data_6XYU
# 
_entry.id   6XYU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.342 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6XYU         
WWPDB D_1292106560 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2020-03-18 
_pdbx_database_PDB_obs_spr.pdb_id           6XYU 
_pdbx_database_PDB_obs_spr.replace_pdb_id   1QON 
_pdbx_database_PDB_obs_spr.details          ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB 'earlier model'  1qon re-refinement 
PDB 'native protein' 6xys unspecified   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6XYU 
_pdbx_database_status.recvd_initial_deposition_date   2020-01-31 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Nachon, F.'    1 0000-0003-0293-2429 
'Sussman, J.L.' 2 0000-0003-0306-3878 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   CH 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Molecules 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1420-3049 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            25 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
;A Second Look at the Crystal Structures ofDrosophila melanogasterAcetylcholinesterase in Complex with Tacrine Derivatives Provides Insights Concerning Catalytic Intermediates and the Design of Specific Insecticides.
;
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.3390/molecules25051198 
_citation.pdbx_database_id_PubMed   32155891 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Nachon, F.'       1 0000-0003-0293-2429 
primary 'Rosenberry, T.L.' 2 0000-0003-3579-7681 
primary 'Silman, I.'       3 ?                   
primary 'Sussman, J.L.'    4 0000-0003-0306-3878 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6XYU 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     94.910 
_cell.length_a_esd                 ? 
_cell.length_b                     94.910 
_cell.length_b_esd                 ? 
_cell.length_c                     160.040 
_cell.length_c_esd                 ? 
_cell.volume                       1441625.612 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6XYU 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            'P 4nw 2abw' 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Acetylcholinesterase 64654.270 1   3.1.1.7 ? ? ? 
2 branched    man 
'beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 586.542   1   
?       ? ? ? 
3 non-polymer syn '9-(3-IODOBENZYLAMINO)-1,2,3,4-TETRAHYDROACRIDINE' 414.283   1   ?       ? ? ? 
4 non-polymer syn 'IODIDE ION' 126.904   1   ?       ? ? ? 
5 water       nat water 18.015    154 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;VIDRLVVQTSSGPVRGRSVTVQGREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATGLSATCVQERYEYFPGFSGE
EIWNPNTNVSEDCLYINVWAPAKARLRHGRGANGGEHPNGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLD
IYNADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQALAIRWLKDNAHAFGGNPEWMTLFGESAG
SSSVNAQLMSPVTRGLVKRGMMQSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVDAKTISVQQ
WNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMGNVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNI
FGKATQAEREAIIFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYYFTHRTSTSLWGEWMGVLH
GDEIEYFFGQPLNNSLQYRPVERELGKRMLSAVIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARC
SFWNDYLPKVRSWAGTCDGDS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;VIDRLVVQTSSGPVRGRSVTVQGREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATGLSATCVQERYEYFPGFSGE
EIWNPNTNVSEDCLYINVWAPAKARLRHGRGANGGEHPNGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLD
IYNADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQALAIRWLKDNAHAFGGNPEWMTLFGESAG
SSSVNAQLMSPVTRGLVKRGMMQSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVDAKTISVQQ
WNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMGNVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNI
FGKATQAEREAIIFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYYFTHRTSTSLWGEWMGVLH
GDEIEYFFGQPLNNSLQYRPVERELGKRMLSAVIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARC
SFWNDYLPKVRSWAGTCDGDS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   ILE n 
1 3   ASP n 
1 4   ARG n 
1 5   LEU n 
1 6   VAL n 
1 7   VAL n 
1 8   GLN n 
1 9   THR n 
1 10  SER n 
1 11  SER n 
1 12  GLY n 
1 13  PRO n 
1 14  VAL n 
1 15  ARG n 
1 16  GLY n 
1 17  ARG n 
1 18  SER n 
1 19  VAL n 
1 20  THR n 
1 21  VAL n 
1 22  GLN n 
1 23  GLY n 
1 24  ARG n 
1 25  GLU n 
1 26  VAL n 
1 27  HIS n 
1 28  VAL n 
1 29  TYR n 
1 30  THR n 
1 31  GLY n 
1 32  ILE n 
1 33  PRO n 
1 34  TYR n 
1 35  ALA n 
1 36  LYS n 
1 37  PRO n 
1 38  PRO n 
1 39  VAL n 
1 40  GLU n 
1 41  ASP n 
1 42  LEU n 
1 43  ARG n 
1 44  PHE n 
1 45  ARG n 
1 46  LYS n 
1 47  PRO n 
1 48  VAL n 
1 49  PRO n 
1 50  ALA n 
1 51  GLU n 
1 52  PRO n 
1 53  TRP n 
1 54  HIS n 
1 55  GLY n 
1 56  VAL n 
1 57  LEU n 
1 58  ASP n 
1 59  ALA n 
1 60  THR n 
1 61  GLY n 
1 62  LEU n 
1 63  SER n 
1 64  ALA n 
1 65  THR n 
1 66  CYS n 
1 67  VAL n 
1 68  GLN n 
1 69  GLU n 
1 70  ARG n 
1 71  TYR n 
1 72  GLU n 
1 73  TYR n 
1 74  PHE n 
1 75  PRO n 
1 76  GLY n 
1 77  PHE n 
1 78  SER n 
1 79  GLY n 
1 80  GLU n 
1 81  GLU n 
1 82  ILE n 
1 83  TRP n 
1 84  ASN n 
1 85  PRO n 
1 86  ASN n 
1 87  THR n 
1 88  ASN n 
1 89  VAL n 
1 90  SER n 
1 91  GLU n 
1 92  ASP n 
1 93  CYS n 
1 94  LEU n 
1 95  TYR n 
1 96  ILE n 
1 97  ASN n 
1 98  VAL n 
1 99  TRP n 
1 100 ALA n 
1 101 PRO n 
1 102 ALA n 
1 103 LYS n 
1 104 ALA n 
1 105 ARG n 
1 106 LEU n 
1 107 ARG n 
1 108 HIS n 
1 109 GLY n 
1 110 ARG n 
1 111 GLY n 
1 112 ALA n 
1 113 ASN n 
1 114 GLY n 
1 115 GLY n 
1 116 GLU n 
1 117 HIS n 
1 118 PRO n 
1 119 ASN n 
1 120 GLY n 
1 121 LYS n 
1 122 GLN n 
1 123 ALA n 
1 124 ASP n 
1 125 THR n 
1 126 ASP n 
1 127 HIS n 
1 128 LEU n 
1 129 ILE n 
1 130 HIS n 
1 131 ASN n 
1 132 GLY n 
1 133 ASN n 
1 134 PRO n 
1 135 GLN n 
1 136 ASN n 
1 137 THR n 
1 138 THR n 
1 139 ASN n 
1 140 GLY n 
1 141 LEU n 
1 142 PRO n 
1 143 ILE n 
1 144 LEU n 
1 145 ILE n 
1 146 TRP n 
1 147 ILE n 
1 148 TYR n 
1 149 GLY n 
1 150 GLY n 
1 151 GLY n 
1 152 PHE n 
1 153 MET n 
1 154 THR n 
1 155 GLY n 
1 156 SER n 
1 157 ALA n 
1 158 THR n 
1 159 LEU n 
1 160 ASP n 
1 161 ILE n 
1 162 TYR n 
1 163 ASN n 
1 164 ALA n 
1 165 ASP n 
1 166 ILE n 
1 167 MET n 
1 168 ALA n 
1 169 ALA n 
1 170 VAL n 
1 171 GLY n 
1 172 ASN n 
1 173 VAL n 
1 174 ILE n 
1 175 VAL n 
1 176 ALA n 
1 177 SER n 
1 178 PHE n 
1 179 GLN n 
1 180 TYR n 
1 181 ARG n 
1 182 VAL n 
1 183 GLY n 
1 184 ALA n 
1 185 PHE n 
1 186 GLY n 
1 187 PHE n 
1 188 LEU n 
1 189 HIS n 
1 190 LEU n 
1 191 ALA n 
1 192 PRO n 
1 193 GLU n 
1 194 MET n 
1 195 PRO n 
1 196 SER n 
1 197 GLU n 
1 198 PHE n 
1 199 ALA n 
1 200 GLU n 
1 201 GLU n 
1 202 ALA n 
1 203 PRO n 
1 204 GLY n 
1 205 ASN n 
1 206 VAL n 
1 207 GLY n 
1 208 LEU n 
1 209 TRP n 
1 210 ASP n 
1 211 GLN n 
1 212 ALA n 
1 213 LEU n 
1 214 ALA n 
1 215 ILE n 
1 216 ARG n 
1 217 TRP n 
1 218 LEU n 
1 219 LYS n 
1 220 ASP n 
1 221 ASN n 
1 222 ALA n 
1 223 HIS n 
1 224 ALA n 
1 225 PHE n 
1 226 GLY n 
1 227 GLY n 
1 228 ASN n 
1 229 PRO n 
1 230 GLU n 
1 231 TRP n 
1 232 MET n 
1 233 THR n 
1 234 LEU n 
1 235 PHE n 
1 236 GLY n 
1 237 GLU n 
1 238 SER n 
1 239 ALA n 
1 240 GLY n 
1 241 SER n 
1 242 SER n 
1 243 SER n 
1 244 VAL n 
1 245 ASN n 
1 246 ALA n 
1 247 GLN n 
1 248 LEU n 
1 249 MET n 
1 250 SER n 
1 251 PRO n 
1 252 VAL n 
1 253 THR n 
1 254 ARG n 
1 255 GLY n 
1 256 LEU n 
1 257 VAL n 
1 258 LYS n 
1 259 ARG n 
1 260 GLY n 
1 261 MET n 
1 262 MET n 
1 263 GLN n 
1 264 SER n 
1 265 GLY n 
1 266 THR n 
1 267 MET n 
1 268 ASN n 
1 269 ALA n 
1 270 PRO n 
1 271 TRP n 
1 272 SER n 
1 273 HIS n 
1 274 MET n 
1 275 THR n 
1 276 SER n 
1 277 GLU n 
1 278 LYS n 
1 279 ALA n 
1 280 VAL n 
1 281 GLU n 
1 282 ILE n 
1 283 GLY n 
1 284 LYS n 
1 285 ALA n 
1 286 LEU n 
1 287 ILE n 
1 288 ASN n 
1 289 ASP n 
1 290 CYS n 
1 291 ASN n 
1 292 CYS n 
1 293 ASN n 
1 294 ALA n 
1 295 SER n 
1 296 MET n 
1 297 LEU n 
1 298 LYS n 
1 299 THR n 
1 300 ASN n 
1 301 PRO n 
1 302 ALA n 
1 303 HIS n 
1 304 VAL n 
1 305 MET n 
1 306 SER n 
1 307 CYS n 
1 308 MET n 
1 309 ARG n 
1 310 SER n 
1 311 VAL n 
1 312 ASP n 
1 313 ALA n 
1 314 LYS n 
1 315 THR n 
1 316 ILE n 
1 317 SER n 
1 318 VAL n 
1 319 GLN n 
1 320 GLN n 
1 321 TRP n 
1 322 ASN n 
1 323 SER n 
1 324 TYR n 
1 325 SER n 
1 326 GLY n 
1 327 ILE n 
1 328 LEU n 
1 329 SER n 
1 330 PHE n 
1 331 PRO n 
1 332 SER n 
1 333 ALA n 
1 334 PRO n 
1 335 THR n 
1 336 ILE n 
1 337 ASP n 
1 338 GLY n 
1 339 ALA n 
1 340 PHE n 
1 341 LEU n 
1 342 PRO n 
1 343 ALA n 
1 344 ASP n 
1 345 PRO n 
1 346 MET n 
1 347 THR n 
1 348 LEU n 
1 349 MET n 
1 350 LYS n 
1 351 THR n 
1 352 ALA n 
1 353 ASP n 
1 354 LEU n 
1 355 LYS n 
1 356 ASP n 
1 357 TYR n 
1 358 ASP n 
1 359 ILE n 
1 360 LEU n 
1 361 MET n 
1 362 GLY n 
1 363 ASN n 
1 364 VAL n 
1 365 ARG n 
1 366 ASP n 
1 367 GLU n 
1 368 GLY n 
1 369 THR n 
1 370 TYR n 
1 371 PHE n 
1 372 LEU n 
1 373 LEU n 
1 374 TYR n 
1 375 ASP n 
1 376 PHE n 
1 377 ILE n 
1 378 ASP n 
1 379 TYR n 
1 380 PHE n 
1 381 ASP n 
1 382 LYS n 
1 383 ASP n 
1 384 ASP n 
1 385 ALA n 
1 386 THR n 
1 387 ALA n 
1 388 LEU n 
1 389 PRO n 
1 390 ARG n 
1 391 ASP n 
1 392 LYS n 
1 393 TYR n 
1 394 LEU n 
1 395 GLU n 
1 396 ILE n 
1 397 MET n 
1 398 ASN n 
1 399 ASN n 
1 400 ILE n 
1 401 PHE n 
1 402 GLY n 
1 403 LYS n 
1 404 ALA n 
1 405 THR n 
1 406 GLN n 
1 407 ALA n 
1 408 GLU n 
1 409 ARG n 
1 410 GLU n 
1 411 ALA n 
1 412 ILE n 
1 413 ILE n 
1 414 PHE n 
1 415 GLN n 
1 416 TYR n 
1 417 THR n 
1 418 SER n 
1 419 TRP n 
1 420 GLU n 
1 421 GLY n 
1 422 ASN n 
1 423 PRO n 
1 424 GLY n 
1 425 TYR n 
1 426 GLN n 
1 427 ASN n 
1 428 GLN n 
1 429 GLN n 
1 430 GLN n 
1 431 ILE n 
1 432 GLY n 
1 433 ARG n 
1 434 ALA n 
1 435 VAL n 
1 436 GLY n 
1 437 ASP n 
1 438 HIS n 
1 439 PHE n 
1 440 PHE n 
1 441 THR n 
1 442 CYS n 
1 443 PRO n 
1 444 THR n 
1 445 ASN n 
1 446 GLU n 
1 447 TYR n 
1 448 ALA n 
1 449 GLN n 
1 450 ALA n 
1 451 LEU n 
1 452 ALA n 
1 453 GLU n 
1 454 ARG n 
1 455 GLY n 
1 456 ALA n 
1 457 SER n 
1 458 VAL n 
1 459 HIS n 
1 460 TYR n 
1 461 TYR n 
1 462 TYR n 
1 463 PHE n 
1 464 THR n 
1 465 HIS n 
1 466 ARG n 
1 467 THR n 
1 468 SER n 
1 469 THR n 
1 470 SER n 
1 471 LEU n 
1 472 TRP n 
1 473 GLY n 
1 474 GLU n 
1 475 TRP n 
1 476 MET n 
1 477 GLY n 
1 478 VAL n 
1 479 LEU n 
1 480 HIS n 
1 481 GLY n 
1 482 ASP n 
1 483 GLU n 
1 484 ILE n 
1 485 GLU n 
1 486 TYR n 
1 487 PHE n 
1 488 PHE n 
1 489 GLY n 
1 490 GLN n 
1 491 PRO n 
1 492 LEU n 
1 493 ASN n 
1 494 ASN n 
1 495 SER n 
1 496 LEU n 
1 497 GLN n 
1 498 TYR n 
1 499 ARG n 
1 500 PRO n 
1 501 VAL n 
1 502 GLU n 
1 503 ARG n 
1 504 GLU n 
1 505 LEU n 
1 506 GLY n 
1 507 LYS n 
1 508 ARG n 
1 509 MET n 
1 510 LEU n 
1 511 SER n 
1 512 ALA n 
1 513 VAL n 
1 514 ILE n 
1 515 GLU n 
1 516 PHE n 
1 517 ALA n 
1 518 LYS n 
1 519 THR n 
1 520 GLY n 
1 521 ASN n 
1 522 PRO n 
1 523 ALA n 
1 524 GLN n 
1 525 ASP n 
1 526 GLY n 
1 527 GLU n 
1 528 GLU n 
1 529 TRP n 
1 530 PRO n 
1 531 ASN n 
1 532 PHE n 
1 533 SER n 
1 534 LYS n 
1 535 GLU n 
1 536 ASP n 
1 537 PRO n 
1 538 VAL n 
1 539 TYR n 
1 540 TYR n 
1 541 ILE n 
1 542 PHE n 
1 543 SER n 
1 544 THR n 
1 545 ASP n 
1 546 ASP n 
1 547 LYS n 
1 548 ILE n 
1 549 GLU n 
1 550 LYS n 
1 551 LEU n 
1 552 ALA n 
1 553 ARG n 
1 554 GLY n 
1 555 PRO n 
1 556 LEU n 
1 557 ALA n 
1 558 ALA n 
1 559 ARG n 
1 560 CYS n 
1 561 SER n 
1 562 PHE n 
1 563 TRP n 
1 564 ASN n 
1 565 ASP n 
1 566 TYR n 
1 567 LEU n 
1 568 PRO n 
1 569 LYS n 
1 570 VAL n 
1 571 ARG n 
1 572 SER n 
1 573 TRP n 
1 574 ALA n 
1 575 GLY n 
1 576 THR n 
1 577 CYS n 
1 578 ASP n 
1 579 GLY n 
1 580 ASP n 
1 581 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   581 
_entity_src_gen.gene_src_common_name               'Fruit fly' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'Ace, CG17907' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Drosophila melanogaster' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     7227 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Drosophila melanogaster' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7227 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            'SCHNEIDER LINE 2' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          'PLASMID DNA' 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'S2-SEC 1/3' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_DROME 
_struct_ref.pdbx_db_accession          P07140 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;VIDRLVVQTSSGPVRGRSVTVQGREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATGLSATCVQERYEYFPGFSGE
EIWNPNTNVSEDCLYINVWAPAKARLRHGRGANGGEHPNGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLD
IYNADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQALAIRWLKDNAHAFGGNPEWMTLFGESAG
SSSVNAQLMSPVTRGLVKRGMMQSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVDAKTISVQQ
WNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMGNVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNI
FGKATQAEREAIIFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYYFTHRTSTSLWGEWMGVLH
GDEIEYFFGQPLNNSLQYRPVERELGKRMLSAVIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARC
SFWNDYLPKVRSWAGTCDGDS
;
_struct_ref.pdbx_align_begin           39 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6XYU 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 581 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P07140 
_struct_ref_seq.db_align_beg                  39 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  619 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       581 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                            ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                           ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                         ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                    ? 'C4 H7 N O4'     133.103 
BMA 'D-saccharide, beta linking' . beta-D-mannopyranose                               'beta-D-mannose; D-mannose; mannose' 
'C6 H12 O6'      180.156 
CYS 'L-peptide linking'          y CYSTEINE                                           ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                          ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                    ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                            ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                          ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                              ? 'H2 O'           18.015  
I40 non-polymer                  . '9-(3-IODOBENZYLAMINO)-1,2,3,4-TETRAHYDROACRIDINE' ? 'C20 H19 I N2'   414.283 
ILE 'L-peptide linking'          y ISOLEUCINE                                         ? 'C6 H13 N O2'    131.173 
IOD non-polymer                  . 'IODIDE ION'                                       ? 'I -1'           126.904 
LEU 'L-peptide linking'          y LEUCINE                                            ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                             ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                                         ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose           
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                                      ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                            ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                             ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                          ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                         ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                           ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                             ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6XYU 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.78 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         55.68 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              4.6 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '13% MPEG2000, 0.1 M ammonium sulfate, 0.03 M leucine, 0.1 M acetate, pH 4.6' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     'IMAGE PLATE' 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MAR scanner 345 mm plate' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         1998-01-19 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ELETTRA BEAMLINE 5.2R' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   5.2R 
_diffrn_source.pdbx_synchrotron_site       ELETTRA 
# 
_reflns.B_iso_Wilson_estimate            52.05 
_reflns.entry_id                         6XYU 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.51 
_reflns.d_resolution_low                 42.45 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       24909 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             96.64 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  2.8 
_reflns.pdbx_Rmerge_I_obs                0.0635 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            10.97 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.0766 
_reflns.pdbx_Rpim_I_all                  0.0412 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.997 
_reflns.pdbx_CC_star                     0.999 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.51 
_reflns_shell.d_res_low                   2.6 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.68 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           2458 
_reflns_shell.percent_possible_all        98.40 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.519 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             2.8 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             0.638 
_reflns_shell.pdbx_Rpim_I_all             0.358 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.763 
_reflns_shell.pdbx_CC_star                0.93 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               66.71 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6XYU 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.51 
_refine.ls_d_res_low                             42.45 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     24877 
_refine.ls_number_reflns_R_free                  870 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    96.68 
_refine.ls_percent_reflns_R_free                 3.50 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1882 
_refine.ls_R_factor_R_free                       0.2523 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1858 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.36 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1qon 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 31.4005 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.3755 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.51 
_refine_hist.d_res_low                        42.45 
_refine_hist.number_atoms_solvent             154 
_refine_hist.number_atoms_total               4447 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        4293 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.0081 ? 4419 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.9644 ? 6020 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.0551 ? 634  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.0077 ? 781  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 5.1624 ? 2573 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.51 2.67  . . 144 3949 97.78 . . . 0.3970 . 0.3194 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.67 2.87  . . 146 4031 98.96 . . . 0.3271 . 0.2736 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.87 3.16  . . 147 4045 99.24 . . . 0.3120 . 0.2307 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.16 3.62  . . 145 4024 97.86 . . . 0.2596 . 0.1816 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.62 4.56  . . 144 3971 95.59 . . . 0.2142 . 0.1563 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.56 42.45 . . 144 3987 91.09 . . . 0.2201 . 0.1538 . . . . . . . . . . . 
# 
_struct.entry_id                     6XYU 
_struct.title                        
'Update of AChE from Drosophila Melanogaster complex with tacrine derivative 9-(3-iodobenzylamino)-1,2,3,4-tetrahydroacridine' 
_struct.pdbx_descriptor              'Acetylcholinesterase (E.C.3.1.1.7)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6XYU 
_struct_keywords.text            'acetylcholinesterase, insect, inhibitor, complex, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 VAL A 39  ? ARG A 43  ? VAL A 39  ARG A 43  5 ? 5  
HELX_P HELX_P2  AA2 PHE A 77  ? ILE A 82  ? PHE A 77  ILE A 82  1 ? 6  
HELX_P HELX_P3  AA3 LEU A 159 ? ASN A 163 ? LEU A 159 ASN A 163 5 ? 5  
HELX_P HELX_P4  AA4 ALA A 164 ? ASN A 172 ? ALA A 164 ASN A 172 1 ? 9  
HELX_P HELX_P5  AA5 VAL A 182 ? LEU A 188 ? VAL A 182 LEU A 188 1 ? 7  
HELX_P HELX_P6  AA6 LEU A 190 ? MET A 194 ? LEU A 190 MET A 194 5 ? 5  
HELX_P HELX_P7  AA7 PRO A 195 ? ALA A 202 ? PRO A 195 ALA A 202 5 ? 8  
HELX_P HELX_P8  AA8 ASN A 205 ? ALA A 222 ? ASN A 205 ALA A 222 1 ? 18 
HELX_P HELX_P9  AA9 HIS A 223 ? PHE A 225 ? HIS A 223 PHE A 225 5 ? 3  
HELX_P HELX_P10 AB1 SER A 238 ? SER A 250 ? SER A 238 SER A 250 1 ? 13 
HELX_P HELX_P11 AB2 ALA A 269 ? HIS A 273 ? ALA A 269 HIS A 273 5 ? 5  
HELX_P HELX_P12 AB3 THR A 275 ? CYS A 290 ? THR A 275 CYS A 290 1 ? 16 
HELX_P HELX_P13 AB4 ASN A 300 ? VAL A 311 ? ASN A 300 VAL A 311 1 ? 12 
HELX_P HELX_P14 AB5 ASP A 312 ? GLN A 320 ? ASP A 312 GLN A 320 1 ? 9  
HELX_P HELX_P15 AB6 TRP A 321 ? TYR A 324 ? TRP A 321 TYR A 324 5 ? 4  
HELX_P HELX_P16 AB7 ASP A 344 ? LYS A 350 ? ASP A 344 LYS A 350 1 ? 7  
HELX_P HELX_P17 AB8 GLY A 368 ? PHE A 376 ? GLY A 368 PHE A 376 1 ? 9  
HELX_P HELX_P18 AB9 PRO A 389 ? PHE A 401 ? PRO A 389 PHE A 401 1 ? 13 
HELX_P HELX_P19 AC1 THR A 405 ? TYR A 416 ? THR A 405 TYR A 416 1 ? 12 
HELX_P HELX_P20 AC2 GLY A 424 ? PHE A 440 ? GLY A 424 PHE A 440 1 ? 17 
HELX_P HELX_P21 AC3 PHE A 440 ? ARG A 454 ? PHE A 440 ARG A 454 1 ? 15 
HELX_P HELX_P22 AC4 GLY A 473 ? GLY A 477 ? GLY A 473 GLY A 477 5 ? 5  
HELX_P HELX_P23 AC5 GLU A 483 ? PHE A 488 ? GLU A 483 PHE A 488 1 ? 6  
HELX_P HELX_P24 AC6 GLY A 489 ? ASN A 493 ? GLY A 489 ASN A 493 5 ? 5  
HELX_P HELX_P25 AC7 ARG A 499 ? GLY A 520 ? ARG A 499 GLY A 520 1 ? 22 
HELX_P HELX_P26 AC8 ARG A 553 ? ASP A 565 ? ARG A 553 ASP A 565 1 ? 13 
HELX_P HELX_P27 AC9 ASP A 565 ? ARG A 571 ? ASP A 565 ARG A 571 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 66  SG  ? ? ? 1_555 A CYS 93  SG ? ? A CYS 66  A CYS 93  1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf2 disulf ?    ? A CYS 292 SG  ? ? ? 1_555 A CYS 307 SG ? ? A CYS 292 A CYS 307 1_555 ? ? ? ? ? ? ? 2.107 ? ?               
disulf3 disulf ?    ? A CYS 442 SG  ? ? ? 1_555 A CYS 560 SG ? ? A CYS 442 A CYS 560 1_555 ? ? ? ? ? ? ? 2.077 ? ?               
covale1 covale one  ? A SER 238 CB  ? ? ? 1_555 D IOD .   I  ? ? A SER 238 A IOD 602 1_555 ? ? ? ? ? ? ? 2.149 ? ?               
covale2 covale one  ? A ASN 493 ND2 ? ? ? 1_555 B NAG .   C1 ? ? A ASN 493 B NAG 1   1_555 ? ? ? ? ? ? ? 1.431 ? N-Glycosylation 
covale3 covale both ? B NAG .   O4  ? ? ? 1_555 B NAG .   C1 ? ? B NAG 1   B NAG 2   1_555 ? ? ? ? ? ? ? 1.447 ? ?               
covale4 covale both ? B NAG .   O4  ? ? ? 1_555 B BMA .   C1 ? ? B NAG 2   B BMA 3   1_555 ? ? ? ? ? ? ? 1.443 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 11 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? parallel      
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? parallel      
AA2 5  6  ? parallel      
AA2 6  7  ? parallel      
AA2 7  8  ? parallel      
AA2 8  9  ? parallel      
AA2 9  10 ? parallel      
AA2 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  VAL A 6   ? THR A 9   ? VAL A 6   THR A 9   
AA1 2  GLY A 12  ? ARG A 15  ? GLY A 12  ARG A 15  
AA1 3  LEU A 57  ? ASP A 58  ? LEU A 57  ASP A 58  
AA2 1  ARG A 17  ? VAL A 21  ? ARG A 17  VAL A 21  
AA2 2  ARG A 24  ? PRO A 33  ? ARG A 24  PRO A 33  
AA2 3  TYR A 95  ? PRO A 101 ? TYR A 95  PRO A 101 
AA2 4  ILE A 174 ? PHE A 178 ? ILE A 174 PHE A 178 
AA2 5  LEU A 141 ? ILE A 147 ? LEU A 141 ILE A 147 
AA2 6  GLY A 227 ? GLU A 237 ? GLY A 227 GLU A 237 
AA2 7  ARG A 259 ? GLN A 263 ? ARG A 259 GLN A 263 
AA2 8  ASP A 358 ? VAL A 364 ? ASP A 358 VAL A 364 
AA2 9  SER A 457 ? PHE A 463 ? SER A 457 PHE A 463 
AA2 10 TYR A 539 ? PHE A 542 ? TYR A 539 PHE A 542 
AA2 11 LEU A 551 ? ALA A 552 ? LEU A 551 ALA A 552 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N VAL A 7   ? N VAL A 7   O VAL A 14  ? O VAL A 14  
AA1 2  3  N ARG A 15  ? N ARG A 15  O LEU A 57  ? O LEU A 57  
AA2 1  2  N VAL A 19  ? N VAL A 19  O VAL A 26  ? O VAL A 26  
AA2 2  3  N HIS A 27  ? N HIS A 27  O ALA A 100 ? O ALA A 100 
AA2 3  4  N TRP A 99  ? N TRP A 99  O VAL A 175 ? O VAL A 175 
AA2 4  5  O ILE A 174 ? O ILE A 174 N LEU A 144 ? N LEU A 144 
AA2 5  6  N LEU A 141 ? N LEU A 141 O ASN A 228 ? O ASN A 228 
AA2 6  7  N GLY A 236 ? N GLY A 236 O GLN A 263 ? O GLN A 263 
AA2 7  8  N GLY A 260 ? N GLY A 260 O ASP A 358 ? O ASP A 358 
AA2 8  9  N ASN A 363 ? N ASN A 363 O PHE A 463 ? O PHE A 463 
AA2 9  10 N TYR A 462 ? N TYR A 462 O TYR A 540 ? O TYR A 540 
AA2 10 11 N TYR A 539 ? N TYR A 539 O ALA A 552 ? O ALA A 552 
# 
_atom_sites.entry_id                    6XYU 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.010536 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010536 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006248 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_a3 
_atom_type.scat_Cromer_Mann_a4 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_b3 
_atom_type.scat_Cromer_Mann_b4 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C ? ? 3.54356  2.42580  ? ? 25.62398 1.50364  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
I ? ? 40.26819 12.56501 ? ? 1.42647  27.02115 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N ? ? 4.01032  2.96436  ? ? 19.97189 1.75589  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O ? ? 4.49882  3.47563  ? ? 15.80542 1.70748  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S ? ? 9.55732  6.39887  ? ? 1.23737  29.19336 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 3   ? 25.83222 43.78432 -21.80097 1.000 101.19616 ? 3   ASP A N   1 
ATOM   2    C CA  . ASP A 1 3   ? 26.87091 43.70225 -20.77960 1.000 109.88834 ? 3   ASP A CA  1 
ATOM   3    C C   . ASP A 1 3   ? 26.27550 43.12374 -19.51117 1.000 114.12466 ? 3   ASP A C   1 
ATOM   4    O O   . ASP A 1 3   ? 25.10922 43.35576 -19.19585 1.000 117.65012 ? 3   ASP A O   1 
ATOM   5    C CB  . ASP A 1 3   ? 27.48763 45.07547 -20.49473 1.000 116.45483 ? 3   ASP A CB  1 
ATOM   6    C CG  . ASP A 1 3   ? 27.83821 45.83720 -21.75813 1.000 135.63077 ? 3   ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 3   ? 27.91271 47.08574 -21.67847 1.000 135.39998 ? 3   ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 3   ? 28.04499 45.19428 -22.82120 1.000 151.99886 ? 3   ASP A OD2 1 
ATOM   9    N N   . ARG A 1 4   ? 27.07201 42.34494 -18.79130 1.000 111.61201 ? 4   ARG A N   1 
ATOM   10   C CA  . ARG A 1 4   ? 26.63754 41.87532 -17.48686 1.000 106.79792 ? 4   ARG A CA  1 
ATOM   11   C C   . ARG A 1 4   ? 26.80637 42.93794 -16.41488 1.000 102.45293 ? 4   ARG A C   1 
ATOM   12   O O   . ARG A 1 4   ? 26.31048 42.76025 -15.29732 1.000 108.15099 ? 4   ARG A O   1 
ATOM   13   C CB  . ARG A 1 4   ? 27.40600 40.61819 -17.09966 1.000 109.68660 ? 4   ARG A CB  1 
ATOM   14   C CG  . ARG A 1 4   ? 28.87926 40.68129 -17.43555 1.000 117.20599 ? 4   ARG A CG  1 
ATOM   15   C CD  . ARG A 1 4   ? 29.53499 39.33154 -17.22264 1.000 123.42412 ? 4   ARG A CD  1 
ATOM   16   N NE  . ARG A 1 4   ? 29.33213 38.83660 -15.86378 1.000 121.69700 ? 4   ARG A NE  1 
ATOM   17   C CZ  . ARG A 1 4   ? 30.04462 39.22708 -14.81114 1.000 125.05753 ? 4   ARG A CZ  1 
ATOM   18   N NH1 . ARG A 1 4   ? 31.01244 40.12446 -14.95584 1.000 122.91934 ? 4   ARG A NH1 1 
ATOM   19   N NH2 . ARG A 1 4   ? 29.78728 38.72184 -13.61003 1.000 127.60644 ? 4   ARG A NH2 1 
ATOM   20   N N   . LEU A 1 5   ? 27.50449 44.02357 -16.72811 1.000 93.12703  ? 5   LEU A N   1 
ATOM   21   C CA  . LEU A 1 5   ? 27.56364 45.19414 -15.87716 1.000 82.32975  ? 5   LEU A CA  1 
ATOM   22   C C   . LEU A 1 5   ? 26.39535 46.13516 -16.11196 1.000 84.15896  ? 5   LEU A C   1 
ATOM   23   O O   . LEU A 1 5   ? 26.35918 47.21717 -15.51525 1.000 87.33570  ? 5   LEU A O   1 
ATOM   24   C CB  . LEU A 1 5   ? 28.87605 45.94297 -16.09661 1.000 80.36537  ? 5   LEU A CB  1 
ATOM   25   C CG  . LEU A 1 5   ? 30.16459 45.14565 -15.93089 1.000 87.51121  ? 5   LEU A CG  1 
ATOM   26   C CD1 . LEU A 1 5   ? 31.36592 46.04335 -16.20965 1.000 94.08941  ? 5   LEU A CD1 1 
ATOM   27   C CD2 . LEU A 1 5   ? 30.24424 44.53423 -14.54448 1.000 82.73175  ? 5   LEU A CD2 1 
ATOM   28   N N   . VAL A 1 6   ? 25.44114 45.74905 -16.95842 1.000 80.27861  ? 6   VAL A N   1 
ATOM   29   C CA  . VAL A 1 6   ? 24.30798 46.59730 -17.31422 1.000 74.61241  ? 6   VAL A CA  1 
ATOM   30   C C   . VAL A 1 6   ? 23.08532 46.13079 -16.54484 1.000 70.23916  ? 6   VAL A C   1 
ATOM   31   O O   . VAL A 1 6   ? 22.77564 44.93301 -16.52201 1.000 65.67507  ? 6   VAL A O   1 
ATOM   32   C CB  . VAL A 1 6   ? 24.03981 46.57825 -18.83182 1.000 77.84360  ? 6   VAL A CB  1 
ATOM   33   C CG1 . VAL A 1 6   ? 22.56314 46.83564 -19.12589 1.000 67.43385  ? 6   VAL A CG1 1 
ATOM   34   C CG2 . VAL A 1 6   ? 24.90163 47.62406 -19.52013 1.000 80.18223  ? 6   VAL A CG2 1 
ATOM   35   N N   . VAL A 1 7   ? 22.38549 47.07449 -15.92088 1.000 70.46936  ? 7   VAL A N   1 
ATOM   36   C CA  . VAL A 1 7   ? 21.15858 46.78460 -15.19418 1.000 74.64750  ? 7   VAL A CA  1 
ATOM   37   C C   . VAL A 1 7   ? 20.06553 47.70724 -15.70869 1.000 77.28775  ? 7   VAL A C   1 
ATOM   38   O O   . VAL A 1 7   ? 20.26932 48.92132 -15.82689 1.000 76.00737  ? 7   VAL A O   1 
ATOM   39   C CB  . VAL A 1 7   ? 21.34499 46.92668 -13.66977 1.000 68.79782  ? 7   VAL A CB  1 
ATOM   40   C CG1 . VAL A 1 7   ? 20.00347 47.07480 -12.95521 1.000 62.47862  ? 7   VAL A CG1 1 
ATOM   41   C CG2 . VAL A 1 7   ? 22.07654 45.71534 -13.14091 1.000 72.87139  ? 7   VAL A CG2 1 
ATOM   42   N N   . GLN A 1 8   ? 18.91984 47.12124 -16.03720 1.000 78.12858  ? 8   GLN A N   1 
ATOM   43   C CA  . GLN A 1 8   ? 17.75192 47.84925 -16.51537 1.000 79.12588  ? 8   GLN A CA  1 
ATOM   44   C C   . GLN A 1 8   ? 16.99923 48.42022 -15.31323 1.000 78.47794  ? 8   GLN A C   1 
ATOM   45   O O   . GLN A 1 8   ? 16.30240 47.68819 -14.60743 1.000 79.94027  ? 8   GLN A O   1 
ATOM   46   C CB  . GLN A 1 8   ? 16.87746 46.90472 -17.33668 1.000 81.84420  ? 8   GLN A CB  1 
ATOM   47   C CG  . GLN A 1 8   ? 15.60674 47.51188 -17.89459 1.000 86.49723  ? 8   GLN A CG  1 
ATOM   48   C CD  . GLN A 1 8   ? 15.87396 48.68611 -18.82319 1.000 92.44779  ? 8   GLN A CD  1 
ATOM   49   O OE1 . GLN A 1 8   ? 16.87569 48.70993 -19.54497 1.000 90.17586  ? 8   GLN A OE1 1 
ATOM   50   N NE2 . GLN A 1 8   ? 14.97882 49.67366 -18.80198 1.000 93.31576  ? 8   GLN A NE2 1 
ATOM   51   N N   . THR A 1 9   ? 17.11980 49.73344 -15.07218 1.000 72.81908  ? 9   THR A N   1 
ATOM   52   C CA  . THR A 1 9   ? 16.39847 50.35780 -13.96827 1.000 72.82071  ? 9   THR A CA  1 
ATOM   53   C C   . THR A 1 9   ? 15.04620 50.89712 -14.42122 1.000 76.08771  ? 9   THR A C   1 
ATOM   54   O O   . THR A 1 9   ? 14.69565 50.88311 -15.60160 1.000 82.81900  ? 9   THR A O   1 
ATOM   55   C CB  . THR A 1 9   ? 17.17835 51.51140 -13.32551 1.000 69.92089  ? 9   THR A CB  1 
ATOM   56   O OG1 . THR A 1 9   ? 16.99951 52.70987 -14.09569 1.000 61.56067  ? 9   THR A OG1 1 
ATOM   57   C CG2 . THR A 1 9   ? 18.66172 51.19226 -13.16740 1.000 73.95753  ? 9   THR A CG2 1 
ATOM   58   N N   . SER A 1 10  ? 14.29238 51.41582 -13.44960 1.000 71.25532  ? 10  SER A N   1 
ATOM   59   C CA  . SER A 1 10  ? 12.99431 52.01766 -13.72611 1.000 65.34845  ? 10  SER A CA  1 
