ? 102.100 78.058  13.239  1.00 36.47 ? 57  TYR E CD1 1 
ATOM 4168  C CD2 . TYR E 1 57  ? 102.636 76.294  11.713  1.00 36.51 ? 57  TYR E CD2 1 
ATOM 4169  C CE1 . TYR E 1 57  ? 100.757 77.947  12.904  1.00 36.34 ? 57  TYR E CE1 1 
ATOM 4170  C CE2 . TYR E 1 57  ? 101.295 76.175  11.373  1.00 36.42 ? 57  TYR E CE2 1 
ATOM 4171  C CZ  . TYR E 1 57  ? 100.360 77.003  11.970  1.00 36.34 ? 57  TYR E CZ  1 
ATOM 4172  O OH  . TYR E 1 57  ? 99.030  76.891  11.638  1.00 36.45 ? 57  TYR E OH  1 
ATOM 4173  N N   . THR E 1 58  ? 106.491 79.516  14.358  1.00 36.59 ? 58  THR E N   1 
ATOM 4174  C CA  . THR E 1 58  ? 107.693 79.943  15.073  1.00 36.53 ? 58  THR E CA  1 
ATOM 4175  C C   . THR E 1 58  ? 108.259 78.848  15.967  1.00 36.66 ? 58  THR E C   1 
ATOM 4176  O O   . THR E 1 58  ? 107.518 78.210  16.717  1.00 36.84 ? 58  THR E O   1 
ATOM 4177  C CB  . THR E 1 58  ? 107.398 81.157  15.972  1.00 36.65 ? 58  THR E CB  1 
ATOM 4178  O OG1 . THR E 1 58  ? 106.334 80.838  16.879  1.00 36.58 ? 58  THR E OG1 1 
ATOM 4179  C CG2 . THR E 1 58  ? 106.995 82.348  15.137  1.00 36.74 ? 58  THR E CG2 1 
ATOM 4180  N N   . SER E 1 59  ? 109.574 78.650  15.888  1.00 36.78 ? 59  SER E N   1 
ATOM 4181  C CA  . SER E 1 59  ? 110.295 77.793  16.826  1.00 36.85 ? 59  SER E CA  1 
ATOM 4182  C C   . SER E 1 59  ? 110.617 78.573  18.102  1.00 36.82 ? 59  SER E C   1 
ATOM 4183  O O   . SER E 1 59  ? 110.432 78.058  19.204  1.00 36.81 ? 59  SER E O   1 
ATOM 4184  C CB  . SER E 1 59  ? 111.585 77.268  16.189  1.00 37.11 ? 59  SER E CB  1 
ATOM 4185  O OG  . SER E 1 59  ? 112.192 76.278  17.004  1.00 37.24 ? 59  SER E OG  1 
ATOM 4186  N N   . ASN E 1 60  ? 111.099 79.806  17.942  1.00 36.97 ? 60  ASN E N   1 
ATOM 4187  C CA  . ASN E 1 60  ? 111.451 80.671  19.081  1.00 37.22 ? 60  ASN E CA  1 
ATOM 4188  C C   . ASN E 1 60  ? 110.237 81.413  19.656  1.00 37.20 ? 60  ASN E C   1 
ATOM 4189  O O   . ASN E 1 60  ? 109.278 81.706  18.940  1.00 37.13 ? 60  ASN E O   1 
ATOM 4190  C CB  . ASN E 1 60  ? 112.558 81.670  18.697  1.00 37.35 ? 60  ASN E CB  1 
ATOM 4191  C CG  . ASN E 1 60  ? 112.091 82.733  17.713  1.00 37.43 ? 60  ASN E CG  1 
ATOM 4192  O OD1 . ASN E 1 60  ? 111.279 82.465  16.824  1.00 37.43 ? 60  ASN E OD1 1 
ATOM 4193  N ND2 . ASN E 1 60  ? 112.615 83.944  17.862  1.00 37.57 ? 60  ASN E ND2 1 
ATOM 4194  N N   . GLN E 1 61  ? 110.304 81.713  20.952  1.00 37.16 ? 61  GLN E N   1 
ATOM 4195  C CA  . GLN E 1 61  ? 109.236 82.423  21.662  1.00 37.02 ? 61  GLN E CA  1 
ATOM 4196  C C   . GLN E 1 61  ? 109.257 83.928  21.385  1.00 36.99 ? 61  GLN E C   1 
ATOM 4197  O O   . GLN E 1 61  ? 108.200 84.559  21.332  1.00 37.14 ? 61  GLN E O   1 
ATOM 4198  C CB  . GLN E 1 61  ? 109.346 82.176  23.170  1.00 37.12 ? 61  GLN E CB  1 
ATOM 4199  C CG  . GLN E 1 61  ? 108.104 82.566  23.963  1.00 37.21 ? 61  GLN E CG  1 
ATOM 4200  C CD  . GLN E 1 61  ? 108.301 82.466  25.464  1.00 37.24 ? 61  GLN E CD  1 
ATOM 4201  O OE1 . GLN E 1 61  ? 109.138 81.702  25.950  1.00 37.27 ? 61  GLN E OE1 1 
ATOM 4202  N NE2 . GLN E 1 61  ? 107.518 83.235  26.212  1.00 37.32 ? 61  GLN E NE2 1 
ATOM 4203  N N   . ALA E 1 62  ? 110.455 84.495  21.225  1.00 36.96 ? 62  ALA E N   1 
ATOM 4204  C CA  . ALA E 1 62  ? 110.633 85.936  20.979  1.00 36.85 ? 62  ALA E CA  1 
ATOM 4205  C C   . ALA E 1 62  ? 109.899 86.459  19.738  1.00 36.78 ? 62  ALA E C   1 
ATOM 4206  O O   . ALA E 1 62  ? 109.509 87.628  19.699  1.00 36.92 ? 62  ALA E O   1 
ATOM 4207  C CB  . ALA E 1 62  ? 112.115 86.274  20.884  1.00 36.91 ? 62  ALA E CB  1 
ATOM 4208  N N   . ALA E 1 63  ? 109.727 85.601  18.732  1.00 36.84 ? 63  ALA E N   1 
ATOM 4209  C CA  . ALA E 1 63  ? 108.937 85.931  17.542  1.00 36.91 ? 63  ALA E CA  1 
ATOM 4210  C C   . ALA E 1 63  ? 107.459 86.141  17.876  1.00 36.82 ? 63  ALA E C   1 
ATOM 4211  O O   . ALA E 1 63  ? 106.837 87.074  17.369  1.00 36.91 ? 63  ALA E O   1 
ATOM 4212  C CB  . ALA E 1 63  ? 109.089 84.849  16.483  1.00 37.01 ? 63  ALA E CB  1 
ATOM 4213  N N   . LEU E 1 64  ? 106.908 85.275  18.728  1.00 36.89 ? 64  LEU E N   1 
ATOM 4214  C CA  . LEU E 1 64  ? 105.517 85.397  19.184  1.00 37.01 ? 64  LEU E CA  1 
ATOM 4215  C C   . LEU E 1 64  ? 105.303 86.612  20.092  1.00 37.02 ? 64  LEU E C   1 
ATOM 4216  O O   . LEU E 1 64  ? 104.247 87.246  20.037  1.00 37.07 ? 64  LEU E O   1 
ATOM 4217  C CB  . LEU E 1 64  ? 105.066 84.129  19.919  1.00 37.12 ? 64  LEU E CB  1 
ATOM 4218  C CG  . LEU E 1 64  ? 105.071 82.817  19.128  1.00 37.29 ? 64  LEU E CG  1 
ATOM 4219  C CD1 . LEU E 1 64  ? 104.759 81.645  20.047  1.00 37.40 ? 64  LEU E CD1 1 
ATOM 4220  C CD2 . LEU E 1 64  ? 104.084 82.867  17.971  1.00 37.32 ? 64  LEU E CD2 1 
ATOM 4221  N N   . ILE E 1 65  ? 106.302 86.924  20.920  1.00 37.10 ? 65  ILE E N   1 
ATOM 4222  C CA  . ILE E 1 65  ? 106.239 88.073  21.834  1.00 37.16 ? 65  ILE E CA  1 
ATOM 4223  C C   . ILE E 1 65  ? 106.304 89.400  21.064  1.00 37.20 ? 65  ILE E C   1 
ATOM 4224  O O   . ILE E 1 65  ? 105.634 90.366  21.439  1.00 37.29 ? 65  ILE E O   1 
ATOM 4225  C CB  . ILE E 1 65  ? 107.353 88.014  22.915  1.00 37.23 ? 65  ILE E CB  1 
ATOM 4226  C CG1 . ILE E 1 65  ? 107.177 86.772  23.803  1.00 37.33 ? 65  ILE E CG1 1 
ATOM 4227  C CG2 . ILE E 1 65  ? 107.348 89.268  23.790  1.00 37.26 ? 65  ILE E CG2 1 
ATOM 4228  C CD1 . ILE E 1 65  ? 108.405 86.405  24.612  1.00 37.48 ? 65  ILE E CD1 1 
ATOM 4229  N N   . SER E 1 66  ? 107.103 89.440  19.998  1.00 37.26 ? 66  SER E N   1 
ATOM 4230  C CA  . SER E 1 66  ? 107.222 90.630  19.144  1.00 37.39 ? 66  SER E CA  1 
ATOM 4231  C C   . SER E 1 66  ? 105.905 91.009  18.457  1.00 37.52 ? 66  SER E C   1 
ATOM 4232  O O   . SER E 1 66  ? 105.609 92.196  18.297  1.00 37.55 ? 66  SER E O   1 
ATOM 4233  C CB  . SER E 1 66  ? 108.317 90.428  18.090  1.00 37.37 ? 66  SER E CB  1 
ATOM 4234  O OG  . SER E 1 66  ? 108.574 91.626  17.377  1.00 37.36 ? 66  SER E OG  1 
ATOM 4235  N N   . LEU E 1 67  ? 105.126 90.004  18.054  1.00 37.78 ? 67  LEU E N   1 
ATOM 4236  C CA  . LEU E 1 67  ? 103.803 90.229  17.448  1.00 38.04 ? 67  LEU E CA  1 
ATOM 4237  C C   . LEU E 1 67  ? 102.770 90.812  18.423  1.00 38.13 ? 67  LEU E C   1 
ATOM 4238  O O   . LEU E 1 67  ? 101.890 91.567  18.001  1.00 38.34 ? 67  LEU E O   1 
ATOM 4239  C CB  . LEU E 1 67  ? 103.250 88.943  16.805  1.00 38.16 ? 67  LEU E CB  1 
ATOM 4240  C CG  . LEU E 1 67  ? 103.543 88.753  15.312  1.00 38.40 ? 67  LEU E CG  1 
ATOM 4241  C CD1 . LEU E 1 67  ? 105.031 88.619  15.020  1.00 38.45 ? 67  LEU E CD1 1 
ATOM 4242  C CD2 . LEU E 1 67  ? 102.791 87.541  14.787  1.00 38.59 ? 67  LEU E CD2 1 
ATOM 4243  N N   . GLY E 1 68  ? 102.878 90.470  19.709  1.00 37.98 ? 68  GLY E N   1 
ATOM 4244  C CA  . GLY E 1 68  ? 101.921 90.939  20.720  1.00 37.88 ? 68  GLY E CA  1 
ATOM 4245  C C   . GLY E 1 68  ? 101.733 90.090  21.969  1.00 37.72 ? 68  GLY E C   1 
ATOM 4246  O O   . GLY E 1 68  ? 101.248 90.602  22.981  1.00 37.88 ? 68  GLY E O   1 
ATOM 4247  N N   . LEU E 1 69  ? 102.080 88.800  21.907  1.00 37.46 ? 69  LEU E N   1 
ATOM 4248  C CA  . LEU E 1 69  ? 101.974 87.893  23.063  1.00 37.38 ? 69  LEU E CA  1 
ATOM 4249  C C   . LEU E 1 69  ? 102.747 88.412  24.278  1.00 37.38 ? 69  LEU E C   1 
ATOM 4250  O O   . LEU E 1 69  ? 103.800 89.039  24.134  1.00 37.44 ? 69  LEU E O   1 
ATOM 4251  C CB  . LEU E 1 69  ? 102.484 86.491  22.699  1.00 37.38 ? 69  LEU E CB  1 
ATOM 4252  C CG  . LEU E 1 69  ? 102.330 85.357  23.722  1.00 37.33 ? 69  LEU E CG  1 
ATOM 4253  C CD1 . LEU E 1 69  ? 100.869 85.037  24.002  1.00 37.36 ? 69  LEU E CD1 1 
ATOM 4254  C CD2 . LEU E 1 69  ? 103.054 84.111  23.235  1.00 37.37 ? 69  LEU E CD2 1 
ATOM 4255  N N   . LYS E 1 70  ? 102.215 88.143  25.469  1.00 37.37 ? 70  LYS E N   1 
ATOM 4256  C CA  . LYS E 1 70  ? 102.842 88.568  26.722  1.00 37.30 ? 70  LYS E CA  1 
ATOM 4257  C C   . LYS E 1 70  ? 104.064 87.713  27.046  1.00 37.09 ? 70  LYS E C   1 
ATOM 4258  O O   . LYS E 1 70  ? 104.288 86.667  26.429  1.00 37.05 ? 70  LYS E O   1 
ATOM 4259  C CB  . LYS E 1 70  ? 101.845 88.486  27.883  1.00 37.51 ? 70  LYS E CB  1 
ATOM 4260  C CG  . LYS E 1 70  ? 100.628 89.385  27.733  1.00 37.82 ? 70  LYS E CG  1 
ATOM 4261  C CD  . LYS E 1 70  ? 99.788  89.384  29.002  1.00 38.07 ? 70  LYS E CD  1 
ATOM 4262  C CE  . LYS E 1 70  ? 98.583  90.306  28.885  1.00 38.26 ? 70  LYS E CE  1 
ATOM 4263  N NZ  . LYS E 1 70  ? 97.595  89.836  27.873  1.00 38.34 ? 70  LYS E NZ  1 
ATOM 4264  N N   . SER E 1 71  ? 104.850 88.168  28.020  1.00 36.84 ? 71  SER E N   1 
ATOM 4265  C CA  . SER E 1 71  ? 105.981 87.395  28.536  1.00 36.56 ? 71  SER E CA  1 
ATOM 4266  C C   . SER E 1 71  ? 105.477 86.163  29.285  1.00 36.24 ? 71  SER E C   1 
ATOM 4267  O O   . SER E 1 71  ? 104.312 86.112  29.695  1.00 36.23 ? 71  SER E O   1 
ATOM 4268  C CB  . SER E 1 71  ? 106.843 88.253  29.465  1.00 36.59 ? 71  SER E CB  1 
ATOM 4269  O OG  . SER E 1 71  ? 107.341 89.395  28.790  1.00 36.60 ? 71  SER E OG  1 
ATOM 4270  N N   . THR E 1 72  ? 106.354 85.175  29.456  1.00 35.94 ? 72  THR E N   1 
ATOM 4271  C CA  . THR E 1 72  ? 105.998 83.926  30.134  1.00 35.78 ? 72  THR E CA  1 
ATOM 4272  C C   . THR E 1 72  ? 105.525 84.223  31.565  1.00 35.65 ? 72  THR E C   1 
ATOM 4273  O O   . THR E 1 72  ? 106.170 85.013  32.261  1.00 35.81 ? 72  THR E O   1 
ATOM 4274  C CB  . THR E 1 72  ? 107.190 82.949  30.190  1.00 35.87 ? 72  THR E CB  1 
ATOM 4275  O OG1 . THR E 1 72  ? 107.774 82.825  28.887  1.00 35.93 ? 72  THR E OG1 1 
ATOM 4276  C CG2 . THR E 1 72  ? 106.747 81.570  30.675  1.00 35.94 ? 72  THR E CG2 1 
ATOM 4277  N N   . PRO E 1 73  ? 104.401 83.611  32.007  1.00 35.35 ? 73  PRO E N   1 
ATOM 4278  C CA  . PRO E 1 73  ? 103.899 83.925  33.354  1.00 35.35 ? 73  PRO E CA  1 
ATOM 4279  C C   . PRO E 1 73  ? 104.797 83.418  34.487  1.00 35.42 ? 73  PRO E C   1 
ATOM 4280  O O   . PRO E 1 73  ? 105.684 82.591  34.258  1.00 35.51 ? 73  PRO E O   1 
ATOM 4281  C CB  . PRO E 1 73  ? 102.530 83.227  33.408  1.00 35.35 ? 73  PRO E CB  1 
ATOM 4282  C CG  . PRO E 1 73  ? 102.215 82.824  32.011  1.00 35.32 ? 73  PRO E CG  1 
ATOM 4283  C CD  . PRO E 1 73  ? 103.527 82.638  31.324  1.00 35.28 ? 73  PRO E CD  1 
ATOM 4284  N N   . ALA E 1 74  ? 104.552 83.923  35.694  1.00 35.52 ? 74  ALA E N   1 
ATOM 4285  C CA  . ALA E 1 74  ? 105.347 83.563  36.869  1.00 35.57 ? 74  ALA E CA  1 
ATOM 4286  C C   . ALA E 1 74  ? 105.127 82.097  37.237  1.00 35.42 ? 74  ALA E C   1 
ATOM 4287  O O   . ALA E 1 74  ? 103.983 81.642  37.317  1.00 35.50 ? 74  ALA E O   1 
ATOM 4288  C CB  . ALA E 1 74  ? 104.998 84.462  38.046  1.00 35.68 ? 74  ALA E CB  1 
ATOM 4289  N N   . ASN E 1 75  ? 106.230 81.377  37.450  1.00 35.20 ? 75  ASN E N   1 
ATOM 4290  C CA  . ASN E 1 75  ? 106.220 79.942  37.766  1.00 35.04 ? 75  ASN E CA  1 
ATOM 4291  C C   . ASN E 1 75  ? 105.570 79.090  36.663  1.00 34.83 ? 75  ASN E C   1 
ATOM 4292  O O   . ASN E 1 75  ? 104.834 78.143  36.953  1.00 34.81 ? 75  ASN E O   1 
ATOM 4293  C CB  . ASN E 1 75  ? 105.548 79.685  39.127  1.00 35.14 ? 75  ASN E CB  1 
ATOM 4294  C CG  . ASN E 1 75  ? 106.090 80.576  40.231  1.00 35.37 ? 75  ASN E CG  1 
ATOM 4295  O OD1 . ASN E 1 75  ? 107.265 80.946  40.230  1.00 35.52 ? 75  ASN E OD1 1 
ATOM 4296  N ND2 . ASN E 1 75  ? 105.231 80.920  41.183  1.00 35.47 ? 75  ASN E ND2 1 
ATOM 4297  N N   . VAL E 1 76  ? 105.851 79.440  35.406  1.00 34.65 ? 76  VAL E N   1 
ATOM 4298  C CA  . VAL E 1 76  ? 105.372 78.698  34.232  1.00 34.49 ? 76  VAL E CA  1 
ATOM 4299  C C   . VAL E 1 76  ? 106.548 78.449  33.289  1.00 34.47 ? 76  VAL E C   1 
ATOM 4300  O O   . VAL E 1 76  ? 107.336 79.357  33.017  1.00 34.47 ? 76  VAL E O   1 
ATOM 4301  C CB  . VAL E 1 76  ? 104.254 79.464  33.485  1.00 34.35 ? 76  VAL E CB  1 
ATOM 4302  C CG1 . VAL E 1 76  ? 103.851 78.744  32.198  1.00 34.32 ? 76  VAL E CG1 1 
ATOM 4303  C CG2 . VAL E 1 76  ? 103.044 79.646  34.389  1.00 34.40 ? 76  VAL E CG2 1 
ATOM 4304  N N   . THR E 1 77  ? 106.649 77.214  32.795  1.00 34.42 ? 77  THR E N   1 
ATOM 4305  C CA  . THR E 1 77  ? 107.732 76.792  31.907  1.00 34.40 ? 77  THR E CA  1 
ATOM 4306  C C   . THR E 1 77  ? 107.199 76.529  30.500  1.00 34.33 ? 77  THR E C   1 
ATOM 4307  O O   . THR E 1 77  ? 106.971 75.382  30.108  1.00 34.35 ? 77  THR E O   1 
ATOM 4308  C CB  . THR E 1 77  ? 108.428 75.528  32.448  1.00 34.48 ? 77  THR E CB  1 
ATOM 4309  O OG1 . THR E 1 77  ? 107.453 74.506  32.684  1.00 34.42 ? 77  THR E OG1 1 
ATOM 4310  C CG2 . THR E 1 77  ? 109.157 75.837  33.747  1.00 34.60 ? 77  THR E CG2 1 
ATOM 4311  N N   . PHE E 1 78  ? 106.995 77.613  29.755  1.00 34.32 ? 78  PHE E N   1 
ATOM 4312  C CA  . PHE E 1 78  ? 106.589 77.543  28.351  1.00 34.26 ? 78  PHE E CA  1 
ATOM 4313  C C   . PHE E 1 78  ? 107.791 77.150  27.495  1.00 34.03 ? 78  PHE E C   1 
ATOM 4314  O O   . PHE E 1 78  ? 108.902 77.636  27.720  1.00 34.15 ? 78  PHE E O   1 
ATOM 4315  C CB  . PHE E 1 78  ? 106.029 78.895  27.889  1.00 34.49 ? 78  PHE E CB  1 
ATOM 4316  C CG  . PHE E 1 78  ? 105.579 78.914  26.454  1.00 34.68 ? 78  PHE E CG  1 
ATOM 4317  C CD1 . PHE E 1 78  ? 104.321 78.437  26.097  1.00 34.79 ? 78  PHE E CD1 1 
ATOM 4318  C CD2 . PHE E 1 78  ? 106.408 79.422  25.455  1.00 34.80 ? 78  PHE E CD2 1 
ATOM 4319  C CE1 . PHE E 1 78  ? 103.903 78.458  24.773  1.00 34.94 ? 78  PHE E CE1 1 
ATOM 4320  C CE2 . PHE E 1 78  ? 105.995 79.445  24.131  1.00 34.93 ? 78  PHE E CE2 1 
ATOM 4321  C CZ  . PHE E 1 78  ? 104.740 78.963  23.789  1.00 34.99 ? 78  PHE E CZ  1 
ATOM 4322  N N   . SER E 1 79  ? 107.561 76.274  26.519  1.00 33.69 ? 79  SER E N   1 
ATOM 4323  C CA  . SER E 1 79  ? 108.633 75.765  25.661  1.00 33.53 ? 79  SER E CA  1 
ATOM 4324  C C   . SER E 1 79  ? 108.072 75.137  24.385  1.00 33.30 ? 79  SER E C   1 
ATOM 4325  O O   . SER E 1 79  ? 107.383 74.117  24.442  1.00 33.36 ? 79  SER E O   1 
ATOM 4326  C CB  . SER E 1 79  ? 109.467 74.731  26.423  1.00 33.61 ? 79  SER E CB  1 
ATOM 4327  O OG  . SER E 1 79  ? 110.501 74.197  25.614  1.00 33.71 ? 79  SER E OG  1 
ATOM 4328  N N   . ILE E 1 80  ? 108.378 75.747  23.240  1.00 33.07 ? 80  ILE E N   1 
ATOM 4329  C CA  . ILE E 1 80  ? 107.944 75.234  21.940  1.00 32.89 ? 80  ILE E CA  1 
ATOM 4330  C C   . ILE E 1 80  ? 108.880 74.094  21.540  1.00 32.77 ? 80  ILE E C   1 
ATOM 4331  O O   . ILE E 1 80  ? 110.094 74.287  21.454  1.00 32.79 ? 80  ILE E O   1 
ATOM 4332  C CB  . ILE E 1 80  ? 107.948 76.333  20.850  1.00 32.91 ? 80  ILE E CB  1 
ATOM 4333  C CG1 . ILE E 1 80  ? 107.009 77.485  21.241  1.00 32.96 ? 80  ILE E CG1 1 
ATOM 4334  C CG2 . ILE E 1 80  ? 107.546 75.750  19.494  1.00 32.94 ? 80  ILE E CG2 1 
ATOM 4335  C CD1 . ILE E 1 80  ? 107.177 78.743  20.415  1.00 33.00 ? 80  ILE E CD1 1 
ATOM 4336  N N   . VAL E 1 81  ? 108.306 72.914  21.302  1.00 32.73 ? 81  VAL E N   1 
ATOM 4337  C CA  . VAL E 1 81  ? 109.073 71.717  20.948  1.00 32.76 ? 81  VAL E CA  1 
ATOM 4338  C C   . VAL E 1 81  ? 109.605 71.838  19.525  1.00 32.87 ? 81  VAL E C   1 
ATOM 4339  O O   . VAL E 1 81  ? 110.815 71.771  19.296  1.00 32.99 ? 81  VAL E O   1 
ATOM 4340  C CB  . VAL E 1 81  ? 108.213 70.436  21.081  1.00 32.81 ? 81  VAL E CB  1 
ATOM 4341  C CG1 . VAL E 1 81  ? 108.920 69.215  20.493  1.00 32.88 ? 81  VAL E CG1 1 
ATOM 4342  C CG2 . VAL E 1 81  ? 107.855 70.191  22.541  1.00 32.82 ? 81  VAL E CG2 1 
ATOM 4343  N N   . SER E 1 82  ? 108.686 72.008  18.579  1.00 32.95 ? 82  SER E N   1 
ATOM 4344  C CA  . SER E 1 82  ? 109.024 72.123  17.161  1.00 33.10 ? 82  SER E CA  1 
ATOM 4345  C C   . SER E 1 82  ? 107.937 72.878  16.406  1.00 33.16 ? 82  SER E C   1 
ATOM 4346  O O   . SER E 1 82  ? 106.799 72.976  16.871  1.00 33.23 ? 82  SER E O   1 
ATOM 4347  C CB  . SER E 1 82  ? 109.224 70.736  16.548  1.00 33.14 ? 82  SER E CB  1 
ATOM 4348  O OG  . SER E 1 82  ? 108.077 69.922  16.734  1.00 33.18 ? 82  SER E OG  1 
ATOM 4349  N N   . ALA E 1 83  ? 108.303 73.407  15.242  1.00 33.30 ? 83  ALA E N   1 
ATOM 4350  C CA  . ALA E 1 83  ? 107.385 74.189  14.417  1.00 33.46 ? 83  ALA E CA  1 
ATOM 4351  C C   . ALA E 1 83  ? 107.789 74.146  12.947  1.00 33.71 ? 83  ALA E C   1 
ATOM 4352  O O   . ALA E 1 83  ? 108.631 74.927  12.499  1.00 33.85 ? 83  ALA E O   1 
ATOM 4353  C CB  . ALA E 1 83  ? 107.328 75.625  14.915  1.00 33.47 ? 83  ALA E CB  1 
ATOM 4354  N N   . SER E 1 84  ? 107.181 73.221  12.206  1.00 34.04 ? 84  SER E N   1 
ATOM 4355  C CA  . SER E 1 84  ? 107.363 73.126  10.758  1.00 34.33 ? 84  SER E CA  1 
ATOM 4356  C C   . SER E 1 84  ? 106.519 74.191  10.053  1.00 34.53 ? 84  SER E C   1 
ATOM 4357  O O   . SER E 1 84  ? 105.825 74.974  10.706  1.00 34.55 ? 84  SER E O   1 
ATOM 4358  C CB  . SER E 1 84  ? 106.987 71.722  10.267  1.00 34.48 ? 84  SER E CB  1 
ATOM 4359  O OG  . SER E 1 84  ? 105.600 71.471  10.422  1.00 34.54 ? 84  SER E OG  1 
ATOM 4360  N N   . ALA E 1 85  ? 106.589 74.221  8.724   1.00 35.05 ? 85  ALA E N   1 
ATOM 4361  C CA  . ALA E 1 85  ? 105.828 75.182  7.919   1.00 35.50 ? 85  ALA E CA  1 
ATOM 4362  C C   . ALA E 1 85  ? 104.312 75.106  8.139   1.00 35.79 ? 85  ALA E C   1 
ATOM 4363  O O   . ALA E 1 85  ? 103.644 76.141  8.177   1.00 35.91 ? 85  ALA E O   1 
ATOM 4364  C CB  . ALA E 1 85  ? 106.149 75.000  6.441   1.00 35.61 ? 85  ALA E CB  1 
ATOM 4365  N N   . ASN E 1 86  ? 103.785 73.888  8.284   1.00 36.15 ? 86  ASN E N   1 
ATOM 4366  C CA  . ASN E 1 86  ? 102.338 73.656  8.412   1.00 36.49 ? 86  ASN E CA  1 
ATOM 4367  C C   . ASN E 1 86  ? 101.930 72.907  9.696   1.00 36.55 ? 86  ASN E C   1 
ATOM 4368  O O   . ASN E 1 86  ? 100.886 72.249  9.721   1.00 36.63 ? 86  ASN E O   1 
ATOM 4369  C CB  . ASN E 1 86  ? 101.831 72.898  7.177   1.00 36.84 ? 86  ASN E CB  1 
ATOM 4370  C CG  . ASN E 1 86  ? 102.134 73.623  5.877   1.00 37.16 ? 86  ASN E CG  1 
ATOM 4371  O OD1 . ASN E 1 86  ? 103.294 73.796  5.506   1.00 37.25 ? 86  ASN E OD1 1 
ATOM 4372  N ND2 . ASN E 1 86  ? 101.087 74.041  5.173   1.00 37.45 ? 86  ASN E ND2 1 
ATOM 4373  N N   . SER E 1 87  ? 102.736 73.014  10.755  1.00 36.55 ? 87  SER E N   1 
ATOM 4374  C CA  . SER E 1 87  ? 102.394 72.422  12.058  1.00 36.52 ? 87  SER E CA  1 
ATOM 4375  C C   . SER E 1 87  ? 103.205 73.028  13.204  1.00 36.58 ? 87  SER E C   1 
ATOM 4376  O O   . SER E 1 87  ? 104.158 73.779  12.978  1.00 36.60 ? 87  SER E O   1 
ATOM 4377  C CB  . SER E 1 87  ? 102.609 70.903  12.033  1.00 36.53 ? 87  SER E CB  1 
ATOM 4378  O OG  . SER E 1 87  ? 102.125 70.299  13.221  1.00 36.60 ? 87  SER E OG  1 
ATOM 4379  N N   . TYR E 1 88  ? 102.810 72.693  14.432  1.00 36.69 ? 88  TYR E N   1 
ATOM 4380  C CA  . TYR E 1 88  ? 103.548 73.093  15.636  1.00 36.75 ? 88  TYR E CA  1 
ATOM 4381  C C   . TYR E 1 88  ? 103.223 72.211  16.842  1.00 37.06 ? 88  TYR E C   1 
ATOM 4382  O O   . TYR E 1 88  ? 102.216 71.499  16.853  1.00 37.14 ? 88  TYR E O   1 
ATOM 4383  C CB  . TYR E 1 88  ? 103.285 74.566  15.976  1.00 36.59 ? 88  TYR E CB  1 
ATOM 4384  C CG  . TYR E 1 88  ? 101.834 74.907  16.249  1.00 36.51 ? 88  TYR E CG  1 
ATOM 4385  C CD1 . TYR E 1 88  ? 101.297 74.790  17.532  1.00 36.43 ? 88  TYR E CD1 1 
ATOM 4386  C CD2 . TYR E 1 88  ? 100.999 75.362  15.228  1.00 36.53 ? 88  TYR E CD2 1 
ATOM 4387  C CE1 . TYR E 1 88  ? 99.970  75.103  17.788  1.00 36.37 ? 88  TYR E CE1 1 
ATOM 4388  C CE2 . TYR E 1 88  ? 99.670  75.679  15.475  1.00 36.49 ? 88  TYR E CE2 1 
ATOM 4389  C CZ  . TYR E 1 88  ? 99.159  75.549  16.756  1.00 36.40 ? 88  TYR E CZ  1 
ATOM 4390  O OH  . TYR E 1 88  ? 97.844  75.861  17.005  1.00 36.43 ? 88  TYR E OH  1 
ATOM 4391  N N   . CYS E 1 89  ? 104.094 72.271  17.847  1.00 37.62 ? 89  CYS E N   1 
ATOM 4392  C CA  . CYS E 1 89  ? 103.913 71.554  19.113  1.00 38.04 ? 89  CYS E CA  1 
ATOM 4393  C C   . CYS E 1 89  ? 104.483 72.402  20.250  1.00 37.48 ? 89  CYS E C   1 
ATOM 4394  O O   . CYS E 1 89  ? 105.679 72.698  20.261  1.00 37.51 ? 89  CYS E O   1 
ATOM 4395  C CB  . CYS E 1 89  ? 104.613 70.194  19.061  1.00 39.02 ? 89  CYS E CB  1 
ATOM 4396  S SG  . CYS E 1 89  ? 104.495 69.225  20.585  1.00 40.38 ? 89  CYS E SG  1 
ATOM 4397  N N   . MET E 1 90  ? 103.623 72.784  21.196  1.00 36.81 ? 90  MET E N   1 
ATOM 4398  C CA  . MET E 1 90  ? 103.997 73.666  22.303  1.00 36.33 ? 90  MET E CA  1 
ATOM 4399  C C   . MET E 1 90  ? 103.572 73.058  23.640  1.00 35.96 ? 90  MET E C   1 
ATOM 4400  O O   . MET E 1 90  ? 102.379 72.966  23.938  1.00 35.94 ? 90  MET E O   1 
ATOM 4401  C CB  . MET E 1 90  ? 103.351 75.046  22.127  1.00 36.33 ? 90  MET E CB  1 
ATOM 4402  C CG  . MET E 1 90  ? 103.568 75.671  20.757  1.00 36.32 ? 90  MET E CG  1 
ATOM 4403  S SD  . MET E 1 90  ? 103.060 77.399  20.682  1.00 36.31 ? 90  MET E SD  1 
ATOM 4404  C CE  . MET E 1 90  ? 101.296 77.254  20.951  1.00 36.30 ? 90  MET E CE  1 
ATOM 4405  N N   . ILE E 1 91  ? 104.559 72.635  24.433  1.00 35.57 ? 91  ILE E N   1 
ATOM 4406  C CA  . ILE E 1 91  ? 104.330 72.121  25.784  1.00 35.27 ? 91  ILE E CA  1 
ATOM 4407  C C   . ILE E 1 91  ? 104.483 73.267  26.786  1.00 34.97 ? 91  ILE E C   1 
ATOM 4408  O O   . ILE E 1 91  ? 105.364 74.117  26.638  1.00 35.06 ? 91  ILE E O   1 
ATOM 4409  C CB  . ILE E 1 91  ? 105.330 70.994  26.141  1.00 35.34 ? 91  ILE E CB  1 
ATOM 4410  C CG1 . ILE E 1 91  ? 105.300 69.869  25.090  1.00 35.48 ? 91  ILE E CG1 1 
ATOM 4411  C CG2 . ILE E 1 91  ? 105.058 70.443  27.541  1.00 35.37 ? 91  ILE E CG2 1 
ATOM 4412  C CD1 . ILE E 1 91  ? 103.966 69.162  24.938  1.00 35.54 ? 91  ILE E CD1 1 
ATOM 4413  N N   . ALA E 1 92  ? 103.619 73.283  27.799  1.00 34.64 ? 92  ALA E N   1 
ATOM 4414  C CA  . ALA E 1 92  ? 103.689 74.271  28.879  1.00 34.42 ? 92  ALA E CA  1 
ATOM 4415  C C   . ALA E 1 92  ? 103.030 73.738  30.149  1.00 34.21 ? 92  ALA E C   1 
ATOM 4416  O O   . ALA E 1 92  ? 102.102 72.927  30.084  1.00 34.13 ? 92  ALA E O   1 
ATOM 4417  C CB  . ALA E 1 92  ? 103.033 75.575  28.449  1.00 34.49 ? 92  ALA E CB  1 
ATOM 4418  N N   . GLY E 1 93  ? 103.516 74.203  31.297  1.00 34.02 ? 93  GLY E N   1 
ATOM 4419  C CA  . GLY E 1 93  ? 103.013 73.754  32.594  1.00 33.89 ? 93  GLY E CA  1 
ATOM 4420  C C   . GLY E 1 93  ? 103.444 74.640  33.748  1.00 33.77 ? 93  GLY E C   1 
ATOM 4421  O O   . GLY E 1 93  ? 104.490 75.290  33.686  1.00 33.83 ? 93  GLY E O   1 
ATOM 4422  N N   . HIS E 1 94  ? 102.629 74.651  34.800  1.00 33.62 ? 94  HIS E N   1 
ATOM 4423  C CA  . HIS E 1 94  ? 102.909 75.409  36.018  1.00 33.49 ? 94  HIS E CA  1 
ATOM 4424  C C   . HIS E 1 94  ? 103.664 74.499  36.988  1.00 33.50 ? 94  HIS E C   1 
ATOM 4425  O O   . HIS E 1 94  ? 103.484 73.279  36.964  1.00 33.61 ? 94  HIS E O   1 
ATOM 4426  C CB  . HIS E 1 94  ? 101.598 75.897  36.646  1.00 33.42 ? 94  HIS E CB  1 
ATOM 4427  C CG  . HIS E 1 94  ? 101.734 77.159  37.440  1.00 33.39 ? 94  HIS E CG  1 
ATOM 4428  N ND1 . HIS E 1 94  ? 101.377 78.394  36.944  1.00 33.41 ? 94  HIS E ND1 1 
ATOM 4429  C CD2 . HIS E 1 94  ? 102.214 77.379  38.687  1.00 33.38 ? 94  HIS E CD2 1 
ATOM 4430  C CE1 . HIS E 1 94  ? 101.619 79.319  37.856  1.00 33.44 ? 94  HIS E CE1 1 
ATOM 4431  N NE2 . HIS E 1 94  ? 102.125 78.728  38.924  1.00 33.41 ? 94  HIS E NE2 1 
ATOM 4432  N N   . SER E 1 95  ? 104.504 75.092  37.834  1.00 33.42 ? 95  SER E N   1 
ATOM 4433  C CA  . SER E 1 95  ? 105.323 74.327  38.784  1.00 33.30 ? 95  SER E CA  1 
ATOM 4434  C C   . SER E 1 95  ? 104.467 73.629  39.840  1.00 33.15 ? 95  SER E C   1 
ATOM 4435  O O   . SER E 1 95  ? 104.692 72.457  40.148  1.00 33.23 ? 95  SER E O   1 
ATOM 4436  C CB  . SER E 1 95  ? 106.362 75.227  39.458  1.00 33.39 ? 95  SER E CB  1 
ATOM 4437  O OG  . SER E 1 95  ? 105.742 76.263  40.196  1.00 33.47 ? 95  SER E OG  1 
ATOM 4438  N N   . GLY E 1 96  ? 103.494 74.361  40.388  1.00 32.96 ? 96  GLY E N   1 
ATOM 4439  C CA  . GLY E 1 96  ? 102.491 73.802  41.302  1.00 32.84 ? 96  GLY E CA  1 
ATOM 4440  C C   . GLY E 1 96  ? 101.134 73.635  40.644  1.00 32.59 ? 96  GLY E C   1 
ATOM 4441  O O   . GLY E 1 96  ? 100.118 74.078  41.188  1.00 32.56 ? 96  GLY E O   1 
ATOM 4442  N N   . GLY E 1 97  ? 101.122 72.996  39.474  1.00 32.33 ? 97  GLY E N   1 
ATOM 4443  C CA  . GLY E 1 97  ? 99.892  72.677  38.748  1.00 32.11 ? 97  GLY E CA  1 
ATOM 4444  C C   . GLY E 1 97  ? 99.520  71.218  38.938  1.00 31.91 ? 97  GLY E C   1 
ATOM 4445  O O   . GLY E 1 97  ? 99.871  70.610  39.953  1.00 31.98 ? 97  GLY E O   1 
ATOM 4446  N N   . THR E 1 98  ? 98.810  70.665  37.956  1.00 31.56 ? 98  THR E N   1 
ATOM 4447  C CA  . THR E 1 98  ? 98.397  69.260  37.966  1.00 31.30 ? 98  THR E CA  1 
ATOM 4448  C C   . THR E 1 98  ? 99.215  68.443  36.970  1.00 31.00 ? 98  THR E C   1 
ATOM 4449  O O   . THR E 1 98  ? 99.894  67.487  37.354  1.00 31.05 ? 98  THR E O   1 
ATOM 4450  C CB  . THR E 1 98  ? 96.901  69.117  37.628  1.00 31.35 ? 98  THR E CB  1 
ATOM 4451  O OG1 . THR E 1 98  ? 96.632  69.723  36.357  1.00 31.30 ? 98  THR E OG1 1 
ATOM 4452  C CG2 . THR E 1 98  ? 96.051  69.783  38.700  1.00 31.42 ? 98  THR E CG2 1 
ATOM 4453  N N   . VAL E 1 99  ? 99.141  68.829  35.697  1.00 30.61 ? 99  VAL E N   1 
ATOM 4454  C CA  . VAL E 1 99  ? 99.843  68.142  34.606  1.00 30.35 ? 99  VAL E CA  1 
ATOM 4455  C C   . VAL E 1 99  ? 100.318 69.132  33.542  1.00 30.06 ? 99  VAL E C   1 
ATOM 4456  O O   . VAL E 1 99  ? 99.910  70.296  33.536  1.00 30.16 ? 99  VAL E O   1 
ATOM 4457  C CB  . VAL E 1 99  ? 98.946  67.069  33.935  1.00 30.45 ? 99  VAL E CB  1 
ATOM 4458  C CG1 . VAL E 1 99  ? 98.817  65.840  34.824  1.00 30.52 ? 99  VAL E CG1 1 
ATOM 4459  C CG2 . VAL E 1 99  ? 97.568  67.628  33.592  1.00 30.52 ? 99  VAL E CG2 1 
ATOM 4460  N N   . TRP E 1 100 ? 101.183 68.657  32.648  1.00 29.73 ? 100 TRP E N   1 
ATOM 4461  C CA  . TRP E 1 100 ? 101.643 69.449  31.505  1.00 29.57 ? 100 TRP E CA  1 
ATOM 4462  C C   . TRP E 1 100 ? 100.531 69.567  30.466  1.00 29.76 ? 100 TRP E C   1 
ATOM 4463  O O   . TRP E 1 100 ? 99.731  68.644  30.296  1.00 29.91 ? 100 TRP E O   1 
ATOM 4464  C CB  . TRP E 1 100 ? 102.877 68.815  30.860  1.00 29.37 ? 100 TRP E CB  1 
ATOM 4465  C CG  . TRP E 1 100 ? 104.090 68.831  31.731  1.00 29.17 ? 100 TRP E CG  1 
ATOM 4466  C CD1 . TRP E 1 100 ? 104.452 67.890  32.649  1.00 29.08 ? 100 TRP E CD1 1 
ATOM 4467  C CD2 . TRP E 1 100 ? 105.108 69.836  31.761  1.00 28.95 ? 100 TRP E CD2 1 
ATOM 4468  N NE1 . TRP E 1 100 ? 105.633 68.248  33.254  1.00 28.98 ? 100 TRP E NE1 1 
ATOM 4469  C CE2 . TRP E 1 100 ? 106.058 69.438  32.728  1.00 28.90 ? 100 TRP E CE2 1 
ATOM 4470  C CE3 . TRP E 1 100 ? 105.310 71.036  31.067  1.00 28.91 ? 100 TRP E CE3 1 
ATOM 4471  C CZ2 . TRP E 1 100 ? 107.196 70.198  33.019  1.00 28.93 ? 100 TRP E CZ2 1 
ATOM 4472  C CZ3 . TRP E 1 100 ? 106.442 71.793  31.356  1.00 28.95 ? 100 TRP E CZ3 1 
ATOM 4473  C CH2 . TRP E 1 100 ? 107.370 71.368  32.326  1.00 28.96 ? 100 TRP E CH2 1 
ATOM 4474  N N   . PHE E 1 101 ? 100.494 70.707  29.778  1.00 29.96 ? 101 PHE E N   1 
ATOM 4475  C CA  . PHE E 1 101 ? 99.505  70.980  28.737  1.00 30.13 ? 101 PHE E CA  1 
ATOM 4476  C C   . PHE E 1 101 ? 100.205 71.128  27.391  1.00 30.19 ? 101 PHE E C   1 
ATOM 4477  O O   . PHE E 1 101 ? 101.129 71.932  27.260  1.00 30.31 ? 101 PHE E O   1 
ATOM 4478  C CB  . PHE E 1 101 ? 98.743  72.269  29.048  1.00 30.32 ? 101 PHE E CB  1 
ATOM 4479  C CG  . PHE E 1 101 ? 97.759  72.146  30.180  1.00 30.39 ? 101 PHE E CG  1 
ATOM 4480  C CD1 . PHE E 1 101 ? 98.196  72.089  31.500  1.00 30.53 ? 101 PHE E CD1 1 
ATOM 4481  C CD2 . PHE E 1 101 ? 96.388  72.114  29.930  1.00 30.42 ? 101 PHE E CD2 1 
ATOM 4482  C CE1 . PHE E 1 101 ? 97.290  71.984  32.546  1.00 30.59 ? 101 PHE E CE1 1 
ATOM 4483  C CE2 . PHE E 1 101 ? 95.478  72.011  30.971  1.00 30.54 ? 101 PHE E CE2 1 
ATOM 4484  C CZ  . PHE E 1 101 ? 95.929  71.945  32.281  1.00 30.60 ? 101 PHE E CZ  1 
ATOM 4485  N N   . ALA E 1 102 ? 99.763  70.349  26.404  1.00 30.37 ? 102 ALA E N   1 
ATOM 4486  C CA  . ALA E 1 102 ? 100.259 70.453  25.030  1.00 30.57 ? 102 ALA E CA  1 
ATOM 4487  C C   . ALA E 1 102 ? 99.404  71.433  24.233  1.00 30.78 ? 102 ALA E C   1 
ATOM 4488  O O   . ALA E 1 102 ? 98.360  71.889  24.708  1.00 30.81 ? 102 ALA E O   1 
ATOM 4489  C CB  . ALA E 1 102 ? 100.254 69.087  24.365  1.00 30.60 ? 102 ALA E CB  1 
ATOM 4490  N N   . ALA E 1 103 ? 99.857  71.755  23.023  1.00 31.11 ? 103 ALA E N   1 
ATOM 4491  C CA  . ALA E 1 103 ? 99.138  72.678  22.141  1.00 31.41 ? 103 ALA E CA  1 
ATOM 4492  C C   . ALA E 1 103 ? 99.562  72.507  20.680  1.00 31.72 ? 103 ALA E C   1 
ATOM 4493  O O   . ALA E 1 103 ? 100.622 72.989  20.273  1.00 31.76 ? 103 ALA E O   1 
ATOM 4494  C CB  . ALA E 1 103 ? 99.350  74.115  22.596  1.00 31.43 ? 103 ALA E CB  1 
ATOM 4495  N N   . THR E 1 104 ? 98.725  71.808  19.912  1.00 32.08 ? 104 THR E N   1 
ATOM 4496  C CA  . THR E 1 104 ? 98.939  71.566  18.483  1.00 32.34 ? 104 THR E CA  1 
ATOM 4497  C C   . THR E 1 104 ? 97.754  72.150  17.707  1.00 32.69 ? 104 THR E C   1 
ATOM 4498  O O   . THR E 1 104 ? 96.713  72.431  18.309  1.00 32.83 ? 104 THR E O   1 
ATOM 4499  C CB  . THR E 1 104 ? 99.056  70.051  18.194  1.00 32.41 ? 104 THR E CB  1 
ATOM 4500  O OG1 . THR E 1 104 ? 97.766  69.433  18.271  1.00 32.45 ? 104 THR E OG1 1 
ATOM 4501  C CG2 . THR E 1 104 ? 99.991  69.380  19.188  1.00 32.50 ? 104 THR E CG2 1 
ATOM 4502  N N   . PRO E 1 105 ? 97.898  72.341  16.376  1.00 33.13 ? 105 PRO E N   1 
ATOM 4503  C CA  . PRO E 1 105 ? 96.775  72.911  15.616  1.00 33.45 ? 105 PRO E CA  1 
ATOM 4504  C C   . PRO E 1 105 ? 95.588  71.956  15.433  1.00 33.95 ? 105 PRO E C   1 
ATOM 4505  O O   . PRO E 1 105 ? 94.441  72.396  15.533  1.00 34.10 ? 105 PRO E O   1 
ATOM 4506  C CB  . PRO E 1 105 ? 97.394  73.292  14.263  1.00 33.34 ? 105 PRO E CB  1 
ATOM 4507  C CG  . PRO E 1 105 ? 98.706  72.602  14.184  1.00 33.31 ? 105 PRO E CG  1 
ATOM 4508  C CD  . PRO E 1 105 ? 99.055  72.021  15.520  1.00 33.23 ? 105 PRO E CD  1 
ATOM 4509  N N   . ASP E 1 106 ? 95.862  70.676  15.175  1.00 34.61 ? 106 ASP E N   1 
ATOM 4510  C CA  . ASP E 1 106 ? 94.797  69.686  14.944  1.00 35.22 ? 106 ASP E CA  1 
ATOM 4511  C C   . ASP E 1 106 ? 94.002  69.320  16.207  1.00 35.56 ? 106 ASP E C   1 
ATOM 4512  O O   . ASP E 1 106 ? 92.775  69.212  16.149  1.00 35.76 ? 106 ASP E O   1 
ATOM 4513  C CB  . ASP E 1 106 ? 95.339  68.421  14.249  1.00 35.53 ? 106 ASP E CB  1 
ATOM 4514  C CG  . ASP E 1 106 ? 96.302  67.619  15.117  1.00 35.77 ? 106 ASP E CG  1 
ATOM 4515  O OD1 . ASP E 1 106 ? 97.037  68.226  15.926  1.00 35.93 ? 106 ASP E OD1 1 
ATOM 4516  O OD2 . ASP E 1 106 ? 96.326  66.377  14.982  1.00 35.86 ? 106 ASP E OD2 1 
ATOM 4517  N N   . LYS E 1 107 ? 94.695  69.143  17.332  1.00 35.96 ? 107 LYS E N   1 
ATOM 4518  C CA  . LYS E 1 107 ? 94.059  68.756  18.601  1.00 36.36 ? 107 LYS E CA  1 
ATOM 4519  C C   . LYS E 1 107 ? 93.714  69.940  19.513  1.00 36.64 ? 107 LYS E C   1 
ATOM 4520  O O   . LYS E 1 107 ? 92.979  69.769  20.488  1.00 36.62 ? 107 LYS E O   1 
ATOM 4521  C CB  . LYS E 1 107 ? 94.950  67.772  19.365  1.00 36.45 ? 107 LYS E CB  1 
ATOM 4522  C CG  . LYS E 1 107 ? 95.190  66.459  18.636  1.00 36.66 ? 107 LYS E CG  1 
ATOM 4523  C CD  . LYS E 1 107 ? 96.125  65.540  19.407  1.00 36.88 ? 107 LYS E CD  1 
ATOM 4524  C CE  . LYS E 1 107 ? 95.439  64.895  20.601  1.00 37.03 ? 107 LYS E CE  1 
ATOM 4525  N NZ  . LYS E 1 107 ? 96.324  63.915  21.290  1.00 37.12 ? 107 LYS E NZ  1 
ATOM 4526  N N   . GLY E 1 108 ? 94.238  71.128  19.203  1.00 37.06 ? 108 GLY E N   1 
ATOM 4527  C CA  . GLY E 1 108 ? 94.041  72.312  20.042  1.00 37.38 ? 108 GLY E CA  1 
ATOM 4528  C C   . GLY E 1 108 ? 94.888  72.243  21.298  1.00 37.66 ? 108 GLY E C   1 
ATOM 4529  O O   . GLY E 1 108 ? 95.905  71.549  21.325  1.00 37.75 ? 108 GLY E O   1 
ATOM 4530  N N   . VAL E 1 109 ? 94.466  72.969  22.332  1.00 38.04 ? 109 VAL E N   1 
ATOM 4531  C CA  . VAL E 1 109 ? 95.137  72.954  23.634  1.00 38.33 ? 109 VAL E CA  1 
ATOM 4532  C C   . VAL E 1 109 ? 94.502  71.862  24.497  1.00 38.62 ? 109 VAL E C   1 
ATOM 4533  O O   . VAL E 1 109 ? 93.312  71.934  24.808  1.00 38.77 ? 109 VAL E O   1 
ATOM 4534  C CB  . VAL E 1 109 ? 95.028  74.319  24.350  1.00 38.50 ? 109 VAL E CB  1 
ATOM 4535  C CG1 . VAL E 1 109 ? 95.746  74.288  25.698  1.00 38.57 ? 109 VAL E CG1 1 
ATOM 4536  C CG2 . VAL E 1 109 ? 95.585  75.431  23.465  1.00 38.56 ? 109 VAL E CG2 1 
ATOM 4537  N N   . TYR E 1 110 ? 95.299  70.859  24.869  1.00 38.99 ? 110 TYR E N   1 
ATOM 4538  C CA  . TYR E 1 110 ? 94.842  69.746  25.710  1.00 39.35 ? 110 TYR E CA  1 
ATOM 4539  C C   . TYR E 1 110 ? 95.884  69.387  26.766  1.00 39.82 ? 110 TYR E C   1 
ATOM 4540  O O   . TYR E 1 110 ? 97.030  69.840  26.695  1.00 40.04 ? 110 TYR E O   1 
ATOM 4541  C CB  . TYR E 1 110 ? 94.515  68.518  24.850  1.00 39.25 ? 110 TYR E CB  1 
ATOM 4542  C CG  . TYR E 1 110 ? 95.691  67.961  24.074  1.00 39.14 ? 110 TYR E CG  1 
ATOM 4543  C CD1 . TYR E 1 110 ? 96.054  68.499  22.840  1.00 39.13 ? 110 TYR E CD1 1 
ATOM 4544  C CD2 . TYR E 1 110 ? 96.434  66.887  24.567  1.00 39.09 ? 110 TYR E CD2 1 
ATOM 4545  C CE1 . TYR E 1 110 ? 97.127  67.992  22.123  1.00 39.07 ? 110 TYR E CE1 1 
ATOM 4546  C CE2 . TYR E 1 110 ? 97.510  66.372  23.857  1.00 39.10 ? 110 TYR E CE2 1 
ATOM 4547  C CZ  . TYR E 1 110 ? 97.852  66.928  22.635  1.00 39.11 ? 110 TYR E CZ  1 
ATOM 4548  O OH  . TYR E 1 110 ? 98.916  66.424  21.925  1.00 39.19 ? 110 TYR E OH  1 
ATOM 4549  N N   . LYS E 1 111 ? 95.475  68.564  27.731  1.00 40.42 ? 111 LYS E N   1 
ATOM 4550  C CA  . LYS E 1 111 ? 96.341  68.151  28.842  1.00 41.05 ? 111 LYS E CA  1 
ATOM 4551  C C   . LYS E 1 111 ? 96.809  66.706  28.675  1.00 41.38 ? 111 LYS E C   1 
ATOM 4552  O O   . LYS E 1 111 ? 96.040  65.845  28.241  1.00 41.54 ? 111 LYS E O   1 
ATOM 4553  C CB  . LYS E 1 111 ? 95.643  68.349  30.197  1.00 41.42 ? 111 LYS E CB  1 
ATOM 4554  C CG  . LYS E 1 111 ? 94.423  67.477  30.470  1.00 41.67 ? 111 LYS E CG  1 
ATOM 4555  C CD  . LYS E 1 111 ? 93.824  67.810  31.825  1.00 41.99 ? 111 LYS E CD  1 
ATOM 4556  C CE  . LYS E 1 111 ? 92.595  66.961  32.119  1.00 42.27 ? 111 LYS E CE  1 
ATOM 4557  N NZ  . LYS E 1 111 ? 91.986  67.264  33.446  1.00 42.33 ? 111 LYS E NZ  1 
ATOM 4558  N N   . THR E 1 112 ? 98.070  66.456  29.031  1.00 41.76 ? 112 THR E N   1 
ATOM 4559  C CA  . THR E 1 112 ? 98.692  65.132  28.896  1.00 42.19 ? 112 THR E CA  1 
ATOM 4560  C C   . THR E 1 112 ? 98.756  64.402  30.240  1.00 42.42 ? 112 THR E C   1 
ATOM 4561  O O   . THR E 1 112 ? 98.466  64.980  31.290  1.00 42.41 ? 112 THR E O   1 
ATOM 4562  C CB  . THR E 1 112 ? 100.103 65.224  28.254  1.00 42.41 ? 112 THR E CB  1 
ATOM 4563  O OG1 . THR E 1 112 ? 100.621 63.905  28.029  1.00 42.63 ? 112 THR E OG1 1 
ATOM 4564  C CG2 . THR E 1 112 ? 101.098 66.029  29.116  1.00 42.32 ? 112 THR E CG2 1 
ATOM 4565  N N   . ASN E 1 113 ? 99.143  63.128  30.189  1.00 42.76 ? 113 ASN E N   1 
ATOM 4566  C CA  . ASN E 1 113 ? 99.242  62.284  31.386  1.00 43.05 ? 113 ASN E CA  1 
ATOM 4567  C C   . ASN E 1 113 ? 100.465 62.588  32.263  1.00 43.07 ? 113 ASN E C   1 
ATOM 4568  O O   . ASN E 1 113 ? 100.483 62.209  33.437  1.00 43.14 ? 113 ASN E O   1 
ATOM 4569  C CB  . ASN E 1 113 ? 99.255  60.800  30.996  1.00 43.32 ? 113 ASN E CB  1 
ATOM 4570  C CG  . ASN E 1 113 ? 97.967  60.358  30.321  1.00 43.69 ? 113 ASN E CG  1 
ATOM 4571  O OD1 . ASN E 1 113 ? 97.132  61.179  29.937  1.00 43.88 ? 113 ASN E OD1 1 
ATOM 4572  N ND2 . ASN E 1 113 ? 97.803  59.048  30.170  1.00 43.95 ? 113 ASN E ND2 1 
ATOM 4573  N N   . THR E 1 114 ? 101.476 63.254  31.700  1.00 42.95 ? 114 THR E N   1 
ATOM 4574  C CA  . THR E 1 114 ? 102.707 63.575  32.428  1.00 42.92 ? 114 THR E CA  1 
ATOM 4575  C C   . THR E 1 114 ? 102.453 64.616  33.521  1.00 42.75 ? 114 THR E C   1 
ATOM 4576  O O   . THR E 1 114 ? 101.783 65.621  33.281  1.00 42.67 ? 114 THR E O   1 
ATOM 4577  C CB  . THR E 1 114 ? 103.804 64.106  31.478  1.00 43.06 ? 114 THR E CB  1 
ATOM 4578  O OG1 . THR E 1 114 ? 103.940 63.223  30.357  1.00 43.18 ? 114 THR E OG1 1 
ATOM 4579  C CG2 . THR E 1 114 ? 105.149 64.224  32.196  1.00 43.11 ? 114 THR E CG2 1 
ATOM 4580  N N   . ALA E 1 115 ? 102.997 64.364  34.712  1.00 42.77 ? 115 ALA E N   1 
ATOM 4581  C CA  . ALA E 1 115 ? 102.810 65.242  35.871  1.00 42.75 ? 115 ALA E CA  1 
ATOM 4582  C C   . ALA E 1 115 ? 103.825 66.381  35.876  1.00 42.74 ? 115 ALA E C   1 
ATOM 4583  O O   . ALA E 1 115 ? 104.914 66.259  35.310  1.00 42.81 ? 115 ALA E O   1 
ATOM 4584  C CB  . ALA E 1 115 ? 102.918 64.442  37.160  1.00 42.91 ? 115 ALA E CB  1 
ATOM 4585  N N   . VAL E 1 116 ? 103.459 67.481  36.532  1.00 42.90 ? 116 VAL E N   1 
ATOM 4586  C CA  . VAL E 1 116 ? 104.332 68.662  36.641  1.00 43.05 ? 116 VAL E CA  1 
ATOM 4587  C C   . VAL E 1 116 ? 105.560 68.417  37.528  1.00 43.55 ? 116 VAL E C   1 
ATOM 4588  O O   . VAL E 1 116 ? 106.594 69.065  37.343  1.00 43.76 ? 116 VAL E O   1 
ATOM 4589  C CB  . VAL E 1 116 ? 103.579 69.921  37.146  1.00 42.93 ? 116 VAL E CB  1 
ATOM 4590  C CG1 . VAL E 1 116 ? 102.425 70.269  36.210  1.00 42.89 ? 116 VAL E CG1 1 
ATOM 4591  C CG2 . VAL E 1 116 ? 103.109 69.765  38.594  1.00 42.98 ? 116 VAL E CG2 1 
ATOM 4592  N N   . THR E 1 117 ? 105.438 67.499  38.488  1.00 43.94 ? 117 THR E N   1 
ATOM 4593  C CA  . THR E 1 117 ? 106.578 67.047  39.292  1.00 44.22 ? 117 THR E CA  1 
ATOM 4594  C C   . THR E 1 117 ? 107.594 66.278  38.444  1.00 44.30 ? 117 THR E C   1 
ATOM 4595  O O   . THR E 1 117 ? 108.803 66.413  38.648  1.00 44.49 ? 117 THR E O   1 
ATOM 4596  C CB  . THR E 1 117 ? 106.131 66.153  40.467  1.00 44.54 ? 117 THR E CB  1 
ATOM 4597  O OG1 . THR E 1 117 ? 105.319 65.078  39.976  1.00 44.68 ? 117 THR E OG1 1 
ATOM 4598  C CG2 . THR E 1 117 ? 105.340 66.961  41.489  1.00 44.67 ? 117 THR E CG2 1 
ATOM 4599  N N   . SER E 1 118 ? 107.098 65.476  37.500  1.00 44.37 ? 118 SER E N   1 
ATOM 4600  C CA  . SER E 1 118 ? 107.950 64.779  36.530  1.00 44.50 ? 118 SER E CA  1 
ATOM 4601  C C   . SER E 1 118 ? 108.507 65.745  35.484  1.00 44.49 ? 118 SER E C   1 
ATOM 4602  O O   . SER E 1 118 ? 108.069 66.896  35.390  1.00 44.41 ? 118 SER E O   1 
ATOM 4603  C CB  . SER E 1 118 ? 107.169 63.659  35.834  1.00 44.61 ? 118 SER E CB  1 
ATOM 4604  O OG  . SER E 1 118 ? 106.640 62.743  36.778  1.00 44.73 ? 118 SER E OG  1 
ATOM 4605  N N   . SER E 1 119 ? 109.467 65.263  34.696  1.00 44.65 ? 119 SER E N   1 
ATOM 4606  C CA  . SER E 1 119 ? 110.152 66.088  33.694  1.00 44.77 ? 119 SER E CA  1 
ATOM 4607  C C   . SER E 1 119 ? 109.245 66.462  32.521  1.00 44.88 ? 119 SER E C   1 
ATOM 4608  O O   . SER E 1 119 ? 108.184 65.863  32.320  1.00 44.83 ? 119 SER E O   1 
ATOM 4609  C CB  . SER E 1 119 ? 111.399 65.371  33.171  1.00 44.90 ? 119 SER E CB  1 
ATOM 4610  O OG  . SER E 1 119 ? 112.173 66.225  32.345  1.00 44.99 ? 119 SER E OG  1 
ATOM 4611  N N   . GLN E 1 120 ? 109.684 67.457  31.750  1.00 44.97 ? 120 GLN E N   1 
ATOM 4612  C CA  . GLN E 1 120 ? 108.911 67.986  30.623  1.00 45.08 ? 120 GLN E CA  1 
ATOM 4613  C C   . GLN E 1 120 ? 108.803 66.950  29.497  1.00 45.31 ? 120 GLN E C   1 
ATOM 4614  O O   . GLN E 1 120 ? 109.799 66.297  29.174  1.00 45.67 ? 120 GLN E O   1 
ATOM 4615  C CB  . GLN E 1 120 ? 109.564 69.265  30.087  1.00 45.05 ? 120 GLN E CB  1 
ATOM 4616  C CG  . GLN E 1 120 ? 108.753 70.001  29.029  1.00 45.09 ? 120 GLN E CG  1 
ATOM 4617  C CD  . GLN E 1 120 ? 109.416 71.288  28.575  1.00 45.21 ? 120 GLN E CD  1 
ATOM 4618  O OE1 . GLN E 1 120 ? 109.809 72.122  29.392  1.00 45.22 ? 120 GLN E OE1 1 
ATOM 4619  N NE2 . GLN E 1 120 ? 109.540 71.460  27.263  1.00 45.29 ? 120 GLN E NE2 1 
ATOM 4620  N N   . PRO E 1 121 ? 107.595 66.779  28.912  1.00 45.40 ? 121 PRO E N   1 
ATOM 4621  C CA  . PRO E 1 121 ? 107.444 65.922  27.729  1.00 45.55 ? 121 PRO E CA  1 
ATOM 4622  C C   . PRO E 1 121 ? 108.292 66.380  26.538  1.00 45.58 ? 121 PRO E C   1 
ATOM 4623  O O   . PRO E 1 121 ? 108.323 67.574  26.230  1.00 45.53 ? 121 PRO E O   1 
ATOM 4624  C CB  . PRO E 1 121 ? 105.954 66.042  27.393  1.00 45.56 ? 121 PRO E CB  1 
ATOM 4625  C CG  . PRO E 1 121 ? 105.301 66.348  28.691  1.00 45.48 ? 121 PRO E CG  1 
ATOM 4626  C CD  . PRO E 1 121 ? 106.284 67.179  29.462  1.00 45.42 ? 121 PRO E CD  1 
ATOM 4627  N N   . GLU E 1 122 ? 108.970 65.432  25.893  1.00 45.76 ? 122 GLU E N   1 
ATOM 4628  C CA  . GLU E 1 122 ? 109.831 65.727  24.741  1.00 45.90 ? 122 GLU E CA  1 
ATOM 4629  C C   . GLU E 1 122 ? 109.016 66.134  23.517  1.00 45.50 ? 122 GLU E C   1 
ATOM 4630  O O   . GLU E 1 122 ? 109.379 67.081  22.820  1.00 45.42 ? 122 GLU E O   1 
ATOM 4631  C CB  . GLU E 1 122 ? 110.715 64.521  24.395  1.00 46.32 ? 122 GLU E CB  1 
ATOM 4632  C CG  . GLU E 1 122 ? 111.741 64.155  25.464  1.00 46.56 ? 122 GLU E CG  1 
ATOM 4633  C CD  . GLU E 1 122 ? 112.812 65.219  25.679  1.00 46.77 ? 122 GLU E CD  1 
ATOM 4634  O OE1 . GLU E 1 122 ? 113.068 66.029  24.761  1.00 46.76 ? 122 GLU E OE1 1 
ATOM 4635  O OE2 . GLU E 1 122 ? 113.406 65.239  26.777  1.00 46.96 ? 122 GLU E OE2 1 
ATOM 4636  N N   . SER E 1 123 ? 107.928 65.407  23.262  1.00 45.20 ? 123 SER E N   1 
ATOM 4637  C CA  . SER E 1 123 ? 106.984 65.730  22.189  1.00 45.03 ? 123 SER E CA  1 
ATOM 4638  C C   . SER E 1 123 ? 105.547 65.507  22.656  1.00 44.61 ? 123 SER E C   1 
ATOM 4639  O O   . SER E 1 123 ? 105.287 64.652  23.506  1.00 44.74 ? 123 SER E O   1 
ATOM 4640  C CB  . SER E 1 123 ? 107.268 64.872  20.954  1.00 45.23 ? 123 SER E CB  1 
ATOM 4641  O OG  . SER E 1 123 ? 106.438 65.246  19.868  1.00 45.30 ? 123 SER E OG  1 
ATOM 4642  N N   . CYS E 1 124 ? 104.624 66.281  22.089  1.00 44.10 ? 124 CYS E N   1 
ATOM 4643  C CA  . CYS E 1 124 ? 103.205 66.207  22.447  1.00 43.87 ? 124 CYS E CA  1 
ATOM 4644  C C   . CYS E 1 124 ? 102.568 64.909  21.923  1.00 44.47 ? 124 CYS E C   1 
ATOM 4645  O O   . CYS E 1 124 ? 103.001 64.394  20.889  1.00 44.77 ? 124 CYS E O   1 
ATOM 4646  C CB  . CYS E 1 124 ? 102.450 67.426  21.901  1.00 43.10 ? 124 CYS E CB  1 
ATOM 4647  S SG  . CYS E 1 124 ? 102.955 67.941  20.241  1.00 42.51 ? 124 CYS E SG  1 
ATOM 4648  N N   . PRO E 1 125 ? 101.549 64.371  22.635  1.00 44.93 ? 125 PRO E N   1 
ATOM 4649  C CA  . PRO E 1 125 ? 100.868 63.156  22.149  1.00 45.17 ? 125 PRO E CA  1 
ATOM 4650  C C   . PRO E 1 125 ? 100.088 63.339  20.841  1.00 45.54 ? 125 PRO E C   1 
ATOM 4651  O O   . PRO E 1 125 ? 99.694  62.357  20.207  1.00 45.78 ? 125 PRO E O   1 
ATOM 4652  C CB  . PRO E 1 125 ? 99.900  62.806  23.291  1.00 45.17 ? 125 PRO E CB  1 
ATOM 4653  C CG  . PRO E 1 125 ? 100.449 63.486  24.492  1.00 45.13 ? 125 PRO E CG  1 
ATOM 4654  C CD  . PRO E 1 125 ? 101.082 64.744  23.986  1.00 45.02 ? 125 PRO E CD  1 
ATOM 4655  O OXT . PRO E 1 125 ? 99.828  64.453  20.382  1.00 45.77 ? 125 PRO E OXT 1 
ATOM 4656  N N   . PHE F 1 1   ? 82.723  79.964  93.541  1.00 65.53 ? 1   PHE F N   1 
ATOM 4657  C CA  . PHE F 1 1   ? 83.139  81.002  92.553  1.00 65.24 ? 1   PHE F CA  1 
ATOM 4658  C C   . PHE F 1 1   ? 84.073  82.013  93.230  1.00 64.19 ? 1   PHE F C   1 
ATOM 4659  O O   . PHE F 1 1   ? 83.618  82.954  93.888  1.00 64.28 ? 1   PHE F O   1 
ATOM 4660  C CB  . PHE F 1 1   ? 81.901  81.692  91.957  1.00 66.00 ? 1   PHE F CB  1 
ATOM 4661  C CG  . PHE F 1 1   ? 82.119  82.270  90.581  1.00 66.66 ? 1   PHE F CG  1 
ATOM 4662  C CD1 . PHE F 1 1   ? 83.061  83.275  90.367  1.00 66.87 ? 1   PHE F CD1 1 
ATOM 4663  C CD2 . PHE F 1 1   ? 81.369  81.822  89.497  1.00 67.09 ? 1   PHE F CD2 1 
ATOM 4664  C CE1 . PHE F 1 1   ? 83.255  83.810  89.103  1.00 67.09 ? 1   PHE F CE1 1 
ATOM 4665  C CE2 . PHE F 1 1   ? 81.563  82.356  88.231  1.00 67.25 ? 1   PHE F CE2 1 
ATOM 4666  C CZ  . PHE F 1 1   ? 82.506  83.352  88.034  1.00 67.25 ? 1   PHE F CZ  1 
ATOM 4667  N N   . THR F 1 2   ? 85.379  81.810  93.056  1.00 62.81 ? 2   THR F N   1 
ATOM 4668  C CA  . THR F 1 2   ? 86.401  82.651  93.689  1.00 61.68 ? 2   THR F CA  1 
ATOM 4669  C C   . THR F 1 2   ? 86.665  83.926  92.889  1.00 60.37 ? 2   THR F C   1 
ATOM 4670  O O   . THR F 1 2   ? 86.191  84.074  91.760  1.00 60.21 ? 2   THR F O   1 
ATOM 4671  C CB  . THR F 1 2   ? 87.738  81.889  93.838  1.00 61.85 ? 2   THR F CB  1 
ATOM 4672  O OG1 . THR F 1 2   ? 88.178  81.433  92.553  1.00 61.94 ? 2   THR F OG1 1 
ATOM 4673  C CG2 . THR F 1 2   ? 87.590  80.693  94.769  1.00 61.91 ? 2   THR F CG2 1 
ATOM 4674  N N   . LEU F 1 3   ? 87.425  84.837  93.492  1.00 59.31 ? 3   LEU F N   1 
ATOM 4675  C CA  . LEU F 1 3   ? 87.907  86.040  92.808  1.00 58.56 ? 3   LEU F CA  1 
ATOM 4676  C C   . LEU F 1 3   ? 89.019  85.693  91.816  1.00 57.74 ? 3   LEU F C   1 
ATOM 4677  O O   . LEU F 1 3   ? 89.073  86.264  90.728  1.00 57.87 ? 3   LEU F O   1 
ATOM 4678  C CB  . LEU F 1 3   ? 88.409  87.077  93.821  1.00 58.65 ? 3   LEU F CB  1 
ATOM 4679  C CG  . LEU F 1 3   ? 88.837  88.453  93.294  1.00 58.84 ? 3   LEU F CG  1 
ATOM 4680  C CD1 . LEU F 1 3   ? 87.674  89.189  92.644  1.00 58.83 ? 3   LEU F CD1 1 
ATOM 4681  C CD2 . LEU F 1 3   ? 89.429  89.280  94.426  1.00 59.00 ? 3   LEU F CD2 1 
ATOM 4682  N N   . ILE F 1 4   ? 89.907  84.776  92.207  1.00 56.84 ? 4   ILE F N   1 
ATOM 4683  C CA  . ILE F 1 4   ? 90.980  84.284  91.324  1.00 56.10 ? 4   ILE F CA  1 
ATOM 4684  C C   . ILE F 1 4   ? 90.453  83.587  90.057  1.00 55.55 ? 4   ILE F C   1 
ATOM 4685  O O   . ILE F 1 4   ? 91.054  83.719  88.988  1.00 55.56 ? 4   ILE F O   1 
ATOM 4686  C CB  . ILE F 1 4   ? 91.989  83.370  92.087  1.00 56.16 ? 4   ILE F CB  1 
ATOM 4687  C CG1 . ILE F 1 4   ? 93.216  83.020  91.228  1.00 56.20 ? 4   ILE F CG1 1 
ATOM 4688  C CG2 . ILE F 1 4   ? 91.344  82.074  92.570  1.00 56.30 ? 4   ILE F CG2 1 
ATOM 4689  C CD1 . ILE F 1 4   ? 93.995  84.211  90.716  1.00 56.15 ? 4   ILE F CD1 1 
ATOM 4690  N N   . GLU F 1 5   ? 89.345  82.853  90.182  1.00 55.12 ? 5   GLU F N   1 
ATOM 4691  C CA  . GLU F 1 5   ? 88.691  82.223  89.025  1.00 54.70 ? 5   GLU F CA  1 
ATOM 4692  C C   . GLU F 1 5   ? 88.065  83.267  88.094  1.00 54.01 ? 5   GLU F C   1 
ATOM 4693  O O   . GLU F 1 5   ? 88.026  83.066  86.882  1.00 54.13 ? 5   GLU F O   1 
ATOM 4694  C CB  . GLU F 1 5   ? 87.637  81.205  89.482  1.00 54.98 ? 5   GLU F CB  1 
ATOM 4695  C CG  . GLU F 1 5   ? 86.973  80.416  88.357  1.00 55.44 ? 5   GLU F CG  1 
ATOM 4696  C CD  . GLU F 1 5   ? 85.627  80.982  87.931  1.00 55.80 ? 5   GLU F CD  1 
ATOM 4697  O OE1 . GLU F 1 5   ? 84.697  81.000  88.765  1.00 55.97 ? 5   GLU F OE1 1 
ATOM 4698  O OE2 . GLU F 1 5   ? 85.496  81.398  86.760  1.00 55.93 ? 5   GLU F OE2 1 
ATOM 4699  N N   . LEU F 1 6   ? 87.570  84.364  88.663  1.00 53.26 ? 6   LEU F N   1 
ATOM 4700  C CA  . LEU F 1 6   ? 87.086  85.503  87.879  1.00 52.82 ? 6   LEU F CA  1 
ATOM 4701  C C   . LEU F 1 6   ? 88.242  86.301  87.273  1.00 52.17 ? 6   LEU F C   1 
ATOM 4702  O O   . LEU F 1 6   ? 88.151  86.764  86.136  1.00 52.30 ? 6   LEU F O   1 
ATOM 4703  C CB  . LEU F 1 6   ? 86.234  86.428  88.756  1.00 53.07 ? 6   LEU F CB  1 
ATOM 4704  C CG  . LEU F 1 6   ? 85.426  87.547  88.084  1.00 53.25 ? 6   LEU F CG  1 
ATOM 4705  C CD1 . LEU F 1 6   ? 84.413  86.999  87.082  1.00 53.35 ? 6   LEU F CD1 1 
ATOM 4706  C CD2 . LEU F 1 6   ? 84.742  88.405  89.144  1.00 53.36 ? 6   LEU F CD2 1 
ATOM 4707  N N   . LEU F 1 7   ? 89.317  86.460  88.045  1.00 51.68 ? 7   LEU F N   1 
ATOM 4708  C CA  . LEU F 1 7   ? 90.487  87.247  87.641  1.00 51.18 ? 7   LEU F CA  1 
ATOM 4709  C C   . LEU F 1 7   ? 91.239  86.638  86.457  1.00 50.46 ? 7   LEU F C   1 
ATOM 4710  O O   . LEU F 1 7   ? 91.660  87.368  85.557  1.00 50.55 ? 7   LEU F O   1 
ATOM 4711  C CB  . LEU F 1 7   ? 91.435  87.418  88.833  1.00 51.54 ? 7   LEU F CB  1 
ATOM 4712  C CG  . LEU F 1 7   ? 92.699  88.269  88.673  1.00 52.00 ? 7   LEU F CG  1 
ATOM 4713  C CD1 . LEU F 1 7   ? 92.377  89.665  88.159  1.00 52.25 ? 7   LEU F CD1 1 
ATOM 4714  C CD2 . LEU F 1 7   ? 93.425  88.338  90.008  1.00 52.11 ? 7   LEU F CD2 1 
ATOM 4715  N N   . ILE F 1 8   ? 91.416  85.316  86.470  1.00 49.67 ? 8   ILE F N   1 
ATOM 4716  C CA  . ILE F 1 8   ? 92.035  84.606  85.338  1.00 48.95 ? 8   ILE F CA  1 
ATOM 4717  C C   . ILE F 1 8   ? 91.157  84.640  84.080  1.00 48.10 ? 8   ILE F C   1 
ATOM 4718  O O   . ILE F 1 8   ? 91.683  84.709  82.973  1.00 48.25 ? 8   ILE F O   1 
ATOM 4719  C CB  . ILE F 1 8   ? 92.441  83.146  85.692  1.00 49.08 ? 8   ILE F CB  1 
ATOM 4720  C CG1 . ILE F 1 8   ? 93.391  82.581  84.622  1.00 49.31 ? 8   ILE F CG1 1 
ATOM 4721  C CG2 . ILE F 1 8   ? 91.221  82.247  85.871  1.00 49.12 ? 8   ILE F CG2 1 
ATOM 4722  C CD1 . ILE F 1 8   ? 94.127  81.321  85.032  1.00 49.49 ? 8   ILE F CD1 1 
ATOM 4723  N N   . VAL F 1 9   ? 89.835  84.603  84.254  1.00 47.27 ? 9   VAL F N   1 
ATOM 4724  C CA  . VAL F 1 9   ? 88.891  84.744  83.132  1.00 46.73 ? 9   VAL F CA  1 
ATOM 4725  C C   . VAL F 1 9   ? 88.998  86.133  82.486  1.00 46.19 ? 9   VAL F C   1 
ATOM 4726  O O   . VAL F 1 9   ? 88.923  86.251  81.263  1.00 46.23 ? 9   VAL F O   1 
ATOM 4727  C CB  . VAL F 1 9   ? 87.434  84.439  83.572  1.00 46.84 ? 9   VAL F CB  1 
ATOM 4728  C CG1 . VAL F 1 9   ? 86.413  84.877  82.525  1.00 46.95 ? 9   VAL F CG1 1 
ATOM 4729  C CG2 . VAL F 1 9   ? 87.274  82.951  83.857  1.00 46.91 ? 9   VAL F CG2 1 
ATOM 4730  N N   . ILE F 1 10  ? 89.177  87.168  83.307  1.00 45.60 ? 10  ILE F N   1 
ATOM 4731  C CA  . ILE F 1 10  ? 89.419  88.532  82.815  1.00 45.28 ? 10  ILE F CA  1 
ATOM 4732  C C   . ILE F 1 10  ? 90.758  88.612  82.062  1.00 44.89 ? 10  ILE F C   1 
ATOM 4733  O O   . ILE F 1 10  ? 90.857  89.306  81.048  1.00 44.97 ? 10  ILE F O   1 
ATOM 4734  C CB  . ILE F 1 10  ? 89.369  89.571  83.969  1.00 45.46 ? 10  ILE F CB  1 
ATOM 4735  C CG1 . ILE F 1 10  ? 87.945  89.670  84.537  1.00 45.68 ? 10  ILE F CG1 1 
ATOM 4736  C CG2 . ILE F 1 10  ? 89.824  90.955  83.504  1.00 45.52 ? 10  ILE F CG2 1 
ATOM 4737  C CD1 . ILE F 1 10  ? 87.874  90.227  85.944  1.00 45.81 ? 10  ILE F CD1 1 
ATOM 4738  N N   . ALA F 1 11  ? 91.769  87.901  82.559  1.00 44.53 ? 11  ALA F N   1 
ATOM 4739  C CA  . ALA F 1 11  ? 93.087  87.841  81.915  1.00 44.37 ? 11  ALA F CA  1 
ATOM 4740  C C   . ALA F 1 11  ? 93.061  87.172  80.536  1.00 44.14 ? 11  ALA F C   1 
ATOM 4741  O O   . ALA F 1 11  ? 93.726  87.642  79.612  1.00 44.27 ? 11  ALA F O   1 
ATOM 4742  C CB  . ALA F 1 11  ? 94.090  87.133  82.817  1.00 44.52 ? 11  ALA F CB  1 
ATOM 4743  N N   . ILE F 1 12  ? 92.299  86.085  80.407  1.00 43.94 ? 12  ILE F N   1 
ATOM 4744  C CA  . ILE F 1 12  ? 92.181  85.352  79.136  1.00 43.88 ? 12  ILE F CA  1 
ATOM 4745  C C   . ILE F 1 12  ? 91.371  86.140  78.094  1.00 43.93 ? 12  ILE F C   1 
ATOM 4746  O O   . ILE F 1 12  ? 91.694  86.092  76.906  1.00 44.27 ? 12  ILE F O   1 
ATOM 4747  C CB  . ILE F 1 12  ? 91.579  83.934  79.345  1.00 43.83 ? 12  ILE F CB  1 
ATOM 4748  C CG1 . ILE F 1 12  ? 92.490  83.071  80.236  1.00 44.06 ? 12  ILE F CG1 1 
ATOM 4749  C CG2 . ILE F 1 12  ? 91.320  83.223  78.015  1.00 43.85 ? 12  ILE F CG2 1 
ATOM 4750  C CD1 . ILE F 1 12  ? 93.899  82.848  79.720  1.00 44.26 ? 12  ILE F CD1 1 
ATOM 4751  N N   . ILE F 1 13  ? 90.340  86.863  78.533  1.00 43.69 ? 13  ILE F N   1 
ATOM 4752  C CA  . ILE F 1 13  ? 89.550  87.728  77.638  1.00 43.60 ? 13  ILE F CA  1 
ATOM 4753  C C   . ILE F 1 13  ? 90.429  88.815  76.995  1.00 43.55 ? 13  ILE F C   1 
ATOM 4754  O O   . ILE F 1 13  ? 90.256  89.130  75.816  1.00 43.61 ? 13  ILE F O   1 
ATOM 4755  C CB  . ILE F 1 13  ? 88.332  88.356  78.371  1.00 43.76 ? 13  ILE F CB  1 
ATOM 4756  C CG1 . ILE F 1 13  ? 87.299  87.272  78.709  1.00 43.92 ? 13  ILE F CG1 1 
ATOM 4757  C CG2 . ILE F 1 13  ? 87.654  89.438  77.526  1.00 43.84 ? 13  ILE F CG2 1 
ATOM 4758  C CD1 . ILE F 1 13  ? 86.379  87.631  79.857  1.00 44.05 ? 13  ILE F CD1 1 
ATOM 4759  N N   . ALA F 1 14  ? 91.362  89.372  77.766  1.00 43.61 ? 14  ALA F N   1 
ATOM 4760  C CA  . ALA F 1 14  ? 92.331  90.350  77.251  1.00 43.68 ? 14  ALA F CA  1 
ATOM 4761  C C   . ALA F 1 14  ? 93.266  89.758  76.191  1.00 43.73 ? 14  ALA F C   1 
ATOM 4762  O O   . ALA F 1 14  ? 93.628  90.444  75.231  1.00 43.84 ? 14  ALA F O   1 
ATOM 4763  C CB  . ALA F 1 14  ? 93.145  90.941  78.395  1.00 43.75 ? 14  ALA F CB  1 
ATOM 4764  N N   . ILE F 1 15  ? 93.652  88.495  76.374  1.00 43.74 ? 15  ILE F N   1 
ATOM 4765  C CA  . ILE F 1 15  ? 94.505  87.778  75.417  1.00 43.83 ? 15  ILE F CA  1 
ATOM 4766  C C   . ILE F 1 15  ? 93.730  87.443  74.139  1.00 43.79 ? 15  ILE F C   1 
ATOM 4767  O O   . ILE F 1 15  ? 94.217  87.695  73.035  1.00 43.92 ? 15  ILE F O   1 
ATOM 4768  C CB  . ILE F 1 15  ? 95.092  86.481  76.033  1.00 44.00 ? 15  ILE F CB  1 
ATOM 4769  C CG1 . ILE F 1 15  ? 96.017  86.819  77.212  1.00 44.22 ? 15  ILE F CG1 1 
ATOM 4770  C CG2 . ILE F 1 15  ? 95.868  85.675  74.992  1.00 44.10 ? 15  ILE F CG2 1 
ATOM 4771  C CD1 . ILE F 1 15  ? 96.260  85.664  78.161  1.00 44.27 ? 15  ILE F CD1 1 
ATOM 4772  N N   . LEU F 1 16  ? 92.540  86.866  74.302  1.00 43.76 ? 16  LEU F N   1 
ATOM 4773  C CA  . LEU F 1 16  ? 91.681  86.497  73.163  1.00 43.77 ? 16  LEU F CA  1 
ATOM 4774  C C   . LEU F 1 16  ? 91.201  87.706  72.348  1.00 43.68 ? 16  LEU F C   1 
ATOM 4775  O O   . LEU F 1 16  ? 91.068  87.611  71.127  1.00 43.80 ? 16  LEU F O   1 
ATOM 4776  C CB  . LEU F 1 16  ? 90.478  85.652  73.625  1.00 43.94 ? 16  LEU F CB  1 
ATOM 4777  C CG  . LEU F 1 16  ? 90.673  84.130  73.697  1.00 44.26 ? 16  LEU F CG  1 
ATOM 4778  C CD1 . LEU F 1 16  ? 91.989  83.724  74.352  1.00 44.40 ? 16  LEU F CD1 1 
ATOM 4779  C CD2 . LEU F 1 16  ? 89.495  83.486  74.415  1.00 44.39 ? 16  LEU F CD2 1 
ATOM 4780  N N   . ALA F 1 17  ? 90.943  88.829  73.021  1.00 43.48 ? 17  ALA F N   1 
ATOM 4781  C CA  . ALA F 1 17  ? 90.528  90.069  72.349  1.00 43.36 ? 17  ALA F CA  1 
ATOM 4782  C C   . ALA F 1 17  ? 91.624  90.689  71.472  1.00 43.29 ? 17  ALA F C   1 
ATOM 4783  O O   . ALA F 1 17  ? 91.318  91.416  70.526  1.00 43.40 ? 17  ALA F O   1 
ATOM 4784  C CB  . ALA F 1 17  ? 90.041  91.089  73.370  1.00 43.38 ? 17  ALA F CB  1 
ATOM 4785  N N   . ALA F 1 18  ? 92.888  90.414  71.795  1.00 43.01 ? 18  ALA F N   1 
ATOM 4786  C CA  . ALA F 1 18  ? 94.022  90.905  71.011  1.00 42.88 ? 18  ALA F CA  1 
ATOM 4787  C C   . ALA F 1 18  ? 94.284  90.028  69.787  1.00 42.74 ? 18  ALA F C   1 
ATOM 4788  O O   . ALA F 1 18  ? 94.327  90.527  68.661  1.00 42.83 ? 18  ALA F O   1 
ATOM 4789  C CB  . ALA F 1 18  ? 95.270  90.977  71.879  1.00 42.97 ? 18  ALA F CB  1 
ATOM 4790  N N   . VAL F 1 19  ? 94.450  88.727  70.020  1.00 42.61 ? 19  VAL F N   1 
ATOM 4791  C CA  . VAL F 1 19  ? 94.902  87.793  68.974  1.00 42.61 ? 19  VAL F CA  1 
ATOM 4792  C C   . VAL F 1 19  ? 93.839  87.424  67.929  1.00 42.56 ? 19  VAL F C   1 
ATOM 4793  O O   . VAL F 1 19  ? 94.157  87.319  66.742  1.00 42.66 ? 19  VAL F O   1 
ATOM 4794  C CB  . VAL F 1 19  ? 95.518  86.493  69.567  1.00 42.69 ? 19  VAL F CB  1 
ATOM 4795  C CG1 . VAL F 1 19  ? 96.651  86.828  70.531  1.00 42.75 ? 19  VAL F CG1 1 
ATOM 4796  C CG2 . VAL F 1 19  ? 94.468  85.607  70.238  1.00 42.69 ? 19  VAL F CG2 1 
ATOM 4797  N N   . LEU F 1 20  ? 92.592  87.238  68.363  1.00 42.47 ? 20  LEU F N   1 
ATOM 4798  C CA  . LEU F 1 20  ? 91.522  86.757  67.475  1.00 42.47 ? 20  LEU F CA  1 
ATOM 4799  C C   . LEU F 1 20  ? 90.968  87.827  66.524  1.00 42.21 ? 20  LEU F C   1 
ATOM 4800  O O   . LEU F 1 20  ? 90.390  87.484  65.489  1.00 42.16 ? 20  LEU F O   1 
ATOM 4801  C CB  . LEU F 1 20  ? 90.378  86.146  68.289  1.00 42.79 ? 20  LEU F CB  1 
ATOM 4802  C CG  . LEU F 1 20  ? 90.732  84.980  69.219  1.00 43.17 ? 20  LEU F CG  1 
ATOM 4803  C CD1 . LEU F 1 20  ? 89.527  84.593  70.061  1.00 43.27 ? 20  LEU F CD1 1 
ATOM 4804  C CD2 . LEU F 1 20  ? 91.234  83.781  68.429  1.00 43.25 ? 20  LEU F CD2 1 
ATOM 4805  N N   . ILE F 1 21  ? 91.135  89.103  66.874  1.00 41.85 ? 21  ILE F N   1 
ATOM 4806  C CA  . ILE F 1 21  ? 90.702  90.216  66.020  1.00 41.51 ? 21  ILE F CA  1 
ATOM 4807  C C   . ILE F 1 21  ? 91.709  90.325  64.864  1.00 41.13 ? 21  ILE F C   1 
ATOM 4808  O O   . ILE F 1 21  ? 92.887  90.599  65.107  1.00 41.33 ? 21  ILE F O   1 
ATOM 4809  C CB  . ILE F 1 21  ? 90.607  91.554  66.809  1.00 41.75 ? 21  ILE F CB  1 
ATOM 4810  C CG1 . ILE F 1 21  ? 89.305  91.637  67.628  1.00 41.94 ? 21  ILE F CG1 1 
ATOM 4811  C CG2 . ILE F 1 21  ? 90.627  92.765  65.876  1.00 41.83 ? 21  ILE F CG2 1 
ATOM 4812  C CD1 . ILE F 1 21  ? 88.965  90.436  68.490  1.00 42.01 ? 21  ILE F CD1 1 
ATOM 4813  N N   . PRO F 1 22  ? 91.256  90.112  63.609  1.00 40.49 ? 22  PRO F N   1 
ATOM 4814  C CA  . PRO F 1 22  ? 92.181  90.100  62.473  1.00 40.05 ? 22  PRO F CA  1 
ATOM 4815  C C   . PRO F 1 22  ? 92.589  91.498  62.006  1.00 39.58 ? 22  PRO F C   1 
ATOM 4816  O O   . PRO F 1 22  ? 92.024  92.497  62.458  1.00 39.64 ? 22  PRO F O   1 
ATOM 4817  C CB  . PRO F 1 22  ? 91.368  89.400  61.385  1.00 40.17 ? 22  PRO F CB  1 
ATOM 4818  C CG  . PRO F 1 22  ? 89.968  89.818  61.666  1.00 40.35 ? 22  PRO F CG  1 
ATOM 4819  C CD  . PRO F 1 22  ? 89.859  89.940  63.163  1.00 40.46 ? 22  PRO F CD  1 
ATOM 4820  N N   . ASN F 1 23  ? 93.567  91.548  61.101  1.00 38.96 ? 23  ASN F N   1 
ATOM 4821  C CA  . ASN F 1 23  ? 94.004  92.801  60.485  1.00 38.42 ? 23  ASN F CA  1 
ATOM 4822  C C   . ASN F 1 23  ? 92.942  93.249  59.479  1.00 38.17 ? 23  ASN F C   1 
ATOM 4823  O O   . ASN F 1 23  ? 92.812  92.667  58.399  1.00 38.30 ? 23  ASN F O   1 
ATOM 4824  C CB  . ASN F 1 23  ? 95.369  92.619  59.805  1.00 38.26 ? 23  ASN F CB  1 
ATOM 4825  C CG  . ASN F 1 23  ? 96.022  93.940  59.426  1.00 38.22 ? 23  ASN F CG  1 
ATOM 4826  O OD1 . ASN F 1 23  ? 95.422  94.778  58.753  1.00 38.19 ? 23  ASN F OD1 1 
ATOM 4827  N ND2 . ASN F 1 23  ? 97.268  94.124  59.848  1.00 38.32 ? 23  ASN F ND2 1 
ATOM 4828  N N   . LEU F 1 24  ? 92.179  94.277  59.851  1.00 37.77 ? 24  LEU F N   1 
ATOM 4829  C CA  . LEU F 1 24  ? 91.080  94.775  59.023  1.00 37.53 ? 24  LEU F CA  1 
ATOM 4830  C C   . LEU F 1 24  ? 91.585  95.595  57.837  1.00 37.24 ? 24  LEU F C   1 
ATOM 4831  O O   . LEU F 1 24  ? 91.133  95.390  56.712  1.00 37.38 ? 24  LEU F O   1 
ATOM 4832  C CB  . LEU F 1 24  ? 90.107  95.614  59.859  1.00 37.66 ? 24  LEU F CB  1 
ATOM 4833  C CG  . LEU F 1 24  ? 89.427  94.911  61.041  1.00 37.78 ? 24  LEU F CG  1 
ATOM 4834  C CD1 . LEU F 1 24  ? 88.740  95.926  61.941  1.00 37.90 ? 24  LEU F CD1 1 
ATOM 4835  C CD2 . LEU F 1 24  ? 88.431  93.861  60.571  1.00 37.72 ? 24  LEU F CD2 1 
ATOM 4836  N N   . LEU F 1 25  ? 92.521  96.511  58.095  1.00 36.76 ? 25  LEU F N   1 
ATOM 4837  C CA  . LEU F 1 25  ? 93.052  97.417  57.066  1.00 36.40 ? 25  LEU F CA  1 
ATOM 4838  C C   . LEU F 1 25  ? 93.655  96.673  55.877  1.00 35.85 ? 25  LEU F C   1 
ATOM 4839  O O   . LEU F 1 25  ? 93.429  97.053  54.729  1.00 35.80 ? 25  LEU F O   1 
ATOM 4840  C CB  . LEU F 1 25  ? 94.106  98.362  57.662  1.00 36.59 ? 25  LEU F CB  1 
ATOM 4841  C CG  . LEU F 1 25  ? 94.676  99.460  56.749  1.00 36.81 ? 25  LEU F CG  1 
ATOM 4842  C CD1 . LEU F 1 25  ? 93.591  100.439 56.327  1.00 36.91 ? 25  LEU F CD1 1 
ATOM 4843  C CD2 . LEU F 1 25  ? 95.818  100.193 57.437  1.00 36.92 ? 25  LEU F CD2 1 
ATOM 4844  N N   . ALA F 1 26  ? 94.418  95.620  56.164  1.00 35.52 ? 26  ALA F N   1 
ATOM 4845  C CA  . ALA F 1 26  ? 95.047  94.803  55.123  1.00 35.27 ? 26  ALA F CA  1 
ATOM 4846  C C   . ALA F 1 26  ? 94.016  94.017  54.309  1.00 34.96 ? 26  ALA F C   1 
ATOM 4847  O O   . ALA F 1 26  ? 94.144  93.908  53.089  1.00 34.98 ? 26  ALA F O   1 
ATOM 4848  C CB  . ALA F 1 26  ? 96.078  93.860  55.734  1.00 35.29 ? 26  ALA F CB  1 
ATOM 4849  N N   . ALA F 1 27  ? 92.999  93.483  54.984  1.00 34.79 ? 27  ALA F N   1 
ATOM 4850  C CA  . ALA F 1 27  ? 91.914  92.744  54.324  1.00 34.77 ? 27  ALA F CA  1 
ATOM 4851  C C   . ALA F 1 27  ? 91.130  93.597  53.319  1.00 34.60 ? 27  ALA F C   1 
ATOM 4852  O O   . ALA F 1 27  ? 90.744  93.103  52.259  1.00 34.63 ? 27  ALA F O   1 
ATOM 4853  C CB  . ALA F 1 27  ? 90.966  92.157  55.361  1.00 34.88 ? 27  ALA F CB  1 
ATOM 4854  N N   . ARG F 1 28  ? 90.901  94.867  53.658  1.00 34.46 ? 28  ARG F N   1 
ATOM 4855  C CA  . ARG F 1 28  ? 90.178  95.793  52.778  1.00 34.32 ? 28  ARG F CA  1 
ATOM 4856  C C   . ARG F 1 28  ? 90.990  96.227  51.553  1.00 34.16 ? 28  ARG F C   1 
ATOM 4857  O O   . ARG F 1 28  ? 90.411  96.434  50.487  1.00 34.28 ? 28  ARG F O   1 
ATOM 4858  C CB  . ARG F 1 28  ? 89.705  97.030  53.549  1.00 34.46 ? 28  ARG F CB  1 
ATOM 4859  C CG  . ARG F 1 28  ? 88.719  96.723  54.667  1.00 34.64 ? 28  ARG F CG  1 
ATOM 4860  C CD  . ARG F 1 28  ? 87.889  97.939  55.051  1.00 34.76 ? 28  ARG F CD  1 
ATOM 4861  N NE  . ARG F 1 28  ? 86.720  98.104  54.187  1.00 34.86 ? 28  ARG F NE  1 
ATOM 4862  C CZ  . ARG F 1 28  ? 85.599  97.378  54.255  1.00 35.08 ? 28  ARG F CZ  1 
ATOM 4863  N NH1 . ARG F 1 28  ? 84.604  97.631  53.409  1.00 35.19 ? 28  ARG F NH1 1 
ATOM 4864  N NH2 . ARG F 1 28  ? 85.455  96.399  55.153  1.00 35.14 ? 28  ARG F NH2 1 
ATOM 4865  N N   . LYS F 1 29  ? 92.310  96.371  51.706  1.00 34.02 ? 29  LYS F N   1 
ATOM 4866  C CA  . LYS F 1 29  ? 93.203  96.748  50.590  1.00 33.92 ? 29  LYS F CA  1 
ATOM 4867  C C   . LYS F 1 29  ? 93.039  95.863  49.352  1.00 33.86 ? 29  LYS F C   1 
ATOM 4868  O O   . LYS F 1 29  ? 93.000  96.370  48.230  1.00 34.02 ? 29  LYS F O   1 
ATOM 4869  C CB  . LYS F 1 29  ? 94.680  96.723  51.018  1.00 33.96 ? 29  LYS F CB  1 
ATOM 4870  C CG  . LYS F 1 29  ? 95.153  97.946  51.787  1.00 34.05 ? 29  LYS F CG  1 
ATOM 4871  C CD  . LYS F 1 29  ? 96.674  98.001  51.826  1.00 34.19 ? 29  LYS F CD  1 
ATOM 4872  C CE  . LYS F 1 29  ? 97.186  99.137  52.699  1.00 34.36 ? 29  LYS F CE  1 
ATOM 4873  N NZ  . LYS F 1 29  ? 97.178  98.803  54.151  1.00 34.43 ? 29  LYS F NZ  1 
ATOM 4874  N N   . ARG F 1 30  ? 92.942  94.552  49.566  1.00 33.59 ? 30  ARG F N   1 
ATOM 4875  C CA  . ARG F 1 30  ? 92.815  93.587  48.467  1.00 33.40 ? 30  ARG F CA  1 
ATOM 4876  C C   . ARG F 1 30  ? 91.408  93.591  47.871  1.00 33.27 ? 30  ARG F C   1 
ATOM 4877  O O   . ARG F 1 30  ? 91.245  93.384  46.667  1.00 33.42 ? 30  ARG F O   1 
ATOM 4878  C CB  . ARG F 1 30  ? 93.185  92.173  48.929  1.00 33.43 ? 30  ARG F CB  1 
ATOM 4879  C CG  . ARG F 1 30  ? 94.559  92.035  49.580  1.00 33.49 ? 30  ARG F CG  1 
ATOM 4880  C CD  . ARG F 1 30  ? 95.706  92.443  48.663  1.00 33.56 ? 30  ARG F CD  1 
ATOM 4881  N NE  . ARG F 1 30  ? 96.991  92.485  49.364  1.00 33.57 ? 30  ARG F NE  1 
ATOM 4882  C CZ  . ARG F 1 30  ? 98.161  92.789  48.798  1.00 33.63 ? 30  ARG F CZ  1 
ATOM 4883  N NH1 . ARG F 1 30  ? 98.240  93.085  47.500  1.00 33.65 ? 30  ARG F NH1 1 
ATOM 4884  N NH2 . ARG F 1 30  ? 99.268  92.797  49.537  1.00 33.67 ? 30  ARG F NH2 1 
ATOM 4885  N N   . ALA F 1 31  ? 90.403  93.813  48.716  1.00 32.98 ? 31  ALA F N   1 
ATOM 4886  C CA  . ALA F 1 31  ? 89.027  94.012  48.256  1.00 32.87 ? 31  ALA F CA  1 
ATOM 4887  C C   . ALA F 1 31  ? 88.883  95.306  47.454  1.00 32.84 ? 31  ALA F C   1 
ATOM 4888  O O   . ALA F 1 31  ? 88.133  95.351  46.478  1.00 32.95 ? 31  ALA F O   1 
ATOM 4889  C CB  . ALA F 1 31  ? 88.070  94.017  49.437  1.00 32.90 ? 31  ALA F CB  1 
ATOM 4890  N N   . ASN F 1 32  ? 89.593  96.351  47.878  1.00 32.86 ? 32  ASN F N   1 
ATOM 4891  C CA  . ASN F 1 32  ? 89.640  97.626  47.148  1.00 32.92 ? 32  ASN F CA  1 
ATOM 4892  C C   . ASN F 1 32  ? 90.320  97.501  45.779  1.00 33.12 ? 32  ASN F C   1 
ATOM 4893  O O   . ASN F 1 32  ? 89.928  98.187  44.833  1.00 33.24 ? 32  ASN F O   1 
ATOM 4894  C CB  . ASN F 1 32  ? 90.352  98.706  47.978  1.00 32.83 ? 32  ASN F CB  1 
ATOM 4895  C CG  . ASN F 1 32  ? 89.540  99.168  49.181  1.00 32.76 ? 32  ASN F CG  1 
ATOM 4896  O OD1 . ASN F 1 32  ? 88.316  99.281  49.101  1.00 32.77 ? 32  ASN F OD1 1 
ATOM 4897  N ND2 . ASN F 1 32  ? 90.210  99.433  50.297  1.00 32.81 ? 32  ASN F ND2 1 
ATOM 4898  N N   . ASP F 1 33  ? 91.336  96.641  45.684  1.00 33.25 ? 33  ASP F N   1 
ATOM 4899  C CA  . ASP F 1 33  ? 91.987  96.337  44.400  1.00 33.42 ? 33  ASP F CA  1 
ATOM 4900  C C   . ASP F 1 33  ? 91.042  95.617  43.436  1.00 33.48 ? 33  ASP F C   1 
ATOM 4901  O O   . ASP F 1 33  ? 91.092  95.855  42.227  1.00 33.61 ? 33  ASP F O   1 
ATOM 4902  C CB  . ASP F 1 33  ? 93.244  95.481  44.606  1.00 33.64 ? 33  ASP F CB  1 
ATOM 4903  C CG  . ASP F 1 33  ? 94.354  96.215  45.344  1.00 33.90 ? 33  ASP F CG  1 
ATOM 4904  O OD1 . ASP F 1 33  ? 94.310  97.461  45.456  1.00 33.97 ? 33  ASP F OD1 1 
ATOM 4905  O OD2 . ASP F 1 33  ? 95.287  95.532  45.818  1.00 34.02 ? 33  ASP F OD2 1 
ATOM 4906  N N   . THR F 1 34  ? 90.197  94.737  43.975  1.00 33.41 ? 34  THR F N   1 
ATOM 4907  C CA  . THR F 1 34  ? 89.178  94.039  43.185  1.00 33.36 ? 34  THR F CA  1 
ATOM 4908  C C   . THR F 1 34  ? 88.145  95.003  42.591  1.00 33.33 ? 34  THR F C   1 
ATOM 4909  O O   . THR F 1 34  ? 87.678  94.791  41.474  1.00 33.44 ? 34  THR F O   1 
ATOM 4910  C CB  . THR F 1 34  ? 88.438  92.975  44.028  1.00 33.50 ? 34  THR F CB  1 
ATOM 4911  O OG1 . THR F 1 34  ? 89.388  92.197  44.767  1.00 33.50 ? 34  THR F OG1 1 
ATOM 4912  C CG2 . THR F 1 34  ? 87.605  92.047  43.142  1.00 33.60 ? 34  THR F CG2 1 
ATOM 4913  N N   . VAL F 1 35  ? 87.800  96.052  43.341  1.00 33.30 ? 35  VAL F N   1 
ATOM 4914  C CA  . VAL F 1 35  ? 86.874  97.094  42.869  1.00 33.32 ? 35  VAL F CA  1 
ATOM 4915  C C   . VAL F 1 35  ? 87.492  97.895  41.718  1.00 33.25 ? 35  VAL F C   1 
ATOM 4916  O O   . VAL F 1 35  ? 86.808  98.207  40.741  1.00 33.36 ? 35  VAL F O   1 
ATOM 4917  C CB  . VAL F 1 35  ? 86.450  98.048  44.019  1.00 33.52 ? 35  VAL F CB  1 
ATOM 4918  C CG1 . VAL F 1 35  ? 85.649  99.243  43.500  1.00 33.63 ? 35  VAL F CG1 1 
ATOM 4919  C CG2 . VAL F 1 35  ? 85.637  97.298  45.066  1.00 33.60 ? 35  VAL F CG2 1 
ATOM 4920  N N   . VAL F 1 36  ? 88.779  98.222  41.846  1.00 33.13 ? 36  VAL F N   1 
ATOM 4921  C CA  . VAL F 1 36  ? 89.512  98.957  40.808  1.00 33.03 ? 36  VAL F CA  1 
ATOM 4922  C C   . VAL F 1 36  ? 89.722  98.087  39.566  1.00 33.02 ? 36  VAL F C   1 
ATOM 4923  O O   . VAL F 1 36  ? 89.549  98.561  38.441  1.00 33.10 ? 36  VAL F O   1 
ATOM 4924  C CB  . VAL F 1 36  ? 90.876  99.476  41.332  1.00 33.02 ? 36  VAL F CB  1 
ATOM 4925  C CG1 . VAL F 1 36  ? 91.716  100.074 40.206  1.00 33.08 ? 36  VAL F CG1 1 
ATOM 4926  C CG2 . VAL F 1 36  ? 90.670  100.507 42.433  1.00 33.01 ? 36  VAL F CG2 1 
ATOM 4927  N N   . THR F 1 37  ? 90.100  96.827  39.778  1.00 33.06 ? 37  THR F N   1 
ATOM 4928  C CA  . THR F 1 37  ? 90.289  95.869  38.684  1.00 33.11 ? 37  THR F CA  1 
ATOM 4929  C C   . THR F 1 37  ? 88.978  95.566  37.954  1.00 33.10 ? 37  THR F C   1 
ATOM 4930  O O   . THR F 1 37  ? 88.968  95.455  36.728  1.00 33.26 ? 37  THR F O   1 
ATOM 4931  C CB  . THR F 1 37  ? 90.906  94.545  39.190  1.00 33.23 ? 37  THR F CB  1 
ATOM 4932  O OG1 . THR F 1 37  ? 92.095  94.821  39.940  1.00 33.31 ? 37  THR F OG1 1 
ATOM 4933  C CG2 . THR F 1 37  ? 91.250  93.611  38.025  1.00 33.28 ? 37  THR F CG2 1 
ATOM 4934  N N   . ALA F 1 38  ? 87.886  95.438  38.708  1.00 33.05 ? 38  ALA F N   1 
ATOM 4935  C CA  . ALA F 1 38  ? 86.559  95.195  38.129  1.00 33.10 ? 38  ALA F CA  1 
ATOM 4936  C C   . ALA F 1 38  ? 86.054  96.381  37.310  1.00 33.09 ? 38  ALA F C   1 
ATOM 4937  O O   . ALA F 1 38  ? 85.507  96.190  36.224  1.00 33.10 ? 38  ALA F O   1 
ATOM 4938  C CB  . ALA F 1 38  ? 85.552  94.852  39.220  1.00 33.16 ? 38  ALA F CB  1 
ATOM 4939  N N   . TYR F 1 39  ? 86.239  97.593  37.833  1.00 33.22 ? 39  TYR F N   1 
ATOM 4940  C CA  . TYR F 1 39  ? 85.803  98.814  37.143  1.00 33.27 ? 39  TYR F CA  1 
ATOM 4941  C C   . TYR F 1 39  ? 86.607  99.081  35.869  1.00 33.48 ? 39  TYR F C   1 
ATOM 4942  O O   . TYR F 1 39  ? 86.044  99.533  34.870  1.00 33.64 ? 39  TYR F O   1 
ATOM 4943  C CB  . TYR F 1 39  ? 85.875  100.032 38.069  1.00 33.19 ? 39  TYR F CB  1 
ATOM 4944  C CG  . TYR F 1 39  ? 85.126  101.230 37.530  1.00 33.27 ? 39  TYR F CG  1 
ATOM 4945  C CD1 . TYR F 1 39  ? 83.739  101.323 37.655  1.00 33.33 ? 39  TYR F CD1 1 
ATOM 4946  C CD2 . TYR F 1 39  ? 85.798  102.269 36.883  1.00 33.35 ? 39  TYR F CD2 1 
ATOM 4947  C CE1 . TYR F 1 39  ? 83.043  102.417 37.156  1.00 33.32 ? 39  TYR F CE1 1 
ATOM 4948  C CE2 . TYR F 1 39  ? 85.110  103.367 36.382  1.00 33.36 ? 39  TYR F CE2 1 
ATOM 4949  C CZ  . TYR F 1 39  ? 83.735  103.437 36.521  1.00 33.36 ? 39  TYR F CZ  1 
ATOM 4950  O OH  . TYR F 1 39  ? 83.051  104.524 36.027  1.00 33.46 ? 39  TYR F OH  1 
ATOM 4951  N N   . LEU F 1 40  ? 87.912  98.810  35.911  1.00 33.68 ? 40  LEU F N   1 
ATOM 4952  C CA  . LEU F 1 40  ? 88.760  98.879  34.713  1.00 33.88 ? 40  LEU F CA  1 
ATOM 4953  C C   . LEU F 1 40  ? 88.421  97.777  33.706  1.00 34.31 ? 40  LEU F C   1 
ATOM 4954  O O   . LEU F 1 40  ? 88.447  98.019  32.500  1.00 34.49 ? 40  LEU F O   1 
ATOM 4955  C CB  . LEU F 1 40  ? 90.247  98.807  35.079  1.00 33.80 ? 40  LEU F CB  1 
ATOM 4956  C CG  . LEU F 1 40  ? 90.837  100.043 35.761  1.00 33.73 ? 40  LEU F CG  1 
ATOM 4957  C CD1 . LEU F 1 40  ? 92.191  99.709  36.359  1.00 33.66 ? 40  LEU F CD1 1 
ATOM 4958  C CD2 . LEU F 1 40  ? 90.959  101.211 34.792  1.00 33.70 ? 40  LEU F CD2 1 
ATOM 4959  N N   . ASN F 1 41  ? 88.110  96.579  34.204  1.00 34.79 ? 41  ASN F N   1 
ATOM 4960  C CA  . ASN F 1 41  ? 87.651  95.473  33.354  1.00 35.15 ? 41  ASN F CA  1 
ATOM 4961  C C   . ASN F 1 41  ? 86.320  95.811  32.672  1.00 35.40 ? 41  ASN F C   1 
ATOM 4962  O O   . ASN F 1 41  ? 86.118  95.467  31.506  1.00 35.49 ? 41  ASN F O   1 
ATOM 4963  C CB  . ASN F 1 41  ? 87.518  94.178  34.168  1.00 35.34 ? 41  ASN F CB  1 
ATOM 4964  C CG  . ASN F 1 41  ? 87.200  92.967  33.306  1.00 35.61 ? 41  ASN F CG  1 
ATOM 4965  O OD1 . ASN F 1 41  ? 87.793  92.768  32.245  1.00 35.79 ? 41  ASN F OD1 1 
ATOM 4966  N ND2 . ASN F 1 41  ? 86.264  92.143  33.766  1.00 35.71 ? 41  ASN F ND2 1 
ATOM 4967  N N   . ASP F 1 42  ? 85.426  96.478  33.402  1.00 35.76 ? 42  ASP F N   1 
ATOM 4968  C CA  . ASP F 1 42  ? 84.179  97.002  32.829  1.00 36.04 ? 42  ASP F CA  1 
ATOM 4969  C C   . ASP F 1 42  ? 84.442  98.164  31.869  1.00 36.01 ? 42  ASP F C   1 
ATOM 4970  O O   . ASP F 1 42  ? 83.809  98.250  30.818  1.00 36.17 ? 42  ASP F O   1 
ATOM 4971  C CB  . ASP F 1 42  ? 83.207  97.455  33.931  1.00 36.32 ? 42  ASP F CB  1 
ATOM 4972  C CG  . ASP F 1 42  ? 82.676  96.296  34.769  1.00 36.66 ? 42  ASP F CG  1 
ATOM 4973  O OD1 . ASP F 1 42  ? 82.408  95.208  34.211  1.00 36.82 ? 42  ASP F OD1 1 
ATOM 4974  O OD2 . ASP F 1 42  ? 82.515  96.480  35.994  1.00 36.78 ? 42  ASP F OD2 1 
ATOM 4975  N N   . ALA F 1 43  ? 85.371  99.048  32.234  1.00 35.92 ? 43  ALA F N   1 
ATOM 4976  C CA  . ALA F 1 43  ? 85.756  100.186 31.388  1.00 35.94 ? 43  ALA F CA  1 
ATOM 4977  C C   . ALA F 1 43  ? 86.320  99.756  30.032  1.00 36.00 ? 43  ALA F C   1 
ATOM 4978  O O   . ALA F 1 43  ? 86.064  100.411 29.023  1.00 36.16 ? 43  ALA F O   1 
ATOM 4979  C CB  . ALA F 1 43  ? 86.758  101.074 32.113  1.00 35.95 ? 43  ALA F CB  1 
ATOM 4980  N N   . VAL F 1 44  ? 87.083  98.664  30.020  1.00 36.18 ? 44  VAL F N   1 
ATOM 4981  C CA  . VAL F 1 44  ? 87.623  98.086  28.778  1.00 36.35 ? 44  VAL F CA  1 
ATOM 4982  C C   . VAL F 1 44  ? 86.505  97.574  27.856  1.00 36.53 ? 44  VAL F C   1 
ATOM 4983  O O   . VAL F 1 44  ? 86.606  97.707  26.635  1.00 36.62 ? 44  VAL F O   1 
ATOM 4984  C CB  . VAL F 1 44  ? 88.655  96.962  29.081  1.00 36.45 ? 44  VAL F CB  1 
ATOM 4985  C CG1 . VAL F 1 44  ? 89.024  96.167  27.829  1.00 36.57 ? 44  VAL F CG1 1 
ATOM 4986  C CG2 . VAL F 1 44  ? 89.913  97.547  29.721  1.00 36.45 ? 44  VAL F CG2 1 
ATOM 4987  N N   . LYS F 1 45  ? 85.451  96.999  28.438  1.00 36.84 ? 45  LYS F N   1 
ATOM 4988  C CA  . LYS F 1 45  ? 84.309  96.493  27.663  1.00 37.12 ? 45  LYS F CA  1 
ATOM 4989  C C   . LYS F 1 45  ? 83.548  97.615  26.957  1.00 37.00 ? 45  LYS F C   1 
ATOM 4990  O O   . LYS F 1 45  ? 83.283  97.525  25.758  1.00 37.15 ? 45  LYS F O   1 
ATOM 4991  C CB  . LYS F 1 45  ? 83.350  95.690  28.551  1.00 37.49 ? 45  LYS F CB  1 
ATOM 4992  C CG  . LYS F 1 45  ? 83.932  94.382  29.067  1.00 37.82 ? 45  LYS F CG  1 
ATOM 4993  C CD  . LYS F 1 45  ? 83.122  93.818  30.226  1.00 38.10 ? 45  LYS F CD  1 
ATOM 4994  C CE  . LYS F 1 45  ? 83.805  92.607  30.841  1.00 38.33 ? 45  LYS F CE  1 
ATOM 4995  N NZ  . LYS F 1 45  ? 83.105  92.114  32.060  1.00 38.49 ? 45  LYS F NZ  1 
ATOM 4996  N N   . PHE F 1 46  ? 83.209  98.666  27.701  1.00 36.90 ? 46  PHE F N   1 
ATOM 4997  C CA  . PHE F 1 46  ? 82.488  99.816  27.135  1.00 36.84 ? 46  PHE F CA  1 
ATOM 4998  C C   . PHE F 1 46  ? 83.340  100.697 26.211  1.00 36.81 ? 46  PHE F C   1 
ATOM 4999  O O   . PHE F 1 46  ? 82.788  101.480 25.435  1.00 36.96 ? 46  PHE F O   1 
ATOM 5000  C CB  . PHE F 1 46  ? 81.834  100.651 28.243  1.00 36.83 ? 46  PHE F CB  1 
ATOM 5001  C CG  . PHE F 1 46  ? 80.617  100.002 28.838  1.00 36.90 ? 46  PHE F CG  1 
ATOM 5002  C CD1 . PHE F 1 46  ? 79.399  100.047 28.170  1.00 37.06 ? 46  PHE F CD1 1 
ATOM 5003  C CD2 . PHE F 1 46  ? 80.687  99.328  30.052  1.00 36.99 ? 46  PHE F CD2 1 
ATOM 5004  C CE1 . PHE F 1 46  ? 78.271  99.441  28.704  1.00 37.14 ? 46  PHE F CE1 1 
ATOM 5005  C CE2 . PHE F 1 46  ? 79.563  98.722  30.595  1.00 37.16 ? 46  PHE F CE2 1 
ATOM 5006  C CZ  . PHE F 1 46  ? 78.353  98.776  29.919  1.00 37.19 ? 46  PHE F CZ  1 
ATOM 5007  N N   . GLN F 1 47  ? 84.666  100.579 26.298  1.00 36.77 ? 47  GLN F N   1 
ATOM 5008  C CA  . GLN F 1 47  ? 85.566  101.171 25.298  1.00 36.82 ? 47  GLN F CA  1 
ATOM 5009  C C   . GLN F 1 47  ? 85.445  100.447 23.953  1.00 37.07 ? 47  GLN F C   1 
ATOM 5010  O O   . GLN F 1 47  ? 85.452  101.089 22.902  1.00 37.28 ? 47  GLN F O   1 
ATOM 5011  C CB  . GLN F 1 47  ? 87.026  101.155 25.774  1.00 36.79 ? 47  GLN F CB  1 
ATOM 5012  C CG  . GLN F 1 47  ? 87.364  102.235 26.794  1.00 36.85 ? 47  GLN F CG  1 
ATOM 5013  C CD  . GLN F 1 47  ? 87.726  103.570 26.164  1.00 36.98 ? 47  GLN F CD  1 
ATOM 5014  O OE1 . GLN F 1 47  ? 87.167  103.962 25.138  1.00 37.07 ? 47  GLN F OE1 1 
ATOM 5015  N NE2 . GLN F 1 47  ? 88.660  104.280 26.784  1.00 37.07 ? 47  GLN F NE2 1 
ATOM 5016  N N   . GLU F 1 48  ? 85.342  99.117  23.996  1.00 37.41 ? 48  GLU F N   1 
ATOM 5017  C CA  . GLU F 1 48  ? 85.119  98.306  22.790  1.00 37.74 ? 48  GLU F CA  1 
ATOM 5018  C C   . GLU F 1 48  ? 83.723  98.512  22.191  1.00 37.83 ? 48  GLU F C   1 
ATOM 5019  O O   . GLU F 1 48  ? 83.556  98.415  20.976  1.00 38.01 ? 48  GLU F O   1 
ATOM 5020  C CB  . GLU F 1 48  ? 85.344  96.815  23.077  1.00 38.07 ? 48  GLU F CB  1 
ATOM 5021  C CG  . GLU F 1 48  ? 86.784  96.442  23.417  1.00 38.39 ? 48  GLU F CG  1 
ATOM 5022  C CD  . GLU F 1 48  ? 87.728  96.516  22.225  1.00 38.68 ? 48  GLU F CD  1 
ATOM 5023  O OE1 . GLU F 1 48  ? 87.384  95.990  21.144  1.00 38.76 ? 48  GLU F OE1 1 
ATOM 5024  O OE2 . GLU F 1 48  ? 88.827  97.093  22.374  1.00 38.77 ? 48  GLU F OE2 1 
ATOM 5025  N N   . MET F 1 49  ? 82.729  98.782  23.038  1.00 37.94 ? 49  MET F N   1 
ATOM 5026  C CA  . MET F 1 49  ? 81.370  99.096  22.570  1.00 38.06 ? 49  MET F CA  1 
ATOM 5027  C C   . MET F 1 49  ? 81.289  100.458 21.876  1.00 37.98 ? 49  MET F C   1 
ATOM 5028  O O   . MET F 1 49  ? 80.531  100.617 20.917  1.00 38.26 ? 49  MET F O   1 
ATOM 5029  C CB  . MET F 1 49  ? 80.366  99.036  23.724  1.00 38.24 ? 49  MET F CB  1 
ATOM 5030  C CG  . MET F 1 49  ? 80.115  97.625  24.228  1.00 38.47 ? 49  MET F CG  1 
ATOM 5031  S SD  . MET F 1 49  ? 79.068  97.549  25.692  1.00 38.86 ? 49  MET F SD  1 
ATOM 5032  C CE  . MET F 1 49  ? 77.542  98.233  25.054  1.00 38.96 ? 49  MET F CE  1 
ATOM 5033  N N   . TYR F 1 50  ? 82.057  101.430 22.363  1.00 37.79 ? 50  TYR F N   1 
ATOM 5034  C CA  . TYR F 1 50  ? 82.172  102.738 21.707  1.00 37.80 ? 50  TYR F CA  1 
ATOM 5035  C C   . TYR F 1 50  ? 82.950  102.638 20.388  1.00 38.04 ? 50  TYR F C   1 
ATOM 5036  O O   . TYR F 1 50  ? 82.682  103.394 19.451  1.00 38.25 ? 50  TYR F O   1 
ATOM 5037  C CB  . TYR F 1 50  ? 82.845  103.750 22.637  1.00 37.76 ? 50  TYR F CB  1 
ATOM 5038  C CG  . TYR F 1 50  ? 82.648  105.193 22.227  1.00 37.79 ? 50  TYR F CG  1 
ATOM 5039  C CD1 . TYR F 1 50  ? 83.544  105.825 21.364  1.00 37.66 ? 50  TYR F CD1 1 
ATOM 5040  C CD2 . TYR F 1 50  ? 81.576  105.938 22.719  1.00 37.87 ? 50  TYR F CD2 1 
ATOM 5041  C CE1 . TYR F 1 50  ? 83.371  107.151 20.993  1.00 37.67 ? 50  TYR F CE1 1 
ATOM 5042  C CE2 . TYR F 1 50  ? 81.394  107.266 22.354  1.00 37.85 ? 50  TYR F CE2 1 
ATOM 5043  C CZ  . TYR F 1 50  ? 82.295  107.868 21.492  1.00 37.80 ? 50  TYR F CZ  1 
ATOM 5044  O OH  . TYR F 1 50  ? 82.120  109.182 21.125  1.00 37.98 ? 50  TYR F OH  1 
ATOM 5045  N N   . GLN F 1 51  ? 83.913  101.718 20.332  1.00 38.31 ? 51  GLN F N   1 
ATOM 5046  C CA  . GLN F 1 51  ? 84.662  101.419 19.104  1.00 38.55 ? 51  GLN F CA  1 
ATOM 5047  C C   . GLN F 1 51  ? 83.766  100.840 17.998  1.00 38.78 ? 51  GLN F C   1 
ATOM 5048  O O   . GLN F 1 51  ? 84.016  101.077 16.816  1.00 38.94 ? 51  GLN F O   1 
ATOM 5049  C CB  . GLN F 1 51  ? 85.819  100.453 19.411  1.00 38.73 ? 51  GLN F CB  1 
ATOM 5050  C CG  . GLN F 1 51  ? 86.813  100.217 18.278  1.00 38.88 ? 51  GLN F CG  1 
ATOM 5051  C CD  . GLN F 1 51  ? 87.646  101.439 17.940  1.00 38.88 ? 51  GLN F CD  1 
ATOM 5052  O OE1 . GLN F 1 51  ? 88.185  102.101 18.825  1.00 38.93 ? 51  GLN F OE1 1 
ATOM 5053  N NE2 . GLN F 1 51  ? 87.774  101.728 16.652  1.00 38.97 ? 51  GLN F NE2 1 
ATOM 5054  N N   . ILE F 1 52  ? 82.739  100.082 18.384  1.00 38.96 ? 52  ILE F N   1 
ATOM 5055  C CA  . ILE F 1 52  ? 81.742  99.564  17.434  1.00 39.19 ? 52  ILE F CA  1 
ATOM 5056  C C   . ILE F 1 52  ? 80.906  100.705 16.838  1.00 39.35 ? 52  ILE F C   1 
ATOM 5057  O O   . ILE F 1 52  ? 80.648  100.720 15.632  1.00 39.50 ? 52  ILE F O   1 
ATOM 5058  C CB  . ILE F 1 52  ? 80.823  98.499  18.090  1.00 39.24 ? 52  ILE F CB  1 
ATOM 5059  C CG1 . ILE F 1 52  ? 81.632  97.243  18.440  1.00 39.33 ? 52  ILE F CG1 1 
ATOM 5060  C CG2 . ILE F 1 52  ? 79.661  98.114  17.172  1.00 39.29 ? 52  ILE F CG2 1 
ATOM 5061  C CD1 . ILE F 1 52  ? 81.012  96.377  19.518  1.00 39.33 ? 52  ILE F CD1 1 
ATOM 5062  N N   . ASP F 1 53  ? 80.500  101.653 17.681  1.00 39.54 ? 53  ASP F N   1 
ATOM 5063  C CA  . ASP F 1 53  ? 79.644  102.765 17.256  1.00 39.77 ? 53  ASP F CA  1 
ATOM 5064  C C   . ASP F 1 53  ? 80.411  103.826 16.469  1.00 39.75 ? 53  ASP F C   1 
ATOM 5065  O O   . ASP F 1 53  ? 80.093  104.094 15.308  1.00 39.95 ? 53  ASP F O   1 
ATOM 5066  C CB  . ASP F 1 53  ? 78.966  103.417 18.468  1.00 40.03 ? 53  ASP F CB  1 
ATOM 5067  C CG  . ASP F 1 53  ? 78.027  102.470 19.199  1.00 40.34 ? 53  ASP F CG  1 
ATOM 5068  O OD1 . ASP F 1 53  ? 78.107  101.243 18.975  1.00 40.49 ? 53  ASP F OD1 1 
ATOM 5069  O OD2 . ASP F 1 53  ? 77.208  102.957 20.009  1.00 40.58 ? 53  ASP F OD2 1 
ATOM 5070  N N   . ASN F 1 54  ? 81.425  104.411 17.105  1.00 39.52 ? 54  ASN F N   1 
ATOM 5071  C CA  . ASN F 1 54  ? 82.112  105.602 16.584  1.00 39.56 ? 54  ASN F CA  1 
ATOM 5072  C C   . ASN F 1 54  ? 83.424  105.340 15.828  1.00 39.43 ? 54  ASN F C   1 
ATOM 5073  O O   . ASN F 1 54  ? 83.958  106.263 15.209  1.00 39.61 ? 54  ASN F O   1 
ATOM 5074  C CB  . ASN F 1 54  ? 82.388  106.580 17.732  1.00 39.76 ? 54  ASN F CB  1 
ATOM 5075  C CG  . ASN F 1 54  ? 81.116  107.099 18.378  1.00 39.96 ? 54  ASN F CG  1 
ATOM 5076  O OD1 . ASN F 1 54  ? 80.685  108.220 18.110  1.00 40.17 ? 54  ASN F OD1 1 
ATOM 5077  N ND2 . ASN F 1 54  ? 80.511  106.284 19.234  1.00 40.00 ? 54  ASN F ND2 1 
ATOM 5078  N N   . ASN F 1 55  ? 83.937  104.106 15.880  1.00 39.07 ? 55  ASN F N   1 
ATOM 5079  C CA  . ASN F 1 55  ? 85.243  103.744 15.296  1.00 38.83 ? 55  ASN F CA  1 
ATOM 5080  C C   . ASN F 1 55  ? 86.404  104.536 15.920  1.00 38.56 ? 55  ASN F C   1 
ATOM 5081  O O   . ASN F 1 55  ? 87.309  104.995 15.221  1.00 38.71 ? 55  ASN F O   1 
ATOM 5082  C CB  . ASN F 1 55  ? 85.235  103.889 13.763  1.00 39.00 ? 55  ASN F CB  1 
ATOM 5083  C CG  . ASN F 1 55  ? 84.044  103.206 13.111  1.00 39.27 ? 55  ASN F CG  1 
ATOM 5084  O OD1 . ASN F 1 55  ? 83.390  103.778 12.239  1.00 39.50 ? 55  ASN F OD1 1 
ATOM 5085  N ND2 . ASN F 1 55  ? 83.756  101.978 13.532  1.00 39.40 ? 55  ASN F ND2 1 
ATOM 5086  N N   . SER F 1 56  ? 86.361  104.678 17.244  1.00 38.22 ? 56  SER F N   1 
ATOM 5087  C CA  . SER F 1 56  ? 87.404  105.371 18.010  1.00 37.99 ? 56  SER F CA  1 
ATOM 5088  C C   . SER F 1 56  ? 87.285  105.027 19.497  1.00 37.53 ? 56  SER F C   1 
ATOM 5089  O O   . SER F 1 56  ? 86.383  104.287 19.894  1.00 37.69 ? 56  SER F O   1 
ATOM 5090  C CB  . SER F 1 56  ? 87.294  106.887 17.815  1.00 38.25 ? 56  SER F CB  1 
ATOM 5091  O OG  . SER F 1 56  ? 88.375  107.563 18.435  1.00 38.43 ? 56  SER F OG  1 
ATOM 5092  N N   . TYR F 1 57  ? 88.207  105.549 20.304  1.00 36.99 ? 57  TYR F N   1 
ATOM 5093  C CA  . TYR F 1 57  ? 88.166  105.389 21.762  1.00 36.72 ? 57  TYR F CA  1 
ATOM 5094  C C   . TYR F 1 57  ? 87.892  106.728 22.449  1.00 36.67 ? 57  TYR F C   1 
ATOM 5095  O O   . TYR F 1 57  ? 88.266  107.788 21.941  1.00 36.63 ? 57  TYR F O   1 
ATOM 5096  C CB  . TYR F 1 57  ? 89.473  104.782 22.275  1.00 36.60 ? 57  TYR F CB  1 
ATOM 5097  C CG  . TYR F 1 57  ? 89.658  103.326 21.901  1.00 36.53 ? 57  TYR F CG  1 
ATOM 5098  C CD1 . TYR F 1 57  ? 88.876  102.330 22.490  1.00 36.47 ? 57  TYR F CD1 1 
ATOM 5099  C CD2 . TYR F 1 57  ? 90.618  102.937 20.965  1.00 36.51 ? 57  TYR F CD2 1 
ATOM 5100  C CE1 . TYR F 1 57  ? 89.041  100.993 22.155  1.00 36.34 ? 57  TYR F CE1 1 
ATOM 5101  C CE2 . TYR F 1 57  ? 90.790  101.601 20.624  1.00 36.42 ? 57  TYR F CE2 1 
ATOM 5102  C CZ  . TYR F 1 57  ? 90.000  100.634 21.221  1.00 36.34 ? 57  TYR F CZ  1 
ATOM 5103  O OH  . TYR F 1 57  ? 90.165  99.310  20.889  1.00 36.45 ? 57  TYR F OH  1 
ATOM 5104  N N   . THR F 1 58  ? 87.245  106.660 23.611  1.00 36.59 ? 58  THR F N   1 
ATOM 5105  C CA  . THR F 1 58  ? 86.770  107.843 24.325  1.00 36.53 ? 58  THR F CA  1 
ATOM 5106  C C   . THR F 1 58  ? 87.842  108.452 25.220  1.00 36.66 ? 58  THR F C   1 
ATOM 5107  O O   . THR F 1 58  ? 88.509  107.737 25.970  1.00 36.84 ? 58  THR F O   1 
ATOM 5108  C CB  . THR F 1 58  ? 85.569  107.499 25.225  1.00 36.65 ? 58  THR F CB  1 
ATOM 5109  O OG1 . THR F 1 58  ? 85.930  106.449 26.131  1.00 36.58 ? 58  THR F OG1 1 
ATOM 5110  C CG2 . THR F 1 58  ? 84.395  107.050 24.390  1.00 36.74 ? 58  THR F CG2 1 