ATOM   60   C C   . SER A 1 10  ? 13.07321 53.10266 -14.78498 1.000 61.63902  ? 10  SER A C   1 
ATOM   61   O O   . SER A 1 10  ? 12.09021 53.34724 -15.48798 1.000 64.06183  ? 10  SER A O   1 
ATOM   62   C CB  . SER A 1 10  ? 12.40550 52.61352 -12.43858 1.000 70.58898  ? 10  SER A CB  1 
ATOM   63   O OG  . SER A 1 10  ? 12.97323 53.88748 -12.12925 1.000 71.58119  ? 10  SER A OG  1 
ATOM   64   N N   . SER A 1 11  ? 14.20740 53.79644 -14.88057 1.000 64.75772  ? 11  SER A N   1 
ATOM   65   C CA  . SER A 1 11  ? 14.34664 54.95812 -15.74778 1.000 65.72645  ? 11  SER A CA  1 
ATOM   66   C C   . SER A 1 11  ? 15.25270 54.69124 -16.94060 1.000 69.23378  ? 11  SER A C   1 
ATOM   67   O O   . SER A 1 11  ? 15.61567 55.63400 -17.65473 1.000 71.28366  ? 11  SER A O   1 
ATOM   68   C CB  . SER A 1 11  ? 14.88856 56.14831 -14.95957 1.000 65.99477  ? 11  SER A CB  1 
ATOM   69   O OG  . SER A 1 11  ? 14.21402 56.29883 -13.73222 1.000 80.69885  ? 11  SER A OG  1 
ATOM   70   N N   . GLY A 1 12  ? 15.64251 53.44038 -17.16474 1.000 64.50380  ? 12  GLY A N   1 
ATOM   71   C CA  . GLY A 1 12  ? 16.54531 53.12701 -18.23895 1.000 73.53415  ? 12  GLY A CA  1 
ATOM   72   C C   . GLY A 1 12  ? 17.67263 52.21480 -17.80941 1.000 77.88302  ? 12  GLY A C   1 
ATOM   73   O O   . GLY A 1 12  ? 17.89019 51.97212 -16.61654 1.000 69.63830  ? 12  GLY A O   1 
ATOM   74   N N   . PRO A 1 13  ? 18.39613 51.66603 -18.79273 1.000 77.17003  ? 13  PRO A N   1 
ATOM   75   C CA  . PRO A 1 13  ? 19.55733 50.82849 -18.47511 1.000 64.56195  ? 13  PRO A CA  1 
ATOM   76   C C   . PRO A 1 13  ? 20.71916 51.66564 -17.97145 1.000 66.33680  ? 13  PRO A C   1 
ATOM   77   O O   . PRO A 1 13  ? 20.94610 52.78879 -18.43239 1.000 68.73975  ? 13  PRO A O   1 
ATOM   78   C CB  . PRO A 1 13  ? 19.89254 50.16889 -19.81336 1.000 66.26098  ? 13  PRO A CB  1 
ATOM   79   C CG  . PRO A 1 13  ? 19.37561 51.13730 -20.83389 1.000 69.73610  ? 13  PRO A CG  1 
ATOM   80   C CD  . PRO A 1 13  ? 18.11782 51.69922 -20.24292 1.000 68.25311  ? 13  PRO A CD  1 
ATOM   81   N N   . VAL A 1 14  ? 21.45092 51.10287 -17.00639 1.000 61.54098  ? 14  VAL A N   1 
ATOM   82   C CA  . VAL A 1 14  ? 22.66379 51.70344 -16.47024 1.000 65.54680  ? 14  VAL A CA  1 
ATOM   83   C C   . VAL A 1 14  ? 23.78190 50.67779 -16.55266 1.000 68.17635  ? 14  VAL A C   1 
ATOM   84   O O   . VAL A 1 14  ? 23.56644 49.47413 -16.37378 1.000 64.41208  ? 14  VAL A O   1 
ATOM   85   C CB  . VAL A 1 14  ? 22.50018 52.19415 -15.00720 1.000 66.40484  ? 14  VAL A CB  1 
ATOM   86   C CG1 . VAL A 1 14  ? 21.29927 53.13284 -14.86866 1.000 72.19761  ? 14  VAL A CG1 1 
ATOM   87   C CG2 . VAL A 1 14  ? 22.39618 51.01237 -14.04849 1.000 54.55803  ? 14  VAL A CG2 1 
ATOM   88   N N   . ARG A 1 15  ? 24.98523 51.16796 -16.82785 1.000 70.53255  ? 15  ARG A N   1 
ATOM   89   C CA  . ARG A 1 15  ? 26.18755 50.35203 -16.86191 1.000 73.07353  ? 15  ARG A CA  1 
ATOM   90   C C   . ARG A 1 15  ? 27.08924 50.73490 -15.69731 1.000 75.76208  ? 15  ARG A C   1 
ATOM   91   O O   . ARG A 1 15  ? 27.26939 51.92037 -15.40792 1.000 77.61625  ? 15  ARG A O   1 
ATOM   92   C CB  . ARG A 1 15  ? 26.93907 50.53955 -18.17417 1.000 71.45178  ? 15  ARG A CB  1 
ATOM   93   C CG  . ARG A 1 15  ? 28.03944 49.52851 -18.39720 1.000 88.99814  ? 15  ARG A CG  1 
ATOM   94   C CD  . ARG A 1 15  ? 28.72158 49.75525 -19.74622 1.000 109.15086 ? 15  ARG A CD  1 
ATOM   95   N NE  . ARG A 1 15  ? 29.07796 51.16141 -19.91970 1.000 114.40444 ? 15  ARG A NE  1 
ATOM   96   C CZ  . ARG A 1 15  ? 30.15570 51.73652 -19.39164 1.000 107.80029 ? 15  ARG A CZ  1 
ATOM   97   N NH1 . ARG A 1 15  ? 31.00589 51.02564 -18.65831 1.000 106.20039 ? 15  ARG A NH1 1 
ATOM   98   N NH2 . ARG A 1 15  ? 30.38795 53.02570 -19.60517 1.000 99.42915  ? 15  ARG A NH2 1 
ATOM   99   N N   . GLY A 1 16  ? 27.66258 49.73538 -15.03795 1.000 71.94883  ? 16  GLY A N   1 
ATOM   100  C CA  . GLY A 1 16  ? 28.52659 50.02469 -13.91654 1.000 77.89232  ? 16  GLY A CA  1 
ATOM   101  C C   . GLY A 1 16  ? 29.91143 49.42753 -14.03475 1.000 87.08122  ? 16  GLY A C   1 
ATOM   102  O O   . GLY A 1 16  ? 30.34743 49.04422 -15.12714 1.000 88.34136  ? 16  GLY A O   1 
ATOM   103  N N   . ARG A 1 17  ? 30.60653 49.34801 -12.90216 1.000 84.71530  ? 17  ARG A N   1 
ATOM   104  C CA  . ARG A 1 17  ? 31.92545 48.74921 -12.79850 1.000 82.35365  ? 17  ARG A CA  1 
ATOM   105  C C   . ARG A 1 17  ? 31.83305 47.39409 -12.11031 1.000 82.81998  ? 17  ARG A C   1 
ATOM   106  O O   . ARG A 1 17  ? 30.84148 47.06990 -11.45424 1.000 85.01811  ? 17  ARG A O   1 
ATOM   107  C CB  . ARG A 1 17  ? 32.86537 49.64849 -11.99862 1.000 79.31713  ? 17  ARG A CB  1 
ATOM   108  C CG  . ARG A 1 17  ? 33.62861 50.65741 -12.81369 1.000 69.78364  ? 17  ARG A CG  1 
ATOM   109  C CD  . ARG A 1 17  ? 33.93852 51.87131 -11.94898 1.000 75.41812  ? 17  ARG A CD  1 
ATOM   110  N NE  . ARG A 1 17  ? 34.35375 51.48969 -10.59313 1.000 84.43282  ? 17  ARG A NE  1 
ATOM   111  C CZ  . ARG A 1 17  ? 33.99951 52.13759 -9.48327  1.000 84.57972  ? 17  ARG A CZ  1 
ATOM   112  N NH1 . ARG A 1 17  ? 33.20077 53.20148 -9.54281  1.000 83.19381  ? 17  ARG A NH1 1 
ATOM   113  N NH2 . ARG A 1 17  ? 34.43007 51.70821 -8.30798  1.000 83.68276  ? 17  ARG A NH2 1 
ATOM   114  N N   . SER A 1 18  ? 32.89497 46.60860 -12.25424 1.000 79.24092  ? 18  SER A N   1 
ATOM   115  C CA  . SER A 1 18  ? 33.07687 45.37307 -11.50505 1.000 75.95387  ? 18  SER A CA  1 
ATOM   116  C C   . SER A 1 18  ? 34.32251 45.52933 -10.65547 1.000 78.38781  ? 18  SER A C   1 
ATOM   117  O O   . SER A 1 18  ? 35.41756 45.71841 -11.19100 1.000 68.12043  ? 18  SER A O   1 
ATOM   118  C CB  . SER A 1 18  ? 33.21132 44.15515 -12.42055 1.000 81.75931  ? 18  SER A CB  1 
ATOM   119  O OG  . SER A 1 18  ? 33.28094 42.95632 -11.66162 1.000 78.52511  ? 18  SER A OG  1 
ATOM   120  N N   . VAL A 1 19  ? 34.14674 45.48177 -9.33703  1.000 76.29329  ? 19  VAL A N   1 
ATOM   121  C CA  . VAL A 1 19  ? 35.25945 45.40959 -8.40065  1.000 78.16152  ? 19  VAL A CA  1 
ATOM   122  C C   . VAL A 1 19  ? 35.28197 44.01359 -7.79826  1.000 80.19324  ? 19  VAL A C   1 
ATOM   123  O O   . VAL A 1 19  ? 34.24746 43.34536 -7.68190  1.000 83.39321  ? 19  VAL A O   1 
ATOM   124  C CB  . VAL A 1 19  ? 35.17238 46.48039 -7.29487  1.000 70.20873  ? 19  VAL A CB  1 
ATOM   125  C CG1 . VAL A 1 19  ? 35.10688 47.86732 -7.90805  1.000 73.82505  ? 19  VAL A CG1 1 
ATOM   126  C CG2 . VAL A 1 19  ? 33.96855 46.22427 -6.40332  1.000 66.76707  ? 19  VAL A CG2 1 
ATOM   127  N N   . THR A 1 20  ? 36.47891 43.56047 -7.44252  1.000 77.48667  ? 20  THR A N   1 
ATOM   128  C CA  . THR A 1 20  ? 36.65764 42.32016 -6.69467  1.000 78.47224  ? 20  THR A CA  1 
ATOM   129  C C   . THR A 1 20  ? 37.39944 42.65767 -5.40272  1.000 77.71735  ? 20  THR A C   1 
ATOM   130  O O   . THR A 1 20  ? 38.62049 42.83201 -5.39876  1.000 82.29550  ? 20  THR A O   1 
ATOM   131  C CB  . THR A 1 20  ? 37.39869 41.27861 -7.52189  1.000 85.26364  ? 20  THR A CB  1 
ATOM   132  O OG1 . THR A 1 20  ? 36.67550 41.02160 -8.73841  1.000 81.08700  ? 20  THR A OG1 1 
ATOM   133  C CG2 . THR A 1 20  ? 37.53481 39.99073 -6.72699  1.000 86.82562  ? 20  THR A CG2 1 
ATOM   134  N N   . VAL A 1 21  ? 36.66307 42.76391 -4.30511  1.000 72.74235  ? 21  VAL A N   1 
ATOM   135  C CA  . VAL A 1 21  ? 37.24088 43.06551 -3.00084  1.000 77.48132  ? 21  VAL A CA  1 
ATOM   136  C C   . VAL A 1 21  ? 36.84548 41.97882 -2.01098  1.000 72.26782  ? 21  VAL A C   1 
ATOM   137  O O   . VAL A 1 21  ? 35.71187 41.48387 -2.03485  1.000 65.21807  ? 21  VAL A O   1 
ATOM   138  C CB  . VAL A 1 21  ? 36.79011 44.44661 -2.49546  1.000 79.64388  ? 21  VAL A CB  1 
ATOM   139  C CG1 . VAL A 1 21  ? 37.38519 45.52196 -3.37934  1.000 92.58621  ? 21  VAL A CG1 1 
ATOM   140  C CG2 . VAL A 1 21  ? 35.28824 44.52399 -2.51686  1.000 65.74062  ? 21  VAL A CG2 1 
ATOM   141  N N   . GLN A 1 22  ? 37.78376 41.61504 -1.13372  1.000 63.62049  ? 22  GLN A N   1 
ATOM   142  C CA  . GLN A 1 22  ? 37.56097 40.56450 -0.14741  1.000 69.57193  ? 22  GLN A CA  1 
ATOM   143  C C   . GLN A 1 22  ? 37.13867 39.26483 -0.81968  1.000 75.06545  ? 22  GLN A C   1 
ATOM   144  O O   . GLN A 1 22  ? 36.38385 38.46766 -0.25456  1.000 83.17051  ? 22  GLN A O   1 
ATOM   145  C CB  . GLN A 1 22  ? 36.53042 40.99760 0.90367   1.000 65.89403  ? 22  GLN A CB  1 
ATOM   146  C CG  . GLN A 1 22  ? 36.84645 42.33676 1.55574   1.000 61.98804  ? 22  GLN A CG  1 
ATOM   147  C CD  . GLN A 1 22  ? 37.91284 42.20319 2.61881   1.000 69.28678  ? 22  GLN A CD  1 
ATOM   148  O OE1 . GLN A 1 22  ? 37.74156 41.45575 3.58381   1.000 76.21258  ? 22  GLN A OE1 1 
ATOM   149  N NE2 . GLN A 1 22  ? 39.03098 42.90900 2.44006   1.000 63.08451  ? 22  GLN A NE2 1 
ATOM   150  N N   . GLY A 1 23  ? 37.61702 39.05807 -2.04151  1.000 70.77835  ? 23  GLY A N   1 
ATOM   151  C CA  . GLY A 1 23  ? 37.36195 37.82323 -2.73833  1.000 79.78948  ? 23  GLY A CA  1 
ATOM   152  C C   . GLY A 1 23  ? 35.96074 37.64440 -3.26237  1.000 82.39944  ? 23  GLY A C   1 
ATOM   153  O O   . GLY A 1 23  ? 35.57295 36.51193 -3.55051  1.000 83.31580  ? 23  GLY A O   1 
ATOM   154  N N   . ARG A 1 24  ? 35.18158 38.71624 -3.40162  1.000 89.84969  ? 24  ARG A N   1 
ATOM   155  C CA  . ARG A 1 24  ? 33.87967 38.61599 -4.04518  1.000 95.53952  ? 24  ARG A CA  1 
ATOM   156  C C   . ARG A 1 24  ? 33.66668 39.75142 -5.04458  1.000 84.64332  ? 24  ARG A C   1 
ATOM   157  O O   . ARG A 1 24  ? 34.12156 40.88121 -4.82986  1.000 67.43012  ? 24  ARG A O   1 
ATOM   158  C CB  . ARG A 1 24  ? 32.74097 38.58291 -3.00877  1.000 97.75440  ? 24  ARG A CB  1 
ATOM   159  C CG  . ARG A 1 24  ? 31.45295 38.15527 -3.64670  1.000 113.46747 ? 24  ARG A CG  1 
ATOM   160  C CD  . ARG A 1 24  ? 30.23249 38.52142 -2.86456  1.000 114.81978 ? 24  ARG A CD  1 
ATOM   161  N NE  . ARG A 1 24  ? 29.60974 37.30543 -2.37770  1.000 121.21538 ? 24  ARG A NE  1 
ATOM   162  C CZ  . ARG A 1 24  ? 29.60020 36.97279 -1.10185  1.000 121.72947 ? 24  ARG A CZ  1 
ATOM   163  N NH1 . ARG A 1 24  ? 30.15842 37.79612 -0.23086  1.000 118.76674 ? 24  ARG A NH1 1 
ATOM   164  N NH2 . ARG A 1 24  ? 29.02218 35.84988 -0.70044  1.000 124.94880 ? 24  ARG A NH2 1 
ATOM   165  N N   . GLU A 1 25  ? 32.98486 39.42814 -6.15112  1.000 80.16000  ? 25  GLU A N   1 
ATOM   166  C CA  . GLU A 1 25  ? 32.64698 40.41193 -7.17145  1.000 80.01240  ? 25  GLU A CA  1 
ATOM   167  C C   . GLU A 1 25  ? 31.49645 41.29438 -6.70244  1.000 70.59972  ? 25  GLU A C   1 
ATOM   168  O O   . GLU A 1 25  ? 30.45606 40.79470 -6.26495  1.000 74.76529  ? 25  GLU A O   1 
ATOM   169  C CB  . GLU A 1 25  ? 32.26875 39.71420 -8.48288  1.000 90.84549  ? 25  GLU A CB  1 
ATOM   170  C CG  . GLU A 1 25  ? 32.33850 40.59423 -9.72288  1.000 97.33922  ? 25  GLU A CG  1 
ATOM   171  C CD  . GLU A 1 25  ? 31.77301 39.91839 -10.96643 1.000 106.32889 ? 25  GLU A CD  1 
ATOM   172  O OE1 . GLU A 1 25  ? 31.25536 38.77931 -10.87571 1.000 109.23089 ? 25  GLU A OE1 1 
ATOM   173  O OE2 . GLU A 1 25  ? 31.84560 40.53768 -12.04585 1.000 108.34065 ? 25  GLU A OE2 1 
ATOM   174  N N   . VAL A 1 26  ? 31.68519 42.60758 -6.79811  1.000 63.61027  ? 26  VAL A N   1 
ATOM   175  C CA  . VAL A 1 26  ? 30.62143 43.58665 -6.61942  1.000 58.43054  ? 26  VAL A CA  1 
ATOM   176  C C   . VAL A 1 26  ? 30.48687 44.40286 -7.90151  1.000 64.58275  ? 26  VAL A C   1 
ATOM   177  O O   . VAL A 1 26  ? 31.47324 44.67261 -8.59336  1.000 75.41608  ? 26  VAL A O   1 
ATOM   178  C CB  . VAL A 1 26  ? 30.89026 44.51661 -5.41638  1.000 58.84727  ? 26  VAL A CB  1 
ATOM   179  C CG1 . VAL A 1 26  ? 29.63897 45.28688 -5.06391  1.000 58.52495  ? 26  VAL A CG1 1 
ATOM   180  C CG2 . VAL A 1 26  ? 31.39496 43.72384 -4.21215  1.000 58.38664  ? 26  VAL A CG2 1 
ATOM   181  N N   . HIS A 1 27  ? 29.25989 44.80739 -8.21201  1.000 63.25783  ? 27  HIS A N   1 
ATOM   182  C CA  . HIS A 1 27  ? 28.96616 45.65307 -9.36319  1.000 63.66032  ? 27  HIS A CA  1 
ATOM   183  C C   . HIS A 1 27  ? 28.57703 47.04016 -8.87041  1.000 65.12098  ? 27  HIS A C   1 
ATOM   184  O O   . HIS A 1 27  ? 27.54051 47.19206 -8.21900  1.000 65.79157  ? 27  HIS A O   1 
ATOM   185  C CB  . HIS A 1 27  ? 27.85293 45.03118 -10.20148 1.000 61.70256  ? 27  HIS A CB  1 
ATOM   186  C CG  . HIS A 1 27  ? 28.30613 43.84010 -10.98692 1.000 68.80916  ? 27  HIS A CG  1 
ATOM   187  N ND1 . HIS A 1 27  ? 27.46994 43.12870 -11.81836 1.000 72.12738  ? 27  HIS A ND1 1 
ATOM   188  C CD2 . HIS A 1 27  ? 29.51883 43.24531 -11.07468 1.000 65.84548  ? 27  HIS A CD2 1 
ATOM   189  C CE1 . HIS A 1 27  ? 28.14656 42.14627 -12.38333 1.000 71.38677  ? 27  HIS A CE1 1 
ATOM   190  N NE2 . HIS A 1 27  ? 29.39058 42.19253 -11.94266 1.000 71.28625  ? 27  HIS A NE2 1 
ATOM   191  N N   . VAL A 1 28  ? 29.39420 48.04740 -9.19412  1.000 66.71082  ? 28  VAL A N   1 
ATOM   192  C CA  . VAL A 1 28  ? 29.34340 49.35875 -8.54355  1.000 64.46996  ? 28  VAL A CA  1 
ATOM   193  C C   . VAL A 1 28  ? 28.82360 50.38933 -9.54461  1.000 58.44687  ? 28  VAL A C   1 
ATOM   194  O O   . VAL A 1 28  ? 29.57463 50.89787 -10.38790 1.000 62.04803  ? 28  VAL A O   1 
ATOM   195  C CB  . VAL A 1 28  ? 30.71183 49.77552 -7.98444  1.000 66.56876  ? 28  VAL A CB  1 
ATOM   196  C CG1 . VAL A 1 28  ? 30.60817 51.13350 -7.29781  1.000 58.21635  ? 28  VAL A CG1 1 
ATOM   197  C CG2 . VAL A 1 28  ? 31.26436 48.72268 -7.02409  1.000 70.11563  ? 28  VAL A CG2 1 
ATOM   198  N N   . TYR A 1 29  ? 27.55021 50.75771 -9.39439  1.000 61.21756  ? 29  TYR A N   1 
ATOM   199  C CA  . TYR A 1 29  ? 26.87383 51.74925 -10.22884 1.000 65.60016  ? 29  TYR A CA  1 
ATOM   200  C C   . TYR A 1 29  ? 26.84825 53.08763 -9.49271  1.000 64.96689  ? 29  TYR A C   1 
ATOM   201  O O   . TYR A 1 29  ? 26.13305 53.23656 -8.50113  1.000 65.90958  ? 29  TYR A O   1 
ATOM   202  C CB  . TYR A 1 29  ? 25.45616 51.28022 -10.56911 1.000 63.34798  ? 29  TYR A CB  1 
ATOM   203  C CG  . TYR A 1 29  ? 25.40272 49.84491 -11.05829 1.000 68.89551  ? 29  TYR A CG  1 
ATOM   204  C CD1 . TYR A 1 29  ? 25.39551 48.78129 -10.16465 1.000 72.51299  ? 29  TYR A CD1 1 
ATOM   205  C CD2 . TYR A 1 29  ? 25.39232 49.55568 -12.41196 1.000 71.26804  ? 29  TYR A CD2 1 
ATOM   206  C CE1 . TYR A 1 29  ? 25.36784 47.47443 -10.60806 1.000 76.84427  ? 29  TYR A CE1 1 
ATOM   207  C CE2 . TYR A 1 29  ? 25.36484 48.25386 -12.86035 1.000 84.38227  ? 29  TYR A CE2 1 
ATOM   208  C CZ  . TYR A 1 29  ? 25.35137 47.21753 -11.95740 1.000 89.36284  ? 29  TYR A CZ  1 
ATOM   209  O OH  . TYR A 1 29  ? 25.32697 45.91669 -12.41093 1.000 101.35574 ? 29  TYR A OH  1 
ATOM   210  N N   . THR A 1 30  ? 27.61130 54.06496 -9.98496  1.000 69.08020  ? 30  THR A N   1 
ATOM   211  C CA  . THR A 1 30  ? 27.72478 55.38280 -9.36745  1.000 64.91508  ? 30  THR A CA  1 
ATOM   212  C C   . THR A 1 30  ? 27.18840 56.46014 -10.30734 1.000 71.96136  ? 30  THR A C   1 
ATOM   213  O O   . THR A 1 30  ? 27.52292 56.47775 -11.49829 1.000 82.33830  ? 30  THR A O   1 
ATOM   214  C CB  . THR A 1 30  ? 29.18260 55.68373 -9.01200  1.000 61.99066  ? 30  THR A CB  1 
ATOM   215  O OG1 . THR A 1 30  ? 30.03220 55.12776 -10.02857 1.000 73.96474  ? 30  THR A OG1 1 
ATOM   216  C CG2 . THR A 1 30  ? 29.55627 55.07796 -7.65899  1.000 55.56441  ? 30  THR A CG2 1 
ATOM   217  N N   . GLY A 1 31  ? 26.35113 57.35035 -9.77667  1.000 66.06487  ? 31  GLY A N   1 
ATOM   218  C CA  . GLY A 1 31  ? 25.88452 58.50877 -10.52325 1.000 56.09894  ? 31  GLY A CA  1 
ATOM   219  C C   . GLY A 1 31  ? 24.63828 58.28893 -11.36031 1.000 52.24943  ? 31  GLY A C   1 
ATOM   220  O O   . GLY A 1 31  ? 24.58403 58.70517 -12.51992 1.000 60.17651  ? 31  GLY A O   1 
ATOM   221  N N   . ILE A 1 32  ? 23.63852 57.62946 -10.79425 1.000 51.27914  ? 32  ILE A N   1 
ATOM   222  C CA  . ILE A 1 32  ? 22.38298 57.35193 -11.50216 1.000 55.29184  ? 32  ILE A CA  1 
ATOM   223  C C   . ILE A 1 32  ? 21.42138 58.47971 -11.17667 1.000 55.39946  ? 32  ILE A C   1 
ATOM   224  O O   . ILE A 1 32  ? 21.12934 58.70800 -10.00233 1.000 52.22505  ? 32  ILE A O   1 
ATOM   225  C CB  . ILE A 1 32  ? 21.79924 55.99386 -11.08769 1.000 52.81216  ? 32  ILE A CB  1 
ATOM   226  C CG1 . ILE A 1 32  ? 22.72461 54.84857 -11.50313 1.000 60.47442  ? 32  ILE A CG1 1 
ATOM   227  C CG2 . ILE A 1 32  ? 20.41373 55.78762 -11.68000 1.000 44.01261  ? 32  ILE A CG2 1 
ATOM   228  C CD1 . ILE A 1 32  ? 22.44964 53.55214 -10.76346 1.000 59.37398  ? 32  ILE A CD1 1 
ATOM   229  N N   . PRO A 1 33  ? 20.93938 59.23704 -12.15973 1.000 60.21544  ? 33  PRO A N   1 
ATOM   230  C CA  . PRO A 1 33  ? 19.98944 60.30338 -11.83812 1.000 52.10516  ? 33  PRO A CA  1 
ATOM   231  C C   . PRO A 1 33  ? 18.73342 59.70038 -11.24151 1.000 52.52851  ? 33  PRO A C   1 
ATOM   232  O O   . PRO A 1 33  ? 18.18511 58.73089 -11.77016 1.000 55.16429  ? 33  PRO A O   1 
ATOM   233  C CB  . PRO A 1 33  ? 19.72478 60.98052 -13.19438 1.000 47.43127  ? 33  PRO A CB  1 
ATOM   234  C CG  . PRO A 1 33  ? 20.24618 60.06895 -14.20228 1.000 49.79658  ? 33  PRO A CG  1 
ATOM   235  C CD  . PRO A 1 33  ? 21.31471 59.23227 -13.58398 1.000 58.32661  ? 33  PRO A CD  1 
ATOM   236  N N   . TYR A 1 34  ? 18.30306 60.25475 -10.10208 1.000 48.16058  ? 34  TYR A N   1 
ATOM   237  C CA  . TYR A 1 34  ? 17.03390 59.86827 -9.50198  1.000 44.13146  ? 34  TYR A CA  1 
ATOM   238  C C   . TYR A 1 34  ? 16.03201 61.00617 -9.48728  1.000 45.83185  ? 34  TYR A C   1 
ATOM   239  O O   . TYR A 1 34  ? 14.86131 60.78708 -9.16256  1.000 43.56441  ? 34  TYR A O   1 
ATOM   240  C CB  . TYR A 1 34  ? 17.24789 59.31805 -8.07767  1.000 50.02952  ? 34  TYR A CB  1 
ATOM   241  C CG  . TYR A 1 34  ? 17.48678 60.32747 -6.96717  1.000 45.47412  ? 34  TYR A CG  1 
ATOM   242  C CD1 . TYR A 1 34  ? 16.42648 60.91108 -6.28140  1.000 40.98121  ? 34  TYR A CD1 1 
ATOM   243  C CD2 . TYR A 1 34  ? 18.77498 60.66664 -6.58316  1.000 46.05395  ? 34  TYR A CD2 1 
ATOM   244  C CE1 . TYR A 1 34  ? 16.65409 61.83234 -5.24186  1.000 48.50432  ? 34  TYR A CE1 1 
ATOM   245  C CE2 . TYR A 1 34  ? 19.01127 61.57633 -5.53827  1.000 50.37883  ? 34  TYR A CE2 1 
ATOM   246  C CZ  . TYR A 1 34  ? 17.95218 62.15857 -4.86535  1.000 49.34400  ? 34  TYR A CZ  1 
ATOM   247  O OH  . TYR A 1 34  ? 18.20059 63.06571 -3.82386  1.000 42.90986  ? 34  TYR A OH  1 
ATOM   248  N N   . ALA A 1 35  ? 16.45181 62.19990 -9.87719  1.000 51.31086  ? 35  ALA A N   1 
ATOM   249  C CA  . ALA A 1 35  ? 15.57088 63.34846 -9.95801  1.000 56.98052  ? 35  ALA A CA  1 
ATOM   250  C C   . ALA A 1 35  ? 16.06760 64.21601 -11.10219 1.000 62.45355  ? 35  ALA A C   1 
ATOM   251  O O   . ALA A 1 35  ? 17.23509 64.12473 -11.50968 1.000 41.10143  ? 35  ALA A O   1 
ATOM   252  C CB  . ALA A 1 35  ? 15.53989 64.13444 -8.62895  1.000 49.85152  ? 35  ALA A CB  1 
ATOM   253  N N   . LYS A 1 36  ? 15.16309 65.04068 -11.63233 1.000 56.88870  ? 36  LYS A N   1 
ATOM   254  C CA  . LYS A 1 36  ? 15.58783 66.08782 -12.54961 1.000 57.40464  ? 36  LYS A CA  1 
ATOM   255  C C   . LYS A 1 36  ? 16.51433 67.04982 -11.81497 1.000 60.07323  ? 36  LYS A C   1 
ATOM   256  O O   . LYS A 1 36  ? 16.34605 67.27681 -10.60327 1.000 55.41526  ? 36  LYS A O   1 
ATOM   257  C CB  . LYS A 1 36  ? 14.38724 66.81948 -13.16467 1.000 48.09438  ? 36  LYS A CB  1 
ATOM   258  C CG  . LYS A 1 36  ? 13.41645 65.84467 -13.81779 1.000 66.22917  ? 36  LYS A CG  1 
ATOM   259  C CD  . LYS A 1 36  ? 12.27399 66.47109 -14.64030 1.000 72.36191  ? 36  LYS A CD  1 
ATOM   260  C CE  . LYS A 1 36  ? 12.52878 67.92577 -15.01756 1.000 82.32842  ? 36  LYS A CE  1 
ATOM   261  N NZ  . LYS A 1 36  ? 11.28685 68.57838 -15.56364 1.000 89.40040  ? 36  LYS A NZ  1 
ATOM   262  N N   . PRO A 1 37  ? 17.54535 67.56329 -12.47684 1.000 56.87184  ? 37  PRO A N   1 
ATOM   263  C CA  . PRO A 1 37  ? 18.47444 68.46432 -11.81374 1.000 61.78091  ? 37  PRO A CA  1 
ATOM   264  C C   . PRO A 1 37  ? 17.74281 69.63023 -11.17204 1.000 62.13542  ? 37  PRO A C   1 
ATOM   265  O O   . PRO A 1 37  ? 17.08175 70.42340 -11.85947 1.000 60.00780  ? 37  PRO A O   1 
ATOM   266  C CB  . PRO A 1 37  ? 19.40157 68.92381 -12.94904 1.000 45.76321  ? 37  PRO A CB  1 
ATOM   267  C CG  . PRO A 1 37  ? 19.19490 67.94453 -14.05911 1.000 46.83864  ? 37  PRO A CG  1 
ATOM   268  C CD  . PRO A 1 37  ? 18.10965 66.99867 -13.71454 1.000 52.56630  ? 37  PRO A CD  1 
ATOM   269  N N   . PRO A 1 38  ? 17.83938 69.76958 -9.85227  1.000 55.97961  ? 38  PRO A N   1 
ATOM   270  C CA  . PRO A 1 38  ? 17.02518 70.77651 -9.14882  1.000 57.52382  ? 38  PRO A CA  1 
ATOM   271  C C   . PRO A 1 38  ? 17.51385 72.17926 -9.45661  1.000 62.01432  ? 38  PRO A C   1 
ATOM   272  O O   . PRO A 1 38  ? 17.87935 72.95689 -8.56138  1.000 61.86294  ? 38  PRO A O   1 
ATOM   273  C CB  . PRO A 1 38  ? 17.19587 70.41189 -7.66582  1.000 47.98763  ? 38  PRO A CB  1 
ATOM   274  C CG  . PRO A 1 38  ? 18.54193 69.75368 -7.59594  1.000 58.20641  ? 38  PRO A CG  1 
ATOM   275  C CD  . PRO A 1 38  ? 18.81534 69.11344 -8.96810  1.000 60.70532  ? 38  PRO A CD  1 
ATOM   276  N N   . VAL A 1 39  ? 17.48263 72.51442 -10.74261 1.000 54.76339  ? 39  VAL A N   1 
ATOM   277  C CA  . VAL A 1 39  ? 18.22892 73.65089 -11.24135 1.000 59.49767  ? 39  VAL A CA  1 
ATOM   278  C C   . VAL A 1 39  ? 17.27700 74.63111 -11.91386 1.000 59.28445  ? 39  VAL A C   1 
ATOM   279  O O   . VAL A 1 39  ? 16.14875 74.29927 -12.28757 1.000 64.07534  ? 39  VAL A O   1 
ATOM   280  C CB  . VAL A 1 39  ? 19.34179 73.20527 -12.19968 1.000 62.72212  ? 39  VAL A CB  1 
ATOM   281  C CG1 . VAL A 1 39  ? 18.79040 73.02897 -13.60922 1.000 50.36760  ? 39  VAL A CG1 1 
ATOM   282  C CG2 . VAL A 1 39  ? 20.47010 74.19055 -12.15174 1.000 74.32566  ? 39  VAL A CG2 1 
ATOM   283  N N   . GLU A 1 40  ? 17.75664 75.86141 -12.05273 1.000 52.55147  ? 40  GLU A N   1 
ATOM   284  C CA  . GLU A 1 40  ? 16.94770 76.99871 -12.46784 1.000 59.14903  ? 40  GLU A CA  1 
ATOM   285  C C   . GLU A 1 40  ? 15.58510 77.04740 -11.78884 1.000 63.17535  ? 40  GLU A C   1 
ATOM   286  O O   . GLU A 1 40  ? 15.50102 77.29834 -10.57797 1.000 67.10732  ? 40  GLU A O   1 
ATOM   287  C CB  . GLU A 1 40  ? 16.78427 76.99503 -13.96802 1.000 74.07703  ? 40  GLU A CB  1 
ATOM   288  C CG  . GLU A 1 40  ? 17.80536 77.85709 -14.62191 1.000 86.56813  ? 40  GLU A CG  1 
ATOM   289  C CD  . GLU A 1 40  ? 18.02863 77.43631 -16.03021 1.000 98.04550  ? 40  GLU A CD  1 
ATOM   290  O OE1 . GLU A 1 40  ? 19.07810 76.81743 -16.29707 1.000 105.12075 ? 40  GLU A OE1 1 
ATOM   291  O OE2 . GLU A 1 40  ? 17.13690 77.70132 -16.85906 1.000 98.23336  ? 40  GLU A OE2 1 
ATOM   292  N N   . ASP A 1 41  ? 14.51359 76.82270 -12.55478 1.000 58.63884  ? 41  ASP A N   1 
ATOM   293  C CA  . ASP A 1 41  ? 13.17823 76.94597 -11.98362 1.000 67.39152  ? 41  ASP A CA  1 
ATOM   294  C C   . ASP A 1 41  ? 12.94153 75.94600 -10.85750 1.000 65.36898  ? 41  ASP A C   1 
ATOM   295  O O   . ASP A 1 41  ? 12.08428 76.17937 -9.99444  1.000 58.19662  ? 41  ASP A O   1 
ATOM   296  C CB  . ASP A 1 41  ? 12.11055 76.76911 -13.05732 1.000 75.96456  ? 41  ASP A CB  1 
ATOM   297  C CG  . ASP A 1 41  ? 10.71418 76.97577 -12.51511 1.000 89.53227  ? 41  ASP A CG  1 
ATOM   298  O OD1 . ASP A 1 41  ? 10.44752 78.07408 -11.97818 1.000 91.34890  ? 41  ASP A OD1 1 
ATOM   299  O OD2 . ASP A 1 41  ? 9.89264  76.03715 -12.60027 1.000 97.66278  ? 41  ASP A OD2 1 
ATOM   300  N N   . LEU A 1 42  ? 13.68583 74.84905 -10.84210 1.000 58.56793  ? 42  LEU A N   1 
ATOM   301  C CA  . LEU A 1 42  ? 13.50084 73.80541 -9.85204  1.000 58.21926  ? 42  LEU A CA  1 
ATOM   302  C C   . LEU A 1 42  ? 14.37792 73.98935 -8.62270  1.000 55.53091  ? 42  LEU A C   1 
ATOM   303  O O   . LEU A 1 42  ? 14.35797 73.12812 -7.74170  1.000 51.92070  ? 42  LEU A O   1 
ATOM   304  C CB  . LEU A 1 42  ? 13.77201 72.43684 -10.47801 1.000 57.79996  ? 42  LEU A CB  1 
ATOM   305  C CG  . LEU A 1 42  ? 12.67604 71.88734 -11.37561 1.000 50.99305  ? 42  LEU A CG  1 
ATOM   306  C CD1 . LEU A 1 42  ? 13.21123 70.64724 -12.01643 1.000 52.30316  ? 42  LEU A CD1 1 
ATOM   307  C CD2 . LEU A 1 42  ? 11.41064 71.58267 -10.59690 1.000 54.78319  ? 42  LEU A CD2 1 
ATOM   308  N N   . ARG A 1 43  ? 15.16118 75.06417 -8.55632  1.000 58.19084  ? 43  ARG A N   1 
ATOM   309  C CA  . ARG A 1 43  ? 15.84571 75.41502 -7.31958  1.000 61.24636  ? 43  ARG A CA  1 
ATOM   310  C C   . ARG A 1 43  ? 14.82471 75.66829 -6.22022  1.000 61.10445  ? 43  ARG A C   1 
ATOM   311  O O   . ARG A 1 43  ? 13.75803 76.23303 -6.46931  1.000 62.18479  ? 43  ARG A O   1 
ATOM   312  C CB  . ARG A 1 43  ? 16.70121 76.65896 -7.52612  1.000 60.95893  ? 43  ARG A CB  1 
ATOM   313  C CG  . ARG A 1 43  ? 17.32732 77.19372 -6.27001  1.000 56.81599  ? 43  ARG A CG  1 
ATOM   314  C CD  . ARG A 1 43  ? 18.14125 78.44380 -6.56383  1.000 63.15968  ? 43  ARG A CD  1 
ATOM   315  N NE  . ARG A 1 43  ? 19.43772 78.17212 -7.19028  1.000 59.98420  ? 43  ARG A NE  1 
ATOM   316  C CZ  . ARG A 1 43  ? 20.23714 79.10990 -7.70226  1.000 57.66638  ? 43  ARG A CZ  1 
ATOM   317  N NH1 . ARG A 1 43  ? 19.89661 80.39314 -7.67989  1.000 58.70942  ? 43  ARG A NH1 1 
ATOM   318  N NH2 . ARG A 1 43  ? 21.38986 78.76385 -8.23154  1.000 56.80530  ? 43  ARG A NH2 1 
ATOM   319  N N   . PHE A 1 44  ? 15.14135 75.22049 -5.00261  1.000 56.22297  ? 44  PHE A N   1 
ATOM   320  C CA  . PHE A 1 44  ? 14.30822 75.34948 -3.80603  1.000 46.90971  ? 44  PHE A CA  1 
ATOM   321  C C   . PHE A 1 44  ? 13.02425 74.52738 -3.86574  1.000 43.38782  ? 44  PHE A C   1 
ATOM   322  O O   . PHE A 1 44  ? 12.25889 74.53189 -2.90860  1.000 51.96257  ? 44  PHE A O   1 
ATOM   323  C CB  . PHE A 1 44  ? 13.93009 76.80754 -3.50552  1.000 45.97421  ? 44  PHE A CB  1 
ATOM   324  C CG  . PHE A 1 44  ? 15.10450 77.74590 -3.46736  1.000 48.48088  ? 44  PHE A CG  1 
ATOM   325  C CD1 . PHE A 1 44  ? 16.22272 77.45169 -2.70293  1.000 46.96248  ? 44  PHE A CD1 1 
ATOM   326  C CD2 . PHE A 1 44  ? 15.08604 78.92799 -4.19192  1.000 51.50263  ? 44  PHE A CD2 1 
ATOM   327  C CE1 . PHE A 1 44  ? 17.30919 78.31923 -2.66072  1.000 51.82257  ? 44  PHE A CE1 1 
ATOM   328  C CE2 . PHE A 1 44  ? 16.16495 79.79622 -4.15853  1.000 59.35033  ? 44  PHE A CE2 1 
ATOM   329  C CZ  . PHE A 1 44  ? 17.28009 79.49208 -3.39240  1.000 58.16935  ? 44  PHE A CZ  1 
ATOM   330  N N   . ARG A 1 45  ? 12.76181 73.81960 -4.94159  1.000 44.52699  ? 45  ARG A N   1 
ATOM   331  C CA  . ARG A 1 45  ? 11.48497 73.14600 -5.07353  1.000 46.06055  ? 45  ARG A CA  1 
ATOM   332  C C   . ARG A 1 45  ? 11.65337 71.67915 -4.74781  1.000 48.49333  ? 45  ARG A C   1 
ATOM   333  O O   . ARG A 1 45  ? 12.77110 71.15268 -4.71765  1.000 45.07559  ? 45  ARG A O   1 
ATOM   334  C CB  . ARG A 1 45  ? 10.92704 73.30845 -6.48811  1.000 47.25968  ? 45  ARG A CB  1 
ATOM   335  C CG  . ARG A 1 45  ? 10.77244 74.75056 -6.93116  1.000 46.49156  ? 45  ARG A CG  1 
ATOM   336  C CD  . ARG A 1 45  ? 9.94822  74.78415 -8.20944  1.000 51.70801  ? 45  ARG A CD  1 
ATOM   337  N NE  . ARG A 1 45  ? 9.76931  76.12434 -8.75564  1.000 59.18273  ? 45  ARG A NE  1 
ATOM   338  C CZ  . ARG A 1 45  ? 8.68527  76.86782 -8.55238  1.000 59.78178  ? 45  ARG A CZ  1 
ATOM   339  N NH1 . ARG A 1 45  ? 7.68466  76.39488 -7.81633  1.000 55.49051  ? 45  ARG A NH1 1 
ATOM   340  N NH2 . ARG A 1 45  ? 8.59951  78.07867 -9.08730  1.000 54.02669  ? 45  ARG A NH2 1 
ATOM   341  N N   . LYS A 1 46  ? 10.52393 71.02110 -4.50814  1.000 49.27656  ? 46  LYS A N   1 
ATOM   342  C CA  . LYS A 1 46  ? 10.55077 69.58496 -4.31302  1.000 52.95144  ? 46  LYS A CA  1 
ATOM   343  C C   . LYS A 1 46  ? 11.20410 68.92054 -5.52500  1.000 52.34592  ? 46  LYS A C   1 
ATOM   344  O O   . LYS A 1 46  ? 11.15626 69.45286 -6.63535  1.000 51.90183  ? 46  LYS A O   1 
ATOM   345  C CB  . LYS A 1 46  ? 9.13725  69.05021 -4.10842  1.000 54.96016  ? 46  LYS A CB  1 
ATOM   346  C CG  . LYS A 1 46  ? 8.46998  69.55015 -2.84380  1.000 54.66354  ? 46  LYS A CG  1 
ATOM   347  C CD  . LYS A 1 46  ? 7.10035  68.91035 -2.65798  1.000 57.01460  ? 46  LYS A CD  1 
ATOM   348  C CE  . LYS A 1 46  ? 6.41801  69.44826 -1.41442  1.000 60.66044  ? 46  LYS A CE  1 
ATOM   349  N NZ  . LYS A 1 46  ? 4.97580  69.11485 -1.34954  1.000 63.25372  ? 46  LYS A NZ  1 
ATOM   350  N N   . PRO A 1 47  ? 11.86282 67.78707 -5.33912  1.000 51.65954  ? 47  PRO A N   1 
ATOM   351  C CA  . PRO A 1 47  ? 12.46992 67.11456 -6.48669  1.000 43.51336  ? 47  PRO A CA  1 
ATOM   352  C C   . PRO A 1 47  ? 11.40443 66.48623 -7.36174  1.000 45.92919  ? 47  PRO A C   1 
ATOM   353  O O   . PRO A 1 47  ? 10.36870 66.01761 -6.88947  1.000 45.45047  ? 47  PRO A O   1 
ATOM   354  C CB  . PRO A 1 47  ? 13.35785 66.04925 -5.84290  1.000 46.03642  ? 47  PRO A CB  1 
ATOM   355  C CG  . PRO A 1 47  ? 12.64075 65.72936 -4.52677  1.000 45.16904  ? 47  PRO A CG  1 
ATOM   356  C CD  . PRO A 1 47  ? 12.09756 67.06283 -4.07668  1.000 48.62379  ? 47  PRO A CD  1 
ATOM   357  N N   . VAL A 1 48  ? 11.65607 66.48023 -8.66447  1.000 51.44259  ? 48  VAL A N   1 
ATOM   358  C CA  . VAL A 1 48  ? 10.71482 65.78416 -9.53336  1.000 57.61625  ? 48  VAL A CA  1 
ATOM   359  C C   . VAL A 1 48  ? 11.43846 64.59377 -10.15442 1.000 58.74396  ? 48  VAL A C   1 
ATOM   360  O O   . VAL A 1 48  ? 12.64462 64.67227 -10.43917 1.000 58.66665  ? 48  VAL A O   1 
ATOM   361  C CB  . VAL A 1 48  ? 10.10031 66.74660 -10.56008 1.000 66.40852  ? 48  VAL A CB  1 
ATOM   362  C CG1 . VAL A 1 48  ? 9.64056  68.02433 -9.86552  1.000 73.74472  ? 48  VAL A CG1 1 
ATOM   363  C CG2 . VAL A 1 48  ? 11.10116 67.13070 -11.53707 1.000 66.58604  ? 48  VAL A CG2 1 
ATOM   364  N N   . PRO A 1 49  ? 10.76467 63.45239 -10.29210 1.000 58.37176  ? 49  PRO A N   1 
ATOM   365  C CA  . PRO A 1 49  ? 11.43358 62.23921 -10.77942 1.000 57.33458  ? 49  PRO A CA  1 
ATOM   366  C C   . PRO A 1 49  ? 12.13359 62.48605 -12.10622 1.000 55.81131  ? 49  PRO A C   1 
ATOM   367  O O   . PRO A 1 49  ? 11.67543 63.28031 -12.92332 1.000 62.89083  ? 49  PRO A O   1 
ATOM   368  C CB  . PRO A 1 49  ? 10.27947 61.24207 -10.92745 1.000 50.67151  ? 49  PRO A CB  1 
ATOM   369  C CG  . PRO A 1 49  ? 9.31443  61.67384 -9.87296  1.000 43.52177  ? 49  PRO A CG  1 
ATOM   370  C CD  . PRO A 1 49  ? 9.37993  63.18377 -9.86731  1.000 45.78131  ? 49  PRO A CD  1 
ATOM   371  N N   . ALA A 1 50  ? 13.26050 61.80487 -12.30150 1.000 61.99206  ? 50  ALA A N   1 
ATOM   372  C CA  . ALA A 1 50  ? 14.11795 62.06591 -13.45186 1.000 70.75697  ? 50  ALA A CA  1 
ATOM   373  C C   . ALA A 1 50  ? 13.48386 61.54045 -14.73874 1.000 66.47236  ? 50  ALA A C   1 
ATOM   374  O O   . ALA A 1 50  ? 12.83729 60.48387 -14.75491 1.000 66.48838  ? 50  ALA A O   1 
ATOM   375  C CB  . ALA A 1 50  ? 15.49867 61.44040 -13.22918 1.000 71.68123  ? 50  ALA A CB  1 
ATOM   376  N N   . GLU A 1 51  ? 13.64598 62.29661 -15.81695 1.000 63.40559  ? 51  GLU A N   1 
ATOM   377  C CA  . GLU A 1 51  ? 13.08380 61.85035 -17.08240 1.000 76.85885  ? 51  GLU A CA  1 
ATOM   378  C C   . GLU A 1 51  ? 13.75501 60.55401 -17.50184 1.000 78.63498  ? 51  GLU A C   1 
ATOM   379  O O   . GLU A 1 51  ? 14.99100 60.44576 -17.42056 1.000 75.72695  ? 51  GLU A O   1 
ATOM   380  C CB  . GLU A 1 51  ? 13.19791 62.92972 -18.16966 1.000 75.17532  ? 51  GLU A CB  1 
ATOM   381  C CG  . GLU A 1 51  ? 11.90095 63.74503 -18.25986 1.000 90.08541  ? 51  GLU A CG  1 
ATOM   382  C CD  . GLU A 1 51  ? 11.46127 64.03475 -19.68106 1.000 114.44788 ? 51  GLU A CD  1 
ATOM   383  O OE1 . GLU A 1 51  ? 12.33744 64.22015 -20.55350 1.000 123.43430 ? 51  GLU A OE1 1 
ATOM   384  O OE2 . GLU A 1 51  ? 10.23543 64.06987 -19.93131 1.000 123.61374 ? 51  GLU A OE2 1 
ATOM   385  N N   . PRO A 1 52  ? 12.99499 59.51552 -17.86117 1.000 80.96196  ? 52  PRO A N   1 
ATOM   386  C CA  . PRO A 1 52  ? 13.59476 58.25769 -18.30381 1.000 77.98464  ? 52  PRO A CA  1 
ATOM   387  C C   . PRO A 1 52  ? 14.47799 58.45966 -19.52409 1.000 71.82482  ? 52  PRO A C   1 
ATOM   388  O O   . PRO A 1 52  ? 14.27519 59.37312 -20.32210 1.000 64.62802  ? 52  PRO A O   1 
ATOM   389  C CB  . PRO A 1 52  ? 12.38841 57.37445 -18.63953 1.000 80.88711  ? 52  PRO A CB  1 