ATOM 5111  N N   . SER F 1 59  ? 87.987  109.774 25.142  1.00 36.78 ? 59  SER F N   1 
ATOM 5112  C CA  . SER F 1 59  ? 88.815  110.529 26.080  1.00 36.85 ? 59  SER F CA  1 
ATOM 5113  C C   . SER F 1 59  ? 88.023  110.819 27.356  1.00 36.82 ? 59  SER F C   1 
ATOM 5114  O O   . SER F 1 59  ? 88.544  110.654 28.458  1.00 36.81 ? 59  SER F O   1 
ATOM 5115  C CB  . SER F 1 59  ? 89.289  111.838 25.444  1.00 37.11 ? 59  SER F CB  1 
ATOM 5116  O OG  . SER F 1 59  ? 90.254  112.484 26.258  1.00 37.24 ? 59  SER F OG  1 
ATOM 5117  N N   . ASN F 1 60  ? 86.771  111.252 27.196  1.00 36.97 ? 60  ASN F N   1 
ATOM 5118  C CA  . ASN F 1 60  ? 85.893  111.568 28.335  1.00 37.22 ? 60  ASN F CA  1 
ATOM 5119  C C   . ASN F 1 60  ? 85.200  110.326 28.910  1.00 37.20 ? 60  ASN F C   1 
ATOM 5120  O O   . ASN F 1 60  ? 84.945  109.355 28.193  1.00 37.13 ? 60  ASN F O   1 
ATOM 5121  C CB  . ASN F 1 60  ? 84.850  112.635 27.951  1.00 37.35 ? 60  ASN F CB  1 
ATOM 5122  C CG  . ASN F 1 60  ? 83.808  112.126 26.967  1.00 37.43 ? 60  ASN F CG  1 
ATOM 5123  O OD1 . ASN F 1 60  ? 84.107  111.326 26.078  1.00 37.43 ? 60  ASN F OD1 1 
ATOM 5124  N ND2 . ASN F 1 60  ? 82.576  112.601 27.116  1.00 37.57 ? 60  ASN F ND2 1 
ATOM 5125  N N   . GLN F 1 61  ? 84.898  110.380 30.206  1.00 37.16 ? 61  GLN F N   1 
ATOM 5126  C CA  . GLN F 1 61  ? 84.231  109.284 30.915  1.00 37.02 ? 61  GLN F CA  1 
ATOM 5127  C C   . GLN F 1 61  ? 82.726  109.246 30.639  1.00 36.99 ? 61  GLN F C   1 
ATOM 5128  O O   . GLN F 1 61  ? 82.138  108.164 30.585  1.00 37.14 ? 61  GLN F O   1 
ATOM 5129  C CB  . GLN F 1 61  ? 84.473  109.403 32.423  1.00 37.12 ? 61  GLN F CB  1 
ATOM 5130  C CG  . GLN F 1 61  ? 84.132  108.147 33.216  1.00 37.21 ? 61  GLN F CG  1 
ATOM 5131  C CD  . GLN F 1 61  ? 84.225  108.347 34.717  1.00 37.24 ? 61  GLN F CD  1 
ATOM 5132  O OE1 . GLN F 1 61  ? 84.954  109.215 35.203  1.00 37.27 ? 61  GLN F OE1 1 
ATOM 5133  N NE2 . GLN F 1 61  ? 83.488  107.535 35.465  1.00 37.32 ? 61  GLN F NE2 1 
ATOM 5134  N N   . ALA F 1 62  ? 82.112  110.420 30.478  1.00 36.96 ? 62  ALA F N   1 
ATOM 5135  C CA  . ALA F 1 62  ? 80.665  110.541 30.232  1.00 36.85 ? 62  ALA F CA  1 
ATOM 5136  C C   . ALA F 1 62  ? 80.171  109.787 28.992  1.00 36.78 ? 62  ALA F C   1 
ATOM 5137  O O   . ALA F 1 62  ? 79.019  109.350 28.952  1.00 36.92 ? 62  ALA F O   1 
ATOM 5138  C CB  . ALA F 1 62  ? 80.268  112.008 30.138  1.00 36.91 ? 62  ALA F CB  1 
ATOM 5139  N N   . ALA F 1 63  ? 81.036  109.649 27.986  1.00 36.84 ? 63  ALA F N   1 
ATOM 5140  C CA  . ALA F 1 63  ? 80.737  108.848 26.795  1.00 36.91 ? 63  ALA F CA  1 
ATOM 5141  C C   . ALA F 1 63  ? 80.587  107.362 27.129  1.00 36.82 ? 63  ALA F C   1 
ATOM 5142  O O   . ALA F 1 63  ? 79.679  106.704 26.621  1.00 36.91 ? 63  ALA F O   1 
ATOM 5143  C CB  . ALA F 1 63  ? 81.813  109.043 25.736  1.00 37.01 ? 63  ALA F CB  1 
ATOM 5144  N N   . LEU F 1 64  ? 81.473  106.846 27.981  1.00 36.89 ? 64  LEU F N   1 
ATOM 5145  C CA  . LEU F 1 64  ? 81.407  105.451 28.436  1.00 37.01 ? 64  LEU F CA  1 
ATOM 5146  C C   . LEU F 1 64  ? 80.202  105.188 29.345  1.00 37.02 ? 64  LEU F C   1 
ATOM 5147  O O   . LEU F 1 64  ? 79.610  104.108 29.289  1.00 37.07 ? 64  LEU F O   1 
ATOM 5148  C CB  . LEU F 1 64  ? 82.692  105.050 29.171  1.00 37.12 ? 64  LEU F CB  1 
ATOM 5149  C CG  . LEU F 1 64  ? 84.003  105.107 28.380  1.00 37.29 ? 64  LEU F CG  1 
ATOM 5150  C CD1 . LEU F 1 64  ? 85.187  104.843 29.299  1.00 37.40 ? 64  LEU F CD1 1 
ATOM 5151  C CD2 . LEU F 1 64  ? 83.992  104.120 27.223  1.00 37.32 ? 64  LEU F CD2 1 
ATOM 5152  N N   . ILE F 1 65  ? 79.850  106.174 30.172  1.00 37.10 ? 65  ILE F N   1 
ATOM 5153  C CA  . ILE F 1 65  ? 78.704  106.065 31.087  1.00 37.16 ? 65  ILE F CA  1 
ATOM 5154  C C   . ILE F 1 65  ? 77.376  106.078 30.317  1.00 37.20 ? 65  ILE F C   1 
ATOM 5155  O O   . ILE F 1 65  ? 76.437  105.369 30.691  1.00 37.29 ? 65  ILE F O   1 
ATOM 5156  C CB  . ILE F 1 65  ? 78.719  107.181 32.168  1.00 37.23 ? 65  ILE F CB  1 
ATOM 5157  C CG1 . ILE F 1 65  ? 79.967  107.054 33.056  1.00 37.33 ? 65  ILE F CG1 1 
ATOM 5158  C CG2 . ILE F 1 65  ? 77.466  107.126 33.042  1.00 37.26 ? 65  ILE F CG2 1 
ATOM 5159  C CD1 . ILE F 1 65  ? 80.285  108.295 33.865  1.00 37.48 ? 65  ILE F CD1 1 
ATOM 5160  N N   . SER F 1 66  ? 77.305  106.875 29.250  1.00 37.26 ? 66  SER F N   1 
ATOM 5161  C CA  . SER F 1 66  ? 76.111  106.947 28.397  1.00 37.39 ? 66  SER F CA  1 
ATOM 5162  C C   . SER F 1 66  ? 75.784  105.615 27.709  1.00 37.52 ? 66  SER F C   1 
ATOM 5163  O O   . SER F 1 66  ? 74.610  105.273 27.549  1.00 37.55 ? 66  SER F O   1 
ATOM 5164  C CB  . SER F 1 66  ? 76.269  108.048 27.343  1.00 37.37 ? 66  SER F CB  1 
ATOM 5165  O OG  . SER F 1 66  ? 75.062  108.258 26.630  1.00 37.36 ? 66  SER F OG  1 
ATOM 5166  N N   . LEU F 1 67  ? 76.820  104.877 27.306  1.00 37.78 ? 67  LEU F N   1 
ATOM 5167  C CA  . LEU F 1 67  ? 76.647  103.546 26.700  1.00 38.04 ? 67  LEU F CA  1 
ATOM 5168  C C   . LEU F 1 67  ? 76.106  102.490 27.674  1.00 38.13 ? 67  LEU F C   1 
ATOM 5169  O O   . LEU F 1 67  ? 75.386  101.582 27.252  1.00 38.34 ? 67  LEU F O   1 
ATOM 5170  C CB  . LEU F 1 67  ? 77.954  103.045 26.057  1.00 38.16 ? 67  LEU F CB  1 
ATOM 5171  C CG  . LEU F 1 67  ? 78.132  103.346 24.564  1.00 38.40 ? 67  LEU F CG  1 
ATOM 5172  C CD1 . LEU F 1 67  ? 78.207  104.838 24.272  1.00 38.45 ? 67  LEU F CD1 1 
ATOM 5173  C CD2 . LEU F 1 67  ? 79.373  102.643 24.039  1.00 38.59 ? 67  LEU F CD2 1 
ATOM 5174  N N   . GLY F 1 68  ? 76.443  102.612 28.960  1.00 37.98 ? 68  GLY F N   1 
ATOM 5175  C CA  . GLY F 1 68  ? 76.012  101.637 29.971  1.00 37.88 ? 68  GLY F CA  1 
ATOM 5176  C C   . GLY F 1 68  ? 76.869  101.483 31.221  1.00 37.72 ? 68  GLY F C   1 
ATOM 5177  O O   . GLY F 1 68  ? 76.376  100.977 32.232  1.00 37.88 ? 68  GLY F O   1 
ATOM 5178  N N   . LEU F 1 69  ? 78.144  101.880 31.158  1.00 37.46 ? 69  LEU F N   1 
ATOM 5179  C CA  . LEU F 1 69  ? 79.054  101.811 32.314  1.00 37.38 ? 69  LEU F CA  1 
ATOM 5180  C C   . LEU F 1 69  ? 78.504  102.562 33.530  1.00 37.38 ? 69  LEU F C   1 
ATOM 5181  O O   . LEU F 1 69  ? 77.836  103.589 33.386  1.00 37.44 ? 69  LEU F O   1 
ATOM 5182  C CB  . LEU F 1 69  ? 80.435  102.376 31.951  1.00 37.38 ? 69  LEU F CB  1 
ATOM 5183  C CG  . LEU F 1 69  ? 81.574  102.266 32.974  1.00 37.33 ? 69  LEU F CG  1 
ATOM 5184  C CD1 . LEU F 1 69  ? 81.951  100.819 33.253  1.00 37.36 ? 69  LEU F CD1 1 
ATOM 5185  C CD2 . LEU F 1 69  ? 82.790  103.040 32.487  1.00 37.37 ? 69  LEU F CD2 1 
ATOM 5186  N N   . LYS F 1 70  ? 78.795  102.040 34.720  1.00 37.37 ? 70  LYS F N   1 
ATOM 5187  C CA  . LYS F 1 70  ? 78.345  102.650 35.974  1.00 37.30 ? 70  LYS F CA  1 
ATOM 5188  C C   . LYS F 1 70  ? 79.151  103.905 36.298  1.00 37.09 ? 70  LYS F C   1 
ATOM 5189  O O   . LYS F 1 70  ? 80.187  104.170 35.681  1.00 37.05 ? 70  LYS F O   1 
ATOM 5190  C CB  . LYS F 1 70  ? 78.466  101.656 37.134  1.00 37.51 ? 70  LYS F CB  1 
ATOM 5191  C CG  . LYS F 1 70  ? 77.617  100.404 36.984  1.00 37.82 ? 70  LYS F CG  1 
ATOM 5192  C CD  . LYS F 1 70  ? 77.651  99.565  38.252  1.00 38.07 ? 70  LYS F CD  1 
ATOM 5193  C CE  . LYS F 1 70  ? 76.778  98.324  38.135  1.00 38.26 ? 70  LYS F CE  1 
ATOM 5194  N NZ  . LYS F 1 70  ? 77.287  97.356  37.123  1.00 38.34 ? 70  LYS F NZ  1 
ATOM 5195  N N   . SER F 1 71  ? 78.664  104.671 37.272  1.00 36.84 ? 71  SER F N   1 
ATOM 5196  C CA  . SER F 1 71  ? 79.392  105.833 37.788  1.00 36.56 ? 71  SER F CA  1 
ATOM 5197  C C   . SER F 1 71  ? 80.643  105.377 38.537  1.00 36.24 ? 71  SER F C   1 
ATOM 5198  O O   . SER F 1 71  ? 80.740  104.216 38.947  1.00 36.23 ? 71  SER F O   1 
ATOM 5199  C CB  . SER F 1 71  ? 78.500  106.659 38.717  1.00 36.59 ? 71  SER F CB  1 
ATOM 5200  O OG  . SER F 1 71  ? 77.340  107.112 38.042  1.00 36.60 ? 71  SER F OG  1 
ATOM 5201  N N   . THR F 1 72  ? 81.596  106.293 38.709  1.00 35.94 ? 72  THR F N   1 
ATOM 5202  C CA  . THR F 1 72  ? 82.858  105.987 39.387  1.00 35.78 ? 72  THR F CA  1 
ATOM 5203  C C   . THR F 1 72  ? 82.580  105.503 40.817  1.00 35.65 ? 72  THR F C   1 
ATOM 5204  O O   . THR F 1 72  ? 81.765  106.115 41.513  1.00 35.81 ? 72  THR F O   1 
ATOM 5205  C CB  . THR F 1 72  ? 83.787  107.217 39.443  1.00 35.87 ? 72  THR F CB  1 
ATOM 5206  O OG1 . THR F 1 72  ? 83.887  107.806 38.140  1.00 35.93 ? 72  THR F OG1 1 
ATOM 5207  C CG2 . THR F 1 72  ? 85.182  106.829 39.928  1.00 35.94 ? 72  THR F CG2 1 
ATOM 5208  N N   . PRO F 1 73  ? 83.236  104.403 41.259  1.00 35.35 ? 73  PRO F N   1 
ATOM 5209  C CA  . PRO F 1 73  ? 82.942  103.889 42.606  1.00 35.35 ? 73  PRO F CA  1 
ATOM 5210  C C   . PRO F 1 73  ? 83.412  104.806 43.739  1.00 35.42 ? 73  PRO F C   1 
ATOM 5211  O O   . PRO F 1 73  ? 84.204  105.725 43.511  1.00 35.51 ? 73  PRO F O   1 
ATOM 5212  C CB  . PRO F 1 73  ? 83.694  102.548 42.659  1.00 35.35 ? 73  PRO F CB  1 
ATOM 5213  C CG  . PRO F 1 73  ? 84.109  102.251 41.262  1.00 35.32 ? 73  PRO F CG  1 
ATOM 5214  C CD  . PRO F 1 73  ? 84.243  103.570 40.576  1.00 35.28 ? 73  PRO F CD  1 
ATOM 5215  N N   . ALA F 1 74  ? 82.918  104.541 44.946  1.00 35.52 ? 74  ALA F N   1 
ATOM 5216  C CA  . ALA F 1 74  ? 83.246  105.350 46.121  1.00 35.57 ? 74  ALA F CA  1 
ATOM 5217  C C   . ALA F 1 74  ? 84.720  105.188 46.489  1.00 35.42 ? 74  ALA F C   1 
ATOM 5218  O O   . ALA F 1 74  ? 85.220  104.063 46.569  1.00 35.50 ? 74  ALA F O   1 
ATOM 5219  C CB  . ALA F 1 74  ? 82.362  104.965 47.298  1.00 35.68 ? 74  ALA F CB  1 
ATOM 5220  N N   . ASN F 1 75  ? 85.395  106.318 46.702  1.00 35.20 ? 75  ASN F N   1 
ATOM 5221  C CA  . ASN F 1 75  ? 86.830  106.366 47.019  1.00 35.04 ? 75  ASN F CA  1 
ATOM 5222  C C   . ASN F 1 75  ? 87.706  105.750 45.915  1.00 34.83 ? 75  ASN F C   1 
ATOM 5223  O O   . ASN F 1 75  ? 88.683  105.052 46.205  1.00 34.81 ? 75  ASN F O   1 
ATOM 5224  C CB  . ASN F 1 75  ? 87.113  105.704 48.379  1.00 35.14 ? 75  ASN F CB  1 
ATOM 5225  C CG  . ASN F 1 75  ? 86.201  106.210 49.483  1.00 35.37 ? 75  ASN F CG  1 
ATOM 5226  O OD1 . ASN F 1 75  ? 85.784  107.369 49.483  1.00 35.52 ? 75  ASN F OD1 1 
ATOM 5227  N ND2 . ASN F 1 75  ? 85.891  105.337 50.436  1.00 35.47 ? 75  ASN F ND2 1 
ATOM 5228  N N   . VAL F 1 76  ? 87.346  106.018 44.658  1.00 34.65 ? 76  VAL F N   1 
ATOM 5229  C CA  . VAL F 1 76  ? 88.107  105.568 43.484  1.00 34.49 ? 76  VAL F CA  1 
ATOM 5230  C C   . VAL F 1 76  ? 88.309  106.754 42.542  1.00 34.47 ? 76  VAL F C   1 
ATOM 5231  O O   . VAL F 1 76  ? 87.369  107.506 42.270  1.00 34.47 ? 76  VAL F O   1 
ATOM 5232  C CB  . VAL F 1 76  ? 87.385  104.421 42.737  1.00 34.35 ? 76  VAL F CB  1 
ATOM 5233  C CG1 . VAL F 1 76  ? 88.121  104.048 41.450  1.00 34.32 ? 76  VAL F CG1 1 
ATOM 5234  C CG2 . VAL F 1 76  ? 87.252  103.205 43.641  1.00 34.40 ? 76  VAL F CG2 1 
ATOM 5235  N N   . THR F 1 77  ? 89.538  106.904 42.047  1.00 34.42 ? 77  THR F N   1 
ATOM 5236  C CA  . THR F 1 77  ? 89.917  108.003 41.160  1.00 34.40 ? 77  THR F CA  1 
ATOM 5237  C C   . THR F 1 77  ? 90.201  107.482 39.753  1.00 34.33 ? 77  THR F C   1 
ATOM 5238  O O   . THR F 1 77  ? 91.356  107.300 39.361  1.00 34.35 ? 77  THR F O   1 
ATOM 5239  C CB  . THR F 1 77  ? 91.152  108.749 41.701  1.00 34.48 ? 77  THR F CB  1 
ATOM 5240  O OG1 . THR F 1 77  ? 92.212  107.815 41.937  1.00 34.42 ? 77  THR F OG1 1 
ATOM 5241  C CG2 . THR F 1 77  ? 90.815  109.464 43.000  1.00 34.60 ? 77  THR F CG2 1 
ATOM 5242  N N   . PHE F 1 78  ? 89.126  107.235 39.007  1.00 34.32 ? 78  PHE F N   1 
ATOM 5243  C CA  . PHE F 1 78  ? 89.212  106.832 37.603  1.00 34.26 ? 78  PHE F CA  1 
ATOM 5244  C C   . PHE F 1 78  ? 89.557  108.050 36.748  1.00 34.03 ? 78  PHE F C   1 
ATOM 5245  O O   . PHE F 1 78  ? 89.027  109.140 36.974  1.00 34.15 ? 78  PHE F O   1 
ATOM 5246  C CB  . PHE F 1 78  ? 87.884  106.219 37.142  1.00 34.49 ? 78  PHE F CB  1 
ATOM 5247  C CG  . PHE F 1 78  ? 87.882  105.768 35.706  1.00 34.68 ? 78  PHE F CG  1 
ATOM 5248  C CD1 . PHE F 1 78  ? 88.409  104.531 35.350  1.00 34.79 ? 78  PHE F CD1 1 
ATOM 5249  C CD2 . PHE F 1 78  ? 87.342  106.577 34.708  1.00 34.80 ? 78  PHE F CD2 1 
ATOM 5250  C CE1 . PHE F 1 78  ? 88.405  104.112 34.025  1.00 34.94 ? 78  PHE F CE1 1 
ATOM 5251  C CE2 . PHE F 1 78  ? 87.335  106.164 33.383  1.00 34.93 ? 78  PHE F CE2 1 
ATOM 5252  C CZ  . PHE F 1 78  ? 87.867  104.930 33.041  1.00 34.99 ? 78  PHE F CZ  1 
ATOM 5253  N N   . SER F 1 79  ? 90.442  107.855 35.772  1.00 33.69 ? 79  SER F N   1 
ATOM 5254  C CA  . SER F 1 79  ? 90.907  108.946 34.914  1.00 33.53 ? 79  SER F CA  1 
ATOM 5255  C C   . SER F 1 79  ? 91.557  108.410 33.638  1.00 33.30 ? 79  SER F C   1 
ATOM 5256  O O   . SER F 1 79  ? 92.604  107.763 33.695  1.00 33.36 ? 79  SER F O   1 
ATOM 5257  C CB  . SER F 1 79  ? 91.907  109.820 35.677  1.00 33.61 ? 79  SER F CB  1 
ATOM 5258  O OG  . SER F 1 79  ? 92.400  110.875 34.867  1.00 33.71 ? 79  SER F OG  1 
ATOM 5259  N N   . ILE F 1 80  ? 90.936  108.693 32.493  1.00 33.07 ? 80  ILE F N   1 
ATOM 5260  C CA  . ILE F 1 80  ? 91.465  108.279 31.194  1.00 32.89 ? 80  ILE F CA  1 
ATOM 5261  C C   . ILE F 1 80  ? 92.567  109.260 30.793  1.00 32.77 ? 80  ILE F C   1 
ATOM 5262  O O   . ILE F 1 80  ? 92.327  110.466 30.708  1.00 32.79 ? 80  ILE F O   1 
ATOM 5263  C CB  . ILE F 1 80  ? 90.368  108.241 30.103  1.00 32.91 ? 80  ILE F CB  1 
ATOM 5264  C CG1 . ILE F 1 80  ? 89.253  107.256 30.494  1.00 32.96 ? 80  ILE F CG1 1 
ATOM 5265  C CG2 . ILE F 1 80  ? 90.966  107.862 28.747  1.00 32.94 ? 80  ILE F CG2 1 
ATOM 5266  C CD1 . ILE F 1 80  ? 87.989  107.374 29.667  1.00 33.00 ? 80  ILE F CD1 1 
ATOM 5267  N N   . VAL F 1 81  ? 93.769  108.734 30.555  1.00 32.73 ? 81  VAL F N   1 
ATOM 5268  C CA  . VAL F 1 81  ? 94.935  109.548 30.201  1.00 32.76 ? 81  VAL F CA  1 
ATOM 5269  C C   . VAL F 1 81  ? 94.793  110.076 28.778  1.00 32.87 ? 81  VAL F C   1 
ATOM 5270  O O   . VAL F 1 81  ? 94.811  111.287 28.550  1.00 32.99 ? 81  VAL F O   1 
ATOM 5271  C CB  . VAL F 1 81  ? 96.249  108.740 30.335  1.00 32.81 ? 81  VAL F CB  1 
ATOM 5272  C CG1 . VAL F 1 81  ? 97.440  109.495 29.746  1.00 32.88 ? 81  VAL F CG1 1 
ATOM 5273  C CG2 . VAL F 1 81  ? 96.508  108.392 31.795  1.00 32.82 ? 81  VAL F CG2 1 
ATOM 5274  N N   . SER F 1 82  ? 94.660  109.150 27.833  1.00 32.95 ? 82  SER F N   1 
ATOM 5275  C CA  . SER F 1 82  ? 94.531  109.484 26.415  1.00 33.10 ? 82  SER F CA  1 
ATOM 5276  C C   . SER F 1 82  ? 93.820  108.368 25.659  1.00 33.16 ? 82  SER F C   1 
ATOM 5277  O O   . SER F 1 82  ? 93.768  107.227 26.124  1.00 33.23 ? 82  SER F O   1 
ATOM 5278  C CB  . SER F 1 82  ? 95.909  109.739 25.801  1.00 33.14 ? 82  SER F CB  1 
ATOM 5279  O OG  . SER F 1 82  ? 96.768  108.626 25.988  1.00 33.18 ? 82  SER F OG  1 
ATOM 5280  N N   . ALA F 1 83  ? 93.276  108.713 24.495  1.00 33.30 ? 83  ALA F N   1 
ATOM 5281  C CA  . ALA F 1 83  ? 92.532  107.764 23.670  1.00 33.46 ? 83  ALA F CA  1 
ATOM 5282  C C   . ALA F 1 83  ? 92.559  108.170 22.200  1.00 33.71 ? 83  ALA F C   1 
ATOM 5283  O O   . ALA F 1 83  ? 91.745  108.981 21.752  1.00 33.85 ? 83  ALA F O   1 
ATOM 5284  C CB  . ALA F 1 83  ? 91.100  107.651 24.168  1.00 33.47 ? 83  ALA F CB  1 
ATOM 5285  N N   . SER F 1 84  ? 93.508  107.600 21.459  1.00 34.04 ? 84  SER F N   1 
ATOM 5286  C CA  . SER F 1 84  ? 93.595  107.786 20.011  1.00 34.33 ? 84  SER F CA  1 
ATOM 5287  C C   . SER F 1 84  ? 92.565  106.901 19.306  1.00 34.53 ? 84  SER F C   1 
ATOM 5288  O O   . SER F 1 84  ? 91.810  106.176 19.958  1.00 34.55 ? 84  SER F O   1 
ATOM 5289  C CB  . SER F 1 84  ? 95.013  107.466 19.520  1.00 34.48 ? 84  SER F CB  1 
ATOM 5290  O OG  . SER F 1 84  ? 95.319  106.091 19.675  1.00 34.54 ? 84  SER F OG  1 
ATOM 5291  N N   . ALA F 1 85  ? 92.532  106.969 17.977  1.00 35.05 ? 85  ALA F N   1 
ATOM 5292  C CA  . ALA F 1 85  ? 91.602  106.171 17.171  1.00 35.50 ? 85  ALA F CA  1 
ATOM 5293  C C   . ALA F 1 85  ? 91.738  104.659 17.391  1.00 35.79 ? 85  ALA F C   1 
ATOM 5294  O O   . ALA F 1 85  ? 90.730  103.951 17.429  1.00 35.91 ? 85  ALA F O   1 
ATOM 5295  C CB  . ALA F 1 85  ? 91.771  106.499 15.693  1.00 35.61 ? 85  ALA F CB  1 
ATOM 5296  N N   . ASN F 1 86  ? 92.976  104.182 17.536  1.00 36.15 ? 86  ASN F N   1 
ATOM 5297  C CA  . ASN F 1 86  ? 93.265  102.744 17.663  1.00 36.49 ? 86  ASN F CA  1 
ATOM 5298  C C   . ASN F 1 86  ? 94.030  102.367 18.947  1.00 36.55 ? 86  ASN F C   1 
ATOM 5299  O O   . ASN F 1 86  ? 94.729  101.350 18.973  1.00 36.63 ? 86  ASN F O   1 
ATOM 5300  C CB  . ASN F 1 86  ? 94.043  102.268 16.429  1.00 36.84 ? 86  ASN F CB  1 
ATOM 5301  C CG  . ASN F 1 86  ? 93.306  102.543 15.129  1.00 37.16 ? 86  ASN F CG  1 
ATOM 5302  O OD1 . ASN F 1 86  ? 93.088  103.695 14.758  1.00 37.25 ? 86  ASN F OD1 1 
ATOM 5303  N ND2 . ASN F 1 86  ? 92.931  101.480 14.424  1.00 37.45 ? 86  ASN F ND2 1 
ATOM 5304  N N   . SER F 1 87  ? 93.891  103.167 20.007  1.00 36.55 ? 87  SER F N   1 
ATOM 5305  C CA  . SER F 1 87  ? 94.497  102.849 21.310  1.00 36.52 ? 87  SER F CA  1 
ATOM 5306  C C   . SER F 1 87  ? 93.859  103.635 22.456  1.00 36.58 ? 87  SER F C   1 
ATOM 5307  O O   . SER F 1 87  ? 93.070  104.557 22.230  1.00 36.60 ? 87  SER F O   1 
ATOM 5308  C CB  . SER F 1 87  ? 96.006  103.124 21.285  1.00 36.53 ? 87  SER F CB  1 
ATOM 5309  O OG  . SER F 1 87  ? 96.628  102.664 22.473  1.00 36.60 ? 87  SER F OG  1 
ATOM 5310  N N   . TYR F 1 88  ? 94.209  103.253 23.684  1.00 36.69 ? 88  TYR F N   1 
ATOM 5311  C CA  . TYR F 1 88  ? 93.780  103.974 24.888  1.00 36.75 ? 88  TYR F CA  1 
ATOM 5312  C C   . TYR F 1 88  ? 94.674  103.684 26.094  1.00 37.06 ? 88  TYR F C   1 
ATOM 5313  O O   . TYR F 1 88  ? 95.426  102.706 26.105  1.00 37.14 ? 88  TYR F O   1 
ATOM 5314  C CB  . TYR F 1 88  ? 92.318  103.653 25.228  1.00 36.59 ? 88  TYR F CB  1 
ATOM 5315  C CG  . TYR F 1 88  ? 92.036  102.189 25.501  1.00 36.51 ? 88  TYR F CG  1 
ATOM 5316  C CD1 . TYR F 1 88  ? 92.173  101.656 26.783  1.00 36.43 ? 88  TYR F CD1 1 
ATOM 5317  C CD2 . TYR F 1 88  ? 91.615  101.337 24.479  1.00 36.53 ? 88  TYR F CD2 1 
ATOM 5318  C CE1 . TYR F 1 88  ? 91.913  100.318 27.039  1.00 36.37 ? 88  TYR F CE1 1 
ATOM 5319  C CE2 . TYR F 1 88  ? 91.350  99.996  24.726  1.00 36.49 ? 88  TYR F CE2 1 
ATOM 5320  C CZ  . TYR F 1 88  ? 91.500  99.491  26.007  1.00 36.40 ? 88  TYR F CZ  1 
ATOM 5321  O OH  . TYR F 1 88  ? 91.241  98.164  26.256  1.00 36.43 ? 88  TYR F OH  1 
ATOM 5322  N N   . CYS F 1 89  ? 94.579  104.551 27.100  1.00 37.62 ? 89  CYS F N   1 
ATOM 5323  C CA  . CYS F 1 89  ? 95.303  104.399 28.365  1.00 38.04 ? 89  CYS F CA  1 
ATOM 5324  C C   . CYS F 1 89  ? 94.433  104.935 29.502  1.00 37.48 ? 89  CYS F C   1 
ATOM 5325  O O   . CYS F 1 89  ? 94.090  106.118 29.514  1.00 37.51 ? 89  CYS F O   1 
ATOM 5326  C CB  . CYS F 1 89  ? 96.634  105.153 28.313  1.00 39.02 ? 89  CYS F CB  1 
ATOM 5327  S SG  . CYS F 1 89  ? 97.607  105.073 29.838  1.00 40.38 ? 89  CYS F SG  1 
ATOM 5328  N N   . MET F 1 90  ? 94.085  104.060 30.448  1.00 36.81 ? 90  MET F N   1 
ATOM 5329  C CA  . MET F 1 90  ? 93.189  104.398 31.555  1.00 36.33 ? 90  MET F CA  1 
ATOM 5330  C C   . MET F 1 90  ? 93.814  103.998 32.892  1.00 35.96 ? 90  MET F C   1 
ATOM 5331  O O   . MET F 1 90  ? 93.953  102.809 33.189  1.00 35.94 ? 90  MET F O   1 
ATOM 5332  C CB  . MET F 1 90  ? 91.836  103.698 31.379  1.00 36.33 ? 90  MET F CB  1 
ATOM 5333  C CG  . MET F 1 90  ? 91.203  103.890 30.009  1.00 36.32 ? 90  MET F CG  1 
ATOM 5334  S SD  . MET F 1 90  ? 89.496  103.314 29.934  1.00 36.31 ? 90  MET F SD  1 
ATOM 5335  C CE  . MET F 1 90  ? 89.712  101.557 30.202  1.00 36.30 ? 90  MET F CE  1 
ATOM 5336  N N   . ILE F 1 91  ? 94.197  105.000 33.685  1.00 35.57 ? 91  ILE F N   1 
ATOM 5337  C CA  . ILE F 1 91  ? 94.720  104.792 35.036  1.00 35.27 ? 91  ILE F CA  1 
ATOM 5338  C C   . ILE F 1 91  ? 93.568  104.898 36.039  1.00 34.97 ? 91  ILE F C   1 
ATOM 5339  O O   . ILE F 1 91  ? 92.684  105.745 35.890  1.00 35.06 ? 91  ILE F O   1 
ATOM 5340  C CB  . ILE F 1 91  ? 95.806  105.836 35.394  1.00 35.34 ? 91  ILE F CB  1 
ATOM 5341  C CG1 . ILE F 1 91  ? 96.932  105.850 34.343  1.00 35.48 ? 91  ILE F CG1 1 
ATOM 5342  C CG2 . ILE F 1 91  ? 96.367  105.586 36.794  1.00 35.37 ? 91  ILE F CG2 1 
ATOM 5343  C CD1 . ILE F 1 91  ? 97.691  104.546 34.190  1.00 35.54 ? 91  ILE F CD1 1 
ATOM 5344  N N   . ALA F 1 92  ? 93.587  104.034 37.051  1.00 34.64 ? 92  ALA F N   1 
ATOM 5345  C CA  . ALA F 1 92  ? 92.597  104.065 38.131  1.00 34.42 ? 92  ALA F CA  1 
ATOM 5346  C C   . ALA F 1 92  ? 93.156  103.427 39.401  1.00 34.21 ? 92  ALA F C   1 
ATOM 5347  O O   . ALA F 1 92  ? 94.003  102.532 39.335  1.00 34.13 ? 92  ALA F O   1 
ATOM 5348  C CB  . ALA F 1 92  ? 91.321  103.358 37.701  1.00 34.49 ? 92  ALA F CB  1 
ATOM 5349  N N   . GLY F 1 93  ? 92.672  103.894 40.549  1.00 34.02 ? 93  GLY F N   1 
ATOM 5350  C CA  . GLY F 1 93  ? 93.140  103.409 41.846  1.00 33.89 ? 93  GLY F CA  1 
ATOM 5351  C C   . GLY F 1 93  ? 92.238  103.804 43.000  1.00 33.77 ? 93  GLY F C   1 
ATOM 5352  O O   . GLY F 1 93  ? 91.546  104.823 42.938  1.00 33.83 ? 93  GLY F O   1 
ATOM 5353  N N   . HIS F 1 94  ? 92.259  102.988 44.052  1.00 33.62 ? 94  HIS F N   1 
ATOM 5354  C CA  . HIS F 1 94  ? 91.490  103.238 45.270  1.00 33.49 ? 94  HIS F CA  1 
ATOM 5355  C C   . HIS F 1 94  ? 92.370  104.028 46.240  1.00 33.50 ? 94  HIS F C   1 
ATOM 5356  O O   . HIS F 1 94  ? 93.596  103.898 46.216  1.00 33.61 ? 94  HIS F O   1 
ATOM 5357  C CB  . HIS F 1 94  ? 91.055  101.909 45.897  1.00 33.42 ? 94  HIS F CB  1 
ATOM 5358  C CG  . HIS F 1 94  ? 89.789  101.994 46.691  1.00 33.39 ? 94  HIS F CG  1 
ATOM 5359  N ND1 . HIS F 1 94  ? 88.568  101.589 46.195  1.00 33.41 ? 94  HIS F ND1 1 
ATOM 5360  C CD2 . HIS F 1 94  ? 89.550  102.464 47.938  1.00 33.38 ? 94  HIS F CD2 1 
ATOM 5361  C CE1 . HIS F 1 94  ? 87.636  101.792 47.108  1.00 33.44 ? 94  HIS F CE1 1 
ATOM 5362  N NE2 . HIS F 1 94  ? 88.205  102.320 48.176  1.00 33.41 ? 94  HIS F NE2 1 
ATOM 5363  N N   . SER F 1 95  ? 91.744  104.844 47.086  1.00 33.42 ? 95  SER F N   1 
ATOM 5364  C CA  . SER F 1 95  ? 92.476  105.692 48.036  1.00 33.30 ? 95  SER F CA  1 
ATOM 5365  C C   . SER F 1 95  ? 93.207  104.864 49.093  1.00 33.15 ? 95  SER F C   1 
ATOM 5366  O O   . SER F 1 95  ? 94.369  105.136 49.400  1.00 33.23 ? 95  SER F O   1 
ATOM 5367  C CB  . SER F 1 95  ? 91.535  106.695 48.711  1.00 33.39 ? 95  SER F CB  1 
ATOM 5368  O OG  . SER F 1 95  ? 90.525  106.034 49.449  1.00 33.47 ? 95  SER F OG  1 
ATOM 5369  N N   . GLY F 1 96  ? 92.515  103.863 49.640  1.00 32.96 ? 96  GLY F N   1 
ATOM 5370  C CA  . GLY F 1 96  ? 93.113  102.883 50.553  1.00 32.84 ? 96  GLY F CA  1 
ATOM 5371  C C   . GLY F 1 96  ? 93.334  101.533 49.896  1.00 32.59 ? 96  GLY F C   1 
ATOM 5372  O O   . GLY F 1 96  ? 92.932  100.501 50.439  1.00 32.56 ? 96  GLY F O   1 
ATOM 5373  N N   . GLY F 1 97  ? 93.972  101.547 48.726  1.00 32.33 ? 97  GLY F N   1 
ATOM 5374  C CA  . GLY F 1 97  ? 94.341  100.332 47.999  1.00 32.11 ? 97  GLY F CA  1 
ATOM 5375  C C   . GLY F 1 97  ? 95.813  100.018 48.189  1.00 31.91 ? 97  GLY F C   1 
ATOM 5376  O O   . GLY F 1 97  ? 96.407  100.393 49.204  1.00 31.98 ? 97  GLY F O   1 
ATOM 5377  N N   . THR F 1 98  ? 96.394  99.331  47.207  1.00 31.56 ? 98  THR F N   1 
ATOM 5378  C CA  . THR F 1 98  ? 97.814  98.974  47.217  1.00 31.30 ? 98  THR F CA  1 
ATOM 5379  C C   . THR F 1 98  ? 98.598  99.824  46.221  1.00 31.00 ? 98  THR F C   1 
ATOM 5380  O O   . THR F 1 98  ? 99.526  100.540 46.605  1.00 31.05 ? 98  THR F O   1 
ATOM 5381  C CB  . THR F 1 98  ? 98.016  97.485  46.879  1.00 31.35 ? 98  THR F CB  1 
ATOM 5382  O OG1 . THR F 1 98  ? 97.422  97.192  45.607  1.00 31.30 ? 98  THR F OG1 1 
ATOM 5383  C CG2 . THR F 1 98  ? 97.385  96.609  47.950  1.00 31.42 ? 98  THR F CG2 1 
ATOM 5384  N N   . VAL F 1 99  ? 98.215  99.735  44.948  1.00 30.61 ? 99  VAL F N   1 
ATOM 5385  C CA  . VAL F 1 99  ? 98.874  100.464 43.857  1.00 30.35 ? 99  VAL F CA  1 
ATOM 5386  C C   . VAL F 1 99  ? 97.866  100.900 42.793  1.00 30.06 ? 99  VAL F C   1 
ATOM 5387  O O   . VAL F 1 99  ? 96.719  100.445 42.787  1.00 30.16 ? 99  VAL F O   1 
ATOM 5388  C CB  . VAL F 1 99  ? 99.982  99.611  43.186  1.00 30.45 ? 99  VAL F CB  1 
ATOM 5389  C CG1 . VAL F 1 99  ? 101.215 99.530  44.075  1.00 30.52 ? 99  VAL F CG1 1 
ATOM 5390  C CG2 . VAL F 1 99  ? 99.478  98.212  42.842  1.00 30.52 ? 99  VAL F CG2 1 
ATOM 5391  N N   . TRP F 1 100 ? 98.306  101.783 41.900  1.00 29.73 ? 100 TRP F N   1 
ATOM 5392  C CA  . TRP F 1 100 ? 97.496  102.211 40.757  1.00 29.57 ? 100 TRP F CA  1 
ATOM 5393  C C   . TRP F 1 100 ? 97.423  101.096 39.717  1.00 29.76 ? 100 TRP F C   1 
ATOM 5394  O O   . TRP F 1 100 ? 98.377  100.333 39.548  1.00 29.91 ? 100 TRP F O   1 
ATOM 5395  C CB  . TRP F 1 100 ? 98.081  103.470 40.112  1.00 29.37 ? 100 TRP F CB  1 
ATOM 5396  C CG  . TRP F 1 100 ? 98.017  104.681 40.983  1.00 29.17 ? 100 TRP F CG  1 
ATOM 5397  C CD1 . TRP F 1 100 ? 98.942  105.080 41.902  1.00 29.08 ? 100 TRP F CD1 1 
ATOM 5398  C CD2 . TRP F 1 100 ? 96.972  105.659 41.014  1.00 28.95 ? 100 TRP F CD2 1 
ATOM 5399  N NE1 . TRP F 1 100 ? 98.538  106.246 42.507  1.00 28.98 ? 100 TRP F NE1 1 
ATOM 5400  C CE2 . TRP F 1 100 ? 97.332  106.623 41.981  1.00 28.90 ? 100 TRP F CE2 1 
ATOM 5401  C CE3 . TRP F 1 100 ? 95.765  105.812 40.320  1.00 28.91 ? 100 TRP F CE3 1 
ATOM 5402  C CZ2 . TRP F 1 100 ? 96.527  107.729 42.272  1.00 28.93 ? 100 TRP F CZ2 1 
ATOM 5403  C CZ3 . TRP F 1 100 ? 94.963  106.913 40.609  1.00 28.95 ? 100 TRP F CZ3 1 
ATOM 5404  C CH2 . TRP F 1 100 ? 95.351  107.857 41.579  1.00 28.96 ? 100 TRP F CH2 1 
ATOM 5405  N N   . PHE F 1 101 ? 96.286  101.014 39.030  1.00 29.96 ? 101 PHE F N   1 
ATOM 5406  C CA  . PHE F 1 101 ? 96.052  100.015 37.988  1.00 30.13 ? 101 PHE F CA  1 
ATOM 5407  C C   . PHE F 1 101 ? 95.876  100.709 36.642  1.00 30.19 ? 101 PHE F C   1 
ATOM 5408  O O   . PHE F 1 101 ? 95.036  101.600 36.512  1.00 30.31 ? 101 PHE F O   1 
ATOM 5409  C CB  . PHE F 1 101 ? 94.795  99.202  38.299  1.00 30.32 ? 101 PHE F CB  1 
ATOM 5410  C CG  . PHE F 1 101 ? 94.956  98.224  39.431  1.00 30.39 ? 101 PHE F CG  1 
ATOM 5411  C CD1 . PHE F 1 101 ? 94.996  98.662  40.751  1.00 30.53 ? 101 PHE F CD1 1 
ATOM 5412  C CD2 . PHE F 1 101 ? 95.043  96.855  39.180  1.00 30.42 ? 101 PHE F CD2 1 
ATOM 5413  C CE1 . PHE F 1 101 ? 95.137  97.761  41.796  1.00 30.59 ? 101 PHE F CE1 1 
ATOM 5414  C CE2 . PHE F 1 101 ? 95.182  95.950  40.221  1.00 30.54 ? 101 PHE F CE2 1 
ATOM 5415  C CZ  . PHE F 1 101 ? 95.230  96.403  41.532  1.00 30.60 ? 101 PHE F CZ  1 
ATOM 5416  N N   . ALA F 1 102 ? 96.672  100.299 35.655  1.00 30.37 ? 102 ALA F N   1 
ATOM 5417  C CA  . ALA F 1 102 ? 96.549  100.790 34.282  1.00 30.57 ? 102 ALA F CA  1 
ATOM 5418  C C   . ALA F 1 102 ? 95.603  99.898  33.484  1.00 30.78 ? 102 ALA F C   1 
ATOM 5419  O O   . ALA F 1 102 ? 95.189  98.836  33.959  1.00 30.81 ? 102 ALA F O   1 
ATOM 5420  C CB  . ALA F 1 102 ? 97.914  100.840 33.616  1.00 30.60 ? 102 ALA F CB  1 
ATOM 5421  N N   . ALA F 1 103 ? 95.263  100.337 32.274  1.00 31.11 ? 103 ALA F N   1 
ATOM 5422  C CA  . ALA F 1 103 ? 94.369  99.582  31.392  1.00 31.41 ? 103 ALA F CA  1 
ATOM 5423  C C   . ALA F 1 103 ? 94.524  100.013 29.931  1.00 31.72 ? 103 ALA F C   1 
ATOM 5424  O O   . ALA F 1 103 ? 94.000  101.053 29.524  1.00 31.76 ? 103 ALA F O   1 
ATOM 5425  C CB  . ALA F 1 103 ? 92.926  99.737  31.847  1.00 31.43 ? 103 ALA F CB  1 
ATOM 5426  N N   . THR F 1 104 ? 95.255  99.205  29.163  1.00 32.08 ? 104 THR F N   1 
ATOM 5427  C CA  . THR F 1 104 ? 95.489  99.429  27.734  1.00 32.34 ? 104 THR F CA  1 
ATOM 5428  C C   . THR F 1 104 ? 94.952  98.222  26.958  1.00 32.69 ? 104 THR F C   1 
ATOM 5429  O O   . THR F 1 104 ? 94.713  97.170  27.559  1.00 32.83 ? 104 THR F O   1 
ATOM 5430  C CB  . THR F 1 104 ? 96.998  99.606  27.445  1.00 32.41 ? 104 THR F CB  1 
ATOM 5431  O OG1 . THR F 1 104 ? 97.667  98.341  27.521  1.00 32.45 ? 104 THR F OG1 1 
ATOM 5432  C CG2 . THR F 1 104 ? 97.631  100.567 28.440  1.00 32.50 ? 104 THR F CG2 1 
ATOM 5433  N N   . PRO F 1 105 ? 94.756  98.359  25.627  1.00 33.13 ? 105 PRO F N   1 
ATOM 5434  C CA  . PRO F 1 105 ? 94.231  97.214  24.866  1.00 33.45 ? 105 PRO F CA  1 
ATOM 5435  C C   . PRO F 1 105 ? 95.233  96.066  24.683  1.00 33.95 ? 105 PRO F C   1 
ATOM 5436  O O   . PRO F 1 105 ? 94.839  94.902  24.782  1.00 34.10 ? 105 PRO F O   1 
ATOM 5437  C CB  . PRO F 1 105 ? 93.826  97.817  23.513  1.00 33.34 ? 105 PRO F CB  1 
ATOM 5438  C CG  . PRO F 1 105 ? 94.463  99.156  23.435  1.00 33.31 ? 105 PRO F CG  1 
ATOM 5439  C CD  . PRO F 1 105 ? 95.029  99.528  24.771  1.00 33.23 ? 105 PRO F CD  1 
ATOM 5440  N N   . ASP F 1 106 ? 96.501  96.390  24.425  1.00 34.61 ? 106 ASP F N   1 
ATOM 5441  C CA  . ASP F 1 106 ? 97.533  95.366  24.194  1.00 35.22 ? 106 ASP F CA  1 
ATOM 5442  C C   . ASP F 1 106 ? 97.929  94.586  25.457  1.00 35.56 ? 106 ASP F C   1 
ATOM 5443  O O   . ASP F 1 106 ? 98.087  93.364  25.398  1.00 35.76 ? 106 ASP F O   1 
ATOM 5444  C CB  . ASP F 1 106 ? 98.775  95.958  23.499  1.00 35.53 ? 106 ASP F CB  1 
ATOM 5445  C CG  . ASP F 1 106 ? 99.538  96.952  24.368  1.00 35.77 ? 106 ASP F CG  1 
ATOM 5446  O OD1 . ASP F 1 106 ? 98.902  97.662  25.177  1.00 35.93 ? 106 ASP F OD1 1 
ATOM 5447  O OD2 . ASP F 1 106 ? 100.778 97.025  24.232  1.00 35.86 ? 106 ASP F OD2 1 
ATOM 5448  N N   . LYS F 1 107 ? 98.079  95.285  26.582  1.00 35.96 ? 107 LYS F N   1 
ATOM 5449  C CA  . LYS F 1 107 ? 98.491  94.664  27.851  1.00 36.36 ? 107 LYS F CA  1 
ATOM 5450  C C   . LYS F 1 107 ? 97.321  94.272  28.762  1.00 36.64 ? 107 LYS F C   1 
ATOM 5451  O O   . LYS F 1 107 ? 97.522  93.545  29.737  1.00 36.62 ? 107 LYS F O   1 
ATOM 5452  C CB  . LYS F 1 107 ? 99.439  95.594  28.615  1.00 36.45 ? 107 LYS F CB  1 
ATOM 5453  C CG  . LYS F 1 107 ? 100.742 95.886  27.886  1.00 36.66 ? 107 LYS F CG  1 
ATOM 5454  C CD  . LYS F 1 107 ? 101.623 96.857  28.657  1.00 36.88 ? 107 LYS F CD  1 
ATOM 5455  C CE  . LYS F 1 107 ? 102.294 96.196  29.852  1.00 37.03 ? 107 LYS F CE  1 
ATOM 5456  N NZ  . LYS F 1 107 ? 103.237 97.120  30.540  1.00 37.12 ? 107 LYS F NZ  1 
ATOM 5457  N N   . GLY F 1 108 ? 96.113  94.748  28.453  1.00 37.06 ? 108 GLY F N   1 
ATOM 5458  C CA  . GLY F 1 108 ? 94.939  94.504  29.291  1.00 37.38 ? 108 GLY F CA  1 
ATOM 5459  C C   . GLY F 1 108 ? 94.973  95.353  30.548  1.00 37.66 ? 108 GLY F C   1 
ATOM 5460  O O   . GLY F 1 108 ? 95.627  96.398  30.576  1.00 37.75 ? 108 GLY F O   1 
ATOM 5461  N N   . VAL F 1 109 ? 94.265  94.903  31.581  1.00 38.04 ? 109 VAL F N   1 
ATOM 5462  C CA  . VAL F 1 109 ? 94.254  95.573  32.884  1.00 38.33 ? 109 VAL F CA  1 
ATOM 5463  C C   . VAL F 1 109 ? 95.370  94.982  33.747  1.00 38.62 ? 109 VAL F C   1 
ATOM 5464  O O   . VAL F 1 109 ? 95.345  93.790  34.058  1.00 38.77 ? 109 VAL F O   1 
ATOM 5465  C CB  . VAL F 1 109 ? 92.893  95.409  33.599  1.00 38.50 ? 109 VAL F CB  1 
ATOM 5466  C CG1 . VAL F 1 109 ? 92.896  96.128  34.948  1.00 38.57 ? 109 VAL F CG1 1 
ATOM 5467  C CG2 . VAL F 1 109 ? 91.760  95.922  32.715  1.00 38.56 ? 109 VAL F CG2 1 
ATOM 5468  N N   . TYR F 1 110 ? 96.340  95.818  34.119  1.00 38.99 ? 110 TYR F N   1 
ATOM 5469  C CA  . TYR F 1 110 ? 97.471  95.405  34.960  1.00 39.35 ? 110 TYR F CA  1 
ATOM 5470  C C   . TYR F 1 110 ? 97.788  96.461  36.016  1.00 39.82 ? 110 TYR F C   1 
ATOM 5471  O O   . TYR F 1 110 ? 97.290  97.588  35.946  1.00 40.04 ? 110 TYR F O   1 
ATOM 5472  C CB  . TYR F 1 110 ? 98.710  95.128  34.100  1.00 39.25 ? 110 TYR F CB  1 
ATOM 5473  C CG  . TYR F 1 110 ? 99.220  96.325  33.324  1.00 39.14 ? 110 TYR F CG  1 
ATOM 5474  C CD1 . TYR F 1 110 ? 98.668  96.667  32.090  1.00 39.13 ? 110 TYR F CD1 1 
ATOM 5475  C CD2 . TYR F 1 110 ? 100.264 97.110  33.818  1.00 39.09 ? 110 TYR F CD2 1 
ATOM 5476  C CE1 . TYR F 1 110 ? 99.132  97.760  31.373  1.00 39.07 ? 110 TYR F CE1 1 
ATOM 5477  C CE2 . TYR F 1 110 ? 100.736 98.206  33.108  1.00 39.10 ? 110 TYR F CE2 1 
ATOM 5478  C CZ  . TYR F 1 110 ? 100.167 98.526  31.886  1.00 39.11 ? 110 TYR F CZ  1 
ATOM 5479  O OH  . TYR F 1 110 ? 100.627 99.609  31.176  1.00 39.19 ? 110 TYR F OH  1 
ATOM 5480  N N   . LYS F 1 111 ? 98.626  96.084  36.981  1.00 40.42 ? 111 LYS F N   1 
ATOM 5481  C CA  . LYS F 1 111 ? 99.004  96.966  38.093  1.00 41.05 ? 111 LYS F CA  1 
ATOM 5482  C C   . LYS F 1 111 ? 100.430 97.491  37.925  1.00 41.38 ? 111 LYS F C   1 
ATOM 5483  O O   . LYS F 1 111 ? 101.320 96.757  37.491  1.00 41.54 ? 111 LYS F O   1 
ATOM 5484  C CB  . LYS F 1 111 ? 98.835  96.260  39.447  1.00 41.42 ? 111 LYS F CB  1 
ATOM 5485  C CG  . LYS F 1 111 ? 99.754  95.076  39.719  1.00 41.67 ? 111 LYS F CG  1 
ATOM 5486  C CD  . LYS F 1 111 ? 99.445  94.463  41.075  1.00 41.99 ? 111 LYS F CD  1 
ATOM 5487  C CE  . LYS F 1 111 ? 100.342 93.270  41.368  1.00 42.27 ? 111 LYS F CE  1 
ATOM 5488  N NZ  . LYS F 1 111 ? 100.064 92.648  42.695  1.00 42.33 ? 111 LYS F NZ  1 
ATOM 5489  N N   . THR F 1 112 ? 100.629 98.761  38.282  1.00 41.76 ? 112 THR F N   1 
ATOM 5490  C CA  . THR F 1 112 ? 101.927 99.436  38.147  1.00 42.19 ? 112 THR F CA  1 
ATOM 5491  C C   . THR F 1 112 ? 102.655 99.528  39.491  1.00 42.42 ? 112 THR F C   1 
ATOM 5492  O O   . THR F 1 112 ? 102.088 99.215  40.541  1.00 42.41 ? 112 THR F O   1 
ATOM 5493  C CB  . THR F 1 112 ? 101.780 100.842 37.506  1.00 42.41 ? 112 THR F CB  1 
ATOM 5494  O OG1 . THR F 1 112 ? 103.077 101.412 37.280  1.00 42.63 ? 112 THR F OG1 1 
ATOM 5495  C CG2 . THR F 1 112 ? 100.936 101.803 38.368  1.00 42.32 ? 112 THR F CG2 1 
ATOM 5496  N N   . ASN F 1 113 ? 103.912 99.966  39.440  1.00 42.76 ? 113 ASN F N   1 
ATOM 5497  C CA  . ASN F 1 113 ? 104.751 100.098 40.638  1.00 43.05 ? 113 ASN F CA  1 
ATOM 5498  C C   . ASN F 1 113 ? 104.399 101.307 41.514  1.00 43.07 ? 113 ASN F C   1 
ATOM 5499  O O   . ASN F 1 113 ? 104.776 101.340 42.688  1.00 43.14 ? 113 ASN F O   1 
ATOM 5500  C CB  . ASN F 1 113 ? 106.234 100.170 40.247  1.00 43.32 ? 113 ASN F CB  1 
ATOM 5501  C CG  . ASN F 1 113 ? 106.727 98.901  39.572  1.00 43.69 ? 113 ASN F CG  1 
ATOM 5502  O OD1 . ASN F 1 113 ? 105.939 98.033  39.187  1.00 43.88 ? 113 ASN F OD1 1 
ATOM 5503  N ND2 . ASN F 1 113 ? 108.042 98.788  39.421  1.00 43.95 ? 113 ASN F ND2 1 
ATOM 5504  N N   . THR F 1 114 ? 103.693 102.291 40.952  1.00 42.95 ? 114 THR F N   1 
ATOM 5505  C CA  . THR F 1 114 ? 103.323 103.509 41.681  1.00 42.92 ? 114 THR F CA  1 
ATOM 5506  C C   . THR F 1 114 ? 102.293 103.212 42.773  1.00 42.75 ? 114 THR F C   1 
ATOM 5507  O O   . THR F 1 114 ? 101.315 102.503 42.533  1.00 42.67 ? 114 THR F O   1 
ATOM 5508  C CB  . THR F 1 114 ? 102.749 104.583 40.730  1.00 43.06 ? 114 THR F CB  1 
ATOM 5509  O OG1 . THR F 1 114 ? 103.627 104.755 39.609  1.00 43.18 ? 114 THR F OG1 1 
ATOM 5510  C CG2 . THR F 1 114 ? 102.578 105.923 41.449  1.00 43.11 ? 114 THR F CG2 1 
ATOM 5511  N N   . ALA F 1 115 ? 102.523 103.765 43.965  1.00 42.77 ? 115 ALA F N   1 
ATOM 5512  C CA  . ALA F 1 115 ? 101.654 103.544 45.123  1.00 42.75 ? 115 ALA F CA  1 
ATOM 5513  C C   . ALA F 1 115 ? 100.475 104.513 45.129  1.00 42.74 ? 115 ALA F C   1 
ATOM 5514  O O   . ALA F 1 115 ? 100.554 105.606 44.562  1.00 42.81 ? 115 ALA F O   1 
ATOM 5515  C CB  . ALA F 1 115 ? 102.448 103.683 46.413  1.00 42.91 ? 115 ALA F CB  1 
ATOM 5516  N N   . VAL F 1 116 ? 99.391  104.103 45.784  1.00 42.90 ? 116 VAL F N   1 
ATOM 5517  C CA  . VAL F 1 116 ? 98.175  104.928 45.894  1.00 43.05 ? 116 VAL F CA  1 
ATOM 5518  C C   . VAL F 1 116 ? 98.372  106.165 46.780  1.00 43.55 ? 116 VAL F C   1 
ATOM 5519  O O   . VAL F 1 116 ? 97.683  107.172 46.596  1.00 43.76 ? 116 VAL F O   1 
ATOM 5520  C CB  . VAL F 1 116 ? 96.947  104.126 46.398  1.00 42.93 ? 116 VAL F CB  1 
ATOM 5521  C CG1 . VAL F 1 116 ? 96.646  102.959 45.462  1.00 42.89 ? 116 VAL F CG1 1 
ATOM 5522  C CG2 . VAL F 1 116 ? 97.122  103.662 47.846  1.00 42.98 ? 116 VAL F CG2 1 
ATOM 5523  N N   . THR F 1 117 ? 99.294  106.079 47.741  1.00 43.94 ? 117 THR F N   1 
ATOM 5524  C CA  . THR F 1 117 ? 99.700  107.237 48.545  1.00 44.22 ? 117 THR F CA  1 
ATOM 5525  C C   . THR F 1 117 ? 100.428 108.282 47.697  1.00 44.30 ? 117 THR F C   1 
ATOM 5526  O O   . THR F 1 117 ? 100.245 109.484 47.902  1.00 44.49 ? 117 THR F O   1 
ATOM 5527  C CB  . THR F 1 117 ? 100.611 106.825 49.720  1.00 44.54 ? 117 THR F CB  1 
ATOM 5528  O OG1 . THR F 1 117 ? 101.717 106.056 49.229  1.00 44.68 ? 117 THR F OG1 1 
ATOM 5529  C CG2 . THR F 1 117 ? 99.835  106.002 50.742  1.00 44.67 ? 117 THR F CG2 1 
ATOM 5530  N N   . SER F 1 118 ? 101.249 107.818 46.753  1.00 44.37 ? 118 SER F N   1 
ATOM 5531  C CA  . SER F 1 118 ? 101.912 108.698 45.784  1.00 44.50 ? 118 SER F CA  1 
ATOM 5532  C C   . SER F 1 118 ? 100.924 109.217 44.738  1.00 44.49 ? 118 SER F C   1 
ATOM 5533  O O   . SER F 1 118 ? 99.792  108.733 44.643  1.00 44.41 ? 118 SER F O   1 
ATOM 5534  C CB  . SER F 1 118 ? 103.062 107.962 45.087  1.00 44.61 ? 118 SER F CB  1 
ATOM 5535  O OG  . SER F 1 118 ? 103.998 107.470 46.031  1.00 44.73 ? 118 SER F OG  1 
ATOM 5536  N N   . SER F 1 119 ? 101.368 110.195 43.950  1.00 44.65 ? 119 SER F N   1 
ATOM 5537  C CA  . SER F 1 119 ? 100.516 110.847 42.948  1.00 44.77 ? 119 SER F CA  1 
ATOM 5538  C C   . SER F 1 119 ? 100.178 109.926 41.774  1.00 44.88 ? 119 SER F C   1 
ATOM 5539  O O   . SER F 1 119 ? 100.820 108.890 41.574  1.00 44.83 ? 119 SER F O   1 
ATOM 5540  C CB  . SER F 1 119 ? 101.183 112.121 42.425  1.00 44.90 ? 119 SER F CB  1 
ATOM 5541  O OG  . SER F 1 119 ? 100.299 112.861 41.599  1.00 44.99 ? 119 SER F OG  1 
ATOM 5542  N N   . GLN F 1 120 ? 99.166  110.325 41.004  1.00 44.97 ? 120 GLN F N   1 
ATOM 5543  C CA  . GLN F 1 120 ? 98.669  109.532 39.877  1.00 45.08 ? 120 GLN F CA  1 
ATOM 5544  C C   . GLN F 1 120 ? 99.709  109.466 38.751  1.00 45.31 ? 120 GLN F C   1 
ATOM 5545  O O   . GLN F 1 120 ? 100.321 110.487 38.428  1.00 45.67 ? 120 GLN F O   1 
ATOM 5546  C CB  . GLN F 1 120 ? 97.365  110.134 39.341  1.00 45.05 ? 120 GLN F CB  1 
ATOM 5547  C CG  . GLN F 1 120 ? 96.662  109.294 38.282  1.00 45.09 ? 120 GLN F CG  1 
ATOM 5548  C CD  . GLN F 1 120 ? 95.349  109.906 37.828  1.00 45.21 ? 120 GLN F CD  1 
ATOM 5549  O OE1 . GLN F 1 120 ? 94.500  110.265 38.645  1.00 45.22 ? 120 GLN F OE1 1 
ATOM 5550  N NE2 . GLN F 1 120 ? 95.173  110.024 36.516  1.00 45.29 ? 120 GLN F NE2 1 
ATOM 5551  N N   . PRO F 1 121 ? 99.927  108.266 38.165  1.00 45.40 ? 121 PRO F N   1 
ATOM 5552  C CA  . PRO F 1 121 ? 100.790 108.149 36.982  1.00 45.55 ? 121 PRO F CA  1 
ATOM 5553  C C   . PRO F 1 121 ? 100.298 108.978 35.792  1.00 45.58 ? 121 PRO F C   1 
ATOM 5554  O O   . PRO F 1 121 ? 99.104  108.962 35.483  1.00 45.53 ? 121 PRO F O   1 
ATOM 5555  C CB  . PRO F 1 121 ? 100.729 106.656 36.646  1.00 45.56 ? 121 PRO F CB  1 
ATOM 5556  C CG  . PRO F 1 121 ? 100.450 105.991 37.944  1.00 45.48 ? 121 PRO F CG  1 
ATOM 5557  C CD  . PRO F 1 121 ? 99.580  106.940 38.715  1.00 45.42 ? 121 PRO F CD  1 
ATOM 5558  N N   . GLU F 1 122 ? 101.218 109.694 35.146  1.00 45.76 ? 122 GLU F N   1 
ATOM 5559  C CA  . GLU F 1 122 ? 100.890 110.543 33.995  1.00 45.90 ? 122 GLU F CA  1 
ATOM 5560  C C   . GLU F 1 122 ? 100.516 109.712 32.771  1.00 45.50 ? 122 GLU F C   1 
ATOM 5561  O O   . GLU F 1 122 ? 99.555  110.038 32.074  1.00 45.42 ? 122 GLU F O   1 
ATOM 5562  C CB  . GLU F 1 122 ? 102.060 111.474 33.650  1.00 46.32 ? 122 GLU F CB  1 
ATOM 5563  C CG  . GLU F 1 122 ? 102.384 112.514 34.718  1.00 46.56 ? 122 GLU F CG  1 
ATOM 5564  C CD  . GLU F 1 122 ? 101.279 113.541 34.934  1.00 46.77 ? 122 GLU F CD  1 
ATOM 5565  O OE1 . GLU F 1 122 ? 100.459 113.765 34.016  1.00 46.76 ? 122 GLU F OE1 1 
ATOM 5566  O OE2 . GLU F 1 122 ? 101.235 114.134 36.032  1.00 46.96 ? 122 GLU F OE2 1 
ATOM 5567  N N   . SER F 1 123 ? 101.285 108.655 32.516  1.00 45.20 ? 123 SER F N   1 
ATOM 5568  C CA  . SER F 1 123 ? 101.000 107.699 31.442  1.00 45.03 ? 123 SER F CA  1 
ATOM 5569  C C   . SER F 1 123 ? 101.280 106.272 31.909  1.00 44.61 ? 123 SER F C   1 
ATOM 5570  O O   . SER F 1 123 ? 102.144 106.045 32.759  1.00 44.74 ? 123 SER F O   1 
ATOM 5571  C CB  . SER F 1 123 ? 101.846 108.017 30.207  1.00 45.23 ? 123 SER F CB  1 
ATOM 5572  O OG  . SER F 1 123 ? 101.506 107.173 29.121  1.00 45.30 ? 123 SER F OG  1 
ATOM 5573  N N   . CYS F 1 124 ? 100.543 105.319 31.341  1.00 44.10 ? 124 CYS F N   1 
ATOM 5574  C CA  . CYS F 1 124 ? 100.673 103.903 31.699  1.00 43.87 ? 124 CYS F CA  1 
ATOM 5575  C C   . CYS F 1 124 ? 101.996 103.319 31.175  1.00 44.47 ? 124 CYS F C   1 
ATOM 5576  O O   . CYS F 1 124 ? 102.493 103.772 30.142  1.00 44.77 ? 124 CYS F O   1 
ATOM 5577  C CB  . CYS F 1 124 ? 99.486  103.101 31.153  1.00 43.10 ? 124 CYS F CB  1 
ATOM 5578  S SG  . CYS F 1 124 ? 98.951  103.585 29.493  1.00 42.51 ? 124 CYS F SG  1 
ATOM 5579  N N   . PRO F 1 125 ? 102.575 102.322 31.887  1.00 44.93 ? 125 PRO F N   1 
ATOM 5580  C CA  . PRO F 1 125 ? 103.816 101.690 31.400  1.00 45.17 ? 125 PRO F CA  1 
ATOM 5581  C C   . PRO F 1 125 ? 103.664 100.903 30.092  1.00 45.54 ? 125 PRO F C   1 
ATOM 5582  O O   . PRO F 1 125 ? 104.660 100.550 29.458  1.00 45.78 ? 125 PRO F O   1 
ATOM 5583  C CB  . PRO F 1 125 ? 104.204 100.737 32.542  1.00 45.17 ? 125 PRO F CB  1 
ATOM 5584  C CG  . PRO F 1 125 ? 103.503 101.257 33.743  1.00 45.13 ? 125 PRO F CG  1 
ATOM 5585  C CD  . PRO F 1 125 ? 102.220 101.840 33.237  1.00 45.02 ? 125 PRO F CD  1 
ATOM 5586  O OXT . PRO F 1 125 ? 102.561 100.600 29.634  1.00 45.77 ? 125 PRO F OXT 1 
ATOM 5587  N N   . PHE G 1 1   ? 87.775  82.894  102.799 1.00 65.53 ? 1   PHE G N   1 
ATOM 5588  C CA  . PHE G 1 1   ? 86.721  83.268  101.812 1.00 65.24 ? 1   PHE G CA  1 
ATOM 5589  C C   . PHE G 1 1   ? 85.673  84.160  102.489 1.00 64.19 ? 1   PHE G C   1 
ATOM 5590  O O   . PHE G 1 1   ? 84.751  83.668  103.146 1.00 64.28 ? 1   PHE G O   1 
ATOM 5591  C CB  . PHE G 1 1   ? 86.081  82.003  101.215 1.00 66.00 ? 1   PHE G CB  1 
ATOM 5592  C CG  . PHE G 1 1   ? 85.495  82.198  99.839  1.00 66.66 ? 1   PHE G CG  1 
ATOM 5593  C CD1 . PHE G 1 1   ? 84.453  83.098  99.625  1.00 66.87 ? 1   PHE G CD1 1 
ATOM 5594  C CD2 . PHE G 1 1   ? 85.973  81.466  98.755  1.00 67.09 ? 1   PHE G CD2 1 
ATOM 5595  C CE1 . PHE G 1 1   ? 83.911  83.271  98.361  1.00 67.09 ? 1   PHE G CE1 1 
ATOM 5596  C CE2 . PHE G 1 1   ? 85.432  81.638  97.489  1.00 67.25 ? 1   PHE G CE2 1 
ATOM 5597  C CZ  . PHE G 1 1   ? 84.399  82.541  97.292  1.00 67.25 ? 1   PHE G CZ  1 
ATOM 5598  N N   . THR G 1 2   ? 85.823  85.473  102.315 1.00 62.81 ? 2   THR G N   1 
ATOM 5599  C CA  . THR G 1 2   ? 84.942  86.461  102.947 1.00 61.68 ? 2   THR G CA  1 
ATOM 5600  C C   . THR G 1 2   ? 83.657  86.673  102.147 1.00 60.37 ? 2   THR G C   1 
ATOM 5601  O O   . THR G 1 2   ? 83.528  86.194  101.018 1.00 60.21 ? 2   THR G O   1 
ATOM 5602  C CB  . THR G 1 2   ? 85.649  87.828  103.096 1.00 61.85 ? 2   THR G CB  1 
ATOM 5603  O OG1 . THR G 1 2   ? 86.087  88.285  101.812 1.00 61.94 ? 2   THR G OG1 1 
ATOM 5604  C CG2 . THR G 1 2   ? 86.849  87.728  104.027 1.00 61.91 ? 2   THR G CG2 1 
ATOM 5605  N N   . LEU G 1 3   ? 82.716  87.396  102.750 1.00 59.31 ? 3   LEU G N   1 
ATOM 5606  C CA  . LEU G 1 3   ? 81.495  87.828  102.066 1.00 58.56 ? 3   LEU G CA  1 
ATOM 5607  C C   . LEU G 1 3   ? 81.796  88.954  101.074 1.00 57.74 ? 3   LEU G C   1 
ATOM 5608  O O   . LEU G 1 3   ? 81.224  88.985  99.986  1.00 57.87 ? 3   LEU G O   1 
ATOM 5609  C CB  . LEU G 1 3   ? 80.438  88.288  103.079 1.00 58.65 ? 3   LEU G CB  1 
ATOM 5610  C CG  . LEU G 1 3   ? 79.046  88.660  102.552 1.00 58.84 ? 3   LEU G CG  1 
ATOM 5611  C CD1 . LEU G 1 3   ? 78.358  87.469  101.902 1.00 58.83 ? 3   LEU G CD1 1 
ATOM 5612  C CD2 . LEU G 1 3   ? 78.195  89.219  103.683 1.00 59.00 ? 3   LEU G CD2 1 
ATOM 5613  N N   . ILE G 1 4   ? 82.677  89.878  101.465 1.00 56.84 ? 4   ILE G N   1 
ATOM 5614  C CA  . ILE G 1 4   ? 83.125  90.970  100.582 1.00 56.10 ? 4   ILE G CA  1 
ATOM 5615  C C   . ILE G 1 4   ? 83.843  90.471  99.315  1.00 55.55 ? 4   ILE G C   1 
ATOM 5616  O O   . ILE G 1 4   ? 83.687  91.066  98.247  1.00 55.56 ? 4   ILE G O   1 
ATOM 5617  C CB  . ILE G 1 4   ? 83.998  92.015  101.346 1.00 56.16 ? 4   ILE G CB  1 
ATOM 5618  C CG1 . ILE G 1 4   ? 84.298  93.255  100.487 1.00 56.20 ? 4   ILE G CG1 1 
ATOM 5619  C CG2 . ILE G 1 4   ? 85.318  91.423  101.829 1.00 56.30 ? 4   ILE G CG2 1 
ATOM 5620  C CD1 . ILE G 1 4   ? 83.076  93.986  99.974  1.00 56.15 ? 4   ILE G CD1 1 
ATOM 5621  N N   . GLU G 1 5   ? 84.621  89.394  99.440  1.00 55.12 ? 5   GLU G N   1 
ATOM 5622  C CA  . GLU G 1 5   ? 85.277  88.766  98.283  1.00 54.70 ? 5   GLU G CA  1 
ATOM 5623  C C   . GLU G 1 5   ? 84.259  88.099  97.352  1.00 54.01 ? 5   GLU G C   1 
ATOM 5624  O O   . GLU G 1 5   ? 84.462  88.067  96.140  1.00 54.13 ? 5   GLU G O   1 
ATOM 5625  C CB  . GLU G 1 5   ? 86.337  87.754  98.741  1.00 54.98 ? 5   GLU G CB  1 
ATOM 5626  C CG  . GLU G 1 5   ? 87.152  87.123  97.615  1.00 55.44 ? 5   GLU G CG  1 
ATOM 5627  C CD  . GLU G 1 5   ? 86.641  85.755  97.189  1.00 55.80 ? 5   GLU G CD  1 
ATOM 5628  O OE1 . GLU G 1 5   ? 86.660  84.824  98.023  1.00 55.97 ? 5   GLU G OE1 1 
ATOM 5629  O OE2 . GLU G 1 5   ? 86.230  85.607  96.018  1.00 55.93 ? 5   GLU G OE2 1 
ATOM 5630  N N   . LEU G 1 6   ? 83.183  87.560  97.921  1.00 53.26 ? 6   LEU G N   1 
ATOM 5631  C CA  . LEU G 1 6   ? 82.064  87.030  97.137  1.00 52.82 ? 6   LEU G CA  1 
ATOM 5632  C C   . LEU G 1 6   ? 81.221  88.152  96.531  1.00 52.17 ? 6   LEU G C   1 
ATOM 5633  O O   . LEU G 1 6   ? 80.762  88.043  95.394  1.00 52.30 ? 6   LEU G O   1 
ATOM 5634  C CB  . LEU G 1 6   ? 81.175  86.141  98.014  1.00 53.07 ? 6   LEU G CB  1 
ATOM 5635  C CG  . LEU G 1 6   ? 80.090  85.289  97.342  1.00 53.25 ? 6   LEU G CG  1 
ATOM 5636  C CD1 . LEU G 1 6   ? 80.678  84.299  96.340  1.00 53.35 ? 6   LEU G CD1 1 
ATOM 5637  C CD2 . LEU G 1 6   ? 79.260  84.571  98.402  1.00 53.36 ? 6   LEU G CD2 1 
ATOM 5638  N N   . LEU G 1 7   ? 81.018  89.220  97.303  1.00 51.68 ? 7   LEU G N   1 
ATOM 5639  C CA  . LEU G 1 7   ? 80.185  90.357  96.898  1.00 51.18 ? 7   LEU G CA  1 
ATOM 5640  C C   . LEU G 1 7   ? 80.763  91.134  95.715  1.00 50.46 ? 7   LEU G C   1 
ATOM 5641  O O   . LEU G 1 7   ? 80.017  91.525  94.815  1.00 50.55 ? 7   LEU G O   1 
ATOM 5642  C CB  . LEU G 1 7   ? 79.976  91.299  98.091  1.00 51.54 ? 7   LEU G CB  1 
ATOM 5643  C CG  . LEU G 1 7   ? 79.074  92.526  97.930  1.00 52.00 ? 7   LEU G CG  1 
ATOM 5644  C CD1 . LEU G 1 7   ? 77.693  92.148  97.416  1.00 52.25 ? 7   LEU G CD1 1 
ATOM 5645  C CD2 . LEU G 1 7   ? 78.976  93.250  99.266  1.00 52.11 ? 7   LEU G CD2 1 
ATOM 5646  N N   . ILE G 1 8   ? 82.077  91.364  95.728  1.00 49.67 ? 8   ILE G N   1 
ATOM 5647  C CA  . ILE G 1 8   ? 82.762  92.011  94.596  1.00 48.95 ? 8   ILE G CA  1 
ATOM 5648  C C   . ILE G 1 8   ? 82.763  91.132  93.338  1.00 48.10 ? 8   ILE G C   1 
ATOM 5649  O O   . ILE G 1 8   ? 82.673  91.655  92.231  1.00 48.25 ? 8   ILE G O   1 
ATOM 5650  C CB  . ILE G 1 8   ? 84.204  92.476  94.951  1.00 49.08 ? 8   ILE G CB  1 
ATOM 5651  C CG1 . ILE G 1 8   ? 84.730  93.447  93.880  1.00 49.31 ? 8   ILE G CG1 1 
ATOM 5652  C CG2 . ILE G 1 8   ? 85.151  91.293  95.129  1.00 49.12 ? 8   ILE G CG2 1 
ATOM 5653  C CD1 . ILE G 1 8   ? 85.959  94.233  94.291  1.00 49.49 ? 8   ILE G CD1 1 
ATOM 5654  N N   . VAL G 1 9   ? 82.854  89.813  93.512  1.00 47.27 ? 9   VAL G N   1 
ATOM 5655  C CA  . VAL G 1 9   ? 82.751  88.864  92.390  1.00 46.73 ? 9   VAL G CA  1 
ATOM 5656  C C   . VAL G 1 9   ? 81.358  88.915  91.744  1.00 46.19 ? 9   VAL G C   1 
ATOM 5657  O O   . VAL G 1 9   ? 81.244  88.835  90.521  1.00 46.23 ? 9   VAL G O   1 
ATOM 5658  C CB  . VAL G 1 9   ? 83.114  87.420  92.830  1.00 46.84 ? 9   VAL G CB  1 
ATOM 5659  C CG1 . VAL G 1 9   ? 82.718  86.382  91.784  1.00 46.95 ? 9   VAL G CG1 1 
ATOM 5660  C CG2 . VAL G 1 9   ? 84.607  87.321  93.116  1.00 46.91 ? 9   VAL G CG2 1 
ATOM 5661  N N   . ILE G 1 10  ? 80.317  89.052  92.565  1.00 45.60 ? 10  ILE G N   1 
ATOM 5662  C CA  . ILE G 1 10  ? 78.945  89.239  92.073  1.00 45.28 ? 10  ILE G CA  1 
ATOM 5663  C C   . ILE G 1 10  ? 78.811  90.573  91.319  1.00 44.89 ? 10  ILE G C   1 
ATOM 5664  O O   . ILE G 1 10  ? 78.113  90.644  90.306  1.00 44.97 ? 10  ILE G O   1 
ATOM 5665  C CB  . ILE G 1 10  ? 77.908  89.147  93.227  1.00 45.46 ? 10  ILE G CB  1 
ATOM 5666  C CG1 . ILE G 1 10  ? 77.867  87.719  93.794  1.00 45.68 ? 10  ILE G CG1 1 
ATOM 5667  C CG2 . ILE G 1 10  ? 76.507  89.546  92.761  1.00 45.52 ? 10  ILE G CG2 1 
ATOM 5668  C CD1 . ILE G 1 10  ? 77.313  87.626  95.202  1.00 45.81 ? 10  ILE G CD1 1 
ATOM 5669  N N   . ALA G 1 11  ? 79.481  91.613  91.817  1.00 44.53 ? 11  ALA G N   1 
ATOM 5670  C CA  . ALA G 1 11  ? 79.487  92.932  91.172  1.00 44.37 ? 11  ALA G CA  1 
ATOM 5671  C C   . ALA G 1 11  ? 80.157  92.933  89.794  1.00 44.14 ? 11  ALA G C   1 
ATOM 5672  O O   . ALA G 1 11  ? 79.660  93.578  88.869  1.00 44.27 ? 11  ALA G O   1 
ATOM 5673  C CB  . ALA G 1 11  ? 80.154  93.962  92.075  1.00 44.52 ? 11  ALA G CB  1 
ATOM 5674  N N   . ILE G 1 12  ? 81.274  92.215  89.665  1.00 43.94 ? 12  ILE G N   1 
ATOM 5675  C CA  . ILE G 1 12  ? 82.011  92.127  88.394  1.00 43.88 ? 12  ILE G CA  1 
ATOM 5676  C C   . ILE G 1 12  ? 81.256  91.286  87.352  1.00 43.93 ? 12  ILE G C   1 
ATOM 5677  O O   . ILE G 1 12  ? 81.291  91.610  86.164  1.00 44.27 ? 12  ILE G O   1 
ATOM 5678  C CB  . ILE G 1 12  ? 83.452  91.582  88.603  1.00 43.83 ? 12  ILE G CB  1 
ATOM 5679  C CG1 . ILE G 1 12  ? 84.277  92.528  89.494  1.00 44.06 ? 12  ILE G CG1 1 
ATOM 5680  C CG2 . ILE G 1 12  ? 84.173  91.352  87.273  1.00 43.85 ? 12  ILE G CG2 1 
ATOM 5681  C CD1 . ILE G 1 12  ? 84.443  93.944  88.979  1.00 44.26 ? 12  ILE G CD1 1 
ATOM 5682  N N   . ILE G 1 13  ? 80.576  90.226  87.791  1.00 43.69 ? 13  ILE G N   1 
ATOM 5683  C CA  . ILE G 1 13  ? 79.743  89.402  86.896  1.00 43.60 ? 13  ILE G CA  1 
ATOM 5684  C C   . ILE G 1 13  ? 78.622  90.236  86.252  1.00 43.55 ? 13  ILE G C   1 
ATOM 5685  O O   . ILE G 1 13  ? 78.314  90.050  85.073  1.00 43.61 ? 13  ILE G O   1 
ATOM 5686  C CB  . ILE G 1 13  ? 79.165  88.159  87.629  1.00 43.76 ? 13  ILE G CB  1 
ATOM 5687  C CG1 . ILE G 1 13  ? 80.290  87.171  87.967  1.00 43.92 ? 13  ILE G CG1 1 
ATOM 5688  C CG2 . ILE G 1 13  ? 78.111  87.438  86.783  1.00 43.84 ? 13  ILE G CG2 1 
ATOM 5689  C CD1 . ILE G 1 13  ? 79.968  86.237  89.115  1.00 44.05 ? 13  ILE G CD1 1 
ATOM 5690  N N   . ALA G 1 14  ? 78.027  91.146  87.024  1.00 43.61 ? 14  ALA G N   1 
ATOM 5691  C CA  . ALA G 1 14  ? 77.011  92.075  86.508  1.00 43.68 ? 14  ALA G CA  1 
ATOM 5692  C C   . ALA G 1 14  ? 77.565  93.033  85.448  1.00 43.73 ? 14  ALA G C   1 
ATOM 5693  O O   . ALA G 1 14  ? 76.865  93.367  84.489  1.00 43.84 ? 14  ALA G O   1 
ATOM 5694  C CB  . ALA G 1 14  ? 76.387  92.864  87.652  1.00 43.75 ? 14  ALA G CB  1 
ATOM 5695  N N   . ILE G 1 15  ? 78.812  93.469  85.632  1.00 43.74 ? 15  ILE G N   1 
ATOM 5696  C CA  . ILE G 1 15  ? 79.493  94.350  84.674  1.00 43.83 ? 15  ILE G CA  1 
ATOM 5697  C C   . ILE G 1 15  ? 79.860  93.590  83.397  1.00 43.79 ? 15  ILE G C   1 
ATOM 5698  O O   . ILE G 1 15  ? 79.588  94.066  82.292  1.00 43.92 ? 15  ILE G O   1 
ATOM 5699  C CB  . ILE G 1 15  ? 80.765  94.990  85.291  1.00 44.00 ? 15  ILE G CB  1 
ATOM 5700  C CG1 . ILE G 1 15  ? 80.390  95.900  86.470  1.00 44.22 ? 15  ILE G CG1 1 
ATOM 5701  C CG2 . ILE G 1 15  ? 81.539  95.798  84.249  1.00 44.10 ? 15  ILE G CG2 1 
ATOM 5702  C CD1 . ILE G 1 15  ? 81.534  96.189  87.419  1.00 44.27 ? 15  ILE G CD1 1 
ATOM 5703  N N   . LEU G 1 16  ? 80.484  92.424  83.560  1.00 43.76 ? 16  LEU G N   1 
ATOM 5704  C CA  . LEU G 1 16  ? 80.887  91.580  82.421  1.00 43.77 ? 16  LEU G CA  1 
ATOM 5705  C C   . LEU G 1 16  ? 79.699  91.052  81.606  1.00 43.68 ? 16  LEU G C   1 
ATOM 5706  O O   . LEU G 1 16  ? 79.800  90.923  80.385  1.00 43.80 ? 16  LEU G O   1 
ATOM 5707  C CB  . LEU G 1 16  ? 81.780  90.412  82.883  1.00 43.94 ? 16  LEU G CB  1 
ATOM 5708  C CG  . LEU G 1 16  ? 83.293  90.670  82.955  1.00 44.26 ? 16  LEU G CG  1 
ATOM 5709  C CD1 . LEU G 1 16  ? 83.646  92.000  83.610  1.00 44.40 ? 16  LEU G CD1 1 
ATOM 5710  C CD2 . LEU G 1 16  ? 83.985  89.518  83.673  1.00 44.39 ? 16  LEU G CD2 1 
ATOM 5711  N N   . ALA G 1 17  ? 78.588  90.750  82.278  1.00 43.48 ? 17  ALA G N   1 
ATOM 5712  C CA  . ALA G 1 17  ? 77.365  90.284  81.606  1.00 43.36 ? 17  ALA G CA  1 
ATOM 5713  C C   . ALA G 1 17  ? 76.702  91.355  80.730  1.00 43.29 ? 17  ALA G C   1 
ATOM 5714  O O   . ALA G 1 17  ? 75.987  91.020  79.783  1.00 43.40 ? 17  ALA G O   1 
ATOM 5715  C CB  . ALA G 1 17  ? 76.365  89.757  82.628  1.00 43.38 ? 17  ALA G CB  1 
ATOM 5716  N N   . ALA G 1 18  ? 76.925  92.629  81.053  1.00 43.01 ? 18  ALA G N   1 
ATOM 5717  C CA  . ALA G 1 18  ? 76.389  93.742  80.268  1.00 42.88 ? 18  ALA G CA  1 
ATOM 5718  C C   . ALA G 1 18  ? 77.254  94.039  79.045  1.00 42.74 ? 18  ALA G C   1 
ATOM 5719  O O   . ALA G 1 18  ? 76.755  94.062  77.918  1.00 42.83 ? 18  ALA G O   1 
ATOM 5720  C CB  . ALA G 1 18  ? 76.267  94.986  81.136  1.00 42.97 ? 18  ALA G CB  1 
ATOM 5721  N N   . VAL G 1 19  ? 78.548  94.257  79.278  1.00 42.61 ? 19  VAL G N   1 
ATOM 5722  C CA  . VAL G 1 19  ? 79.463  94.747  78.231  1.00 42.61 ? 19  VAL G CA  1 
ATOM 5723  C C   . VAL G 1 19  ? 79.874  93.700  77.187  1.00 42.56 ? 19  VAL G C   1 
ATOM 5724  O O   . VAL G 1 19  ? 79.967  94.021  76.000  1.00 42.66 ? 19  VAL G O   1 
ATOM 5725  C CB  . VAL G 1 19  ? 80.737  95.415  78.825  1.00 42.69 ? 19  VAL G CB  1 
ATOM 5726  C CG1 . VAL G 1 19  ? 80.356  96.534  79.788  1.00 42.75 ? 19  VAL G CG1 1 
ATOM 5727  C CG2 . VAL G 1 19  ? 81.665  94.402  79.496  1.00 42.69 ? 19  VAL G CG2 1 
ATOM 5728  N N   . LEU G 1 20  ? 80.111  92.461  77.621  1.00 42.47 ? 20  LEU G N   1 
ATOM 5729  C CA  . LEU G 1 20  ? 80.634  91.411  76.732  1.00 42.47 ? 20  LEU G CA  1 
ATOM 5730  C C   . LEU G 1 20  ? 79.589  90.815  75.782  1.00 42.21 ? 20  LEU G C   1 
ATOM 5731  O O   . LEU G 1 20  ? 79.954  90.251  74.747  1.00 42.16 ? 20  LEU G O   1 
ATOM 5732  C CB  . LEU G 1 20  ? 81.292  90.292  77.547  1.00 42.79 ? 20  LEU G CB  1 
ATOM 5733  C CG  . LEU G 1 20  ? 82.442  90.694  78.477  1.00 43.17 ? 20  LEU G CG  1 
ATOM 5734  C CD1 . LEU G 1 20  ? 82.877  89.505  79.319  1.00 43.27 ? 20  LEU G CD1 1 
ATOM 5735  C CD2 . LEU G 1 20  ? 83.620  91.244  77.687  1.00 43.25 ? 20  LEU G CD2 1 
ATOM 5736  N N   . ILE G 1 21  ? 78.306  90.930  76.132  1.00 41.85 ? 21  ILE G N   1 
ATOM 5737  C CA  . ILE G 1 21  ? 77.212  90.452  75.277  1.00 41.51 ? 21  ILE G CA  1 
ATOM 5738  C C   . ILE G 1 21  ? 77.062  91.455  74.121  1.00 41.13 ? 21  ILE G C   1 
ATOM 5739  O O   . ILE G 1 21  ? 76.741  92.620  74.365  1.00 41.33 ? 21  ILE G O   1 
ATOM 5740  C CB  . ILE G 1 21  ? 75.878  90.303  76.066  1.00 41.75 ? 21  ILE G CB  1 
ATOM 5741  C CG1 . ILE G 1 21  ? 75.848  88.999  76.886  1.00 41.94 ? 21  ILE G CG1 1 
ATOM 5742  C CG2 . ILE G 1 21  ? 74.667  90.274  75.134  1.00 41.83 ? 21  ILE G CG2 1 
ATOM 5743  C CD1 . ILE G 1 21  ? 77.062  88.708  77.747  1.00 42.01 ? 21  ILE G CD1 1 
ATOM 5744  N N   . PRO G 1 22  ? 77.293  91.010  72.866  1.00 40.49 ? 22  PRO G N   1 
ATOM 5745  C CA  . PRO G 1 22  ? 77.268  91.935  71.730  1.00 40.05 ? 22  PRO G CA  1 
ATOM 5746  C C   . PRO G 1 22  ? 75.855  92.286  71.263  1.00 39.58 ? 22  PRO G C   1 
ATOM 5747  O O   . PRO G 1 22  ? 74.879  91.681  71.716  1.00 39.64 ? 22  PRO G O   1 
ATOM 5748  C CB  . PRO G 1 22  ? 78.001  91.151  70.643  1.00 40.17 ? 22  PRO G CB  1 
ATOM 5749  C CG  . PRO G 1 22  ? 77.640  89.735  70.924  1.00 40.35 ? 22  PRO G CG  1 
ATOM 5750  C CD  . PRO G 1 22  ? 77.522  89.621  72.421  1.00 40.46 ? 22  PRO G CD  1 
ATOM 5751  N N   . ASN G 1 23  ? 75.766  93.261  70.358  1.00 38.96 ? 23  ASN G N   1 
ATOM 5752  C CA  . ASN G 1 23  ? 74.497  93.647  69.742  1.00 38.42 ? 23  ASN G CA  1 
ATOM 5753  C C   . ASN G 1 23  ? 74.091  92.568  68.736  1.00 38.17 ? 23  ASN G C   1 
ATOM 5754  O O   . ASN G 1 23  ? 74.678  92.462  67.656  1.00 38.30 ? 23  ASN G O   1 
ATOM 5755  C CB  . ASN G 1 23  ? 74.623  95.018  69.062  1.00 38.26 ? 23  ASN G CB  1 
ATOM 5756  C CG  . ASN G 1 23  ? 73.277  95.618  68.683  1.00 38.22 ? 23  ASN G CG  1 
ATOM 5757  O OD1 . ASN G 1 23  ? 72.464  94.984  68.010  1.00 38.19 ? 23  ASN G OD1 1 
ATOM 5758  N ND2 . ASN G 1 23  ? 73.043  96.855  69.105  1.00 38.32 ? 23  ASN G ND2 1 
ATOM 5759  N N   . LEU G 1 24  ? 73.095  91.765  69.108  1.00 37.77 ? 24  LEU G N   1 
ATOM 5760  C CA  . LEU G 1 24  ? 72.642  90.646  68.280  1.00 37.53 ? 24  LEU G CA  1 
ATOM 5761  C C   . LEU G 1 24  ? 71.802  91.117  67.094  1.00 37.24 ? 24  LEU G C   1 
ATOM 5762  O O   . LEU G 1 24  ? 72.026  90.674  65.969  1.00 37.38 ? 24  LEU G O   1 
ATOM 5763  C CB  . LEU G 1 24  ? 71.843  89.640  69.116  1.00 37.66 ? 24  LEU G CB  1 
ATOM 5764  C CG  . LEU G 1 24  ? 72.573  88.989  70.298  1.00 37.78 ? 24  LEU G CG  1 
ATOM 5765  C CD1 . LEU G 1 24  ? 71.586  88.261  71.198  1.00 37.90 ? 24  LEU G CD1 1 
ATOM 5766  C CD2 . LEU G 1 24  ? 73.662  88.036  69.828  1.00 37.72 ? 24  LEU G CD2 1 
ATOM 5767  N N   . LEU G 1 25  ? 70.850  92.016  67.352  1.00 36.76 ? 25  LEU G N   1 
ATOM 5768  C CA  . LEU G 1 25  ? 69.922  92.510  66.323  1.00 36.40 ? 25  LEU G CA  1 
ATOM 5769  C C   . LEU G 1 25  ? 70.642  93.142  65.134  1.00 35.85 ? 25  LEU G C   1 
ATOM 5770  O O   . LEU G 1 25  ? 70.271  92.901  63.985  1.00 35.80 ? 25  LEU G O   1 
ATOM 5771  C CB  . LEU G 1 25  ? 68.935  93.525  66.918  1.00 36.59 ? 25  LEU G CB  1 
ATOM 5772  C CG  . LEU G 1 25  ? 67.816  94.050  66.006  1.00 36.81 ? 25  LEU G CG  1 
ATOM 5773  C CD1 . LEU G 1 25  ? 66.882  92.926  65.583  1.00 36.91 ? 25  LEU G CD1 1 
ATOM 5774  C CD2 . LEU G 1 25  ? 67.037  95.162  66.693  1.00 36.92 ? 25  LEU G CD2 1 
ATOM 5775  N N   . ALA G 1 26  ? 71.663  93.947  65.421  1.00 35.52 ? 26  ALA G N   1 
ATOM 5776  C CA  . ALA G 1 26  ? 72.454  94.609  64.380  1.00 35.27 ? 26  ALA G CA  1 
ATOM 5777  C C   . ALA G 1 26  ? 73.281  93.610  63.566  1.00 34.96 ? 26  ALA G C   1 
ATOM 5778  O O   . ALA G 1 26  ? 73.385  93.742  62.346  1.00 34.98 ? 26  ALA G O   1 
ATOM 5779  C CB  . ALA G 1 26  ? 73.355  95.677  64.991  1.00 35.29 ? 26  ALA G CB  1 
ATOM 5780  N N   . ALA G 1 27  ? 73.856  92.616  64.241  1.00 34.79 ? 27  ALA G N   1 
ATOM 5781  C CA  . ALA G 1 27  ? 74.638  91.561  63.581  1.00 34.77 ? 27  ALA G CA  1 
ATOM 5782  C C   . ALA G 1 27  ? 73.818  90.744  62.576  1.00 34.60 ? 27  ALA G C   1 
ATOM 5783  O O   . ALA G 1 27  ? 74.327  90.378  61.516  1.00 34.63 ? 27  ALA G O   1 
ATOM 5784  C CB  . ALA G 1 27  ? 75.263  90.638  64.618  1.00 34.88 ? 27  ALA G CB  1 
ATOM 5785  N N   . ARG G 1 28  ? 72.558  90.464  62.915  1.00 34.46 ? 28  ARG G N   1 
ATOM 5786  C CA  . ARG G 1 28  ? 71.662  89.703  62.035  1.00 34.32 ? 28  ARG G CA  1 
ATOM 5787  C C   . ARG G 1 28  ? 71.196  90.497  60.810  1.00 34.16 ? 28  ARG G C   1 
ATOM 5788  O O   . ARG G 1 28  ? 71.012  89.911  59.744  1.00 34.28 ? 28  ARG G O   1 
ATOM 5789  C CB  . ARG G 1 28  ? 70.445  89.181  62.806  1.00 34.46 ? 28  ARG G CB  1 
ATOM 5790  C CG  . ARG G 1 28  ? 70.791  88.209  63.923  1.00 34.64 ? 28  ARG G CG  1 
ATOM 5791  C CD  . ARG G 1 28  ? 69.610  87.330  64.308  1.00 34.76 ? 28  ARG G CD  1 
ATOM 5792  N NE  . ARG G 1 28  ? 69.493  86.155  63.444  1.00 34.86 ? 28  ARG G NE  1 
ATOM 5793  C CZ  . ARG G 1 28  ? 70.263  85.064  63.512  1.00 35.08 ? 28  ARG G CZ  1 
ATOM 5794  N NH1 . ARG G 1 28  ? 70.051  84.060  62.666  1.00 35.19 ? 28  ARG G NH1 1 
ATOM 5795  N NH2 . ARG G 1 28  ? 71.246  84.960  64.410  1.00 35.14 ? 28  ARG G NH2 1 
ATOM 5796  N N   . LYS G 1 29  ? 70.999  91.811  60.963  1.00 34.02 ? 29  LYS G N   1 
ATOM 5797  C CA  . LYS G 1 29  ? 70.585  92.688  59.847  1.00 33.92 ? 29  LYS G CA  1 
ATOM 5798  C C   . LYS G 1 29  ? 71.476  92.560  58.609  1.00 33.86 ? 29  LYS G C   1 
ATOM 5799  O O   . LYS G 1 29  ? 70.972  92.500  57.487  1.00 34.02 ? 29  LYS G O   1 
ATOM 5800  C CB  . LYS G 1 29  ? 70.551  94.164  60.274  1.00 33.96 ? 29  LYS G CB  1 
ATOM 5801  C CG  . LYS G 1 29  ? 69.310  94.587  61.043  1.00 34.05 ? 29  LYS G CG  1 
ATOM 5802  C CD  . LYS G 1 29  ? 69.194  96.105  61.082  1.00 34.19 ? 29  LYS G CD  1 
ATOM 5803  C CE  . LYS G 1 29  ? 68.038  96.571  61.955  1.00 34.36 ? 29  LYS G CE  1 
ATOM 5804  N NZ  . LYS G 1 29  ? 68.371  96.577  63.408  1.00 34.43 ? 29  LYS G NZ  1 
ATOM 5805  N N   . ARG G 1 30  ? 72.790  92.515  58.823  1.00 33.59 ? 30  ARG G N   1 
ATOM 5806  C CA  . ARG G 1 30  ? 73.760  92.427  57.724  1.00 33.40 ? 30  ARG G CA  1 
ATOM 5807  C C   . ARG G 1 30  ? 73.812  91.021  57.128  1.00 33.27 ? 30  ARG G C   1 
ATOM 5808  O O   . ARG G 1 30  ? 74.027  90.867  55.924  1.00 33.42 ? 30  ARG G O   1 
ATOM 5809  C CB  . ARG G 1 30  ? 75.157  92.854  58.187  1.00 33.43 ? 30  ARG G CB  1 
ATOM 5810  C CG  . ARG G 1 30  ? 75.240  94.232  58.837  1.00 33.49 ? 30  ARG G CG  1 
ATOM 5811  C CD  . ARG G 1 30  ? 74.786  95.362  57.920  1.00 33.56 ? 30  ARG G CD  1 
ATOM 5812  N NE  . ARG G 1 30  ? 74.692  96.644  58.621  1.00 33.57 ? 30  ARG G NE  1 
ATOM 5813  C CZ  . ARG G 1 30  ? 74.341  97.801  58.055  1.00 33.63 ? 30  ARG G CZ  1 
ATOM 5814  N NH1 . ARG G 1 30  ? 74.043  97.869  56.757  1.00 33.65 ? 30  ARG G NH1 1 
ATOM 5815  N NH2 . ARG G 1 30  ? 74.289  98.907  58.794  1.00 33.67 ? 30  ARG G NH2 1 
ATOM 5816  N N   . ALA G 1 31  ? 73.631  90.008  57.973  1.00 32.98 ? 31  ALA G N   1 
ATOM 5817  C CA  . ALA G 1 31  ? 73.489  88.625  57.513  1.00 32.87 ? 31  ALA G CA  1 
ATOM 5818  C C   . ALA G 1 31  ? 72.201  88.429  56.711  1.00 32.84 ? 31  ALA G C   1 
ATOM 5819  O O   . ALA G 1 31  ? 72.187  87.678  55.735  1.00 32.95 ? 31  ALA G O   1 
ATOM 5820  C CB  . ALA G 1 31  ? 73.522  87.669  58.694  1.00 32.90 ? 31  ALA G CB  1 
ATOM 5821  N N   . ASN G 1 32  ? 71.128  89.097  57.135  1.00 32.86 ? 32  ASN G N   1 
ATOM 5822  C CA  . ASN G 1 32  ? 69.853  89.092  56.405  1.00 32.92 ? 32  ASN G CA  1 
ATOM 5823  C C   . ASN G 1 32  ? 69.950  89.776  55.036  1.00 33.12 ? 32  ASN G C   1 
ATOM 5824  O O   . ASN G 1 32  ? 69.280  89.357  54.089  1.00 33.24 ? 32  ASN G O   1 
ATOM 5825  C CB  . ASN G 1 32  ? 68.744  89.760  57.235  1.00 32.83 ? 32  ASN G CB  1 
ATOM 5826  C CG  . ASN G 1 32  ? 68.316  88.930  58.438  1.00 32.76 ? 32  ASN G CG  1 
ATOM 5827  O OD1 . ASN G 1 32  ? 68.254  87.704  58.359  1.00 32.77 ? 32  ASN G OD1 1 
ATOM 5828  N ND2 . ASN G 1 32  ? 68.025  89.589  59.556  1.00 32.81 ? 32  ASN G ND2 1 
ATOM 5829  N N   . ASP G 1 33  ? 70.768  90.826  54.941  1.00 33.25 ? 33  ASP G N   1 
ATOM 5830  C CA  . ASP G 1 33  ? 71.046  91.489  53.657  1.00 33.42 ? 33  ASP G CA  1 
ATOM 5831  C C   . ASP G 1 33  ? 71.804  90.574  52.693  1.00 33.48 ? 33  ASP G C   1 
ATOM 5832  O O   . ASP G 1 33  ? 71.564  90.614  51.484  1.00 33.61 ? 33  ASP G O   1 
ATOM 5833  C CB  . ASP G 1 33  ? 71.851  92.779  53.862  1.00 33.64 ? 33  ASP G CB  1 
ATOM 5834  C CG  . ASP G 1 33  ? 71.072  93.859  54.601  1.00 33.90 ? 33  ASP G CG  1 
ATOM 5835  O OD1 . ASP G 1 33  ? 69.829  93.765  54.713  1.00 33.97 ? 33  ASP G OD1 1 
ATOM 5836  O OD2 . ASP G 1 33  ? 71.717  94.819  55.075  1.00 34.02 ? 33  ASP G OD2 1 
ATOM 5837  N N   . THR G 1 34  ? 72.717  89.765  53.232  1.00 33.41 ? 34  THR G N   1 
ATOM 5838  C CA  . THR G 1 34  ? 73.456  88.775  52.442  1.00 33.36 ? 34  THR G CA  1 
ATOM 5839  C C   . THR G 1 34  ? 72.534  87.703  51.848  1.00 33.33 ? 34  THR G C   1 
ATOM 5840  O O   . THR G 1 34  ? 72.766  87.246  50.731  1.00 33.44 ? 34  THR G O   1 
ATOM 5841  C CB  . THR G 1 34  ? 74.549  88.079  53.285  1.00 33.50 ? 34  THR G CB  1 
ATOM 5842  O OG1 . THR G 1 34  ? 75.287  89.060  54.024  1.00 33.50 ? 34  THR G OG1 1 
ATOM 5843  C CG2 . THR G 1 34  ? 75.510  87.284  52.400  1.00 33.60 ? 34  THR G CG2 1 
ATOM 5844  N N   . VAL G 1 35  ? 71.500  87.317  52.598  1.00 33.30 ? 35  VAL G N   1 
ATOM 5845  C CA  . VAL G 1 35  ? 70.496  86.349  52.126  1.00 33.32 ? 35  VAL G CA  1 
ATOM 5846  C C   . VAL G 1 35  ? 69.671  86.935  50.975  1.00 33.25 ? 35  VAL G C   1 
ATOM 5847  O O   . VAL G 1 35  ? 69.387  86.239  49.998  1.00 33.36 ? 35  VAL G O   1 
ATOM 5848  C CB  . VAL G 1 35  ? 69.560  85.887  53.276  1.00 33.52 ? 35  VAL G CB  1 
ATOM 5849  C CG1 . VAL G 1 35  ? 68.398  85.039  52.756  1.00 33.63 ? 35  VAL G CG1 1 
ATOM 5850  C CG2 . VAL G 1 35  ? 70.342  85.106  54.323  1.00 33.60 ? 35  VAL G CG2 1 
ATOM 5851  N N   . VAL G 1 36  ? 69.293  88.207  51.102  1.00 33.13 ? 36  VAL G N   1 
ATOM 5852  C CA  . VAL G 1 36  ? 68.528  88.910  50.065  1.00 33.03 ? 36  VAL G CA  1 
ATOM 5853  C C   . VAL G 1 36  ? 69.389  89.155  48.822  1.00 33.02 ? 36  VAL G C   1 
ATOM 5854  O O   . VAL G 1 36  ? 68.923  88.963  47.698  1.00 33.10 ? 36  VAL G O   1 
ATOM 5855  C CB  . VAL G 1 36  ? 67.955  90.253  50.588  1.00 33.02 ? 36  VAL G CB  1 
ATOM 5856  C CG1 . VAL G 1 36  ? 67.323  91.067  49.463  1.00 33.08 ? 36  VAL G CG1 1 
ATOM 5857  C CG2 . VAL G 1 36  ? 66.933  90.005  51.690  1.00 33.01 ? 36  VAL G CG2 1 
ATOM 5858  N N   . THR G 1 37  ? 70.634  89.583  49.035  1.00 33.06 ? 37  THR G N   1 
ATOM 5859  C CA  . THR G 1 37  ? 71.583  89.812  47.941  1.00 33.11 ? 37  THR G CA  1 
ATOM 5860  C C   . THR G 1 37  ? 71.938  88.513  47.211  1.00 33.10 ? 37  THR G C   1 
ATOM 5861  O O   . THR G 1 37  ? 72.050  88.508  45.985  1.00 33.26 ? 37  THR G O   1 
ATOM 5862  C CB  . THR G 1 37  ? 72.881  90.481  48.447  1.00 33.23 ? 37  THR G CB  1 
ATOM 5863  O OG1 . THR G 1 37  ? 72.557  91.658  49.197  1.00 33.31 ? 37  THR G OG1 1 
ATOM 5864  C CG2 . THR G 1 37  ? 73.800  90.863  47.282  1.00 33.28 ? 37  THR G CG2 1 
ATOM 5865  N N   . ALA G 1 38  ? 72.111  87.427  47.965  1.00 33.05 ? 38  ALA G N   1 
ATOM 5866  C CA  . ALA G 1 38  ? 72.407  86.111  47.386  1.00 33.10 ? 38  ALA G CA  1 
ATOM 5867  C C   . ALA G 1 38  ? 71.242  85.559  46.567  1.00 33.09 ? 38  ALA G C   1 
ATOM 5868  O O   . ALA G 1 38  ? 71.455  85.020  45.481  1.00 33.10 ? 38  ALA G O   1 
ATOM 5869  C CB  . ALA G 1 38  ? 72.790  85.119  48.477  1.00 33.16 ? 38  ALA G CB  1 
ATOM 5870  N N   . TYR G 1 39  ? 70.023  85.694  47.090  1.00 33.22 ? 39  TYR G N   1 
ATOM 5871  C CA  . TYR G 1 39  ? 68.821  85.210  46.400  1.00 33.27 ? 39  TYR G CA  1 
ATOM 5872  C C   . TYR G 1 39  ? 68.522  86.002  45.125  1.00 33.48 ? 39  TYR G C   1 
ATOM 5873  O O   . TYR G 1 39  ? 68.094  85.422  44.127  1.00 33.64 ? 39  TYR G O   1 
ATOM 5874  C CB  . TYR G 1 39  ? 67.602  85.233  47.326  1.00 33.19 ? 39  TYR G CB  1 
ATOM 5875  C CG  . TYR G 1 39  ? 66.434  84.436  46.786  1.00 33.27 ? 39  TYR G CG  1 
ATOM 5876  C CD1 . TYR G 1 39  ? 66.397  83.046  46.911  1.00 33.33 ? 39  TYR G CD1 1 
ATOM 5877  C CD2 . TYR G 1 39  ? 65.370  85.065  46.139  1.00 33.35 ? 39  TYR G CD2 1 
ATOM 5878  C CE1 . TYR G 1 39  ? 65.333  82.307  46.413  1.00 33.32 ? 39  TYR G CE1 1 
ATOM 5879  C CE2 . TYR G 1 39  ? 64.300  84.334  45.639  1.00 33.36 ? 39  TYR G CE2 1 
ATOM 5880  C CZ  . TYR G 1 39  ? 64.285  82.957  45.777  1.00 33.36 ? 39  TYR G CZ  1 
ATOM 5881  O OH  . TYR G 1 39  ? 63.227  82.230  45.283  1.00 33.46 ? 39  TYR G OH  1 
ATOM 5882  N N   . LEU G 1 40  ? 68.741  87.317  45.167  1.00 33.68 ? 40  LEU G N   1 
ATOM 5883  C CA  . LEU G 1 40  ? 68.638  88.162  43.970  1.00 33.88 ? 40  LEU G CA  1 
ATOM 5884  C C   . LEU G 1 40  ? 69.752  87.867  42.963  1.00 34.31 ? 40  LEU G C   1 
ATOM 5885  O O   . LEU G 1 40  ? 69.510  87.884  41.757  1.00 34.49 ? 40  LEU G O   1 
ATOM 5886  C CB  . LEU G 1 40  ? 68.650  89.650  44.336  1.00 33.80 ? 40  LEU G CB  1 
ATOM 5887  C CG  . LEU G 1 40  ? 67.390  90.190  45.018  1.00 33.73 ? 40  LEU G CG  1 
ATOM 5888  C CD1 . LEU G 1 40  ? 67.669  91.557  45.616  1.00 33.66 ? 40  LEU G CD1 1 
ATOM 5889  C CD2 . LEU G 1 40  ? 66.219  90.265  44.048  1.00 33.70 ? 40  LEU G CD2 1 
ATOM 5890  N N   . ASN G 1 41  ? 70.962  87.605  43.461  1.00 34.79 ? 41  ASN G N   1 
ATOM 5891  C CA  . ASN G 1 41  ? 72.085  87.191  42.611  1.00 35.15 ? 41  ASN G CA  1 
ATOM 5892  C C   . ASN G 1 41  ? 71.802  85.848  41.929  1.00 35.40 ? 41  ASN G C   1 
ATOM 5893  O O   . ASN G 1 41  ? 72.153  85.660  40.763  1.00 35.49 ? 41  ASN G O   1 
ATOM 5894  C CB  . ASN G 1 41  ? 73.384  87.111  43.425  1.00 35.34 ? 41  ASN G CB  1 
ATOM 5895  C CG  . ASN G 1 41  ? 74.608  86.842  42.563  1.00 35.61 ? 41  ASN G CG  1 
ATOM 5896  O OD1 . ASN G 1 41  ? 74.783  87.442  41.502  1.00 35.79 ? 41  ASN G OD1 1 
ATOM 5897  N ND2 . ASN G 1 41  ? 75.468  85.939  43.024  1.00 35.71 ? 41  ASN G ND2 1 
ATOM 5898  N N   . ASP G 1 42  ? 71.171  84.927  42.659  1.00 35.76 ? 42  ASP G N   1 
ATOM 5899  C CA  . ASP G 1 42  ? 70.698  83.660  42.086  1.00 36.04 ? 42  ASP G CA  1 
ATOM 5900  C C   . ASP G 1 42  ? 69.527  83.876  41.126  1.00 36.01 ? 42  ASP G C   1 
ATOM 5901  O O   . ASP G 1 42  ? 69.466  83.240  40.074  1.00 36.17 ? 42  ASP G O   1 
ATOM 5902  C CB  . ASP G 1 42  ? 70.285  82.671  43.188  1.00 36.32 ? 42  ASP G CB  1 
ATOM 5903  C CG  . ASP G 1 42  ? 71.464  82.187  44.026  1.00 36.66 ? 42  ASP G CG  1 
ATOM 5904  O OD1 . ASP G 1 42  ? 72.562  81.964  43.469  1.00 36.82 ? 42  ASP G OD1 1 
ATOM 5905  O OD2 . ASP G 1 42  ? 71.286  82.019  45.251  1.00 36.78 ? 42  ASP G OD2 1 
ATOM 5906  N N   . ALA G 1 43  ? 68.606  84.769  41.491  1.00 35.92 ? 43  ALA G N   1 
ATOM 5907  C CA  . ALA G 1 43  ? 67.453  85.107  40.645  1.00 35.94 ? 43  ALA G CA  1 
ATOM 5908  C C   . ALA G 1 43  ? 67.860  85.688  39.289  1.00 36.00 ? 43  ALA G C   1 
ATOM 5909  O O   . ALA G 1 43  ? 67.216  85.406  38.280  1.00 36.16 ? 43  ALA G O   1 
ATOM 5910  C CB  . ALA G 1 43  ? 66.525  86.073  41.370  1.00 35.95 ? 43  ALA G CB  1 
ATOM 5911  N N   . VAL G 1 44  ? 68.921  86.495  39.276  1.00 36.18 ? 44  VAL G N   1 
ATOM 5912  C CA  . VAL G 1 44  ? 69.476  87.058  38.035  1.00 36.35 ? 44  VAL G CA  1 
ATOM 5913  C C   . VAL G 1 44  ? 70.033  85.961  37.113  1.00 36.53 ? 44  VAL G C   1 
ATOM 5914  O O   . VAL G 1 44  ? 69.896  86.057  35.892  1.00 36.62 ? 44  VAL G O   1 
ATOM 5915  C CB  . VAL G 1 44  ? 70.558  88.135  38.338  1.00 36.45 ? 44  VAL G CB  1 
ATOM 5916  C CG1 . VAL G 1 44  ? 71.337  88.535  37.086  1.00 36.57 ? 44  VAL G CG1 1 
ATOM 5917  C CG2 . VAL G 1 44  ? 69.922  89.368  38.978  1.00 36.45 ? 44  VAL G CG2 1 
ATOM 5918  N N   . LYS G 1 45  ? 70.650  84.931  37.695  1.00 36.84 ? 45  LYS G N   1 
ATOM 5919  C CA  . LYS G 1 45  ? 71.201  83.811  36.920  1.00 37.12 ? 45  LYS G CA  1 
ATOM 5920  C C   . LYS G 1 45  ? 70.111  83.005  36.214  1.00 37.00 ? 45  LYS G C   1 
ATOM 5921  O O   . LYS G 1 45  ? 70.212  82.744  35.015  1.00 37.15 ? 45  LYS G O   1 
ATOM 5922  C CB  . LYS G 1 45  ? 72.043  82.885  37.808  1.00 37.49 ? 45  LYS G CB  1 
ATOM 5923  C CG  . LYS G 1 45  ? 73.326  83.519  38.324  1.00 37.82 ? 45  LYS G CG  1 
ATOM 5924  C CD  . LYS G 1 45  ? 73.922  82.732  39.483  1.00 38.10 ? 45  LYS G CD  1 
ATOM 5925  C CE  . LYS G 1 45  ? 75.105  83.464  40.098  1.00 38.33 ? 45  LYS G CE  1 
ATOM 5926  N NZ  . LYS G 1 45  ? 75.626  82.784  41.317  1.00 38.49 ? 45  LYS G NZ  1 
ATOM 5927  N N   . PHE G 1 46  ? 69.075  82.624  36.958  1.00 36.90 ? 46  PHE G N   1 
ATOM 5928  C CA  . PHE G 1 46  ? 67.955  81.857  36.392  1.00 36.84 ? 46  PHE G CA  1 
ATOM 5929  C C   . PHE G 1 46  ? 67.041  82.672  35.468  1.00 36.81 ? 46  PHE G C   1 
ATOM 5930  O O   . PHE G 1 46  ? 66.281  82.090  34.691  1.00 36.96 ? 46  PHE G O   1 
ATOM 5931  C CB  . PHE G 1 46  ? 67.147  81.169  37.500  1.00 36.83 ? 46  PHE G CB  1 
ATOM 5932  C CG  . PHE G 1 46  ? 67.845  79.980  38.095  1.00 36.90 ? 46  PHE G CG  1 
ATOM 5933  C CD1 . PHE G 1 46  ? 67.848  78.761  37.427  1.00 37.06 ? 46  PHE G CD1 1 
ATOM 5934  C CD2 . PHE G 1 46  ? 68.515  80.078  39.309  1.00 36.99 ? 46  PHE G CD2 1 
ATOM 5935  C CE1 . PHE G 1 46  ? 68.500  77.659  37.961  1.00 37.14 ? 46  PHE G CE1 1 
ATOM 5936  C CE2 . PHE G 1 46  ? 69.166  78.979  39.852  1.00 37.16 ? 46  PHE G CE2 1 
ATOM 5937  C CZ  . PHE G 1 46  ? 69.161  77.767  39.176  1.00 37.19 ? 46  PHE G CZ  1 
ATOM 5938  N N   . GLN G 1 47  ? 67.105  84.003  35.555  1.00 36.77 ? 47  GLN G N   1 
ATOM 5939  C CA  . GLN G 1 47  ? 66.478  84.878  34.554  1.00 36.82 ? 47  GLN G CA  1 
ATOM 5940  C C   . GLN G 1 47  ? 67.206  84.786  33.210  1.00 37.07 ? 47  GLN G C   1 
ATOM 5941  O O   . GLN G 1 47  ? 66.563  84.767  32.158  1.00 37.28 ? 47  GLN G O   1 
ATOM 5942  C CB  . GLN G 1 47  ? 66.434  86.337  35.031  1.00 36.79 ? 47  GLN G CB  1 
ATOM 5943  C CG  . GLN G 1 47  ? 65.341  86.632  36.050  1.00 36.85 ? 47  GLN G CG  1 
ATOM 5944  C CD  . GLN G 1 47  ? 63.992  86.939  35.420  1.00 36.98 ? 47  GLN G CD  1 
ATOM 5945  O OE1 . GLN G 1 47  ? 63.624  86.365  34.394  1.00 37.07 ? 47  GLN G OE1 1 
ATOM 5946  N NE2 . GLN G 1 47  ? 63.245  87.844  36.041  1.00 37.07 ? 47  GLN G NE2 1 
ATOM 5947  N N   . GLU G 1 48  ? 68.538  84.737  33.252  1.00 37.41 ? 48  GLU G N   1 
ATOM 5948  C CA  . GLU G 1 48  ? 69.358  84.546  32.047  1.00 37.74 ? 48  GLU G CA  1 
ATOM 5949  C C   . GLU G 1 48  ? 69.208  83.144  31.448  1.00 37.83 ? 48  GLU G C   1 
ATOM 5950  O O   . GLU G 1 48  ? 69.312  82.981  30.233  1.00 38.01 ? 48  GLU G O   1 
ATOM 5951  C CB  . GLU G 1 48  ? 70.839  84.832  32.334  1.00 38.07 ? 48  GLU G CB  1 
ATOM 5952  C CG  . GLU G 1 48  ? 71.153  86.285  32.674  1.00 38.39 ? 48  GLU G CG  1 
ATOM 5953  C CD  . GLU G 1 48  ? 71.041  87.226  31.482  1.00 38.68 ? 48  GLU G CD  1 
ATOM 5954  O OE1 . GLU G 1 48  ? 71.581  86.904  30.401  1.00 38.76 ? 48  GLU G OE1 1 
ATOM 5955  O OE2 . GLU G 1 48  ? 70.420  88.301  31.631  1.00 38.77 ? 48  GLU G OE2 1 
ATOM 5956  N N   . MET G 1 49  ? 68.979  82.139  32.295  1.00 37.94 ? 49  MET G N   1 
ATOM 5957  C CA  . MET G 1 49  ? 68.720  80.769  31.827  1.00 38.06 ? 49  MET G CA  1 
ATOM 5958  C C   . MET G 1 49  ? 67.362  80.633  31.132  1.00 37.98 ? 49  MET G C   1 
ATOM 5959  O O   . MET G 1 49  ? 67.234  79.870  30.173  1.00 38.26 ? 49  MET G O   1 
ATOM 5960  C CB  . MET G 1 49  ? 68.821  79.768  32.980  1.00 38.24 ? 49  MET G CB  1 
ATOM 5961  C CG  . MET G 1 49  ? 70.241  79.574  33.485  1.00 38.47 ? 49  MET G CG  1 
ATOM 5962  S SD  . MET G 1 49  ? 70.359  78.531  34.949  1.00 38.86 ? 49  MET G SD  1 
ATOM 5963  C CE  . MET G 1 49  ? 69.736  76.979  34.310  1.00 38.96 ? 49  MET G CE  1 
ATOM 5964  N N   . TYR G 1 50  ? 66.360  81.361  31.620  1.00 37.79 ? 50  TYR G N   1 
ATOM 5965  C CA  . TYR G 1 50  ? 65.049  81.423  30.964  1.00 37.80 ? 50  TYR G CA  1 
ATOM 5966  C C   . TYR G 1 50  ? 65.118  82.205  29.645  1.00 38.04 ? 50  TYR G C   1 
ATOM 5967  O O   . TYR G 1 50  ? 64.373  81.907  28.707  1.00 38.25 ? 50  TYR G O   1 
ATOM 5968  C CB  . TYR G 1 50  ? 64.010  82.054  31.893  1.00 37.76 ? 50  TYR G CB  1 
ATOM 5969  C CG  . TYR G 1 50  ? 62.576  81.800  31.483  1.00 37.79 ? 50  TYR G CG  1 
ATOM 5970  C CD1 . TYR G 1 50  ? 61.909  82.669  30.620  1.00 37.66 ? 50  TYR G CD1 1 
ATOM 5971  C CD2 . TYR G 1 50  ? 61.875  80.698  31.975  1.00 37.87 ? 50  TYR G CD2 1 
ATOM 5972  C CE1 . TYR G 1 50  ? 60.591  82.443  30.249  1.00 37.67 ? 50  TYR G CE1 1 
ATOM 5973  C CE2 . TYR G 1 50  ? 60.556  80.464  31.610  1.00 37.85 ? 50  TYR G CE2 1 
ATOM 5974  C CZ  . TYR G 1 50  ? 59.918  81.339  30.748  1.00 37.80 ? 50  TYR G CZ  1 
ATOM 5975  O OH  . TYR G 1 50  ? 58.612  81.111  30.380  1.00 37.98 ? 50  TYR G OH  1 
ATOM 5976  N N   . GLN G 1 51  ? 65.998  83.204  29.588  1.00 38.31 ? 51  GLN G N   1 
ATOM 5977  C CA  . GLN G 1 51  ? 66.267  83.965  28.360  1.00 38.55 ? 51  GLN G CA  1 
ATOM 5978  C C   . GLN G 1 51  ? 66.881  83.093  27.255  1.00 38.78 ? 51  GLN G C   1 
ATOM 5979  O O   . GLN G 1 51  ? 66.635  83.333  26.072  1.00 38.94 ? 51  GLN G O   1 
ATOM 5980  C CB  . GLN G 1 51  ? 67.185  85.159  28.668  1.00 38.73 ? 51  GLN G CB  1 
ATOM 5981  C CG  . GLN G 1 51  ? 67.381  86.162  27.535  1.00 38.88 ? 51  GLN G CG  1 
ATOM 5982  C CD  . GLN G 1 51  ? 66.126  86.945  27.197  1.00 38.88 ? 51  GLN G CD  1 
ATOM 5983  O OE1 . GLN G 1 51  ? 65.442  87.457  28.081  1.00 38.93 ? 51  GLN G OE1 1 
ATOM 5984  N NE2 . GLN G 1 51  ? 65.832  87.062  25.908  1.00 38.97 ? 51  GLN G NE2 1 
ATOM 5985  N N   . ILE G 1 52  ? 67.680  82.097  27.640  1.00 38.96 ? 52  ILE G N   1 
ATOM 5986  C CA  . ILE G 1 52  ? 68.238  81.122  26.691  1.00 39.19 ? 52  ILE G CA  1 
ATOM 5987  C C   . ILE G 1 52  ? 67.132  80.241  26.094  1.00 39.35 ? 52  ILE G C   1 
ATOM 5988  O O   . ILE G 1 52  ? 67.127  79.982  24.888  1.00 39.50 ? 52  ILE G O   1 
ATOM 5989  C CB  . ILE G 1 52  ? 69.339  80.246  27.347  1.00 39.24 ? 52  ILE G CB  1 
ATOM 5990  C CG1 . ILE G 1 52  ? 70.562  81.106  27.697  1.00 39.33 ? 52  ILE G CG1 1 
ATOM 5991  C CG2 . ILE G 1 52  ? 69.770  79.101  26.429  1.00 39.29 ? 52  ILE G CG2 1 
ATOM 5992  C CD1 . ILE G 1 52  ? 71.452  80.521  28.775  1.00 39.33 ? 52  ILE G CD1 1 
ATOM 5993  N N   . ASP G 1 53  ? 66.201  79.796  26.938  1.00 39.54 ? 53  ASP G N   1 
ATOM 5994  C CA  . ASP G 1 53  ? 65.124  78.896  26.512  1.00 39.77 ? 53  ASP G CA  1 
ATOM 5995  C C   . ASP G 1 53  ? 64.033  79.620  25.725  1.00 39.75 ? 53  ASP G C   1 
ATOM 5996  O O   . ASP G 1 53  ? 63.779  79.291  24.564  1.00 39.95 ? 53  ASP G O   1 
ATOM 5997  C CB  . ASP G 1 53  ? 64.500  78.193  27.725  1.00 40.03 ? 53  ASP G CB  1 
ATOM 5998  C CG  . ASP G 1 53  ? 65.484  77.292  28.456  1.00 40.34 ? 53  ASP G CG  1 
ATOM 5999  O OD1 . ASP G 1 53  ? 66.707  77.422  28.231  1.00 40.49 ? 53  ASP G OD1 1 
ATOM 6000  O OD2 . ASP G 1 53  ? 65.031  76.454  29.265  1.00 40.58 ? 53  ASP G OD2 1 
ATOM 6001  N N   . ASN G 1 54  ? 63.407  80.609  26.362  1.00 39.52 ? 54  ASN G N   1 
ATOM 6002  C CA  . ASN G 1 54  ? 62.190  81.248  25.840  1.00 39.56 ? 54  ASN G CA  1 
ATOM 6003  C C   . ASN G 1 54  ? 62.399  82.570  25.084  1.00 39.43 ? 54  ASN G C   1 
ATOM 6004  O O   . ASN G 1 54  ? 61.455  83.065  24.465  1.00 39.61 ? 54  ASN G O   1 
ATOM 6005  C CB  . ASN G 1 54  ? 61.202  81.484  26.988  1.00 39.76 ? 54  ASN G CB  1 
ATOM 6006  C CG  . ASN G 1 54  ? 60.734  80.192  27.634  1.00 39.96 ? 54  ASN G CG  1 
ATOM 6007  O OD1 . ASN G 1 54  ? 59.631  79.716  27.366  1.00 40.17 ? 54  ASN G OD1 1 
ATOM 6008  N ND2 . ASN G 1 54  ? 61.573  79.620  28.490  1.00 40.00 ? 54  ASN G ND2 1 
ATOM 6009  N N   . ASN G 1 55  ? 63.611  83.131  25.136  1.00 39.07 ? 55  ASN G N   1 
ATOM 6010  C CA  . ASN G 1 55  ? 63.920  84.451  24.552  1.00 38.83 ? 55  ASN G CA  1 
ATOM 6011  C C   . ASN G 1 55  ? 63.082  85.579  25.176  1.00 38.56 ? 55  ASN G C   1 
ATOM 6012  O O   . ASN G 1 55  ? 62.587  86.465  24.477  1.00 38.71 ? 55  ASN G O   1 
ATOM 6013  C CB  . ASN G 1 55  ? 63.776  84.437  23.019  1.00 39.00 ? 55  ASN G CB  1 
ATOM 6014  C CG  . ASN G 1 55  ? 64.506  83.275  22.367  1.00 39.27 ? 55  ASN G CG  1 
ATOM 6015  O OD1 . ASN G 1 55  ? 63.961  82.598  21.495  1.00 39.50 ? 55  ASN G OD1 1 
ATOM 6016  N ND2 . ASN G 1 55  ? 65.745  83.037  22.789  1.00 39.40 ? 55  ASN G ND2 1 
ATOM 6017  N N   . SER G 1 56  ? 62.941  85.530  26.500  1.00 38.22 ? 56  SER G N   1 
ATOM 6018  C CA  . SER G 1 56  ? 62.207  86.544  27.266  1.00 37.99 ? 56  SER G CA  1 
ATOM 6019  C C   . SER G 1 56  ? 62.556  86.439  28.753  1.00 37.53 ? 56  SER G C   1 
ATOM 6020  O O   . SER G 1 56  ? 63.331  85.568  29.150  1.00 37.69 ? 56  SER G O   1 
ATOM 6021  C CB  . SER G 1 56  ? 60.697  86.373  27.071  1.00 38.25 ? 56  SER G CB  1 
ATOM 6022  O OG  . SER G 1 56  ? 59.977  87.427  27.690  1.00 38.43 ? 56  SER G OG  1 
ATOM 6023  N N   . TYR G 1 57  ? 61.996  87.340  29.560  1.00 36.99 ? 57  TYR G N   1 
ATOM 6024  C CA  . TYR G 1 57  ? 62.158  87.306  31.018  1.00 36.72 ? 57  TYR G CA  1 
ATOM 6025  C C   . TYR G 1 57  ? 60.831  86.978  31.705  1.00 36.67 ? 57  TYR G C   1 
ATOM 6026  O O   . TYR G 1 57  ? 59.757  87.309  31.196  1.00 36.63 ? 57  TYR G O   1 
ATOM 6027  C CB  . TYR G 1 57  ? 62.712  88.636  31.531  1.00 36.60 ? 57  TYR G CB  1 
ATOM 6028  C CG  . TYR G 1 57  ? 64.159  88.879  31.157  1.00 36.53 ? 57  TYR G CG  1 
ATOM 6029  C CD1 . TYR G 1 57  ? 65.185  88.139  31.747  1.00 36.47 ? 57  TYR G CD1 1 
ATOM 6030  C CD2 . TYR G 1 57  ? 64.509  89.854  30.221  1.00 36.51 ? 57  TYR G CD2 1 
ATOM 6031  C CE1 . TYR G 1 57  ? 66.515  88.357  31.412  1.00 36.34 ? 57  TYR G CE1 1 
ATOM 6032  C CE2 . TYR G 1 57  ? 65.837  90.080  29.880  1.00 36.42 ? 57  TYR G CE2 1 
ATOM 6033  C CZ  . TYR G 1 57  ? 66.836  89.330  30.478  1.00 36.34 ? 57  TYR G CZ  1 
ATOM 6034  O OH  . TYR G 1 57  ? 68.152  89.548  30.145  1.00 36.45 ? 57  TYR G OH  1 
ATOM 6035  N N   . THR G 1 58  ? 60.925  86.334  32.867  1.00 36.59 ? 58  THR G N   1 
ATOM 6036  C CA  . THR G 1 58  ? 59.762  85.811  33.581  1.00 36.53 ? 58  THR G CA  1 
ATOM 6037  C C   . THR G 1 58  ? 59.110  86.858  34.476  1.00 36.66 ? 58  THR G C   1 
ATOM 6038  O O   . THR G 1 58  ? 59.797  87.553  35.226  1.00 36.84 ? 58  THR G O   1 
ATOM 6039  C CB  . THR G 1 58  ? 60.154  84.625  34.481  1.00 36.65 ? 58  THR G CB  1 
ATOM 6040  O OG1 . THR G 1 58  ? 61.189  85.029  35.387  1.00 36.58 ? 58  THR G OG1 1 
ATOM 6041  C CG2 . THR G 1 58  ? 60.650  83.471  33.645  1.00 36.74 ? 58  THR G CG2 1 
ATOM 6042  N N   . SER G 1 59  ? 57.784  86.950  34.398  1.00 36.78 ? 59  SER G N   1 
ATOM 6043  C CA  . SER G 1 59  ? 56.996  87.747  35.335  1.00 36.85 ? 59  SER G CA  1 
ATOM 6044  C C   . SER G 1 59  ? 56.738  86.943  36.611  1.00 36.82 ? 59  SER G C   1 
ATOM 6045  O O   . SER G 1 59  ? 56.881  87.471  37.713  1.00 36.81 ? 59  SER G O   1 
ATOM 6046  C CB  . SER G 1 59  ? 55.668  88.167  34.699  1.00 37.11 ? 59  SER G CB  1 
ATOM 6047  O OG  . SER G 1 59  ? 54.984  89.105  35.513  1.00 37.24 ? 59  SER G OG  1 
ATOM 6048  N N   . ASN G 1 60  ? 56.356  85.675  36.451  1.00 36.97 ? 60  ASN G N   1 
ATOM 6049  C CA  . ASN G 1 60  ? 56.075  84.785  37.590  1.00 37.22 ? 60  ASN G CA  1 
ATOM 6050  C C   . ASN G 1 60  ? 57.344  84.143  38.165  1.00 37.20 ? 60  ASN G C   1 
ATOM 6051  O O   . ASN G 1 60  ? 58.324  83.927  37.449  1.00 37.13 ? 60  ASN G O   1 
ATOM 6052  C CB  . ASN G 1 60  ? 55.051  83.700  37.207  1.00 37.35 ? 60  ASN G CB  1 
ATOM 6053  C CG  . ASN G 1 60  ? 55.602  82.679  36.222  1.00 37.43 ? 60  ASN G CG  1 
ATOM 6054  O OD1 . ASN G 1 60  ? 56.389  83.011  35.334  1.00 37.43 ? 60  ASN G OD1 1 
ATOM 6055  N ND2 . ASN G 1 60  ? 55.177  81.429  36.371  1.00 37.57 ? 60  ASN G ND2 1 
ATOM 6056  N N   . GLN G 1 61  ? 57.302  83.838  39.461  1.00 37.16 ? 61  GLN G N   1 
ATOM 6057  C CA  . GLN G 1 61  ? 58.424  83.216  40.171  1.00 37.02 ? 61  GLN G CA  1 
ATOM 6058  C C   . GLN G 1 61  ? 58.523  81.714  39.894  1.00 36.99 ? 61  GLN G C   1 
ATOM 6059  O O   . GLN G 1 61  ? 59.627  81.170  39.841  1.00 37.14 ? 61  GLN G O   1 
ATOM 6060  C CB  . GLN G 1 61  ? 58.295  83.454  41.679  1.00 37.12 ? 61  GLN G CB  1 
ATOM 6061  C CG  . GLN G 1 61  ? 59.564  83.164  42.472  1.00 37.21 ? 61  GLN G CG  1 
ATOM 6062  C CD  . GLN G 1 61  ? 59.360  83.249  43.973  1.00 37.24 ? 61  GLN G CD  1 
ATOM 6063  O OE1 . GLN G 1 61  ? 58.464  83.942  44.459  1.00 37.27 ? 61  GLN G OE1 1 
ATOM 6064  N NE2 . GLN G 1 61  ? 60.201  82.544  44.721  1.00 37.32 ? 61  GLN G NE2 1 
ATOM 6065  N N   . ALA G 1 62  ? 57.374  81.053  39.734  1.00 36.96 ? 62  ALA G N   1 
ATOM 6066  C CA  . ALA G 1 62  ? 57.312  79.602  39.488  1.00 36.85 ? 62  ALA G CA  1 
ATOM 6067  C C   . ALA G 1 62  ? 58.085  79.140  38.247  1.00 36.78 ? 62  ALA G C   1 
ATOM 6068  O O   . ALA G 1 62  ? 58.568  78.006  38.208  1.00 36.92 ? 62  ALA G O   1 
ATOM 6069  C CB  . ALA G 1 62  ? 55.862  79.146  39.394  1.00 36.91 ? 62  ALA G CB  1 
ATOM 6070  N N   . ALA G 1 63  ? 58.188  80.009  37.241  1.00 36.84 ? 63  ALA G N   1 
ATOM 6071  C CA  . ALA G 1 63  ? 59.001  79.743  36.051  1.00 36.91 ? 63  ALA G CA  1 
ATOM 6072  C C   . ALA G 1 63  ? 60.492  79.653  36.385  1.00 36.82 ? 63  ALA G C   1 
ATOM 6073  O O   . ALA G 1 63  ? 61.186  78.772  35.878  1.00 36.91 ? 63  ALA G O   1 
ATOM 6074  C CB  . ALA G 1 63  ? 58.763  80.810  34.992  1.00 37.01 ? 63  ALA G CB  1 
ATOM 6075  N N   . LEU G 1 64  ? 60.971  80.559  37.237  1.00 36.89 ? 64  LEU G N   1 
ATOM 6076  C CA  . LEU G 1 64  ? 62.369  80.549  37.692  1.00 37.01 ? 64  LEU G CA  1 
ATOM 6077  C C   . LEU G 1 64  ? 62.679  79.356  38.601  1.00 37.02 ? 64  LEU G C   1 
ATOM 6078  O O   . LEU G 1 64  ? 63.782  78.809  38.545  1.00 37.07 ? 64  LEU G O   1 
ATOM 6079  C CB  . LEU G 1 64  ? 62.716  81.850  38.427  1.00 37.12 ? 64  LEU G CB  1 
ATOM 6080  C CG  . LEU G 1 64  ? 62.607  83.157  37.636  1.00 37.29 ? 64  LEU G CG  1 
ATOM 6081  C CD1 . LEU G 1 64  ? 62.823  84.351  38.555  1.00 37.40 ? 64  LEU G CD1 1 
ATOM 6082  C CD2 . LEU G 1 64  ? 63.594  83.186  36.479  1.00 37.32 ? 64  LEU G CD2 1 
ATOM 6083  N N   . ILE G 1 65  ? 61.709  78.965  39.428  1.00 37.10 ? 65  ILE G N   1 
ATOM 6084  C CA  . ILE G 1 65  ? 61.863  77.824  40.343  1.00 37.16 ? 65  ILE G CA  1 
ATOM 6085  C C   . ILE G 1 65  ? 61.905  76.496  39.573  1.00 37.20 ? 65  ILE G C   1 
ATOM 6086  O O   . ILE G 1 65  ? 62.650  75.587  39.947  1.00 37.29 ? 65  ILE G O   1 
ATOM 6087  C CB  . ILE G 1 65  ? 60.748  77.794  41.424  1.00 37.23 ? 65  ILE G CB  1 
ATOM 6088  C CG1 . ILE G 1 65  ? 60.824  79.046  42.312  1.00 37.33 ? 65  ILE G CG1 1 
ATOM 6089  C CG2 . ILE G 1 65  ? 60.854  76.544  42.298  1.00 37.26 ? 65  ILE G CG2 1 
ATOM 6090  C CD1 . ILE G 1 65  ? 59.571  79.313  43.121  1.00 37.48 ? 65  ILE G CD1 1 
ATOM 6091  N N   . SER G 1 66  ? 61.111  76.393  38.506  1.00 37.26 ? 66  SER G N   1 
ATOM 6092  C CA  . SER G 1 66  ? 61.087  75.197  37.653  1.00 37.39 ? 66  SER G CA  1 
ATOM 6093  C C   . SER G 1 66  ? 62.431  74.924  36.965  1.00 37.52 ? 66  SER G C   1 
ATOM 6094  O O   . SER G 1 66  ? 62.821  73.765  36.805  1.00 37.55 ? 66  SER G O   1 
ATOM 6095  C CB  . SER G 1 66  ? 59.980  75.311  36.599  1.00 37.37 ? 66  SER G CB  1 
ATOM 6096  O OG  . SER G 1 66  ? 59.820  74.096  35.886  1.00 37.36 ? 66  SER G OG  1 
ATOM 6097  N N   . LEU G 1 67  ? 63.126  75.989  36.562  1.00 37.78 ? 67  LEU G N   1 
ATOM 6098  C CA  . LEU G 1 67  ? 64.464  75.870  35.956  1.00 38.04 ? 67  LEU G CA  1 
ATOM 6099  C C   . LEU G 1 67  ? 65.540  75.372  36.931  1.00 38.13 ? 67  LEU G C   1 
ATOM 6100  O O   . LEU G 1 67  ? 66.477  74.690  36.509  1.00 38.34 ? 67  LEU G O   1 
ATOM 6101  C CB  . LEU G 1 67  ? 64.911  77.196  35.313  1.00 38.16 ? 67  LEU G CB  1 
ATOM 6102  C CG  . LEU G 1 67  ? 64.604  77.362  33.820  1.00 38.40 ? 67  LEU G CG  1 
ATOM 6103  C CD1 . LEU G 1 67  ? 63.110  77.377  33.528  1.00 38.45 ? 67  LEU G CD1 1 
ATOM 6104  C CD2 . LEU G 1 67  ? 65.257  78.631  33.295  1.00 38.59 ? 67  LEU G CD2 1 
ATOM 6105  N N   . GLY G 1 68  ? 65.405  75.704  38.217  1.00 37.98 ? 68  GLY G N   1 
ATOM 6106  C CA  . GLY G 1 68  ? 66.397  75.313  39.228  1.00 37.88 ? 68  GLY G CA  1 
ATOM 6107  C C   . GLY G 1 68  ? 66.516  76.175  40.477  1.00 37.72 ? 68  GLY G C   1 
ATOM 6108  O O   . GLY G 1 68  ? 67.041  75.703  41.489  1.00 37.88 ? 68  GLY G O   1 
ATOM 6109  N N   . LEU G 1 69  ? 66.068  77.433  40.415  1.00 37.46 ? 69  LEU G N   1 
ATOM 6110  C CA  . LEU G 1 69  ? 66.100  78.345  41.571  1.00 37.38 ? 69  LEU G CA  1 
ATOM 6111  C C   . LEU G 1 69  ? 65.372  77.766  42.786  1.00 37.38 ? 69  LEU G C   1 
ATOM 6112  O O   . LEU G 1 69  ? 64.372  77.057  42.643  1.00 37.44 ? 69  LEU G O   1 
ATOM 6113  C CB  . LEU G 1 69  ? 65.480  79.702  41.207  1.00 37.38 ? 69  LEU G CB  1 
ATOM 6114  C CG  . LEU G 1 69  ? 65.543  80.845  42.230  1.00 37.33 ? 69  LEU G CG  1 
ATOM 6115  C CD1 . LEU G 1 69  ? 66.974  81.280  42.510  1.00 37.36 ? 69  LEU G CD1 1 
ATOM 6116  C CD2 . LEU G 1 69  ? 64.721  82.028  41.743  1.00 37.37 ? 69  LEU G CD2 1 
ATOM 6117  N N   . LYS G 1 70  ? 65.881  78.077  43.977  1.00 37.37 ? 70  LYS G N   1 
ATOM 6118  C CA  . LYS G 1 70  ? 65.290  77.603  45.230  1.00 37.30 ? 70  LYS G CA  1 
ATOM 6119  C C   . LYS G 1 70  ? 64.003  78.357  45.554  1.00 37.09 ? 70  LYS G C   1 
ATOM 6120  O O   . LYS G 1 70  ? 63.697  79.382  44.937  1.00 37.05 ? 70  LYS G O   1 
ATOM 6121  C CB  . LYS G 1 70  ? 66.278  77.764  46.391  1.00 37.51 ? 70  LYS G CB  1 
ATOM 6122  C CG  . LYS G 1 70  ? 67.563  76.966  46.241  1.00 37.82 ? 70  LYS G CG  1 
ATOM 6123  C CD  . LYS G 1 70  ? 68.400  77.034  47.509  1.00 38.07 ? 70  LYS G CD  1 
ATOM 6124  C CE  . LYS G 1 70  ? 69.675  76.212  47.392  1.00 38.26 ? 70  LYS G CE  1 
ATOM 6125  N NZ  . LYS G 1 70  ? 70.622  76.760  46.380  1.00 38.34 ? 70  LYS G NZ  1 
ATOM 6126  N N   . SER G 1 71  ? 63.257  77.841  46.528  1.00 36.84 ? 71  SER G N   1 
ATOM 6127  C CA  . SER G 1 71  ? 62.067  78.521  47.044  1.00 36.56 ? 71  SER G CA  1 
ATOM 6128  C C   . SER G 1 71  ? 62.471  79.789  47.793  1.00 36.24 ? 71  SER G C   1 
ATOM 6129  O O   . SER G 1 71  ? 63.628  79.933  48.203  1.00 36.23 ? 71  SER G O   1 
ATOM 6130  C CB  . SER G 1 71  ? 61.277  77.597  47.973  1.00 36.59 ? 71  SER G CB  1 
ATOM 6131  O OG  . SER G 1 71  ? 60.872  76.419  47.298  1.00 36.60 ? 71  SER G OG  1 
ATOM 6132  N N   . THR G 1 72  ? 61.518  80.704  47.965  1.00 35.94 ? 72  THR G N   1 
ATOM 6133  C CA  . THR G 1 72  ? 61.773  81.978  48.643  1.00 35.78 ? 72  THR G CA  1 
ATOM 6134  C C   . THR G 1 72  ? 62.268  81.719  50.073  1.00 35.65 ? 72  THR G C   1 
ATOM 6135  O O   . THR G 1 72  ? 61.689  80.881  50.770  1.00 35.81 ? 72  THR G O   1 
ATOM 6136  C CB  . THR G 1 72  ? 60.506  82.856  48.698  1.00 35.87 ? 72  THR G CB  1 
ATOM 6137  O OG1 . THR G 1 72  ? 59.914  82.933  47.396  1.00 35.93 ? 72  THR G OG1 1 
ATOM 6138  C CG2 . THR G 1 72  ? 60.838  84.266  49.183  1.00 35.94 ? 72  THR G CG2 1 
ATOM 6139  N N   . PRO G 1 73  ? 63.340  82.420  50.515  1.00 35.35 ? 73  PRO G N   1 
ATOM 6140  C CA  . PRO G 1 73  ? 63.865  82.147  51.862  1.00 35.35 ? 73  PRO G CA  1 
ATOM 6141  C C   . PRO G 1 73  ? 62.930  82.580  52.995  1.00 35.42 ? 73  PRO G C   1 
ATOM 6142  O O   . PRO G 1 73  ? 61.979  83.333  52.767  1.00 35.51 ? 73  PRO G O   1 
ATOM 6143  C CB  . PRO G 1 73  ? 65.175  82.952  51.916  1.00 35.35 ? 73  PRO G CB  1 
ATOM 6144  C CG  . PRO G 1 73  ? 65.456  83.379  50.519  1.00 35.32 ? 73  PRO G CG  1 
ATOM 6145  C CD  . PRO G 1 73  ? 64.132  83.459  49.833  1.00 35.28 ? 73  PRO G CD  1 
ATOM 6146  N N   . ALA G 1 74  ? 63.214  82.097  54.202  1.00 35.52 ? 74  ALA G N   1 
ATOM 6147  C CA  . ALA G 1 74  ? 62.393  82.392  55.377  1.00 35.57 ? 74  ALA G CA  1 
ATOM 6148  C C   . ALA G 1 74  ? 62.496  83.870  55.745  1.00 35.42 ? 74  ALA G C   1 
ATOM 6149  O O   . ALA G 1 74  ? 63.599  84.416  55.825  1.00 35.50 ? 74  ALA G O   1 
ATOM 6150  C CB  . ALA G 1 74  ? 62.813  81.523  56.554  1.00 35.68 ? 74  ALA G CB  1 
ATOM 6151  N N   . ASN G 1 75  ? 61.339  84.500  55.958  1.00 35.20 ? 75  ASN G N   1 
ATOM 6152  C CA  . ASN G 1 75  ? 61.233  85.931  56.274  1.00 35.04 ? 75  ASN G CA  1 
ATOM 6153  C C   . ASN G 1 75  ? 61.813  86.832  55.171  1.00 34.83 ? 75  ASN G C   1 
ATOM 6154  O O   . ASN G 1 75  ? 62.471  87.836  55.461  1.00 34.81 ? 75  ASN G O   1 
ATOM 6155  C CB  . ASN G 1 75  ? 61.883  86.241  57.635  1.00 35.14 ? 75  ASN G CB  1 
ATOM 6156  C CG  . ASN G 1 75  ? 61.415  85.309  58.739  1.00 35.37 ? 75  ASN G CG  1 
ATOM 6157  O OD1 . ASN G 1 75  ? 60.273  84.846  58.739  1.00 35.52 ? 75  ASN G OD1 1 
ATOM 6158  N ND2 . ASN G 1 75  ? 62.299  85.035  59.692  1.00 35.47 ? 75  ASN G ND2 1 
ATOM 6159  N N   . VAL G 1 76  ? 61.561  86.461  53.914  1.00 34.65 ? 76  VAL G N   1 
ATOM 6160  C CA  . VAL G 1 76  ? 61.979  87.239  52.740  1.00 34.49 ? 76  VAL G CA  1 
ATOM 6161  C C   . VAL G 1 76  ? 60.786  87.393  51.798  1.00 34.47 ? 76  VAL G C   1 
ATOM 6162  O O   . VAL G 1 76  ? 60.073  86.424  51.526  1.00 34.47 ? 76  VAL G O   1 
ATOM 6163  C CB  . VAL G 1 76  ? 63.154  86.565  51.993  1.00 34.35 ? 76  VAL G CB  1 
ATOM 6164  C CG1 . VAL G 1 76  ? 63.498  87.315  50.706  1.00 34.32 ? 76  VAL G CG1 1 
ATOM 6165  C CG2 . VAL G 1 76  ? 64.375  86.480  52.897  1.00 34.40 ? 76  VAL G CG2 1 
ATOM 6166  N N   . THR G 1 77  ? 60.587  88.616  51.303  1.00 34.42 ? 77  THR G N   1 
ATOM 6167  C CA  . THR G 1 77  ? 59.473  88.950  50.416  1.00 34.40 ? 77  THR G CA  1 
ATOM 6168  C C   . THR G 1 77  ? 59.983  89.254  49.009  1.00 34.33 ? 77  THR G C   1 
ATOM 6169  O O   . THR G 1 77  ? 60.118  90.416  48.617  1.00 34.35 ? 77  THR G O   1 
ATOM 6170  C CB  . THR G 1 77  ? 58.678  90.154  50.956  1.00 34.48 ? 77  THR G CB  1 
ATOM 6171  O OG1 . THR G 1 77  ? 59.568  91.251  51.193  1.00 34.42 ? 77  THR G OG1 1 
ATOM 6172  C CG2 . THR G 1 77  ? 57.977  89.788  52.256  1.00 34.60 ? 77  THR G CG2 1 
ATOM 6173  N N   . PHE G 1 78  ? 60.273  88.190  48.263  1.00 34.32 ? 78  PHE G N   1 
ATOM 6174  C CA  . PHE G 1 78  ? 60.672  88.293  46.859  1.00 34.26 ? 78  PHE G CA  1 
ATOM 6175  C C   . PHE G 1 78  ? 59.442  88.588  46.004  1.00 34.03 ? 78  PHE G C   1 
ATOM 6176  O O   . PHE G 1 78  ? 58.374  88.014  46.229  1.00 34.15 ? 78  PHE G O   1 
ATOM 6177  C CB  . PHE G 1 78  ? 61.339  86.990  46.398  1.00 34.49 ? 78  PHE G CB  1 
ATOM 6178  C CG  . PHE G 1 78  ? 61.789  87.006  44.962  1.00 34.68 ? 78  PHE G CG  1 
ATOM 6179  C CD1 . PHE G 1 78  ? 63.004  87.583  44.606  1.00 34.79 ? 78  PHE G CD1 1 
ATOM 6180  C CD2 . PHE G 1 78  ? 61.003  86.434  43.964  1.00 34.80 ? 78  PHE G CD2 1 
ATOM 6181  C CE1 . PHE G 1 78  ? 63.423  87.596  43.281  1.00 34.94 ? 78  PHE G CE1 1 
ATOM 6182  C CE2 . PHE G 1 78  ? 61.416  86.444  42.639  1.00 34.93 ? 78  PHE G CE2 1 
ATOM 6183  C CZ  . PHE G 1 78  ? 62.628  87.025  42.297  1.00 34.99 ? 78  PHE G CZ  1 
ATOM 6184  N N   . SER G 1 79  ? 59.601  89.480  45.028  1.00 33.69 ? 79  SER G N   1 
ATOM 6185  C CA  . SER G 1 79  ? 58.492  89.901  44.170  1.00 33.53 ? 79  SER G CA  1 
ATOM 6186  C C   . SER G 1 79  ? 59.001  90.572  42.893  1.00 33.30 ? 79  SER G C   1 
ATOM 6187  O O   . SER G 1 79  ? 59.606  91.644  42.951  1.00 33.36 ? 79  SER G O   1 
ATOM 6188  C CB  . SER G 1 79  ? 57.578  90.865  44.932  1.00 33.61 ? 79  SER G CB  1 
ATOM 6189  O OG  . SER G 1 79  ? 56.504  91.314  44.123  1.00 33.71 ? 79  SER G OG  1 
ATOM 6190  N N   . ILE G 1 80  ? 58.744  89.940  41.748  1.00 33.07 ? 80  ILE G N   1 
ATOM 6191  C CA  . ILE G 1 80  ? 59.136  90.486  40.449  1.00 32.89 ? 80  ILE G CA  1 
ATOM 6192  C C   . ILE G 1 80  ? 58.111  91.547  40.049  1.00 32.77 ? 80  ILE G C   1 
ATOM 6193  O O   . ILE G 1 80  ? 56.916  91.258  39.964  1.00 32.79 ? 80  ILE G O   1 
ATOM 6194  C CB  . ILE G 1 80  ? 59.219  89.390  39.359  1.00 32.91 ? 80  ILE G CB  1 
ATOM 6195  C CG1 . ILE G 1 80  ? 60.248  88.316  39.749  1.00 32.96 ? 80  ILE G CG1 1 
ATOM 6196  C CG2 . ILE G 1 80  ? 59.574  90.003  38.003  1.00 32.94 ? 80  ILE G CG2 1 
ATOM 6197  C CD1 . ILE G 1 80  ? 60.180  87.049  38.923  1.00 33.00 ? 80  ILE G CD1 1 
ATOM 6198  N N   . VAL G 1 81  ? 58.588  92.769  39.811  1.00 32.73 ? 81  VAL G N   1 
ATOM 6199  C CA  . VAL G 1 81  ? 57.728  93.901  39.457  1.00 32.76 ? 81  VAL G CA  1 
ATOM 6200  C C   . VAL G 1 81  ? 57.207  93.737  38.034  1.00 32.87 ? 81  VAL G C   1 
ATOM 6201  O O   . VAL G 1 81  ? 55.995  93.707  37.805  1.00 32.99 ? 81  VAL G O   1 
ATOM 6202  C CB  . VAL G 1 81  ? 58.483  95.247  39.590  1.00 32.81 ? 81  VAL G CB  1 
ATOM 6203  C CG1 . VAL G 1 81  ? 57.680  96.407  39.002  1.00 32.88 ? 81  VAL G CG1 1 
ATOM 6204  C CG2 . VAL G 1 81  ? 58.820  95.519  41.050  1.00 32.82 ? 81  VAL G CG2 1 
ATOM 6205  N N   . SER G 1 82  ? 58.137  93.642  37.088  1.00 32.95 ? 82  SER G N   1 
ATOM 6206  C CA  . SER G 1 82  ? 57.809  93.500  35.670  1.00 33.10 ? 82  SER G CA  1 
ATOM 6207  C C   . SER G 1 82  ? 58.952  92.835  34.915  1.00 33.16 ? 82  SER G C   1 
ATOM 6208  O O   . SER G 1 82  ? 60.095  92.828  35.380  1.00 33.23 ? 82  SER G O   1 
ATOM 6209  C CB  . SER G 1 82  ? 57.499  94.867  35.057  1.00 33.14 ? 82  SER G CB  1 
ATOM 6210  O OG  . SER G 1 82  ? 58.576  95.769  35.243  1.00 33.18 ? 82  SER G OG  1 
ATOM 6211  N N   . ALA G 1 83  ? 58.630  92.278  33.751  1.00 33.30 ? 83  ALA G N   1 
ATOM 6212  C CA  . ALA G 1 83  ? 59.608  91.572  32.926  1.00 33.46 ? 83  ALA G CA  1 
ATOM 6213  C C   . ALA G 1 83  ? 59.202  91.583  31.455  1.00 33.71 ? 83  ALA G C   1 
ATOM 6214  O O   . ALA G 1 83  ? 58.425  90.736  31.008  1.00 33.85 ? 83  ALA G O   1 
ATOM 6215  C CB  . ALA G 1 83  ? 59.779  90.145  33.424  1.00 33.47 ? 83  ALA G CB  1 
ATOM 6216  N N   . SER G 1 84  ? 59.734  92.553  30.714  1.00 34.04 ? 84  SER G N   1 
ATOM 6217  C CA  . SER G 1 84  ? 59.544  92.633  29.266  1.00 34.33 ? 84  SER G CA  1 
ATOM 6218  C C   . SER G 1 84  ? 60.470  91.639  28.562  1.00 34.53 ? 84  SER G C   1 
ATOM 6219  O O   . SER G 1 84  ? 61.225  90.914  29.214  1.00 34.55 ? 84  SER G O   1 
ATOM 6220  C CB  . SER G 1 84  ? 59.806  94.063  28.775  1.00 34.48 ? 84  SER G CB  1 
ATOM 6221  O OG  . SER G 1 84  ? 61.168  94.425  28.931  1.00 34.54 ? 84  SER G OG  1 
ATOM 6222  N N   . ALA G 1 85  ? 60.403  91.604  27.233  1.00 35.05 ? 85  ALA G N   1 
ATOM 6223  C CA  . ALA G 1 85  ? 61.238  90.707  26.427  1.00 35.50 ? 85  ALA G CA  1 
ATOM 6224  C C   . ALA G 1 85  ? 62.743  90.904  26.647  1.00 35.79 ? 85  ALA G C   1 
ATOM 6225  O O   . ALA G 1 85  ? 63.492  89.926  26.685  1.00 35.91 ? 85  ALA G O   1 
ATOM 6226  C CB  . ALA G 1 85  ? 60.904  90.863  24.949  1.00 35.61 ? 85  ALA G CB  1 
ATOM 6227  N N   . ASN G 1 86  ? 63.171  92.160  26.792  1.00 36.15 ? 86  ASN G N   1 
ATOM 6228  C CA  . ASN G 1 86  ? 64.595  92.507  26.919  1.00 36.49 ? 86  ASN G CA  1 
ATOM 6229  C C   . ASN G 1 86  ? 64.941  93.286  28.203  1.00 36.55 ? 86  ASN G C   1 
ATOM 6230  O O   . ASN G 1 86  ? 65.929  94.026  28.229  1.00 36.63 ? 86  ASN G O   1 
ATOM 6231  C CB  . ASN G 1 86  ? 65.040  93.303  25.685  1.00 36.84 ? 86  ASN G CB  1 
ATOM 6232  C CG  . ASN G 1 86  ? 64.795  92.556  24.385  1.00 37.16 ? 86  ASN G CG  1 
ATOM 6233  O OD1 . ASN G 1 86  ? 63.652  92.292  24.014  1.00 37.25 ? 86  ASN G OD1 1 
ATOM 6234  N ND2 . ASN G 1 86  ? 65.872  92.224  23.681  1.00 37.45 ? 86  ASN G ND2 1 
ATOM 6235  N N   . SER G 1 87  ? 64.147  93.115  29.263  1.00 36.55 ? 87  SER G N   1 
ATOM 6236  C CA  . SER G 1 87  ? 64.441  93.733  30.566  1.00 36.52 ? 87  SER G CA  1 
ATOM 6237  C C   . SER G 1 87  ? 63.681  93.064  31.712  1.00 36.58 ? 87  SER G C   1 
ATOM 6238  O O   . SER G 1 87  ? 62.791  92.239  31.486  1.00 36.60 ? 87  SER G O   1 
ATOM 6239  C CB  . SER G 1 87  ? 64.105  95.230  30.541  1.00 36.53 ? 87  SER G CB  1 
ATOM 6240  O OG  . SER G 1 87  ? 64.539  95.870  31.729  1.00 36.60 ? 87  SER G OG  1 
ATOM 6241  N N   . TYR G 1 88  ? 64.048  93.429  32.940  1.00 36.69 ? 88  TYR G N   1 
ATOM 6242  C CA  . TYR G 1 88  ? 63.345  92.972  34.144  1.00 36.75 ? 88  TYR G CA  1 
ATOM 6243  C C   . TYR G 1 88  ? 63.598  93.877  35.350  1.00 37.06 ? 88  TYR G C   1 
ATOM 6244  O O   . TYR G 1 88  ? 64.545  94.668  35.361  1.00 37.14 ? 88  TYR G O   1 
ATOM 6245  C CB  . TYR G 1 88  ? 63.725  91.524  34.484  1.00 36.59 ? 88  TYR G CB  1 
ATOM 6246  C CG  . TYR G 1 88  ? 65.199  91.301  34.757  1.00 36.51 ? 88  TYR G CG  1 
ATOM 6247  C CD1 . TYR G 1 88  ? 65.725  91.460  36.040  1.00 36.43 ? 88  TYR G CD1 1 
ATOM 6248  C CD2 . TYR G 1 88  ? 66.067  90.915  33.735  1.00 36.53 ? 88  TYR G CD2 1 
ATOM 6249  C CE1 . TYR G 1 88  ? 67.073  91.254  36.296  1.00 36.37 ? 88  TYR G CE1 1 
ATOM 6250  C CE2 . TYR G 1 88  ? 67.418  90.704  33.983  1.00 36.49 ? 88  TYR G CE2 1 
ATOM 6251  C CZ  . TYR G 1 88  ? 67.916  90.875  35.263  1.00 36.40 ? 88  TYR G CZ  1 
ATOM 6252  O OH  . TYR G 1 88  ? 69.252  90.669  35.513  1.00 36.43 ? 88  TYR G OH  1 
ATOM 6253  N N   . CYS G 1 89  ? 62.735  93.747  36.356  1.00 37.62 ? 89  CYS G N   1 
ATOM 6254  C CA  . CYS G 1 89  ? 62.858  94.477  37.621  1.00 38.04 ? 89  CYS G CA  1 
ATOM 6255  C C   . CYS G 1 89  ? 62.358  93.586  38.758  1.00 37.48 ? 89  CYS G C   1 
ATOM 6256  O O   . CYS G 1 89  ? 61.189  93.195  38.770  1.00 37.51 ? 89  CYS G O   1 
ATOM 6257  C CB  . CYS G 1 89  ? 62.052  95.776  37.569  1.00 39.02 ? 89  CYS G CB  1 
ATOM 6258  S SG  . CYS G 1 89  ? 62.092  96.752  39.093  1.00 40.38 ? 89  CYS G SG  1 
ATOM 6259  N N   . MET G 1 90  ? 63.246  93.274  39.704  1.00 36.81 ? 90  MET G N   1 
ATOM 6260  C CA  . MET G 1 90  ? 62.945  92.364  40.811  1.00 36.33 ? 90  MET G CA  1 
ATOM 6261  C C   . MET G 1 90  ? 63.319  93.005  42.148  1.00 35.96 ? 90  MET G C   1 
ATOM 6262  O O   . MET G 1 90  ? 64.501  93.192  42.446  1.00 35.94 ? 90  MET G O   1 
ATOM 6263  C CB  . MET G 1 90  ? 63.699  91.041  40.635  1.00 36.33 ? 90  MET G CB  1 
ATOM 6264  C CG  . MET G 1 90  ? 63.532  90.401  39.265  1.00 36.32 ? 90  MET G CG  1 
ATOM 6265  S SD  . MET G 1 90  ? 64.177  88.718  39.190  1.00 36.31 ? 90  MET G SD  1 
ATOM 6266  C CE  . MET G 1 90  ? 65.924  89.004  39.458  1.00 36.30 ? 90  MET G CE  1 
ATOM 6267  N N   . ILE G 1 91  ? 62.302  93.347  42.941  1.00 35.57 ? 91  ILE G N   1 
ATOM 6268  C CA  . ILE G 1 91  ? 62.489  93.878  44.292  1.00 35.27 ? 91  ILE G CA  1 
ATOM 6269  C C   . ILE G 1 91  ? 62.429  92.723  45.295  1.00 34.97 ? 91  ILE G C   1 
ATOM 6270  O O   . ILE G 1 91  ? 61.619  91.805  45.146  1.00 35.06 ? 91  ILE G O   1 
ATOM 6271  C CB  . ILE G 1 91  ? 61.402  94.922  44.650  1.00 35.34 ? 91  ILE G CB  1 
ATOM 6272  C CG1 . ILE G 1 91  ? 61.342  96.045  43.599  1.00 35.48 ? 91  ILE G CG1 1 
ATOM 6273  C CG2 . ILE G 1 91  ? 61.629  95.492  46.050  1.00 35.37 ? 91  ILE G CG2 1 
ATOM 6274  C CD1 . ILE G 1 91  ? 62.614  96.857  43.446  1.00 35.54 ? 91  ILE G CD1 1 
ATOM 6275  N N   . ALA G 1 92  ? 63.292  92.777  46.307  1.00 34.64 ? 92  ALA G N   1 
ATOM 6276  C CA  . ALA G 1 92  ? 63.300  91.787  47.387  1.00 34.42 ? 92  ALA G CA  1 
ATOM 6277  C C   . ALA G 1 92  ? 63.915  92.370  48.657  1.00 34.21 ? 92  ALA G C   1 
ATOM 6278  O O   . ALA G 1 92  ? 64.775  93.253  48.592  1.00 34.13 ? 92  ALA G O   1 
ATOM 6279  C CB  . ALA G 1 92  ? 64.059  90.539  46.958  1.00 34.49 ? 92  ALA G CB  1 
ATOM 6280  N N   . GLY G 1 93  ? 63.468  91.868  49.805  1.00 34.02 ? 93  GLY G N   1 
ATOM 6281  C CA  . GLY G 1 93  ? 63.934  92.355  51.102  1.00 33.89 ? 93  GLY G CA  1 
ATOM 6282  C C   . GLY G 1 93  ? 63.575  91.439  52.256  1.00 33.77 ? 93  GLY G C   1 
ATOM 6283  O O   . GLY G 1 93  ? 62.585  90.706  52.194  1.00 33.83 ? 93  GLY G O   1 
ATOM 6284  N N   . HIS G 1 94  ? 64.389  91.492  53.308  1.00 33.62 ? 94  HIS G N   1 
ATOM 6285  C CA  . HIS G 1 94  ? 64.171  90.714  54.526  1.00 33.49 ? 94  HIS G CA  1 
ATOM 6286  C C   . HIS G 1 94  ? 63.346  91.561  55.496  1.00 33.50 ? 94  HIS G C   1 
ATOM 6287  O O   . HIS G 1 94  ? 63.427  92.792  55.472  1.00 33.61 ? 94  HIS G O   1 
ATOM 6288  C CB  . HIS G 1 94  ? 65.516  90.333  55.154  1.00 33.42 ? 94  HIS G CB  1 
ATOM 6289  C CG  . HIS G 1 94  ? 65.482  89.064  55.948  1.00 33.39 ? 94  HIS G CG  1 
ATOM 6290  N ND1 . HIS G 1 94  ? 65.936  87.862  55.451  1.00 33.41 ? 94  HIS G ND1 1 
ATOM 6291  C CD2 . HIS G 1 94  ? 65.022  88.806  57.195  1.00 33.38 ? 94  HIS G CD2 1 
ATOM 6292  C CE1 . HIS G 1 94  ? 65.771  86.920  56.363  1.00 33.44 ? 94  HIS G CE1 1 
ATOM 6293  N NE2 . HIS G 1 94  ? 65.220  87.469  57.432  1.00 33.41 ? 94  HIS G NE2 1 
ATOM 6294  N N   . SER G 1 95  ? 62.556  90.903  56.342  1.00 33.42 ? 95  SER G N   1 
ATOM 6295  C CA  . SER G 1 95  ? 61.678  91.600  57.292  1.00 33.30 ? 95  SER G CA  1 
ATOM 6296  C C   . SER G 1 95  ? 62.476  92.364  58.349  1.00 33.15 ? 95  SER G C   1 
ATOM 6297  O O   . SER G 1 95  ? 62.157  93.514  58.656  1.00 33.23 ? 95  SER G O   1 
ATOM 6298  C CB  . SER G 1 95  ? 60.714  90.619  57.966  1.00 33.39 ? 95  SER G CB  1 
ATOM 6299  O OG  . SER G 1 95  ? 61.416  89.637  58.705  1.00 33.47 ? 95  SER G OG  1 
ATOM 6300  N N   . GLY G 1 96  ? 63.504  91.713  58.896  1.00 32.96 ? 96  GLY G N   1 
ATOM 6301  C CA  . GLY G 1 96  ? 64.459  92.350  59.810  1.00 32.84 ? 96  GLY G CA  1 
ATOM 6302  C C   . GLY G 1 96  ? 65.799  92.625  59.152  1.00 32.59 ? 96  GLY G C   1 
ATOM 6303  O O   . GLY G 1 96  ? 66.846  92.265  59.695  1.00 32.56 ? 96  GLY G O   1 
ATOM 6304  N N   . GLY G 1 97  ? 65.759  93.263  57.982  1.00 32.33 ? 97  GLY G N   1 
ATOM 6305  C CA  . GLY G 1 97  ? 66.959  93.680  57.255  1.00 32.11 ? 97  GLY G CA  1 
ATOM 6306  C C   . GLY G 1 97  ? 67.213  95.163  57.445  1.00 31.91 ? 97  GLY G C   1 
ATOM 6307  O O   . GLY G 1 97  ? 66.815  95.741  58.461  1.00 31.98 ? 97  GLY G O   1 
ATOM 6308  N N   . THR G 1 98  ? 67.877  95.772  56.463  1.00 31.56 ? 98  THR G N   1 
ATOM 6309  C CA  . THR G 1 98  ? 68.176  97.205  56.473  1.00 31.30 ? 98  THR G CA  1 
ATOM 6310  C C   . THR G 1 98  ? 67.295  97.954  55.478  1.00 31.00 ? 98  THR G C   1 
ATOM 6311  O O   . THR G 1 98  ? 66.542  98.852  55.861  1.00 31.05 ? 98  THR G O   1 
ATOM 6312  C CB  . THR G 1 98  ? 69.655  97.467  56.135  1.00 31.35 ? 98  THR G CB  1 
ATOM 6313  O OG1 . THR G 1 98  ? 69.972  96.885  54.864  1.00 31.30 ? 98  THR G OG1 1 
ATOM 6314  C CG2 . THR G 1 98  ? 70.556  96.871  57.207  1.00 31.42 ? 98  THR G CG2 1 
ATOM 6315  N N   . VAL G 1 99  ? 67.399  97.575  54.205  1.00 30.61 ? 99  VAL G N   1 
ATOM 6316  C CA  . VAL G 1 99  ? 66.645  98.204  53.113  1.00 30.35 ? 99  VAL G CA  1 
ATOM 6317  C C   . VAL G 1 99  ? 66.250  97.179  52.049  1.00 30.06 ? 99  VAL G C   1 
ATOM 6318  O O   . VAL G 1 99  ? 66.750  96.051  52.044  1.00 30.16 ? 99  VAL G O   1 
ATOM 6319  C CB  . VAL G 1 99  ? 67.452  99.345  52.443  1.00 30.45 ? 99  VAL G CB  1 
ATOM 6320  C CG1 . VAL G 1 99  ? 67.483  100.580 53.331  1.00 30.52 ? 99  VAL G CG1 1 
ATOM 6321  C CG2 . VAL G 1 99  ? 68.870  98.899  52.099  1.00 30.52 ? 99  VAL G CG2 1 
ATOM 6322  N N   . TRP G 1 100 ? 65.349  97.583  51.156  1.00 29.73 ? 100 TRP G N   1 
ATOM 6323  C CA  . TRP G 1 100 ? 64.955  96.757  50.013  1.00 29.57 ? 100 TRP G CA  1 
ATOM 6324  C C   . TRP G 1 100 ? 66.072  96.728  48.973  1.00 29.76 ? 100 TRP G C   1 
ATOM 6325  O O   . TRP G 1 100 ? 66.795  97.713  48.804  1.00 29.91 ? 100 TRP G O   1 
ATOM 6326  C CB  . TRP G 1 100 ? 63.674  97.290  49.368  1.00 29.37 ? 100 TRP G CB  1 
ATOM 6327  C CG  . TRP G 1 100 ? 62.466  97.177  50.239  1.00 29.17 ? 100 TRP G CG  1 
ATOM 6328  C CD1 . TRP G 1 100 ? 62.029  98.085  51.158  1.00 29.08 ? 100 TRP G CD1 1 
ATOM 6329  C CD2 . TRP G 1 100 ? 61.531  96.094  50.270  1.00 28.95 ? 100 TRP G CD2 1 
ATOM 6330  N NE1 . TRP G 1 100 ? 60.881  97.635  51.762  1.00 28.98 ? 100 TRP G NE1 1 
ATOM 6331  C CE2 . TRP G 1 100 ? 60.553  96.415  51.236  1.00 28.90 ? 100 TRP G CE2 1 
ATOM 6332  C CE3 . TRP G 1 100 ? 61.426  94.881  49.576  1.00 28.91 ? 100 TRP G CE3 1 
ATOM 6333  C CZ2 . TRP G 1 100 ? 59.480  95.565  51.528  1.00 28.93 ? 100 TRP G CZ2 1 
ATOM 6334  C CZ3 . TRP G 1 100 ? 60.359  94.036  49.865  1.00 28.95 ? 100 TRP G CZ3 1 
ATOM 6335  C CH2 . TRP G 1 100 ? 59.400  94.385  50.835  1.00 28.96 ? 100 TRP G CH2 1 
ATOM 6336  N N   . PHE G 1 101 ? 66.200  95.595  48.286  1.00 29.96 ? 101 PHE G N   1 
ATOM 6337  C CA  . PHE G 1 101 ? 67.208  95.402  47.244  1.00 30.13 ? 101 PHE G CA  1 
ATOM 6338  C C   . PHE G 1 101 ? 66.521  95.198  45.899  1.00 30.19 ? 101 PHE G C   1 
ATOM 6339  O O   . PHE G 1 101 ? 65.665  94.323  45.768  1.00 30.31 ? 101 PHE G O   1 
ATOM 6340  C CB  . PHE G 1 101 ? 68.071  94.178  47.556  1.00 30.32 ? 101 PHE G CB  1 
ATOM 6341  C CG  . PHE G 1 101 ? 69.041  94.380  48.687  1.00 30.39 ? 101 PHE G CG  1 
ATOM 6342  C CD1 . PHE G 1 101 ? 68.601  94.402  50.008  1.00 30.53 ? 101 PHE G CD1 1 
ATOM 6343  C CD2 . PHE G 1 101 ? 70.405  94.522  48.437  1.00 30.42 ? 101 PHE G CD2 1 
ATOM 6344  C CE1 . PHE G 1 101 ? 69.496  94.579  51.053  1.00 30.59 ? 101 PHE G CE1 1 
ATOM 6345  C CE2 . PHE G 1 101 ? 71.304  94.697  49.478  1.00 30.54 ? 101 PHE G CE2 1 
ATOM 6346  C CZ  . PHE G 1 101 ? 70.850  94.727  50.788  1.00 30.60 ? 101 PHE G CZ  1 
ATOM 6347  N N   . ALA G 1 102 ? 66.899  96.010  44.912  1.00 30.37 ? 102 ALA G N   1 
ATOM 6348  C CA  . ALA G 1 102 ? 66.413  95.867  43.538  1.00 30.57 ? 102 ALA G CA  1 
ATOM 6349  C C   . ALA G 1 102 ? 67.344  94.958  42.740  1.00 30.78 ? 102 ALA G C   1 
ATOM 6350  O O   . ALA G 1 102 ? 68.421  94.588  43.216  1.00 30.81 ? 102 ALA G O   1 
ATOM 6351  C CB  . ALA G 1 102 ? 66.309  97.229  42.872  1.00 30.60 ? 102 ALA G CB  1 
ATOM 6352  N N   . ALA G 1 103 ? 66.918  94.601  41.530  1.00 31.11 ? 103 ALA G N   1 
ATOM 6353  C CA  . ALA G 1 103 ? 67.709  93.738  40.649  1.00 31.41 ? 103 ALA G CA  1 
ATOM 6354  C C   . ALA G 1 103 ? 67.272  93.876  39.187  1.00 31.72 ? 103 ALA G C   1 
ATOM 6355  O O   . ALA G 1 103 ? 66.254  93.310  38.781  1.00 31.76 ? 103 ALA G O   1 
ATOM 6356  C CB  . ALA G 1 103 ? 67.612  92.289  41.104  1.00 31.43 ? 103 ALA G CB  1 
ATOM 6357  N N   . THR G 1 104 ? 68.050  94.639  38.420  1.00 32.08 ? 104 THR G N   1 
ATOM 6358  C CA  . THR G 1 104 ? 67.817  94.863  36.990  1.00 32.34 ? 104 THR G CA  1 
ATOM 6359  C C   . THR G 1 104 ? 69.045  94.376  36.214  1.00 32.69 ? 104 THR G C   1 
ATOM 6360  O O   . THR G 1 104 ? 70.106  94.179  36.816  1.00 32.83 ? 104 THR G O   1 
ATOM 6361  C CB  . THR G 1 104 ? 67.579  96.364  36.701  1.00 32.41 ? 104 THR G CB  1 
ATOM 6362  O OG1 . THR G 1 104 ? 68.816  97.083  36.778  1.00 32.45 ? 104 THR G OG1 1 
ATOM 6363  C CG2 . THR G 1 104 ? 66.594  96.958  37.696  1.00 32.50 ? 104 THR G CG2 1 
ATOM 6364  N N   . PRO G 1 105 ? 68.916  94.173  34.883  1.00 33.13 ? 105 PRO G N   1 
ATOM 6365  C CA  . PRO G 1 105 ? 70.082  93.696  34.123  1.00 33.45 ? 105 PRO G CA  1 
ATOM 6366  C C   . PRO G 1 105 ? 71.188  94.743  33.940  1.00 33.95 ? 105 PRO G C   1 
ATOM 6367  O O   . PRO G 1 105 ? 72.366  94.396  34.039  1.00 34.10 ? 105 PRO G O   1 
ATOM 6368  C CB  . PRO G 1 105 ? 69.495  93.266  32.770  1.00 33.34 ? 105 PRO G CB  1 
ATOM 6369  C CG  . PRO G 1 105 ? 68.132  93.849  32.692  1.00 33.31 ? 105 PRO G CG  1 
ATOM 6370  C CD  . PRO G 1 105 ? 67.737  94.400  34.027  1.00 33.23 ? 105 PRO G CD  1 
ATOM 6371  N N   . ASP G 1 106 ? 70.813  95.997  33.681  1.00 34.61 ? 106 ASP G N   1 
ATOM 6372  C CA  . ASP G 1 106 ? 71.795  97.069  33.451  1.00 35.22 ? 106 ASP G CA  1 
ATOM 6373  C C   . ASP G 1 106 ? 72.558  97.497  34.714  1.00 35.56 ? 106 ASP G C   1 
ATOM 6374  O O   . ASP G 1 106 ? 73.772  97.703  34.655  1.00 35.76 ? 106 ASP G O   1 
ATOM 6375  C CB  . ASP G 1 106 ? 71.153  98.287  32.756  1.00 35.53 ? 106 ASP G CB  1 
ATOM 6376  C CG  . ASP G 1 106 ? 70.129  99.009  33.624  1.00 35.77 ? 106 ASP G CG  1 
ATOM 6377  O OD1 . ASP G 1 106 ? 69.445  98.344  34.434  1.00 35.93 ? 106 ASP G OD1 1 
ATOM 6378  O OD2 . ASP G 1 106 ? 70.006  100.245 33.489  1.00 35.86 ? 106 ASP G OD2 1 
ATOM 6379  N N   . LYS G 1 107 ? 71.853  97.618  35.839  1.00 35.96 ? 107 LYS G N   1 
ATOM 6380  C CA  . LYS G 1 107 ? 72.457  98.055  37.108  1.00 36.36 ? 107 LYS G CA  1 
ATOM 6381  C C   . LYS G 1 107 ? 72.895  96.902  38.019  1.00 36.64 ? 107 LYS G C   1 
ATOM 6382  O O   . LYS G 1 107 ? 73.614  97.132  38.994  1.00 36.62 ? 107 LYS G O   1 
ATOM 6383  C CB  . LYS G 1 107 ? 71.489  98.965  37.872  1.00 36.45 ? 107 LYS G CB  1 
ATOM 6384  C CG  . LYS G 1 107 ? 71.145  100.254 37.143  1.00 36.66 ? 107 LYS G CG  1 
ATOM 6385  C CD  . LYS G 1 107 ? 70.139  101.095 37.914  1.00 36.88 ? 107 LYS G CD  1 
ATOM 6386  C CE  . LYS G 1 107 ? 70.772  101.793 39.108  1.00 37.03 ? 107 LYS G CE  1 
ATOM 6387  N NZ  . LYS G 1 107 ? 69.811  102.698 39.797  1.00 37.12 ? 107 LYS G NZ  1 
ATOM 6388  N N   . GLY G 1 108 ? 72.469  95.676  37.710  1.00 37.06 ? 108 GLY G N   1 
ATOM 6389  C CA  . GLY G 1 108 ? 72.760  94.512  38.548  1.00 37.38 ? 108 GLY G CA  1 
ATOM 6390  C C   . GLY G 1 108 ? 71.910  94.512  39.805  1.00 37.66 ? 108 GLY G C   1 
ATOM 6391  O O   . GLY G 1 108 ? 70.840  95.123  39.832  1.00 37.75 ? 108 GLY G O   1 
ATOM 6392  N N   . VAL G 1 109 ? 72.388  93.823  40.838  1.00 38.04 ? 109 VAL G N   1 
ATOM 6393  C CA  . VAL G 1 109 ? 71.719  93.784  42.141  1.00 38.33 ? 109 VAL G CA  1 
ATOM 6394  C C   . VAL G 1 109 ? 72.264  94.923  43.004  1.00 38.62 ? 109 VAL G C   1 
ATOM 6395  O O   . VAL G 1 109 ? 73.456  94.947  43.315  1.00 38.77 ? 109 VAL G O   1 
ATOM 6396  C CB  . VAL G 1 109 ? 71.937  92.432  42.856  1.00 38.50 ? 109 VAL G CB  1 
ATOM 6397  C CG1 . VAL G 1 109 ? 71.220  92.405  44.205  1.00 38.57 ? 109 VAL G CG1 1 
ATOM 6398  C CG2 . VAL G 1 109 ? 71.471  91.279  41.971  1.00 38.56 ? 109 VAL G CG2 1 
ATOM 6399  N N   . TYR G 1 110 ? 71.390  95.859  43.376  1.00 38.99 ? 110 TYR G N   1 
ATOM 6400  C CA  . TYR G 1 110 ? 71.757  97.006  44.217  1.00 39.35 ? 110 TYR G CA  1 
ATOM 6401  C C   . TYR G 1 110 ? 70.689  97.280  45.273  1.00 39.82 ? 110 TYR G C   1 
ATOM 6402  O O   . TYR G 1 110 ? 69.583  96.737  45.202  1.00 40.04 ? 110 TYR G O   1 
ATOM 6403  C CB  . TYR G 1 110 ? 71.984  98.255  43.357  1.00 39.25 ? 110 TYR G CB  1 
ATOM 6404  C CG  . TYR G 1 110 ? 70.767  98.717  42.581  1.00 39.14 ? 110 TYR G CG  1 
ATOM 6405  C CD1 . TYR G 1 110 ? 70.448  98.151  41.347  1.00 39.13 ? 110 TYR G CD1 1 
ATOM 6406  C CD2 . TYR G 1 110 ? 69.940  99.728  43.074  1.00 39.09 ? 110 TYR G CD2 1 
ATOM 6407  C CE1 . TYR G 1 110 ? 69.337  98.570  40.630  1.00 39.07 ? 110 TYR G CE1 1 
ATOM 6408  C CE2 . TYR G 1 110 ? 68.826  100.155 42.364  1.00 39.10 ? 110 TYR G CE2 1 
ATOM 6409  C CZ  . TYR G 1 110 ? 68.530  99.574  41.142  1.00 39.11 ? 110 TYR G CZ  1 
ATOM 6410  O OH  . TYR G 1 110 ? 67.429  99.990  40.432  1.00 39.19 ? 110 TYR G OH  1 
ATOM 6411  N N   . LYS G 1 111 ? 71.032  98.133  46.238  1.00 40.42 ? 111 LYS G N   1 
ATOM 6412  C CA  . LYS G 1 111 ? 70.135  98.475  47.349  1.00 41.05 ? 111 LYS G CA  1 
ATOM 6413  C C   . LYS G 1 111 ? 69.553  99.878  47.182  1.00 41.38 ? 111 LYS G C   1 
ATOM 6414  O O   . LYS G 1 111 ? 70.250  100.797 46.747  1.00 41.54 ? 111 LYS G O   1 
ATOM 6415  C CB  . LYS G 1 111 ? 70.847  98.334  48.704  1.00 41.42 ? 111 LYS G CB  1 
ATOM 6416  C CG  . LYS G 1 111 ? 71.993  99.301  48.976  1.00 41.67 ? 111 LYS G CG  1 
ATOM 6417  C CD  . LYS G 1 111 ? 72.617  99.017  50.332  1.00 41.99 ? 111 LYS G CD  1 
ATOM 6418  C CE  . LYS G 1 111 ? 73.774  99.961  50.625  1.00 42.27 ? 111 LYS G CE  1 
ATOM 6419  N NZ  . LYS G 1 111 ? 74.406  99.708  51.952  1.00 42.33 ? 111 LYS G NZ  1 
ATOM 6420  N N   . THR G 1 112 ? 68.276  100.026 47.538  1.00 41.76 ? 112 THR G N   1 
ATOM 6421  C CA  . THR G 1 112 ? 67.549  101.296 47.403  1.00 42.19 ? 112 THR G CA  1 
ATOM 6422  C C   . THR G 1 112 ? 67.428  102.019 48.747  1.00 42.42 ? 112 THR G C   1 
ATOM 6423  O O   . THR G 1 112 ? 67.763  101.466 49.797  1.00 42.41 ? 112 THR G O   1 
ATOM 6424  C CB  . THR G 1 112 ? 66.150  101.092 46.762  1.00 42.41 ? 112 THR G CB  1 
ATOM 6425  O OG1 . THR G 1 112 ? 65.528  102.365 46.536  1.00 42.63 ? 112 THR G OG1 1 
ATOM 6426  C CG2 . THR G 1 112 ? 65.224  100.210 47.624  1.00 42.32 ? 112 THR G CG2 1 
ATOM 6427  N N   . ASN G 1 113 ? 66.939  103.257 48.697  1.00 42.76 ? 113 ASN G N   1 
ATOM 6428  C CA  . ASN G 1 113 ? 66.774  104.091 49.894  1.00 43.05 ? 113 ASN G CA  1 
ATOM 6429  C C   . ASN G 1 113 ? 65.579  103.690 50.770  1.00 43.07 ? 113 ASN G C   1 
ATOM 6430  O O   . ASN G 1 113 ? 65.531  104.066 51.945  1.00 43.14 ? 113 ASN G O   1 
ATOM 6431  C CB  . ASN G 1 113 ? 66.642  105.569 49.503  1.00 43.32 ? 113 ASN G CB  1 
ATOM 6432  C CG  . ASN G 1 113 ? 67.890  106.113 48.829  1.00 43.69 ? 113 ASN G CG  1 
ATOM 6433  O OD1 . ASN G 1 113 ? 68.788  105.361 48.444  1.00 43.88 ? 113 ASN G OD1 1 
ATOM 6434  N ND2 . ASN G 1 113 ? 67.949  107.432 48.678  1.00 43.95 ? 113 ASN G ND2 1 
ATOM 6435  N N   . THR G 1 114 ? 64.625  102.945 50.208  1.00 42.95 ? 114 THR G N   1 
ATOM 6436  C CA  . THR G 1 114 ? 63.423  102.526 50.937  1.00 42.92 ? 114 THR G CA  1 
ATOM 6437  C C   . THR G 1 114 ? 63.761  101.509 52.029  1.00 42.75 ? 114 THR G C   1 
ATOM 6438  O O   . THR G 1 114 ? 64.508  100.561 51.789  1.00 42.67 ? 114 THR G O   1 
ATOM 6439  C CB  . THR G 1 114 ? 62.373  101.909 49.986  1.00 43.06 ? 114 THR G CB  1 
ATOM 6440  O OG1 . THR G 1 114 ? 62.165  102.779 48.865  1.00 43.18 ? 114 THR G OG1 1 
ATOM 6441  C CG2 . THR G 1 114 ? 61.041  101.684 50.705  1.00 43.11 ? 114 THR G CG2 1 
ATOM 6442  N N   . ALA G 1 115 ? 63.198  101.717 53.221  1.00 42.77 ? 115 ALA G N   1 
ATOM 6443  C CA  . ALA G 1 115 ? 63.455  100.857 54.379  1.00 42.75 ? 115 ALA G CA  1 
ATOM 6444  C C   . ALA G 1 115 ? 62.534  99.640  54.385  1.00 42.74 ? 115 ALA G C   1 
ATOM 6445  O O   . ALA G 1 115 ? 61.439  99.675  53.818  1.00 42.81 ? 115 ALA G O   1 
ATOM 6446  C CB  . ALA G 1 115 ? 63.283  101.645 55.668  1.00 42.91 ? 115 ALA G CB  1 
ATOM 6447  N N   . VAL G 1 116 ? 62.988  98.573  55.040  1.00 42.90 ? 116 VAL G N   1 
ATOM 6448  C CA  . VAL G 1 116 ? 62.212  97.326  55.149  1.00 43.05 ? 116 VAL G CA  1 
ATOM 6449  C C   . VAL G 1 116 ? 60.968  97.472  56.036  1.00 43.55 ? 116 VAL G C   1 
ATOM 6450  O O   . VAL G 1 116 ? 59.989  96.743  55.852  1.00 43.76 ? 116 VAL G O   1 
ATOM 6451  C CB  . VAL G 1 116 ? 63.063  96.131  55.654  1.00 42.93 ? 116 VAL G CB  1 
ATOM 6452  C CG1 . VAL G 1 116 ? 64.241  95.877  54.718  1.00 42.89 ? 116 VAL G CG1 1 
ATOM 6453  C CG2 . VAL G 1 116 ? 63.520  96.324  57.102  1.00 42.98 ? 116 VAL G CG2 1 
ATOM 6454  N N   . THR G 1 117 ? 61.017  98.397  56.996  1.00 43.94 ? 117 THR G N   1 
ATOM 6455  C CA  . THR G 1 117 ? 59.844  98.756  57.801  1.00 44.22 ? 117 THR G CA  1 
ATOM 6456  C C   . THR G 1 117 ? 58.770  99.441  56.953  1.00 44.30 ? 117 THR G C   1 
ATOM 6457  O O   . THR G 1 117 ? 57.576  99.210  57.157  1.00 44.49 ? 117 THR G O   1 
ATOM 6458  C CB  . THR G 1 117 ? 60.218  99.683  58.976  1.00 44.54 ? 117 THR G CB  1 
ATOM 6459  O OG1 . THR G 1 117 ? 60.941  100.819 58.485  1.00 44.68 ? 117 THR G OG1 1 
ATOM 6460  C CG2 . THR G 1 117 ? 61.071  98.941  59.997  1.00 44.67 ? 117 THR G CG2 1 
ATOM 6461  N N   . SER G 1 118 ? 59.200  100.280 56.009  1.00 44.37 ? 118 SER G N   1 
ATOM 6462  C CA  . SER G 1 118 ? 58.295  100.907 55.039  1.00 44.50 ? 118 SER G CA  1 
ATOM 6463  C C   . SER G 1 118 ? 57.816  99.899  53.993  1.00 44.49 ? 118 SER G C   1 
ATOM 6464  O O   . SER G 1 118 ? 58.345  98.787  53.899  1.00 44.41 ? 118 SER G O   1 
ATOM 6465  C CB  . SER G 1 118 ? 58.983  102.086 54.343  1.00 44.61 ? 118 SER G CB  1 
ATOM 6466  O OG  . SER G 1 118 ? 59.437  103.041 55.287  1.00 44.73 ? 118 SER G OG  1 
ATOM 6467  N N   . SER G 1 119 ? 56.820  100.303 53.205  1.00 44.65 ? 119 SER G N   1 
ATOM 6468  C CA  . SER G 1 119 ? 56.204  99.425  52.203  1.00 44.77 ? 119 SER G CA  1 
ATOM 6469  C C   . SER G 1 119 ? 57.138  99.125  51.030  1.00 44.88 ? 119 SER G C   1 
ATOM 6470  O O   . SER G 1 119 ? 58.147  99.808  50.829  1.00 44.83 ? 119 SER G O   1 
ATOM 6471  C CB  . SER G 1 119 ? 54.904  100.041 51.680  1.00 44.90 ? 119 SER G CB  1 
ATOM 6472  O OG  . SER G 1 119 ? 54.200  99.127  50.854  1.00 44.99 ? 119 SER G OG  1 
ATOM 6473  N N   . GLN G 1 120 ? 56.780  98.098  50.260  1.00 44.97 ? 120 GLN G N   1 
ATOM 6474  C CA  . GLN G 1 120 ? 57.592  97.633  49.132  1.00 45.08 ? 120 GLN G CA  1 
ATOM 6475  C C   . GLN G 1 120 ? 57.617  98.674  48.006  1.00 45.31 ? 120 GLN G C   1 
ATOM 6476  O O   . GLN G 1 120 ? 56.572  99.245  47.683  1.00 45.67 ? 120 GLN G O   1 
ATOM 6477  C CB  . GLN G 1 120 ? 57.044  96.305  48.596  1.00 45.05 ? 120 GLN G CB  1 
ATOM 6478  C CG  . GLN G 1 120 ? 57.911  95.637  47.538  1.00 45.09 ? 120 GLN G CG  1 
ATOM 6479  C CD  . GLN G 1 120 ? 57.353  94.301  47.084  1.00 45.21 ? 120 GLN G CD  1 
ATOM 6480  O OE1 . GLN G 1 120 ? 57.029  93.438  47.901  1.00 45.22 ? 120 GLN G OE1 1 
ATOM 6481  N NE2 . GLN G 1 120 ? 57.243  94.120  45.772  1.00 45.29 ? 120 GLN G NE2 1 
ATOM 6482  N N   . PRO G 1 121 ? 58.807  98.941  47.421  1.00 45.40 ? 121 PRO G N   1 
ATOM 6483  C CA  . PRO G 1 121 ? 58.889  99.807  46.238  1.00 45.55 ? 121 PRO G CA  1 
ATOM 6484  C C   . PRO G 1 121 ? 58.081  99.283  45.047  1.00 45.58 ? 121 PRO G C   1 
ATOM 6485  O O   . PRO G 1 121 ? 58.145  98.091  44.739  1.00 45.53 ? 121 PRO G O   1 
ATOM 6486  C CB  . PRO G 1 121 ? 60.384  99.807  45.902  1.00 45.56 ? 121 PRO G CB  1 
ATOM 6487  C CG  . PRO G 1 121 ? 61.059  99.555  47.199  1.00 45.48 ? 121 PRO G CG  1 
ATOM 6488  C CD  . PRO G 1 121 ? 60.146  98.648  47.971  1.00 45.42 ? 121 PRO G CD  1 
ATOM 6489  N N   . GLU G 1 122 ? 57.328  100.173 44.402  1.00 45.76 ? 122 GLU G N   1 
ATOM 6490  C CA  . GLU G 1 122 ? 56.493  99.811  43.250  1.00 45.90 ? 122 GLU G CA  1 
ATOM 6491  C C   . GLU G 1 122 ? 57.339  99.470  42.027  1.00 45.50 ? 122 GLU G C   1 
ATOM 6492  O O   . GLU G 1 122 ? 57.052  98.498  41.330  1.00 45.42 ? 122 GLU G O   1 
ATOM 6493  C CB  . GLU G 1 122 ? 55.515  100.942 42.905  1.00 46.32 ? 122 GLU G CB  1 
ATOM 6494  C CG  . GLU G 1 122 ? 54.464  101.224 43.973  1.00 46.56 ? 122 GLU G CG  1 
ATOM 6495  C CD  . GLU G 1 122 ? 53.482  100.079 44.189  1.00 46.77 ? 122 GLU G CD  1 
ATOM 6496  O OE1 . GLU G 1 122 ? 53.291  99.251  43.271  1.00 46.76 ? 122 GLU G OE1 1 
ATOM 6497  O OE2 . GLU G 1 122 ? 52.891  100.011 45.287  1.00 46.96 ? 122 GLU G OE2 1 
ATOM 6498  N N   . SER G 1 123 ? 58.364  100.282 41.771  1.00 45.20 ? 123 SER G N   1 
ATOM 6499  C CA  . SER G 1 123 ? 59.331  100.036 40.697  1.00 45.03 ? 123 SER G CA  1 
ATOM 6500  C C   . SER G 1 123 ? 60.745  100.373 41.165  1.00 44.61 ? 123 SER G C   1 
ATOM 6501  O O   . SER G 1 123 ? 60.937  101.246 42.015  1.00 44.74 ? 123 SER G O   1 
ATOM 6502  C CB  . SER G 1 123 ? 58.979  100.868 39.463  1.00 45.23 ? 123 SER G CB  1 
ATOM 6503  O OG  . SER G 1 123 ? 59.836  100.562 38.376  1.00 45.30 ? 123 SER G OG  1 
ATOM 6504  N N   . CYS G 1 124 ? 61.727  99.675  40.597  1.00 44.10 ? 124 CYS G N   1 
ATOM 6505  C CA  . CYS G 1 124 ? 63.137  99.863  40.955  1.00 43.87 ? 124 CYS G CA  1 
ATOM 6506  C C   . CYS G 1 124 ? 63.667  101.208 40.431  1.00 44.47 ? 124 CYS G C   1 
ATOM 6507  O O   . CYS G 1 124 ? 63.194  101.686 39.398  1.00 44.77 ? 124 CYS G O   1 
ATOM 6508  C CB  . CYS G 1 124 ? 63.987  98.708  40.409  1.00 43.10 ? 124 CYS G CB  1 
ATOM 6509  S SG  . CYS G 1 124 ? 63.524  98.154  38.749  1.00 42.51 ? 124 CYS G SG  1 
ATOM 6510  N N   . PRO G 1 125 ? 64.640  101.826 41.143  1.00 44.93 ? 125 PRO G N   1 
ATOM 6511  C CA  . PRO G 1 125 ? 65.221  103.092 40.657  1.00 45.17 ? 125 PRO G CA  1 
ATOM 6512  C C   . PRO G 1 125 ? 66.014  102.972 39.348  1.00 45.54 ? 125 PRO G C   1 
ATOM 6513  O O   . PRO G 1 125 ? 66.327  103.982 38.714  1.00 45.78 ? 125 PRO G O   1 
ATOM 6514  C CB  . PRO G 1 125 ? 66.158  103.518 41.798  1.00 45.17 ? 125 PRO G CB  1 
ATOM 6515  C CG  . PRO G 1 125 ? 65.666  102.796 42.999  1.00 45.13 ? 125 PRO G CG  1 
ATOM 6516  C CD  . PRO G 1 125 ? 65.135  101.492 42.493  1.00 45.02 ? 125 PRO G CD  1 
ATOM 6517  O OXT . PRO G 1 125 ? 66.361  101.882 38.890  1.00 45.77 ? 125 PRO G OXT 1 
ATOM 6518  N N   . PHE H 1 1   ? 84.621  87.796  112.063 1.00 65.53 ? 1   PHE H N   1 
ATOM 6519  C CA  . PHE H 1 1   ? 84.291  86.728  111.076 1.00 65.24 ? 1   PHE H CA  1 
ATOM 6520  C C   . PHE H 1 1   ? 83.440  85.645  111.752 1.00 64.19 ? 1   PHE H C   1 
ATOM 6521  O O   . PHE H 1 1   ? 83.969  84.743  112.410 1.00 64.28 ? 1   PHE H O   1 
ATOM 6522  C CB  . PHE H 1 1   ? 85.580  86.139  110.479 1.00 66.00 ? 1   PHE H CB  1 
ATOM 6523  C CG  . PHE H 1 1   ? 85.410  85.546  109.103 1.00 66.66 ? 1   PHE H CG  1 
ATOM 6524  C CD1 . PHE H 1 1   ? 84.552  84.469  108.889 1.00 66.87 ? 1   PHE H CD1 1 
ATOM 6525  C CD2 . PHE H 1 1   ? 86.121  86.054  108.019 1.00 67.09 ? 1   PHE H CD2 1 
ATOM 6526  C CE1 . PHE H 1 1   ? 84.401  83.920  107.625 1.00 67.09 ? 1   PHE H CE1 1 
ATOM 6527  C CE2 . PHE H 1 1   ? 85.972  85.506  106.753 1.00 67.25 ? 1   PHE H CE2 1 
ATOM 6528  C CZ  . PHE H 1 1   ? 85.111  84.438  106.556 1.00 67.25 ? 1   PHE H CZ  1 
ATOM 6529  N N   . THR H 1 2   ? 82.122  85.742  111.578 1.00 62.81 ? 2   THR H N   1 
ATOM 6530  C CA  . THR H 1 2   ? 81.171  84.822  112.210 1.00 61.68 ? 2   THR H CA  1 
ATOM 6531  C C   . THR H 1 2   ? 81.011  83.530  111.410 1.00 60.37 ? 2   THR H C   1 
ATOM 6532  O O   . THR H 1 2   ? 81.495  83.420  110.281 1.00 60.21 ? 2   THR H O   1 
ATOM 6533  C CB  . THR H 1 2   ? 79.777  85.474  112.359 1.00 61.85 ? 2   THR H CB  1 
ATOM 6534  O OG1 . THR H 1 2   ? 79.302  85.893  111.074 1.00 61.94 ? 2   THR H OG1 1 
ATOM 6535  C CG2 . THR H 1 2   ? 79.828  86.677  113.290 1.00 61.91 ? 2   THR H CG2 1 
ATOM 6536  N N   . LEU H 1 3   ? 80.326  82.560  112.012 1.00 59.31 ? 3   LEU H N   1 
ATOM 6537  C CA  . LEU H 1 3   ? 79.943  81.323  111.329 1.00 58.56 ? 3   LEU H CA  1 
ATOM 6538  C C   . LEU H 1 3   ? 78.807  81.579  110.336 1.00 57.74 ? 3   LEU H C   1 
ATOM 6539  O O   . LEU H 1 3   ? 78.799  81.006  109.248 1.00 57.87 ? 3   LEU H O   1 
ATOM 6540  C CB  . LEU H 1 3   ? 79.526  80.249  112.341 1.00 58.65 ? 3   LEU H CB  1 
ATOM 6541  C CG  . LEU H 1 3   ? 79.210  78.842  111.814 1.00 58.84 ? 3   LEU H CG  1 
ATOM 6542  C CD1 . LEU H 1 3   ? 80.428  78.203  111.164 1.00 58.83 ? 3   LEU H CD1 1 
ATOM 6543  C CD2 . LEU H 1 3   ? 78.686  77.970  112.945 1.00 59.00 ? 3   LEU H CD2 1 
ATOM 6544  N N   . ILE H 1 4   ? 77.848  82.422  110.727 1.00 56.84 ? 4   ILE H N   1 
ATOM 6545  C CA  . ILE H 1 4   ? 76.739  82.826  109.843 1.00 56.10 ? 4   ILE H CA  1 
ATOM 6546  C C   . ILE H 1 4   ? 77.209  83.563  108.577 1.00 55.55 ? 4   ILE H C   1 
ATOM 6547  O O   . ILE H 1 4   ? 76.621  83.383  107.508 1.00 55.56 ? 4   ILE H O   1 
ATOM 6548  C CB  . ILE H 1 4   ? 75.660  83.656  110.607 1.00 56.16 ? 4   ILE H CB  1 
ATOM 6549  C CG1 . ILE H 1 4   ? 74.408  83.906  109.748 1.00 56.20 ? 4   ILE H CG1 1 
ATOM 6550  C CG2 . ILE H 1 4   ? 76.198  84.999  111.090 1.00 56.30 ? 4   ILE H CG2 1 
ATOM 6551  C CD1 . ILE H 1 4   ? 73.728  82.656  109.235 1.00 56.15 ? 4   ILE H CD1 1 
ATOM 6552  N N   . GLU H 1 5   ? 78.254  84.384  108.702 1.00 55.12 ? 5   GLU H N   1 
ATOM 6553  C CA  . GLU H 1 5   ? 78.856  85.064  107.546 1.00 54.70 ? 5   GLU H CA  1 
ATOM 6554  C C   . GLU H 1 5   ? 79.563  84.075  106.614 1.00 54.01 ? 5   GLU H C   1 
ATOM 6555  O O   . GLU H 1 5   ? 79.587  84.278  105.402 1.00 54.13 ? 5   GLU H O   1 
ATOM 6556  C CB  . GLU H 1 5   ? 79.824  86.164  108.003 1.00 54.98 ? 5   GLU H CB  1 
ATOM 6557  C CG  . GLU H 1 5   ? 80.422  87.005  106.878 1.00 55.44 ? 5   GLU H CG  1 
ATOM 6558  C CD  . GLU H 1 5   ? 81.810  86.548  106.452 1.00 55.80 ? 5   GLU H CD  1 
ATOM 6559  O OE1 . GLU H 1 5   ? 82.739  86.605  107.286 1.00 55.97 ? 5   GLU H OE1 1 
ATOM 6560  O OE2 . GLU H 1 5   ? 81.974  86.144  105.282 1.00 55.93 ? 5   GLU H OE2 1 
ATOM 6561  N N   . LEU H 1 6   ? 80.145  83.021  107.184 1.00 53.26 ? 6   LEU H N   1 
ATOM 6562  C CA  . LEU H 1 6   ? 80.720  81.924  106.399 1.00 52.82 ? 6   LEU H CA  1 
ATOM 6563  C C   . LEU H 1 6   ? 79.632  81.037  105.793 1.00 52.17 ? 6   LEU H C   1 
ATOM 6564  O O   . LEU H 1 6   ? 79.760  80.582  104.656 1.00 52.30 ? 6   LEU H O   1 
ATOM 6565  C CB  . LEU H 1 6   ? 81.643  81.072  107.277 1.00 53.07 ? 6   LEU H CB  1 
ATOM 6566  C CG  . LEU H 1 6   ? 82.538  80.021  106.605 1.00 53.25 ? 6   LEU H CG  1 
ATOM 6567  C CD1 . LEU H 1 6   ? 83.504  80.649  105.603 1.00 53.35 ? 6   LEU H CD1 1 
ATOM 6568  C CD2 . LEU H 1 6   ? 83.289  79.221  107.665 1.00 53.36 ? 6   LEU H CD2 1 
ATOM 6569  N N   . LEU H 1 7   ? 78.573  80.791  106.565 1.00 51.68 ? 7   LEU H N   1 
ATOM 6570  C CA  . LEU H 1 7   ? 77.470  79.913  106.160 1.00 51.18 ? 7   LEU H CA  1 
ATOM 6571  C C   . LEU H 1 7   ? 76.671  80.459  104.977 1.00 50.46 ? 7   LEU H C   1 
ATOM 6572  O O   . LEU H 1 7   ? 76.310  79.698  104.076 1.00 50.55 ? 7   LEU H O   1 
ATOM 6573  C CB  . LEU H 1 7   ? 76.538  79.666  107.352 1.00 51.54 ? 7   LEU H CB  1 
ATOM 6574  C CG  . LEU H 1 7   ? 75.347  78.716  107.191 1.00 52.00 ? 7   LEU H CG  1 
ATOM 6575  C CD1 . LEU H 1 7   ? 75.781  77.351  106.677 1.00 52.25 ? 7   LEU H CD1 1 
ATOM 6576  C CD2 . LEU H 1 7   ? 74.628  78.589  108.526 1.00 52.11 ? 7   LEU H CD2 1 
ATOM 6577  N N   . ILE H 1 8   ? 76.388  81.763  104.989 1.00 49.67 ? 8   ILE H N   1 
ATOM 6578  C CA  . ILE H 1 8   ? 75.715  82.421  103.858 1.00 48.95 ? 8   ILE H CA  1 
ATOM 6579  C C   . ILE H 1 8   ? 76.593  82.458  102.600 1.00 48.10 ? 8   ILE H C   1 
ATOM 6580  O O   . ILE H 1 8   ? 76.075  82.347  101.493 1.00 48.25 ? 8   ILE H O   1 
ATOM 6581  C CB  . ILE H 1 8   ? 75.192  83.844  104.212 1.00 49.08 ? 8   ILE H CB  1 
ATOM 6582  C CG1 . ILE H 1 8   ? 74.201  84.331  103.141 1.00 49.31 ? 8   ILE H CG1 1 
ATOM 6583  C CG2 . ILE H 1 8   ? 76.337  84.838  104.390 1.00 49.12 ? 8   ILE H CG2 1 
ATOM 6584  C CD1 . ILE H 1 8   ? 73.366  85.527  103.552 1.00 49.49 ? 8   ILE H CD1 1 
ATOM 6585  N N   . VAL H 1 9   ? 77.908  82.602  102.774 1.00 47.27 ? 9   VAL H N   1 
ATOM 6586  C CA  . VAL H 1 9   ? 78.860  82.537  101.652 1.00 46.73 ? 9   VAL H CA  1 
ATOM 6587  C C   . VAL H 1 9   ? 78.865  81.144  101.006 1.00 46.19 ? 9   VAL H C   1 
ATOM 6588  O O   . VAL H 1 9   ? 78.950  81.032  99.783  1.00 46.23 ? 9   VAL H O   1 
ATOM 6589  C CB  . VAL H 1 9   ? 80.288  82.958  102.093 1.00 46.84 ? 9   VAL H CB  1 
ATOM 6590  C CG1 . VAL H 1 9   ? 81.341  82.604  101.046 1.00 46.95 ? 9   VAL H CG1 1 
ATOM 6591  C CG2 . VAL H 1 9   ? 80.328  84.454  102.378 1.00 46.91 ? 9   VAL H CG2 1 
ATOM 6592  N N   . ILE H 1 10  ? 78.771  80.098  101.827 1.00 45.60 ? 10  ILE H N   1 
ATOM 6593  C CA  . ILE H 1 10  ? 78.639  78.719  101.335 1.00 45.28 ? 10  ILE H CA  1 
ATOM 6594  C C   . ILE H 1 10  ? 77.311  78.532  100.581 1.00 44.89 ? 10  ILE H C   1 
ATOM 6595  O O   . ILE H 1 10  ? 77.268  77.832  99.567  1.00 44.97 ? 10  ILE H O   1 
ATOM 6596  C CB  . ILE H 1 10  ? 78.772  77.687  102.488 1.00 45.46 ? 10  ILE H CB  1 
ATOM 6597  C CG1 . ILE H 1 10  ? 80.200  77.703  103.056 1.00 45.68 ? 10  ILE H CG1 1 
ATOM 6598  C CG2 . ILE H 1 10  ? 78.430  76.271  102.023 1.00 45.52 ? 10  ILE H CG2 1 
ATOM 6599  C CD1 . ILE H 1 10  ? 80.315  77.153  104.464 1.00 45.81 ? 10  ILE H CD1 1 
ATOM 6600  N N   . ALA H 1 11  ? 76.245  79.159  101.078 1.00 44.53 ? 11  ALA H N   1 
ATOM 6601  C CA  . ALA H 1 11  ? 74.927  79.113  100.433 1.00 44.37 ? 11  ALA H CA  1 
ATOM 6602  C C   . ALA H 1 11  ? 74.899  79.782  99.055  1.00 44.14 ? 11  ALA H C   1 
ATOM 6603  O O   . ALA H 1 11  ? 74.275  79.260  98.130  1.00 44.27 ? 11  ALA H O   1 
ATOM 6604  C CB  . ALA H 1 11  ? 73.870  79.738  101.336 1.00 44.52 ? 11  ALA H CB  1 
ATOM 6605  N N   . ILE H 1 12  ? 75.572  80.927  98.926  1.00 43.94 ? 12  ILE H N   1 
ATOM 6606  C CA  . ILE H 1 12  ? 75.631  81.667  97.655  1.00 43.88 ? 12  ILE H CA  1 
ATOM 6607  C C   . ILE H 1 12  ? 76.502  80.947  96.613  1.00 43.93 ? 12  ILE H C   1 
ATOM 6608  O O   . ILE H 1 12  ? 76.177  80.969  95.425  1.00 44.27 ? 12  ILE H O   1 
ATOM 6609  C CB  . ILE H 1 12  ? 76.117  83.128  97.864  1.00 43.83 ? 12  ILE H CB  1 
ATOM 6610  C CG1 . ILE H 1 12  ? 75.139  83.915  98.756  1.00 44.06 ? 12  ILE H CG1 1 
ATOM 6611  C CG2 . ILE H 1 12  ? 76.318  83.859  96.535  1.00 43.85 ? 12  ILE H CG2 1 
ATOM 6612  C CD1 . ILE H 1 12  ? 73.718  84.024  98.239  1.00 44.26 ? 12  ILE H CD1 1 
ATOM 6613  N N   . ILE H 1 13  ? 77.588  80.309  97.053  1.00 43.69 ? 13  ILE H N   1 
ATOM 6614  C CA  . ILE H 1 13  ? 78.445  79.510  96.157  1.00 43.60 ? 13  ILE H CA  1 
ATOM 6615  C C   . ILE H 1 13  ? 77.657  78.357  95.514  1.00 43.55 ? 13  ILE H C   1 
ATOM 6616  O O   . ILE H 1 13  ? 77.855  78.057  94.335  1.00 43.61 ? 13  ILE H O   1 
ATOM 6617  C CB  . ILE H 1 13  ? 79.710  78.982  96.891  1.00 43.76 ? 13  ILE H CB  1 
ATOM 6618  C CG1 . ILE H 1 13  ? 80.652  80.146  97.229  1.00 43.92 ? 13  ILE H CG1 1 
ATOM 6619  C CG2 . ILE H 1 13  ? 80.473  77.958  96.045  1.00 43.84 ? 13  ILE H CG2 1 
ATOM 6620  C CD1 . ILE H 1 13  ? 81.598  79.862  98.378  1.00 44.05 ? 13  ILE H CD1 1 
ATOM 6621  N N   . ALA H 1 14  ? 76.771  77.726  96.285  1.00 43.61 ? 14  ALA H N   1 
ATOM 6622  C CA  . ALA H 1 14  ? 75.884  76.673  95.769  1.00 43.68 ? 14  ALA H CA  1 
ATOM 6623  C C   . ALA H 1 14  ? 74.905  77.188  94.709  1.00 43.73 ? 14  ALA H C   1 
ATOM 6624  O O   . ALA H 1 14  ? 74.599  76.476  93.749  1.00 43.84 ? 14  ALA H O   1 
ATOM 6625  C CB  . ALA H 1 14  ? 75.120  76.018  96.913  1.00 43.75 ? 14  ALA H CB  1 
ATOM 6626  N N   . ILE H 1 15  ? 74.419  78.417  94.892  1.00 43.74 ? 15  ILE H N   1 
ATOM 6627  C CA  . ILE H 1 15  ? 73.511  79.063  93.935  1.00 43.83 ? 15  ILE H CA  1 
ATOM 6628  C C   . ILE H 1 15  ? 74.256  79.459  92.658  1.00 43.79 ? 15  ILE H C   1 
ATOM 6629  O O   . ILE H 1 15  ? 73.792  79.169  91.553  1.00 43.92 ? 15  ILE H O   1 
ATOM 6630  C CB  . ILE H 1 15  ? 72.821  80.308  94.551  1.00 44.00 ? 15  ILE H CB  1 
ATOM 6631  C CG1 . ILE H 1 15  ? 71.926  79.896  95.730  1.00 44.22 ? 15  ILE H CG1 1 
ATOM 6632  C CG2 . ILE H 1 15  ? 71.983  81.049  93.510  1.00 44.10 ? 15  ILE H CG2 1 
ATOM 6633  C CD1 . ILE H 1 15  ? 71.591  81.028  96.679  1.00 44.27 ? 15  ILE H CD1 1 
ATOM 6634  N N   . LEU H 1 16  ? 75.396  80.129  92.821  1.00 43.76 ? 16  LEU H N   1 
ATOM 6635  C CA  . LEU H 1 16  ? 76.224  80.567  91.682  1.00 43.77 ? 16  LEU H CA  1 
ATOM 6636  C C   . LEU H 1 16  ? 76.799  79.400  90.867  1.00 43.68 ? 16  LEU H C   1 
ATOM 6637  O O   . LEU H 1 16  ? 76.924  79.507  89.646  1.00 43.80 ? 16  LEU H O   1 
ATOM 6638  C CB  . LEU H 1 16  ? 77.355  81.506  92.144  1.00 43.94 ? 16  LEU H CB  1 
ATOM 6639  C CG  . LEU H 1 16  ? 77.037  83.007  92.216  1.00 44.26 ? 16  LEU H CG  1 
ATOM 6640  C CD1 . LEU H 1 16  ? 75.693  83.306  92.871  1.00 44.40 ? 16  LEU H CD1 1 
ATOM 6641  C CD2 . LEU H 1 16  ? 78.160  83.744  92.935  1.00 44.39 ? 16  LEU H CD2 1 
ATOM 6642  N N   . ALA H 1 17  ? 77.146  78.302  91.540  1.00 43.48 ? 17  ALA H N   1 
ATOM 6643  C CA  . ALA H 1 17  ? 77.660  77.099  90.867  1.00 43.36 ? 17  ALA H CA  1 
ATOM 6644  C C   . ALA H 1 17  ? 76.617  76.394  89.991  1.00 43.29 ? 17  ALA H C   1 
ATOM 6645  O O   . ALA H 1 17  ? 76.981  75.694  89.044  1.00 43.40 ? 17  ALA H O   1 
ATOM 6646  C CB  . ALA H 1 17  ? 78.227  76.121  91.889  1.00 43.38 ? 17  ALA H CB  1 
ATOM 6647  N N   . ALA H 1 18  ? 75.335  76.566  90.313  1.00 43.01 ? 18  ALA H N   1 
ATOM 6648  C CA  . ALA H 1 18  ? 74.245  75.985  89.528  1.00 42.88 ? 18  ALA H CA  1 
ATOM 6649  C C   . ALA H 1 18  ? 73.913  76.838  88.305  1.00 42.74 ? 18  ALA H C   1 
ATOM 6650  O O   . ALA H 1 18  ? 73.911  76.338  87.178  1.00 42.83 ? 18  ALA H O   1 
ATOM 6651  C CB  . ALA H 1 18  ? 73.007  75.813  90.396  1.00 42.97 ? 18  ALA H CB  1 
ATOM 6652  N N   . VAL H 1 19  ? 73.644  78.122  88.538  1.00 42.61 ? 19  VAL H N   1 
ATOM 6653  C CA  . VAL H 1 19  ? 73.118  79.017  87.492  1.00 42.61 ? 19  VAL H CA  1 
ATOM 6654  C C   . VAL H 1 19  ? 74.148  79.470  86.448  1.00 42.56 ? 19  VAL H C   1 
ATOM 6655  O O   . VAL H 1 19  ? 73.823  79.550  85.261  1.00 42.66 ? 19  VAL H O   1 
ATOM 6656  C CB  . VAL H 1 19  ? 72.399  80.263  88.085  1.00 42.69 ? 19  VAL H CB  1 
ATOM 6657  C CG1 . VAL H 1 19  ? 71.296  79.837  89.048  1.00 42.75 ? 19  VAL H CG1 1 
ATOM 6658  C CG2 . VAL H 1 19  ? 73.374  81.231  88.757  1.00 42.69 ? 19  VAL H CG2 1 
ATOM 6659  N N   . LEU H 1 20  ? 75.376  79.756  86.882  1.00 42.47 ? 20  LEU H N   1 
ATOM 6660  C CA  . LEU H 1 20  ? 76.404  80.321  85.994  1.00 42.47 ? 20  LEU H CA  1 
ATOM 6661  C C   . LEU H 1 20  ? 77.042  79.300  85.043  1.00 42.21 ? 20  LEU H C   1 
ATOM 6662  O O   . LEU H 1 20  ? 77.591  79.688  84.008  1.00 42.16 ? 20  LEU H O   1 
ATOM 6663  C CB  . LEU H 1 20  ? 77.495  81.023  86.808  1.00 42.79 ? 20  LEU H CB  1 
ATOM 6664  C CG  . LEU H 1 20  ? 77.048  82.156  87.739  1.00 43.17 ? 20  LEU H CG  1 
ATOM 6665  C CD1 . LEU H 1 20  ? 78.218  82.639  88.581  1.00 43.27 ? 20  LEU H CD1 1 
ATOM 6666  C CD2 . LEU H 1 20  ? 76.451  83.311  86.948  1.00 43.25 ? 20  LEU H CD2 1 
ATOM 6667  N N   . ILE H 1 21  ? 76.979  78.014  85.393  1.00 41.85 ? 21  ILE H N   1 
ATOM 6668  C CA  . ILE H 1 21  ? 77.500  76.940  84.538  1.00 41.51 ? 21  ILE H CA  1 
ATOM 6669  C C   . ILE H 1 21  ? 76.505  76.751  83.382  1.00 41.13 ? 21  ILE H C   1 
ATOM 6670  O O   . ILE H 1 21  ? 75.353  76.383  83.625  1.00 41.33 ? 21  ILE H O   1 
ATOM 6671  C CB  . ILE H 1 21  ? 77.702  75.614  85.327  1.00 41.75 ? 21  ILE H CB  1 
ATOM 6672  C CG1 . ILE H 1 21  ? 79.006  75.636  86.147  1.00 41.94 ? 21  ILE H CG1 1 
ATOM 6673  C CG2 . ILE H 1 21  ? 77.780  74.405  84.395  1.00 41.83 ? 21  ILE H CG2 1 
ATOM 6674  C CD1 . ILE H 1 21  ? 79.248  76.860  87.009  1.00 42.01 ? 21  ILE H CD1 1 
ATOM 6675  N N   . PRO H 1 22  ? 76.940  76.999  82.127  1.00 40.49 ? 22  PRO H N   1 
ATOM 6676  C CA  . PRO H 1 22  ? 76.018  76.937  80.991  1.00 40.05 ? 22  PRO H CA  1 
ATOM 6677  C C   . PRO H 1 22  ? 75.723  75.511  80.524  1.00 39.58 ? 22  PRO H C   1 
ATOM 6678  O O   . PRO H 1 22  ? 76.367  74.560  80.976  1.00 39.64 ? 22  PRO H O   1 
ATOM 6679  C CB  . PRO H 1 22  ? 76.771  77.701  79.904  1.00 40.17 ? 22  PRO H CB  1 
ATOM 6680  C CG  . PRO H 1 22  ? 78.201  77.397  80.185  1.00 40.35 ? 22  PRO H CG  1 
ATOM 6681  C CD  . PRO H 1 22  ? 78.319  77.284  81.682  1.00 40.46 ? 22  PRO H CD  1 
ATOM 6682  N N   . ASN H 1 23  ? 74.753  75.383  79.619  1.00 38.96 ? 23  ASN H N   1 
ATOM 6683  C CA  . ASN H 1 23  ? 74.418  74.099  79.002  1.00 38.42 ? 23  ASN H CA  1 
ATOM 6684  C C   . ASN H 1 23  ? 75.513  73.738  77.997  1.00 38.17 ? 23  ASN H C   1 
ATOM 6685  O O   . ASN H 1 23  ? 75.596  74.328  76.916  1.00 38.30 ? 23  ASN H O   1 
ATOM 6686  C CB  . ASN H 1 23  ? 73.043  74.170  78.322  1.00 38.26 ? 23  ASN H CB  1 
ATOM 6687  C CG  . ASN H 1 23  ? 72.499  72.802  77.943  1.00 38.22 ? 23  ASN H CG  1 
ATOM 6688  O OD1 . ASN H 1 23  ? 73.164  72.015  77.270  1.00 38.19 ? 23  ASN H OD1 1 
ATOM 6689  N ND2 . ASN H 1 23  ? 71.272  72.518  78.365  1.00 38.32 ? 23  ASN H ND2 1 
ATOM 6690  N N   . LEU H 1 24  ? 76.356  72.774  78.368  1.00 37.77 ? 24  LEU H N   1 
ATOM 6691  C CA  . LEU H 1 24  ? 77.492  72.367  77.541  1.00 37.53 ? 24  LEU H CA  1 
ATOM 6692  C C   . LEU H 1 24  ? 77.055  71.509  76.355  1.00 37.24 ? 24  LEU H C   1 
ATOM 6693  O O   . LEU H 1 24  ? 77.489  71.750  75.230  1.00 37.38 ? 24  LEU H O   1 
ATOM 6694  C CB  . LEU H 1 24  ? 78.529  71.608  78.377  1.00 37.66 ? 24  LEU H CB  1 
ATOM 6695  C CG  . LEU H 1 24  ? 79.150  72.364  79.559  1.00 37.78 ? 24  LEU H CG  1 
ATOM 6696  C CD1 . LEU H 1 24  ? 79.916  71.407  80.459  1.00 37.90 ? 24  LEU H CD1 1 
ATOM 6697  C CD2 . LEU H 1 24  ? 80.059  73.491  79.089  1.00 37.72 ? 24  LEU H CD2 1 
ATOM 6698  N N   . LEU H 1 25  ? 76.195  70.521  76.612  1.00 36.76 ? 25  LEU H N   1 
ATOM 6699  C CA  . LEU H 1 25  ? 75.739  69.575  75.583  1.00 36.40 ? 25  LEU H CA  1 
ATOM 6700  C C   . LEU H 1 25  ? 75.079  70.268  74.394  1.00 35.85 ? 25  LEU H C   1 
ATOM 6701  O O   . LEU H 1 25  ? 75.335  69.908  73.246  1.00 35.80 ? 25  LEU H O   1 
ATOM 6702  C CB  . LEU H 1 25  ? 74.764  68.548  76.178  1.00 36.59 ? 25  LEU H CB  1 
ATOM 6703  C CG  . LEU H 1 25  ? 74.284  67.408  75.266  1.00 36.81 ? 25  LEU H CG  1 
ATOM 6704  C CD1 . LEU H 1 25  ? 75.445  66.520  74.843  1.00 36.91 ? 25  LEU H CD1 1 
ATOM 6705  C CD2 . LEU H 1 25  ? 73.205  66.585  75.953  1.00 36.92 ? 25  LEU H CD2 1 
ATOM 6706  N N   . ALA H 1 26  ? 74.233  71.256  74.681  1.00 35.52 ? 26  ALA H N   1 
ATOM 6707  C CA  . ALA H 1 26  ? 73.540  72.021  73.640  1.00 35.27 ? 26  ALA H CA  1 
ATOM 6708  C C   . ALA H 1 26  ? 74.506  72.887  72.826  1.00 34.96 ? 26  ALA H C   1 
ATOM 6709  O O   . ALA H 1 26  ? 74.370  72.986  71.606  1.00 34.98 ? 26  ALA H O   1 
ATOM 6710  C CB  . ALA H 1 26  ? 72.437  72.878  74.251  1.00 35.29 ? 26  ALA H CB  1 
ATOM 6711  N N   . ALA H 1 27  ? 75.476  73.501  73.502  1.00 34.79 ? 27  ALA H N   1 
ATOM 6712  C CA  . ALA H 1 27  ? 76.498  74.325  72.842  1.00 34.77 ? 27  ALA H CA  1 
ATOM 6713  C C   . ALA H 1 27  ? 77.348  73.538  71.837  1.00 34.60 ? 27  ALA H C   1 
ATOM 6714  O O   . ALA H 1 27  ? 77.694  74.062  70.777  1.00 34.63 ? 27  ALA H O   1 
ATOM 6715  C CB  . ALA H 1 27  ? 77.396  74.986  73.879  1.00 34.88 ? 27  ALA H CB  1 
ATOM 6716  N N   . ARG H 1 28  ? 77.679  72.290  72.176  1.00 34.46 ? 28  ARG H N   1 
ATOM 6717  C CA  . ARG H 1 28  ? 78.474  71.426  71.296  1.00 34.32 ? 28  ARG H CA  1 
ATOM 6718  C C   . ARG H 1 28  ? 77.700  70.928  70.070  1.00 34.16 ? 28  ARG H C   1 
ATOM 6719  O O   . ARG H 1 28  ? 78.294  70.768  69.005  1.00 34.28 ? 28  ARG H O   1 
ATOM 6720  C CB  . ARG H 1 28  ? 79.045  70.231  72.067  1.00 34.46 ? 28  ARG H CB  1 
ATOM 6721  C CG  . ARG H 1 28  ? 80.003  70.616  73.185  1.00 34.64 ? 28  ARG H CG  1 
ATOM 6722  C CD  . ARG H 1 28  ? 80.928  69.470  73.570  1.00 34.76 ? 28  ARG H CD  1 
ATOM 6723  N NE  . ARG H 1 28  ? 82.107  69.400  72.706  1.00 34.86 ? 28  ARG H NE  1 
ATOM 6724  C CZ  . ARG H 1 28  ? 83.166  70.214  72.774  1.00 35.08 ? 28  ARG H CZ  1 
ATOM 6725  N NH1 . ARG H 1 28  ? 84.177  70.042  71.929  1.00 35.19 ? 28  ARG H NH1 1 
ATOM 6726  N NH2 . ARG H 1 28  ? 83.230  71.201  73.672  1.00 35.14 ? 28  ARG H NH2 1 
ATOM 6727  N N   . LYS H 1 29  ? 76.396  70.679  70.223  1.00 34.02 ? 29  LYS H N   1 
ATOM 6728  C CA  . LYS H 1 29  ? 75.536  70.231  69.107  1.00 33.92 ? 29  LYS H CA  1 
ATOM 6729  C C   . LYS H 1 29  ? 75.629  71.126  67.869  1.00 33.86 ? 29  LYS H C   1 
ATOM 6730  O O   . LYS H 1 29  ? 75.709  70.625  66.747  1.00 34.02 ? 29  LYS H O   1 
ATOM 6731  C CB  . LYS H 1 29  ? 74.062  70.137  69.534  1.00 33.96 ? 29  LYS H CB  1 
ATOM 6732  C CG  . LYS H 1 29  ? 73.689  68.880  70.303  1.00 34.05 ? 29  LYS H CG  1 
ATOM 6733  C CD  . LYS H 1 29  ? 72.177  68.703  70.342  1.00 34.19 ? 29  LYS H CD  1 
ATOM 6734  C CE  . LYS H 1 29  ? 71.758  67.529  71.214  1.00 34.36 ? 29  LYS H CE  1 
ATOM 6735  N NZ  . LYS H 1 29  ? 71.739  67.862  72.667  1.00 34.43 ? 29  LYS H NZ  1 
ATOM 6736  N N   . ARG H 1 30  ? 75.621  72.440  68.083  1.00 33.59 ? 30  ARG H N   1 
ATOM 6737  C CA  . ARG H 1 30  ? 75.669  73.413  66.985  1.00 33.40 ? 30  ARG H CA  1 
ATOM 6738  C C   . ARG H 1 30  ? 77.072  73.522  66.389  1.00 33.27 ? 30  ARG H C   1 
ATOM 6739  O O   . ARG H 1 30  ? 77.219  73.743  65.185  1.00 33.42 ? 30  ARG H O   1 
ATOM 6740  C CB  . ARG H 1 30  ? 75.187  74.792  67.447  1.00 33.43 ? 30  ARG H CB  1 
ATOM 6741  C CG  . ARG H 1 30  ? 73.806  74.819  68.097  1.00 33.49 ? 30  ARG H CG  1 
ATOM 6742  C CD  . ARG H 1 30  ? 72.696  74.321  67.180  1.00 33.56 ? 30  ARG H CD  1 
ATOM 6743  N NE  . ARG H 1 30  ? 71.418  74.175  67.881  1.00 33.57 ? 30  ARG H NE  1 
ATOM 6744  C CZ  . ARG H 1 30  ? 70.277  73.778  67.314  1.00 33.63 ? 30  ARG H CZ  1 
ATOM 6745  N NH1 . ARG H 1 30  ? 70.222  73.478  66.016  1.00 33.65 ? 30  ARG H NH1 1 
ATOM 6746  N NH2 . ARG H 1 30  ? 69.174  73.681  68.053  1.00 33.67 ? 30  ARG H NH2 1 
ATOM 6747  N N   . ALA H 1 31  ? 78.092  73.382  67.234  1.00 32.98 ? 31  ALA H N   1 
ATOM 6748  C CA  . ALA H 1 31  ? 79.480  73.295  66.774  1.00 32.87 ? 31  ALA H CA  1 
ATOM 6749  C C   . ALA H 1 31  ? 79.728  72.016  65.972  1.00 32.84 ? 31  ALA H C   1 
ATOM 6750  O O   . ALA H 1 31  ? 80.478  72.032  64.996  1.00 32.95 ? 31  ALA H O   1 
ATOM 6751  C CB  . ALA H 1 31  ? 80.434  73.366  67.956  1.00 32.90 ? 31  ALA H CB  1 
ATOM 6752  N N   . ASN H 1 32  ? 79.103  70.917  66.397  1.00 32.86 ? 32  ASN H N   1 
ATOM 6753  C CA  . ASN H 1 32  ? 79.159  69.643  65.666  1.00 32.92 ? 32  ASN H CA  1 
ATOM 6754  C C   . ASN H 1 32  ? 78.472  69.713  64.297  1.00 33.12 ? 32  ASN H C   1 
ATOM 6755  O O   . ASN H 1 32  ? 78.918  69.061  63.350  1.00 33.24 ? 32  ASN H O   1 
ATOM 6756  C CB  . ASN H 1 32  ? 78.536  68.509  66.496  1.00 32.83 ? 32  ASN H CB  1 
ATOM 6757  C CG  . ASN H 1 32  ? 79.383  68.114  67.699  1.00 32.76 ? 32  ASN H CG  1 
ATOM 6758  O OD1 . ASN H 1 32  ? 80.611  68.101  67.618  1.00 32.77 ? 32  ASN H OD1 1 
ATOM 6759  N ND2 . ASN H 1 32  ? 78.737  67.797  68.816  1.00 32.81 ? 32  ASN H ND2 1 
ATOM 6760  N N   . ASP H 1 33  ? 77.390  70.488  64.202  1.00 33.25 ? 33  ASP H N   1 
ATOM 6761  C CA  . ASP H 1 33  ? 76.718  70.740  62.917  1.00 33.42 ? 33  ASP H CA  1 
ATOM 6762  C C   . ASP H 1 33  ? 77.602  71.533  61.954  1.00 33.48 ? 33  ASP H C   1 
ATOM 6763  O O   . ASP H 1 33  ? 77.571  71.293  60.745  1.00 33.61 ? 33  ASP H O   1 
ATOM 6764  C CB  . ASP H 1 33  ? 75.396  71.492  63.123  1.00 33.64 ? 33  ASP H CB  1 
ATOM 6765  C CG  . ASP H 1 33  ? 74.347  70.670  63.861  1.00 33.90 ? 33  ASP H CG  1 
ATOM 6766  O OD1 . ASP H 1 33  ? 74.492  69.432  63.973  1.00 33.97 ? 33  ASP H OD1 1 
ATOM 6767  O OD2 . ASP H 1 33  ? 73.363  71.276  64.335  1.00 34.02 ? 33  ASP H OD2 1 
ATOM 6768  N N   . THR H 1 34  ? 78.373  72.478  62.493  1.00 33.41 ? 34  THR H N   1 
ATOM 6769  C CA  . THR H 1 34  ? 79.333  73.256  61.703  1.00 33.36 ? 34  THR H CA  1 
ATOM 6770  C C   . THR H 1 34  ? 80.440  72.378  61.110  1.00 33.33 ? 34  THR H C   1 
ATOM 6771  O O   . THR H 1 34  ? 80.888  72.628  59.993  1.00 33.44 ? 34  THR H O   1 
ATOM 6772  C CB  . THR H 1 34  ? 79.984  74.376  62.547  1.00 33.50 ? 34  THR H CB  1 
ATOM 6773  O OG1 . THR H 1 34  ? 78.974  75.075  63.286  1.00 33.50 ? 34  THR H OG1 1 
ATOM 6774  C CG2 . THR H 1 34  ? 80.740  75.368  61.662  1.00 33.60 ? 34  THR H CG2 1 
ATOM 6775  N N   . VAL H 1 35  ? 80.868  71.361  61.860  1.00 33.30 ? 35  VAL H N   1 
ATOM 6776  C CA  . VAL H 1 35  ? 81.875  70.397  61.388  1.00 33.32 ? 35  VAL H CA  1 
ATOM 6777  C C   . VAL H 1 35  ? 81.323  69.548  60.237  1.00 33.25 ? 35  VAL H C   1 
ATOM 6778  O O   . VAL H 1 35  ? 82.030  69.293  59.260  1.00 33.36 ? 35  VAL H O   1 
ATOM 6779  C CB  . VAL H 1 35  ? 82.374  69.479  62.538  1.00 33.52 ? 35  VAL H CB  1 
ATOM 6780  C CG1 . VAL H 1 35  ? 83.269  68.353  62.018  1.00 33.63 ? 35  VAL H CG1 1 
ATOM 6781  C CG2 . VAL H 1 35  ? 83.123  70.292  63.585  1.00 33.60 ? 35  VAL H CG2 1 
ATOM 6782  N N   . VAL H 1 36  ? 80.067  69.119  60.364  1.00 33.13 ? 36  VAL H N   1 
ATOM 6783  C CA  . VAL H 1 36  ? 79.396  68.327  59.326  1.00 33.03 ? 36  VAL H CA  1 
ATOM 6784  C C   . VAL H 1 36  ? 79.117  69.178  58.083  1.00 33.02 ? 36  VAL H C   1 
ATOM 6785  O O   . VAL H 1 36  ? 79.327  68.720  56.959  1.00 33.10 ? 36  VAL H O   1 
ATOM 6786  C CB  . VAL H 1 36  ? 78.077  67.701  59.849  1.00 33.02 ? 36  VAL H CB  1 
ATOM 6787  C CG1 . VAL H 1 36  ? 77.289  67.037  58.723  1.00 33.08 ? 36  VAL H CG1 1 
ATOM 6788  C CG2 . VAL H 1 36  ? 78.365  66.690  60.951  1.00 33.01 ? 36  VAL H CG2 1 
ATOM 6789  N N   . THR H 1 37  ? 78.639  70.404  58.296  1.00 33.06 ? 37  THR H N   1 
ATOM 6790  C CA  . THR H 1 37  ? 78.373  71.343  57.202  1.00 33.11 ? 37  THR H CA  1 
ATOM 6791  C C   . THR H 1 37  ? 79.656  71.751  56.472  1.00 33.10 ? 37  THR H C   1 
ATOM 6792  O O   . THR H 1 37  ? 79.657  71.862  55.246  1.00 33.26 ? 37  THR H O   1 
ATOM 6793  C CB  . THR H 1 37  ? 77.652  72.614  57.708  1.00 33.23 ? 37  THR H CB  1 
ATOM 6794  O OG1 . THR H 1 37  ? 76.489  72.242  58.458  1.00 33.31 ? 37  THR H OG1 1 
ATOM 6795  C CG2 . THR H 1 37  ? 77.234  73.517  56.543  1.00 33.28 ? 37  THR H CG2 1 
ATOM 6796  N N   . ALA H 1 38  ? 80.734  71.967  57.226  1.00 33.05 ? 38  ALA H N   1 
ATOM 6797  C CA  . ALA H 1 38  ? 82.038  72.315  56.648  1.00 33.10 ? 38  ALA H CA  1 
ATOM 6798  C C   . ALA H 1 38  ? 82.636  71.174  55.829  1.00 33.09 ? 38  ALA H C   1 
ATOM 6799  O O   . ALA H 1 38  ? 83.166  71.408  54.743  1.00 33.10 ? 38  ALA H O   1 
ATOM 6800  C CB  . ALA H 1 38  ? 83.013  72.738  57.739  1.00 33.16 ? 38  ALA H CB  1 
ATOM 6801  N N   . TYR H 1 39  ? 82.550  69.951  56.352  1.00 33.22 ? 39  TYR H N   1 
ATOM 6802  C CA  . TYR H 1 39  ? 83.082  68.769  55.662  1.00 33.27 ? 39  TYR H CA  1 
ATOM 6803  C C   . TYR H 1 39  ? 82.303  68.439  54.387  1.00 33.48 ? 39  TYR H C   1 
ATOM 6804  O O   . TYR H 1 39  ? 82.901  68.034  53.389  1.00 33.64 ? 39  TYR H O   1 
ATOM 6805  C CB  . TYR H 1 39  ? 83.108  67.549  56.588  1.00 33.19 ? 39  TYR H CB  1 
ATOM 6806  C CG  . TYR H 1 39  ? 83.951  66.415  56.048  1.00 33.27 ? 39  TYR H CG  1 
ATOM 6807  C CD1 . TYR H 1 39  ? 85.341  66.434  56.174  1.00 33.33 ? 39  TYR H CD1 1 
ATOM 6808  C CD2 . TYR H 1 39  ? 83.366  65.326  55.401  1.00 33.35 ? 39  TYR H CD2 1 
ATOM 6809  C CE1 . TYR H 1 39  ? 86.123  65.400  55.675  1.00 33.32 ? 39  TYR H CE1 1 
ATOM 6810  C CE2 . TYR H 1 39  ? 84.139  64.287  54.901  1.00 33.36 ? 39  TYR H CE2 1 
ATOM 6811  C CZ  . TYR H 1 39  ? 85.516  64.327  55.040  1.00 33.36 ? 39  TYR H CZ  1 
ATOM 6812  O OH  . TYR H 1 39  ? 86.285  63.299  54.545  1.00 33.46 ? 39  TYR H OH  1 
ATOM 6813  N N   . LEU H 1 40  ? 80.980  68.604  54.429  1.00 33.68 ? 40  LEU H N   1 
ATOM 6814  C CA  . LEU H 1 40  ? 80.140  68.467  53.231  1.00 33.88 ? 40  LEU H CA  1 
ATOM 6815  C C   . LEU H 1 40  ? 80.391  69.592  52.224  1.00 34.31 ? 40  LEU H C   1 
ATOM 6816  O O   . LEU H 1 40  ? 80.384  69.350  51.019  1.00 34.49 ? 40  LEU H O   1 
ATOM 6817  C CB  . LEU H 1 40  ? 78.653  68.419  53.597  1.00 33.80 ? 40  LEU H CB  1 
ATOM 6818  C CG  . LEU H 1 40  ? 78.164  67.139  54.278  1.00 33.73 ? 40  LEU H CG  1 
ATOM 6819  C CD1 . LEU H 1 40  ? 76.787  67.363  54.876  1.00 33.66 ? 40  LEU H CD1 1 
ATOM 6820  C CD2 . LEU H 1 40  ? 78.136  65.966  53.309  1.00 33.70 ? 40  LEU H CD2 1 
ATOM 6821  N N   . ASN H 1 41  ? 80.603  70.812  52.723  1.00 34.79 ? 41  ASN H N   1 
ATOM 6822  C CA  . ASN H 1 41  ? 80.972  71.951  51.872  1.00 35.15 ? 41  ASN H CA  1 
ATOM 6823  C C   . ASN H 1 41  ? 82.326  71.722  51.191  1.00 35.40 ? 41  ASN H C   1 
ATOM 6824  O O   . ASN H 1 41  ? 82.500  72.080  50.025  1.00 35.49 ? 41  ASN H O   1 
ATOM 6825  C CB  . ASN H 1 41  ? 81.001  73.252  52.687  1.00 35.34 ? 41  ASN H CB  1 
ATOM 6826  C CG  . ASN H 1 41  ? 81.220  74.486  51.825  1.00 35.61 ? 41  ASN H CG  1 
ATOM 6827  O OD1 . ASN H 1 41  ? 80.613  74.637  50.764  1.00 35.79 ? 41  ASN H OD1 1 
ATOM 6828  N ND2 . ASN H 1 41  ? 82.087  75.382  52.286  1.00 35.71 ? 41  ASN H ND2 1 
ATOM 6829  N N   . ASP H 1 42  ? 83.271  71.128  51.921  1.00 35.76 ? 42  ASP H N   1 
ATOM 6830  C CA  . ASP H 1 42  ? 84.557  70.707  51.348  1.00 36.04 ? 42  ASP H CA  1 
ATOM 6831  C C   . ASP H 1 42  ? 84.388  69.528  50.388  1.00 36.01 ? 42  ASP H C   1 
ATOM 6832  O O   . ASP H 1 42  ? 85.026  69.493  49.337  1.00 36.17 ? 42  ASP H O   1 
ATOM 6833  C CB  . ASP H 1 42  ? 85.561  70.333  52.451  1.00 36.32 ? 42  ASP H CB  1 
ATOM 6834  C CG  . ASP H 1 42  ? 85.997  71.531  53.289  1.00 36.66 ? 42  ASP H CG  1 
ATOM 6835  O OD1 . ASP H 1 42  ? 86.176  72.637  52.732  1.00 36.82 ? 42  ASP H OD1 1 
ATOM 6836  O OD2 . ASP H 1 42  ? 86.172  71.360  54.514  1.00 36.78 ? 42  ASP H OD2 1 
ATOM 6837  N N   . ALA H 1 43  ? 83.533  68.572  50.753  1.00 35.92 ? 43  ALA H N   1 
ATOM 6838  C CA  . ALA H 1 43  ? 83.241  67.406  49.907  1.00 35.94 ? 43  ALA H CA  1 
ATOM 6839  C C   . ALA H 1 43  ? 82.645  67.790  48.551  1.00 36.00 ? 43  ALA H C   1 
ATOM 6840  O O   . ALA H 1 43  ? 82.953  67.158  47.542  1.00 36.16 ? 43  ALA H O   1 
ATOM 6841  C CB  . ALA H 1 43  ? 82.313  66.441  50.631  1.00 35.95 ? 43  ALA H CB  1 
ATOM 6842  N N   . VAL H 1 44  ? 81.796  68.817  48.538  1.00 36.18 ? 44  VAL H N   1 
ATOM 6843  C CA  . VAL H 1 44  ? 81.212  69.350  47.297  1.00 36.35 ? 44  VAL H CA  1 
ATOM 6844  C C   . VAL H 1 44  ? 82.285  69.950  46.374  1.00 36.53 ? 44  VAL H C   1 
ATOM 6845  O O   . VAL H 1 44  ? 82.195  69.810  45.154  1.00 36.62 ? 44  VAL H O   1 
ATOM 6846  C CB  . VAL H 1 44  ? 80.092  70.387  47.599  1.00 36.45 ? 44  VAL H CB  1 
ATOM 6847  C CG1 . VAL H 1 44  ? 79.661  71.150  46.348  1.00 36.57 ? 44  VAL H CG1 1 
ATOM 6848  C CG2 . VAL H 1 44  ? 78.885  69.702  48.239  1.00 36.45 ? 44  VAL H CG2 1 
ATOM 6849  N N   . LYS H 1 45  ? 83.289  70.608  46.957  1.00 36.84 ? 45  LYS H N   1 
ATOM 6850  C CA  . LYS H 1 45  ? 84.387  71.204  46.182  1.00 37.12 ? 45  LYS H CA  1 
ATOM 6851  C C   . LYS H 1 45  ? 85.236  70.147  45.477  1.00 37.00 ? 45  LYS H C   1 
ATOM 6852  O O   . LYS H 1 45  ? 85.493  70.258  44.278  1.00 37.15 ? 45  LYS H O   1 
ATOM 6853  C CB  . LYS H 1 45  ? 85.278  72.082  47.071  1.00 37.49 ? 45  LYS H CB  1 
ATOM 6854  C CG  . LYS H 1 45  ? 84.593  73.339  47.587  1.00 37.82 ? 45  LYS H CG  1 
ATOM 6855  C CD  . LYS H 1 45  ? 85.355  73.965  48.746  1.00 38.10 ? 45  LYS H CD  1 
ATOM 6856  C CE  . LYS H 1 45  ? 84.576  75.118  49.361  1.00 38.33 ? 45  LYS H CE  1 
ATOM 6857  N NZ  . LYS H 1 45  ? 85.234  75.666  50.580  1.00 38.49 ? 45  LYS H NZ  1 
ATOM 6858  N N   . PHE H 1 46  ? 85.659  69.127  46.220  1.00 36.90 ? 46  PHE H N   1 
ATOM 6859  C CA  . PHE H 1 46  ? 86.470  68.039  45.655  1.00 36.84 ? 46  PHE H CA  1 
ATOM 6860  C C   . PHE H 1 46  ? 85.692  67.092  44.730  1.00 36.81 ? 46  PHE H C   1 
ATOM 6861  O O   . PHE H 1 46  ? 86.305  66.357  43.954  1.00 36.96 ? 46  PHE H O   1 
ATOM 6862  C CB  . PHE H 1 46  ? 87.189  67.259  46.762  1.00 36.83 ? 46  PHE H CB  1 
ATOM 6863  C CG  . PHE H 1 46  ? 88.349  68.004  47.358  1.00 36.90 ? 46  PHE H CG  1 
ATOM 6864  C CD1 . PHE H 1 46  ? 89.567  68.057  46.690  1.00 37.06 ? 46  PHE H CD1 1 
ATOM 6865  C CD2 . PHE H 1 46  ? 88.224  68.670  48.572  1.00 36.99 ? 46  PHE H CD2 1 
ATOM 6866  C CE1 . PHE H 1 46  ? 90.642  68.752  47.225  1.00 37.14 ? 46  PHE H CE1 1 
ATOM 6867  C CE2 . PHE H 1 46  ? 89.296  69.364  49.116  1.00 37.16 ? 46  PHE H CE2 1 
ATOM 6868  C CZ  . PHE H 1 46  ? 90.507  69.407  48.440  1.00 37.19 ? 46  PHE H CZ  1 
ATOM 6869  N N   . GLN H 1 47  ? 84.360  67.103  44.817  1.00 36.77 ? 47  GLN H N   1 
ATOM 6870  C CA  . GLN H 1 47  ? 83.511  66.441  43.816  1.00 36.82 ? 47  GLN H CA  1 
ATOM 6871  C C   . GLN H 1 47  ? 83.574  67.173  42.472  1.00 37.07 ? 47  GLN H C   1 
ATOM 6872  O O   . GLN H 1 47  ? 83.619  66.532  41.420  1.00 37.28 ? 47  GLN H O   1 
ATOM 6873  C CB  . GLN H 1 47  ? 82.055  66.339  44.292  1.00 36.79 ? 47  GLN H CB  1 
ATOM 6874  C CG  . GLN H 1 47  ? 81.804  65.235  45.312  1.00 36.85 ? 47  GLN H CG  1 
ATOM 6875  C CD  . GLN H 1 47  ? 81.551  63.875  44.681  1.00 36.98 ? 47  GLN H CD  1 
ATOM 6876  O OE1 . GLN H 1 47  ? 82.139  63.530  43.656  1.00 37.07 ? 47  GLN H OE1 1 
ATOM 6877  N NE2 . GLN H 1 47  ? 80.677  63.092  45.302  1.00 37.07 ? 47  GLN H NE2 1 
ATOM 6878  N N   . GLU H 1 48  ? 83.569  68.506  42.514  1.00 37.41 ? 48  GLU H N   1 
ATOM 6879  C CA  . GLU H 1 48  ? 83.727  69.333  41.309  1.00 37.74 ? 48  GLU H CA  1 
ATOM 6880  C C   . GLU H 1 48  ? 85.135  69.240  40.710  1.00 37.83 ? 48  GLU H C   1 
ATOM 6881  O O   . GLU H 1 48  ? 85.294  69.350  39.495  1.00 38.01 ? 48  GLU H O   1 
ATOM 6882  C CB  . GLU H 1 48  ? 83.382  70.802  41.596  1.00 38.07 ? 48  GLU H CB  1 
ATOM 6883  C CG  . GLU H 1 48  ? 81.918  71.057  41.936  1.00 38.39 ? 48  GLU H CG  1 
ATOM 6884  C CD  . GLU H 1 48  ? 80.983  70.907  40.744  1.00 38.68 ? 48  GLU H CD  1 
ATOM 6885  O OE1 . GLU H 1 48  ? 81.283  71.460  39.663  1.00 38.76 ? 48  GLU H OE1 1 
ATOM 6886  O OE2 . GLU H 1 48  ? 79.933  70.244  40.892  1.00 38.77 ? 48  GLU H OE2 1 
ATOM 6887  N N   . MET H 1 49  ? 86.148  69.051  41.557  1.00 37.94 ? 49  MET H N   1 
ATOM 6888  C CA  . MET H 1 49  ? 87.527  68.848  41.090  1.00 38.06 ? 49  MET H CA  1 
ATOM 6889  C C   . MET H 1 49  ? 87.718  67.496  40.395  1.00 37.98 ? 49  MET H C   1 
ATOM 6890  O O   . MET H 1 49  ? 88.486  67.399  39.437  1.00 38.26 ? 49  MET H O   1 
ATOM 6891  C CB  . MET H 1 49  ? 88.523  68.988  42.244  1.00 38.24 ? 49  MET H CB  1 
ATOM 6892  C CG  . MET H 1 49  ? 88.660  70.415  42.748  1.00 38.47 ? 49  MET H CG  1 
ATOM 6893  S SD  . MET H 1 49  ? 89.697  70.574  44.213  1.00 38.86 ? 49  MET H SD  1 
ATOM 6894  C CE  . MET H 1 49  ? 91.273  70.015  43.575  1.00 38.96 ? 49  MET H CE  1 
ATOM 6895  N N   . TYR H 1 50  ? 87.031  66.465  40.883  1.00 37.79 ? 50  TYR H N   1 
ATOM 6896  C CA  . TYR H 1 50  ? 87.021  65.153  40.226  1.00 37.80 ? 50  TYR H CA  1 
ATOM 6897  C C   . TYR H 1 50  ? 86.238  65.190  38.907  1.00 38.04 ? 50  TYR H C   1 
ATOM 6898  O O   . TYR H 1 50  ? 86.566  64.458  37.970  1.00 38.25 ? 50  TYR H O   1 
ATOM 6899  C CB  . TYR H 1 50  ? 86.432  64.089  41.156  1.00 37.76 ? 50  TYR H CB  1 
ATOM 6900  C CG  . TYR H 1 50  ? 86.744  62.667  40.746  1.00 37.79 ? 50  TYR H CG  1 
ATOM 6901  C CD1 . TYR H 1 50  ? 85.902  61.966  39.882  1.00 37.66 ? 50  TYR H CD1 1 
ATOM 6902  C CD2 . TYR H 1 50  ? 87.872  62.010  41.238  1.00 37.87 ? 50  TYR H CD2 1 
ATOM 6903  C CE1 . TYR H 1 50  ? 86.181  60.658  39.512  1.00 37.67 ? 50  TYR H CE1 1 
ATOM 6904  C CE2 . TYR H 1 50  ? 88.160  60.702  40.873  1.00 37.85 ? 50  TYR H CE2 1 
ATOM 6905  C CZ  . TYR H 1 50  ? 87.312  60.029  40.010  1.00 37.80 ? 50  TYR H CZ  1 
ATOM 6906  O OH  . TYR H 1 50  ? 87.592  58.733  39.643  1.00 37.98 ? 50  TYR H OH  1 
ATOM 6907  N N   . GLN H 1 51  ? 85.204  66.030  38.851  1.00 38.31 ? 51  GLN H N   1 
ATOM 6908  C CA  . GLN H 1 51  ? 84.434  66.268  37.623  1.00 38.55 ? 51  GLN H CA  1 
ATOM 6909  C C   . GLN H 1 51  ? 85.281  66.916  36.517  1.00 38.78 ? 51  GLN H C   1 
ATOM 6910  O O   . GLN H 1 51  ? 85.051  66.661  35.334  1.00 38.94 ? 51  GLN H O   1 
ATOM 6911  C CB  . GLN H 1 51  ? 83.203  67.137  37.930  1.00 38.73 ? 51  GLN H CB  1 
ATOM 6912  C CG  . GLN H 1 51  ? 82.194  67.293  36.797  1.00 38.88 ? 51  GLN H CG  1 
ATOM 6913  C CD  . GLN H 1 51  ? 81.461  66.008  36.458  1.00 38.88 ? 51  GLN H CD  1 
ATOM 6914  O OE1 . GLN H 1 51  ? 80.977  65.304  37.343  1.00 38.93 ? 51  GLN H OE1 1 
ATOM 6915  N NE2 . GLN H 1 51  ? 81.357  65.709  35.169  1.00 38.97 ? 51  GLN H NE2 1 
ATOM 6916  N N   . ILE H 1 52  ? 86.243  67.755  36.903  1.00 38.96 ? 52  ILE H N   1 
ATOM 6917  C CA  . ILE H 1 52  ? 87.195  68.352  35.954  1.00 39.19 ? 52  ILE H CA  1 
ATOM 6918  C C   . ILE H 1 52  ? 88.121  67.282  35.358  1.00 39.35 ? 52  ILE H C   1 
ATOM 6919  O O   . ILE H 1 52  ? 88.379  67.287  34.152  1.00 39.50 ? 52  ILE H O   1 
ATOM 6920  C CB  . ILE H 1 52  ? 88.026  69.487  36.610  1.00 39.24 ? 52  ILE H CB  1 
ATOM 6921  C CG1 . ILE H 1 52  ? 87.118  70.674  36.960  1.00 39.33 ? 52  ILE H CG1 1 
ATOM 6922  C CG2 . ILE H 1 52  ? 89.153  69.964  35.692  1.00 39.29 ? 52  ILE H CG2 1 
ATOM 6923  C CD1 . ILE H 1 52  ? 87.666  71.587  38.038  1.00 39.33 ? 52  ILE H CD1 1 
ATOM 6924  N N   . ASP H 1 53  ? 88.602  66.369  36.201  1.00 39.54 ? 53  ASP H N   1 
ATOM 6925  C CA  . ASP H 1 53  ? 89.544  65.330  35.776  1.00 39.77 ? 53  ASP H CA  1 
ATOM 6926  C C   . ASP H 1 53  ? 88.865  64.211  34.988  1.00 39.75 ? 53  ASP H C   1 
ATOM 6927  O O   . ASP H 1 53  ? 89.205  63.970  33.827  1.00 39.95 ? 53  ASP H O   1 
ATOM 6928  C CB  . ASP H 1 53  ? 90.272  64.735  36.988  1.00 40.03 ? 53  ASP H CB  1 
ATOM 6929  C CG  . ASP H 1 53  ? 91.132  65.754  37.720  1.00 40.34 ? 53  ASP H CG  1 
ATOM 6930  O OD1 . ASP H 1 53  ? 90.954  66.970  37.495  1.00 40.49 ? 53  ASP H OD1 1 
ATOM 6931  O OD2 . ASP H 1 53  ? 91.987  65.334  38.529  1.00 40.58 ? 53  ASP H OD2 1 
ATOM 6932  N N   . ASN H 1 54  ? 87.901  63.546  35.624  1.00 39.52 ? 54  ASN H N   1 
ATOM 6933  C CA  . ASN H 1 54  ? 87.312  62.304  35.103  1.00 39.56 ? 54  ASN H CA  1 
ATOM 6934  C C   . ASN H 1 54  ? 85.984  62.459  34.347  1.00 39.43 ? 54  ASN H C   1 
ATOM 6935  O O   . ASN H 1 54  ? 85.526  61.496  33.727  1.00 39.61 ? 54  ASN H O   1 
ATOM 6936  C CB  . ASN H 1 54  ? 87.116  61.307  36.250  1.00 39.76 ? 54  ASN H CB  1 
ATOM 6937  C CG  . ASN H 1 54  ? 88.425  60.891  36.897  1.00 39.96 ? 54  ASN H CG  1 
ATOM 6938  O OD1 . ASN H 1 54  ? 88.945  59.808  36.628  1.00 40.17 ? 54  ASN H OD1 1 
ATOM 6939  N ND2 . ASN H 1 54  ? 88.963  61.752  37.753  1.00 40.00 ? 54  ASN H ND2 1 
ATOM 6940  N N   . ASN H 1 55  ? 85.374  63.648  34.398  1.00 39.07 ? 55  ASN H N   1 
ATOM 6941  C CA  . ASN H 1 55  ? 84.042  63.904  33.814  1.00 38.83 ? 55  ASN H CA  1 
ATOM 6942  C C   . ASN H 1 55  ? 82.949  63.021  34.438  1.00 38.56 ? 55  ASN H C   1 
ATOM 6943  O O   . ASN H 1 55  ? 82.084  62.491  33.738  1.00 38.71 ? 55  ASN H O   1 
ATOM 6944  C CB  . ASN H 1 55  ? 84.063  63.761  32.281  1.00 39.00 ? 55  ASN H CB  1 
ATOM 6945  C CG  . ASN H 1 55  ? 85.195  64.537  31.630  1.00 39.27 ? 55  ASN H CG  1 
ATOM 6946  O OD1 . ASN H 1 55  ? 85.893  64.020  30.758  1.00 39.50 ? 55  ASN H OD1 1 
ATOM 6947  N ND2 . ASN H 1 55  ? 85.383  65.784  32.051  1.00 39.40 ? 55  ASN H ND2 1 
ATOM 6948  N N   . SER H 1 56  ? 83.003  62.883  35.762  1.00 38.22 ? 56  SER H N   1 
ATOM 6949  C CA  . SER H 1 56  ? 82.019  62.108  36.527  1.00 37.99 ? 56  SER H CA  1 
ATOM 6950  C C   . SER H 1 56  ? 82.110  62.461  38.014  1.00 37.53 ? 56  SER H C   1 
ATOM 6951  O O   . SER H 1 56  ? 82.949  63.270  38.412  1.00 37.69 ? 56  SER H O   1 
ATOM 6952  C CB  . SER H 1 56  ? 82.251  60.606  36.332  1.00 38.25 ? 56  SER H CB  1 
ATOM 6953  O OG  . SER H 1 56  ? 81.227  59.845  36.951  1.00 38.43 ? 56  SER H OG  1 
ATOM 6954  N N   . TYR H 1 57  ? 81.232  61.865  38.821  1.00 36.99 ? 57  TYR H N   1 
ATOM 6955  C CA  . TYR H 1 57  ? 81.260  62.028  40.279  1.00 36.72 ? 57  TYR H CA  1 
ATOM 6956  C C   . TYR H 1 57  ? 81.640  60.715  40.966  1.00 36.67 ? 57  TYR H C   1 
ATOM 6957  O O   . TYR H 1 57  ? 81.353  59.629  40.457  1.00 36.63 ? 57  TYR H O   1 
ATOM 6958  C CB  . TYR H 1 57  ? 79.908  62.528  40.792  1.00 36.60 ? 57  TYR H CB  1 
ATOM 6959  C CG  . TYR H 1 57  ? 79.607  63.964  40.418  1.00 36.53 ? 57  TYR H CG  1 
ATOM 6960  C CD1 . TYR H 1 57  ? 80.305  65.020  41.008  1.00 36.47 ? 57  TYR H CD1 1 
ATOM 6961  C CD2 . TYR H 1 57  ? 78.619  64.275  39.482  1.00 36.51 ? 57  TYR H CD2 1 
ATOM 6962  C CE1 . TYR H 1 57  ? 80.034  66.340  40.673  1.00 36.34 ? 57  TYR H CE1 1 
ATOM 6963  C CE2 . TYR H 1 57  ? 78.340  65.593  39.141  1.00 36.42 ? 57  TYR H CE2 1 
ATOM 6964  C CZ  . TYR H 1 57  ? 79.049  66.621  39.739  1.00 36.34 ? 57  TYR H CZ  1 
ATOM 6965  O OH  . TYR H 1 57  ? 78.779  67.927  39.406  1.00 36.45 ? 57  TYR H OH  1 
ATOM 6966  N N   . THR H 1 58  ? 82.279  60.835  42.128  1.00 36.59 ? 58  THR H N   1 
ATOM 6967  C CA  . THR H 1 58  ? 82.848  59.694  42.843  1.00 36.53 ? 58  THR H CA  1 
ATOM 6968  C C   . THR H 1 58  ? 81.828  59.000  43.737  1.00 36.66 ? 58  THR H C   1 
ATOM 6969  O O   . THR H 1 58  ? 81.106  59.659  44.486  1.00 36.84 ? 58  THR H O   1 
ATOM 6970  C CB  . THR H 1 58  ? 84.017  60.133  43.743  1.00 36.65 ? 58  THR H CB  1 
ATOM 6971  O OG1 . THR H 1 58  ? 83.572  61.151  44.649  1.00 36.58 ? 58  THR H OG1 1 
ATOM 6972  C CG2 . THR H 1 58  ? 85.151  60.676  42.907  1.00 36.74 ? 58  THR H CG2 1 
ATOM 6973  N N   . SER H 1 59  ? 81.790  57.671  43.658  1.00 36.78 ? 59  SER H N   1 
ATOM 6974  C CA  . SER H 1 59  ? 81.025  56.852  44.596  1.00 36.85 ? 59  SER H CA  1 
ATOM 6975  C C   . SER H 1 59  ? 81.838  56.627  45.872  1.00 36.82 ? 59  SER H C   1 
ATOM 6976  O O   . SER H 1 59  ? 81.304  56.749  46.974  1.00 36.81 ? 59  SER H O   1 
ATOM 6977  C CB  . SER H 1 59  ? 80.659  55.509  43.959  1.00 37.11 ? 59  SER H CB  1 
ATOM 6978  O OG  . SER H 1 59  ? 79.749  54.788  44.774  1.00 37.24 ? 59  SER H OG  1 
ATOM 6979  N N   . ASN H 1 60  ? 83.120  56.296  45.712  1.00 36.97 ? 60  ASN H N   1 
ATOM 6980  C CA  . ASN H 1 60  ? 84.021  56.051  46.852  1.00 37.22 ? 60  ASN H CA  1 
ATOM 6981  C C   . ASN H 1 60  ? 84.611  57.344  47.427  1.00 37.20 ? 60  ASN H C   1 
ATOM 6982  O O   . ASN H 1 60  ? 84.787  58.332  46.710  1.00 37.13 ? 60  ASN H O   1 
ATOM 6983  C CB  . ASN H 1 60  ? 85.146  55.072  46.468  1.00 37.35 ? 60  ASN H CB  1 
ATOM 6984  C CG  . ASN H 1 60  ? 86.145  55.663  45.484  1.00 37.43 ? 60  ASN H CG  1 
ATOM 6985  O OD1 . ASN H 1 60  ? 85.782  56.436  44.596  1.00 37.43 ? 60  ASN H OD1 1 
ATOM 6986  N ND2 . ASN H 1 60  ? 87.410  55.288  45.633  1.00 37.57 ? 60  ASN H ND2 1 
ATOM 6987  N N   . GLN H 1 61  ? 84.917  57.314  48.723  1.00 37.16 ? 61  GLN H N   1 
ATOM 6988  C CA  . GLN H 1 61  ? 85.493  58.460  49.433  1.00 37.02 ? 61  GLN H CA  1 
ATOM 6989  C C   . GLN H 1 61  ? 86.990  58.620  49.157  1.00 36.99 ? 61  GLN H C   1 
ATOM 6990  O O   . GLN H 1 61  ? 87.489  59.745  49.103  1.00 37.14 ? 61  GLN H O   1 
ATOM 6991  C CB  . GLN H 1 61  ? 85.261  58.322  50.941  1.00 37.12 ? 61  GLN H CB  1 
ATOM 6992  C CG  . GLN H 1 61  ? 85.499  59.601  51.734  1.00 37.21 ? 61  GLN H CG  1 
ATOM 6993  C CD  . GLN H 1 61  ? 85.422  59.394  53.235  1.00 37.24 ? 61  GLN H CD  1 
ATOM 6994  O OE1 . GLN H 1 61  ? 84.765  58.471  53.720  1.00 37.27 ? 61  GLN H OE1 1 
ATOM 6995  N NE2 . GLN H 1 61  ? 86.092  60.263  53.983  1.00 37.32 ? 61  GLN H NE2 1 
ATOM 6996  N N   . ALA H 1 62  ? 87.697  57.498  48.996  1.00 36.96 ? 62  ALA H N   1 
ATOM 6997  C CA  . ALA H 1 62  ? 89.149  57.495  48.751  1.00 36.85 ? 62  ALA H CA  1 
ATOM 6998  C C   . ALA H 1 62  ? 89.581  58.286  47.510  1.00 36.78 ? 62  ALA H C   1 
ATOM 6999  O O   . ALA H 1 62  ? 90.694  58.814  47.471  1.00 36.92 ? 62  ALA H O   1 