ATOM   390  C CG  . PRO A 1 52  ? 11.27541 57.92763 -17.80296 1.000 86.87824  ? 52  PRO A CG  1 
ATOM   391  C CD  . PRO A 1 52  ? 11.52855 59.41156 -17.70870 1.000 86.84435  ? 52  PRO A CD  1 
ATOM   392  N N   . TRP A 1 53  ? 15.46085 57.58173 -19.66129 1.000 76.03190  ? 53  TRP A N   1 
ATOM   393  C CA  . TRP A 1 53  ? 16.44660 57.63617 -20.72951 1.000 82.77144  ? 53  TRP A CA  1 
ATOM   394  C C   . TRP A 1 53  ? 16.46910 56.30088 -21.45061 1.000 86.74106  ? 53  TRP A C   1 
ATOM   395  O O   . TRP A 1 53  ? 15.90971 55.30362 -20.98520 1.000 79.81755  ? 53  TRP A O   1 
ATOM   396  C CB  . TRP A 1 53  ? 17.84709 57.93987 -20.18121 1.000 87.77059  ? 53  TRP A CB  1 
ATOM   397  C CG  . TRP A 1 53  ? 18.29195 56.93249 -19.14251 1.000 88.58887  ? 53  TRP A CG  1 
ATOM   398  C CD1 . TRP A 1 53  ? 18.83882 55.69483 -19.37294 1.000 80.15434  ? 53  TRP A CD1 1 
ATOM   399  C CD2 . TRP A 1 53  ? 18.21020 57.07579 -17.71476 1.000 85.88475  ? 53  TRP A CD2 1 
ATOM   400  N NE1 . TRP A 1 53  ? 19.09989 55.06742 -18.18292 1.000 80.47044  ? 53  TRP A NE1 1 
ATOM   401  C CE2 . TRP A 1 53  ? 18.72696 55.89254 -17.14750 1.000 86.87656  ? 53  TRP A CE2 1 
ATOM   402  C CE3 . TRP A 1 53  ? 17.75335 58.08865 -16.86529 1.000 87.89091  ? 53  TRP A CE3 1 
ATOM   403  C CZ2 . TRP A 1 53  ? 18.80354 55.69722 -15.75850 1.000 85.23322  ? 53  TRP A CZ2 1 
ATOM   404  C CZ3 . TRP A 1 53  ? 17.82362 57.89208 -15.49160 1.000 88.71743  ? 53  TRP A CZ3 1 
ATOM   405  C CH2 . TRP A 1 53  ? 18.34626 56.70439 -14.95338 1.000 87.15137  ? 53  TRP A CH2 1 
ATOM   406  N N   . HIS A 1 54  ? 17.13442 56.27716 -22.59509 1.000 100.65016 ? 54  HIS A N   1 
ATOM   407  C CA  . HIS A 1 54  ? 17.59950 55.00469 -23.11011 1.000 111.67391 ? 54  HIS A CA  1 
ATOM   408  C C   . HIS A 1 54  ? 18.96761 55.17427 -23.74218 1.000 92.79282  ? 54  HIS A C   1 
ATOM   409  O O   . HIS A 1 54  ? 19.37095 56.26703 -24.14943 1.000 84.54247  ? 54  HIS A O   1 
ATOM   410  C CB  . HIS A 1 54  ? 16.62728 54.36138 -24.08785 1.000 133.40404 ? 54  HIS A CB  1 
ATOM   411  C CG  . HIS A 1 54  ? 16.43677 52.90243 -23.83071 1.000 150.22913 ? 54  HIS A CG  1 
ATOM   412  N ND1 . HIS A 1 54  ? 17.48631 52.01018 -23.85301 1.000 155.26067 ? 54  HIS A ND1 1 
ATOM   413  C CD2 . HIS A 1 54  ? 15.33842 52.18500 -23.49728 1.000 153.96998 ? 54  HIS A CD2 1 
ATOM   414  C CE1 . HIS A 1 54  ? 17.03881 50.80030 -23.57169 1.000 156.76443 ? 54  HIS A CE1 1 
ATOM   415  N NE2 . HIS A 1 54  ? 15.73887 50.87870 -23.35040 1.000 154.93424 ? 54  HIS A NE2 1 
ATOM   416  N N   . GLY A 1 55  ? 19.67131 54.05722 -23.80853 1.000 87.66967  ? 55  GLY A N   1 
ATOM   417  C CA  . GLY A 1 55  ? 21.10225 54.06827 -23.97267 1.000 91.66247  ? 55  GLY A CA  1 
ATOM   418  C C   . GLY A 1 55  ? 21.67304 53.69664 -22.62663 1.000 86.19621  ? 55  GLY A C   1 
ATOM   419  O O   . GLY A 1 55  ? 21.11453 54.08124 -21.60005 1.000 82.79420  ? 55  GLY A O   1 
ATOM   420  N N   . VAL A 1 56  ? 22.73335 52.89515 -22.60922 1.000 88.86880  ? 56  VAL A N   1 
ATOM   421  C CA  . VAL A 1 56  ? 23.39499 52.59150 -21.35322 1.000 82.61693  ? 56  VAL A CA  1 
ATOM   422  C C   . VAL A 1 56  ? 23.88644 53.90582 -20.77229 1.000 75.57407  ? 56  VAL A C   1 
ATOM   423  O O   . VAL A 1 56  ? 24.59080 54.67456 -21.43750 1.000 76.30828  ? 56  VAL A O   1 
ATOM   424  C CB  . VAL A 1 56  ? 24.51198 51.55908 -21.57308 1.000 96.52171  ? 56  VAL A CB  1 
ATOM   425  C CG1 . VAL A 1 56  ? 24.00715 50.45232 -22.51285 1.000 99.20662  ? 56  VAL A CG1 1 
ATOM   426  C CG2 . VAL A 1 56  ? 25.77988 52.17069 -22.15653 1.000 104.56264 ? 56  VAL A CG2 1 
ATOM   427  N N   . LEU A 1 57  ? 23.42288 54.22652 -19.56919 1.000 73.70000  ? 57  LEU A N   1 
ATOM   428  C CA  . LEU A 1 57  ? 23.90980 55.39755 -18.85455 1.000 68.72365  ? 57  LEU A CA  1 
ATOM   429  C C   . LEU A 1 57  ? 25.21500 55.03240 -18.16371 1.000 73.85646  ? 57  LEU A C   1 
ATOM   430  O O   . LEU A 1 57  ? 25.26842 54.05552 -17.40675 1.000 70.93384  ? 57  LEU A O   1 
ATOM   431  C CB  . LEU A 1 57  ? 22.87065 55.87945 -17.84511 1.000 67.14009  ? 57  LEU A CB  1 
ATOM   432  C CG  . LEU A 1 57  ? 23.15068 57.15691 -17.04581 1.000 67.27725  ? 57  LEU A CG  1 
ATOM   433  C CD1 . LEU A 1 57  ? 21.93951 58.07840 -17.07701 1.000 63.12245  ? 57  LEU A CD1 1 
ATOM   434  C CD2 . LEU A 1 57  ? 23.50717 56.82714 -15.60769 1.000 67.86540  ? 57  LEU A CD2 1 
ATOM   435  N N   . ASP A 1 58  ? 26.26916 55.79795 -18.45119 1.000 77.94413  ? 58  ASP A N   1 
ATOM   436  C CA  . ASP A 1 58  ? 27.56250 55.63506 -17.79546 1.000 80.83672  ? 58  ASP A CA  1 
ATOM   437  C C   . ASP A 1 58  ? 27.43992 55.82617 -16.28580 1.000 79.10938  ? 58  ASP A C   1 
ATOM   438  O O   . ASP A 1 58  ? 27.42555 56.96178 -15.79668 1.000 79.66071  ? 58  ASP A O   1 
ATOM   439  C CB  . ASP A 1 58  ? 28.57156 56.62861 -18.37829 1.000 76.61866  ? 58  ASP A CB  1 
ATOM   440  C CG  . ASP A 1 58  ? 29.98873 56.35823 -17.92995 1.000 84.84946  ? 58  ASP A CG  1 
ATOM   441  O OD1 . ASP A 1 58  ? 30.56530 55.34657 -18.36986 1.000 94.72824  ? 58  ASP A OD1 1 
ATOM   442  O OD2 . ASP A 1 58  ? 30.53506 57.16084 -17.15032 1.000 88.25002  ? 58  ASP A OD2 1 
ATOM   443  N N   . ALA A 1 59  ? 27.33254 54.72801 -15.54022 1.000 73.24532  ? 59  ALA A N   1 
ATOM   444  C CA  . ALA A 1 59  ? 27.35642 54.81982 -14.08553 1.000 74.52860  ? 59  ALA A CA  1 
ATOM   445  C C   . ALA A 1 59  ? 28.66816 54.25169 -13.55730 1.000 77.33680  ? 59  ALA A C   1 
ATOM   446  O O   . ALA A 1 59  ? 28.67193 53.32808 -12.74015 1.000 80.98318  ? 59  ALA A O   1 
ATOM   447  C CB  . ALA A 1 59  ? 26.15893 54.09535 -13.47235 1.000 69.17762  ? 59  ALA A CB  1 
ATOM   448  N N   . THR A 1 60  ? 29.78739 54.78685 -14.04764 1.000 73.52578  ? 60  THR A N   1 
ATOM   449  C CA  . THR A 1 60  ? 31.11544 54.32819 -13.68053 1.000 65.96011  ? 60  THR A CA  1 
ATOM   450  C C   . THR A 1 60  ? 31.97172 55.41203 -13.04524 1.000 70.81680  ? 60  THR A C   1 
ATOM   451  O O   . THR A 1 60  ? 33.01194 55.08569 -12.46271 1.000 80.99753  ? 60  THR A O   1 
ATOM   452  C CB  . THR A 1 60  ? 31.85955 53.75736 -14.90857 1.000 72.72818  ? 60  THR A CB  1 
ATOM   453  O OG1 . THR A 1 60  ? 32.28379 54.82133 -15.76558 1.000 73.35347  ? 60  THR A OG1 1 
ATOM   454  C CG2 . THR A 1 60  ? 30.97386 52.80416 -15.70995 1.000 67.15762  ? 60  THR A CG2 1 
ATOM   455  N N   . GLY A 1 61  ? 31.57315 56.68006 -13.13452 1.000 67.68589  ? 61  GLY A N   1 
ATOM   456  C CA  . GLY A 1 61  ? 32.25318 57.74681 -12.44038 1.000 69.29890  ? 61  GLY A CA  1 
ATOM   457  C C   . GLY A 1 61  ? 31.46901 58.19615 -11.21456 1.000 74.24579  ? 61  GLY A C   1 
ATOM   458  O O   . GLY A 1 61  ? 30.32483 57.81922 -10.99569 1.000 68.97693  ? 61  GLY A O   1 
ATOM   459  N N   . LEU A 1 62  ? 32.11328 59.02105 -10.39971 1.000 76.29379  ? 62  LEU A N   1 
ATOM   460  C CA  . LEU A 1 62  ? 31.41113 59.59002 -9.26236  1.000 70.39112  ? 62  LEU A CA  1 
ATOM   461  C C   . LEU A 1 62  ? 30.55800 60.76515 -9.71108  1.000 64.17064  ? 62  LEU A C   1 
ATOM   462  O O   . LEU A 1 62  ? 30.90352 61.49917 -10.64155 1.000 58.06842  ? 62  LEU A O   1 
ATOM   463  C CB  . LEU A 1 62  ? 32.38561 60.03892 -8.17266  1.000 68.79053  ? 62  LEU A CB  1 
ATOM   464  C CG  . LEU A 1 62  ? 33.30372 58.94265 -7.63667  1.000 80.15457  ? 62  LEU A CG  1 
ATOM   465  C CD1 . LEU A 1 62  ? 33.97095 59.38860 -6.35924  1.000 75.71308  ? 62  LEU A CD1 1 
ATOM   466  C CD2 . LEU A 1 62  ? 32.52426 57.64885 -7.41256  1.000 88.24102  ? 62  LEU A CD2 1 
ATOM   467  N N   . SER A 1 63  ? 29.43582 60.94247 -9.02914  1.000 66.59956  ? 63  SER A N   1 
ATOM   468  C CA  . SER A 1 63  ? 28.54113 62.03305 -9.34954  1.000 57.55509  ? 63  SER A CA  1 
ATOM   469  C C   . SER A 1 63  ? 29.02289 63.32441 -8.70183  1.000 62.50050  ? 63  SER A C   1 
ATOM   470  O O   . SER A 1 63  ? 29.99071 63.35146 -7.93299  1.000 65.01874  ? 63  SER A O   1 
ATOM   471  C CB  . SER A 1 63  ? 27.12527 61.71760 -8.89092  1.000 56.71148  ? 63  SER A CB  1 
ATOM   472  O OG  . SER A 1 63  ? 26.87576 62.35365 -7.64912  1.000 71.53321  ? 63  SER A OG  1 
ATOM   473  N N   . ALA A 1 64  ? 28.31068 64.40288 -9.01526  1.000 60.14419  ? 64  ALA A N   1 
ATOM   474  C CA  . ALA A 1 64  ? 28.65618 65.72622 -8.53544  1.000 60.88406  ? 64  ALA A CA  1 
ATOM   475  C C   . ALA A 1 64  ? 28.38937 65.82456 -7.04338  1.000 64.51018  ? 64  ALA A C   1 
ATOM   476  O O   . ALA A 1 64  ? 27.70275 64.98818 -6.45581  1.000 72.74159  ? 64  ALA A O   1 
ATOM   477  C CB  . ALA A 1 64  ? 27.85529 66.78950 -9.28580  1.000 53.50924  ? 64  ALA A CB  1 
ATOM   478  N N   . THR A 1 65  ? 28.94336 66.86108 -6.42288  1.000 64.03848  ? 65  THR A N   1 
ATOM   479  C CA  . THR A 1 65  ? 28.63374 67.17868 -5.03451  1.000 64.38017  ? 65  THR A CA  1 
ATOM   480  C C   . THR A 1 65  ? 27.65859 68.34573 -5.00189  1.000 55.38894  ? 65  THR A C   1 
ATOM   481  O O   . THR A 1 65  ? 27.87631 69.35738 -5.67789  1.000 58.74875  ? 65  THR A O   1 
ATOM   482  C CB  . THR A 1 65  ? 29.89748 67.52516 -4.24462  1.000 76.81420  ? 65  THR A CB  1 
ATOM   483  O OG1 . THR A 1 65  ? 30.77286 66.38843 -4.21733  1.000 81.41988  ? 65  THR A OG1 1 
ATOM   484  C CG2 . THR A 1 65  ? 29.54256 67.95203 -2.80843  1.000 75.20147  ? 65  THR A CG2 1 
ATOM   485  N N   . CYS A 1 66  ? 26.58511 68.19420 -4.22880  1.000 47.23776  ? 66  CYS A N   1 
ATOM   486  C CA  . CYS A 1 66  ? 25.62503 69.27263 -4.02834  1.000 44.89714  ? 66  CYS A CA  1 
ATOM   487  C C   . CYS A 1 66  ? 26.32529 70.50725 -3.46902  1.000 50.77098  ? 66  CYS A C   1 
ATOM   488  O O   . CYS A 1 66  ? 27.28930 70.40760 -2.70186  1.000 51.46954  ? 66  CYS A O   1 
ATOM   489  C CB  . CYS A 1 66  ? 24.51043 68.81680 -3.08885  1.000 43.34516  ? 66  CYS A CB  1 
ATOM   490  S SG  . CYS A 1 66  ? 23.32535 67.62882 -3.80230  1.000 59.33931  ? 66  CYS A SG  1 
ATOM   491  N N   . VAL A 1 67  ? 25.84015 71.68513 -3.87543  1.000 54.35132  ? 67  VAL A N   1 
ATOM   492  C CA  . VAL A 1 67  ? 26.58509 72.91475 -3.62845  1.000 59.23446  ? 67  VAL A CA  1 
ATOM   493  C C   . VAL A 1 67  ? 26.82815 73.07281 -2.13656  1.000 61.17532  ? 67  VAL A C   1 
ATOM   494  O O   . VAL A 1 67  ? 25.92161 72.87982 -1.31551  1.000 58.21687  ? 67  VAL A O   1 
ATOM   495  C CB  . VAL A 1 67  ? 25.84869 74.13020 -4.21590  1.000 57.36865  ? 67  VAL A CB  1 
ATOM   496  C CG1 . VAL A 1 67  ? 26.58881 75.41003 -3.86178  1.000 55.31233  ? 67  VAL A CG1 1 
ATOM   497  C CG2 . VAL A 1 67  ? 25.70263 74.00597 -5.73593  1.000 52.88066  ? 67  VAL A CG2 1 
ATOM   498  N N   . GLN A 1 68  ? 28.07136 73.38748 -1.77961  1.000 66.22311  ? 68  GLN A N   1 
ATOM   499  C CA  . GLN A 1 68  ? 28.45128 73.62873 -0.39507  1.000 61.74491  ? 68  GLN A CA  1 
ATOM   500  C C   . GLN A 1 68  ? 29.80447 74.32209 -0.38729  1.000 70.86992  ? 68  GLN A C   1 
ATOM   501  O O   . GLN A 1 68  ? 30.45492 74.47550 -1.42902  1.000 75.59307  ? 68  GLN A O   1 
ATOM   502  C CB  . GLN A 1 68  ? 28.49974 72.33124 0.41068   1.000 57.01725  ? 68  GLN A CB  1 
ATOM   503  C CG  . GLN A 1 68  ? 29.33415 71.25624 -0.23288  1.000 63.78540  ? 68  GLN A CG  1 
ATOM   504  C CD  . GLN A 1 68  ? 29.13647 69.90394 0.41264   1.000 63.75645  ? 68  GLN A CD  1 
ATOM   505  O OE1 . GLN A 1 68  ? 29.91024 69.50181 1.29105   1.000 65.88729  ? 68  GLN A OE1 1 
ATOM   506  N NE2 . GLN A 1 68  ? 28.09641 69.18752 -0.01931  1.000 51.75182  ? 68  GLN A NE2 1 
ATOM   507  N N   . GLU A 1 69  ? 30.21443 74.74849 0.80849   1.000 72.15187  ? 69  GLU A N   1 
ATOM   508  C CA  . GLU A 1 69  ? 31.49991 75.38978 1.04680   1.000 71.03691  ? 69  GLU A CA  1 
ATOM   509  C C   . GLU A 1 69  ? 32.44010 74.40960 1.73106   1.000 64.59931  ? 69  GLU A C   1 
ATOM   510  O O   . GLU A 1 69  ? 32.01399 73.53998 2.49746   1.000 69.72357  ? 69  GLU A O   1 
ATOM   511  C CB  . GLU A 1 69  ? 31.34498 76.65517 1.90000   1.000 71.82380  ? 69  GLU A CB  1 
ATOM   512  C CG  . GLU A 1 69  ? 30.64509 77.78438 1.15737   1.000 88.51324  ? 69  GLU A CG  1 
ATOM   513  C CD  . GLU A 1 69  ? 31.42730 78.25140 -0.06593  1.000 104.96678 ? 69  GLU A CD  1 
ATOM   514  O OE1 . GLU A 1 69  ? 32.63778 78.53769 0.07730   1.000 106.62402 ? 69  GLU A OE1 1 
ATOM   515  O OE2 . GLU A 1 69  ? 30.83587 78.32540 -1.16884  1.000 111.61576 ? 69  GLU A OE2 1 
ATOM   516  N N   . ARG A 1 70  ? 33.72260 74.53999 1.44206   1.000 65.27963  ? 70  ARG A N   1 
ATOM   517  C CA  . ARG A 1 70  ? 34.70511 73.63698 2.01137   1.000 74.14714  ? 70  ARG A CA  1 
ATOM   518  C C   . ARG A 1 70  ? 35.36857 74.29047 3.21178   1.000 79.78701  ? 70  ARG A C   1 
ATOM   519  O O   . ARG A 1 70  ? 35.80536 75.44265 3.14273   1.000 85.76042  ? 70  ARG A O   1 
ATOM   520  C CB  . ARG A 1 70  ? 35.75456 73.22630 0.97937   1.000 79.04777  ? 70  ARG A CB  1 
ATOM   521  C CG  . ARG A 1 70  ? 36.41756 74.36224 0.22001   1.000 84.53812  ? 70  ARG A CG  1 
ATOM   522  C CD  . ARG A 1 70  ? 37.19097 73.80649 -0.97399  1.000 89.07048  ? 70  ARG A CD  1 
ATOM   523  N NE  . ARG A 1 70  ? 36.60901 72.54433 -1.43612  1.000 84.10595  ? 70  ARG A NE  1 
ATOM   524  C CZ  . ARG A 1 70  ? 37.22267 71.36863 -1.35592  1.000 78.42169  ? 70  ARG A CZ  1 
ATOM   525  N NH1 . ARG A 1 70  ? 38.44079 71.30017 -0.84374  1.000 79.24498  ? 70  ARG A NH1 1 
ATOM   526  N NH2 . ARG A 1 70  ? 36.62230 70.26736 -1.78312  1.000 76.59410  ? 70  ARG A NH2 1 
ATOM   527  N N   . TYR A 1 71  ? 35.43161 73.55626 4.30908   1.000 80.08383  ? 71  TYR A N   1 
ATOM   528  C CA  . TYR A 1 71  ? 36.19537 74.01119 5.45549   1.000 82.19844  ? 71  TYR A CA  1 
ATOM   529  C C   . TYR A 1 71  ? 37.67892 73.96727 5.11269   1.000 76.14415  ? 71  TYR A C   1 
ATOM   530  O O   . TYR A 1 71  ? 38.21187 72.90729 4.77121   1.000 75.71704  ? 71  TYR A O   1 
ATOM   531  C CB  . TYR A 1 71  ? 35.88199 73.14325 6.67056   1.000 87.08089  ? 71  TYR A CB  1 
ATOM   532  C CG  . TYR A 1 71  ? 34.44243 73.24034 7.13858   1.000 80.20716  ? 71  TYR A CG  1 
ATOM   533  C CD1 . TYR A 1 71  ? 33.45188 72.45658 6.56903   1.000 67.87297  ? 71  TYR A CD1 1 
ATOM   534  C CD2 . TYR A 1 71  ? 34.07819 74.12191 8.15308   1.000 84.47740  ? 71  TYR A CD2 1 
ATOM   535  C CE1 . TYR A 1 71  ? 32.14546 72.54239 6.99768   1.000 66.93382  ? 71  TYR A CE1 1 
ATOM   536  C CE2 . TYR A 1 71  ? 32.76491 74.21209 8.59387   1.000 77.62605  ? 71  TYR A CE2 1 
ATOM   537  C CZ  . TYR A 1 71  ? 31.80757 73.42177 8.01295   1.000 76.76943  ? 71  TYR A CZ  1 
ATOM   538  O OH  . TYR A 1 71  ? 30.50404 73.51268 8.44705   1.000 84.57608  ? 71  TYR A OH  1 
ATOM   539  N N   . GLU A 1 72  ? 38.33642 75.12157 5.16415   1.000 72.47767  ? 72  GLU A N   1 
ATOM   540  C CA  . GLU A 1 72  ? 39.77187 75.21187 4.95485   1.000 79.75324  ? 72  GLU A CA  1 
ATOM   541  C C   . GLU A 1 72  ? 40.46434 75.74901 6.19828   1.000 80.92618  ? 72  GLU A C   1 
ATOM   542  O O   . GLU A 1 72  ? 41.41424 76.52974 6.11278   1.000 86.21412  ? 72  GLU A O   1 
ATOM   543  C CB  . GLU A 1 72  ? 40.09480 76.08257 3.74544   1.000 94.65488  ? 72  GLU A CB  1 
ATOM   544  C CG  . GLU A 1 72  ? 39.44567 75.63152 2.45178   1.000 100.71508 ? 72  GLU A CG  1 
ATOM   545  C CD  . GLU A 1 72  ? 40.13929 74.44576 1.82011   1.000 104.43636 ? 72  GLU A CD  1 
ATOM   546  O OE1 . GLU A 1 72  ? 40.99273 73.80871 2.48346   1.000 104.43466 ? 72  GLU A OE1 1 
ATOM   547  O OE2 . GLU A 1 72  ? 39.82393 74.15838 0.64690   1.000 104.51458 ? 72  GLU A OE2 1 
ATOM   548  N N   . TYR A 1 73  ? 39.99722 75.32883 7.37903   1.000 80.61276  ? 73  TYR A N   1 
ATOM   549  C CA  . TYR A 1 73  ? 40.60860 75.81067 8.61262   1.000 81.40934  ? 73  TYR A CA  1 
ATOM   550  C C   . TYR A 1 73  ? 42.04289 75.31885 8.74989   1.000 77.83857  ? 73  TYR A C   1 
ATOM   551  O O   . TYR A 1 73  ? 42.87011 75.98742 9.37650   1.000 74.24345  ? 73  TYR A O   1 
ATOM   552  C CB  . TYR A 1 73  ? 39.78269 75.38551 9.82427   1.000 81.75827  ? 73  TYR A CB  1 
ATOM   553  C CG  . TYR A 1 73  ? 38.46334 76.12349 9.99207   1.000 87.48795  ? 73  TYR A CG  1 
ATOM   554  C CD1 . TYR A 1 73  ? 37.54031 76.19660 8.95354   1.000 88.05923  ? 73  TYR A CD1 1 
ATOM   555  C CD2 . TYR A 1 73  ? 38.12899 76.72414 11.20268  1.000 89.06789  ? 73  TYR A CD2 1 
ATOM   556  C CE1 . TYR A 1 73  ? 36.32526 76.85725 9.11377   1.000 88.61960  ? 73  TYR A CE1 1 
ATOM   557  C CE2 . TYR A 1 73  ? 36.91664 77.38717 11.37307  1.000 86.69689  ? 73  TYR A CE2 1 
ATOM   558  C CZ  . TYR A 1 73  ? 36.02180 77.45151 10.32738  1.000 89.31576  ? 73  TYR A CZ  1 
ATOM   559  O OH  . TYR A 1 73  ? 34.82462 78.11386 10.49624  1.000 90.87481  ? 73  TYR A OH  1 
ATOM   560  N N   . PHE A 1 74  ? 42.36099 74.17401 8.15838   1.000 78.41214  ? 74  PHE A N   1 
ATOM   561  C CA  . PHE A 1 74  ? 43.70663 73.60956 8.19072   1.000 84.38752  ? 74  PHE A CA  1 
ATOM   562  C C   . PHE A 1 74  ? 44.10405 73.29925 6.75962   1.000 90.07596  ? 74  PHE A C   1 
ATOM   563  O O   . PHE A 1 74  ? 43.96461 72.15644 6.30117   1.000 84.24606  ? 74  PHE A O   1 
ATOM   564  C CB  . PHE A 1 74  ? 43.75909 72.36481 9.07384   1.000 86.80166  ? 74  PHE A CB  1 
ATOM   565  C CG  . PHE A 1 74  ? 43.16369 72.57612 10.42579  1.000 85.54536  ? 74  PHE A CG  1 
ATOM   566  C CD1 . PHE A 1 74  ? 41.82838 72.27942 10.65869  1.000 81.23778  ? 74  PHE A CD1 1 
ATOM   567  C CD2 . PHE A 1 74  ? 43.92762 73.10660 11.45666  1.000 77.71513  ? 74  PHE A CD2 1 
ATOM   568  C CE1 . PHE A 1 74  ? 41.27179 72.48767 11.89595  1.000 74.90526  ? 74  PHE A CE1 1 
ATOM   569  C CE2 . PHE A 1 74  ? 43.37598 73.32380 12.69031  1.000 75.18080  ? 74  PHE A CE2 1 
ATOM   570  C CZ  . PHE A 1 74  ? 42.04370 73.00846 12.91481  1.000 75.00567  ? 74  PHE A CZ  1 
ATOM   571  N N   . PRO A 1 75  ? 44.59878 74.29686 6.02373   1.000 100.08612 ? 75  PRO A N   1 
ATOM   572  C CA  . PRO A 1 75  ? 44.93727 74.08615 4.60831   1.000 99.32649  ? 75  PRO A CA  1 
ATOM   573  C C   . PRO A 1 75  ? 45.99385 73.00405 4.45953   1.000 95.12924  ? 75  PRO A C   1 
ATOM   574  O O   . PRO A 1 75  ? 47.08856 73.09219 5.02566   1.000 96.35983  ? 75  PRO A O   1 
ATOM   575  C CB  . PRO A 1 75  ? 45.45743 75.45835 4.16030   1.000 103.37825 ? 75  PRO A CB  1 
ATOM   576  C CG  . PRO A 1 75  ? 44.96503 76.42779 5.19514   1.000 102.51672 ? 75  PRO A CG  1 
ATOM   577  C CD  . PRO A 1 75  ? 44.94250 75.65617 6.47287   1.000 105.29166 ? 75  PRO A CD  1 
ATOM   578  N N   . GLY A 1 76  ? 45.64844 71.96475 3.70413   1.000 89.34405  ? 76  GLY A N   1 
ATOM   579  C CA  . GLY A 1 76  ? 46.54748 70.86673 3.45997   1.000 96.39810  ? 76  GLY A CA  1 
ATOM   580  C C   . GLY A 1 76  ? 46.45862 69.72621 4.45064   1.000 100.22890 ? 76  GLY A C   1 
ATOM   581  O O   . GLY A 1 76  ? 46.93489 68.62524 4.14903   1.000 109.49178 ? 76  GLY A O   1 
ATOM   582  N N   . PHE A 1 77  ? 45.87339 69.94768 5.62266   1.000 87.39116  ? 77  PHE A N   1 
ATOM   583  C CA  . PHE A 1 77  ? 45.70964 68.85854 6.57026   1.000 76.84853  ? 77  PHE A CA  1 
ATOM   584  C C   . PHE A 1 77  ? 44.74704 67.84119 5.98646   1.000 76.27637  ? 77  PHE A C   1 
ATOM   585  O O   . PHE A 1 77  ? 43.58024 68.15812 5.72278   1.000 74.56057  ? 77  PHE A O   1 
ATOM   586  C CB  . PHE A 1 77  ? 45.19583 69.38211 7.90438   1.000 80.40864  ? 77  PHE A CB  1 
ATOM   587  C CG  . PHE A 1 77  ? 45.05746 68.32413 8.95608   1.000 77.46367  ? 77  PHE A CG  1 
ATOM   588  C CD1 . PHE A 1 77  ? 43.89136 68.20854 9.68287   1.000 70.65913  ? 77  PHE A CD1 1 
ATOM   589  C CD2 . PHE A 1 77  ? 46.10221 67.44963 9.22194   1.000 84.54486  ? 77  PHE A CD2 1 
ATOM   590  C CE1 . PHE A 1 77  ? 43.75765 67.23279 10.66122  1.000 71.35964  ? 77  PHE A CE1 1 
ATOM   591  C CE2 . PHE A 1 77  ? 45.98262 66.47461 10.19787  1.000 84.80287  ? 77  PHE A CE2 1 
ATOM   592  C CZ  . PHE A 1 77  ? 44.80267 66.36410 10.92071  1.000 76.75398  ? 77  PHE A CZ  1 
ATOM   593  N N   . SER A 1 78  ? 45.24004 66.62272 5.76684   1.000 79.57811  ? 78  SER A N   1 
ATOM   594  C CA  . SER A 1 78  ? 44.39335 65.59510 5.17370   1.000 75.51787  ? 78  SER A CA  1 
ATOM   595  C C   . SER A 1 78  ? 43.14962 65.34679 6.02013   1.000 75.18791  ? 78  SER A C   1 
ATOM   596  O O   . SER A 1 78  ? 42.05285 65.15661 5.47501   1.000 80.90243  ? 78  SER A O   1 
ATOM   597  C CB  . SER A 1 78  ? 45.19450 64.31035 4.96997   1.000 78.47108  ? 78  SER A CB  1 
ATOM   598  O OG  . SER A 1 78  ? 44.96281 63.38958 6.00897   1.000 90.30326  ? 78  SER A OG  1 
ATOM   599  N N   . GLY A 1 79  ? 43.28853 65.40080 7.35576   1.000 70.60988  ? 79  GLY A N   1 
ATOM   600  C CA  . GLY A 1 79  ? 42.17011 65.09084 8.23688   1.000 55.85739  ? 79  GLY A CA  1 
ATOM   601  C C   . GLY A 1 79  ? 40.95227 65.98637 8.05629   1.000 64.89829  ? 79  GLY A C   1 
ATOM   602  O O   . GLY A 1 79  ? 39.81798 65.56020 8.30810   1.000 63.11566  ? 79  GLY A O   1 
ATOM   603  N N   . GLU A 1 80  ? 41.15770 67.23460 7.62825   1.000 70.72837  ? 80  GLU A N   1 
ATOM   604  C CA  . GLU A 1 80  ? 40.01095 68.09611 7.35832   1.000 75.56458  ? 80  GLU A CA  1 
ATOM   605  C C   . GLU A 1 80  ? 39.42179 67.84879 5.97689   1.000 78.00568  ? 80  GLU A C   1 
ATOM   606  O O   . GLU A 1 80  ? 38.19391 67.79812 5.82408   1.000 76.33035  ? 80  GLU A O   1 
ATOM   607  C CB  . GLU A 1 80  ? 40.39252 69.56942 7.48117   1.000 74.60139  ? 80  GLU A CB  1 
ATOM   608  C CG  . GLU A 1 80  ? 39.27575 70.51455 7.04395   1.000 67.07038  ? 80  GLU A CG  1 
ATOM   609  C CD  . GLU A 1 80  ? 39.69689 71.96374 7.09297   1.000 79.44937  ? 80  GLU A CD  1 
ATOM   610  O OE1 . GLU A 1 80  ? 40.77533 72.28637 6.54042   1.000 84.46071  ? 80  GLU A OE1 1 
ATOM   611  O OE2 . GLU A 1 80  ? 38.95118 72.77993 7.67977   1.000 79.18084  ? 80  GLU A OE2 1 
ATOM   612  N N   . GLU A 1 81  ? 40.26869 67.70968 4.95850   1.000 87.54322  ? 81  GLU A N   1 
ATOM   613  C CA  . GLU A 1 81  ? 39.75125 67.76889 3.59725   1.000 100.99242 ? 81  GLU A CA  1 
ATOM   614  C C   . GLU A 1 81  ? 39.19041 66.44242 3.10270   1.000 87.11074  ? 81  GLU A C   1 
ATOM   615  O O   . GLU A 1 81  ? 38.48470 66.43630 2.08557   1.000 87.84025  ? 81  GLU A O   1 
ATOM   616  C CB  . GLU A 1 81  ? 40.83336 68.27230 2.63280   1.000 112.37887 ? 81  GLU A CB  1 
ATOM   617  C CG  . GLU A 1 81  ? 40.86603 69.79293 2.50824   1.000 121.75138 ? 81  GLU A CG  1 
ATOM   618  C CD  . GLU A 1 81  ? 40.37595 70.28225 1.15276   1.000 130.11041 ? 81  GLU A CD  1 
ATOM   619  O OE1 . GLU A 1 81  ? 39.89185 69.45343 0.35281   1.000 132.63349 ? 81  GLU A OE1 1 
ATOM   620  O OE2 . GLU A 1 81  ? 40.44511 71.50383 0.89345   1.000 135.39507 ? 81  GLU A OE2 1 
ATOM   621  N N   . ILE A 1 82  ? 39.45114 65.33247 3.79983   1.000 66.92236  ? 82  ILE A N   1 
ATOM   622  C CA  . ILE A 1 82  ? 38.77167 64.08827 3.45947   1.000 60.39100  ? 82  ILE A CA  1 
ATOM   623  C C   . ILE A 1 82  ? 37.26876 64.17579 3.68370   1.000 68.99174  ? 82  ILE A C   1 
ATOM   624  O O   . ILE A 1 82  ? 36.52690 63.30613 3.21005   1.000 73.64728  ? 82  ILE A O   1 
ATOM   625  C CB  . ILE A 1 82  ? 39.36640 62.89286 4.23635   1.000 60.22456  ? 82  ILE A CB  1 
ATOM   626  C CG1 . ILE A 1 82  ? 39.16053 63.03474 5.74962   1.000 60.70870  ? 82  ILE A CG1 1 
ATOM   627  C CG2 . ILE A 1 82  ? 40.82955 62.74350 3.94378   1.000 60.34048  ? 82  ILE A CG2 1 
ATOM   628  C CD1 . ILE A 1 82  ? 38.64224 61.77646 6.38693   1.000 52.79985  ? 82  ILE A CD1 1 
ATOM   629  N N   . TRP A 1 83  ? 36.80224 65.21155 4.38438   1.000 67.75920  ? 83  TRP A N   1 
ATOM   630  C CA  . TRP A 1 83  ? 35.38339 65.52308 4.50644   1.000 70.07381  ? 83  TRP A CA  1 
ATOM   631  C C   . TRP A 1 83  ? 34.93283 66.59120 3.52124   1.000 53.48615  ? 83  TRP A C   1 
ATOM   632  O O   . TRP A 1 83  ? 33.74012 66.88708 3.44248   1.000 58.34765  ? 83  TRP A O   1 
ATOM   633  C CB  . TRP A 1 83  ? 35.06189 65.97112 5.94783   1.000 67.53299  ? 83  TRP A CB  1 
ATOM   634  C CG  . TRP A 1 83  ? 35.50399 64.95619 6.90248   1.000 67.20517  ? 83  TRP A CG  1 
ATOM   635  C CD1 . TRP A 1 83  ? 36.64897 64.96669 7.64632   1.000 76.74114  ? 83  TRP A CD1 1 
ATOM   636  C CD2 . TRP A 1 83  ? 34.84945 63.72055 7.18585   1.000 61.16453  ? 83  TRP A CD2 1 
ATOM   637  N NE1 . TRP A 1 83  ? 36.73762 63.81315 8.39181   1.000 73.00587  ? 83  TRP A NE1 1 
ATOM   638  C CE2 . TRP A 1 83  ? 35.64417 63.03113 8.12476   1.000 60.95895  ? 83  TRP A CE2 1 
ATOM   639  C CE3 . TRP A 1 83  ? 33.66620 63.12683 6.73740   1.000 58.36979  ? 83  TRP A CE3 1 
ATOM   640  C CZ2 . TRP A 1 83  ? 35.29294 61.78232 8.62096   1.000 57.83746  ? 83  TRP A CZ2 1 
ATOM   641  C CZ3 . TRP A 1 83  ? 33.31858 61.88180 7.23225   1.000 55.52505  ? 83  TRP A CZ3 1 
ATOM   642  C CH2 . TRP A 1 83  ? 34.12625 61.22705 8.16728   1.000 59.05014  ? 83  TRP A CH2 1 
ATOM   643  N N   . ASN A 1 84  ? 35.84033 67.19173 2.81595   1.000 49.20613  ? 84  ASN A N   1 
ATOM   644  C CA  . ASN A 1 84  ? 35.45235 68.14458 1.79834   1.000 67.37584  ? 84  ASN A CA  1 
ATOM   645  C C   . ASN A 1 84  ? 35.02319 67.42083 0.51911   1.000 65.59754  ? 84  ASN A C   1 
ATOM   646  O O   . ASN A 1 84  ? 35.39023 66.26173 0.29256   1.000 63.29851  ? 84  ASN A O   1 
ATOM   647  C CB  . ASN A 1 84  ? 36.61072 69.10361 1.53871   1.000 69.97429  ? 84  ASN A CB  1 
ATOM   648  C CG  . ASN A 1 84  ? 36.65506 70.22961 2.54738   1.000 63.83887  ? 84  ASN A CG  1 
ATOM   649  O OD1 . ASN A 1 84  ? 35.61588 70.73388 2.95729   1.000 65.21015  ? 84  ASN A OD1 1 
ATOM   650  N ND2 . ASN A 1 84  ? 37.85115 70.62802 2.95373   1.000 61.85784  ? 84  ASN A ND2 1 
ATOM   651  N N   . PRO A 1 85  ? 34.21993 68.07381 -0.31830  1.000 67.19203  ? 85  PRO A N   1 
ATOM   652  C CA  . PRO A 1 85  ? 33.79793 67.44682 -1.57972  1.000 70.86824  ? 85  PRO A CA  1 
ATOM   653  C C   . PRO A 1 85  ? 34.99271 66.98280 -2.40393  1.000 63.32191  ? 85  PRO A C   1 
ATOM   654  O O   . PRO A 1 85  ? 35.96986 67.70743 -2.56551  1.000 57.52154  ? 85  PRO A O   1 
ATOM   655  C CB  . PRO A 1 85  ? 33.02447 68.56722 -2.28249  1.000 68.91840  ? 85  PRO A CB  1 
ATOM   656  C CG  . PRO A 1 85  ? 32.52724 69.42214 -1.16618  1.000 67.05747  ? 85  PRO A CG  1 
ATOM   657  C CD  . PRO A 1 85  ? 33.58597 69.38840 -0.11462  1.000 65.63879  ? 85  PRO A CD  1 
ATOM   658  N N   . ASN A 1 86  ? 34.92548 65.74447 -2.89545  1.000 62.52260  ? 86  ASN A N   1 
ATOM   659  C CA  . ASN A 1 86  ? 35.98539 65.18039 -3.72375  1.000 63.08041  ? 86  ASN A CA  1 
ATOM   660  C C   . ASN A 1 86  ? 35.57768 65.02235 -5.18196  1.000 60.77239  ? 86  ASN A C   1 
ATOM   661  O O   . ASN A 1 86  ? 36.34930 64.46575 -5.96904  1.000 65.08762  ? 86  ASN A O   1 
ATOM   662  C CB  . ASN A 1 86  ? 36.45844 63.82976 -3.15979  1.000 61.88339  ? 86  ASN A CB  1 
ATOM   663  C CG  . ASN A 1 86  ? 35.42477 62.72616 -3.30283  1.000 63.01980  ? 86  ASN A CG  1 
ATOM   664  O OD1 . ASN A 1 86  ? 34.26033 62.96809 -3.61939  1.000 63.05362  ? 86  ASN A OD1 1 
ATOM   665  N ND2 . ASN A 1 86  ? 35.85553 61.49685 -3.06015  1.000 66.73334  ? 86  ASN A ND2 1 
ATOM   666  N N   . THR A 1 87  ? 34.37826 65.45912 -5.54997  1.000 61.47577  ? 87  THR A N   1 
ATOM   667  C CA  . THR A 1 87  ? 33.99242 65.68063 -6.93559  1.000 57.66928  ? 87  THR A CA  1 
ATOM   668  C C   . THR A 1 87  ? 33.51715 67.12077 -7.09238  1.000 60.38917  ? 87  THR A C   1 
ATOM   669  O O   . THR A 1 87  ? 33.40692 67.87859 -6.12390  1.000 67.36984  ? 87  THR A O   1 
ATOM   670  C CB  . THR A 1 87  ? 32.90136 64.70653 -7.40756  1.000 55.51350  ? 87  THR A CB  1 
ATOM   671  O OG1 . THR A 1 87  ? 31.63352 65.04706 -6.83338  1.000 60.29602  ? 87  THR A OG1 1 
ATOM   672  C CG2 . THR A 1 87  ? 33.24919 63.27455 -7.07497  1.000 51.54534  ? 87  THR A CG2 1 
ATOM   673  N N   . ASN A 1 88  ? 33.23862 67.49047 -8.33589  1.000 67.70685  ? 88  ASN A N   1 
ATOM   674  C CA  . ASN A 1 88  ? 32.84454 68.85419 -8.63321  1.000 68.37876  ? 88  ASN A CA  1 
ATOM   675  C C   . ASN A 1 88  ? 31.55755 69.18411 -7.89794  1.000 66.99725  ? 88  ASN A C   1 
ATOM   676  O O   . ASN A 1 88  ? 30.67180 68.33491 -7.73903  1.000 62.22604  ? 88  ASN A O   1 
ATOM   677  C CB  . ASN A 1 88  ? 32.67725 69.04300 -10.14433 1.000 79.04386  ? 88  ASN A CB  1 
ATOM   678  C CG  . ASN A 1 88  ? 33.97808 69.45058 -10.83772 1.000 91.34699  ? 88  ASN A CG  1 
ATOM   679  O OD1 . ASN A 1 88  ? 35.04917 69.43559 -10.22425 1.000 90.35759  ? 88  ASN A OD1 1 
ATOM   680  N ND2 . ASN A 1 88  ? 33.88600 69.82413 -12.12283 1.000 96.79558  ? 88  ASN A ND2 1 
ATOM   681  N N   . VAL A 1 89  ? 31.49358 70.41340 -7.40271  1.000 69.07574  ? 89  VAL A N   1 
ATOM   682  C CA  . VAL A 1 89  ? 30.30665 70.95534 -6.75060  1.000 63.56941  ? 89  VAL A CA  1 
ATOM   683  C C   . VAL A 1 89  ? 29.36939 71.51904 -7.81747  1.000 64.33093  ? 89  VAL A C   1 
ATOM   684  O O   . VAL A 1 89  ? 29.80424 72.25757 -8.70957  1.000 66.38362  ? 89  VAL A O   1 
ATOM   685  C CB  . VAL A 1 89  ? 30.70121 72.03712 -5.73267  1.000 61.53863  ? 89  VAL A CB  1 
ATOM   686  C CG1 . VAL A 1 89  ? 29.58315 73.04904 -5.55263  1.000 65.77878  ? 89  VAL A CG1 1 
ATOM   687  C CG2 . VAL A 1 89  ? 31.06081 71.38837 -4.40632  1.000 63.02631  ? 89  VAL A CG2 1 
ATOM   688  N N   . SER A 1 90  ? 28.08519 71.16634 -7.73204  1.000 57.27170  ? 90  SER A N   1 
ATOM   689  C CA  . SER A 1 90  ? 27.08817 71.71312 -8.64391  1.000 60.19719  ? 90  SER A CA  1 
ATOM   690  C C   . SER A 1 90  ? 25.68477 71.44480 -8.12568  1.000 59.85147  ? 90  SER A C   1 
ATOM   691  O O   . SER A 1 90  ? 25.45331 70.49684 -7.36975  1.000 60.94417  ? 90  SER A O   1 
ATOM   692  C CB  . SER A 1 90  ? 27.23127 71.12373 -10.04481 1.000 65.51405  ? 90  SER A CB  1 
ATOM   693  O OG  . SER A 1 90  ? 25.95508 71.02955 -10.64829 1.000 66.20274  ? 90  SER A OG  1 
ATOM   694  N N   . GLU A 1 91  ? 24.73627 72.27573 -8.58524  1.000 52.23384  ? 91  GLU A N   1 
ATOM   695  C CA  . GLU A 1 91  ? 23.34303 72.04421 -8.22519  1.000 48.27294  ? 91  GLU A CA  1 
ATOM   696  C C   . GLU A 1 91  ? 22.81418 70.77450 -8.85981  1.000 53.83821  ? 91  GLU A C   1 
ATOM   697  O O   . GLU A 1 91  ? 21.98963 70.08177 -8.26011  1.000 63.52382  ? 91  GLU A O   1 
ATOM   698  C CB  . GLU A 1 91  ? 22.47523 73.22645 -8.62773  1.000 46.69956  ? 91  GLU A CB  1 
ATOM   699  C CG  . GLU A 1 91  ? 22.51391 74.36754 -7.64178  1.000 52.43865  ? 91  GLU A CG  1 
ATOM   700  C CD  . GLU A 1 91  ? 21.61914 75.50053 -8.05749  1.000 67.46687  ? 91  GLU A CD  1 
ATOM   701  O OE1 . GLU A 1 91  ? 20.72667 75.85121 -7.25807  1.000 64.42767  ? 91  GLU A OE1 1 
ATOM   702  O OE2 . GLU A 1 91  ? 21.80182 76.02655 -9.18778  1.000 81.93185  ? 91  GLU A OE2 1 
ATOM   703  N N   . ASP A 1 92  ? 23.26722 70.45562 -10.06778 1.000 62.89131  ? 92  ASP A N   1 
ATOM   704  C CA  . ASP A 1 92  ? 22.96921 69.16352 -10.66224 1.000 62.79337  ? 92  ASP A CA  1 
ATOM   705  C C   . ASP A 1 92  ? 23.72529 68.09893 -9.88162  1.000 59.72630  ? 92  ASP A C   1 
ATOM   706  O O   . ASP A 1 92  ? 24.88625 67.80476 -10.19047 1.000 60.39789  ? 92  ASP A O   1 
ATOM   707  C CB  . ASP A 1 92  ? 23.34810 69.16314 -12.14399 1.000 61.17644  ? 92  ASP A CB  1 
ATOM   708  C CG  . ASP A 1 92  ? 22.81010 67.95935 -12.88891 1.000 62.51649  ? 92  ASP A CG  1 
ATOM   709  O OD1 . ASP A 1 92  ? 22.32171 67.01081 -12.24356 1.000 63.42736  ? 92  ASP A OD1 1 
ATOM   710  O OD2 . ASP A 1 92  ? 22.88976 67.96175 -14.13835 1.000 75.32277  ? 92  ASP A OD2 1 
ATOM   711  N N   . CYS A 1 93  ? 23.08619 67.54220 -8.84677  1.000 57.18130  ? 93  CYS A N   1 
ATOM   712  C CA  . CYS A 1 93  ? 23.76253 66.60645 -7.95539  1.000 55.09498  ? 93  CYS A CA  1 
ATOM   713  C C   . CYS A 1 93  ? 22.89594 65.44147 -7.49861  1.000 55.53041  ? 93  CYS A C   1 
ATOM   714  O O   . CYS A 1 93  ? 23.41308 64.55966 -6.81046  1.000 60.86059  ? 93  CYS A O   1 
ATOM   715  C CB  . CYS A 1 93  ? 24.31471 67.33341 -6.71058  1.000 48.58762  ? 93  CYS A CB  1 
ATOM   716  S SG  . CYS A 1 93  ? 23.07959 68.23573 -5.73490  1.000 65.27770  ? 93  CYS A SG  1 
ATOM   717  N N   . LEU A 1 94  ? 21.61876 65.38862 -7.86913  1.000 50.65740  ? 94  LEU A N   1 
ATOM   718  C CA  . LEU A 1 94  ? 20.71547 64.33982 -7.39447  1.000 49.37843  ? 94  LEU A CA  1 
ATOM   719  C C   . LEU A 1 94  ? 21.00253 63.03136 -8.13367  1.000 48.17510  ? 94  LEU A C   1 
ATOM   720  O O   . LEU A 1 94  ? 20.36931 62.69771 -9.13830  1.000 65.31226  ? 94  LEU A O   1 
ATOM   721  C CB  . LEU A 1 94  ? 19.26837 64.78902 -7.54917  1.000 46.77757  ? 94  LEU A CB  1 
ATOM   722  C CG  . LEU A 1 94  ? 19.00496 66.10027 -6.79539  1.000 50.20048  ? 94  LEU A CG  1 
ATOM   723  C CD1 . LEU A 1 94  ? 17.52851 66.40523 -6.73787  1.000 53.42772  ? 94  LEU A CD1 1 
ATOM   724  C CD2 . LEU A 1 94  ? 19.59017 66.05875 -5.38023  1.000 45.47972  ? 94  LEU A CD2 1 
ATOM   725  N N   . TYR A 1 95  ? 21.96980 62.26823 -7.60992  1.000 48.41944  ? 95  TYR A N   1 
ATOM   726  C CA  . TYR A 1 95  ? 22.36543 60.98274 -8.16877  1.000 48.95223  ? 95  TYR A CA  1 
ATOM   727  C C   . TYR A 1 95  ? 22.46888 59.92414 -7.07646  1.000 49.70920  ? 95  TYR A C   1 
ATOM   728  O O   . TYR A 1 95  ? 22.75062 60.22874 -5.91015  1.000 52.04102  ? 95  TYR A O   1 
ATOM   729  C CB  . TYR A 1 95  ? 23.69662 61.10002 -8.93878  1.000 42.59307  ? 95  TYR A CB  1 
ATOM   730  C CG  . TYR A 1 95  ? 23.59791 62.11771 -10.03500 1.000 46.22419  ? 95  TYR A CG  1 
ATOM   731  C CD1 . TYR A 1 95  ? 23.97597 63.42986 -9.80044  1.000 44.18525  ? 95  TYR A CD1 1 
ATOM   732  C CD2 . TYR A 1 95  ? 23.08176 61.77913 -11.30231 1.000 44.10690  ? 95  TYR A CD2 1 
ATOM   733  C CE1 . TYR A 1 95  ? 23.85946 64.38043 -10.77103 1.000 55.70931  ? 95  TYR A CE1 1 
ATOM   734  C CE2 . TYR A 1 95  ? 22.98246 62.72642 -12.30350 1.000 44.84211  ? 95  TYR A CE2 1 
ATOM   735  C CZ  . TYR A 1 95  ? 23.37553 64.03200 -12.02462 1.000 61.05482  ? 95  TYR A CZ  1 
ATOM   736  O OH  . TYR A 1 95  ? 23.29046 65.03078 -12.95899 1.000 58.20645  ? 95  TYR A OH  1 
ATOM   737  N N   . ILE A 1 96  ? 22.24215 58.67085 -7.48639  1.000 47.82707  ? 96  ILE A N   1 
ATOM   738  C CA  . ILE A 1 96  ? 22.18660 57.51111 -6.60501  1.000 58.16275  ? 96  ILE A CA  1 
ATOM   739  C C   . ILE A 1 96  ? 23.40239 56.64974 -6.89735  1.000 60.83567  ? 96  ILE A C   1 
ATOM   740  O O   . ILE A 1 96  ? 23.97174 56.70165 -7.99319  1.000 65.03464  ? 96  ILE A O   1 
ATOM   741  C CB  . ILE A 1 96  ? 20.87807 56.70548 -6.78889  1.000 61.74972  ? 96  ILE A CB  1 
ATOM   742  C CG1 . ILE A 1 96  ? 19.74777 57.28935 -5.95886  1.000 67.81524  ? 96  ILE A CG1 1 
ATOM   743  C CG2 . ILE A 1 96  ? 21.02310 55.25162 -6.36538  1.000 61.93895  ? 96  ILE A CG2 1 
ATOM   744  C CD1 . ILE A 1 96  ? 18.45943 56.51614 -6.14551  1.000 78.08476  ? 96  ILE A CD1 1 
ATOM   745  N N   . ASN A 1 97  ? 23.82897 55.88713 -5.89034  1.000 56.74536  ? 97  ASN A N   1 
ATOM   746  C CA  . ASN A 1 97  ? 24.87996 54.89948 -6.04735  1.000 55.31920  ? 97  ASN A CA  1 
ATOM   747  C C   . ASN A 1 97  ? 24.38866 53.56235 -5.51806  1.000 56.61732  ? 97  ASN A C   1 
ATOM   748  O O   . ASN A 1 97  ? 23.72567 53.50708 -4.48098  1.000 53.00181  ? 97  ASN A O   1 
ATOM   749  C CB  . ASN A 1 97  ? 26.13612 55.34802 -5.32876  1.000 47.70078  ? 97  ASN A CB  1 
ATOM   750  C CG  . ASN A 1 97  ? 26.52255 56.75186 -5.69941  1.000 50.72685  ? 97  ASN A CG  1 
ATOM   751  O OD1 . ASN A 1 97  ? 26.97742 57.00005 -6.81136  1.000 59.34859  ? 97  ASN A OD1 1 
ATOM   752  N ND2 . ASN A 1 97  ? 26.31479 57.69195 -4.78499  1.000 53.59731  ? 97  ASN A ND2 1 
ATOM   753  N N   . VAL A 1 98  ? 24.69156 52.48894 -6.24498  1.000 48.55210  ? 98  VAL A N   1 
ATOM   754  C CA  . VAL A 1 98  ? 24.30141 51.14600 -5.84363  1.000 54.93958  ? 98  VAL A CA  1 
ATOM   755  C C   . VAL A 1 98  ? 25.54260 50.26762 -5.86253  1.000 62.42843  ? 98  VAL A C   1 
ATOM   756  O O   . VAL A 1 98  ? 26.26956 50.24464 -6.86149  1.000 56.95981  ? 98  VAL A O   1 
ATOM   757  C CB  . VAL A 1 98  ? 23.21543 50.56093 -6.76447  1.000 54.44409  ? 98  VAL A CB  1 
ATOM   758  C CG1 . VAL A 1 98  ? 22.76815 49.18552 -6.24730  1.000 57.67450  ? 98  VAL A CG1 1 
ATOM   759  C CG2 . VAL A 1 98  ? 22.04312 51.51492 -6.87293  1.000 46.38544  ? 98  VAL A CG2 1 
ATOM   760  N N   . TRP A 1 99  ? 25.80397 49.57122 -4.75173  1.000 62.56584  ? 99  TRP A N   1 
ATOM   761  C CA  . TRP A 1 99  ? 26.80853 48.51058 -4.70050  1.000 59.16700  ? 99  TRP A CA  1 
ATOM   762  C C   . TRP A 1 99  ? 26.04747 47.20167 -4.58349  1.000 61.85914  ? 99  TRP A C   1 
ATOM   763  O O   . TRP A 1 99  ? 25.27377 47.01773 -3.63827  1.000 65.58264  ? 99  TRP A O   1 
ATOM   764  C CB  . TRP A 1 99  ? 27.77246 48.67095 -3.52368  1.000 57.56979  ? 99  TRP A CB  1 
ATOM   765  C CG  . TRP A 1 99  ? 28.74481 49.83331 -3.58852  1.000 54.22839  ? 99  TRP A CG  1 
ATOM   766  C CD1 . TRP A 1 99  ? 30.07541 49.78047 -3.92864  1.000 53.56610  ? 99  TRP A CD1 1 
ATOM   767  C CD2 . TRP A 1 99  ? 28.47168 51.20389 -3.25735  1.000 48.00144  ? 99  TRP A CD2 1 
ATOM   768  N NE1 . TRP A 1 99  ? 30.63436 51.03809 -3.85588  1.000 51.19729  ? 99  TRP A NE1 1 
ATOM   769  C CE2 . TRP A 1 99  ? 29.67288 51.92646 -3.43969  1.000 44.93877  ? 99  TRP A CE2 1 
ATOM   770  C CE3 . TRP A 1 99  ? 27.32846 51.88890 -2.82256  1.000 47.00684  ? 99  TRP A CE3 1 
ATOM   771  C CZ2 . TRP A 1 99  ? 29.75841 53.29799 -3.21300  1.000 43.15802  ? 99  TRP A CZ2 1 
ATOM   772  C CZ3 . TRP A 1 99  ? 27.41860 53.25747 -2.59539  1.000 51.12732  ? 99  TRP A CZ3 1 
ATOM   773  C CH2 . TRP A 1 99  ? 28.62585 53.94390 -2.78799  1.000 51.53748  ? 99  TRP A CH2 1 
ATOM   774  N N   . ALA A 1 100 ? 26.23014 46.31079 -5.55419  1.000 66.59624  ? 100 ALA A N   1 
ATOM   775  C CA  . ALA A 1 100 ? 25.41203 45.10698 -5.64219  1.000 61.70031  ? 100 ALA A CA  1 
ATOM   776  C C   . ALA A 1 100 ? 26.32772 43.90537 -5.81941  1.000 57.03215  ? 100 ALA A C   1 
ATOM   777  O O   . ALA A 1 100 ? 27.15648 43.89339 -6.75033  1.000 60.27071  ? 100 ALA A O   1 
ATOM   778  C CB  . ALA A 1 100 ? 24.39714 45.22199 -6.78194  1.000 49.59067  ? 100 ALA A CB  1 
ATOM   779  N N   . PRO A 1 101 ? 26.26987 42.91224 -4.93749  1.000 66.15492  ? 101 PRO A N   1 
ATOM   780  C CA  . PRO A 1 101 ? 27.09060 41.71458 -5.13984  1.000 65.06657  ? 101 PRO A CA  1 
ATOM   781  C C   . PRO A 1 101 ? 26.71199 41.00135 -6.42751  1.000 68.91786  ? 101 PRO A C   1 
ATOM   782  O O   . PRO A 1 101 ? 25.60814 41.15378 -6.95468  1.000 72.69712  ? 101 PRO A O   1 
ATOM   783  C CB  . PRO A 1 101 ? 26.78200 40.85775 -3.90704  1.000 65.59450  ? 101 PRO A CB  1 
ATOM   784  C CG  . PRO A 1 101 ? 26.39305 41.85244 -2.85221  1.000 62.77276  ? 101 PRO A CG  1 
ATOM   785  C CD  . PRO A 1 101 ? 25.67376 42.95683 -3.58574  1.000 64.11100  ? 101 PRO A CD  1 
ATOM   786  N N   . ALA A 1 102 ? 27.66503 40.21434 -6.92103  1.000 72.96742  ? 102 ALA A N   1 
ATOM   787  C CA  . ALA A 1 102 ? 27.59974 39.47299 -8.17745  1.000 67.46985  ? 102 ALA A CA  1 
ATOM   788  C C   . ALA A 1 102 ? 26.26094 38.79155 -8.44134  1.000 66.90512  ? 102 ALA A C   1 
ATOM   789  O O   . ALA A 1 102 ? 26.21648 37.61326 -8.80504  1.000 76.72018  ? 102 ALA A O   1 
ATOM   790  C CB  . ALA A 1 102 ? 28.71472 38.43899 -8.19104  1.000 73.52558  ? 102 ALA A CB  1 
ATOM   791  N N   . THR A 1 137 ? 13.67630 36.96098 3.66155   1.000 117.75410 ? 137 THR A N   1 
ATOM   792  C CA  . THR A 1 137 ? 14.94194 36.24586 3.78594   0.000 122.67264 ? 137 THR A CA  1 
ATOM   793  C C   . THR A 1 137 ? 15.47293 35.75044 2.44105   1.000 126.00706 ? 137 THR A C   1 
ATOM   794  O O   . THR A 1 137 ? 16.65246 35.91911 2.13580   1.000 127.01990 ? 137 THR A O   1 
ATOM   795  C CB  . THR A 1 137 ? 14.81822 35.03515 4.73629   1.000 127.67691 ? 137 THR A CB  1 
ATOM   796  O OG1 . THR A 1 137 ? 14.21126 35.45118 5.96599   1.000 130.24300 ? 137 THR A OG1 1 
ATOM   797  C CG2 . THR A 1 137 ? 16.19593 34.43456 5.01746   1.000 123.69490 ? 137 THR A CG2 1 
ATOM   798  N N   . THR A 1 138 ? 14.59923 35.13744 1.64252   1.000 123.71079 ? 138 THR A N   1 
ATOM   799  C CA  . THR A 1 138 ? 15.02187 34.38092 0.47035   0.989 118.69531 ? 138 THR A CA  1 
ATOM   800  C C   . THR A 1 138 ? 14.62826 35.00705 -0.86753  0.146 112.24524 ? 138 THR A C   1 
ATOM   801  O O   . THR A 1 138 ? 14.87668 34.39191 -1.91071  1.000 115.67021 ? 138 THR A O   1 
ATOM   802  C CB  . THR A 1 138 ? 14.46203 32.95431 0.55051   1.000 120.87921 ? 138 THR A CB  1 
ATOM   803  O OG1 . THR A 1 138 ? 13.07791 32.96070 0.17547   1.000 122.46780 ? 138 THR A OG1 1 
ATOM   804  C CG2 . THR A 1 138 ? 14.59209 32.40733 1.97117   1.000 118.45986 ? 138 THR A CG2 1 
ATOM   805  N N   . ASN A 1 139 ? 14.04566 36.20978 -0.87703  1.000 103.78191 ? 139 ASN A N   1 
ATOM   806  C CA  . ASN A 1 139 ? 13.54394 36.83542 -2.10120  1.000 95.39035  ? 139 ASN A CA  1 
ATOM   807  C C   . ASN A 1 139 ? 14.39533 38.04165 -2.50935  1.000 86.92233  ? 139 ASN A C   1 
ATOM   808  O O   . ASN A 1 139 ? 13.87348 39.12771 -2.79140  1.000 80.96381  ? 139 ASN A O   1 
ATOM   809  C CB  . ASN A 1 139 ? 12.07410 37.23481 -1.90087  1.000 101.00304 ? 139 ASN A CB  1 
ATOM   810  C CG  . ASN A 1 139 ? 11.44714 37.87047 -3.14161  1.000 109.39903 ? 139 ASN A CG  1 
ATOM   811  O OD1 . ASN A 1 139 ? 11.92966 37.69061 -4.26106  1.000 115.12453 ? 139 ASN A OD1 1 
ATOM   812  N ND2 . ASN A 1 139 ? 10.37605 38.63505 -2.93754  1.000 107.79715 ? 139 ASN A ND2 1 
ATOM   813  N N   . GLY A 1 140 ? 15.70660 37.86713 -2.55309  1.000 80.40377  ? 140 GLY A N   1 
ATOM   814  C CA  . GLY A 1 140 ? 16.61434 38.96012 -2.82997  1.000 73.65497  ? 140 GLY A CA  1 
ATOM   815  C C   . GLY A 1 140 ? 17.44973 39.33219 -1.61370  1.000 72.18210  ? 140 GLY A C   1 
ATOM   816  O O   . GLY A 1 140 ? 17.19264 38.91545 -0.48221  1.000 74.33951  ? 140 GLY A O   1 
ATOM   817  N N   . LEU A 1 141 ? 18.46529 40.14816 -1.88363  1.000 64.44898  ? 141 LEU A N   1 
ATOM   818  C CA  . LEU A 1 141 ? 19.45443 40.55417 -0.90156  1.000 65.96835  ? 141 LEU A CA  1 
ATOM   819  C C   . LEU A 1 141 ? 18.94694 41.72788 -0.06131  1.000 67.10023  ? 141 LEU A C   1 
ATOM   820  O O   . LEU A 1 141 ? 18.06350 42.47735 -0.48557  1.000 66.96879  ? 141 LEU A O   1 
ATOM   821  C CB  . LEU A 1 141 ? 20.75161 40.94019 -1.61022  1.000 66.45990  ? 141 LEU A CB  1 
ATOM   822  C CG  . LEU A 1 141 ? 21.68821 39.85138 -2.15523  1.000 66.92247  ? 141 LEU A CG  1 
ATOM   823  C CD1 . LEU A 1 141 ? 23.01284 40.46663 -2.61343  1.000 64.94248  ? 141 LEU A CD1 1 
ATOM   824  C CD2 . LEU A 1 141 ? 21.94070 38.73462 -1.15264  1.000 53.66706  ? 141 LEU A CD2 1 
ATOM   825  N N   . PRO A 1 142 ? 19.48480 41.90872 1.14308   1.000 61.48043  ? 142 PRO A N   1 
ATOM   826  C CA  . PRO A 1 142 ? 19.12198 43.09300 1.92858   1.000 62.29620  ? 142 PRO A CA  1 
ATOM   827  C C   . PRO A 1 142 ? 19.70889 44.34195 1.29840   1.000 61.88046  ? 142 PRO A C   1 
ATOM   828  O O   . PRO A 1 142 ? 20.78099 44.30784 0.68608   1.000 62.32637  ? 142 PRO A O   1 
ATOM   829  C CB  . PRO A 1 142 ? 19.74344 42.82118 3.30451   1.000 56.16523  ? 142 PRO A CB  1 
ATOM   830  C CG  . PRO A 1 142 ? 20.02234 41.32866 3.31082   1.000 56.87718  ? 142 PRO A CG  1 
ATOM   831  C CD  . PRO A 1 142 ? 20.32963 40.97614 1.90332   1.000 56.40325  ? 142 PRO A CD  1 
ATOM   832  N N   . ILE A 1 143 ? 18.99304 45.45418 1.44906   1.000 51.15821  ? 143 ILE A N   1 
ATOM   833  C CA  . ILE A 1 143 ? 19.43495 46.73893 0.91982   1.000 53.89283  ? 143 ILE A CA  1 
ATOM   834  C C   . ILE A 1 143 ? 19.67852 47.65526 2.09242   1.000 50.02918  ? 143 ILE A C   1 
ATOM   835  O O   . ILE A 1 143 ? 18.76959 47.90091 2.89239   1.000 56.25176  ? 143 ILE A O   1 
ATOM   836  C CB  . ILE A 1 143 ? 18.41858 47.37602 -0.04347  1.000 53.69727  ? 143 ILE A CB  1 
ATOM   837  C CG1 . ILE A 1 143 ? 18.23238 46.52218 -1.28362  1.000 56.83763  ? 143 ILE A CG1 1 
ATOM   838  C CG2 . ILE A 1 143 ? 18.91347 48.71781 -0.49598  1.000 47.08732  ? 143 ILE A CG2 1 
ATOM   839  C CD1 . ILE A 1 143 ? 16.82937 46.08302 -1.45841  1.000 64.69513  ? 143 ILE A CD1 1 
ATOM   840  N N   . LEU A 1 144 ? 20.89582 48.16641 2.18271   1.000 49.12334  ? 144 LEU A N   1 
ATOM   841  C CA  . LEU A 1 144 ? 21.25441 49.19673 3.13880   1.000 37.43080  ? 144 LEU A CA  1 
ATOM   842  C C   . LEU A 1 144 ? 21.41745 50.50468 2.39178   1.000 43.90953  ? 144 LEU A C   1 
ATOM   843  O O   . LEU A 1 144 ? 22.10272 50.55092 1.36711   1.000 47.81320  ? 144 LEU A O   1 
ATOM   844  C CB  . LEU A 1 144 ? 22.55330 48.85305 3.84846   1.000 47.04687  ? 144 LEU A CB  1 
ATOM   845  C CG  . LEU A 1 144 ? 22.39147 47.82268 4.94584   1.000 55.41186  ? 144 LEU A CG  1 
ATOM   846  C CD1 . LEU A 1 144 ? 22.51028 46.45811 4.31462   1.000 54.77086  ? 144 LEU A CD1 1 
ATOM   847  C CD2 . LEU A 1 144 ? 23.46353 48.07375 5.98300   1.000 50.71698  ? 144 LEU A CD2 1 
ATOM   848  N N   . ILE A 1 145 ? 20.81125 51.56343 2.91171   1.000 40.78557  ? 145 ILE A N   1 
ATOM   849  C CA  . ILE A 1 145 ? 20.86031 52.87702 2.29135   1.000 45.36660  ? 145 ILE A CA  1 
ATOM   850  C C   . ILE A 1 145 ? 21.55213 53.84467 3.24495   1.000 48.16643  ? 145 ILE A C   1 
ATOM   851  O O   . ILE A 1 145 ? 21.05627 54.09511 4.35256   1.000 49.41252  ? 145 ILE A O   1 
ATOM   852  C CB  . ILE A 1 145 ? 19.45292 53.37780 1.92940   1.000 50.52640  ? 145 ILE A CB  1 
ATOM   853  C CG1 . ILE A 1 145 ? 18.66563 52.28803 1.20177   1.000 44.86485  ? 145 ILE A CG1 1 
ATOM   854  C CG2 . ILE A 1 145 ? 19.52803 54.66181 1.10026   1.000 31.12341  ? 145 ILE A CG2 1 
ATOM   855  C CD1 . ILE A 1 145 ? 17.28797 52.72430 0.84117   1.000 50.49119  ? 145 ILE A CD1 1 
ATOM   856  N N   . TRP A 1 146 ? 22.64733 54.44572 2.78035   1.000 50.57840  ? 146 TRP A N   1 
ATOM   857  C CA  . TRP A 1 146 ? 23.43813 55.40386 3.54634   1.000 50.01202  ? 146 TRP A CA  1 
ATOM   858  C C   . TRP A 1 146 ? 23.05227 56.85371 3.23631   1.000 47.54491  ? 146 TRP A C   1 
ATOM   859  O O   . TRP A 1 146 ? 23.04714 57.26467 2.06667   1.000 57.57209  ? 146 TRP A O   1 
ATOM   860  C CB  . TRP A 1 146 ? 24.91913 55.18732 3.25080   1.000 38.35245  ? 146 TRP A CB  1 
ATOM   861  C CG  . TRP A 1 146 ? 25.80668 56.22687 3.82419   1.000 48.55296  ? 146 TRP A CG  1 
ATOM   862  C CD1 . TRP A 1 146 ? 26.37681 57.27277 3.16153   1.000 51.09366  ? 146 TRP A CD1 1 
ATOM   863  C CD2 . TRP A 1 146 ? 26.24054 56.32801 5.18636   1.000 52.29154  ? 146 TRP A CD2 1 
ATOM   864  N NE1 . TRP A 1 146 ? 27.14862 58.01145 4.01608   1.000 52.40688  ? 146 TRP A NE1 1 
ATOM   865  C CE2 . TRP A 1 146 ? 27.08965 57.44986 5.26731   1.000 53.36247  ? 146 TRP A CE2 1 
ATOM   866  C CE3 . TRP A 1 146 ? 26.01142 55.56534 6.34012   1.000 55.90498  ? 146 TRP A CE3 1 
ATOM   867  C CZ2 . TRP A 1 146 ? 27.70137 57.84516 6.46583   1.000 51.84603  ? 146 TRP A CZ2 1 
ATOM   868  C CZ3 . TRP A 1 146 ? 26.63044 55.95064 7.54075   1.000 52.29021  ? 146 TRP A CZ3 1 
ATOM   869  C CH2 . TRP A 1 146 ? 27.46492 57.07869 7.58813   1.000 52.39012  ? 146 TRP A CH2 1 
ATOM   870  N N   . ILE A 1 147 ? 22.76059 57.62995 4.28871   1.000 38.24004  ? 147 ILE A N   1 
ATOM   871  C CA  . ILE A 1 147 ? 22.58807 59.08338 4.21250   1.000 32.06541  ? 147 ILE A CA  1 
ATOM   872  C C   . ILE A 1 147 ? 23.73031 59.76383 4.95151   1.000 39.72498  ? 147 ILE A C   1 
ATOM   873  O O   . ILE A 1 147 ? 23.88554 59.59672 6.16703   1.000 50.84287  ? 147 ILE A O   1 
ATOM   874  C CB  . ILE A 1 147 ? 21.25663 59.53813 4.80875   1.000 35.41135  ? 147 ILE A CB  1 
ATOM   875  C CG1 . ILE A 1 147 ? 20.10780 58.65140 4.34014   1.000 36.25490  ? 147 ILE A CG1 1 
ATOM   876  C CG2 . ILE A 1 147 ? 21.01711 60.99316 4.46424   1.000 34.45145  ? 147 ILE A CG2 1 
ATOM   877  C CD1 . ILE A 1 147 ? 18.74928 59.08244 4.91977   1.000 36.11520  ? 147 ILE A CD1 1 
ATOM   878  N N   . TYR A 1 148 ? 24.50002 60.57157 4.24281   1.000 50.77511  ? 148 TYR A N   1 
ATOM   879  C CA  . TYR A 1 148 ? 25.64728 61.20480 4.86820   1.000 48.28526  ? 148 TYR A CA  1 
ATOM   880  C C   . TYR A 1 148 ? 25.19514 62.35179 5.75252   1.000 41.65947  ? 148 TYR A C   1 
ATOM   881  O O   . TYR A 1 148 ? 24.07707 62.86168 5.64400   1.000 44.20615  ? 148 TYR A O   1 
ATOM   882  C CB  . TYR A 1 148 ? 26.62882 61.72884 3.81559   1.000 48.45664  ? 148 TYR A CB  1 
ATOM   883  C CG  . TYR A 1 148 ? 25.98765 62.67298 2.83431   1.000 48.15187  ? 148 TYR A CG  1 
ATOM   884  C CD1 . TYR A 1 148 ? 25.83715 64.01630 3.13445   1.000 46.65355  ? 148 TYR A CD1 1 
ATOM   885  C CD2 . TYR A 1 148 ? 25.50046 62.20878 1.60908   1.000 52.12549  ? 148 TYR A CD2 1 
ATOM   886  C CE1 . TYR A 1 148 ? 25.22883 64.88379 2.23869   1.000 55.41038  ? 148 TYR A CE1 1 
ATOM   887  C CE2 . TYR A 1 148 ? 24.89660 63.07086 0.69877   1.000 51.09472  ? 148 TYR A CE2 1 
ATOM   888  C CZ  . TYR A 1 148 ? 24.76657 64.40558 1.01890   1.000 57.44666  ? 148 TYR A CZ  1 
ATOM   889  O OH  . TYR A 1 148 ? 24.15737 65.26032 0.12733   1.000 56.30436  ? 148 TYR A OH  1 
ATOM   890  N N   . GLY A 1 149 ? 26.10360 62.77762 6.62133   1.000 39.96316  ? 149 GLY A N   1 
ATOM   891  C CA  . GLY A 1 149 ? 25.91422 63.96513 7.41495   1.000 43.16354  ? 149 GLY A CA  1 
ATOM   892  C C   . GLY A 1 149 ? 26.79146 65.10837 6.94843   1.000 48.30098  ? 149 GLY A C   1 
ATOM   893  O O   . GLY A 1 149 ? 27.49788 65.03208 5.94421   1.000 54.40721  ? 149 GLY A O   1 
ATOM   894  N N   . GLY A 1 150 ? 26.76939 66.17071 7.73745   1.000 56.93127  ? 150 GLY A N   1 
ATOM   895  C CA  . GLY A 1 150 ? 27.41354 67.40615 7.36481   1.000 49.16386  ? 150 GLY A CA  1 
ATOM   896  C C   . GLY A 1 150 ? 26.53518 68.56516 7.76637   1.000 46.95965  ? 150 GLY A C   1 
ATOM   897  O O   . GLY A 1 150 ? 26.57501 69.62139 7.13714   1.000 43.96498  ? 150 GLY A O   1 
ATOM   898  N N   . GLY A 1 151 ? 25.72331 68.35900 8.80776   1.000 50.34958  ? 151 GLY A N   1 
ATOM   899  C CA  . GLY A 1 151 ? 24.98379 69.43743 9.44201   1.000 50.94330  ? 151 GLY A CA  1 
ATOM   900  C C   . GLY A 1 151 ? 23.92771 70.06901 8.57477   1.000 54.97529  ? 151 GLY A C   1 
ATOM   901  O O   . GLY A 1 151 ? 23.60905 71.24934 8.75567   1.000 57.31661  ? 151 GLY A O   1 
ATOM   902  N N   . PHE A 1 152 ? 23.39479 69.31252 7.61747   1.000 57.41802  ? 152 PHE A N   1 
ATOM   903  C CA  . PHE A 1 152 ? 22.46709 69.76601 6.59155   1.000 48.12996  ? 152 PHE A CA  1 
ATOM   904  C C   . PHE A 1 152 ? 23.01774 70.92566 5.76559   1.000 51.65763  ? 152 PHE A C   1 
ATOM   905  O O   . PHE A 1 152 ? 22.24542 71.59049 5.05667   1.000 55.61872  ? 152 PHE A O   1 
ATOM   906  C CB  . PHE A 1 152 ? 21.11551 70.12237 7.21513   1.000 45.60540  ? 152 PHE A CB  1 
ATOM   907  C CG  . PHE A 1 152 ? 20.52504 69.00418 8.01710   1.000 49.05154  ? 152 PHE A CG  1 
ATOM   908  C CD1 . PHE A 1 152 ? 20.66508 68.97449 9.40232   1.000 55.00044  ? 152 PHE A CD1 1 
ATOM   909  C CD2 . PHE A 1 152 ? 19.84881 67.96697 7.38794   1.000 40.04300  ? 152 PHE A CD2 1 
ATOM   910  C CE1 . PHE A 1 152 ? 20.13640 67.94266 10.14527  1.000 45.47400  ? 152 PHE A CE1 1 
ATOM   911  C CE2 . PHE A 1 152 ? 19.32422 66.92061 8.11693   1.000 41.73764  ? 152 PHE A CE2 1 
ATOM   912  C CZ  . PHE A 1 152 ? 19.47601 66.91288 9.52015   1.000 44.88949  ? 152 PHE A CZ  1 
ATOM   913  N N   . MET A 1 153 ? 24.33729 71.19334 5.84417   1.000 41.73004  ? 153 MET A N   1 
ATOM   914  C CA  . MET A 1 153 ? 24.99646 72.19229 5.01512   1.000 47.55429  ? 153 MET A CA  1 
ATOM   915  C C   . MET A 1 153 ? 26.07467 71.64244 4.10614   1.000 46.43528  ? 153 MET A C   1 
ATOM   916  O O   . MET A 1 153 ? 26.50915 72.36103 3.20607   1.000 54.27485  ? 153 MET A O   1 
ATOM   917  C CB  . MET A 1 153 ? 25.68823 73.29540 5.83893   1.000 58.11399  ? 153 MET A CB  1 
ATOM   918  C CG  . MET A 1 153 ? 25.02456 73.74976 7.08968   1.000 55.01434  ? 153 MET A CG  1 
ATOM   919  S SD  . MET A 1 153 ? 23.53784 74.72982 6.72774   1.000 57.32486  ? 153 MET A SD  1 
ATOM   920  C CE  . MET A 1 153 ? 24.16364 76.22687 5.99501   1.000 40.76559  ? 153 MET A CE  1 
ATOM   921  N N   . THR A 1 154 ? 26.57886 70.44560 4.36486   1.000 46.43848  ? 154 THR A N   1 
ATOM   922  C CA  . THR A 1 154 ? 27.72807 69.89141 3.67037   1.000 46.29738  ? 154 THR A CA  1 
ATOM   923  C C   . THR A 1 154 ? 27.52756 68.38506 3.57617   1.000 46.90279  ? 154 THR A C   1 
ATOM   924  O O   . THR A 1 154 ? 26.52194 67.83571 4.03537   1.000 45.77892  ? 154 THR A O   1 
ATOM   925  C CB  . THR A 1 154 ? 29.06057 70.23610 4.38791   1.000 51.13956  ? 154 THR A CB  1 
ATOM   926  O OG1 . THR A 1 154 ? 29.26263 69.40551 5.55028   1.000 53.10319  ? 154 THR A OG1 1 
ATOM   927  C CG2 . THR A 1 154 ? 29.16859 71.70012 4.78220   1.000 40.18779  ? 154 THR A CG2 1 
ATOM   928  N N   . GLY A 1 155 ? 28.50437 67.71638 2.99732   1.000 45.90878  ? 155 GLY A N   1 
ATOM   929  C CA  . GLY A 1 155 ? 28.47651 66.27387 2.91895   1.000 49.45203  ? 155 GLY A CA  1 
ATOM   930  C C   . GLY A 1 155 ? 28.21495 65.78998 1.50031   1.000 49.17266  ? 155 GLY A C   1 
ATOM   931  O O   . GLY A 1 155 ? 27.63586 66.48840 0.66391   1.000 48.30997  ? 155 GLY A O   1 
ATOM   932  N N   . SER A 1 156 ? 28.64432 64.55735 1.24049   1.000 48.65415  ? 156 SER A N   1 
ATOM   933  C CA  . SER A 1 156 ? 28.53297 63.97540 -0.08746  1.000 54.24362  ? 156 SER A CA  1 
ATOM   934  C C   . SER A 1 156 ? 28.63637 62.46149 0.02943   1.000 54.51072  ? 156 SER A C   1 
ATOM   935  O O   . SER A 1 156 ? 29.49918 61.95523 0.75101   1.000 51.83576  ? 156 SER A O   1 
ATOM   936  C CB  . SER A 1 156 ? 29.62892 64.52070 -1.01962  1.000 53.65313  ? 156 SER A CB  1 
ATOM   937  O OG  . SER A 1 156 ? 30.01022 63.55697 -1.98416  1.000 53.41403  ? 156 SER A OG  1 
ATOM   938  N N   . ALA A 1 157 ? 27.76367 61.74575 -0.69229  1.000 52.11311  ? 157 ALA A N   1 
ATOM   939  C CA  . ALA A 1 157 ? 27.88025 60.29159 -0.79341  1.000 53.70166  ? 157 ALA A CA  1 
ATOM   940  C C   . ALA A 1 157 ? 29.19391 59.84672 -1.42134  1.000 51.82022  ? 157 ALA A C   1 
ATOM   941  O O   . ALA A 1 157 ? 29.52913 58.66247 -1.31269  1.000 56.83566  ? 157 ALA A O   1 
ATOM   942  C CB  . ALA A 1 157 ? 26.72031 59.69265 -1.60884  1.000 35.11927  ? 157 ALA A CB  1 
ATOM   943  N N   . THR A 1 158 ? 29.95284 60.74855 -2.05395  1.000 42.69797  ? 158 THR A N   1 
ATOM   944  C CA  . THR A 1 158 ? 31.11840 60.34272 -2.84192  1.000 50.03658  ? 158 THR A CA  1 
ATOM   945  C C   . THR A 1 158 ? 32.40330 60.23933 -2.03744  1.000 54.64612  ? 158 THR A C   1 
ATOM   946  O O   . THR A 1 158 ? 33.43091 59.85918 -2.60016  1.000 59.29220  ? 158 THR A O   1 
ATOM   947  C CB  . THR A 1 158 ? 31.36778 61.30949 -4.01940  1.000 56.33114  ? 158 THR A CB  1 
ATOM   948  O OG1 . THR A 1 158 ? 31.85501 62.56865 -3.53523  1.000 51.33615  ? 158 THR A OG1 1 
ATOM   949  C CG2 . THR A 1 158 ? 30.09963 61.53391 -4.83101  1.000 58.28548  ? 158 THR A CG2 1 
ATOM   950  N N   . LEU A 1 159 ? 32.39820 60.59914 -0.76114  1.000 63.06668  ? 159 LEU A N   1 
ATOM   951  C CA  . LEU A 1 159 ? 33.63991 60.56090 -0.00218  1.000 69.02964  ? 159 LEU A CA  1 
ATOM   952  C C   . LEU A 1 159 ? 34.18275 59.13738 0.02721   1.000 62.83440  ? 159 LEU A C   1 
ATOM   953  O O   . LEU A 1 159 ? 33.41865 58.16944 0.08726   1.000 66.22930  ? 159 LEU A O   1 
ATOM   954  C CB  . LEU A 1 159 ? 33.40740 61.08329 1.41603   1.000 72.81268  ? 159 LEU A CB  1 
ATOM   955  C CG  . LEU A 1 159 ? 32.71368 62.44797 1.54156   1.000 70.91817  ? 159 LEU A CG  1 
ATOM   956  C CD1 . LEU A 1 159 ? 32.63117 62.87629 3.01606   1.000 53.39103  ? 159 LEU A CD1 1 
ATOM   957  C CD2 . LEU A 1 159 ? 33.38984 63.52676 0.67497   1.000 69.63294  ? 159 LEU A CD2 1 
ATOM   958  N N   . ASP A 1 160 ? 35.50995 59.00695 -0.05781  1.000 51.74615  ? 160 ASP A N   1 
ATOM   959  C CA  . ASP A 1 160 ? 36.11031 57.68242 0.07093   1.000 59.23091  ? 160 ASP A CA  1 
ATOM   960  C C   . ASP A 1 160 ? 35.58269 56.94753 1.28910   1.000 61.74886  ? 160 ASP A C   1 
ATOM   961  O O   . ASP A 1 160 ? 35.33205 55.73909 1.23300   1.000 60.55712  ? 160 ASP A O   1 
ATOM   962  C CB  . ASP A 1 160 ? 37.62366 57.78805 0.16781   1.000 65.86777  ? 160 ASP A CB  1 
ATOM   963  C CG  . ASP A 1 160 ? 38.22341 58.33461 -1.06475  1.000 76.84349  ? 160 ASP A CG  1 
ATOM   964  O OD1 . ASP A 1 160 ? 38.52927 59.54237 -1.08878  1.000 92.06503  ? 160 ASP A OD1 1 
ATOM   965  O OD2 . ASP A 1 160 ? 38.36425 57.55649 -2.02218  1.000 77.47141  ? 160 ASP A OD2 1 
ATOM   966  N N   . ILE A 1 161 ? 35.39288 57.67293 2.39629   1.000 60.40340  ? 161 ILE A N   1 
ATOM   967  C CA  . ILE A 1 161 ? 35.04617 57.04626 3.66159   1.000 61.70114  ? 161 ILE A CA  1 
ATOM   968  C C   . ILE A 1 161 ? 33.71728 56.30930 3.55105   1.000 61.01013  ? 161 ILE A C   1 
ATOM   969  O O   . ILE A 1 161 ? 33.50580 55.29193 4.22414   1.000 62.41902  ? 161 ILE A O   1 
ATOM   970  C CB  . ILE A 1 161 ? 35.06530 58.11937 4.77517   1.000 68.75029  ? 161 ILE A CB  1 
ATOM   971  C CG1 . ILE A 1 161 ? 35.21737 57.48685 6.14551   1.000 61.97186  ? 161 ILE A CG1 1 
ATOM   972  C CG2 . ILE A 1 161 ? 33.87721 59.03205 4.71165   1.000 76.77066  ? 161 ILE A CG2 1 
ATOM   973  C CD1 . ILE A 1 161 ? 36.34171 56.58412 6.16616   1.000 64.34683  ? 161 ILE A CD1 1 
ATOM   974  N N   . TYR A 1 162 ? 32.83386 56.76217 2.65794   1.000 60.81421  ? 162 TYR A N   1 
ATOM   975  C CA  . TYR A 1 162 ? 31.53064 56.14458 2.43188   1.000 56.35549  ? 162 TYR A CA  1 
ATOM   976  C C   . TYR A 1 162 ? 31.56703 55.06304 1.35564   1.000 56.02739  ? 162 TYR A C   1 
ATOM   977  O O   . TYR A 1 162 ? 30.50502 54.59360 0.92627   1.000 54.71693  ? 162 TYR A O   1 
ATOM   978  C CB  . TYR A 1 162 ? 30.48882 57.21110 2.05913   1.000 46.02699  ? 162 TYR A CB  1 
ATOM   979  C CG  . TYR A 1 162 ? 30.39187 58.35778 3.04255   1.000 50.12323  ? 162 TYR A CG  1 
ATOM   980  C CD1 . TYR A 1 162 ? 30.69436 58.17638 4.39651   1.000 55.07358  ? 162 TYR A CD1 1 
ATOM   981  C CD2 . TYR A 1 162 ? 29.98796 59.61487 2.63175   1.000 50.08196  ? 162 TYR A CD2 1 
ATOM   982  C CE1 . TYR A 1 162 ? 30.60705 59.22383 5.30826   1.000 52.45101  ? 162 TYR A CE1 1 
ATOM   983  C CE2 . TYR A 1 162 ? 29.89368 60.66361 3.53312   1.000 57.39686  ? 162 TYR A CE2 1 
ATOM   984  C CZ  . TYR A 1 162 ? 30.20320 60.46207 4.87254   1.000 56.03106  ? 162 TYR A CZ  1 
ATOM   985  O OH  . TYR A 1 162 ? 30.11190 61.50891 5.76082   1.000 49.67052  ? 162 TYR A OH  1 
ATOM   986  N N   . ASN A 1 163 ? 32.75827 54.66668 0.90824   1.000 54.14321  ? 163 ASN A N   1 
ATOM   987  C CA  . ASN A 1 163 ? 32.87837 53.57119 -0.04025  1.000 50.88938  ? 163 ASN A CA  1 
ATOM   988  C C   . ASN A 1 163 ? 32.23529 52.32143 0.53244   1.000 56.95297  ? 163 ASN A C   1 
ATOM   989  O O   . ASN A 1 163 ? 32.69543 51.78551 1.55200   1.000 58.03677  ? 163 ASN A O   1 
ATOM   990  C CB  . ASN A 1 163 ? 34.34349 53.31396 -0.35671  1.000 62.14781  ? 163 ASN A CB  1 
ATOM   991  C CG  . ASN A 1 163 ? 34.52685 52.40746 -1.54867  1.000 65.46261  ? 163 ASN A CG  1 
ATOM   992  O OD1 . ASN A 1 163 ? 33.58014 51.78156 -2.01304  1.000 58.41358  ? 163 ASN A OD1 1 
ATOM   993  N ND2 . ASN A 1 163 ? 35.75437 52.33578 -2.05639  1.000 67.40670  ? 163 ASN A ND2 1 
ATOM   994  N N   . ALA A 1 164 ? 31.16346 51.86427 -0.11935  1.000 51.15614  ? 164 ALA A N   1 
ATOM   995  C CA  . ALA A 1 164 ? 30.46647 50.65407 0.29065   1.000 48.05898  ? 164 ALA A CA  1 
ATOM   996  C C   . ALA A 1 164 ? 31.03634 49.39543 -0.33113  1.000 51.08407  ? 164 ALA A C   1 
ATOM   997  O O   . ALA A 1 164 ? 30.35734 48.36677 -0.32601  1.000 56.97347  ? 164 ALA A O   1 
ATOM   998  C CB  . ALA A 1 164 ? 28.98915 50.74171 -0.05614  1.000 51.93622  ? 164 ALA A CB  1 
ATOM   999  N N   . ASP A 1 165 ? 32.25533 49.44471 -0.86685  1.000 45.47782  ? 165 ASP A N   1 
ATOM   1000 C CA  . ASP A 1 165 ? 32.79595 48.27223 -1.54342  1.000 54.98673  ? 165 ASP A CA  1 
ATOM   1001 C C   . ASP A 1 165 ? 32.89250 47.09803 -0.58805  1.000 59.24437  ? 165 ASP A C   1 
ATOM   1002 O O   . ASP A 1 165 ? 32.36323 46.01292 -0.85731  1.000 61.41022  ? 165 ASP A O   1 
ATOM   1003 C CB  . ASP A 1 165 ? 34.17792 48.57514 -2.11124  1.000 62.66203  ? 165 ASP A CB  1 
ATOM   1004 C CG  . ASP A 1 165 ? 34.14449 49.07116 -3.52277  1.000 70.42285  ? 165 ASP A CG  1 
ATOM   1005 O OD1 . ASP A 1 165 ? 33.05504 49.42201 -4.04965  1.000 73.00857  ? 165 ASP A OD1 1 
ATOM   1006 O OD2 . ASP A 1 165 ? 35.25304 49.12755 -4.08921  1.000 65.38596  ? 165 ASP A OD2 1 
ATOM   1007 N N   . ILE A 1 166 ? 33.58472 47.29953 0.53558   1.000 60.23982  ? 166 ILE A N   1 
ATOM   1008 C CA  . ILE A 1 166 ? 33.82543 46.20697 1.46883   1.000 64.50086  ? 166 ILE A CA  1 
ATOM   1009 C C   . ILE A 1 166 ? 32.51761 45.74118 2.09699   1.000 57.93831  ? 166 ILE A C   1 
ATOM   1010 O O   . ILE A 1 166 ? 32.25198 44.53454 2.17430   1.000 54.25562  ? 166 ILE A O   1 
ATOM   1011 C CB  . ILE A 1 166 ? 34.85557 46.63598 2.52742   1.000 67.45686  ? 166 ILE A CB  1 
ATOM   1012 C CG1 . ILE A 1 166 ? 36.24038 46.72746 1.88747   1.000 63.63526  ? 166 ILE A CG1 1 
ATOM   1013 C CG2 . ILE A 1 166 ? 34.86820 45.67677 3.73952   1.000 63.34057  ? 166 ILE A CG2 1 
ATOM   1014 C CD1 . ILE A 1 166 ? 37.22006 47.56912 2.68265   1.000 55.79056  ? 166 ILE A CD1 1 
ATOM   1015 N N   . MET A 1 167 ? 31.68246 46.68438 2.54588   1.000 44.83801  ? 167 MET A N   1 
ATOM   1016 C CA  . MET A 1 167 ? 30.43661 46.31339 3.20204   1.000 43.48605  ? 167 MET A CA  1 
ATOM   1017 C C   . MET A 1 167 ? 29.61257 45.40373 2.32361   1.000 60.29258  ? 167 MET A C   1 
ATOM   1018 O O   . MET A 1 167 ? 29.13202 44.35630 2.77007   1.000 53.99141  ? 167 MET A O   1 
ATOM   1019 C CB  . MET A 1 167 ? 29.61589 47.54564 3.54387   1.000 41.07831  ? 167 MET A CB  1 
ATOM   1020 C CG  . MET A 1 167 ? 28.19896 47.20535 3.98713   1.000 48.19954  ? 167 MET A CG  1 
ATOM   1021 S SD  . MET A 1 167 ? 27.25810 48.64073 4.55546   1.000 48.43924  ? 167 MET A SD  1 
ATOM   1022 C CE  . MET A 1 167 ? 27.98638 48.90494 6.16786   1.000 49.50503  ? 167 MET A CE  1 
ATOM   1023 N N   . ALA A 1 168 ? 29.41207 45.81546 1.06859   1.000 58.28120  ? 168 ALA A N   1 
ATOM   1024 C CA  . ALA A 1 168 ? 28.66783 44.99507 0.12788   1.000 55.74614  ? 168 ALA A CA  1 
ATOM   1025 C C   . ALA A 1 168 ? 29.33933 43.64538 -0.03589  1.000 58.11989  ? 168 ALA A C   1 
ATOM   1026 O O   . ALA A 1 168 ? 28.70170 42.60101 0.11783   1.000 62.68749  ? 168 ALA A O   1 
ATOM   1027 C CB  . ALA A 1 168 ? 28.55013 45.71084 -1.22028  1.000 63.01183  ? 168 ALA A CB  1 
ATOM   1028 N N   . ALA A 1 169 ? 30.64492 43.64868 -0.29965  1.000 49.87447  ? 169 ALA A N   1 
ATOM   1029 C CA  . ALA A 1 169 ? 31.34242 42.40129 -0.58506  1.000 53.06904  ? 169 ALA A CA  1 
ATOM   1030 C C   . ALA A 1 169 ? 31.27304 41.45221 0.59302   1.000 64.11572  ? 169 ALA A C   1 
ATOM   1031 O O   . ALA A 1 169 ? 30.85680 40.29798 0.45010   1.000 70.39625  ? 169 ALA A O   1 
ATOM   1032 C CB  . ALA A 1 169 ? 32.79696 42.67996 -0.95257  1.000 62.01619  ? 169 ALA A CB  1 
ATOM   1033 N N   . VAL A 1 170 ? 31.67978 41.92822 1.77206   1.000 73.22145  ? 170 VAL A N   1 
ATOM   1034 C CA  . VAL A 1 170 ? 31.75198 41.07137 2.94829   1.000 66.43050  ? 170 VAL A CA  1 
ATOM   1035 C C   . VAL A 1 170 ? 30.36733 40.80564 3.51302   1.000 57.12056  ? 170 VAL A C   1 
ATOM   1036 O O   . VAL A 1 170 ? 30.03785 39.66977 3.86972   1.000 60.36720  ? 170 VAL A O   1 
ATOM   1037 C CB  . VAL A 1 170 ? 32.67286 41.70734 3.99339   1.000 64.04626  ? 170 VAL A CB  1 
ATOM   1038 C CG1 . VAL A 1 170 ? 32.53715 40.96817 5.28751   1.000 63.24071  ? 170 VAL A CG1 1 
ATOM   1039 C CG2 . VAL A 1 170 ? 34.10078 41.65302 3.51653   1.000 69.23034  ? 170 VAL A CG2 1 
ATOM   1040 N N   . GLY A 1 171 ? 29.53771 41.84288 3.60166   1.000 51.40650  ? 171 GLY A N   1 
ATOM   1041 C CA  . GLY A 1 171 ? 28.19141 41.65510 4.10293   1.000 58.63301  ? 171 GLY A CA  1 
ATOM   1042 C C   . GLY A 1 171 ? 27.33279 40.83772 3.16920   1.000 63.00761  ? 171 GLY A C   1 
ATOM   1043 O O   . GLY A 1 171 ? 26.41921 40.13039 3.61799   1.000 53.96772  ? 171 GLY A O   1 
ATOM   1044 N N   . ASN A 1 172 ? 27.64465 40.88251 1.87024   1.000 66.93294  ? 172 ASN A N   1 
ATOM   1045 C CA  . ASN A 1 172 ? 26.81600 40.29899 0.82092   1.000 58.11185  ? 172 ASN A CA  1 
ATOM   1046 C C   . ASN A 1 172 ? 25.41820 40.91230 0.86524   1.000 59.37936  ? 172 ASN A C   1 
ATOM   1047 O O   . ASN A 1 172 ? 24.40236 40.23094 1.00122   1.000 63.42210  ? 172 ASN A O   1 
ATOM   1048 C CB  . ASN A 1 172 ? 26.77035 38.77703 0.92525   1.000 53.78955  ? 172 ASN A CB  1 
ATOM   1049 C CG  . ASN A 1 172 ? 26.21494 38.14936 -0.30893  1.000 70.01534  ? 172 ASN A CG  1 