ATOM 7000  C CB  . ALA H 1 62  ? 89.663  56.064  48.656  1.00 36.91 ? 62  ALA H CB  1 
ATOM 7001  N N   . ALA H 1 63  ? 88.708  58.354  46.504  1.00 36.84 ? 63  ALA H N   1 
ATOM 7002  C CA  . ALA H 1 63  ? 88.942  59.177  45.314  1.00 36.91 ? 63  ALA H CA  1 
ATOM 7003  C C   . ALA H 1 63  ? 88.972  60.670  45.648  1.00 36.82 ? 63  ALA H C   1 
ATOM 7004  O O   . ALA H 1 63  ? 89.824  61.399  45.141  1.00 36.91 ? 63  ALA H O   1 
ATOM 7005  C CB  . ALA H 1 63  ? 87.885  58.897  44.255  1.00 37.01 ? 63  ALA H CB  1 
ATOM 7006  N N   . LEU H 1 64  ? 88.046  61.113  46.500  1.00 36.89 ? 64  LEU H N   1 
ATOM 7007  C CA  . LEU H 1 64  ? 88.000  62.509  46.955  1.00 37.01 ? 64  LEU H CA  1 
ATOM 7008  C C   . LEU H 1 64  ? 89.180  62.868  47.864  1.00 37.02 ? 64  LEU H C   1 
ATOM 7009  O O   . LEU H 1 64  ? 89.683  63.992  47.808  1.00 37.07 ? 64  LEU H O   1 
ATOM 7010  C CB  . LEU H 1 64  ? 86.687  62.805  47.690  1.00 37.12 ? 64  LEU H CB  1 
ATOM 7011  C CG  . LEU H 1 64  ? 85.385  62.642  46.898  1.00 37.29 ? 64  LEU H CG  1 
ATOM 7012  C CD1 . LEU H 1 64  ? 84.184  62.811  47.817  1.00 37.40 ? 64  LEU H CD1 1 
ATOM 7013  C CD2 . LEU H 1 64  ? 85.317  63.628  45.741  1.00 37.32 ? 64  LEU H CD2 1 
ATOM 7014  N N   . ILE H 1 65  ? 89.610  61.913  48.691  1.00 37.10 ? 65  ILE H N   1 
ATOM 7015  C CA  . ILE H 1 65  ? 90.743  62.114  49.606  1.00 37.16 ? 65  ILE H CA  1 
ATOM 7016  C C   . ILE H 1 65  ? 92.068  62.208  48.837  1.00 37.20 ? 65  ILE H C   1 
ATOM 7017  O O   . ILE H 1 65  ? 92.946  62.989  49.211  1.00 37.29 ? 65  ILE H O   1 
ATOM 7018  C CB  . ILE H 1 65  ? 90.817  61.000  50.687  1.00 37.23 ? 65  ILE H CB  1 
ATOM 7019  C CG1 . ILE H 1 65  ? 89.563  61.026  51.575  1.00 37.33 ? 65  ILE H CG1 1 
ATOM 7020  C CG2 . ILE H 1 65  ? 92.062  61.156  51.562  1.00 37.26 ? 65  ILE H CG2 1 
ATOM 7021  C CD1 . ILE H 1 65  ? 89.346  59.763  52.383  1.00 37.48 ? 65  ILE H CD1 1 
ATOM 7022  N N   . SER H 1 66  ? 92.204  61.419  47.770  1.00 37.26 ? 66  SER H N   1 
ATOM 7023  C CA  . SER H 1 66  ? 93.400  61.444  46.917  1.00 37.39 ? 66  SER H CA  1 
ATOM 7024  C C   . SER H 1 66  ? 93.619  62.798  46.230  1.00 37.52 ? 66  SER H C   1 
ATOM 7025  O O   . SER H 1 66  ? 94.761  63.233  46.069  1.00 37.55 ? 66  SER H O   1 
ATOM 7026  C CB  . SER H 1 66  ? 93.331  60.333  45.863  1.00 37.37 ? 66  SER H CB  1 
ATOM 7027  O OG  . SER H 1 66  ? 94.551  60.222  45.150  1.00 37.36 ? 66  SER H OG  1 
ATOM 7028  N N   . LEU H 1 67  ? 92.527  63.450  45.826  1.00 37.78 ? 67  LEU H N   1 
ATOM 7029  C CA  . LEU H 1 67  ? 92.592  64.791  45.220  1.00 38.04 ? 67  LEU H CA  1 
ATOM 7030  C C   . LEU H 1 67  ? 93.046  65.886  46.195  1.00 38.13 ? 67  LEU H C   1 
ATOM 7031  O O   . LEU H 1 67  ? 93.691  66.850  45.774  1.00 38.34 ? 67  LEU H O   1 
ATOM 7032  C CB  . LEU H 1 67  ? 91.249  65.185  44.577  1.00 38.16 ? 67  LEU H CB  1 
ATOM 7033  C CG  . LEU H 1 67  ? 91.096  64.871  43.084  1.00 38.40 ? 67  LEU H CG  1 
ATOM 7034  C CD1 . LEU H 1 67  ? 91.141  63.378  42.792  1.00 38.45 ? 67  LEU H CD1 1 
ATOM 7035  C CD2 . LEU H 1 67  ? 89.802  65.473  42.559  1.00 38.59 ? 67  LEU H CD2 1 
ATOM 7036  N N   . GLY H 1 68  ? 92.719  65.737  47.481  1.00 37.98 ? 68  GLY H N   1 
ATOM 7037  C CA  . GLY H 1 68  ? 93.070  66.744  48.493  1.00 37.88 ? 68  GLY H CA  1 
ATOM 7038  C C   . GLY H 1 68  ? 92.204  66.829  49.741  1.00 37.72 ? 68  GLY H C   1 
ATOM 7039  O O   . GLY H 1 68  ? 92.654  67.372  50.753  1.00 37.88 ? 68  GLY H O   1 
ATOM 7040  N N   . LEU H 1 69  ? 90.965  66.330  49.678  1.00 37.46 ? 69  LEU H N   1 
ATOM 7041  C CA  . LEU H 1 69  ? 90.052  66.326  50.834  1.00 37.38 ? 69  LEU H CA  1 
ATOM 7042  C C   . LEU H 1 69  ? 90.660  65.621  52.050  1.00 37.38 ? 69  LEU H C   1 
ATOM 7043  O O   . LEU H 1 69  ? 91.408  64.651  51.906  1.00 37.44 ? 69  LEU H O   1 
ATOM 7044  C CB  . LEU H 1 69  ? 88.721  65.652  50.470  1.00 37.38 ? 69  LEU H CB  1 
ATOM 7045  C CG  . LEU H 1 69  ? 87.576  65.669  51.493  1.00 37.33 ? 69  LEU H CG  1 
ATOM 7046  C CD1 . LEU H 1 69  ? 87.084  67.081  51.773  1.00 37.36 ? 69  LEU H CD1 1 
ATOM 7047  C CD2 . LEU H 1 69  ? 86.427  64.800  51.006  1.00 37.37 ? 69  LEU H CD2 1 
ATOM 7048  N N   . LYS H 1 70  ? 90.328  66.117  53.240  1.00 37.37 ? 70  LYS H N   1 
ATOM 7049  C CA  . LYS H 1 70  ? 90.825  65.546  54.494  1.00 37.30 ? 70  LYS H CA  1 
ATOM 7050  C C   . LYS H 1 70  ? 90.123  64.230  54.817  1.00 37.09 ? 70  LYS H C   1 
ATOM 7051  O O   . LYS H 1 70  ? 89.112  63.883  54.200  1.00 37.05 ? 70  LYS H O   1 
ATOM 7052  C CB  . LYS H 1 70  ? 90.624  66.526  55.654  1.00 37.51 ? 70  LYS H CB  1 
ATOM 7053  C CG  . LYS H 1 70  ? 91.370  67.842  55.505  1.00 37.82 ? 70  LYS H CG  1 
ATOM 7054  C CD  . LYS H 1 70  ? 91.268  68.676  56.773  1.00 38.07 ? 70  LYS H CD  1 
ATOM 7055  C CE  . LYS H 1 70  ? 92.038  69.983  56.657  1.00 38.26 ? 70  LYS H CE  1 
ATOM 7056  N NZ  . LYS H 1 70  ? 91.453  70.908  55.644  1.00 38.34 ? 70  LYS H NZ  1 
ATOM 7057  N N   . SER H 1 71  ? 90.669  63.505  55.792  1.00 36.84 ? 71  SER H N   1 
ATOM 7058  C CA  . SER H 1 71  ? 90.037  62.289  56.307  1.00 36.56 ? 71  SER H CA  1 
ATOM 7059  C C   . SER H 1 71  ? 88.753  62.642  57.056  1.00 36.24 ? 71  SER H C   1 
ATOM 7060  O O   . SER H 1 71  ? 88.563  63.792  57.466  1.00 36.23 ? 71  SER H O   1 
ATOM 7061  C CB  . SER H 1 71  ? 90.992  61.537  57.237  1.00 36.59 ? 71  SER H CB  1 
ATOM 7062  O OG  . SER H 1 71  ? 92.185  61.179  56.562  1.00 36.60 ? 71  SER H OG  1 
ATOM 7063  N N   . THR H 1 72  ? 87.877  61.653  57.227  1.00 35.94 ? 72  THR H N   1 
ATOM 7064  C CA  . THR H 1 72  ? 86.594  61.856  57.905  1.00 35.78 ? 72  THR H CA  1 
ATOM 7065  C C   . THR H 1 72  ? 86.832  62.361  59.336  1.00 35.65 ? 72  THR H C   1 
ATOM 7066  O O   . THR H 1 72  ? 87.693  61.816  60.032  1.00 35.81 ? 72  THR H O   1 
ATOM 7067  C CB  . THR H 1 72  ? 85.767  60.555  57.961  1.00 35.87 ? 72  THR H CB  1 
ATOM 7068  O OG1 . THR H 1 72  ? 85.715  59.960  56.658  1.00 35.93 ? 72  THR H OG1 1 
ATOM 7069  C CG2 . THR H 1 72  ? 84.345  60.830  58.445  1.00 35.94 ? 72  THR H CG2 1 
ATOM 7070  N N   . PRO H 1 73  ? 86.089  63.404  59.777  1.00 35.35 ? 73  PRO H N   1 
ATOM 7071  C CA  . PRO H 1 73  ? 86.340  63.940  61.125  1.00 35.35 ? 73  PRO H CA  1 
ATOM 7072  C C   . PRO H 1 73  ? 85.945  62.988  62.257  1.00 35.42 ? 73  PRO H C   1 
ATOM 7073  O O   . PRO H 1 73  ? 85.231  62.008  62.029  1.00 35.51 ? 73  PRO H O   1 
ATOM 7074  C CB  . PRO H 1 73  ? 85.483  65.215  61.178  1.00 35.35 ? 73  PRO H CB  1 
ATOM 7075  C CG  . PRO H 1 73  ? 85.046  65.479  59.781  1.00 35.32 ? 73  PRO H CG  1 
ATOM 7076  C CD  . PRO H 1 73  ? 85.019  64.154  59.095  1.00 35.28 ? 73  PRO H CD  1 
ATOM 7077  N N   . ALA H 1 74  ? 86.416  63.291  63.464  1.00 35.52 ? 74  ALA H N   1 
ATOM 7078  C CA  . ALA H 1 74  ? 86.154  62.459  64.640  1.00 35.57 ? 74  ALA H CA  1 
ATOM 7079  C C   . ALA H 1 74  ? 84.672  62.502  65.007  1.00 35.42 ? 74  ALA H C   1 
ATOM 7080  O O   . ALA H 1 74  ? 84.083  63.582  65.087  1.00 35.50 ? 74  ALA H O   1 
ATOM 7081  C CB  . ALA H 1 74  ? 87.005  62.913  65.817  1.00 35.68 ? 74  ALA H CB  1 
ATOM 7082  N N   . ASN H 1 75  ? 84.090  61.320  65.220  1.00 35.20 ? 75  ASN H N   1 
ATOM 7083  C CA  . ASN H 1 75  ? 82.664  61.158  65.536  1.00 35.04 ? 75  ASN H CA  1 
ATOM 7084  C C   . ASN H 1 75  ? 81.741  61.701  64.432  1.00 34.83 ? 75  ASN H C   1 
ATOM 7085  O O   . ASN H 1 75  ? 80.711  62.318  64.722  1.00 34.81 ? 75  ASN H O   1 
ATOM 7086  C CB  . ASN H 1 75  ? 82.328  61.794  66.896  1.00 35.14 ? 75  ASN H CB  1 
ATOM 7087  C CG  . ASN H 1 75  ? 83.277  61.363  68.001  1.00 35.37 ? 75  ASN H CG  1 
ATOM 7088  O OD1 . ASN H 1 75  ? 83.786  60.241  68.000  1.00 35.52 ? 75  ASN H OD1 1 
ATOM 7089  N ND2 . ASN H 1 75  ? 83.516  62.258  68.953  1.00 35.47 ? 75  ASN H ND2 1 
ATOM 7090  N N   . VAL H 1 76  ? 82.122  61.463  63.176  1.00 34.65 ? 76  VAL H N   1 
ATOM 7091  C CA  . VAL H 1 76  ? 81.328  61.850  62.001  1.00 34.49 ? 76  VAL H CA  1 
ATOM 7092  C C   . VAL H 1 76  ? 81.222  60.652  61.059  1.00 34.47 ? 76  VAL H C   1 
ATOM 7093  O O   . VAL H 1 76  ? 82.219  59.979  60.787  1.00 34.47 ? 76  VAL H O   1 
ATOM 7094  C CB  . VAL H 1 76  ? 81.955  63.052  61.255  1.00 34.35 ? 76  VAL H CB  1 
ATOM 7095  C CG1 . VAL H 1 76  ? 81.191  63.365  59.968  1.00 34.32 ? 76  VAL H CG1 1 
ATOM 7096  C CG2 . VAL H 1 76  ? 81.990  64.275  62.158  1.00 34.40 ? 76  VAL H CG2 1 
ATOM 7097  N N   . THR H 1 77  ? 80.009  60.404  60.564  1.00 34.42 ? 77  THR H N   1 
ATOM 7098  C CA  . THR H 1 77  ? 79.719  59.278  59.676  1.00 34.40 ? 77  THR H CA  1 
ATOM 7099  C C   . THR H 1 77  ? 79.395  59.775  58.269  1.00 34.33 ? 77  THR H C   1 
ATOM 7100  O O   . THR H 1 77  ? 78.229  59.864  57.877  1.00 34.35 ? 77  THR H O   1 
ATOM 7101  C CB  . THR H 1 77  ? 78.548  58.435  60.217  1.00 34.48 ? 77  THR H CB  1 
ATOM 7102  O OG1 . THR H 1 77  ? 77.416  59.280  60.453  1.00 34.42 ? 77  THR H OG1 1 
ATOM 7103  C CG2 . THR H 1 77  ? 78.942  57.749  61.516  1.00 34.60 ? 77  THR H CG2 1 
ATOM 7104  N N   . PHE H 1 78  ? 80.447  60.108  57.524  1.00 34.32 ? 78  PHE H N   1 
ATOM 7105  C CA  . PHE H 1 78  ? 80.329  60.503  56.120  1.00 34.26 ? 78  PHE H CA  1 
ATOM 7106  C C   . PHE H 1 78  ? 80.084  59.262  55.264  1.00 34.03 ? 78  PHE H C   1 
ATOM 7107  O O   . PHE H 1 78  ? 80.700  58.217  55.490  1.00 34.15 ? 78  PHE H O   1 
ATOM 7108  C CB  . PHE H 1 78  ? 81.604  61.221  55.659  1.00 34.49 ? 78  PHE H CB  1 
ATOM 7109  C CG  . PHE H 1 78  ? 81.570  61.670  54.223  1.00 34.68 ? 78  PHE H CG  1 
ATOM 7110  C CD1 . PHE H 1 78  ? 80.945  62.861  53.867  1.00 34.79 ? 78  PHE H CD1 1 
ATOM 7111  C CD2 . PHE H 1 78  ? 82.174  60.908  53.225  1.00 34.80 ? 78  PHE H CD2 1 
ATOM 7112  C CE1 . PHE H 1 78  ? 80.916  63.279  52.543  1.00 34.94 ? 78  PHE H CE1 1 
ATOM 7113  C CE2 . PHE H 1 78  ? 82.147  61.321  51.901  1.00 34.93 ? 78  PHE H CE2 1 
ATOM 7114  C CZ  . PHE H 1 78  ? 81.518  62.508  51.558  1.00 34.99 ? 78  PHE H CZ  1 
ATOM 7115  N N   . SER H 1 79  ? 79.186  59.385  54.288  1.00 33.69 ? 79  SER H N   1 
ATOM 7116  C CA  . SER H 1 79  ? 78.810  58.260  53.430  1.00 33.53 ? 79  SER H CA  1 
ATOM 7117  C C   . SER H 1 79  ? 78.120  58.742  52.153  1.00 33.30 ? 79  SER H C   1 
ATOM 7118  O O   . SER H 1 79  ? 77.024  59.303  52.211  1.00 33.36 ? 79  SER H O   1 
ATOM 7119  C CB  . SER H 1 79  ? 77.884  57.308  54.192  1.00 33.61 ? 79  SER H CB  1 
ATOM 7120  O OG  . SER H 1 79  ? 77.478  56.217  53.383  1.00 33.71 ? 79  SER H OG  1 
ATOM 7121  N N   . ILE H 1 80  ? 78.762  58.510  51.009  1.00 33.07 ? 80  ILE H N   1 
ATOM 7122  C CA  . ILE H 1 80  ? 78.201  58.880  49.709  1.00 32.89 ? 80  ILE H CA  1 
ATOM 7123  C C   . ILE H 1 80  ? 77.182  57.814  49.309  1.00 32.77 ? 80  ILE H C   1 
ATOM 7124  O O   . ILE H 1 80  ? 77.519  56.631  49.223  1.00 32.79 ? 80  ILE H O   1 
ATOM 7125  C CB  . ILE H 1 80  ? 79.293  59.007  48.619  1.00 32.91 ? 80  ILE H CB  1 
ATOM 7126  C CG1 . ILE H 1 80  ? 80.324  60.078  49.010  1.00 32.96 ? 80  ILE H CG1 1 
ATOM 7127  C CG2 . ILE H 1 80  ? 78.666  59.337  47.263  1.00 32.94 ? 80  ILE H CG2 1 
ATOM 7128  C CD1 . ILE H 1 80  ? 81.594  60.062  48.184  1.00 33.00 ? 80  ILE H CD1 1 
ATOM 7129  N N   . VAL H 1 81  ? 75.942  58.242  49.070  1.00 32.73 ? 81  VAL H N   1 
ATOM 7130  C CA  . VAL H 1 81  ? 74.845  57.336  48.716  1.00 32.76 ? 81  VAL H CA  1 
ATOM 7131  C C   . VAL H 1 81  ? 75.030  56.822  47.293  1.00 32.87 ? 81  VAL H C   1 
ATOM 7132  O O   . VAL H 1 81  ? 75.109  55.613  47.065  1.00 32.99 ? 81  VAL H O   1 
ATOM 7133  C CB  . VAL H 1 81  ? 73.470  58.036  48.849  1.00 32.81 ? 81  VAL H CB  1 
ATOM 7134  C CG1 . VAL H 1 81  ? 72.344  57.188  48.260  1.00 32.88 ? 81  VAL H CG1 1 
ATOM 7135  C CG2 . VAL H 1 81  ? 73.184  58.362  50.309  1.00 32.82 ? 81  VAL H CG2 1 
ATOM 7136  N N   . SER H 1 82  ? 75.088  57.755  46.347  1.00 32.95 ? 82  SER H N   1 
ATOM 7137  C CA  . SER H 1 82  ? 75.244  57.434  44.930  1.00 33.10 ? 82  SER H CA  1 
ATOM 7138  C C   . SER H 1 82  ? 75.862  58.603  44.174  1.00 33.16 ? 82  SER H C   1 
ATOM 7139  O O   . SER H 1 82  ? 75.823  59.745  44.640  1.00 33.23 ? 82  SER H O   1 
ATOM 7140  C CB  . SER H 1 82  ? 73.891  57.069  44.316  1.00 33.14 ? 82  SER H CB  1 
ATOM 7141  O OG  . SER H 1 82  ? 72.945  58.109  44.502  1.00 33.18 ? 82  SER H OG  1 
ATOM 7142  N N   . ALA H 1 83  ? 76.433  58.303  43.010  1.00 33.30 ? 83  ALA H N   1 
ATOM 7143  C CA  . ALA H 1 83  ? 77.098  59.309  42.186  1.00 33.46 ? 83  ALA H CA  1 
ATOM 7144  C C   . ALA H 1 83  ? 77.105  58.903  40.715  1.00 33.71 ? 83  ALA H C   1 
ATOM 7145  O O   . ALA H 1 83  ? 77.981  58.160  40.268  1.00 33.85 ? 83  ALA H O   1 
ATOM 7146  C CB  . ALA H 1 83  ? 78.517  59.537  42.684  1.00 33.47 ? 83  ALA H CB  1 
ATOM 7147  N N   . SER H 1 84  ? 76.113  59.395  39.974  1.00 34.04 ? 84  SER H N   1 
ATOM 7148  C CA  . SER H 1 84  ? 76.041  59.202  38.526  1.00 34.33 ? 84  SER H CA  1 
ATOM 7149  C C   . SER H 1 84  ? 76.998  60.168  37.822  1.00 34.53 ? 84  SER H C   1 
ATOM 7150  O O   . SER H 1 84  ? 77.692  60.951  38.474  1.00 34.55 ? 84  SER H O   1 
ATOM 7151  C CB  . SER H 1 84  ? 74.603  59.407  38.035  1.00 34.48 ? 84  SER H CB  1 
ATOM 7152  O OG  . SER H 1 84  ? 74.187  60.754  38.190  1.00 34.54 ? 84  SER H OG  1 
ATOM 7153  N N   . ALA H 1 85  ? 77.036  60.102  36.493  1.00 35.05 ? 85  ALA H N   1 
ATOM 7154  C CA  . ALA H 1 85  ? 77.899  60.973  35.687  1.00 35.50 ? 85  ALA H CA  1 
ATOM 7155  C C   . ALA H 1 85  ? 77.642  62.469  35.908  1.00 35.79 ? 85  ALA H C   1 
ATOM 7156  O O   . ALA H 1 85  ? 78.589  63.256  35.945  1.00 35.91 ? 85  ALA H O   1 
ATOM 7157  C CB  . ALA H 1 85  ? 77.757  60.633  34.209  1.00 35.61 ? 85  ALA H CB  1 
ATOM 7158  N N   . ASN H 1 86  ? 76.369  62.845  36.052  1.00 36.15 ? 86  ASN H N   1 
ATOM 7159  C CA  . ASN H 1 86  ? 75.966  64.255  36.179  1.00 36.49 ? 86  ASN H CA  1 
ATOM 7160  C C   . ASN H 1 86  ? 75.173  64.570  37.463  1.00 36.55 ? 86  ASN H C   1 
ATOM 7161  O O   . ASN H 1 86  ? 74.394  65.527  37.489  1.00 36.63 ? 86  ASN H O   1 
ATOM 7162  C CB  . ASN H 1 86  ? 75.152  64.667  34.945  1.00 36.84 ? 86  ASN H CB  1 
ATOM 7163  C CG  . ASN H 1 86  ? 75.909  64.453  33.645  1.00 37.16 ? 86  ASN H CG  1 
ATOM 7164  O OD1 . ASN H 1 86  ? 76.219  63.322  33.274  1.00 37.25 ? 86  ASN H OD1 1 
ATOM 7165  N ND2 . ASN H 1 86  ? 76.198  65.542  32.941  1.00 37.45 ? 86  ASN H ND2 1 
ATOM 7166  N N   . SER H 1 87  ? 75.375  63.783  38.523  1.00 36.55 ? 87  SER H N   1 
ATOM 7167  C CA  . SER H 1 87  ? 74.745  64.051  39.825  1.00 36.52 ? 87  SER H CA  1 
ATOM 7168  C C   . SER H 1 87  ? 75.444  63.319  40.972  1.00 36.58 ? 87  SER H C   1 
ATOM 7169  O O   . SER H 1 87  ? 76.304  62.463  40.746  1.00 36.60 ? 87  SER H O   1 
ATOM 7170  C CB  . SER H 1 87  ? 73.264  63.656  39.800  1.00 36.53 ? 87  SER H CB  1 
ATOM 7171  O OG  . SER H 1 87  ? 72.606  64.064  40.988  1.00 36.60 ? 87  SER H OG  1 
ATOM 7172  N N   . TYR H 1 88  ? 75.064  63.671  42.200  1.00 36.69 ? 88  TYR H N   1 
ATOM 7173  C CA  . TYR H 1 88  ? 75.549  62.986  43.404  1.00 36.75 ? 88  TYR H CA  1 
ATOM 7174  C C   . TYR H 1 88  ? 74.634  63.203  44.610  1.00 37.06 ? 88  TYR H C   1 
ATOM 7175  O O   . TYR H 1 88  ? 73.807  64.118  44.620  1.00 37.14 ? 88  TYR H O   1 
ATOM 7176  C CB  . TYR H 1 88  ? 76.981  63.424  43.744  1.00 36.59 ? 88  TYR H CB  1 
ATOM 7177  C CG  . TYR H 1 88  ? 77.144  64.906  44.017  1.00 36.51 ? 88  TYR H CG  1 
ATOM 7178  C CD1 . TYR H 1 88  ? 76.964  65.425  45.300  1.00 36.43 ? 88  TYR H CD1 1 
ATOM 7179  C CD2 . TYR H 1 88  ? 77.496  65.789  42.996  1.00 36.53 ? 88  TYR H CD2 1 
ATOM 7180  C CE1 . TYR H 1 88  ? 77.115  66.780  45.556  1.00 36.37 ? 88  TYR H CE1 1 
ATOM 7181  C CE2 . TYR H 1 88  ? 77.652  67.147  43.243  1.00 36.49 ? 88  TYR H CE2 1 
ATOM 7182  C CZ  . TYR H 1 88  ? 77.461  67.638  44.524  1.00 36.40 ? 88  TYR H CZ  1 
ATOM 7183  O OH  . TYR H 1 88  ? 77.613  68.981  44.773  1.00 36.43 ? 88  TYR H OH  1 
ATOM 7184  N N   . CYS H 1 89  ? 74.798  62.346  45.615  1.00 37.62 ? 89  CYS H N   1 
ATOM 7185  C CA  . CYS H 1 89  ? 74.064  62.439  46.880  1.00 38.04 ? 89  CYS H CA  1 
ATOM 7186  C C   . CYS H 1 89  ? 74.975  61.976  48.017  1.00 37.48 ? 89  CYS H C   1 
ATOM 7187  O O   . CYS H 1 89  ? 75.412  60.823  48.029  1.00 37.51 ? 89  CYS H O   1 
ATOM 7188  C CB  . CYS H 1 89  ? 72.799  61.581  46.828  1.00 39.02 ? 89  CYS H CB  1 
ATOM 7189  S SG  . CYS H 1 89  ? 71.822  61.582  48.352  1.00 40.38 ? 89  CYS H SG  1 
ATOM 7190  N N   . MET H 1 90  ? 75.250  62.875  48.964  1.00 36.81 ? 90  MET H N   1 
ATOM 7191  C CA  . MET H 1 90  ? 76.171  62.610  50.071  1.00 36.33 ? 90  MET H CA  1 
ATOM 7192  C C   . MET H 1 90  ? 75.516  62.959  51.408  1.00 35.96 ? 90  MET H C   1 
ATOM 7193  O O   . MET H 1 90  ? 75.281  64.132  51.705  1.00 35.94 ? 90  MET H O   1 
ATOM 7194  C CB  . MET H 1 90  ? 77.463  63.417  49.895  1.00 36.33 ? 90  MET H CB  1 
ATOM 7195  C CG  . MET H 1 90  ? 78.110  63.276  48.525  1.00 36.32 ? 90  MET H CG  1 
ATOM 7196  S SD  . MET H 1 90  ? 79.765  63.988  48.451  1.00 36.31 ? 90  MET H SD  1 
ATOM 7197  C CE  . MET H 1 90  ? 79.409  65.722  48.719  1.00 36.30 ? 90  MET H CE  1 
ATOM 7198  N N   . ILE H 1 91  ? 75.214  61.929  52.200  1.00 35.57 ? 91  ILE H N   1 
ATOM 7199  C CA  . ILE H 1 91  ? 74.676  62.094  53.551  1.00 35.27 ? 91  ILE H CA  1 
ATOM 7200  C C   . ILE H 1 91  ? 75.832  62.080  54.554  1.00 34.97 ? 91  ILE H C   1 
ATOM 7201  O O   . ILE H 1 91  ? 76.781  61.308  54.406  1.00 35.06 ? 91  ILE H O   1 
ATOM 7202  C CB  . ILE H 1 91  ? 73.677  60.966  53.909  1.00 35.34 ? 91  ILE H CB  1 
ATOM 7203  C CG1 . ILE H 1 91  ? 72.556  60.861  52.858  1.00 35.48 ? 91  ILE H CG1 1 
ATOM 7204  C CG2 . ILE H 1 91  ? 73.097  61.170  55.309  1.00 35.37 ? 91  ILE H CG2 1 
ATOM 7205  C CD1 . ILE H 1 91  ? 71.694  62.100  52.705  1.00 35.54 ? 91  ILE H CD1 1 
ATOM 7206  N N   . ALA H 1 92  ? 75.743  62.940  55.567  1.00 34.64 ? 92  ALA H N   1 
ATOM 7207  C CA  . ALA H 1 92  ? 76.732  62.988  56.647  1.00 34.42 ? 92  ALA H CA  1 
ATOM 7208  C C   . ALA H 1 92  ? 76.124  63.579  57.917  1.00 34.21 ? 92  ALA H C   1 
ATOM 7209  O O   . ALA H 1 92  ? 75.208  64.403  57.851  1.00 34.13 ? 92  ALA H O   1 
ATOM 7210  C CB  . ALA H 1 92  ? 77.948  63.796  56.218  1.00 34.49 ? 92  ALA H CB  1 
ATOM 7211  N N   . GLY H 1 93  ? 76.644  63.152  59.065  1.00 34.02 ? 93  GLY H N   1 
ATOM 7212  C CA  . GLY H 1 93  ? 76.138  63.598  60.362  1.00 33.89 ? 93  GLY H CA  1 
ATOM 7213  C C   . GLY H 1 93  ? 77.068  63.277  61.516  1.00 33.77 ? 93  GLY H C   1 
ATOM 7214  O O   . GLY H 1 93  ? 77.839  62.317  61.455  1.00 33.83 ? 93  GLY H O   1 
ATOM 7215  N N   . HIS H 1 94  ? 76.981  64.088  62.569  1.00 33.62 ? 94  HIS H N   1 
ATOM 7216  C CA  . HIS H 1 94  ? 77.767  63.900  63.787  1.00 33.49 ? 94  HIS H CA  1 
ATOM 7217  C C   . HIS H 1 94  ? 76.953  63.042  64.756  1.00 33.50 ? 94  HIS H C   1 
ATOM 7218  O O   . HIS H 1 94  ? 75.721  63.074  64.732  1.00 33.61 ? 94  HIS H O   1 
ATOM 7219  C CB  . HIS H 1 94  ? 78.094  65.260  64.414  1.00 33.42 ? 94  HIS H CB  1 
ATOM 7220  C CG  . HIS H 1 94  ? 79.363  65.277  65.208  1.00 33.39 ? 94  HIS H CG  1 
ATOM 7221  N ND1 . HIS H 1 94  ? 80.547  65.779  64.711  1.00 33.41 ? 94  HIS H ND1 1 
ATOM 7222  C CD2 . HIS H 1 94  ? 79.639  64.827  66.454  1.00 33.38 ? 94  HIS H CD2 1 
ATOM 7223  C CE1 . HIS H 1 94  ? 81.494  65.651  65.623  1.00 33.44 ? 94  HIS H CE1 1 
ATOM 7224  N NE2 . HIS H 1 94  ? 80.969  65.079  66.691  1.00 33.41 ? 94  HIS H NE2 1 
ATOM 7225  N N   . SER H 1 95  ? 77.643  62.279  65.603  1.00 33.42 ? 95  SER H N   1 
ATOM 7226  C CA  . SER H 1 95  ? 76.981  61.374  66.552  1.00 33.30 ? 95  SER H CA  1 
ATOM 7227  C C   . SER H 1 95  ? 76.186  62.141  67.608  1.00 33.15 ? 95  SER H C   1 
ATOM 7228  O O   . SER H 1 95  ? 75.049  61.776  67.915  1.00 33.23 ? 95  SER H O   1 
ATOM 7229  C CB  . SER H 1 95  ? 78.000  60.450  67.227  1.00 33.39 ? 95  SER H CB  1 
ATOM 7230  O OG  . SER H 1 95  ? 78.953  61.191  67.965  1.00 33.47 ? 95  SER H OG  1 
ATOM 7231  N N   . GLY H 1 96  ? 76.795  63.194  68.156  1.00 32.96 ? 96  GLY H N   1 
ATOM 7232  C CA  . GLY H 1 96  ? 76.120  64.123  69.069  1.00 32.84 ? 96  GLY H CA  1 
ATOM 7233  C C   . GLY H 1 96  ? 75.791  65.450  68.412  1.00 32.59 ? 96  GLY H C   1 
ATOM 7234  O O   . GLY H 1 96  ? 76.109  66.511  68.955  1.00 32.56 ? 96  GLY H O   1 
ATOM 7235  N N   . GLY H 1 97  ? 75.156  65.385  67.242  1.00 32.33 ? 97  GLY H N   1 
ATOM 7236  C CA  . GLY H 1 97  ? 74.691  66.567  66.515  1.00 32.11 ? 97  GLY H CA  1 
ATOM 7237  C C   . GLY H 1 97  ? 73.199  66.762  66.705  1.00 31.91 ? 97  GLY H C   1 
ATOM 7238  O O   . GLY H 1 97  ? 72.637  66.340  67.720  1.00 31.98 ? 97  GLY H O   1 
ATOM 7239  N N   . THR H 1 98  ? 72.564  67.400  65.722  1.00 31.56 ? 98  THR H N   1 
ATOM 7240  C CA  . THR H 1 98  ? 71.120  67.642  65.732  1.00 31.30 ? 98  THR H CA  1 
ATOM 7241  C C   . THR H 1 98  ? 70.408  66.731  64.736  1.00 31.00 ? 98  THR H C   1 
ATOM 7242  O O   . THR H 1 98  ? 69.540  65.943  65.120  1.00 31.05 ? 98  THR H O   1 
ATOM 7243  C CB  . THR H 1 98  ? 70.799  69.109  65.394  1.00 31.35 ? 98  THR H CB  1 
ATOM 7244  O OG1 . THR H 1 98  ? 71.368  69.449  64.123  1.00 31.30 ? 98  THR H OG1 1 
ATOM 7245  C CG2 . THR H 1 98  ? 71.358  70.033  66.466  1.00 31.42 ? 98  THR H CG2 1 
ATOM 7246  N N   . VAL H 1 99  ? 70.782  66.851  63.463  1.00 30.61 ? 99  VAL H N   1 
ATOM 7247  C CA  . VAL H 1 99  ? 70.184  66.072  62.372  1.00 30.35 ? 99  VAL H CA  1 
ATOM 7248  C C   . VAL H 1 99  ? 71.225  65.719  61.308  1.00 30.06 ? 99  VAL H C   1 
ATOM 7249  O O   . VAL H 1 99  ? 72.331  66.264  61.303  1.00 30.16 ? 99  VAL H O   1 
ATOM 7250  C CB  . VAL H 1 99  ? 69.012  66.833  61.701  1.00 30.45 ? 99  VAL H CB  1 
ATOM 7251  C CG1 . VAL H 1 99  ? 67.776  66.814  62.589  1.00 30.52 ? 99  VAL H CG1 1 
ATOM 7252  C CG2 . VAL H 1 99  ? 69.401  68.268  61.358  1.00 30.52 ? 99  VAL H CG2 1 
ATOM 7253  N N   . TRP H 1 100 ? 70.857  64.803  60.414  1.00 29.73 ? 100 TRP H N   1 
ATOM 7254  C CA  . TRP H 1 100 ? 71.699  64.442  59.272  1.00 29.57 ? 100 TRP H CA  1 
ATOM 7255  C C   . TRP H 1 100 ? 71.683  65.559  58.232  1.00 29.76 ? 100 TRP H C   1 
ATOM 7256  O O   . TRP H 1 100 ? 70.670  66.243  58.063  1.00 29.91 ? 100 TRP H O   1 
ATOM 7257  C CB  . TRP H 1 100 ? 71.217  63.141  58.626  1.00 29.37 ? 100 TRP H CB  1 
ATOM 7258  C CG  . TRP H 1 100 ? 71.379  61.938  59.498  1.00 29.17 ? 100 TRP H CG  1 
ATOM 7259  C CD1 . TRP H 1 100 ? 70.489  61.465  60.416  1.00 29.08 ? 100 TRP H CD1 1 
ATOM 7260  C CD2 . TRP H 1 100 ? 72.499  61.048  59.528  1.00 28.95 ? 100 TRP H CD2 1 
ATOM 7261  N NE1 . TRP H 1 100 ? 70.985  60.336  61.021  1.00 28.98 ? 100 TRP H NE1 1 
ATOM 7262  C CE2 . TRP H 1 100 ? 72.217  60.057  60.495  1.00 28.90 ? 100 TRP H CE2 1 
ATOM 7263  C CE3 . TRP H 1 100 ? 73.715  60.992  58.835  1.00 28.91 ? 100 TRP H CE3 1 
ATOM 7264  C CZ2 . TRP H 1 100 ? 73.109  59.019  60.787  1.00 28.93 ? 100 TRP H CZ2 1 
ATOM 7265  C CZ3 . TRP H 1 100 ? 74.603  59.959  59.124  1.00 28.95 ? 100 TRP H CZ3 1 
ATOM 7266  C CH2 . TRP H 1 100 ? 74.292  58.986  60.094  1.00 28.96 ? 100 TRP H CH2 1 
ATOM 7267  N N   . PHE H 1 101 ? 72.810  65.733  57.545  1.00 29.96 ? 101 PHE H N   1 
ATOM 7268  C CA  . PHE H 1 101 ? 72.963  66.748  56.504  1.00 30.13 ? 101 PHE H CA  1 
ATOM 7269  C C   . PHE H 1 101 ? 73.195  66.070  55.158  1.00 30.19 ? 101 PHE H C   1 
ATOM 7270  O O   . PHE H 1 101 ? 74.103  65.249  55.028  1.00 30.31 ? 101 PHE H O   1 
ATOM 7271  C CB  . PHE H 1 101 ? 74.151  67.659  56.815  1.00 30.32 ? 101 PHE H CB  1 
ATOM 7272  C CG  . PHE H 1 101 ? 73.910  68.621  57.947  1.00 30.39 ? 101 PHE H CG  1 
ATOM 7273  C CD1 . PHE H 1 101 ? 73.906  68.180  59.267  1.00 30.53 ? 101 PHE H CD1 1 
ATOM 7274  C CD2 . PHE H 1 101 ? 73.714  69.978  57.696  1.00 30.42 ? 101 PHE H CD2 1 
ATOM 7275  C CE1 . PHE H 1 101 ? 73.693  69.067  60.313  1.00 30.59 ? 101 PHE H CE1 1 
ATOM 7276  C CE2 . PHE H 1 101 ? 73.503  70.869  58.738  1.00 30.54 ? 101 PHE H CE2 1 
ATOM 7277  C CZ  . PHE H 1 101 ? 73.491  70.414  60.048  1.00 30.60 ? 101 PHE H CZ  1 
ATOM 7278  N N   . ALA H 1 102 ? 72.369  66.415  54.171  1.00 30.37 ? 102 ALA H N   1 
ATOM 7279  C CA  . ALA H 1 102 ? 72.531  65.935  52.797  1.00 30.57 ? 102 ALA H CA  1 
ATOM 7280  C C   . ALA H 1 102 ? 73.402  66.901  52.000  1.00 30.78 ? 102 ALA H C   1 
ATOM 7281  O O   . ALA H 1 102 ? 73.729  67.993  52.475  1.00 30.81 ? 102 ALA H O   1 
ATOM 7282  C CB  . ALA H 1 102 ? 71.174  65.776  52.131  1.00 30.60 ? 102 ALA H CB  1 
ATOM 7283  N N   . ALA H 1 103 ? 73.777  66.491  50.790  1.00 31.11 ? 103 ALA H N   1 
ATOM 7284  C CA  . ALA H 1 103 ? 74.607  67.316  49.909  1.00 31.41 ? 103 ALA H CA  1 
ATOM 7285  C C   . ALA H 1 103 ? 74.488  66.873  48.447  1.00 31.72 ? 103 ALA H C   1 
ATOM 7286  O O   . ALA H 1 103 ? 75.094  65.879  48.040  1.00 31.76 ? 103 ALA H O   1 
ATOM 7287  C CB  . ALA H 1 103 ? 76.058  67.277  50.364  1.00 31.43 ? 103 ALA H CB  1 
ATOM 7288  N N   . THR H 1 104 ? 73.694  67.621  47.679  1.00 32.08 ? 104 THR H N   1 
ATOM 7289  C CA  . THR H 1 104 ? 73.479  67.379  46.250  1.00 32.34 ? 104 THR H CA  1 
ATOM 7290  C C   . THR H 1 104 ? 73.918  68.625  45.474  1.00 32.69 ? 104 THR H C   1 
ATOM 7291  O O   . THR H 1 104 ? 74.071  69.693  46.075  1.00 32.83 ? 104 THR H O   1 
ATOM 7292  C CB  . THR H 1 104 ? 71.989  67.081  45.960  1.00 32.41 ? 104 THR H CB  1 
ATOM 7293  O OG1 . THR H 1 104 ? 71.221  68.288  46.037  1.00 32.45 ? 104 THR H OG1 1 
ATOM 7294  C CG2 . THR H 1 104 ? 71.436  66.072  46.955  1.00 32.50 ? 104 THR H CG2 1 
ATOM 7295  N N   . PRO H 1 105 ? 74.125  68.505  44.143  1.00 33.13 ? 105 PRO H N   1 
ATOM 7296  C CA  . PRO H 1 105 ? 74.556  69.689  43.383  1.00 33.45 ? 105 PRO H CA  1 
ATOM 7297  C C   . PRO H 1 105 ? 73.465  70.752  43.200  1.00 33.95 ? 105 PRO H C   1 
ATOM 7298  O O   . PRO H 1 105 ? 73.764  71.944  43.299  1.00 34.10 ? 105 PRO H O   1 
ATOM 7299  C CB  . PRO H 1 105 ? 75.009  69.120  42.030  1.00 33.34 ? 105 PRO H CB  1 
ATOM 7300  C CG  . PRO H 1 105 ? 74.481  67.734  41.952  1.00 33.31 ? 105 PRO H CG  1 
ATOM 7301  C CD  . PRO H 1 105 ? 73.946  67.318  43.287  1.00 33.23 ? 105 PRO H CD  1 
ATOM 7302  N N   . ASP H 1 106 ? 72.228  70.327  42.941  1.00 34.61 ? 106 ASP H N   1 
ATOM 7303  C CA  . ASP H 1 106 ? 71.117  71.265  42.710  1.00 35.22 ? 106 ASP H CA  1 
ATOM 7304  C C   . ASP H 1 106 ? 70.658  72.010  43.973  1.00 35.56 ? 106 ASP H C   1 
ATOM 7305  O O   . ASP H 1 106 ? 70.403  73.215  43.914  1.00 35.76 ? 106 ASP H O   1 
ATOM 7306  C CB  . ASP H 1 106 ? 69.926  70.575  42.014  1.00 35.53 ? 106 ASP H CB  1 
ATOM 7307  C CG  . ASP H 1 106 ? 69.245  69.523  42.883  1.00 35.77 ? 106 ASP H CG  1 
ATOM 7308  O OD1 . ASP H 1 106 ? 69.936  68.866  43.692  1.00 35.93 ? 106 ASP H OD1 1 
ATOM 7309  O OD2 . ASP H 1 106 ? 68.015  69.350  42.747  1.00 35.86 ? 106 ASP H OD2 1 
ATOM 7310  N N   . LYS H 1 107 ? 70.565  71.301  45.098  1.00 35.96 ? 107 LYS H N   1 
ATOM 7311  C CA  . LYS H 1 107 ? 70.104  71.887  46.367  1.00 36.36 ? 107 LYS H CA  1 
ATOM 7312  C C   . LYS H 1 107 ? 71.238  72.371  47.279  1.00 36.64 ? 107 LYS H C   1 
ATOM 7313  O O   . LYS H 1 107 ? 70.979  73.080  48.253  1.00 36.62 ? 107 LYS H O   1 
ATOM 7314  C CB  . LYS H 1 107 ? 69.233  70.883  47.130  1.00 36.45 ? 107 LYS H CB  1 
ATOM 7315  C CG  . LYS H 1 107 ? 67.959  70.488  46.401  1.00 36.66 ? 107 LYS H CG  1 
ATOM 7316  C CD  . LYS H 1 107 ? 67.159  69.449  47.172  1.00 36.88 ? 107 LYS H CD  1 
ATOM 7317  C CE  . LYS H 1 107 ? 66.436  70.053  48.366  1.00 37.03 ? 107 LYS H CE  1 
ATOM 7318  N NZ  . LYS H 1 107 ? 65.570  69.057  49.055  1.00 37.12 ? 107 LYS H NZ  1 
ATOM 7319  N N   . GLY H 1 108 ? 72.481  71.994  46.969  1.00 37.06 ? 108 GLY H N   1 
ATOM 7320  C CA  . GLY H 1 108 ? 73.632  72.332  47.808  1.00 37.38 ? 108 GLY H CA  1 
ATOM 7321  C C   . GLY H 1 108 ? 73.665  71.482  49.065  1.00 37.66 ? 108 GLY H C   1 
ATOM 7322  O O   . GLY H 1 108 ? 73.098  70.389  49.092  1.00 37.75 ? 108 GLY H O   1 
ATOM 7323  N N   . VAL H 1 109 ? 74.335  71.988  50.098  1.00 38.04 ? 109 VAL H N   1 
ATOM 7324  C CA  . VAL H 1 109 ? 74.400  71.320  51.401  1.00 38.33 ? 109 VAL H CA  1 
ATOM 7325  C C   . VAL H 1 109 ? 73.239  71.820  52.263  1.00 38.62 ? 109 VAL H C   1 
ATOM 7326  O O   . VAL H 1 109 ? 73.168  73.010  52.575  1.00 38.77 ? 109 VAL H O   1 
ATOM 7327  C CB  . VAL H 1 109 ? 75.742  71.593  52.117  1.00 38.50 ? 109 VAL H CB  1 
ATOM 7328  C CG1 . VAL H 1 109 ? 75.797  70.877  53.465  1.00 38.57 ? 109 VAL H CG1 1 
ATOM 7329  C CG2 . VAL H 1 109 ? 76.913  71.173  51.232  1.00 38.56 ? 109 VAL H CG2 1 
ATOM 7330  N N   . TYR H 1 110 ? 72.339  70.909  52.636  1.00 38.99 ? 110 TYR H N   1 
ATOM 7331  C CA  . TYR H 1 110 ? 71.179  71.229  53.476  1.00 39.35 ? 110 TYR H CA  1 
ATOM 7332  C C   . TYR H 1 110 ? 70.947  70.151  54.532  1.00 39.82 ? 110 TYR H C   1 
ATOM 7333  O O   . TYR H 1 110 ? 71.535  69.067  54.461  1.00 40.04 ? 110 TYR H O   1 
ATOM 7334  C CB  . TYR H 1 110 ? 69.921  71.406  52.616  1.00 39.25 ? 110 TYR H CB  1 
ATOM 7335  C CG  . TYR H 1 110 ? 69.509  70.172  51.840  1.00 39.14 ? 110 TYR H CG  1 
ATOM 7336  C CD1 . TYR H 1 110 ? 70.088  69.876  50.606  1.00 39.13 ? 110 TYR H CD1 1 
ATOM 7337  C CD2 . TYR H 1 110 ? 68.532  69.305  52.333  1.00 39.09 ? 110 TYR H CD2 1 
ATOM 7338  C CE1 . TYR H 1 110 ? 69.713  68.749  49.888  1.00 39.07 ? 110 TYR H CE1 1 
ATOM 7339  C CE2 . TYR H 1 110 ? 68.150  68.174  51.622  1.00 39.10 ? 110 TYR H CE2 1 
ATOM 7340  C CZ  . TYR H 1 110 ? 68.743  67.902  50.401  1.00 39.11 ? 110 TYR H CZ  1 
ATOM 7341  O OH  . TYR H 1 110 ? 68.371  66.785  49.690  1.00 39.19 ? 110 TYR H OH  1 
ATOM 7342  N N   . LYS H 1 111 ? 70.081  70.459  55.497  1.00 40.42 ? 111 LYS H N   1 
ATOM 7343  C CA  . LYS H 1 111 ? 69.775  69.549  56.608  1.00 41.05 ? 111 LYS H CA  1 
ATOM 7344  C C   . LYS H 1 111 ? 68.396  68.911  56.440  1.00 41.38 ? 111 LYS H C   1 
ATOM 7345  O O   . LYS H 1 111 ? 67.450  69.571  56.006  1.00 41.54 ? 111 LYS H O   1 
ATOM 7346  C CB  . LYS H 1 111 ? 69.887  70.266  57.963  1.00 41.42 ? 111 LYS H CB  1 
ATOM 7347  C CG  . LYS H 1 111 ? 68.875  71.372  58.235  1.00 41.67 ? 111 LYS H CG  1 
ATOM 7348  C CD  . LYS H 1 111 ? 69.133  72.008  59.591  1.00 41.99 ? 111 LYS H CD  1 
ATOM 7349  C CE  . LYS H 1 111 ? 68.143  73.125  59.884  1.00 42.27 ? 111 LYS H CE  1 
ATOM 7350  N NZ  . LYS H 1 111 ? 68.370  73.767  61.211  1.00 42.33 ? 111 LYS H NZ  1 
ATOM 7351  N N   . THR H 1 112 ? 68.299  67.629  56.797  1.00 41.76 ? 112 THR H N   1 
ATOM 7352  C CA  . THR H 1 112 ? 67.060  66.852  56.661  1.00 42.19 ? 112 THR H CA  1 
ATOM 7353  C C   . THR H 1 112 ? 66.342  66.702  58.005  1.00 42.42 ? 112 THR H C   1 
ATOM 7354  O O   . THR H 1 112 ? 66.881  67.059  59.055  1.00 42.41 ? 112 THR H O   1 
ATOM 7355  C CB  . THR H 1 112 ? 67.320  65.463  56.020  1.00 42.41 ? 112 THR H CB  1 
ATOM 7356  O OG1 . THR H 1 112 ? 66.073  64.790  55.794  1.00 42.63 ? 112 THR H OG1 1 
ATOM 7357  C CG2 . THR H 1 112 ? 68.239  64.572  56.882  1.00 42.32 ? 112 THR H CG2 1 
ATOM 7358  N N   . ASN H 1 113 ? 65.124  66.164  57.954  1.00 42.76 ? 113 ASN H N   1 
ATOM 7359  C CA  . ASN H 1 113 ? 64.298  65.965  59.151  1.00 43.05 ? 113 ASN H CA  1 
ATOM 7360  C C   . ASN H 1 113 ? 64.746  64.788  60.028  1.00 43.07 ? 113 ASN H C   1 
ATOM 7361  O O   . ASN H 1 113 ? 64.372  64.724  61.202  1.00 43.14 ? 113 ASN H O   1 
ATOM 7362  C CB  . ASN H 1 113 ? 62.826  65.774  58.760  1.00 43.32 ? 113 ASN H CB  1 
ATOM 7363  C CG  . ASN H 1 113 ? 62.233  66.999  58.085  1.00 43.69 ? 113 ASN H CG  1 
ATOM 7364  O OD1 . ASN H 1 113 ? 62.948  67.927  57.701  1.00 43.88 ? 113 ASN H OD1 1 
ATOM 7365  N ND2 . ASN H 1 113 ? 60.913  67.005  57.934  1.00 43.95 ? 113 ASN H ND2 1 
ATOM 7366  N N   . THR H 1 114 ? 65.528  63.864  59.465  1.00 42.95 ? 114 THR H N   1 
ATOM 7367  C CA  . THR H 1 114 ? 65.995  62.680  60.194  1.00 42.92 ? 114 THR H CA  1 
ATOM 7368  C C   . THR H 1 114 ? 66.998  63.058  61.287  1.00 42.75 ? 114 THR H C   1 
ATOM 7369  O O   . THR H 1 114 ? 67.915  63.843  61.047  1.00 42.67 ? 114 THR H O   1 
ATOM 7370  C CB  . THR H 1 114 ? 66.654  61.655  59.243  1.00 43.06 ? 114 THR H CB  1 
ATOM 7371  O OG1 . THR H 1 114 ? 65.794  61.413  58.122  1.00 43.18 ? 114 THR H OG1 1 
ATOM 7372  C CG2 . THR H 1 114 ? 66.932  60.333  59.962  1.00 43.11 ? 114 THR H CG2 1 
ATOM 7373  N N   . ALA H 1 115 ? 66.813  62.488  62.478  1.00 42.77 ? 115 ALA H N   1 
ATOM 7374  C CA  . ALA H 1 115 ? 67.661  62.778  63.637  1.00 42.75 ? 115 ALA H CA  1 
ATOM 7375  C C   . ALA H 1 115 ? 68.914  61.907  63.643  1.00 42.74 ? 115 ALA H C   1 
ATOM 7376  O O   . ALA H 1 115 ? 68.924  60.811  63.076  1.00 42.81 ? 115 ALA H O   1 
ATOM 7377  C CB  . ALA H 1 115 ? 66.880  62.575  64.926  1.00 42.91 ? 115 ALA H CB  1 
ATOM 7378  N N   . VAL H 1 116 ? 69.962  62.403  64.298  1.00 42.90 ? 116 VAL H N   1 
ATOM 7379  C CA  . VAL H 1 116 ? 71.239  61.678  64.408  1.00 43.05 ? 116 VAL H CA  1 
ATOM 7380  C C   . VAL H 1 116 ? 71.143  60.429  65.295  1.00 43.55 ? 116 VAL H C   1 
ATOM 7381  O O   . VAL H 1 116 ? 71.910  59.481  65.110  1.00 43.76 ? 116 VAL H O   1 
ATOM 7382  C CB  . VAL H 1 116 ? 72.399  62.577  64.913  1.00 42.93 ? 116 VAL H CB  1 
ATOM 7383  C CG1 . VAL H 1 116 ? 72.606  63.764  63.977  1.00 42.89 ? 116 VAL H CG1 1 
ATOM 7384  C CG2 . VAL H 1 116 ? 72.187  63.025  66.360  1.00 42.98 ? 116 VAL H CG2 1 
ATOM 7385  N N   . THR H 1 117 ? 70.217  60.441  66.254  1.00 43.94 ? 117 THR H N   1 
ATOM 7386  C CA  . THR H 1 117 ? 69.905  59.254  67.059  1.00 44.22 ? 117 THR H CA  1 
ATOM 7387  C C   . THR H 1 117 ? 69.263  58.153  66.210  1.00 44.30 ? 117 THR H C   1 
ATOM 7388  O O   . THR H 1 117 ? 69.542  56.970  66.415  1.00 44.49 ? 117 THR H O   1 
ATOM 7389  C CB  . THR H 1 117 ? 68.963  59.591  68.234  1.00 44.54 ? 117 THR H CB  1 
ATOM 7390  O OG1 . THR H 1 117 ? 67.799  60.268  67.742  1.00 44.68 ? 117 THR H OG1 1 
ATOM 7391  C CG2 . THR H 1 117 ? 69.670  60.473  69.255  1.00 44.67 ? 117 THR H CG2 1 
ATOM 7392  N N   . SER H 1 118 ? 68.408  58.550  65.266  1.00 44.37 ? 118 SER H N   1 
ATOM 7393  C CA  . SER H 1 118 ? 67.818  57.620  64.297  1.00 44.50 ? 118 SER H CA  1 
ATOM 7394  C C   . SER H 1 118 ? 68.845  57.183  63.251  1.00 44.49 ? 118 SER H C   1 
ATOM 7395  O O   . SER H 1 118 ? 69.935  57.755  63.157  1.00 44.41 ? 118 SER H O   1 
ATOM 7396  C CB  . SER H 1 118 ? 66.613  58.261  63.600  1.00 44.61 ? 118 SER H CB  1 
ATOM 7397  O OG  . SER H 1 118 ? 65.640  58.676  64.544  1.00 44.73 ? 118 SER H OG  1 
ATOM 7398  N N   . SER H 1 119 ? 68.482  56.171  62.462  1.00 44.65 ? 119 SER H N   1 
ATOM 7399  C CA  . SER H 1 119 ? 69.383  55.591  61.461  1.00 44.77 ? 119 SER H CA  1 
ATOM 7400  C C   . SER H 1 119 ? 69.646  56.536  60.287  1.00 44.88 ? 119 SER H C   1 
ATOM 7401  O O   . SER H 1 119 ? 68.924  57.517  60.087  1.00 44.83 ? 119 SER H O   1 
ATOM 7402  C CB  . SER H 1 119 ? 68.821  54.267  60.937  1.00 44.90 ? 119 SER H CB  1 
ATOM 7403  O OG  . SER H 1 119 ? 69.762  53.601  60.112  1.00 44.99 ? 119 SER H OG  1 
ATOM 7404  N N   . GLN H 1 120 ? 70.687  56.220  59.518  1.00 44.97 ? 120 GLN H N   1 
ATOM 7405  C CA  . GLN H 1 120 ? 71.119  57.050  58.390  1.00 45.08 ? 120 GLN H CA  1 
ATOM 7406  C C   . GLN H 1 120 ? 70.078  57.033  57.264  1.00 45.31 ? 120 GLN H C   1 
ATOM 7407  O O   . GLN H 1 120 ? 69.550  55.966  56.941  1.00 45.67 ? 120 GLN H O   1 
ATOM 7408  C CB  . GLN H 1 120 ? 72.468  56.555  57.855  1.00 45.05 ? 120 GLN H CB  1 
ATOM 7409  C CG  . GLN H 1 120 ? 73.101  57.449  56.796  1.00 45.09 ? 120 GLN H CG  1 
ATOM 7410  C CD  . GLN H 1 120 ? 74.459  56.945  56.343  1.00 45.21 ? 120 GLN H CD  1 
ATOM 7411  O OE1 . GLN H 1 120 ? 75.334  56.655  57.160  1.00 45.22 ? 120 GLN H OE1 1 
ATOM 7412  N NE2 . GLN H 1 120 ? 74.644  56.842  55.031  1.00 45.29 ? 120 GLN H NE2 1 
ATOM 7413  N N   . PRO H 1 121 ? 69.764  58.212  56.679  1.00 45.40 ? 121 PRO H N   1 
ATOM 7414  C CA  . PRO H 1 121 ? 68.895  58.259  55.495  1.00 45.55 ? 121 PRO H CA  1 
ATOM 7415  C C   . PRO H 1 121 ? 69.452  57.472  54.305  1.00 45.58 ? 121 PRO H C   1 
ATOM 7416  O O   . PRO H 1 121 ? 70.641  57.584  53.997  1.00 45.53 ? 121 PRO H O   1 
ATOM 7417  C CB  . PRO H 1 121 ? 68.836  59.752  55.160  1.00 45.56 ? 121 PRO H CB  1 
ATOM 7418  C CG  . PRO H 1 121 ? 69.060  60.437  56.457  1.00 45.48 ? 121 PRO H CG  1 
ATOM 7419  C CD  . PRO H 1 121 ? 70.003  59.561  57.229  1.00 45.42 ? 121 PRO H CD  1 
ATOM 7420  N N   . GLU H 1 122 ? 68.593  56.685  53.659  1.00 45.76 ? 122 GLU H N   1 
ATOM 7421  C CA  . GLU H 1 122 ? 68.989  55.865  52.508  1.00 45.90 ? 122 GLU H CA  1 
ATOM 7422  C C   . GLU H 1 122 ? 69.295  56.724  51.284  1.00 45.50 ? 122 GLU H C   1 
ATOM 7423  O O   . GLU H 1 122 ? 70.279  56.476  50.587  1.00 45.42 ? 122 GLU H O   1 
ATOM 7424  C CB  . GLU H 1 122 ? 67.897  54.843  52.162  1.00 46.32 ? 122 GLU H CB  1 
ATOM 7425  C CG  . GLU H 1 122 ? 67.658  53.780  53.230  1.00 46.56 ? 122 GLU H CG  1 
ATOM 7426  C CD  . GLU H 1 122 ? 68.842  52.845  53.446  1.00 46.77 ? 122 GLU H CD  1 
ATOM 7427  O OE1 . GLU H 1 122 ? 69.677  52.688  52.528  1.00 46.76 ? 122 GLU H OE1 1 
ATOM 7428  O OE2 . GLU H 1 122 ? 68.933  52.257  54.544  1.00 46.96 ? 122 GLU H OE2 1 
ATOM 7429  N N   . SER H 1 123 ? 68.443  57.716  51.029  1.00 45.20 ? 123 SER H N   1 
ATOM 7430  C CA  . SER H 1 123 ? 68.651  58.692  49.955  1.00 45.03 ? 123 SER H CA  1 
ATOM 7431  C C   . SER H 1 123 ? 68.257  60.091  50.422  1.00 44.61 ? 123 SER H C   1 
ATOM 7432  O O   . SER H 1 123 ? 67.377  60.248  51.272  1.00 44.74 ? 123 SER H O   1 
ATOM 7433  C CB  . SER H 1 123 ? 67.833  58.307  48.720  1.00 45.23 ? 123 SER H CB  1 
ATOM 7434  O OG  . SER H 1 123 ? 68.105  59.176  47.634  1.00 45.30 ? 123 SER H OG  1 
ATOM 7435  N N   . CYS H 1 124 ? 68.915  61.101  49.855  1.00 44.10 ? 124 CYS H N   1 
ATOM 7436  C CA  . CYS H 1 124 ? 68.671  62.501  50.213  1.00 43.87 ? 124 CYS H CA  1 
ATOM 7437  C C   . CYS H 1 124 ? 67.306  62.977  49.689  1.00 44.47 ? 124 CYS H C   1 
ATOM 7438  O O   . CYS H 1 124 ? 66.847  62.485  48.655  1.00 44.77 ? 124 CYS H O   1 
ATOM 7439  C CB  . CYS H 1 124 ? 69.790  63.397  49.667  1.00 43.10 ? 124 CYS H CB  1 
ATOM 7440  S SG  . CYS H 1 124 ? 70.363  62.957  48.007  1.00 42.51 ? 124 CYS H SG  1 
ATOM 7441  N N   . PRO H 1 125 ? 66.648  63.925  50.400  1.00 44.93 ? 125 PRO H N   1 
ATOM 7442  C CA  . PRO H 1 125 ? 65.360  64.455  49.914  1.00 45.17 ? 125 PRO H CA  1 
ATOM 7443  C C   . PRO H 1 125 ? 65.449  65.251  48.605  1.00 45.54 ? 125 PRO H C   1 
ATOM 7444  O O   . PRO H 1 125 ? 64.428  65.524  47.971  1.00 45.78 ? 125 PRO H O   1 
ATOM 7445  C CB  . PRO H 1 125 ? 64.897  65.373  51.055  1.00 45.17 ? 125 PRO H CB  1 
ATOM 7446  C CG  . PRO H 1 125 ? 65.637  64.911  52.257  1.00 45.13 ? 125 PRO H CG  1 
ATOM 7447  C CD  . PRO H 1 125 ? 66.963  64.433  51.751  1.00 45.02 ? 125 PRO H CD  1 
ATOM 7448  O OXT . PRO H 1 125 ? 66.524  65.642  48.147  1.00 45.77 ? 125 PRO H OXT 1 
ATOM 7449  N N   . PHE I 1 1   ? 83.361  79.824  130.573 1.00 65.53 ? 1   PHE I N   1 
ATOM 7450  C CA  . PHE I 1 1   ? 83.605  80.915  129.586 1.00 65.24 ? 1   PHE I CA  1 
ATOM 7451  C C   . PHE I 1 1   ? 84.364  82.064  130.263 1.00 64.19 ? 1   PHE I C   1 
ATOM 7452  O O   . PHE I 1 1   ? 83.763  82.919  130.920 1.00 64.28 ? 1   PHE I O   1 
ATOM 7453  C CB  . PHE I 1 1   ? 82.272  81.398  128.989 1.00 66.00 ? 1   PHE I CB  1 
ATOM 7454  C CG  . PHE I 1 1   ? 82.394  82.003  127.613 1.00 66.66 ? 1   PHE I CG  1 
ATOM 7455  C CD1 . PHE I 1 1   ? 83.162  83.146  127.399 1.00 66.87 ? 1   PHE I CD1 1 
ATOM 7456  C CD2 . PHE I 1 1   ? 81.726  81.440  126.529 1.00 67.09 ? 1   PHE I CD2 1 
ATOM 7457  C CE1 . PHE I 1 1   ? 83.268  83.706  126.136 1.00 67.09 ? 1   PHE I CE1 1 
ATOM 7458  C CE2 . PHE I 1 1   ? 81.832  81.998  125.263 1.00 67.25 ? 1   PHE I CE2 1 
ATOM 7459  C CZ  . PHE I 1 1   ? 82.603  83.133  125.066 1.00 67.25 ? 1   PHE I CZ  1 
ATOM 7460  N N   . THR I 1 2   ? 85.685  82.074  130.089 1.00 62.81 ? 2   THR I N   1 
ATOM 7461  C CA  . THR I 1 2   ? 86.559  83.068  130.722 1.00 61.68 ? 2   THR I CA  1 
ATOM 7462  C C   . THR I 1 2   ? 86.614  84.369  129.922 1.00 60.37 ? 2   THR I C   1 
ATOM 7463  O O   . THR I 1 2   ? 86.123  84.439  128.793 1.00 60.21 ? 2   THR I O   1 
ATOM 7464  C CB  . THR I 1 2   ? 88.001  82.531  130.871 1.00 61.85 ? 2   THR I CB  1 
ATOM 7465  O OG1 . THR I 1 2   ? 88.509  82.152  129.587 1.00 61.94 ? 2   THR I OG1 1 
ATOM 7466  C CG2 . THR I 1 2   ? 88.047  81.327  131.802 1.00 61.91 ? 2   THR I CG2 1 
ATOM 7467  N N   . LEU I 1 3   ? 87.218  85.391  130.525 1.00 59.31 ? 3   LEU I N   1 
ATOM 7468  C CA  . LEU I 1 3   ? 87.499  86.655  129.842 1.00 58.56 ? 3   LEU I CA  1 
ATOM 7469  C C   . LEU I 1 3   ? 88.653  86.492  128.850 1.00 57.74 ? 3   LEU I C   1 
ATOM 7470  O O   . LEU I 1 3   ? 88.615  87.064  127.761 1.00 57.87 ? 3   LEU I O   1 
ATOM 7471  C CB  . LEU I 1 3   ? 87.828  87.759  130.855 1.00 58.65 ? 3   LEU I CB  1 
ATOM 7472  C CG  . LEU I 1 3   ? 88.029  89.187  130.328 1.00 58.84 ? 3   LEU I CG  1 
ATOM 7473  C CD1 . LEU I 1 3   ? 86.763  89.726  129.678 1.00 58.83 ? 3   LEU I CD1 1 
ATOM 7474  C CD2 . LEU I 1 3   ? 88.480  90.099  131.460 1.00 59.00 ? 3   LEU I CD2 1 
ATOM 7475  N N   . ILE I 1 4   ? 89.677  85.730  129.241 1.00 56.84 ? 4   ILE I N   1 
ATOM 7476  C CA  . ILE I 1 4   ? 90.815  85.417  128.358 1.00 56.10 ? 4   ILE I CA  1 
ATOM 7477  C C   . ILE I 1 4   ? 90.408  84.644  127.091 1.00 55.55 ? 4   ILE I C   1 
ATOM 7478  O O   . ILE I 1 4   ? 90.979  84.872  126.022 1.00 55.56 ? 4   ILE I O   1 
ATOM 7479  C CB  . ILE I 1 4   ? 91.958  84.677  129.122 1.00 56.16 ? 4   ILE I CB  1 
ATOM 7480  C CG1 . ILE I 1 4   ? 93.226  84.530  128.263 1.00 56.20 ? 4   ILE I CG1 1 
ATOM 7481  C CG2 . ILE I 1 4   ? 91.530  83.295  129.605 1.00 56.30 ? 4   ILE I CG2 1 
ATOM 7482  C CD1 . ILE I 1 4   ? 93.803  85.831  127.751 1.00 56.15 ? 4   ILE I CD1 1 
ATOM 7483  N N   . GLU I 1 5   ? 89.432  83.742  127.215 1.00 55.12 ? 5   GLU I N   1 
ATOM 7484  C CA  . GLU I 1 5   ? 88.888  83.015  126.059 1.00 54.70 ? 5   GLU I CA  1 
ATOM 7485  C C   . GLU I 1 5   ? 88.103  83.944  125.127 1.00 54.01 ? 5   GLU I C   1 
ATOM 7486  O O   . GLU I 1 5   ? 88.096  83.740  123.915 1.00 54.13 ? 5   GLU I O   1 
ATOM 7487  C CB  . GLU I 1 5   ? 88.012  81.840  126.516 1.00 54.98 ? 5   GLU I CB  1 
ATOM 7488  C CG  . GLU I 1 5   ? 87.484  80.954  125.390 1.00 55.44 ? 5   GLU I CG  1 
ATOM 7489  C CD  . GLU I 1 5   ? 86.065  81.297  124.964 1.00 55.80 ? 5   GLU I CD  1 
ATOM 7490  O OE1 . GLU I 1 5   ? 85.143  81.165  125.797 1.00 55.97 ? 5   GLU I OE1 1 
ATOM 7491  O OE2 . GLU I 1 5   ? 85.869  81.686  123.793 1.00 55.93 ? 5   GLU I OE2 1 
ATOM 7492  N N   . LEU I 1 6   ? 87.438  84.947  125.697 1.00 53.26 ? 6   LEU I N   1 
ATOM 7493  C CA  . LEU I 1 6   ? 86.776  85.994  124.912 1.00 52.82 ? 6   LEU I CA  1 
ATOM 7494  C C   . LEU I 1 6   ? 87.789  86.967  124.306 1.00 52.17 ? 6   LEU I C   1 
ATOM 7495  O O   . LEU I 1 6   ? 87.624  87.409  123.169 1.00 52.30 ? 6   LEU I O   1 
ATOM 7496  C CB  . LEU I 1 6   ? 85.787  86.769  125.789 1.00 53.07 ? 6   LEU I CB  1 
ATOM 7497  C CG  . LEU I 1 6   ? 84.810  87.743  125.117 1.00 53.25 ? 6   LEU I CG  1 
ATOM 7498  C CD1 . LEU I 1 6   ? 83.898  87.040  124.115 1.00 53.35 ? 6   LEU I CD1 1 
ATOM 7499  C CD2 . LEU I 1 6   ? 83.996  88.480  126.177 1.00 53.36 ? 6   LEU I CD2 1 
ATOM 7500  N N   . LEU I 1 7   ? 88.824  87.297  125.079 1.00 51.68 ? 7   LEU I N   1 
ATOM 7501  C CA  . LEU I 1 7   ? 89.852  88.262  124.675 1.00 51.18 ? 7   LEU I CA  1 
ATOM 7502  C C   . LEU I 1 7   ? 90.693  87.783  123.491 1.00 50.46 ? 7   LEU I C   1 
ATOM 7503  O O   . LEU I 1 7   ? 90.991  88.571  122.591 1.00 50.55 ? 7   LEU I O   1 
ATOM 7504  C CB  . LEU I 1 7   ? 90.761  88.583  125.867 1.00 51.54 ? 7   LEU I CB  1 
ATOM 7505  C CG  . LEU I 1 7   ? 91.871  89.627  125.707 1.00 52.00 ? 7   LEU I CG  1 
ATOM 7506  C CD1 . LEU I 1 7   ? 91.328  90.953  125.193 1.00 52.25 ? 7   LEU I CD1 1 
ATOM 7507  C CD2 . LEU I 1 7   ? 92.576  89.812  127.042 1.00 52.11 ? 7   LEU I CD2 1 
ATOM 7508  N N   . ILE I 1 8   ? 91.081  86.506  123.504 1.00 49.67 ? 8   ILE I N   1 
ATOM 7509  C CA  . ILE I 1 8   ? 91.806  85.905  122.372 1.00 48.95 ? 8   ILE I CA  1 
ATOM 7510  C C   . ILE I 1 8   ? 90.934  85.797  121.114 1.00 48.10 ? 8   ILE I C   1 
ATOM 7511  O O   . ILE I 1 8   ? 91.442  85.950  120.007 1.00 48.25 ? 8   ILE I O   1 
ATOM 7512  C CB  . ILE I 1 8   ? 92.442  84.530  122.727 1.00 49.08 ? 8   ILE I CB  1 
ATOM 7513  C CG1 . ILE I 1 8   ? 93.470  84.125  121.657 1.00 49.31 ? 8   ILE I CG1 1 
ATOM 7514  C CG2 . ILE I 1 8   ? 91.382  83.446  122.905 1.00 49.12 ? 8   ILE I CG2 1 
ATOM 7515  C CD1 . ILE I 1 8   ? 94.399  83.000  122.067 1.00 49.49 ? 8   ILE I CD1 1 
ATOM 7516  N N   . VAL I 1 9   ? 89.635  85.548  121.288 1.00 47.27 ? 9   VAL I N   1 
ATOM 7517  C CA  . VAL I 1 9   ? 88.681  85.535  120.165 1.00 46.73 ? 9   VAL I CA  1 
ATOM 7518  C C   . VAL I 1 9   ? 88.563  86.924  119.519 1.00 46.19 ? 9   VAL I C   1 
ATOM 7519  O O   . VAL I 1 9   ? 88.471  87.028  118.296 1.00 46.23 ? 9   VAL I O   1 
ATOM 7520  C CB  . VAL I 1 9   ? 87.292  84.999  120.606 1.00 46.84 ? 9   VAL I CB  1 
ATOM 7521  C CG1 . VAL I 1 9   ? 86.214  85.268  119.559 1.00 46.95 ? 9   VAL I CG1 1 
ATOM 7522  C CG2 . VAL I 1 9   ? 87.374  83.505  120.891 1.00 46.91 ? 9   VAL I CG2 1 
ATOM 7523  N N   . ILE I 1 10  ? 88.573  87.973  120.341 1.00 45.60 ? 10  ILE I N   1 
ATOM 7524  C CA  . ILE I 1 10  ? 88.592  89.359  119.849 1.00 45.28 ? 10  ILE I CA  1 
ATOM 7525  C C   . ILE I 1 10  ? 89.901  89.653  119.096 1.00 44.89 ? 10  ILE I C   1 
ATOM 7526  O O   . ILE I 1 10  ? 89.888  90.355  118.082 1.00 44.97 ? 10  ILE I O   1 
ATOM 7527  C CB  . ILE I 1 10  ? 88.376  90.376  121.003 1.00 45.46 ? 10  ILE I CB  1 
ATOM 7528  C CG1 . ILE I 1 10  ? 86.954  90.244  121.570 1.00 45.68 ? 10  ILE I CG1 1 
ATOM 7529  C CG2 . ILE I 1 10  ? 88.602  91.815  120.538 1.00 45.52 ? 10  ILE I CG2 1 
ATOM 7530  C CD1 . ILE I 1 10  ? 86.794  90.782  122.978 1.00 45.81 ? 10  ILE I CD1 1 
ATOM 7531  N N   . ALA I 1 11  ? 91.014  89.114  119.593 1.00 44.53 ? 11  ALA I N   1 
ATOM 7532  C CA  . ALA I 1 11  ? 92.324  89.267  118.949 1.00 44.37 ? 11  ALA I CA  1 
ATOM 7533  C C   . ALA I 1 11  ? 92.407  88.603  117.570 1.00 44.14 ? 11  ALA I C   1 
ATOM 7534  O O   . ALA I 1 11  ? 92.987  89.174  116.646 1.00 44.27 ? 11  ALA I O   1 
ATOM 7535  C CB  . ALA I 1 11  ? 93.428  88.730  119.852 1.00 44.52 ? 11  ALA I CB  1 
ATOM 7536  N N   . ILE I 1 12  ? 91.829  87.407  117.441 1.00 43.94 ? 12  ILE I N   1 
ATOM 7537  C CA  . ILE I 1 12  ? 91.831  86.665  116.170 1.00 43.88 ? 12  ILE I CA  1 
ATOM 7538  C C   . ILE I 1 12  ? 90.905  87.312  115.128 1.00 43.93 ? 12  ILE I C   1 
ATOM 7539  O O   . ILE I 1 12  ? 91.232  87.317  113.940 1.00 44.27 ? 12  ILE I O   1 
ATOM 7540  C CB  . ILE I 1 12  ? 91.465  85.169  116.379 1.00 43.83 ? 12  ILE I CB  1 
ATOM 7541  C CG1 . ILE I 1 12  ? 92.503  84.464  117.271 1.00 44.06 ? 12  ILE I CG1 1 
ATOM 7542  C CG2 . ILE I 1 12  ? 91.324  84.425  115.049 1.00 43.85 ? 12  ILE I CG2 1 
ATOM 7543  C CD1 . ILE I 1 12  ? 93.929  84.470  116.755 1.00 44.26 ? 12  ILE I CD1 1 
ATOM 7544  N N   . ILE I 1 13  ? 89.771  87.860  115.567 1.00 43.69 ? 13  ILE I N   1 
ATOM 7545  C CA  . ILE I 1 13  ? 88.852  88.587  114.672 1.00 43.60 ? 13  ILE I CA  1 
ATOM 7546  C C   . ILE I 1 13  ? 89.544  89.800  114.029 1.00 43.55 ? 13  ILE I C   1 
ATOM 7547  O O   . ILE I 1 13  ? 89.323  90.084  112.850 1.00 43.61 ? 13  ILE I O   1 
ATOM 7548  C CB  . ILE I 1 13  ? 87.548  89.010  115.405 1.00 43.76 ? 13  ILE I CB  1 
ATOM 7549  C CG1 . ILE I 1 13  ? 86.704  87.774  115.742 1.00 43.92 ? 13  ILE I CG1 1 
ATOM 7550  C CG2 . ILE I 1 13  ? 86.705  89.969  114.559 1.00 43.84 ? 13  ILE I CG2 1 
ATOM 7551  C CD1 . ILE I 1 13  ? 85.737  87.980  116.890 1.00 44.05 ? 13  ILE I CD1 1 
ATOM 7552  N N   . ALA I 1 14  ? 90.376  90.501  114.800 1.00 43.61 ? 14  ALA I N   1 
ATOM 7553  C CA  . ALA I 1 14  ? 91.175  91.622  114.285 1.00 43.68 ? 14  ALA I CA  1 
ATOM 7554  C C   . ALA I 1 14  ? 92.193  91.189  113.225 1.00 43.73 ? 14  ALA I C   1 
ATOM 7555  O O   . ALA I 1 14  ? 92.440  91.924  112.266 1.00 43.84 ? 14  ALA I O   1 
ATOM 7556  C CB  . ALA I 1 14  ? 91.883  92.337  115.429 1.00 43.75 ? 14  ALA I CB  1 
ATOM 7557  N N   . ILE I 1 15  ? 92.777  90.004  113.409 1.00 43.74 ? 15  ILE I N   1 
ATOM 7558  C CA  . ILE I 1 15  ? 93.734  89.434  112.451 1.00 43.83 ? 15  ILE I CA  1 
ATOM 7559  C C   . ILE I 1 15  ? 93.024  88.978  111.174 1.00 43.79 ? 15  ILE I C   1 
ATOM 7560  O O   . ILE I 1 15  ? 93.464  89.305  110.069 1.00 43.92 ? 15  ILE I O   1 
ATOM 7561  C CB  . ILE I 1 15  ? 94.523  88.248  113.068 1.00 44.00 ? 15  ILE I CB  1 
ATOM 7562  C CG1 . ILE I 1 15  ? 95.381  88.731  114.247 1.00 44.22 ? 15  ILE I CG1 1 
ATOM 7563  C CG2 . ILE I 1 15  ? 95.419  87.578  112.027 1.00 44.10 ? 15  ILE I CG2 1 
ATOM 7564  C CD1 . ILE I 1 15  ? 95.806  87.630  115.196 1.00 44.27 ? 15  ILE I CD1 1 
ATOM 7565  N N   . LEU I 1 16  ? 91.942  88.218  111.336 1.00 43.76 ? 16  LEU I N   1 
ATOM 7566  C CA  . LEU I 1 16  ? 91.154  87.715  110.198 1.00 43.77 ? 16  LEU I CA  1 
ATOM 7567  C C   . LEU I 1 16  ? 90.486  88.831  109.382 1.00 43.68 ? 16  LEU I C   1 
ATOM 7568  O O   . LEU I 1 16  ? 90.370  88.715  108.161 1.00 43.80 ? 16  LEU I O   1 
ATOM 7569  C CB  . LEU I 1 16  ? 90.102  86.687  110.659 1.00 43.94 ? 16  LEU I CB  1 
ATOM 7570  C CG  . LEU I 1 16  ? 90.541  85.216  110.731 1.00 44.26 ? 16  LEU I CG  1 
ATOM 7571  C CD1 . LEU I 1 16  ? 91.904  85.028  111.386 1.00 44.40 ? 16  LEU I CD1 1 
ATOM 7572  C CD2 . LEU I 1 16  ? 89.481  84.391  111.449 1.00 44.39 ? 16  LEU I CD2 1 
ATOM 7573  N N   . ALA I 1 17  ? 90.051  89.897  110.055 1.00 43.48 ? 17  ALA I N   1 
ATOM 7574  C CA  . ALA I 1 17  ? 89.441  91.055  109.382 1.00 43.36 ? 17  ALA I CA  1 
ATOM 7575  C C   . ALA I 1 17  ? 90.424  91.843  108.506 1.00 43.29 ? 17  ALA I C   1 
ATOM 7576  O O   . ALA I 1 17  ? 90.005  92.511  107.560 1.00 43.40 ? 17  ALA I O   1 
ATOM 7577  C CB  . ALA I 1 17  ? 88.797  91.983  110.404 1.00 43.38 ? 17  ALA I CB  1 
ATOM 7578  N N   . ALA I 1 18  ? 91.716  91.775  108.830 1.00 43.01 ? 18  ALA I N   1 
ATOM 7579  C CA  . ALA I 1 18  ? 92.755  92.442  108.045 1.00 42.88 ? 18  ALA I CA  1 
ATOM 7580  C C   . ALA I 1 18  ? 93.155  91.619  106.822 1.00 42.74 ? 18  ALA I C   1 
ATOM 7581  O O   . ALA I 1 18  ? 93.118  92.118  105.695 1.00 42.83 ? 18  ALA I O   1 
ATOM 7582  C CB  . ALA I 1 18  ? 93.975  92.714  108.914 1.00 42.97 ? 18  ALA I CB  1 
ATOM 7583  N N   . VAL I 1 19  ? 93.528  90.362  107.055 1.00 42.61 ? 19  VAL I N   1 
ATOM 7584  C CA  . VAL I 1 19  ? 94.126  89.513  106.009 1.00 42.61 ? 19  VAL I CA  1 
ATOM 7585  C C   . VAL I 1 19  ? 93.136  88.978  104.964 1.00 42.56 ? 19  VAL I C   1 
ATOM 7586  O O   . VAL I 1 19  ? 93.467  88.925  103.777 1.00 42.66 ? 19  VAL I O   1 
ATOM 7587  C CB  . VAL I 1 19  ? 94.943  88.328  106.602 1.00 42.69 ? 19  VAL I CB  1 
ATOM 7588  C CG1 . VAL I 1 19  ? 96.007  88.842  107.566 1.00 42.75 ? 19  VAL I CG1 1 
ATOM 7589  C CG2 . VAL I 1 19  ? 94.049  87.285  107.273 1.00 42.69 ? 19  VAL I CG2 1 
ATOM 7590  N N   . LEU I 1 20  ? 91.935  88.593  105.397 1.00 42.47 ? 20  LEU I N   1 
ATOM 7591  C CA  . LEU I 1 20  ? 90.956  87.946  104.509 1.00 42.47 ? 20  LEU I CA  1 
ATOM 7592  C C   . LEU I 1 20  ? 90.238  88.912  103.558 1.00 42.21 ? 20  LEU I C   1 
ATOM 7593  O O   . LEU I 1 20  ? 89.723  88.481  102.523 1.00 42.16 ? 20  LEU I O   1 
ATOM 7594  C CB  . LEU I 1 20  ? 89.925  87.158  105.323 1.00 42.79 ? 20  LEU I CB  1 
ATOM 7595  C CG  . LEU I 1 20  ? 90.463  86.065  106.253 1.00 43.17 ? 20  LEU I CG  1 
ATOM 7596  C CD1 . LEU I 1 20  ? 89.335  85.489  107.094 1.00 43.27 ? 20  LEU I CD1 1 
ATOM 7597  C CD2 . LEU I 1 20  ? 91.152  84.962  105.463 1.00 43.25 ? 20  LEU I CD2 1 
ATOM 7598  N N   . ILE I 1 21  ? 90.197  90.200  103.908 1.00 41.85 ? 21  ILE I N   1 
ATOM 7599  C CA  . ILE I 1 21  ? 89.590  91.228  103.054 1.00 41.51 ? 21  ILE I CA  1 
ATOM 7600  C C   . ILE I 1 21  ? 90.568  91.498  101.898 1.00 41.13 ? 21  ILE I C   1 
ATOM 7601  O O   . ILE I 1 21  ? 91.685  91.958  102.142 1.00 41.33 ? 21  ILE I O   1 
ATOM 7602  C CB  . ILE I 1 21  ? 89.281  92.533  103.842 1.00 41.75 ? 21  ILE I CB  1 
ATOM 7603  C CG1 . ILE I 1 21  ? 87.983  92.405  104.662 1.00 41.94 ? 21  ILE I CG1 1 
ATOM 7604  C CG2 . ILE I 1 21  ? 89.106  93.732  102.910 1.00 41.83 ? 21  ILE I CG2 1 
ATOM 7605  C CD1 . ILE I 1 21  ? 87.841  91.165  105.523 1.00 42.01 ? 21  ILE I CD1 1 
ATOM 7606  N N   . PRO I 1 22  ? 90.155  91.215  100.643 1.00 40.49 ? 22  PRO I N   1 
ATOM 7607  C CA  . PRO I 1 22  ? 91.069  91.352  99.507  1.00 40.05 ? 22  PRO I CA  1 
ATOM 7608  C C   . PRO I 1 22  ? 91.248  92.797  99.040  1.00 39.58 ? 22  PRO I C   1 
ATOM 7609  O O   . PRO I 1 22  ? 90.529  93.692  99.493  1.00 39.64 ? 22  PRO I O   1 
ATOM 7610  C CB  . PRO I 1 22  ? 90.381  90.530  98.419  1.00 40.17 ? 22  PRO I CB  1 
ATOM 7611  C CG  . PRO I 1 22  ? 88.931  90.717  98.700  1.00 40.35 ? 22  PRO I CG  1 
ATOM 7612  C CD  . PRO I 1 22  ? 88.804  90.820  100.197 1.00 40.46 ? 22  PRO I CD  1 
ATOM 7613  N N   . ASN I 1 23  ? 92.205  93.004  98.136  1.00 38.96 ? 23  ASN I N   1 
ATOM 7614  C CA  . ASN I 1 23  ? 92.434  94.310  97.520  1.00 38.42 ? 23  ASN I CA  1 
ATOM 7615  C C   . ASN I 1 23  ? 91.314  94.582  96.513  1.00 38.17 ? 23  ASN I C   1 
ATOM 7616  O O   . ASN I 1 23  ? 91.280  93.987  95.433  1.00 38.30 ? 23  ASN I O   1 
ATOM 7617  C CB  . ASN I 1 23  ? 93.811  94.351  96.840  1.00 38.26 ? 23  ASN I CB  1 
ATOM 7618  C CG  . ASN I 1 23  ? 94.243  95.760  96.461  1.00 38.22 ? 23  ASN I CG  1 
ATOM 7619  O OD1 . ASN I 1 23  ? 93.516  96.490  95.788  1.00 38.19 ? 23  ASN I OD1 1 
ATOM 7620  N ND2 . ASN I 1 23  ? 95.443  96.142  96.884  1.00 38.32 ? 23  ASN I ND2 1 
ATOM 7621  N N   . LEU I 1 24  ? 90.396  95.474  96.885  1.00 37.77 ? 24  LEU I N   1 
ATOM 7622  C CA  . LEU I 1 24  ? 89.231  95.788  96.057  1.00 37.53 ? 24  LEU I CA  1 
ATOM 7623  C C   . LEU I 1 24  ? 89.598  96.679  94.871  1.00 37.24 ? 24  LEU I C   1 
ATOM 7624  O O   . LEU I 1 24  ? 89.184  96.404  93.746  1.00 37.38 ? 24  LEU I O   1 
ATOM 7625  C CB  . LEU I 1 24  ? 88.135  96.460  96.893  1.00 37.66 ? 24  LEU I CB  1 
ATOM 7626  C CG  . LEU I 1 24  ? 87.577  95.657  98.074  1.00 37.78 ? 24  LEU I CG  1 
ATOM 7627  C CD1 . LEU I 1 24  ? 86.735  96.547  98.975  1.00 37.90 ? 24  LEU I CD1 1 
ATOM 7628  C CD2 . LEU I 1 24  ? 86.763  94.460  97.604  1.00 37.72 ? 24  LEU I CD2 1 
ATOM 7629  N N   . LEU I 1 25  ? 90.374  97.734  95.129  1.00 36.76 ? 25  LEU I N   1 
ATOM 7630  C CA  . LEU I 1 25  ? 90.752  98.714  94.100  1.00 36.40 ? 25  LEU I CA  1 
ATOM 7631  C C   . LEU I 1 25  ? 91.467  98.076  92.912  1.00 35.85 ? 25  LEU I C   1 
ATOM 7632  O O   . LEU I 1 25  ? 91.183  98.415  91.763  1.00 35.80 ? 25  LEU I O   1 
ATOM 7633  C CB  . LEU I 1 25  ? 91.640  99.816  94.696  1.00 36.59 ? 25  LEU I CB  1 
ATOM 7634  C CG  . LEU I 1 25  ? 92.027  100.991 93.784  1.00 36.81 ? 25  LEU I CG  1 
ATOM 7635  C CD1 . LEU I 1 25  ? 90.798  101.783 93.361  1.00 36.91 ? 25  LEU I CD1 1 
ATOM 7636  C CD2 . LEU I 1 25  ? 93.035  101.899 94.472  1.00 36.92 ? 25  LEU I CD2 1 
ATOM 7637  N N   . ALA I 1 26  ? 92.390  97.160  93.199  1.00 35.52 ? 26  ALA I N   1 
ATOM 7638  C CA  . ALA I 1 26  ? 93.143  96.455  92.158  1.00 35.27 ? 26  ALA I CA  1 
ATOM 7639  C C   . ALA I 1 26  ? 92.252  95.513  91.343  1.00 34.96 ? 26  ALA I C   1 
ATOM 7640  O O   . ALA I 1 26  ? 92.396  95.426  90.123  1.00 34.98 ? 26  ALA I O   1 
ATOM 7641  C CB  . ALA I 1 26  ? 94.312  95.690  92.769  1.00 35.29 ? 26  ALA I CB  1 
ATOM 7642  N N   . ALA I 1 27  ? 91.334  94.822  92.019  1.00 34.79 ? 27  ALA I N   1 
ATOM 7643  C CA  . ALA I 1 27  ? 90.382  93.918  91.358  1.00 34.77 ? 27  ALA I CA  1 
ATOM 7644  C C   . ALA I 1 27  ? 89.471  94.634  90.353  1.00 34.60 ? 27  ALA I C   1 
ATOM 7645  O O   . ALA I 1 27  ? 89.170  94.084  89.293  1.00 34.63 ? 27  ALA I O   1 
ATOM 7646  C CB  . ALA I 1 27  ? 89.541  93.186  92.395  1.00 34.88 ? 27  ALA I CB  1 
ATOM 7647  N N   . ARG I 1 28  ? 89.041  95.851  90.692  1.00 34.46 ? 28  ARG I N   1 
ATOM 7648  C CA  . ARG I 1 28  ? 88.178  96.648  89.812  1.00 34.32 ? 28  ARG I CA  1 
ATOM 7649  C C   . ARG I 1 28  ? 88.910  97.207  88.587  1.00 34.16 ? 28  ARG I C   1 
ATOM 7650  O O   . ARG I 1 28  ? 88.305  97.319  87.521  1.00 34.28 ? 28  ARG I O   1 
ATOM 7651  C CB  . ARG I 1 28  ? 87.512  97.793  90.583  1.00 34.46 ? 28  ARG I CB  1 
ATOM 7652  C CG  . ARG I 1 28  ? 86.588  97.331  91.700  1.00 34.64 ? 28  ARG I CG  1 
ATOM 7653  C CD  . ARG I 1 28  ? 85.573  98.398  92.085  1.00 34.76 ? 28  ARG I CD  1 
ATOM 7654  N NE  . ARG I 1 28  ? 84.393  98.372  91.220  1.00 34.86 ? 28  ARG I NE  1 
ATOM 7655  C CZ  . ARG I 1 28  ? 83.403  97.475  91.288  1.00 35.08 ? 28  ARG I CZ  1 
ATOM 7656  N NH1 . ARG I 1 28  ? 82.381  97.564  90.442  1.00 35.19 ? 28  ARG I NH1 1 
ATOM 7657  N NH2 . ARG I 1 28  ? 83.419  96.486  92.186  1.00 35.14 ? 28  ARG I NH2 1 
ATOM 7658  N N   . LYS I 1 29  ? 90.190  97.562  88.740  1.00 34.02 ? 29  LYS I N   1 
ATOM 7659  C CA  . LYS I 1 29  ? 91.011  98.078  87.625  1.00 33.92 ? 29  LYS I CA  1 
ATOM 7660  C C   . LYS I 1 29  ? 90.991  97.179  86.386  1.00 33.86 ? 29  LYS I C   1 
ATOM 7661  O O   . LYS I 1 29  ? 90.871  97.672  85.264  1.00 34.02 ? 29  LYS I O   1 
ATOM 7662  C CB  . LYS I 1 29  ? 92.472  98.291  88.052  1.00 33.96 ? 29  LYS I CB  1 
ATOM 7663  C CG  . LYS I 1 29  ? 92.742  99.574  88.821  1.00 34.05 ? 29  LYS I CG  1 
ATOM 7664  C CD  . LYS I 1 29  ? 94.234  99.873  88.861  1.00 34.19 ? 29  LYS I CD  1 
ATOM 7665  C CE  . LYS I 1 29  ? 94.556  101.077 89.734  1.00 34.36 ? 29  LYS I CE  1 
ATOM 7666  N NZ  . LYS I 1 29  ? 94.602  100.746 91.187  1.00 34.43 ? 29  LYS I NZ  1 
ATOM 7667  N N   . ARG I 1 30  ? 91.106  95.869  86.600  1.00 33.59 ? 30  ARG I N   1 
ATOM 7668  C CA  . ARG I 1 30  ? 91.137  94.896  85.502  1.00 33.40 ? 30  ARG I CA  1 
ATOM 7669  C C   . ARG I 1 30  ? 89.748  94.674  84.905  1.00 33.27 ? 30  ARG I C   1 
ATOM 7670  O O   . ARG I 1 30  ? 89.620  94.442  83.701  1.00 33.42 ? 30  ARG I O   1 
ATOM 7671  C CB  . ARG I 1 30  ? 91.730  93.560  85.964  1.00 33.43 ? 30  ARG I CB  1 
ATOM 7672  C CG  . ARG I 1 30  ? 93.107  93.645  86.614  1.00 33.49 ? 30  ARG I CG  1 
ATOM 7673  C CD  . ARG I 1 30  ? 94.174  94.232  85.698  1.00 33.56 ? 30  ARG I CD  1 
ATOM 7674  N NE  . ARG I 1 30  ? 95.435  94.481  86.399  1.00 33.57 ? 30  ARG I NE  1 
ATOM 7675  C CZ  . ARG I 1 30  ? 96.541  94.969  85.833  1.00 33.63 ? 30  ARG I CZ  1 
ATOM 7676  N NH1 . ARG I 1 30  ? 96.572  95.273  84.535  1.00 33.65 ? 30  ARG I NH1 1 
ATOM 7677  N NH2 . ARG I 1 30  ? 97.632  95.155  86.572  1.00 33.67 ? 30  ARG I NH2 1 
ATOM 7678  N N   . ALA I 1 31  ? 88.719  94.730  85.750  1.00 32.98 ? 31  ALA I N   1 
ATOM 7679  C CA  . ALA I 1 31  ? 87.329  94.705  85.289  1.00 32.87 ? 31  ALA I CA  1 
ATOM 7680  C C   . ALA I 1 31  ? 86.979  95.960  84.487  1.00 32.84 ? 31  ALA I C   1 
ATOM 7681  O O   . ALA I 1 31  ? 86.233  95.883  83.511  1.00 32.95 ? 31  ALA I O   1 
ATOM 7682  C CB  . ALA I 1 31  ? 86.384  94.556  86.470  1.00 32.90 ? 31  ALA I CB  1 
ATOM 7683  N N   . ASN I 1 32  ? 87.512  97.105  84.912  1.00 32.86 ? 32  ASN I N   1 
ATOM 7684  C CA  . ASN I 1 32  ? 87.353  98.370  84.182  1.00 32.92 ? 32  ASN I CA  1 
ATOM 7685  C C   . ASN I 1 32  ? 88.045  98.357  82.813  1.00 33.12 ? 32  ASN I C   1 
ATOM 7686  O O   . ASN I 1 32  ? 87.547  98.971  81.867  1.00 33.24 ? 32  ASN I O   1 
ATOM 7687  C CB  . ASN I 1 32  ? 87.882  99.552  85.012  1.00 32.83 ? 32  ASN I CB  1 
ATOM 7688  C CG  . ASN I 1 32  ? 87.006  99.877  86.215  1.00 32.76 ? 32  ASN I CG  1 
ATOM 7689  O OD1 . ASN I 1 32  ? 85.781  99.792  86.135  1.00 32.77 ? 32  ASN I OD1 1 
ATOM 7690  N ND2 . ASN I 1 32  ? 87.625  100.246 87.332  1.00 32.81 ? 32  ASN I ND2 1 
ATOM 7691  N N   . ASP I 1 33  ? 89.186  97.672  82.718  1.00 33.25 ? 33  ASP I N   1 
ATOM 7692  C CA  . ASP I 1 33  ? 89.877  97.476  81.434  1.00 33.42 ? 33  ASP I CA  1 
ATOM 7693  C C   . ASP I 1 33  ? 89.061  96.614  80.470  1.00 33.48 ? 33  ASP I C   1 
ATOM 7694  O O   . ASP I 1 33  ? 89.073  96.857  79.261  1.00 33.61 ? 33  ASP I O   1 
ATOM 7695  C CB  . ASP I 1 33  ? 91.256  96.834  81.640  1.00 33.64 ? 33  ASP I CB  1 
ATOM 7696  C CG  . ASP I 1 33  ? 92.233  97.738  82.379  1.00 33.90 ? 33  ASP I CG  1 
ATOM 7697  O OD1 . ASP I 1 33  ? 91.989  98.960  82.491  1.00 33.97 ? 33  ASP I OD1 1 
ATOM 7698  O OD2 . ASP I 1 33  ? 93.264  97.214  82.853  1.00 34.02 ? 33  ASP I OD2 1 
ATOM 7699  N N   . THR I 1 34  ? 88.369  95.610  81.008  1.00 33.41 ? 34  THR I N   1 
ATOM 7700  C CA  . THR I 1 34  ? 87.475  94.756  80.219  1.00 33.36 ? 34  THR I CA  1 
ATOM 7701  C C   . THR I 1 34  ? 86.300  95.542  79.625  1.00 33.33 ? 34  THR I C   1 
ATOM 7702  O O   . THR I 1 34  ? 85.875  95.257  78.507  1.00 33.44 ? 34  THR I O   1 
ATOM 7703  C CB  . THR I 1 34  ? 86.916  93.587  81.062  1.00 33.50 ? 34  THR I CB  1 
ATOM 7704  O OG1 . THR I 1 34  ? 87.979  92.973  81.800  1.00 33.50 ? 34  THR I OG1 1 
ATOM 7705  C CG2 . THR I 1 34  ? 86.244  92.537  80.176  1.00 33.60 ? 34  THR I CG2 1 
ATOM 7706  N N   . VAL I 1 35  ? 85.791  96.521  80.374  1.00 33.30 ? 35  VAL I N   1 
ATOM 7707  C CA  . VAL I 1 35  ? 84.710  97.400  79.903  1.00 33.32 ? 35  VAL I CA  1 
ATOM 7708  C C   . VAL I 1 35  ? 85.191  98.291  78.751  1.00 33.25 ? 35  VAL I C   1 
ATOM 7709  O O   . VAL I 1 35  ? 84.466  98.488  77.774  1.00 33.36 ? 35  VAL I O   1 
ATOM 7710  C CB  . VAL I 1 35  ? 84.137  98.274  81.052  1.00 33.52 ? 35  VAL I CB  1 
ATOM 7711  C CG1 . VAL I 1 35  ? 83.154  99.324  80.533  1.00 33.63 ? 35  VAL I CG1 1 
ATOM 7712  C CG2 . VAL I 1 35  ? 83.456  97.402  82.099  1.00 33.60 ? 35  VAL I CG2 1 
ATOM 7713  N N   . VAL I 1 36  ? 86.408  98.820  78.879  1.00 33.13 ? 36  VAL I N   1 
ATOM 7714  C CA  . VAL I 1 36  ? 87.014  99.664  77.842  1.00 33.03 ? 36  VAL I CA  1 
ATOM 7715  C C   . VAL I 1 36  ? 87.361  98.839  76.599  1.00 33.02 ? 36  VAL I C   1 
ATOM 7716  O O   . VAL I 1 36  ? 87.115  99.279  75.475  1.00 33.10 ? 36  VAL I O   1 
ATOM 7717  C CB  . VAL I 1 36  ? 88.277  100.396 78.366  1.00 33.02 ? 36  VAL I CB  1 
ATOM 7718  C CG1 . VAL I 1 36  ? 89.009  101.122 77.240  1.00 33.08 ? 36  VAL I CG1 1 
ATOM 7719  C CG2 . VAL I 1 36  ? 87.907  101.380 79.467  1.00 33.01 ? 36  VAL I CG2 1 
ATOM 7720  N N   . THR I 1 37  ? 87.937  97.656  76.812  1.00 33.06 ? 37  THR I N   1 
ATOM 7721  C CA  . THR I 1 37  ? 88.279  96.742  75.718  1.00 33.11 ? 37  THR I CA  1 
ATOM 7722  C C   . THR I 1 37  ? 87.033  96.232  74.987  1.00 33.10 ? 37  THR I C   1 
ATOM 7723  O O   . THR I 1 37  ? 87.042  96.121  73.761  1.00 33.26 ? 37  THR I O   1 
ATOM 7724  C CB  . THR I 1 37  ? 89.100  95.534  76.224  1.00 33.23 ? 37  THR I CB  1 
ATOM 7725  O OG1 . THR I 1 37  ? 90.229  95.998  76.974  1.00 33.31 ? 37  THR I OG1 1 
ATOM 7726  C CG2 . THR I 1 37  ? 89.591  94.668  75.059  1.00 33.28 ? 37  THR I CG2 1 
ATOM 7727  N N   . ALA I 1 38  ? 85.976  95.929  75.741  1.00 33.05 ? 38  ALA I N   1 
ATOM 7728  C CA  . ALA I 1 38  ? 84.705  95.476  75.162  1.00 33.10 ? 38  ALA I CA  1 
ATOM 7729  C C   . ALA I 1 38  ? 84.017  96.565  74.343  1.00 33.09 ? 38  ALA I C   1 
ATOM 7730  O O   . ALA I 1 38  ? 83.507  96.289  73.257  1.00 33.10 ? 38  ALA I O   1 
ATOM 7731  C CB  . ALA I 1 38  ? 83.767  94.975  76.253  1.00 33.16 ? 38  ALA I CB  1 
ATOM 7732  N N   . TYR I 1 39  ? 84.003  97.791  74.866  1.00 33.22 ? 39  TYR I N   1 
ATOM 7733  C CA  . TYR I 1 39  ? 83.377  98.926  74.176  1.00 33.27 ? 39  TYR I CA  1 
ATOM 7734  C C   . TYR I 1 39  ? 84.128  99.319  72.902  1.00 33.48 ? 39  TYR I C   1 
ATOM 7735  O O   . TYR I 1 39  ? 83.499  99.674  71.903  1.00 33.64 ? 39  TYR I O   1 
ATOM 7736  C CB  . TYR I 1 39  ? 83.252  100.139 75.102  1.00 33.19 ? 39  TYR I CB  1 
ATOM 7737  C CG  . TYR I 1 39  ? 82.319  101.202 74.563  1.00 33.27 ? 39  TYR I CG  1 
ATOM 7738  C CD1 . TYR I 1 39  ? 80.935  101.070 74.687  1.00 33.33 ? 39  TYR I CD1 1 
ATOM 7739  C CD2 . TYR I 1 39  ? 82.815  102.335 73.916  1.00 33.35 ? 39  TYR I CD2 1 
ATOM 7740  C CE1 . TYR I 1 39  ? 80.073  102.037 74.189  1.00 33.32 ? 39  TYR I CE1 1 
ATOM 7741  C CE2 . TYR I 1 39  ? 81.960  103.308 73.415  1.00 33.36 ? 39  TYR I CE2 1 
ATOM 7742  C CZ  . TYR I 1 39  ? 80.591  103.156 73.554  1.00 33.36 ? 39  TYR I CZ  1 
ATOM 7743  O OH  . TYR I 1 39  ? 79.742  104.118 73.059  1.00 33.46 ? 39  TYR I OH  1 
ATOM 7744  N N   . LEU I 1 40  ? 85.459  99.261  72.944  1.00 33.68 ? 40  LEU I N   1 
ATOM 7745  C CA  . LEU I 1 40  ? 86.286  99.466  71.747  1.00 33.88 ? 40  LEU I CA  1 
ATOM 7746  C C   . LEU I 1 40  ? 86.128  98.324  70.740  1.00 34.31 ? 40  LEU I C   1 
ATOM 7747  O O   . LEU I 1 40  ? 86.116  98.567  69.534  1.00 34.49 ? 40  LEU I O   1 
ATOM 7748  C CB  . LEU I 1 40  ? 87.764  99.634  72.113  1.00 33.80 ? 40  LEU I CB  1 
ATOM 7749  C CG  . LEU I 1 40  ? 88.147  100.950 72.795  1.00 33.73 ? 40  LEU I CG  1 
ATOM 7750  C CD1 . LEU I 1 40  ? 89.538  100.838 73.393  1.00 33.66 ? 40  LEU I CD1 1 
ATOM 7751  C CD2 . LEU I 1 40  ? 88.080  102.122 71.826  1.00 33.70 ? 40  LEU I CD2 1 
ATOM 7752  N N   . ASN I 1 41  ? 86.014  97.092  71.238  1.00 34.79 ? 41  ASN I N   1 
ATOM 7753  C CA  . ASN I 1 41  ? 85.739  95.926  70.387  1.00 35.15 ? 41  ASN I CA  1 
ATOM 7754  C C   . ASN I 1 41  ? 84.372  96.045  69.705  1.00 35.40 ? 41  ASN I C   1 
ATOM 7755  O O   . ASN I 1 41  ? 84.228  95.674  68.539  1.00 35.49 ? 41  ASN I O   1 
ATOM 7756  C CB  . ASN I 1 41  ? 85.816  94.627  71.201  1.00 35.34 ? 41  ASN I CB  1 
ATOM 7757  C CG  . ASN I 1 41  ? 85.698  93.380  70.339  1.00 35.61 ? 41  ASN I CG  1 
ATOM 7758  O OD1 . ASN I 1 41  ? 86.316  93.279  69.278  1.00 35.79 ? 41  ASN I OD1 1 
ATOM 7759  N ND2 . ASN I 1 41  ? 84.906  92.417  70.799  1.00 35.71 ? 41  ASN I ND2 1 
ATOM 7760  N N   . ASP I 1 42  ? 83.381  96.560  70.435  1.00 35.76 ? 42  ASP I N   1 
ATOM 7761  C CA  . ASP I 1 42  ? 82.066  96.876  69.862  1.00 36.04 ? 42  ASP I CA  1 
ATOM 7762  C C   . ASP I 1 42  ? 82.140  98.065  68.901  1.00 36.01 ? 42  ASP I C   1 
ATOM 7763  O O   . ASP I 1 42  ? 81.501  98.049  67.850  1.00 36.17 ? 42  ASP I O   1 
ATOM 7764  C CB  . ASP I 1 42  ? 81.035  97.166  70.964  1.00 36.32 ? 42  ASP I CB  1 
ATOM 7765  C CG  . ASP I 1 42  ? 80.697  95.938  71.802  1.00 36.66 ? 42  ASP I CG  1 
ATOM 7766  O OD1 . ASP I 1 42  ? 80.608  94.821  71.244  1.00 36.82 ? 42  ASP I OD1 1 
ATOM 7767  O OD2 . ASP I 1 42  ? 80.508  96.093  73.027  1.00 36.78 ? 42  ASP I OD2 1 
ATOM 7768  N N   . ALA I 1 43  ? 82.914  99.087  69.267  1.00 35.92 ? 43  ALA I N   1 
ATOM 7769  C CA  . ALA I 1 43  ? 83.110  100.273 68.421  1.00 35.94 ? 43  ALA I CA  1 
ATOM 7770  C C   . ALA I 1 43  ? 83.736  99.939  67.065  1.00 36.00 ? 43  ALA I C   1 
ATOM 7771  O O   . ALA I 1 43  ? 83.379  100.544 66.057  1.00 36.16 ? 43  ALA I O   1 
ATOM 7772  C CB  . ALA I 1 43  ? 83.957  101.310 69.146  1.00 35.95 ? 43  ALA I CB  1 
ATOM 7773  N N   . VAL I 1 44  ? 84.666  98.984  67.053  1.00 36.18 ? 44  VAL I N   1 
ATOM 7774  C CA  . VAL I 1 44  ? 85.292  98.501  65.812  1.00 36.35 ? 44  VAL I CA  1 
ATOM 7775  C C   . VAL I 1 44  ? 84.271  97.816  64.889  1.00 36.53 ? 44  VAL I C   1 
ATOM 7776  O O   . VAL I 1 44  ? 84.350  97.963  63.668  1.00 36.62 ? 44  VAL I O   1 
ATOM 7777  C CB  . VAL I 1 44  ? 86.492  97.557  66.114  1.00 36.45 ? 44  VAL I CB  1 
ATOM 7778  C CG1 . VAL I 1 44  ? 86.984  96.832  64.863  1.00 36.57 ? 44  VAL I CG1 1 
ATOM 7779  C CG2 . VAL I 1 44  ? 87.639  98.338  66.755  1.00 36.45 ? 44  VAL I CG2 1 
ATOM 7780  N N   . LYS I 1 45  ? 83.323  97.079  65.471  1.00 36.84 ? 45  LYS I N   1 
ATOM 7781  C CA  . LYS I 1 45  ? 82.278  96.395  64.695  1.00 37.12 ? 45  LYS I CA  1 
ATOM 7782  C C   . LYS I 1 45  ? 81.346  97.380  63.990  1.00 37.00 ? 45  LYS I C   1 
ATOM 7783  O O   . LYS I 1 45  ? 81.100  97.249  62.791  1.00 37.15 ? 45  LYS I O   1 
ATOM 7784  C CB  . LYS I 1 45  ? 81.460  95.448  65.583  1.00 37.49 ? 45  LYS I CB  1 
ATOM 7785  C CG  . LYS I 1 45  ? 82.245  94.250  66.100  1.00 37.82 ? 45  LYS I CG  1 
ATOM 7786  C CD  . LYS I 1 45  ? 81.536  93.564  67.258  1.00 38.10 ? 45  LYS I CD  1 
ATOM 7787  C CE  . LYS I 1 45  ? 82.405  92.478  67.874  1.00 38.33 ? 45  LYS I CE  1 
ATOM 7788  N NZ  . LYS I 1 45  ? 81.793  91.879  69.092  1.00 38.49 ? 45  LYS I NZ  1 
ATOM 7789  N N   . PHE I 1 46  ? 80.842  98.362  64.733  1.00 36.90 ? 46  PHE I N   1 
ATOM 7790  C CA  . PHE I 1 46  ? 79.945  99.381  64.168  1.00 36.84 ? 46  PHE I CA  1 
ATOM 7791  C C   . PHE I 1 46  ? 80.644  100.388 63.244  1.00 36.81 ? 46  PHE I C   1 
ATOM 7792  O O   . PHE I 1 46  ? 79.974  101.072 62.467  1.00 36.96 ? 46  PHE I O   1 
ATOM 7793  C CB  . PHE I 1 46  ? 79.165  100.100 65.275  1.00 36.83 ? 46  PHE I CB  1 
ATOM 7794  C CG  . PHE I 1 46  ? 78.069  99.264  65.870  1.00 36.90 ? 46  PHE I CG  1 
ATOM 7795  C CD1 . PHE I 1 46  ? 76.859  99.112  65.202  1.00 37.06 ? 46  PHE I CD1 1 
ATOM 7796  C CD2 . PHE I 1 46  ? 78.247  98.609  67.084  1.00 36.99 ? 46  PHE I CD2 1 
ATOM 7797  C CE1 . PHE I 1 46  ? 75.844  98.332  65.736  1.00 37.14 ? 46  PHE I CE1 1 
ATOM 7798  C CE2 . PHE I 1 46  ? 77.234  97.830  67.627  1.00 37.16 ? 46  PHE I CE2 1 
ATOM 7799  C CZ  . PHE I 1 46  ? 76.031  97.689  66.951  1.00 37.19 ? 46  PHE I CZ  1 
ATOM 7800  N N   . GLN I 1 47  ? 81.973  100.485 63.331  1.00 36.77 ? 47  GLN I N   1 
ATOM 7801  C CA  . GLN I 1 47  ? 82.766  101.214 62.331  1.00 36.82 ? 47  GLN I CA  1 
ATOM 7802  C C   . GLN I 1 47  ? 82.763  100.480 60.986  1.00 37.07 ? 47  GLN I C   1 
ATOM 7803  O O   . GLN I 1 47  ? 82.666  101.116 59.935  1.00 37.28 ? 47  GLN I O   1 
ATOM 7804  C CB  . GLN I 1 47  ? 84.209  101.434 62.807  1.00 36.79 ? 47  GLN I CB  1 
ATOM 7805  C CG  . GLN I 1 47  ? 84.369  102.554 63.827  1.00 36.85 ? 47  GLN I CG  1 
ATOM 7806  C CD  . GLN I 1 47  ? 84.511  103.930 63.197  1.00 36.98 ? 47  GLN I CD  1 
ATOM 7807  O OE1 . GLN I 1 47  ? 83.897  104.227 62.171  1.00 37.07 ? 47  GLN I OE1 1 
ATOM 7808  N NE2 . GLN I 1 47  ? 85.319  104.781 63.818  1.00 37.07 ? 47  GLN I NE2 1 
ATOM 7809  N N   . GLU I 1 48  ? 82.876  99.152  61.028  1.00 37.41 ? 48  GLU I N   1 
ATOM 7810  C CA  . GLU I 1 48  ? 82.786  98.315  59.823  1.00 37.74 ? 48  GLU I CA  1 
ATOM 7811  C C   . GLU I 1 48  ? 81.376  98.294  59.223  1.00 37.83 ? 48  GLU I C   1 
ATOM 7812  O O   . GLU I 1 48  ? 81.227  98.171  58.008  1.00 38.01 ? 48  GLU I O   1 
ATOM 7813  C CB  . GLU I 1 48  ? 83.249  96.879  60.110  1.00 38.07 ? 48  GLU I CB  1 
ATOM 7814  C CG  . GLU I 1 48  ? 84.729  96.743  60.450  1.00 38.39 ? 48  GLU I CG  1 
ATOM 7815  C CD  . GLU I 1 48  ? 85.649  96.968  59.259  1.00 38.68 ? 48  GLU I CD  1 
ATOM 7816  O OE1 . GLU I 1 48  ? 85.395  96.394  58.177  1.00 38.76 ? 48  GLU I OE1 1 
ATOM 7817  O OE2 . GLU I 1 48  ? 86.642  97.715  59.407  1.00 38.77 ? 48  GLU I OE2 1 
ATOM 7818  N N   . MET I 1 49  ? 80.351  98.400  60.070  1.00 37.94 ? 49  MET I N   1 
ATOM 7819  C CA  . MET I 1 49  ? 78.959  98.491  59.602  1.00 38.06 ? 49  MET I CA  1 
ATOM 7820  C C   . MET I 1 49  ? 78.659  99.822  58.908  1.00 37.98 ? 49  MET I C   1 
ATOM 7821  O O   . MET I 1 49  ? 77.887  99.857  57.949  1.00 38.26 ? 49  MET I O   1 
ATOM 7822  C CB  . MET I 1 49  ? 77.978  98.270  60.756  1.00 38.24 ? 49  MET I CB  1 
ATOM 7823  C CG  . MET I 1 49  ? 77.957  96.837  61.260  1.00 38.47 ? 49  MET I CG  1 
ATOM 7824  S SD  . MET I 1 49  ? 76.935  96.593  62.724  1.00 38.86 ? 49  MET I SD  1 
ATOM 7825  C CE  . MET I 1 49  ? 75.319  97.023  62.085  1.00 38.96 ? 49  MET I CE  1 
ATOM 7826  N N   . TYR I 1 50  ? 79.261  100.905 59.396  1.00 37.79 ? 50  TYR I N   1 
ATOM 7827  C CA  . TYR I 1 50  ? 79.165  102.214 58.740  1.00 37.80 ? 50  TYR I CA  1 
ATOM 7828  C C   . TYR I 1 50  ? 79.949  102.241 57.421  1.00 38.04 ? 50  TYR I C   1 
ATOM 7829  O O   . TYR I 1 50  ? 79.563  102.944 56.483  1.00 38.25 ? 50  TYR I O   1 
ATOM 7830  C CB  . TYR I 1 50  ? 79.665  103.322 59.670  1.00 37.76 ? 50  TYR I CB  1 
ATOM 7831  C CG  . TYR I 1 50  ? 79.239  104.715 59.259  1.00 37.79 ? 50  TYR I CG  1 
ATOM 7832  C CD1 . TYR I 1 50  ? 80.021  105.482 58.396  1.00 37.66 ? 50  TYR I CD1 1 
ATOM 7833  C CD2 . TYR I 1 50  ? 78.061  105.277 59.751  1.00 37.87 ? 50  TYR I CD2 1 
ATOM 7834  C CE1 . TYR I 1 50  ? 79.638  106.763 58.026  1.00 37.67 ? 50  TYR I CE1 1 
ATOM 7835  C CE2 . TYR I 1 50  ? 77.668  106.558 59.386  1.00 37.85 ? 50  TYR I CE2 1 
ATOM 7836  C CZ  . TYR I 1 50  ? 78.460  107.297 58.524  1.00 37.80 ? 50  TYR I CZ  1 
ATOM 7837  O OH  . TYR I 1 50  ? 78.075  108.567 58.157  1.00 37.98 ? 50  TYR I OH  1 
ATOM 7838  N N   . GLN I 1 51  ? 81.047  101.488 57.365  1.00 38.31 ? 51  GLN I N   1 
ATOM 7839  C CA  . GLN I 1 51  ? 81.835  101.314 56.137  1.00 38.55 ? 51  GLN I CA  1 
ATOM 7840  C C   . GLN I 1 51  ? 81.044  100.599 55.031  1.00 38.78 ? 51  GLN I C   1 
ATOM 7841  O O   . GLN I 1 51  ? 81.253  100.872 53.848  1.00 38.94 ? 51  GLN I O   1 
ATOM 7842  C CB  . GLN I 1 51  ? 83.132  100.547 56.444  1.00 38.73 ? 51  GLN I CB  1 
ATOM 7843  C CG  . GLN I 1 51  ? 84.151  100.474 55.312  1.00 38.88 ? 51  GLN I CG  1 
ATOM 7844  C CD  . GLN I 1 51  ? 84.777  101.814 54.974  1.00 38.88 ? 51  GLN I CD  1 
ATOM 7845  O OE1 . GLN I 1 51  ? 85.202  102.555 55.858  1.00 38.93 ? 51  GLN I OE1 1 
ATOM 7846  N NE2 . GLN I 1 51  ? 84.857  102.120 53.685  1.00 38.97 ? 51  GLN I NE2 1 
ATOM 7847  N N   . ILE I 1 52  ? 80.152  99.684  55.416  1.00 38.96 ? 52  ILE I N   1 
ATOM 7848  C CA  . ILE I 1 52  ? 79.252  99.013  54.466  1.00 39.19 ? 52  ILE I CA  1 
ATOM 7849  C C   . ILE I 1 52  ? 78.243  100.004 53.870  1.00 39.35 ? 52  ILE I C   1 
ATOM 7850  O O   . ILE I 1 52  ? 77.987  99.978  52.664  1.00 39.50 ? 52  ILE I O   1 
ATOM 7851  C CB  . ILE I 1 52  ? 78.516  97.814  55.122  1.00 39.24 ? 52  ILE I CB  1 
ATOM 7852  C CG1 . ILE I 1 52  ? 79.517  96.704  55.472  1.00 39.33 ? 52  ILE I CG1 1 
ATOM 7853  C CG2 . ILE I 1 52  ? 77.431  97.247  54.204  1.00 39.29 ? 52  ILE I CG2 1 
ATOM 7854  C CD1 . ILE I 1 52  ? 79.044  95.750  56.550  1.00 39.33 ? 52  ILE I CD1 1 
ATOM 7855  N N   . ASP I 1 53  ? 77.689  100.875 54.713  1.00 39.54 ? 53  ASP I N   1 
ATOM 7856  C CA  . ASP I 1 53  ? 76.666  101.834 54.288  1.00 39.77 ? 53  ASP I CA  1 
ATOM 7857  C C   . ASP I 1 53  ? 77.252  103.005 53.501  1.00 39.75 ? 53  ASP I C   1 
ATOM 7858  O O   . ASP I 1 53  ? 76.895  103.218 52.340  1.00 39.95 ? 53  ASP I O   1 
ATOM 7859  C CB  . ASP I 1 53  ? 75.892  102.368 55.500  1.00 40.03 ? 53  ASP I CB  1 
ATOM 7860  C CG  . ASP I 1 53  ? 75.117  101.283 56.231  1.00 40.34 ? 53  ASP I CG  1 
ATOM 7861  O OD1 . ASP I 1 53  ? 75.393  100.085 56.006  1.00 40.49 ? 53  ASP I OD1 1 
ATOM 7862  O OD2 . ASP I 1 53  ? 74.230  101.631 57.040  1.00 40.58 ? 53  ASP I OD2 1 
ATOM 7863  N N   . ASN I 1 54  ? 78.159  103.746 54.137  1.00 39.52 ? 54  ASN I N   1 
ATOM 7864  C CA  . ASN I 1 54  ? 78.646  105.031 53.616  1.00 39.56 ? 54  ASN I CA  1 
ATOM 7865  C C   . ASN I 1 54  ? 79.983  104.985 52.861  1.00 39.43 ? 54  ASN I C   1 
ATOM 7866  O O   . ASN I 1 54  ? 80.361  105.982 52.242  1.00 39.61 ? 54  ASN I O   1 
ATOM 7867  C CB  . ASN I 1 54  ? 78.759  106.041 54.764  1.00 39.76 ? 54  ASN I CB  1 
ATOM 7868  C CG  . ASN I 1 54  ? 77.421  106.349 55.410  1.00 39.96 ? 54  ASN I CG  1 
ATOM 7869  O OD1 . ASN I 1 54  ? 76.815  107.386 55.142  1.00 40.17 ? 54  ASN I OD1 1 
ATOM 7870  N ND2 . ASN I 1 54  ? 76.954  105.447 56.266  1.00 40.00 ? 54  ASN I ND2 1 
ATOM 7871  N N   . ASN I 1 55  ? 80.687  103.850 52.912  1.00 39.07 ? 55  ASN I N   1 
ATOM 7872  C CA  . ASN I 1 55  ? 82.035  103.702 52.328  1.00 38.83 ? 55  ASN I CA  1 
ATOM 7873  C C   . ASN I 1 55  ? 83.052  104.670 52.953  1.00 38.56 ? 55  ASN I C   1 
ATOM 7874  O O   . ASN I 1 55  ? 83.873  105.270 52.254  1.00 38.71 ? 55  ASN I O   1 
ATOM 7875  C CB  . ASN I 1 55  ? 82.004  103.844 50.796  1.00 39.00 ? 55  ASN I CB  1 
ATOM 7876  C CG  . ASN I 1 55  ? 80.938  102.979 50.144  1.00 39.27 ? 55  ASN I CG  1 
ATOM 7877  O OD1 . ASN I 1 55  ? 80.201  103.438 49.272  1.00 39.50 ? 55  ASN I OD1 1 
ATOM 7878  N ND2 . ASN I 1 55  ? 80.852  101.720 50.565  1.00 39.40 ? 55  ASN I ND2 1 
ATOM 7879  N N   . SER I 1 56  ? 82.987  104.804 54.277  1.00 38.22 ? 56  SER I N   1 
ATOM 7880  C CA  . SER I 1 56  ? 83.905  105.655 55.043  1.00 37.99 ? 56  SER I CA  1 
ATOM 7881  C C   . SER I 1 56  ? 83.842  105.297 56.530  1.00 37.53 ? 56  SER I C   1 
ATOM 7882  O O   . SER I 1 56  ? 83.071  104.421 56.927  1.00 37.69 ? 56  SER I O   1 
ATOM 7883  C CB  . SER I 1 56  ? 83.552  107.134 54.848  1.00 38.25 ? 56  SER I CB  1 
ATOM 7884  O OG  . SER I 1 56  ? 84.510  107.976 55.468  1.00 38.43 ? 56  SER I OG  1 
ATOM 7885  N N   . TYR I 1 57  ? 84.668  105.961 57.338  1.00 36.99 ? 57  TYR I N   1 
ATOM 7886  C CA  . TYR I 1 57  ? 84.654  105.796 58.796  1.00 36.72 ? 57  TYR I CA  1 
ATOM 7887  C C   . TYR I 1 57  ? 84.168  107.074 59.482  1.00 36.67 ? 57  TYR I C   1 
ATOM 7888  O O   . TYR I 1 57  ? 84.366  108.180 58.974  1.00 36.63 ? 57  TYR I O   1 
ATOM 7889  C CB  . TYR I 1 57  ? 86.041  105.407 59.309  1.00 36.60 ? 57  TYR I CB  1 
ATOM 7890  C CG  . TYR I 1 57  ? 86.458  104.000 58.935  1.00 36.53 ? 57  TYR I CG  1 
ATOM 7891  C CD1 . TYR I 1 57  ? 85.847  102.892 59.524  1.00 36.47 ? 57  TYR I CD1 1 
ATOM 7892  C CD2 . TYR I 1 57  ? 87.468  103.770 57.999  1.00 36.51 ? 57  TYR I CD2 1 
ATOM 7893  C CE1 . TYR I 1 57  ? 86.224  101.598 59.189  1.00 36.34 ? 57  TYR I CE1 1 
ATOM 7894  C CE2 . TYR I 1 57  ? 87.853  102.480 57.658  1.00 36.42 ? 57  TYR I CE2 1 
ATOM 7895  C CZ  . TYR I 1 57  ? 87.229  101.398 58.255  1.00 36.34 ? 57  TYR I CZ  1 
ATOM 7896  O OH  . TYR I 1 57  ? 87.605  100.118 57.922  1.00 36.45 ? 57  TYR I OH  1 
ATOM 7897  N N   . THR I 1 58  ? 83.540  106.902 60.644  1.00 36.59 ? 58  THR I N   1 
ATOM 7898  C CA  . THR I 1 58  ? 82.880  107.993 61.359  1.00 36.53 ? 58  THR I CA  1 
ATOM 7899  C C   . THR I 1 58  ? 83.840  108.767 62.253  1.00 36.66 ? 58  THR I C   1 
ATOM 7900  O O   . THR I 1 58  ? 84.613  108.169 63.003  1.00 36.84 ? 58  THR I O   1 
ATOM 7901  C CB  . THR I 1 58  ? 81.750  107.461 62.258  1.00 36.65 ? 58  THR I CB  1 
ATOM 7902  O OG1 . THR I 1 58  ? 82.275  106.482 63.164  1.00 36.58 ? 58  THR I OG1 1 
ATOM 7903  C CG2 . THR I 1 58  ? 80.664  106.828 61.422  1.00 36.74 ? 58  THR I CG2 1 
ATOM 7904  N N   . SER I 1 59  ? 83.770  110.095 62.175  1.00 36.78 ? 59  SER I N   1 
ATOM 7905  C CA  . SER I 1 59  ? 84.466  110.973 63.113  1.00 36.85 ? 59  SER I CA  1 
ATOM 7906  C C   . SER I 1 59  ? 83.637  111.132 64.389  1.00 36.82 ? 59  SER I C   1 
ATOM 7907  O O   . SER I 1 59  ? 84.178  111.053 65.491  1.00 36.81 ? 59  SER I O   1 
ATOM 7908  C CB  . SER I 1 59  ? 84.722  112.342 62.477  1.00 37.11 ? 59  SER I CB  1 
ATOM 7909  O OG  . SER I 1 59  ? 85.571  113.134 63.292  1.00 37.24 ? 59  SER I OG  1 
ATOM 7910  N N   . ASN I 1 60  ? 82.332  111.357 64.229  1.00 36.97 ? 60  ASN I N   1 
ATOM 7911  C CA  . ASN I 1 60  ? 81.414  111.529 65.368  1.00 37.22 ? 60  ASN I CA  1 
ATOM 7912  C C   . ASN I 1 60  ? 80.930  110.191 65.943  1.00 37.20 ? 60  ASN I C   1 
ATOM 7913  O O   . ASN I 1 60  ? 80.835  109.192 65.226  1.00 37.13 ? 60  ASN I O   1 
ATOM 7914  C CB  . ASN I 1 60  ? 80.213  112.413 64.984  1.00 37.35 ? 60  ASN I CB  1 
ATOM 7915  C CG  . ASN I 1 60  ? 79.266  111.743 63.999  1.00 37.43 ? 60  ASN I CG  1 
ATOM 7916  O OD1 . ASN I 1 60  ? 79.691  111.002 63.111  1.00 37.43 ? 60  ASN I OD1 1 
ATOM 7917  N ND2 . ASN I 1 60  ? 77.975  112.014 64.148  1.00 37.57 ? 60  ASN I ND2 1 
ATOM 7918  N N   . GLN I 1 61  ? 80.622  110.196 67.239  1.00 37.16 ? 61  GLN I N   1 
ATOM 7919  C CA  . GLN I 1 61  ? 80.141  109.007 67.948  1.00 37.02 ? 61  GLN I CA  1 
ATOM 7920  C C   . GLN I 1 61  ? 78.662  108.726 67.671  1.00 36.99 ? 61  GLN I C   1 
ATOM 7921  O O   . GLN I 1 61  ? 78.255  107.564 67.617  1.00 37.14 ? 61  GLN I O   1 
ATOM 7922  C CB  . GLN I 1 61  ? 80.360  109.163 69.456  1.00 37.12 ? 61  GLN I CB  1 
ATOM 7923  C CG  . GLN I 1 61  ? 80.226  107.868 70.249  1.00 37.21 ? 61  GLN I CG  1 
ATOM 7924  C CD  . GLN I 1 61  ? 80.285  108.081 71.750  1.00 37.24 ? 61  GLN I CD  1 
ATOM 7925  O OE1 . GLN I 1 61  ? 80.865  109.054 72.236  1.00 37.27 ? 61  GLN I OE1 1 
ATOM 7926  N NE2 . GLN I 1 61  ? 79.688  107.160 72.497  1.00 37.32 ? 61  GLN I NE2 1 
ATOM 7927  N N   . ALA I 1 62  ? 77.866  109.787 67.511  1.00 36.96 ? 62  ALA I N   1 
ATOM 7928  C CA  . ALA I 1 62  ? 76.419  109.673 67.264  1.00 36.85 ? 62  ALA I CA  1 
ATOM 7929  C C   . ALA I 1 62  ? 76.053  108.850 66.023  1.00 36.78 ? 62  ALA I C   1 
ATOM 7930  O O   . ALA I 1 62  ? 74.987  108.233 65.984  1.00 36.92 ? 62  ALA I O   1 
ATOM 7931  C CB  . ALA I 1 62  ? 75.791  111.057 67.170  1.00 36.91 ? 62  ALA I CB  1 
ATOM 7932  N N   . ALA I 1 63  ? 76.929  108.853 65.018  1.00 36.84 ? 63  ALA I N   1 
ATOM 7933  C CA  . ALA I 1 63  ? 76.763  108.013 63.827  1.00 36.91 ? 63  ALA I CA  1 
ATOM 7934  C C   . ALA I 1 63  ? 76.854  106.523 64.161  1.00 36.82 ? 63  ALA I C   1 
ATOM 7935  O O   . ALA I 1 63  ? 76.064  105.727 63.653  1.00 36.91 ? 63  ALA I O   1 
ATOM 7936  C CB  . ALA I 1 63  ? 77.794  108.379 62.769  1.00 37.01 ? 63  ALA I CB  1 
ATOM 7937  N N   . LEU I 1 64  ? 77.812  106.157 65.013  1.00 36.89 ? 64  LEU I N   1 
ATOM 7938  C CA  . LEU I 1 64  ? 77.971  104.768 65.468  1.00 37.01 ? 64  LEU I CA  1 
ATOM 7939  C C   . LEU I 1 64  ? 76.824  104.315 66.376  1.00 37.02 ? 64  LEU I C   1 
ATOM 7940  O O   . LEU I 1 64  ? 76.414  103.154 66.321  1.00 37.07 ? 64  LEU I O   1 
ATOM 7941  C CB  . LEU I 1 64  ? 79.304  104.580 66.203  1.00 37.12 ? 64  LEU I CB  1 
ATOM 7942  C CG  . LEU I 1 64  ? 80.589  104.848 65.413  1.00 37.29 ? 64  LEU I CG  1 
ATOM 7943  C CD1 . LEU I 1 64  ? 81.799  104.777 66.332  1.00 37.40 ? 64  LEU I CD1 1 