ATOM   1050 O OD1 . ASN A 1 172 ? 26.39313 38.66998 -1.41464  1.000 62.22628  ? 172 ASN A OD1 1 
ATOM   1051 N ND2 . ASN A 1 172 ? 25.52001 37.02983 -0.14062  1.000 73.15749  ? 172 ASN A ND2 1 
ATOM   1052 N N   . VAL A 1 173 ? 25.39992 42.24014 0.77403   1.000 56.68796  ? 173 VAL A N   1 
ATOM   1053 C CA  . VAL A 1 173 ? 24.17212 43.01700 0.79147   1.000 57.93779  ? 173 VAL A CA  1 
ATOM   1054 C C   . VAL A 1 173 ? 24.26751 44.09952 -0.26858  1.000 58.87223  ? 173 VAL A C   1 
ATOM   1055 O O   . VAL A 1 173 ? 25.35484 44.52142 -0.66867  1.000 55.68838  ? 173 VAL A O   1 
ATOM   1056 C CB  . VAL A 1 173 ? 23.89680 43.68471 2.16419   1.000 51.98393  ? 173 VAL A CB  1 
ATOM   1057 C CG1 . VAL A 1 173 ? 23.52677 42.64723 3.21260   1.000 45.93884  ? 173 VAL A CG1 1 
ATOM   1058 C CG2 . VAL A 1 173 ? 25.08811 44.53439 2.59183   1.000 43.52175  ? 173 VAL A CG2 1 
ATOM   1059 N N   . ILE A 1 174 ? 23.09726 44.56362 -0.69998  1.000 60.92252  ? 174 ILE A N   1 
ATOM   1060 C CA  . ILE A 1 174 ? 23.02282 45.77081 -1.50558  1.000 60.24614  ? 174 ILE A CA  1 
ATOM   1061 C C   . ILE A 1 174 ? 23.24435 46.96926 -0.59783  1.000 62.39714  ? 174 ILE A C   1 
ATOM   1062 O O   . ILE A 1 174 ? 22.58242 47.10978 0.44106   1.000 58.67091  ? 174 ILE A O   1 
ATOM   1063 C CB  . ILE A 1 174 ? 21.66150 45.87394 -2.21232  1.000 57.16200  ? 174 ILE A CB  1 
ATOM   1064 C CG1 . ILE A 1 174 ? 21.32515 44.59173 -2.97570  1.000 54.40657  ? 174 ILE A CG1 1 
ATOM   1065 C CG2 . ILE A 1 174 ? 21.63390 47.07641 -3.10057  1.000 55.67462  ? 174 ILE A CG2 1 
ATOM   1066 C CD1 . ILE A 1 174 ? 22.33059 44.24819 -3.94114  1.000 61.14315  ? 174 ILE A CD1 1 
ATOM   1067 N N   . VAL A 1 175 ? 24.17617 47.83682 -0.97704  1.000 61.86183  ? 175 VAL A N   1 
ATOM   1068 C CA  . VAL A 1 175 ? 24.33474 49.13067 -0.32653  1.000 57.17061  ? 175 VAL A CA  1 
ATOM   1069 C C   . VAL A 1 175 ? 24.11540 50.23646 -1.35476  1.000 60.64533  ? 175 VAL A C   1 
ATOM   1070 O O   . VAL A 1 175 ? 24.64446 50.18981 -2.47262  1.000 63.87566  ? 175 VAL A O   1 
ATOM   1071 C CB  . VAL A 1 175 ? 25.71108 49.29917 0.34980   1.000 48.66593  ? 175 VAL A CB  1 
ATOM   1072 C CG1 . VAL A 1 175 ? 25.69849 50.56233 1.18017   1.000 36.47087  ? 175 VAL A CG1 1 
ATOM   1073 C CG2 . VAL A 1 175 ? 26.06977 48.08154 1.19314   1.000 47.00668  ? 175 VAL A CG2 1 
ATOM   1074 N N   . ALA A 1 176 ? 23.36104 51.24732 -0.95383  1.000 51.50309  ? 176 ALA A N   1 
ATOM   1075 C CA  . ALA A 1 176 ? 23.07089 52.38872 -1.79018  1.000 47.64336  ? 176 ALA A CA  1 
ATOM   1076 C C   . ALA A 1 176 ? 23.33469 53.67400 -1.02125  1.000 50.40205  ? 176 ALA A C   1 
ATOM   1077 O O   . ALA A 1 176 ? 23.12155 53.74850 0.18514   1.000 54.72428  ? 176 ALA A O   1 
ATOM   1078 C CB  . ALA A 1 176 ? 21.61909 52.35739 -2.26717  1.000 51.49073  ? 176 ALA A CB  1 
ATOM   1079 N N   . SER A 1 177 ? 23.80494 54.68811 -1.73480  1.000 55.02388  ? 177 SER A N   1 
ATOM   1080 C CA  . SER A 1 177 ? 23.94057 56.02697 -1.18915  1.000 45.89004  ? 177 SER A CA  1 
ATOM   1081 C C   . SER A 1 177 ? 23.50641 56.99793 -2.26660  1.000 47.23931  ? 177 SER A C   1 
ATOM   1082 O O   . SER A 1 177 ? 23.28670 56.61418 -3.41613  1.000 59.01687  ? 177 SER A O   1 
ATOM   1083 C CB  . SER A 1 177 ? 25.36707 56.32165 -0.74907  1.000 40.93702  ? 177 SER A CB  1 
ATOM   1084 O OG  . SER A 1 177 ? 26.22011 56.24154 -1.87571  1.000 47.17764  ? 177 SER A OG  1 
ATOM   1085 N N   . PHE A 1 178 ? 23.40918 58.26852 -1.90188  1.000 44.07802  ? 178 PHE A N   1 
ATOM   1086 C CA  . PHE A 1 178 ? 22.86216 59.23434 -2.83625  1.000 47.71597  ? 178 PHE A CA  1 
ATOM   1087 C C   . PHE A 1 178 ? 23.10797 60.64187 -2.31784  1.000 48.98834  ? 178 PHE A C   1 
ATOM   1088 O O   . PHE A 1 178 ? 23.23128 60.85852 -1.11556  1.000 58.81729  ? 178 PHE A O   1 
ATOM   1089 C CB  . PHE A 1 178 ? 21.37006 58.99921 -3.03864  1.000 43.47243  ? 178 PHE A CB  1 
ATOM   1090 C CG  . PHE A 1 178 ? 20.57955 59.14126 -1.79604  1.000 40.39590  ? 178 PHE A CG  1 
ATOM   1091 C CD1 . PHE A 1 178 ? 20.25341 60.40649 -1.30244  1.000 46.31823  ? 178 PHE A CD1 1 
ATOM   1092 C CD2 . PHE A 1 178 ? 20.15396 58.01811 -1.10732  1.000 42.33610  ? 178 PHE A CD2 1 
ATOM   1093 C CE1 . PHE A 1 178 ? 19.53107 60.55278 -0.15830  1.000 44.58299  ? 178 PHE A CE1 1 
ATOM   1094 C CE2 . PHE A 1 178 ? 19.42318 58.15460 0.05554   1.000 36.22016  ? 178 PHE A CE2 1 
ATOM   1095 C CZ  . PHE A 1 178 ? 19.11093 59.42328 0.52894   1.000 41.48137  ? 178 PHE A CZ  1 
ATOM   1096 N N   . GLN A 1 179 ? 23.11214 61.60537 -3.23498  1.000 50.41209  ? 179 GLN A N   1 
ATOM   1097 C CA  . GLN A 1 179 ? 23.14972 63.00107 -2.83286  1.000 52.38774  ? 179 GLN A CA  1 
ATOM   1098 C C   . GLN A 1 179 ? 21.74967 63.54760 -2.57403  1.000 50.97677  ? 179 GLN A C   1 
ATOM   1099 O O   . GLN A 1 179 ? 20.76585 63.18105 -3.23280  1.000 45.12181  ? 179 GLN A O   1 
ATOM   1100 C CB  . GLN A 1 179 ? 23.84231 63.87196 -3.88077  1.000 53.92484  ? 179 GLN A CB  1 
ATOM   1101 C CG  . GLN A 1 179 ? 25.13243 63.30710 -4.41091  1.000 53.09860  ? 179 GLN A CG  1 
ATOM   1102 C CD  . GLN A 1 179 ? 26.27533 63.44015 -3.43897  1.000 51.90351  ? 179 GLN A CD  1 
ATOM   1103 O OE1 . GLN A 1 179 ? 26.10571 63.26230 -2.23072  1.000 58.74030  ? 179 GLN A OE1 1 
ATOM   1104 N NE2 . GLN A 1 179 ? 27.45736 63.74777 -3.96136  1.000 43.04359  ? 179 GLN A NE2 1 
ATOM   1105 N N   . TYR A 1 180 ? 21.68151 64.44273 -1.59603  1.000 48.93135  ? 180 TYR A N   1 
ATOM   1106 C CA  . TYR A 1 180 ? 20.48166 65.18550 -1.26829  1.000 41.65304  ? 180 TYR A CA  1 
ATOM   1107 C C   . TYR A 1 180 ? 20.88581 66.63579 -1.05773  1.000 45.13832  ? 180 TYR A C   1 
ATOM   1108 O O   . TYR A 1 180 ? 21.99595 66.92276 -0.60007  1.000 45.91223  ? 180 TYR A O   1 
ATOM   1109 C CB  . TYR A 1 180 ? 19.76992 64.59285 -0.02017  1.000 34.20112  ? 180 TYR A CB  1 
ATOM   1110 C CG  . TYR A 1 180 ? 20.53596 64.70036 1.27544   1.000 42.80719  ? 180 TYR A CG  1 
ATOM   1111 C CD1 . TYR A 1 180 ? 21.39547 63.68109 1.69225   1.000 45.76874  ? 180 TYR A CD1 1 
ATOM   1112 C CD2 . TYR A 1 180 ? 20.39290 65.81442 2.09795   1.000 42.03530  ? 180 TYR A CD2 1 
ATOM   1113 C CE1 . TYR A 1 180 ? 22.09940 63.77607 2.88838   1.000 49.61485  ? 180 TYR A CE1 1 
ATOM   1114 C CE2 . TYR A 1 180 ? 21.08704 65.91144 3.30381   1.000 51.61887  ? 180 TYR A CE2 1 
ATOM   1115 C CZ  . TYR A 1 180 ? 21.93360 64.89134 3.69762   1.000 53.80928  ? 180 TYR A CZ  1 
ATOM   1116 O OH  . TYR A 1 180 ? 22.61807 65.00698 4.89075   1.000 50.23169  ? 180 TYR A OH  1 
ATOM   1117 N N   . ARG A 1 181 ? 20.00153 67.55433 -1.43624  1.000 44.96561  ? 181 ARG A N   1 
ATOM   1118 C CA  . ARG A 1 181 ? 20.35061 68.96422 -1.36079  1.000 46.90833  ? 181 ARG A CA  1 
ATOM   1119 C C   . ARG A 1 181 ? 20.57113 69.38351 0.09544   1.000 53.60564  ? 181 ARG A C   1 
ATOM   1120 O O   . ARG A 1 181 ? 19.77188 69.06689 0.98483   1.000 45.92189  ? 181 ARG A O   1 
ATOM   1121 C CB  . ARG A 1 181 ? 19.25795 69.81044 -2.00719  1.000 43.88241  ? 181 ARG A CB  1 
ATOM   1122 C CG  . ARG A 1 181 ? 19.44444 70.06868 -3.50534  1.000 55.50150  ? 181 ARG A CG  1 
ATOM   1123 C CD  . ARG A 1 181 ? 18.21919 70.72395 -4.16321  1.000 36.33291  ? 181 ARG A CD  1 
ATOM   1124 N NE  . ARG A 1 181 ? 17.04332 69.85598 -4.09675  1.000 52.96809  ? 181 ARG A NE  1 
ATOM   1125 C CZ  . ARG A 1 181 ? 15.81429 70.24463 -4.42118  1.000 49.28897  ? 181 ARG A CZ  1 
ATOM   1126 N NH1 . ARG A 1 181 ? 15.61099 71.49562 -4.83277  1.000 39.28432  ? 181 ARG A NH1 1 
ATOM   1127 N NH2 . ARG A 1 181 ? 14.79442 69.38791 -4.32339  1.000 44.87701  ? 181 ARG A NH2 1 
ATOM   1128 N N   . VAL A 1 182 ? 21.66850 70.09878 0.33188   1.000 54.24310  ? 182 VAL A N   1 
ATOM   1129 C CA  . VAL A 1 182 ? 22.00958 70.60324 1.64717   1.000 44.34333  ? 182 VAL A CA  1 
ATOM   1130 C C   . VAL A 1 182 ? 22.00448 72.12383 1.61613   1.000 57.30143  ? 182 VAL A C   1 
ATOM   1131 O O   . VAL A 1 182 ? 21.94593 72.75403 0.55608   1.000 54.31604  ? 182 VAL A O   1 
ATOM   1132 C CB  . VAL A 1 182 ? 23.36564 70.08446 2.13267   1.000 43.36914  ? 182 VAL A CB  1 
ATOM   1133 C CG1 . VAL A 1 182 ? 23.25596 68.61093 2.49754   1.000 42.43607  ? 182 VAL A CG1 1 
ATOM   1134 C CG2 . VAL A 1 182 ? 24.42336 70.33326 1.08248   1.000 41.78028  ? 182 VAL A CG2 1 
ATOM   1135 N N   . GLY A 1 183 ? 22.07391 72.71006 2.81301   1.000 59.09735  ? 183 GLY A N   1 
ATOM   1136 C CA  . GLY A 1 183 ? 22.06840 74.14171 2.90556   1.000 59.78247  ? 183 GLY A CA  1 
ATOM   1137 C C   . GLY A 1 183 ? 20.75964 74.75029 2.41401   1.000 57.14572  ? 183 GLY A C   1 
ATOM   1138 O O   . GLY A 1 183 ? 19.69240 74.11636 2.38507   1.000 52.23076  ? 183 GLY A O   1 
ATOM   1139 N N   . ALA A 1 184 ? 20.86051 76.02442 2.02710   1.000 44.66710  ? 184 ALA A N   1 
ATOM   1140 C CA  . ALA A 1 184 ? 19.66346 76.74129 1.61658   1.000 48.12460  ? 184 ALA A CA  1 
ATOM   1141 C C   . ALA A 1 184 ? 19.02566 76.09371 0.39350   1.000 55.63230  ? 184 ALA A C   1 
ATOM   1142 O O   . ALA A 1 184 ? 17.80895 76.19089 0.20459   1.000 58.90440  ? 184 ALA A O   1 
ATOM   1143 C CB  . ALA A 1 184 ? 20.00403 78.19894 1.35271   1.000 52.61018  ? 184 ALA A CB  1 
ATOM   1144 N N   . PHE A 1 185 ? 19.83061 75.40127 -0.42139  1.000 59.11112  ? 185 PHE A N   1 
ATOM   1145 C CA  . PHE A 1 185 ? 19.31036 74.66273 -1.56917  1.000 57.81105  ? 185 PHE A CA  1 
ATOM   1146 C C   . PHE A 1 185 ? 18.33910 73.58169 -1.13242  1.000 56.75322  ? 185 PHE A C   1 
ATOM   1147 O O   . PHE A 1 185 ? 17.32825 73.33302 -1.80366  1.000 57.36048  ? 185 PHE A O   1 
ATOM   1148 C CB  . PHE A 1 185 ? 20.46938 74.05176 -2.36275  1.000 48.36394  ? 185 PHE A CB  1 
ATOM   1149 C CG  . PHE A 1 185 ? 21.54016 75.04910 -2.71612  1.000 52.91128  ? 185 PHE A CG  1 
ATOM   1150 C CD1 . PHE A 1 185 ? 21.46237 75.78154 -3.88854  1.000 58.82639  ? 185 PHE A CD1 1 
ATOM   1151 C CD2 . PHE A 1 185 ? 22.61226 75.27230 -1.86644  1.000 55.73650  ? 185 PHE A CD2 1 
ATOM   1152 C CE1 . PHE A 1 185 ? 22.44312 76.70609 -4.21239  1.000 65.01217  ? 185 PHE A CE1 1 
ATOM   1153 C CE2 . PHE A 1 185 ? 23.59798 76.19945 -2.19052  1.000 58.26637  ? 185 PHE A CE2 1 
ATOM   1154 C CZ  . PHE A 1 185 ? 23.51544 76.91392 -3.36042  1.000 61.02725  ? 185 PHE A CZ  1 
ATOM   1155 N N   . GLY A 1 186 ? 18.62621 72.93138 -0.00823  1.000 53.42111  ? 186 GLY A N   1 
ATOM   1156 C CA  . GLY A 1 186 ? 17.77618 71.86639 0.46599   1.000 46.74609  ? 186 GLY A CA  1 
ATOM   1157 C C   . GLY A 1 186 ? 16.74082 72.33515 1.46513   1.000 51.29265  ? 186 GLY A C   1 
ATOM   1158 O O   . GLY A 1 186 ? 15.76600 71.62198 1.71980   1.000 50.57422  ? 186 GLY A O   1 
ATOM   1159 N N   . PHE A 1 187 ? 16.92539 73.52962 2.04640   1.000 53.03376  ? 187 PHE A N   1 
ATOM   1160 C CA  . PHE A 1 187 ? 16.13019 73.85795 3.22292   1.000 53.38279  ? 187 PHE A CA  1 
ATOM   1161 C C   . PHE A 1 187 ? 15.57936 75.27451 3.27142   1.000 52.68977  ? 187 PHE A C   1 
ATOM   1162 O O   . PHE A 1 187 ? 14.98296 75.64070 4.29277   1.000 49.68719  ? 187 PHE A O   1 
ATOM   1163 C CB  . PHE A 1 187 ? 16.94927 73.56925 4.48054   1.000 47.23641  ? 187 PHE A CB  1 
ATOM   1164 C CG  . PHE A 1 187 ? 17.21835 72.11690 4.66126   1.000 40.43369  ? 187 PHE A CG  1 
ATOM   1165 C CD1 . PHE A 1 187 ? 16.28372 71.30183 5.27340   1.000 38.61812  ? 187 PHE A CD1 1 
ATOM   1166 C CD2 . PHE A 1 187 ? 18.37472 71.55223 4.15760   1.000 40.51236  ? 187 PHE A CD2 1 
ATOM   1167 C CE1 . PHE A 1 187 ? 16.51737 69.95171 5.40436   1.000 43.80100  ? 187 PHE A CE1 1 
ATOM   1168 C CE2 . PHE A 1 187 ? 18.62658 70.20278 4.28807   1.000 41.65866  ? 187 PHE A CE2 1 
ATOM   1169 C CZ  . PHE A 1 187 ? 17.69831 69.39766 4.90845   1.000 43.83396  ? 187 PHE A CZ  1 
ATOM   1170 N N   . LEU A 1 188 ? 15.72825 76.07001 2.21276   1.000 52.19269  ? 188 LEU A N   1 
ATOM   1171 C CA  . LEU A 1 188 ? 15.08437 77.37625 2.18474   1.000 46.65797  ? 188 LEU A CA  1 
ATOM   1172 C C   . LEU A 1 188 ? 13.59511 77.19646 2.41274   1.000 43.69946  ? 188 LEU A C   1 
ATOM   1173 O O   . LEU A 1 188 ? 12.95229 76.37491 1.75978   1.000 43.64865  ? 188 LEU A O   1 
ATOM   1174 C CB  . LEU A 1 188 ? 15.34651 78.07787 0.85303   1.000 48.13396  ? 188 LEU A CB  1 
ATOM   1175 C CG  . LEU A 1 188 ? 14.71424 79.46085 0.70044   1.000 55.64864  ? 188 LEU A CG  1 
ATOM   1176 C CD1 . LEU A 1 188 ? 15.22209 80.42124 1.75793   1.000 56.63012  ? 188 LEU A CD1 1 
ATOM   1177 C CD2 . LEU A 1 188 ? 14.98181 80.01330 -0.68766  1.000 55.37440  ? 188 LEU A CD2 1 
ATOM   1178 N N   . HIS A 1 189 ? 13.05130 77.92641 3.38019   1.000 60.63224  ? 189 HIS A N   1 
ATOM   1179 C CA  . HIS A 1 189 ? 11.68808 77.69536 3.85112   1.000 57.21464  ? 189 HIS A CA  1 
ATOM   1180 C C   . HIS A 1 189 ? 11.00665 79.04362 3.93951   1.000 53.64810  ? 189 HIS A C   1 
ATOM   1181 O O   . HIS A 1 189 ? 11.33581 79.83704 4.82264   1.000 61.33127  ? 189 HIS A O   1 
ATOM   1182 C CB  . HIS A 1 189 ? 11.69437 76.98447 5.20269   1.000 51.09379  ? 189 HIS A CB  1 
ATOM   1183 C CG  . HIS A 1 189 ? 10.34804 76.89054 5.85425   1.000 55.49902  ? 189 HIS A CG  1 
ATOM   1184 N ND1 . HIS A 1 189 ? 9.43594  75.90245 5.54492   1.000 50.88887  ? 189 HIS A ND1 1 
ATOM   1185 C CD2 . HIS A 1 189 ? 9.76991  77.64804 6.82200   1.000 53.03373  ? 189 HIS A CD2 1 
ATOM   1186 C CE1 . HIS A 1 189 ? 8.35712  76.05432 6.29463   1.000 47.88761  ? 189 HIS A CE1 1 
ATOM   1187 N NE2 . HIS A 1 189 ? 8.52990  77.11078 7.07210   1.000 50.98021  ? 189 HIS A NE2 1 
ATOM   1188 N N   . LEU A 1 190 ? 10.07475 79.31378 3.01185   1.000 55.22563  ? 190 LEU A N   1 
ATOM   1189 C CA  . LEU A 1 190 ? 9.39732  80.60452 2.97047   1.000 52.93404  ? 190 LEU A CA  1 
ATOM   1190 C C   . LEU A 1 190 ? 7.90054  80.51894 2.73803   1.000 53.16292  ? 190 LEU A C   1 
ATOM   1191 O O   . LEU A 1 190 ? 7.25160  81.56986 2.66204   1.000 53.41054  ? 190 LEU A O   1 
ATOM   1192 C CB  . LEU A 1 190 ? 9.99893  81.49972 1.88304   1.000 53.44229  ? 190 LEU A CB  1 
ATOM   1193 C CG  . LEU A 1 190 ? 11.51146 81.55044 1.76742   1.000 58.57817  ? 190 LEU A CG  1 
ATOM   1194 C CD1 . LEU A 1 190 ? 11.89266 81.88352 0.34038   1.000 57.15793  ? 190 LEU A CD1 1 
ATOM   1195 C CD2 . LEU A 1 190 ? 12.11846 82.55042 2.77068   1.000 53.72756  ? 190 LEU A CD2 1 
ATOM   1196 N N   . ALA A 1 191 ? 7.33408  79.32595 2.59427   1.000 52.08152  ? 191 ALA A N   1 
ATOM   1197 C CA  . ALA A 1 191 ? 5.92349  79.23077 2.22903   1.000 51.77637  ? 191 ALA A CA  1 
ATOM   1198 C C   . ALA A 1 191 ? 4.99894  79.99694 3.16591   1.000 56.25551  ? 191 ALA A C   1 
ATOM   1199 O O   . ALA A 1 191 ? 4.05532  80.63476 2.66690   1.000 64.89725  ? 191 ALA A O   1 
ATOM   1200 C CB  . ALA A 1 191 ? 5.51617  77.75503 2.12967   1.000 44.85224  ? 191 ALA A CB  1 
ATOM   1201 N N   . PRO A 1 192 ? 5.19747  80.00250 4.48892   1.000 57.45923  ? 192 PRO A N   1 
ATOM   1202 C CA  . PRO A 1 192 ? 4.30174  80.80724 5.33443   1.000 55.96894  ? 192 PRO A CA  1 
ATOM   1203 C C   . PRO A 1 192 ? 4.33134  82.29076 5.00623   1.000 64.93960  ? 192 PRO A C   1 
ATOM   1204 O O   . PRO A 1 192 ? 3.31898  82.98127 5.18347   1.000 67.54508  ? 192 PRO A O   1 
ATOM   1205 C CB  . PRO A 1 192 ? 4.80459  80.51924 6.75930   1.000 50.94376  ? 192 PRO A CB  1 
ATOM   1206 C CG  . PRO A 1 192 ? 6.03749  79.72282 6.61867   1.000 55.71768  ? 192 PRO A CG  1 
ATOM   1207 C CD  . PRO A 1 192 ? 6.00837  79.06625 5.29256   1.000 47.32797  ? 192 PRO A CD  1 
ATOM   1208 N N   . GLU A 1 193 ? 5.45802  82.80036 4.51177   1.000 65.73269  ? 193 GLU A N   1 
ATOM   1209 C CA  . GLU A 1 193 ? 5.57537  84.20832 4.15498   1.000 61.47315  ? 193 GLU A CA  1 
ATOM   1210 C C   . GLU A 1 193 ? 4.83898  84.55888 2.86773   1.000 66.57724  ? 193 GLU A C   1 
ATOM   1211 O O   . GLU A 1 193 ? 4.77617  85.73972 2.50847   1.000 66.01572  ? 193 GLU A O   1 
ATOM   1212 C CB  . GLU A 1 193 ? 7.05324  84.56696 4.01661   1.000 61.43607  ? 193 GLU A CB  1 
ATOM   1213 C CG  . GLU A 1 193 ? 7.36751  86.03426 4.18873   1.000 72.47194  ? 193 GLU A CG  1 
ATOM   1214 C CD  . GLU A 1 193 ? 7.19332  86.50319 5.61645   1.000 75.05514  ? 193 GLU A CD  1 
ATOM   1215 O OE1 . GLU A 1 193 ? 7.06600  87.73624 5.81734   1.000 75.04767  ? 193 GLU A OE1 1 
ATOM   1216 O OE2 . GLU A 1 193 ? 7.18504  85.63667 6.52775   1.000 70.63608  ? 193 GLU A OE2 1 
ATOM   1217 N N   . MET A 1 194 ? 4.26758  83.57926 2.18146   1.000 67.07338  ? 194 MET A N   1 
ATOM   1218 C CA  . MET A 1 194 ? 3.69608  83.74551 0.85753   1.000 65.78165  ? 194 MET A CA  1 
ATOM   1219 C C   . MET A 1 194 ? 2.27768  83.20575 0.80779   1.000 61.72971  ? 194 MET A C   1 
ATOM   1220 O O   . MET A 1 194 ? 1.90615  82.34705 1.61308   1.000 72.05805  ? 194 MET A O   1 
ATOM   1221 C CB  . MET A 1 194 ? 4.56059  82.97726 -0.13482  1.000 70.74251  ? 194 MET A CB  1 
ATOM   1222 C CG  . MET A 1 194 ? 5.89457  83.58154 -0.32624  1.000 71.46928  ? 194 MET A CG  1 
ATOM   1223 S SD  . MET A 1 194 ? 6.61936  82.42253 -1.48543  1.000 63.19477  ? 194 MET A SD  1 
ATOM   1224 C CE  . MET A 1 194 ? 7.87121  81.53544 -0.55840  1.000 71.43811  ? 194 MET A CE  1 
ATOM   1225 N N   . PRO A 1 195 ? 1.47453  83.65649 -0.15075  1.000 62.94938  ? 195 PRO A N   1 
ATOM   1226 C CA  . PRO A 1 195 ? 0.10311  83.15313 -0.26271  1.000 59.54306  ? 195 PRO A CA  1 
ATOM   1227 C C   . PRO A 1 195 ? 0.03786  81.66416 -0.55670  1.000 57.22749  ? 195 PRO A C   1 
ATOM   1228 O O   . PRO A 1 195 ? 1.02489  80.99886 -0.86858  1.000 55.52479  ? 195 PRO A O   1 
ATOM   1229 C CB  . PRO A 1 195 ? -0.46660 83.97663 -1.41865  1.000 63.65130  ? 195 PRO A CB  1 
ATOM   1230 C CG  . PRO A 1 195 ? 0.24486  85.27642 -1.30275  1.000 63.45341  ? 195 PRO A CG  1 
ATOM   1231 C CD  . PRO A 1 195 ? 1.65890  84.88624 -0.94230  1.000 73.68422  ? 195 PRO A CD  1 
ATOM   1232 N N   . SER A 1 196 ? -1.17880 81.13679 -0.41831  1.000 65.60617  ? 196 SER A N   1 
ATOM   1233 C CA  . SER A 1 196 ? -1.41331 79.71025 -0.62346  1.000 62.53638  ? 196 SER A CA  1 
ATOM   1234 C C   . SER A 1 196 ? -0.88292 79.25300 -1.96994  1.000 62.99730  ? 196 SER A C   1 
ATOM   1235 O O   . SER A 1 196 ? -0.22417 78.20279 -2.06980  1.000 56.55614  ? 196 SER A O   1 
ATOM   1236 C CB  . SER A 1 196 ? -2.91098 79.42390 -0.48820  1.000 77.80185  ? 196 SER A CB  1 
ATOM   1237 O OG  . SER A 1 196 ? -3.28099 78.25646 -1.19548  1.000 89.71933  ? 196 SER A OG  1 
ATOM   1238 N N   . GLU A 1 197 ? -1.11831 80.06932 -3.00345  1.000 66.37049  ? 197 GLU A N   1 
ATOM   1239 C CA  . GLU A 1 197 ? -0.76689 79.73321 -4.37462  1.000 63.21848  ? 197 GLU A CA  1 
ATOM   1240 C C   . GLU A 1 197 ? 0.71143  79.38765 -4.51594  1.000 59.93012  ? 197 GLU A C   1 
ATOM   1241 O O   . GLU A 1 197 ? 1.08129  78.49560 -5.28652  1.000 67.22397  ? 197 GLU A O   1 
ATOM   1242 C CB  . GLU A 1 197 ? -1.16802 80.90709 -5.27171  1.000 67.44964  ? 197 GLU A CB  1 
ATOM   1243 C CG  . GLU A 1 197 ? -0.31260 81.14569 -6.47847  1.000 86.12920  ? 197 GLU A CG  1 
ATOM   1244 C CD  . GLU A 1 197 ? -0.71602 82.39940 -7.23929  1.000 99.49302  ? 197 GLU A CD  1 
ATOM   1245 O OE1 . GLU A 1 197 ? -1.15504 83.37627 -6.59394  1.000 105.75134 ? 197 GLU A OE1 1 
ATOM   1246 O OE2 . GLU A 1 197 ? -0.61084 82.40018 -8.48501  1.000 102.23212 ? 197 GLU A OE2 1 
ATOM   1247 N N   . PHE A 1 198 ? 1.56726  80.04110 -3.73765  1.000 59.52155  ? 198 PHE A N   1 
ATOM   1248 C CA  . PHE A 1 198 ? 3.00752  79.89503 -3.87458  1.000 56.35876  ? 198 PHE A CA  1 
ATOM   1249 C C   . PHE A 1 198 ? 3.60665  78.87936 -2.91455  1.000 58.12864  ? 198 PHE A C   1 
ATOM   1250 O O   . PHE A 1 198 ? 4.81823  78.90918 -2.68708  1.000 61.70392  ? 198 PHE A O   1 
ATOM   1251 C CB  . PHE A 1 198 ? 3.68297  81.24181 -3.69356  1.000 55.77812  ? 198 PHE A CB  1 
ATOM   1252 C CG  . PHE A 1 198 ? 3.14501  82.29698 -4.60613  1.000 59.94047  ? 198 PHE A CG  1 
ATOM   1253 C CD1 . PHE A 1 198 ? 2.06330  83.06945 -4.23060  1.000 61.23438  ? 198 PHE A CD1 1 
ATOM   1254 C CD2 . PHE A 1 198 ? 3.71257  82.50562 -5.85098  1.000 64.30612  ? 198 PHE A CD2 1 
ATOM   1255 C CE1 . PHE A 1 198 ? 1.57090  84.04249 -5.08285  1.000 62.48168  ? 198 PHE A CE1 1 
ATOM   1256 C CE2 . PHE A 1 198 ? 3.21679  83.47249 -6.70788  1.000 59.50855  ? 198 PHE A CE2 1 
ATOM   1257 C CZ  . PHE A 1 198 ? 2.15403  84.23790 -6.31908  1.000 64.85969  ? 198 PHE A CZ  1 
ATOM   1258 N N   . ALA A 1 199 ? 2.79727  77.95209 -2.39380  1.000 50.62951  ? 199 ALA A N   1 
ATOM   1259 C CA  . ALA A 1 199 ? 3.29705  76.96003 -1.44492  1.000 49.93675  ? 199 ALA A CA  1 
ATOM   1260 C C   . ALA A 1 199 ? 4.54894  76.25057 -1.95482  1.000 59.55519  ? 199 ALA A C   1 
ATOM   1261 O O   . ALA A 1 199 ? 5.57569  76.20325 -1.26523  1.000 71.96481  ? 199 ALA A O   1 
ATOM   1262 C CB  . ALA A 1 199 ? 2.19899  75.94371 -1.13251  1.000 50.17519  ? 199 ALA A CB  1 
ATOM   1263 N N   . GLU A 1 200 ? 4.48442  75.69469 -3.16115  1.000 61.90744  ? 200 GLU A N   1 
ATOM   1264 C CA  . GLU A 1 200 ? 5.57993  74.89717 -3.71854  1.000 59.97394  ? 200 GLU A CA  1 
ATOM   1265 C C   . GLU A 1 200 ? 6.76232  75.73124 -4.19008  1.000 57.62221  ? 200 GLU A C   1 
ATOM   1266 O O   . GLU A 1 200 ? 7.70851  75.18667 -4.80254  1.000 49.86246  ? 200 GLU A O   1 
ATOM   1267 C CB  . GLU A 1 200 ? 5.06710  74.03832 -4.87005  1.000 43.87324  ? 200 GLU A CB  1 
ATOM   1268 C CG  . GLU A 1 200 ? 4.20578  72.89181 -4.41741  1.000 55.66043  ? 200 GLU A CG  1 
ATOM   1269 C CD  . GLU A 1 200 ? 4.82678  72.13382 -3.25577  1.000 61.55422  ? 200 GLU A CD  1 
ATOM   1270 O OE1 . GLU A 1 200 ? 6.06372  71.94922 -3.22993  1.000 64.70984  ? 200 GLU A OE1 1 
ATOM   1271 O OE2 . GLU A 1 200 ? 4.07173  71.72032 -2.35960  1.000 71.42695  ? 200 GLU A OE2 1 
ATOM   1272 N N   . GLU A 1 201 ? 6.75046  77.03209 -3.90642  1.000 49.83920  ? 201 GLU A N   1 
ATOM   1273 C CA  . GLU A 1 201 ? 7.86158  77.87523 -4.31466  1.000 50.80120  ? 201 GLU A CA  1 
ATOM   1274 C C   . GLU A 1 201 ? 9.10355  77.64797 -3.44860  1.000 55.59914  ? 201 GLU A C   1 
ATOM   1275 O O   . GLU A 1 201 ? 10.22279 77.55609 -3.97017  1.000 53.99936  ? 201 GLU A O   1 
ATOM   1276 C CB  . GLU A 1 201 ? 7.41334  79.33325 -4.30158  1.000 48.00974  ? 201 GLU A CB  1 
ATOM   1277 C CG  . GLU A 1 201 ? 8.30926  80.23649 -5.10676  1.000 66.58793  ? 201 GLU A CG  1 
ATOM   1278 C CD  . GLU A 1 201 ? 8.11063  80.16228 -6.61946  1.000 70.33644  ? 201 GLU A CD  1 
ATOM   1279 O OE1 . GLU A 1 201 ? 7.00390  80.40979 -7.11391  1.000 76.01316  ? 201 GLU A OE1 1 
ATOM   1280 O OE2 . GLU A 1 201 ? 9.08448  79.88452 -7.33493  1.000 73.79824  ? 201 GLU A OE2 1 
ATOM   1281 N N   . ALA A 1 202 ? 8.94021  77.54517 -2.13020  1.000 63.60526  ? 202 ALA A N   1 
ATOM   1282 C CA  . ALA A 1 202 ? 10.05898 77.26173 -1.22809  1.000 61.58942  ? 202 ALA A CA  1 
ATOM   1283 C C   . ALA A 1 202 ? 9.50898  76.55683 0.00267   1.000 64.41074  ? 202 ALA A C   1 
ATOM   1284 O O   . ALA A 1 202 ? 9.44898  77.12207 1.09869   1.000 62.74271  ? 202 ALA A O   1 
ATOM   1285 C CB  . ALA A 1 202 ? 10.80283 78.54305 -0.85953  1.000 56.15694  ? 202 ALA A CB  1 
ATOM   1286 N N   . PRO A 1 203 ? 9.07336  75.30829 -0.15340  1.000 60.54163  ? 203 PRO A N   1 
ATOM   1287 C CA  . PRO A 1 203 ? 8.32555  74.66049 0.92682   1.000 51.48221  ? 203 PRO A CA  1 
ATOM   1288 C C   . PRO A 1 203 ? 9.19983  74.31019 2.11720   1.000 50.92619  ? 203 PRO A C   1 
ATOM   1289 O O   . PRO A 1 203 ? 8.68782  74.18608 3.23935   1.000 46.97786  ? 203 PRO A O   1 
ATOM   1290 C CB  . PRO A 1 203 ? 7.76721  73.40451 0.24504   1.000 46.96907  ? 203 PRO A CB  1 
ATOM   1291 C CG  . PRO A 1 203 ? 8.84103  73.05749 -0.77286  1.000 47.89528  ? 203 PRO A CG  1 
ATOM   1292 C CD  . PRO A 1 203 ? 9.37533  74.38078 -1.26292  1.000 55.71856  ? 203 PRO A CD  1 
ATOM   1293 N N   . GLY A 1 204 ? 10.50272 74.19395 1.91053   1.000 46.81319  ? 204 GLY A N   1 
ATOM   1294 C CA  . GLY A 1 204 ? 11.41699 73.75346 2.93463   1.000 36.36269  ? 204 GLY A CA  1 
ATOM   1295 C C   . GLY A 1 204 ? 11.53599 72.24278 2.96785   1.000 42.66206  ? 204 GLY A C   1 
ATOM   1296 O O   . GLY A 1 204 ? 10.66744 71.50637 2.49410   1.000 40.82898  ? 204 GLY A O   1 
ATOM   1297 N N   . ASN A 1 205 ? 12.65253 71.78390 3.52902   1.000 33.55125  ? 205 ASN A N   1 
ATOM   1298 C CA  . ASN A 1 205 ? 12.92791 70.36219 3.69982   1.000 49.87981  ? 205 ASN A CA  1 
ATOM   1299 C C   . ASN A 1 205 ? 13.02752 69.60966 2.36735   1.000 53.69854  ? 205 ASN A C   1 
ATOM   1300 O O   . ASN A 1 205 ? 12.86898 68.37924 2.34036   1.000 58.60895  ? 205 ASN A O   1 
ATOM   1301 C CB  . ASN A 1 205 ? 11.86892 69.69235 4.60103   1.000 49.56866  ? 205 ASN A CB  1 
ATOM   1302 C CG  . ASN A 1 205 ? 11.79396 70.31344 6.00601   1.000 54.31035  ? 205 ASN A CG  1 
ATOM   1303 O OD1 . ASN A 1 205 ? 12.80577 70.66973 6.59976   1.000 58.22967  ? 205 ASN A OD1 1 
ATOM   1304 N ND2 . ASN A 1 205 ? 10.58456 70.43986 6.52985   1.000 53.93986  ? 205 ASN A ND2 1 
ATOM   1305 N N   . VAL A 1 206 ? 13.29070 70.29605 1.24474   1.000 47.98466  ? 206 VAL A N   1 
ATOM   1306 C CA  . VAL A 1 206 ? 13.33243 69.56843 -0.02363  1.000 51.60291  ? 206 VAL A CA  1 
ATOM   1307 C C   . VAL A 1 206 ? 14.48423 68.55833 -0.02909  1.000 52.16275  ? 206 VAL A C   1 
ATOM   1308 O O   . VAL A 1 206 ? 14.37294 67.48044 -0.63298  1.000 46.77603  ? 206 VAL A O   1 
ATOM   1309 C CB  . VAL A 1 206 ? 13.37110 70.53474 -1.23747  1.000 47.24402  ? 206 VAL A CB  1 
ATOM   1310 C CG1 . VAL A 1 206 ? 12.17835 71.47465 -1.20819  1.000 39.45484  ? 206 VAL A CG1 1 
ATOM   1311 C CG2 . VAL A 1 206 ? 14.67681 71.31536 -1.34069  1.000 48.85494  ? 206 VAL A CG2 1 
ATOM   1312 N N   . GLY A 1 207 ? 15.56574 68.84388 0.70864   1.000 54.96983  ? 207 GLY A N   1 
ATOM   1313 C CA  . GLY A 1 207 ? 16.60883 67.84350 0.92081   1.000 47.93053  ? 207 GLY A CA  1 
ATOM   1314 C C   . GLY A 1 207 ? 16.10279 66.54766 1.52967   1.000 44.17557  ? 207 GLY A C   1 
ATOM   1315 O O   . GLY A 1 207 ? 16.61533 65.47091 1.21628   1.000 49.29411  ? 207 GLY A O   1 
ATOM   1316 N N   . LEU A 1 208 ? 15.09926 66.62623 2.41052   1.000 46.85550  ? 208 LEU A N   1 
ATOM   1317 C CA  . LEU A 1 208 ? 14.44947 65.41337 2.91274   1.000 47.46232  ? 208 LEU A CA  1 
ATOM   1318 C C   . LEU A 1 208 ? 13.45830 64.84788 1.90107   1.000 46.06549  ? 208 LEU A C   1 
ATOM   1319 O O   . LEU A 1 208 ? 13.21677 63.63379 1.87526   1.000 44.95894  ? 208 LEU A O   1 
ATOM   1320 C CB  . LEU A 1 208 ? 13.73763 65.70068 4.23644   1.000 41.25986  ? 208 LEU A CB  1 
ATOM   1321 C CG  . LEU A 1 208 ? 14.57865 66.48814 5.24061   1.000 43.46640  ? 208 LEU A CG  1 
ATOM   1322 C CD1 . LEU A 1 208 ? 13.78505 66.84874 6.48048   1.000 41.00961  ? 208 LEU A CD1 1 
ATOM   1323 C CD2 . LEU A 1 208 ? 15.80303 65.66401 5.59344   1.000 41.69655  ? 208 LEU A CD2 1 
ATOM   1324 N N   . TRP A 1 209 ? 12.86421 65.70520 1.07310   1.000 37.06637  ? 209 TRP A N   1 
ATOM   1325 C CA  . TRP A 1 209 ? 12.12735 65.19162 -0.07497  1.000 44.48621  ? 209 TRP A CA  1 
ATOM   1326 C C   . TRP A 1 209 ? 13.05351 64.45651 -1.03851  1.000 44.45393  ? 209 TRP A C   1 
ATOM   1327 O O   . TRP A 1 209 ? 12.70161 63.38340 -1.54661  1.000 39.57260  ? 209 TRP A O   1 
ATOM   1328 C CB  . TRP A 1 209 ? 11.41308 66.32306 -0.77737  1.000 38.22090  ? 209 TRP A CB  1 
ATOM   1329 C CG  . TRP A 1 209 ? 10.29549 66.85877 0.02583   1.000 53.25563  ? 209 TRP A CG  1 
ATOM   1330 C CD1 . TRP A 1 209 ? 10.30715 67.98385 0.80775   1.000 48.71107  ? 209 TRP A CD1 1 
ATOM   1331 C CD2 . TRP A 1 209 ? 8.98394  66.30205 0.13900   1.000 53.56706  ? 209 TRP A CD2 1 
ATOM   1332 N NE1 . TRP A 1 209 ? 9.07480  68.16298 1.38969   1.000 50.32858  ? 209 TRP A NE1 1 
ATOM   1333 C CE2 . TRP A 1 209 ? 8.24661  67.14307 1.00544   1.000 50.52786  ? 209 TRP A CE2 1 
ATOM   1334 C CE3 . TRP A 1 209 ? 8.36072  65.17456 -0.40331  1.000 49.30278  ? 209 TRP A CE3 1 
ATOM   1335 C CZ2 . TRP A 1 209 ? 6.91775  66.89746 1.33281   1.000 47.31806  ? 209 TRP A CZ2 1 
ATOM   1336 C CZ3 . TRP A 1 209 ? 7.03820  64.92938 -0.08022  1.000 52.32232  ? 209 TRP A CZ3 1 
ATOM   1337 C CH2 . TRP A 1 209 ? 6.33075  65.78911 0.78152   1.000 55.04443  ? 209 TRP A CH2 1 
ATOM   1338 N N   . ASP A 1 210 ? 14.25222 64.99948 -1.26964  1.000 43.40418  ? 210 ASP A N   1 
ATOM   1339 C CA  . ASP A 1 210 ? 15.24699 64.31315 -2.08786  1.000 50.70770  ? 210 ASP A CA  1 
ATOM   1340 C C   . ASP A 1 210 ? 15.47379 62.89359 -1.58944  1.000 54.96691  ? 210 ASP A C   1 
ATOM   1341 O O   . ASP A 1 210 ? 15.33723 61.92389 -2.34963  1.000 54.49127  ? 210 ASP A O   1 
ATOM   1342 C CB  . ASP A 1 210 ? 16.57391 65.07863 -2.07965  1.000 48.60152  ? 210 ASP A CB  1 
ATOM   1343 C CG  . ASP A 1 210 ? 16.48740 66.42214 -2.76042  1.000 48.74439  ? 210 ASP A CG  1 
ATOM   1344 O OD1 . ASP A 1 210 ? 15.54083 66.65069 -3.54629  1.000 42.02901  ? 210 ASP A OD1 1 
ATOM   1345 O OD2 . ASP A 1 210 ? 17.38080 67.25494 -2.49724  1.000 51.05138  ? 210 ASP A OD2 1 
ATOM   1346 N N   . GLN A 1 211 ? 15.83222 62.76399 -0.30321  1.000 47.05549  ? 211 GLN A N   1 
ATOM   1347 C CA  . GLN A 1 211 ? 16.09938 61.45105 0.27957   1.000 48.25533  ? 211 GLN A CA  1 
ATOM   1348 C C   . GLN A 1 211 ? 14.89557 60.53661 0.13296   1.000 48.90877  ? 211 GLN A C   1 
ATOM   1349 O O   . GLN A 1 211 ? 15.02902 59.37431 -0.26667  1.000 50.93004  ? 211 GLN A O   1 
ATOM   1350 C CB  . GLN A 1 211 ? 16.46698 61.58530 1.75680   1.000 43.98825  ? 211 GLN A CB  1 
ATOM   1351 C CG  . GLN A 1 211 ? 17.51988 62.60929 2.03209   1.000 40.83313  ? 211 GLN A CG  1 
ATOM   1352 C CD  . GLN A 1 211 ? 17.57882 62.99328 3.48614   1.000 49.71102  ? 211 GLN A CD  1 
ATOM   1353 O OE1 . GLN A 1 211 ? 16.67646 62.66854 4.25733   1.000 59.47786  ? 211 GLN A OE1 1 
ATOM   1354 N NE2 . GLN A 1 211 ? 18.64244 63.69753 3.87414   1.000 45.79347  ? 211 GLN A NE2 1 
ATOM   1355 N N   . ALA A 1 212 ? 13.71020 61.04711 0.47775   1.000 42.33790  ? 212 ALA A N   1 
ATOM   1356 C CA  . ALA A 1 212 ? 12.47595 60.31557 0.23156   1.000 36.43661  ? 212 ALA A CA  1 
ATOM   1357 C C   . ALA A 1 212 ? 12.42201 59.81105 -1.19801  1.000 48.01340  ? 212 ALA A C   1 
ATOM   1358 O O   . ALA A 1 212 ? 12.07581 58.65273 -1.44320  1.000 45.15923  ? 212 ALA A O   1 
ATOM   1359 C CB  . ALA A 1 212 ? 11.27074 61.21115 0.52167   1.000 41.81196  ? 212 ALA A CB  1 
ATOM   1360 N N   . LEU A 1 213 ? 12.80338 60.66157 -2.15482  1.000 55.80488  ? 213 LEU A N   1 
ATOM   1361 C CA  . LEU A 1 213 ? 12.71882 60.28229 -3.56015  1.000 49.37694  ? 213 LEU A CA  1 
ATOM   1362 C C   . LEU A 1 213 ? 13.76286 59.23514 -3.92223  1.000 47.93644  ? 213 LEU A C   1 
ATOM   1363 O O   . LEU A 1 213 ? 13.49408 58.35110 -4.74098  1.000 53.09752  ? 213 LEU A O   1 
ATOM   1364 C CB  . LEU A 1 213 ? 12.86015 61.51841 -4.44784  1.000 49.30447  ? 213 LEU A CB  1 
ATOM   1365 C CG  . LEU A 1 213 ? 12.49638 61.26780 -5.90768  1.000 49.99111  ? 213 LEU A CG  1 
ATOM   1366 C CD1 . LEU A 1 213 ? 11.01365 60.92195 -6.00283  1.000 55.27310  ? 213 LEU A CD1 1 
ATOM   1367 C CD2 . LEU A 1 213 ? 12.87535 62.46031 -6.80494  1.000 40.72835  ? 213 LEU A CD2 1 
ATOM   1368 N N   . ALA A 1 214 ? 14.95889 59.30668 -3.32959  1.000 46.65244  ? 214 ALA A N   1 
ATOM   1369 C CA  . ALA A 1 214 ? 15.97640 58.30907 -3.66005  1.000 49.41796  ? 214 ALA A CA  1 
ATOM   1370 C C   . ALA A 1 214 ? 15.65726 56.97160 -3.01320  1.000 56.32938  ? 214 ALA A C   1 
ATOM   1371 O O   . ALA A 1 214 ? 15.90916 55.91005 -3.60109  1.000 61.48468  ? 214 ALA A O   1 
ATOM   1372 C CB  . ALA A 1 214 ? 17.37067 58.78525 -3.24710  1.000 43.83715  ? 214 ALA A CB  1 
ATOM   1373 N N   . ILE A 1 215 ? 15.09185 57.00095 -1.80695  1.000 54.99249  ? 215 ILE A N   1 
ATOM   1374 C CA  . ILE A 1 215 ? 14.68812 55.75666 -1.17089  1.000 51.81531  ? 215 ILE A CA  1 
ATOM   1375 C C   . ILE A 1 215 ? 13.54757 55.12329 -1.95694  1.000 47.92208  ? 215 ILE A C   1 
ATOM   1376 O O   . ILE A 1 215 ? 13.50755 53.89873 -2.13492  1.000 50.87165  ? 215 ILE A O   1 
ATOM   1377 C CB  . ILE A 1 215 ? 14.33763 56.00649 0.31327   1.000 49.83988  ? 215 ILE A CB  1 
ATOM   1378 C CG1 . ILE A 1 215 ? 15.61515 56.35094 1.08030   1.000 40.87200  ? 215 ILE A CG1 1 
ATOM   1379 C CG2 . ILE A 1 215 ? 13.69797 54.78597 0.95176   1.000 31.97156  ? 215 ILE A CG2 1 
ATOM   1380 C CD1 . ILE A 1 215 ? 15.40782 57.09555 2.38207   1.000 31.08729  ? 215 ILE A CD1 1 
ATOM   1381 N N   . ARG A 1 216 ? 12.62806 55.94563 -2.47504  1.000 39.08498  ? 216 ARG A N   1 
ATOM   1382 C CA  . ARG A 1 216 ? 11.56256 55.41357 -3.31897  1.000 52.49879  ? 216 ARG A CA  1 
ATOM   1383 C C   . ARG A 1 216 ? 12.14431 54.75629 -4.55495  1.000 57.37349  ? 216 ARG A C   1 
ATOM   1384 O O   . ARG A 1 216 ? 11.77406 53.62561 -4.89757  1.000 61.16565  ? 216 ARG A O   1 
ATOM   1385 C CB  . ARG A 1 216 ? 10.57136 56.50547 -3.71574  1.000 65.37191  ? 216 ARG A CB  1 
ATOM   1386 C CG  . ARG A 1 216 ? 9.27842  56.42740 -2.92840  1.000 85.75625  ? 216 ARG A CG  1 
ATOM   1387 C CD  . ARG A 1 216 ? 8.03226  56.64571 -3.77133  1.000 102.12644 ? 216 ARG A CD  1 
ATOM   1388 N NE  . ARG A 1 216 ? 6.85917  56.85945 -2.91765  1.000 112.68798 ? 216 ARG A NE  1 
ATOM   1389 C CZ  . ARG A 1 216 ? 6.19187  55.89033 -2.29050  1.000 115.17597 ? 216 ARG A CZ  1 
ATOM   1390 N NH1 . ARG A 1 216 ? 6.56738  54.62141 -2.42206  1.000 112.27924 ? 216 ARG A NH1 1 
ATOM   1391 N NH2 . ARG A 1 216 ? 5.14087  56.18927 -1.53475  1.000 116.08395 ? 216 ARG A NH2 1 
ATOM   1392 N N   . TRP A 1 217 ? 13.08865 55.44830 -5.21088  1.000 48.19972  ? 217 TRP A N   1 
ATOM   1393 C CA  . TRP A 1 217 ? 13.78268 54.89637 -6.36352  1.000 48.38091  ? 217 TRP A CA  1 
ATOM   1394 C C   . TRP A 1 217 ? 14.41284 53.55161 -6.03625  1.000 54.71840  ? 217 TRP A C   1 
ATOM   1395 O O   . TRP A 1 217 ? 14.37776 52.62076 -6.85028  1.000 61.48087  ? 217 TRP A O   1 
ATOM   1396 C CB  . TRP A 1 217 ? 14.85068 55.87961 -6.84458  1.000 53.66518  ? 217 TRP A CB  1 
ATOM   1397 C CG  . TRP A 1 217 ? 15.35001 55.59483 -8.24520  1.000 53.68418  ? 217 TRP A CG  1 
ATOM   1398 C CD1 . TRP A 1 217 ? 14.88277 56.13699 -9.40779  1.000 46.67926  ? 217 TRP A CD1 1 
ATOM   1399 C CD2 . TRP A 1 217 ? 16.39904 54.69516 -8.61598  1.000 60.42684  ? 217 TRP A CD2 1 
ATOM   1400 N NE1 . TRP A 1 217 ? 15.57104 55.62307 -10.48643 1.000 59.85466  ? 217 TRP A NE1 1 
ATOM   1401 C CE2 . TRP A 1 217 ? 16.51441 54.74247 -10.02512 1.000 66.21667  ? 217 TRP A CE2 1 
ATOM   1402 C CE3 . TRP A 1 217 ? 17.25639 53.85604 -7.89869  1.000 61.14828  ? 217 TRP A CE3 1 
ATOM   1403 C CZ2 . TRP A 1 217 ? 17.46103 53.98937 -10.72320 1.000 62.61868  ? 217 TRP A CZ2 1 
ATOM   1404 C CZ3 . TRP A 1 217 ? 18.18864 53.09308 -8.60306  1.000 60.93521  ? 217 TRP A CZ3 1 
ATOM   1405 C CH2 . TRP A 1 217 ? 18.27985 53.16802 -9.99030  1.000 63.81951  ? 217 TRP A CH2 1 
ATOM   1406 N N   . LEU A 1 218 ? 14.98557 53.42413 -4.84143  1.000 52.75422  ? 218 LEU A N   1 
ATOM   1407 C CA  . LEU A 1 218 ? 15.66922 52.18393 -4.50516  1.000 50.37769  ? 218 LEU A CA  1 
ATOM   1408 C C   . LEU A 1 218 ? 14.67446 51.06571 -4.22916  1.000 49.14177  ? 218 LEU A C   1 
ATOM   1409 O O   . LEU A 1 218 ? 14.94007 49.90492 -4.55697  1.000 56.23227  ? 218 LEU A O   1 
ATOM   1410 C CB  . LEU A 1 218 ? 16.60491 52.41625 -3.32005  1.000 54.66188  ? 218 LEU A CB  1 
ATOM   1411 C CG  . LEU A 1 218 ? 17.82981 53.22462 -3.74622  1.000 55.84922  ? 218 LEU A CG  1 
ATOM   1412 C CD1 . LEU A 1 218 ? 18.45687 53.99976 -2.56884  1.000 51.63684  ? 218 LEU A CD1 1 
ATOM   1413 C CD2 . LEU A 1 218 ? 18.85139 52.31460 -4.47720  1.000 37.03448  ? 218 LEU A CD2 1 
ATOM   1414 N N   . LYS A 1 219 ? 13.51848 51.38949 -3.64472  1.000 53.49091  ? 219 LYS A N   1 
ATOM   1415 C CA  . LYS A 1 219 ? 12.47716 50.37942 -3.47105  1.000 59.68920  ? 219 LYS A CA  1 
ATOM   1416 C C   . LYS A 1 219 ? 11.98445 49.89449 -4.82377  1.000 57.63007  ? 219 LYS A C   1 
ATOM   1417 O O   . LYS A 1 219 ? 11.81282 48.68811 -5.05391  1.000 52.93496  ? 219 LYS A O   1 
ATOM   1418 C CB  . LYS A 1 219 ? 11.30932 50.95441 -2.66315  1.000 60.94972  ? 219 LYS A CB  1 
ATOM   1419 C CG  . LYS A 1 219 ? 11.32816 50.60885 -1.19736  1.000 67.48640  ? 219 LYS A CG  1 
ATOM   1420 C CD  . LYS A 1 219 ? 10.19944 49.64880 -0.80804  1.000 73.46363  ? 219 LYS A CD  1 
ATOM   1421 C CE  . LYS A 1 219 ? 10.07811 49.55032 0.72611   1.000 76.14295  ? 219 LYS A CE  1 
ATOM   1422 N NZ  . LYS A 1 219 ? 9.11342  48.50065 1.17901   1.000 77.16349  ? 219 LYS A NZ  1 
ATOM   1423 N N   . ASP A 1 220 ? 11.73666 50.84591 -5.72436  1.000 55.26999  ? 220 ASP A N   1 
ATOM   1424 C CA  . ASP A 1 220 ? 11.23892 50.53314 -7.05010  1.000 53.43713  ? 220 ASP A CA  1 
ATOM   1425 C C   . ASP A 1 220 ? 12.19997 49.61458 -7.78486  1.000 61.05196  ? 220 ASP A C   1 
ATOM   1426 O O   . ASP A 1 220 ? 11.77595 48.72801 -8.53639  1.000 74.42685  ? 220 ASP A O   1 
ATOM   1427 C CB  . ASP A 1 220 ? 11.03667 51.82917 -7.83610  1.000 54.80702  ? 220 ASP A CB  1 
ATOM   1428 C CG  . ASP A 1 220 ? 9.85400  52.65169 -7.34148  1.000 61.95610  ? 220 ASP A CG  1 
ATOM   1429 O OD1 . ASP A 1 220 ? 8.95612  52.09016 -6.67028  1.000 63.96512  ? 220 ASP A OD1 1 
ATOM   1430 O OD2 . ASP A 1 220 ? 9.81677  53.86735 -7.65658  1.000 56.72448  ? 220 ASP A OD2 1 
ATOM   1431 N N   . ASN A 1 221 ? 13.49963 49.80121 -7.55982  1.000 55.17169  ? 221 ASN A N   1 
ATOM   1432 C CA  . ASN A 1 221 ? 14.54100 49.17092 -8.35222  1.000 51.74529  ? 221 ASN A CA  1 
ATOM   1433 C C   . ASN A 1 221 ? 15.36209 48.18076 -7.55954  1.000 59.26015  ? 221 ASN A C   1 
ATOM   1434 O O   . ASN A 1 221 ? 16.37547 47.68091 -8.06643  1.000 63.92126  ? 221 ASN A O   1 
ATOM   1435 C CB  . ASN A 1 221 ? 15.42675 50.24278 -8.95703  1.000 65.42951  ? 221 ASN A CB  1 
ATOM   1436 C CG  . ASN A 1 221 ? 14.67856 51.06519 -9.95981  1.000 84.97534  ? 221 ASN A CG  1 
ATOM   1437 O OD1 . ASN A 1 221 ? 13.53411 50.76237 -10.28601 1.000 96.60745  ? 221 ASN A OD1 1 
ATOM   1438 N ND2 . ASN A 1 221 ? 15.29226 52.11887 -10.43406 1.000 88.15526  ? 221 ASN A ND2 1 
ATOM   1439 N N   . ALA A 1 222 ? 14.93401 47.87615 -6.33385  1.000 60.19478  ? 222 ALA A N   1 
ATOM   1440 C CA  . ALA A 1 222 ? 15.62877 46.89191 -5.51458  1.000 65.88531  ? 222 ALA A CA  1 
ATOM   1441 C C   . ALA A 1 222 ? 15.81038 45.57678 -6.25826  1.000 66.33049  ? 222 ALA A C   1 
ATOM   1442 O O   . ALA A 1 222 ? 16.92144 45.03951 -6.32524  1.000 66.17423  ? 222 ALA A O   1 
ATOM   1443 C CB  . ALA A 1 222 ? 14.85967 46.66946 -4.21304  1.000 69.09614  ? 222 ALA A CB  1 
ATOM   1444 N N   . HIS A 1 223 ? 14.72146 45.04751 -6.83324  1.000 69.69569  ? 223 HIS A N   1 
ATOM   1445 C CA  . HIS A 1 223 ? 14.78808 43.74242 -7.48110  1.000 75.29520  ? 223 HIS A CA  1 
ATOM   1446 C C   . HIS A 1 223 ? 15.73717 43.75602 -8.66947  1.000 74.37937  ? 223 HIS A C   1 
ATOM   1447 O O   . HIS A 1 223 ? 16.41463 42.75717 -8.92750  1.000 78.92429  ? 223 HIS A O   1 
ATOM   1448 C CB  . HIS A 1 223 ? 13.39201 43.28867 -7.91779  1.000 90.82626  ? 223 HIS A CB  1 
ATOM   1449 C CG  . HIS A 1 223 ? 12.63083 42.55328 -6.85501  1.000 104.75144 ? 223 HIS A CG  1 
ATOM   1450 N ND1 . HIS A 1 223 ? 13.07190 41.36712 -6.30580  1.000 108.66156 ? 223 HIS A ND1 1 
ATOM   1451 C CD2 . HIS A 1 223 ? 11.45651 42.83668 -6.24068  1.000 106.75804 ? 223 HIS A CD2 1 
ATOM   1452 C CE1 . HIS A 1 223 ? 12.20416 40.95202 -5.39944  1.000 108.23765 ? 223 HIS A CE1 1 
ATOM   1453 N NE2 . HIS A 1 223 ? 11.21423 41.82505 -5.34127  1.000 108.23473 ? 223 HIS A NE2 1 
ATOM   1454 N N   . ALA A 1 224 ? 15.82319 44.87724 -9.39077  1.000 70.05810  ? 224 ALA A N   1 
ATOM   1455 C CA  . ALA A 1 224 ? 16.71477 44.93231 -10.54596 1.000 67.23194  ? 224 ALA A CA  1 
ATOM   1456 C C   . ALA A 1 224 ? 18.18258 44.83883 -10.15717 1.000 75.64220  ? 224 ALA A C   1 
ATOM   1457 O O   . ALA A 1 224 ? 19.02253 44.57514 -11.02584 1.000 76.08094  ? 224 ALA A O   1 
ATOM   1458 C CB  . ALA A 1 224 ? 16.48956 46.21449 -11.35126 1.000 59.71902  ? 224 ALA A CB  1 
ATOM   1459 N N   . PHE A 1 225 ? 18.51951 45.05758 -8.88539  1.000 71.66805  ? 225 PHE A N   1 
ATOM   1460 C CA  . PHE A 1 225 ? 19.89841 44.93086 -8.44012  1.000 62.37884  ? 225 PHE A CA  1 
ATOM   1461 C C   . PHE A 1 225 ? 20.12102 43.66258 -7.63353  1.000 61.86871  ? 225 PHE A C   1 
ATOM   1462 O O   . PHE A 1 225 ? 21.21754 43.46345 -7.09940  1.000 58.33319  ? 225 PHE A O   1 
ATOM   1463 C CB  . PHE A 1 225 ? 20.32002 46.17589 -7.65813  1.000 61.47229  ? 225 PHE A CB  1 
ATOM   1464 C CG  . PHE A 1 225 ? 20.49490 47.39002 -8.52797  1.000 59.49555  ? 225 PHE A CG  1 
ATOM   1465 C CD1 . PHE A 1 225 ? 19.46996 48.31991 -8.65662  1.000 57.23975  ? 225 PHE A CD1 1 
ATOM   1466 C CD2 . PHE A 1 225 ? 21.66877 47.57861 -9.25956  1.000 57.64861  ? 225 PHE A CD2 1 
ATOM   1467 C CE1 . PHE A 1 225 ? 19.60921 49.43728 -9.49040  1.000 59.14385  ? 225 PHE A CE1 1 
ATOM   1468 C CE2 . PHE A 1 225 ? 21.82208 48.69875 -10.09450 1.000 58.97781  ? 225 PHE A CE2 1 
ATOM   1469 C CZ  . PHE A 1 225 ? 20.78433 49.63237 -10.20838 1.000 55.65135  ? 225 PHE A CZ  1 
ATOM   1470 N N   . GLY A 1 226 ? 19.13042 42.76956 -7.59806  1.000 64.00117  ? 226 GLY A N   1 
ATOM   1471 C CA  . GLY A 1 226 ? 19.17180 41.60451 -6.74137  1.000 67.61017  ? 226 GLY A CA  1 
ATOM   1472 C C   . GLY A 1 226 ? 18.75528 41.87050 -5.31177  1.000 73.32231  ? 226 GLY A C   1 
ATOM   1473 O O   . GLY A 1 226 ? 19.00723 41.02922 -4.44489  1.000 80.59179  ? 226 GLY A O   1 
ATOM   1474 N N   . GLY A 1 227 ? 18.12909 43.01095 -5.03839  1.000 67.76662  ? 227 GLY A N   1 
ATOM   1475 C CA  . GLY A 1 227 ? 17.75183 43.39049 -3.68757  1.000 65.25411  ? 227 GLY A CA  1 
ATOM   1476 C C   . GLY A 1 227 ? 16.28516 43.12116 -3.41115  1.000 67.92517  ? 227 GLY A C   1 
ATOM   1477 O O   . GLY A 1 227 ? 15.43665 43.25983 -4.28995  1.000 72.44953  ? 227 GLY A O   1 
ATOM   1478 N N   . ASN A 1 228 ? 16.00359 42.70715 -2.17675  1.000 69.01746  ? 228 ASN A N   1 
ATOM   1479 C CA  . ASN A 1 228 ? 14.64146 42.52303 -1.69591  1.000 64.75078  ? 228 ASN A CA  1 
ATOM   1480 C C   . ASN A 1 228 ? 14.12459 43.87124 -1.21215  1.000 65.06613  ? 228 ASN A C   1 
ATOM   1481 O O   . ASN A 1 228 ? 14.58633 44.35891 -0.17197  1.000 67.17492  ? 228 ASN A O   1 
ATOM   1482 C CB  . ASN A 1 228 ? 14.61960 41.50165 -0.56483  1.000 62.34674  ? 228 ASN A CB  1 
ATOM   1483 C CG  . ASN A 1 228 ? 13.22574 41.18359 -0.07389  1.000 60.06372  ? 228 ASN A CG  1 
ATOM   1484 O OD1 . ASN A 1 228 ? 12.33199 42.01454 -0.11805  1.000 68.36512  ? 228 ASN A OD1 1 
ATOM   1485 N ND2 . ASN A 1 228 ? 13.03783 39.96210 0.40442   1.000 57.38875  ? 228 ASN A ND2 1 
ATOM   1486 N N   . PRO A 1 229 ? 13.15899 44.48486 -1.89369  1.000 65.12383  ? 229 PRO A N   1 
ATOM   1487 C CA  . PRO A 1 229 ? 12.70427 45.82544 -1.48778  1.000 61.52550  ? 229 PRO A CA  1 
ATOM   1488 C C   . PRO A 1 229 ? 12.04336 45.87854 -0.11562  1.000 62.13957  ? 229 PRO A C   1 
ATOM   1489 O O   . PRO A 1 229 ? 12.01893 46.94515 0.51159   1.000 62.68919  ? 229 PRO A O   1 
ATOM   1490 C CB  . PRO A 1 229 ? 11.70166 46.20159 -2.58737  1.000 59.04743  ? 229 PRO A CB  1 
ATOM   1491 C CG  . PRO A 1 229 ? 11.70491 45.08442 -3.55693  1.000 60.26582  ? 229 PRO A CG  1 
ATOM   1492 C CD  . PRO A 1 229 ? 12.29190 43.89437 -2.91689  1.000 60.13831  ? 229 PRO A CD  1 
ATOM   1493 N N   . GLU A 1 230 ? 11.46342 44.78429 0.35896   1.000 58.75461  ? 230 GLU A N   1 
ATOM   1494 C CA  . GLU A 1 230 ? 10.90185 44.80439 1.69972   1.000 72.54544  ? 230 GLU A CA  1 
ATOM   1495 C C   . GLU A 1 230 ? 11.97068 44.61601 2.77505   1.000 68.90068  ? 230 GLU A C   1 
ATOM   1496 O O   . GLU A 1 230 ? 11.65265 44.63083 3.96682   1.000 64.28659  ? 230 GLU A O   1 
ATOM   1497 C CB  . GLU A 1 230 ? 9.80243  43.74089 1.81448   1.000 87.34155  ? 230 GLU A CB  1 
ATOM   1498 C CG  . GLU A 1 230 ? 8.49401  44.13798 1.11334   1.000 98.40677  ? 230 GLU A CG  1 
ATOM   1499 C CD  . GLU A 1 230 ? 7.48595  44.78819 2.06010   1.000 108.53435 ? 230 GLU A CD  1 
ATOM   1500 O OE1 . GLU A 1 230 ? 7.13091  44.15119 3.07726   1.000 112.55464 ? 230 GLU A OE1 1 
ATOM   1501 O OE2 . GLU A 1 230 ? 7.05913  45.93914 1.79376   1.000 109.93909 ? 230 GLU A OE2 1 
ATOM   1502 N N   . TRP A 1 231 ? 13.23157 44.49971 2.37629   1.000 64.38834  ? 231 TRP A N   1 
ATOM   1503 C CA  . TRP A 1 231 ? 14.33512 44.24685 3.28200   1.000 55.75015  ? 231 TRP A CA  1 
ATOM   1504 C C   . TRP A 1 231 ? 15.31864 45.41506 3.28329   1.000 56.48189  ? 231 TRP A C   1 
ATOM   1505 O O   . TRP A 1 231 ? 16.50657 45.23732 2.98989   1.000 61.40387  ? 231 TRP A O   1 
ATOM   1506 C CB  . TRP A 1 231 ? 15.03014 42.95356 2.86675   1.000 62.81953  ? 231 TRP A CB  1 
ATOM   1507 C CG  . TRP A 1 231 ? 15.67201 42.23140 3.98561   1.000 71.84322  ? 231 TRP A CG  1 
ATOM   1508 C CD1 . TRP A 1 231 ? 15.74950 42.62916 5.29742   1.000 71.86043  ? 231 TRP A CD1 1 
ATOM   1509 C CD2 . TRP A 1 231 ? 16.34296 40.97613 3.90642   1.000 70.24873  ? 231 TRP A CD2 1 
ATOM   1510 N NE1 . TRP A 1 231 ? 16.43445 41.68699 6.03565   1.000 67.51323  ? 231 TRP A NE1 1 
ATOM   1511 C CE2 . TRP A 1 231 ? 16.80340 40.66126 5.20483   1.000 72.27068  ? 231 TRP A CE2 1 
ATOM   1512 C CE3 . TRP A 1 231 ? 16.60498 40.08745 2.86572   1.000 72.25030  ? 231 TRP A CE3 1 
ATOM   1513 C CZ2 . TRP A 1 231 ? 17.50784 39.49296 5.48154   1.000 74.03624  ? 231 TRP A CZ2 1 
ATOM   1514 C CZ3 . TRP A 1 231 ? 17.30482 38.92737 3.14280   1.000 78.41710  ? 231 TRP A CZ3 1 
ATOM   1515 C CH2 . TRP A 1 231 ? 17.74821 38.63990 4.43945   1.000 76.20413  ? 231 TRP A CH2 1 
ATOM   1516 N N   . MET A 1 232 ? 14.84754 46.61222 3.61661   1.000 53.16555  ? 232 MET A N   1 
ATOM   1517 C CA  . MET A 1 232 ? 15.66832 47.81179 3.54792   1.000 52.42521  ? 232 MET A CA  1 
ATOM   1518 C C   . MET A 1 232 ? 16.03040 48.33557 4.93316   1.000 53.47681  ? 232 MET A C   1 
ATOM   1519 O O   . MET A 1 232 ? 15.22530 48.28910 5.86857   1.000 62.15789  ? 232 MET A O   1 
ATOM   1520 C CB  . MET A 1 232 ? 14.94860 48.89565 2.75508   1.000 55.71425  ? 232 MET A CB  1 
ATOM   1521 C CG  . MET A 1 232 ? 14.51847 48.41363 1.38498   1.000 64.62745  ? 232 MET A CG  1 
ATOM   1522 S SD  . MET A 1 232 ? 14.45705 49.73235 0.17160   1.000 65.44031  ? 232 MET A SD  1 
ATOM   1523 C CE  . MET A 1 232 ? 14.15072 51.10412 1.28068   1.000 46.48671  ? 232 MET A CE  1 
ATOM   1524 N N   . THR A 1 233 ? 17.24266 48.85374 5.05094   1.000 47.42571  ? 233 THR A N   1 
ATOM   1525 C CA  . THR A 1 233 ? 17.73467 49.42033 6.29674   1.000 54.44218  ? 233 THR A CA  1 
ATOM   1526 C C   . THR A 1 233 ? 18.36423 50.76014 5.96934   1.000 49.70570  ? 233 THR A C   1 
ATOM   1527 O O   . THR A 1 233 ? 19.30240 50.81607 5.17104   1.000 61.24740  ? 233 THR A O   1 
ATOM   1528 C CB  . THR A 1 233 ? 18.76453 48.49762 6.97428   1.000 48.76499  ? 233 THR A CB  1 
ATOM   1529 O OG1 . THR A 1 233 ? 18.18603 47.21372 7.23393   1.000 45.93491  ? 233 THR A OG1 1 
ATOM   1530 C CG2 . THR A 1 233 ? 19.23582 49.09957 8.28246   1.000 37.98105  ? 233 THR A CG2 1 
ATOM   1531 N N   . LEU A 1 234 ? 17.85319 51.83069 6.57150   1.000 42.24514  ? 234 LEU A N   1 
ATOM   1532 C CA  . LEU A 1 234 ? 18.53011 53.12264 6.49662   1.000 46.09681  ? 234 LEU A CA  1 
ATOM   1533 C C   . LEU A 1 234 ? 19.61766 53.22351 7.55857   1.000 47.36943  ? 234 LEU A C   1 
ATOM   1534 O O   . LEU A 1 234 ? 19.47912 52.69693 8.66518   1.000 47.90436  ? 234 LEU A O   1 
ATOM   1535 C CB  . LEU A 1 234 ? 17.54338 54.27015 6.68987   1.000 53.11656  ? 234 LEU A CB  1 
ATOM   1536 C CG  . LEU A 1 234 ? 16.35091 54.35029 5.74157   1.000 53.85929  ? 234 LEU A CG  1 
ATOM   1537 C CD1 . LEU A 1 234 ? 15.56319 55.61803 5.99278   1.000 50.96194  ? 234 LEU A CD1 1 
ATOM   1538 C CD2 . LEU A 1 234 ? 16.85657 54.31625 4.33868   1.000 54.20964  ? 234 LEU A CD2 1 
ATOM   1539 N N   . PHE A 1 235 ? 20.71161 53.89446 7.21431   1.000 49.70148  ? 235 PHE A N   1 
ATOM   1540 C CA  . PHE A 1 235 ? 21.73479 54.20587 8.19671   1.000 45.36327  ? 235 PHE A CA  1 
ATOM   1541 C C   . PHE A 1 235 ? 22.47459 55.46204 7.76742   1.000 47.55048  ? 235 PHE A C   1 
ATOM   1542 O O   . PHE A 1 235 ? 22.60555 55.74638 6.57456   1.000 48.74266  ? 235 PHE A O   1 
ATOM   1543 C CB  . PHE A 1 235 ? 22.69030 53.02633 8.44996   1.000 35.77959  ? 235 PHE A CB  1 
ATOM   1544 C CG  . PHE A 1 235 ? 23.59765 52.68194 7.31868   1.000 39.72742  ? 235 PHE A CG  1 
ATOM   1545 C CD1 . PHE A 1 235 ? 23.08682 52.37565 6.05443   1.000 47.25067  ? 235 PHE A CD1 1 
ATOM   1546 C CD2 . PHE A 1 235 ? 24.97342 52.56392 7.53684   1.000 37.91965  ? 235 PHE A CD2 1 
ATOM   1547 C CE1 . PHE A 1 235 ? 23.93222 52.01935 5.00662   1.000 46.78335  ? 235 PHE A CE1 1 
ATOM   1548 C CE2 . PHE A 1 235 ? 25.83510 52.21158 6.48558   1.000 48.53054  ? 235 PHE A CE2 1 
ATOM   1549 C CZ  . PHE A 1 235 ? 25.30726 51.94071 5.21127   1.000 47.43598  ? 235 PHE A CZ  1 
ATOM   1550 N N   . GLY A 1 236 ? 22.91417 56.22762 8.76511   1.000 44.55570  ? 236 GLY A N   1 
ATOM   1551 C CA  . GLY A 1 236 ? 23.60305 57.48794 8.55870   1.000 40.95890  ? 236 GLY A CA  1 
ATOM   1552 C C   . GLY A 1 236 ? 24.21846 57.99828 9.85093   1.000 52.90828  ? 236 GLY A C   1 
ATOM   1553 O O   . GLY A 1 236 ? 24.07789 57.39792 10.92232  1.000 48.40646  ? 236 GLY A O   1 
ATOM   1554 N N   . GLU A 1 237 ? 24.86959 59.15895 9.73635   1.000 53.86414  ? 237 GLU A N   1 
ATOM   1555 C CA  . GLU A 1 237 ? 25.67984 59.74803 10.79094  1.000 47.53411  ? 237 GLU A CA  1 
ATOM   1556 C C   . GLU A 1 237 ? 25.42279 61.25420 10.84287  1.000 56.99786  ? 237 GLU A C   1 
ATOM   1557 O O   . GLU A 1 237 ? 25.16299 61.86686 9.79977   1.000 50.73387  ? 237 GLU A O   1 
ATOM   1558 C CB  . GLU A 1 237 ? 27.14848 59.42582 10.52554  1.000 32.64665  ? 237 GLU A CB  1 
ATOM   1559 C CG  . GLU A 1 237 ? 28.03345 59.60102 11.70020  1.000 48.60112  ? 237 GLU A CG  1 
ATOM   1560 C CD  . GLU A 1 237 ? 28.55699 61.00585 11.78958  1.000 54.38424  ? 237 GLU A CD  1 
ATOM   1561 O OE1 . GLU A 1 237 ? 28.54493 61.71423 10.76090  1.000 57.17166  ? 237 GLU A OE1 1 
ATOM   1562 O OE2 . GLU A 1 237 ? 28.96370 61.40668 12.88980  1.000 57.40395  ? 237 GLU A OE2 1 
ATOM   1563 N N   . SER A 1 238 ? 25.49222 61.85038 12.06518  1.000 56.66033  ? 238 SER A N   1 
ATOM   1564 C CA  . SER A 1 238 ? 25.21969 63.28056 12.28844  1.000 57.93114  ? 238 SER A CA  1 
ATOM   1565 C C   . SER A 1 238 ? 23.87660 63.61975 11.63453  1.000 50.33358  ? 238 SER A C   1 
ATOM   1566 O O   . SER A 1 238 ? 22.84656 62.99606 11.93470  1.000 41.33821  ? 238 SER A O   1 
ATOM   1567 C CB  . SER A 1 238 ? 26.37756 64.15657 11.73113  1.000 92.87634  ? 238 SER A CB  1 
ATOM   1568 N N   . ALA A 1 239 ? 23.88360 64.57023 10.69664  1.000 45.47650  ? 239 ALA A N   1 
ATOM   1569 C CA  . ALA A 1 239 ? 22.64856 64.94433 10.01859  1.000 46.91690  ? 239 ALA A CA  1 
ATOM   1570 C C   . ALA A 1 239 ? 22.06623 63.78094 9.20861   1.000 45.23543  ? 239 ALA A C   1 
ATOM   1571 O O   . ALA A 1 239 ? 20.84047 63.63354 9.12347   1.000 45.06712  ? 239 ALA A O   1 
ATOM   1572 C CB  . ALA A 1 239 ? 22.90335 66.17254 9.14905   1.000 44.20291  ? 239 ALA A CB  1 
ATOM   1573 N N   . GLY A 1 240 ? 22.90993 62.91090 8.65882   1.000 46.50444  ? 240 GLY A N   1 
ATOM   1574 C CA  . GLY A 1 240 ? 22.38005 61.72596 7.99523   1.000 54.53607  ? 240 GLY A CA  1 
ATOM   1575 C C   . GLY A 1 240 ? 21.59519 60.83215 8.93808   1.000 57.58960  ? 240 GLY A C   1 
ATOM   1576 O O   . GLY A 1 240 ? 20.50299 60.35314 8.60555   1.000 52.91529  ? 240 GLY A O   1 
ATOM   1577 N N   . SER A 1 241 ? 22.14993 60.59471 10.12611  1.000 55.49363  ? 241 SER A N   1 
ATOM   1578 C CA  . SER A 1 241 ? 21.42635 59.89620 11.17793  1.000 49.14069  ? 241 SER A CA  1 
ATOM   1579 C C   . SER A 1 241 ? 20.09209 60.56632 11.47122  1.000 44.37036  ? 241 SER A C   1 
ATOM   1580 O O   . SER A 1 241 ? 19.03899 59.91297 11.45937  1.000 39.03332  ? 241 SER A O   1 
ATOM   1581 C CB  . SER A 1 241 ? 22.29821 59.83397 12.42867  1.000 53.24128  ? 241 SER A CB  1 
ATOM   1582 O OG  . SER A 1 241 ? 21.57757 59.30248 13.51195  1.000 45.73954  ? 241 SER A OG  1 
ATOM   1583 N N   . SER A 1 242 ? 20.09900 61.87253 11.72980  1.000 43.53117  ? 242 SER A N   1 
ATOM   1584 C CA  . SER A 1 242 ? 18.80437 62.52371 11.90190  1.000 47.10287  ? 242 SER A CA  1 
ATOM   1585 C C   . SER A 1 242 ? 17.93009 62.36391 10.66872  1.000 50.61899  ? 242 SER A C   1 
ATOM   1586 O O   . SER A 1 242 ? 16.69911 62.33472 10.78645  1.000 54.84754  ? 242 SER A O   1 
ATOM   1587 C CB  . SER A 1 242 ? 18.94613 64.00955 12.22192  1.000 52.35153  ? 242 SER A CB  1 
ATOM   1588 O OG  . SER A 1 242 ? 19.87602 64.25762 13.24637  1.000 60.11198  ? 242 SER A OG  1 
ATOM   1589 N N   . SER A 1 243 ? 18.52505 62.27814 9.47338   1.000 44.05003  ? 243 SER A N   1 
ATOM   1590 C CA  . SER A 1 243 ? 17.67518 62.09739 8.29756   1.000 47.11177  ? 243 SER A CA  1 
ATOM   1591 C C   . SER A 1 243 ? 17.09050 60.68764 8.25000   1.000 51.02382  ? 243 SER A C   1 
ATOM   1592 O O   . SER A 1 243 ? 15.91173 60.50909 7.90686   1.000 51.76040  ? 243 SER A O   1 
ATOM   1593 C CB  . SER A 1 243 ? 18.43302 62.43443 7.01957   1.000 41.75246  ? 243 SER A CB  1 
ATOM   1594 O OG  . SER A 1 243 ? 19.06041 63.70789 7.13358   1.000 47.47375  ? 243 SER A OG  1 
ATOM   1595 N N   . VAL A 1 244 ? 17.88924 59.67722 8.60728   1.000 37.41636  ? 244 VAL A N   1 
ATOM   1596 C CA  . VAL A 1 244 ? 17.32785 58.34597 8.81976   1.000 39.25156  ? 244 VAL A CA  1 
ATOM   1597 C C   . VAL A 1 244 ? 16.11116 58.44838 9.72959   1.000 41.00994  ? 244 VAL A C   1 
ATOM   1598 O O   . VAL A 1 244 ? 15.02987 57.93519 9.42355   1.000 47.82968  ? 244 VAL A O   1 
ATOM   1599 C CB  . VAL A 1 244 ? 18.38982 57.39176 9.40385   1.000 37.89459  ? 244 VAL A CB  1 
ATOM   1600 C CG1 . VAL A 1 244 ? 17.71255 56.15796 9.97451   1.000 36.63633  ? 244 VAL A CG1 1 
ATOM   1601 C CG2 . VAL A 1 244 ? 19.40796 56.98207 8.35126   1.000 35.43166  ? 244 VAL A CG2 1 
ATOM   1602 N N   . ASN A 1 245 ? 16.27886 59.13159 10.85782  1.000 51.47174  ? 245 ASN A N   1 
ATOM   1603 C CA  . ASN A 1 245 ? 15.18014 59.42941 11.77195  1.000 48.44305  ? 245 ASN A CA  1 
ATOM   1604 C C   . ASN A 1 245 ? 13.97772 60.03955 11.05420  1.000 43.02919  ? 245 ASN A C   1 
ATOM   1605 O O   . ASN A 1 245 ? 12.84209 59.58167 11.21088  1.000 45.04109  ? 245 ASN A O   1 
ATOM   1606 C CB  . ASN A 1 245 ? 15.71306 60.38684 12.82958  1.000 51.54133  ? 245 ASN A CB  1 
ATOM   1607 C CG  . ASN A 1 245 ? 14.83318 60.51240 14.02593  1.000 51.60151  ? 245 ASN A CG  1 
ATOM   1608 O OD1 . ASN A 1 245 ? 15.24890 61.11333 15.00252  1.000 58.61745  ? 245 ASN A OD1 1 
ATOM   1609 N ND2 . ASN A 1 245 ? 13.61935 59.97550 13.97138  1.000 30.15163  ? 245 ASN A ND2 1 
ATOM   1610 N N   . ALA A 1 246 ? 14.19858 61.10655 10.29395  1.000 50.53214  ? 246 ALA A N   1 
ATOM   1611 C CA  . ALA A 1 246 ? 13.07581 61.77305 9.64171   1.000 44.84077  ? 246 ALA A CA  1 
ATOM   1612 C C   . ALA A 1 246 ? 12.37641 60.84701 8.65612   1.000 50.68093  ? 246 ALA A C   1 
ATOM   1613 O O   . ALA A 1 246 ? 11.14040 60.80418 8.60863   1.000 54.87345  ? 246 ALA A O   1 
ATOM   1614 C CB  . ALA A 1 246 ? 13.55805 63.03335 8.93488   1.000 47.20270  ? 246 ALA A CB  1 
ATOM   1615 N N   . GLN A 1 247 ? 13.15158 60.08479 7.87042   1.000 46.51000  ? 247 GLN A N   1 
ATOM   1616 C CA  . GLN A 1 247 ? 12.55361 59.18963 6.88466   1.000 35.93908  ? 247 GLN A CA  1 
ATOM   1617 C C   . GLN A 1 247 ? 11.77163 58.06881 7.54218   1.000 45.97969  ? 247 GLN A C   1 
ATOM   1618 O O   . GLN A 1 247 ? 10.77718 57.61733 6.97161   1.000 55.48791  ? 247 GLN A O   1 
ATOM   1619 C CB  . GLN A 1 247 ? 13.62302 58.59479 5.96519   1.000 34.88346  ? 247 GLN A CB  1 
ATOM   1620 C CG  . GLN A 1 247 ? 14.42798 59.61932 5.17840   1.000 36.51831  ? 247 GLN A CG  1 
ATOM   1621 C CD  . GLN A 1 247 ? 13.57770 60.44321 4.24876   1.000 44.65737  ? 247 GLN A CD  1 
ATOM   1622 O OE1 . GLN A 1 247 ? 12.61965 59.94690 3.64599   1.000 49.52642  ? 247 GLN A OE1 1 
ATOM   1623 N NE2 . GLN A 1 247 ? 13.91630 61.71551 4.12808   1.000 49.29745  ? 247 GLN A NE2 1 
ATOM   1624 N N   . LEU A 1 248 ? 12.19143 57.60255 8.73162   1.000 46.94788  ? 248 LEU A N   1 
ATOM   1625 C CA  . LEU A 1 248 ? 11.42937 56.55285 9.41053   1.000 44.51601  ? 248 LEU A CA  1 
ATOM   1626 C C   . LEU A 1 248 ? 10.12369 57.08582 9.98319   1.000 47.79319  ? 248 LEU A C   1 
ATOM   1627 O O   . LEU A 1 248 ? 9.12802  56.35639 10.02449  1.000 53.34838  ? 248 LEU A O   1 
ATOM   1628 C CB  . LEU A 1 248 ? 12.23416 55.90771 10.54767  1.000 40.97022  ? 248 LEU A CB  1 
ATOM   1629 C CG  . LEU A 1 248 ? 13.55882 55.17397 10.33587  1.000 52.91216  ? 248 LEU A CG  1 
ATOM   1630 C CD1 . LEU A 1 248 ? 14.24735 55.03359 11.66925  1.000 54.23122  ? 248 LEU A CD1 1 
ATOM   1631 C CD2 . LEU A 1 248 ? 13.40171 53.80464 9.68744   1.000 56.29280  ? 248 LEU A CD2 1 
ATOM   1632 N N   . MET A 1 249 ? 10.10540 58.34012 10.43862  1.000 51.00229  ? 249 MET A N   1 
ATOM   1633 C CA  . MET A 1 249 ? 8.99973  58.84621 11.24726  1.000 52.45002  ? 249 MET A CA  1 
ATOM   1634 C C   . MET A 1 249 ? 8.07018  59.79290 10.49972  1.000 62.93981  ? 249 MET A C   1 
ATOM   1635 O O   . MET A 1 249 ? 6.95558  60.04680 10.98148  1.000 68.90099  ? 249 MET A O   1 
ATOM   1636 C CB  . MET A 1 249 ? 9.53243  59.57836 12.48877  1.000 53.15372  ? 249 MET A CB  1 
ATOM   1637 C CG  . MET A 1 249 ? 10.40165 58.73107 13.40559  1.000 51.13445  ? 249 MET A CG  1 
ATOM   1638 S SD  . MET A 1 249 ? 9.45198  57.31941 13.94349  1.000 60.11672  ? 249 MET A SD  1 
ATOM   1639 C CE  . MET A 1 249 ? 10.74787 56.17461 14.36413  1.000 59.43200  ? 249 MET A CE  1 
ATOM   1640 N N   . SER A 1 250 ? 8.50312  60.32885 9.35941   1.000 56.10939  ? 250 SER A N   1 
ATOM   1641 C CA  . SER A 1 250 ? 7.67819  61.26222 8.60530   1.000 57.60054  ? 250 SER A CA  1 
ATOM   1642 C C   . SER A 1 250 ? 6.41355  60.58103 8.11762   1.000 55.53155  ? 250 SER A C   1 
ATOM   1643 O O   . SER A 1 250 ? 6.48400  59.47573 7.55823   1.000 58.41234  ? 250 SER A O   1 
ATOM   1644 C CB  . SER A 1 250 ? 8.46119  61.81483 7.41272   1.000 58.80806  ? 250 SER A CB  1 
ATOM   1645 O OG  . SER A 1 250 ? 7.73225  62.80271 6.71311   1.000 63.13106  ? 250 SER A OG  1 
ATOM   1646 N N   . PRO A 1 251 ? 5.24303  61.18830 8.27864   1.000 50.56772  ? 251 PRO A N   1 
ATOM   1647 C CA  . PRO A 1 251 ? 4.05395  60.63506 7.62952   1.000 46.35163  ? 251 PRO A CA  1 
ATOM   1648 C C   . PRO A 1 251 ? 4.20589  60.52233 6.12015   1.000 59.54642  ? 251 PRO A C   1 
ATOM   1649 O O   . PRO A 1 251 ? 3.65260  59.59125 5.51725   1.000 70.28316  ? 251 PRO A O   1 
ATOM   1650 C CB  . PRO A 1 251 ? 2.94606  61.61948 8.01662   1.000 44.26210  ? 251 PRO A CB  1 
ATOM   1651 C CG  . PRO A 1 251 ? 3.64813  62.85918 8.40883   1.000 45.45175  ? 251 PRO A CG  1 
ATOM   1652 C CD  . PRO A 1 251 ? 4.95034  62.43424 9.01295   1.000 45.76660  ? 251 PRO A CD  1 
ATOM   1653 N N   . VAL A 1 252 ? 4.96001  61.43309 5.49378   1.000 52.22677  ? 252 VAL A N   1 
ATOM   1654 C CA  . VAL A 1 252 ? 5.14752  61.39505 4.04687   1.000 49.48631  ? 252 VAL A CA  1 
ATOM   1655 C C   . VAL A 1 252 ? 5.72069  60.05551 3.59227   1.000 55.72727  ? 252 VAL A C   1 
ATOM   1656 O O   . VAL A 1 252 ? 5.42602  59.58315 2.48643   1.000 54.25036  ? 252 VAL A O   1 
ATOM   1657 C CB  . VAL A 1 252 ? 6.04783  62.56972 3.62110   1.000 51.13017  ? 252 VAL A CB  1 
ATOM   1658 C CG1 . VAL A 1 252 ? 6.55841  62.37805 2.18315   1.000 51.61049  ? 252 VAL A CG1 1 
ATOM   1659 C CG2 . VAL A 1 252 ? 5.30296  63.88976 3.76633   1.000 45.04509  ? 252 VAL A CG2 1 
ATOM   1660 N N   . THR A 1 253 ? 6.51649  59.41124 4.44084   1.000 58.50265  ? 253 THR A N   1 
ATOM   1661 C CA  . THR A 1 253 ? 7.28712  58.23591 4.06068   1.000 61.43782  ? 253 THR A CA  1 
ATOM   1662 C C   . THR A 1 253 ? 7.08518  57.03849 4.96703   1.000 74.32846  ? 253 THR A C   1 
ATOM   1663 O O   . THR A 1 253 ? 7.48134  55.93498 4.57629   1.000 80.64466  ? 253 THR A O   1 
ATOM   1664 C CB  . THR A 1 253 ? 8.78673  58.56283 4.06689   1.000 57.32290  ? 253 THR A CB  1 
ATOM   1665 O OG1 . THR A 1 253 ? 9.16535  58.92483 5.41052   1.000 61.06985  ? 253 THR A OG1 1 
ATOM   1666 C CG2 . THR A 1 253 ? 9.10202  59.73268 3.10758   1.000 41.23675  ? 253 THR A CG2 1 
ATOM   1667 N N   . ARG A 1 254 ? 6.52160  57.21183 6.16346   1.000 80.39759  ? 254 ARG A N   1 
ATOM   1668 C CA  . ARG A 1 254 ? 6.59041  56.16678 7.17763   1.000 84.19326  ? 254 ARG A CA  1 
ATOM   1669 C C   . ARG A 1 254 ? 5.91413  54.89463 6.68400   1.000 78.90801  ? 254 ARG A C   1 
ATOM   1670 O O   . ARG A 1 254 ? 4.98565  54.93038 5.86968   1.000 65.98443  ? 254 ARG A O   1 
ATOM   1671 C CB  . ARG A 1 254 ? 5.95086  56.62979 8.49342   1.000 90.38927  ? 254 ARG A CB  1 
ATOM   1672 C CG  . ARG A 1 254 ? 4.45897  56.91653 8.39713   1.000 98.75034  ? 254 ARG A CG  1 
ATOM   1673 C CD  . ARG A 1 254 ? 3.72108  56.56682 9.67779   1.000 101.41345 ? 254 ARG A CD  1 
ATOM   1674 N NE  . ARG A 1 254 ? 4.40812  57.04684 10.87612  1.000 111.27293 ? 254 ARG A NE  1 
ATOM   1675 C CZ  . ARG A 1 254 ? 4.83481  56.25882 11.86547  1.000 120.77511 ? 254 ARG A CZ  1 
ATOM   1676 N NH1 . ARG A 1 254 ? 4.65295  54.94258 11.80841  1.000 123.24800 ? 254 ARG A NH1 1 
ATOM   1677 N NH2 . ARG A 1 254 ? 5.44530  56.78475 12.91955  1.000 119.54514 ? 254 ARG A NH2 1 
ATOM   1678 N N   . GLY A 1 255 ? 6.40594  53.76185 7.18966   1.000 81.86257  ? 255 GLY A N   1 
ATOM   1679 C CA  . GLY A 1 255 ? 6.00678  52.44904 6.75111   1.000 89.18181  ? 255 GLY A CA  1 
ATOM   1680 C C   . GLY A 1 255 ? 6.91109  51.85814 5.69147   1.000 91.30473  ? 255 GLY A C   1 
ATOM   1681 O O   . GLY A 1 255 ? 7.10650  50.63924 5.65902   1.000 104.27692 ? 255 GLY A O   1 
ATOM   1682 N N   . LEU A 1 256 ? 7.47173  52.69973 4.82681   1.000 82.87626  ? 256 LEU A N   1 
ATOM   1683 C CA  . LEU A 1 256 ? 8.35089  52.21201 3.77238   1.000 75.21628  ? 256 LEU A CA  1 
ATOM   1684 C C   . LEU A 1 256 ? 9.55733  51.49691 4.36257   1.000 79.53741  ? 256 LEU A C   1 
ATOM   1685 O O   . LEU A 1 256 ? 9.83420  50.33676 4.03944   1.000 82.66363  ? 256 LEU A O   1 
ATOM   1686 C CB  . LEU A 1 256 ? 8.78554  53.38279 2.88968   1.000 70.80023  ? 256 LEU A CB  1 
ATOM   1687 C CG  . LEU A 1 256 ? 7.83769  53.88529 1.78507   1.000 75.88509  ? 256 LEU A CG  1 
ATOM   1688 C CD1 . LEU A 1 256 ? 6.36136  53.97798 2.21941   1.000 79.57422  ? 256 LEU A CD1 1 
ATOM   1689 C CD2 . LEU A 1 256 ? 8.32000  55.22773 1.24166   1.000 69.19601  ? 256 LEU A CD2 1 
ATOM   1690 N N   . VAL A 1 257 ? 10.27005 52.17523 5.25017   1.000 75.24666  ? 257 VAL A N   1 
ATOM   1691 C CA  . VAL A 1 257 ? 11.42975 51.63095 5.94250   1.000 63.92753  ? 257 VAL A CA  1 
ATOM   1692 C C   . VAL A 1 257 ? 11.14083 51.66870 7.43719   1.000 57.54097  ? 257 VAL A C   1 
ATOM   1693 O O   . VAL A 1 257 ? 10.70003 52.69122 7.96500   1.000 66.77229  ? 257 VAL A O   1 
ATOM   1694 C CB  . VAL A 1 257 ? 12.70008 52.42939 5.61361   1.000 59.26200  ? 257 VAL A CB  1 
ATOM   1695 C CG1 . VAL A 1 257 ? 13.92267 51.59955 5.88956   1.000 58.88346  ? 257 VAL A CG1 1 
ATOM   1696 C CG2 . VAL A 1 257 ? 12.64208 52.88818 4.17371   1.000 56.77487  ? 257 VAL A CG2 1 
ATOM   1697 N N   . LYS A 1 258 ? 11.35918 50.54824 8.10193   1.000 52.02378  ? 258 LYS A N   1 
ATOM   1698 C CA  . LYS A 1 258 ? 11.08469 50.42752 9.52830   1.000 51.43235  ? 258 LYS A CA  1 
ATOM   1699 C C   . LYS A 1 258 ? 12.28726 49.84249 10.25773  1.000 53.74339  ? 258 LYS A C   1 
ATOM   1700 O O   . LYS A 1 258 ? 12.13204 49.22348 11.31151  1.000 64.20703  ? 258 LYS A O   1 
ATOM   1701 C CB  . LYS A 1 258 ? 9.83622  49.57188 9.77548   1.000 58.11510  ? 258 LYS A CB  1 
ATOM   1702 C CG  . LYS A 1 258 ? 8.59086  50.06790 9.03680   1.000 71.23938  ? 258 LYS A CG  1 
ATOM   1703 C CD  . LYS A 1 258 ? 7.37194  49.20385 9.32154   1.000 78.45680  ? 258 LYS A CD  1 
ATOM   1704 C CE  . LYS A 1 258 ? 7.00424  48.37779 8.09523   1.000 86.93434  ? 258 LYS A CE  1 
ATOM   1705 N NZ  . LYS A 1 258 ? 6.39468  47.04499 8.43713   1.000 86.40907  ? 258 LYS A NZ  1 
ATOM   1706 N N   . ARG A 1 259 ? 13.47840 49.99038 9.69067   1.000 48.22532  ? 259 ARG A N   1 
ATOM   1707 C CA  . ARG A 1 259 ? 14.68887 49.46344 10.30061  1.000 48.93555  ? 259 ARG A CA  1 
ATOM   1708 C C   . ARG A 1 259 ? 15.80996 50.42795 9.96040   1.000 56.72538  ? 259 ARG A C   1 
ATOM   1709 O O   . ARG A 1 259 ? 16.12824 50.60892 8.78082   1.000 65.67954  ? 259 ARG A O   1 