ATOM 7944  C CD2 . LEU I 1 64  ? 80.737  103.872 64.255  1.00 37.32 ? 64  LEU I CD2 1 
ATOM 7945  N N   . ILE I 1 65  ? 76.318  105.231 67.204  1.00 37.10 ? 65  ILE I N   1 
ATOM 7946  C CA  . ILE I 1 65  ? 75.204  104.940 68.119  1.00 37.16 ? 65  ILE I CA  1 
ATOM 7947  C C   . ILE I 1 65  ? 73.891  104.738 67.348  1.00 37.20 ? 65  ILE I C   1 
ATOM 7948  O O   . ILE I 1 65  ? 73.079  103.888 67.722  1.00 37.29 ? 65  ILE I O   1 
ATOM 7949  C CB  . ILE I 1 65  ? 75.039  106.043 69.199  1.00 37.23 ? 65  ILE I CB  1 
ATOM 7950  C CG1 . ILE I 1 65  ? 76.291  106.119 70.088  1.00 37.33 ? 65  ILE I CG1 1 
ATOM 7951  C CG2 . ILE I 1 65  ? 73.811  105.787 70.074  1.00 37.26 ? 65  ILE I CG2 1 
ATOM 7952  C CD1 . ILE I 1 65  ? 76.405  107.395 70.897  1.00 37.48 ? 65  ILE I CD1 1 
ATOM 7953  N N   . SER I 1 66  ? 73.693  105.514 66.282  1.00 37.26 ? 66  SER I N   1 
ATOM 7954  C CA  . SER I 1 66  ? 72.503  105.392 65.428  1.00 37.39 ? 66  SER I CA  1 
ATOM 7955  C C   . SER I 1 66  ? 72.395  104.025 64.740  1.00 37.52 ? 66  SER I C   1 
ATOM 7956  O O   . SER I 1 66  ? 71.292  103.499 64.579  1.00 37.55 ? 66  SER I O   1 
ATOM 7957  C CB  . SER I 1 66  ? 72.482  106.505 64.374  1.00 37.37 ? 66  SER I CB  1 
ATOM 7958  O OG  . SER I 1 66  ? 71.257  106.517 63.661  1.00 37.36 ? 66  SER I OG  1 
ATOM 7959  N N   . LEU I 1 67  ? 73.536  103.464 64.337  1.00 37.78 ? 67  LEU I N   1 
ATOM 7960  C CA  . LEU I 1 67  ? 73.580  102.122 63.731  1.00 38.04 ? 67  LEU I CA  1 
ATOM 7961  C C   . LEU I 1 67  ? 73.216  100.993 64.705  1.00 38.13 ? 67  LEU I C   1 
ATOM 7962  O O   . LEU I 1 67  ? 72.652  99.981  64.283  1.00 38.34 ? 67  LEU I O   1 
ATOM 7963  C CB  . LEU I 1 67  ? 74.951  101.839 63.088  1.00 38.16 ? 67  LEU I CB  1 
ATOM 7964  C CG  . LEU I 1 67  ? 75.079  102.164 61.596  1.00 38.40 ? 67  LEU I CG  1 
ATOM 7965  C CD1 . LEU I 1 67  ? 74.913  103.649 61.304  1.00 38.45 ? 67  LEU I CD1 1 
ATOM 7966  C CD2 . LEU I 1 67  ? 76.417  101.670 61.071  1.00 38.59 ? 67  LEU I CD2 1 
ATOM 7967  N N   . GLY I 1 68  ? 73.529  101.168 65.991  1.00 37.98 ? 68  GLY I N   1 
ATOM 7968  C CA  . GLY I 1 68  ? 73.261  100.136 67.003  1.00 37.88 ? 68  GLY I CA  1 
ATOM 7969  C C   . GLY I 1 68  ? 74.130  100.121 68.252  1.00 37.72 ? 68  GLY I C   1 
ATOM 7970  O O   . GLY I 1 68  ? 73.726  99.543  69.263  1.00 37.88 ? 68  GLY I O   1 
ATOM 7971  N N   . LEU I 1 69  ? 75.325  100.719 68.190  1.00 37.46 ? 69  LEU I N   1 
ATOM 7972  C CA  . LEU I 1 69  ? 76.234  100.797 69.346  1.00 37.38 ? 69  LEU I CA  1 
ATOM 7973  C C   . LEU I 1 69  ? 75.571  101.450 70.561  1.00 37.38 ? 69  LEU I C   1 
ATOM 7974  O O   . LEU I 1 69  ? 74.746  102.356 70.418  1.00 37.44 ? 69  LEU I O   1 
ATOM 7975  C CB  . LEU I 1 69  ? 77.506  101.577 68.983  1.00 37.38 ? 69  LEU I CB  1 
ATOM 7976  C CG  . LEU I 1 69  ? 78.648  101.653 70.006  1.00 37.33 ? 69  LEU I CG  1 
ATOM 7977  C CD1 . LEU I 1 69  ? 79.253  100.285 70.285  1.00 37.36 ? 69  LEU I CD1 1 
ATOM 7978  C CD2 . LEU I 1 69  ? 79.723  102.612 69.519  1.00 37.37 ? 69  LEU I CD2 1 
ATOM 7979  N N   . LYS I 1 70  ? 75.941  100.982 71.752  1.00 37.37 ? 70  LYS I N   1 
ATOM 7980  C CA  . LYS I 1 70  ? 75.398  101.511 73.005  1.00 37.30 ? 70  LYS I CA  1 
ATOM 7981  C C   . LYS I 1 70  ? 75.992  102.879 73.329  1.00 37.09 ? 70  LYS I C   1 
ATOM 7982  O O   . LYS I 1 70  ? 76.972  103.308 72.713  1.00 37.05 ? 70  LYS I O   1 
ATOM 7983  C CB  . LYS I 1 70  ? 75.678  100.550 74.166  1.00 37.51 ? 70  LYS I CB  1 
ATOM 7984  C CG  . LYS I 1 70  ? 75.042  99.178  74.015  1.00 37.82 ? 70  LYS I CG  1 
ATOM 7985  C CD  . LYS I 1 70  ? 75.210  98.355  75.284  1.00 38.07 ? 70  LYS I CD  1 
ATOM 7986  C CE  . LYS I 1 70  ? 74.548  96.990  75.167  1.00 38.26 ? 70  LYS I CE  1 
ATOM 7987  N NZ  . LYS I 1 70  ? 75.207  96.116  74.154  1.00 38.34 ? 70  LYS I NZ  1 
ATOM 7988  N N   . SER I 1 71  ? 75.388  103.557 74.304  1.00 36.84 ? 71  SER I N   1 
ATOM 7989  C CA  . SER I 1 71  ? 75.920  104.821 74.820  1.00 36.56 ? 71  SER I CA  1 
ATOM 7990  C C   . SER I 1 71  ? 77.227  104.573 75.569  1.00 36.24 ? 71  SER I C   1 
ATOM 7991  O O   . SER I 1 71  ? 77.510  103.442 75.979  1.00 36.23 ? 71  SER I O   1 
ATOM 7992  C CB  . SER I 1 71  ? 74.906  105.493 75.749  1.00 36.59 ? 71  SER I CB  1 
ATOM 7993  O OG  . SER I 1 71  ? 73.688  105.753 75.074  1.00 36.60 ? 71  SER I OG  1 
ATOM 7994  N N   . THR I 1 72  ? 78.020  105.630 75.741  1.00 35.94 ? 72  THR I N   1 
ATOM 7995  C CA  . THR I 1 72  ? 79.315  105.531 76.419  1.00 35.78 ? 72  THR I CA  1 
ATOM 7996  C C   . THR I 1 72  ? 79.118  105.008 77.850  1.00 35.65 ? 72  THR I C   1 
ATOM 7997  O O   . THR I 1 72  ? 78.215  105.481 78.546  1.00 35.81 ? 72  THR I O   1 
ATOM 7998  C CB  . THR I 1 72  ? 80.033  106.895 76.475  1.00 35.87 ? 72  THR I CB  1 
ATOM 7999  O OG1 . THR I 1 72  ? 80.038  107.492 75.173  1.00 35.93 ? 72  THR I OG1 1 
ATOM 8000  C CG2 . THR I 1 72  ? 81.473  106.736 76.960  1.00 35.94 ? 72  THR I CG2 1 
ATOM 8001  N N   . PRO I 1 73  ? 79.943  104.029 78.291  1.00 35.35 ? 73  PRO I N   1 
ATOM 8002  C CA  . PRO I 1 73  ? 79.735  103.474 79.639  1.00 35.35 ? 73  PRO I CA  1 
ATOM 8003  C C   . PRO I 1 73  ? 80.052  104.455 80.771  1.00 35.42 ? 73  PRO I C   1 
ATOM 8004  O O   . PRO I 1 73  ? 80.684  105.489 80.543  1.00 35.51 ? 73  PRO I O   1 
ATOM 8005  C CB  . PRO I 1 73  ? 80.693  102.272 79.692  1.00 35.35 ? 73  PRO I CB  1 
ATOM 8006  C CG  . PRO I 1 73  ? 81.151  102.045 78.295  1.00 35.32 ? 73  PRO I CG  1 
ATOM 8007  C CD  . PRO I 1 73  ? 81.071  103.368 77.609  1.00 35.28 ? 73  PRO I CD  1 
ATOM 8008  N N   . ALA I 1 74  ? 79.606  104.114 81.978  1.00 35.52 ? 74  ALA I N   1 
ATOM 8009  C CA  . ALA I 1 74  ? 79.800  104.964 83.154  1.00 35.57 ? 74  ALA I CA  1 
ATOM 8010  C C   . ALA I 1 74  ? 81.280  105.042 83.522  1.00 35.42 ? 74  ALA I C   1 
ATOM 8011  O O   . ALA I 1 74  ? 81.955  104.012 83.602  1.00 35.50 ? 74  ALA I O   1 
ATOM 8012  C CB  . ALA I 1 74  ? 78.988  104.442 84.330  1.00 35.68 ? 74  ALA I CB  1 
ATOM 8013  N N   . ASN I 1 75  ? 81.765  106.266 83.735  1.00 35.20 ? 75  ASN I N   1 
ATOM 8014  C CA  . ASN I 1 75  ? 83.173  106.544 84.052  1.00 35.04 ? 75  ASN I CA  1 
ATOM 8015  C C   . ASN I 1 75  ? 84.137  106.077 82.949  1.00 34.83 ? 75  ASN I C   1 
ATOM 8016  O O   . ASN I 1 75  ? 85.213  105.546 83.239  1.00 34.81 ? 75  ASN I O   1 
ATOM 8017  C CB  . ASN I 1 75  ? 83.558  105.937 85.412  1.00 35.14 ? 75  ASN I CB  1 
ATOM 8018  C CG  . ASN I 1 75  ? 82.576  106.289 86.516  1.00 35.37 ? 75  ASN I CG  1 
ATOM 8019  O OD1 . ASN I 1 75  ? 81.979  107.366 86.516  1.00 35.52 ? 75  ASN I OD1 1 
ATOM 8020  N ND2 . ASN I 1 75  ? 82.411  105.378 87.469  1.00 35.47 ? 75  ASN I ND2 1 
ATOM 8021  N N   . VAL I 1 76  ? 83.738  106.284 81.692  1.00 34.65 ? 76  VAL I N   1 
ATOM 8022  C CA  . VAL I 1 76  ? 84.562  105.963 80.518  1.00 34.49 ? 76  VAL I CA  1 
ATOM 8023  C C   . VAL I 1 76  ? 84.570  107.166 79.576  1.00 34.47 ? 76  VAL I C   1 
ATOM 8024  O O   . VAL I 1 76  ? 83.522  107.756 79.304  1.00 34.47 ? 76  VAL I O   1 
ATOM 8025  C CB  . VAL I 1 76  ? 84.035  104.715 79.771  1.00 34.35 ? 76  VAL I CB  1 
ATOM 8026  C CG1 . VAL I 1 76  ? 84.821  104.464 78.484  1.00 34.32 ? 76  VAL I CG1 1 
ATOM 8027  C CG2 . VAL I 1 76  ? 84.099  103.493 80.674  1.00 34.40 ? 76  VAL I CG2 1 
ATOM 8028  N N   . THR I 1 77  ? 85.760  107.511 79.081  1.00 34.42 ? 77  THR I N   1 
ATOM 8029  C CA  . THR I 1 77  ? 85.957  108.658 78.194  1.00 34.40 ? 77  THR I CA  1 
ATOM 8030  C C   . THR I 1 77  ? 86.321  108.189 76.787  1.00 34.33 ? 77  THR I C   1 
ATOM 8031  O O   . THR I 1 77  ? 87.491  108.195 76.395  1.00 34.35 ? 77  THR I O   1 
ATOM 8032  C CB  . THR I 1 77  ? 87.056  109.592 78.735  1.00 34.48 ? 77  THR I CB  1 
ATOM 8033  O OG1 . THR I 1 77  ? 88.252  108.842 78.972  1.00 34.42 ? 77  THR I OG1 1 
ATOM 8034  C CG2 . THR I 1 77  ? 86.607  110.244 80.034  1.00 34.60 ? 77  THR I CG2 1 
ATOM 8035  N N   . PHE I 1 78  ? 85.300  107.771 76.041  1.00 34.32 ? 78  PHE I N   1 
ATOM 8036  C CA  . PHE I 1 78  ? 85.451  107.388 74.637  1.00 34.26 ? 78  PHE I CA  1 
ATOM 8037  C C   . PHE I 1 78  ? 85.595  108.645 73.782  1.00 34.03 ? 78  PHE I C   1 
ATOM 8038  O O   . PHE I 1 78  ? 84.896  109.636 74.007  1.00 34.15 ? 78  PHE I O   1 
ATOM 8039  C CB  . PHE I 1 78  ? 84.238  106.569 74.175  1.00 34.49 ? 78  PHE I CB  1 
ATOM 8040  C CG  . PHE I 1 78  ? 84.309  106.124 72.740  1.00 34.68 ? 78  PHE I CG  1 
ATOM 8041  C CD1 . PHE I 1 78  ? 85.029  104.988 72.383  1.00 34.79 ? 78  PHE I CD1 1 
ATOM 8042  C CD2 . PHE I 1 78  ? 83.646  106.835 71.741  1.00 34.80 ? 78  PHE I CD2 1 
ATOM 8043  C CE1 . PHE I 1 78  ? 85.093  104.574 71.059  1.00 34.94 ? 78  PHE I CE1 1 
ATOM 8044  C CE2 . PHE I 1 78  ? 83.707  106.426 70.417  1.00 34.93 ? 78  PHE I CE2 1 
ATOM 8045  C CZ  . PHE I 1 78  ? 84.430  105.294 70.074  1.00 34.99 ? 78  PHE I CZ  1 
ATOM 8046  N N   . SER I 1 79  ? 86.499  108.596 72.806  1.00 33.69 ? 79  SER I N   1 
ATOM 8047  C CA  . SER I 1 79  ? 86.784  109.747 71.948  1.00 33.53 ? 79  SER I CA  1 
ATOM 8048  C C   . SER I 1 79  ? 87.511  109.324 70.672  1.00 33.30 ? 79  SER I C   1 
ATOM 8049  O O   . SER I 1 79  ? 88.649  108.853 70.730  1.00 33.36 ? 79  SER I O   1 
ATOM 8050  C CB  . SER I 1 79  ? 87.630  110.771 72.711  1.00 33.61 ? 79  SER I CB  1 
ATOM 8051  O OG  . SER I 1 79  ? 87.946  111.892 71.902  1.00 33.71 ? 79  SER I OG  1 
ATOM 8052  N N   . ILE I 1 80  ? 86.853  109.503 69.527  1.00 33.07 ? 80  ILE I N   1 
ATOM 8053  C CA  . ILE I 1 80  ? 87.443  109.179 68.228  1.00 32.89 ? 80  ILE I CA  1 
ATOM 8054  C C   . ILE I 1 80  ? 88.372  110.325 67.828  1.00 32.77 ? 80  ILE I C   1 
ATOM 8055  O O   . ILE I 1 80  ? 87.940  111.476 67.742  1.00 32.79 ? 80  ILE I O   1 
ATOM 8056  C CB  . ILE I 1 80  ? 86.365  108.965 67.137  1.00 32.91 ? 80  ILE I CB  1 
ATOM 8057  C CG1 . ILE I 1 80  ? 85.424  107.813 67.527  1.00 32.96 ? 80  ILE I CG1 1 
ATOM 8058  C CG2 . ILE I 1 80  ? 87.017  108.687 65.781  1.00 32.94 ? 80  ILE I CG2 1 
ATOM 8059  C CD1 . ILE I 1 80  ? 84.158  107.727 66.701  1.00 33.00 ? 80  ILE I CD1 1 
ATOM 8060  N N   . VAL I 1 81  ? 89.643  109.999 67.590  1.00 32.73 ? 81  VAL I N   1 
ATOM 8061  C CA  . VAL I 1 81  ? 90.663  110.991 67.236  1.00 32.76 ? 81  VAL I CA  1 
ATOM 8062  C C   . VAL I 1 81  ? 90.437  111.488 65.813  1.00 32.87 ? 81  VAL I C   1 
ATOM 8063  O O   . VAL I 1 81  ? 90.261  112.687 65.585  1.00 32.99 ? 81  VAL I O   1 
ATOM 8064  C CB  . VAL I 1 81  ? 92.090  110.404 67.370  1.00 32.81 ? 81  VAL I CB  1 
ATOM 8065  C CG1 . VAL I 1 81  ? 93.144  111.341 66.782  1.00 32.88 ? 81  VAL I CG1 1 
ATOM 8066  C CG2 . VAL I 1 81  ? 92.401  110.102 68.830  1.00 32.82 ? 81  VAL I CG2 1 
ATOM 8067  N N   . SER I 1 82  ? 90.456  110.554 64.867  1.00 32.95 ? 82  SER I N   1 
ATOM 8068  C CA  . SER I 1 82  ? 90.275  110.862 63.450  1.00 33.10 ? 82  SER I CA  1 
ATOM 8069  C C   . SER I 1 82  ? 89.753  109.647 62.694  1.00 33.16 ? 82  SER I C   1 
ATOM 8070  O O   . SER I 1 82  ? 89.885  108.512 63.159  1.00 33.23 ? 82  SER I O   1 
ATOM 8071  C CB  . SER I 1 82  ? 91.594  111.336 62.836  1.00 33.14 ? 82  SER I CB  1 
ATOM 8072  O OG  . SER I 1 82  ? 92.621  110.375 63.023  1.00 33.18 ? 82  SER I OG  1 
ATOM 8073  N N   . ALA I 1 83  ? 89.161  109.900 61.530  1.00 33.30 ? 83  ALA I N   1 
ATOM 8074  C CA  . ALA I 1 83  ? 88.580  108.843 60.705  1.00 33.46 ? 83  ALA I CA  1 
ATOM 8075  C C   . ALA I 1 83  ? 88.541  109.248 59.234  1.00 33.71 ? 83  ALA I C   1 
ATOM 8076  O O   . ALA I 1 83  ? 87.607  109.917 58.786  1.00 33.85 ? 83  ALA I O   1 
ATOM 8077  C CB  . ALA I 1 83  ? 87.184  108.501 61.202  1.00 33.47 ? 83  ALA I CB  1 
ATOM 8078  N N   . SER I 1 84  ? 89.569  108.838 58.493  1.00 34.04 ? 84  SER I N   1 
ATOM 8079  C CA  . SER I 1 84  ? 89.626  109.036 57.045  1.00 34.33 ? 84  SER I CA  1 
ATOM 8080  C C   . SER I 1 84  ? 88.752  107.996 56.340  1.00 34.53 ? 84  SER I C   1 
ATOM 8081  O O   . SER I 1 84  ? 88.123  107.160 56.992  1.00 34.55 ? 84  SER I O   1 
ATOM 8082  C CB  . SER I 1 84  ? 91.077  108.949 56.555  1.00 34.48 ? 84  SER I CB  1 
ATOM 8083  O OG  . SER I 1 84  ? 91.601  107.640 56.710  1.00 34.54 ? 84  SER I OG  1 
ATOM 8084  N N   . ALA I 1 85  ? 88.709  108.059 55.011  1.00 35.05 ? 85  ALA I N   1 
ATOM 8085  C CA  . ALA I 1 85  ? 87.919  107.121 54.205  1.00 35.50 ? 85  ALA I CA  1 
ATOM 8086  C C   . ALA I 1 85  ? 88.297  105.651 54.425  1.00 35.79 ? 85  ALA I C   1 
ATOM 8087  O O   . ALA I 1 85  ? 87.417  104.790 54.463  1.00 35.91 ? 85  ALA I O   1 
ATOM 8088  C CB  . ALA I 1 85  ? 88.034  107.472 52.728  1.00 35.61 ? 85  ALA I CB  1 
ATOM 8089  N N   . ASN I 1 86  ? 89.596  105.379 54.571  1.00 36.15 ? 86  ASN I N   1 
ATOM 8090  C CA  . ASN I 1 86  ? 90.113  104.007 54.698  1.00 36.49 ? 86  ASN I CA  1 
ATOM 8091  C C   . ASN I 1 86  ? 90.928  103.757 55.982  1.00 36.55 ? 86  ASN I C   1 
ATOM 8092  O O   . ASN I 1 86  ? 91.781  102.866 56.007  1.00 36.63 ? 86  ASN I O   1 
ATOM 8093  C CB  . ASN I 1 86  ? 90.957  103.662 53.464  1.00 36.84 ? 86  ASN I CB  1 
ATOM 8094  C CG  . ASN I 1 86  ? 90.186  103.815 52.164  1.00 37.16 ? 86  ASN I CG  1 
ATOM 8095  O OD1 . ASN I 1 86  ? 89.785  104.917 51.792  1.00 37.25 ? 86  ASN I OD1 1 
ATOM 8096  N ND2 . ASN I 1 86  ? 89.987  102.705 51.459  1.00 37.45 ? 86  ASN I ND2 1 
ATOM 8097  N N   . SER I 1 87  ? 90.662  104.525 57.041  1.00 36.55 ? 87  SER I N   1 
ATOM 8098  C CA  . SER I 1 87  ? 91.311  104.308 58.344  1.00 36.52 ? 87  SER I CA  1 
ATOM 8099  C C   . SER I 1 87  ? 90.554  104.981 59.491  1.00 36.58 ? 87  SER I C   1 
ATOM 8100  O O   . SER I 1 87  ? 89.628  105.764 59.265  1.00 36.60 ? 87  SER I O   1 
ATOM 8101  C CB  . SER I 1 87  ? 92.755  104.823 58.320  1.00 36.53 ? 87  SER I CB  1 
ATOM 8102  O OG  . SER I 1 87  ? 93.444  104.469 59.508  1.00 36.60 ? 87  SER I OG  1 
ATOM 8103  N N   . TYR I 1 88  ? 90.961  104.661 60.718  1.00 36.69 ? 88  TYR I N   1 
ATOM 8104  C CA  . TYR I 1 88  ? 90.422  105.303 61.923  1.00 36.75 ? 88  TYR I CA  1 
ATOM 8105  C C   . TYR I 1 88  ? 91.351  105.161 63.129  1.00 37.06 ? 88  TYR I C   1 
ATOM 8106  O O   . TYR I 1 88  ? 92.250  104.317 63.140  1.00 37.14 ? 88  TYR I O   1 
ATOM 8107  C CB  . TYR I 1 88  ? 89.030  104.751 62.262  1.00 36.59 ? 88  TYR I CB  1 
ATOM 8108  C CG  . TYR I 1 88  ? 88.987  103.261 62.535  1.00 36.51 ? 88  TYR I CG  1 
ATOM 8109  C CD1 . TYR I 1 88  ? 89.208  102.757 63.818  1.00 36.43 ? 88  TYR I CD1 1 
ATOM 8110  C CD2 . TYR I 1 88  ? 88.709  102.352 61.513  1.00 36.53 ? 88  TYR I CD2 1 
ATOM 8111  C CE1 . TYR I 1 88  ? 89.167  101.394 64.074  1.00 36.37 ? 88  TYR I CE1 1 
ATOM 8112  C CE2 . TYR I 1 88  ? 88.664  100.986 61.760  1.00 36.49 ? 88  TYR I CE2 1 
ATOM 8113  C CZ  . TYR I 1 88  ? 88.893  100.512 63.041  1.00 36.40 ? 88  TYR I CZ  1 
ATOM 8114  O OH  . TYR I 1 88  ? 88.850  99.161  63.290  1.00 36.43 ? 88  TYR I OH  1 
ATOM 8115  N N   . CYS I 1 89  ? 91.117  106.002 64.134  1.00 37.62 ? 89  CYS I N   1 
ATOM 8116  C CA  . CYS I 1 89  ? 91.855  105.968 65.400  1.00 38.04 ? 89  CYS I CA  1 
ATOM 8117  C C   . CYS I 1 89  ? 90.910  106.356 66.537  1.00 37.48 ? 89  CYS I C   1 
ATOM 8118  O O   . CYS I 1 89  ? 90.381  107.469 66.548  1.00 37.51 ? 89  CYS I O   1 
ATOM 8119  C CB  . CYS I 1 89  ? 93.048  106.926 65.349  1.00 39.02 ? 89  CYS I CB  1 
ATOM 8120  S SG  . CYS I 1 89  ? 94.021  107.004 66.873  1.00 40.38 ? 89  CYS I SG  1 
ATOM 8121  N N   . MET I 1 90  ? 90.708  105.437 67.483  1.00 36.81 ? 90  MET I N   1 
ATOM 8122  C CA  . MET I 1 90  ? 89.768  105.626 68.590  1.00 36.33 ? 90  MET I CA  1 
ATOM 8123  C C   . MET I 1 90  ? 90.449  105.332 69.927  1.00 35.96 ? 90  MET I C   1 
ATOM 8124  O O   . MET I 1 90  ? 90.778  104.181 70.224  1.00 35.94 ? 90  MET I O   1 
ATOM 8125  C CB  . MET I 1 90  ? 88.546  104.717 68.413  1.00 36.33 ? 90  MET I CB  1 
ATOM 8126  C CG  . MET I 1 90  ? 87.891  104.806 67.043  1.00 36.32 ? 90  MET I CG  1 
ATOM 8127  S SD  . MET I 1 90  ? 86.299  103.962 66.968  1.00 36.31 ? 90  MET I SD  1 
ATOM 8128  C CE  . MET I 1 90  ? 86.794  102.262 67.236  1.00 36.30 ? 90  MET I CE  1 
ATOM 8129  N N   . ILE I 1 91  ? 90.666  106.383 70.720  1.00 35.57 ? 91  ILE I N   1 
ATOM 8130  C CA  . ILE I 1 91  ? 91.215  106.261 72.071  1.00 35.27 ? 91  ILE I CA  1 
ATOM 8131  C C   . ILE I 1 91  ? 90.061  106.181 73.073  1.00 34.97 ? 91  ILE I C   1 
ATOM 8132  O O   . ILE I 1 91  ? 89.052  106.874 72.925  1.00 35.06 ? 91  ILE I O   1 
ATOM 8133  C CB  . ILE I 1 91  ? 92.120  107.467 72.429  1.00 35.34 ? 91  ILE I CB  1 
ATOM 8134  C CG1 . ILE I 1 91  ? 93.228  107.662 71.378  1.00 35.48 ? 91  ILE I CG1 1 
ATOM 8135  C CG2 . ILE I 1 91  ? 92.713  107.310 73.829  1.00 35.37 ? 91  ILE I CG2 1 
ATOM 8136  C CD1 . ILE I 1 91  ? 94.188  106.497 71.226  1.00 35.54 ? 91  ILE I CD1 1 
ATOM 8137  N N   . ALA I 1 92  ? 90.219  105.331 74.086  1.00 34.64 ? 92  ALA I N   1 
ATOM 8138  C CA  . ALA I 1 92  ? 89.237  105.202 75.165  1.00 34.42 ? 92  ALA I CA  1 
ATOM 8139  C C   . ALA I 1 92  ? 89.890  104.663 76.435  1.00 34.21 ? 92  ALA I C   1 
ATOM 8140  O O   . ALA I 1 92  ? 90.870  103.916 76.370  1.00 34.13 ? 92  ALA I O   1 
ATOM 8141  C CB  . ALA I 1 92  ? 88.091  104.299 74.735  1.00 34.49 ? 92  ALA I CB  1 
ATOM 8142  N N   . GLY I 1 93  ? 89.337  105.046 77.583  1.00 34.02 ? 93  GLY I N   1 
ATOM 8143  C CA  . GLY I 1 93  ? 89.877  104.642 78.880  1.00 33.89 ? 93  GLY I CA  1 
ATOM 8144  C C   . GLY I 1 93  ? 88.924  104.886 80.034  1.00 33.77 ? 93  GLY I C   1 
ATOM 8145  O O   . GLY I 1 93  ? 88.077  105.781 79.972  1.00 33.83 ? 93  GLY I O   1 
ATOM 8146  N N   . HIS I 1 94  ? 89.075  104.085 81.087  1.00 33.62 ? 94  HIS I N   1 
ATOM 8147  C CA  . HIS I 1 94  ? 88.276  104.208 82.304  1.00 33.49 ? 94  HIS I CA  1 
ATOM 8148  C C   . HIS I 1 94  ? 89.017  105.129 83.274  1.00 33.50 ? 94  HIS I C   1 
ATOM 8149  O O   . HIS I 1 94  ? 90.248  105.198 83.251  1.00 33.61 ? 94  HIS I O   1 
ATOM 8150  C CB  . HIS I 1 94  ? 88.060  102.826 82.931  1.00 33.42 ? 94  HIS I CB  1 
ATOM 8151  C CG  . HIS I 1 94  ? 86.797  102.706 83.725  1.00 33.39 ? 94  HIS I CG  1 
ATOM 8152  N ND1 . HIS I 1 94  ? 85.658  102.109 83.229  1.00 33.41 ? 94  HIS I ND1 1 
ATOM 8153  C CD2 . HIS I 1 94  ? 86.486  103.131 84.973  1.00 33.38 ? 94  HIS I CD2 1 
ATOM 8154  C CE1 . HIS I 1 94  ? 84.704  102.160 84.142  1.00 33.44 ? 94  HIS I CE1 1 
ATOM 8155  N NE2 . HIS I 1 94  ? 85.182  102.773 85.210  1.00 33.41 ? 94  HIS I NE2 1 
ATOM 8156  N N   . SER I 1 95  ? 88.268  105.833 84.121  1.00 33.42 ? 95  SER I N   1 
ATOM 8157  C CA  . SER I 1 95  ? 88.853  106.789 85.070  1.00 33.30 ? 95  SER I CA  1 
ATOM 8158  C C   . SER I 1 95  ? 89.708  106.089 86.127  1.00 33.15 ? 95  SER I C   1 
ATOM 8159  O O   . SER I 1 95  ? 90.811  106.545 86.435  1.00 33.23 ? 95  SER I O   1 
ATOM 8160  C CB  . SER I 1 95  ? 87.763  107.627 85.745  1.00 33.39 ? 95  SER I CB  1 
ATOM 8161  O OG  . SER I 1 95  ? 86.872  106.811 86.483  1.00 33.47 ? 95  SER I OG  1 
ATOM 8162  N N   . GLY I 1 96  ? 89.186  104.989 86.674  1.00 32.96 ? 96  GLY I N   1 
ATOM 8163  C CA  . GLY I 1 96  ? 89.933  104.118 87.588  1.00 32.84 ? 96  GLY I CA  1 
ATOM 8164  C C   . GLY I 1 96  ? 90.369  102.822 86.930  1.00 32.59 ? 96  GLY I C   1 
ATOM 8165  O O   . GLY I 1 96  ? 90.139  101.739 87.473  1.00 32.56 ? 96  GLY I O   1 
ATOM 8166  N N   . GLY I 1 97  ? 90.997  102.939 85.760  1.00 32.33 ? 97  GLY I N   1 
ATOM 8167  C CA  . GLY I 1 97  ? 91.557  101.798 85.034  1.00 32.11 ? 97  GLY I CA  1 
ATOM 8168  C C   . GLY I 1 97  ? 93.060  101.725 85.224  1.00 31.91 ? 97  GLY I C   1 
ATOM 8169  O O   . GLY I 1 97  ? 93.586  102.191 86.239  1.00 31.98 ? 97  GLY I O   1 
ATOM 8170  N N   . THR I 1 98  ? 93.745  101.141 84.242  1.00 31.56 ? 98  THR I N   1 
ATOM 8171  C CA  . THR I 1 98  ? 95.204  101.017 84.252  1.00 31.30 ? 98  THR I CA  1 
ATOM 8172  C C   . THR I 1 98  ? 95.841  101.983 83.257  1.00 31.00 ? 98  THR I C   1 
ATOM 8173  O O   . THR I 1 98  ? 96.641  102.839 83.641  1.00 31.05 ? 98  THR I O   1 
ATOM 8174  C CB  . THR I 1 98  ? 95.643  99.581  83.914  1.00 31.35 ? 98  THR I CB  1 
ATOM 8175  O OG1 . THR I 1 98  ? 95.104  99.196  82.643  1.00 31.30 ? 98  THR I OG1 1 
ATOM 8176  C CG2 . THR I 1 98  ? 95.160  98.614  84.985  1.00 31.42 ? 98  THR I CG2 1 
ATOM 8177  N N   . VAL I 1 99  ? 95.478  101.833 81.984  1.00 30.61 ? 99  VAL I N   1 
ATOM 8178  C CA  . VAL I 1 99  ? 96.011  102.659 80.892  1.00 30.35 ? 99  VAL I CA  1 
ATOM 8179  C C   . VAL I 1 99  ? 94.946  102.927 79.828  1.00 30.06 ? 99  VAL I C   1 
ATOM 8180  O O   . VAL I 1 99  ? 93.887  102.293 79.823  1.00 30.16 ? 99  VAL I O   1 
ATOM 8181  C CB  . VAL I 1 99  ? 97.241  101.995 80.222  1.00 30.45 ? 99  VAL I CB  1 
ATOM 8182  C CG1 . VAL I 1 99  ? 98.471  102.114 81.111  1.00 30.52 ? 99  VAL I CG1 1 
ATOM 8183  C CG2 . VAL I 1 99  ? 96.970  100.533 79.878  1.00 30.52 ? 99  VAL I CG2 1 
ATOM 8184  N N   . TRP I 1 100 ? 95.238  103.869 78.935  1.00 29.73 ? 100 TRP I N   1 
ATOM 8185  C CA  . TRP I 1 100 ? 94.370  104.161 77.792  1.00 29.57 ? 100 TRP I CA  1 
ATOM 8186  C C   . TRP I 1 100 ? 94.477  103.049 76.752  1.00 29.76 ? 100 TRP I C   1 
ATOM 8187  O O   . TRP I 1 100 ? 95.542  102.450 76.583  1.00 29.91 ? 100 TRP I O   1 
ATOM 8188  C CB  . TRP I 1 100 ? 94.745  105.497 77.147  1.00 29.37 ? 100 TRP I CB  1 
ATOM 8189  C CG  . TRP I 1 100 ? 94.486  106.683 78.019  1.00 29.17 ? 100 TRP I CG  1 
ATOM 8190  C CD1 . TRP I 1 100 ? 95.335  107.226 78.937  1.00 29.08 ? 100 TRP I CD1 1 
ATOM 8191  C CD2 . TRP I 1 100 ? 93.297  107.479 78.049  1.00 28.95 ? 100 TRP I CD2 1 
ATOM 8192  N NE1 . TRP I 1 100 ? 94.748  108.311 79.542  1.00 28.98 ? 100 TRP I NE1 1 
ATOM 8193  C CE2 . TRP I 1 100 ? 93.497  108.489 79.016  1.00 28.90 ? 100 TRP I CE2 1 
ATOM 8194  C CE3 . TRP I 1 100 ? 92.081  107.437 77.355  1.00 28.91 ? 100 TRP I CE3 1 
ATOM 8195  C CZ2 . TRP I 1 100 ? 92.525  109.451 79.307  1.00 28.93 ? 100 TRP I CZ2 1 
ATOM 8196  C CZ3 . TRP I 1 100 ? 91.113  108.394 77.644  1.00 28.95 ? 100 TRP I CZ3 1 
ATOM 8197  C CH2 . TRP I 1 100 ? 91.343  109.388 78.614  1.00 28.96 ? 100 TRP I CH2 1 
ATOM 8198  N N   . PHE I 1 101 ? 93.368  102.785 76.065  1.00 29.96 ? 101 PHE I N   1 
ATOM 8199  C CA  . PHE I 1 101 ? 93.299  101.761 75.023  1.00 30.13 ? 101 PHE I CA  1 
ATOM 8200  C C   . PHE I 1 101 ? 93.013  102.418 73.677  1.00 30.19 ? 101 PHE I C   1 
ATOM 8201  O O   . PHE I 1 101 ? 92.041  103.162 73.547  1.00 30.31 ? 101 PHE I O   1 
ATOM 8202  C CB  . PHE I 1 101 ? 92.188  100.756 75.334  1.00 30.32 ? 101 PHE I CB  1 
ATOM 8203  C CG  . PHE I 1 101 ? 92.505  99.817  76.465  1.00 30.39 ? 101 PHE I CG  1 
ATOM 8204  C CD1 . PHE I 1 101 ? 92.474  100.256 77.786  1.00 30.53 ? 101 PHE I CD1 1 
ATOM 8205  C CD2 . PHE I 1 101 ? 92.811  98.480  76.215  1.00 30.42 ? 101 PHE I CD2 1 
ATOM 8206  C CE1 . PHE I 1 101 ? 92.758  99.389  78.831  1.00 30.59 ? 101 PHE I CE1 1 
ATOM 8207  C CE2 . PHE I 1 101 ? 93.094  97.609  77.256  1.00 30.54 ? 101 PHE I CE2 1 
ATOM 8208  C CZ  . PHE I 1 101 ? 93.068  98.064  78.566  1.00 30.60 ? 101 PHE I CZ  1 
ATOM 8209  N N   . ALA I 1 102 ? 93.865  102.141 72.690  1.00 30.37 ? 102 ALA I N   1 
ATOM 8210  C CA  . ALA I 1 102 ? 93.665  102.607 71.317  1.00 30.57 ? 102 ALA I CA  1 
ATOM 8211  C C   . ALA I 1 102 ? 92.875  101.573 70.519  1.00 30.78 ? 102 ALA I C   1 
ATOM 8212  O O   . ALA I 1 102 ? 92.638  100.459 70.994  1.00 30.81 ? 102 ALA I O   1 
ATOM 8213  C CB  . ALA I 1 102 ? 95.004  102.875 70.651  1.00 30.60 ? 102 ALA I CB  1 
ATOM 8214  N N   . ALA I 1 103 ? 92.469  101.952 69.309  1.00 31.11 ? 103 ALA I N   1 
ATOM 8215  C CA  . ALA I 1 103 ? 91.709  101.063 68.427  1.00 31.41 ? 103 ALA I CA  1 
ATOM 8216  C C   . ALA I 1 103 ? 91.793  101.514 66.965  1.00 31.72 ? 103 ALA I C   1 
ATOM 8217  O O   . ALA I 1 103 ? 91.108  102.456 66.559  1.00 31.76 ? 103 ALA I O   1 
ATOM 8218  C CB  . ALA I 1 103 ? 90.259  100.984 68.882  1.00 31.43 ? 103 ALA I CB  1 
ATOM 8219  N N   . THR I 1 104 ? 92.644  100.834 66.198  1.00 32.08 ? 104 THR I N   1 
ATOM 8220  C CA  . THR I 1 104 ? 92.840  101.092 64.768  1.00 32.34 ? 104 THR I CA  1 
ATOM 8221  C C   . THR I 1 104 ? 92.504  99.815  63.992  1.00 32.69 ? 104 THR I C   1 
ATOM 8222  O O   . THR I 1 104 ? 92.437  98.738  64.594  1.00 32.83 ? 104 THR I O   1 
ATOM 8223  C CB  . THR I 1 104 ? 94.300  101.511 64.480  1.00 32.41 ? 104 THR I CB  1 
ATOM 8224  O OG1 . THR I 1 104 ? 95.164  100.370 64.557  1.00 32.45 ? 104 THR I OG1 1 
ATOM 8225  C CG2 . THR I 1 104 ? 94.770  102.560 65.475  1.00 32.50 ? 104 THR I CG2 1 
ATOM 8226  N N   . PRO I 1 105 ? 92.288  99.918  62.661  1.00 33.13 ? 105 PRO I N   1 
ATOM 8227  C CA  . PRO I 1 105 ? 91.955  98.704  61.900  1.00 33.45 ? 105 PRO I CA  1 
ATOM 8228  C C   . PRO I 1 105 ? 93.128  97.732  61.718  1.00 33.95 ? 105 PRO I C   1 
ATOM 8229  O O   . PRO I 1 105 ? 92.927  96.520  61.817  1.00 34.10 ? 105 PRO I O   1 
ATOM 8230  C CB  . PRO I 1 105 ? 91.458  99.234  60.548  1.00 33.34 ? 105 PRO I CB  1 
ATOM 8231  C CG  . PRO I 1 105 ? 91.871  100.658 60.470  1.00 33.31 ? 105 PRO I CG  1 
ATOM 8232  C CD  . PRO I 1 105 ? 92.370  101.116 61.805  1.00 33.23 ? 105 PRO I CD  1 
ATOM 8233  N N   . ASP I 1 106 ? 94.328  98.256  61.460  1.00 34.61 ? 106 ASP I N   1 
ATOM 8234  C CA  . ASP I 1 106 ? 95.511  97.411  61.230  1.00 35.22 ? 106 ASP I CA  1 
ATOM 8235  C C   . ASP I 1 106 ? 96.028  96.705  62.492  1.00 35.56 ? 106 ASP I C   1 
ATOM 8236  O O   . ASP I 1 106 ? 96.380  95.525  62.433  1.00 35.76 ? 106 ASP I O   1 
ATOM 8237  C CB  . ASP I 1 106 ? 96.642  98.196  60.534  1.00 35.53 ? 106 ASP I CB  1 
ATOM 8238  C CG  . ASP I 1 106 ? 97.235  99.300  61.403  1.00 35.77 ? 106 ASP I CG  1 
ATOM 8239  O OD1 . ASP I 1 106 ? 96.492  99.898  62.213  1.00 35.93 ? 106 ASP I OD1 1 
ATOM 8240  O OD2 . ASP I 1 106 ? 98.447  99.572  61.268  1.00 35.86 ? 106 ASP I OD2 1 
ATOM 8241  N N   . LYS I 1 107 ? 96.062  97.420  63.618  1.00 35.96 ? 107 LYS I N   1 
ATOM 8242  C CA  . LYS I 1 107 ? 96.569  96.873  64.886  1.00 36.36 ? 107 LYS I CA  1 
ATOM 8243  C C   . LYS I 1 107 ? 95.478  96.298  65.798  1.00 36.64 ? 107 LYS I C   1 
ATOM 8244  O O   . LYS I 1 107 ? 95.793  95.612  66.772  1.00 36.62 ? 107 LYS I O   1 
ATOM 8245  C CB  . LYS I 1 107 ? 97.355  97.944  65.650  1.00 36.45 ? 107 LYS I CB  1 
ATOM 8246  C CG  . LYS I 1 107 ? 98.594  98.441  64.922  1.00 36.66 ? 107 LYS I CG  1 
ATOM 8247  C CD  . LYS I 1 107 ? 99.307  99.542  65.693  1.00 36.88 ? 107 LYS I CD  1 
ATOM 8248  C CE  . LYS I 1 107 ? 100.075 98.998  66.888  1.00 37.03 ? 107 LYS I CE  1 
ATOM 8249  N NZ  . LYS I 1 107 ? 100.858 100.061 67.577  1.00 37.12 ? 107 LYS I NZ  1 
ATOM 8250  N N   . GLY I 1 108 ? 94.209  96.573  65.488  1.00 37.06 ? 108 GLY I N   1 
ATOM 8251  C CA  . GLY I 1 108 ? 93.089  96.143  66.326  1.00 37.38 ? 108 GLY I CA  1 
ATOM 8252  C C   . GLY I 1 108 ? 92.986  96.987  67.583  1.00 37.66 ? 108 GLY I C   1 
ATOM 8253  O O   . GLY I 1 108 ? 93.463  98.123  67.610  1.00 37.75 ? 108 GLY I O   1 
ATOM 8254  N N   . VAL I 1 109 ? 92.359  96.428  68.616  1.00 38.04 ? 109 VAL I N   1 
ATOM 8255  C CA  . VAL I 1 109 ? 92.240  97.088  69.918  1.00 38.33 ? 109 VAL I CA  1 
ATOM 8256  C C   . VAL I 1 109 ? 93.436  96.684  70.781  1.00 38.62 ? 109 VAL I C   1 
ATOM 8257  O O   . VAL I 1 109 ? 93.604  95.504  71.093  1.00 38.77 ? 109 VAL I O   1 
ATOM 8258  C CB  . VAL I 1 109 ? 90.923  96.707  70.634  1.00 38.50 ? 109 VAL I CB  1 
ATOM 8259  C CG1 . VAL I 1 109 ? 90.810  97.417  71.982  1.00 38.57 ? 109 VAL I CG1 1 
ATOM 8260  C CG2 . VAL I 1 109 ? 89.723  97.031  69.749  1.00 38.56 ? 109 VAL I CG2 1 
ATOM 8261  N N   . TYR I 1 110 ? 94.259  97.665  71.154  1.00 38.99 ? 110 TYR I N   1 
ATOM 8262  C CA  . TYR I 1 110 ? 95.442  97.440  71.996  1.00 39.35 ? 110 TYR I CA  1 
ATOM 8263  C C   . TYR I 1 110 ? 95.584  98.533  73.051  1.00 39.82 ? 110 TYR I C   1 
ATOM 8264  O O   . TYR I 1 110 ? 94.911  99.565  72.981  1.00 40.04 ? 110 TYR I O   1 
ATOM 8265  C CB  . TYR I 1 110 ? 96.710  97.366  71.136  1.00 39.25 ? 110 TYR I CB  1 
ATOM 8266  C CG  . TYR I 1 110 ? 97.020  98.630  70.360  1.00 39.14 ? 110 TYR I CG  1 
ATOM 8267  C CD1 . TYR I 1 110 ? 96.421  98.878  69.126  1.00 39.13 ? 110 TYR I CD1 1 
ATOM 8268  C CD2 . TYR I 1 110 ? 97.924  99.573  70.854  1.00 39.09 ? 110 TYR I CD2 1 
ATOM 8269  C CE1 . TYR I 1 110 ? 96.703  100.032 68.409  1.00 39.07 ? 110 TYR I CE1 1 
ATOM 8270  C CE2 . TYR I 1 110 ? 98.214  100.730 70.144  1.00 39.10 ? 110 TYR I CE2 1 
ATOM 8271  C CZ  . TYR I 1 110 ? 97.601  100.954 68.922  1.00 39.11 ? 110 TYR I CZ  1 
ATOM 8272  O OH  . TYR I 1 110 ? 97.881  102.098 68.211  1.00 39.19 ? 110 TYR I OH  1 
ATOM 8273  N N   . LYS I 1 111 ? 96.472  98.296  74.016  1.00 40.42 ? 111 LYS I N   1 
ATOM 8274  C CA  . LYS I 1 111 ? 96.703  99.227  75.128  1.00 41.05 ? 111 LYS I CA  1 
ATOM 8275  C C   . LYS I 1 111 ? 98.026  99.975  74.961  1.00 41.38 ? 111 LYS I C   1 
ATOM 8276  O O   . LYS I 1 111 ? 99.023  99.394  74.527  1.00 41.54 ? 111 LYS I O   1 
ATOM 8277  C CB  . LYS I 1 111 ? 96.649  98.504  76.483  1.00 41.42 ? 111 LYS I CB  1 
ATOM 8278  C CG  . LYS I 1 111 ? 97.747  97.483  76.755  1.00 41.67 ? 111 LYS I CG  1 
ATOM 8279  C CD  . LYS I 1 111 ? 97.541  96.828  78.111  1.00 41.99 ? 111 LYS I CD  1 
ATOM 8280  C CE  . LYS I 1 111 ? 98.618  95.795  78.404  1.00 42.27 ? 111 LYS I CE  1 
ATOM 8281  N NZ  . LYS I 1 111 ? 98.444  95.136  79.731  1.00 42.33 ? 111 LYS I NZ  1 
ATOM 8282  N N   . THR I 1 112 ? 98.018  101.261 75.318  1.00 41.76 ? 112 THR I N   1 
ATOM 8283  C CA  . THR I 1 112 ? 99.190  102.136 75.183  1.00 42.19 ? 112 THR I CA  1 
ATOM 8284  C C   . THR I 1 112 ? 99.893  102.344 76.527  1.00 42.42 ? 112 THR I C   1 
ATOM 8285  O O   . THR I 1 112 ? 99.385  101.943 77.577  1.00 42.41 ? 112 THR I O   1 
ATOM 8286  C CB  . THR I 1 112 ? 98.819  103.499 74.542  1.00 42.41 ? 112 THR I CB  1 
ATOM 8287  O OG1 . THR I 1 112 ? 100.007 104.271 74.317  1.00 42.63 ? 112 THR I OG1 1 
ATOM 8288  C CG2 . THR I 1 112 ? 97.831  104.312 75.404  1.00 42.32 ? 112 THR I CG2 1 
ATOM 8289  N N   . ASN I 1 113 ? 101.063 102.978 76.477  1.00 42.76 ? 113 ASN I N   1 
ATOM 8290  C CA  . ASN I 1 113 ? 101.870 103.243 77.674  1.00 43.05 ? 113 ASN I CA  1 
ATOM 8291  C C   . ASN I 1 113 ? 101.328 104.380 78.551  1.00 43.07 ? 113 ASN I C   1 
ATOM 8292  O O   . ASN I 1 113 ? 101.695 104.474 79.725  1.00 43.14 ? 113 ASN I O   1 
ATOM 8293  C CB  . ASN I 1 113 ? 103.322 103.553 77.284  1.00 43.32 ? 113 ASN I CB  1 
ATOM 8294  C CG  . ASN I 1 113 ? 104.013 102.380 76.609  1.00 43.69 ? 113 ASN I CG  1 
ATOM 8295  O OD1 . ASN I 1 113 ? 103.376 101.397 76.224  1.00 43.88 ? 113 ASN I OD1 1 
ATOM 8296  N ND2 . ASN I 1 113 ? 105.329 102.481 76.459  1.00 43.95 ? 113 ASN I ND2 1 
ATOM 8297  N N   . THR I 1 114 ? 100.473 105.238 77.988  1.00 42.95 ? 114 THR I N   1 
ATOM 8298  C CA  . THR I 1 114 ? 99.912  106.380 78.717  1.00 42.92 ? 114 THR I CA  1 
ATOM 8299  C C   . THR I 1 114 ? 98.943  105.922 79.809  1.00 42.75 ? 114 THR I C   1 
ATOM 8300  O O   . THR I 1 114 ? 98.092  105.064 79.569  1.00 42.67 ? 114 THR I O   1 
ATOM 8301  C CB  . THR I 1 114 ? 99.172  107.348 77.767  1.00 43.06 ? 114 THR I CB  1 
ATOM 8302  O OG1 . THR I 1 114 ? 100.011 107.659 76.646  1.00 43.18 ? 114 THR I OG1 1 
ATOM 8303  C CG2 . THR I 1 114 ? 98.788  108.642 78.485  1.00 43.11 ? 114 THR I CG2 1 
ATOM 8304  N N   . ALA I 1 115 ? 99.080  106.505 81.001  1.00 42.77 ? 115 ALA I N   1 
ATOM 8305  C CA  . ALA I 1 115 ? 98.258  106.146 82.159  1.00 42.75 ? 115 ALA I CA  1 
ATOM 8306  C C   . ALA I 1 115 ? 96.938  106.913 82.165  1.00 42.74 ? 115 ALA I C   1 
ATOM 8307  O O   . ALA I 1 115 ? 96.840  108.004 81.598  1.00 42.81 ? 115 ALA I O   1 
ATOM 8308  C CB  . ALA I 1 115 ? 99.019  106.411 83.449  1.00 42.91 ? 115 ALA I CB  1 
ATOM 8309  N N   . VAL I 1 116 ? 95.934  106.333 82.820  1.00 42.90 ? 116 VAL I N   1 
ATOM 8310  C CA  . VAL I 1 116 ? 94.602  106.952 82.929  1.00 43.05 ? 116 VAL I CA  1 
ATOM 8311  C C   . VAL I 1 116 ? 94.596  108.204 83.816  1.00 43.55 ? 116 VAL I C   1 
ATOM 8312  O O   . VAL I 1 116 ? 93.755  109.088 83.631  1.00 43.76 ? 116 VAL I O   1 
ATOM 8313  C CB  . VAL I 1 116 ? 93.519  105.962 83.433  1.00 42.93 ? 116 VAL I CB  1 
ATOM 8314  C CG1 . VAL I 1 116 ? 93.409  104.762 82.497  1.00 42.89 ? 116 VAL I CG1 1 
ATOM 8315  C CG2 . VAL I 1 116 ? 93.765  105.532 84.881  1.00 42.98 ? 116 VAL I CG2 1 
ATOM 8316  N N   . THR I 1 117 ? 95.520  108.268 84.776  1.00 43.94 ? 117 THR I N   1 
ATOM 8317  C CA  . THR I 1 117 ? 95.734  109.476 85.581  1.00 44.22 ? 117 THR I CA  1 
ATOM 8318  C C   . THR I 1 117 ? 96.285  110.625 84.733  1.00 44.30 ? 117 THR I C   1 
ATOM 8319  O O   . THR I 1 117 ? 95.911  111.782 84.938  1.00 44.49 ? 117 THR I O   1 
ATOM 8320  C CB  . THR I 1 117 ? 96.700  109.216 86.756  1.00 44.54 ? 117 THR I CB  1 
ATOM 8321  O OG1 . THR I 1 117 ? 97.915  108.636 86.265  1.00 44.68 ? 117 THR I OG1 1 
ATOM 8322  C CG2 . THR I 1 117 ? 96.066  108.279 87.777  1.00 44.67 ? 117 THR I CG2 1 
ATOM 8323  N N   . SER I 1 118 ? 97.169  110.299 83.789  1.00 44.37 ? 118 SER I N   1 
ATOM 8324  C CA  . SER I 1 118 ? 97.683  111.274 82.820  1.00 44.50 ? 118 SER I CA  1 
ATOM 8325  C C   . SER I 1 118 ? 96.624  111.627 81.774  1.00 44.49 ? 118 SER I C   1 
ATOM 8326  O O   . SER I 1 118 ? 95.584  110.968 81.679  1.00 44.41 ? 118 SER I O   1 
ATOM 8327  C CB  . SER I 1 118 ? 98.936  110.733 82.124  1.00 44.61 ? 118 SER I CB  1 
ATOM 8328  O OG  . SER I 1 118 ? 99.939  110.398 83.068  1.00 44.73 ? 118 SER I OG  1 
ATOM 8329  N N   . SER I 1 119 ? 96.905  112.665 80.986  1.00 44.65 ? 119 SER I N   1 
ATOM 8330  C CA  . SER I 1 119 ? 95.959  113.170 79.984  1.00 44.77 ? 119 SER I CA  1 
ATOM 8331  C C   . SER I 1 119 ? 95.775  112.207 78.810  1.00 44.88 ? 119 SER I C   1 
ATOM 8332  O O   . SER I 1 119 ? 96.574  111.288 78.610  1.00 44.83 ? 119 SER I O   1 
ATOM 8333  C CB  . SER I 1 119 ? 96.413  114.536 79.461  1.00 44.90 ? 119 SER I CB  1 
ATOM 8334  O OG  . SER I 1 119 ? 95.421  115.124 78.635  1.00 44.99 ? 119 SER I OG  1 
ATOM 8335  N N   . GLN I 1 120 ? 94.712  112.438 78.040  1.00 44.97 ? 120 GLN I N   1 
ATOM 8336  C CA  . GLN I 1 120 ? 94.349  111.576 76.912  1.00 45.08 ? 120 GLN I CA  1 
ATOM 8337  C C   . GLN I 1 120 ? 95.386  111.678 75.787  1.00 45.31 ? 120 GLN I C   1 
ATOM 8338  O O   . GLN I 1 120 ? 95.826  112.784 75.463  1.00 45.67 ? 120 GLN I O   1 
ATOM 8339  C CB  . GLN I 1 120 ? 92.965  111.960 76.376  1.00 45.05 ? 120 GLN I CB  1 
ATOM 8340  C CG  . GLN I 1 120 ? 92.407  111.018 75.317  1.00 45.09 ? 120 GLN I CG  1 
ATOM 8341  C CD  . GLN I 1 120 ? 91.012  111.410 74.863  1.00 45.21 ? 120 GLN I CD  1 
ATOM 8342  O OE1 . GLN I 1 120 ? 90.117  111.628 75.680  1.00 45.22 ? 120 GLN I OE1 1 
ATOM 8343  N NE2 . GLN I 1 120 ? 90.820  111.498 73.551  1.00 45.29 ? 120 GLN I NE2 1 
ATOM 8344  N N   . PRO I 1 121 ? 95.795  110.528 75.201  1.00 45.40 ? 121 PRO I N   1 
ATOM 8345  C CA  . PRO I 1 121 ? 96.665  110.552 74.018  1.00 45.55 ? 121 PRO I CA  1 
ATOM 8346  C C   . PRO I 1 121 ? 96.047  111.291 72.827  1.00 45.58 ? 121 PRO I C   1 
ATOM 8347  O O   . PRO I 1 121 ? 94.871  111.083 72.519  1.00 45.53 ? 121 PRO I O   1 
ATOM 8348  C CB  . PRO I 1 121 ? 96.846  109.069 73.682  1.00 45.56 ? 121 PRO I CB  1 
ATOM 8349  C CG  . PRO I 1 121 ? 96.677  108.367 74.980  1.00 45.48 ? 121 PRO I CG  1 
ATOM 8350  C CD  . PRO I 1 121 ? 95.665  109.164 75.751  1.00 45.42 ? 121 PRO I CD  1 
ATOM 8351  N N   . GLU I 1 122 ? 96.840  112.146 72.182  1.00 45.76 ? 122 GLU I N   1 
ATOM 8352  C CA  . GLU I 1 122 ? 96.379  112.931 71.031  1.00 45.90 ? 122 GLU I CA  1 
ATOM 8353  C C   . GLU I 1 122 ? 96.144  112.051 69.807  1.00 45.50 ? 122 GLU I C   1 
ATOM 8354  O O   . GLU I 1 122 ? 95.143  112.218 69.110  1.00 45.42 ? 122 GLU I O   1 
ATOM 8355  C CB  . GLU I 1 122 ? 97.384  114.039 70.686  1.00 46.32 ? 122 GLU I CB  1 
ATOM 8356  C CG  . GLU I 1 122 ? 97.536  115.117 71.755  1.00 46.56 ? 122 GLU I CG  1 
ATOM 8357  C CD  . GLU I 1 122 ? 96.280  115.953 71.970  1.00 46.77 ? 122 GLU I CD  1 
ATOM 8358  O OE1 . GLU I 1 122 ? 95.435  116.042 71.052  1.00 46.76 ? 122 GLU I OE1 1 
ATOM 8359  O OE2 . GLU I 1 122 ? 96.141  116.531 73.068  1.00 46.96 ? 122 GLU I OE2 1 
ATOM 8360  N N   . SER I 1 123 ? 97.074  111.131 69.552  1.00 45.20 ? 123 SER I N   1 
ATOM 8361  C CA  . SER I 1 123 ? 96.946  110.142 68.478  1.00 45.03 ? 123 SER I CA  1 
ATOM 8362  C C   . SER I 1 123 ? 97.452  108.779 68.945  1.00 44.61 ? 123 SER I C   1 
ATOM 8363  O O   . SER I 1 123 ? 98.342  108.694 69.795  1.00 44.74 ? 123 SER I O   1 
ATOM 8364  C CB  . SER I 1 123 ? 97.730  110.592 67.243  1.00 45.23 ? 123 SER I CB  1 
ATOM 8365  O OG  . SER I 1 123 ? 97.530  109.704 66.157  1.00 45.30 ? 123 SER I OG  1 
ATOM 8366  N N   . CYS I 1 124 ? 96.878  107.719 68.377  1.00 44.10 ? 124 CYS I N   1 
ATOM 8367  C CA  . CYS I 1 124 ? 97.235  106.343 68.735  1.00 43.87 ? 124 CYS I CA  1 
ATOM 8368  C C   . CYS I 1 124 ? 98.634  105.979 68.211  1.00 44.47 ? 124 CYS I C   1 
ATOM 8369  O O   . CYS I 1 124 ? 99.052  106.507 67.178  1.00 44.77 ? 124 CYS I O   1 
ATOM 8370  C CB  . CYS I 1 124 ? 96.192  105.360 68.188  1.00 43.10 ? 124 CYS I CB  1 
ATOM 8371  S SG  . CYS I 1 124 ? 95.587  105.752 66.528  1.00 42.51 ? 124 CYS I SG  1 
ATOM 8372  N N   . PRO I 1 125 ? 99.366  105.088 68.923  1.00 44.93 ? 125 PRO I N   1 
ATOM 8373  C CA  . PRO I 1 125 ? 100.693 104.664 68.437  1.00 45.17 ? 125 PRO I CA  1 
ATOM 8374  C C   . PRO I 1 125 ? 100.670 103.864 67.128  1.00 45.54 ? 125 PRO I C   1 
ATOM 8375  O O   . PRO I 1 125 ? 101.710 103.675 66.495  1.00 45.78 ? 125 PRO I O   1 
ATOM 8376  C CB  . PRO I 1 125 ? 101.229 103.786 69.579  1.00 45.17 ? 125 PRO I CB  1 
ATOM 8377  C CG  . PRO I 1 125 ? 100.453 104.187 70.780  1.00 45.13 ? 125 PRO I CG  1 
ATOM 8378  C CD  . PRO I 1 125 ? 99.093  104.556 70.274  1.00 45.02 ? 125 PRO I CD  1 
ATOM 8379  O OXT . PRO I 1 125 ? 99.630  103.387 66.670  1.00 45.77 ? 125 PRO I OXT 1 
ATOM 8380  N N   . PHE J 1 1   ? 87.861  83.542  139.834 1.00 65.53 ? 1   PHE J N   1 
ATOM 8381  C CA  . PHE J 1 1   ? 86.762  83.742  138.846 1.00 65.24 ? 1   PHE J CA  1 
ATOM 8382  C C   . PHE J 1 1   ? 85.584  84.454  139.523 1.00 64.19 ? 1   PHE J C   1 
ATOM 8383  O O   . PHE J 1 1   ? 84.753  83.820  140.180 1.00 64.28 ? 1   PHE J O   1 
ATOM 8384  C CB  . PHE J 1 1   ? 86.333  82.390  138.249 1.00 66.00 ? 1   PHE J CB  1 
ATOM 8385  C CG  . PHE J 1 1   ? 85.724  82.488  136.874 1.00 66.66 ? 1   PHE J CG  1 
ATOM 8386  C CD1 . PHE J 1 1   ? 84.551  83.210  136.659 1.00 66.87 ? 1   PHE J CD1 1 
ATOM 8387  C CD2 . PHE J 1 1   ? 86.314  81.843  135.789 1.00 67.09 ? 1   PHE J CD2 1 
ATOM 8388  C CE1 . PHE J 1 1   ? 83.988  83.293  135.395 1.00 67.09 ? 1   PHE J CE1 1 
ATOM 8389  C CE2 . PHE J 1 1   ? 85.752  81.926  134.524 1.00 67.25 ? 1   PHE J CE2 1 
ATOM 8390  C CZ  . PHE J 1 1   ? 84.588  82.651  134.326 1.00 67.25 ? 1   PHE J CZ  1 
ATOM 8391  N N   . THR J 1 2   ? 85.521  85.775  139.349 1.00 62.81 ? 2   THR J N   1 
ATOM 8392  C CA  . THR J 1 2   ? 84.492  86.608  139.981 1.00 61.68 ? 2   THR J CA  1 
ATOM 8393  C C   . THR J 1 2   ? 83.191  86.610  139.181 1.00 60.37 ? 2   THR J C   1 
ATOM 8394  O O   . THR J 1 2   ? 83.140  86.117  138.052 1.00 60.21 ? 2   THR J O   1 
ATOM 8395  C CB  . THR J 1 2   ? 84.971  88.070  140.130 1.00 61.85 ? 2   THR J CB  1 
ATOM 8396  O OG1 . THR J 1 2   ? 85.330  88.592  138.846 1.00 61.94 ? 2   THR J OG1 1 
ATOM 8397  C CG2 . THR J 1 2   ? 86.171  88.165  141.062 1.00 61.91 ? 2   THR J CG2 1 
ATOM 8398  N N   . LEU J 1 3   ? 82.145  87.173  139.783 1.00 59.31 ? 3   LEU J N   1 
ATOM 8399  C CA  . LEU J 1 3   ? 80.870  87.404  139.099 1.00 58.56 ? 3   LEU J CA  1 
ATOM 8400  C C   . LEU J 1 3   ? 80.988  88.563  138.107 1.00 57.74 ? 3   LEU J C   1 
ATOM 8401  O O   . LEU J 1 3   ? 80.418  88.501  137.018 1.00 57.87 ? 3   LEU J O   1 
ATOM 8402  C CB  . LEU J 1 3   ? 79.754  87.688  140.112 1.00 58.65 ? 3   LEU J CB  1 
ATOM 8403  C CG  . LEU J 1 3   ? 78.320  87.831  139.584 1.00 58.84 ? 3   LEU J CG  1 
ATOM 8404  C CD1 . LEU J 1 3   ? 77.832  86.545  138.934 1.00 58.83 ? 3   LEU J CD1 1 
ATOM 8405  C CD2 . LEU J 1 3   ? 77.390  88.246  140.715 1.00 59.00 ? 3   LEU J CD2 1 
ATOM 8406  N N   . ILE J 1 4   ? 81.708  89.616  138.498 1.00 56.84 ? 4   ILE J N   1 
ATOM 8407  C CA  . ILE J 1 4   ? 81.976  90.766  137.615 1.00 56.10 ? 4   ILE J CA  1 
ATOM 8408  C C   . ILE J 1 4   ? 82.765  90.389  136.349 1.00 55.55 ? 4   ILE J C   1 
ATOM 8409  O O   . ILE J 1 4   ? 82.515  90.951  135.280 1.00 55.56 ? 4   ILE J O   1 
ATOM 8410  C CB  . ILE J 1 4   ? 82.669  91.938  138.379 1.00 56.16 ? 4   ILE J CB  1 
ATOM 8411  C CG1 . ILE J 1 4   ? 82.766  93.210  137.520 1.00 56.20 ? 4   ILE J CG1 1 
ATOM 8412  C CG2 . ILE J 1 4   ? 84.067  91.566  138.862 1.00 56.30 ? 4   ILE J CG2 1 
ATOM 8413  C CD1 . ILE J 1 4   ? 81.443  93.735  137.007 1.00 56.15 ? 4   ILE J CD1 1 
ATOM 8414  N N   . GLU J 1 5   ? 83.705  89.451  136.473 1.00 55.12 ? 5   GLU J N   1 
ATOM 8415  C CA  . GLU J 1 5   ? 84.454  88.936  135.317 1.00 54.70 ? 5   GLU J CA  1 
ATOM 8416  C C   . GLU J 1 5   ? 83.557  88.114  134.385 1.00 54.01 ? 5   GLU J C   1 
ATOM 8417  O O   . GLU J 1 5   ? 83.762  88.116  133.173 1.00 54.13 ? 5   GLU J O   1 
ATOM 8418  C CB  . GLU J 1 5   ? 85.663  88.108  135.775 1.00 54.98 ? 5   GLU J CB  1 
ATOM 8419  C CG  . GLU J 1 5   ? 86.569  87.616  134.649 1.00 55.44 ? 5   GLU J CG  1 
ATOM 8420  C CD  . GLU J 1 5   ? 86.284  86.184  134.224 1.00 55.80 ? 5   GLU J CD  1 
ATOM 8421  O OE1 . GLU J 1 5   ? 86.452  85.268  135.057 1.00 55.97 ? 5   GLU J OE1 1 
ATOM 8422  O OE2 . GLU J 1 5   ? 85.903  85.972  133.053 1.00 55.93 ? 5   GLU J OE2 1 
ATOM 8423  N N   . LEU J 1 6   ? 82.581  87.410  134.955 1.00 53.26 ? 6   LEU J N   1 
ATOM 8424  C CA  . LEU J 1 6   ? 81.562  86.707  134.170 1.00 52.82 ? 6   LEU J CA  1 
ATOM 8425  C C   . LEU J 1 6   ? 80.550  87.679  133.563 1.00 52.17 ? 6   LEU J C   1 
ATOM 8426  O O   . LEU J 1 6   ? 80.115  87.497  132.427 1.00 52.30 ? 6   LEU J O   1 
ATOM 8427  C CB  . LEU J 1 6   ? 80.827  85.687  135.047 1.00 53.07 ? 6   LEU J CB  1 
ATOM 8428  C CG  . LEU J 1 6   ? 79.893  84.672  134.375 1.00 53.25 ? 6   LEU J CG  1 
ATOM 8429  C CD1 . LEU J 1 6   ? 80.633  83.789  133.373 1.00 53.35 ? 6   LEU J CD1 1 
ATOM 8430  C CD2 . LEU J 1 6   ? 79.189  83.829  135.435 1.00 53.36 ? 6   LEU J CD2 1 
ATOM 8431  N N   . LEU J 1 7   ? 80.178  88.701  134.336 1.00 51.68 ? 7   LEU J N   1 
ATOM 8432  C CA  . LEU J 1 7   ? 79.173  89.689  133.931 1.00 51.18 ? 7   LEU J CA  1 
ATOM 8433  C C   . LEU J 1 7   ? 79.619  90.548  132.748 1.00 50.46 ? 7   LEU J C   1 
ATOM 8434  O O   . LEU J 1 7   ? 78.820  90.815  131.847 1.00 50.55 ? 7   LEU J O   1 
ATOM 8435  C CB  . LEU J 1 7   ? 78.815  90.585  135.123 1.00 51.54 ? 7   LEU J CB  1 
ATOM 8436  C CG  . LEU J 1 7   ? 77.728  91.652  134.962 1.00 52.00 ? 7   LEU J CG  1 
ATOM 8437  C CD1 . LEU J 1 7   ? 76.425  91.056  134.448 1.00 52.25 ? 7   LEU J CD1 1 
ATOM 8438  C CD2 . LEU J 1 7   ? 77.514  92.350  136.297 1.00 52.11 ? 7   LEU J CD2 1 
ATOM 8439  N N   . ILE J 1 8   ? 80.879  90.987  132.760 1.00 49.67 ? 8   ILE J N   1 
ATOM 8440  C CA  . ILE J 1 8   ? 81.451  91.736  131.629 1.00 48.95 ? 8   ILE J CA  1 
ATOM 8441  C C   . ILE J 1 8   ? 81.594  90.868  130.371 1.00 48.10 ? 8   ILE J C   1 
ATOM 8442  O O   . ILE J 1 8   ? 81.421  91.369  129.264 1.00 48.25 ? 8   ILE J O   1 
ATOM 8443  C CB  . ILE J 1 8   ? 82.800  92.426  131.984 1.00 49.08 ? 8   ILE J CB  1 
ATOM 8444  C CG1 . ILE J 1 8   ? 83.164  93.469  130.914 1.00 49.31 ? 8   ILE J CG1 1 
ATOM 8445  C CG2 . ILE J 1 8   ? 83.925  91.410  132.162 1.00 49.12 ? 8   ILE J CG2 1 
ATOM 8446  C CD1 . ILE J 1 8   ? 84.250  94.442  131.324 1.00 49.49 ? 8   ILE J CD1 1 
ATOM 8447  N N   . VAL J 1 9   ? 81.895  89.580  130.545 1.00 47.27 ? 9   VAL J N   1 
ATOM 8448  C CA  . VAL J 1 9   ? 81.947  88.627  129.423 1.00 46.73 ? 9   VAL J CA  1 
ATOM 8449  C C   . VAL J 1 9   ? 80.564  88.454  128.776 1.00 46.19 ? 9   VAL J C   1 
ATOM 8450  O O   . VAL J 1 9   ? 80.464  88.357  127.553 1.00 46.23 ? 9   VAL J O   1 
ATOM 8451  C CB  . VAL J 1 9   ? 82.537  87.261  129.864 1.00 46.84 ? 9   VAL J CB  1 
ATOM 8452  C CG1 . VAL J 1 9   ? 82.312  86.173  128.817 1.00 46.95 ? 9   VAL J CG1 1 
ATOM 8453  C CG2 . VAL J 1 9   ? 84.027  87.402  130.149 1.00 46.91 ? 9   VAL J CG2 1 
ATOM 8454  N N   . ILE J 1 10  ? 79.514  88.421  129.598 1.00 45.60 ? 10  ILE J N   1 
ATOM 8455  C CA  . ILE J 1 10  ? 78.130  88.385  129.105 1.00 45.28 ? 10  ILE J CA  1 
ATOM 8456  C C   . ILE J 1 10  ? 77.784  89.681  128.351 1.00 44.89 ? 10  ILE J C   1 
ATOM 8457  O O   . ILE J 1 10  ? 77.083  89.639  127.338 1.00 44.97 ? 10  ILE J O   1 
ATOM 8458  C CB  . ILE J 1 10  ? 77.121  88.129  130.258 1.00 45.46 ? 10  ILE J CB  1 
ATOM 8459  C CG1 . ILE J 1 10  ? 77.309  86.713  130.826 1.00 45.68 ? 10  ILE J CG1 1 
ATOM 8460  C CG2 . ILE J 1 10  ? 75.674  88.297  129.793 1.00 45.52 ? 10  ILE J CG2 1 
ATOM 8461  C CD1 . ILE J 1 10  ? 76.778  86.532  132.234 1.00 45.81 ? 10  ILE J CD1 1 
ATOM 8462  N N   . ALA J 1 11  ? 78.277  90.815  128.849 1.00 44.53 ? 11  ALA J N   1 
ATOM 8463  C CA  . ALA J 1 11  ? 78.072  92.118  128.204 1.00 44.37 ? 11  ALA J CA  1 
ATOM 8464  C C   . ALA J 1 11  ? 78.733  92.227  126.826 1.00 44.14 ? 11  ALA J C   1 
ATOM 8465  O O   . ALA J 1 11  ? 78.140  92.783  125.901 1.00 44.27 ? 11  ALA J O   1 
ATOM 8466  C CB  . ALA J 1 11  ? 78.565  93.242  129.107 1.00 44.52 ? 11  ALA J CB  1 
ATOM 8467  N N   . ILE J 1 12  ? 79.951  91.698  126.698 1.00 43.94 ? 12  ILE J N   1 
ATOM 8468  C CA  . ILE J 1 12  ? 80.693  91.729  125.426 1.00 43.88 ? 12  ILE J CA  1 
ATOM 8469  C C   . ILE J 1 12  ? 80.084  90.777  124.385 1.00 43.93 ? 12  ILE J C   1 
ATOM 8470  O O   . ILE J 1 12  ? 80.066  91.103  123.197 1.00 44.27 ? 12  ILE J O   1 
ATOM 8471  C CB  . ILE J 1 12  ? 82.202  91.422  125.636 1.00 43.83 ? 12  ILE J CB  1 
ATOM 8472  C CG1 . ILE J 1 12  ? 82.865  92.488  126.528 1.00 44.06 ? 12  ILE J CG1 1 
ATOM 8473  C CG2 . ILE J 1 12  ? 82.952  91.312  124.307 1.00 43.85 ? 12  ILE J CG2 1 
ATOM 8474  C CD1 . ILE J 1 12  ? 82.802  93.913  126.012 1.00 44.26 ? 12  ILE J CD1 1 
ATOM 8475  N N   . ILE J 1 13  ? 79.582  89.622  124.824 1.00 43.69 ? 13  ILE J N   1 
ATOM 8476  C CA  . ILE J 1 13  ? 78.892  88.675  123.928 1.00 43.60 ? 13  ILE J CA  1 
ATOM 8477  C C   . ILE J 1 13  ? 77.652  89.318  123.284 1.00 43.55 ? 13  ILE J C   1 
ATOM 8478  O O   . ILE J 1 13  ? 77.379  89.085  122.105 1.00 43.61 ? 13  ILE J O   1 
ATOM 8479  C CB  . ILE J 1 13  ? 78.521  87.355  124.661 1.00 43.76 ? 13  ILE J CB  1 
ATOM 8480  C CG1 . ILE J 1 13  ? 79.791  86.561  125.000 1.00 43.92 ? 13  ILE J CG1 1 
ATOM 8481  C CG2 . ILE J 1 13  ? 77.597  86.474  123.815 1.00 43.84 ? 13  ILE J CG2 1 
ATOM 8482  C CD1 . ILE J 1 13  ? 79.623  85.587  126.148 1.00 44.05 ? 13  ILE J CD1 1 
ATOM 8483  N N   . ALA J 1 14  ? 76.919  90.121  124.056 1.00 43.61 ? 14  ALA J N   1 
ATOM 8484  C CA  . ALA J 1 14  ? 75.767  90.874  123.540 1.00 43.68 ? 14  ALA J CA  1 
ATOM 8485  C C   . ALA J 1 14  ? 76.160  91.908  122.480 1.00 43.73 ? 14  ALA J C   1 
ATOM 8486  O O   . ALA J 1 14  ? 75.416  92.126  121.520 1.00 43.84 ? 14  ALA J O   1 
ATOM 8487  C CB  . ALA J 1 14  ? 75.024  91.553  124.683 1.00 43.75 ? 14  ALA J CB  1 
ATOM 8488  N N   . ILE J 1 15  ? 77.320  92.540  122.663 1.00 43.74 ? 15  ILE J N   1 
ATOM 8489  C CA  . ILE J 1 15  ? 77.852  93.519  121.706 1.00 43.83 ? 15  ILE J CA  1 
ATOM 8490  C C   . ILE J 1 15  ? 78.336  92.827  120.429 1.00 43.79 ? 15  ILE J C   1 
ATOM 8491  O O   . ILE J 1 15  ? 77.992  93.253  119.324 1.00 43.92 ? 15  ILE J O   1 
ATOM 8492  C CB  . ILE J 1 15  ? 79.005  94.354  122.323 1.00 44.00 ? 15  ILE J CB  1 
ATOM 8493  C CG1 . ILE J 1 15  ? 78.488  95.193  123.502 1.00 44.22 ? 15  ILE J CG1 1 
ATOM 8494  C CG2 . ILE J 1 15  ? 79.639  95.276  121.282 1.00 44.10 ? 15  ILE J CG2 1 
ATOM 8495  C CD1 . ILE J 1 15  ? 79.570  95.662  124.451 1.00 44.27 ? 15  ILE J CD1 1 
ATOM 8496  N N   . LEU J 1 16  ? 79.139  91.777  120.592 1.00 43.76 ? 16  LEU J N   1 
ATOM 8497  C CA  . LEU J 1 16  ? 79.673  91.009  119.454 1.00 43.77 ? 16  LEU J CA  1 
ATOM 8498  C C   . LEU J 1 16  ? 78.585  90.296  118.638 1.00 43.68 ? 16  LEU J C   1 
ATOM 8499  O O   . LEU J 1 16  ? 78.706  90.185  117.417 1.00 43.80 ? 16  LEU J O   1 
ATOM 8500  C CB  . LEU J 1 16  ? 80.742  89.999  119.915 1.00 43.94 ? 16  LEU J CB  1 
ATOM 8501  C CG  . LEU J 1 16  ? 82.194  90.496  119.988 1.00 44.26 ? 16  LEU J CG  1 
ATOM 8502  C CD1 . LEU J 1 16  ? 82.328  91.866  120.643 1.00 44.40 ? 16  LEU J CD1 1 
ATOM 8503  C CD2 . LEU J 1 16  ? 83.061  89.471  120.707 1.00 44.39 ? 16  LEU J CD2 1 
ATOM 8504  N N   . ALA J 1 17  ? 77.537  89.819  119.310 1.00 43.48 ? 17  ALA J N   1 
ATOM 8505  C CA  . ALA J 1 17  ? 76.405  89.163  118.638 1.00 43.36 ? 17  ALA J CA  1 
ATOM 8506  C C   . ALA J 1 17  ? 75.579  90.114  117.761 1.00 43.29 ? 17  ALA J C   1 
ATOM 8507  O O   . ALA J 1 17  ? 74.928  89.668  116.814 1.00 43.40 ? 17  ALA J O   1 
ATOM 8508  C CB  . ALA J 1 17  ? 75.503  88.483  119.659 1.00 43.38 ? 17  ALA J CB  1 
ATOM 8509  N N   . ALA J 1 18  ? 75.594  91.407  118.084 1.00 43.01 ? 18  ALA J N   1 
ATOM 8510  C CA  . ALA J 1 18  ? 74.887  92.419  117.299 1.00 42.88 ? 18  ALA J CA  1 
ATOM 8511  C C   . ALA J 1 18  ? 75.693  92.852  116.076 1.00 42.74 ? 18  ALA J C   1 
ATOM 8512  O O   . ALA J 1 18  ? 75.197  92.794  114.949 1.00 42.83 ? 18  ALA J O   1 
ATOM 8513  C CB  . ALA J 1 18  ? 74.566  93.627  118.167 1.00 42.97 ? 18  ALA J CB  1 
ATOM 8514  N N   . VAL J 1 19  ? 76.935  93.274  116.310 1.00 42.61 ? 19  VAL J N   1 
ATOM 8515  C CA  . VAL J 1 19  ? 77.760  93.905  115.263 1.00 42.61 ? 19  VAL J CA  1 
ATOM 8516  C C   . VAL J 1 19  ? 78.334  92.938  114.219 1.00 42.56 ? 19  VAL J C   1 
ATOM 8517  O O   . VAL J 1 19  ? 78.375  93.270  113.032 1.00 42.66 ? 19  VAL J O   1 
ATOM 8518  C CB  . VAL J 1 19  ? 78.910  94.769  115.857 1.00 42.69 ? 19  VAL J CB  1 
ATOM 8519  C CG1 . VAL J 1 19  ? 78.354  95.812  116.820 1.00 42.75 ? 19  VAL J CG1 1 
ATOM 8520  C CG2 . VAL J 1 19  ? 79.988  93.918  116.529 1.00 42.69 ? 19  VAL J CG2 1 
ATOM 8521  N N   . LEU J 1 20  ? 78.767  91.753  114.653 1.00 42.47 ? 20  LEU J N   1 
ATOM 8522  C CA  . LEU J 1 20  ? 79.452  90.801  113.765 1.00 42.47 ? 20  LEU J CA  1 
ATOM 8523  C C   . LEU J 1 20  ? 78.516  90.044  112.814 1.00 42.21 ? 20  LEU J C   1 
ATOM 8524  O O   . LEU J 1 20  ? 78.968  89.546  111.779 1.00 42.16 ? 20  LEU J O   1 
ATOM 8525  C CB  . LEU J 1 20  ? 80.280  89.802  114.579 1.00 42.79 ? 20  LEU J CB  1 
ATOM 8526  C CG  . LEU J 1 20  ? 81.351  90.383  115.510 1.00 43.17 ? 20  LEU J CG  1 
ATOM 8527  C CD1 . LEU J 1 20  ? 81.972  89.280  116.352 1.00 43.27 ? 20  LEU J CD1 1 
ATOM 8528  C CD2 . LEU J 1 20  ? 82.426  91.116  114.720 1.00 43.25 ? 20  LEU J CD2 1 
ATOM 8529  N N   . ILE J 1 21  ? 77.231  89.952  113.163 1.00 41.85 ? 21  ILE J N   1 
ATOM 8530  C CA  . ILE J 1 21  ? 76.228  89.304  112.309 1.00 41.51 ? 21  ILE J CA  1 
ATOM 8531  C C   . ILE J 1 21  ? 75.920  90.270  111.153 1.00 41.13 ? 21  ILE J C   1 
ATOM 8532  O O   . ILE J 1 21  ? 75.416  91.368  111.396 1.00 41.33 ? 21  ILE J O   1 
ATOM 8533  C CB  . ILE J 1 21  ? 74.936  88.943  113.097 1.00 41.75 ? 21  ILE J CB  1 
ATOM 8534  C CG1 . ILE J 1 21  ? 75.116  87.651  113.917 1.00 41.94 ? 21  ILE J CG1 1 
ATOM 8535  C CG2 . ILE J 1 21  ? 73.746  88.720  112.165 1.00 41.83 ? 21  ILE J CG2 1 
ATOM 8536  C CD1 . ILE J 1 21  ? 76.360  87.559  114.779 1.00 42.01 ? 21  ILE J CD1 1 
ATOM 8537  N N   . PRO J 1 22  ? 76.220  89.868  109.898 1.00 40.49 ? 22  PRO J N   1 
ATOM 8538  C CA  . PRO J 1 22  ? 76.047  90.776  108.762 1.00 40.05 ? 22  PRO J CA  1 
ATOM 8539  C C   . PRO J 1 22  ? 74.596  90.897  108.294 1.00 39.58 ? 22  PRO J C   1 
ATOM 8540  O O   . PRO J 1 22  ? 73.730  90.142  108.747 1.00 39.64 ? 22  PRO J O   1 
ATOM 8541  C CB  . PRO J 1 22  ? 76.896  90.121  107.675 1.00 40.17 ? 22  PRO J CB  1 
ATOM 8542  C CG  . PRO J 1 22  ? 76.768  88.665  107.956 1.00 40.35 ? 22  PRO J CG  1 
ATOM 8543  C CD  . PRO J 1 22  ? 76.669  88.534  109.453 1.00 40.46 ? 22  PRO J CD  1 
ATOM 8544  N N   . ASN J 1 23  ? 74.351  91.844  107.389 1.00 38.96 ? 23  ASN J N   1 
ATOM 8545  C CA  . ASN J 1 23  ? 73.037  92.021  106.773 1.00 38.42 ? 23  ASN J CA  1 
ATOM 8546  C C   . ASN J 1 23  ? 72.811  90.891  105.767 1.00 38.17 ? 23  ASN J C   1 
ATOM 8547  O O   . ASN J 1 23  ? 73.407  90.880  104.687 1.00 38.30 ? 23  ASN J O   1 
ATOM 8548  C CB  . ASN J 1 23  ? 72.941  93.395  106.093 1.00 38.26 ? 23  ASN J CB  1 
ATOM 8549  C CG  . ASN J 1 23  ? 71.517  93.770  105.713 1.00 38.22 ? 23  ASN J CG  1 
ATOM 8550  O OD1 . ASN J 1 23  ? 70.817  93.014  105.041 1.00 38.19 ? 23  ASN J OD1 1 
ATOM 8551  N ND2 . ASN J 1 23  ? 71.087  94.954  106.135 1.00 38.32 ? 23  ASN J ND2 1 
ATOM 8552  N N   . LEU J 1 24  ? 71.956  89.938  106.138 1.00 37.77 ? 24  LEU J N   1 
ATOM 8553  C CA  . LEU J 1 24  ? 71.689  88.761  105.310 1.00 37.53 ? 24  LEU J CA  1 
ATOM 8554  C C   . LEU J 1 24  ? 70.785  89.091  104.125 1.00 37.24 ? 24  LEU J C   1 
ATOM 8555  O O   . LEU J 1 24  ? 71.077  88.689  102.999 1.00 37.38 ? 24  LEU J O   1 
ATOM 8556  C CB  . LEU J 1 24  ? 71.061  87.640  106.146 1.00 37.66 ? 24  LEU J CB  1 
ATOM 8557  C CG  . LEU J 1 24  ? 71.886  87.115  107.328 1.00 37.78 ? 24  LEU J CG  1 
ATOM 8558  C CD1 . LEU J 1 24  ? 71.029  86.238  108.228 1.00 37.90 ? 24  LEU J CD1 1 
ATOM 8559  C CD2 . LEU J 1 24  ? 73.115  86.349  106.859 1.00 37.72 ? 24  LEU J CD2 1 
ATOM 8560  N N   . LEU J 1 25  ? 69.700  89.826  104.382 1.00 36.76 ? 25  LEU J N   1 
ATOM 8561  C CA  . LEU J 1 25  ? 68.706  90.164  103.352 1.00 36.40 ? 25  LEU J CA  1 
ATOM 8562  C C   . LEU J 1 25  ? 69.314  90.904  102.164 1.00 35.85 ? 25  LEU J C   1 
ATOM 8563  O O   . LEU J 1 25  ? 68.988  90.606  101.015 1.00 35.80 ? 25  LEU J O   1 
ATOM 8564  C CB  . LEU J 1 25  ? 67.568  91.007  103.948 1.00 36.59 ? 25  LEU J CB  1 
ATOM 8565  C CG  . LEU J 1 25  ? 66.379  91.346  103.035 1.00 36.81 ? 25  LEU J CG  1 
ATOM 8566  C CD1 . LEU J 1 25  ? 65.638  90.086  102.612 1.00 36.91 ? 25  LEU J CD1 1 
ATOM 8567  C CD2 . LEU J 1 25  ? 65.431  92.318  103.722 1.00 36.92 ? 25  LEU J CD2 1 
ATOM 8568  N N   . ALA J 1 26  ? 70.193  91.862  102.451 1.00 35.52 ? 26  ALA J N   1 
ATOM 8569  C CA  . ALA J 1 26  ? 70.868  92.642  101.411 1.00 35.27 ? 26  ALA J CA  1 
ATOM 8570  C C   . ALA J 1 26  ? 71.845  91.789  100.596 1.00 34.96 ? 26  ALA J C   1 
ATOM 8571  O O   . ALA J 1 26  ? 71.927  91.936  99.376  1.00 34.98 ? 26  ALA J O   1 
ATOM 8572  C CB  . ALA J 1 26  ? 71.585  93.841  102.021 1.00 35.29 ? 26  ALA J CB  1 
ATOM 8573  N N   . ALA J 1 27  ? 72.572  90.900  101.272 1.00 34.79 ? 27  ALA J N   1 
ATOM 8574  C CA  . ALA J 1 27  ? 73.513  89.985  100.612 1.00 34.77 ? 27  ALA J CA  1 
ATOM 8575  C C   . ALA J 1 27  ? 72.835  89.046  99.607  1.00 34.60 ? 27  ALA J C   1 
ATOM 8576  O O   . ALA J 1 27  ? 73.397  88.767  98.547  1.00 34.63 ? 27  ALA J O   1 
ATOM 8577  C CB  . ALA J 1 27  ? 74.278  89.174  101.649 1.00 34.88 ? 27  ALA J CB  1 
ATOM 8578  N N   . ARG J 1 28  ? 71.637  88.568  99.945  1.00 34.46 ? 28  ARG J N   1 
ATOM 8579  C CA  . ARG J 1 28  ? 70.875  87.673  99.065  1.00 34.32 ? 28  ARG J CA  1 
ATOM 8580  C C   . ARG J 1 28  ? 70.287  88.382  97.840  1.00 34.16 ? 28  ARG J C   1 
ATOM 8581  O O   . ARG J 1 28  ? 70.200  87.773  96.774  1.00 34.28 ? 28  ARG J O   1 
ATOM 8582  C CB  . ARG J 1 28  ? 69.757  86.962  99.836  1.00 34.46 ? 28  ARG J CB  1 
ATOM 8583  C CG  . ARG J 1 28  ? 70.255  86.058  100.954 1.00 34.64 ? 28  ARG J CG  1 
ATOM 8584  C CD  . ARG J 1 28  ? 69.229  85.001  101.338 1.00 34.76 ? 28  ARG J CD  1 
ATOM 8585  N NE  . ARG J 1 28  ? 69.303  83.822  100.474 1.00 34.86 ? 28  ARG J NE  1 
ATOM 8586  C CZ  . ARG J 1 28  ? 70.239  82.870  100.543 1.00 35.08 ? 28  ARG J CZ  1 
ATOM 8587  N NH1 . ARG J 1 28  ? 70.191  81.845  99.697  1.00 35.19 ? 28  ARG J NH1 1 
ATOM 8588  N NH2 . ARG J 1 28  ? 71.226  82.925  101.440 1.00 35.14 ? 28  ARG J NH2 1 
ATOM 8589  N N   . LYS J 1 29  ? 69.882  89.647  97.993  1.00 34.02 ? 29  LYS J N   1 
ATOM 8590  C CA  . LYS J 1 29  ? 69.333  90.446  96.877  1.00 33.92 ? 29  LYS J CA  1 
ATOM 8591  C C   . LYS J 1 29  ? 70.233  90.462  95.639  1.00 33.86 ? 29  LYS J C   1 
ATOM 8592  O O   . LYS J 1 29  ? 69.746  90.322  94.517  1.00 34.02 ? 29  LYS J O   1 
ATOM 8593  C CB  . LYS J 1 29  ? 69.062  91.898  97.304  1.00 33.96 ? 29  LYS J CB  1 
ATOM 8594  C CG  . LYS J 1 29  ? 67.769  92.116  98.072  1.00 34.05 ? 29  LYS J CG  1 
ATOM 8595  C CD  . LYS J 1 29  ? 67.410  93.595  98.112  1.00 34.19 ? 29  LYS J CD  1 
ATOM 8596  C CE  . LYS J 1 29  ? 66.194  93.869  98.984  1.00 34.36 ? 29  LYS J CE  1 
ATOM 8597  N NZ  . LYS J 1 29  ? 66.522  93.928  100.437 1.00 34.43 ? 29  LYS J NZ  1 
ATOM 8598  N N   . ARG J 1 30  ? 71.537  90.629  95.853  1.00 33.59 ? 30  ARG J N   1 
ATOM 8599  C CA  . ARG J 1 30  ? 72.508  90.699  94.755  1.00 33.40 ? 30  ARG J CA  1 
ATOM 8600  C C   . ARG J 1 30  ? 72.787  89.319  94.159  1.00 33.27 ? 30  ARG J C   1 
ATOM 8601  O O   . ARG J 1 30  ? 73.023  89.201  92.955  1.00 33.42 ? 30  ARG J O   1 
ATOM 8602  C CB  . ARG J 1 30  ? 73.819  91.345  95.218  1.00 33.43 ? 30  ARG J CB  1 
ATOM 8603  C CG  . ARG J 1 30  ? 73.679  92.718  95.868  1.00 33.49 ? 30  ARG J CG  1 
ATOM 8604  C CD  . ARG J 1 30  ? 73.050  93.760  94.951  1.00 33.56 ? 30  ARG J CD  1 
ATOM 8605  N NE  . ARG J 1 30  ? 72.751  95.011  95.652  1.00 33.57 ? 30  ARG J NE  1 
ATOM 8606  C CZ  . ARG J 1 30  ? 72.219  96.096  95.085  1.00 33.63 ? 30  ARG J CZ  1 
ATOM 8607  N NH1 . ARG J 1 30  ? 71.914  96.115  93.787  1.00 33.65 ? 30  ARG J NH1 1 
ATOM 8608  N NH2 . ARG J 1 30  ? 71.990  97.179  95.824  1.00 33.67 ? 30  ARG J NH2 1 
ATOM 8609  N N   . ALA J 1 31  ? 72.771  88.290  95.004  1.00 32.98 ? 31  ALA J N   1 
ATOM 8610  C CA  . ALA J 1 31  ? 72.852  86.902  94.544  1.00 32.87 ? 31  ALA J CA  1 
ATOM 8611  C C   . ALA J 1 31  ? 71.612  86.501  93.741  1.00 32.84 ? 31  ALA J C   1 
ATOM 8612  O O   . ALA J 1 31  ? 71.719  85.759  92.765  1.00 32.95 ? 31  ALA J O   1 
ATOM 8613  C CB  . ALA J 1 31  ? 73.038  85.964  95.725  1.00 32.90 ? 31  ALA J CB  1 
ATOM 8614  N N   . ASN J 1 32  ? 70.446  86.988  94.166  1.00 32.86 ? 32  ASN J N   1 
ATOM 8615  C CA  . ASN J 1 32  ? 69.189  86.779  93.435  1.00 32.92 ? 32  ASN J CA  1 
ATOM 8616  C C   . ASN J 1 32  ? 69.175  87.470  92.066  1.00 33.12 ? 32  ASN J C   1 
ATOM 8617  O O   . ASN J 1 32  ? 68.582  86.948  91.119  1.00 33.24 ? 32  ASN J O   1 
ATOM 8618  C CB  . ASN J 1 32  ? 67.987  87.260  94.264  1.00 32.83 ? 32  ASN J CB  1 
ATOM 8619  C CG  . ASN J 1 32  ? 67.697  86.372  95.467  1.00 32.76 ? 32  ASN J CG  1 
ATOM 8620  O OD1 . ASN J 1 32  ? 67.831  85.150  95.388  1.00 32.77 ? 32  ASN J OD1 1 
ATOM 8621  N ND2 . ASN J 1 32  ? 67.304  86.976  96.584  1.00 32.81 ? 32  ASN J ND2 1 
ATOM 8622  N N   . ASP J 1 33  ? 69.814  88.637  91.971  1.00 33.25 ? 33  ASP J N   1 
ATOM 8623  C CA  . ASP J 1 33  ? 69.982  89.336  90.687  1.00 33.42 ? 33  ASP J CA  1 
ATOM 8624  C C   . ASP J 1 33  ? 70.877  88.555  89.723  1.00 33.48 ? 33  ASP J C   1 
ATOM 8625  O O   . ASP J 1 33  ? 70.635  88.556  88.515  1.00 33.61 ? 33  ASP J O   1 
ATOM 8626  C CB  . ASP J 1 33  ? 70.569  90.739  90.893  1.00 33.64 ? 33  ASP J CB  1 
ATOM 8627  C CG  . ASP J 1 33  ? 69.626  91.680  91.631  1.00 33.90 ? 33  ASP J CG  1 
ATOM 8628  O OD1 . ASP J 1 33  ? 68.415  91.387  91.742  1.00 33.97 ? 33  ASP J OD1 1 
ATOM 8629  O OD2 . ASP J 1 33  ? 70.109  92.731  92.105  1.00 34.02 ? 33  ASP J OD2 1 
ATOM 8630  N N   . THR J 1 34  ? 71.908  87.903  90.262  1.00 33.41 ? 34  THR J N   1 
ATOM 8631  C CA  . THR J 1 34  ? 72.797  87.044  89.473  1.00 33.36 ? 34  THR J CA  1 
ATOM 8632  C C   . THR J 1 34  ? 72.059  85.839  88.879  1.00 33.33 ? 34  THR J C   1 
ATOM 8633  O O   . THR J 1 34  ? 72.361  85.425  87.762  1.00 33.44 ? 34  THR J O   1 
ATOM 8634  C CB  . THR J 1 34  ? 73.987  86.533  90.316  1.00 33.50 ? 34  THR J CB  1 
ATOM 8635  O OG1 . THR J 1 34  ? 74.558  87.620  91.055  1.00 33.50 ? 34  THR J OG1 1 
ATOM 8636  C CG2 . THR J 1 34  ? 75.064  85.903  89.431  1.00 33.60 ? 34  THR J CG2 1 
ATOM 8637  N N   . VAL J 1 35  ? 71.101  85.291  89.628  1.00 33.30 ? 35  VAL J N   1 
ATOM 8638  C CA  . VAL J 1 35  ? 70.265  84.175  89.157  1.00 33.32 ? 35  VAL J CA  1 
ATOM 8639  C C   . VAL J 1 35  ? 69.357  84.621  88.005  1.00 33.25 ? 35  VAL J C   1 
ATOM 8640  O O   . VAL J 1 35  ? 69.189  83.888  87.028  1.00 33.36 ? 35  VAL J O   1 
ATOM 8641  C CB  . VAL J 1 35  ? 69.415  83.569  90.306  1.00 33.52 ? 35  VAL J CB  1 
ATOM 8642  C CG1 . VAL J 1 35  ? 68.405  82.544  89.786  1.00 33.63 ? 35  VAL J CG1 1 
ATOM 8643  C CG2 . VAL J 1 35  ? 70.313  82.923  91.354  1.00 33.60 ? 35  VAL J CG2 1 
ATOM 8644  N N   . VAL J 1 36  ? 68.779  85.815  88.132  1.00 33.13 ? 36  VAL J N   1 
ATOM 8645  C CA  . VAL J 1 36  ? 67.912  86.386  87.094  1.00 33.03 ? 36  VAL J CA  1 
ATOM 8646  C C   . VAL J 1 36  ? 68.723  86.766  85.852  1.00 33.02 ? 36  VAL J C   1 
ATOM 8647  O O   . VAL J 1 36  ? 68.294  86.502  84.727  1.00 33.10 ? 36  VAL J O   1 
ATOM 8648  C CB  . VAL J 1 36  ? 67.131  87.619  87.618  1.00 33.02 ? 36  VAL J CB  1 
ATOM 8649  C CG1 . VAL J 1 36  ? 66.376  88.322  86.492  1.00 33.08 ? 36  VAL J CG1 1 
ATOM 8650  C CG2 . VAL J 1 36  ? 66.161  87.211  88.719  1.00 33.01 ? 36  VAL J CG2 1 
ATOM 8651  N N   . THR J 1 37  ? 69.882  87.389  86.065  1.00 33.06 ? 37  THR J N   1 
ATOM 8652  C CA  . THR J 1 37  ? 70.783  87.767  84.971  1.00 33.11 ? 37  THR J CA  1 
ATOM 8653  C C   . THR J 1 37  ? 71.342  86.542  84.241  1.00 33.10 ? 37  THR J C   1 
ATOM 8654  O O   . THR J 1 37  ? 71.453  86.555  83.015  1.00 33.26 ? 37  THR J O   1 
ATOM 8655  C CB  . THR J 1 37  ? 71.957  88.636  85.477  1.00 33.23 ? 37  THR J CB  1 
ATOM 8656  O OG1 . THR J 1 37  ? 71.447  89.746  86.227  1.00 33.31 ? 37  THR J OG1 1 
ATOM 8657  C CG2 . THR J 1 37  ? 72.802  89.161  84.313  1.00 33.28 ? 37  THR J CG2 1 
ATOM 8658  N N   . ALA J 1 38  ? 71.687  85.498  84.995  1.00 33.05 ? 38  ALA J N   1 
ATOM 8659  C CA  . ALA J 1 38  ? 72.190  84.246  84.417  1.00 33.10 ? 38  ALA J CA  1 
ATOM 8660  C C   . ALA J 1 38  ? 71.130  83.515  83.597  1.00 33.09 ? 38  ALA J C   1 
ATOM 8661  O O   . ALA J 1 38  ? 71.427  83.017  82.511  1.00 33.10 ? 38  ALA J O   1 
ATOM 8662  C CB  . ALA J 1 38  ? 72.728  83.329  85.508  1.00 33.16 ? 38  ALA J CB  1 
ATOM 8663  N N   . TYR J 1 39  ? 69.905  83.453  84.120  1.00 33.22 ? 39  TYR J N   1 
ATOM 8664  C CA  . TYR J 1 39  ? 68.797  82.781  83.430  1.00 33.27 ? 39  TYR J CA  1 
ATOM 8665  C C   . TYR J 1 39  ? 68.375  83.515  82.155  1.00 33.48 ? 39  TYR J C   1 
ATOM 8666  O O   . TYR J 1 39  ? 68.045  82.873  81.156  1.00 33.64 ? 39  TYR J O   1 
ATOM 8667  C CB  . TYR J 1 39  ? 67.589  82.608  84.355  1.00 33.19 ? 39  TYR J CB  1 
ATOM 8668  C CG  . TYR J 1 39  ? 66.565  81.634  83.816  1.00 33.27 ? 39  TYR J CG  1 
ATOM 8669  C CD1 . TYR J 1 39  ? 66.752  80.256  83.941  1.00 33.33 ? 39  TYR J CD1 1 
ATOM 8670  C CD2 . TYR J 1 39  ? 65.413  82.084  83.168  1.00 33.35 ? 39  TYR J CD2 1 
ATOM 8671  C CE1 . TYR J 1 39  ? 65.820  79.355  83.442  1.00 33.32 ? 39  TYR J CE1 1 
ATOM 8672  C CE2 . TYR J 1 39  ? 64.475  81.190  82.667  1.00 33.36 ? 39  TYR J CE2 1 
ATOM 8673  C CZ  . TYR J 1 39  ? 64.682  79.829  82.806  1.00 33.36 ? 39  TYR J CZ  1 
ATOM 8674  O OH  . TYR J 1 39  ? 63.754  78.941  82.312  1.00 33.46 ? 39  TYR J OH  1 
ATOM 8675  N N   . LEU J 1 40  ? 68.379  84.848  82.197  1.00 33.68 ? 40  LEU J N   1 
ATOM 8676  C CA  . LEU J 1 40  ? 68.142  85.666  80.999  1.00 33.88 ? 40  LEU J CA  1 
ATOM 8677  C C   . LEU J 1 40  ? 69.289  85.553  79.993  1.00 34.31 ? 40  LEU J C   1 
ATOM 8678  O O   . LEU J 1 40  ? 69.048  85.531  78.787  1.00 34.49 ? 40  LEU J O   1 
ATOM 8679  C CB  . LEU J 1 40  ? 67.914  87.136  81.365  1.00 33.80 ? 40  LEU J CB  1 
ATOM 8680  C CG  . LEU J 1 40  ? 66.584  87.467  82.047  1.00 33.73 ? 40  LEU J CG  1 
ATOM 8681  C CD1 . LEU J 1 40  ? 66.640  88.860  82.645  1.00 33.66 ? 40  LEU J CD1 1 
ATOM 8682  C CD2 . LEU J 1 40  ? 65.416  87.353  81.077  1.00 33.70 ? 40  LEU J CD2 1 
ATOM 8683  N N   . ASN J 1 41  ? 70.525  85.489  80.492  1.00 34.79 ? 41  ASN J N   1 
ATOM 8684  C CA  . ASN J 1 41  ? 71.701  85.261  79.641  1.00 35.15 ? 41  ASN J CA  1 
ATOM 8685  C C   . ASN J 1 41  ? 71.637  83.890  78.959  1.00 35.40 ? 41  ASN J C   1 
ATOM 8686  O O   . ASN J 1 41  ? 72.014  83.760  77.794  1.00 35.49 ? 41  ASN J O   1 
ATOM 8687  C CB  . ASN J 1 41  ? 72.996  85.390  80.456  1.00 35.34 ? 41  ASN J CB  1 
ATOM 8688  C CG  . ASN J 1 41  ? 74.247  85.321  79.594  1.00 35.61 ? 41  ASN J CG  1 
ATOM 8689  O OD1 . ASN J 1 41  ? 74.324  85.942  78.533  1.00 35.79 ? 41  ASN J OD1 1 
ATOM 8690  N ND2 . ASN J 1 41  ? 75.241  84.569  80.055  1.00 35.71 ? 41  ASN J ND2 1 
ATOM 8691  N N   . ASP J 1 42  ? 71.162  82.880  79.689  1.00 35.76 ? 42  ASP J N   1 
ATOM 8692  C CA  . ASP J 1 42  ? 70.899  81.553  79.116  1.00 36.04 ? 42  ASP J CA  1 
ATOM 8693  C C   . ASP J 1 42  ? 69.708  81.578  78.156  1.00 36.01 ? 42  ASP J C   1 
ATOM 8694  O O   . ASP J 1 42  ? 69.751  80.941  77.105  1.00 36.17 ? 42  ASP J O   1 
ATOM 8695  C CB  . ASP J 1 42  ? 70.650  80.511  80.218  1.00 36.32 ? 42  ASP J CB  1 
ATOM 8696  C CG  . ASP J 1 42  ? 71.891  80.222  81.057  1.00 36.66 ? 42  ASP J CG  1 
ATOM 8697  O OD1 . ASP J 1 42  ? 73.011  80.178  80.500  1.00 36.82 ? 42  ASP J OD1 1 
ATOM 8698  O OD2 . ASP J 1 42  ? 71.742  80.028  82.282  1.00 36.78 ? 42  ASP J OD2 1 
ATOM 8699  N N   . ALA J 1 43  ? 68.656  82.311  78.521  1.00 35.92 ? 43  ALA J N   1 
ATOM 8700  C CA  . ALA J 1 43  ? 67.464  82.460  77.675  1.00 35.94 ? 43  ALA J CA  1 
ATOM 8701  C C   . ALA J 1 43  ? 67.773  83.098  76.318  1.00 36.00 ? 43  ALA J C   1 
ATOM 8702  O O   . ALA J 1 43  ? 67.183  82.716  75.310  1.00 36.16 ? 43  ALA J O   1 
ATOM 8703  C CB  . ALA J 1 43  ? 66.393  83.264  78.399  1.00 35.95 ? 43  ALA J CB  1 
ATOM 8704  N N   . VAL J 1 44  ? 68.690  84.065  76.306  1.00 36.18 ? 44  VAL J N   1 
ATOM 8705  C CA  . VAL J 1 44  ? 69.148  84.710  75.065  1.00 36.35 ? 44  VAL J CA  1 
ATOM 8706  C C   . VAL J 1 44  ? 69.874  83.717  74.143  1.00 36.53 ? 44  VAL J C   1 
ATOM 8707  O O   . VAL J 1 44  ? 69.724  83.790  72.922  1.00 36.62 ? 44  VAL J O   1 
ATOM 8708  C CB  . VAL J 1 44  ? 70.043  85.947  75.368  1.00 36.45 ? 44  VAL J CB  1 
ATOM 8709  C CG1 . VAL J 1 44  ? 70.748  86.467  74.116  1.00 36.57 ? 44  VAL J CG1 1 
ATOM 8710  C CG2 . VAL J 1 44  ? 69.217  87.062  76.008  1.00 36.45 ? 44  VAL J CG2 1 
ATOM 8711  N N   . LYS J 1 45  ? 70.648  82.800  74.725  1.00 36.84 ? 45  LYS J N   1 
ATOM 8712  C CA  . LYS J 1 45  ? 71.373  81.782  73.950  1.00 37.12 ? 45  LYS J CA  1 
ATOM 8713  C C   . LYS J 1 45  ? 70.427  80.812  73.245  1.00 37.00 ? 45  LYS J C   1 
ATOM 8714  O O   . LYS J 1 45  ? 70.568  80.570  72.046  1.00 37.15 ? 45  LYS J O   1 
ATOM 8715  C CB  . LYS J 1 45  ? 72.352  81.003  74.839  1.00 37.49 ? 45  LYS J CB  1 
ATOM 8716  C CG  . LYS J 1 45  ? 73.517  81.835  75.356  1.00 37.82 ? 45  LYS J CG  1 
ATOM 8717  C CD  . LYS J 1 45  ? 74.231  81.155  76.514  1.00 38.10 ? 45  LYS J CD  1 
ATOM 8718  C CE  . LYS J 1 45  ? 75.281  82.067  77.130  1.00 38.33 ? 45  LYS J CE  1 
ATOM 8719  N NZ  . LYS J 1 45  ? 75.904  81.480  78.349  1.00 38.49 ? 45  LYS J NZ  1 
ATOM 8720  N N   . PHE J 1 46  ? 69.465  80.269  73.988  1.00 36.90 ? 46  PHE J N   1 
ATOM 8721  C CA  . PHE J 1 46  ? 68.483  79.332  73.422  1.00 36.84 ? 46  PHE J CA  1 
ATOM 8722  C C   . PHE J 1 46  ? 67.449  79.990  72.497  1.00 36.81 ? 46  PHE J C   1 
ATOM 8723  O O   . PHE J 1 46  ? 66.794  79.293  71.721  1.00 36.96 ? 46  PHE J O   1 
ATOM 8724  C CB  . PHE J 1 46  ? 67.796  78.524  74.529  1.00 36.83 ? 46  PHE J CB  1 
ATOM 8725  C CG  . PHE J 1 46  ? 68.675  77.462  75.125  1.00 36.90 ? 46  PHE J CG  1 
ATOM 8726  C CD1 . PHE J 1 46  ? 68.875  76.259  74.457  1.00 37.06 ? 46  PHE J CD1 1 
ATOM 8727  C CD2 . PHE J 1 46  ? 69.321  77.666  76.339  1.00 36.99 ? 46  PHE J CD2 1 
ATOM 8728  C CE1 . PHE J 1 46  ? 69.695  75.276  74.992  1.00 37.14 ? 46  PHE J CE1 1 
ATOM 8729  C CE2 . PHE J 1 46  ? 70.140  76.686  76.883  1.00 37.16 ? 46  PHE J CE2 1 
ATOM 8730  C CZ  . PHE J 1 46  ? 70.329  75.489  76.207  1.00 37.19 ? 46  PHE J CZ  1 
ATOM 8731  N N   . GLN J 1 47  ? 67.299  81.313  72.585  1.00 36.77 ? 47  GLN J N   1 
ATOM 8732  C CA  . GLN J 1 47  ? 66.540  82.076  71.584  1.00 36.82 ? 47  GLN J CA  1 
ATOM 8733  C C   . GLN J 1 47  ? 67.273  82.103  70.240  1.00 37.07 ? 47  GLN J C   1 
ATOM 8734  O O   . GLN J 1 47  ? 66.643  81.980  69.188  1.00 37.28 ? 47  GLN J O   1 
ATOM 8735  C CB  . GLN J 1 47  ? 66.262  83.510  72.060  1.00 36.79 ? 47  GLN J CB  1 
ATOM 8736  C CG  . GLN J 1 47  ? 65.136  83.625  73.079  1.00 36.85 ? 47  GLN J CG  1 
ATOM 8737  C CD  . GLN J 1 47  ? 63.755  83.712  72.449  1.00 36.98 ? 47  GLN J CD  1 
ATOM 8738  O OE1 . GLN J 1 47  ? 63.484  83.086  71.423  1.00 37.07 ? 47  GLN J OE1 1 
ATOM 8739  N NE2 . GLN J 1 47  ? 62.872  84.485  73.069  1.00 37.07 ? 47  GLN J NE2 1 
ATOM 8740  N N   . GLU J 1 48  ? 68.597  82.268  70.282  1.00 37.41 ? 48  GLU J N   1 
ATOM 8741  C CA  . GLU J 1 48  ? 69.436  82.212  69.077  1.00 37.74 ? 48  GLU J CA  1 
ATOM 8742  C C   . GLU J 1 48  ? 69.514  80.804  68.478  1.00 37.83 ? 48  GLU J C   1 
ATOM 8743  O O   . GLU J 1 48  ? 69.644  80.660  67.263  1.00 38.01 ? 48  GLU J O   1 
ATOM 8744  C CB  . GLU J 1 48  ? 70.853  82.732  69.364  1.00 38.07 ? 48  GLU J CB  1 
ATOM 8745  C CG  . GLU J 1 48  ? 70.929  84.217  69.704  1.00 38.39 ? 48  GLU J CG  1 
ATOM 8746  C CD  . GLU J 1 48  ? 70.668  85.127  68.513  1.00 38.68 ? 48  GLU J CD  1 
ATOM 8747  O OE1 . GLU J 1 48  ? 71.252  84.896  67.431  1.00 38.76 ? 48  GLU J OE1 1 
ATOM 8748  O OE2 . GLU J 1 48  ? 69.882  86.089  68.661  1.00 38.77 ? 48  GLU J OE2 1 
ATOM 8749  N N   . MET J 1 49  ? 69.449  79.775  69.325  1.00 37.94 ? 49  MET J N   1 
ATOM 8750  C CA  . MET J 1 49  ? 69.414  78.381  68.857  1.00 38.06 ? 49  MET J CA  1 
ATOM 8751  C C   . MET J 1 49  ? 68.096  78.028  68.162  1.00 37.98 ? 49  MET J C   1 
ATOM 8752  O O   . MET J 1 49  ? 68.092  77.255  67.203  1.00 38.26 ? 49  MET J O   1 
ATOM 8753  C CB  . MET J 1 49  ? 69.674  77.410  70.011  1.00 38.24 ? 49  MET J CB  1 
ATOM 8754  C CG  . MET J 1 49  ? 71.106  77.446  70.515  1.00 38.47 ? 49  MET J CG  1 
ATOM 8755  S SD  . MET J 1 49  ? 71.390  76.436  71.980  1.00 38.86 ? 49  MET J SD  1 
ATOM 8756  C CE  . MET J 1 49  ? 71.025  74.804  71.341  1.00 38.96 ? 49  MET J CE  1 
ATOM 8757  N N   . TYR J 1 50  ? 66.989  78.586  68.650  1.00 37.79 ? 50  TYR J N   1 
ATOM 8758  C CA  . TYR J 1 50  ? 65.686  78.437  67.993  1.00 37.80 ? 50  TYR J CA  1 
ATOM 8759  C C   . TYR J 1 50  ? 65.628  79.219  66.674  1.00 38.04 ? 50  TYR J C   1 
ATOM 8760  O O   . TYR J 1 50  ? 64.941  78.805  65.736  1.00 38.25 ? 50  TYR J O   1 
ATOM 8761  C CB  . TYR J 1 50  ? 64.558  78.893  68.922  1.00 37.76 ? 50  TYR J CB  1 
ATOM 8762  C CG  . TYR J 1 50  ? 63.184  78.412  68.512  1.00 37.79 ? 50  TYR J CG  1 
ATOM 8763  C CD1 . TYR J 1 50  ? 62.387  79.163  67.648  1.00 37.66 ? 50  TYR J CD1 1 
ATOM 8764  C CD2 . TYR J 1 50  ? 62.669  77.212  69.004  1.00 37.87 ? 50  TYR J CD2 1 
ATOM 8765  C CE1 . TYR J 1 50  ? 61.122  78.728  67.278  1.00 37.67 ? 50  TYR J CE1 1 
ATOM 8766  C CE2 . TYR J 1 50  ? 61.405  76.768  68.638  1.00 37.85 ? 50  TYR J CE2 1 
ATOM 8767  C CZ  . TYR J 1 50  ? 60.635  77.530  67.776  1.00 37.80 ? 50  TYR J CZ  1 
ATOM 8768  O OH  . TYR J 1 50  ? 59.382  77.095  67.408  1.00 37.98 ? 50  TYR J OH  1 
ATOM 8769  N N   . GLN J 1 51  ? 66.337  80.347  66.618  1.00 38.31 ? 51  GLN J N   1 
ATOM 8770  C CA  . GLN J 1 51  ? 66.480  81.141  65.390  1.00 38.55 ? 51  GLN J CA  1 
ATOM 8771  C C   . GLN J 1 51  ? 67.226  80.379  64.285  1.00 38.78 ? 51  GLN J C   1 
ATOM 8772  O O   . GLN J 1 51  ? 66.945  80.576  63.102  1.00 38.94 ? 51  GLN J O   1 
ATOM 8773  C CB  . GLN J 1 51  ? 67.194  82.468  65.698  1.00 38.73 ? 51  GLN J CB  1 
ATOM 8774  C CG  . GLN J 1 51  ? 67.227  83.489  64.565  1.00 38.88 ? 51  GLN J CG  1 
ATOM 8775  C CD  . GLN J 1 51  ? 65.863  84.060  64.226  1.00 38.88 ? 51  GLN J CD  1 
ATOM 8776  O OE1 . GLN J 1 51  ? 65.105  84.455  65.110  1.00 38.93 ? 51  GLN J OE1 1 
ATOM 8777  N NE2 . GLN J 1 51  ? 65.554  84.128  62.937  1.00 38.97 ? 51  GLN J NE2 1 
ATOM 8778  N N   . ILE J 1 52  ? 68.175  79.524  64.670  1.00 38.96 ? 52  ILE J N   1 
ATOM 8779  C CA  . ILE J 1 52  ? 68.882  78.652  63.721  1.00 39.19 ? 52  ILE J CA  1 
ATOM 8780  C C   . ILE J 1 52  ? 67.932  77.604  63.124  1.00 39.35 ? 52  ILE J C   1 
ATOM 8781  O O   . ILE J 1 52  ? 67.969  77.348  61.918  1.00 39.50 ? 52  ILE J O   1 
ATOM 8782  C CB  . ILE J 1 52  ? 70.110  77.964  64.378  1.00 39.24 ? 52  ILE J CB  1 
ATOM 8783  C CG1 . ILE J 1 52  ? 71.179  79.009  64.727  1.00 39.33 ? 52  ILE J CG1 1 
ATOM 8784  C CG2 . ILE J 1 52  ? 70.720  76.903  63.459  1.00 39.29 ? 52  ILE J CG2 1 
ATOM 8785  C CD1 . ILE J 1 52  ? 72.151  78.575  65.806  1.00 39.33 ? 52  ILE J CD1 1 
ATOM 8786  N N   . ASP J 1 53  ? 67.085  77.016  63.968  1.00 39.54 ? 53  ASP J N   1 
ATOM 8787  C CA  . ASP J 1 53  ? 66.167  75.955  63.542  1.00 39.77 ? 53  ASP J CA  1 
ATOM 8788  C C   . ASP J 1 53  ? 64.974  76.494  62.754  1.00 39.75 ? 53  ASP J C   1 
ATOM 8789  O O   . ASP J 1 53  ? 64.776  76.128  61.593  1.00 39.95 ? 53  ASP J O   1 
ATOM 8790  C CB  . ASP J 1 53  ? 65.664  75.160  64.754  1.00 40.03 ? 53  ASP J CB  1 
ATOM 8791  C CG  . ASP J 1 53  ? 66.780  74.430  65.486  1.00 40.34 ? 53  ASP J CG  1 
ATOM 8792  O OD1 . ASP J 1 53  ? 67.965  74.754  65.261  1.00 40.49 ? 53  ASP J OD1 1 
ATOM 8793  O OD2 . ASP J 1 53  ? 66.466  73.530  66.295  1.00 40.58 ? 53  ASP J OD2 1 
ATOM 8794  N N   . ASN J 1 54  ? 64.197  77.370  63.391  1.00 39.52 ? 54  ASN J N   1 
ATOM 8795  C CA  . ASN J 1 54  ? 62.894  77.805  62.869  1.00 39.56 ? 54  ASN J CA  1 
ATOM 8796  C C   . ASN J 1 54  ? 62.887  79.143  62.113  1.00 39.43 ? 54  ASN J C   1 
ATOM 8797  O O   . ASN J 1 54  ? 61.876  79.480  61.493  1.00 39.61 ? 54  ASN J O   1 
ATOM 8798  C CB  . ASN J 1 54  ? 61.880  77.879  64.016  1.00 39.76 ? 54  ASN J CB  1 
ATOM 8799  C CG  . ASN J 1 54  ? 61.625  76.529  64.662  1.00 39.96 ? 54  ASN J CG  1 
ATOM 8800  O OD1 . ASN J 1 54  ? 60.613  75.882  64.394  1.00 40.17 ? 54  ASN J OD1 1 
ATOM 8801  N ND2 . ASN J 1 54  ? 62.545  76.099  65.519  1.00 40.00 ? 54  ASN J ND2 1 
ATOM 8802  N N   . ASN J 1 55  ? 63.993  79.892  62.165  1.00 39.07 ? 55  ASN J N   1 
ATOM 8803  C CA  . ASN J 1 55  ? 64.087  81.244  61.581  1.00 38.83 ? 55  ASN J CA  1 
ATOM 8804  C C   . ASN J 1 55  ? 63.078  82.222  62.205  1.00 38.56 ? 55  ASN J C   1 
ATOM 8805  O O   . ASN J 1 55  ? 62.447  83.018  61.505  1.00 38.71 ? 55  ASN J O   1 
ATOM 8806  C CB  . ASN J 1 55  ? 63.947  81.207  60.048  1.00 39.00 ? 55  ASN J CB  1 
ATOM 8807  C CG  . ASN J 1 55  ? 64.854  80.177  59.396  1.00 39.27 ? 55  ASN J CG  1 
ATOM 8808  O OD1 . ASN J 1 55  ? 64.426  79.422  58.524  1.00 39.50 ? 55  ASN J OD1 1 
ATOM 8809  N ND2 . ASN J 1 55  ? 66.115  80.141  59.818  1.00 39.40 ? 55  ASN J ND2 1 
ATOM 8810  N N   . SER J 1 56  ? 62.947  82.152  63.529  1.00 38.22 ? 56  SER J N   1 
ATOM 8811  C CA  . SER J 1 56  ? 62.059  83.035  64.294  1.00 37.99 ? 56  SER J CA  1 
ATOM 8812  C C   . SER J 1 56  ? 62.420  82.987  65.781  1.00 37.53 ? 56  SER J C   1 
ATOM 8813  O O   . SER J 1 56  ? 63.325  82.252  66.179  1.00 37.69 ? 56  SER J O   1 
ATOM 8814  C CB  . SER J 1 56  ? 60.596  82.624  64.099  1.00 38.25 ? 56  SER J CB  1 
ATOM 8815  O OG  . SER J 1 56  ? 59.716  83.548  64.718  1.00 38.43 ? 56  SER J OG  1 
ATOM 8816  N N   . TYR J 1 57  ? 61.722  83.787  66.588  1.00 36.99 ? 57  TYR J N   1 
ATOM 8817  C CA  . TYR J 1 57  ? 61.887  83.779  68.046  1.00 36.72 ? 57  TYR J CA  1 
ATOM 8818  C C   . TYR J 1 57  ? 60.630  83.242  68.733  1.00 36.67 ? 57  TYR J C   1 
ATOM 8819  O O   . TYR J 1 57  ? 59.517  83.396  68.224  1.00 36.63 ? 57  TYR J O   1 
ATOM 8820  C CB  . TYR J 1 57  ? 62.220  85.180  68.559  1.00 36.60 ? 57  TYR J CB  1 
ATOM 8821  C CG  . TYR J 1 57  ? 63.609  85.653  68.186  1.00 36.53 ? 57  TYR J CG  1 
ATOM 8822  C CD1 . TYR J 1 57  ? 64.741  85.087  68.775  1.00 36.47 ? 57  TYR J CD1 1 
ATOM 8823  C CD2 . TYR J 1 57  ? 63.799  86.672  67.250  1.00 36.51 ? 57  TYR J CD2 1 
ATOM 8824  C CE1 . TYR J 1 57  ? 66.019  85.516  68.441  1.00 36.34 ? 57  TYR J CE1 1 
ATOM 8825  C CE2 . TYR J 1 57  ? 65.073  87.108  66.909  1.00 36.42 ? 57  TYR J CE2 1 
ATOM 8826  C CZ  . TYR J 1 57  ? 66.179  86.528  67.507  1.00 36.34 ? 57  TYR J CZ  1 
ATOM 8827  O OH  . TYR J 1 57  ? 67.443  86.955  67.175  1.00 36.45 ? 57  TYR J OH  1 
ATOM 8828  N N   . THR J 1 58  ? 60.826  82.622  69.895  1.00 36.59 ? 58  THR J N   1 
ATOM 8829  C CA  . THR J 1 58  ? 59.762  81.919  70.609  1.00 36.53 ? 58  THR J CA  1 
ATOM 8830  C C   . THR J 1 58  ? 58.950  82.847  71.503  1.00 36.66 ? 58  THR J C   1 
ATOM 8831  O O   . THR J 1 58  ? 59.516  83.644  72.253  1.00 36.84 ? 58  THR J O   1 
ATOM 8832  C CB  . THR J 1 58  ? 60.339  80.811  71.509  1.00 36.65 ? 58  THR J CB  1 
ATOM 8833  O OG1 . THR J 1 58  ? 61.295  81.376  72.415  1.00 36.58 ? 58  THR J OG1 1 
ATOM 8834  C CG2 . THR J 1 58  ? 61.015  79.752  70.674  1.00 36.74 ? 58  THR J CG2 1 
ATOM 8835  N N   . SER J 1 59  ? 57.626  82.725  71.425  1.00 36.78 ? 59  SER J N   1 
ATOM 8836  C CA  . SER J 1 59  ? 56.720  83.385  72.362  1.00 36.85 ? 59  SER J CA  1 
ATOM 8837  C C   . SER J 1 59  ? 56.594  82.550  73.638  1.00 36.82 ? 59  SER J C   1 
ATOM 8838  O O   . SER J 1 59  ? 56.651  83.095  74.740  1.00 36.81 ? 59  SER J O   1 
ATOM 8839  C CB  . SER J 1 59  ? 55.343  83.586  71.725  1.00 37.11 ? 59  SER J CB  1 
ATOM 8840  O OG  . SER J 1 59  ? 54.516  84.402  72.540  1.00 37.24 ? 59  SER J OG  1 
ATOM 8841  N N   . ASN J 1 60  ? 56.421  81.238  73.478  1.00 36.97 ? 60  ASN J N   1 
ATOM 8842  C CA  . ASN J 1 60  ? 56.286  80.314  74.617  1.00 37.22 ? 60  ASN J CA  1 
ATOM 8843  C C   . ASN J 1 60  ? 57.642  79.884  75.193  1.00 37.20 ? 60  ASN J C   1 
ATOM 8844  O O   . ASN J 1 60  ? 58.644  79.829  74.476  1.00 37.13 ? 60  ASN J O   1 
ATOM 8845  C CB  . ASN J 1 60  ? 55.451  79.079  74.233  1.00 37.35 ? 60  ASN J CB  1 
ATOM 8846  C CG  . ASN J 1 60  ? 56.158  78.159  73.249  1.00 37.43 ? 60  ASN J CG  1 
ATOM 8847  O OD1 . ASN J 1 60  ? 56.882  78.613  72.361  1.00 37.43 ? 60  ASN J OD1 1 
ATOM 8848  N ND2 . ASN J 1 60  ? 55.939  76.857  73.398  1.00 37.57 ? 60  ASN J ND2 1 
ATOM 8849  N N   . GLN J 1 61  ? 57.649  79.577  76.489  1.00 37.16 ? 61  GLN J N   1 
ATOM 8850  C CA  . GLN J 1 61  ? 58.856  79.143  77.198  1.00 37.02 ? 61  GLN J CA  1 
ATOM 8851  C C   . GLN J 1 61  ? 59.196  77.676  76.922  1.00 36.99 ? 61  GLN J C   1 
ATOM 8852  O O   . GLN J 1 61  ? 60.373  77.317  76.869  1.00 37.14 ? 61  GLN J O   1 
ATOM 8853  C CB  . GLN J 1 61  ? 58.690  79.357  78.706  1.00 37.12 ? 61  GLN J CB  1 
ATOM 8854  C CG  . GLN J 1 61  ? 59.989  79.274  79.500  1.00 37.21 ? 61  GLN J CG  1 
ATOM 8855  C CD  . GLN J 1 61  ? 59.774  79.325  81.001  1.00 37.24 ? 61  GLN J CD  1 
ATOM 8856  O OE1 . GLN J 1 61  ? 58.778  79.866  81.486  1.00 37.27 ? 61  GLN J OE1 1 
ATOM 8857  N NE2 . GLN J 1 61  ? 60.717  78.765  81.749  1.00 37.32 ? 61  GLN J NE2 1 
ATOM 8858  N N   . ALA J 1 62  ? 58.168  76.839  76.761  1.00 36.96 ? 62  ALA J N   1 
ATOM 8859  C CA  . ALA J 1 62  ? 58.340  75.397  76.515  1.00 36.85 ? 62  ALA J CA  1 
ATOM 8860  C C   . ALA J 1 62  ? 59.177  75.065  75.275  1.00 36.78 ? 62  ALA J C   1 
ATOM 8861  O O   . ALA J 1 62  ? 59.836  74.024  75.236  1.00 36.92 ? 62  ALA J O   1 
ATOM 8862  C CB  . ALA J 1 62  ? 56.981  74.714  76.421  1.00 36.91 ? 62  ALA J CB  1 
ATOM 8863  N N   . ALA J 1 63  ? 59.139  75.940  74.269  1.00 36.84 ? 63  ALA J N   1 
ATOM 8864  C CA  . ALA J 1 63  ? 59.985  75.807  73.079  1.00 36.91 ? 63  ALA J CA  1 
ATOM 8865  C C   . ALA J 1 63  ? 61.471  75.958  73.413  1.00 36.82 ? 63  ALA J C   1 
ATOM 8866  O O   . ALA J 1 63  ? 62.298  75.200  72.906  1.00 36.91 ? 63  ALA J O   1 
ATOM 8867  C CB  . ALA J 1 63  ? 59.579  76.822  72.020  1.00 37.01 ? 63  ALA J CB  1 
ATOM 8868  N N   . LEU J 1 64  ? 61.798  76.930  74.265  1.00 36.89 ? 64  LEU J N   1 
ATOM 8869  C CA  . LEU J 1 64  ? 63.179  77.144  74.721  1.00 37.01 ? 64  LEU J CA  1 
ATOM 8870  C C   . LEU J 1 64  ? 63.677  76.016  75.630  1.00 37.02 ? 64  LEU J C   1 
ATOM 8871  O O   . LEU J 1 64  ? 64.854  75.653  75.574  1.00 37.07 ? 64  LEU J O   1 
ATOM 8872  C CB  . LEU J 1 64  ? 63.313  78.484  75.456  1.00 37.12 ? 64  LEU J CB  1 
ATOM 8873  C CG  . LEU J 1 64  ? 62.995  79.757  74.665  1.00 37.29 ? 64  LEU J CG  1 
ATOM 8874  C CD1 . LEU J 1 64  ? 63.017  80.969  75.584  1.00 37.40 ? 64  LEU J CD1 1 
ATOM 8875  C CD2 . LEU J 1 64  ? 63.965  79.943  73.508  1.00 37.32 ? 64  LEU J CD2 1 
ATOM 8876  N N   . ILE J 1 65  ? 62.781  75.474  76.457  1.00 37.10 ? 65  ILE J N   1 
ATOM 8877  C CA  . ILE J 1 65  ? 63.117  74.373  77.372  1.00 37.16 ? 65  ILE J CA  1 
ATOM 8878  C C   . ILE J 1 65  ? 63.371  73.069  76.602  1.00 37.20 ? 65  ILE J C   1 
ATOM 8879  O O   . ILE J 1 65  ? 64.253  72.292  76.976  1.00 37.29 ? 65  ILE J O   1 
ATOM 8880  C CB  . ILE J 1 65  ? 62.021  74.165  78.452  1.00 37.23 ? 65  ILE J CB  1 
ATOM 8881  C CG1 . ILE J 1 65  ? 61.895  75.412  79.340  1.00 37.33 ? 65  ILE J CG1 1 
ATOM 8882  C CG2 . ILE J 1 65  ? 62.326  72.948  79.327  1.00 37.26 ? 65  ILE J CG2 1 
ATOM 8883  C CD1 . ILE J 1 65  ? 60.615  75.475  80.149  1.00 37.48 ? 65  ILE J CD1 1 
ATOM 8884  N N   . SER J 1 66  ? 62.605  72.840  75.535  1.00 37.26 ? 66  SER J N   1 
ATOM 8885  C CA  . SER J 1 66  ? 62.774  71.656  74.682  1.00 37.39 ? 66  SER J CA  1 
ATOM 8886  C C   . SER J 1 66  ? 64.144  71.602  73.994  1.00 37.52 ? 66  SER J C   1 
ATOM 8887  O O   . SER J 1 66  ? 64.715  70.521  73.834  1.00 37.55 ? 66  SER J O   1 