ATOM   1710 C CB  . ARG A 1 259 ? 14.99654 48.05129 9.81073   1.000 38.87425  ? 259 ARG A CB  1 
ATOM   1711 C CG  . ARG A 1 259 ? 16.29133 47.51432 10.34522  1.000 41.72930  ? 259 ARG A CG  1 
ATOM   1712 C CD  . ARG A 1 259 ? 16.52462 46.08800 9.91388   1.000 43.02272  ? 259 ARG A CD  1 
ATOM   1713 N NE  . ARG A 1 259 ? 15.50006 45.17561 10.39975  1.000 43.10808  ? 259 ARG A NE  1 
ATOM   1714 C CZ  . ARG A 1 259 ? 15.41606 43.90412 10.02360  1.000 49.23383  ? 259 ARG A CZ  1 
ATOM   1715 N NH1 . ARG A 1 259 ? 16.30805 43.40370 9.17801   1.000 52.20899  ? 259 ARG A NH1 1 
ATOM   1716 N NH2 . ARG A 1 259 ? 14.45715 43.12508 10.49651  1.000 52.07365  ? 259 ARG A NH2 1 
ATOM   1717 N N   . GLY A 1 260 ? 16.38821 51.05447 10.97864  1.000 47.92369  ? 260 GLY A N   1 
ATOM   1718 C CA  . GLY A 1 260 ? 17.31543 52.14929 10.76042  1.000 44.10145  ? 260 GLY A CA  1 
ATOM   1719 C C   . GLY A 1 260 ? 18.43077 52.13044 11.78123  1.000 49.20878  ? 260 GLY A C   1 
ATOM   1720 O O   . GLY A 1 260 ? 18.27988 51.61276 12.88974  1.000 58.24290  ? 260 GLY A O   1 
ATOM   1721 N N   . MET A 1 261 ? 19.56866 52.69320 11.38020  1.000 41.56257  ? 261 MET A N   1 
ATOM   1722 C CA  . MET A 1 261 ? 20.73861 52.83248 12.22887  1.000 42.66973  ? 261 MET A CA  1 
ATOM   1723 C C   . MET A 1 261 ? 21.10230 54.30297 12.26565  1.000 50.32998  ? 261 MET A C   1 
ATOM   1724 O O   . MET A 1 261 ? 21.41468 54.89761 11.22352  1.000 46.49856  ? 261 MET A O   1 
ATOM   1725 C CB  . MET A 1 261 ? 21.91832 51.99524 11.73234  1.000 39.42635  ? 261 MET A CB  1 
ATOM   1726 C CG  . MET A 1 261 ? 23.26350 52.46671 12.27188  1.000 41.05949  ? 261 MET A CG  1 
ATOM   1727 S SD  . MET A 1 261 ? 24.63396 51.40715 11.74435  1.000 47.79493  ? 261 MET A SD  1 
ATOM   1728 C CE  . MET A 1 261 ? 25.73958 51.53908 13.14539  1.000 40.46074  ? 261 MET A CE  1 
ATOM   1729 N N   . MET A 1 262 ? 21.03658 54.89123 13.45860  1.000 48.91589  ? 262 MET A N   1 
ATOM   1730 C CA  . MET A 1 262 ? 21.26933 56.31733 13.63947  1.000 45.49663  ? 262 MET A CA  1 
ATOM   1731 C C   . MET A 1 262 ? 22.55097 56.50899 14.45194  1.000 53.65166  ? 262 MET A C   1 
ATOM   1732 O O   . MET A 1 262 ? 22.60658 56.15308 15.63253  1.000 66.74063  ? 262 MET A O   1 
ATOM   1733 C CB  . MET A 1 262 ? 20.05608 56.96623 14.29846  1.000 41.62765  ? 262 MET A CB  1 
ATOM   1734 C CG  . MET A 1 262 ? 18.81905 56.97608 13.42356  1.000 43.18062  ? 262 MET A CG  1 
ATOM   1735 S SD  . MET A 1 262 ? 17.30001 56.95874 14.37527  1.000 56.19792  ? 262 MET A SD  1 
ATOM   1736 C CE  . MET A 1 262 ? 17.44448 58.52937 15.17051  1.000 56.20624  ? 262 MET A CE  1 
ATOM   1737 N N   . GLN A 1 263 ? 23.57909 57.06437 13.81392  1.000 49.19687  ? 263 GLN A N   1 
ATOM   1738 C CA  . GLN A 1 263 ? 24.88632 57.27751 14.42835  1.000 45.49645  ? 263 GLN A CA  1 
ATOM   1739 C C   . GLN A 1 263 ? 25.02784 58.75044 14.78251  1.000 50.80636  ? 263 GLN A C   1 
ATOM   1740 O O   . GLN A 1 263 ? 25.19827 59.59523 13.89241  1.000 59.14225  ? 263 GLN A O   1 
ATOM   1741 C CB  . GLN A 1 263 ? 26.01982 56.84993 13.49197  1.000 42.83866  ? 263 GLN A CB  1 
ATOM   1742 C CG  . GLN A 1 263 ? 25.84756 55.46719 12.89200  1.000 40.79721  ? 263 GLN A CG  1 
ATOM   1743 C CD  . GLN A 1 263 ? 26.92171 55.10652 11.86784  1.000 42.54201  ? 263 GLN A CD  1 
ATOM   1744 O OE1 . GLN A 1 263 ? 27.97137 55.76441 11.75486  1.000 39.83647  ? 263 GLN A OE1 1 
ATOM   1745 N NE2 . GLN A 1 263 ? 26.66090 54.04034 11.11754  1.000 33.73235  ? 263 GLN A NE2 1 
ATOM   1746 N N   . SER A 1 264 ? 24.99228 59.03937 16.08706  1.000 44.57511  ? 264 SER A N   1 
ATOM   1747 C CA  . SER A 1 264 ? 25.18254 60.37872 16.64218  1.000 40.00915  ? 264 SER A CA  1 
ATOM   1748 C C   . SER A 1 264 ? 24.24407 61.40385 16.01127  1.000 39.64892  ? 264 SER A C   1 
ATOM   1749 O O   . SER A 1 264 ? 24.64095 62.52007 15.69249  1.000 50.84024  ? 264 SER A O   1 
ATOM   1750 C CB  . SER A 1 264 ? 26.63596 60.83348 16.52101  1.000 37.19231  ? 264 SER A CB  1 
ATOM   1751 O OG  . SER A 1 264 ? 27.48977 59.84988 17.06524  1.000 44.86282  ? 264 SER A OG  1 
ATOM   1752 N N   . GLY A 1 265 ? 22.97949 61.05264 15.86393  1.000 38.46798  ? 265 GLY A N   1 
ATOM   1753 C CA  . GLY A 1 265 ? 22.09096 62.02705 15.27908  1.000 29.68537  ? 265 GLY A CA  1 
ATOM   1754 C C   . GLY A 1 265 ? 20.63521 61.65092 15.37101  1.000 48.59449  ? 265 GLY A C   1 
ATOM   1755 O O   . GLY A 1 265 ? 20.18094 60.62594 14.83562  1.000 49.70866  ? 265 GLY A O   1 
ATOM   1756 N N   . THR A 1 266 ? 19.88786 62.50954 16.04653  1.000 42.19525  ? 266 THR A N   1 
ATOM   1757 C CA  . THR A 1 266 ? 18.47986 62.28322 16.31609  1.000 45.68967  ? 266 THR A CA  1 
ATOM   1758 C C   . THR A 1 266 ? 17.78994 63.62733 16.14906  1.000 51.75057  ? 266 THR A C   1 
ATOM   1759 O O   . THR A 1 266 ? 18.41485 64.67923 16.29672  1.000 52.96849  ? 266 THR A O   1 
ATOM   1760 C CB  . THR A 1 266 ? 18.24687 61.67301 17.72578  1.000 48.82889  ? 266 THR A CB  1 
ATOM   1761 O OG1 . THR A 1 266 ? 18.93098 62.43744 18.72915  1.000 52.30086  ? 266 THR A OG1 1 
ATOM   1762 C CG2 . THR A 1 266 ? 18.76072 60.24940 17.81236  1.000 41.61499  ? 266 THR A CG2 1 
ATOM   1763 N N   . MET A 1 267 ? 16.50934 63.58790 15.79323  1.000 51.09348  ? 267 MET A N   1 
ATOM   1764 C CA  . MET A 1 267 ? 15.80641 64.81365 15.43122  1.000 43.64765  ? 267 MET A CA  1 
ATOM   1765 C C   . MET A 1 267 ? 15.50131 65.69645 16.63030  1.000 50.26663  ? 267 MET A C   1 
ATOM   1766 O O   . MET A 1 267 ? 15.31924 66.90550 16.46140  1.000 56.78343  ? 267 MET A O   1 
ATOM   1767 C CB  . MET A 1 267 ? 14.51396 64.46278 14.70676  1.000 51.09561  ? 267 MET A CB  1 
ATOM   1768 C CG  . MET A 1 267 ? 14.74073 63.83309 13.36061  1.000 61.01852  ? 267 MET A CG  1 
ATOM   1769 S SD  . MET A 1 267 ? 14.54481 65.11304 12.14611  1.000 67.19177  ? 267 MET A SD  1 
ATOM   1770 C CE  . MET A 1 267 ? 12.76700 65.24119 12.20453  1.000 63.42597  ? 267 MET A CE  1 
ATOM   1771 N N   . ASN A 1 268 ? 15.42013 65.12385 17.83391  1.000 52.50893  ? 268 ASN A N   1 
ATOM   1772 C CA  . ASN A 1 268 ? 15.24906 65.94778 19.02385  1.000 51.42659  ? 268 ASN A CA  1 
ATOM   1773 C C   . ASN A 1 268 ? 16.47525 66.80357 19.29487  1.000 46.87300  ? 268 ASN A C   1 
ATOM   1774 O O   . ASN A 1 268 ? 16.36806 67.78246 20.03359  1.000 53.58733  ? 268 ASN A O   1 
ATOM   1775 C CB  . ASN A 1 268 ? 14.94516 65.07587 20.24402  1.000 41.93163  ? 268 ASN A CB  1 
ATOM   1776 C CG  . ASN A 1 268 ? 16.03989 64.04588 20.51018  1.000 52.68540  ? 268 ASN A CG  1 
ATOM   1777 O OD1 . ASN A 1 268 ? 16.67898 63.55930 19.56520  1.000 55.59313  ? 268 ASN A OD1 1 
ATOM   1778 N ND2 . ASN A 1 268 ? 16.26905 63.71068 21.79678  1.000 48.51772  ? 268 ASN A ND2 1 
ATOM   1779 N N   . ALA A 1 269 ? 17.61940 66.46298 18.69914  1.000 43.13440  ? 269 ALA A N   1 
ATOM   1780 C CA  . ALA A 1 269 ? 18.84870 67.20212 18.93918  1.000 47.60679  ? 269 ALA A CA  1 
ATOM   1781 C C   . ALA A 1 269 ? 18.68474 68.65966 18.51056  1.000 54.39270  ? 269 ALA A C   1 
ATOM   1782 O O   . ALA A 1 269 ? 17.98442 68.94345 17.53281  1.000 64.63724  ? 269 ALA A O   1 
ATOM   1783 C CB  . ALA A 1 269 ? 20.01506 66.55408 18.19373  1.000 43.90286  ? 269 ALA A CB  1 
ATOM   1784 N N   . PRO A 1 270 ? 19.29918 69.60689 19.22951  1.000 60.48168  ? 270 PRO A N   1 
ATOM   1785 C CA  . PRO A 1 270 ? 19.05631 71.03505 18.93810  1.000 59.83086  ? 270 PRO A CA  1 
ATOM   1786 C C   . PRO A 1 270 ? 19.44615 71.46372 17.53814  1.000 61.13349  ? 270 PRO A C   1 
ATOM   1787 O O   . PRO A 1 270 ? 18.81999 72.37082 16.97857  1.000 74.50285  ? 270 PRO A O   1 
ATOM   1788 C CB  . PRO A 1 270 ? 19.89893 71.76038 19.99760  1.000 59.72820  ? 270 PRO A CB  1 
ATOM   1789 C CG  . PRO A 1 270 ? 20.69372 70.68735 20.71620  1.000 63.48599  ? 270 PRO A CG  1 
ATOM   1790 C CD  . PRO A 1 270 ? 19.96835 69.40685 20.52528  1.000 61.54655  ? 270 PRO A CD  1 
ATOM   1791 N N   . TRP A 1 271 ? 20.45717 70.84423 16.95463  1.000 48.03479  ? 271 TRP A N   1 
ATOM   1792 C CA  . TRP A 1 271 ? 20.92448 71.21743 15.63237  1.000 49.25202  ? 271 TRP A CA  1 
ATOM   1793 C C   . TRP A 1 271 ? 20.13416 70.55587 14.51009  1.000 52.32397  ? 271 TRP A C   1 
ATOM   1794 O O   . TRP A 1 271 ? 20.38699 70.85065 13.34152  1.000 58.55738  ? 271 TRP A O   1 
ATOM   1795 C CB  . TRP A 1 271 ? 22.39827 70.84735 15.50049  1.000 49.76681  ? 271 TRP A CB  1 
ATOM   1796 C CG  . TRP A 1 271 ? 22.66993 69.40573 15.85923  1.000 52.95005  ? 271 TRP A CG  1 
ATOM   1797 C CD1 . TRP A 1 271 ? 23.06592 68.92358 17.06547  1.000 57.38450  ? 271 TRP A CD1 1 
ATOM   1798 C CD2 . TRP A 1 271 ? 22.56555 68.27114 14.98983  1.000 58.03487  ? 271 TRP A CD2 1 
ATOM   1799 N NE1 . TRP A 1 271 ? 23.21608 67.55928 17.00844  1.000 55.67779  ? 271 TRP A NE1 1 
ATOM   1800 C CE2 . TRP A 1 271 ? 22.91537 67.13440 15.74449  1.000 50.79650  ? 271 TRP A CE2 1 
ATOM   1801 C CE3 . TRP A 1 271 ? 22.21133 68.10652 13.64164  1.000 54.16726  ? 271 TRP A CE3 1 
ATOM   1802 C CZ2 . TRP A 1 271 ? 22.92699 65.85020 15.19895  1.000 49.64808  ? 271 TRP A CZ2 1 
ATOM   1803 C CZ3 . TRP A 1 271 ? 22.20890 66.83240 13.11308  1.000 49.03591  ? 271 TRP A CZ3 1 
ATOM   1804 C CH2 . TRP A 1 271 ? 22.57224 65.71995 13.89005  1.000 46.45877  ? 271 TRP A CH2 1 
ATOM   1805 N N   . SER A 1 272 ? 19.18977 69.68024 14.83125  1.000 48.86394  ? 272 SER A N   1 
ATOM   1806 C CA  . SER A 1 272 ? 18.56293 68.80840 13.85192  1.000 46.82406  ? 272 SER A CA  1 
ATOM   1807 C C   . SER A 1 272 ? 17.07829 69.10024 13.66976  1.000 42.88932  ? 272 SER A C   1 
ATOM   1808 O O   . SER A 1 272 ? 16.38866 68.36984 12.96072  1.000 47.72069  ? 272 SER A O   1 
ATOM   1809 C CB  . SER A 1 272 ? 18.80011 67.34760 14.25560  1.000 52.68392  ? 272 SER A CB  1 
ATOM   1810 O OG  . SER A 1 272 ? 17.82871 66.48669 13.71534  1.000 61.20560  ? 272 SER A OG  1 
ATOM   1811 N N   . HIS A 1 273 ? 16.55820 70.13388 14.30950  1.000 50.03526  ? 273 HIS A N   1 
ATOM   1812 C CA  . HIS A 1 273 ? 15.21135 70.57581 13.99633  1.000 52.25628  ? 273 HIS A CA  1 
ATOM   1813 C C   . HIS A 1 273 ? 15.16408 72.07355 14.21267  1.000 52.64157  ? 273 HIS A C   1 
ATOM   1814 O O   . HIS A 1 273 ? 16.00573 72.64652 14.90649  1.000 45.90620  ? 273 HIS A O   1 
ATOM   1815 C CB  . HIS A 1 273 ? 14.15162 69.87967 14.83766  1.000 46.64127  ? 273 HIS A CB  1 
ATOM   1816 C CG  . HIS A 1 273 ? 14.27564 70.19042 16.28481  1.000 55.49484  ? 273 HIS A CG  1 
ATOM   1817 N ND1 . HIS A 1 273 ? 15.26214 69.64194 17.07647  1.000 52.25563  ? 273 HIS A ND1 1 
ATOM   1818 C CD2 . HIS A 1 273 ? 13.56893 71.02840 17.07919  1.000 55.93503  ? 273 HIS A CD2 1 
ATOM   1819 C CE1 . HIS A 1 273 ? 15.14725 70.12266 18.30049  1.000 52.54574  ? 273 HIS A CE1 1 
ATOM   1820 N NE2 . HIS A 1 273 ? 14.13304 70.96706 18.32548  1.000 51.74181  ? 273 HIS A NE2 1 
ATOM   1821 N N   . MET A 1 274 ? 14.19809 72.70441 13.56402  1.000 49.11546  ? 274 MET A N   1 
ATOM   1822 C CA  . MET A 1 274 ? 14.09322 74.14766 13.56093  1.000 40.68378  ? 274 MET A CA  1 
ATOM   1823 C C   . MET A 1 274 ? 12.63907 74.48149 13.29176  1.000 54.13254  ? 274 MET A C   1 
ATOM   1824 O O   . MET A 1 274 ? 11.97640 73.80815 12.48954  1.000 63.92370  ? 274 MET A O   1 
ATOM   1825 C CB  . MET A 1 274 ? 15.01497 74.76003 12.50314  1.000 49.08839  ? 274 MET A CB  1 
ATOM   1826 C CG  . MET A 1 274 ? 15.04346 76.26288 12.51003  1.000 57.42636  ? 274 MET A CG  1 
ATOM   1827 S SD  . MET A 1 274 ? 16.00212 76.99973 11.17586  1.000 61.96735  ? 274 MET A SD  1 
ATOM   1828 C CE  . MET A 1 274 ? 17.47687 75.99752 11.16625  1.000 61.16139  ? 274 MET A CE  1 
ATOM   1829 N N   . THR A 1 275 ? 12.13923 75.49666 13.98579  1.000 50.46247  ? 275 THR A N   1 
ATOM   1830 C CA  . THR A 1 275 ? 10.76944 75.90745 13.75497  1.000 57.23315  ? 275 THR A CA  1 
ATOM   1831 C C   . THR A 1 275 ? 10.62471 76.50375 12.36433  1.000 62.12761  ? 275 THR A C   1 
ATOM   1832 O O   . THR A 1 275 ? 11.60050 76.86802 11.70016  1.000 59.62137  ? 275 THR A O   1 
ATOM   1833 C CB  . THR A 1 275 ? 10.32486 76.95051 14.76670  1.000 52.85731  ? 275 THR A CB  1 
ATOM   1834 O OG1 . THR A 1 275 ? 11.22807 78.06599 14.69666  1.000 59.02857  ? 275 THR A OG1 1 
ATOM   1835 C CG2 . THR A 1 275 ? 10.28877 76.35423 16.14946  1.000 45.27355  ? 275 THR A CG2 1 
ATOM   1836 N N   . SER A 1 276 ? 9.37076  76.62928 11.94299  1.000 60.18432  ? 276 SER A N   1 
ATOM   1837 C CA  . SER A 1 276 ? 9.09867  77.27573 10.67141  1.000 63.19256  ? 276 SER A CA  1 
ATOM   1838 C C   . SER A 1 276 ? 9.41688  78.76793 10.75053  1.000 63.34352  ? 276 SER A C   1 
ATOM   1839 O O   . SER A 1 276 ? 10.02560 79.32544 9.83076   1.000 63.91746  ? 276 SER A O   1 
ATOM   1840 C CB  . SER A 1 276 ? 7.64182  77.03076 10.27058  1.000 59.04125  ? 276 SER A CB  1 
ATOM   1841 O OG  . SER A 1 276 ? 7.13836  78.06765 9.45714   1.000 62.93290  ? 276 SER A OG  1 
ATOM   1842 N N   . GLU A 1 277 ? 9.06145  79.41693 11.86721  1.000 67.46270  ? 277 GLU A N   1 
ATOM   1843 C CA  . GLU A 1 277 ? 9.26466  80.85908 11.99116  1.000 72.32372  ? 277 GLU A CA  1 
ATOM   1844 C C   . GLU A 1 277 ? 10.74083 81.21941 11.99232  1.000 68.32008  ? 277 GLU A C   1 
ATOM   1845 O O   . GLU A 1 277 ? 11.11928 82.26777 11.45224  1.000 73.25593  ? 277 GLU A O   1 
ATOM   1846 C CB  . GLU A 1 277 ? 8.60260  81.39814 13.25831  1.000 78.64718  ? 277 GLU A CB  1 
ATOM   1847 C CG  . GLU A 1 277 ? 7.10340  81.47231 13.20290  1.000 85.04656  ? 277 GLU A CG  1 
ATOM   1848 C CD  . GLU A 1 277 ? 6.45741  80.17395 13.61045  1.000 88.39297  ? 277 GLU A CD  1 
ATOM   1849 O OE1 . GLU A 1 277 ? 5.20833  80.14168 13.69547  1.000 89.47549  ? 277 GLU A OE1 1 
ATOM   1850 O OE2 . GLU A 1 277 ? 7.20566  79.19763 13.86913  1.000 80.23349  ? 277 GLU A OE2 1 
ATOM   1851 N N   . LYS A 1 278 ? 11.59611 80.37693 12.59395  1.000 65.22593  ? 278 LYS A N   1 
ATOM   1852 C CA  . LYS A 1 278 ? 13.02826 80.66000 12.53013  1.000 65.05315  ? 278 LYS A CA  1 
ATOM   1853 C C   . LYS A 1 278 ? 13.56243 80.40103 11.12944  1.000 59.92892  ? 278 LYS A C   1 
ATOM   1854 O O   . LYS A 1 278 ? 14.38939 81.16490 10.63392  1.000 65.80410  ? 278 LYS A O   1 
ATOM   1855 C CB  . LYS A 1 278 ? 13.82746 79.83702 13.54318  1.000 58.71359  ? 278 LYS A CB  1 
ATOM   1856 C CG  . LYS A 1 278 ? 15.21578 80.49962 13.79767  1.000 70.98266  ? 278 LYS A CG  1 
ATOM   1857 C CD  . LYS A 1 278 ? 15.58848 80.59492 15.29340  1.000 94.71755  ? 278 LYS A CD  1 
ATOM   1858 C CE  . LYS A 1 278 ? 15.02621 79.42136 16.09504  1.000 98.13625  ? 278 LYS A CE  1 
ATOM   1859 N NZ  . LYS A 1 278 ? 15.36033 79.45238 17.55277  1.000 91.63928  ? 278 LYS A NZ  1 
ATOM   1860 N N   . ALA A 1 279 ? 13.10834 79.31208 10.49100  1.000 57.53178  ? 279 ALA A N   1 
ATOM   1861 C CA  . ALA A 1 279 ? 13.48985 79.01036 9.10985   1.000 51.50901  ? 279 ALA A CA  1 
ATOM   1862 C C   . ALA A 1 279 ? 13.16204 80.17563 8.19102   1.000 52.77782  ? 279 ALA A C   1 
ATOM   1863 O O   . ALA A 1 279 ? 14.02913 80.65387 7.45718   1.000 61.49964  ? 279 ALA A O   1 
ATOM   1864 C CB  . ALA A 1 279 ? 12.78335 77.73647 8.65157   1.000 43.49564  ? 279 ALA A CB  1 
ATOM   1865 N N   . VAL A 1 280 ? 11.92211 80.67695 8.25304   1.000 59.66451  ? 280 VAL A N   1 
ATOM   1866 C CA  . VAL A 1 280 ? 11.53336 81.84051 7.45234   1.000 62.78078  ? 280 VAL A CA  1 
ATOM   1867 C C   . VAL A 1 280 ? 12.49485 82.99765 7.68066   1.000 69.45465  ? 280 VAL A C   1 
ATOM   1868 O O   . VAL A 1 280 ? 12.96810 83.62878 6.73028   1.000 64.39320  ? 280 VAL A O   1 
ATOM   1869 C CB  . VAL A 1 280 ? 10.08904 82.26329 7.77049   1.000 54.65517  ? 280 VAL A CB  1 
ATOM   1870 C CG1 . VAL A 1 280 ? 9.82416  83.66005 7.21646   1.000 53.00177  ? 280 VAL A CG1 1 
ATOM   1871 C CG2 . VAL A 1 280 ? 9.11186  81.27425 7.18003   1.000 51.83630  ? 280 VAL A CG2 1 
ATOM   1872 N N   . GLU A 1 281 ? 12.78801 83.29803 8.95171   1.000 74.61220  ? 281 GLU A N   1 
ATOM   1873 C CA  . GLU A 1 281 ? 13.66276 84.42493 9.26654   1.000 76.04678  ? 281 GLU A CA  1 
ATOM   1874 C C   . GLU A 1 281 ? 15.04460 84.23049 8.65651   1.000 66.12450  ? 281 GLU A C   1 
ATOM   1875 O O   . GLU A 1 281 ? 15.60673 85.16440 8.07403   1.000 64.08009  ? 281 GLU A O   1 
ATOM   1876 C CB  . GLU A 1 281 ? 13.75099 84.61823 10.78454  1.000 80.91083  ? 281 GLU A CB  1 
ATOM   1877 C CG  . GLU A 1 281 ? 12.41518 85.00376 11.44214  1.000 93.83128  ? 281 GLU A CG  1 
ATOM   1878 C CD  . GLU A 1 281 ? 12.42132 84.94725 12.98719  1.000 102.49801 ? 281 GLU A CD  1 
ATOM   1879 O OE1 . GLU A 1 281 ? 11.51174 85.55246 13.60285  1.000 102.39249 ? 281 GLU A OE1 1 
ATOM   1880 O OE2 . GLU A 1 281 ? 13.31880 84.30362 13.58743  1.000 101.27611 ? 281 GLU A OE2 1 
ATOM   1881 N N   . ILE A 1 282 ? 15.59969 83.01881 8.76526   1.000 60.53411  ? 282 ILE A N   1 
ATOM   1882 C CA  . ILE A 1 282 ? 16.84895 82.69812 8.07660   1.000 65.06511  ? 282 ILE A CA  1 
ATOM   1883 C C   . ILE A 1 282 ? 16.69071 82.90512 6.57741   1.000 74.32921  ? 282 ILE A C   1 
ATOM   1884 O O   . ILE A 1 282 ? 17.52747 83.54328 5.92195   1.000 77.31130  ? 282 ILE A O   1 
ATOM   1885 C CB  . ILE A 1 282 ? 17.27079 81.25103 8.37046   1.000 64.22699  ? 282 ILE A CB  1 
ATOM   1886 C CG1 . ILE A 1 282 ? 17.67268 81.06504 9.83577   1.000 57.84546  ? 282 ILE A CG1 1 
ATOM   1887 C CG2 . ILE A 1 282 ? 18.35954 80.82885 7.39208   1.000 69.47758  ? 282 ILE A CG2 1 
ATOM   1888 C CD1 . ILE A 1 282 ? 19.00638 81.60194 10.16750  1.000 75.80927  ? 282 ILE A CD1 1 
ATOM   1889 N N   . GLY A 1 283 ? 15.62124 82.33862 6.01136   1.000 70.18035  ? 283 GLY A N   1 
ATOM   1890 C CA  . GLY A 1 283 ? 15.36137 82.51075 4.59289   1.000 73.06576  ? 283 GLY A CA  1 
ATOM   1891 C C   . GLY A 1 283 ? 15.28884 83.96621 4.18960   1.000 72.20441  ? 283 GLY A C   1 
ATOM   1892 O O   . GLY A 1 283 ? 15.90263 84.37889 3.20281   1.000 71.93478  ? 283 GLY A O   1 
ATOM   1893 N N   . LYS A 1 284 ? 14.55126 84.76914 4.96525   1.000 52.34892  ? 284 LYS A N   1 
ATOM   1894 C CA  . LYS A 1 284 ? 14.40997 86.18655 4.65866   1.000 55.39607  ? 284 LYS A CA  1 
ATOM   1895 C C   . LYS A 1 284 ? 15.75661 86.89041 4.70448   1.000 69.50615  ? 284 LYS A C   1 
ATOM   1896 O O   . LYS A 1 284 ? 16.02816 87.78750 3.89885   1.000 77.82315  ? 284 LYS A O   1 
ATOM   1897 C CB  . LYS A 1 284 ? 13.42936 86.84050 5.62967   1.000 58.29013  ? 284 LYS A CB  1 
ATOM   1898 C CG  . LYS A 1 284 ? 11.97975 86.80125 5.17979   1.000 64.68354  ? 284 LYS A CG  1 
ATOM   1899 C CD  . LYS A 1 284 ? 11.19869 88.00268 5.70736   1.000 75.89190  ? 284 LYS A CD  1 
ATOM   1900 C CE  . LYS A 1 284 ? 10.17614 87.56403 6.74771   1.000 86.45199  ? 284 LYS A CE  1 
ATOM   1901 N NZ  . LYS A 1 284 ? 9.67476  88.67664 7.62249   1.000 93.60308  ? 284 LYS A NZ  1 
ATOM   1902 N N   . ALA A 1 285 ? 16.62255 86.48615 5.63013   1.000 67.83829  ? 285 ALA A N   1 
ATOM   1903 C CA  . ALA A 1 285 ? 17.95734 87.07221 5.69205   1.000 69.49420  ? 285 ALA A CA  1 
ATOM   1904 C C   . ALA A 1 285 ? 18.76913 86.69540 4.45943   1.000 66.60510  ? 285 ALA A C   1 
ATOM   1905 O O   . ALA A 1 285 ? 19.41211 87.55120 3.84732   1.000 67.45757  ? 285 ALA A O   1 
ATOM   1906 C CB  . ALA A 1 285 ? 18.66722 86.62844 6.97437   1.000 57.21769  ? 285 ALA A CB  1 
ATOM   1907 N N   . LEU A 1 286 ? 18.73640 85.41430 4.07792   1.000 61.10780  ? 286 LEU A N   1 
ATOM   1908 C CA  . LEU A 1 286 ? 19.44889 84.95741 2.89110   1.000 63.16053  ? 286 LEU A CA  1 
ATOM   1909 C C   . LEU A 1 286 ? 18.99983 85.71885 1.64832   1.000 71.61885  ? 286 LEU A C   1 
ATOM   1910 O O   . LEU A 1 286 ? 19.82685 86.21532 0.87413   1.000 70.85209  ? 286 LEU A O   1 
ATOM   1911 C CB  . LEU A 1 286 ? 19.22934 83.45485 2.70990   1.000 60.40337  ? 286 LEU A CB  1 
ATOM   1912 C CG  . LEU A 1 286 ? 19.72589 82.87172 1.39161   1.000 60.16625  ? 286 LEU A CG  1 
ATOM   1913 C CD1 . LEU A 1 286 ? 21.24576 82.74288 1.39965   1.000 54.40385  ? 286 LEU A CD1 1 
ATOM   1914 C CD2 . LEU A 1 286 ? 19.06140 81.53018 1.13296   1.000 60.66216  ? 286 LEU A CD2 1 
ATOM   1915 N N   . ILE A 1 287 ? 17.68596 85.82076 1.44355   1.000 73.93326  ? 287 ILE A N   1 
ATOM   1916 C CA  . ILE A 1 287 ? 17.15870 86.57694 0.31123   1.000 71.10029  ? 287 ILE A CA  1 
ATOM   1917 C C   . ILE A 1 287 ? 17.70920 87.99336 0.31962   1.000 80.54933  ? 287 ILE A C   1 
ATOM   1918 O O   . ILE A 1 287 ? 18.13700 88.52519 -0.71151  1.000 87.71431  ? 287 ILE A O   1 
ATOM   1919 C CB  . ILE A 1 287 ? 15.62404 86.57761 0.34554   1.000 70.65355  ? 287 ILE A CB  1 
ATOM   1920 C CG1 . ILE A 1 287 ? 15.10127 85.14541 0.22276   1.000 67.66852  ? 287 ILE A CG1 1 
ATOM   1921 C CG2 . ILE A 1 287 ? 15.07857 87.44861 -0.75344  1.000 77.70726  ? 287 ILE A CG2 1 
ATOM   1922 C CD1 . ILE A 1 287 ? 13.60040 85.05616 0.32923   1.000 72.33255  ? 287 ILE A CD1 1 
ATOM   1923 N N   . ASN A 1 288 ? 17.69857 88.62956 1.48899   1.000 83.21976  ? 288 ASN A N   1 
ATOM   1924 C CA  . ASN A 1 288 ? 18.33537 89.93196 1.61587   1.000 82.93317  ? 288 ASN A CA  1 
ATOM   1925 C C   . ASN A 1 288 ? 19.82504 89.82628 1.34507   1.000 84.73270  ? 288 ASN A C   1 
ATOM   1926 O O   . ASN A 1 288 ? 20.39451 90.63613 0.60526   1.000 84.67726  ? 288 ASN A O   1 
ATOM   1927 C CB  . ASN A 1 288 ? 18.08502 90.49210 3.00818   1.000 82.79057  ? 288 ASN A CB  1 
ATOM   1928 C CG  . ASN A 1 288 ? 16.72225 91.10409 3.14141   1.000 82.25494  ? 288 ASN A CG  1 
ATOM   1929 O OD1 . ASN A 1 288 ? 16.23963 91.74569 2.21587   1.000 76.96441  ? 288 ASN A OD1 1 
ATOM   1930 N ND2 . ASN A 1 288 ? 16.09102 90.92254 4.30349   1.000 86.36033  ? 288 ASN A ND2 1 
ATOM   1931 N N   . ASP A 1 289 ? 20.46546 88.81091 1.93138   1.000 90.47006  ? 289 ASP A N   1 
ATOM   1932 C CA  . ASP A 1 289 ? 21.90825 88.63594 1.80487   1.000 96.22870  ? 289 ASP A CA  1 
ATOM   1933 C C   . ASP A 1 289 ? 22.33680 88.45864 0.34994   1.000 90.91561  ? 289 ASP A C   1 
ATOM   1934 O O   . ASP A 1 289 ? 23.43409 88.88873 -0.02411  1.000 91.42003  ? 289 ASP A O   1 
ATOM   1935 C CB  . ASP A 1 289 ? 22.36419 87.43615 2.64620   1.000 100.66382 ? 289 ASP A CB  1 
ATOM   1936 C CG  . ASP A 1 289 ? 22.38199 87.72553 4.15313   1.000 101.60847 ? 289 ASP A CG  1 
ATOM   1937 O OD1 . ASP A 1 289 ? 22.95694 86.90783 4.90265   1.000 96.42213  ? 289 ASP A OD1 1 
ATOM   1938 O OD2 . ASP A 1 289 ? 21.82951 88.75719 4.58881   1.000 102.79476 ? 289 ASP A OD2 1 
ATOM   1939 N N   . CYS A 1 290 ? 21.50411 87.82506 -0.48252  1.000 84.42914  ? 290 CYS A N   1 
ATOM   1940 C CA  . CYS A 1 290 ? 21.77717 87.73470 -1.91165  1.000 90.74991  ? 290 CYS A CA  1 
ATOM   1941 C C   . CYS A 1 290 ? 21.17377 88.87683 -2.71355  1.000 101.07085 ? 290 CYS A C   1 
ATOM   1942 O O   . CYS A 1 290 ? 21.01712 88.74182 -3.93194  1.000 106.00508 ? 290 CYS A O   1 
ATOM   1943 C CB  . CYS A 1 290 ? 21.27981 86.41514 -2.48665  1.000 82.81017  ? 290 CYS A CB  1 
ATOM   1944 S SG  . CYS A 1 290 ? 21.59445 85.03344 -1.44311  1.000 83.83081  ? 290 CYS A SG  1 
ATOM   1945 N N   . ASN A 1 291 ? 20.81576 89.98177 -2.06411  1.000 102.67860 ? 291 ASN A N   1 
ATOM   1946 C CA  . ASN A 1 291 ? 20.47573 91.21777 -2.75535  1.000 106.44716 ? 291 ASN A CA  1 
ATOM   1947 C C   . ASN A 1 291 ? 19.19215 91.04834 -3.57008  1.000 100.18900 ? 291 ASN A C   1 
ATOM   1948 O O   . ASN A 1 291 ? 19.16400 91.26063 -4.79234  1.000 101.72278 ? 291 ASN A O   1 
ATOM   1949 C CB  . ASN A 1 291 ? 21.65618 91.66255 -3.63188  1.000 115.20542 ? 291 ASN A CB  1 
ATOM   1950 C CG  . ASN A 1 291 ? 21.46306 93.04200 -4.23343  1.000 130.36864 ? 291 ASN A CG  1 
ATOM   1951 O OD1 . ASN A 1 291 ? 20.83413 93.91251 -3.63081  1.000 137.75509 ? 291 ASN A OD1 1 
ATOM   1952 N ND2 . ASN A 1 291 ? 22.00038 93.24664 -5.43372  1.000 132.84978 ? 291 ASN A ND2 1 
ATOM   1953 N N   . CYS A 1 292 ? 18.11204 90.66929 -2.86108  1.000 90.89819  ? 292 CYS A N   1 
ATOM   1954 C CA  . CYS A 1 292 ? 16.84849 90.34644 -3.51571  1.000 84.19019  ? 292 CYS A CA  1 
ATOM   1955 C C   . CYS A 1 292 ? 15.65441 90.84870 -2.70047  1.000 89.20737  ? 292 CYS A C   1 
ATOM   1956 O O   . CYS A 1 292 ? 14.51792 90.40315 -2.92948  1.000 87.30927  ? 292 CYS A O   1 
ATOM   1957 C CB  . CYS A 1 292 ? 16.69627 88.81648 -3.70791  1.000 74.26217  ? 292 CYS A CB  1 
ATOM   1958 S SG  . CYS A 1 292 ? 17.46648 88.09213 -5.19010  1.000 78.17551  ? 292 CYS A SG  1 
ATOM   1959 N N   . ASN A 1 293 ? 15.87718 91.78701 -1.77662  1.000 101.19800 ? 293 ASN A N   1 
ATOM   1960 C CA  . ASN A 1 293 ? 14.85278 92.56910 -1.06329  1.000 113.75878 ? 293 ASN A CA  1 
ATOM   1961 C C   . ASN A 1 293 ? 14.02650 91.85768 0.02277   1.000 113.27067 ? 293 ASN A C   1 
ATOM   1962 O O   . ASN A 1 293 ? 13.87700 92.38512 1.13368   1.000 128.34382 ? 293 ASN A O   1 
ATOM   1963 C CB  . ASN A 1 293 ? 13.92463 93.22082 -2.07737  1.000 117.97023 ? 293 ASN A CB  1 
ATOM   1964 C CG  . ASN A 1 293 ? 14.64920 94.22535 -2.94574  1.000 128.44107 ? 293 ASN A CG  1 
ATOM   1965 O OD1 . ASN A 1 293 ? 14.23732 94.53024 -4.07072  1.000 137.77381 ? 293 ASN A OD1 1 
ATOM   1966 N ND2 . ASN A 1 293 ? 15.75507 94.74828 -2.42089  1.000 127.29111 ? 293 ASN A ND2 1 
ATOM   1967 N N   . ALA A 1 294 ? 13.44261 90.69700 -0.27431  1.000 97.46934  ? 294 ALA A N   1 
ATOM   1968 C CA  . ALA A 1 294 ? 12.80028 89.86712 0.76322   1.000 88.75044  ? 294 ALA A CA  1 
ATOM   1969 C C   . ALA A 1 294 ? 11.60112 90.52011 1.46210   1.000 84.83924  ? 294 ALA A C   1 
ATOM   1970 O O   . ALA A 1 294 ? 10.67675 89.82783 1.89740   1.000 76.87113  ? 294 ALA A O   1 
ATOM   1971 C CB  . ALA A 1 294 ? 13.82208 89.43075 1.82560   1.000 75.96617  ? 294 ALA A CB  1 
ATOM   1972 N N   . SER A 1 295 ? 11.59434 91.84288 1.58418   1.000 86.90243  ? 295 SER A N   1 
ATOM   1973 C CA  . SER A 1 295 ? 10.38430 92.50655 2.04308   1.000 91.87352  ? 295 SER A CA  1 
ATOM   1974 C C   . SER A 1 295 ? 9.27919  92.53019 0.98712   1.000 91.96435  ? 295 SER A C   1 
ATOM   1975 O O   . SER A 1 295 ? 8.17600  92.99828 1.28462   1.000 97.75928  ? 295 SER A O   1 
ATOM   1976 C CB  . SER A 1 295 ? 10.70576 93.93483 2.47657   1.000 96.25159  ? 295 SER A CB  1 
ATOM   1977 O OG  . SER A 1 295 ? 10.64604 94.80969 1.36318   1.000 98.92694  ? 295 SER A OG  1 
ATOM   1978 N N   . MET A 1 296 ? 9.52761  92.05081 -0.22832  1.000 81.84983  ? 296 MET A N   1 
ATOM   1979 C CA  . MET A 1 296 ? 8.45674  91.92082 -1.20099  1.000 85.16848  ? 296 MET A CA  1 
ATOM   1980 C C   . MET A 1 296 ? 7.87189  90.51637 -1.24802  1.000 84.15617  ? 296 MET A C   1 
ATOM   1981 O O   . MET A 1 296 ? 7.00737  90.24916 -2.08668  1.000 85.71236  ? 296 MET A O   1 
ATOM   1982 C CB  . MET A 1 296 ? 8.95083  92.33676 -2.58357  1.000 91.63516  ? 296 MET A CB  1 
ATOM   1983 C CG  . MET A 1 296 ? 9.19632  93.83664 -2.71177  1.000 102.54899 ? 296 MET A CG  1 
ATOM   1984 S SD  . MET A 1 296 ? 9.57331  94.33923 -4.40587  1.000 109.54907 ? 296 MET A SD  1 
ATOM   1985 C CE  . MET A 1 296 ? 10.10690 92.78073 -5.12223  1.000 101.62475 ? 296 MET A CE  1 
ATOM   1986 N N   . LEU A 1 297 ? 8.29325  89.63250 -0.33494  1.000 81.02782  ? 297 LEU A N   1 
ATOM   1987 C CA  . LEU A 1 297 ? 7.87341  88.23363 -0.36353  1.000 79.78509  ? 297 LEU A CA  1 
ATOM   1988 C C   . LEU A 1 297 ? 6.36019  88.08039 -0.32591  1.000 83.92716  ? 297 LEU A C   1 
ATOM   1989 O O   . LEU A 1 297 ? 5.83105  87.08881 -0.83032  1.000 83.30210  ? 297 LEU A O   1 
ATOM   1990 C CB  . LEU A 1 297 ? 8.48306  87.48320 0.82047   1.000 75.92860  ? 297 LEU A CB  1 
ATOM   1991 C CG  . LEU A 1 297 ? 9.74377  86.66635 0.57033   1.000 75.10852  ? 297 LEU A CG  1 
ATOM   1992 C CD1 . LEU A 1 297 ? 10.15545 86.00085 1.84798   1.000 77.82688  ? 297 LEU A CD1 1 
ATOM   1993 C CD2 . LEU A 1 297 ? 9.49611  85.62979 -0.50564  1.000 77.93143  ? 297 LEU A CD2 1 
ATOM   1994 N N   . LYS A 1 298 ? 5.65480  89.00984 0.31407   1.000 90.30730  ? 298 LYS A N   1 
ATOM   1995 C CA  . LYS A 1 298 ? 4.20709  88.92724 0.43886   1.000 95.30230  ? 298 LYS A CA  1 
ATOM   1996 C C   . LYS A 1 298 ? 3.49376  89.66878 -0.67620  1.000 91.74196  ? 298 LYS A C   1 
ATOM   1997 O O   . LYS A 1 298 ? 2.48823  89.17243 -1.19648  1.000 81.90441  ? 298 LYS A O   1 
ATOM   1998 C CB  . LYS A 1 298 ? 3.73475  89.48971 1.78971   1.000 102.72824 ? 298 LYS A CB  1 
ATOM   1999 C CG  . LYS A 1 298 ? 4.44601  88.94250 3.02728   1.000 107.33713 ? 298 LYS A CG  1 
ATOM   2000 C CD  . LYS A 1 298 ? 3.44191  88.52834 4.09348   1.000 109.76229 ? 298 LYS A CD  1 
ATOM   2001 C CE  . LYS A 1 298 ? 2.96486  89.69076 4.95491   1.000 114.94142 ? 298 LYS A CE  1 
ATOM   2002 N NZ  . LYS A 1 298 ? 2.99590  89.29520 6.39745   1.000 118.33185 ? 298 LYS A NZ  1 
ATOM   2003 N N   . THR A 1 299 ? 3.99331  90.85390 -1.04270  1.000 90.39707  ? 299 THR A N   1 
ATOM   2004 C CA  . THR A 1 299 ? 3.34606  91.66552 -2.07091  1.000 96.51135  ? 299 THR A CA  1 
ATOM   2005 C C   . THR A 1 299 ? 3.55075  91.08408 -3.46813  1.000 88.96940  ? 299 THR A C   1 
ATOM   2006 O O   . THR A 1 299 ? 2.63448  91.12211 -4.29641  1.000 88.33276  ? 299 THR A O   1 
ATOM   2007 C CB  . THR A 1 299 ? 3.86888  93.09945 -2.00365  1.000 102.90655 ? 299 THR A CB  1 
ATOM   2008 O OG1 . THR A 1 299 ? 5.03711  93.22899 -2.83049  1.000 99.14823  ? 299 THR A OG1 1 
ATOM   2009 C CG2 . THR A 1 299 ? 4.21975  93.44081 -0.55129  1.000 108.30136 ? 299 THR A CG2 1 
ATOM   2010 N N   . ASN A 1 300 ? 4.74633  90.56526 -3.76285  1.000 82.67275  ? 300 ASN A N   1 
ATOM   2011 C CA  . ASN A 1 300 ? 5.00415  89.88221 -5.03073  1.000 81.72809  ? 300 ASN A CA  1 
ATOM   2012 C C   . ASN A 1 300 ? 6.08397  88.84383 -4.80575  1.000 74.50517  ? 300 ASN A C   1 
ATOM   2013 O O   . ASN A 1 300 ? 7.27727  89.09752 -5.02182  1.000 66.88186  ? 300 ASN A O   1 
ATOM   2014 C CB  . ASN A 1 300 ? 5.40299  90.85032 -6.14662  1.000 96.14530  ? 300 ASN A CB  1 
ATOM   2015 C CG  . ASN A 1 300 ? 5.66453  90.14676 -7.47795  1.000 107.10157 ? 300 ASN A CG  1 
ATOM   2016 O OD1 . ASN A 1 300 ? 5.53234  88.92576 -7.59449  1.000 111.25652 ? 300 ASN A OD1 1 
ATOM   2017 N ND2 . ASN A 1 300 ? 6.00866  90.92417 -8.49378  1.000 114.63611 ? 300 ASN A ND2 1 
ATOM   2018 N N   . PRO A 1 301 ? 5.69784  87.64009 -4.38730  1.000 71.05133  ? 301 PRO A N   1 
ATOM   2019 C CA  . PRO A 1 301 ? 6.70776  86.59588 -4.17363  1.000 76.19158  ? 301 PRO A CA  1 
ATOM   2020 C C   . PRO A 1 301 ? 7.37024  86.12976 -5.44843  1.000 80.84637  ? 301 PRO A C   1 
ATOM   2021 O O   . PRO A 1 301 ? 8.57535  85.85012 -5.43819  1.000 80.31340  ? 301 PRO A O   1 
ATOM   2022 C CB  . PRO A 1 301 ? 5.91529  85.46231 -3.49885  1.000 72.41821  ? 301 PRO A CB  1 
ATOM   2023 C CG  . PRO A 1 301 ? 4.46341  85.78009 -3.77505  1.000 74.04630  ? 301 PRO A CG  1 
ATOM   2024 C CD  . PRO A 1 301 ? 4.37693  87.26038 -3.86903  1.000 74.13027  ? 301 PRO A CD  1 
ATOM   2025 N N   . ALA A 1 302 ? 6.61653  86.03117 -6.54727  1.000 87.66884  ? 302 ALA A N   1 
ATOM   2026 C CA  . ALA A 1 302 ? 7.16698  85.44539 -7.76626  1.000 78.56607  ? 302 ALA A CA  1 
ATOM   2027 C C   . ALA A 1 302 ? 8.43270  86.17157 -8.19024  1.000 72.56335  ? 302 ALA A C   1 
ATOM   2028 O O   . ALA A 1 302 ? 9.42833  85.53473 -8.56542  1.000 66.54855  ? 302 ALA A O   1 
ATOM   2029 C CB  . ALA A 1 302 ? 6.12340  85.46174 -8.88434  1.000 70.57936  ? 302 ALA A CB  1 
ATOM   2030 N N   . HIS A 1 303 ? 8.43261  87.50301 -8.07055  1.000 70.45494  ? 303 HIS A N   1 
ATOM   2031 C CA  . HIS A 1 303 ? 9.60482  88.27518 -8.45189  1.000 78.38834  ? 303 HIS A CA  1 
ATOM   2032 C C   . HIS A 1 303 ? 10.77652 88.04092 -7.49753  1.000 82.47104  ? 303 HIS A C   1 
ATOM   2033 O O   . HIS A 1 303 ? 11.92688 87.92919 -7.94219  1.000 83.99614  ? 303 HIS A O   1 
ATOM   2034 C CB  . HIS A 1 303 ? 9.24856  89.75371 -8.52328  1.000 88.90666  ? 303 HIS A CB  1 
ATOM   2035 C CG  . HIS A 1 303 ? 10.41702 90.62409 -8.85142  1.000 104.20850 ? 303 HIS A CG  1 
ATOM   2036 N ND1 . HIS A 1 303 ? 11.15863 91.26926 -7.88261  1.000 109.00320 ? 303 HIS A ND1 1 
ATOM   2037 C CD2 . HIS A 1 303 ? 10.99417 90.92987 -10.03650 1.000 105.75133 ? 303 HIS A CD2 1 
ATOM   2038 C CE1 . HIS A 1 303 ? 12.13356 91.94791 -8.45983  1.000 110.94388 ? 303 HIS A CE1 1 
ATOM   2039 N NE2 . HIS A 1 303 ? 12.05656 91.75708 -9.76618  1.000 110.93941 ? 303 HIS A NE2 1 