ATOM 8888  C CB  . SER J 1 66  ? 61.663  71.590  73.627  1.00 37.37 ? 66  SER J CB  1 
ATOM 8889  O OG  . SER J 1 66  ? 61.701  70.365  72.914  1.00 37.36 ? 66  SER J OG  1 
ATOM 8890  N N   . LEU J 1 67  ? 64.660  72.765  73.591  1.00 37.78 ? 67  LEU J N   1 
ATOM 8891  C CA  . LEU J 1 67  ? 65.999  72.862  72.986  1.00 38.04 ? 67  LEU J CA  1 
ATOM 8892  C C   . LEU J 1 67  ? 67.141  72.544  73.961  1.00 38.13 ? 67  LEU J C   1 
ATOM 8893  O O   . LEU J 1 67  ? 68.176  72.021  73.539  1.00 38.34 ? 67  LEU J O   1 
ATOM 8894  C CB  . LEU J 1 67  ? 66.228  74.243  72.343  1.00 38.16 ? 67  LEU J CB  1 
ATOM 8895  C CG  . LEU J 1 67  ? 65.898  74.357  70.850  1.00 38.40 ? 67  LEU J CG  1 
ATOM 8896  C CD1 . LEU J 1 67  ? 64.421  74.132  70.557  1.00 38.45 ? 67  LEU J CD1 1 
ATOM 8897  C CD2 . LEU J 1 67  ? 66.339  75.714  70.325  1.00 38.59 ? 67  LEU J CD2 1 
ATOM 8898  N N   . GLY J 1 68  ? 66.954  72.850  75.247  1.00 37.98 ? 68  GLY J N   1 
ATOM 8899  C CA  . GLY J 1 68  ? 67.995  72.623  76.258  1.00 37.88 ? 68  GLY J CA  1 
ATOM 8900  C C   . GLY J 1 68  ? 67.974  73.493  77.507  1.00 37.72 ? 68  GLY J C   1 
ATOM 8901  O O   . GLY J 1 68  ? 68.568  73.112  78.519  1.00 37.88 ? 68  GLY J O   1 
ATOM 8902  N N   . LEU J 1 69  ? 67.330  74.663  77.444  1.00 37.46 ? 69  LEU J N   1 
ATOM 8903  C CA  . LEU J 1 69  ? 67.215  75.568  78.601  1.00 37.38 ? 69  LEU J CA  1 
ATOM 8904  C C   . LEU J 1 69  ? 66.589  74.879  79.816  1.00 37.38 ? 69  LEU J C   1 
ATOM 8905  O O   . LEU J 1 69  ? 65.716  74.019  79.672  1.00 37.44 ? 69  LEU J O   1 
ATOM 8906  C CB  . LEU J 1 69  ? 66.385  76.808  78.237  1.00 37.38 ? 69  LEU J CB  1 
ATOM 8907  C CG  . LEU J 1 69  ? 66.263  77.946  79.260  1.00 37.33 ? 69  LEU J CG  1 
ATOM 8908  C CD1 . LEU J 1 69  ? 67.605  78.606  79.539  1.00 37.36 ? 69  LEU J CD1 1 
ATOM 8909  C CD2 . LEU J 1 69  ? 65.262  78.982  78.772  1.00 37.37 ? 69  LEU J CD2 1 
ATOM 8910  N N   . LYS J 1 70  ? 67.041  75.268  81.007  1.00 37.37 ? 70  LYS J N   1 
ATOM 8911  C CA  . LYS J 1 70  ? 66.533  74.705  82.260  1.00 37.30 ? 70  LYS J CA  1 
ATOM 8912  C C   . LYS J 1 70  ? 65.142  75.244  82.583  1.00 37.09 ? 70  LYS J C   1 
ATOM 8913  O O   . LYS J 1 70  ? 64.675  76.206  81.966  1.00 37.05 ? 70  LYS J O   1 
ATOM 8914  C CB  . LYS J 1 70  ? 67.482  75.024  83.420  1.00 37.51 ? 70  LYS J CB  1 
ATOM 8915  C CG  . LYS J 1 70  ? 68.879  74.443  83.271  1.00 37.82 ? 70  LYS J CG  1 
ATOM 8916  C CD  . LYS J 1 70  ? 69.694  74.644  84.540  1.00 38.07 ? 70  LYS J CD  1 
ATOM 8917  C CE  . LYS J 1 70  ? 71.084  74.037  84.423  1.00 38.26 ? 70  LYS J CE  1 
ATOM 8918  N NZ  . LYS J 1 70  ? 71.932  74.730  83.411  1.00 38.34 ? 70  LYS J NZ  1 
ATOM 8919  N N   . SER J 1 71  ? 64.488  74.614  83.557  1.00 36.84 ? 71  SER J N   1 
ATOM 8920  C CA  . SER J 1 71  ? 63.204  75.094  84.073  1.00 36.56 ? 71  SER J CA  1 
ATOM 8921  C C   . SER J 1 71  ? 63.400  76.411  84.822  1.00 36.24 ? 71  SER J C   1 
ATOM 8922  O O   . SER J 1 71  ? 64.518  76.739  85.232  1.00 36.23 ? 71  SER J O   1 
ATOM 8923  C CB  . SER J 1 71  ? 62.573  74.055  85.002  1.00 36.59 ? 71  SER J CB  1 
ATOM 8924  O OG  . SER J 1 71  ? 62.363  72.827  84.327  1.00 36.60 ? 71  SER J OG  1 
ATOM 8925  N N   . THR J 1 72  ? 62.312  77.161  84.993  1.00 35.94 ? 72  THR J N   1 
ATOM 8926  C CA  . THR J 1 72  ? 62.358  78.459  85.671  1.00 35.78 ? 72  THR J CA  1 
ATOM 8927  C C   . THR J 1 72  ? 62.888  78.283  87.102  1.00 35.65 ? 72  THR J C   1 
ATOM 8928  O O   . THR J 1 72  ? 62.451  77.362  87.798  1.00 35.81 ? 72  THR J O   1 
ATOM 8929  C CB  . THR J 1 72  ? 60.967  79.122  85.727  1.00 35.87 ? 72  THR J CB  1 
ATOM 8930  O OG1 . THR J 1 72  ? 60.370  79.103  84.424  1.00 35.93 ? 72  THR J OG1 1 
ATOM 8931  C CG2 . THR J 1 72  ? 61.068  80.567  86.212  1.00 35.94 ? 72  THR J CG2 1 
ATOM 8932  N N   . PRO J 1 73  ? 63.834  79.147  87.544  1.00 35.35 ? 73  PRO J N   1 
ATOM 8933  C CA  . PRO J 1 73  ? 64.396  78.962  88.891  1.00 35.35 ? 73  PRO J CA  1 
ATOM 8934  C C   . PRO J 1 73  ? 63.403  79.239  90.024  1.00 35.42 ? 73  PRO J C   1 
ATOM 8935  O O   . PRO J 1 73  ? 62.344  79.830  89.795  1.00 35.51 ? 73  PRO J O   1 
ATOM 8936  C CB  . PRO J 1 73  ? 65.559  79.967  88.945  1.00 35.35 ? 73  PRO J CB  1 
ATOM 8937  C CG  . PRO J 1 73  ? 65.768  80.433  87.548  1.00 35.32 ? 73  PRO J CG  1 
ATOM 8938  C CD  . PRO J 1 73  ? 64.449  80.300  86.861  1.00 35.28 ? 73  PRO J CD  1 
ATOM 8939  N N   . ALA J 1 74  ? 63.761  78.808  91.231  1.00 35.52 ? 74  ALA J N   1 
ATOM 8940  C CA  . ALA J 1 74  ? 62.903  78.967  92.406  1.00 35.57 ? 74  ALA J CA  1 
ATOM 8941  C C   . ALA J 1 74  ? 62.766  80.443  92.774  1.00 35.42 ? 74  ALA J C   1 
ATOM 8942  O O   . ALA J 1 74  ? 63.768  81.159  92.854  1.00 35.50 ? 74  ALA J O   1 
ATOM 8943  C CB  . ALA J 1 74  ? 63.456  78.178  93.583  1.00 35.68 ? 74  ALA J CB  1 
ATOM 8944  N N   . ASN J 1 75  ? 61.523  80.879  92.986  1.00 35.20 ? 75  ASN J N   1 
ATOM 8945  C CA  . ASN J 1 75  ? 61.189  82.275  93.303  1.00 35.04 ? 75  ASN J CA  1 
ATOM 8946  C C   . ASN J 1 75  ? 61.617  83.257  92.199  1.00 34.83 ? 75  ASN J C   1 
ATOM 8947  O O   . ASN J 1 75  ? 62.105  84.353  92.489  1.00 34.81 ? 75  ASN J O   1 
ATOM 8948  C CB  . ASN J 1 75  ? 61.780  82.685  94.663  1.00 35.14 ? 75  ASN J CB  1 
ATOM 8949  C CG  . ASN J 1 75  ? 61.467  81.690  95.767  1.00 35.37 ? 75  ASN J CG  1 
ATOM 8950  O OD1 . ASN J 1 75  ? 60.415  81.049  95.767  1.00 35.52 ? 75  ASN J OD1 1 
ATOM 8951  N ND2 . ASN J 1 75  ? 62.383  81.561  96.720  1.00 35.47 ? 75  ASN J ND2 1 
ATOM 8952  N N   . VAL J 1 76  ? 61.427  82.849  90.942  1.00 34.65 ? 76  VAL J N   1 
ATOM 8953  C CA  . VAL J 1 76  ? 61.716  83.685  89.768  1.00 34.49 ? 76  VAL J CA  1 
ATOM 8954  C C   . VAL J 1 76  ? 60.514  83.645  88.826  1.00 34.47 ? 76  VAL J C   1 
ATOM 8955  O O   . VAL J 1 76  ? 59.966  82.575  88.554  1.00 34.47 ? 76  VAL J O   1 
ATOM 8956  C CB  . VAL J 1 76  ? 62.984  83.208  89.022  1.00 34.35 ? 76  VAL J CB  1 
ATOM 8957  C CG1 . VAL J 1 76  ? 63.203  84.004  87.735  1.00 34.32 ? 76  VAL J CG1 1 
ATOM 8958  C CG2 . VAL J 1 76  ? 64.202  83.321  89.926  1.00 34.40 ? 76  VAL J CG2 1 
ATOM 8959  N N   . THR J 1 77  ? 60.121  84.820  88.331  1.00 34.42 ? 77  THR J N   1 
ATOM 8960  C CA  . THR J 1 77  ? 58.968  84.971  87.443  1.00 34.40 ? 77  THR J CA  1 
ATOM 8961  C C   . THR J 1 77  ? 59.423  85.353  86.036  1.00 34.33 ? 77  THR J C   1 
ATOM 8962  O O   . THR J 1 77  ? 59.370  86.522  85.644  1.00 34.35 ? 77  THR J O   1 
ATOM 8963  C CB  . THR J 1 77  ? 57.990  86.032  87.984  1.00 34.48 ? 77  THR J CB  1 
ATOM 8964  O OG1 . THR J 1 77  ? 58.692  87.257  88.220  1.00 34.42 ? 77  THR J OG1 1 
ATOM 8965  C CG2 . THR J 1 77  ? 57.356  85.558  89.283  1.00 34.60 ? 77  THR J CG2 1 
ATOM 8966  N N   . PHE J 1 78  ? 59.881  84.350  85.291  1.00 34.32 ? 78  PHE J N   1 
ATOM 8967  C CA  . PHE J 1 78  ? 60.258  84.515  83.887  1.00 34.26 ? 78  PHE J CA  1 
ATOM 8968  C C   . PHE J 1 78  ? 58.997  84.608  83.031  1.00 34.03 ? 78  PHE J C   1 
ATOM 8969  O O   . PHE J 1 78  ? 58.034  83.871  83.257  1.00 34.15 ? 78  PHE J O   1 
ATOM 8970  C CB  . PHE J 1 78  ? 61.125  83.336  83.426  1.00 34.49 ? 78  PHE J CB  1 
ATOM 8971  C CG  . PHE J 1 78  ? 61.567  83.425  81.990  1.00 34.68 ? 78  PHE J CG  1 
ATOM 8972  C CD1 . PHE J 1 78  ? 62.674  84.189  81.634  1.00 34.79 ? 78  PHE J CD1 1 
ATOM 8973  C CD2 . PHE J 1 78  ? 60.884  82.733  80.992  1.00 34.80 ? 78  PHE J CD2 1 
ATOM 8974  C CE1 . PHE J 1 78  ? 63.086  84.269  80.310  1.00 34.94 ? 78  PHE J CE1 1 
ATOM 8975  C CE2 . PHE J 1 78  ? 61.290  82.810  79.667  1.00 34.93 ? 78  PHE J CE2 1 
ATOM 8976  C CZ  . PHE J 1 78  ? 62.393  83.578  79.325  1.00 34.99 ? 78  PHE J CZ  1 
ATOM 8977  N N   . SER J 1 79  ? 59.010  85.514  82.055  1.00 33.69 ? 79  SER J N   1 
ATOM 8978  C CA  . SER J 1 79  ? 57.849  85.752  81.197  1.00 33.53 ? 79  SER J CA  1 
ATOM 8979  C C   . SER J 1 79  ? 58.243  86.496  79.920  1.00 33.30 ? 79  SER J C   1 
ATOM 8980  O O   . SER J 1 79  ? 58.668  87.651  79.978  1.00 33.36 ? 79  SER J O   1 
ATOM 8981  C CB  . SER J 1 79  ? 56.792  86.556  81.959  1.00 33.61 ? 79  SER J CB  1 
ATOM 8982  O OG  . SER J 1 79  ? 55.659  86.827  81.149  1.00 33.71 ? 79  SER J OG  1 
ATOM 8983  N N   . ILE J 1 80  ? 58.091  85.830  78.776  1.00 33.07 ? 80  ILE J N   1 
ATOM 8984  C CA  . ILE J 1 80  ? 58.391  86.432  77.476  1.00 32.89 ? 80  ILE J CA  1 
ATOM 8985  C C   . ILE J 1 80  ? 57.209  87.315  77.076  1.00 32.77 ? 80  ILE J C   1 
ATOM 8986  O O   . ILE J 1 80  ? 56.076  86.838  76.990  1.00 32.79 ? 80  ILE J O   1 
ATOM 8987  C CB  . ILE J 1 80  ? 58.649  85.364  76.386  1.00 32.91 ? 80  ILE J CB  1 
ATOM 8988  C CG1 . ILE J 1 80  ? 59.837  84.470  76.777  1.00 32.96 ? 80  ILE J CG1 1 
ATOM 8989  C CG2 . ILE J 1 80  ? 58.901  86.026  75.030  1.00 32.94 ? 80  ILE J CG2 1 
ATOM 8990  C CD1 . ILE J 1 80  ? 59.975  83.208  75.951  1.00 33.00 ? 80  ILE J CD1 1 
ATOM 8991  N N   . VAL J 1 81  ? 57.484  88.598  76.838  1.00 32.73 ? 81  VAL J N   1 
ATOM 8992  C CA  . VAL J 1 81  ? 56.453  89.577  76.483  1.00 32.76 ? 81  VAL J CA  1 
ATOM 8993  C C   . VAL J 1 81  ? 55.965  89.332  75.060  1.00 32.87 ? 81  VAL J C   1 
ATOM 8994  O O   . VAL J 1 81  ? 54.774  89.108  74.832  1.00 32.99 ? 81  VAL J O   1 
ATOM 8995  C CB  . VAL J 1 81  ? 56.982  91.027  76.617  1.00 32.81 ? 81  VAL J CB  1 
ATOM 8996  C CG1 . VAL J 1 81  ? 56.004  92.042  76.028  1.00 32.88 ? 81  VAL J CG1 1 
ATOM 8997  C CG2 . VAL J 1 81  ? 57.270  91.350  78.077  1.00 32.82 ? 81  VAL J CG2 1 
ATOM 8998  N N   . SER J 1 82  ? 56.899  89.387  74.115  1.00 32.95 ? 82  SER J N   1 
ATOM 8999  C CA  . SER J 1 82  ? 56.599  89.194  72.697  1.00 33.10 ? 82  SER J CA  1 
ATOM 9000  C C   . SER J 1 82  ? 57.834  88.721  71.942  1.00 33.16 ? 82  SER J C   1 
ATOM 9001  O O   . SER J 1 82  ? 58.963  88.898  72.407  1.00 33.23 ? 82  SER J O   1 
ATOM 9002  C CB  . SER J 1 82  ? 56.073  90.493  72.083  1.00 33.14 ? 82  SER J CB  1 
ATOM 9003  O OG  . SER J 1 82  ? 56.991  91.557  72.270  1.00 33.18 ? 82  SER J OG  1 
ATOM 9004  N N   . ALA J 1 83  ? 57.606  88.119  70.778  1.00 33.30 ? 83  ALA J N   1 
ATOM 9005  C CA  . ALA J 1 83  ? 58.684  87.580  69.953  1.00 33.46 ? 83  ALA J CA  1 
ATOM 9006  C C   . ALA J 1 83  ? 58.282  87.525  68.482  1.00 33.71 ? 83  ALA J C   1 
ATOM 9007  O O   . ALA J 1 83  ? 57.651  86.565  68.035  1.00 33.85 ? 83  ALA J O   1 
ATOM 9008  C CB  . ALA J 1 83  ? 59.083  86.200  70.451  1.00 33.47 ? 83  ALA J CB  1 
ATOM 9009  N N   . SER J 1 84  ? 58.651  88.569  67.741  1.00 34.04 ? 84  SER J N   1 
ATOM 9010  C CA  . SER J 1 84  ? 58.451  88.617  66.293  1.00 34.33 ? 84  SER J CA  1 
ATOM 9011  C C   . SER J 1 84  ? 59.526  87.785  65.589  1.00 34.53 ? 84  SER J C   1 
ATOM 9012  O O   . SER J 1 84  ? 60.387  87.190  66.242  1.00 34.55 ? 84  SER J O   1 
ATOM 9013  C CB  . SER J 1 84  ? 58.481  90.070  65.802  1.00 34.48 ? 84  SER J CB  1 
ATOM 9014  O OG  . SER J 1 84  ? 59.767  90.646  65.958  1.00 34.54 ? 84  SER J OG  1 
ATOM 9015  N N   . ALA J 1 85  ? 59.466  87.739  64.260  1.00 35.05 ? 85  ALA J N   1 
ATOM 9016  C CA  . ALA J 1 85  ? 60.434  86.988  63.455  1.00 35.50 ? 85  ALA J CA  1 
ATOM 9017  C C   . ALA J 1 85  ? 61.888  87.424  63.675  1.00 35.79 ? 85  ALA J C   1 
ATOM 9018  O O   . ALA J 1 85  ? 62.784  86.579  63.713  1.00 35.91 ? 85  ALA J O   1 
ATOM 9019  C CB  . ALA J 1 85  ? 60.079  87.088  61.977  1.00 35.61 ? 85  ALA J CB  1 
ATOM 9020  N N   . ASN J 1 86  ? 62.108  88.733  63.820  1.00 36.15 ? 86  ASN J N   1 
ATOM 9021  C CA  . ASN J 1 86  ? 63.458  89.304  63.948  1.00 36.49 ? 86  ASN J CA  1 
ATOM 9022  C C   . ASN J 1 86  ? 63.674  90.129  65.232  1.00 36.55 ? 86  ASN J C   1 
ATOM 9023  O O   . ASN J 1 86  ? 64.531  91.017  65.258  1.00 36.63 ? 86  ASN J O   1 
ATOM 9024  C CB  . ASN J 1 86  ? 63.769  90.161  62.714  1.00 36.84 ? 86  ASN J CB  1 
ATOM 9025  C CG  . ASN J 1 86  ? 63.648  89.384  61.414  1.00 37.16 ? 86  ASN J CG  1 
ATOM 9026  O OD1 . ASN J 1 86  ? 62.563  88.940  61.042  1.00 37.25 ? 86  ASN J OD1 1 
ATOM 9027  N ND2 . ASN J 1 86  ? 64.765  89.230  60.709  1.00 37.45 ? 86  ASN J ND2 1 
ATOM 9028  N N   . SER J 1 87  ? 62.918  89.833  66.291  1.00 36.55 ? 87  SER J N   1 
ATOM 9029  C CA  . SER J 1 87  ? 63.108  90.490  67.594  1.00 36.52 ? 87  SER J CA  1 
ATOM 9030  C C   . SER J 1 87  ? 62.465  89.707  68.740  1.00 36.58 ? 87  SER J C   1 
ATOM 9031  O O   . SER J 1 87  ? 61.720  88.750  68.514  1.00 36.60 ? 87  SER J O   1 
ATOM 9032  C CB  . SER J 1 87  ? 62.536  91.913  67.569  1.00 36.53 ? 87  SER J CB  1 
ATOM 9033  O OG  . SER J 1 87  ? 62.862  92.615  68.757  1.00 36.60 ? 87  SER J OG  1 
ATOM 9034  N N   . TYR J 1 88  ? 62.768  90.127  69.968  1.00 36.69 ? 88  TYR J N   1 
ATOM 9035  C CA  . TYR J 1 88  ? 62.147  89.562  71.172  1.00 36.75 ? 88  TYR J CA  1 
ATOM 9036  C C   . TYR J 1 88  ? 62.252  90.497  72.378  1.00 37.06 ? 88  TYR J C   1 
ATOM 9037  O O   . TYR J 1 88  ? 63.060  91.429  72.389  1.00 37.14 ? 88  TYR J O   1 
ATOM 9038  C CB  . TYR J 1 88  ? 62.755  88.194  71.512  1.00 36.59 ? 88  TYR J CB  1 
ATOM 9039  C CG  . TYR J 1 88  ? 64.246  88.211  71.786  1.00 36.51 ? 88  TYR J CG  1 
ATOM 9040  C CD1 . TYR J 1 88  ? 64.739  88.453  73.068  1.00 36.43 ? 88  TYR J CD1 1 
ATOM 9041  C CD2 . TYR J 1 88  ? 65.165  87.969  70.764  1.00 36.53 ? 88  TYR J CD2 1 
ATOM 9042  C CE1 . TYR J 1 88  ? 66.103  88.466  73.325  1.00 36.37 ? 88  TYR J CE1 1 
ATOM 9043  C CE2 . TYR J 1 88  ? 66.532  87.979  71.012  1.00 36.49 ? 88  TYR J CE2 1 
ATOM 9044  C CZ  . TYR J 1 88  ? 66.996  88.227  72.293  1.00 36.40 ? 88  TYR J CZ  1 
ATOM 9045  O OH  . TYR J 1 88  ? 68.348  88.238  72.542  1.00 36.43 ? 88  TYR J OH  1 
ATOM 9046  N N   . CYS J 1 89  ? 61.421  90.230  73.384  1.00 37.62 ? 89  CYS J N   1 
ATOM 9047  C CA  . CYS J 1 89  ? 61.425  90.969  74.649  1.00 38.04 ? 89  CYS J CA  1 
ATOM 9048  C C   . CYS J 1 89  ? 61.074  90.009  75.786  1.00 37.48 ? 89  CYS J C   1 
ATOM 9049  O O   . CYS J 1 89  ? 59.983  89.436  75.797  1.00 37.51 ? 89  CYS J O   1 
ATOM 9050  C CB  . CYS J 1 89  ? 60.420  92.122  74.597  1.00 39.02 ? 89  CYS J CB  1 
ATOM 9051  S SG  . CYS J 1 89  ? 60.302  93.092  76.121  1.00 40.38 ? 89  CYS J SG  1 
ATOM 9052  N N   . MET J 1 90  ? 62.000  89.844  76.732  1.00 36.81 ? 90  MET J N   1 
ATOM 9053  C CA  . MET J 1 90  ? 61.848  88.898  77.839  1.00 36.33 ? 90  MET J CA  1 
ATOM 9054  C C   . MET J 1 90  ? 62.115  89.591  79.176  1.00 35.96 ? 90  MET J C   1 
ATOM 9055  O O   . MET J 1 90  ? 63.252  89.965  79.474  1.00 35.94 ? 90  MET J O   1 
ATOM 9056  C CB  . MET J 1 90  ? 62.805  87.714  77.663  1.00 36.33 ? 90  MET J CB  1 
ATOM 9057  C CG  . MET J 1 90  ? 62.744  87.055  76.293  1.00 36.32 ? 90  MET J CG  1 
ATOM 9058  S SD  . MET J 1 90  ? 63.650  85.498  76.219  1.00 36.31 ? 90  MET J SD  1 
ATOM 9059  C CE  . MET J 1 90  ? 65.329  86.061  76.487  1.00 36.30 ? 90  MET J CE  1 
ATOM 9060  N N   . ILE J 1 91  ? 61.056  89.765  79.969  1.00 35.57 ? 91  ILE J N   1 
ATOM 9061  C CA  . ILE J 1 91  ? 61.154  90.320  81.320  1.00 35.27 ? 91  ILE J CA  1 
ATOM 9062  C C   . ILE J 1 91  ? 61.280  89.170  82.323  1.00 34.97 ? 91  ILE J C   1 
ATOM 9063  O O   . ILE J 1 91  ? 60.629  88.134  82.174  1.00 35.06 ? 91  ILE J O   1 
ATOM 9064  C CB  . ILE J 1 91  ? 59.914  91.175  81.677  1.00 35.34 ? 91  ILE J CB  1 
ATOM 9065  C CG1 . ILE J 1 91  ? 59.674  92.274  80.626  1.00 35.48 ? 91  ILE J CG1 1 
ATOM 9066  C CG2 . ILE J 1 91  ? 60.046  91.774  83.077  1.00 35.37 ? 91  ILE J CG2 1 
ATOM 9067  C CD1 . ILE J 1 91  ? 60.800  93.280  80.474  1.00 35.54 ? 91  ILE J CD1 1 
ATOM 9068  N N   . ALA J 1 92  ? 62.123  89.361  83.335  1.00 34.64 ? 92  ALA J N   1 
ATOM 9069  C CA  . ALA J 1 92  ? 62.291  88.386  84.415  1.00 34.42 ? 92  ALA J CA  1 
ATOM 9070  C C   . ALA J 1 92  ? 62.803  89.060  85.685  1.00 34.21 ? 92  ALA J C   1 
ATOM 9071  O O   . ALA J 1 92  ? 63.510  90.070  85.620  1.00 34.13 ? 92  ALA J O   1 
ATOM 9072  C CB  . ALA J 1 92  ? 63.239  87.276  83.986  1.00 34.49 ? 92  ALA J CB  1 
ATOM 9073  N N   . GLY J 1 93  ? 62.442  88.493  86.833  1.00 34.02 ? 93  GLY J N   1 
ATOM 9074  C CA  . GLY J 1 93  ? 62.824  89.049  88.130  1.00 33.89 ? 93  GLY J CA  1 
ATOM 9075  C C   . GLY J 1 93  ? 62.617  88.086  89.284  1.00 33.77 ? 93  GLY J C   1 
ATOM 9076  O O   . GLY J 1 93  ? 61.757  87.204  89.222  1.00 33.83 ? 93  GLY J O   1 
ATOM 9077  N N   . HIS J 1 94  ? 63.411  88.270  90.337  1.00 33.62 ? 94  HIS J N   1 
ATOM 9078  C CA  . HIS J 1 94  ? 63.320  87.467  91.555  1.00 33.49 ? 94  HIS J CA  1 
ATOM 9079  C C   . HIS J 1 94  ? 62.369  88.171  92.524  1.00 33.50 ? 94  HIS J C   1 
ATOM 9080  O O   . HIS J 1 94  ? 62.252  89.398  92.500  1.00 33.61 ? 94  HIS J O   1 
ATOM 9081  C CB  . HIS J 1 94  ? 64.709  87.307  92.182  1.00 33.42 ? 94  HIS J CB  1 
ATOM 9082  C CG  . HIS J 1 94  ? 64.879  86.049  92.976  1.00 33.39 ? 94  HIS J CG  1 
ATOM 9083  N ND1 . HIS J 1 94  ? 65.520  84.934  92.479  1.00 33.41 ? 94  HIS J ND1 1 
ATOM 9084  C CD2 . HIS J 1 94  ? 64.466  85.720  94.222  1.00 33.38 ? 94  HIS J CD2 1 
ATOM 9085  C CE1 . HIS J 1 94  ? 65.508  83.980  93.391  1.00 33.44 ? 94  HIS J CE1 1 
ATOM 9086  N NE2 . HIS J 1 94  ? 64.876  84.432  94.459  1.00 33.41 ? 94  HIS J NE2 1 
ATOM 9087  N N   . SER J 1 95  ? 61.695  87.394  93.370  1.00 33.42 ? 95  SER J N   1 
ATOM 9088  C CA  . SER J 1 95  ? 60.717  87.941  94.320  1.00 33.30 ? 95  SER J CA  1 
ATOM 9089  C C   . SER J 1 95  ? 61.381  88.823  95.377  1.00 33.15 ? 95  SER J C   1 
ATOM 9090  O O   . SER J 1 95  ? 60.882  89.907  95.684  1.00 33.23 ? 95  SER J O   1 
ATOM 9091  C CB  . SER J 1 95  ? 59.923  86.818  94.994  1.00 33.39 ? 95  SER J CB  1 
ATOM 9092  O OG  . SER J 1 95  ? 60.773  85.961  95.733  1.00 33.47 ? 95  SER J OG  1 
ATOM 9093  N N   . GLY J 1 96  ? 62.501  88.346  95.924  1.00 32.96 ? 96  GLY J N   1 
ATOM 9094  C CA  . GLY J 1 96  ? 63.341  89.128  96.838  1.00 32.84 ? 96  GLY J CA  1 
ATOM 9095  C C   . GLY J 1 96  ? 64.619  89.615  96.180  1.00 32.59 ? 96  GLY J C   1 
ATOM 9096  O O   . GLY J 1 96  ? 65.710  89.428  96.724  1.00 32.56 ? 96  GLY J O   1 
ATOM 9097  N N   . GLY J 1 97  ? 64.478  90.238  95.011  1.00 32.33 ? 97  GLY J N   1 
ATOM 9098  C CA  . GLY J 1 97  ? 65.595  90.842  94.284  1.00 32.11 ? 97  GLY J CA  1 
ATOM 9099  C C   . GLY J 1 97  ? 65.608  92.347  94.474  1.00 31.91 ? 97  GLY J C   1 
ATOM 9100  O O   . GLY J 1 97  ? 65.121  92.854  95.489  1.00 31.98 ? 97  GLY J O   1 
ATOM 9101  N N   . THR J 1 98  ? 66.165  93.055  93.492  1.00 31.56 ? 98  THR J N   1 
ATOM 9102  C CA  . THR J 1 98  ? 66.230  94.517  93.502  1.00 31.30 ? 98  THR J CA  1 
ATOM 9103  C C   . THR J 1 98  ? 65.240  95.115  92.506  1.00 31.00 ? 98  THR J C   1 
ATOM 9104  O O   . THR J 1 98  ? 64.353  95.881  92.890  1.00 31.05 ? 98  THR J O   1 
ATOM 9105  C CB  . THR J 1 98  ? 67.648  95.014  93.165  1.00 31.35 ? 98  THR J CB  1 
ATOM 9106  O OG1 . THR J 1 98  ? 68.054  94.490  91.893  1.00 31.30 ? 98  THR J OG1 1 
ATOM 9107  C CG2 . THR J 1 98  ? 68.633  94.570  94.236  1.00 31.42 ? 98  THR J CG2 1 
ATOM 9108  N N   . VAL J 1 99  ? 65.405  94.758  91.233  1.00 30.61 ? 99  VAL J N   1 
ATOM 9109  C CA  . VAL J 1 99  ? 64.559  95.257  90.142  1.00 30.35 ? 99  VAL J CA  1 
ATOM 9110  C C   . VAL J 1 99  ? 64.334  94.182  89.078  1.00 30.06 ? 99  VAL J C   1 
ATOM 9111  O O   . VAL J 1 99  ? 65.009  93.149  89.072  1.00 30.16 ? 99  VAL J O   1 
ATOM 9112  C CB  . VAL J 1 99  ? 65.173  96.513  89.471  1.00 30.45 ? 99  VAL J CB  1 
ATOM 9113  C CG1 . VAL J 1 99  ? 65.005  97.737  90.359  1.00 30.52 ? 99  VAL J CG1 1 
ATOM 9114  C CG2 . VAL J 1 99  ? 66.644  96.300  89.128  1.00 30.52 ? 99  VAL J CG2 1 
ATOM 9115  N N   . TRP J 1 100 ? 63.381  94.436  88.184  1.00 29.73 ? 100 TRP J N   1 
ATOM 9116  C CA  . TRP J 1 100 ? 63.124  93.557  87.041  1.00 29.57 ? 100 TRP J CA  1 
ATOM 9117  C C   . TRP J 1 100 ? 64.232  93.708  86.002  1.00 29.76 ? 100 TRP J C   1 
ATOM 9118  O O   . TRP J 1 100 ? 64.788  94.796  85.832  1.00 29.91 ? 100 TRP J O   1 
ATOM 9119  C CB  . TRP J 1 100 ? 61.775  93.878  86.395  1.00 29.37 ? 100 TRP J CB  1 
ATOM 9120  C CG  . TRP J 1 100 ? 60.600  93.572  87.267  1.00 29.17 ? 100 TRP J CG  1 
ATOM 9121  C CD1 . TRP J 1 100 ? 60.023  94.399  88.185  1.00 29.08 ? 100 TRP J CD1 1 
ATOM 9122  C CD2 . TRP J 1 100 ? 59.852  92.352  87.297  1.00 28.95 ? 100 TRP J CD2 1 
ATOM 9123  N NE1 . TRP J 1 100 ? 58.962  93.769  88.789  1.00 28.98 ? 100 TRP J NE1 1 
ATOM 9124  C CE2 . TRP J 1 100 ? 58.834  92.512  88.263  1.00 28.90 ? 100 TRP J CE2 1 
ATOM 9125  C CE3 . TRP J 1 100 ? 59.943  91.139  86.603  1.00 28.91 ? 100 TRP J CE3 1 
ATOM 9126  C CZ2 . TRP J 1 100 ? 57.912  91.502  88.555  1.00 28.93 ? 100 TRP J CZ2 1 
ATOM 9127  C CZ3 . TRP J 1 100 ? 59.025  90.133  86.892  1.00 28.95 ? 100 TRP J CZ3 1 
ATOM 9128  C CH2 . TRP J 1 100 ? 58.022  90.324  87.862  1.00 28.96 ? 100 TRP J CH2 1 
ATOM 9129  N N   . PHE J 1 101 ? 64.541  92.611  85.315  1.00 29.96 ? 101 PHE J N   1 
ATOM 9130  C CA  . PHE J 1 101 ? 65.567  92.582  84.273  1.00 30.13 ? 101 PHE J CA  1 
ATOM 9131  C C   . PHE J 1 101 ? 64.922  92.270  82.927  1.00 30.19 ? 101 PHE J C   1 
ATOM 9132  O O   . PHE J 1 101 ? 64.217  91.269  82.797  1.00 30.31 ? 101 PHE J O   1 
ATOM 9133  C CB  . PHE J 1 101 ? 66.615  91.513  84.585  1.00 30.32 ? 101 PHE J CB  1 
ATOM 9134  C CG  . PHE J 1 101 ? 67.540  91.867  85.717  1.00 30.39 ? 101 PHE J CG  1 
ATOM 9135  C CD1 . PHE J 1 101 ? 67.102  91.818  87.037  1.00 30.53 ? 101 PHE J CD1 1 
ATOM 9136  C CD2 . PHE J 1 101 ? 68.864  92.227  85.466  1.00 30.42 ? 101 PHE J CD2 1 
ATOM 9137  C CE1 . PHE J 1 101 ? 67.957  92.137  88.082  1.00 30.59 ? 101 PHE J CE1 1 
ATOM 9138  C CE2 . PHE J 1 101 ? 69.723  92.544  86.508  1.00 30.54 ? 101 PHE J CE2 1 
ATOM 9139  C CZ  . PHE J 1 101 ? 69.269  92.500  87.818  1.00 30.60 ? 101 PHE J CZ  1 
ATOM 9140  N N   . ALA J 1 102 ? 65.165  93.132  81.940  1.00 30.37 ? 102 ALA J N   1 
ATOM 9141  C CA  . ALA J 1 102 ? 64.709  92.913  80.566  1.00 30.57 ? 102 ALA J CA  1 
ATOM 9142  C C   . ALA J 1 102 ? 65.773  92.165  79.769  1.00 30.78 ? 102 ALA J C   1 
ATOM 9143  O O   . ALA J 1 102 ? 66.896  91.973  80.245  1.00 30.81 ? 102 ALA J O   1 
ATOM 9144  C CB  . ALA J 1 102 ? 64.387  94.241  79.901  1.00 30.60 ? 102 ALA J CB  1 
ATOM 9145  N N   . ALA J 1 103 ? 65.411  91.744  78.559  1.00 31.11 ? 103 ALA J N   1 
ATOM 9146  C CA  . ALA J 1 103 ? 66.330  91.020  77.678  1.00 31.41 ? 103 ALA J CA  1 
ATOM 9147  C C   . ALA J 1 103 ? 65.877  91.085  76.216  1.00 31.72 ? 103 ALA J C   1 
ATOM 9148  O O   . ALA J 1 103 ? 64.963  90.363  75.809  1.00 31.76 ? 103 ALA J O   1 
ATOM 9149  C CB  . ALA J 1 103 ? 66.467  89.574  78.133  1.00 31.43 ? 103 ALA J CB  1 
ATOM 9150  N N   . THR J 1 104 ? 66.523  91.963  75.449  1.00 32.08 ? 104 THR J N   1 
ATOM 9151  C CA  . THR J 1 104 ? 66.257  92.148  74.019  1.00 32.34 ? 104 THR J CA  1 
ATOM 9152  C C   . THR J 1 104 ? 67.548  91.863  73.244  1.00 32.69 ? 104 THR J C   1 
ATOM 9153  O O   . THR J 1 104 ? 68.626  91.840  73.845  1.00 32.83 ? 104 THR J O   1 
ATOM 9154  C CB  . THR J 1 104 ? 65.781  93.591  73.730  1.00 32.41 ? 104 THR J CB  1 
ATOM 9155  O OG1 . THR J 1 104 ? 66.886  94.499  73.807  1.00 32.45 ? 104 THR J OG1 1 
ATOM 9156  C CG2 . THR J 1 104 ? 64.713  94.018  74.724  1.00 32.50 ? 104 THR J CG2 1 
ATOM 9157  N N   . PRO J 1 105 ? 67.453  91.643  71.913  1.00 33.13 ? 105 PRO J N   1 
ATOM 9158  C CA  . PRO J 1 105 ? 68.680  91.359  71.152  1.00 33.45 ? 105 PRO J CA  1 
ATOM 9159  C C   . PRO J 1 105 ? 69.604  92.570  70.970  1.00 33.95 ? 105 PRO J C   1 
ATOM 9160  O O   . PRO J 1 105 ? 70.823  92.417  71.070  1.00 34.10 ? 105 PRO J O   1 
ATOM 9161  C CB  . PRO J 1 105 ? 68.171  90.841  69.799  1.00 33.34 ? 105 PRO J CB  1 
ATOM 9162  C CG  . PRO J 1 105 ? 66.732  91.197  69.721  1.00 33.31 ? 105 PRO J CG  1 
ATOM 9163  C CD  . PRO J 1 105 ? 66.254  91.677  71.056  1.00 33.23 ? 105 PRO J CD  1 
ATOM 9164  N N   . ASP J 1 106 ? 69.033  93.747  70.711  1.00 34.61 ? 106 ASP J N   1 
ATOM 9165  C CA  . ASP J 1 106 ? 69.830  94.963  70.481  1.00 35.22 ? 106 ASP J CA  1 
ATOM 9166  C C   . ASP J 1 106 ? 70.514  95.508  71.744  1.00 35.56 ? 106 ASP J C   1 
ATOM 9167  O O   . ASP J 1 106 ? 71.679  95.907  71.685  1.00 35.76 ? 106 ASP J O   1 
ATOM 9168  C CB  . ASP J 1 106 ? 69.001  96.062  69.785  1.00 35.53 ? 106 ASP J CB  1 
ATOM 9169  C CG  . ASP J 1 106 ? 67.874  96.610  70.654  1.00 35.77 ? 106 ASP J CG  1 
ATOM 9170  O OD1 . ASP J 1 106 ? 67.305  95.845  71.463  1.00 35.93 ? 106 ASP J OD1 1 
ATOM 9171  O OD2 . ASP J 1 106 ? 67.554  97.811  70.518  1.00 35.86 ? 106 ASP J OD2 1 
ATOM 9172  N N   . LYS J 1 107 ? 69.799  95.515  72.869  1.00 35.96 ? 107 LYS J N   1 
ATOM 9173  C CA  . LYS J 1 107 ? 70.324  96.043  74.138  1.00 36.36 ? 107 LYS J CA  1 
ATOM 9174  C C   . LYS J 1 107 ? 70.942  94.976  75.050  1.00 36.64 ? 107 LYS J C   1 
ATOM 9175  O O   . LYS J 1 107 ? 71.614  95.318  76.024  1.00 36.62 ? 107 LYS J O   1 
ATOM 9176  C CB  . LYS J 1 107 ? 69.223  96.786  74.901  1.00 36.45 ? 107 LYS J CB  1 
ATOM 9177  C CG  . LYS J 1 107 ? 68.676  98.003  74.172  1.00 36.66 ? 107 LYS J CG  1 
ATOM 9178  C CD  . LYS J 1 107 ? 67.548  98.672  74.943  1.00 36.88 ? 107 LYS J CD  1 
ATOM 9179  C CE  . LYS J 1 107 ? 68.060  99.462  76.137  1.00 37.03 ? 107 LYS J CE  1 
ATOM 9180  N NZ  . LYS J 1 107 ? 66.966  100.201 76.826  1.00 37.12 ? 107 LYS J NZ  1 
ATOM 9181  N N   . GLY J 1 108 ? 70.717  93.697  74.740  1.00 37.06 ? 108 GLY J N   1 
ATOM 9182  C CA  . GLY J 1 108 ? 71.192  92.595  75.578  1.00 37.38 ? 108 GLY J CA  1 
ATOM 9183  C C   . GLY J 1 108 ? 70.352  92.459  76.835  1.00 37.66 ? 108 GLY J C   1 
ATOM 9184  O O   . GLY J 1 108 ? 69.198  92.889  76.862  1.00 37.75 ? 108 GLY J O   1 
ATOM 9185  N N   . VAL J 1 109 ? 70.935  91.855  77.868  1.00 38.04 ? 109 VAL J N   1 
ATOM 9186  C CA  . VAL J 1 109 ? 70.280  91.710  79.171  1.00 38.33 ? 109 VAL J CA  1 
ATOM 9187  C C   . VAL J 1 109 ? 70.635  92.922  80.034  1.00 38.62 ? 109 VAL J C   1 
ATOM 9188  O O   . VAL J 1 109 ? 71.808  93.136  80.345  1.00 38.77 ? 109 VAL J O   1 
ATOM 9189  C CB  . VAL J 1 109 ? 70.713  90.410  79.887  1.00 38.50 ? 109 VAL J CB  1 
ATOM 9190  C CG1 . VAL J 1 109 ? 70.008  90.268  81.235  1.00 38.57 ? 109 VAL J CG1 1 
ATOM 9191  C CG2 . VAL J 1 109 ? 70.438  89.197  79.002  1.00 38.56 ? 109 VAL J CG2 1 
ATOM 9192  N N   . TYR J 1 110 ? 69.622  93.705  80.406  1.00 38.99 ? 110 TYR J N   1 
ATOM 9193  C CA  . TYR J 1 110 ? 69.799  94.895  81.247  1.00 39.35 ? 110 TYR J CA  1 
ATOM 9194  C C   . TYR J 1 110 ? 68.701  94.994  82.302  1.00 39.82 ? 110 TYR J C   1 
ATOM 9195  O O   . TYR J 1 110 ? 67.697  94.280  82.232  1.00 40.04 ? 110 TYR J O   1 
ATOM 9196  C CB  . TYR J 1 110 ? 69.823  96.165  80.387  1.00 39.25 ? 110 TYR J CB  1 
ATOM 9197  C CG  . TYR J 1 110 ? 68.549  96.425  79.610  1.00 39.14 ? 110 TYR J CG  1 
ATOM 9198  C CD1 . TYR J 1 110 ? 68.325  95.815  78.376  1.00 39.13 ? 110 TYR J CD1 1 
ATOM 9199  C CD2 . TYR J 1 110 ? 67.570  97.290  80.104  1.00 39.09 ? 110 TYR J CD2 1 
ATOM 9200  C CE1 . TYR J 1 110 ? 67.161  96.051  77.659  1.00 39.07 ? 110 TYR J CE1 1 
ATOM 9201  C CE2 . TYR J 1 110 ? 66.402  97.533  79.393  1.00 39.10 ? 110 TYR J CE2 1 
ATOM 9202  C CZ  . TYR J 1 110 ? 66.203  96.911  78.171  1.00 39.11 ? 110 TYR J CZ  1 
ATOM 9203  O OH  . TYR J 1 110 ? 65.050  97.146  77.460  1.00 39.19 ? 110 TYR J OH  1 
ATOM 9204  N N   . LYS J 1 111 ? 68.902  95.891  83.267  1.00 40.42 ? 111 LYS J N   1 
ATOM 9205  C CA  . LYS J 1 111 ? 67.962  96.085  84.378  1.00 41.05 ? 111 LYS J CA  1 
ATOM 9206  C C   . LYS J 1 111 ? 67.162  97.377  84.211  1.00 41.38 ? 111 LYS J C   1 
ATOM 9207  O O   . LYS J 1 111 ? 67.703  98.396  83.777  1.00 41.54 ? 111 LYS J O   1 
ATOM 9208  C CB  . LYS J 1 111 ? 68.687  96.061  85.733  1.00 41.42 ? 111 LYS J CB  1 
ATOM 9209  C CG  . LYS J 1 111 ? 69.663  97.199  86.006  1.00 41.67 ? 111 LYS J CG  1 
ATOM 9210  C CD  . LYS J 1 111 ? 70.325  97.019  87.362  1.00 41.99 ? 111 LYS J CD  1 
ATOM 9211  C CE  . LYS J 1 111 ? 71.314  98.137  87.655  1.00 42.27 ? 111 LYS J CE  1 
ATOM 9212  N NZ  . LYS J 1 111 ? 71.978  97.989  88.982  1.00 42.33 ? 111 LYS J NZ  1 
ATOM 9213  N N   . THR J 1 112 ? 65.878  97.318  84.567  1.00 41.76 ? 112 THR J N   1 
ATOM 9214  C CA  . THR J 1 112 ? 64.957  98.454  84.431  1.00 42.19 ? 112 THR J CA  1 
ATOM 9215  C C   . THR J 1 112 ? 64.720  99.148  85.776  1.00 42.42 ? 112 THR J C   1 
ATOM 9216  O O   . THR J 1 112 ? 65.140  98.656  86.825  1.00 42.41 ? 112 THR J O   1 
ATOM 9217  C CB  . THR J 1 112 ? 63.609  98.028  83.790  1.00 42.41 ? 112 THR J CB  1 
ATOM 9218  O OG1 . THR J 1 112 ? 62.791  99.184  83.564  1.00 42.63 ? 112 THR J OG1 1 
ATOM 9219  C CG2 . THR J 1 112 ? 62.836  97.008  84.652  1.00 42.32 ? 112 THR J CG2 1 
ATOM 9220  N N   . ASN J 1 113 ? 64.039  100.292 85.725  1.00 42.76 ? 113 ASN J N   1 
ATOM 9221  C CA  . ASN J 1 113 ? 63.742  101.088 86.922  1.00 43.05 ? 113 ASN J CA  1 
ATOM 9222  C C   . ASN J 1 113 ? 62.627  100.500 87.798  1.00 43.07 ? 113 ASN J C   1 
ATOM 9223  O O   . ASN J 1 113 ? 62.518  100.864 88.972  1.00 43.14 ? 113 ASN J O   1 
ATOM 9224  C CB  . ASN J 1 113 ? 63.374  102.526 86.531  1.00 43.32 ? 113 ASN J CB  1 
ATOM 9225  C CG  . ASN J 1 113 ? 64.519  103.263 85.857  1.00 43.69 ? 113 ASN J CG  1 
ATOM 9226  O OD1 . ASN J 1 113 ? 65.527  102.666 85.472  1.00 43.88 ? 113 ASN J OD1 1 
ATOM 9227  N ND2 . ASN J 1 113 ? 64.365  104.574 85.706  1.00 43.95 ? 113 ASN J ND2 1 
ATOM 9228  N N   . THR J 1 114 ? 61.805  99.612  87.235  1.00 42.95 ? 114 THR J N   1 
ATOM 9229  C CA  . THR J 1 114 ? 60.686  99.006  87.964  1.00 42.92 ? 114 THR J CA  1 
ATOM 9230  C C   . THR J 1 114 ? 61.182  98.056  89.057  1.00 42.75 ? 114 THR J C   1 
ATOM 9231  O O   . THR J 1 114 ? 62.072  97.240  88.816  1.00 42.67 ? 114 THR J O   1 
ATOM 9232  C CB  . THR J 1 114 ? 59.748  98.228  87.013  1.00 43.06 ? 114 THR J CB  1 
ATOM 9233  O OG1 . THR J 1 114 ? 59.404  99.053  85.892  1.00 43.18 ? 114 THR J OG1 1 
ATOM 9234  C CG2 . THR J 1 114 ? 58.470  97.792  87.732  1.00 43.11 ? 114 THR J CG2 1 
ATOM 9235  N N   . ALA J 1 115 ? 60.593  98.171  90.248  1.00 42.77 ? 115 ALA J N   1 
ATOM 9236  C CA  . ALA J 1 115 ? 60.984  97.363  91.407  1.00 42.75 ? 115 ALA J CA  1 
ATOM 9237  C C   . ALA J 1 115 ? 60.271  96.014  91.412  1.00 42.74 ? 115 ALA J C   1 
ATOM 9238  O O   . ALA J 1 115 ? 59.184  95.872  90.845  1.00 42.81 ? 115 ALA J O   1 
ATOM 9239  C CB  . ALA J 1 115 ? 60.688  98.114  92.696  1.00 42.91 ? 115 ALA J CB  1 
ATOM 9240  N N   . VAL J 1 116 ? 60.890  95.034  92.068  1.00 42.90 ? 116 VAL J N   1 
ATOM 9241  C CA  . VAL J 1 116 ? 60.325  93.678  92.177  1.00 43.05 ? 116 VAL J CA  1 
ATOM 9242  C C   . VAL J 1 116 ? 59.073  93.622  93.063  1.00 43.55 ? 116 VAL J C   1 
ATOM 9243  O O   . VAL J 1 116 ? 58.224  92.746  92.879  1.00 43.76 ? 116 VAL J O   1 
ATOM 9244  C CB  . VAL J 1 116 ? 61.357  92.636  92.682  1.00 42.93 ? 116 VAL J CB  1 
ATOM 9245  C CG1 . VAL J 1 116 ? 62.560  92.574  91.746  1.00 42.89 ? 116 VAL J CG1 1 
ATOM 9246  C CG2 . VAL J 1 116 ? 61.776  92.900  94.129  1.00 42.98 ? 116 VAL J CG2 1 
ATOM 9247  N N   . THR J 1 117 ? 58.972  94.543  94.023  1.00 43.94 ? 117 THR J N   1 
ATOM 9248  C CA  . THR J 1 117 ? 57.757  94.709  94.828  1.00 44.22 ? 117 THR J CA  1 
ATOM 9249  C C   . THR J 1 117 ? 56.587  95.213  93.979  1.00 44.30 ? 117 THR J C   1 
ATOM 9250  O O   . THR J 1 117 ? 55.445  94.793  94.183  1.00 44.49 ? 117 THR J O   1 
ATOM 9251  C CB  . THR J 1 117 ? 57.977  95.685  96.003  1.00 44.54 ? 117 THR J CB  1 
ATOM 9252  O OG1 . THR J 1 117 ? 58.508  96.922  95.511  1.00 44.68 ? 117 THR J OG1 1 
ATOM 9253  C CG2 . THR J 1 117 ? 58.938  95.089  97.024  1.00 44.67 ? 117 THR J CG2 1 
ATOM 9254  N N   . SER J 1 118 ? 56.877  96.110  93.035  1.00 44.37 ? 118 SER J N   1 
ATOM 9255  C CA  . SER J 1 118 ? 55.883  96.584  92.065  1.00 44.50 ? 118 SER J CA  1 
ATOM 9256  C C   . SER J 1 118 ? 55.573  95.512  91.019  1.00 44.49 ? 118 SER J C   1 
ATOM 9257  O O   . SER J 1 118 ? 56.273  94.499  90.925  1.00 44.41 ? 118 SER J O   1 
ATOM 9258  C CB  . SER J 1 118 ? 56.373  97.858  91.369  1.00 44.61 ? 118 SER J CB  1 
ATOM 9259  O OG  . SER J 1 118 ? 56.668  98.873  92.313  1.00 44.73 ? 118 SER J OG  1 
ATOM 9260  N N   . SER J 1 119 ? 54.525  95.750  90.231  1.00 44.65 ? 119 SER J N   1 
ATOM 9261  C CA  . SER J 1 119 ? 54.058  94.785  89.229  1.00 44.77 ? 119 SER J CA  1 
ATOM 9262  C C   . SER J 1 119 ? 55.028  94.639  88.056  1.00 44.88 ? 119 SER J C   1 
ATOM 9263  O O   . SER J 1 119 ? 55.915  95.475  87.855  1.00 44.83 ? 119 SER J O   1 
ATOM 9264  C CB  . SER J 1 119 ? 52.676  95.184  88.705  1.00 44.90 ? 119 SER J CB  1 
ATOM 9265  O OG  . SER J 1 119 ? 52.128  94.169  87.880  1.00 44.99 ? 119 SER J OG  1 
ATOM 9266  N N   . GLN J 1 120 ? 54.841  93.568  87.286  1.00 44.97 ? 120 GLN J N   1 
ATOM 9267  C CA  . GLN J 1 120 ? 55.717  93.239  86.158  1.00 45.08 ? 120 GLN J CA  1 
ATOM 9268  C C   . GLN J 1 120 ? 55.574  94.271  85.032  1.00 45.31 ? 120 GLN J C   1 
ATOM 9269  O O   . GLN J 1 120 ? 54.451  94.666  84.709  1.00 45.67 ? 120 GLN J O   1 
ATOM 9270  C CB  . GLN J 1 120 ? 55.389  91.841  85.622  1.00 45.05 ? 120 GLN J CB  1 
ATOM 9271  C CG  . GLN J 1 120 ? 56.353  91.321  84.564  1.00 45.09 ? 120 GLN J CG  1 
ATOM 9272  C CD  . GLN J 1 120 ? 56.017  89.911  84.110  1.00 45.21 ? 120 GLN J CD  1 
ATOM 9273  O OE1 . GLN J 1 120 ? 55.835  89.008  84.927  1.00 45.22 ? 120 GLN J OE1 1 
ATOM 9274  N NE2 . GLN J 1 120 ? 55.937  89.716  82.798  1.00 45.29 ? 120 GLN J NE2 1 
ATOM 9275  N N   . PRO J 1 121 ? 56.707  94.725  84.447  1.00 45.40 ? 121 PRO J N   1 
ATOM 9276  C CA  . PRO J 1 121 ? 56.648  95.594  83.264  1.00 45.55 ? 121 PRO J CA  1 
ATOM 9277  C C   . PRO J 1 121 ? 55.935  94.946  82.073  1.00 45.58 ? 121 PRO J C   1 
ATOM 9278  O O   . PRO J 1 121 ? 56.190  93.779  81.765  1.00 45.53 ? 121 PRO J O   1 
ATOM 9279  C CB  . PRO J 1 121 ? 58.124  95.833  82.929  1.00 45.56 ? 121 PRO J CB  1 
ATOM 9280  C CG  . PRO J 1 121 ? 58.830  95.693  84.226  1.00 45.48 ? 121 PRO J CG  1 
ATOM 9281  C CD  . PRO J 1 121 ? 58.075  94.651  84.998  1.00 45.42 ? 121 PRO J CD  1 
ATOM 9282  N N   . GLU J 1 122 ? 55.050  95.704  81.428  1.00 45.76 ? 122 GLU J N   1 
ATOM 9283  C CA  . GLU J 1 122 ? 54.284  95.212  80.276  1.00 45.90 ? 122 GLU J CA  1 
ATOM 9284  C C   . GLU J 1 122 ? 55.173  95.012  79.053  1.00 45.50 ? 122 GLU J C   1 
ATOM 9285  O O   . GLU J 1 122 ? 55.047  94.006  78.356  1.00 45.42 ? 122 GLU J O   1 
ATOM 9286  C CB  . GLU J 1 122 ? 53.137  96.172  79.930  1.00 46.32 ? 122 GLU J CB  1 
ATOM 9287  C CG  . GLU J 1 122 ? 52.053  96.281  80.999  1.00 46.56 ? 122 GLU J CG  1 
ATOM 9288  C CD  . GLU J 1 122 ? 51.268  94.993  81.214  1.00 46.77 ? 122 GLU J CD  1 
ATOM 9289  O OE1 . GLU J 1 122 ? 51.213  94.145  80.296  1.00 46.76 ? 122 GLU J OE1 1 
ATOM 9290  O OE2 . GLU J 1 122 ? 50.696  94.831  82.312  1.00 46.96 ? 122 GLU J OE2 1 
ATOM 9291  N N   . SER J 1 123 ? 56.055  95.978  78.797  1.00 45.20 ? 123 SER J N   1 
ATOM 9292  C CA  . SER J 1 123 ? 57.049  95.889  77.724  1.00 45.03 ? 123 SER J CA  1 
ATOM 9293  C C   . SER J 1 123 ? 58.391  96.450  78.192  1.00 44.61 ? 123 SER J C   1 
ATOM 9294  O O   . SER J 1 123 ? 58.440  97.342  79.042  1.00 44.74 ? 123 SER J O   1 
ATOM 9295  C CB  . SER J 1 123 ? 56.569  96.655  76.489  1.00 45.23 ? 123 SER J CB  1 
ATOM 9296  O OG  . SER J 1 123 ? 57.464  96.490  75.403  1.00 45.30 ? 123 SER J OG  1 
ATOM 9297  N N   . CYS J 1 124 ? 59.472  95.919  77.624  1.00 44.10 ? 124 CYS J N   1 
ATOM 9298  C CA  . CYS J 1 124 ? 60.833  96.330  77.983  1.00 43.87 ? 124 CYS J CA  1 
ATOM 9299  C C   . CYS J 1 124 ? 61.141  97.743  77.459  1.00 44.47 ? 124 CYS J C   1 
ATOM 9300  O O   . CYS J 1 124 ? 60.597  98.139  76.425  1.00 44.77 ? 124 CYS J O   1 
ATOM 9301  C CB  . CYS J 1 124 ? 61.858  95.327  77.436  1.00 43.10 ? 124 CYS J CB  1 
ATOM 9302  S SG  . CYS J 1 124 ? 61.491  94.706  75.777  1.00 42.51 ? 124 CYS J SG  1 
ATOM 9303  N N   . PRO J 1 125 ? 62.002  98.510  78.170  1.00 44.93 ? 125 PRO J N   1 
ATOM 9304  C CA  . PRO J 1 125 ? 62.372  99.853  77.684  1.00 45.17 ? 125 PRO J CA  1 
ATOM 9305  C C   . PRO J 1 125 ? 63.174  99.861  76.376  1.00 45.54 ? 125 PRO J C   1 
ATOM 9306  O O   . PRO J 1 125 ? 63.321  100.908 75.742  1.00 45.78 ? 125 PRO J O   1 
ATOM 9307  C CB  . PRO J 1 125 ? 63.228  100.423 78.826  1.00 45.17 ? 125 PRO J CB  1 
ATOM 9308  C CG  . PRO J 1 125 ? 62.858  99.632  80.027  1.00 45.13 ? 125 PRO J CG  1 
ATOM 9309  C CD  . PRO J 1 125 ? 62.544  98.259  79.521  1.00 45.02 ? 125 PRO J CD  1 
ATOM 9310  O OXT . PRO J 1 125 ? 63.692  98.841  75.918  1.00 45.77 ? 125 PRO J OXT 1 
ATOM 9311  N N   . PHE K 1 1   ? 83.987  87.846  149.089 1.00 65.53 ? 1   PHE K N   1 
ATOM 9312  C CA  . PHE K 1 1   ? 83.832  86.739  148.101 1.00 65.24 ? 1   PHE K CA  1 
ATOM 9313  C C   . PHE K 1 1   ? 83.168  85.533  148.777 1.00 64.19 ? 1   PHE K C   1 
ATOM 9314  O O   . PHE K 1 1   ? 83.836  84.728  149.434 1.00 64.28 ? 1   PHE K O   1 
ATOM 9315  C CB  . PHE K 1 1   ? 85.200  86.366  147.504 1.00 66.00 ? 1   PHE K CB  1 
ATOM 9316  C CG  . PHE K 1 1   ? 85.126  85.754  146.128 1.00 66.66 ? 1   PHE K CG  1 
ATOM 9317  C CD1 . PHE K 1 1   ? 84.453  84.553  145.913 1.00 66.87 ? 1   PHE K CD1 1 
ATOM 9318  C CD2 . PHE K 1 1   ? 85.747  86.370  145.044 1.00 67.09 ? 1   PHE K CD2 1 
ATOM 9319  C CE1 . PHE K 1 1   ? 84.392  83.987  144.649 1.00 67.09 ? 1   PHE K CE1 1 
ATOM 9320  C CE2 . PHE K 1 1   ? 85.687  85.805  143.778 1.00 67.25 ? 1   PHE K CE2 1 
ATOM 9321  C CZ  . PHE K 1 1   ? 85.010  84.613  143.580 1.00 67.25 ? 1   PHE K CZ  1 
ATOM 9322  N N   . THR K 1 2   ? 81.852  85.416  148.604 1.00 62.81 ? 2   THR K N   1 
ATOM 9323  C CA  . THR K 1 2   ? 81.061  84.355  149.236 1.00 61.68 ? 2   THR K CA  1 
ATOM 9324  C C   . THR K 1 2   ? 81.111  83.055  148.435 1.00 60.37 ? 2   THR K C   1 
ATOM 9325  O O   . THR K 1 2   ? 81.606  83.025  147.306 1.00 60.21 ? 2   THR K O   1 
ATOM 9326  C CB  . THR K 1 2   ? 79.580  84.774  149.385 1.00 61.85 ? 2   THR K CB  1 
ATOM 9327  O OG1 . THR K 1 2   ? 79.044  85.112  148.101 1.00 61.94 ? 2   THR K OG1 1 
ATOM 9328  C CG2 . THR K 1 2   ? 79.437  85.969  150.317 1.00 61.91 ? 2   THR K CG2 1 
ATOM 9329  N N   . LEU K 1 3   ? 80.592  81.987  149.037 1.00 59.31 ? 3   LEU K N   1 
ATOM 9330  C CA  . LEU K 1 3   ? 80.413  80.704  148.353 1.00 58.56 ? 3   LEU K CA  1 
ATOM 9331  C C   . LEU K 1 3   ? 79.250  80.774  147.362 1.00 57.74 ? 3   LEU K C   1 
ATOM 9332  O O   . LEU K 1 3   ? 79.334  80.208  146.273 1.00 57.87 ? 3   LEU K O   1 
ATOM 9333  C CB  . LEU K 1 3   ? 80.175  79.576  149.366 1.00 58.65 ? 3   LEU K CB  1 
ATOM 9334  C CG  . LEU K 1 3   ? 80.089  78.138  148.838 1.00 58.84 ? 3   LEU K CG  1 
ATOM 9335  C CD1 . LEU K 1 3   ? 81.395  77.703  148.187 1.00 58.83 ? 3   LEU K CD1 1 
ATOM 9336  C CD2 . LEU K 1 3   ? 79.713  77.192  149.969 1.00 59.00 ? 3   LEU K CD2 1 
ATOM 9337  N N   . ILE K 1 4   ? 78.168  81.451  147.753 1.00 56.84 ? 4   ILE K N   1 
ATOM 9338  C CA  . ILE K 1 4   ? 77.008  81.672  146.870 1.00 56.10 ? 4   ILE K CA  1 
ATOM 9339  C C   . ILE K 1 4   ? 77.352  82.476  145.604 1.00 55.55 ? 4   ILE K C   1 
ATOM 9340  O O   . ILE K 1 4   ? 76.800  82.204  144.535 1.00 55.56 ? 4   ILE K O   1 
ATOM 9341  C CB  . ILE K 1 4   ? 75.809  82.317  147.634 1.00 56.16 ? 4   ILE K CB  1 
ATOM 9342  C CG1 . ILE K 1 4   ? 74.533  82.362  146.775 1.00 56.20 ? 4   ILE K CG1 1 
ATOM 9343  C CG2 . ILE K 1 4   ? 76.124  83.729  148.118 1.00 56.30 ? 4   ILE K CG2 1 
ATOM 9344  C CD1 . ILE K 1 4   ? 74.063  81.019  146.263 1.00 56.15 ? 4   ILE K CD1 1 
ATOM 9345  N N   . GLU K 1 5   ? 78.251  83.454  145.729 1.00 55.12 ? 5   GLU K N   1 
ATOM 9346  C CA  . GLU K 1 5   ? 78.735  84.223  144.572 1.00 54.70 ? 5   GLU K CA  1 
ATOM 9347  C C   . GLU K 1 5   ? 79.593  83.360  143.640 1.00 54.01 ? 5   GLU K C   1 
ATOM 9348  O O   . GLU K 1 5   ? 79.583  83.566  142.428 1.00 54.13 ? 5   GLU K O   1 
ATOM 9349  C CB  . GLU K 1 5   ? 79.513  85.464  145.030 1.00 54.98 ? 5   GLU K CB  1 
ATOM 9350  C CG  . GLU K 1 5   ? 79.968  86.390  143.905 1.00 55.44 ? 5   GLU K CG  1 
ATOM 9351  C CD  . GLU K 1 5   ? 81.411  86.164  143.479 1.00 55.80 ? 5   GLU K CD  1 
ATOM 9352  O OE1 . GLU K 1 5   ? 82.319  86.369  144.312 1.00 55.97 ? 5   GLU K OE1 1 
ATOM 9353  O OE2 . GLU K 1 5   ? 81.638  85.792  142.308 1.00 55.93 ? 5   GLU K OE2 1 
ATOM 9354  N N   . LEU K 1 6   ? 80.336  82.414  144.209 1.00 53.26 ? 6   LEU K N   1 
ATOM 9355  C CA  . LEU K 1 6   ? 81.080  81.425  143.424 1.00 52.82 ? 6   LEU K CA  1 
ATOM 9356  C C   . LEU K 1 6   ? 80.149  80.374  142.817 1.00 52.17 ? 6   LEU K C   1 
ATOM 9357  O O   . LEU K 1 6   ? 80.349  79.946  141.680 1.00 52.30 ? 6   LEU K O   1 
ATOM 9358  C CB  . LEU K 1 6   ? 82.129  80.732  144.301 1.00 53.07 ? 6   LEU K CB  1 
ATOM 9359  C CG  . LEU K 1 6   ? 83.181  79.839  143.628 1.00 53.25 ? 6   LEU K CG  1 
ATOM 9360  C CD1 . LEU K 1 6   ? 84.033  80.615  142.627 1.00 53.35 ? 6   LEU K CD1 1 
ATOM 9361  C CD2 . LEU K 1 6   ? 84.052  79.170  144.688 1.00 53.36 ? 6   LEU K CD2 1 
ATOM 9362  N N   . LEU K 1 7   ? 79.144  79.960  143.590 1.00 51.68 ? 7   LEU K N   1 
ATOM 9363  C CA  . LEU K 1 7   ? 78.197  78.916  143.185 1.00 51.18 ? 7   LEU K CA  1 
ATOM 9364  C C   . LEU K 1 7   ? 77.320  79.327  142.002 1.00 50.46 ? 7   LEU K C   1 
ATOM 9365  O O   . LEU K 1 7   ? 77.086  78.518  141.101 1.00 50.55 ? 7   LEU K O   1 
ATOM 9366  C CB  . LEU K 1 7   ? 77.317  78.522  144.377 1.00 51.54 ? 7   LEU K CB  1 
ATOM 9367  C CG  . LEU K 1 7   ? 76.295  77.392  144.217 1.00 52.00 ? 7   LEU K CG  1 
ATOM 9368  C CD1 . LEU K 1 7   ? 76.943  76.115  143.702 1.00 52.25 ? 7   LEU K CD1 1 
ATOM 9369  C CD2 . LEU K 1 7   ? 75.606  77.150  145.552 1.00 52.11 ? 7   LEU K CD2 1 
ATOM 9370  N N   . ILE K 1 8   ? 76.831  80.568  142.015 1.00 49.67 ? 8   ILE K N   1 
ATOM 9371  C CA  . ILE K 1 8   ? 76.059  81.110  140.884 1.00 48.95 ? 8   ILE K CA  1 
ATOM 9372  C C   . ILE K 1 8   ? 76.920  81.288  139.626 1.00 48.10 ? 8   ILE K C   1 
ATOM 9373  O O   . ILE K 1 8   ? 76.426  81.095  138.519 1.00 48.25 ? 8   ILE K O   1 
ATOM 9374  C CB  . ILE K 1 8   ? 75.315  82.429  141.239 1.00 49.08 ? 8   ILE K CB  1 
ATOM 9375  C CG1 . ILE K 1 8   ? 74.257  82.750  140.169 1.00 49.31 ? 8   ILE K CG1 1 
ATOM 9376  C CG2 . ILE K 1 8   ? 76.284  83.595  141.418 1.00 49.12 ? 8   ILE K CG2 1 
ATOM 9377  C CD1 . ILE K 1 8   ? 73.241  83.796  140.581 1.00 49.49 ? 8   ILE K CD1 1 
ATOM 9378  N N   . VAL K 1 9   ? 78.195  81.641  139.800 1.00 47.27 ? 9   VAL K N   1 
ATOM 9379  C CA  . VAL K 1 9   ? 79.144  81.732  138.678 1.00 46.73 ? 9   VAL K CA  1 
ATOM 9380  C C   . VAL K 1 9   ? 79.374  80.357  138.031 1.00 46.19 ? 9   VAL K C   1 
ATOM 9381  O O   . VAL K 1 9   ? 79.475  80.261  136.808 1.00 46.23 ? 9   VAL K O   1 
ATOM 9382  C CB  . VAL K 1 9   ? 80.486  82.377  139.118 1.00 46.84 ? 9   VAL K CB  1 
ATOM 9383  C CG1 . VAL K 1 9   ? 81.582  82.197  138.071 1.00 46.95 ? 9   VAL K CG1 1 
ATOM 9384  C CG2 . VAL K 1 9   ? 80.284  83.860  139.404 1.00 46.91 ? 9   VAL K CG2 1 
ATOM 9385  N N   . ILE K 1 10  ? 79.449  79.310  138.852 1.00 45.60 ? 10  ILE K N   1 
ATOM 9386  C CA  . ILE K 1 10  ? 79.541  77.928  138.359 1.00 45.28 ? 10  ILE K CA  1 
ATOM 9387  C C   . ILE K 1 10  ? 78.260  77.529  137.605 1.00 44.89 ? 10  ILE K C   1 
ATOM 9388  O O   . ILE K 1 10  ? 78.330  76.832  136.591 1.00 44.97 ? 10  ILE K O   1 
ATOM 9389  C CB  . ILE K 1 10  ? 79.839  76.930  139.512 1.00 45.46 ? 10  ILE K CB  1 
ATOM 9390  C CG1 . ILE K 1 10  ? 81.246  77.176  140.080 1.00 45.68 ? 10  ILE K CG1 1 
ATOM 9391  C CG2 . ILE K 1 10  ? 79.729  75.478  139.046 1.00 45.52 ? 10  ILE K CG2 1 
ATOM 9392  C CD1 . ILE K 1 10  ? 81.448  76.651  141.487 1.00 45.81 ? 10  ILE K CD1 1 
ATOM 9393  N N   . ALA K 1 11  ? 77.108  77.976  138.103 1.00 44.53 ? 11  ALA K N   1 
ATOM 9394  C CA  . ALA K 1 11  ? 75.814  77.719  137.459 1.00 44.37 ? 11  ALA K CA  1 
ATOM 9395  C C   . ALA K 1 11  ? 75.678  78.375  136.081 1.00 44.14 ? 11  ALA K C   1 
ATOM 9396  O O   . ALA K 1 11  ? 75.146  77.760  135.156 1.00 44.27 ? 11  ALA K O   1 
ATOM 9397  C CB  . ALA K 1 11  ? 74.670  78.165  138.362 1.00 44.52 ? 11  ALA K CB  1 
ATOM 9398  N N   . ILE K 1 12  ? 76.157  79.613  135.952 1.00 43.94 ? 12  ILE K N   1 
ATOM 9399  C CA  . ILE K 1 12  ? 76.096  80.354  134.681 1.00 43.88 ? 12  ILE K CA  1 
ATOM 9400  C C   . ILE K 1 12  ? 77.071  79.784  133.639 1.00 43.93 ? 12  ILE K C   1 
ATOM 9401  O O   . ILE K 1 12  ? 76.746  79.753  132.451 1.00 44.27 ? 12  ILE K O   1 
ATOM 9402  C CB  . ILE K 1 12  ? 76.340  81.874  134.891 1.00 43.83 ? 12  ILE K CB  1 
ATOM 9403  C CG1 . ILE K 1 12  ? 75.248  82.493  135.783 1.00 44.06 ? 12  ILE K CG1 1 
ATOM 9404  C CG2 . ILE K 1 12  ? 76.420  82.628  133.562 1.00 43.85 ? 12  ILE K CG2 1 
ATOM 9405  C CD1 . ILE K 1 12  ? 73.828  82.372  135.268 1.00 44.26 ? 12  ILE K CD1 1 
ATOM 9406  N N   . ILE K 1 13  ? 78.246  79.329  134.078 1.00 43.69 ? 13  ILE K N   1 
ATOM 9407  C CA  . ILE K 1 13  ? 79.219  78.679  133.182 1.00 43.60 ? 13  ILE K CA  1 
ATOM 9408  C C   . ILE K 1 13  ? 78.628  77.414  132.538 1.00 43.55 ? 13  ILE K C   1 
ATOM 9409  O O   . ILE K 1 13  ? 78.871  77.150  131.359 1.00 43.61 ? 13  ILE K O   1 
ATOM 9410  C CB  . ILE K 1 13  ? 80.553  78.362  133.915 1.00 43.76 ? 13  ILE K CB  1 
ATOM 9411  C CG1 . ILE K 1 13  ? 81.296  79.662  134.253 1.00 43.92 ? 13  ILE K CG1 1 
ATOM 9412  C CG2 . ILE K 1 13  ? 81.471  77.474  133.068 1.00 43.84 ? 13  ILE K CG2 1 
ATOM 9413  C CD1 . ILE K 1 13  ? 82.276  79.534  135.401 1.00 44.05 ? 13  ILE K CD1 1 
ATOM 9414  N N   . ALA K 1 14  ? 77.855  76.648  133.309 1.00 43.61 ? 14  ALA K N   1 
ATOM 9415  C CA  . ALA K 1 14  ? 77.149  75.467  132.794 1.00 43.68 ? 14  ALA K CA  1 
ATOM 9416  C C   . ALA K 1 14  ? 76.100  75.818  131.734 1.00 43.73 ? 14  ALA K C   1 
ATOM 9417  O O   . ALA K 1 14  ? 75.912  75.066  130.774 1.00 43.84 ? 14  ALA K O   1 
ATOM 9418  C CB  . ALA K 1 14  ? 76.501  74.697  133.937 1.00 43.75 ? 14  ALA K CB  1 
ATOM 9419  N N   . ILE K 1 15  ? 75.422  76.952  131.918 1.00 43.74 ? 15  ILE K N   1 
ATOM 9420  C CA  . ILE K 1 15  ? 74.421  77.443  130.961 1.00 43.83 ? 15  ILE K CA  1 
ATOM 9421  C C   . ILE K 1 15  ? 75.093  77.955  129.684 1.00 43.79 ? 15  ILE K C   1 
ATOM 9422  O O   . ILE K 1 15  ? 74.681  77.594  128.579 1.00 43.92 ? 15  ILE K O   1 
ATOM 9423  C CB  . ILE K 1 15  ? 73.540  78.561  131.578 1.00 44.00 ? 15  ILE K CB  1 
ATOM 9424  C CG1 . ILE K 1 15  ? 72.724  78.010  132.757 1.00 44.22 ? 15  ILE K CG1 1 
ATOM 9425  C CG2 . ILE K 1 15  ? 72.593  79.157  130.537 1.00 44.10 ? 15  ILE K CG2 1 
ATOM 9426  C CD1 . ILE K 1 15  ? 72.211  79.072  133.706 1.00 44.27 ? 15  ILE K CD1 1 
ATOM 9427  N N   . LEU K 1 16  ? 76.110  78.800  129.846 1.00 43.76 ? 16  LEU K N   1 
ATOM 9428  C CA  . LEU K 1 16  ? 76.855  79.365  128.708 1.00 43.77 ? 16  LEU K CA  1 
ATOM 9429  C C   . LEU K 1 16  ? 77.611  78.307  127.892 1.00 43.68 ? 16  LEU K C   1 
ATOM 9430  O O   . LEU K 1 16  ? 77.717  78.433  126.671 1.00 43.80 ? 16  LEU K O   1 
ATOM 9431  C CB  . LEU K 1 16  ? 77.820  80.474  129.170 1.00 43.94 ? 16  LEU K CB  1 
ATOM 9432  C CG  . LEU K 1 16  ? 77.265  81.905  129.243 1.00 44.26 ? 16  LEU K CG  1 
ATOM 9433  C CD1 . LEU K 1 16  ? 75.891  81.983  129.898 1.00 44.40 ? 16  LEU K CD1 1 
ATOM 9434  C CD2 . LEU K 1 16  ? 78.254  82.813  129.962 1.00 44.39 ? 16  LEU K CD2 1 
ATOM 9435  N N   . ALA K 1 17  ? 78.130  77.279  128.564 1.00 43.48 ? 17  ALA K N   1 
ATOM 9436  C CA  . ALA K 1 17  ? 78.831  76.175  127.891 1.00 43.36 ? 17  ALA K CA  1 
ATOM 9437  C C   . ALA K 1 17  ? 77.915  75.311  127.014 1.00 43.29 ? 17  ALA K C   1 
ATOM 9438  O O   . ALA K 1 17  ? 78.387  74.679  126.067 1.00 43.40 ? 17  ALA K O   1 
ATOM 9439  C CB  . ALA K 1 17  ? 79.549  75.301  128.912 1.00 43.38 ? 17  ALA K CB  1 
ATOM 9440  N N   . ALA K 1 18  ? 76.622  75.274  127.338 1.00 43.01 ? 18  ALA K N   1 
ATOM 9441  C CA  . ALA K 1 18  ? 75.640  74.526  126.553 1.00 42.88 ? 18  ALA K CA  1 
ATOM 9442  C C   . ALA K 1 18  ? 75.175  75.315  125.330 1.00 42.74 ? 18  ALA K C   1 
ATOM 9443  O O   . ALA K 1 18  ? 75.252  74.821  124.203 1.00 42.83 ? 18  ALA K O   1 
ATOM 9444  C CB  . ALA K 1 18  ? 74.446  74.156  127.421 1.00 42.97 ? 18  ALA K CB  1 
ATOM 9445  N N   . VAL K 1 19  ? 74.702  76.538  125.564 1.00 42.61 ? 19  VAL K N   1 
ATOM 9446  C CA  . VAL K 1 19  ? 74.038  77.337  124.518 1.00 42.61 ? 19  VAL K CA  1 
ATOM 9447  C C   . VAL K 1 19  ? 74.981  77.950  123.474 1.00 42.56 ? 19  VAL K C   1 
ATOM 9448  O O   . VAL K 1 19  ? 74.647  77.977  122.287 1.00 42.66 ? 19  VAL K O   1 
ATOM 9449  C CB  . VAL K 1 19  ? 73.128  78.451  125.112 1.00 42.69 ? 19  VAL K CB  1 
ATOM 9450  C CG1 . VAL K 1 19  ? 72.109  77.853  126.075 1.00 42.75 ? 19  VAL K CG1 1 
ATOM 9451  C CG2 . VAL K 1 19  ? 73.935  79.563  125.784 1.00 42.69 ? 19  VAL K CG2 1 
ATOM 9452  N N   . LEU K 1 20  ? 76.147  78.431  123.908 1.00 42.47 ? 20  LEU K N   1 
ATOM 9453  C CA  . LEU K 1 20  ? 77.071  79.154  123.019 1.00 42.47 ? 20  LEU K CA  1 
ATOM 9454  C C   . LEU K 1 20  ? 77.865  78.250  122.068 1.00 42.21 ? 20  LEU K C   1 
ATOM 9455  O O   . LEU K 1 20  ? 78.343  78.722  121.033 1.00 42.16 ? 20  LEU K O   1 
ATOM 9456  C CB  . LEU K 1 20  ? 78.035  80.022  123.834 1.00 42.79 ? 20  LEU K CB  1 
ATOM 9457  C CG  . LEU K 1 20  ? 77.411  81.068  124.765 1.00 43.17 ? 20  LEU K CG  1 
ATOM 9458  C CD1 . LEU K 1 20  ? 78.488  81.733  125.607 1.00 43.27 ? 20  LEU K CD1 1 
ATOM 9459  C CD2 . LEU K 1 20  ? 76.635  82.113  123.975 1.00 43.25 ? 20  LEU K CD2 1 
ATOM 9460  N N   . ILE K 1 21  ? 78.009  76.970  122.417 1.00 41.85 ? 21  ILE K N   1 
ATOM 9461  C CA  . ILE K 1 21  ? 78.697  75.994  121.562 1.00 41.51 ? 21  ILE K CA  1 
ATOM 9462  C C   . ILE K 1 21  ? 77.744  75.648  120.406 1.00 41.13 ? 21  ILE K C   1 
ATOM 9463  O O   . ILE K 1 21  ? 76.667  75.099  120.650 1.00 41.33 ? 21  ILE K O   1 
ATOM 9464  C CB  . ILE K 1 21  ? 79.110  74.718  122.350 1.00 41.75 ? 21  ILE K CB  1 
ATOM 9465  C CG1 . ILE K 1 21  ? 80.394  74.949  123.170 1.00 41.94 ? 21  ILE K CG1 1 
ATOM 9466  C CG2 . ILE K 1 21  ? 79.381  73.538  121.417 1.00 41.83 ? 21  ILE K CG2 1 
ATOM 9467  C CD1 . ILE K 1 21  ? 80.436  76.196  124.032 1.00 42.01 ? 21  ILE K CD1 1 
ATOM 9468  N N   . PRO K 1 22  ? 78.133  75.963  119.151 1.00 40.49 ? 22  PRO K N   1 
ATOM 9469  C CA  . PRO K 1 22  ? 77.232  75.754  118.016 1.00 40.05 ? 22  PRO K CA  1 
ATOM 9470  C C   . PRO K 1 22  ? 77.171  74.299  117.548 1.00 39.58 ? 22  PRO K C   1 
ATOM 9471  O O   . PRO K 1 22  ? 77.960  73.465  118.000 1.00 39.64 ? 22  PRO K O   1 
ATOM 9472  C CB  . PRO K 1 22  ? 77.852  76.629  116.928 1.00 40.17 ? 22  PRO K CB  1 
ATOM 9473  C CG  . PRO K 1 22  ? 79.312  76.560  117.209 1.00 40.35 ? 22  PRO K CG  1 
ATOM 9474  C CD  . PRO K 1 22  ? 79.448  76.467  118.706 1.00 40.46 ? 22  PRO K CD  1 
ATOM 9475  N N   . ASN K 1 23  ? 76.234  74.017  116.643 1.00 38.96 ? 23  ASN K N   1 
ATOM 9476  C CA  . ASN K 1 23  ? 76.110  72.696  116.026 1.00 38.42 ? 23  ASN K CA  1 
ATOM 9477  C C   . ASN K 1 23  ? 77.249  72.516  115.020 1.00 38.17 ? 23  ASN K C   1 
ATOM 9478  O O   . ASN K 1 23  ? 77.235  73.113  113.940 1.00 38.30 ? 23  ASN K O   1 
ATOM 9479  C CB  . ASN K 1 23  ? 74.741  72.545  115.346 1.00 38.26 ? 23  ASN K CB  1 
ATOM 9480  C CG  . ASN K 1 23  ? 74.424  71.107  114.967 1.00 38.22 ? 23  ASN K CG  1 
ATOM 9481  O OD1 . ASN K 1 23  ? 75.208  70.438  114.294 1.00 38.19 ? 23  ASN K OD1 1 
ATOM 9482  N ND2 . ASN K 1 23  ? 73.259  70.629  115.389 1.00 38.32 ? 23  ASN K ND2 1 
ATOM 9483  N N   . LEU K 1 24  ? 78.236  71.701  115.391 1.00 37.77 ? 24  LEU K N   1 
ATOM 9484  C CA  . LEU K 1 24  ? 79.422  71.482  114.563 1.00 37.53 ? 24  LEU K CA  1 
ATOM 9485  C C   . LEU K 1 24  ? 79.129  70.565  113.377 1.00 37.24 ? 24  LEU K C   1 
ATOM 9486  O O   . LEU K 1 24  ? 79.518  70.874  112.252 1.00 37.38 ? 24  LEU K O   1 
ATOM 9487  C CB  . LEU K 1 24  ? 80.568  70.900  115.398 1.00 37.66 ? 24  LEU K CB  1 
ATOM 9488  C CG  . LEU K 1 24  ? 81.060  71.746  116.580 1.00 37.78 ? 24  LEU K CG  1 
ATOM 9489  C CD1 . LEU K 1 24  ? 81.971  70.925  117.480 1.00 37.90 ? 24  LEU K CD1 1 
ATOM 9490  C CD2 . LEU K 1 24  ? 81.775  73.004  116.111 1.00 37.72 ? 24  LEU K CD2 1 
ATOM 9491  N N   . LEU K 1 25  ? 78.439  69.452  113.634 1.00 36.76 ? 25  LEU K N   1 
ATOM 9492  C CA  . LEU K 1 25  ? 78.141  68.445  112.604 1.00 36.40 ? 25  LEU K CA  1 
ATOM 9493  C C   . LEU K 1 25  ? 77.377  69.023  111.416 1.00 35.85 ? 25  LEU K C   1 
ATOM 9494  O O   . LEU K 1 25  ? 77.688  68.709  110.267 1.00 35.80 ? 25  LEU K O   1 
ATOM 9495  C CB  . LEU K 1 25  ? 77.345  67.274  113.199 1.00 36.59 ? 25  LEU K CB  1 
ATOM 9496  C CG  . LEU K 1 25  ? 77.055  66.072  112.287 1.00 36.81 ? 25  LEU K CG  1 
ATOM 9497  C CD1 . LEU K 1 25  ? 78.344  65.383  111.863 1.00 36.91 ? 25  LEU K CD1 1 
ATOM 9498  C CD2 . LEU K 1 25  ? 76.122  65.086  112.974 1.00 36.92 ? 25  LEU K CD2 1 
ATOM 9499  N N   . ALA K 1 26  ? 76.384  69.862  111.703 1.00 35.52 ? 26  ALA K N   1 
ATOM 9500  C CA  . ALA K 1 26  ? 75.577  70.505  110.663 1.00 35.27 ? 26  ALA K CA  1 
ATOM 9501  C C   . ALA K 1 26  ? 76.389  71.516  109.849 1.00 34.96 ? 26  ALA K C   1 
ATOM 9502  O O   . ALA K 1 26  ? 76.239  71.592  108.629 1.00 34.98 ? 26  ALA K O   1 
ATOM 9503  C CB  . ALA K 1 26  ? 74.350  71.173  111.275 1.00 35.29 ? 26  ALA K CB  1 
ATOM 9504  N N   . ALA K 1 27  ? 77.248  72.278  110.525 1.00 34.79 ? 27  ALA K N   1 
ATOM 9505  C CA  . ALA K 1 27  ? 78.124  73.256  109.865 1.00 34.77 ? 27  ALA K CA  1 
ATOM 9506  C C   . ALA K 1 27  ? 79.089  72.617  108.859 1.00 34.60 ? 27  ALA K C   1 
ATOM 9507  O O   . ALA K 1 27  ? 79.345  73.190  107.799 1.00 34.63 ? 27  ALA K O   1 
ATOM 9508  C CB  . ALA K 1 27  ? 78.903  74.053  110.902 1.00 34.88 ? 27  ALA K CB  1 
ATOM 9509  N N   . ARG K 1 28  ? 79.616  71.439  109.197 1.00 34.46 ? 28  ARG K N   1 
ATOM 9510  C CA  . ARG K 1 28  ? 80.541  70.714  108.317 1.00 34.32 ? 28  ARG K CA  1 
ATOM 9511  C C   . ARG K 1 28  ? 79.856  70.099  107.092 1.00 34.16 ? 28  ARG K C   1 
ATOM 9512  O O   . ARG K 1 28  ? 80.468  70.036  106.025 1.00 34.28 ? 28  ARG K O   1 
ATOM 9513  C CB  . ARG K 1 28  ? 81.297  69.626  109.087 1.00 34.46 ? 28  ARG K CB  1 
ATOM 9514  C CG  . ARG K 1 28  ? 82.180  70.160  110.205 1.00 34.64 ? 28  ARG K CG  1 
ATOM 9515  C CD  . ARG K 1 28  ? 83.278  69.178  110.589 1.00 34.76 ? 28  ARG K CD  1 
ATOM 9516  N NE  . ARG K 1 28  ? 84.453  69.300  109.725 1.00 34.86 ? 28  ARG K NE  1 
ATOM 9517  C CZ  . ARG K 1 28  ? 85.367  70.273  109.793 1.00 35.08 ? 28  ARG K CZ  1 
ATOM 9518  N NH1 . ARG K 1 28  ? 86.393  70.267  108.947 1.00 35.19 ? 28  ARG K NH1 1 
ATOM 9519  N NH2 . ARG K 1 28  ? 85.271  71.257  110.691 1.00 35.14 ? 28  ARG K NH2 1 
ATOM 9520  N N   . LYS K 1 29  ? 78.609  69.642  107.245 1.00 34.02 ? 29  LYS K N   1 
ATOM 9521  C CA  . LYS K 1 29  ? 77.833  69.062  106.129 1.00 33.92 ? 29  LYS K CA  1 
ATOM 9522  C C   . LYS K 1 29  ? 77.779  69.961  104.891 1.00 33.86 ? 29  LYS K C   1 
ATOM 9523  O O   . LYS K 1 29  ? 77.939  69.479  103.769 1.00 34.02 ? 29  LYS K O   1 
ATOM 9524  C CB  . LYS K 1 29  ? 76.393  68.732  106.556 1.00 33.96 ? 29  LYS K CB  1 
ATOM 9525  C CG  . LYS K 1 29  ? 76.228  67.431  107.325 1.00 34.05 ? 29  LYS K CG  1 
ATOM 9526  C CD  . LYS K 1 29  ? 74.764  67.012  107.364 1.00 34.19 ? 29  LYS K CD  1 
ATOM 9527  C CE  . LYS K 1 29  ? 74.540  65.786  108.236 1.00 34.36 ? 29  LYS K CE  1 
ATOM 9528  N NZ  . LYS K 1 29  ? 74.468  66.110  109.689 1.00 34.43 ? 29  LYS K NZ  1 
ATOM 9529  N N   . ARG K 1 30  ? 77.560  71.257  105.106 1.00 33.59 ? 30  ARG K N   1 
ATOM 9530  C CA  . ARG K 1 30  ? 77.450  72.224  104.008 1.00 33.40 ? 30  ARG K CA  1 
ATOM 9531  C C   . ARG K 1 30  ? 78.817  72.559  103.412 1.00 33.27 ? 30  ARG K C   1 
ATOM 9532  O O   . ARG K 1 30  ? 78.926  72.800  102.207 1.00 33.42 ? 30  ARG K O   1 
ATOM 9533  C CB  . ARG K 1 30  ? 76.752  73.508  104.471 1.00 33.43 ? 30  ARG K CB  1 
ATOM 9534  C CG  . ARG K 1 30  ? 75.386  73.312  105.121 1.00 33.49 ? 30  ARG K CG  1 
ATOM 9535  C CD  . ARG K 1 30  ? 74.369  72.641  104.204 1.00 33.56 ? 30  ARG K CD  1 
ATOM 9536  N NE  . ARG K 1 30  ? 73.133  72.292  104.906 1.00 33.57 ? 30  ARG K NE  1 
ATOM 9537  C CZ  . ARG K 1 30  ? 72.070  71.716  104.339 1.00 33.63 ? 30  ARG K CZ  1 
ATOM 9538  N NH1 . ARG K 1 30  ? 72.063  71.411  103.041 1.00 33.65 ? 30  ARG K NH1 1 
ATOM 9539  N NH2 . ARG K 1 30  ? 70.997  71.443  105.078 1.00 33.67 ? 30  ARG K NH2 1 
ATOM 9540  N N   . ALA K 1 31  ? 79.847  72.584  104.256 1.00 32.98 ? 31  ALA K N   1 
ATOM 9541  C CA  . ALA K 1 31  ? 81.230  72.722  103.796 1.00 32.87 ? 31  ALA K CA  1 
ATOM 9542  C C   . ALA K 1 31  ? 81.681  71.500  102.993 1.00 32.84 ? 31  ALA K C   1 
ATOM 9543  O O   . ALA K 1 31  ? 82.418  71.637  102.017 1.00 32.95 ? 31  ALA K O   1 
ATOM 9544  C CB  . ALA K 1 31  ? 82.160  72.946  104.977 1.00 32.90 ? 31  ALA K CB  1 
ATOM 9545  N N   . ASN K 1 32  ? 81.241  70.315  103.417 1.00 32.86 ? 32  ASN K N   1 
ATOM 9546  C CA  . ASN K 1 32  ? 81.502  69.067  102.686 1.00 32.92 ? 32  ASN K CA  1 
ATOM 9547  C C   . ASN K 1 32  ? 80.811  69.026  101.317 1.00 33.12 ? 32  ASN K C   1 
ATOM 9548  O O   . ASN K 1 32  ? 81.357  68.454  100.370 1.00 33.24 ? 32  ASN K O   1 
ATOM 9549  C CB  . ASN K 1 32  ? 81.070  67.847  103.516 1.00 32.83 ? 32  ASN K CB  1 
ATOM 9550  C CG  . ASN K 1 32  ? 81.969  67.593  104.718 1.00 32.76 ? 32  ASN K CG  1 
ATOM 9551  O OD1 . ASN K 1 32  ? 83.184  67.777  104.638 1.00 32.77 ? 32  ASN K OD1 1 
ATOM 9552  N ND2 . ASN K 1 32  ? 81.382  67.175  105.836 1.00 32.81 ? 32  ASN K ND2 1 
ATOM 9553  N N   . ASP K 1 33  ? 79.619  69.616  101.223 1.00 33.25 ? 33  ASP K N   1 
ATOM 9554  C CA  . ASP K 1 33  ? 78.914  69.757  99.939  1.00 33.42 ? 33  ASP K CA  1 
ATOM 9555  C C   . ASP K 1 33  ? 79.658  70.683  98.976  1.00 33.48 ? 33  ASP K C   1 
ATOM 9556  O O   . ASP K 1 33  ? 79.666  70.441  97.767  1.00 33.61 ? 33  ASP K O   1 
ATOM 9557  C CB  . ASP K 1 33  ? 77.488  70.286  100.145 1.00 33.64 ? 33  ASP K CB  1 
ATOM 9558  C CG  . ASP K 1 33  ? 76.586  69.306  100.883 1.00 33.90 ? 33  ASP K CG  1 
ATOM 9559  O OD1 . ASP K 1 33  ? 76.928  68.107  100.994 1.00 33.97 ? 33  ASP K OD1 1 
ATOM 9560  O OD2 . ASP K 1 33  ? 75.517  69.745  101.358 1.00 34.02 ? 33  ASP K OD2 1 
ATOM 9561  N N   . THR K 1 34  ? 80.267  71.739  99.514  1.00 33.41 ? 34  THR K N   1 
ATOM 9562  C CA  . THR K 1 34  ? 81.089  72.662  98.725  1.00 33.36 ? 34  THR K CA  1 
ATOM 9563  C C   . THR K 1 34  ? 82.323  71.974  98.131  1.00 33.33 ? 34  THR K C   1 
ATOM 9564  O O   . THR K 1 34  ? 82.725  72.293  97.014  1.00 33.44 ? 34  THR K O   1 
ATOM 9565  C CB  . THR K 1 34  ? 81.552  73.872  99.569  1.00 33.50 ? 34  THR K CB  1 
ATOM 9566  O OG1 . THR K 1 34  ? 80.443  74.398  100.308 1.00 33.50 ? 34  THR K OG1 1 
ATOM 9567  C CG2 . THR K 1 34  ? 82.138  74.974  98.684  1.00 33.60 ? 34  THR K CG2 1 
ATOM 9568  N N   . VAL K 1 35  ? 82.910  71.039  98.880  1.00 33.30 ? 35  VAL K N   1 
ATOM 9569  C CA  . VAL K 1 35  ? 84.058  70.250  98.408  1.00 33.32 ? 35  VAL K CA  1 
ATOM 9570  C C   . VAL K 1 35  ? 83.650  69.324  97.256  1.00 33.25 ? 35  VAL K C   1 
ATOM 9571  O O   . VAL K 1 35  ? 84.389  69.186  96.279  1.00 33.36 ? 35  VAL K O   1 
ATOM 9572  C CB  . VAL K 1 35  ? 84.699  69.425  99.557  1.00 33.52 ? 35  VAL K CB  1 
ATOM 9573  C CG1 . VAL K 1 35  ? 85.764  68.457  99.036  1.00 33.63 ? 35  VAL K CG1 1 
ATOM 9574  C CG2 . VAL K 1 35  ? 85.308  70.347  100.604 1.00 33.60 ? 35  VAL K CG2 1 
ATOM 9575  N N   . VAL K 1 36  ? 82.480  68.698  97.383  1.00 33.13 ? 36  VAL K N   1 
ATOM 9576  C CA  . VAL K 1 36  ? 81.944  67.809  96.345  1.00 33.03 ? 36  VAL K CA  1 
ATOM 9577  C C   . VAL K 1 36  ? 81.532  68.604  95.103  1.00 33.02 ? 36  VAL K C   1 
ATOM 9578  O O   . VAL K 1 36  ? 81.813  68.186  93.978  1.00 33.10 ? 36  VAL K O   1 
ATOM 9579  C CB  . VAL K 1 36  ? 80.744  66.978  96.869  1.00 33.02 ? 36  VAL K CB  1 
ATOM 9580  C CG1 . VAL K 1 36  ? 80.073  66.196  95.743  1.00 33.08 ? 36  VAL K CG1 1 
ATOM 9581  C CG2 . VAL K 1 36  ? 81.192  66.026  97.970  1.00 33.01 ? 36  VAL K CG2 1 
ATOM 9582  N N   . THR K 1 37  ? 80.862  69.737  95.316  1.00 33.06 ? 37  THR K N   1 
ATOM 9583  C CA  . THR K 1 37  ? 80.448  70.621  94.223  1.00 33.11 ? 37  THR K CA  1 
ATOM 9584  C C   . THR K 1 37  ? 81.648  71.231  93.493  1.00 33.10 ? 37  THR K C   1 
ATOM 9585  O O   . THR K 1 37  ? 81.631  71.341  92.267  1.00 33.26 ? 37  THR K O   1 
ATOM 9586  C CB  . THR K 1 37  ? 79.532  71.759  94.729  1.00 33.23 ? 37  THR K CB  1 
ATOM 9587  O OG1 . THR K 1 37  ? 78.444  71.205  95.480  1.00 33.31 ? 37  THR K OG1 1 
ATOM 9588  C CG2 . THR K 1 37  ? 78.973  72.583  93.565  1.00 33.28 ? 37  THR K CG2 1 
ATOM 9589  N N   . ALA K 1 38  ? 82.678  71.617  94.247  1.00 33.05 ? 38  ALA K N   1 
ATOM 9590  C CA  . ALA K 1 38  ? 83.908  72.171  93.668  1.00 33.10 ? 38  ALA K CA  1 
ATOM 9591  C C   . ALA K 1 38  ? 84.682  71.141  92.848  1.00 33.09 ? 38  ALA K C   1 
ATOM 9592  O O   . ALA K 1 38  ? 85.167  71.459  91.762  1.00 33.10 ? 38  ALA K O   1 
ATOM 9593  C CB  . ALA K 1 38  ? 84.803  72.746  94.759  1.00 33.16 ? 38  ALA K CB  1 
ATOM 9594  N N   . TYR K 1 39  ? 84.794  69.920  93.370  1.00 33.22 ? 39  TYR K N   1 
ATOM 9595  C CA  . TYR K 1 39  ? 85.510  68.840  92.680  1.00 33.27 ? 39  TYR K CA  1 
ATOM 9596  C C   . TYR K 1 39  ? 84.793  68.389  91.406  1.00 33.48 ? 39  TYR K C   1 
ATOM 9597  O O   . TYR K 1 39  ? 85.448  68.086  90.407  1.00 33.64 ? 39  TYR K O   1 
ATOM 9598  C CB  . TYR K 1 39  ? 85.732  67.640  93.606  1.00 33.19 ? 39  TYR K CB  1 
ATOM 9599  C CG  . TYR K 1 39  ? 86.747  66.657  93.065  1.00 33.27 ? 39  TYR K CG  1 
ATOM 9600  C CD1 . TYR K 1 39  ? 88.116  66.899  93.190  1.00 33.33 ? 39  TYR K CD1 1 
ATOM 9601  C CD2 . TYR K 1 39  ? 86.344  65.488  92.418  1.00 33.35 ? 39  TYR K CD2 1 
ATOM 9602  C CE1 . TYR K 1 39  ? 89.054  66.005  92.691  1.00 33.32 ? 39  TYR K CE1 1 
ATOM 9603  C CE2 . TYR K 1 39  ? 87.275  64.587  91.917  1.00 33.36 ? 39  TYR K CE2 1 
ATOM 9604  C CZ  . TYR K 1 39  ? 88.627  64.849  92.055  1.00 33.36 ? 39  TYR K CZ  1 
ATOM 9605  O OH  . TYR K 1 39  ? 89.551  63.958  91.560  1.00 33.46 ? 39  TYR K OH  1 
ATOM 9606  N N   . LEU K 1 40  ? 83.462  68.339  91.448  1.00 33.68 ? 40  LEU K N   1 
ATOM 9607  C CA  . LEU K 1 40  ? 82.654  68.069  90.250  1.00 33.88 ? 40  LEU K CA  1 
ATOM 9608  C C   . LEU K 1 40  ? 82.719  69.220  89.244  1.00 34.31 ? 40  LEU K C   1 
ATOM 9609  O O   . LEU K 1 40  ? 82.751  68.980  88.038  1.00 34.49 ? 40  LEU K O   1 
ATOM 9610  C CB  . LEU K 1 40  ? 81.194  67.782  90.617  1.00 33.80 ? 40  LEU K CB  1 
ATOM 9611  C CG  . LEU K 1 40  ? 80.918  66.439  91.298  1.00 33.73 ? 40  LEU K CG  1 
ATOM 9612  C CD1 . LEU K 1 40  ? 79.523  66.438  91.896  1.00 33.66 ? 40  LEU K CD1 1 
ATOM 9613  C CD2 . LEU K 1 40  ? 81.079  65.277  90.328  1.00 33.70 ? 40  LEU K CD2 1 
ATOM 9614  N N   . ASN K 1 41  ? 82.733  70.458  89.743  1.00 34.79 ? 41  ASN K N   1 
ATOM 9615  C CA  . ASN K 1 41  ? 82.913  71.642  88.893  1.00 35.15 ? 41  ASN K CA  1 
ATOM 9616  C C   . ASN K 1 41  ? 84.286  71.634  88.210  1.00 35.40 ? 41  ASN K C   1 
ATOM 9617  O O   . ASN K 1 41  ? 84.400  72.016  87.045  1.00 35.49 ? 41  ASN K O   1 
ATOM 9618  C CB  . ASN K 1 41  ? 82.732  72.930  89.708  1.00 35.34 ? 41  ASN K CB  1 
ATOM 9619  C CG  . ASN K 1 41  ? 82.749  74.183  88.847  1.00 35.61 ? 41  ASN K CG  1 
ATOM 9620  O OD1 . ASN K 1 41  ? 82.126  74.235  87.786  1.00 35.79 ? 41  ASN K OD1 1 
ATOM 9621  N ND2 . ASN K 1 41  ? 83.461  75.207  89.307  1.00 35.71 ? 41  ASN K ND2 1 
ATOM 9622  N N   . ASP K 1 42  ? 85.314  71.200  88.940  1.00 35.76 ? 42  ASP K N   1 
ATOM 9623  C CA  . ASP K 1 42  ? 86.651  70.992  88.367  1.00 36.04 ? 42  ASP K CA  1 
ATOM 9624  C C   . ASP K 1 42  ? 86.674  69.801  87.406  1.00 36.01 ? 42  ASP K C   1 
ATOM 9625  O O   . ASP K 1 42  ? 87.309  69.869  86.355  1.00 36.17 ? 42  ASP K O   1 
ATOM 9626  C CB  . ASP K 1 42  ? 87.703  70.785  89.469  1.00 36.32 ? 42  ASP K CB  1 
ATOM 9627  C CG  . ASP K 1 42  ? 87.941  72.036  90.308  1.00 36.66 ? 42  ASP K CG  1 
ATOM 9628  O OD1 . ASP K 1 42  ? 87.939  73.157  89.750  1.00 36.82 ? 42  ASP K OD1 1 
ATOM 9629  O OD2 . ASP K 1 42  ? 88.141  71.895  91.533  1.00 36.78 ? 42  ASP K OD2 1 
ATOM 9630  N N   . ALA K 1 43  ? 85.984  68.720  87.771  1.00 35.92 ? 43  ALA K N   1 
ATOM 9631  C CA  . ALA K 1 43  ? 85.884  67.523  86.925  1.00 35.94 ? 43  ALA K CA  1 
ATOM 9632  C C   . ALA K 1 43  ? 85.233  67.806  85.569  1.00 36.00 ? 43  ALA K C   1 
ATOM 9633  O O   . ALA K 1 43  ? 85.638  67.232  84.560  1.00 36.16 ? 43  ALA K O   1 
ATOM 9634  C CB  . ALA K 1 43  ? 85.124  66.420  87.649  1.00 35.95 ? 43  ALA K CB  1 
ATOM 9635  N N   . VAL K 1 44  ? 84.230  68.683  85.557  1.00 36.18 ? 44  VAL K N   1 
ATOM 9636  C CA  . VAL K 1 44  ? 83.567  69.114  84.316  1.00 36.35 ? 44  VAL K CA  1 
ATOM 9637  C C   . VAL K 1 44  ? 84.529  69.880  83.394  1.00 36.53 ? 44  VAL K C   1 
ATOM 9638  O O   . VAL K 1 44  ? 84.462  69.728  82.173  1.00 36.62 ? 44  VAL K O   1 
ATOM 9639  C CB  . VAL K 1 44  ? 82.295  69.958  84.619  1.00 36.45 ? 44  VAL K CB  1 
ATOM 9640  C CG1 . VAL K 1 44  ? 81.745  70.642  83.368  1.00 36.57 ? 44  VAL K CG1 1 
ATOM 9641  C CG2 . VAL K 1 44  ? 81.214  69.087  85.259  1.00 36.45 ? 44  VAL K CG2 1 
ATOM 9642  N N   . LYS K 1 45  ? 85.414  70.691  83.976  1.00 36.84 ? 45  LYS K N   1 
ATOM 9643  C CA  . LYS K 1 45  ? 86.401  71.457  83.201  1.00 37.12 ? 45  LYS K CA  1 
ATOM 9644  C C   . LYS K 1 45  ? 87.409  70.551  82.495  1.00 37.00 ? 45  LYS K C   1 
ATOM 9645  O O   . LYS K 1 45  ? 87.644  70.702  81.296  1.00 37.15 ? 45  LYS K O   1 
ATOM 9646  C CB  . LYS K 1 45  ? 87.140  72.467  84.090  1.00 37.49 ? 45  LYS K CB  1 
ATOM 9647  C CG  . LYS K 1 45  ? 86.261  73.597  84.607  1.00 37.82 ? 45  LYS K CG  1 
ATOM 9648  C CD  . LYS K 1 45  ? 86.912  74.337  85.766  1.00 38.10 ? 45  LYS K CD  1 
ATOM 9649  C CE  . LYS K 1 45  ? 85.958  75.349  86.382  1.00 38.33 ? 45  LYS K CE  1 
ATOM 9650  N NZ  . LYS K 1 45  ? 86.520  75.995  87.600  1.00 38.49 ? 45  LYS K NZ  1 
ATOM 9651  N N   . PHE K 1 46  ? 87.991  69.612  83.238  1.00 36.90 ? 46  PHE K N   1 
ATOM 9652  C CA  . PHE K 1 46  ? 88.967  68.669  82.672  1.00 36.84 ? 46  PHE K CA  1 
ATOM 9653  C C   . PHE K 1 46  ? 88.351  67.610  81.747  1.00 36.81 ? 46  PHE K C   1 
ATOM 9654  O O   . PHE K 1 46  ? 89.074  66.983  80.970  1.00 36.96 ? 46  PHE K O   1 
ATOM 9655  C CB  . PHE K 1 46  ? 89.802  68.015  83.779  1.00 36.83 ? 46  PHE K CB  1 
ATOM 9656  C CG  . PHE K 1 46  ? 90.827  68.936  84.374  1.00 36.90 ? 46  PHE K CG  1 
ATOM 9657  C CD1 . PHE K 1 46  ? 92.021  69.185  83.706  1.00 37.06 ? 46  PHE K CD1 1 
ATOM 9658  C CD2 . PHE K 1 46  ? 90.598  69.573  85.588  1.00 36.99 ? 46  PHE K CD2 1 
ATOM 9659  C CE1 . PHE K 1 46  ? 92.970  70.044  84.241  1.00 37.14 ? 46  PHE K CE1 1 
ATOM 9660  C CE2 . PHE K 1 46  ? 91.544  70.431  86.132  1.00 37.16 ? 46  PHE K CE2 1 
ATOM 9661  C CZ  . PHE K 1 46  ? 92.732  70.669  85.456  1.00 37.19 ? 46  PHE K CZ  1 
ATOM 9662  N N   . GLN K 1 47  ? 87.035  67.406  81.834  1.00 36.77 ? 47  GLN K N   1 
ATOM 9663  C CA  . GLN K 1 47  ? 86.303  66.616  80.834  1.00 36.82 ? 47  GLN K CA  1 
ATOM 9664  C C   . GLN K 1 47  ? 86.247  67.349  79.489  1.00 37.07 ? 47  GLN K C   1 
ATOM 9665  O O   . GLN K 1 47  ? 86.394  66.724  78.437  1.00 37.28 ? 47  GLN K O   1 
ATOM 9666  C CB  . GLN K 1 47  ? 84.882  66.280  81.310  1.00 36.79 ? 47  GLN K CB  1 
ATOM 9667  C CG  . GLN K 1 47  ? 84.813  65.150  82.329  1.00 36.85 ? 47  GLN K CG  1 
ATOM 9668  C CD  . GLN K 1 47  ? 84.783  63.767  81.698  1.00 36.98 ? 47  GLN K CD  1 
ATOM 9669  O OE1 . GLN K 1 47  ? 85.418  63.522  80.672  1.00 37.07 ? 47  GLN K OE1 1 
ATOM 9670  N NE2 . GLN K 1 47  ? 84.046  62.854  82.318  1.00 37.07 ? 47  GLN K NE2 1 
ATOM 9671  N N   . GLU K 1 48  ? 86.027  68.664  79.532  1.00 37.41 ? 48  GLU K N   1 
ATOM 9672  C CA  . GLU K 1 48  ? 86.049  69.505  78.327  1.00 37.74 ? 48  GLU K CA  1 
ATOM 9673  C C   . GLU K 1 48  ? 87.453  69.640  77.728  1.00 37.83 ? 48  GLU K C   1 
ATOM 9674  O O   . GLU K 1 48  ? 87.592  69.776  76.513  1.00 38.01 ? 48  GLU K O   1 
ATOM 9675  C CB  . GLU K 1 48  ? 85.472  70.899  78.615  1.00 38.07 ? 48  GLU K CB  1 
ATOM 9676  C CG  . GLU K 1 48  ? 83.986  70.915  78.956  1.00 38.39 ? 48  GLU K CG  1 
ATOM 9677  C CD  . GLU K 1 48  ? 83.087  70.617  77.764  1.00 38.68 ? 48  GLU K CD  1 
ATOM 9678  O OE1 . GLU K 1 48  ? 83.294  71.211  76.683  1.00 38.76 ? 48  GLU K OE1 1 
ATOM 9679  O OE2 . GLU K 1 48  ? 82.158  69.793  77.912  1.00 38.77 ? 48  GLU K OE2 1 
ATOM 9680  N N   . MET K 1 49  ? 88.484  69.617  78.575  1.00 37.94 ? 49  MET K N   1 
ATOM 9681  C CA  . MET K 1 49  ? 89.878  69.639  78.106  1.00 38.06 ? 49  MET K CA  1 
ATOM 9682  C C   . MET K 1 49  ? 90.284  68.336  77.411  1.00 37.98 ? 49  MET K C   1 
ATOM 9683  O O   . MET K 1 49  ? 91.057  68.364  76.452  1.00 38.26 ? 49  MET K O   1 
ATOM 9684  C CB  . MET K 1 49  ? 90.838  69.937  79.260  1.00 38.24 ? 49  MET K CB  1 
ATOM 9685  C CG  . MET K 1 49  ? 90.743  71.367  79.765  1.00 38.47 ? 49  MET K CG  1 
ATOM 9686  S SD  . MET K 1 49  ? 91.742  71.692  81.230  1.00 38.86 ? 49  MET K SD  1 
ATOM 9687  C CE  . MET K 1 49  ? 93.388  71.393  80.590  1.00 38.96 ? 49  MET K CE  1 
ATOM 9688  N N   . TYR K 1 50  ? 89.771  67.208  77.899  1.00 37.79 ? 50  TYR K N   1 
ATOM 9689  C CA  . TYR K 1 50  ? 89.973  65.912  77.242  1.00 37.80 ? 50  TYR K CA  1 
ATOM 9690  C C   . TYR K 1 50  ? 89.194  65.822  75.923  1.00 38.04 ? 50  TYR K C   1 
ATOM 9691  O O   . TYR K 1 50  ? 89.635  65.153  74.985  1.00 38.25 ? 50  TYR K O   1 
ATOM 9692  C CB  . TYR K 1 50  ? 89.564  64.766  78.171  1.00 37.76 ? 50  TYR K CB  1 
ATOM 9693  C CG  . TYR K 1 50  ? 90.101  63.413  77.760  1.00 37.79 ? 50  TYR K CG  1 
ATOM 9694  C CD1 . TYR K 1 50  ? 89.382  62.586  76.896  1.00 37.66 ? 50  TYR K CD1 1 
ATOM 9695  C CD2 . TYR K 1 50  ? 91.320  62.947  78.252  1.00 37.87 ? 50  TYR K CD2 1 
ATOM 9696  C CE1 . TYR K 1 50  ? 89.868  61.340  76.525  1.00 37.67 ? 50  TYR K CE1 1 
ATOM 9697  C CE2 . TYR K 1 50  ? 91.815  61.702  77.886  1.00 37.85 ? 50  TYR K CE2 1 
ATOM 9698  C CZ  . TYR K 1 50  ? 91.085  60.902  77.023  1.00 37.80 ? 50  TYR K CZ  1 
ATOM 9699  O OH  . TYR K 1 50  ? 91.571  59.668  76.655  1.00 37.98 ? 50  TYR K OH  1 
ATOM 9700  N N   . GLN K 1 51  ? 88.038  66.485  75.867  1.00 38.31 ? 51  GLN K N   1 
ATOM 9701  C CA  . GLN K 1 51  ? 87.239  66.596  74.639  1.00 38.55 ? 51  GLN K CA  1 
ATOM 9702  C C   . GLN K 1 51  ? 87.970  67.373  73.534  1.00 38.78 ? 51  GLN K C   1 
ATOM 9703  O O   . GLN K 1 51  ? 87.784  67.084  72.351  1.00 38.94 ? 51  GLN K O   1 
ATOM 9704  C CB  . GLN K 1 51  ? 85.884  67.255  74.948  1.00 38.73 ? 51  GLN K CB  1 
ATOM 9705  C CG  . GLN K 1 51  ? 84.862  67.246  73.815  1.00 38.88 ? 51  GLN K CG  1 
ATOM 9706  C CD  . GLN K 1 51  ? 84.347  65.861  73.476  1.00 38.88 ? 51  GLN K CD  1 
ATOM 9707  O OE1 . GLN K 1 51  ? 83.983  65.088  74.360  1.00 38.93 ? 51  GLN K OE1 1 
ATOM 9708  N NE2 . GLN K 1 51  ? 84.291  65.550  72.187  1.00 38.97 ? 51  GLN K NE2 1 
ATOM 9709  N N   . ILE K 1 52  ? 88.785  68.356  73.920  1.00 38.96 ? 52  ILE K N   1 
ATOM 9710  C CA  . ILE K 1 52  ? 89.628  69.098  72.971  1.00 39.19 ? 52  ILE K CA  1 
ATOM 9711  C C   . ILE K 1 52  ? 90.713  68.191  72.373  1.00 39.35 ? 52  ILE K C   1 
ATOM 9712  O O   . ILE K 1 52  ? 90.967  68.239  71.167  1.00 39.50 ? 52  ILE K O   1 
ATOM 9713  C CB  . ILE K 1 52  ? 90.265  70.352  73.627  1.00 39.24 ? 52  ILE K CB  1 
ATOM 9714  C CG1 . ILE K 1 52  ? 89.178  71.377  73.977  1.00 39.33 ? 52  ILE K CG1 1 
ATOM 9715  C CG2 . ILE K 1 52  ? 91.300  71.005  72.709  1.00 39.29 ? 52  ILE K CG2 1 
ATOM 9716  C CD1 . ILE K 1 52  ? 89.572  72.366  75.056  1.00 39.33 ? 52  ILE K CD1 1 
ATOM 9717  N N   . ASP K 1 53  ? 91.335  67.368  73.216  1.00 39.54 ? 53  ASP K N   1 
ATOM 9718  C CA  . ASP K 1 53  ? 92.433  66.494  72.790  1.00 39.77 ? 53  ASP K CA  1 
ATOM 9719  C C   . ASP K 1 53  ? 91.943  65.281  72.002  1.00 39.75 ? 53  ASP K C   1 
ATOM 9720  O O   . ASP K 1 53  ? 92.316  65.098  70.841  1.00 39.95 ? 53  ASP K O   1 
ATOM 9721  C CB  . ASP K 1 53  ? 93.248  66.024  74.002  1.00 40.03 ? 53  ASP K CB  1 
ATOM 9722  C CG  . ASP K 1 53  ? 93.932  67.168  74.734  1.00 40.34 ? 53  ASP K CG  1 
ATOM 9723  O OD1 . ASP K 1 53  ? 93.560  68.340  74.510  1.00 40.49 ? 53  ASP K OD1 1 
ATOM 9724  O OD2 . ASP K 1 53  ? 94.844  66.891  75.543  1.00 40.58 ? 53  ASP K OD2 1 
ATOM 9725  N N   . ASN K 1 54  ? 91.099  64.469  72.639  1.00 39.52 ? 54  ASN K N   1 
ATOM 9726  C CA  . ASN K 1 54  ? 90.717  63.148  72.117  1.00 39.56 ? 54  ASN K CA  1 
ATOM 9727  C C   . ASN K 1 54  ? 89.381  63.088  71.361  1.00 39.43 ? 54  ASN K C   1 
ATOM 9728  O O   . ASN K 1 54  ? 89.084  62.064  70.741  1.00 39.61 ? 54  ASN K O   1 
ATOM 9729  C CB  . ASN K 1 54  ? 90.685  62.132  73.264  1.00 39.76 ? 54  ASN K CB  1 
ATOM 9730  C CG  . ASN K 1 54  ? 92.044  61.933  73.910  1.00 39.96 ? 54  ASN K CG  1 
ATOM 9731  O OD1 . ASN K 1 54  ? 92.732  60.948  73.641  1.00 40.17 ? 54  ASN K OD1 1 
ATOM 9732  N ND2 . ASN K 1 54  ? 92.437  62.869  74.767  1.00 40.00 ? 54  ASN K ND2 1 
ATOM 9733  N N   . ASN K 1 55  ? 88.587  64.162  71.413  1.00 39.07 ? 55  ASN K N   1 
ATOM 9734  C CA  . ASN K 1 55  ? 87.232  64.201  70.830  1.00 38.83 ? 55  ASN K CA  1 
ATOM 9735  C C   . ASN K 1 55  ? 86.296  63.154  71.454  1.00 38.56 ? 55  ASN K C   1 
ATOM 9736  O O   . ASN K 1 55  ? 85.526  62.491  70.754  1.00 38.71 ? 55  ASN K O   1 
ATOM 9737  C CB  . ASN K 1 55  ? 87.274  64.063  69.297  1.00 39.00 ? 55  ASN K CB  1 
ATOM 9738  C CG  . ASN K 1 55  ? 88.267  65.012  68.645  1.00 39.27 ? 55  ASN K CG  1 
ATOM 9739  O OD1 . ASN K 1 55  ? 89.039  64.615  67.773  1.00 39.50 ? 55  ASN K OD1 1 
ATOM 9740  N ND2 . ASN K 1 55  ? 88.251  66.273  69.067  1.00 39.40 ? 55  ASN K ND2 1 
ATOM 9741  N N   . SER K 1 56  ? 86.372  63.025  72.778  1.00 38.22 ? 56  SER K N   1 
ATOM 9742  C CA  . SER K 1 56  ? 85.526  62.102  73.543  1.00 37.99 ? 56  SER K CA  1 
ATOM 9743  C C   . SER K 1 56  ? 85.559  62.464  75.030  1.00 37.53 ? 56  SER K C   1 
ATOM 9744  O O   . SER K 1 56  ? 86.257  63.398  75.428  1.00 37.69 ? 56  SER K O   1 
ATOM 9745  C CB  . SER K 1 56  ? 85.996  60.657  73.347  1.00 38.25 ? 56  SER K CB  1 
ATOM 9746  O OG  . SER K 1 56  ? 85.109  59.740  73.966  1.00 38.43 ? 56  SER K OG  1 
ATOM 9747  N N   . TYR K 1 57  ? 84.789  61.734  75.837  1.00 36.99 ? 57  TYR K N   1 
ATOM 9748  C CA  . TYR K 1 57  ? 84.791  61.899  77.295  1.00 36.72 ? 57  TYR K CA  1 
ATOM 9749  C C   . TYR K 1 57  ? 85.378  60.664  77.981  1.00 36.67 ? 57  TYR K C   1 
ATOM 9750  O O   . TYR K 1 57  ? 85.269  59.546  77.472  1.00 36.63 ? 57  TYR K O   1 
ATOM 9751  C CB  . TYR K 1 57  ? 83.377  62.174  77.809  1.00 36.60 ? 57  TYR K CB  1 
ATOM 9752  C CG  . TYR K 1 57  ? 82.848  63.544  77.436  1.00 36.53 ? 57  TYR K CG  1 
ATOM 9753  C CD1 . TYR K 1 57  ? 83.367  64.697  78.025  1.00 36.47 ? 57  TYR K CD1 1 
ATOM 9754  C CD2 . TYR K 1 57  ? 81.822  63.692  76.500  1.00 36.51 ? 57  TYR K CD2 1 
ATOM 9755  C CE1 . TYR K 1 57  ? 82.887  65.957  77.691  1.00 36.34 ? 57  TYR K CE1 1 
ATOM 9756  C CE2 . TYR K 1 57  ? 81.334  64.947  76.160  1.00 36.42 ? 57  TYR K CE2 1 
ATOM 9757  C CZ  . TYR K 1 57  ? 81.869  66.076  76.758  1.00 36.34 ? 57  TYR K CZ  1 
ATOM 9758  O OH  . TYR K 1 57  ? 81.391  67.321  76.426  1.00 36.45 ? 57  TYR K OH  1 
ATOM 9759  N N   . THR K 1 58  ? 85.990  60.885  79.143  1.00 36.59 ? 58  THR K N   1 
ATOM 9760  C CA  . THR K 1 58  ? 86.736  59.850  79.857  1.00 36.53 ? 58  THR K CA  1 
ATOM 9761  C C   . THR K 1 58  ? 85.841  59.001  80.751  1.00 36.66 ? 58  THR K C   1 
ATOM 9762  O O   . THR K 1 58  ? 85.023  59.535  81.502  1.00 36.84 ? 58  THR K O   1 
ATOM 9763  C CB  . THR K 1 58  ? 87.819  60.472  80.757  1.00 36.65 ? 58  THR K CB  1 
ATOM 9764  O OG1 . THR K 1 58  ? 87.216  61.404  81.664  1.00 36.58 ? 58  THR K OG1 1 
ATOM 9765  C CG2 . THR K 1 58  ? 88.850  61.190  79.922  1.00 36.74 ? 58  THR K CG2 1 
ATOM 9766  N N   . SER K 1 59  ? 86.017  57.684  80.672  1.00 36.78 ? 59  SER K N   1 
ATOM 9767  C CA  . SER K 1 59  ? 85.395  56.751  81.610  1.00 36.85 ? 59  SER K CA  1 
ATOM 9768  C C   . SER K 1 59  ? 86.234  56.659  82.886  1.00 36.82 ? 59  SER K C   1 
ATOM 9769  O O   . SER K 1 59  ? 85.688  56.693  83.988  1.00 36.81 ? 59  SER K O   1 
ATOM 9770  C CB  . SER K 1 59  ? 85.250  55.367  80.973  1.00 37.11 ? 59  SER K CB  1 
ATOM 9771  O OG  . SER K 1 59  ? 84.468  54.508  81.787  1.00 37.24 ? 59  SER K OG  1 
ATOM 9772  N N   . ASN K 1 60  ? 87.553  56.539  82.725  1.00 36.97 ? 60  ASN K N   1 
ATOM 9773  C CA  . ASN K 1 60  ? 88.482  56.442  83.864  1.00 37.22 ? 60  ASN K CA  1 
ATOM 9774  C C   . ASN K 1 60  ? 88.856  57.814  84.440  1.00 37.20 ? 60  ASN K C   1 
ATOM 9775  O O   . ASN K 1 60  ? 88.871  58.818  83.724  1.00 37.13 ? 60  ASN K O   1 
ATOM 9776  C CB  . ASN K 1 60  ? 89.750  55.657  83.480  1.00 37.35 ? 60  ASN K CB  1 
ATOM 9777  C CG  . ASN K 1 60  ? 90.640  56.402  82.496  1.00 37.43 ? 60  ASN K CG  1 
ATOM 9778  O OD1 . ASN K 1 60  ? 90.156  57.107  81.608  1.00 37.43 ? 60  ASN K OD1 1 
ATOM 9779  N ND2 . ASN K 1 60  ? 91.949  56.236  82.644  1.00 37.57 ? 60  ASN K ND2 1 
ATOM 9780  N N   . GLN K 1 61  ? 89.163  57.833  85.736  1.00 37.16 ? 61  GLN K N   1 
ATOM 9781  C CA  . GLN K 1 61  ? 89.548  59.057  86.446  1.00 37.02 ? 61  GLN K CA  1 
ATOM 9782  C C   . GLN K 1 61  ? 90.999  59.456  86.169  1.00 36.99 ? 61  GLN K C   1 
ATOM 9783  O O   . GLN K 1 61  ? 91.311  60.647  86.116  1.00 37.14 ? 61  GLN K O   1 
ATOM 9784  C CB  . GLN K 1 61  ? 89.341  58.882  87.954  1.00 37.12 ? 61  GLN K CB  1 
ATOM 9785  C CG  . GLN K 1 61  ? 89.371  60.183  88.748  1.00 37.21 ? 61  GLN K CG  1 
ATOM 9786  C CD  . GLN K 1 61  ? 89.329  59.966  90.249  1.00 37.24 ? 61  GLN K CD  1 
ATOM 9787  O OE1 . GLN K 1 61  ? 88.829  58.948  90.734  1.00 37.27 ? 61  GLN K OE1 1 
ATOM 9788  N NE2 . GLN K 1 61  ? 89.850  60.931  90.996  1.00 37.32 ? 61  GLN K NE2 1 
ATOM 9789  N N   . ALA K 1 62  ? 91.877  58.463  86.008  1.00 36.96 ? 62  ALA K N   1 
ATOM 9790  C CA  . ALA K 1 62  ? 93.311  58.693  85.762  1.00 36.85 ? 62  ALA K CA  1 
ATOM 9791  C C   . ALA K 1 62  ? 93.609  59.544  84.522  1.00 36.78 ? 62  ALA K C   1 
ATOM 9792  O O   . ALA K 1 62  ? 94.622  60.244  84.482  1.00 36.92 ? 62  ALA K O   1 
ATOM 9793  C CB  . ALA K 1 62  ? 94.049  57.364  85.667  1.00 36.91 ? 62  ALA K CB  1 
ATOM 9794  N N   . ALA K 1 63  ? 92.736  59.471  83.516  1.00 36.84 ? 63  ALA K N   1 
ATOM 9795  C CA  . ALA K 1 63  ? 92.834  60.321  82.326  1.00 36.91 ? 63  ALA K CA  1 
ATOM 9796  C C   . ALA K 1 63  ? 92.623  61.800  82.661  1.00 36.82 ? 63  ALA K C   1 
ATOM 9797  O O   . ALA K 1 63  ? 93.347  62.657  82.153  1.00 36.91 ? 63  ALA K O   1 
ATOM 9798  C CB  . ALA K 1 63  ? 91.836  59.875  81.267  1.00 37.01 ? 63  ALA K CB  1 
ATOM 9799  N N   . LEU K 1 64  ? 91.639  62.087  83.513  1.00 36.89 ? 64  LEU K N   1 
ATOM 9800  C CA  . LEU K 1 64  ? 91.369  63.458  83.969  1.00 37.01 ? 64  LEU K CA  1 
ATOM 9801  C C   . LEU K 1 64  ? 92.476  64.001  84.877  1.00 37.02 ? 64  LEU K C   1 
ATOM 9802  O O   . LEU K 1 64  ? 92.790  65.192  84.822  1.00 37.07 ? 64  LEU K O   1 
ATOM 9803  C CB  . LEU K 1 64  ? 90.025  63.537  84.704  1.00 37.12 ? 64  LEU K CB  1 
ATOM 9804  C CG  . LEU K 1 64  ? 88.766  63.168  83.913  1.00 37.29 ? 64  LEU K CG  1 
ATOM 9805  C CD1 . LEU K 1 64  ? 87.553  63.140  84.833  1.00 37.40 ? 64  LEU K CD1 1 
ATOM 9806  C CD2 . LEU K 1 64  ? 88.540  64.129  82.756  1.00 37.32 ? 64  LEU K CD2 1 
ATOM 9807  N N   . ILE K 1 65  ? 93.054  63.128  85.704  1.00 37.10 ? 65  ILE K N   1 
ATOM 9808  C CA  . ILE K 1 65  ? 94.140  63.508  86.619  1.00 37.16 ? 65  ILE K CA  1 
ATOM 9809  C C   . ILE K 1 65  ? 95.433  63.815  85.849  1.00 37.20 ? 65  ILE K C   1 
ATOM 9810  O O   . ILE K 1 65  ? 96.174  64.728  86.224  1.00 37.29 ? 65  ILE K O   1 
ATOM 9811  C CB  . ILE K 1 65  ? 94.394  62.421  87.699  1.00 37.23 ? 65  ILE K CB  1 
ATOM 9812  C CG1 . ILE K 1 65  ? 93.152  62.244  88.587  1.00 37.33 ? 65  ILE K CG1 1 
ATOM 9813  C CG2 . ILE K 1 65  ? 95.597  62.775  88.574  1.00 37.26 ? 65  ILE K CG2 1 
ATOM 9814  C CD1 . ILE K 1 65  ? 93.142  60.963  89.396  1.00 37.48 ? 65  ILE K CD1 1 
ATOM 9815  N N   . SER K 1 66  ? 95.693  63.059  84.782  1.00 37.26 ? 66  SER K N   1 
ATOM 9816  C CA  . SER K 1 66  ? 96.869  63.276  83.929  1.00 37.39 ? 66  SER K CA  1 
ATOM 9817  C C   . SER K 1 66  ? 96.867  64.648  83.241  1.00 37.52 ? 66  SER K C   1 
ATOM 9818  O O   . SER K 1 66  ? 97.924  65.262  83.081  1.00 37.55 ? 66  SER K O   1 
ATOM 9819  C CB  . SER K 1 66  ? 96.979  62.170  82.874  1.00 37.37 ? 66  SER K CB  1 
ATOM 9820  O OG  . SER K 1 66  ? 98.201  62.257  82.160  1.00 37.36 ? 66  SER K OG  1 
ATOM 9821  N N   . LEU K 1 67  ? 95.684  65.116  82.839  1.00 37.78 ? 67  LEU K N   1 
ATOM 9822  C CA  . LEU K 1 67  ? 95.532  66.450  82.234  1.00 38.04 ? 67  LEU K CA  1 
ATOM 9823  C C   . LEU K 1 67  ? 95.804  67.604  83.208  1.00 38.13 ? 67  LEU K C   1 
ATOM 9824  O O   . LEU K 1 67  ? 96.285  68.659  82.787  1.00 38.34 ? 67  LEU K O   1 
ATOM 9825  C CB  . LEU K 1 67  ? 94.143  66.623  81.591  1.00 38.16 ? 67  LEU K CB  1 
ATOM 9826  C CG  . LEU K 1 67  ? 94.042  66.289  80.098  1.00 38.40 ? 67  LEU K CG  1 
ATOM 9827  C CD1 . LEU K 1 67  ? 94.327  64.823  79.805  1.00 38.45 ? 67  LEU K CD1 1 
ATOM 9828  C CD2 . LEU K 1 67  ? 92.668  66.674  79.573  1.00 38.59 ? 67  LEU K CD2 1 
ATOM 9829  N N   . GLY K 1 68  ? 95.506  67.404  84.494  1.00 37.98 ? 68  GLY K N   1 
ATOM 9830  C CA  . GLY K 1 68  ? 95.691  68.454  85.506  1.00 37.88 ? 68  GLY K CA  1 
ATOM 9831  C C   . GLY K 1 68  ? 94.822  68.397  86.755  1.00 37.72 ? 68  GLY K C   1 
ATOM 9832  O O   . GLY K 1 68  ? 95.179  69.006  87.767  1.00 37.88 ? 68  GLY K O   1 
ATOM 9833  N N   . LEU K 1 69  ? 93.680  67.705  86.693  1.00 37.46 ? 69  LEU K N   1 
ATOM 9834  C CA  . LEU K 1 69  ? 92.780  67.554  87.849  1.00 37.38 ? 69  LEU K CA  1 
ATOM 9835  C C   . LEU K 1 69  ? 93.494  66.956  89.064  1.00 37.38 ? 69  LEU K C   1 
ATOM 9836  O O   . LEU K 1 69  ? 94.389  66.119  88.920  1.00 37.44 ? 69  LEU K O   1 
ATOM 9837  C CB  . LEU K 1 69  ? 91.575  66.674  87.485  1.00 37.38 ? 69  LEU K CB  1 
ATOM 9838  C CG  . LEU K 1 69  ? 90.443  66.506  88.509  1.00 37.33 ? 69  LEU K CG  1 
ATOM 9839  C CD1 . LEU K 1 69  ? 89.729  67.820  88.789  1.00 37.36 ? 69  LEU K CD1 1 
ATOM 9840  C CD2 . LEU K 1 69  ? 89.448  65.463  88.021  1.00 37.37 ? 69  LEU K CD2 1 
ATOM 9841  N N   . LYS K 1 70  ? 93.087  67.391  90.255  1.00 37.37 ? 70  LYS K N   1 
ATOM 9842  C CA  . LYS K 1 70  ? 93.671  66.907  91.508  1.00 37.30 ? 70  LYS K CA  1 
ATOM 9843  C C   . LYS K 1 70  ? 93.190  65.495  91.831  1.00 37.09 ? 70  LYS K C   1 
ATOM 9844  O O   . LYS K 1 70  ? 92.247  64.989  91.214  1.00 37.05 ? 70  LYS K O   1 
ATOM 9845  C CB  . LYS K 1 70  ? 93.314  67.842  92.669  1.00 37.51 ? 70  LYS K CB  1 
ATOM 9846  C CG  . LYS K 1 70  ? 93.838  69.261  92.520  1.00 37.82 ? 70  LYS K CG  1 
ATOM 9847  C CD  . LYS K 1 70  ? 93.604  70.067  93.789  1.00 38.07 ? 70  LYS K CD  1 
ATOM 9848  C CE  . LYS K 1 70  ? 94.154  71.481  93.672  1.00 38.26 ? 70  LYS K CE  1 
ATOM 9849  N NZ  . LYS K 1 70  ? 93.427  72.300  92.660  1.00 38.34 ? 70  LYS K NZ  1 
ATOM 9850  N N   . SER K 1 71  ? 93.846  64.867  92.805  1.00 36.84 ? 71  SER K N   1 
ATOM 9851  C CA  . SER K 1 71  ? 93.418  63.565  93.320  1.00 36.56 ? 71  SER K CA  1 
ATOM 9852  C C   . SER K 1 71  ? 92.095  63.706  94.070  1.00 36.24 ? 71  SER K C   1 
ATOM 9853  O O   . SER K 1 71  ? 91.722  64.810  94.481  1.00 36.23 ? 71  SER K O   1 
ATOM 9854  C CB  . SER K 1 71  ? 94.482  62.976  94.249  1.00 36.59 ? 71  SER K CB  1 
ATOM 9855  O OG  . SER K 1 71  ? 95.717  62.816  93.574  1.00 36.60 ? 71  SER K OG  1 
ATOM 9856  N N   . THR K 1 72  ? 91.389  62.589  94.241  1.00 35.94 ? 72  THR K N   1 
ATOM 9857  C CA  . THR K 1 72  ? 90.091  62.582  94.919  1.00 35.78 ? 72  THR K CA  1 
ATOM 9858  C C   . THR K 1 72  ? 90.245  63.118  96.350  1.00 35.65 ? 72  THR K C   1 
ATOM 9859  O O   . THR K 1 72  ? 91.183  62.719  97.046  1.00 35.81 ? 72  THR K O   1 
ATOM 9860  C CB  . THR K 1 72  ? 89.484  61.165  94.974  1.00 35.87 ? 72  THR K CB  1 
ATOM 9861  O OG1 . THR K 1 72  ? 89.528  60.570  93.671  1.00 35.93 ? 72  THR K OG1 1 
ATOM 9862  C CG2 . THR K 1 72  ? 88.037  61.207  95.460  1.00 35.94 ? 72  THR K CG2 1 
ATOM 9863  N N   . PRO K 1 73  ? 89.344  64.028  96.792  1.00 35.35 ? 73  PRO K N   1 
ATOM 9864  C CA  . PRO K 1 73  ? 89.506  64.597  98.140  1.00 35.35 ? 73  PRO K CA  1 
ATOM 9865  C C   . PRO K 1 73  ? 89.270  63.593  99.272  1.00 35.42 ? 73  PRO K C   1 
ATOM 9866  O O   . PRO K 1 73  ? 88.723  62.511  99.043  1.00 35.51 ? 73  PRO K O   1 
ATOM 9867  C CB  . PRO K 1 73  ? 88.454  65.718  98.194  1.00 35.35 ? 73  PRO K CB  1 
ATOM 9868  C CG  . PRO K 1 73  ? 87.980  65.908  96.797  1.00 35.32 ? 73  PRO K CG  1 
ATOM 9869  C CD  . PRO K 1 73  ? 88.166  64.596  96.110  1.00 35.28 ? 73  PRO K CD  1 
ATOM 9870  N N   . ALA K 1 74  ? 89.686  63.968  100.479 1.00 35.52 ? 74  ALA K N   1 
ATOM 9871  C CA  . ALA K 1 74  ? 89.562  63.104  101.654 1.00 35.57 ? 74  ALA K CA  1 
ATOM 9872  C C   . ALA K 1 74  ? 88.093  62.908  102.023 1.00 35.42 ? 74  ALA K C   1 
ATOM 9873  O O   . ALA K 1 74  ? 87.337  63.879  102.103 1.00 35.50 ? 74  ALA K O   1 
ATOM 9874  C CB  . ALA K 1 74  ? 90.329  63.689  102.831 1.00 35.68 ? 74  ALA K CB  1 
ATOM 9875  N N   . ASN K 1 75  ? 87.708  61.647  102.235 1.00 35.20 ? 75  ASN K N   1 
ATOM 9876  C CA  . ASN K 1 75  ? 86.327  61.257  102.551 1.00 35.04 ? 75  ASN K CA  1 
ATOM 9877  C C   . ASN K 1 75  ? 85.328  61.645  101.448 1.00 34.83 ? 75  ASN K C   1 
ATOM 9878  O O   . ASN K 1 75  ? 84.213  62.088  101.738 1.00 34.81 ? 75  ASN K O   1 
ATOM 9879  C CB  . ASN K 1 75  ? 85.894  61.830  103.912 1.00 35.14 ? 75  ASN K CB  1 
ATOM 9880  C CG  . ASN K 1 75  ? 86.901  61.558  105.016 1.00 35.37 ? 75  ASN K CG  1 
ATOM 9881  O OD1 . ASN K 1 75  ? 87.584  60.533  105.015 1.00 35.52 ? 75  ASN K OD1 1 
ATOM 9882  N ND2 . ASN K 1 75  ? 86.993  62.479  105.969 1.00 35.47 ? 75  ASN K ND2 1 
ATOM 9883  N N   . VAL K 1 76  ? 85.743  61.472  100.191 1.00 34.65 ? 76  VAL K N   1 
ATOM 9884  C CA  . VAL K 1 76  ? 84.896  61.727  99.017  1.00 34.49 ? 76  VAL K CA  1 
ATOM 9885  C C   . VAL K 1 76  ? 84.984  60.528  98.074  1.00 34.47 ? 76  VAL K C   1 
ATOM 9886  O O   . VAL K 1 76  ? 86.076  60.024  97.802  1.00 34.47 ? 76  VAL K O   1 
ATOM 9887  C CB  . VAL K 1 76  ? 85.321  63.014  98.271  1.00 34.35 ? 76  VAL K CB  1 
ATOM 9888  C CG1 . VAL K 1 76  ? 84.516  63.201  96.984  1.00 34.32 ? 76  VAL K CG1 1 
ATOM 9889  C CG2 . VAL K 1 76  ? 85.158  64.226  99.175  1.00 34.40 ? 76  VAL K CG2 1 
ATOM 9890  N N   . THR K 1 77  ? 83.826  60.088  97.580  1.00 34.42 ? 77  THR K N   1 
ATOM 9891  C CA  . THR K 1 77  ? 83.722  58.930  96.692  1.00 34.40 ? 77  THR K CA  1 
ATOM 9892  C C   . THR K 1 77  ? 83.321  59.369  95.285  1.00 34.33 ? 77  THR K C   1 
ATOM 9893  O O   . THR K 1 77  ? 82.156  59.268  94.893  1.00 34.35 ? 77  THR K O   1 
ATOM 9894  C CB  . THR K 1 77  ? 82.702  57.909  97.232  1.00 34.48 ? 77  THR K CB  1 
ATOM 9895  O OG1 . THR K 1 77  ? 81.449  58.561  97.469  1.00 34.42 ? 77  THR K OG1 1 
ATOM 9896  C CG2 . THR K 1 77  ? 83.202  57.295  98.531  1.00 34.60 ? 77  THR K CG2 1 
ATOM 9897  N N   . PHE K 1 78  ? 84.306  59.867  94.540  1.00 34.32 ? 78  PHE K N   1 
ATOM 9898  C CA  . PHE K 1 78  ? 84.124  60.238  93.136  1.00 34.26 ? 78  PHE K CA  1 
ATOM 9899  C C   . PHE K 1 78  ? 84.082  58.974  92.280  1.00 34.03 ? 78  PHE K C   1 
ATOM 9900  O O   . PHE K 1 78  ? 84.859  58.042  92.505  1.00 34.15 ? 78  PHE K O   1 
ATOM 9901  C CB  . PHE K 1 78  ? 85.267  61.153  92.674  1.00 34.49 ? 78  PHE K CB  1 
ATOM 9902  C CG  . PHE K 1 78  ? 85.160  61.591  91.239  1.00 34.68 ? 78  PHE K CG  1 
ATOM 9903  C CD1 . PHE K 1 78  ? 84.352  62.666  90.883  1.00 34.79 ? 78  PHE K CD1 1 
ATOM 9904  C CD2 . PHE K 1 78  ? 85.879  60.936  90.240  1.00 34.80 ? 78  PHE K CD2 1 
ATOM 9905  C CE1 . PHE K 1 78  ? 84.255  63.074  89.559  1.00 34.94 ? 78  PHE K CE1 1 
ATOM 9906  C CE2 . PHE K 1 78  ? 85.785  61.340  88.916  1.00 34.93 ? 78  PHE K CE2 1 
ATOM 9907  C CZ  . PHE K 1 78  ? 84.973  62.410  88.574  1.00 34.99 ? 78  PHE K CZ  1 
ATOM 9908  N N   . SER K 1 79  ? 83.176  58.951  91.304  1.00 33.69 ? 79  SER K N   1 
ATOM 9909  C CA  . SER K 1 79  ? 82.986  57.781  90.445  1.00 33.53 ? 79  SER K CA  1 
ATOM 9910  C C   . SER K 1 79  ? 82.227  58.145  89.169  1.00 33.30 ? 79  SER K C   1 
ATOM 9911  O O   . SER K 1 79  ? 81.055  58.523  89.227  1.00 33.36 ? 79  SER K O   1 
ATOM 9912  C CB  . SER K 1 79  ? 82.225  56.692  91.207  1.00 33.61 ? 79  SER K CB  1 
ATOM 9913  O OG  . SER K 1 79  ? 82.000  55.550  90.398  1.00 33.71 ? 79  SER K OG  1 
ATOM 9914  N N   . ILE K 1 80  ? 82.897  58.021  88.024  1.00 33.07 ? 80  ILE K N   1 
ATOM 9915  C CA  . ILE K 1 80  ? 82.283  58.296  86.725  1.00 32.89 ? 80  ILE K CA  1 
ATOM 9916  C C   . ILE K 1 80  ? 81.449  57.079  86.325  1.00 32.77 ? 80  ILE K C   1 
ATOM 9917  O O   . ILE K 1 80  ? 81.972  55.967  86.239  1.00 32.79 ? 80  ILE K O   1 
ATOM 9918  C CB  . ILE K 1 80  ? 83.340  58.598  85.635  1.00 32.91 ? 80  ILE K CB  1 
ATOM 9919  C CG1 . ILE K 1 80  ? 84.185  59.821  86.026  1.00 32.96 ? 80  ILE K CG1 1 
ATOM 9920  C CG2 . ILE K 1 80  ? 82.668  58.823  84.279  1.00 32.94 ? 80  ILE K CG2 1 
ATOM 9921  C CD1 . ILE K 1 80  ? 85.441  60.009  85.199  1.00 33.00 ? 80  ILE K CD1 1 
ATOM 9922  N N   . VAL K 1 81  ? 80.156  57.302  86.087  1.00 32.73 ? 81  VAL K N   1 
ATOM 9923  C CA  . VAL K 1 81  ? 79.219  56.232  85.732  1.00 32.76 ? 81  VAL K CA  1 
ATOM 9924  C C   . VAL K 1 81  ? 79.484  55.755  84.309  1.00 32.87 ? 81  VAL K C   1 
ATOM 9925  O O   . VAL K 1 81  ? 79.757  54.574  84.080  1.00 32.99 ? 81  VAL K O   1 
ATOM 9926  C CB  . VAL K 1 81  ? 77.750  56.701  85.866  1.00 32.81 ? 81  VAL K CB  1 
ATOM 9927  C CG1 . VAL K 1 81  ? 76.775  55.683  85.278  1.00 32.88 ? 81  VAL K CG1 1 
ATOM 9928  C CG2 . VAL K 1 81  ? 77.416  56.976  87.326  1.00 32.82 ? 81  VAL K CG2 1 
ATOM 9929  N N   . SER K 1 82  ? 79.391  56.685  83.364  1.00 32.95 ? 82  SER K N   1 
ATOM 9930  C CA  . SER K 1 82  ? 79.596  56.394  81.946  1.00 33.10 ? 82  SER K CA  1 
ATOM 9931  C C   . SER K 1 82  ? 80.018  57.647  81.191  1.00 33.16 ? 82  SER K C   1 
ATOM 9932  O O   . SER K 1 82  ? 79.795  58.768  81.657  1.00 33.23 ? 82  SER K O   1 
ATOM 9933  C CB  . SER K 1 82  ? 78.319  55.816  81.332  1.00 33.14 ? 82  SER K CB  1 
ATOM 9934  O OG  . SER K 1 82  ? 77.218  56.690  81.520  1.00 33.18 ? 82  SER K OG  1 
ATOM 9935  N N   . ALA K 1 83  ? 80.628  57.444  80.027  1.00 33.30 ? 83  ALA K N   1 
ATOM 9936  C CA  . ALA K 1 83  ? 81.123  58.544  79.202  1.00 33.46 ? 83  ALA K CA  1 
ATOM 9937  C C   . ALA K 1 83  ? 81.194  58.145  77.732  1.00 33.71 ? 83  ALA K C   1 
ATOM 9938  O O   . ALA K 1 83  ? 82.179  57.553  77.283  1.00 33.85 ? 83  ALA K O   1 
ATOM 9939  C CB  . ALA K 1 83  ? 82.486  58.998  79.700  1.00 33.47 ? 83  ALA K CB  1 
ATOM 9940  N N   . SER K 1 84  ? 80.136  58.471  76.991  1.00 34.04 ? 84  SER K N   1 
ATOM 9941  C CA  . SER K 1 84  ? 80.095  58.270  75.543  1.00 34.33 ? 84  SER K CA  1 
ATOM 9942  C C   . SER K 1 84  ? 80.883  59.377  74.838  1.00 34.53 ? 84  SER K C   1 
ATOM 9943  O O   . SER K 1 84  ? 81.442  60.261  75.491  1.00 34.55 ? 84  SER K O   1 
ATOM 9944  C CB  . SER K 1 84  ? 78.642  58.240  75.052  1.00 34.48 ? 84  SER K CB  1 
ATOM 9945  O OG  . SER K 1 84  ? 78.014  59.502  75.208  1.00 34.54 ? 84  SER K OG  1 
ATOM 9946  N N   . ALA K 1 85  ? 80.931  59.319  73.509  1.00 35.05 ? 85  ALA K N   1 
ATOM 9947  C CA  . ALA K 1 85  ? 81.642  60.318  72.704  1.00 35.50 ? 85  ALA K CA  1 
ATOM 9948  C C   . ALA K 1 85  ? 81.147  61.753  72.925  1.00 35.79 ? 85  ALA K C   1 
ATOM 9949  O O   . ALA K 1 85  ? 81.955  62.682  72.963  1.00 35.91 ? 85  ALA K O   1 
ATOM 9950  C CB  . ALA K 1 85  ? 81.556  59.960  71.226  1.00 35.61 ? 85  ALA K CB  1 
ATOM 9951  N N   . ASN K 1 86  ? 79.830  61.919  73.070  1.00 36.15 ? 86  ASN K N   1 
ATOM 9952  C CA  . ASN K 1 86  ? 79.205  63.245  73.198  1.00 36.49 ? 86  ASN K CA  1 
ATOM 9953  C C   . ASN K 1 86  ? 78.373  63.427  74.483  1.00 36.55 ? 86  ASN K C   1 
ATOM 9954  O O   . ASN K 1 86  ? 77.450  64.247  74.509  1.00 36.63 ? 86  ASN K O   1 
ATOM 9955  C CB  . ASN K 1 86  ? 78.335  63.521  71.965  1.00 36.84 ? 86  ASN K CB  1 
ATOM 9956  C CG  . ASN K 1 86  ? 79.116  63.432  70.664  1.00 37.16 ? 86  ASN K CG  1 
ATOM 9957  O OD1 . ASN K 1 86  ? 79.605  62.366  70.292  1.00 37.25 ? 86  ASN K OD1 1 
ATOM 9958  N ND2 . ASN K 1 86  ? 79.226  64.554  69.960  1.00 37.45 ? 86  ASN K ND2 1 
ATOM 9959  N N   . SER K 1 87  ? 78.699  62.683  75.542  1.00 36.55 ? 87  SER K N   1 
ATOM 9960  C CA  . SER K 1 87  ? 78.035  62.846  76.845  1.00 36.52 ? 87  SER K CA  1 
ATOM 9961  C C   . SER K 1 87  ? 78.844  62.235  77.991  1.00 36.58 ? 87  SER K C   1 
ATOM 9962  O O   . SER K 1 87  ? 79.830  61.530  77.764  1.00 36.60 ? 87  SER K O   1 
ATOM 9963  C CB  . SER K 1 87  ? 76.637  62.217  76.820  1.00 36.53 ? 87  SER K CB  1 
ATOM 9964  O OG  . SER K 1 87  ? 75.922  62.513  78.008  1.00 36.60 ? 87  SER K OG  1 
ATOM 9965  N N   . TYR K 1 88  ? 78.413  62.521  79.219  1.00 36.69 ? 88  TYR K N   1 
ATOM 9966  C CA  . TYR K 1 88  ? 79.002  61.923  80.423  1.00 36.75 ? 88  TYR K CA  1 
ATOM 9967  C C   . TYR K 1 88  ? 78.064  61.990  81.629  1.00 37.06 ? 88  TYR K C   1 
ATOM 9968  O O   . TYR K 1 88  ? 77.100  62.759  81.640  1.00 37.14 ? 88  TYR K O   1 
ATOM 9969  C CB  . TYR K 1 88  ? 80.344  62.586  80.762  1.00 36.59 ? 88  TYR K CB  1 
ATOM 9970  C CG  . TYR K 1 88  ? 80.267  64.075  81.036  1.00 36.51 ? 88  TYR K CG  1 
ATOM 9971  C CD1 . TYR K 1 88  ? 80.006  64.558  82.319  1.00 36.43 ? 88  TYR K CD1 1 
ATOM 9972  C CD2 . TYR K 1 88  ? 80.471  65.004  80.015  1.00 36.53 ? 88  TYR K CD2 1 
ATOM 9973  C CE1 . TYR K 1 88  ? 79.937  65.919  82.576  1.00 36.37 ? 88  TYR K CE1 1 
ATOM 9974  C CE2 . TYR K 1 88  ? 80.406  66.369  80.263  1.00 36.49 ? 88  TYR K CE2 1 
ATOM 9975  C CZ  . TYR K 1 88  ? 80.139  66.822  81.544  1.00 36.40 ? 88  TYR K CZ  1 
ATOM 9976  O OH  . TYR K 1 88  ? 80.073  68.172  81.794  1.00 36.43 ? 88  TYR K OH  1 
ATOM 9977  N N   . CYS K 1 89  ? 78.365  61.170  82.634  1.00 37.62 ? 89  CYS K N   1 
ATOM 9978  C CA  . CYS K 1 89  ? 77.626  61.143  83.899  1.00 38.04 ? 89  CYS K CA  1 
ATOM 9979  C C   . CYS K 1 89  ? 78.600  60.832  85.036  1.00 37.48 ? 89  CYS K C   1 
ATOM 9980  O O   . CYS K 1 89  ? 79.217  59.765  85.047  1.00 37.51 ? 89  CYS K O   1 
ATOM 9981  C CB  . CYS K 1 89  ? 76.515  60.092  83.847  1.00 39.02 ? 89  CYS K CB  1 
ATOM 9982  S SG  . CYS K 1 89  ? 75.551  59.935  85.372  1.00 40.38 ? 89  CYS K SG  1 
ATOM 9983  N N   . MET K 1 90  ? 78.727  61.764  85.983  1.00 36.81 ? 90  MET K N   1 
ATOM 9984  C CA  . MET K 1 90  ? 79.679  61.650  87.089  1.00 36.33 ? 90  MET K CA  1 
ATOM 9985  C C   . MET K 1 90  ? 78.977  61.888  88.427  1.00 35.96 ? 90  MET K C   1 
ATOM 9986  O O   . MET K 1 90  ? 78.556  63.008  88.725  1.00 35.94 ? 90  MET K O   1 
ATOM 9987  C CB  . MET K 1 90  ? 80.824  62.654  86.913  1.00 36.33 ? 90  MET K CB  1 
ATOM 9988  C CG  . MET K 1 90  ? 81.484  62.620  85.543  1.00 36.32 ? 90  MET K CG  1 
ATOM 9989  S SD  . MET K 1 90  ? 83.003  63.589  85.469  1.00 36.31 ? 90  MET K SD  1 
ATOM 9990  C CE  . MET K 1 90  ? 82.372  65.244  85.738  1.00 36.30 ? 90  MET K CE  1 
ATOM 9991  N N   . ILE K 1 91  ? 78.845  60.822  89.219  1.00 35.57 ? 91  ILE K N   1 
ATOM 9992  C CA  . ILE K 1 91  ? 78.288  60.898  90.570  1.00 35.27 ? 91  ILE K CA  1 
ATOM 9993  C C   . ILE K 1 91  ? 79.432  61.071  91.573  1.00 34.97 ? 91  ILE K C   1 
ATOM 9994  O O   . ILE K 1 91  ? 80.493  60.461  91.423  1.00 35.06 ? 91  ILE K O   1 
ATOM 9995  C CB  . ILE K 1 91  ? 77.484  59.624  90.927  1.00 35.34 ? 91  ILE K CB  1 
ATOM 9996  C CG1 . ILE K 1 91  ? 76.395  59.340  89.876  1.00 35.48 ? 91  ILE K CG1 1 
ATOM 9997  C CG2 . ILE K 1 91  ? 76.880  59.731  92.327  1.00 35.37 ? 91  ILE K CG2 1 
ATOM 9998  C CD1 . ILE K 1 91  ? 75.344  60.424  89.725  1.00 35.54 ? 91  ILE K CD1 1 
ATOM 9999  N N   . ALA K 1 92  ? 79.206  61.905  92.586  1.00 34.64 ? 92  ALA K N   1 
ATOM 10000 C CA  . ALA K 1 92  ? 80.175  62.111  93.665  1.00 34.42 ? 92  ALA K CA  1 
ATOM 10001 C C   . ALA K 1 92  ? 79.480  62.596  94.935  1.00 34.21 ? 92  ALA K C   1 
ATOM 10002 O O   . ALA K 1 92  ? 78.443  63.261  94.871  1.00 34.13 ? 92  ALA K O   1 
ATOM 10003 C CB  . ALA K 1 92  ? 81.244  63.105  93.236  1.00 34.49 ? 92  ALA K CB  1 
ATOM 10004 N N   . GLY K 1 93  ? 80.062  62.258  96.083  1.00 34.02 ? 93  GLY K N   1 
ATOM 10005 C CA  . GLY K 1 93  ? 79.491  62.616  97.380  1.00 33.89 ? 93  GLY K CA  1 
ATOM 10006 C C   . GLY K 1 93  ? 80.461  62.448  98.534  1.00 33.77 ? 93  GLY K C   1 
ATOM 10007 O O   . GLY K 1 93  ? 81.378  61.625  98.472  1.00 33.83 ? 93  GLY K O   1 
ATOM 10008 N N   . HIS K 1 94  ? 80.246  63.234  99.587  1.00 33.62 ? 94  HIS K N   1 
ATOM 10009 C CA  . HIS K 1 94  ? 81.052  63.176  100.805 1.00 33.49 ? 94  HIS K CA  1 
ATOM 10010 C C   . HIS K 1 94  ? 80.388  62.197  101.774 1.00 33.50 ? 94  HIS K C   1 
ATOM 10011 O O   . HIS K 1 94  ? 79.166  62.029  101.751 1.00 33.61 ? 94  HIS K O   1 
ATOM 10012 C CB  . HIS K 1 94  ? 81.156  64.570  101.433 1.00 33.42 ? 94  HIS K CB  1 
ATOM 10013 C CG  . HIS K 1 94  ? 82.406  64.791  102.227 1.00 33.39 ? 94  HIS K CG  1 
ATOM 10014 N ND1 . HIS K 1 94  ? 83.493  65.478  101.731 1.00 33.41 ? 94  HIS K ND1 1 
ATOM 10015 C CD2 . HIS K 1 94  ? 82.750  64.392  103.474 1.00 33.38 ? 94  HIS K CD2 1 
ATOM 10016 C CE1 . HIS K 1 94  ? 84.447  65.504  102.643 1.00 33.44 ? 94  HIS K CE1 1 
ATOM 10017 N NE2 . HIS K 1 94  ? 84.021  64.854  103.711 1.00 33.41 ? 94  HIS K NE2 1 
ATOM 10018 N N   . SER K 1 95  ? 81.192  61.555  102.620 1.00 33.42 ? 95  SER K N   1 
ATOM 10019 C CA  . SER K 1 95  ? 80.685  60.555  103.569 1.00 33.30 ? 95  SER K CA  1 
ATOM 10020 C C   . SER K 1 95  ? 79.777  61.183  104.626 1.00 33.15 ? 95  SER K C   1 
ATOM 10021 O O   . SER K 1 95  ? 78.714  60.639  104.934 1.00 33.23 ? 95  SER K O   1 
ATOM 10022 C CB  . SER K 1 95  ? 81.839  59.807  104.243 1.00 33.39 ? 95  SER K CB  1 
ATOM 10023 O OG  . SER K 1 95  ? 82.661  60.691  104.982 1.00 33.47 ? 95  SER K OG  1 
ATOM 10024 N N   . GLY K 1 96  ? 80.208  62.321  105.174 1.00 32.96 ? 96  GLY K N   1 
ATOM 10025 C CA  . GLY K 1 96  ? 79.393  63.128  106.088 1.00 32.84 ? 96  GLY K CA  1 
ATOM 10026 C C   . GLY K 1 96  ? 78.854  64.385  105.431 1.00 32.59 ? 96  GLY K C   1 
ATOM 10027 O O   . GLY K 1 96  ? 78.997  65.483  105.975 1.00 32.56 ? 96  GLY K O   1 
ATOM 10028 N N   . GLY K 1 97  ? 78.238  64.219  104.262 1.00 32.33 ? 97  GLY K N   1 
ATOM 10029 C CA  . GLY K 1 97  ? 77.588  65.311  103.536 1.00 32.11 ? 97  GLY K CA  1 
ATOM 10030 C C   . GLY K 1 97  ? 76.084  65.263  103.726 1.00 31.91 ? 97  GLY K C   1 
ATOM 10031 O O   . GLY K 1 97  ? 75.597  64.756  104.741 1.00 31.98 ? 97  GLY K O   1 
ATOM 10032 N N   . THR K 1 98  ? 75.354  65.791  102.744 1.00 31.56 ? 98  THR K N   1 
ATOM 10033 C CA  . THR K 1 98  ? 73.890  65.796  102.754 1.00 31.30 ? 98  THR K CA  1 
ATOM 10034 C C   . THR K 1 98  ? 73.333  64.783  101.759 1.00 31.00 ? 98  THR K C   1 
ATOM 10035 O O   . THR K 1 98  ? 72.604  63.865  102.142 1.00 31.05 ? 98  THR K O   1 
ATOM 10036 C CB  . THR K 1 98  ? 73.336  67.193  102.417 1.00 31.35 ? 98  THR K CB  1 
ATOM 10037 O OG1 . THR K 1 98  ? 73.843  67.621  101.146 1.00 31.30 ? 98  THR K OG1 1 
ATOM 10038 C CG2 . THR K 1 98  ? 73.740  68.195  103.489 1.00 31.42 ? 98  THR K CG2 1 
ATOM 10039 N N   . VAL K 1 99  ? 73.683  64.962  100.485 1.00 30.61 ? 99  VAL K N   1 
ATOM 10040 C CA  . VAL K 1 99  ? 73.218  64.097  99.394  1.00 30.35 ? 99  VAL K CA  1 
ATOM 10041 C C   . VAL K 1 99  ? 74.301  63.917  98.329  1.00 30.06 ? 99  VAL K C   1 
ATOM 10042 O O   . VAL K 1 99  ? 75.305  64.633  98.324  1.00 30.16 ? 99  VAL K O   1 
ATOM 10043 C CB  . VAL K 1 99  ? 71.938  64.660  98.724  1.00 30.45 ? 99  VAL K CB  1 
ATOM 10044 C CG1 . VAL K 1 99  ? 70.722  64.442  99.612  1.00 30.52 ? 99  VAL K CG1 1 
ATOM 10045 C CG2 . VAL K 1 99  ? 72.091  66.139  98.381  1.00 30.52 ? 99  VAL K CG2 1 
ATOM 10046 N N   . TRP K 1 100 ? 74.086  62.954  97.436  1.00 29.73 ? 100 TRP K N   1 
ATOM 10047 C CA  . TRP K 1 100 ? 74.974  62.734  96.292  1.00 29.57 ? 100 TRP K CA  1 
ATOM 10048 C C   . TRP K 1 100 ? 74.778  63.834  95.253  1.00 29.76 ? 100 TRP K C   1 
ATOM 10049 O O   . TRP K 1 100 ? 73.668  64.346  95.085  1.00 29.91 ? 100 TRP K O   1 
ATOM 10050 C CB  . TRP K 1 100 ? 74.708  61.372  95.647  1.00 29.37 ? 100 TRP K CB  1 
ATOM 10051 C CG  . TRP K 1 100 ? 75.062  60.211  96.518  1.00 29.17 ? 100 TRP K CG  1 
ATOM 10052 C CD1 . TRP K 1 100 ? 74.260  59.601  97.436  1.00 29.08 ? 100 TRP K CD1 1 
ATOM 10053 C CD2 . TRP K 1 100 ? 76.311  59.513  96.547  1.00 28.95 ? 100 TRP K CD2 1 
ATOM 10054 N NE1 . TRP K 1 100 ? 74.932  58.566  98.040  1.00 28.98 ? 100 TRP K NE1 1 
ATOM 10055 C CE2 . TRP K 1 100 ? 76.193  58.489  97.514  1.00 28.90 ? 100 TRP K CE2 1 
ATOM 10056 C CE3 . TRP K 1 100 ? 77.520  59.654  95.853  1.00 28.91 ? 100 TRP K CE3 1 
ATOM 10057 C CZ2 . TRP K 1 100 ? 77.240  57.608  97.804  1.00 28.93 ? 100 TRP K CZ2 1 
ATOM 10058 C CZ3 . TRP K 1 100 ? 78.562  58.777  96.142  1.00 28.95 ? 100 TRP K CZ3 1 
ATOM 10059 C CH2 . TRP K 1 100 ? 78.412  57.767  97.111  1.00 28.96 ? 100 TRP K CH2 1 
ATOM 10060 N N   . PHE K 1 101 ? 75.862  64.187  94.566  1.00 29.96 ? 101 PHE K N   1 
ATOM 10061 C CA  . PHE K 1 101 ? 75.849  65.214  93.525  1.00 30.13 ? 101 PHE K CA  1 
ATOM 10062 C C   . PHE K 1 101 ? 76.186  64.583  92.179  1.00 30.19 ? 101 PHE K C   1 
ATOM 10063 O O   . PHE K 1 101 ? 77.215  63.920  92.048  1.00 30.31 ? 101 PHE K O   1 
ATOM 10064 C CB  . PHE K 1 101 ? 76.874  66.305  93.837  1.00 30.32 ? 101 PHE K CB  1 
ATOM 10065 C CG  . PHE K 1 101 ? 76.483  67.215  94.969  1.00 30.39 ? 101 PHE K CG  1 
ATOM 10066 C CD1 . PHE K 1 101 ? 76.550  66.779  96.289  1.00 30.53 ? 101 PHE K CD1 1 
ATOM 10067 C CD2 . PHE K 1 101 ? 76.070  68.523  94.719  1.00 30.42 ? 101 PHE K CD2 1 
ATOM 10068 C CE1 . PHE K 1 101 ? 76.197  67.620  97.335  1.00 30.59 ? 101 PHE K CE1 1 
ATOM 10069 C CE2 . PHE K 1 101 ? 75.718  69.368  95.761  1.00 30.54 ? 101 PHE K CE2 1 
ATOM 10070 C CZ  . PHE K 1 101 ? 75.780  68.916  97.071  1.00 30.60 ? 101 PHE K CZ  1 
ATOM 10071 N N   . ALA K 1 102 ? 75.315  64.791  91.192  1.00 30.37 ? 102 ALA K N   1 
ATOM 10072 C CA  . ALA K 1 102 ? 75.552  64.344  89.818  1.00 30.57 ? 102 ALA K CA  1 
ATOM 10073 C C   . ALA K 1 102 ? 76.256  65.438  89.021  1.00 30.78 ? 102 ALA K C   1 
ATOM 10074 O O   . ALA K 1 102 ? 76.402  66.568  89.497  1.00 30.81 ? 102 ALA K O   1 
ATOM 10075 C CB  . ALA K 1 102 ? 74.238  63.969  89.152  1.00 30.60 ? 102 ALA K CB  1 
ATOM 10076 N N   . ALA K 1 103 ? 76.691  65.094  87.811  1.00 31.11 ? 103 ALA K N   1 
ATOM 10077 C CA  . ALA K 1 103 ? 77.377  66.042  86.930  1.00 31.41 ? 103 ALA K CA  1 
ATOM 10078 C C   . ALA K 1 103 ? 77.330  65.587  85.468  1.00 31.72 ? 103 ALA K C   1 
ATOM 10079 O O   . ALA K 1 103 ? 78.088  64.703  85.061  1.00 31.76 ? 103 ALA K O   1 
ATOM 10080 C CB  . ALA K 1 103 ? 78.816  66.238  87.384  1.00 31.43 ? 103 ALA K CB  1 
ATOM 10081 N N   . THR K 1 104 ? 76.426  66.197  84.701  1.00 32.08 ? 104 THR K N   1 
ATOM 10082 C CA  . THR K 1 104 ? 76.252  65.924  83.271  1.00 32.34 ? 104 THR K CA  1 
ATOM 10083 C C   . THR K 1 104 ? 76.484  67.225  82.496  1.00 32.69 ? 104 THR K C   1 
ATOM 10084 O O   . THR K 1 104 ? 76.463  68.303  83.097  1.00 32.83 ? 104 THR K O   1 
ATOM 10085 C CB  . THR K 1 104 ? 74.830  65.390  82.982  1.00 32.41 ? 104 THR K CB  1 
ATOM 10086 O OG1 . THR K 1 104 ? 73.877  66.457  83.059  1.00 32.45 ? 104 THR K OG1 1 
ATOM 10087 C CG2 . THR K 1 104 ? 74.446  64.305  83.976  1.00 32.50 ? 104 THR K CG2 1 
ATOM 10088 N N   . PRO K 1 105 ? 76.707  67.140  81.165  1.00 33.13 ? 105 PRO K N   1 
ATOM 10089 C CA  . PRO K 1 105 ? 76.941  68.378  80.404  1.00 33.45 ? 105 PRO K CA  1 
ATOM 10090 C C   . PRO K 1 105 ? 75.694  69.252  80.223  1.00 33.95 ? 105 PRO K C   1 
ATOM 10091 O O   . PRO K 1 105 ? 75.797  70.476  80.322  1.00 34.10 ? 105 PRO K O   1 
ATOM 10092 C CB  . PRO K 1 105 ? 77.479  67.890  79.051  1.00 33.34 ? 105 PRO K CB  1 
ATOM 10093 C CG  . PRO K 1 105 ? 77.182  66.438  78.973  1.00 33.31 ? 105 PRO K CG  1 
ATOM 10094 C CD  . PRO K 1 105 ? 76.722  65.940  80.308  1.00 33.23 ? 105 PRO K CD  1 
ATOM 10095 N N   . ASP K 1 106 ? 74.540  68.633  79.964  1.00 34.61 ? 106 ASP K N   1 
ATOM 10096 C CA  . ASP K 1 106 ? 73.293  69.380  79.734  1.00 35.22 ? 106 ASP K CA  1 
ATOM 10097 C C   . ASP K 1 106 ? 72.721  70.041  80.997  1.00 35.56 ? 106 ASP K C   1 
ATOM 10098 O O   . ASP K 1 106 ? 72.275  71.189  80.939  1.00 35.76 ? 106 ASP K O   1 
ATOM 10099 C CB  . ASP K 1 106 ? 72.229  68.507  79.038  1.00 35.53 ? 106 ASP K CB  1 
ATOM 10100 C CG  . ASP K 1 106 ? 71.727  67.359  79.907  1.00 35.77 ? 106 ASP K CG  1 
ATOM 10101 O OD1 . ASP K 1 106 ? 72.515  66.821  80.716  1.00 35.93 ? 106 ASP K OD1 1 
ATOM 10102 O OD2 . ASP K 1 106 ? 70.540  66.990  79.771  1.00 35.86 ? 106 ASP K OD2 1 
ATOM 10103 N N   . LYS K 1 107 ? 72.744  69.326  82.122  1.00 35.96 ? 107 LYS K N   1 
ATOM 10104 C CA  . LYS K 1 107 ? 72.195  69.829  83.391  1.00 36.36 ? 107 LYS K CA  1 
ATOM 10105 C C   . LYS K 1 107 ? 73.237  70.489  84.303  1.00 36.64 ? 107 LYS K C   1 
ATOM 10106 O O   . LYS K 1 107 ? 72.867  71.147  85.278  1.00 36.62 ? 107 LYS K O   1 
ATOM 10107 C CB  . LYS K 1 107 ? 71.498  68.698  84.155  1.00 36.45 ? 107 LYS K CB  1 
ATOM 10108 C CG  . LYS K 1 107 ? 70.303  68.103  83.426  1.00 36.66 ? 107 LYS K CG  1 
ATOM 10109 C CD  . LYS K 1 107 ? 69.681  66.948  84.196  1.00 36.88 ? 107 LYS K CD  1 
ATOM 10110 C CE  . LYS K 1 107 ? 68.871  67.427  85.391  1.00 37.03 ? 107 LYS K CE  1 
ATOM 10111 N NZ  . LYS K 1 107 ? 68.177  66.304  86.080  1.00 37.12 ? 107 LYS K NZ  1 
ATOM 10112 N N   . GLY K 1 108 ? 74.523  70.317  83.993  1.00 37.06 ? 108 GLY K N   1 
ATOM 10113 C CA  . GLY K 1 108 ? 75.605  70.836  84.831  1.00 37.38 ? 108 GLY K CA  1 
ATOM 10114 C C   . GLY K 1 108 ? 75.776  70.002  86.087  1.00 37.66 ? 108 GLY K C   1 
ATOM 10115 O O   . GLY K 1 108 ? 75.392  68.832  86.115  1.00 37.75 ? 108 GLY K O   1 
ATOM 10116 N N   . VAL K 1 109 ? 76.355  70.609  87.121  1.00 38.04 ? 109 VAL K N   1 
ATOM 10117 C CA  . VAL K 1 109 ? 76.528  69.960  88.423  1.00 38.33 ? 109 VAL K CA  1 
ATOM 10118 C C   . VAL K 1 109 ? 75.302  70.266  89.287  1.00 38.62 ? 109 VAL K C   1 
ATOM 10119 O O   . VAL K 1 109 ? 75.040  71.429  89.598  1.00 38.77 ? 109 VAL K O   1 
ATOM 10120 C CB  . VAL K 1 109 ? 77.809  70.445  89.139  1.00 38.50 ? 109 VAL K CB  1 
ATOM 10121 C CG1 . VAL K 1 109 ? 77.979  69.747  90.487  1.00 38.57 ? 109 VAL K CG1 1 
ATOM 10122 C CG2 . VAL K 1 109 ? 79.031  70.220  88.254  1.00 38.56 ? 109 VAL K CG2 1 
ATOM 10123 N N   . TYR K 1 110 ? 74.561  69.222  89.659  1.00 38.99 ? 110 TYR K N   1 
ATOM 10124 C CA  . TYR K 1 110 ? 73.364  69.350  90.500  1.00 39.35 ? 110 TYR K CA  1 
ATOM 10125 C C   . TYR K 1 110 ? 73.310  68.249  91.555  1.00 39.82 ? 110 TYR K C   1 
ATOM 10126 O O   . TYR K 1 110 ? 74.064  67.274  91.484  1.00 40.04 ? 110 TYR K O   1 
ATOM 10127 C CB  . TYR K 1 110 ? 72.094  69.323  89.640  1.00 39.25 ? 110 TYR K CB  1 
ATOM 10128 C CG  . TYR K 1 110 ? 71.887  68.038  88.864  1.00 39.14 ? 110 TYR K CG  1 
ATOM 10129 C CD1 . TYR K 1 110 ? 72.505  67.840  87.629  1.00 39.13 ? 110 TYR K CD1 1 
ATOM 10130 C CD2 . TYR K 1 110 ? 71.062  67.025  89.357  1.00 39.09 ? 110 TYR K CD2 1 
ATOM 10131 C CE1 . TYR K 1 110 ? 72.316  66.668  86.912  1.00 39.07 ? 110 TYR K CE1 1 
ATOM 10132 C CE2 . TYR K 1 110 ? 70.867  65.848  88.646  1.00 39.10 ? 110 TYR K CE2 1 
ATOM 10133 C CZ  . TYR K 1 110 ? 71.496  65.675  87.424  1.00 39.11 ? 110 TYR K CZ  1 
ATOM 10134 O OH  . TYR K 1 110 ? 71.308  64.514  86.713  1.00 39.19 ? 110 TYR K OH  1 
ATOM 10135 N N   . LYS K 1 111 ? 72.406  68.413  92.520  1.00 40.42 ? 111 LYS K N   1 
ATOM 10136 C CA  . LYS K 1 111 ? 72.251  67.465  93.631  1.00 41.05 ? 111 LYS K CA  1 
ATOM 10137 C C   . LYS K 1 111 ? 70.993  66.613  93.464  1.00 41.38 ? 111 LYS K C   1 
ATOM 10138 O O   . LYS K 1 111 ? 69.953  67.112  93.030  1.00 41.54 ? 111 LYS K O   1 
ATOM 10139 C CB  . LYS K 1 111 ? 72.246  68.190  94.986  1.00 41.42 ? 111 LYS K CB  1 
ATOM 10140 C CG  . LYS K 1 111 ? 71.070  69.119  95.260  1.00 41.67 ? 111 LYS K CG  1 
ATOM 10141 C CD  . LYS K 1 111 ? 71.223  69.787  96.615  1.00 41.99 ? 111 LYS K CD  1 
ATOM 10142 C CE  . LYS K 1 111 ? 70.066  70.730  96.910  1.00 42.27 ? 111 LYS K CE  1 
ATOM 10143 N NZ  . LYS K 1 111 ? 70.187  71.400  98.237  1.00 42.33 ? 111 LYS K NZ  1 
ATOM 10144 N N   . THR K 1 112 ? 71.104  65.333  93.820  1.00 41.76 ? 112 THR K N   1 
ATOM 10145 C CA  . THR K 1 112 ? 70.006  64.366  93.684  1.00 42.19 ? 112 THR K CA  1 
ATOM 10146 C C   . THR K 1 112 ? 69.322  64.101  95.028  1.00 42.42 ? 112 THR K C   1 
ATOM 10147 O O   . THR K 1 112 ? 69.797  64.540  96.078  1.00 42.41 ? 112 THR K O   1 
ATOM 10148 C CB  . THR K 1 112 ? 70.487  63.037  93.042  1.00 42.41 ? 112 THR K CB  1 
ATOM 10149 O OG1 . THR K 1 112 ? 69.364  62.172  92.817  1.00 42.63 ? 112 THR K OG1 1 
ATOM 10150 C CG2 . THR K 1 112 ? 71.537  62.306  93.904  1.00 42.32 ? 112 THR K CG2 1 
ATOM 10151 N N   . ASN K 1 113 ? 68.207  63.374  94.978  1.00 42.76 ? 113 ASN K N   1 
ATOM 10152 C CA  . ASN K 1 113 ? 67.425  63.044  96.175  1.00 43.05 ? 113 ASN K CA  1 
ATOM 10153 C C   . ASN K 1 113 ? 68.057  61.954  97.051  1.00 43.07 ? 113 ASN K C   1 
ATOM 10154 O O   . ASN K 1 113 ? 67.698  61.831  98.225  1.00 43.14 ? 113 ASN K O   1 
ATOM 10155 C CB  . ASN K 1 113 ? 66.002  62.619  95.784  1.00 43.32 ? 113 ASN K CB  1 
ATOM 10156 C CG  . ASN K 1 113 ? 65.219  63.733  95.110  1.00 43.69 ? 113 ASN K CG  1 
ATOM 10157 O OD1 . ASN K 1 113 ? 65.775  64.764  94.726  1.00 43.88 ? 113 ASN K OD1 1 
ATOM 10158 N ND2 . ASN K 1 113 ? 63.915  63.526  94.960  1.00 43.95 ? 113 ASN K ND2 1 
ATOM 10159 N N   . THR K 1 114 ? 68.978  61.169  96.488  1.00 42.95 ? 114 THR K N   1 
ATOM 10160 C CA  . THR K 1 114 ? 69.629  60.075  97.216  1.00 42.92 ? 114 THR K CA  1 
ATOM 10161 C C   . THR K 1 114 ? 70.558  60.609  98.309  1.00 42.75 ? 114 THR K C   1 
ATOM 10162 O O   . THR K 1 114 ? 71.337  61.532  98.068  1.00 42.67 ? 114 THR K O   1 
ATOM 10163 C CB  . THR K 1 114 ? 70.445  59.170  96.265  1.00 43.06 ? 114 THR K CB  1 
ATOM 10164 O OG1 . THR K 1 114 ? 69.634  58.793  95.144  1.00 43.18 ? 114 THR K OG1 1 
ATOM 10165 C CG2 . THR K 1 114 ? 70.932  57.911  96.983  1.00 43.11 ? 114 THR K CG2 1 
ATOM 10166 N N   . ALA K 1 115 ? 70.468  60.016  99.500  1.00 42.77 ? 115 ALA K N   1 
ATOM 10167 C CA  . ALA K 1 115 ? 71.259  60.439  100.658 1.00 42.75 ? 115 ALA K CA  1 
ATOM 10168 C C   . ALA K 1 115 ? 72.636  59.782  100.663 1.00 42.74 ? 115 ALA K C   1 
ATOM 10169 O O   . ALA K 1 115 ? 72.822  58.702  100.096 1.00 42.81 ? 115 ALA K O   1 
ATOM 10170 C CB  . ALA K 1 115 ? 70.521  60.113  101.948 1.00 42.91 ? 115 ALA K CB  1 
ATOM 10171 N N   . VAL K 1 116 ? 73.590  60.440  101.319 1.00 42.90 ? 116 VAL K N   1 
ATOM 10172 C CA  . VAL K 1 116 ? 74.968  59.930  101.428 1.00 43.05 ? 116 VAL K CA  1 
ATOM 10173 C C   . VAL K 1 116 ? 75.075  58.682  102.314 1.00 43.55 ? 116 VAL K C   1 
ATOM 10174 O O   . VAL K 1 116 ? 75.985  57.869  102.129 1.00 43.76 ? 116 VAL K O   1 
ATOM 10175 C CB  . VAL K 1 116 ? 75.968  61.004  101.932 1.00 42.93 ? 116 VAL K CB  1 
ATOM 10176 C CG1 . VAL K 1 116 ? 75.980  62.209  100.997 1.00 42.89 ? 116 VAL K CG1 1 
ATOM 10177 C CG2 . VAL K 1 116 ? 75.687  61.411  103.380 1.00 42.98 ? 116 VAL K CG2 1 
ATOM 10178 N N   . THR K 1 117 ? 74.159  58.543  103.274 1.00 43.94 ? 117 THR K N   1 
ATOM 10179 C CA  . THR K 1 117 ? 74.043  57.322  104.078 1.00 44.22 ? 117 THR K CA  1 
ATOM 10180 C C   . THR K 1 117 ? 73.587  56.132  103.229 1.00 44.30 ? 117 THR K C   1 
ATOM 10181 O O   . THR K 1 117 ? 74.053  55.009  103.433 1.00 44.49 ? 117 THR K O   1 
ATOM 10182 C CB  . THR K 1 117 ? 73.059  57.502  105.253 1.00 44.54 ? 117 THR K CB  1 
ATOM 10183 O OG1 . THR K 1 117 ? 71.802  57.983  104.763 1.00 44.68 ? 117 THR K OG1 1 
ATOM 10184 C CG2 . THR K 1 117 ? 73.616  58.486  106.275 1.00 44.67 ? 117 THR K CG2 1 
ATOM 10185 N N   . SER K 1 118 ? 72.679  56.386  102.286 1.00 44.37 ? 118 SER K N   1 
ATOM 10186 C CA  . SER K 1 118 ? 72.246  55.374  101.316 1.00 44.50 ? 118 SER K CA  1 
ATOM 10187 C C   . SER K 1 118 ? 73.329  55.108  100.270 1.00 44.49 ? 118 SER K C   1 
ATOM 10188 O O   . SER K 1 118 ? 74.312  55.849  100.175 1.00 44.41 ? 118 SER K O   1 
ATOM 10189 C CB  . SER K 1 118 ? 70.953  55.812  100.620 1.00 44.61 ? 118 SER K CB  1 
ATOM 10190 O OG  . SER K 1 118 ? 69.926  56.065  101.564 1.00 44.73 ? 118 SER K OG  1 
ATOM 10191 N N   . SER K 1 119 ? 73.133  54.052  99.481  1.00 44.65 ? 119 SER K N   1 
ATOM 10192 C CA  . SER K 1 119 ? 74.116  53.624  98.479  1.00 44.77 ? 119 SER K CA  1 
ATOM 10193 C C   . SER K 1 119 ? 74.223  54.600  97.305  1.00 44.88 ? 119 SER K C   1 
ATOM 10194 O O   . SER K 1 119 ? 73.351  55.452  97.105  1.00 44.83 ? 119 SER K O   1 
ATOM 10195 C CB  . SER K 1 119 ? 73.774  52.227  97.955  1.00 44.90 ? 119 SER K CB  1 
ATOM 10196 O OG  . SER K 1 119 ? 74.810  51.722  97.129  1.00 44.99 ? 119 SER K OG  1 
ATOM 10197 N N   . GLN K 1 120 ? 75.301  54.456  96.535  1.00 44.97 ? 120 GLN K N   1 
ATOM 10198 C CA  . GLN K 1 120 ? 75.593  55.346  95.408  1.00 45.08 ? 120 GLN K CA  1 
ATOM 10199 C C   . GLN K 1 120 ? 74.567  55.161  94.282  1.00 45.31 ? 120 GLN K C   1 
ATOM 10200 O O   . GLN K 1 120 ? 74.218  54.023  93.958  1.00 45.67 ? 120 GLN K O   1 
ATOM 10201 C CB  . GLN K 1 120 ? 77.003  55.075  94.872  1.00 45.05 ? 120 GLN K CB  1 
ATOM 10202 C CG  . GLN K 1 120 ? 77.484  56.059  93.814  1.00 45.09 ? 120 GLN K CG  1 
ATOM 10203 C CD  . GLN K 1 120 ? 78.905  55.780  93.359  1.00 45.21 ? 120 GLN K CD  1 
ATOM 10204 O OE1 . GLN K 1 120 ? 79.815  55.636  94.176  1.00 45.22 ? 120 GLN K OE1 1 
ATOM 10205 N NE2 . GLN K 1 120 ? 79.104  55.710  92.047  1.00 45.29 ? 120 GLN K NE2 1 
ATOM 10206 N N   . PRO K 1 121 ? 74.067  56.274  93.697  1.00 45.40 ? 121 PRO K N   1 
ATOM 10207 C CA  . PRO K 1 121 ? 73.202  56.181  92.514  1.00 45.55 ? 121 PRO K CA  1 
ATOM 10208 C C   . PRO K 1 121 ? 73.878  55.495  91.323  1.00 45.58 ? 121 PRO K C   1 
ATOM 10209 O O   . PRO K 1 121 ? 75.033  55.797  91.015  1.00 45.53 ? 121 PRO K O   1 
ATOM 10210 C CB  . PRO K 1 121 ? 72.902  57.645  92.179  1.00 45.56 ? 121 PRO K CB  1 
ATOM 10211 C CG  . PRO K 1 121 ? 73.014  58.357  93.477  1.00 45.48 ? 121 PRO K CG  1 
ATOM 10212 C CD  . PRO K 1 121 ? 74.086  57.645  94.248  1.00 45.42 ? 121 PRO K CD  1 
ATOM 10213 N N   . GLU K 1 122 ? 73.156  54.580  90.678  1.00 45.76 ? 122 GLU K N   1 
ATOM 10214 C CA  . GLU K 1 122 ? 73.679  53.835  89.526  1.00 45.90 ? 122 GLU K CA  1 
ATOM 10215 C C   . GLU K 1 122 ? 73.842  54.732  88.302  1.00 45.50 ? 122 GLU K C   1 
ATOM 10216 O O   . GLU K 1 122 ? 74.852  54.646  87.605  1.00 45.42 ? 122 GLU K O   1 
ATOM 10217 C CB  . GLU K 1 122 ? 72.766  52.650  89.180  1.00 46.32 ? 122 GLU K CB  1 
ATOM 10218 C CG  . GLU K 1 122 ? 72.701  51.562  90.248  1.00 46.56 ? 122 GLU K CG  1 
ATOM 10219 C CD  . GLU K 1 122 ? 74.020  50.830  90.463  1.00 46.77 ? 122 GLU K CD  1 
ATOM 10220 O OE1 . GLU K 1 122 ? 74.870  50.810  89.545  1.00 46.76 ? 122 GLU K OE1 1 
ATOM 10221 O OE2 . GLU K 1 122 ? 74.206  50.264  91.561  1.00 46.96 ? 122 GLU K OE2 1 
ATOM 10222 N N   . SER K 1 123 ? 72.841  55.574  88.048  1.00 45.20 ? 123 SER K N   1 
ATOM 10223 C CA  . SER K 1 123 ? 72.889  56.571  86.974  1.00 45.03 ? 123 SER K CA  1 
ATOM 10224 C C   . SER K 1 123 ? 72.274  57.889  87.442  1.00 44.61 ? 123 SER K C   1 
ATOM 10225 O O   . SER K 1 123 ? 71.381  57.901  88.293  1.00 44.74 ? 123 SER K O   1 
ATOM 10226 C CB  . SER K 1 123 ? 72.143  56.060  85.740  1.00 45.23 ? 123 SER K CB  1 
ATOM 10227 O OG  . SER K 1 123 ? 72.271  56.961  84.654  1.00 45.30 ? 123 SER K OG  1 
ATOM 10228 N N   . CYS K 1 124 ? 72.761  58.991  86.875  1.00 44.10 ? 124 CYS K N   1 
ATOM 10229 C CA  . CYS K 1 124 ? 72.294  60.334  87.234  1.00 43.87 ? 124 CYS K CA  1 
ATOM 10230 C C   . CYS K 1 124 ? 70.870  60.584  86.711  1.00 44.47 ? 124 CYS K C   1 
ATOM 10231 O O   . CYS K 1 124 ? 70.496  60.025  85.677  1.00 44.77 ? 124 CYS K O   1 
ATOM 10232 C CB  . CYS K 1 124 ? 73.255  61.398  86.688  1.00 43.10 ? 124 CYS K CB  1 
ATOM 10233 S SG  . CYS K 1 124 ? 73.890  61.057  85.028  1.00 42.51 ? 124 CYS K SG  1 
ATOM 10234 N N   . PRO K 1 125 ? 70.069  61.413  87.423  1.00 44.93 ? 125 PRO K N   1 
ATOM 10235 C CA  . PRO K 1 125 ? 68.712  61.728  86.937  1.00 45.17 ? 125 PRO K CA  1 
ATOM 10236 C C   . PRO K 1 125 ? 68.671  62.529  85.629  1.00 45.54 ? 125 PRO K C   1 
ATOM 10237 O O   . PRO K 1 125 ? 67.619  62.634  84.995  1.00 45.78 ? 125 PRO K O   1 
ATOM 10238 C CB  . PRO K 1 125 ? 68.108  62.560  88.079  1.00 45.17 ? 125 PRO K CB  1 
ATOM 10239 C CG  . PRO K 1 125 ? 68.913  62.222  89.280  1.00 45.13 ? 125 PRO K CG  1 
ATOM 10240 C CD  . PRO K 1 125 ? 70.298  61.964  88.773  1.00 45.02 ? 125 PRO K CD  1 
ATOM 10241 O OXT . PRO K 1 125 ? 69.669  63.089  85.171  1.00 45.77 ? 125 PRO K OXT 1 
ATOM 10242 N N   . PHE L 1 1   ? 79.794  83.812  158.340 1.00 65.53 ? 1   PHE L N   1 
ATOM 10243 C CA  . PHE L 1 1   ? 80.907  83.702  157.352 1.00 65.24 ? 1   PHE L CA  1 
ATOM 10244 C C   . PHE L 1 1   ? 82.138  83.087  158.029 1.00 64.19 ? 1   PHE L C   1 
ATOM 10245 O O   . PHE L 1 1   ? 82.915  83.786  158.686 1.00 64.28 ? 1   PHE L O   1 
ATOM 10246 C CB  . PHE L 1 1   ? 81.224  85.084  156.755 1.00 66.00 ? 1   PHE L CB  1 
ATOM 10247 C CG  . PHE L 1 1   ? 81.840  85.035  155.380 1.00 66.66 ? 1   PHE L CG  1 
ATOM 10248 C CD1 . PHE L 1 1   ? 83.067  84.411  155.165 1.00 66.87 ? 1   PHE L CD1 1 
ATOM 10249 C CD2 . PHE L 1 1   ? 81.200  85.631  154.295 1.00 67.09 ? 1   PHE L CD2 1 
ATOM 10250 C CE1 . PHE L 1 1   ? 83.635  84.373  153.901 1.00 67.09 ? 1   PHE L CE1 1 
ATOM 10251 C CE2 . PHE L 1 1   ? 81.767  85.593  153.030 1.00 67.25 ? 1   PHE L CE2 1 
ATOM 10252 C CZ  . PHE L 1 1   ? 82.986  84.965  152.832 1.00 67.25 ? 1   PHE L CZ  1 
ATOM 10253 N N   . THR L 1 2   ? 82.308  81.776  157.855 1.00 62.81 ? 2   THR L N   1 
ATOM 10254 C CA  . THR L 1 2   ? 83.400  81.029  158.487 1.00 61.68 ? 2   THR L CA  1 
ATOM 10255 C C   . THR L 1 2   ? 84.697  81.131  157.687 1.00 60.37 ? 2   THR L C   1 
ATOM 10256 O O   . THR L 1 2   ? 84.708  81.627  156.558 1.00 60.21 ? 2   THR L O   1 
ATOM 10257 C CB  . THR L 1 2   ? 83.041  79.532  158.636 1.00 61.85 ? 2   THR L CB  1 
ATOM 10258 O OG1 . THR L 1 2   ? 82.725  78.983  157.352 1.00 61.94 ? 2   THR L OG1 1 
ATOM 10259 C CG2 . THR L 1 2   ? 81.852  79.341  159.567 1.00 61.91 ? 2   THR L CG2 1 
ATOM 10260 N N   . LEU L 1 3   ? 85.785  80.655  158.289 1.00 59.31 ? 3   LEU L N   1 
ATOM 10261 C CA  . LEU L 1 3   ? 87.074  80.528  157.606 1.00 58.56 ? 3   LEU L CA  1 
ATOM 10262 C C   . LEU L 1 3   ? 87.051  79.363  156.614 1.00 57.74 ? 3   LEU L C   1 
ATOM 10263 O O   . LEU L 1 3   ? 87.614  79.470  155.525 1.00 57.87 ? 3   LEU L O   1 
ATOM 10264 C CB  . LEU L 1 3   ? 88.210  80.335  158.618 1.00 58.65 ? 3   LEU L CB  1 
ATOM 10265 C CG  . LEU L 1 3   ? 89.651  80.307  158.091 1.00 58.84 ? 3   LEU L CG  1 
ATOM 10266 C CD1 . LEU L 1 3   ? 90.033  81.629  157.441 1.00 58.83 ? 3   LEU L CD1 1 
ATOM 10267 C CD2 . LEU L 1 3   ? 90.611  79.969  159.222 1.00 59.00 ? 3   LEU L CD2 1 
ATOM 10268 N N   . ILE L 1 4   ? 86.418  78.255  157.004 1.00 56.84 ? 4   ILE L N   1 
ATOM 10269 C CA  . ILE L 1 4   ? 86.244  77.087  156.121 1.00 56.10 ? 4   ILE L CA  1 
ATOM 10270 C C   . ILE L 1 4   ? 85.428  77.399  154.855 1.00 55.55 ? 4   ILE L C   1 
ATOM 10271 O O   . ILE L 1 4   ? 85.722  76.859  153.786 1.00 55.56 ? 4   ILE L O   1 
ATOM 10272 C CB  . ILE L 1 4   ? 85.647  75.863  156.885 1.00 56.16 ? 4   ILE L CB  1 
ATOM 10273 C CG1 . ILE L 1 4   ? 85.654  74.587  156.026 1.00 56.20 ? 4   ILE L CG1 1 
ATOM 10274 C CG2 . ILE L 1 4   ? 84.224  76.121  157.368 1.00 56.30 ? 4   ILE L CG2 1 
ATOM 10275 C CD1 . ILE L 1 4   ? 87.015  74.171  155.514 1.00 56.15 ? 4   ILE L CD1 1 
ATOM 10276 N N   . GLU L 1 5   ? 84.414  78.258  154.980 1.00 55.12 ? 5   GLU L N   1 
ATOM 10277 C CA  . GLU L 1 5   ? 83.626  78.711  153.823 1.00 54.70 ? 5   GLU L CA  1 
ATOM 10278 C C   . GLU L 1 5   ? 84.454  79.603  152.892 1.00 54.01 ? 5   GLU L C   1 
ATOM 10279 O O   . GLU L 1 5   ? 84.250  79.585  151.680 1.00 54.13 ? 5   GLU L O   1 
ATOM 10280 C CB  . GLU L 1 5   ? 82.355  79.438  154.281 1.00 54.98 ? 5   GLU L CB  1 
ATOM 10281 C CG  . GLU L 1 5   ? 81.412  79.856  153.155 1.00 55.44 ? 5   GLU L CG  1 
ATOM 10282 C CD  . GLU L 1 5   ? 81.581  81.307  152.729 1.00 55.80 ? 5   GLU L CD  1 
ATOM 10283 O OE1 . GLU L 1 5   ? 81.339  82.206  153.563 1.00 55.97 ? 5   GLU L OE1 1 
ATOM 10284 O OE2 . GLU L 1 5   ? 81.943  81.549  151.559 1.00 55.93 ? 5   GLU L OE2 1 
ATOM 10285 N N   . LEU L 1 6   ? 85.370  80.384  153.461 1.00 53.26 ? 6   LEU L N   1 
ATOM 10286 C CA  . LEU L 1 6   ? 86.329  81.167  152.676 1.00 52.82 ? 6   LEU L CA  1 
ATOM 10287 C C   . LEU L 1 6   ? 87.417  80.279  152.070 1.00 52.17 ? 6   LEU L C   1 
ATOM 10288 O O   . LEU L 1 6   ? 87.836  80.496  150.933 1.00 52.30 ? 6   LEU L O   1 
ATOM 10289 C CB  . LEU L 1 6   ? 86.979  82.242  153.554 1.00 53.07 ? 6   LEU L CB  1 
ATOM 10290 C CG  . LEU L 1 6   ? 87.829  83.330  152.881 1.00 53.25 ? 6   LEU L CG  1 
ATOM 10291 C CD1 . LEU L 1 6   ? 87.020  84.150  151.880 1.00 53.35 ? 6   LEU L CD1 1 
ATOM 10292 C CD2 . LEU L 1 6   ? 88.462  84.226  153.942 1.00 53.36 ? 6   LEU L CD2 1 
ATOM 10293 N N   . LEU L 1 7   ? 87.870  79.291  152.842 1.00 51.68 ? 7   LEU L N   1 
ATOM 10294 C CA  . LEU L 1 7   ? 88.951  78.387  152.438 1.00 51.18 ? 7   LEU L CA  1 
ATOM 10295 C C   . LEU L 1 7   ? 88.576  77.494  151.254 1.00 50.46 ? 7   LEU L C   1 
ATOM 10296 O O   . LEU L 1 7   ? 89.394  77.293  150.354 1.00 50.55 ? 7   LEU L O   1 
ATOM 10297 C CB  . LEU L 1 7   ? 89.380  77.523  153.630 1.00 51.54 ? 7   LEU L CB  1 
ATOM 10298 C CG  . LEU L 1 7   ? 90.550  76.547  153.469 1.00 52.00 ? 7   LEU L CG  1 
ATOM 10299 C CD1 . LEU L 1 7   ? 91.800  77.246  152.955 1.00 52.25 ? 7   LEU L CD1 1 
ATOM 10300 C CD2 . LEU L 1 7   ? 90.819  75.868  154.804 1.00 52.11 ? 7   LEU L CD2 1 
ATOM 10301 N N   . ILE L 1 8   ? 87.356  76.956  151.267 1.00 49.67 ? 8   ILE L N   1 
ATOM 10302 C CA  . ILE L 1 8   ? 86.846  76.163  150.136 1.00 48.95 ? 8   ILE L CA  1 
ATOM 10303 C C   . ILE L 1 8   ? 86.634  77.016  148.878 1.00 48.10 ? 8   ILE L C   1 
ATOM 10304 O O   . ILE L 1 8   ? 86.846  76.531  147.771 1.00 48.25 ? 8   ILE L O   1 
ATOM 10305 C CB  . ILE L 1 8   ? 85.557  75.366  150.490 1.00 49.08 ? 8   ILE L CB  1 
ATOM 10306 C CG1 . ILE L 1 8   ? 85.279  74.297  149.420 1.00 49.31 ? 8   ILE L CG1 1 
ATOM 10307 C CG2 . ILE L 1 8   ? 84.354  76.288  150.668 1.00 49.12 ? 8   ILE L CG2 1 
ATOM 10308 C CD1 . ILE L 1 8   ? 84.275  73.239  149.830 1.00 49.49 ? 8   ILE L CD1 1 
ATOM 10309 N N   . VAL L 1 9   ? 86.229  78.276  149.051 1.00 47.27 ? 9   VAL L N   1 
ATOM 10310 C CA  . VAL L 1 9   ? 86.101  79.221  147.929 1.00 46.73 ? 9   VAL L CA  1 
ATOM 10311 C C   . VAL L 1 9   ? 87.466  79.506  147.283 1.00 46.19 ? 9   VAL L C   1 
ATOM 10312 O O   . VAL L 1 9   ? 87.558  79.611  146.060 1.00 46.23 ? 9   VAL L O   1 
ATOM 10313 C CB  . VAL L 1 9   ? 85.402  80.536  148.370 1.00 46.84 ? 9   VAL L CB  1 
ATOM 10314 C CG1 . VAL L 1 9   ? 85.539  81.638  147.323 1.00 46.95 ? 9   VAL L CG1 1 
ATOM 10315 C CG2 . VAL L 1 9   ? 83.929  80.274  148.655 1.00 46.91 ? 9   VAL L CG2 1 
ATOM 10316 N N   . ILE L 1 10  ? 88.509  79.623  148.104 1.00 45.60 ? 10  ILE L N   1 
ATOM 10317 C CA  . ILE L 1 10  ? 89.886  79.770  147.612 1.00 45.28 ? 10  ILE L CA  1 
ATOM 10318 C C   . ILE L 1 10  ? 90.336  78.507  146.858 1.00 44.89 ? 10  ILE L C   1 
ATOM 10319 O O   . ILE L 1 10  ? 91.031  78.605  145.844 1.00 44.97 ? 10  ILE L O   1 
ATOM 10320 C CB  . ILE L 1 10  ? 90.871  80.108  148.765 1.00 45.46 ? 10  ILE L CB  1 
ATOM 10321 C CG1 . ILE L 1 10  ? 90.569  81.503  149.333 1.00 45.68 ? 10  ILE L CG1 1 
ATOM 10322 C CG2 . ILE L 1 10  ? 92.327  80.056  148.300 1.00 45.52 ? 10  ILE L CG2 1 
ATOM 10323 C CD1 . ILE L 1 10  ? 91.084  81.727  150.741 1.00 45.81 ? 10  ILE L CD1 1 
ATOM 10324 N N   . ALA L 1 11  ? 89.935  77.337  147.356 1.00 44.53 ? 11  ALA L N   1 
ATOM 10325 C CA  . ALA L 1 11  ? 90.245  76.055  146.711 1.00 44.37 ? 11  ALA L CA  1 
ATOM 10326 C C   . ALA L 1 11  ? 89.595  75.893  145.333 1.00 44.14 ? 11  ALA L C   1 
ATOM 10327 O O   . ALA L 1 11  ? 90.232  75.386  144.408 1.00 44.27 ? 11  ALA L O   1 
ATOM 10328 C CB  . ALA L 1 11  ? 89.845  74.894  147.614 1.00 44.52 ? 11  ALA L CB  1 
ATOM 10329 N N   . ILE L 1 12  ? 88.339  76.322  145.204 1.00 43.94 ? 12  ILE L N   1 
ATOM 10330 C CA  . ILE L 1 12  ? 87.601  76.231  143.933 1.00 43.88 ? 12  ILE L CA  1 
ATOM 10331 C C   . ILE L 1 12  ? 88.133  77.229  142.891 1.00 43.93 ? 12  ILE L C   1 
ATOM 10332 O O   . ILE L 1 12  ? 88.176  76.905  141.703 1.00 44.27 ? 12  ILE L O   1 
ATOM 10333 C CB  . ILE L 1 12  ? 86.073  76.415  144.142 1.00 43.83 ? 12  ILE L CB  1 
ATOM 10334 C CG1 . ILE L 1 12  ? 85.498  75.299  145.034 1.00 44.06 ? 12  ILE L CG1 1 
ATOM 10335 C CG2 . ILE L 1 12  ? 85.316  76.464  142.813 1.00 43.85 ? 12  ILE L CG2 1 
ATOM 10336 C CD1 . ILE L 1 12  ? 85.676  73.884  144.518 1.00 44.26 ? 12  ILE L CD1 1 
ATOM 10337 N N   . ILE L 1 13  ? 88.539  78.421  143.330 1.00 43.69 ? 13  ILE L N   1 
ATOM 10338 C CA  . ILE L 1 13  ? 89.150  79.420  142.435 1.00 43.60 ? 13  ILE L CA  1 
ATOM 10339 C C   . ILE L 1 13  ? 90.438  78.880  141.791 1.00 43.55 ? 13  ILE L C   1 
ATOM 10340 O O   . ILE L 1 13  ? 90.692  79.133  140.612 1.00 43.61 ? 13  ILE L O   1 
ATOM 10341 C CB  . ILE L 1 13  ? 89.413  80.765  143.168 1.00 43.76 ? 13  ILE L CB  1 
ATOM 10342 C CG1 . ILE L 1 13  ? 88.084  81.455  143.506 1.00 43.92 ? 13  ILE L CG1 1 
ATOM 10343 C CG2 . ILE L 1 13  ? 90.264  81.718  142.322 1.00 43.84 ? 13  ILE L CG2 1 
ATOM 10344 C CD1 . ILE L 1 13  ? 88.173  82.439  144.654 1.00 44.05 ? 13  ILE L CD1 1 
ATOM 10345 N N   . ALA L 1 14  ? 91.234  78.138  142.563 1.00 43.61 ? 14  ALA L N   1 
ATOM 10346 C CA  . ALA L 1 14  ? 92.443  77.481  142.047 1.00 43.68 ? 14  ALA L CA  1 
ATOM 10347 C C   . ALA L 1 14  ? 92.135  76.418  140.987 1.00 43.73 ? 14  ALA L C   1 
ATOM 10348 O O   . ALA L 1 14  ? 92.894  76.261  140.027 1.00 43.84 ? 14  ALA L O   1 
ATOM 10349 C CB  . ALA L 1 14  ? 93.238  76.864  143.190 1.00 43.75 ? 14  ALA L CB  1 
ATOM 10350 N N   . ILE L 1 15  ? 91.029  75.695  141.170 1.00 43.74 ? 15  ILE L N   1 
ATOM 10351 C CA  . ILE L 1 15  ? 90.578  74.676  140.213 1.00 43.83 ? 15  ILE L CA  1 
ATOM 10352 C C   . ILE L 1 15  ? 90.040  75.327  138.936 1.00 43.79 ? 15  ILE L C   1 
ATOM 10353 O O   . ILE L 1 15  ? 90.418  74.930  137.831 1.00 43.92 ? 15  ILE L O   1 
ATOM 10354 C CB  . ILE L 1 15  ? 89.497  73.751  140.830 1.00 44.00 ? 15  ILE L CB  1 
ATOM 10355 C CG1 . ILE L 1 15  ? 90.080  72.957  142.009 1.00 44.22 ? 15  ILE L CG1 1 
ATOM 10356 C CG2 . ILE L 1 15  ? 88.939  72.780  139.788 1.00 44.10 ? 15  ILE L CG2 1 
ATOM 10357 C CD1 . ILE L 1 15  ? 89.038  72.401  142.957 1.00 44.27 ? 15  ILE L CD1 1 
ATOM 10358 N N   . LEU L 1 16  ? 89.155  76.309  139.099 1.00 43.76 ? 16  LEU L N   1 
ATOM 10359 C CA  . LEU L 1 16  ? 88.561  77.031  137.960 1.00 43.77 ? 16  LEU L CA  1 
ATOM 10360 C C   . LEU L 1 16  ? 89.588  77.829  137.145 1.00 43.68 ? 16  LEU L C   1 
ATOM 10361 O O   . LEU L 1 16  ? 89.459  77.930  135.924 1.00 43.80 ? 16  LEU L O   1 
ATOM 10362 C CB  . LEU L 1 16  ? 87.414  77.951  138.422 1.00 43.94 ? 16  LEU L CB  1 
ATOM 10363 C CG  . LEU L 1 16  ? 86.007  77.339  138.494 1.00 44.26 ? 16  LEU L CG  1 
ATOM 10364 C CD1 . LEU L 1 16  ? 85.984  75.962  139.149 1.00 44.40 ? 16  LEU L CD1 1 
ATOM 10365 C CD2 . LEU L 1 16  ? 85.059  78.291  139.213 1.00 44.39 ? 16  LEU L CD2 1 
ATOM 10366 N N   . ALA L 1 17  ? 90.594  78.389  137.817 1.00 43.48 ? 17  ALA L N   1 
ATOM 10367 C CA  . ALA L 1 17  ? 91.669  79.134  137.145 1.00 43.36 ? 17  ALA L CA  1 
ATOM 10368 C C   . ALA L 1 17  ? 92.570  78.254  136.268 1.00 43.29 ? 17  ALA L C   1 
ATOM 10369 O O   . ALA L 1 17  ? 93.183  78.751  135.321 1.00 43.40 ? 17  ALA L O   1 
ATOM 10370 C CB  . ALA L 1 17  ? 92.514  79.886  138.166 1.00 43.38 ? 17  ALA L CB  1 
ATOM 10371 N N   . ALA L 1 18  ? 92.659  76.963  136.591 1.00 43.01 ? 18  ALA L N   1 
ATOM 10372 C CA  . ALA L 1 18  ? 93.446  76.012  135.806 1.00 42.88 ? 18  ALA L CA  1 
ATOM 10373 C C   . ALA L 1 18  ? 92.677  75.516  134.583 1.00 42.74 ? 18  ALA L C   1 
ATOM 10374 O O   . ALA L 1 18  ? 93.167  75.613  133.456 1.00 42.83 ? 18  ALA L O   1 
ATOM 10375 C CB  . ALA L 1 18  ? 93.863  74.833  136.675 1.00 42.97 ? 18  ALA L CB  1 
ATOM 10376 N N   . VAL L 1 19  ? 91.474  74.994  134.817 1.00 42.61 ? 19  VAL L N   1 
ATOM 10377 C CA  . VAL L 1 19  ? 90.702  74.299  133.770 1.00 42.61 ? 19  VAL L CA  1 
ATOM 10378 C C   . VAL L 1 19  ? 90.052  75.217  132.726 1.00 42.56 ? 19  VAL L C   1 
ATOM 10379 O O   . VAL L 1 19  ? 90.038  74.882  131.539 1.00 42.66 ? 19  VAL L O   1 
ATOM 10380 C CB  . VAL L 1 19  ? 89.625  73.345  134.364 1.00 42.69 ? 19  VAL L CB  1 
ATOM 10381 C CG1 . VAL L 1 19  ? 90.264  72.350  135.327 1.00 42.75 ? 19  VAL L CG1 1 
ATOM 10382 C CG2 . VAL L 1 19  ? 88.482  74.106  135.035 1.00 42.69 ? 19  VAL L CG2 1 
ATOM 10383 N N   . LEU L 1 20  ? 89.525  76.362  133.160 1.00 42.47 ? 20  LEU L N   1 
ATOM 10384 C CA  . LEU L 1 20  ? 88.765  77.256  132.271 1.00 42.47 ? 20  LEU L CA  1 
ATOM 10385 C C   . LEU L 1 20  ? 89.637  78.086  131.321 1.00 42.21 ? 20  LEU L C   1 
ATOM 10386 O O   . LEU L 1 20  ? 89.147  78.546  130.286 1.00 42.16 ? 20  LEU L O   1 
ATOM 10387 C CB  . LEU L 1 20  ? 87.859  78.185  133.086 1.00 42.79 ? 20  LEU L CB  1 
ATOM 10388 C CG  . LEU L 1 20  ? 86.838  77.520  134.017 1.00 43.17 ? 20  LEU L CG  1 
ATOM 10389 C CD1 . LEU L 1 20  ? 86.131  78.569  134.858 1.00 43.27 ? 20  LEU L CD1 1 
ATOM 10390 C CD2 . LEU L 1 20  ? 85.826  76.702  133.226 1.00 43.25 ? 20  LEU L CD2 1 
ATOM 10391 N N   . ILE L 1 21  ? 90.910  78.282  131.670 1.00 41.85 ? 21  ILE L N   1 
ATOM 10392 C CA  . ILE L 1 21  ? 91.858  79.008  130.816 1.00 41.51 ? 21  ILE L CA  1 
ATOM 10393 C C   . ILE L 1 21  ? 92.243  78.071  129.660 1.00 41.13 ? 21  ILE L C   1 
ATOM 10394 O O   . ILE L 1 21  ? 92.834  77.017  129.903 1.00 41.33 ? 21  ILE L O   1 
ATOM 10395 C CB  . ILE L 1 21  ? 93.116  79.472  131.604 1.00 41.75 ? 21  ILE L CB  1 
ATOM 10396 C CG1 . ILE L 1 21  ? 92.833  80.745  132.424 1.00 41.94 ? 21  ILE L CG1 1 
ATOM 10397 C CG2 . ILE L 1 21  ? 94.285  79.791  130.672 1.00 41.83 ? 21  ILE L CG2 1 
ATOM 10398 C CD1 . ILE L 1 21  ? 91.585  80.737  133.286 1.00 42.01 ? 21  ILE L CD1 1 
ATOM 10399 N N   . PRO L 1 22  ? 91.912  78.447  128.405 1.00 40.49 ? 22  PRO L N   1 
ATOM 10400 C CA  . PRO L 1 22  ? 92.158  77.556  127.269 1.00 40.05 ? 22  PRO L CA  1 
ATOM 10401 C C   . PRO L 1 22  ? 93.614  77.553  126.802 1.00 39.58 ? 22  PRO L C   1 
ATOM 10402 O O   . PRO L 1 22  ? 94.416  78.374  127.254 1.00 39.64 ? 22  PRO L O   1 
ATOM 10403 C CB  . PRO L 1 22  ? 91.258  78.140  126.182 1.00 40.17 ? 22  PRO L CB  1 
ATOM 10404 C CG  . PRO L 1 22  ? 91.269  79.602  126.463 1.00 40.35 ? 22  PRO L CG  1 
ATOM 10405 C CD  . PRO L 1 22  ? 91.357  79.741  127.960 1.00 40.46 ? 22  PRO L CD  1 
ATOM 10406 N N   . ASN L 1 23  ? 93.934  76.628  125.897 1.00 38.96 ? 23  ASN L N   1 
ATOM 10407 C CA  . ASN L 1 23  ? 95.259  76.557  125.280 1.00 38.42 ? 23  ASN L CA  1 
ATOM 10408 C C   . ASN L 1 23  ? 95.393  77.703  124.274 1.00 38.17 ? 23  ASN L C   1 
ATOM 10409 O O   . ASN L 1 23  ? 94.798  77.665  123.194 1.00 38.30 ? 23  ASN L O   1 
ATOM 10410 C CB  . ASN L 1 23  ? 95.465  75.196  124.600 1.00 38.26 ? 23  ASN L CB  1 
ATOM 10411 C CG  . ASN L 1 23  ? 96.915  74.937  124.221 1.00 38.22 ? 23  ASN L CG  1 
ATOM 10412 O OD1 . ASN L 1 23  ? 97.552  75.747  123.548 1.00 38.19 ? 23  ASN L OD1 1 
ATOM 10413 N ND2 . ASN L 1 23  ? 97.439  73.792  124.643 1.00 38.32 ? 23  ASN L ND2 1 
ATOM 10414 N N   . LEU L 1 24  ? 96.168  78.721  124.646 1.00 37.77 ? 24  LEU L N   1 
ATOM 10415 C CA  . LEU L 1 24  ? 96.339  79.916  123.818 1.00 37.53 ? 24  LEU L CA  1 
ATOM 10416 C C   . LEU L 1 24  ? 97.268  79.660  122.632 1.00 37.24 ? 24  LEU L C   1 
ATOM 10417 O O   . LEU L 1 24  ? 96.944  80.037  121.507 1.00 37.38 ? 24  LEU L O   1 
ATOM 10418 C CB  . LEU L 1 24  ? 96.874  81.084  124.654 1.00 37.66 ? 24  LEU L CB  1 
ATOM 10419 C CG  . LEU L 1 24  ? 96.010  81.541  125.836 1.00 37.78 ? 24  LEU L CG  1 
ATOM 10420 C CD1 . LEU L 1 24  ? 96.793  82.484  126.736 1.00 37.90 ? 24  LEU L CD1 1 
ATOM 10421 C CD2 . LEU L 1 24  ? 94.724  82.205  125.366 1.00 37.72 ? 24  LEU L CD2 1 
ATOM 10422 N N   . LEU L 1 25  ? 98.408  79.015  122.890 1.00 36.76 ? 25  LEU L N   1 
ATOM 10423 C CA  . LEU L 1 25  ? 99.426  78.759  121.860 1.00 36.40 ? 25  LEU L CA  1 
ATOM 10424 C C   . LEU L 1 25  ? 98.879  77.972  120.672 1.00 35.85 ? 25  LEU L C   1 
ATOM 10425 O O   . LEU L 1 25  ? 99.181  78.295  119.523 1.00 35.80 ? 25  LEU L O   1 
ATOM 10426 C CB  . LEU L 1 25  ? 100.628 78.010  122.456 1.00 36.59 ? 25  LEU L CB  1 
ATOM 10427 C CG  . LEU L 1 25  ? 101.841 77.768  121.543 1.00 36.81 ? 25  LEU L CG  1 
ATOM 10428 C CD1 . LEU L 1 25  ? 102.478 79.084  121.121 1.00 36.91 ? 25  LEU L CD1 1 
ATOM 10429 C CD2 . LEU L 1 25  ? 102.864 76.876  122.231 1.00 36.92 ? 25  LEU L CD2 1 
ATOM 10430 N N   . ALA L 1 26  ? 98.081  76.946  120.959 1.00 35.52 ? 26  ALA L N   1 
ATOM 10431 C CA  . ALA L 1 26  ? 97.471  76.114  119.918 1.00 35.27 ? 26  ALA L CA  1 
ATOM 10432 C C   . ALA L 1 26  ? 96.429  76.885  119.104 1.00 34.96 ? 26  ALA L C   1 
ATOM 10433 O O   . ALA L 1 26  ? 96.359  76.732  117.884 1.00 34.98 ? 26  ALA L O   1 
ATOM 10434 C CB  . ALA L 1 26  ? 96.853  74.861  120.529 1.00 35.29 ? 26  ALA L CB  1 
ATOM 10435 N N   . ALA L 1 27  ? 95.633  77.713  119.779 1.00 34.79 ? 27  ALA L N   1 
ATOM 10436 C CA  . ALA L 1 27  ? 94.620  78.549  119.119 1.00 34.77 ? 27  ALA L CA  1 
ATOM 10437 C C   . ALA L 1 27  ? 95.221  79.539  118.114 1.00 34.60 ? 27  ALA L C   1 
ATOM 10438 O O   . ALA L 1 27  ? 94.638  79.772  117.054 1.00 34.63 ? 27  ALA L O   1 
ATOM 10439 C CB  . ALA L 1 27  ? 93.792  79.295  120.157 1.00 34.88 ? 27  ALA L CB  1 
ATOM 10440 N N   . ARG L 1 28  ? 96.377  80.113  118.453 1.00 34.46 ? 28  ARG L N   1 
ATOM 10441 C CA  . ARG L 1 28  ? 97.064  81.066  117.573 1.00 34.32 ? 28  ARG L CA  1 
ATOM 10442 C C   . ARG L 1 28  ? 97.707  80.407  116.347 1.00 34.16 ? 28  ARG L C   1 
ATOM 10443 O O   . ARG L 1 28  ? 97.745  81.021  115.282 1.00 34.28 ? 28  ARG L O   1 
ATOM 10444 C CB  . ARG L 1 28  ? 98.121  81.865  118.344 1.00 34.46 ? 28  ARG L CB  1 
ATOM 10445 C CG  . ARG L 1 28  ? 97.551  82.726  119.461 1.00 34.64 ? 28  ARG L CG  1 
ATOM 10446 C CD  . ARG L 1 28  ? 98.488  83.862  119.846 1.00 34.76 ? 28  ARG L CD  1 
ATOM 10447 N NE  . ARG L 1 28  ? 98.320  85.031  118.982 1.00 34.86 ? 28  ARG L NE  1 
ATOM 10448 C CZ  . ARG L 1 28  ? 97.310  85.905  119.050 1.00 35.08 ? 28  ARG L CZ  1 
ATOM 10449 N NH1 . ARG L 1 28  ? 97.275  86.931  118.204 1.00 35.19 ? 28  ARG L NH1 1 
ATOM 10450 N NH2 . ARG L 1 28  ? 96.331  85.770  119.948 1.00 35.14 ? 28  ARG L NH2 1 
ATOM 10451 N N   . LYS L 1 29  ? 98.213  79.179  116.501 1.00 34.02 ? 29  LYS L N   1 
ATOM 10452 C CA  . LYS L 1 29  ? 98.824  78.427  115.385 1.00 33.92 ? 29  LYS L CA  1 
ATOM 10453 C C   . LYS L 1 29  ? 97.929  78.338  114.147 1.00 33.86 ? 29  LYS L C   1 
ATOM 10454 O O   . LYS L 1 29  ? 98.404  78.517  113.025 1.00 34.02 ? 29  LYS L O   1 
ATOM 10455 C CB  . LYS L 1 29  ? 99.212  77.002  115.812 1.00 33.96 ? 29  LYS L CB  1 
ATOM 10456 C CG  . LYS L 1 29  ? 100.518 76.889  116.581 1.00 34.05 ? 29  LYS L CG  1 
ATOM 10457 C CD  . LYS L 1 29  ? 100.995 75.443  116.620 1.00 34.19 ? 29  LYS L CD  1 
ATOM 10458 C CE  . LYS L 1 29  ? 102.229 75.268  117.492 1.00 34.36 ? 29  LYS L CE  1 
ATOM 10459 N NZ  . LYS L 1 29  ? 101.907 75.183  118.945 1.00 34.43 ? 29  LYS L NZ  1 
ATOM 10460 N N   . ARG L 1 30  ? 96.643  78.066  114.361 1.00 33.59 ? 30  ARG L N   1 
ATOM 10461 C CA  . ARG L 1 30  ? 95.680  77.919  113.263 1.00 33.40 ? 30  ARG L CA  1 
ATOM 10462 C C   . ARG L 1 30  ? 95.292  79.271  112.666 1.00 33.27 ? 30  ARG L C   1 
ATOM 10463 O O   . ARG L 1 30  ? 95.046  79.370  111.462 1.00 33.42 ? 30  ARG L O   1 
ATOM 10464 C CB  . ARG L 1 30  ? 94.426  77.169  113.725 1.00 33.43 ? 30  ARG L CB  1 
ATOM 10465 C CG  . ARG L 1 30  ? 94.676  75.811  114.375 1.00 33.49 ? 30  ARG L CG  1 
ATOM 10466 C CD  . ARG L 1 30  ? 95.387  74.823  113.458 1.00 33.56 ? 30  ARG L CD  1 
ATOM 10467 N NE  . ARG L 1 30  ? 95.786  73.601  114.159 1.00 33.57 ? 30  ARG L NE  1 
ATOM 10468 C CZ  . ARG L 1 30  ? 96.404  72.563  113.593 1.00 33.63 ? 30  ARG L CZ  1 
ATOM 10469 N NH1 . ARG L 1 30  ? 96.710  72.568  112.295 1.00 33.65 ? 30  ARG L NH1 1 
ATOM 10470 N NH2 . ARG L 1 30  ? 96.720  71.501  114.332 1.00 33.67 ? 30  ARG L NH2 1 
ATOM 10471 N N   . ALA L 1 31  ? 95.224  80.298  113.511 1.00 32.98 ? 31  ALA L N   1 
ATOM 10472 C CA  . ALA L 1 31  ? 95.032  81.675  113.051 1.00 32.87 ? 31  ALA L CA  1 
ATOM 10473 C C   . ALA L 1 31  ? 96.235  82.175  112.249 1.00 32.84 ? 31  ALA L C   1 
ATOM 10474 O O   . ALA L 1 31  ? 96.068  82.906  111.273 1.00 32.95 ? 31  ALA L O   1 
ATOM 10475 C CB  . ALA L 1 31  ? 94.770  82.595  114.232 1.00 32.90 ? 31  ALA L CB  1 
ATOM 10476 N N   . ASN L 1 32  ? 97.436  81.783  112.673 1.00 32.86 ? 32  ASN L N   1 
ATOM 10477 C CA  . ASN L 1 32  ? 98.673  82.094  111.943 1.00 32.92 ? 32  ASN L CA  1 
ATOM 10478 C C   . ASN L 1 32  ? 98.742  81.406  110.574 1.00 33.12 ? 32  ASN L C   1 
ATOM 10479 O O   . ASN L 1 32  ? 99.292  81.974  109.627 1.00 33.24 ? 32  ASN L O   1 
ATOM 10480 C CB  . ASN L 1 32  ? 99.909  81.711  112.772 1.00 32.83 ? 32  ASN L CB  1 
ATOM 10481 C CG  . ASN L 1 32  ? 100.127 82.619  113.976 1.00 32.76 ? 32  ASN L CG  1 
ATOM 10482 O OD1 . ASN L 1 32  ? 99.896  83.825  113.898 1.00 32.77 ? 32  ASN L OD1 1 
ATOM 10483 N ND2 . ASN L 1 32  ? 100.569 82.047  115.092 1.00 32.81 ? 32  ASN L ND2 1 
ATOM 10484 N N   . ASP L 1 33  ? 98.200  80.191  110.479 1.00 33.25 ? 33  ASP L N   1 
ATOM 10485 C CA  . ASP L 1 33  ? 98.089  79.481  109.195 1.00 33.42 ? 33  ASP L CA  1 
ATOM 10486 C C   . ASP L 1 33  ? 97.134  80.188  108.231 1.00 33.48 ? 33  ASP L C   1 
ATOM 10487 O O   . ASP L 1 33  ? 97.376  80.205  107.022 1.00 33.61 ? 33  ASP L O   1 
ATOM 10488 C CB  . ASP L 1 33  ? 97.617  78.035  109.400 1.00 33.64 ? 33  ASP L CB  1 
ATOM 10489 C CG  . ASP L 1 33  ? 98.632  77.173  110.139 1.00 33.90 ? 33  ASP L CG  1 
ATOM 10490 O OD1 . ASP L 1 33  ? 99.816  77.563  110.250 1.00 33.97 ? 33  ASP L OD1 1 
ATOM 10491 O OD2 . ASP L 1 33  ? 98.236  76.087  110.613 1.00 34.02 ? 33  ASP L OD2 1 
ATOM 10492 N N   . THR L 1 34  ? 96.054  80.753  108.770 1.00 33.41 ? 34  THR L N   1 
ATOM 10493 C CA  . THR L 1 34  ? 95.098  81.538  107.980 1.00 33.36 ? 34  THR L CA  1 
ATOM 10494 C C   . THR L 1 34  ? 95.737  82.799  107.387 1.00 33.33 ? 34  THR L C   1 
ATOM 10495 O O   . THR L 1 34  ? 95.402  83.187  106.270 1.00 33.44 ? 34  THR L O   1 
ATOM 10496 C CB  . THR L 1 34  ? 93.870  81.951  108.824 1.00 33.50 ? 34  THR L CB  1 
ATOM 10497 O OG1 . THR L 1 34  ? 93.389  80.822  109.563 1.00 33.50 ? 34  THR L OG1 1 
ATOM 10498 C CG2 . THR L 1 34  ? 92.747  82.493  107.938 1.00 33.60 ? 34  THR L CG2 1 
ATOM 10499 N N   . VAL L 1 35  ? 96.648  83.422  108.136 1.00 33.30 ? 35  VAL L N   1 
ATOM 10500 C CA  . VAL L 1 35  ? 97.390  84.602  107.664 1.00 33.32 ? 35  VAL L CA  1 
ATOM 10501 C C   . VAL L 1 35  ? 98.332  84.231  106.513 1.00 33.25 ? 35  VAL L C   1 
ATOM 10502 O O   . VAL L 1 35  ? 98.440  84.975  105.536 1.00 33.36 ? 35  VAL L O   1 
ATOM 10503 C CB  . VAL L 1 35  ? 98.188  85.275  108.814 1.00 33.52 ? 35  VAL L CB  1 
ATOM 10504 C CG1 . VAL L 1 35  ? 99.113  86.378  108.294 1.00 33.63 ? 35  VAL L CG1 1 
ATOM 10505 C CG2 . VAL L 1 35  ? 97.242  85.846  109.861 1.00 33.60 ? 35  VAL L CG2 1 
ATOM 10506 N N   . VAL L 1 36  ? 99.004  83.087  106.640 1.00 33.13 ? 36  VAL L N   1 
ATOM 10507 C CA  . VAL L 1 36  ? 99.915  82.588  105.603 1.00 33.03 ? 36  VAL L CA  1 
ATOM 10508 C C   . VAL L 1 36  ? 99.137  82.144  104.360 1.00 33.02 ? 36  VAL L C   1 
ATOM 10509 O O   . VAL L 1 36  ? 99.543  82.442  103.235 1.00 33.10 ? 36  VAL L O   1 
ATOM 10510 C CB  . VAL L 1 36  ? 100.793 81.422  106.126 1.00 33.02 ? 36  VAL L CB  1 
ATOM 10511 C CG1 . VAL L 1 36  ? 101.602 80.783  105.000 1.00 33.08 ? 36  VAL L CG1 1 
ATOM 10512 C CG2 . VAL L 1 36  ? 101.726 81.907  107.227 1.00 33.01 ? 36  VAL L CG2 1 
ATOM 10513 N N   . THR L 1 37  ? 98.032  81.430  104.573 1.00 33.06 ? 37  THR L N   1 
ATOM 10514 C CA  . THR L 1 37  ? 97.165  80.980  103.479 1.00 33.11 ? 37  THR L CA  1 
ATOM 10515 C C   . THR L 1 37  ? 96.508  82.156  102.749 1.00 33.10 ? 37  THR L C   1 
ATOM 10516 O O   . THR L 1 37  ? 96.399  82.134  101.523 1.00 33.26 ? 37  THR L O   1 
ATOM 10517 C CB  . THR L 1 37  ? 96.065  80.020  103.985 1.00 33.23 ? 37  THR L CB  1 
ATOM 10518 O OG1 . THR L 1 37  ? 96.662  78.954  104.735 1.00 33.31 ? 37  THR L OG1 1 
ATOM 10519 C CG2 . THR L 1 37  ? 95.265  79.428  102.820 1.00 33.28 ? 37  THR L CG2 1 
ATOM 10520 N N   . ALA L 1 38  ? 96.081  83.168  103.503 1.00 33.05 ? 38  ALA L N   1 
ATOM 10521 C CA  . ALA L 1 38  ? 95.478  84.376  102.925 1.00 33.10 ? 38  ALA L CA  1 
ATOM 10522 C C   . ALA L 1 38  ? 96.476  85.190  102.105 1.00 33.09 ? 38  ALA L C   1 
ATOM 10523 O O   . ALA L 1 38  ? 96.140  85.663  101.019 1.00 33.10 ? 38  ALA L O   1 
ATOM 10524 C CB  . ALA L 1 38  ? 94.867  85.246  104.015 1.00 33.16 ? 38  ALA L CB  1 
ATOM 10525 N N   . TYR L 1 39  ? 97.692  85.351  102.628 1.00 33.22 ? 39  TYR L N   1 
ATOM 10526 C CA  . TYR L 1 39  ? 98.742  86.110  101.938 1.00 33.27 ? 39  TYR L CA  1 
ATOM 10527 C C   . TYR L 1 39  ? 99.222  85.412  100.663 1.00 33.48 ? 39  TYR L C   1 
ATOM 10528 O O   . TYR L 1 39  ? 99.499  86.079  99.664  1.00 33.64 ? 39  TYR L O   1 
ATOM 10529 C CB  . TYR L 1 39  ? 99.932  86.380  102.864 1.00 33.19 ? 39  TYR L CB  1 
ATOM 10530 C CG  . TYR L 1 39  ? 100.874 87.434  102.324 1.00 33.27 ? 39  TYR L CG  1 
ATOM 10531 C CD1 . TYR L 1 39  ? 100.577 88.792  102.449 1.00 33.33 ? 39  TYR L CD1 1 
ATOM 10532 C CD2 . TYR L 1 39  ? 102.058 87.078  101.677 1.00 33.35 ? 39  TYR L CD2 1 
ATOM 10533 C CE1 . TYR L 1 39  ? 101.432 89.765  101.950 1.00 33.32 ? 39  TYR L CE1 1 
ATOM 10534 C CE2 . TYR L 1 39  ? 102.921 88.044  101.176 1.00 33.36 ? 39  TYR L CE2 1 
ATOM 10535 C CZ  . TYR L 1 39  ? 102.605 89.385  101.315 1.00 33.36 ? 39  TYR L CZ  1 
ATOM 10536 O OH  . TYR L 1 39  ? 103.458 90.345  100.820 1.00 33.46 ? 39  TYR L OH  1 
ATOM 10537 N N   . LEU L 1 40  ? 99.326  84.084  100.705 1.00 33.68 ? 40  LEU L N   1 
ATOM 10538 C CA  . LEU L 1 40  ? 99.628  83.288  99.507  1.00 33.88 ? 40  LEU L CA  1 
ATOM 10539 C C   . LEU L 1 40  ? 98.476  83.307  98.501  1.00 34.31 ? 40  LEU L C   1 
ATOM 10540 O O   . LEU L 1 40  ? 98.715  83.349  97.295  1.00 34.49 ? 40  LEU L O   1 
ATOM 10541 C CB  . LEU L 1 40  ? 99.973  81.840  99.874  1.00 33.80 ? 40  LEU L CB  1 
ATOM 10542 C CG  . LEU L 1 40  ? 101.326 81.618  100.555 1.00 33.73 ? 40  LEU L CG  1 
ATOM 10543 C CD1 . LEU L 1 40  ? 101.383 80.225  101.153 1.00 33.66 ? 40  LEU L CD1 1 
ATOM 10544 C CD2 . LEU L 1 40  ? 102.481 81.826  99.586  1.00 33.70 ? 40  LEU L CD2 1 
ATOM 10545 N N   . ASN L 1 41  ? 97.238  83.271  98.999  1.00 34.79 ? 41  ASN L N   1 
ATOM 10546 C CA  . ASN L 1 41  ? 96.048  83.404  98.149  1.00 35.15 ? 41  ASN L CA  1 
ATOM 10547 C C   . ASN L 1 41  ? 96.001  84.776  97.467  1.00 35.40 ? 41  ASN L C   1 
ATOM 10548 O O   . ASN L 1 41  ? 95.615  84.875  96.302  1.00 35.49 ? 41  ASN L O   1 
ATOM 10549 C CB  . ASN L 1 41  ? 94.768  83.171  98.963  1.00 35.34 ? 41  ASN L CB  1 
ATOM 10550 C CG  . ASN L 1 41  ? 93.515  83.138  98.102  1.00 35.61 ? 41  ASN L CG  1 
ATOM 10551 O OD1 . ASN L 1 41  ? 93.489  82.513  97.041  1.00 35.79 ? 41  ASN L OD1 1 
ATOM 10552 N ND2 . ASN L 1 41  ? 92.464  83.808  98.562  1.00 35.71 ? 41  ASN L ND2 1 
ATOM 10553 N N   . ASP L 1 42  ? 96.393  85.821  98.197  1.00 35.76 ? 42  ASP L N   1 
ATOM 10554 C CA  . ASP L 1 42  ? 96.548  87.165  97.624  1.00 36.04 ? 42  ASP L CA  1 
ATOM 10555 C C   . ASP L 1 42  ? 97.737  87.236  96.664  1.00 36.01 ? 42  ASP L C   1 
ATOM 10556 O O   . ASP L 1 42  ? 97.643  87.868  95.613  1.00 36.17 ? 42  ASP L O   1 
ATOM 10557 C CB  . ASP L 1 42  ? 96.712  88.224  98.726  1.00 36.32 ? 42  ASP L CB  1 
ATOM 10558 C CG  . ASP L 1 42  ? 95.452  88.411  99.565  1.00 36.66 ? 42  ASP L CG  1 
ATOM 10559 O OD1 . ASP L 1 42  ? 94.332  88.365  99.007  1.00 36.82 ? 42  ASP L OD1 1 
ATOM 10560 O OD2 . ASP L 1 42  ? 95.584  88.617  100.790 1.00 36.78 ? 42  ASP L OD2 1 
ATOM 10561 N N   . ALA L 1 43  ? 98.845  86.590  97.029  1.00 35.92 ? 43  ALA L N   1 
ATOM 10562 C CA  . ALA L 1 43  ? 100.045 86.538  96.183  1.00 35.94 ? 43  ALA L CA  1 
ATOM 10563 C C   . ALA L 1 43  ? 99.789  85.877  94.827  1.00 36.00 ? 43  ALA L C   1 
ATOM 10564 O O   . ALA L 1 43  ? 100.346 86.305  93.818  1.00 36.16 ? 43  ALA L O   1 
ATOM 10565 C CB  . ALA L 1 43  ? 101.178 85.822  96.907  1.00 35.95 ? 43  ALA L CB  1 
ATOM 10566 N N   . VAL L 1 44  ? 98.953  84.839  94.814  1.00 36.18 ? 44  VAL L N   1 
ATOM 10567 C CA  . VAL L 1 44  ? 98.549  84.160  93.573  1.00 36.35 ? 44  VAL L CA  1 
ATOM 10568 C C   . VAL L 1 44  ? 97.745  85.090  92.651  1.00 36.53 ? 44  VAL L C   1 
ATOM 10569 O O   . VAL L 1 44  ? 97.900  85.030  91.430  1.00 36.62 ? 44  VAL L O   1 
ATOM 10570 C CB  . VAL L 1 44  ? 97.757  82.854  93.876  1.00 36.45 ? 44  VAL L CB  1 
ATOM 10571 C CG1 . VAL L 1 44  ? 97.096  82.279  92.624  1.00 36.57 ? 44  VAL L CG1 1 
ATOM 10572 C CG2 . VAL L 1 44  ? 98.670  81.810  94.516  1.00 36.45 ? 44  VAL L CG2 1 
ATOM 10573 N N   . LYS L 1 45  ? 96.899  85.942  93.233  1.00 36.84 ? 45  LYS L N   1 
ATOM 10574 C CA  . LYS L 1 45  ? 96.095  86.898  92.458  1.00 37.12 ? 45  LYS L CA  1 
ATOM 10575 C C   . LYS L 1 45  ? 96.960  87.941  91.752  1.00 37.00 ? 45  LYS L C   1 
ATOM 10576 O O   . LYS L 1 45  ? 96.800  88.171  90.553  1.00 37.15 ? 45  LYS L O   1 
ATOM 10577 C CB  . LYS L 1 45  ? 95.056  87.595  93.347  1.00 37.49 ? 45  LYS L CB  1 
ATOM 10578 C CG  . LYS L 1 45  ? 93.962  86.672  93.863  1.00 37.82 ? 45  LYS L CG  1 
ATOM 10579 C CD  . LYS L 1 45  ? 93.196  87.293  95.022  1.00 38.10 ? 45  LYS L CD  1 
ATOM 10580 C CE  . LYS L 1 45  ? 92.222  86.299  95.637  1.00 38.33 ? 45  LYS L CE  1 
ATOM 10581 N NZ  . LYS L 1 45  ? 91.554  86.834  96.856  1.00 38.49 ? 45  LYS L NZ  1 
ATOM 10582 N N   . PHE L 1 46  ? 97.874  88.560  92.496  1.00 36.90 ? 46  PHE L N   1 
ATOM 10583 C CA  . PHE L 1 46  ? 98.777  89.573  91.930  1.00 36.84 ? 46  PHE L CA  1 
ATOM 10584 C C   . PHE L 1 46  ? 99.861  89.001  91.006  1.00 36.81 ? 46  PHE L C   1 
ATOM 10585 O O   . PHE L 1 46  ? 100.459 89.749  90.229  1.00 36.96 ? 46  PHE L O   1 
ATOM 10586 C CB  . PHE L 1 46  ? 99.397  90.434  93.038  1.00 36.83 ? 46  PHE L CB  1 
ATOM 10587 C CG  . PHE L 1 46  ? 98.435  91.422  93.633  1.00 36.90 ? 46  PHE L CG  1 
ATOM 10588 C CD1 . PHE L 1 46  ? 98.139  92.604  92.965  1.00 37.06 ? 46  PHE L CD1 1 
ATOM 10589 C CD2 . PHE L 1 46  ? 97.808  91.166  94.847  1.00 36.99 ? 46  PHE L CD2 1 
ATOM 10590 C CE1 . PHE L 1 46  ? 97.243  93.518  93.500  1.00 37.14 ? 46  PHE L CE1 1 
ATOM 10591 C CE2 . PHE L 1 46  ? 96.912  92.077  95.390  1.00 37.16 ? 46  PHE L CE2 1 
ATOM 10592 C CZ  . PHE L 1 46  ? 96.627  93.255  94.714  1.00 37.19 ? 46  PHE L CZ  1 
ATOM 10593 N N   . GLN L 1 47  ? 100.118 87.694  91.093  1.00 36.77 ? 47  GLN L N   1 
ATOM 10594 C CA  . GLN L 1 47  ? 100.936 86.995  90.092  1.00 36.82 ? 47  GLN L CA  1 
ATOM 10595 C C   . GLN L 1 47  ? 100.207 86.909  88.748  1.00 37.07 ? 47  GLN L C   1 
ATOM 10596 O O   . GLN L 1 47  ? 100.826 87.082  87.696  1.00 37.28 ? 47  GLN L O   1 
ATOM 10597 C CB  . GLN L 1 47  ? 101.329 85.588  90.568  1.00 36.79 ? 47  GLN L CB  1 
ATOM 10598 C CG  . GLN L 1 47  ? 102.460 85.565  91.588  1.00 36.85 ? 47  GLN L CG  1 
ATOM 10599 C CD  . GLN L 1 47  ? 103.843 85.590  90.957  1.00 36.98 ? 47  GLN L CD  1 
ATOM 10600 O OE1 . GLN L 1 47  ? 104.064 86.235  89.931  1.00 37.07 ? 47  GLN L OE1 1 
ATOM 10601 N NE2 . GLN L 1 47  ? 104.786 84.890  91.578  1.00 37.07 ? 47  GLN L NE2 1 
ATOM 10602 N N   . GLU L 1 48  ? 98.902  86.637  88.790  1.00 37.41 ? 48  GLU L N   1 
ATOM 10603 C CA  . GLU L 1 48  ? 98.060  86.626  87.585  1.00 37.74 ? 48  GLU L CA  1 
ATOM 10604 C C   . GLU L 1 48  ? 97.869  88.023  86.986  1.00 37.83 ? 48  GLU L C   1 
ATOM 10605 O O   . GLU L 1 48  ? 97.729  88.157  85.771  1.00 38.01 ? 48  GLU L O   1 
ATOM 10606 C CB  . GLU L 1 48  ? 96.691  85.993  87.872  1.00 38.07 ? 48  GLU L CB  1 
ATOM 10607 C CG  . GLU L 1 48  ? 96.734  84.507  88.212  1.00 38.39 ? 48  GLU L CG  1 
ATOM 10608 C CD  . GLU L 1 48  ? 97.069  83.621  87.020  1.00 38.68 ? 48  GLU L CD  1 
ATOM 10609 O OE1 . GLU L 1 48  ? 96.467  83.804  85.939  1.00 38.76 ? 48  GLU L OE1 1 
ATOM 10610 O OE2 . GLU L 1 48  ? 97.929  82.726  87.169  1.00 38.77 ? 48  GLU L OE2 1 
ATOM 10611 N N   . MET L 1 49  ? 97.851  89.054  87.833  1.00 37.94 ? 49  MET L N   1 
ATOM 10612 C CA  . MET L 1 49  ? 97.773  90.446  87.365  1.00 38.06 ? 49  MET L CA  1 
ATOM 10613 C C   . MET L 1 49  ? 99.059  90.904  86.670  1.00 37.98 ? 49  MET L C   1 
ATOM 10614 O O   . MET L 1 49  ? 99.001  91.676  85.711  1.00 38.26 ? 49  MET L O   1 
ATOM 10615 C CB  . MET L 1 49  ? 97.436  91.394  88.519  1.00 38.24 ? 49  MET L CB  1 
ATOM 10616 C CG  . MET L 1 49  ? 96.011  91.241  89.023  1.00 38.47 ? 49  MET L CG  1 
ATOM 10617 S SD  . MET L 1 49  ? 95.647  92.226  90.488  1.00 38.86 ? 49  MET L SD  1 
ATOM 10618 C CE  . MET L 1 49  ? 95.879  93.882  89.849  1.00 38.96 ? 49  MET L CE  1 
ATOM 10619 N N   . TYR L 1 50  ? 100.207 90.437  87.158  1.00 37.79 ? 50  TYR L N   1 
ATOM 10620 C CA  . TYR L 1 50  ? 101.494 90.691  86.501  1.00 37.80 ? 50  TYR L CA  1 
ATOM 10621 C C   . TYR L 1 50  ? 101.615 89.916  85.182  1.00 38.04 ? 50  TYR L C   1 
ATOM 10622 O O   . TYR L 1 50  ? 102.266 90.384  84.245  1.00 38.25 ? 50  TYR L O   1 
ATOM 10623 C CB  . TYR L 1 50  ? 102.655 90.328  87.431  1.00 37.76 ? 50  TYR L CB  1 
ATOM 10624 C CG  . TYR L 1 50  ? 103.986 90.918  87.021  1.00 37.79 ? 50  TYR L CG  1 
ATOM 10625 C CD1 . TYR L 1 50  ? 104.841 90.234  86.157  1.00 37.66 ? 50  TYR L CD1 1 
ATOM 10626 C CD2 . TYR L 1 50  ? 104.402 92.156  87.513  1.00 37.87 ? 50  TYR L CD2 1 
ATOM 10627 C CE1 . TYR L 1 50  ? 106.067 90.770  85.786  1.00 37.67 ? 50  TYR L CE1 1 
ATOM 10628 C CE2 . TYR L 1 50  ? 105.626 92.700  87.147  1.00 37.85 ? 50  TYR L CE2 1 
ATOM 10629 C CZ  . TYR L 1 50  ? 106.456 92.003  86.285  1.00 37.80 ? 50  TYR L CZ  1 
ATOM 10630 O OH  . TYR L 1 50  ? 107.669 92.538  85.917  1.00 37.98 ? 50  TYR L OH  1 
ATOM 10631 N N   . GLN L 1 51  ? 101.000 88.735  85.126  1.00 38.31 ? 51  GLN L N   1 
ATOM 10632 C CA  . GLN L 1 51  ? 100.921 87.932  83.898  1.00 38.55 ? 51  GLN L CA  1 
ATOM 10633 C C   . GLN L 1 51  ? 100.116 88.631  82.793  1.00 38.78 ? 51  GLN L C   1 
ATOM 10634 O O   . GLN L 1 51  ? 100.412 88.457  81.610  1.00 38.94 ? 51  GLN L O   1 
ATOM 10635 C CB  . GLN L 1 51  ? 100.317 86.552  84.206  1.00 38.73 ? 51  GLN L CB  1 
ATOM 10636 C CG  . GLN L 1 51  ? 100.367 85.532  83.073  1.00 38.88 ? 51  GLN L CG  1 
ATOM 10637 C CD  . GLN L 1 51  ? 101.772 85.072  82.734  1.00 38.88 ? 51  GLN L CD  1 
ATOM 10638 O OE1 . GLN L 1 51  ? 102.559 84.739  83.619  1.00 38.93 ? 51  GLN L OE1 1 
ATOM 10639 N NE2 . GLN L 1 51  ? 102.086 85.030  81.446  1.00 38.97 ? 51  GLN L NE2 1 
ATOM 10640 N N   . ILE L 1 52  ? 99.101  89.406  83.178  1.00 38.96 ? 52  ILE L N   1 
ATOM 10641 C CA  . ILE L 1 52  ? 98.326  90.219  82.229  1.00 39.19 ? 52  ILE L CA  1 
ATOM 10642 C C   . ILE L 1 52  ? 99.188  91.340  81.632  1.00 39.35 ? 52  ILE L C   1 
ATOM 10643 O O   . ILE L 1 52  ? 99.131  91.592  80.426  1.00 39.50 ? 52  ILE L O   1 
ATOM 10644 C CB  . ILE L 1 52  ? 97.047  90.806  82.885  1.00 39.24 ? 52  ILE L CB  1 
ATOM 10645 C CG1 . ILE L 1 52  ? 96.066  89.678  83.235  1.00 39.33 ? 52  ILE L CG1 1 
ATOM 10646 C CG2 . ILE L 1 52  ? 96.353  91.814  81.967  1.00 39.29 ? 52  ILE L CG2 1 
ATOM 10647 C CD1 . ILE L 1 52  ? 95.062  90.032  84.314  1.00 39.33 ? 52  ILE L CD1 1 
ATOM 10648 N N   . ASP L 1 53  ? 99.986  91.995  82.476  1.00 39.54 ? 53  ASP L N   1 
ATOM 10649 C CA  . ASP L 1 53  ? 100.815 93.127  82.050  1.00 39.77 ? 53  ASP L CA  1 
ATOM 10650 C C   . ASP L 1 53  ? 102.047 92.686  81.263  1.00 39.75 ? 53  ASP L C   1 
ATOM 10651 O O   . ASP L 1 53  ? 102.215 93.066  80.102  1.00 39.95 ? 53  ASP L O   1 
ATOM 10652 C CB  . ASP L 1 53  ? 101.252 93.959  83.262  1.00 40.03 ? 53  ASP L CB  1 
ATOM 10653 C CG  . ASP L 1 53  ? 100.081 94.597  83.994  1.00 40.34 ? 53  ASP L CG  1 
ATOM 10654 O OD1 . ASP L 1 53  ? 98.925  94.179  83.769  1.00 40.49 ? 53  ASP L OD1 1 
ATOM 10655 O OD2 . ASP L 1 53  ? 100.320 95.519  84.803  1.00 40.58 ? 53  ASP L OD2 1 
ATOM 10656 N N   . ASN L 1 54  ? 102.892 91.875  81.899  1.00 39.52 ? 54  ASN L N   1 
ATOM 10657 C CA  . ASN L 1 54  ? 104.227 91.547  81.378  1.00 39.56 ? 54  ASN L CA  1 
ATOM 10658 C C   . ASN L 1 54  ? 104.341 90.214  80.622  1.00 39.43 ? 54  ASN L C   1 
ATOM 10659 O O   . ASN L 1 54  ? 105.377 89.959  80.002  1.00 39.61 ? 54  ASN L O   1 
ATOM 10660 C CB  . ASN L 1 54  ? 105.243 91.555  82.525  1.00 39.76 ? 54  ASN L CB  1 
ATOM 10661 C CG  . ASN L 1 54  ? 105.388 92.921  83.171  1.00 39.96 ? 54  ASN L CG  1 
ATOM 10662 O OD1 . ASN L 1 54  ? 106.344 93.648  82.903  1.00 40.17 ? 54  ASN L OD1 1 
ATOM 10663 N ND2 . ASN L 1 54  ? 104.437 93.276  84.028  1.00 40.00 ? 54  ASN L ND2 1 
ATOM 10664 N N   . ASN L 1 55  ? 103.300 89.378  80.673  1.00 39.07 ? 55  ASN L N   1 
ATOM 10665 C CA  . ASN L 1 55  ? 103.315 88.022  80.089  1.00 38.83 ? 55  ASN L CA  1 
ATOM 10666 C C   . ASN L 1 55  ? 104.400 87.129  80.714  1.00 38.56 ? 55  ASN L C   1 
ATOM 10667 O O   . ASN L 1 55  ? 105.093 86.387  80.014  1.00 38.71 ? 55  ASN L O   1 
ATOM 10668 C CB  . ASN L 1 55  ? 103.452 88.070  78.556  1.00 39.00 ? 55  ASN L CB  1 
ATOM 10669 C CG  . ASN L 1 55  ? 102.465 89.024  77.905  1.00 39.27 ? 55  ASN L CG  1 
ATOM 10670 O OD1 . ASN L 1 55  ? 102.831 89.812  77.033  1.00 39.50 ? 55  ASN L OD1 1 
ATOM 10671 N ND2 . ASN L 1 55  ? 101.205 88.958  78.326  1.00 39.40 ? 55  ASN L ND2 1 
ATOM 10672 N N   . SER L 1 56  ? 104.525 87.210  82.038  1.00 38.22 ? 56  SER L N   1 
ATOM 10673 C CA  . SER L 1 56  ? 105.481 86.401  82.803  1.00 37.99 ? 56  SER L CA  1 
ATOM 10674 C C   . SER L 1 56  ? 105.117 86.419  84.290  1.00 37.53 ? 56  SER L C   1 
ATOM 10675 O O   . SER L 1 56  ? 104.156 87.079  84.688  1.00 37.69 ? 56  SER L O   1 
ATOM 10676 C CB  . SER L 1 56  ? 106.906 86.929  82.608  1.00 38.25 ? 56  SER L CB  1 
ATOM 10677 O OG  . SER L 1 56  ? 107.857 86.079  83.227  1.00 38.43 ? 56  SER L OG  1 
ATOM 10678 N N   . TYR L 1 57  ? 105.877 85.679  85.097  1.00 36.99 ? 57  TYR L N   1 
ATOM 10679 C CA  . TYR L 1 57  ? 105.712 85.674  86.555  1.00 36.72 ? 57  TYR L CA  1 
ATOM 10680 C C   . TYR L 1 57  ? 106.922 86.310  87.242  1.00 36.67 ? 57  TYR L C   1 
ATOM 10681 O O   . TYR L 1 57  ? 108.043 86.246  86.733  1.00 36.63 ? 57  TYR L O   1 
ATOM 10682 C CB  . TYR L 1 57  ? 105.493 84.250  87.068  1.00 36.60 ? 57  TYR L CB  1 
ATOM 10683 C CG  . TYR L 1 57  ? 104.146 83.666  86.694  1.00 36.53 ? 57  TYR L CG  1 
ATOM 10684 C CD1 . TYR L 1 57  ? 102.972 84.139  87.284  1.00 36.47 ? 57  TYR L CD1 1 
ATOM 10685 C CD2 . TYR L 1 57  ? 104.040 82.636  85.758  1.00 36.51 ? 57  TYR L CD2 1 
ATOM 10686 C CE1 . TYR L 1 57  ? 101.733 83.608  86.949  1.00 36.34 ? 57  TYR L CE1 1 
ATOM 10687 C CE2 . TYR L 1 57  ? 102.805 82.098  85.418  1.00 36.42 ? 57  TYR L CE2 1 
ATOM 10688 C CZ  . TYR L 1 57  ? 101.656 82.587  86.015  1.00 36.34 ? 57  TYR L CZ  1 
ATOM 10689 O OH  . TYR L 1 57  ? 100.430 82.060  85.683  1.00 36.45 ? 57  TYR L OH  1 
ATOM 10690 N N   . THR L 1 58  ? 106.676 86.912  88.404  1.00 36.59 ? 58  THR L N   1 
ATOM 10691 C CA  . THR L 1 58  ? 107.680 87.699  89.118  1.00 36.53 ? 58  THR L CA  1 
ATOM 10692 C C   . THR L 1 58  ? 108.564 86.839  90.012  1.00 36.66 ? 58  THR L C   1 
ATOM 10693 O O   . THR L 1 58  ? 108.063 85.999  90.762  1.00 36.84 ? 58  THR L O   1 
ATOM 10694 C CB  . THR L 1 58  ? 107.015 88.756  90.018  1.00 36.65 ? 58  THR L CB  1 
ATOM 10695 O OG1 . THR L 1 58  ? 106.107 88.116  90.924  1.00 36.58 ? 58  THR L OG1 1 
ATOM 10696 C CG2 . THR L 1 58  ? 106.256 89.758  89.183  1.00 36.74 ? 58  THR L CG2 1 
ATOM 10697 N N   . SER L 1 59  ? 109.873 87.068  89.934  1.00 36.78 ? 59  SER L N   1 
ATOM 10698 C CA  . SER L 1 59  ? 110.830 86.483  90.871  1.00 36.85 ? 59  SER L CA  1 
ATOM 10699 C C   . SER L 1 59  ? 110.887 87.325  92.147  1.00 36.82 ? 59  SER L C   1 
ATOM 10700 O O   . SER L 1 59  ? 110.875 86.778  93.249  1.00 36.81 ? 59  SER L O   1 
ATOM 10701 C CB  . SER L 1 59  ? 112.219 86.393  90.235  1.00 37.11 ? 59  SER L CB  1 
ATOM 10702 O OG  . SER L 1 59  ? 113.108 85.647  91.049  1.00 37.24 ? 59  SER L OG  1 
ATOM 10703 N N   . ASN L 1 60  ? 110.954 88.648  91.988  1.00 36.97 ? 60  ASN L N   1 
ATOM 10704 C CA  . ASN L 1 60  ? 111.014 89.579  93.127  1.00 37.22 ? 60  ASN L CA  1 
ATOM 10705 C C   . ASN L 1 60  ? 109.628 89.898  93.702  1.00 37.20 ? 60  ASN L C   1 
ATOM 10706 O O   . ASN L 1 60  ? 108.624 89.873  92.986  1.00 37.13 ? 60  ASN L O   1 
ATOM 10707 C CB  . ASN L 1 60  ? 111.747 90.878  92.743  1.00 37.35 ? 60  ASN L CB  1 
ATOM 10708 C CG  . ASN L 1 60  ? 110.967 91.737  91.759  1.00 37.43 ? 60  ASN L CG  1 
ATOM 10709 O OD1 . ASN L 1 60  ? 110.283 91.226  90.870  1.00 37.43 ? 60  ASN L OD1 1 
ATOM 10710 N ND2 . ASN L 1 60  ? 111.081 93.052  91.908  1.00 37.57 ? 60  ASN L ND2 1 
ATOM 10711 N N   . GLN L 1 61  ? 109.596 90.204  94.998  1.00 37.16 ? 61  GLN L N   1 
ATOM 10712 C CA  . GLN L 1 61  ? 108.358 90.539  95.707  1.00 37.02 ? 61  GLN L CA  1 
ATOM 10713 C C   . GLN L 1 61  ? 107.901 91.973  95.431  1.00 36.99 ? 61  GLN L C   1 
ATOM 10714 O O   . GLN L 1 61  ? 106.698 92.237  95.378  1.00 37.14 ? 61  GLN L O   1 
ATOM 10715 C CB  . GLN L 1 61  ? 108.540 90.339  97.216  1.00 37.12 ? 61  GLN L CB  1 
ATOM 10716 C CG  . GLN L 1 61  ? 107.239 90.316  98.009  1.00 37.21 ? 61  GLN L CG  1 
ATOM 10717 C CD  . GLN L 1 61  ? 107.457 90.283  99.510  1.00 37.24 ? 61  GLN L CD  1 
ATOM 10718 O OE1 . GLN L 1 61  ? 108.493 89.824  99.995  1.00 37.27 ? 61  GLN L OE1 1 
ATOM 10719 N NE2 . GLN L 1 61  ? 106.471 90.765  100.258 1.00 37.32 ? 61  GLN L NE2 1 
ATOM 10720 N N   . ALA L 1 62  ? 108.858 92.891  95.271  1.00 36.96 ? 62  ALA L N   1 
ATOM 10721 C CA  . ALA L 1 62  ? 108.570 94.314  95.025  1.00 36.85 ? 62  ALA L CA  1 
ATOM 10722 C C   . ALA L 1 62  ? 107.708 94.578  93.784  1.00 36.78 ? 62  ALA L C   1 
ATOM 10723 O O   . ALA L 1 62  ? 106.968 95.562  93.745  1.00 36.92 ? 62  ALA L O   1 
ATOM 10724 C CB  . ALA L 1 62  ? 109.869 95.104  94.930  1.00 36.91 ? 62  ALA L CB  1 
ATOM 10725 N N   . ALA L 1 63  ? 107.817 93.709  92.778  1.00 36.84 ? 63  ALA L N   1 
ATOM 10726 C CA  . ALA L 1 63  ? 106.963 93.772  91.588  1.00 36.91 ? 63  ALA L CA  1 
ATOM 10727 C C   . ALA L 1 63  ? 105.495 93.503  91.922  1.00 36.82 ? 63  ALA L C   1 
ATOM 10728 O O   . ALA L 1 63  ? 104.610 94.191  91.415  1.00 36.91 ? 63  ALA L O   1 
ATOM 10729 C CB  . ALA L 1 63  ? 107.450 92.794  90.529  1.00 37.01 ? 63  ALA L CB  1 
ATOM 10730 N N   . LEU L 1 64  ? 105.247 92.507  92.774  1.00 36.89 ? 64  LEU L N   1 
ATOM 10731 C CA  . LEU L 1 64  ? 103.888 92.182  93.230  1.00 37.01 ? 64  LEU L CA  1 
ATOM 10732 C C   . LEU L 1 64  ? 103.300 93.266  94.138  1.00 37.02 ? 64  LEU L C   1 
ATOM 10733 O O   . LEU L 1 64  ? 102.098 93.533  94.083  1.00 37.07 ? 64  LEU L O   1 
ATOM 10734 C CB  . LEU L 1 64  ? 103.862 90.836  93.964  1.00 37.12 ? 64  LEU L CB  1 
ATOM 10735 C CG  . LEU L 1 64  ? 104.282 89.593  93.174  1.00 37.29 ? 64  LEU L CG  1 
ATOM 10736 C CD1 . LEU L 1 64  ? 104.358 88.383  94.093  1.00 37.40 ? 64  LEU L CD1 1 
ATOM 10737 C CD2 . LEU L 1 64  ? 103.331 89.329  92.016  1.00 37.32 ? 64  LEU L CD2 1 
ATOM 10738 N N   . ILE L 1 65  ? 104.149 93.879  94.966  1.00 37.10 ? 65  ILE L N   1 
ATOM 10739 C CA  . ILE L 1 65  ? 103.725 94.949  95.881  1.00 37.16 ? 65  ILE L CA  1 
ATOM 10740 C C   . ILE L 1 65  ? 103.367 96.228  95.110  1.00 37.20 ? 65  ILE L C   1 
ATOM 10741 O O   . ILE L 1 65  ? 102.425 96.932  95.485  1.00 37.29 ? 65  ILE L O   1 
ATOM 10742 C CB  . ILE L 1 65  ? 104.801 95.246  96.961  1.00 37.23 ? 65  ILE L CB  1 
ATOM 10743 C CG1 . ILE L 1 65  ? 105.028 94.012  97.849  1.00 37.33 ? 65  ILE L CG1 1 
ATOM 10744 C CG2 . ILE L 1 65  ? 104.399 96.434  97.836  1.00 37.26 ? 65  ILE L CG2 1 
ATOM 10745 C CD1 . ILE L 1 65  ? 106.308 94.053  98.658  1.00 37.48 ? 65  ILE L CD1 1 
ATOM 10746 N N   . SER L 1 66  ? 104.113 96.519  94.044  1.00 37.26 ? 66  SER L N   1 
ATOM 10747 C CA  . SER L 1 66  ? 103.848 97.686  93.191  1.00 37.39 ? 66  SER L CA  1 
ATOM 10748 C C   . SER L 1 66  ? 102.478 97.628  92.503  1.00 37.52 ? 66  SER L C   1 
ATOM 10749 O O   . SER L 1 66  ? 101.822 98.660  92.343  1.00 37.55 ? 66  SER L O   1 
ATOM 10750 C CB  . SER L 1 66  ? 104.950 97.840  92.136  1.00 37.37 ? 66  SER L CB  1 
ATOM 10751 O OG  . SER L 1 66  ? 104.814 99.058  91.423  1.00 37.36 ? 66  SER L OG  1 
ATOM 10752 N N   . LEU L 1 67  ? 102.059 96.428  92.100  1.00 37.78 ? 67  LEU L N   1 
ATOM 10753 C CA  . LEU L 1 67  ? 100.732 96.222  91.494  1.00 38.04 ? 67  LEU L CA  1 
ATOM 10754 C C   . LEU L 1 67  ? 99.567  96.448  92.469  1.00 38.13 ? 67  LEU L C   1 
ATOM 10755 O O   . LEU L 1 67  ? 98.494  96.886  92.047  1.00 38.34 ? 67  LEU L O   1 
ATOM 10756 C CB  . LEU L 1 67  ? 100.615 94.828  90.851  1.00 38.16 ? 67  LEU L CB  1 
ATOM 10757 C CG  . LEU L 1 67  ? 100.953 94.741  89.358  1.00 38.40 ? 67  LEU L CG  1 
ATOM 10758 C CD1 . LEU L 1 67  ? 102.407 95.084  89.066  1.00 38.45 ? 67  LEU L CD1 1 
ATOM 10759 C CD2 . LEU L 1 67  ? 100.623 93.352  88.833  1.00 38.59 ? 67  LEU L CD2 1 
ATOM 10760 N N   . GLY L 1 68  ? 99.779  96.158  93.755  1.00 37.98 ? 68  GLY L N   1 
ATOM 10761 C CA  . GLY L 1 68  ? 98.722  96.300  94.766  1.00 37.88 ? 68  GLY L CA  1 
ATOM 10762 C C   . GLY L 1 68  ? 98.813  95.434  96.015  1.00 37.72 ? 68  GLY L C   1 
ATOM 10763 O O   . GLY L 1 68  ? 98.190  95.766  97.027  1.00 37.88 ? 68  GLY L O   1 
ATOM 10764 N N   . LEU L 1 69  ? 99.550  94.321  95.953  1.00 37.46 ? 69  LEU L N   1 
ATOM 10765 C CA  . LEU L 1 69  ? 99.737  93.427  97.109  1.00 37.38 ? 69  LEU L CA  1 
ATOM 10766 C C   . LEU L 1 69  ? 100.306 94.164  98.324  1.00 37.38 ? 69  LEU L C   1 
ATOM 10767 O O   . LEU L 1 69  ? 101.106 95.092  98.180  1.00 37.44 ? 69  LEU L O   1 
ATOM 10768 C CB  . LEU L 1 69  ? 100.665 92.258  96.745  1.00 37.38 ? 69  LEU L CB  1 
ATOM 10769 C CG  . LEU L 1 69  ? 100.878 91.134  97.768  1.00 37.33 ? 69  LEU L CG  1 
ATOM 10770 C CD1 . LEU L 1 69  ? 99.593  90.368  98.048  1.00 37.36 ? 69  LEU L CD1 1 
ATOM 10771 C CD2 . LEU L 1 69  ? 101.960 90.182  97.281  1.00 37.37 ? 69  LEU L CD2 1 
ATOM 10772 N N   . LYS L 1 70  ? 99.886  93.740  99.515  1.00 37.37 ? 70  LYS L N   1 
ATOM 10773 C CA  . LYS L 1 70  ? 100.347 94.342  100.768 1.00 37.30 ? 70  LYS L CA  1 
ATOM 10774 C C   . LYS L 1 70  ? 101.777 93.918  101.092 1.00 37.09 ? 70  LYS L C   1 
ATOM 10775 O O   . LYS L 1 70  ? 102.320 92.997  100.475 1.00 37.05 ? 70  LYS L O   1 
ATOM 10776 C CB  . LYS L 1 70  ? 99.426  93.948  101.929 1.00 37.51 ? 70  LYS L CB  1 
ATOM 10777 C CG  . LYS L 1 70  ? 97.987  94.415  101.779 1.00 37.82 ? 70  LYS L CG  1 
ATOM 10778 C CD  . LYS L 1 70  ? 97.191  94.148  103.048 1.00 38.07 ? 70  LYS L CD  1 
ATOM 10779 C CE  . LYS L 1 70  ? 95.756  94.641  102.931 1.00 38.26 ? 70  LYS L CE  1 
ATOM 10780 N NZ  . LYS L 1 70  ? 94.968  93.882  101.919 1.00 38.34 ? 70  LYS L NZ  1 
ATOM 10781 N N   . SER L 1 71  ? 102.377 94.599  102.066 1.00 36.84 ? 71  SER L N   1 
ATOM 10782 C CA  . SER L 1 71  ? 103.696 94.223  102.582 1.00 36.56 ? 71  SER L CA  1 
ATOM 10783 C C   . SER L 1 71  ? 103.607 92.895  103.330 1.00 36.24 ? 71  SER L C   1 
ATOM 10784 O O   . SER L 1 71  ? 102.519 92.478  103.741 1.00 36.23 ? 71  SER L O   1 
ATOM 10785 C CB  . SER L 1 71  ? 104.241 95.310  103.511 1.00 36.59 ? 71  SER L CB  1 
ATOM 10786 O OG  . SER L 1 71  ? 104.352 96.551  102.836 1.00 36.60 ? 71  SER L OG  1 
ATOM 10787 N N   . THR L 1 72  ? 104.752 92.235  103.502 1.00 35.94 ? 72  THR L N   1 
ATOM 10788 C CA  . THR L 1 72  ? 104.811 90.938  104.180 1.00 35.78 ? 72  THR L CA  1 
ATOM 10789 C C   . THR L 1 72  ? 104.268 91.070  105.611 1.00 35.65 ? 72  THR L C   1 
ATOM 10790 O O   . THR L 1 72  ? 104.629 92.023  106.307 1.00 35.81 ? 72  THR L O   1 
ATOM 10791 C CB  . THR L 1 72  ? 106.251 90.389  104.236 1.00 35.87 ? 72  THR L CB  1 
ATOM 10792 O OG1 . THR L 1 72  ? 106.844 90.456  102.933 1.00 35.93 ? 72  THR L OG1 1 
ATOM 10793 C CG2 . THR L 1 72  ? 106.267 88.941  104.720 1.00 35.94 ? 72  THR L CG2 1 
ATOM 10794 N N   . PRO L 1 73  ? 103.395 90.133  106.052 1.00 35.35 ? 73  PRO L N   1 
ATOM 10795 C CA  . PRO L 1 73  ? 102.820 90.272  107.400 1.00 35.35 ? 73  PRO L CA  1 
ATOM 10796 C C   . PRO L 1 73  ? 103.832 90.076  108.532 1.00 35.42 ? 73  PRO L C   1 
ATOM 10797 O O   . PRO L 1 73  ? 104.935 89.573  108.304 1.00 35.51 ? 73  PRO L O   1 
ATOM 10798 C CB  . PRO L 1 73  ? 101.742 89.176  107.454 1.00 35.35 ? 73  PRO L CB  1 
ATOM 10799 C CG  . PRO L 1 73  ? 101.571 88.695  106.056 1.00 35.32 ? 73  PRO L CG  1 
ATOM 10800 C CD  . PRO L 1 73  ? 102.875 88.934  105.370 1.00 35.28 ? 73  PRO L CD  1 
ATOM 10801 N N   . ALA L 1 74  ? 103.440 90.477  109.739 1.00 35.52 ? 74  ALA L N   1 
ATOM 10802 C CA  . ALA L 1 74  ? 104.308 90.387  110.915 1.00 35.57 ? 74  ALA L CA  1 
ATOM 10803 C C   . ALA L 1 74  ? 104.563 88.927  111.283 1.00 35.42 ? 74  ALA L C   1 
ATOM 10804 O O   . ALA L 1 74  ? 103.623 88.133  111.362 1.00 35.50 ? 74  ALA L O   1 
ATOM 10805 C CB  . ALA L 1 74  ? 103.692 91.129  112.091 1.00 35.68 ? 74  ALA L CB  1 
ATOM 10806 N N   . ASN L 1 75  ? 105.838 88.593  111.495 1.00 35.20 ? 75  ASN L N   1 
ATOM 10807 C CA  . ASN L 1 75  ? 106.283 87.229  111.811 1.00 35.04 ? 75  ASN L CA  1 
ATOM 10808 C C   . ASN L 1 75  ? 105.936 86.215  110.708 1.00 34.83 ? 75  ASN L C   1 
ATOM 10809 O O   . ASN L 1 75  ? 105.538 85.083  110.998 1.00 34.81 ? 75  ASN L O   1 
ATOM 10810 C CB  . ASN L 1 75  ? 105.727 86.772  113.172 1.00 35.14 ? 75  ASN L CB  1 
ATOM 10811 C CG  . ASN L 1 75  ? 105.958 87.789  114.276 1.00 35.37 ? 75  ASN L CG  1 
ATOM 10812 O OD1 . ASN L 1 75  ? 106.956 88.513  114.276 1.00 35.52 ? 75  ASN L OD1 1 
ATOM 10813 N ND2 . ASN L 1 75  ? 105.034 87.844  115.229 1.00 35.47 ? 75  ASN L ND2 1 
ATOM 10814 N N   . VAL L 1 76  ? 106.092 86.637  109.451 1.00 34.65 ? 76  VAL L N   1 
ATOM 10815 C CA  . VAL L 1 76  ? 105.872 85.781  108.277 1.00 34.49 ? 76  VAL L CA  1 
ATOM 10816 C C   . VAL L 1 76  ? 107.067 85.917  107.335 1.00 34.47 ? 76  VAL L C   1 
ATOM 10817 O O   . VAL L 1 76  ? 107.527 87.029  107.063 1.00 34.47 ? 76  VAL L O   1 
ATOM 10818 C CB  . VAL L 1 76  ? 104.570 86.153  107.531 1.00 34.35 ? 76  VAL L CB  1 
ATOM 10819 C CG1 . VAL L 1 76  ? 104.416 85.342  106.244 1.00 34.32 ? 76  VAL L CG1 1 
ATOM 10820 C CG2 . VAL L 1 76  ? 103.364 85.942  108.434 1.00 34.40 ? 76  VAL L CG2 1 
ATOM 10821 N N   . THR L 1 77  ? 107.554 84.778  106.840 1.00 34.42 ? 77  THR L N   1 
ATOM 10822 C CA  . THR L 1 77  ? 108.715 84.721  105.952 1.00 34.40 ? 77  THR L CA  1 
ATOM 10823 C C   . THR L 1 77  ? 108.293 84.303  104.545 1.00 34.33 ? 77  THR L C   1 
ATOM 10824 O O   . THR L 1 77  ? 108.440 83.142  104.153 1.00 34.35 ? 77  THR L O   1 
ATOM 10825 C CB  . THR L 1 77  ? 109.775 83.742  106.493 1.00 34.48 ? 77  THR L CB  1 
ATOM 10826 O OG1 . THR L 1 77  ? 109.175 82.464  106.730 1.00 34.42 ? 77  THR L OG1 1 
ATOM 10827 C CG2 . THR L 1 77  ? 110.369 84.266  107.792 1.00 34.60 ? 77  THR L CG2 1 
ATOM 10828 N N   . PHE L 1 78  ? 107.756 85.266  103.800 1.00 34.32 ? 78  PHE L N   1 
ATOM 10829 C CA  . PHE L 1 78  ? 107.393 85.071  102.396 1.00 34.26 ? 78  PHE L CA  1 
ATOM 10830 C C   . PHE L 1 78  ? 108.658 85.080  101.540 1.00 34.03 ? 78  PHE L C   1 
ATOM 10831 O O   . PHE L 1 78  ? 109.558 85.893  101.766 1.00 34.15 ? 78  PHE L O   1 
ATOM 10832 C CB  . PHE L 1 78  ? 106.433 86.176  101.934 1.00 34.49 ? 78  PHE L CB  1 
ATOM 10833 C CG  . PHE L 1 78  ? 106.000 86.052  100.499 1.00 34.68 ? 78  PHE L CG  1 
ATOM 10834 C CD1 . PHE L 1 78  ? 104.959 85.201  100.143 1.00 34.79 ? 78  PHE L CD1 1 
ATOM 10835 C CD2 . PHE L 1 78  ? 106.626 86.796  99.501  1.00 34.80 ? 78  PHE L CD2 1 
ATOM 10836 C CE1 . PHE L 1 78  ? 104.555 85.088  98.819  1.00 34.94 ? 78  PHE L CE1 1 
ATOM 10837 C CE2 . PHE L 1 78  ? 106.227 86.687  98.176  1.00 34.93 ? 78  PHE L CE2 1 
ATOM 10838 C CZ  . PHE L 1 78  ? 105.190 85.833  97.834  1.00 34.99 ? 78  PHE L CZ  1 
ATOM 10839 N N   . SER L 1 79  ? 108.717 84.176  100.564 1.00 33.69 ? 79  SER L N   1 
ATOM 10840 C CA  . SER L 1 79  ? 109.895 84.033  99.706  1.00 33.53 ? 79  SER L CA  1 
ATOM 10841 C C   . SER L 1 79  ? 109.561 83.260  98.430  1.00 33.30 ? 79  SER L C   1 
ATOM 10842 O O   . SER L 1 79  ? 109.231 82.074  98.488  1.00 33.36 ? 79  SER L O   1 
ATOM 10843 C CB  . SER L 1 79  ? 111.013 83.316  100.468 1.00 33.61 ? 79  SER L CB  1 
ATOM 10844 O OG  . SER L 1 79  ? 112.164 83.137  99.659  1.00 33.71 ? 79  SER L OG  1 
ATOM 10845 N N   . ILE L 1 80  ? 109.659 83.935  97.285  1.00 33.07 ? 80  ILE L N   1 
ATOM 10846 C CA  . ILE L 1 80  ? 109.409 83.311  95.986  1.00 32.89 ? 80  ILE L CA  1 
ATOM 10847 C C   . ILE L 1 80  ? 110.659 82.526  95.585  1.00 32.77 ? 80  ILE L C   1 
ATOM 10848 O O   . ILE L 1 80  ? 111.749 83.093  95.500  1.00 32.79 ? 80  ILE L O   1 
ATOM 10849 C CB  . ILE L 1 80  ? 109.066 84.354  94.896  1.00 32.91 ? 80  ILE L CB  1 
ATOM 10850 C CG1 . ILE L 1 80  ? 107.810 85.150  95.286  1.00 32.96 ? 80  ILE L CG1 1 
ATOM 10851 C CG2 . ILE L 1 80  ? 108.868 83.674  93.539  1.00 32.94 ? 80  ILE L CG2 1 
ATOM 10852 C CD1 . ILE L 1 80  ? 107.571 86.397  94.460  1.00 33.00 ? 80  ILE L CD1 1 
ATOM 10853 N N   . VAL L 1 81  ? 110.488 81.225  95.347  1.00 32.73 ? 81  VAL L N   1 
ATOM 10854 C CA  . VAL L 1 81  ? 111.595 80.332  94.993  1.00 32.76 ? 81  VAL L CA  1 
ATOM 10855 C C   . VAL L 1 81  ? 112.061 80.616  93.570  1.00 32.87 ? 81  VAL L C   1 
ATOM 10856 O O   . VAL L 1 81  ? 113.230 80.936  93.341  1.00 32.99 ? 81  VAL L O   1 
ATOM 10857 C CB  . VAL L 1 81  ? 111.185 78.845  95.126  1.00 32.81 ? 81  VAL L CB  1 
ATOM 10858 C CG1 . VAL L 1 81  ? 112.242 77.912  94.538  1.00 32.88 ? 81  VAL L CG1 1 
ATOM 10859 C CG2 . VAL L 1 81  ? 110.923 78.500  96.586  1.00 32.82 ? 81  VAL L CG2 1 
ATOM 10860 N N   . SER L 1 82  ? 111.136 80.486  92.624  1.00 32.95 ? 82  SER L N   1 
ATOM 10861 C CA  . SER L 1 82  ? 111.419 80.703  91.207  1.00 33.10 ? 82  SER L CA  1 
ATOM 10862 C C   . SER L 1 82  ? 110.150 81.074  90.451  1.00 33.16 ? 82  SER L C   1 
ATOM 10863 O O   . SER L 1 82  ? 109.039 80.807  90.916  1.00 33.23 ? 82  SER L O   1 
ATOM 10864 C CB  . SER L 1 82  ? 112.048 79.450  90.593  1.00 33.14 ? 82  SER L CB  1 
ATOM 10865 O OG  . SER L 1 82  ? 111.219 78.315  90.779  1.00 33.18 ? 82  SER L OG  1 
ATOM 10866 N N   . ALA L 1 83  ? 110.329 81.693  89.287  1.00 33.30 ? 83  ALA L N   1 
ATOM 10867 C CA  . ALA L 1 83  ? 109.210 82.143  88.463  1.00 33.46 ? 83  ALA L CA  1 
ATOM 10868 C C   . ALA L 1 83  ? 109.607 82.230  86.992  1.00 33.71 ? 83  ALA L C   1 
ATOM 10869 O O   . ALA L 1 83  ? 110.159 83.238  86.544  1.00 33.85 ? 83  ALA L O   1 
ATOM 10870 C CB  . ALA L 1 83  ? 108.702 83.487  88.960  1.00 33.47 ? 83  ALA L CB  1 
ATOM 10871 N N   . SER L 1 84  ? 109.324 81.160  86.251  1.00 34.04 ? 84  SER L N   1 
ATOM 10872 C CA  . SER L 1 84  ? 109.527 81.128  84.803  1.00 34.33 ? 84  SER L CA  1 
ATOM 10873 C C   . SER L 1 84  ? 108.389 81.871  84.098  1.00 34.53 ? 84  SER L C   1 
ATOM 10874 O O   . SER L 1 84  ? 107.483 82.394  84.751  1.00 34.55 ? 84  SER L O   1 
ATOM 10875 C CB  . SER L 1 84  ? 109.615 79.678  84.312  1.00 34.48 ? 84  SER L CB  1 
ATOM 10876 O OG  . SER L 1 84  ? 108.379 79.000  84.467  1.00 34.54 ? 84  SER L OG  1 
ATOM 10877 N N   . ALA L 1 85  ? 108.445 81.922  82.769  1.00 35.05 ? 85  ALA L N   1 
ATOM 10878 C CA  . ALA L 1 85  ? 107.420 82.593  81.964  1.00 35.50 ? 85  ALA L CA  1 
ATOM 10879 C C   . ALA L 1 85  ? 106.006 82.040  82.184  1.00 35.79 ? 85  ALA L C   1 
ATOM 10880 O O   . ALA L 1 85  ? 105.044 82.810  82.222  1.00 35.91 ? 85  ALA L O   1 
ATOM 10881 C CB  . ALA L 1 85  ? 107.781 82.521  80.486  1.00 35.61 ? 85  ALA L CB  1 
ATOM 10882 N N   . ASN L 1 86  ? 105.892 80.718  82.329  1.00 36.15 ? 86  ASN L N   1 
ATOM 10883 C CA  . ASN L 1 86  ? 104.592 80.040  82.457  1.00 36.49 ? 86  ASN L CA  1 
ATOM 10884 C C   . ASN L 1 86  ? 104.443 79.200  83.740  1.00 36.55 ? 86  ASN L C   1 
ATOM 10885 O O   . ASN L 1 86  ? 103.661 78.245  83.766  1.00 36.63 ? 86  ASN L O   1 
ATOM 10886 C CB  . ASN L 1 86  ? 104.351 79.160  81.222  1.00 36.84 ? 86  ASN L CB  1 
ATOM 10887 C CG  . ASN L 1 86  ? 104.409 79.944  79.922  1.00 37.16 ? 86  ASN L CG  1 
ATOM 10888 O OD1 . ASN L 1 86  ? 105.455 80.475  79.551  1.00 37.25 ? 86  ASN L OD1 1 
ATOM 10889 N ND2 . ASN L 1 86  ? 103.284 80.008  79.218  1.00 37.45 ? 86  ASN L ND2 1 
ATOM 10890 N N   . SER L 1 87  ? 105.173 79.556  84.800  1.00 36.55 ? 87  SER L N   1 
ATOM 10891 C CA  . SER L 1 87  ? 105.037 78.886  86.103  1.00 36.52 ? 87  SER L CA  1 
ATOM 10892 C C   . SER L 1 87  ? 105.614 79.718  87.249  1.00 36.58 ? 87  SER L C   1 
ATOM 10893 O O   . SER L 1 87  ? 106.280 80.732  87.023  1.00 36.60 ? 87  SER L O   1 
ATOM 10894 C CB  . SER L 1 87  ? 105.721 77.514  86.078  1.00 36.53 ? 87  SER L CB  1 
ATOM 10895 O OG  . SER L 1 87  ? 105.453 76.788  87.266  1.00 36.60 ? 87  SER L OG  1 
ATOM 10896 N N   . TYR L 1 88  ? 105.345 79.275  88.477  1.00 36.69 ? 88  TYR L N   1 
ATOM 10897 C CA  . TYR L 1 88  ? 105.919 79.888  89.681  1.00 36.75 ? 88  TYR L CA  1 
ATOM 10898 C C   . TYR L 1 88  ? 105.890 78.948  90.887  1.00 37.06 ? 88  TYR L C   1 
ATOM 10899 O O   . TYR L 1 88  ? 105.160 77.954  90.898  1.00 37.14 ? 88  TYR L O   1 
ATOM 10900 C CB  . TYR L 1 88  ? 105.202 81.202  90.021  1.00 36.59 ? 88  TYR L CB  1 
ATOM 10901 C CG  . TYR L 1 88  ? 103.718 81.066  90.294  1.00 36.51 ? 88  TYR L CG  1 
ATOM 10902 C CD1 . TYR L 1 88  ? 103.245 80.785  91.577  1.00 36.43 ? 88  TYR L CD1 1 
ATOM 10903 C CD2 . TYR L 1 88  ? 102.782 81.232  89.273  1.00 36.53 ? 88  TYR L CD2 1 
ATOM 10904 C CE1 . TYR L 1 88  ? 101.887 80.661  91.833  1.00 36.37 ? 88  TYR L CE1 1 
ATOM 10905 C CE2 . TYR L 1 88  ? 101.421 81.113  89.520  1.00 36.49 ? 88  TYR L CE2 1 
ATOM 10906 C CZ  . TYR L 1 88  ? 100.978 80.827  90.801  1.00 36.40 ? 88  TYR L CZ  1 
ATOM 10907 O OH  . TYR L 1 88  ? 99.632  80.707  91.050  1.00 36.43 ? 88  TYR L OH  1 
ATOM 10908 N N   . CYS L 1 89  ? 106.696 79.281  91.892  1.00 37.62 ? 89  CYS L N   1 
ATOM 10909 C CA  . CYS L 1 89  ? 106.752 78.544  93.157  1.00 38.04 ? 89  CYS L CA  1 
ATOM 10910 C C   . CYS L 1 89  ? 107.024 79.529  94.295  1.00 37.48 ? 89  CYS L C   1 
ATOM 10911 O O   . CYS L 1 89  ? 108.065 80.188  94.306  1.00 37.51 ? 89  CYS L O   1 
ATOM 10912 C CB  . CYS L 1 89  ? 107.847 77.476  93.106  1.00 39.02 ? 89  CYS L CB  1 
ATOM 10913 S SG  . CYS L 1 89  ? 108.042 76.519  94.630  1.00 40.38 ? 89  CYS L SG  1 
ATOM 10914 N N   . MET L 1 90  ? 106.087 79.618  95.241  1.00 36.81 ? 90  MET L N   1 
ATOM 10915 C CA  . MET L 1 90  ? 106.162 80.574  96.348  1.00 36.33 ? 90  MET L CA  1 
ATOM 10916 C C   . MET L 1 90  ? 105.953 79.862  97.685  1.00 35.96 ? 90  MET L C   1 
ATOM 10917 O O   . MET L 1 90  ? 104.849 79.397  97.983  1.00 35.94 ? 90  MET L O   1 
ATOM 10918 C CB  . MET L 1 90  ? 105.113 81.677  96.172  1.00 36.33 ? 90  MET L CB  1 
ATOM 10919 C CG  . MET L 1 90  ? 105.121 82.339  94.802  1.00 36.32 ? 90  MET L CG  1 
ATOM 10920 S SD  . MET L 1 90  ? 104.092 83.818  94.727  1.00 36.31 ? 90  MET L SD  1 
ATOM 10921 C CE  . MET L 1 90  ? 102.464 83.121  94.996  1.00 36.30 ? 90  MET L CE  1 
ATOM 10922 N N   . ILE L 1 91  ? 107.022 79.774  98.478  1.00 35.57 ? 91  ILE L N   1 
ATOM 10923 C CA  . ILE L 1 91  ? 106.968 79.213  99.829  1.00 35.27 ? 91  ILE L CA  1 
ATOM 10924 C C   . ILE L 1 91  ? 106.750 80.349  100.831 1.00 34.97 ? 91  ILE L C   1 
ATOM 10925 O O   . ILE L 1 91  ? 107.316 81.434  100.683 1.00 35.06 ? 91  ILE L O   1 
ATOM 10926 C CB  . ILE L 1 91  ? 108.274 78.461  100.186 1.00 35.34 ? 91  ILE L CB  1 
ATOM 10927 C CG1 . ILE L 1 91  ? 108.601 77.384  99.135  1.00 35.48 ? 91  ILE L CG1 1 
ATOM 10928 C CG2 . ILE L 1 91  ? 108.190 77.853  101.586 1.00 35.37 ? 91  ILE L CG2 1 
ATOM 10929 C CD1 . ILE L 1 91  ? 107.560 76.291  98.983  1.00 35.54 ? 91  ILE L CD1 1 
ATOM 10930 N N   . ALA L 1 92  ? 105.925 80.090  101.844 1.00 34.64 ? 92  ALA L N   1 
ATOM 10931 C CA  . ALA L 1 92  ? 105.679 81.049  102.924 1.00 34.42 ? 92  ALA L CA  1 
ATOM 10932 C C   . ALA L 1 92  ? 105.223 80.335  104.194 1.00 34.21 ? 92  ALA L C   1 
ATOM 10933 O O   . ALA L 1 92  ? 104.600 79.272  104.128 1.00 34.13 ? 92  ALA L O   1 
ATOM 10934 C CB  . ALA L 1 92  ? 104.644 82.078  102.495 1.00 34.49 ? 92  ALA L CB  1 
ATOM 10935 N N   . GLY L 1 93  ? 105.536 80.930  105.342 1.00 34.02 ? 93  GLY L N   1 
ATOM 10936 C CA  . GLY L 1 93  ? 105.201 80.345  106.639 1.00 33.89 ? 93  GLY L CA  1 
ATOM 10937 C C   . GLY L 1 93  ? 105.329 81.321  107.793 1.00 33.77 ? 93  GLY L C   1 
ATOM 10938 O O   . GLY L 1 93  ? 106.115 82.269  107.731 1.00 33.83 ? 93  GLY L O   1 
ATOM 10939 N N   . HIS L 1 94  ? 104.552 81.074  108.846 1.00 33.62 ? 94  HIS L N   1 
ATOM 10940 C CA  . HIS L 1 94  ? 104.578 81.881  110.064 1.00 33.49 ? 94  HIS L CA  1 
ATOM 10941 C C   . HIS L 1 94  ? 105.582 81.257  111.033 1.00 33.50 ? 94  HIS L C   1 
ATOM 10942 O O   . HIS L 1 94  ? 105.799 80.042  111.009 1.00 33.61 ? 94  HIS L O   1 
ATOM 10943 C CB  . HIS L 1 94  ? 103.181 81.929  110.691 1.00 33.42 ? 94  HIS L CB  1 
ATOM 10944 C CG  . HIS L 1 94  ? 102.910 83.169  111.485 1.00 33.39 ? 94  HIS L CG  1 
ATOM 10945 N ND1 . HIS L 1 94  ? 102.181 84.227  110.988 1.00 33.41 ? 94  HIS L ND1 1 
ATOM 10946 C CD2 . HIS L 1 94  ? 103.296 83.530  112.732 1.00 33.38 ? 94  HIS L CD2 1 
ATOM 10947 C CE1 . HIS L 1 94  ? 102.117 85.181  111.900 1.00 33.44 ? 94  HIS L CE1 1 
ATOM 10948 N NE2 . HIS L 1 94  ? 102.783 84.782  112.968 1.00 33.41 ? 94  HIS L NE2 1 
ATOM 10949 N N   . SER L 1 95  ? 106.192 82.085  111.879 1.00 33.42 ? 95  SER L N   1 
ATOM 10950 C CA  . SER L 1 95  ? 107.211 81.619  112.829 1.00 33.30 ? 95  SER L CA  1 
ATOM 10951 C C   . SER L 1 95  ? 106.620 80.686  113.885 1.00 33.15 ? 95  SER L C   1 
ATOM 10952 O O   . SER L 1 95  ? 107.205 79.646  114.193 1.00 33.23 ? 95  SER L O   1 
ATOM 10953 C CB  . SER L 1 95  ? 107.912 82.802  113.503 1.00 33.39 ? 95  SER L CB  1 
ATOM 10954 O OG  . SER L 1 95  ? 106.995 83.588  114.242 1.00 33.47 ? 95  SER L OG  1 
ATOM 10955 N N   . GLY L 1 96  ? 105.465 81.072  114.433 1.00 32.96 ? 96  GLY L N   1 
ATOM 10956 C CA  . GLY L 1 96  ? 104.691 80.224  115.347 1.00 32.84 ? 96  GLY L CA  1 
ATOM 10957 C C   . GLY L 1 96  ? 103.456 79.636  114.689 1.00 32.59 ? 96  GLY L C   1 
ATOM 10958 O O   . GLY L 1 96  ? 102.353 79.734  115.233 1.00 32.56 ? 96  GLY L O   1 
ATOM 10959 N N   . GLY L 1 97  ? 103.647 79.026  113.519 1.00 32.33 ? 97  GLY L N   1 
ATOM 10960 C CA  . GLY L 1 97  ? 102.583 78.333  112.793 1.00 32.11 ? 97  GLY L CA  1 
ATOM 10961 C C   . GLY L 1 97  ? 102.691 76.833  112.983 1.00 31.91 ? 97  GLY L C   1 
ATOM 10962 O O   . GLY L 1 97  ? 103.217 76.367  113.998 1.00 31.98 ? 97  GLY L O   1 
ATOM 10963 N N   . THR L 1 98  ? 102.193 76.082  112.000 1.00 31.56 ? 98  THR L N   1 
ATOM 10964 C CA  . THR L 1 98  ? 102.246 74.619  112.010 1.00 31.30 ? 98  THR L CA  1 
ATOM 10965 C C   . THR L 1 98  ? 103.281 74.104  111.015 1.00 31.00 ? 98  THR L C   1 
ATOM 10966 O O   . THR L 1 98  ? 104.228 73.412  111.398 1.00 31.05 ? 98  THR L O   1 
ATOM 10967 C CB  . THR L 1 98  ? 100.873 74.010  111.673 1.00 31.35 ? 98  THR L CB  1 
ATOM 10968 O OG1 . THR L 1 98  ? 100.426 74.499  110.402 1.00 31.30 ? 98  THR L OG1 1 
ATOM 10969 C CG2 . THR L 1 98  ? 99.856  74.373  112.744 1.00 31.42 ? 98  THR L CG2 1 
ATOM 10970 N N   . VAL L 1 99  ? 103.089 74.446  109.742 1.00 30.61 ? 99  VAL L N   1 
ATOM 10971 C CA  . VAL L 1 99  ? 103.972 74.017  108.650 1.00 30.35 ? 99  VAL L CA  1 
ATOM 10972 C C   . VAL L 1 99  ? 104.109 75.106  107.586 1.00 30.06 ? 99  VAL L C   1 
ATOM 10973 O O   . VAL L 1 99  ? 103.353 76.081  107.581 1.00 30.16 ? 99  VAL L O   1 
ATOM 10974 C CB  . VAL L 1 99  ? 103.462 72.715  107.980 1.00 30.45 ? 99  VAL L CB  1 
ATOM 10975 C CG1 . VAL L 1 99  ? 103.728 71.509  108.868 1.00 30.52 ? 99  VAL L CG1 1 
ATOM 10976 C CG2 . VAL L 1 99  ? 101.978 72.809  107.636 1.00 30.52 ? 99  VAL L CG2 1 
ATOM 10977 N N   . TRP L 1 100 ? 105.080 74.930  106.693 1.00 29.73 ? 100 TRP L N   1 
ATOM 10978 C CA  . TRP L 1 100 ? 105.265 75.827  105.550 1.00 29.57 ? 100 TRP L CA  1 
ATOM 10979 C C   . TRP L 1 100 ? 104.174 75.587  104.510 1.00 29.76 ? 100 TRP L C   1 
ATOM 10980 O O   . TRP L 1 100 ? 103.707 74.458  104.341 1.00 29.91 ? 100 TRP L O   1 
ATOM 10981 C CB  . TRP L 1 100 ? 106.637 75.616  104.904 1.00 29.37 ? 100 TRP L CB  1 
ATOM 10982 C CG  . TRP L 1 100 ? 107.782 76.016  105.776 1.00 29.17 ? 100 TRP L CG  1 
ATOM 10983 C CD1 . TRP L 1 100 ? 108.424 75.239  106.694 1.00 29.08 ? 100 TRP L CD1 1 
ATOM 10984 C CD2 . TRP L 1 100 ? 108.430 77.292  105.806 1.00 28.95 ? 100 TRP L CD2 1 
ATOM 10985 N NE1 . TRP L 1 100 ? 109.431 75.951  107.299 1.00 28.98 ? 100 TRP L NE1 1 
ATOM 10986 C CE2 . TRP L 1 100 ? 109.457 77.215  106.773 1.00 28.90 ? 100 TRP L CE2 1 
ATOM 10987 C CE3 . TRP L 1 100 ? 108.241 78.494  105.112 1.00 28.91 ? 100 TRP L CE3 1 
ATOM 10988 C CZ2 . TRP L 1 100 ? 110.295 78.296  107.064 1.00 28.93 ? 100 TRP L CZ2 1 
ATOM 10989 C CZ3 . TRP L 1 100 ? 109.075 79.571  105.401 1.00 28.95 ? 100 TRP L CZ3 1 
ATOM 10990 C CH2 . TRP L 1 100 ? 110.090 79.462  106.371 1.00 28.96 ? 100 TRP L CH2 1 
ATOM 10991 N N   . PHE L 1 101 ? 103.778 76.656  103.823 1.00 29.96 ? 101 PHE L N   1 
ATOM 10992 C CA  . PHE L 1 101 ? 102.753 76.602  102.782 1.00 30.13 ? 101 PHE L CA  1 
ATOM 10993 C C   . PHE L 1 101 ? 103.370 76.965  101.436 1.00 30.19 ? 101 PHE L C   1 
ATOM 10994 O O   . PHE L 1 101 ? 103.992 78.020  101.305 1.00 30.31 ? 101 PHE L O   1 
ATOM 10995 C CB  . PHE L 1 101 ? 101.621 77.583  103.093 1.00 30.32 ? 101 PHE L CB  1 
ATOM 10996 C CG  . PHE L 1 101 ? 100.728 77.155  104.225 1.00 30.39 ? 101 PHE L CG  1 
ATOM 10997 C CD1 . PHE L 1 101 ? 101.160 77.239  105.545 1.00 30.53 ? 101 PHE L CD1 1 
ATOM 10998 C CD2 . PHE L 1 101 ? 99.437  76.690  103.974 1.00 30.42 ? 101 PHE L CD2 1 
ATOM 10999 C CE1 . PHE L 1 101 ? 100.334 76.852  106.591 1.00 30.59 ? 101 PHE L CE1 1 
ATOM 11000 C CE2 . PHE L 1 101 ? 98.607  76.305  105.016 1.00 30.54 ? 101 PHE L CE2 1 
ATOM 11001 C CZ  . PHE L 1 101 ? 99.055  76.384  106.326 1.00 30.60 ? 101 PHE L CZ  1 
ATOM 11002 N N   . ALA L 1 102 ? 103.198 76.086  100.449 1.00 30.37 ? 102 ALA L N   1 
ATOM 11003 C CA  . ALA L 1 102 ? 103.635 76.341  99.075  1.00 30.57 ? 102 ALA L CA  1 
ATOM 11004 C C   . ALA L 1 102 ? 102.514 77.001  98.278  1.00 30.78 ? 102 ALA L C   1 
ATOM 11005 O O   . ALA L 1 102 ? 101.379 77.102  98.753  1.00 30.81 ? 102 ALA L O   1 
ATOM 11006 C CB  . ALA L 1 102 ? 104.063 75.044  98.409  1.00 30.60 ? 102 ALA L CB  1 
ATOM 11007 N N   . ALA L 1 103 ? 102.841 77.450  97.068  1.00 31.11 ? 103 ALA L N   1 
ATOM 11008 C CA  . ALA L 1 103 ? 101.866 78.097  96.186  1.00 31.41 ? 103 ALA L CA  1 
ATOM 11009 C C   . ALA L 1 103 ? 102.323 78.069  94.724  1.00 31.72 ? 103 ALA L C   1 
ATOM 11010 O O   . ALA L 1 103 ? 103.176 78.862  94.318  1.00 31.76 ? 103 ALA L O   1 
ATOM 11011 C CB  . ALA L 1 103 ? 101.613 79.527  96.641  1.00 31.43 ? 103 ALA L CB  1 
ATOM 11012 N N   . THR L 1 104 ? 101.750 77.142  93.957  1.00 32.08 ? 104 THR L N   1 
ATOM 11013 C CA  . THR L 1 104 ? 102.031 76.979  92.527  1.00 32.34 ? 104 THR L CA  1 
ATOM 11014 C C   . THR L 1 104 ? 100.722 77.158  91.752  1.00 32.69 ? 104 THR L C   1 
ATOM 11015 O O   . THR L 1 104 ? 99.645  77.095  92.353  1.00 32.83 ? 104 THR L O   1 
ATOM 11016 C CB  . THR L 1 104 ? 102.622 75.579  92.239  1.00 32.41 ? 104 THR L CB  1 
ATOM 11017 O OG1 . THR L 1 104 ? 101.593 74.585  92.315  1.00 32.45 ? 104 THR L OG1 1 
ATOM 11018 C CG2 . THR L 1 104 ? 103.721 75.240  93.233  1.00 32.50 ? 104 THR L CG2 1 
ATOM 11019 N N   . PRO L 1 105 ? 100.798 77.386  90.421  1.00 33.13 ? 105 PRO L N   1 
ATOM 11020 C CA  . PRO L 1 105 ? 99.552  77.570  89.660  1.00 33.45 ? 105 PRO L CA  1 
ATOM 11021 C C   . PRO L 1 105 ? 98.729  76.288  89.478  1.00 33.95 ? 105 PRO L C   1 
ATOM 11022 O O   . PRO L 1 105 ? 97.502  76.342  89.577  1.00 34.10 ? 105 PRO L O   1 
ATOM 11023 C CB  . PRO L 1 105 ? 100.018 78.128  88.307  1.00 33.34 ? 105 PRO L CB  1 
ATOM 11024 C CG  . PRO L 1 105 ? 101.481 77.889  88.229  1.00 33.31 ? 105 PRO L CG  1 
ATOM 11025 C CD  . PRO L 1 105 ? 101.997 77.449  89.564  1.00 33.23 ? 105 PRO L CD  1 
ATOM 11026 N N   . ASP L 1 106 ? 99.393  75.161  89.219  1.00 34.61 ? 106 ASP L N   1 
ATOM 11027 C CA  . ASP L 1 106 ? 98.697  73.884  88.989  1.00 35.22 ? 106 ASP L CA  1 
ATOM 11028 C C   . ASP L 1 106 ? 98.059  73.286  90.251  1.00 35.56 ? 106 ASP L C   1 
ATOM 11029 O O   . ASP L 1 106 ? 96.930  72.794  90.193  1.00 35.76 ? 106 ASP L O   1 
ATOM 11030 C CB  . ASP L 1 106 ? 99.612  72.856  88.293  1.00 35.53 ? 106 ASP L CB  1 
ATOM 11031 C CG  . ASP L 1 106 ? 100.780 72.401  89.162  1.00 35.77 ? 106 ASP L CG  1 
ATOM 11032 O OD1 . ASP L 1 106 ? 101.285 73.210  89.971  1.00 35.93 ? 106 ASP L OD1 1 
ATOM 11033 O OD2 . ASP L 1 106 ? 101.196 71.230  89.026  1.00 35.86 ? 106 ASP L OD2 1 
ATOM 11034 N N   . LYS L 1 107 ? 98.772  73.337  91.377  1.00 35.96 ? 107 LYS L N   1 
ATOM 11035 C CA  . LYS L 1 107 ? 98.292  72.768  92.646  1.00 36.36 ? 107 LYS L CA  1 
ATOM 11036 C C   . LYS L 1 107 ? 97.589  73.782  93.557  1.00 36.64 ? 107 LYS L C   1 
ATOM 11037 O O   . LYS L 1 107 ? 96.947  73.387  94.532  1.00 36.62 ? 107 LYS L O   1 
ATOM 11038 C CB  . LYS L 1 107 ? 99.449  72.117  93.409  1.00 36.45 ? 107 LYS L CB  1 
ATOM 11039 C CG  . LYS L 1 107 ? 100.092 70.948  92.680  1.00 36.66 ? 107 LYS L CG  1 
ATOM 11040 C CD  . LYS L 1 107 ? 101.271 70.372  93.451  1.00 36.88 ? 107 LYS L CD  1 
ATOM 11041 C CE  . LYS L 1 107 ? 100.824 69.543  94.646  1.00 37.03 ? 107 LYS L CE  1 
ATOM 11042 N NZ  . LYS L 1 107 ? 101.974 68.895  95.334  1.00 37.12 ? 107 LYS L NZ  1 
ATOM 11043 N N   . GLY L 1 108 ? 97.710  75.075  93.247  1.00 37.06 ? 108 GLY L N   1 
ATOM 11044 C CA  . GLY L 1 108 ? 97.148  76.135  94.086  1.00 37.38 ? 108 GLY L CA  1 
ATOM 11045 C C   . GLY L 1 108 ? 97.974  76.339  95.342  1.00 37.66 ? 108 GLY L C   1 
ATOM 11046 O O   . GLY L 1 108 ? 99.158  76.002  95.370  1.00 37.75 ? 108 GLY L O   1 
ATOM 11047 N N   . VAL L 1 109 ? 97.344  76.893  96.376  1.00 38.04 ? 109 VAL L N   1 
ATOM 11048 C CA  . VAL L 1 109 ? 97.985  77.091  97.679  1.00 38.33 ? 109 VAL L CA  1 
ATOM 11049 C C   . VAL L 1 109 ? 97.728  75.854  98.541  1.00 38.62 ? 109 VAL L C   1 
ATOM 11050 O O   . VAL L 1 109 ? 96.577  75.546  98.853  1.00 38.77 ? 109 VAL L O   1 
ATOM 11051 C CB  . VAL L 1 109 ? 97.448  78.352  98.394  1.00 38.50 ? 109 VAL L CB  1 
ATOM 11052 C CG1 . VAL L 1 109 ? 98.139  78.550  99.743  1.00 38.57 ? 109 VAL L CG1 1 
ATOM 11053 C CG2 . VAL L 1 109 ? 97.625  79.583  97.509  1.00 38.56 ? 109 VAL L CG2 1 
ATOM 11054 N N   . TYR L 1 110 ? 98.801  75.156  98.914  1.00 38.99 ? 110 TYR L N   1 
ATOM 11055 C CA  . TYR L 1 110 ? 98.721  73.954  99.755  1.00 39.35 ? 110 TYR L CA  1 
ATOM 11056 C C   . TYR L 1 110 ? 99.823  73.944  100.810 1.00 39.82 ? 110 TYR L C   1 
ATOM 11057 O O   . TYR L 1 110 ? 100.767 74.737  100.740 1.00 40.04 ? 110 TYR L O   1 
ATOM 11058 C CB  . TYR L 1 110 ? 98.799  72.687  98.895  1.00 39.25 ? 110 TYR L CB  1 
ATOM 11059 C CG  . TYR L 1 110 ? 100.091 72.531  98.118  1.00 39.14 ? 110 TYR L CG  1 
ATOM 11060 C CD1 . TYR L 1 110 ? 100.265 73.157  96.884  1.00 39.13 ? 110 TYR L CD1 1 
ATOM 11061 C CD2 . TYR L 1 110 ? 101.136 71.748  98.612  1.00 39.09 ? 110 TYR L CD2 1 
ATOM 11062 C CE1 . TYR L 1 110 ? 101.444 73.016  96.167  1.00 39.07 ? 110 TYR L CE1 1 
ATOM 11063 C CE2 . TYR L 1 110 ? 102.320 71.600  97.901  1.00 39.10 ? 110 TYR L CE2 1 
ATOM 11064 C CZ  . TYR L 1 110 ? 102.468 72.235  96.679  1.00 39.11 ? 110 TYR L CZ  1 
ATOM 11065 O OH  . TYR L 1 110 ? 103.637 72.095  95.969  1.00 39.19 ? 110 TYR L OH  1 
ATOM 11066 N N   . LYS L 1 111 ? 99.695  73.034  101.775 1.00 40.42 ? 111 LYS L N   1 
ATOM 11067 C CA  . LYS L 1 111 ? 100.648 72.917  102.887 1.00 41.05 ? 111 LYS L CA  1 
ATOM 11068 C C   . LYS L 1 111 ? 101.549 71.694  102.719 1.00 41.38 ? 111 LYS L C   1 
ATOM 11069 O O   . LYS L 1 111 ? 101.093 70.635  102.285 1.00 41.54 ? 111 LYS L O   1 
ATOM 11070 C CB  . LYS L 1 111 ? 99.923  72.883  104.241 1.00 41.42 ? 111 LYS L CB  1 
ATOM 11071 C CG  . LYS L 1 111 ? 99.042  71.670  104.514 1.00 41.67 ? 111 LYS L CG  1 
ATOM 11072 C CD  . LYS L 1 111 ? 98.368  71.796  105.870 1.00 41.99 ? 111 LYS L CD  1 
ATOM 11073 C CE  . LYS L 1 111 ? 97.472  70.602  106.163 1.00 42.27 ? 111 LYS L CE  1 
ATOM 11074 N NZ  . LYS L 1 111 ? 96.798  70.695  107.490 1.00 42.33 ? 111 LYS L NZ  1 
ATOM 11075 N N   . THR L 1 112 ? 102.825 71.857  103.075 1.00 41.76 ? 112 THR L N   1 
ATOM 11076 C CA  . THR L 1 112 ? 103.834 70.798  102.940 1.00 42.19 ? 112 THR L CA  1 
ATOM 11077 C C   . THR L 1 112 ? 104.126 70.125  104.284 1.00 42.42 ? 112 THR L C   1 
ATOM 11078 O O   . THR L 1 112 ? 103.668 70.582  105.334 1.00 42.41 ? 112 THR L O   1 
ATOM 11079 C CB  . THR L 1 112 ? 105.143 71.332  102.299 1.00 42.41 ? 112 THR L CB  1 
ATOM 11080 O OG1 . THR L 1 112 ? 106.053 70.245  102.073 1.00 42.63 ? 112 THR L OG1 1 
ATOM 11081 C CG2 . THR L 1 112 ? 105.832 72.411  103.161 1.00 42.32 ? 112 THR L CG2 1 
ATOM 11082 N N   . ASN L 1 113 ? 104.897 69.040  104.233 1.00 42.76 ? 113 ASN L N   1 
ATOM 11083 C CA  . ASN L 1 113 ? 105.258 68.271  105.430 1.00 43.05 ? 113 ASN L CA  1 
ATOM 11084 C C   . ASN L 1 113 ? 106.321 68.946  106.307 1.00 43.07 ? 113 ASN L C   1 
ATOM 11085 O O   . ASN L 1 113 ? 106.459 68.593  107.481 1.00 43.14 ? 113 ASN L O   1 
ATOM 11086 C CB  . ASN L 1 113 ? 105.740 66.867  105.040 1.00 43.32 ? 113 ASN L CB  1 
ATOM 11087 C CG  . ASN L 1 113 ? 104.659 66.040  104.365 1.00 43.69 ? 113 ASN L CG  1 
ATOM 11088 O OD1 . ASN L 1 113 ? 103.606 66.554  103.981 1.00 43.88 ? 113 ASN L OD1 1 
ATOM 11089 N ND2 . ASN L 1 113 ? 104.918 64.746  104.214 1.00 43.95 ? 113 ASN L ND2 1 
ATOM 11090 N N   . THR L 1 114 ? 107.069 69.898  105.744 1.00 42.95 ? 114 THR L N   1 
ATOM 11091 C CA  . THR L 1 114 ? 108.136 70.593  106.473 1.00 42.92 ? 114 THR L CA  1 
ATOM 11092 C C   . THR L 1 114 ? 107.564 71.500  107.566 1.00 42.75 ? 114 THR L C   1 
ATOM 11093 O O   . THR L 1 114 ? 106.611 72.241  107.325 1.00 42.67 ? 114 THR L O   1 
ATOM 11094 C CB  . THR L 1 114 ? 109.008 71.444  105.522 1.00 43.06 ? 114 THR L CB  1 
ATOM 11095 O OG1 . THR L 1 114 ? 109.417 70.649  104.401 1.00 43.18 ? 114 THR L OG1 1 
ATOM 11096 C CG2 . THR L 1 114 ? 110.246 71.982  106.241 1.00 43.11 ? 114 THR L CG2 1 
ATOM 11097 N N   . ALA L 1 115 ? 108.160 71.433  108.757 1.00 42.77 ? 115 ALA L N   1 
ATOM 11098 C CA  . ALA L 1 115 ? 107.705 72.206  109.916 1.00 42.75 ? 115 ALA L CA  1 
ATOM 11099 C C   . ALA L 1 115 ? 108.307 73.608  109.921 1.00 42.74 ? 115 ALA L C   1 
ATOM 11100 O O   . ALA L 1 115 ? 109.379 73.837  109.354 1.00 42.81 ? 115 ALA L O   1 
ATOM 11101 C CB  . ALA L 1 115 ? 108.061 71.482  111.205 1.00 42.91 ? 115 ALA L CB  1 
ATOM 11102 N N   . VAL L 1 116 ? 107.611 74.535  110.577 1.00 42.90 ? 116 VAL L N   1 
ATOM 11103 C CA  . VAL L 1 116 ? 108.065 75.932  110.686 1.00 43.05 ? 116 VAL L CA  1 
ATOM 11104 C C   . VAL L 1 116 ? 109.308 76.089  111.572 1.00 43.55 ? 116 VAL L C   1 
ATOM 11105 O O   . VAL L 1 116 ? 110.083 77.031  111.388 1.00 43.76 ? 116 VAL L O   1 
ATOM 11106 C CB  . VAL L 1 116 ? 106.952 76.888  111.190 1.00 42.93 ? 116 VAL L CB  1 
ATOM 11107 C CG1 . VAL L 1 116 ? 105.748 76.852  110.255 1.00 42.89 ? 116 VAL L CG1 1 
ATOM 11108 C CG2 . VAL L 1 116 ? 106.556 76.591  112.638 1.00 42.98 ? 116 VAL L CG2 1 
ATOM 11109 N N   . THR L 1 117 ? 109.483 75.179  112.533 1.00 43.94 ? 117 THR L N   1 
ATOM 11110 C CA  . THR L 1 117 ? 110.708 75.112  113.337 1.00 44.22 ? 117 THR L CA  1 
ATOM 11111 C C   . THR L 1 117 ? 111.915 74.704  112.489 1.00 44.30 ? 117 THR L C   1 
ATOM 11112 O O   . THR L 1 117 ? 113.018 75.215  112.693 1.00 44.49 ? 117 THR L O   1 
ATOM 11113 C CB  . THR L 1 117 ? 110.566 74.122  114.512 1.00 44.54 ? 117 THR L CB  1 
ATOM 11114 O OG1 . THR L 1 117 ? 110.137 72.846  114.021 1.00 44.68 ? 117 THR L OG1 1 
ATOM 11115 C CG2 . THR L 1 117 ? 109.561 74.638  115.534 1.00 44.67 ? 117 THR L CG2 1 
ATOM 11116 N N   . SER L 1 118 ? 111.698 73.787  111.544 1.00 44.37 ? 118 SER L N   1 
ATOM 11117 C CA  . SER L 1 118 ? 112.727 73.395  110.575 1.00 44.50 ? 118 SER L CA  1 
ATOM 11118 C C   . SER L 1 118 ? 112.950 74.488  109.529 1.00 44.49 ? 118 SER L C   1 
ATOM 11119 O O   . SER L 1 118 ? 112.170 75.441  109.435 1.00 44.41 ? 118 SER L O   1 
ATOM 11120 C CB  . SER L 1 118 ? 112.341 72.085  109.879 1.00 44.61 ? 118 SER L CB  1 
ATOM 11121 O OG  . SER L 1 118 ? 112.129 71.049  110.823 1.00 44.73 ? 118 SER L OG  1 
ATOM 11122 N N   . SER L 1 119 ? 114.013 74.335  108.740 1.00 44.65 ? 119 SER L N   1 
ATOM 11123 C CA  . SER L 1 119 ? 114.401 75.335  107.739 1.00 44.77 ? 119 SER L CA  1 
ATOM 11124 C C   . SER L 1 119 ? 113.422 75.402  106.565 1.00 44.88 ? 119 SER L C   1 
ATOM 11125 O O   . SER L 1 119 ? 112.606 74.497  106.365 1.00 44.83 ? 119 SER L O   1 
ATOM 11126 C CB  . SER L 1 119 ? 115.811 75.049  107.215 1.00 44.90 ? 119 SER L CB  1 
ATOM 11127 O OG  . SER L 1 119 ? 116.275 76.105  106.390 1.00 44.99 ? 119 SER L OG  1 
ATOM 11128 N N   . GLN L 1 120 ? 113.523 76.485  105.795 1.00 44.97 ? 120 GLN L N   1 
ATOM 11129 C CA  . GLN L 1 120 ? 112.623 76.742  104.668 1.00 45.08 ? 120 GLN L CA  1 
ATOM 11130 C C   . GLN L 1 120 ? 112.849 75.725  103.542 1.00 45.31 ? 120 GLN L C   1 
ATOM 11131 O O   . GLN L 1 120 ? 114.000 75.422  103.219 1.00 45.67 ? 120 GLN L O   1 
ATOM 11132 C CB  . GLN L 1 120 ? 112.837 78.162  104.132 1.00 45.05 ? 120 GLN L CB  1 
ATOM 11133 C CG  . GLN L 1 120 ? 111.834 78.603  103.074 1.00 45.09 ? 120 GLN L CG  1 
ATOM 11134 C CD  . GLN L 1 120 ? 112.056 80.035  102.620 1.00 45.21 ? 120 GLN L CD  1 
ATOM 11135 O OE1 . GLN L 1 120 ? 112.164 80.950  103.437 1.00 45.22 ? 120 GLN L OE1 1 
ATOM 11136 N NE2 . GLN L 1 120 ? 112.119 80.236  101.308 1.00 45.29 ? 120 GLN L NE2 1 
ATOM 11137 N N   . PRO L 1 121 ? 111.757 75.181  102.957 1.00 45.40 ? 121 PRO L N   1 
ATOM 11138 C CA  . PRO L 1 121 ? 111.885 74.320  101.774 1.00 45.55 ? 121 PRO L CA  1 
ATOM 11139 C C   . PRO L 1 121 ? 112.544 75.023  100.583 1.00 45.58 ? 121 PRO L C   1 
ATOM 11140 O O   . PRO L 1 121 ? 112.195 76.165  100.275 1.00 45.53 ? 121 PRO L O   1 
ATOM 11141 C CB  . PRO L 1 121 ? 110.434 73.962  101.438 1.00 45.56 ? 121 PRO L CB  1 
ATOM 11142 C CG  . PRO L 1 121 ? 109.718 74.045  102.736 1.00 45.48 ? 121 PRO L CG  1 
ATOM 11143 C CD  . PRO L 1 121 ? 110.387 75.144  103.507 1.00 45.42 ? 121 PRO L CD  1 
ATOM 11144 N N   . GLU L 1 122 ? 113.487 74.339  99.937  1.00 45.76 ? 122 GLU L N   1 
ATOM 11145 C CA  . GLU L 1 122 ? 114.211 74.891  98.786  1.00 45.90 ? 122 GLU L CA  1 
ATOM 11146 C C   . GLU L 1 122 ? 113.309 75.019  97.562  1.00 45.50 ? 122 GLU L C   1 
ATOM 11147 O O   . GLU L 1 122 ? 113.354 76.032  96.865  1.00 45.42 ? 122 GLU L O   1 
ATOM 11148 C CB  . GLU L 1 122 ? 115.432 74.027  98.440  1.00 46.32 ? 122 GLU L CB  1 
ATOM 11149 C CG  . GLU L 1 122 ? 116.521 74.006  99.509  1.00 46.56 ? 122 GLU L CG  1 
ATOM 11150 C CD  . GLU L 1 122 ? 117.199 75.353  99.724  1.00 46.77 ? 122 GLU L CD  1 
ATOM 11151 O OE1 . GLU L 1 122 ? 117.186 76.203  98.806  1.00 46.76 ? 122 GLU L OE1 1 
ATOM 11152 O OE2 . GLU L 1 122 ? 117.757 75.561  100.822 1.00 46.96 ? 122 GLU L OE2 1 
ATOM 11153 N N   . SER L 1 123 ? 112.508 73.985  97.307  1.00 45.20 ? 123 SER L N   1 
ATOM 11154 C CA  . SER L 1 123 ? 111.510 73.993  96.233  1.00 45.03 ? 123 SER L CA  1 
ATOM 11155 C C   . SER L 1 123 ? 110.218 73.326  96.701  1.00 44.61 ? 123 SER L C   1 
ATOM 11156 O O   . SER L 1 123 ? 110.241 72.432  97.551  1.00 44.74 ? 123 SER L O   1 
ATOM 11157 C CB  . SER L 1 123 ? 112.051 73.269  94.999  1.00 45.23 ? 123 SER L CB  1 
ATOM 11158 O OG  . SER L 1 123 ? 111.145 73.360  93.912  1.00 45.30 ? 123 SER L OG  1 
ATOM 11159 N N   . CYS L 1 124 ? 109.097 73.768  96.133  1.00 44.10 ? 124 CYS L N   1 
ATOM 11160 C CA  . CYS L 1 124 ? 107.774 73.248  96.492  1.00 43.87 ? 124 CYS L CA  1 
ATOM 11161 C C   . CYS L 1 124 ? 107.581 71.815  95.968  1.00 44.47 ? 124 CYS L C   1 
ATOM 11162 O O   . CYS L 1 124 ? 108.155 71.464  94.934  1.00 44.77 ? 124 CYS L O   1 
ATOM 11163 C CB  . CYS L 1 124 ? 106.672 74.165  95.945  1.00 43.10 ? 124 CYS L CB  1 
ATOM 11164 S SG  . CYS L 1 124 ? 106.988 74.814  94.285  1.00 42.51 ? 124 CYS L SG  1 
ATOM 11165 N N   . PRO L 1 125 ? 106.785 70.981  96.679  1.00 44.93 ? 125 PRO L N   1 
ATOM 11166 C CA  . PRO L 1 125 ? 106.524 69.613  96.193  1.00 45.17 ? 125 PRO L CA  1 
ATOM 11167 C C   . PRO L 1 125 ? 105.726 69.540  94.885  1.00 45.54 ? 125 PRO L C   1 
ATOM 11168 O O   . PRO L 1 125 ? 105.664 68.484  94.251  1.00 45.78 ? 125 PRO L O   1 
ATOM 11169 C CB  . PRO L 1 125 ? 105.717 68.975  97.335  1.00 45.17 ? 125 PRO L CB  1 
ATOM 11170 C CG  . PRO L 1 125 ? 106.022 69.793  98.536  1.00 45.13 ? 125 PRO L CG  1 
ATOM 11171 C CD  . PRO L 1 125 ? 106.224 71.187  98.030  1.00 45.02 ? 125 PRO L CD  1 
ATOM 11172 O OXT . PRO L 1 125 ? 105.127 70.514  94.426  1.00 45.77 ? 125 PRO L OXT 1 
ATOM 11173 N N   . PHE M 1 1   ? 84.034  79.810  167.601 1.00 65.53 ? 1   PHE M N   1 
ATOM 11174 C CA  . PHE M 1 1   ? 84.099  80.925  166.614 1.00 65.24 ? 1   PHE M CA  1 
ATOM 11175 C C   . PHE M 1 1   ? 84.664  82.181  167.290 1.00 64.19 ? 1   PHE M C   1 
ATOM 11176 O O   . PHE M 1 1   ? 83.935  82.929  167.948 1.00 64.28 ? 1   PHE M O   1 
ATOM 11177 C CB  . PHE M 1 1   ? 82.706  81.188  166.017 1.00 66.00 ? 1   PHE M CB  1 
ATOM 11178 C CG  . PHE M 1 1   ? 82.729  81.804  164.641 1.00 66.66 ? 1   PHE M CG  1 
ATOM 11179 C CD1 . PHE M 1 1   ? 83.304  83.056  164.427 1.00 66.87 ? 1   PHE M CD1 1 
ATOM 11180 C CD2 . PHE M 1 1   ? 82.160  81.141  163.557 1.00 67.09 ? 1   PHE M CD2 1 
ATOM 11181 C CE1 . PHE M 1 1   ? 83.318  83.625  163.163 1.00 67.09 ? 1   PHE M CE1 1 
ATOM 11182 C CE2 . PHE M 1 1   ? 82.174  81.709  162.292 1.00 67.25 ? 1   PHE M CE2 1 
ATOM 11183 C CZ  . PHE M 1 1   ? 82.753  82.952  162.094 1.00 67.25 ? 1   PHE M CZ  1 
ATOM 11184 N N   . THR M 1 2   ? 85.967  82.403  167.116 1.00 62.81 ? 2   THR M N   1 
ATOM 11185 C CA  . THR M 1 2   ? 86.670  83.524  167.748 1.00 61.68 ? 2   THR M CA  1 
ATOM 11186 C C   . THR M 1 2   ? 86.516  84.816  166.948 1.00 60.37 ? 2   THR M C   1 
ATOM 11187 O O   . THR M 1 2   ? 86.019  84.807  165.819 1.00 60.21 ? 2   THR M O   1 
ATOM 11188 C CB  . THR M 1 2   ? 88.180  83.226  167.897 1.00 61.85 ? 2   THR M CB  1 
ATOM 11189 O OG1 . THR M 1 2   ? 88.741  82.932  166.613 1.00 61.94 ? 2   THR M OG1 1 
ATOM 11190 C CG2 . THR M 1 2   ? 88.419  82.045  168.828 1.00 61.91 ? 2   THR M CG2 1 
ATOM 11191 N N   . LEU M 1 3   ? 86.948  85.922  167.550 1.00 59.31 ? 3   LEU M N   1 
ATOM 11192 C CA  . LEU M 1 3   ? 87.023  87.216  166.867 1.00 58.56 ? 3   LEU M CA  1 
ATOM 11193 C C   . LEU M 1 3   ? 88.188  87.239  165.874 1.00 57.74 ? 3   LEU M C   1 
ATOM 11194 O O   . LEU M 1 3   ? 88.058  87.797  164.786 1.00 57.87 ? 3   LEU M O   1 
ATOM 11195 C CB  . LEU M 1 3   ? 87.171  88.358  167.879 1.00 58.65 ? 3   LEU M CB  1 
ATOM 11196 C CG  . LEU M 1 3   ? 87.140  89.799  167.352 1.00 58.84 ? 3   LEU M CG  1 
ATOM 11197 C CD1 . LEU M 1 3   ? 85.804  90.128  166.702 1.00 58.83 ? 3   LEU M CD1 1 
ATOM 11198 C CD2 . LEU M 1 3   ? 87.440  90.772  168.483 1.00 59.00 ? 3   LEU M CD2 1 
ATOM 11199 N N   . ILE M 1 4   ? 89.320  86.651  166.265 1.00 56.84 ? 4   ILE M N   1 
ATOM 11200 C CA  . ILE M 1 4   ? 90.494  86.525  165.382 1.00 56.10 ? 4   ILE M CA  1 
ATOM 11201 C C   . ILE M 1 4   ? 90.215  85.696  164.115 1.00 55.55 ? 4   ILE M C   1 
ATOM 11202 O O   . ILE M 1 4   ? 90.743  86.012  163.046 1.00 55.56 ? 4   ILE M O   1 
ATOM 11203 C CB  . ILE M 1 4   ? 91.741  85.978  166.145 1.00 56.16 ? 4   ILE M CB  1 
ATOM 11204 C CG1 . ILE M 1 4   ? 93.016  86.035  165.286 1.00 56.20 ? 4   ILE M CG1 1 
ATOM 11205 C CG2 . ILE M 1 4   ? 91.540  84.545  166.629 1.00 56.30 ? 4   ILE M CG2 1 
ATOM 11206 C CD1 . ILE M 1 4   ? 93.377  87.412  164.773 1.00 56.15 ? 4   ILE M CD1 1 
ATOM 11207 N N   . GLU M 1 5   ? 89.397  84.649  164.240 1.00 55.12 ? 5   GLU M N   1 
ATOM 11208 C CA  . GLU M 1 5   ? 88.976  83.844  163.084 1.00 54.70 ? 5   GLU M CA  1 
ATOM 11209 C C   . GLU M 1 5   ? 88.052  84.635  162.152 1.00 54.01 ? 5   GLU M C   1 
ATOM 11210 O O   . GLU M 1 5   ? 88.078  84.432  160.940 1.00 54.13 ? 5   GLU M O   1 
ATOM 11211 C CB  . GLU M 1 5   ? 88.300  82.544  163.541 1.00 54.98 ? 5   GLU M CB  1 
ATOM 11212 C CG  . GLU M 1 5   ? 87.921  81.585  162.416 1.00 55.44 ? 5   GLU M CG  1 
ATOM 11213 C CD  . GLU M 1 5   ? 86.464  81.695  161.991 1.00 55.80 ? 5   GLU M CD  1 
ATOM 11214 O OE1 . GLU M 1 5   ? 85.576  81.417  162.825 1.00 55.97 ? 5   GLU M OE1 1 
ATOM 11215 O OE2 . GLU M 1 5   ? 86.208  82.048  160.820 1.00 55.93 ? 5   GLU M OE2 1 
ATOM 11216 N N   . LEU M 1 6   ? 87.235  85.519  162.722 1.00 53.26 ? 6   LEU M N   1 
ATOM 11217 C CA  . LEU M 1 6   ? 86.414  86.445  161.938 1.00 52.82 ? 6   LEU M CA  1 
ATOM 11218 C C   . LEU M 1 6   ? 87.257  87.568  161.331 1.00 52.17 ? 6   LEU M C   1 
ATOM 11219 O O   . LEU M 1 6   ? 87.023  87.978  160.194 1.00 52.30 ? 6   LEU M O   1 
ATOM 11220 C CB  . LEU M 1 6   ? 85.313  87.052  162.815 1.00 53.07 ? 6   LEU M CB  1 
ATOM 11221 C CG  . LEU M 1 6   ? 84.192  87.857  162.143 1.00 53.25 ? 6   LEU M CG  1 
ATOM 11222 C CD1 . LEU M 1 6   ? 83.405  87.016  161.142 1.00 53.35 ? 6   LEU M CD1 1 
ATOM 11223 C CD2 . LEU M 1 6   ? 83.271  88.454  163.203 1.00 53.36 ? 6   LEU M CD2 1 
ATOM 11224 N N   . LEU M 1 7   ? 88.226  88.060  162.103 1.00 51.68 ? 7   LEU M N   1 
ATOM 11225 C CA  . LEU M 1 7   ? 89.086  89.177  161.698 1.00 51.18 ? 7   LEU M CA  1 
ATOM 11226 C C   . LEU M 1 7   ? 89.993  88.838  160.515 1.00 50.46 ? 7   LEU M C   1 
ATOM 11227 O O   . LEU M 1 7   ? 90.160  89.664  159.614 1.00 50.55 ? 7   LEU M O   1 
ATOM 11228 C CB  . LEU M 1 7   ? 89.932  89.640  162.890 1.00 51.54 ? 7   LEU M CB  1 
ATOM 11229 C CG  . LEU M 1 7   ? 90.860  90.848  162.729 1.00 52.00 ? 7   LEU M CG  1 
ATOM 11230 C CD1 . LEU M 1 7   ? 90.112  92.070  162.215 1.00 52.25 ? 7   LEU M CD1 1 
ATOM 11231 C CD2 . LEU M 1 7   ? 91.528  91.144  164.064 1.00 52.11 ? 7   LEU M CD2 1 
ATOM 11232 N N   . ILE M 1 8   ? 90.580  87.640  160.527 1.00 49.67 ? 8   ILE M N   1 
ATOM 11233 C CA  . ILE M 1 8   ? 91.392  87.163  159.396 1.00 48.95 ? 8   ILE M CA  1 
ATOM 11234 C C   . ILE M 1 8   ? 90.548  86.916  158.138 1.00 48.10 ? 8   ILE M C   1 
ATOM 11235 O O   . ILE M 1 8   ? 91.024  87.148  157.031 1.00 48.25 ? 8   ILE M O   1 
ATOM 11236 C CB  . ILE M 1 8   ? 92.240  85.907  159.750 1.00 49.08 ? 8   ILE M CB  1 
ATOM 11237 C CG1 . ILE M 1 8   ? 93.319  85.672  158.680 1.00 49.31 ? 8   ILE M CG1 1 
ATOM 11238 C CG2 . ILE M 1 8   ? 91.367  84.668  159.929 1.00 49.12 ? 8   ILE M CG2 1 
ATOM 11239 C CD1 . ILE M 1 8   ? 94.417  84.711  159.090 1.00 49.49 ? 8   ILE M CD1 1 
ATOM 11240 N N   . VAL M 1 9   ? 89.306  86.462  158.312 1.00 47.27 ? 9   VAL M N   1 
ATOM 11241 C CA  . VAL M 1 9   ? 88.366  86.296  157.190 1.00 46.73 ? 9   VAL M CA  1 
ATOM 11242 C C   . VAL M 1 9   ? 88.027  87.648  156.544 1.00 46.19 ? 9   VAL M C   1 
ATOM 11243 O O   . VAL M 1 9   ? 87.918  87.735  155.321 1.00 46.23 ? 9   VAL M O   1 
ATOM 11244 C CB  . VAL M 1 9   ? 87.081  85.545  157.631 1.00 46.84 ? 9   VAL M CB  1 
ATOM 11245 C CG1 . VAL M 1 9   ? 85.973  85.637  156.584 1.00 46.95 ? 9   VAL M CG1 1 
ATOM 11246 C CG2 . VAL M 1 9   ? 87.401  84.083  157.916 1.00 46.91 ? 9   VAL M CG2 1 
ATOM 11247 N N   . ILE M 1 10  ? 87.868  88.686  157.365 1.00 45.60 ? 10  ILE M N   1 
ATOM 11248 C CA  . ILE M 1 10  ? 87.665  90.056  156.873 1.00 45.28 ? 10  ILE M CA  1 
ATOM 11249 C C   . ILE M 1 10  ? 88.909  90.556  156.119 1.00 44.89 ? 10  ILE M C   1 
ATOM 11250 O O   . ILE M 1 10  ? 88.783  91.246  155.105 1.00 44.97 ? 10  ILE M O   1 
ATOM 11251 C CB  . ILE M 1 10  ? 87.288  91.026  158.026 1.00 45.46 ? 10  ILE M CB  1 
ATOM 11252 C CG1 . ILE M 1 10  ? 85.906  90.668  158.594 1.00 45.68 ? 10  ILE M CG1 1 
ATOM 11253 C CG2 . ILE M 1 10  ? 87.281  92.483  157.561 1.00 45.52 ? 10  ILE M CG2 1 
ATOM 11254 C CD1 . ILE M 1 10  ? 85.663  91.174  160.002 1.00 45.81 ? 10  ILE M CD1 1 
ATOM 11255 N N   . ALA M 1 11  ? 90.094  90.203  156.616 1.00 44.53 ? 11  ALA M N   1 
ATOM 11256 C CA  . ALA M 1 11  ? 91.363  90.564  155.971 1.00 44.37 ? 11  ALA M CA  1 
ATOM 11257 C C   . ALA M 1 11  ? 91.550  89.921  154.593 1.00 44.14 ? 11  ALA M C   1 
ATOM 11258 O O   . ALA M 1 11  ? 92.031  90.577  153.668 1.00 44.27 ? 11  ALA M O   1 
ATOM 11259 C CB  . ALA M 1 11  ? 92.539  90.210  156.874 1.00 44.52 ? 11  ALA M CB  1 
ATOM 11260 N N   . ILE M 1 12  ? 91.172  88.648  154.464 1.00 43.94 ? 12  ILE M N   1 
ATOM 11261 C CA  . ILE M 1 12  ? 91.292  87.915  153.193 1.00 43.88 ? 12  ILE M CA  1 
ATOM 11262 C C   . ILE M 1 12  ? 90.274  88.405  152.151 1.00 43.93 ? 12  ILE M C   1 
ATOM 11263 O O   . ILE M 1 12  ? 90.595  88.462  150.963 1.00 44.27 ? 12  ILE M O   1 
ATOM 11264 C CB  . ILE M 1 12  ? 91.171  86.380  153.402 1.00 43.83 ? 12  ILE M CB  1 
ATOM 11265 C CG1 . ILE M 1 12  ? 92.309  85.851  154.294 1.00 44.06 ? 12  ILE M CG1 1 
ATOM 11266 C CG2 . ILE M 1 12  ? 91.151  85.622  152.073 1.00 43.85 ? 12  ILE M CG2 1 
ATOM 11267 C CD1 . ILE M 1 12  ? 93.715  86.085  153.778 1.00 44.26 ? 12  ILE M CD1 1 
ATOM 11268 N N   . ILE M 1 13  ? 89.067  88.764  152.591 1.00 43.69 ? 13  ILE M N   1 
ATOM 11269 C CA  . ILE M 1 13  ? 88.043  89.334  151.695 1.00 43.60 ? 13  ILE M CA  1 
ATOM 11270 C C   . ILE M 1 13  ? 88.532  90.643  151.052 1.00 43.55 ? 13  ILE M C   1 
ATOM 11271 O O   . ILE M 1 13  ? 88.268  90.887  149.873 1.00 43.61 ? 13  ILE M O   1 
ATOM 11272 C CB  . ILE M 1 13  ? 86.689  89.543  152.429 1.00 43.76 ? 13  ILE M CB  1 
ATOM 11273 C CG1 . ILE M 1 13  ? 86.053  88.187  152.767 1.00 43.92 ? 13  ILE M CG1 1 
ATOM 11274 C CG2 . ILE M 1 13  ? 85.702  90.354  151.583 1.00 43.84 ? 13  ILE M CG2 1 
ATOM 11275 C CD1 . ILE M 1 13  ? 85.067  88.236  153.916 1.00 44.05 ? 13  ILE M CD1 1 
ATOM 11276 N N   . ALA M 1 14  ? 89.241  91.468  151.823 1.00 43.61 ? 14  ALA M N   1 
ATOM 11277 C CA  . ALA M 1 14  ? 89.849  92.702  151.307 1.00 43.68 ? 14  ALA M CA  1 
ATOM 11278 C C   . ALA M 1 14  ? 90.923  92.437  150.247 1.00 43.73 ? 14  ALA M C   1 
ATOM 11279 O O   . ALA M 1 14  ? 91.049  93.202  149.287 1.00 43.84 ? 14  ALA M O   1 
ATOM 11280 C CB  . ALA M 1 14  ? 90.434  93.522  152.451 1.00 43.75 ? 14  ALA M CB  1 
ATOM 11281 N N   . ILE M 1 15  ? 91.690  91.361  150.430 1.00 43.74 ? 15  ILE M N   1 
ATOM 11282 C CA  . ILE M 1 15  ? 92.726  90.952  149.473 1.00 43.83 ? 15  ILE M CA  1 
ATOM 11283 C C   . ILE M 1 15  ? 92.097  90.388  148.196 1.00 43.79 ? 15  ILE M C   1 
ATOM 11284 O O   . ILE M 1 15  ? 92.478  90.781  147.091 1.00 43.92 ? 15  ILE M O   1 
ATOM 11285 C CB  . ILE M 1 15  ? 93.694  89.908  150.089 1.00 44.00 ? 15  ILE M CB  1 
ATOM 11286 C CG1 . ILE M 1 15  ? 94.464  90.523  151.268 1.00 44.22 ? 15  ILE M CG1 1 
ATOM 11287 C CG2 . ILE M 1 15  ? 94.686  89.390  149.048 1.00 44.10 ? 15  ILE M CG2 1 
ATOM 11288 C CD1 . ILE M 1 15  ? 95.061  89.505  152.217 1.00 44.27 ? 15  ILE M CD1 1 
ATOM 11289 N N   . LEU M 1 16  ? 91.151  89.464  148.359 1.00 43.76 ? 16  LEU M N   1 
ATOM 11290 C CA  . LEU M 1 16  ? 90.453  88.841  147.221 1.00 43.77 ? 16  LEU M CA  1 
ATOM 11291 C C   . LEU M 1 16  ? 89.614  89.835  146.405 1.00 43.68 ? 16  LEU M C   1 
ATOM 11292 O O   . LEU M 1 16  ? 89.519  89.702  145.184 1.00 43.80 ? 16  LEU M O   1 
ATOM 11293 C CB  . LEU M 1 16  ? 89.580  87.658  147.682 1.00 43.94 ? 16  LEU M CB  1 
ATOM 11294 C CG  . LEU M 1 16  ? 90.249  86.277  147.755 1.00 44.26 ? 16  LEU M CG  1 
ATOM 11295 C CD1 . LEU M 1 16  ? 91.625  86.309  148.409 1.00 44.40 ? 16  LEU M CD1 1 
ATOM 11296 C CD2 . LEU M 1 16  ? 89.336  85.292  148.473 1.00 44.39 ? 16  LEU M CD2 1 
ATOM 11297 N N   . ALA M 1 17  ? 89.015  90.818  147.078 1.00 43.48 ? 17  ALA M N   1 
ATOM 11298 C CA  . ALA M 1 17  ? 88.227  91.863  146.405 1.00 43.36 ? 17  ALA M CA  1 
ATOM 11299 C C   . ALA M 1 17  ? 89.070  92.798  145.529 1.00 43.29 ? 17  ALA M C   1 
ATOM 11300 O O   . ALA M 1 17  ? 88.549  93.390  144.582 1.00 43.40 ? 17  ALA M O   1 
ATOM 11301 C CB  . ALA M 1 17  ? 87.442  92.676  147.427 1.00 43.38 ? 17  ALA M CB  1 
ATOM 11302 N N   . ALA M 1 18  ? 90.356  92.939  145.851 1.00 43.01 ? 18  ALA M N   1 
ATOM 11303 C CA  . ALA M 1 18  ? 91.275  93.763  145.066 1.00 42.88 ? 18  ALA M CA  1 
ATOM 11304 C C   . ALA M 1 18  ? 91.802  93.015  143.843 1.00 42.74 ? 18  ALA M C   1 
ATOM 11305 O O   . ALA M 1 18  ? 91.684  93.501  142.716 1.00 42.83 ? 18  ALA M O   1 
ATOM 11306 C CB  . ALA M 1 18  ? 92.436  94.227  145.934 1.00 42.97 ? 18  ALA M CB  1 
ATOM 11307 N N   . VAL M 1 19  ? 92.371  91.833  144.076 1.00 42.61 ? 19  VAL M N   1 
ATOM 11308 C CA  . VAL M 1 19  ? 93.097  91.090  143.030 1.00 42.61 ? 19  VAL M CA  1 
ATOM 11309 C C   . VAL M 1 19  ? 92.205  90.404  141.986 1.00 42.56 ? 19  VAL M C   1 
ATOM 11310 O O   . VAL M 1 19  ? 92.540  90.404  140.799 1.00 42.66 ? 19  VAL M O   1 
ATOM 11311 C CB  . VAL M 1 19  ? 94.093  90.053  143.623 1.00 42.69 ? 19  VAL M CB  1 
ATOM 11312 C CG1 . VAL M 1 19  ? 95.062  90.731  144.586 1.00 42.75 ? 19  VAL M CG1 1 
ATOM 11313 C CG2 . VAL M 1 19  ? 93.379  88.880  144.295 1.00 42.69 ? 19  VAL M CG2 1 
ATOM 11314 N N   . LEU M 1 20  ? 91.082  89.831  142.420 1.00 42.47 ? 20  LEU M N   1 
ATOM 11315 C CA  . LEU M 1 20  ? 90.219  89.036  141.532 1.00 42.47 ? 20  LEU M CA  1 
ATOM 11316 C C   . LEU M 1 20  ? 89.355  89.874  140.581 1.00 42.21 ? 20  LEU M C   1 
ATOM 11317 O O   . LEU M 1 20  ? 88.915  89.366  139.546 1.00 42.16 ? 20  LEU M O   1 
ATOM 11318 C CB  . LEU M 1 20  ? 89.328  88.093  142.347 1.00 42.79 ? 20  LEU M CB  1 
ATOM 11319 C CG  . LEU M 1 20  ? 90.034  87.101  143.277 1.00 43.17 ? 20  LEU M CG  1 
ATOM 11320 C CD1 . LEU M 1 20  ? 89.014  86.351  144.119 1.00 43.27 ? 20  LEU M CD1 1 
ATOM 11321 C CD2 . LEU M 1 20  ? 90.891  86.122  142.486 1.00 43.25 ? 20  LEU M CD2 1 
ATOM 11322 N N   . ILE M 1 21  ? 89.108  91.138  140.931 1.00 41.85 ? 21  ILE M N   1 
ATOM 11323 C CA  . ILE M 1 21  ? 88.344  92.056  140.076 1.00 41.51 ? 21  ILE M CA  1 
ATOM 11324 C C   . ILE M 1 21  ? 89.265  92.478  138.920 1.00 41.13 ? 21  ILE M C   1 
ATOM 11325 O O   . ILE M 1 21  ? 90.294  93.112  139.163 1.00 41.33 ? 21  ILE M O   1 
ATOM 11326 C CB  . ILE M 1 21  ? 87.830  93.295  140.865 1.00 41.75 ? 21  ILE M CB  1 
ATOM 11327 C CG1 . ILE M 1 21  ? 86.569  92.961  141.685 1.00 41.94 ? 21  ILE M CG1 1 
ATOM 11328 C CG2 . ILE M 1 21  ? 87.465  94.450  139.933 1.00 41.83 ? 21  ILE M CG2 1 
ATOM 11329 C CD1 . ILE M 1 21  ? 86.628  91.714  142.547 1.00 42.01 ? 21  ILE M CD1 1 
ATOM 11330 N N   . PRO M 1 22  ? 88.902  92.133  137.665 1.00 40.49 ? 22  PRO M N   1 
ATOM 11331 C CA  . PRO M 1 22  ? 89.783  92.414  136.529 1.00 40.05 ? 22  PRO M CA  1 
ATOM 11332 C C   . PRO M 1 22  ? 89.727  93.869  136.062 1.00 39.58 ? 22  PRO M C   1 
ATOM 11333 O O   . PRO M 1 22  ? 88.874  94.638  136.514 1.00 39.64 ? 22  PRO M O   1 
ATOM 11334 C CB  . PRO M 1 22  ? 89.234  91.492  135.442 1.00 40.17 ? 22  PRO M CB  1 
ATOM 11335 C CG  . PRO M 1 22  ? 87.774  91.444  135.723 1.00 40.35 ? 22  PRO M CG  1 
ATOM 11336 C CD  . PRO M 1 22  ? 87.632  91.526  137.220 1.00 40.46 ? 22  PRO M CD  1 
ATOM 11337 N N   . ASN M 1 23  ? 90.638  94.226  135.157 1.00 38.96 ? 23  ASN M N   1 
ATOM 11338 C CA  . ASN M 1 23  ? 90.655  95.553  134.540 1.00 38.42 ? 23  ASN M CA  1 
ATOM 11339 C C   . ASN M 1 23  ? 89.505  95.641  133.535 1.00 38.17 ? 23  ASN M C   1 
ATOM 11340 O O   . ASN M 1 23  ? 89.566  95.048  132.454 1.00 38.30 ? 23  ASN M O   1 
ATOM 11341 C CB  . ASN M 1 23  ? 92.007  95.813  133.860 1.00 38.26 ? 23  ASN M CB  1 
ATOM 11342 C CG  . ASN M 1 23  ? 92.207  97.273  133.481 1.00 38.22 ? 23  ASN M CG  1 
ATOM 11343 O OD1 . ASN M 1 23  ? 91.372  97.877  132.808 1.00 38.19 ? 23  ASN M OD1 1 
ATOM 11344 N ND2 . ASN M 1 23  ? 93.331  97.842  133.903 1.00 38.32 ? 23  ASN M ND2 1 
ATOM 11345 N N   . LEU M 1 24  ? 88.456  96.374  133.906 1.00 37.77 ? 24  LEU M N   1 
ATOM 11346 C CA  . LEU M 1 24  ? 87.256  96.497  133.079 1.00 37.53 ? 24  LEU M CA  1 
ATOM 11347 C C   . LEU M 1 24  ? 87.474  97.435  131.893 1.00 37.24 ? 24  LEU M C   1 
ATOM 11348 O O   . LEU M 1 24  ? 87.110  97.096  130.768 1.00 37.38 ? 24  LEU M O   1 
ATOM 11349 C CB  . LEU M 1 24  ? 86.067  96.985  133.915 1.00 37.66 ? 24  LEU M CB  1 
ATOM 11350 C CG  . LEU M 1 24  ? 85.645  96.103  135.097 1.00 37.78 ? 24  LEU M CG  1 
ATOM 11351 C CD1 . LEU M 1 24  ? 84.672  96.847  135.997 1.00 37.90 ? 24  LEU M CD1 1 
ATOM 11352 C CD2 . LEU M 1 24  ? 85.033  94.791  134.627 1.00 37.72 ? 24  LEU M CD2 1 
ATOM 11353 N N   . LEU M 1 25  ? 88.072  98.600  132.150 1.00 36.76 ? 25  LEU M N   1 
ATOM 11354 C CA  . LEU M 1 25  ? 88.288  99.628  131.121 1.00 36.40 ? 25  LEU M CA  1 
ATOM 11355 C C   . LEU M 1 25  ? 89.095  99.113  129.932 1.00 35.85 ? 25  LEU M C   1 
ATOM 11356 O O   . LEU M 1 25  ? 88.760  99.402  128.783 1.00 35.80 ? 25  LEU M O   1 
ATOM 11357 C CB  . LEU M 1 25  ? 88.988  100.859 131.716 1.00 36.59 ? 25  LEU M CB  1 
ATOM 11358 C CG  . LEU M 1 25  ? 89.180  102.080 130.803 1.00 36.81 ? 25  LEU M CG  1 
ATOM 11359 C CD1 . LEU M 1 25  ? 87.840  102.664 130.381 1.00 36.91 ? 25  LEU M CD1 1 
ATOM 11360 C CD2 . LEU M 1 25  ? 90.031  103.139 131.491 1.00 36.92 ? 25  LEU M CD2 1 
ATOM 11361 N N   . ALA M 1 26  ? 90.153  98.357  130.219 1.00 35.52 ? 26  ALA M N   1 
ATOM 11362 C CA  . ALA M 1 26  ? 91.009  97.781  129.178 1.00 35.27 ? 26  ALA M CA  1 
ATOM 11363 C C   . ALA M 1 26  ? 90.279  96.709  128.364 1.00 34.96 ? 26  ALA M C   1 
ATOM 11364 O O   . ALA M 1 26  ? 90.435  96.645  127.144 1.00 34.98 ? 26  ALA M O   1 
ATOM 11365 C CB  . ALA M 1 26  ? 92.285  97.214  129.789 1.00 35.29 ? 26  ALA M CB  1 
ATOM 11366 N N   . ALA M 1 27  ? 89.485  95.880  129.040 1.00 34.79 ? 27  ALA M N   1 
ATOM 11367 C CA  . ALA M 1 27  ? 88.690  94.835  128.380 1.00 34.77 ? 27  ALA M CA  1 
ATOM 11368 C C   . ALA M 1 27  ? 87.676  95.394  127.375 1.00 34.60 ? 27  ALA M C   1 
ATOM 11369 O O   . ALA M 1 27  ? 87.466  94.803  126.315 1.00 34.63 ? 27  ALA M O   1 
ATOM 11370 C CB  . ALA M 1 27  ? 87.977  93.977  129.417 1.00 34.88 ? 27  ALA M CB  1 
ATOM 11371 N N   . ARG M 1 28  ? 87.056  96.527  127.714 1.00 34.46 ? 28  ARG M N   1 
ATOM 11372 C CA  . ARG M 1 28  ? 86.076  97.175  126.834 1.00 34.32 ? 28  ARG M CA  1 
ATOM 11373 C C   . ARG M 1 28  ? 86.708  97.844  125.608 1.00 34.16 ? 28  ARG M C   1 
ATOM 11374 O O   . ARG M 1 28  ? 86.093  97.857  124.542 1.00 34.28 ? 28  ARG M O   1 
ATOM 11375 C CB  . ARG M 1 28  ? 85.236  98.199  127.605 1.00 34.46 ? 28  ARG M CB  1 
ATOM 11376 C CG  . ARG M 1 28  ? 84.398  97.595  128.723 1.00 34.64 ? 28  ARG M CG  1 
ATOM 11377 C CD  . ARG M 1 28  ? 83.225  98.485  129.107 1.00 34.76 ? 28  ARG M CD  1 
ATOM 11378 N NE  . ARG M 1 28  ? 82.064  98.270  128.244 1.00 34.86 ? 28  ARG M NE  1 
ATOM 11379 C CZ  . ARG M 1 28  ? 81.231  97.226  128.312 1.00 35.08 ? 28  ARG M CZ  1 
ATOM 11380 N NH1 . ARG M 1 28  ? 80.208  97.151  127.467 1.00 35.19 ? 28  ARG M NH1 1 
ATOM 11381 N NH2 . ARG M 1 28  ? 81.405  96.253  129.210 1.00 35.14 ? 28  ARG M NH2 1 
ATOM 11382 N N   . LYS M 1 29  ? 87.915  98.399  125.761 1.00 34.02 ? 29  LYS M N   1 
ATOM 11383 C CA  . LYS M 1 29  ? 88.642  99.040  124.645 1.00 33.92 ? 29  LYS M CA  1 
ATOM 11384 C C   . LYS M 1 29  ? 88.767  98.149  123.407 1.00 33.86 ? 29  LYS M C   1 
ATOM 11385 O O   . LYS M 1 29  ? 88.568  98.616  122.285 1.00 34.02 ? 29  LYS M O   1 
ATOM 11386 C CB  . LYS M 1 29  ? 90.051  99.484  125.072 1.00 33.96 ? 29  LYS M CB  1 
ATOM 11387 C CG  . LYS M 1 29  ? 90.111  100.794 125.841 1.00 34.05 ? 29  LYS M CG  1 
ATOM 11388 C CD  . LYS M 1 29  ? 91.536  101.329 125.880 1.00 34.19 ? 29  LYS M CD  1 
ATOM 11389 C CE  . LYS M 1 29  ? 91.662  102.569 126.752 1.00 34.36 ? 29  LYS M CE  1 
ATOM 11390 N NZ  . LYS M 1 29  ? 91.761  102.251 128.205 1.00 34.43 ? 29  LYS M NZ  1 
ATOM 11391 N N   . ARG M 1 30  ? 89.090  96.874  123.621 1.00 33.59 ? 30  ARG M N   1 
ATOM 11392 C CA  . ARG M 1 30  ? 89.276  95.919  122.523 1.00 33.40 ? 30  ARG M CA  1 
ATOM 11393 C C   . ARG M 1 30  ? 87.940  95.476  121.927 1.00 33.27 ? 30  ARG M C   1 
ATOM 11394 O O   . ARG M 1 30  ? 87.851  95.227  120.723 1.00 33.42 ? 30  ARG M O   1 
ATOM 11395 C CB  . ARG M 1 30  ? 90.075  94.695  122.985 1.00 33.43 ? 30  ARG M CB  1 
ATOM 11396 C CG  . ARG M 1 30  ? 91.422  95.000  123.635 1.00 33.49 ? 30  ARG M CG  1 
ATOM 11397 C CD  . ARG M 1 30  ? 92.380  95.751  122.718 1.00 33.56 ? 30  ARG M CD  1 
ATOM 11398 N NE  . ARG M 1 30  ? 93.586  96.198  123.419 1.00 33.57 ? 30  ARG M NE  1 
ATOM 11399 C CZ  . ARG M 1 30  ? 94.598  96.857  122.852 1.00 33.63 ? 30  ARG M CZ  1 
ATOM 11400 N NH1 . ARG M 1 30  ? 94.580  97.162  121.554 1.00 33.65 ? 30  ARG M NH1 1 
ATOM 11401 N NH2 . ARG M 1 30  ? 95.646  97.216  123.591 1.00 33.67 ? 30  ARG M NH2 1 
ATOM 11402 N N   . ALA M 1 31  ? 86.916  95.368  122.772 1.00 32.98 ? 31  ALA M N   1 
ATOM 11403 C CA  . ALA M 1 31  ? 85.548  95.120  122.312 1.00 32.87 ? 31  ALA M CA  1 
ATOM 11404 C C   . ALA M 1 31  ? 85.001  96.302  121.510 1.00 32.84 ? 31  ALA M C   1 
ATOM 11405 O O   . ALA M 1 31  ? 84.276  96.106  120.534 1.00 32.95 ? 31  ALA M O   1 
ATOM 11406 C CB  . ALA M 1 31  ? 84.640  94.821  123.493 1.00 32.90 ? 31  ALA M CB  1 
ATOM 11407 N N   . ASN M 1 32  ? 85.343  97.518  121.934 1.00 32.86 ? 32  ASN M N   1 
ATOM 11408 C CA  . ASN M 1 32  ? 84.984  98.741  121.204 1.00 32.92 ? 32  ASN M CA  1 
ATOM 11409 C C   . ASN M 1 32  ? 85.668  98.838  119.835 1.00 33.12 ? 32  ASN M C   1 
ATOM 11410 O O   . ASN M 1 32  ? 85.078  99.365  118.888 1.00 33.24 ? 32  ASN M O   1 
ATOM 11411 C CB  . ASN M 1 32  ? 85.316  99.992  122.034 1.00 32.83 ? 32  ASN M CB  1 
ATOM 11412 C CG  . ASN M 1 32  ? 84.400  100.173 123.237 1.00 32.76 ? 32  ASN M CG  1 
ATOM 11413 O OD1 . ASN M 1 32  ? 83.204  99.892  123.158 1.00 32.77 ? 32  ASN M OD1 1 
ATOM 11414 N ND2 . ASN M 1 32  ? 84.953  100.637 124.353 1.00 32.81 ? 32  ASN M ND2 1 
ATOM 11415 N N   . ASP M 1 33  ? 86.904  98.345  119.739 1.00 33.25 ? 33  ASP M N   1 
ATOM 11416 C CA  . ASP M 1 33  ? 87.617  98.262  118.455 1.00 33.42 ? 33  ASP M CA  1 
ATOM 11417 C C   . ASP M 1 33  ? 86.949  97.280  117.492 1.00 33.48 ? 33  ASP M C   1 
ATOM 11418 O O   . ASP M 1 33  ? 86.922  97.521  116.283 1.00 33.61 ? 33  ASP M O   1 
ATOM 11419 C CB  . ASP M 1 33  ? 89.081  97.849  118.661 1.00 33.64 ? 33  ASP M CB  1 
ATOM 11420 C CG  . ASP M 1 33  ? 89.901  98.898  119.399 1.00 33.90 ? 33  ASP M CG  1 
ATOM 11421 O OD1 . ASP M 1 33  ? 89.464  100.066 119.511 1.00 33.97 ? 33  ASP M OD1 1 
ATOM 11422 O OD2 . ASP M 1 33  ? 91.003  98.546  119.873 1.00 34.02 ? 33  ASP M OD2 1 
ATOM 11423 N N   . THR M 1 34  ? 86.427  96.178  118.031 1.00 33.41 ? 34  THR M N   1 
ATOM 11424 C CA  . THR M 1 34  ? 85.682  95.192  117.241 1.00 33.36 ? 34  THR M CA  1 
ATOM 11425 C C   . THR M 1 34  ? 84.396  95.779  116.648 1.00 33.33 ? 34  THR M C   1 
ATOM 11426 O O   . THR M 1 34  ? 84.021  95.429  115.531 1.00 33.44 ? 34  THR M O   1 
ATOM 11427 C CB  . THR M 1 34  ? 85.318  93.948  118.085 1.00 33.50 ? 34  THR M CB  1 
ATOM 11428 O OG1 . THR M 1 34  ? 86.466  93.513  118.824 1.00 33.50 ? 34  THR M OG1 1 
ATOM 11429 C CG2 . THR M 1 34  ? 84.822  92.804  117.200 1.00 33.60 ? 34  THR M CG2 1 
ATOM 11430 N N   . VAL M 1 35  ? 83.737  96.664  117.397 1.00 33.30 ? 35  VAL M N   1 
ATOM 11431 C CA  . VAL M 1 35  ? 82.528  97.359  116.926 1.00 33.32 ? 35  VAL M CA  1 
ATOM 11432 C C   . VAL M 1 35  ? 82.860  98.314  115.774 1.00 33.25 ? 35  VAL M C   1 
ATOM 11433 O O   . VAL M 1 35  ? 82.113  98.393  114.798 1.00 33.36 ? 35  VAL M O   1 
ATOM 11434 C CB  . VAL M 1 35  ? 81.824  98.129  118.076 1.00 33.52 ? 35  VAL M CB  1 
ATOM 11435 C CG1 . VAL M 1 35  ? 80.685  99.008  117.556 1.00 33.63 ? 35  VAL M CG1 1 
ATOM 11436 C CG2 . VAL M 1 35  ? 81.291  97.160  119.123 1.00 33.60 ? 35  VAL M CG2 1 
ATOM 11437 N N   . VAL M 1 36  ? 83.977  99.032  115.901 1.00 33.13 ? 36  VAL M N   1 
ATOM 11438 C CA  . VAL M 1 36  ? 84.439  99.962  114.864 1.00 33.03 ? 36  VAL M CA  1 
ATOM 11439 C C   . VAL M 1 36  ? 84.913  99.203  113.621 1.00 33.02 ? 36  VAL M C   1 
ATOM 11440 O O   . VAL M 1 36  ? 84.599  99.597  112.497 1.00 33.10 ? 36  VAL M O   1 
ATOM 11441 C CB  . VAL M 1 36  ? 85.568  100.886 115.387 1.00 33.02 ? 36  VAL M CB  1 
ATOM 11442 C CG1 . VAL M 1 36  ? 86.174  101.720 114.261 1.00 33.08 ? 36  VAL M CG1 1 
ATOM 11443 C CG2 . VAL M 1 36  ? 85.046  101.799 116.488 1.00 33.01 ? 36  VAL M CG2 1 
ATOM 11444 N N   . THR M 1 37  ? 85.672  98.127  113.834 1.00 33.06 ? 37  THR M N   1 
ATOM 11445 C CA  . THR M 1 37  ? 86.155  97.279  112.740 1.00 33.11 ? 37  THR M CA  1 
ATOM 11446 C C   . THR M 1 37  ? 85.007  96.576  112.010 1.00 33.10 ? 37  THR M C   1 
ATOM 11447 O O   . THR M 1 37  ? 85.033  96.467  110.784 1.00 33.26 ? 37  THR M O   1 
ATOM 11448 C CB  . THR M 1 37  ? 87.159  96.219  113.245 1.00 33.23 ? 37  THR M CB  1 
ATOM 11449 O OG1 . THR M 1 37  ? 88.200  96.858  113.996 1.00 33.31 ? 37  THR M OG1 1 
ATOM 11450 C CG2 . THR M 1 37  ? 87.782  95.443  112.081 1.00 33.28 ? 37  THR M CG2 1 
ATOM 11451 N N   . ALA M 1 38  ? 84.012  96.108  112.764 1.00 33.05 ? 38  ALA M N   1 
ATOM 11452 C CA  . ALA M 1 38  ? 82.830  95.457  112.186 1.00 33.10 ? 38  ALA M CA  1 
ATOM 11453 C C   . ALA M 1 38  ? 81.976  96.421  111.367 1.00 33.09 ? 38  ALA M C   1 
ATOM 11454 O O   . ALA M 1 38  ? 81.517  96.067  110.281 1.00 33.10 ? 38  ALA M O   1 
ATOM 11455 C CB  . ALA M 1 38  ? 81.985  94.812  113.277 1.00 33.16 ? 38  ALA M CB  1 
ATOM 11456 N N   . TYR M 1 39  ? 81.766  97.630  111.889 1.00 33.22 ? 39  TYR M N   1 
ATOM 11457 C CA  . TYR M 1 39  ? 80.966  98.649  111.200 1.00 33.27 ? 39  TYR M CA  1 
ATOM 11458 C C   . TYR M 1 39  ? 81.643  99.157  109.925 1.00 33.48 ? 39  TYR M C   1 
ATOM 11459 O O   . TYR M 1 39  ? 80.966  99.406  108.926 1.00 33.64 ? 39  TYR M O   1 
ATOM 11460 C CB  . TYR M 1 39  ? 80.648  99.827  112.126 1.00 33.19 ? 39  TYR M CB  1 
ATOM 11461 C CG  . TYR M 1 39  ? 79.557  100.726 111.586 1.00 33.27 ? 39  TYR M CG  1 
ATOM 11462 C CD1 . TYR M 1 39  ? 78.212  100.374 111.711 1.00 33.33 ? 39  TYR M CD1 1 
ATOM 11463 C CD2 . TYR M 1 39  ? 79.865  101.924 110.939 1.00 33.35 ? 39  TYR M CD2 1 
ATOM 11464 C CE1 . TYR M 1 39  ? 77.206  101.190 111.213 1.00 33.32 ? 39  TYR M CE1 1 
ATOM 11465 C CE2 . TYR M 1 39  ? 78.865  102.747 110.438 1.00 33.36 ? 39  TYR M CE2 1 
ATOM 11466 C CZ  . TYR M 1 39  ? 77.538  102.377 110.577 1.00 33.36 ? 39  TYR M CZ  1 
ATOM 11467 O OH  . TYR M 1 39  ? 76.545  103.191 110.083 1.00 33.46 ? 39  TYR M OH  1 
ATOM 11468 N N   . LEU M 1 40  ? 82.967  99.313  109.967 1.00 33.68 ? 40  LEU M N   1 
ATOM 11469 C CA  . LEU M 1 40  ? 83.750  99.647  108.769 1.00 33.88 ? 40  LEU M CA  1 
ATOM 11470 C C   . LEU M 1 40  ? 83.776  98.495  107.762 1.00 34.31 ? 40  LEU M C   1 
ATOM 11471 O O   . LEU M 1 40  ? 83.725  98.732  106.556 1.00 34.49 ? 40  LEU M O   1 
ATOM 11472 C CB  . LEU M 1 40  ? 85.182  100.051 109.135 1.00 33.80 ? 40  LEU M CB  1 
ATOM 11473 C CG  . LEU M 1 40  ? 85.350  101.411 109.816 1.00 33.73 ? 40  LEU M CG  1 
ATOM 11474 C CD1 . LEU M 1 40  ? 86.740  101.524 110.414 1.00 33.66 ? 40  LEU M CD1 1 
ATOM 11475 C CD2 . LEU M 1 40  ? 85.095  102.557 108.847 1.00 33.70 ? 40  LEU M CD2 1 
ATOM 11476 N N   . ASN M 1 41  ? 83.862  97.260  108.261 1.00 34.79 ? 41  ASN M N   1 
ATOM 11477 C CA  . ASN M 1 41  ? 83.777  96.066  107.410 1.00 35.15 ? 41  ASN M CA  1 
ATOM 11478 C C   . ASN M 1 41  ? 82.408  95.963  106.729 1.00 35.40 ? 41  ASN M C   1 
ATOM 11479 O O   . ASN M 1 41  ? 82.325  95.574  105.563 1.00 35.49 ? 41  ASN M O   1 
ATOM 11480 C CB  . ASN M 1 41  ? 84.062  94.796  108.225 1.00 35.34 ? 41  ASN M CB  1 
ATOM 11481 C CG  . ASN M 1 41  ? 84.144  93.545  107.363 1.00 35.61 ? 41  ASN M CG  1 
ATOM 11482 O OD1 . ASN M 1 41  ? 84.770  93.545  106.302 1.00 35.79 ? 41  ASN M OD1 1 
ATOM 11483 N ND2 . ASN M 1 41  ? 83.517  92.468  107.824 1.00 35.71 ? 41  ASN M ND2 1 
ATOM 11484 N N   . ASP M 1 42  ? 81.348  96.313  107.459 1.00 35.76 ? 42  ASP M N   1 
ATOM 11485 C CA  . ASP M 1 42  ? 79.999  96.414  106.886 1.00 36.04 ? 42  ASP M CA  1 
ATOM 11486 C C   . ASP M 1 42  ? 79.881  97.599  105.926 1.00 36.01 ? 42  ASP M C   1 
ATOM 11487 O O   . ASP M 1 42  ? 79.252  97.480  104.875 1.00 36.17 ? 42  ASP M O   1 
ATOM 11488 C CB  . ASP M 1 42  ? 78.935  96.536  107.989 1.00 36.32 ? 42  ASP M CB  1 
ATOM 11489 C CG  . ASP M 1 42  ? 78.798  95.269  108.827 1.00 36.66 ? 42  ASP M CG  1 
ATOM 11490 O OD1 . ASP M 1 42  ? 78.889  94.152  108.270 1.00 36.82 ? 42  ASP M OD1 1 
ATOM 11491 O OD2 . ASP M 1 42  ? 78.588  95.393  110.052 1.00 36.78 ? 42  ASP M OD2 1 
ATOM 11492 N N   . ALA M 1 43  ? 80.481  98.732  106.291 1.00 35.92 ? 43  ALA M N   1 
ATOM 11493 C CA  . ALA M 1 43  ? 80.485  99.934  105.445 1.00 35.94 ? 43  ALA M CA  1 
ATOM 11494 C C   . ALA M 1 43  ? 81.156  99.704  104.088 1.00 36.00 ? 43  ALA M C   1 
ATOM 11495 O O   . ALA M 1 43  ? 80.705  100.244 103.080 1.00 36.16 ? 43  ALA M O   1 
ATOM 11496 C CB  . ALA M 1 43  ? 81.154  101.094 106.169 1.00 35.95 ? 43  ALA M CB  1 
ATOM 11497 N N   . VAL M 1 44  ? 82.226  98.910  104.076 1.00 36.18 ? 44  VAL M N   1 
ATOM 11498 C CA  . VAL M 1 44  ? 82.921  98.534  102.834 1.00 36.35 ? 44  VAL M CA  1 
ATOM 11499 C C   . VAL M 1 44  ? 82.023  97.694  101.912 1.00 36.53 ? 44  VAL M C   1 
ATOM 11500 O O   . VAL M 1 44  ? 82.077  97.851  100.691 1.00 36.62 ? 44  VAL M O   1 
ATOM 11501 C CB  . VAL M 1 44  ? 84.257  97.795  103.137 1.00 36.45 ? 44  VAL M CB  1 
ATOM 11502 C CG1 . VAL M 1 44  ? 84.859  97.158  101.885 1.00 36.57 ? 44  VAL M CG1 1 
ATOM 11503 C CG2 . VAL M 1 44  ? 85.264  98.749  103.777 1.00 36.45 ? 44  VAL M CG2 1 
ATOM 11504 N N   . LYS M 1 45  ? 81.206  96.814  102.495 1.00 36.84 ? 45  LYS M N   1 
ATOM 11505 C CA  . LYS M 1 45  ? 80.283  95.972  101.720 1.00 37.12 ? 45  LYS M CA  1 
ATOM 11506 C C   . LYS M 1 45  ? 79.206  96.794  101.015 1.00 37.00 ? 45  LYS M C   1 
ATOM 11507 O O   . LYS M 1 45  ? 78.983  96.625  99.816  1.00 37.15 ? 45  LYS M O   1 
ATOM 11508 C CB  . LYS M 1 45  ? 79.628  94.906  102.609 1.00 37.49 ? 45  LYS M CB  1 
ATOM 11509 C CG  . LYS M 1 45  ? 80.595  93.850  103.125 1.00 37.82 ? 45  LYS M CG  1 
ATOM 11510 C CD  . LYS M 1 45  ? 80.006  93.059  104.284 1.00 38.10 ? 45  LYS M CD  1 
ATOM 11511 C CE  . LYS M 1 45  ? 81.038  92.127  104.899 1.00 38.33 ? 45  LYS M CE  1 
ATOM 11512 N NZ  . LYS M 1 45  ? 80.531  91.437  106.118 1.00 38.49 ? 45  LYS M NZ  1 
ATOM 11513 N N   . PHE M 1 46  ? 78.551  97.683  101.758 1.00 36.90 ? 46  PHE M N   1 
ATOM 11514 C CA  . PHE M 1 46  ? 77.502  98.545  101.193 1.00 36.84 ? 46  PHE M CA  1 
ATOM 11515 C C   . PHE M 1 46  ? 78.030  99.651  100.268 1.00 36.81 ? 46  PHE M C   1 
ATOM 11516 O O   . PHE M 1 46  ? 77.259  100.218 99.492  1.00 36.96 ? 46  PHE M O   1 
ATOM 11517 C CB  . PHE M 1 46  ? 76.617  99.130  102.300 1.00 36.83 ? 46  PHE M CB  1 
ATOM 11518 C CG  . PHE M 1 46  ? 75.669  98.129  102.896 1.00 36.90 ? 46  PHE M CG  1 
ATOM 11519 C CD1 . PHE M 1 46  ? 74.499  97.785  102.228 1.00 37.06 ? 46  PHE M CD1 1 
ATOM 11520 C CD2 . PHE M 1 46  ? 75.950  97.512  104.110 1.00 36.99 ? 46  PHE M CD2 1 
ATOM 11521 C CE1 . PHE M 1 46  ? 73.622  96.853  102.763 1.00 37.14 ? 46  PHE M CE1 1 
ATOM 11522 C CE2 . PHE M 1 46  ? 75.076  96.581  104.653 1.00 37.16 ? 46  PHE M CE2 1 
ATOM 11523 C CZ  . PHE M 1 46  ? 73.911  96.248  103.978 1.00 37.19 ? 46  PHE M CZ  1 
ATOM 11524 N N   . GLN M 1 47  ? 79.326  99.960  100.355 1.00 36.77 ? 47  GLN M N   1 
ATOM 11525 C CA  . GLN M 1 47  ? 79.991  100.806 99.354  1.00 36.82 ? 47  GLN M CA  1 
ATOM 11526 C C   . GLN M 1 47  ? 80.106  100.081 98.010  1.00 37.07 ? 47  GLN M C   1 
ATOM 11527 O O   . GLN M 1 47  ? 79.908  100.692 96.958  1.00 37.28 ? 47  GLN M O   1 
ATOM 11528 C CB  . GLN M 1 47  ? 81.381  101.254 99.830  1.00 36.79 ? 47  GLN M CB  1 
ATOM 11529 C CG  . GLN M 1 47  ? 81.359  102.386 100.849 1.00 36.85 ? 47  GLN M CG  1 
ATOM 11530 C CD  . GLN M 1 47  ? 81.279  103.767 100.219 1.00 36.98 ? 47  GLN M CD  1 
ATOM 11531 O OE1 . GLN M 1 47  ? 80.625  103.961 99.193  1.00 37.07 ? 47  GLN M OE1 1 
ATOM 11532 N NE2 . GLN M 1 47  ? 81.940  104.737 100.839 1.00 37.07 ? 47  GLN M NE2 1 
ATOM 11533 N N   . GLU M 1 48  ? 80.430  98.787  98.052  1.00 37.41 ? 48  GLU M N   1 
ATOM 11534 C CA  . GLU M 1 48  ? 80.475  97.947  96.847  1.00 37.74 ? 48  GLU M CA  1 
ATOM 11535 C C   . GLU M 1 48  ? 79.086  97.700  96.248  1.00 37.83 ? 48  GLU M C   1 
ATOM 11536 O O   . GLU M 1 48  ? 78.959  97.554  95.033  1.00 38.01 ? 48  GLU M O   1 
ATOM 11537 C CB  . GLU M 1 48  ? 81.162  96.604  97.134  1.00 38.07 ? 48  GLU M CB  1 
ATOM 11538 C CG  . GLU M 1 48  ? 82.645  96.707  97.474  1.00 38.39 ? 48  GLU M CG  1 
ATOM 11539 C CD  . GLU M 1 48  ? 83.517  97.076  96.282  1.00 38.68 ? 48  GLU M CD  1 
ATOM 11540 O OE1 . GLU M 1 48  ? 83.358  96.468  95.200  1.00 38.76 ? 48  GLU M OE1 1 
ATOM 11541 O OE2 . GLU M 1 48  ? 84.377  97.972  96.430  1.00 38.77 ? 48  GLU M OE2 1 
ATOM 11542 N N   . MET M 1 49  ? 78.058  97.640  97.095  1.00 37.94 ? 49  MET M N   1 
ATOM 11543 C CA  . MET M 1 49  ? 76.669  97.506  96.628  1.00 38.06 ? 49  MET M CA  1 
ATOM 11544 C C   . MET M 1 49  ? 76.160  98.773  95.933  1.00 37.98 ? 49  MET M C   1 
ATOM 11545 O O   . MET M 1 49  ? 75.391  98.683  94.974  1.00 38.26 ? 49  MET M O   1 
ATOM 11546 C CB  . MET M 1 49  ? 75.736  97.132  97.782  1.00 38.24 ? 49  MET M CB  1 
ATOM 11547 C CG  . MET M 1 49  ? 75.946  95.714  98.286  1.00 38.47 ? 49  MET M CG  1 
ATOM 11548 S SD  . MET M 1 49  ? 74.977  95.310  99.751  1.00 38.86 ? 49  MET M SD  1 
ATOM 11549 C CE  . MET M 1 49  ? 73.313  95.475  99.112  1.00 38.96 ? 49  MET M CE  1 
ATOM 11550 N N   . TYR M 1 50  ? 76.580  99.938  96.421  1.00 37.79 ? 50  TYR M N   1 
ATOM 11551 C CA  . TYR M 1 50  ? 76.275  101.214 95.764  1.00 37.80 ? 50  TYR M CA  1 
ATOM 11552 C C   . TYR M 1 50  ? 77.044  101.366 94.445  1.00 38.04 ? 50  TYR M C   1 
ATOM 11553 O O   . TYR M 1 50  ? 76.550  101.998 93.507  1.00 38.25 ? 50  TYR M O   1 
ATOM 11554 C CB  . TYR M 1 50  ? 76.592  102.389 96.694  1.00 37.76 ? 50  TYR M CB  1 
ATOM 11555 C CG  . TYR M 1 50  ? 75.948  103.695 96.283  1.00 37.79 ? 50  TYR M CG  1 
ATOM 11556 C CD1 . TYR M 1 50  ? 76.597  104.577 95.420  1.00 37.66 ? 50  TYR M CD1 1 
ATOM 11557 C CD2 . TYR M 1 50  ? 74.695  104.061 96.776  1.00 37.87 ? 50  TYR M CD2 1 
ATOM 11558 C CE1 . TYR M 1 50  ? 76.013  105.780 95.049  1.00 37.67 ? 50  TYR M CE1 1 
ATOM 11559 C CE2 . TYR M 1 50  ? 74.102  105.262 96.410  1.00 37.85 ? 50  TYR M CE2 1 
ATOM 11560 C CZ  . TYR M 1 50  ? 74.764  106.119 95.548  1.00 37.80 ? 50  TYR M CZ  1 
ATOM 11561 O OH  . TYR M 1 50  ? 74.181  107.310 95.180  1.00 37.98 ? 50  TYR M OH  1 
ATOM 11562 N N   . GLN M 1 51  ? 78.249  100.799 94.389  1.00 38.31 ? 51  GLN M N   1 
ATOM 11563 C CA  . GLN M 1 51  ? 79.054  100.753 93.160  1.00 38.55 ? 51  GLN M CA  1 
ATOM 11564 C C   . GLN M 1 51  ? 78.388  99.920  92.055  1.00 38.78 ? 51  GLN M C   1 
ATOM 11565 O O   . GLN M 1 51  ? 78.549  100.223 90.872  1.00 38.94 ? 51  GLN M O   1 
ATOM 11566 C CB  . GLN M 1 51  ? 80.458  100.204 93.468  1.00 38.73 ? 51  GLN M CB  1 
ATOM 11567 C CG  . GLN M 1 51  ? 81.475  100.295 92.335  1.00 38.88 ? 51  GLN M CG  1 
ATOM 11568 C CD  . GLN M 1 51  ? 81.877  101.718 91.996  1.00 38.88 ? 51  GLN M CD  1 
ATOM 11569 O OE1 . GLN M 1 51  ? 82.178  102.517 92.880  1.00 38.93 ? 51  GLN M OE1 1 
ATOM 11570 N NE2 . GLN M 1 51  ? 81.907  102.033 90.707  1.00 38.97 ? 51  GLN M NE2 1 
ATOM 11571 N N   . ILE M 1 52  ? 77.654  98.875  92.441  1.00 38.96 ? 52  ILE M N   1 
ATOM 11572 C CA  . ILE M 1 52  ? 76.873  98.067  91.492  1.00 39.19 ? 52  ILE M CA  1 
ATOM 11573 C C   . ILE M 1 52  ? 75.718  98.884  90.895  1.00 39.35 ? 52  ILE M C   1 
ATOM 11574 O O   . ILE M 1 52  ? 75.468  98.817  89.689  1.00 39.50 ? 52  ILE M O   1 
ATOM 11575 C CB  . ILE M 1 52  ? 76.339  96.766  92.148  1.00 39.24 ? 52  ILE M CB  1 
ATOM 11576 C CG1 . ILE M 1 52  ? 77.505  95.831  92.498  1.00 39.33 ? 52  ILE M CG1 1 
ATOM 11577 C CG2 . ILE M 1 52  ? 75.359  96.032  91.230  1.00 39.29 ? 52  ILE M CG2 1 
ATOM 11578 C CD1 . ILE M 1 52  ? 77.192  94.814  93.576  1.00 39.33 ? 52  ILE M CD1 1 
ATOM 11579 N N   . ASP M 1 53  ? 75.032  99.655  91.739  1.00 39.54 ? 53  ASP M N   1 
ATOM 11580 C CA  . ASP M 1 53  ? 73.868  100.438 91.313  1.00 39.77 ? 53  ASP M CA  1 
ATOM 11581 C C   . ASP M 1 53  ? 74.259  101.687 90.526  1.00 39.75 ? 53  ASP M C   1 
ATOM 11582 O O   . ASP M 1 53  ? 73.871  101.839 89.365  1.00 39.95 ? 53  ASP M O   1 
ATOM 11583 C CB  . ASP M 1 53  ? 73.019  100.841 92.526  1.00 40.03 ? 53  ASP M CB  1 
ATOM 11584 C CG  . ASP M 1 53  ? 72.428  99.645  93.257  1.00 40.34 ? 53  ASP M CG  1 
ATOM 11585 O OD1 . ASP M 1 53  ? 72.893  98.507  93.033  1.00 40.49 ? 53  ASP M OD1 1 
ATOM 11586 O OD2 . ASP M 1 53  ? 71.497  99.848  94.067  1.00 40.58 ? 53  ASP M OD2 1 
ATOM 11587 N N   . ASN M 1 54  ? 75.035  102.564 91.162  1.00 39.52 ? 54  ASN M N   1 
ATOM 11588 C CA  . ASN M 1 54  ? 75.309  103.910 90.641  1.00 39.56 ? 54  ASN M CA  1 
ATOM 11589 C C   . ASN M 1 54  ? 76.636  104.078 89.884  1.00 39.43 ? 54  ASN M C   1 
ATOM 11590 O O   . ASN M 1 54  ? 76.849  105.123 89.265  1.00 39.61 ? 54  ASN M O   1 
ATOM 11591 C CB  . ASN M 1 54  ? 75.260  104.926 91.788  1.00 39.76 ? 54  ASN M CB  1 
ATOM 11592 C CG  . ASN M 1 54  ? 73.890  105.015 92.434  1.00 39.96 ? 54  ASN M CG  1 
ATOM 11593 O OD1 . ASN M 1 54  ? 73.125  105.942 92.166  1.00 40.17 ? 54  ASN M OD1 1 
ATOM 11594 N ND2 . ASN M 1 54  ? 73.574  104.051 93.291  1.00 40.00 ? 54  ASN M ND2 1 
ATOM 11595 N N   . ASN M 1 55  ? 77.513  103.071 89.936  1.00 39.07 ? 55  ASN M N   1 
ATOM 11596 C CA  . ASN M 1 55  ? 78.867  103.141 89.351  1.00 38.83 ? 55  ASN M CA  1 
ATOM 11597 C C   . ASN M 1 55  ? 79.717  104.260 89.976  1.00 38.56 ? 55  ASN M C   1 
ATOM 11598 O O   . ASN M 1 55  ? 80.430  104.983 89.276  1.00 38.71 ? 55  ASN M O   1 
ATOM 11599 C CB  . ASN M 1 55  ? 78.813  103.276 87.818  1.00 39.00 ? 55  ASN M CB  1 
ATOM 11600 C CG  . ASN M 1 55  ? 77.900  102.251 87.167  1.00 39.27 ? 55  ASN M CG  1 
ATOM 11601 O OD1 . ASN M 1 55  ? 77.098  102.585 86.296  1.00 39.50 ? 55  ASN M OD1 1 
ATOM 11602 N ND2 . ASN M 1 55  ? 78.016  100.995 87.589  1.00 39.40 ? 55  ASN M ND2 1 
ATOM 11603 N N   . SER M 1 56  ? 79.631  104.382 91.300  1.00 38.22 ? 56  SER M N   1 
ATOM 11604 C CA  . SER M 1 56  ? 80.401  105.370 92.065  1.00 37.99 ? 56  SER M CA  1 
ATOM 11605 C C   . SER M 1 56  ? 80.397  105.006 93.552  1.00 37.53 ? 56  SER M C   1 
ATOM 11606 O O   . SER M 1 56  ? 79.776  104.019 93.950  1.00 37.69 ? 56  SER M O   1 
ATOM 11607 C CB  . SER M 1 56  ? 79.816  106.773 91.870  1.00 38.25 ? 56  SER M CB  1 
ATOM 11608 O OG  . SER M 1 56  ? 80.627  107.758 92.489  1.00 38.43 ? 56  SER M OG  1 
ATOM 11609 N N   . TYR M 1 57  ? 81.106  105.795 94.359  1.00 36.99 ? 57  TYR M N   1 
ATOM 11610 C CA  . TYR M 1 57  ? 81.119  105.630 95.817  1.00 36.72 ? 57  TYR M CA  1 
ATOM 11611 C C   . TYR M 1 57  ? 80.435  106.813 96.504  1.00 36.67 ? 57  TYR M C   1 
ATOM 11612 O O   . TYR M 1 57  ? 80.453  107.937 95.995  1.00 36.63 ? 57  TYR M O   1 
ATOM 11613 C CB  . TYR M 1 57  ? 82.551  105.469 96.329  1.00 36.60 ? 57  TYR M CB  1 
ATOM 11614 C CG  . TYR M 1 57  ? 83.188  104.147 95.956  1.00 36.53 ? 57  TYR M CG  1 
ATOM 11615 C CD1 . TYR M 1 57  ? 82.762  102.955 96.545  1.00 36.47 ? 57  TYR M CD1 1 
ATOM 11616 C CD2 . TYR M 1 57  ? 84.221  104.081 95.020  1.00 36.51 ? 57  TYR M CD2 1 
ATOM 11617 C CE1 . TYR M 1 57  ? 83.342  101.738 96.211  1.00 36.34 ? 57  TYR M CE1 1 
ATOM 11618 C CE2 . TYR M 1 57  ? 84.808  102.869 94.679  1.00 36.42 ? 57  TYR M CE2 1 
ATOM 11619 C CZ  . TYR M 1 57  ? 84.366  101.702 95.276  1.00 36.34 ? 57  TYR M CZ  1 
ATOM 11620 O OH  . TYR M 1 57  ? 84.942  100.498 94.944  1.00 36.45 ? 57  TYR M OH  1 
ATOM 11621 N N   . THR M 1 58  ? 79.843  106.544 97.666  1.00 36.59 ? 58  THR M N   1 
ATOM 11622 C CA  . THR M 1 58  ? 79.017  107.515 98.380  1.00 36.53 ? 58  THR M CA  1 
ATOM 11623 C C   . THR M 1 58  ? 79.840  108.433 99.274  1.00 36.66 ? 58  THR M C   1 
ATOM 11624 O O   . THR M 1 58  ? 80.700  107.967 100.024 1.00 36.84 ? 58  THR M O   1 
ATOM 11625 C CB  . THR M 1 58  ? 77.987  106.809 99.280  1.00 36.65 ? 58  THR M CB  1 
ATOM 11626 O OG1 . THR M 1 58  ? 78.663  105.927 100.187 1.00 36.58 ? 58  THR M OG1 1 
ATOM 11627 C CG2 . THR M 1 58  ? 77.016  106.010 98.445  1.00 36.74 ? 58  THR M CG2 1 
ATOM 11628 N N   . SER M 1 59  ? 79.559  109.732 99.196  1.00 36.78 ? 59  SER M N   1 
ATOM 11629 C CA  . SER M 1 59  ? 80.105  110.711 100.133 1.00 36.85 ? 59  SER M CA  1 
ATOM 11630 C C   . SER M 1 59  ? 79.262  110.735 101.409 1.00 36.82 ? 59  SER M C   1 
ATOM 11631 O O   . SER M 1 59  ? 79.809  110.745 102.511 1.00 36.81 ? 59  SER M O   1 
ATOM 11632 C CB  . SER M 1 59  ? 80.139  112.103 99.497  1.00 37.11 ? 59  SER M CB  1 
ATOM 11633 O OG  . SER M 1 59  ? 80.849  113.022 100.311 1.00 37.24 ? 59  SER M OG  1 
ATOM 11634 N N   . ASN M 1 60  ? 77.938  110.749 101.250 1.00 36.97 ? 60  ASN M N   1 
ATOM 11635 C CA  . ASN M 1 60  ? 77.005  110.771 102.389 1.00 37.22 ? 60  ASN M CA  1 
ATOM 11636 C C   . ASN M 1 60  ? 76.742  109.373 102.964 1.00 37.20 ? 60  ASN M C   1 
ATOM 11637 O O   . ASN M 1 60  ? 76.807  108.372 102.248 1.00 37.13 ? 60  ASN M O   1 
ATOM 11638 C CB  . ASN M 1 60  ? 75.678  111.452 102.006 1.00 37.35 ? 60  ASN M CB  1 
ATOM 11639 C CG  . ASN M 1 60  ? 74.850  110.638 101.021 1.00 37.43 ? 60  ASN M CG  1 
ATOM 11640 O OD1 . ASN M 1 60  ? 75.388  109.974 100.133 1.00 37.43 ? 60  ASN M OD1 1 
ATOM 11641 N ND2 . ASN M 1 60  ? 73.531  110.699 101.171 1.00 37.57 ? 60  ASN M ND2 1 
ATOM 11642 N N   . GLN M 1 61  ? 76.438  109.329 104.261 1.00 37.16 ? 61  GLN M N   1 
ATOM 11643 C CA  . GLN M 1 61  ? 76.153  108.078 104.970 1.00 37.02 ? 61  GLN M CA  1 
ATOM 11644 C C   . GLN M 1 61  ? 74.738  107.564 104.694 1.00 36.99 ? 61  GLN M C   1 
ATOM 11645 O O   . GLN M 1 61  ? 74.523  106.352 104.641 1.00 37.14 ? 61  GLN M O   1 
ATOM 11646 C CB  . GLN M 1 61  ? 76.345  108.269 106.478 1.00 37.12 ? 61  GLN M CB  1 
ATOM 11647 C CG  . GLN M 1 61  ? 76.421  106.969 107.272 1.00 37.21 ? 61  GLN M CG  1 
ATOM 11648 C CD  . GLN M 1 61  ? 76.446  107.189 108.773 1.00 37.24 ? 61  GLN M CD  1 
ATOM 11649 O OE1 . GLN M 1 61  ? 76.862  108.243 109.258 1.00 37.27 ? 61  GLN M OE1 1 
ATOM 11650 N NE2 . GLN M 1 61  ? 76.004  106.185 109.520 1.00 37.32 ? 61  GLN M NE2 1 
ATOM 11651 N N   . ALA M 1 62  ? 73.783  108.484 104.534 1.00 36.96 ? 62  ALA M N   1 
ATOM 11652 C CA  . ALA M 1 62  ? 72.372  108.139 104.288 1.00 36.85 ? 62  ALA M CA  1 
ATOM 11653 C C   . ALA M 1 62  ? 72.143  107.268 103.048 1.00 36.78 ? 62  ALA M C   1 
ATOM 11654 O O   . ALA M 1 62  ? 71.189  106.488 103.009 1.00 36.92 ? 62  ALA M O   1 
ATOM 11655 C CB  . ALA M 1 62  ? 71.530  109.405 104.194 1.00 36.91 ? 62  ALA M CB  1 
ATOM 11656 N N   . ALA M 1 63  ? 73.007  107.411 102.042 1.00 36.84 ? 63  ALA M N   1 
ATOM 11657 C CA  . ALA M 1 63  ? 72.977  106.555 100.851 1.00 36.91 ? 63  ALA M CA  1 
ATOM 11658 C C   . ALA M 1 63  ? 73.306  105.099 101.186 1.00 36.82 ? 63  ALA M C   1 
ATOM 11659 O O   . ALA M 1 63  ? 72.653  104.187 100.678 1.00 36.91 ? 63  ALA M O   1 
ATOM 11660 C CB  . ALA M 1 63  ? 73.936  107.081 99.792  1.00 37.01 ? 63  ALA M CB  1 
ATOM 11661 N N   . LEU M 1 64  ? 74.311  104.891 102.037 1.00 36.89 ? 64  LEU M N   1 
ATOM 11662 C CA  . LEU M 1 64  ? 74.690  103.546 102.493 1.00 37.01 ? 64  LEU M CA  1 
ATOM 11663 C C   . LEU M 1 64  ? 73.630  102.915 103.402 1.00 37.02 ? 64  LEU M C   1 
ATOM 11664 O O   . LEU M 1 64  ? 73.412  101.704 103.346 1.00 37.07 ? 64  LEU M O   1 
ATOM 11665 C CB  . LEU M 1 64  ? 76.036  103.575 103.227 1.00 37.12 ? 64  LEU M CB  1 
ATOM 11666 C CG  . LEU M 1 64  ? 77.261  104.044 102.436 1.00 37.29 ? 64  LEU M CG  1 
ATOM 11667 C CD1 . LEU M 1 64  ? 78.468  104.169 103.355 1.00 37.40 ? 64  LEU M CD1 1 
ATOM 11668 C CD2 . LEU M 1 64  ? 77.563  103.104 101.279 1.00 37.32 ? 64  LEU M CD2 1 
ATOM 11669 N N   . ILE M 1 65  ? 72.985  103.739 104.229 1.00 37.10 ? 65  ILE M N   1 
ATOM 11670 C CA  . ILE M 1 65  ? 71.933  103.273 105.144 1.00 37.16 ? 65  ILE M CA  1 
ATOM 11671 C C   . ILE M 1 65  ? 70.669  102.863 104.374 1.00 37.20 ? 65  ILE M C   1 
ATOM 11672 O O   . ILE M 1 65  ? 70.003  101.894 104.749 1.00 37.29 ? 65  ILE M O   1 
ATOM 11673 C CB  . ILE M 1 65  ? 71.593  104.336 106.225 1.00 37.23 ? 65  ILE M CB  1 
ATOM 11674 C CG1 . ILE M 1 65  ? 72.817  104.612 107.112 1.00 37.33 ? 65  ILE M CG1 1 
ATOM 11675 C CG2 . ILE M 1 65  ? 70.422  103.886 107.100 1.00 37.26 ? 65  ILE M CG2 1 
ATOM 11676 C CD1 . ILE M 1 65  ? 72.725  105.890 107.921 1.00 37.48 ? 65  ILE M CD1 1 
ATOM 11677 N N   . SER M 1 66  ? 70.348  103.597 103.308 1.00 37.26 ? 66  SER M N   1 
ATOM 11678 C CA  . SER M 1 66  ? 69.193  103.286 102.455 1.00 37.39 ? 66  SER M CA  1 
ATOM 11679 C C   . SER M 1 66  ? 69.305  101.919 101.767 1.00 37.52 ? 66  SER M C   1 
ATOM 11680 O O   . SER M 1 66  ? 68.301  101.222 101.607 1.00 37.55 ? 66  SER M O   1 
ATOM 11681 C CB  . SER M 1 66  ? 68.994  104.380 101.400 1.00 37.37 ? 66  SER M CB  1 
ATOM 11682 O OG  . SER M 1 66  ? 67.782  104.196 100.687 1.00 37.36 ? 66  SER M OG  1 
ATOM 11683 N N   . LEU M 1 67  ? 70.521  101.548 101.364 1.00 37.78 ? 67  LEU M N   1 
ATOM 11684 C CA  . LEU M 1 67  ? 70.780  100.230 100.758 1.00 38.04 ? 67  LEU M CA  1 
ATOM 11685 C C   . LEU M 1 67  ? 70.602  99.058  101.733 1.00 38.13 ? 67  LEU M C   1 
ATOM 11686 O O   . LEU M 1 67  ? 70.207  97.968  101.311 1.00 38.34 ? 67  LEU M O   1 
ATOM 11687 C CB  . LEU M 1 67  ? 72.178  100.170 100.115 1.00 38.16 ? 67  LEU M CB  1 
ATOM 11688 C CG  . LEU M 1 67  ? 72.251  100.511 98.622  1.00 38.40 ? 67  LEU M CG  1 
ATOM 11689 C CD1 . LEU M 1 67  ? 71.849  101.950 98.330  1.00 38.45 ? 67  LEU M CD1 1 
ATOM 11690 C CD2 . LEU M 1 67  ? 73.651  100.237 98.096  1.00 38.59 ? 67  LEU M CD2 1 
ATOM 11691 N N   . GLY M 1 68  ? 70.883  99.281  103.019 1.00 37.98 ? 68  GLY M N   1 
ATOM 11692 C CA  . GLY M 1 68  ? 70.784  98.219  104.030 1.00 37.88 ? 68  GLY M CA  1 
ATOM 11693 C C   . GLY M 1 68  ? 71.645  98.345  105.279 1.00 37.72 ? 68  GLY M C   1 
ATOM 11694 O O   . GLY M 1 68  ? 71.339  97.710  106.291 1.00 37.88 ? 68  GLY M O   1 
ATOM 11695 N N   . LEU M 1 69  ? 72.728  99.126  105.216 1.00 37.46 ? 69  LEU M N   1 
ATOM 11696 C CA  . LEU M 1 69  ? 73.614  99.349  106.372 1.00 37.38 ? 69  LEU M CA  1 
ATOM 11697 C C   . LEU M 1 69  ? 72.854  99.887  107.587 1.00 37.38 ? 69  LEU M C   1 
ATOM 11698 O O   . LEU M 1 69  ? 71.895  100.650 107.444 1.00 37.44 ? 69  LEU M O   1 
ATOM 11699 C CB  . LEU M 1 69  ? 74.744  100.323 106.008 1.00 37.38 ? 69  LEU M CB  1 
ATOM 11700 C CG  . LEU M 1 69  ? 75.859  100.581 107.031 1.00 37.33 ? 69  LEU M CG  1 
ATOM 11701 C CD1 . LEU M 1 69  ? 76.676  99.328  107.310 1.00 37.36 ? 69  LEU M CD1 1 
ATOM 11702 C CD2 . LEU M 1 69  ? 76.767  101.700 106.543 1.00 37.37 ? 69  LEU M CD2 1 
ATOM 11703 N N   . LYS M 1 70  ? 73.295  99.486  108.778 1.00 37.37 ? 70  LYS M N   1 
ATOM 11704 C CA  . LYS M 1 70  ? 72.676  99.921  110.031 1.00 37.30 ? 70  LYS M CA  1 
ATOM 11705 C C   . LYS M 1 70  ? 73.042  101.367 110.355 1.00 37.09 ? 70  LYS M C   1 
ATOM 11706 O O   . LYS M 1 70  ? 73.940  101.947 109.738 1.00 37.05 ? 70  LYS M O   1 
ATOM 11707 C CB  . LYS M 1 70  ? 73.106  99.017  111.192 1.00 37.51 ? 70  LYS M CB  1 
ATOM 11708 C CG  . LYS M 1 70  ? 72.698  97.561  111.042 1.00 37.82 ? 70  LYS M CG  1 
ATOM 11709 C CD  . LYS M 1 70  ? 72.997  96.776  112.311 1.00 38.07 ? 70  LYS M CD  1 
ATOM 11710 C CE  . LYS M 1 70  ? 72.562  95.323  112.195 1.00 38.26 ? 70  LYS M CE  1 
ATOM 11711 N NZ  . LYS M 1 70  ? 73.352  94.565  111.182 1.00 38.34 ? 70  LYS M NZ  1 
ATOM 11712 N N   . SER M 1 71  ? 72.338  101.940 111.329 1.00 36.84 ? 71  SER M N   1 
ATOM 11713 C CA  . SER M 1 71  ? 72.660  103.273 111.845 1.00 36.56 ? 71  SER M CA  1 
ATOM 11714 C C   . SER M 1 71  ? 73.991  103.237 112.594 1.00 36.24 ? 71  SER M C   1 
ATOM 11715 O O   . SER M 1 71  ? 74.451  102.166 113.004 1.00 36.23 ? 71  SER M O   1 
ATOM 11716 C CB  . SER M 1 71  ? 71.552  103.774 112.774 1.00 36.59 ? 71  SER M CB  1 
ATOM 11717 O OG  . SER M 1 71  ? 70.308  103.834 112.100 1.00 36.60 ? 71  SER M OG  1 
ATOM 11718 N N   . THR M 1 72  ? 74.604  104.408 112.765 1.00 35.94 ? 72  THR M N   1 
ATOM 11719 C CA  . THR M 1 72  ? 75.898  104.518 113.443 1.00 35.78 ? 72  THR M CA  1 
ATOM 11720 C C   . THR