ATOM   2040 N N   . VAL A 1 304 ? 10.50920 87.96449 -6.18573  1.000 81.36006  ? 304 VAL A N   1 
ATOM   2041 C CA  . VAL A 1 304 ? 11.57087 87.68683 -5.21053  1.000 71.61573  ? 304 VAL A CA  1 
ATOM   2042 C C   . VAL A 1 304 ? 12.18487 86.31593 -5.47064  1.000 65.95291  ? 304 VAL A C   1 
ATOM   2043 O O   . VAL A 1 304 ? 13.39900 86.11986 -5.35598  1.000 64.29706  ? 304 VAL A O   1 
ATOM   2044 C CB  . VAL A 1 304 ? 11.02133 87.80860 -3.77353  1.000 69.22356  ? 304 VAL A CB  1 
ATOM   2045 C CG1 . VAL A 1 304 ? 12.03206 87.31251 -2.75088  1.000 70.28761  ? 304 VAL A CG1 1 
ATOM   2046 C CG2 . VAL A 1 304 ? 10.62717 89.25732 -3.46882  1.000 74.26905  ? 304 VAL A CG2 1 
ATOM   2047 N N   . MET A 1 305 ? 11.36613 85.35966 -5.86875  1.000 69.21013  ? 305 MET A N   1 
ATOM   2048 C CA  . MET A 1 305 ? 11.88182 84.03387 -6.16167  1.000 74.12678  ? 305 MET A CA  1 
ATOM   2049 C C   . MET A 1 305 ? 12.65020 83.98588 -7.48267  1.000 76.83526  ? 305 MET A C   1 
ATOM   2050 O O   . MET A 1 305 ? 13.64945 83.26337 -7.58833  1.000 78.59929  ? 305 MET A O   1 
ATOM   2051 C CB  . MET A 1 305 ? 10.72064 83.05200 -6.17177  1.000 75.49573  ? 305 MET A CB  1 
ATOM   2052 C CG  . MET A 1 305 ? 9.94506  83.00160 -4.87270  1.000 73.81349  ? 305 MET A CG  1 
ATOM   2053 S SD  . MET A 1 305 ? 10.87274 82.62221 -3.36264  1.000 68.97527  ? 305 MET A SD  1 
ATOM   2054 C CE  . MET A 1 305 ? 11.93859 81.28572 -3.88454  1.000 48.95686  ? 305 MET A CE  1 
ATOM   2055 N N   . SER A 1 306 ? 12.18618 84.69699 -8.51379  1.000 77.97744  ? 306 SER A N   1 
ATOM   2056 C CA  . SER A 1 306 ? 12.98459 84.79146 -9.73009  1.000 79.32790  ? 306 SER A CA  1 
ATOM   2057 C C   . SER A 1 306 ? 14.37123 85.30598 -9.39434  1.000 69.15278  ? 306 SER A C   1 
ATOM   2058 O O   . SER A 1 306 ? 15.38484 84.68746 -9.75591  1.000 61.41881  ? 306 SER A O   1 
ATOM   2059 C CB  . SER A 1 306 ? 12.31797 85.72320 -10.74246 1.000 89.36166  ? 306 SER A CB  1 
ATOM   2060 O OG  . SER A 1 306 ? 10.96497 85.38030 -10.94069 1.000 96.49723  ? 306 SER A OG  1 
ATOM   2061 N N   . CYS A 1 307 ? 14.41852 86.43585 -8.66593  1.000 62.71677  ? 307 CYS A N   1 
ATOM   2062 C CA  . CYS A 1 307 ? 15.67291 87.04759 -8.23266  1.000 71.60044  ? 307 CYS A CA  1 
ATOM   2063 C C   . CYS A 1 307 ? 16.58367 86.00054 -7.58996  1.000 74.93005  ? 307 CYS A C   1 
ATOM   2064 O O   . CYS A 1 307 ? 17.75958 85.90007 -7.94849  1.000 80.48166  ? 307 CYS A O   1 
ATOM   2065 C CB  . CYS A 1 307 ? 15.38955 88.22739 -7.27670  1.000 72.98680  ? 307 CYS A CB  1 
ATOM   2066 S SG  . CYS A 1 307 ? 16.74977 89.23585 -6.80834  1.000 83.14543  ? 307 CYS A SG  1 
ATOM   2067 N N   . MET A 1 308 ? 16.03291 85.16436 -6.68732  1.000 62.73053  ? 308 MET A N   1 
ATOM   2068 C CA  . MET A 1 308 ? 16.80330 84.16078 -5.95686  1.000 66.77205  ? 308 MET A CA  1 
ATOM   2069 C C   . MET A 1 308 ? 17.19425 82.97652 -6.82659  1.000 69.23868  ? 308 MET A C   1 
ATOM   2070 O O   . MET A 1 308 ? 18.13619 82.25299 -6.48506  1.000 66.41589  ? 308 MET A O   1 
ATOM   2071 C CB  . MET A 1 308 ? 16.00177 83.67805 -4.74177  1.000 64.32246  ? 308 MET A CB  1 
ATOM   2072 C CG  . MET A 1 308 ? 16.00130 84.65266 -3.56637  1.000 67.07852  ? 308 MET A CG  1 
ATOM   2073 S SD  . MET A 1 308 ? 17.67025 84.92829 -2.95838  1.000 71.07032  ? 308 MET A SD  1 
ATOM   2074 C CE  . MET A 1 308 ? 18.02728 83.35788 -2.17815  1.000 58.32221  ? 308 MET A CE  1 
ATOM   2075 N N   . ARG A 1 309 ? 16.49833 82.75378 -7.93388  1.000 71.43521  ? 309 ARG A N   1 
ATOM   2076 C CA  . ARG A 1 309 ? 16.93482 81.72688 -8.86462  1.000 73.17791  ? 309 ARG A CA  1 
ATOM   2077 C C   . ARG A 1 309 ? 17.89721 82.25350 -9.91396  1.000 82.82587  ? 309 ARG A C   1 
ATOM   2078 O O   . ARG A 1 309 ? 18.49765 81.44741 -10.63081 1.000 87.61096  ? 309 ARG A O   1 
ATOM   2079 C CB  . ARG A 1 309 ? 15.73839 81.08161 -9.54510  1.000 62.77340  ? 309 ARG A CB  1 
ATOM   2080 C CG  . ARG A 1 309 ? 15.02081 80.12987 -8.63365  1.000 73.02297  ? 309 ARG A CG  1 
ATOM   2081 C CD  . ARG A 1 309 ? 13.79269 79.59186 -9.29996  1.000 75.13285  ? 309 ARG A CD  1 
ATOM   2082 N NE  . ARG A 1 309 ? 12.59218 79.82696 -8.51690  1.000 64.64788  ? 309 ARG A NE  1 
ATOM   2083 C CZ  . ARG A 1 309 ? 12.10325 78.92738 -7.68526  1.000 65.83739  ? 309 ARG A CZ  1 
ATOM   2084 N NH1 . ARG A 1 309 ? 11.00527 79.16990 -6.99749  1.000 73.71399  ? 309 ARG A NH1 1 
ATOM   2085 N NH2 . ARG A 1 309 ? 12.72778 77.77602 -7.54217  1.000 65.92105  ? 309 ARG A NH2 1 
ATOM   2086 N N   . SER A 1 310 ? 18.04776 83.57713 -10.02536 1.000 80.12261  ? 310 SER A N   1 
ATOM   2087 C CA  . SER A 1 310 ? 19.09071 84.16699 -10.85629 1.000 83.64122  ? 310 SER A CA  1 
ATOM   2088 C C   . SER A 1 310 ? 20.41993 84.28978 -10.12496 1.000 82.11173  ? 310 SER A C   1 
ATOM   2089 O O   . SER A 1 310 ? 21.45957 84.43723 -10.77857 1.000 85.74024  ? 310 SER A O   1 
ATOM   2090 C CB  . SER A 1 310 ? 18.65715 85.54796 -11.34285 1.000 84.94741  ? 310 SER A CB  1 
ATOM   2091 O OG  . SER A 1 310 ? 17.27308 85.55355 -11.63141 1.000 92.93818  ? 310 SER A OG  1 
ATOM   2092 N N   . VAL A 1 311 ? 20.40045 84.25045 -8.78956  1.000 71.45063  ? 311 VAL A N   1 
ATOM   2093 C CA  . VAL A 1 311 ? 21.62662 84.35943 -8.01621  1.000 69.68551  ? 311 VAL A CA  1 
ATOM   2094 C C   . VAL A 1 311 ? 22.51462 83.16394 -8.31715  1.000 73.72998  ? 311 VAL A C   1 
ATOM   2095 O O   . VAL A 1 311 ? 22.03911 82.02337 -8.42555  1.000 74.63462  ? 311 VAL A O   1 
ATOM   2096 C CB  . VAL A 1 311 ? 21.29691 84.44238 -6.51572  1.000 67.62466  ? 311 VAL A CB  1 
ATOM   2097 C CG1 . VAL A 1 311 ? 22.55779 84.28458 -5.68107  1.000 68.07488  ? 311 VAL A CG1 1 
ATOM   2098 C CG2 . VAL A 1 311 ? 20.57697 85.75282 -6.18370  1.000 65.23712  ? 311 VAL A CG2 1 
ATOM   2099 N N   . ASP A 1 312 ? 23.81430 83.41408 -8.46524  1.000 61.93577  ? 312 ASP A N   1 
ATOM   2100 C CA  . ASP A 1 312 ? 24.73314 82.29910 -8.62968  1.000 66.38070  ? 312 ASP A CA  1 
ATOM   2101 C C   . ASP A 1 312 ? 24.71640 81.41903 -7.38327  1.000 66.69227  ? 312 ASP A C   1 
ATOM   2102 O O   . ASP A 1 312 ? 24.57568 81.90075 -6.24825  1.000 69.08169  ? 312 ASP A O   1 
ATOM   2103 C CB  . ASP A 1 312 ? 26.14188 82.80909 -8.93038  1.000 80.68470  ? 312 ASP A CB  1 
ATOM   2104 C CG  . ASP A 1 312 ? 26.29937 83.27151 -10.38609 1.000 99.92200  ? 312 ASP A CG  1 
ATOM   2105 O OD1 . ASP A 1 312 ? 26.77249 84.40784 -10.59960 1.000 107.09871 ? 312 ASP A OD1 1 
ATOM   2106 O OD2 . ASP A 1 312 ? 25.94440 82.50961 -11.32132 1.000 103.14363 ? 312 ASP A OD2 1 
ATOM   2107 N N   . ALA A 1 313 ? 24.82250 80.11062 -7.60185  1.000 62.63994  ? 313 ALA A N   1 
ATOM   2108 C CA  . ALA A 1 313 ? 24.78529 79.18532 -6.47595  1.000 64.47131  ? 313 ALA A CA  1 
ATOM   2109 C C   . ALA A 1 313 ? 25.88327 79.50053 -5.46530  1.000 75.11593  ? 313 ALA A C   1 
ATOM   2110 O O   . ALA A 1 313 ? 25.67821 79.36552 -4.25306  1.000 85.18319  ? 313 ALA A O   1 
ATOM   2111 C CB  . ALA A 1 313 ? 24.89700 77.74173 -6.97058  1.000 51.49955  ? 313 ALA A CB  1 
ATOM   2112 N N   . LYS A 1 314 ? 27.05410 79.93001 -5.94019  1.000 77.57217  ? 314 LYS A N   1 
ATOM   2113 C CA  . LYS A 1 314 ? 28.14004 80.24507 -5.01810  1.000 80.36811  ? 314 LYS A CA  1 
ATOM   2114 C C   . LYS A 1 314 ? 27.74110 81.35477 -4.05278  1.000 85.38761  ? 314 LYS A C   1 
ATOM   2115 O O   . LYS A 1 314 ? 28.12117 81.32914 -2.87591  1.000 93.42918  ? 314 LYS A O   1 
ATOM   2116 C CB  . LYS A 1 314 ? 29.39897 80.62564 -5.79332  1.000 78.92211  ? 314 LYS A CB  1 
ATOM   2117 C CG  . LYS A 1 314 ? 30.60772 80.88487 -4.90790  1.000 88.51918  ? 314 LYS A CG  1 
ATOM   2118 C CD  . LYS A 1 314 ? 31.25383 79.58282 -4.42967  1.000 90.06746  ? 314 LYS A CD  1 
ATOM   2119 C CE  . LYS A 1 314 ? 32.53770 79.84058 -3.64403  1.000 86.20401  ? 314 LYS A CE  1 
ATOM   2120 N NZ  . LYS A 1 314 ? 33.38120 78.61656 -3.51897  1.000 81.29996  ? 314 LYS A NZ  1 
ATOM   2121 N N   . THR A 1 315 ? 26.95365 82.32328 -4.52079  1.000 80.67733  ? 315 THR A N   1 
ATOM   2122 C CA  . THR A 1 315 ? 26.53788 83.40973 -3.64241  1.000 78.40958  ? 315 THR A CA  1 
ATOM   2123 C C   . THR A 1 315 ? 25.62409 82.89788 -2.53522  1.000 77.48863  ? 315 THR A C   1 
ATOM   2124 O O   . THR A 1 315 ? 25.82309 83.21981 -1.35658  1.000 79.97096  ? 315 THR A O   1 
ATOM   2125 C CB  . THR A 1 315 ? 25.85698 84.51270 -4.45045  1.000 76.80860  ? 315 THR A CB  1 
ATOM   2126 O OG1 . THR A 1 315 ? 26.80236 85.08609 -5.36275  1.000 82.50532  ? 315 THR A OG1 1 
ATOM   2127 C CG2 . THR A 1 315 ? 25.32913 85.60351 -3.52328  1.000 72.21603  ? 315 THR A CG2 1 
ATOM   2128 N N   . ILE A 1 316 ? 24.61485 82.09884 -2.89245  1.000 68.41408  ? 316 ILE A N   1 
ATOM   2129 C CA  . ILE A 1 316 ? 23.81485 81.42714 -1.87315  1.000 65.73896  ? 316 ILE A CA  1 
ATOM   2130 C C   . ILE A 1 316 ? 24.71755 80.59082 -0.97557  1.000 69.67922  ? 316 ILE A C   1 
ATOM   2131 O O   . ILE A 1 316 ? 24.61032 80.62939 0.25677   1.000 69.36158  ? 316 ILE A O   1 
ATOM   2132 C CB  . ILE A 1 316 ? 22.72242 80.55846 -2.52499  1.000 59.87996  ? 316 ILE A CB  1 
ATOM   2133 C CG1 . ILE A 1 316 ? 21.69284 81.41495 -3.26832  1.000 56.39652  ? 316 ILE A CG1 1 
ATOM   2134 C CG2 . ILE A 1 316 ? 22.04215 79.65646 -1.48112  1.000 56.81060  ? 316 ILE A CG2 1 
ATOM   2135 C CD1 . ILE A 1 316 ? 20.83136 80.59810 -4.24086  1.000 53.49838  ? 316 ILE A CD1 1 
ATOM   2136 N N   . SER A 1 317 ? 25.63724 79.83976 -1.59464  1.000 70.22830  ? 317 SER A N   1 
ATOM   2137 C CA  . SER A 1 317 ? 26.53022 78.94927 -0.86618  1.000 74.50231  ? 317 SER A CA  1 
ATOM   2138 C C   . SER A 1 317 ? 27.26437 79.67447 0.25257   1.000 79.50857  ? 317 SER A C   1 
ATOM   2139 O O   . SER A 1 317 ? 27.55029 79.07997 1.30077   1.000 84.76063  ? 317 SER A O   1 
ATOM   2140 C CB  . SER A 1 317 ? 27.52649 78.31455 -1.83978  1.000 76.49582  ? 317 SER A CB  1 
ATOM   2141 O OG  . SER A 1 317 ? 28.49275 77.53447 -1.15658  1.000 74.02354  ? 317 SER A OG  1 
ATOM   2142 N N   . VAL A 1 318 ? 27.54304 80.95916 0.06741   1.000 70.54868  ? 318 VAL A N   1 
ATOM   2143 C CA  . VAL A 1 318 ? 28.27750 81.73579 1.05883   1.000 67.15905  ? 318 VAL A CA  1 
ATOM   2144 C C   . VAL A 1 318 ? 27.33813 82.48632 1.99719   1.000 77.16466  ? 318 VAL A C   1 
ATOM   2145 O O   . VAL A 1 318 ? 27.45472 82.39134 3.22232   1.000 78.21653  ? 318 VAL A O   1 
ATOM   2146 C CB  . VAL A 1 318 ? 29.23649 82.68750 0.32676   1.000 69.20341  ? 318 VAL A CB  1 
ATOM   2147 C CG1 . VAL A 1 318 ? 29.93605 83.59113 1.29840   1.000 72.06085  ? 318 VAL A CG1 1 
ATOM   2148 C CG2 . VAL A 1 318 ? 30.23649 81.87633 -0.48237  1.000 69.08312  ? 318 VAL A CG2 1 
ATOM   2149 N N   . GLN A 1 319 ? 26.38252 83.22839 1.43587   1.000 80.91951  ? 319 GLN A N   1 
ATOM   2150 C CA  . GLN A 1 319 ? 25.52663 84.10838 2.22575   1.000 78.21662  ? 319 GLN A CA  1 
ATOM   2151 C C   . GLN A 1 319 ? 24.60988 83.36084 3.18708   1.000 74.31495  ? 319 GLN A C   1 
ATOM   2152 O O   . GLN A 1 319 ? 24.13926 83.96237 4.16417   1.000 71.45781  ? 319 GLN A O   1 
ATOM   2153 C CB  . GLN A 1 319 ? 24.68436 84.97607 1.29249   1.000 69.77548  ? 319 GLN A CB  1 
ATOM   2154 C CG  . GLN A 1 319 ? 25.50208 85.93124 0.48515   1.000 72.12944  ? 319 GLN A CG  1 
ATOM   2155 C CD  . GLN A 1 319 ? 26.40382 86.78904 1.34972   1.000 79.20585  ? 319 GLN A CD  1 
ATOM   2156 O OE1 . GLN A 1 319 ? 25.93837 87.68018 2.06573   1.000 87.84065  ? 319 GLN A OE1 1 
ATOM   2157 N NE2 . GLN A 1 319 ? 27.70582 86.53384 1.27807   1.000 74.11582  ? 319 GLN A NE2 1 
ATOM   2158 N N   . GLN A 1 320 ? 24.30648 82.08655 2.91791   1.000 68.36651  ? 320 GLN A N   1 
ATOM   2159 C CA  . GLN A 1 320 ? 23.50810 81.32861 3.87476   1.000 68.78192  ? 320 GLN A CA  1 
ATOM   2160 C C   . GLN A 1 320 ? 24.22971 81.21496 5.21158   1.000 65.97814  ? 320 GLN A C   1 
ATOM   2161 O O   . GLN A 1 320 ? 23.58592 81.14649 6.26229   1.000 70.35527  ? 320 GLN A O   1 
ATOM   2162 C CB  . GLN A 1 320 ? 23.18892 79.94125 3.32142   1.000 61.71801  ? 320 GLN A CB  1 
ATOM   2163 C CG  . GLN A 1 320 ? 24.37999 79.02001 3.36952   1.000 60.02714  ? 320 GLN A CG  1 
ATOM   2164 C CD  . GLN A 1 320 ? 24.14100 77.69688 2.70661   1.000 59.67446  ? 320 GLN A CD  1 
ATOM   2165 O OE1 . GLN A 1 320 ? 23.01054 77.20226 2.64168   1.000 62.17112  ? 320 GLN A OE1 1 
ATOM   2166 N NE2 . GLN A 1 320 ? 25.21223 77.11102 2.18815   1.000 52.95432  ? 320 GLN A NE2 1 
ATOM   2167 N N   . TRP A 1 321 ? 25.56185 81.23894 5.19389   1.000 62.10416  ? 321 TRP A N   1 
ATOM   2168 C CA  . TRP A 1 321 ? 26.33161 81.07972 6.41436   1.000 70.37211  ? 321 TRP A CA  1 
ATOM   2169 C C   . TRP A 1 321 ? 26.32466 82.32255 7.28974   1.000 73.62057  ? 321 TRP A C   1 
ATOM   2170 O O   . TRP A 1 321 ? 26.67543 82.22056 8.47014   1.000 78.91091  ? 321 TRP A O   1 
ATOM   2171 C CB  . TRP A 1 321 ? 27.76613 80.68352 6.08124   1.000 71.59193  ? 321 TRP A CB  1 
ATOM   2172 C CG  . TRP A 1 321 ? 27.88972 79.22681 5.77214   1.000 68.31262  ? 321 TRP A CG  1 
ATOM   2173 C CD1 . TRP A 1 321 ? 28.04083 78.66137 4.54317   1.000 65.39602  ? 321 TRP A CD1 1 
ATOM   2174 C CD2 . TRP A 1 321 ? 27.85039 78.14420 6.71044   1.000 69.57195  ? 321 TRP A CD2 1 
ATOM   2175 N NE1 . TRP A 1 321 ? 28.11362 77.29396 4.65622   1.000 65.94636  ? 321 TRP A NE1 1 
ATOM   2176 C CE2 . TRP A 1 321 ? 27.99680 76.94939 5.97560   1.000 70.95578  ? 321 TRP A CE2 1 
ATOM   2177 C CE3 . TRP A 1 321 ? 27.72340 78.06970 8.09951   1.000 60.08659  ? 321 TRP A CE3 1 
ATOM   2178 C CZ2 . TRP A 1 321 ? 28.01363 75.69527 6.58300   1.000 69.40646  ? 321 TRP A CZ2 1 
ATOM   2179 C CZ3 . TRP A 1 321 ? 27.74658 76.82816 8.69826   1.000 52.11608  ? 321 TRP A CZ3 1 
ATOM   2180 C CH2 . TRP A 1 321 ? 27.88714 75.65705 7.94244   1.000 60.17411  ? 321 TRP A CH2 1 
ATOM   2181 N N   . ASN A 1 322 ? 25.91481 83.48019 6.75683   1.000 66.93512  ? 322 ASN A N   1 
ATOM   2182 C CA  . ASN A 1 322 ? 25.76350 84.66368 7.60175   1.000 70.41925  ? 322 ASN A CA  1 
ATOM   2183 C C   . ASN A 1 322 ? 24.83235 84.40967 8.77648   1.000 79.64708  ? 322 ASN A C   1 
ATOM   2184 O O   . ASN A 1 322 ? 24.96165 85.05745 9.82079   1.000 84.54125  ? 322 ASN A O   1 
ATOM   2185 C CB  . ASN A 1 322 ? 25.23498 85.83976 6.79369   1.000 70.07304  ? 322 ASN A CB  1 
ATOM   2186 C CG  . ASN A 1 322 ? 26.18131 86.26318 5.72177   1.000 78.78202  ? 322 ASN A CG  1 
ATOM   2187 O OD1 . ASN A 1 322 ? 27.23284 85.65473 5.54027   1.000 84.11565  ? 322 ASN A OD1 1 
ATOM   2188 N ND2 . ASN A 1 322 ? 25.82067 87.30911 4.99494   1.000 83.33223  ? 322 ASN A ND2 1 
ATOM   2189 N N   . SER A 1 323 ? 23.88960 83.48200 8.62601   1.000 82.04643  ? 323 SER A N   1 
ATOM   2190 C CA  . SER A 1 323 ? 22.92565 83.16996 9.66675   1.000 87.40516  ? 323 SER A CA  1 
ATOM   2191 C C   . SER A 1 323 ? 23.42728 82.09519 10.62476  1.000 90.50338  ? 323 SER A C   1 
ATOM   2192 O O   . SER A 1 323 ? 22.62153 81.47384 11.32971  1.000 86.32865  ? 323 SER A O   1 
ATOM   2193 C CB  . SER A 1 323 ? 21.59704 82.75283 9.03439   1.000 90.73144  ? 323 SER A CB  1 
ATOM   2194 O OG  . SER A 1 323 ? 20.79941 83.89102 8.74126   1.000 97.58731  ? 323 SER A OG  1 
ATOM   2195 N N   . TYR A 1 324 ? 24.73710 81.86865 10.66936  1.000 95.71122  ? 324 TYR A N   1 
ATOM   2196 C CA  . TYR A 1 324 ? 25.34353 80.88921 11.57028  1.000 94.75052  ? 324 TYR A CA  1 
ATOM   2197 C C   . TYR A 1 324 ? 26.02632 81.64562 12.70643  1.000 99.01513  ? 324 TYR A C   1 
ATOM   2198 O O   . TYR A 1 324 ? 27.17630 82.07317 12.58481  1.000 102.96314 ? 324 TYR A O   1 
ATOM   2199 C CB  . TYR A 1 324 ? 26.33367 80.00617 10.81478  1.000 91.66644  ? 324 TYR A CB  1 
ATOM   2200 C CG  . TYR A 1 324 ? 27.08044 78.99699 11.67123  1.000 92.88816  ? 324 TYR A CG  1 
ATOM   2201 C CD1 . TYR A 1 324 ? 26.42262 77.91622 12.24594  1.000 94.92227  ? 324 TYR A CD1 1 
ATOM   2202 C CD2 . TYR A 1 324 ? 28.44552 79.12928 11.90804  1.000 97.73042  ? 324 TYR A CD2 1 
ATOM   2203 C CE1 . TYR A 1 324 ? 27.10539 76.99320 13.03007  1.000 98.16375  ? 324 TYR A CE1 1 
ATOM   2204 C CE2 . TYR A 1 324 ? 29.13505 78.21265 12.69317  1.000 98.68777  ? 324 TYR A CE2 1 
ATOM   2205 C CZ  . TYR A 1 324 ? 28.46272 77.14917 13.24927  1.000 99.50827  ? 324 TYR A CZ  1 
ATOM   2206 O OH  . TYR A 1 324 ? 29.15567 76.24611 14.02290  1.000 99.82296  ? 324 TYR A OH  1 
ATOM   2207 N N   . SER A 1 325 ? 25.31018 81.82933 13.81622  1.000 98.68197  ? 325 SER A N   1 
ATOM   2208 C CA  . SER A 1 325 ? 25.92692 82.27477 15.06067  1.000 104.30854 ? 325 SER A CA  1 
ATOM   2209 C C   . SER A 1 325 ? 25.45275 81.36602 16.17808  1.000 95.58449  ? 325 SER A C   1 
ATOM   2210 O O   . SER A 1 325 ? 24.24381 81.19560 16.38117  1.000 95.88163  ? 325 SER A O   1 
ATOM   2211 C CB  . SER A 1 325 ? 25.61451 83.73385 15.37835  1.000 111.45586 ? 325 SER A CB  1 
ATOM   2212 O OG  . SER A 1 325 ? 26.61475 84.21365 16.25166  1.000 116.40566 ? 325 SER A OG  1 
ATOM   2213 N N   . GLY A 1 326 ? 26.40099 80.77290 16.88630  1.000 83.58081  ? 326 GLY A N   1 
ATOM   2214 C CA  . GLY A 1 326 ? 26.08608 79.64772 17.73407  1.000 77.64330  ? 326 GLY A CA  1 
ATOM   2215 C C   . GLY A 1 326 ? 26.74615 78.39279 17.20478  1.000 74.40389  ? 326 GLY A C   1 
ATOM   2216 O O   . GLY A 1 326 ? 26.52444 78.00580 16.04532  1.000 65.91387  ? 326 GLY A O   1 
ATOM   2217 N N   . ILE A 1 327 ? 27.60208 77.78109 18.03186  1.000 69.44212  ? 327 ILE A N   1 
ATOM   2218 C CA  . ILE A 1 327 ? 28.16587 76.48377 17.68775  1.000 67.41699  ? 327 ILE A CA  1 
ATOM   2219 C C   . ILE A 1 327 ? 27.02371 75.48296 17.55194  1.000 70.74264  ? 327 ILE A C   1 
ATOM   2220 O O   . ILE A 1 327 ? 26.07079 75.48418 18.34382  1.000 76.86785  ? 327 ILE A O   1 
ATOM   2221 C CB  . ILE A 1 327 ? 29.19605 76.04577 18.74391  1.000 68.96399  ? 327 ILE A CB  1 
ATOM   2222 C CG1 . ILE A 1 327 ? 29.90723 74.75848 18.31699  1.000 67.15995  ? 327 ILE A CG1 1 
ATOM   2223 C CG2 . ILE A 1 327 ? 28.53262 75.87428 20.11124  1.000 70.30377  ? 327 ILE A CG2 1 
ATOM   2224 C CD1 . ILE A 1 327 ? 30.87744 74.20545 19.36092  1.000 67.79953  ? 327 ILE A CD1 1 
ATOM   2225 N N   . LEU A 1 328 ? 27.07755 74.66917 16.49560  1.000 67.88987  ? 328 LEU A N   1 
ATOM   2226 C CA  . LEU A 1 328 ? 26.13353 73.57195 16.27834  1.000 67.05613  ? 328 LEU A CA  1 
ATOM   2227 C C   . LEU A 1 328 ? 24.71128 74.05423 16.03650  1.000 68.41703  ? 328 LEU A C   1 
ATOM   2228 O O   . LEU A 1 328 ? 23.75497 73.37910 16.41583  1.000 76.23441  ? 328 LEU A O   1 
ATOM   2229 C CB  . LEU A 1 328 ? 26.13425 72.59042 17.45385  1.000 68.22403  ? 328 LEU A CB  1 
ATOM   2230 C CG  . LEU A 1 328 ? 27.12310 71.42865 17.45961  1.000 75.54503  ? 328 LEU A CG  1 
ATOM   2231 C CD1 . LEU A 1 328 ? 26.66657 70.34933 16.52502  1.000 71.97151  ? 328 LEU A CD1 1 
ATOM   2232 C CD2 . LEU A 1 328 ? 28.44600 71.91268 17.02722  1.000 85.12006  ? 328 LEU A CD2 1 
ATOM   2233 N N   . SER A 1 329 ? 24.53365 75.20970 15.42161  1.000 64.58513  ? 329 SER A N   1 
ATOM   2234 C CA  . SER A 1 329 ? 23.17289 75.69009 15.16331  1.000 67.14528  ? 329 SER A CA  1 
ATOM   2235 C C   . SER A 1 329 ? 23.13465 76.22254 13.71893  1.000 61.80535  ? 329 SER A C   1 
ATOM   2236 O O   . SER A 1 329 ? 23.16168 77.42813 13.44316  1.000 56.60184  ? 329 SER A O   1 
ATOM   2237 C CB  . SER A 1 329 ? 22.77625 76.72202 16.21824  1.000 61.52397  ? 329 SER A CB  1 
ATOM   2238 O OG  . SER A 1 329 ? 21.80106 77.60630 15.73264  1.000 68.32659  ? 329 SER A OG  1 
ATOM   2239 N N   . PHE A 1 330 ? 23.05502 75.30713 12.78172  1.000 66.33490  ? 330 PHE A N   1 
ATOM   2240 C CA  . PHE A 1 330 ? 23.16746 75.66369 11.37589  1.000 65.60497  ? 330 PHE A CA  1 
ATOM   2241 C C   . PHE A 1 330 ? 21.89645 76.33225 10.86349  1.000 57.36282  ? 330 PHE A C   1 
ATOM   2242 O O   . PHE A 1 330 ? 20.80693 76.07655 11.38166  1.000 52.43211  ? 330 PHE A O   1 
ATOM   2243 C CB  . PHE A 1 330 ? 23.46717 74.42256 10.56980  1.000 62.16168  ? 330 PHE A CB  1 
ATOM   2244 C CG  . PHE A 1 330 ? 24.47287 73.55617 11.22532  1.000 64.78354  ? 330 PHE A CG  1 
ATOM   2245 C CD1 . PHE A 1 330 ? 25.79208 73.97998 11.31839  1.000 64.88180  ? 330 PHE A CD1 1 
ATOM   2246 C CD2 . PHE A 1 330 ? 24.10534 72.34761 11.80270  1.000 57.37097  ? 330 PHE A CD2 1 
ATOM   2247 C CE1 . PHE A 1 330 ? 26.74234 73.19608 11.93960  1.000 60.75960  ? 330 PHE A CE1 1 
ATOM   2248 C CE2 . PHE A 1 330 ? 25.05304 71.54932 12.41942  1.000 50.05293  ? 330 PHE A CE2 1 
ATOM   2249 C CZ  . PHE A 1 330 ? 26.37512 71.97853 12.48963  1.000 55.88566  ? 330 PHE A CZ  1 
ATOM   2250 N N   . PRO A 1 331 ? 22.02170 77.20237 9.85002   1.000 61.89531  ? 331 PRO A N   1 
ATOM   2251 C CA  . PRO A 1 331 ? 20.83077 77.85384 9.25738   1.000 61.52787  ? 331 PRO A CA  1 
ATOM   2252 C C   . PRO A 1 331 ? 19.89692 76.90707 8.52562   1.000 52.94957  ? 331 PRO A C   1 
ATOM   2253 O O   . PRO A 1 331 ? 18.79472 77.32332 8.14676   1.000 56.92282  ? 331 PRO A O   1 
ATOM   2254 C CB  . PRO A 1 331 ? 21.42945 78.87569 8.27659   1.000 63.47265  ? 331 PRO A CB  1 
ATOM   2255 C CG  . PRO A 1 331 ? 22.87118 79.00352 8.66300   1.000 66.21222  ? 331 PRO A CG  1 
ATOM   2256 C CD  . PRO A 1 331 ? 23.27715 77.69479 9.26393   1.000 62.27018  ? 331 PRO A CD  1 
ATOM   2257 N N   . SER A 1 332 ? 20.29685 75.66767 8.28493   1.000 51.37783  ? 332 SER A N   1 
ATOM   2258 C CA  . SER A 1 332 ? 19.43753 74.71339 7.60530   1.000 56.34534  ? 332 SER A CA  1 
ATOM   2259 C C   . SER A 1 332 ? 19.25300 73.50257 8.49568   1.000 53.89417  ? 332 SER A C   1 
ATOM   2260 O O   . SER A 1 332 ? 20.22235 72.97878 9.04935   1.000 58.99534  ? 332 SER A O   1 
ATOM   2261 C CB  . SER A 1 332 ? 20.00853 74.29868 6.24544   1.000 56.74013  ? 332 SER A CB  1 
ATOM   2262 O OG  . SER A 1 332 ? 20.54637 75.41118 5.52706   1.000 56.35306  ? 332 SER A OG  1 
ATOM   2263 N N   . ALA A 1 333 ? 18.02531 73.06418 8.62106   1.000 50.85430  ? 333 ALA A N   1 
ATOM   2264 C CA  . ALA A 1 333 ? 17.74497 71.90918 9.45365   1.000 51.76361  ? 333 ALA A CA  1 
ATOM   2265 C C   . ALA A 1 333 ? 16.34847 71.41824 9.13193   1.000 47.65598  ? 333 ALA A C   1 
ATOM   2266 O O   . ALA A 1 333 ? 15.51433 72.19957 8.66373   1.000 50.02673  ? 333 ALA A O   1 
ATOM   2267 C CB  . ALA A 1 333 ? 17.84921 72.26796 10.93833  1.000 52.63659  ? 333 ALA A CB  1 
ATOM   2268 N N   . PRO A 1 334 ? 16.05843 70.16180 9.36867   1.000 44.75493  ? 334 PRO A N   1 
ATOM   2269 C CA  . PRO A 1 334 ? 14.67033 69.70342 9.28750   1.000 41.36866  ? 334 PRO A CA  1 
ATOM   2270 C C   . PRO A 1 334 ? 13.73207 70.66978 9.98566   1.000 50.85862  ? 334 PRO A C   1 
ATOM   2271 O O   . PRO A 1 334 ? 13.91268 70.99586 11.16969  1.000 53.06969  ? 334 PRO A O   1 
ATOM   2272 C CB  . PRO A 1 334 ? 14.72394 68.34050 9.98128   1.000 40.36162  ? 334 PRO A CB  1 
ATOM   2273 C CG  . PRO A 1 334 ? 16.09468 67.85087 9.71846   1.000 29.84265  ? 334 PRO A CG  1 
ATOM   2274 C CD  . PRO A 1 334 ? 16.97957 69.06772 9.71880   1.000 47.74304  ? 334 PRO A CD  1 
ATOM   2275 N N   . THR A 1 335 ? 12.75417 71.16872 9.23198   1.000 55.14914  ? 335 THR A N   1 
ATOM   2276 C CA  . THR A 1 335 ? 11.91465 72.28676 9.64021   1.000 50.63780  ? 335 THR A CA  1 
ATOM   2277 C C   . THR A 1 335 ? 10.48184 71.81414 9.84124   1.000 51.29872  ? 335 THR A C   1 
ATOM   2278 O O   . THR A 1 335 ? 9.96576  71.03064 9.03850   1.000 48.76204  ? 335 THR A O   1 
ATOM   2279 C CB  . THR A 1 335 ? 11.96417 73.39954 8.58207   1.000 54.04433  ? 335 THR A CB  1 
ATOM   2280 O OG1 . THR A 1 335 ? 13.32864 73.80710 8.36996   1.000 48.10397  ? 335 THR A OG1 1 
ATOM   2281 C CG2 . THR A 1 335 ? 11.10354 74.62361 8.99978   1.000 53.32481  ? 335 THR A CG2 1 
ATOM   2282 N N   . ILE A 1 336 ? 9.84040  72.28274 10.91995  1.000 54.61466  ? 336 ILE A N   1 
ATOM   2283 C CA  . ILE A 1 336 ? 8.43267  71.96934 11.16765  1.000 52.16998  ? 336 ILE A CA  1 
ATOM   2284 C C   . ILE A 1 336 ? 7.59566  72.58120 10.05150  1.000 51.29921  ? 336 ILE A C   1 
ATOM   2285 O O   . ILE A 1 336 ? 7.42211  73.80244 9.99257   1.000 55.29050  ? 336 ILE A O   1 
ATOM   2286 C CB  . ILE A 1 336 ? 7.95291  72.47783 12.54598  1.000 63.06584  ? 336 ILE A CB  1 
ATOM   2287 C CG1 . ILE A 1 336 ? 8.95826  72.14609 13.64504  1.000 65.60786  ? 336 ILE A CG1 1 
ATOM   2288 C CG2 . ILE A 1 336 ? 6.60011  71.86820 12.91240  1.000 56.91815  ? 336 ILE A CG2 1 
ATOM   2289 C CD1 . ILE A 1 336 ? 9.18112  70.68163 13.80358  1.000 61.47235  ? 336 ILE A CD1 1 
ATOM   2290 N N   . ASP A 1 337 ? 7.06959  71.74578 9.15671   1.000 52.48230  ? 337 ASP A N   1 
ATOM   2291 C CA  . ASP A 1 337 ? 6.37328  72.23798 7.97408   1.000 54.06735  ? 337 ASP A CA  1 
ATOM   2292 C C   . ASP A 1 337 ? 4.92986  71.77460 7.87762   1.000 61.47387  ? 337 ASP A C   1 
ATOM   2293 O O   . ASP A 1 337 ? 4.24145  72.16692 6.93139   1.000 64.36179  ? 337 ASP A O   1 
ATOM   2294 C CB  . ASP A 1 337 ? 7.12425  71.83721 6.69576   1.000 50.94282  ? 337 ASP A CB  1 
ATOM   2295 C CG  . ASP A 1 337 ? 7.36414  70.33421 6.59091   1.000 60.72812  ? 337 ASP A CG  1 
ATOM   2296 O OD1 . ASP A 1 337 ? 6.70208  69.55600 7.30803   1.000 63.66267  ? 337 ASP A OD1 1 
ATOM   2297 O OD2 . ASP A 1 337 ? 8.23122  69.92343 5.79017   1.000 64.28112  ? 337 ASP A OD2 1 
ATOM   2298 N N   . GLY A 1 338 ? 4.43930  70.98913 8.83396   1.000 67.80826  ? 338 GLY A N   1 
ATOM   2299 C CA  . GLY A 1 338 ? 3.08895  70.45434 8.71028   1.000 67.67197  ? 338 GLY A CA  1 
ATOM   2300 C C   . GLY A 1 338 ? 2.94941  69.62082 7.45831   1.000 61.61944  ? 338 GLY A C   1 
ATOM   2301 O O   . GLY A 1 338 ? 1.94438  69.72106 6.74329   1.000 57.79227  ? 338 GLY A O   1 
ATOM   2302 N N   . ALA A 1 339 ? 3.96759  68.82167 7.16192   1.000 58.07718  ? 339 ALA A N   1 
ATOM   2303 C CA  . ALA A 1 339 ? 4.07646  68.10141 5.90709   1.000 51.84719  ? 339 ALA A CA  1 
ATOM   2304 C C   . ALA A 1 339 ? 5.05260  66.96189 6.10216   1.000 58.30052  ? 339 ALA A C   1 
ATOM   2305 O O   . ALA A 1 339 ? 4.67427  65.89142 6.58925   1.000 65.03446  ? 339 ALA A O   1 
ATOM   2306 C CB  . ALA A 1 339 ? 4.54486  69.02735 4.78286   1.000 43.36187  ? 339 ALA A CB  1 
ATOM   2307 N N   . PHE A 1 340 ? 6.31808  67.18481 5.74256   1.000 58.44340  ? 340 PHE A N   1 
ATOM   2308 C CA  . PHE A 1 340 ? 7.31143  66.15733 6.01058   1.000 50.30577  ? 340 PHE A CA  1 
ATOM   2309 C C   . PHE A 1 340 ? 7.53879  66.00125 7.50619   1.000 61.78941  ? 340 PHE A C   1 
ATOM   2310 O O   . PHE A 1 340 ? 7.60636  64.87691 8.01603   1.000 67.93480  ? 340 PHE A O   1 
ATOM   2311 C CB  . PHE A 1 340 ? 8.62722  66.45624 5.29544   1.000 44.42709  ? 340 PHE A CB  1 
ATOM   2312 C CG  . PHE A 1 340 ? 9.40329  65.20814 4.98496   1.000 53.65387  ? 340 PHE A CG  1 
ATOM   2313 C CD1 . PHE A 1 340 ? 9.18532  64.50980 3.80126   1.000 48.03405  ? 340 PHE A CD1 1 
ATOM   2314 C CD2 . PHE A 1 340 ? 10.27530 64.67162 5.92393   1.000 49.95028  ? 340 PHE A CD2 1 
ATOM   2315 C CE1 . PHE A 1 340 ? 9.85901  63.32610 3.55040   1.000 51.33321  ? 340 PHE A CE1 1 
ATOM   2316 C CE2 . PHE A 1 340 ? 10.96374 63.49884 5.66523   1.000 48.20404  ? 340 PHE A CE2 1 
ATOM   2317 C CZ  . PHE A 1 340 ? 10.75311 62.82164 4.48154   1.000 48.95170  ? 340 PHE A CZ  1 
ATOM   2318 N N   . LEU A 1 341 ? 7.63161  67.11579 8.23109   1.000 61.69085  ? 341 LEU A N   1 
ATOM   2319 C CA  . LEU A 1 341 ? 7.82675  67.11322 9.67771   1.000 61.67434  ? 341 LEU A CA  1 
ATOM   2320 C C   . LEU A 1 341 ? 6.67245  67.89808 10.27473  1.000 63.12684  ? 341 LEU A C   1 
ATOM   2321 O O   . LEU A 1 341 ? 6.78454  69.11479 10.50002  1.000 65.33227  ? 341 LEU A O   1 
ATOM   2322 C CB  . LEU A 1 341 ? 9.18951  67.69788 10.03621  1.000 67.71596  ? 341 LEU A CB  1 
ATOM   2323 C CG  . LEU A 1 341 ? 9.58092  67.72886 11.51466  1.000 85.78364  ? 341 LEU A CG  1 
ATOM   2324 C CD1 . LEU A 1 341 ? 9.39113  66.37021 12.25286  1.000 88.16606  ? 341 LEU A CD1 1 
ATOM   2325 C CD2 . LEU A 1 341 ? 11.01779 68.24294 11.61846  1.000 88.83347  ? 341 LEU A CD2 1 
ATOM   2326 N N   . PRO A 1 342 ? 5.52952  67.25386 10.53857  1.000 65.89853  ? 342 PRO A N   1 
ATOM   2327 C CA  . PRO A 1 342 ? 4.32937  67.99625 10.94119  1.000 72.38044  ? 342 PRO A CA  1 
ATOM   2328 C C   . PRO A 1 342 ? 4.32232  68.50660 12.37868  1.000 69.62119  ? 342 PRO A C   1 
ATOM   2329 O O   . PRO A 1 342 ? 3.44913  69.32210 12.71059  1.000 70.24745  ? 342 PRO A O   1 
ATOM   2330 C CB  . PRO A 1 342 ? 3.19457  66.97359 10.73527  1.000 71.86248  ? 342 PRO A CB  1 
ATOM   2331 C CG  . PRO A 1 342 ? 3.81517  65.80547 10.05736  1.000 66.50309  ? 342 PRO A CG  1 
ATOM   2332 C CD  . PRO A 1 342 ? 5.25315  65.81665 10.41591  1.000 65.20405  ? 342 PRO A CD  1 
ATOM   2333 N N   . ALA A 1 343 ? 5.22146  68.04586 13.24587  1.000 60.94990  ? 343 ALA A N   1 
ATOM   2334 C CA  . ALA A 1 343 ? 5.28130  68.56356 14.60481  1.000 67.45309  ? 343 ALA A CA  1 
ATOM   2335 C C   . ALA A 1 343 ? 6.72964  68.52300 15.07445  1.000 83.69023  ? 343 ALA A C   1 
ATOM   2336 O O   . ALA A 1 343 ? 7.61734  68.03523 14.36514  1.000 78.81687  ? 343 ALA A O   1 
ATOM   2337 C CB  . ALA A 1 343 ? 4.34894  67.78594 15.55018  1.000 53.52054  ? 343 ALA A CB  1 
ATOM   2338 N N   . ASP A 1 344 ? 6.96114  69.07797 16.27073  1.000 95.48257  ? 344 ASP A N   1 
ATOM   2339 C CA  . ASP A 1 344 ? 8.27041  68.99814 16.91153  1.000 100.47497 ? 344 ASP A CA  1 
ATOM   2340 C C   . ASP A 1 344 ? 8.59693  67.54174 17.24077  1.000 97.06361  ? 344 ASP A C   1 
ATOM   2341 O O   . ASP A 1 344 ? 7.76493  66.84366 17.83466  1.000 103.97917 ? 344 ASP A O   1 
ATOM   2342 C CB  . ASP A 1 344 ? 8.30030  69.83971 18.19364  1.000 111.47663 ? 344 ASP A CB  1 
ATOM   2343 C CG  . ASP A 1 344 ? 9.56247  69.60256 19.02701  1.000 115.98248 ? 344 ASP A CG  1 
ATOM   2344 O OD1 . ASP A 1 344 ? 10.66294 69.99702 18.58088  1.000 116.49425 ? 344 ASP A OD1 1 
ATOM   2345 O OD2 . ASP A 1 344 ? 9.45718  69.01034 20.12260  1.000 115.80539 ? 344 ASP A OD2 1 
ATOM   2346 N N   . PRO A 1 345 ? 9.82248  67.05765 16.90231  1.000 85.60087  ? 345 PRO A N   1 
ATOM   2347 C CA  . PRO A 1 345 ? 10.11562 65.61189 16.96119  1.000 83.66177  ? 345 PRO A CA  1 
ATOM   2348 C C   . PRO A 1 345 ? 9.70265  64.86554 18.23094  1.000 95.82970  ? 345 PRO A C   1 
ATOM   2349 O O   . PRO A 1 345 ? 9.50865  63.64441 18.16977  1.000 98.75166  ? 345 PRO A O   1 
ATOM   2350 C CB  . PRO A 1 345 ? 11.63891 65.56976 16.77330  1.000 73.31368  ? 345 PRO A CB  1 
ATOM   2351 C CG  . PRO A 1 345 ? 11.91982 66.73432 15.88279  1.000 75.45894  ? 345 PRO A CG  1 
ATOM   2352 C CD  . PRO A 1 345 ? 10.93444 67.81756 16.29829  1.000 77.52384  ? 345 PRO A CD  1 
ATOM   2353 N N   . MET A 1 346 ? 9.54582  65.53966 19.37478  1.000 100.72958 ? 346 MET A N   1 
ATOM   2354 C CA  . MET A 1 346 ? 9.13420  64.80377 20.57066  1.000 98.70998  ? 346 MET A CA  1 
ATOM   2355 C C   . MET A 1 346 ? 7.61836  64.76403 20.76346  1.000 98.22563  ? 346 MET A C   1 
ATOM   2356 O O   . MET A 1 346 ? 7.11543  63.83776 21.41281  1.000 94.43727  ? 346 MET A O   1 
ATOM   2357 C CB  . MET A 1 346 ? 9.80420  65.37521 21.82806  1.000 97.03309  ? 346 MET A CB  1 
ATOM   2358 C CG  . MET A 1 346 ? 11.31896 65.09503 21.93829  1.000 101.47672 ? 346 MET A CG  1 
ATOM   2359 S SD  . MET A 1 346 ? 11.86366 63.44049 21.41638  1.000 106.82780 ? 346 MET A SD  1 
ATOM   2360 C CE  . MET A 1 346 ? 11.94466 62.50961 22.93981  1.000 93.06057  ? 346 MET A CE  1 
ATOM   2361 N N   . THR A 1 347 ? 6.86854  65.71562 20.18854  1.000 106.67495 ? 347 THR A N   1 
ATOM   2362 C CA  . THR A 1 347 ? 5.41277  65.60914 20.18261  1.000 111.47648 ? 347 THR A CA  1 
ATOM   2363 C C   . THR A 1 347 ? 4.90652  64.64566 19.11468  1.000 111.13628 ? 347 THR A C   1 
ATOM   2364 O O   . THR A 1 347 ? 3.73414  64.25377 19.17037  1.000 106.78026 ? 347 THR A O   1 
ATOM   2365 C CB  . THR A 1 347 ? 4.75661  66.98610 19.99181  1.000 112.60987 ? 347 THR A CB  1 
ATOM   2366 O OG1 . THR A 1 347 ? 5.01749  67.48327 18.67355  1.000 116.03953 ? 347 THR A OG1 1 
ATOM   2367 C CG2 . THR A 1 347 ? 5.26336  67.99299 21.01496  1.000 108.75544 ? 347 THR A CG2 1 
ATOM   2368 N N   . LEU A 1 348 ? 5.76335  64.25893 18.15389  1.000 115.19889 ? 348 LEU A N   1 
ATOM   2369 C CA  . LEU A 1 348 ? 5.41516  63.20041 17.20263  1.000 113.74153 ? 348 LEU A CA  1 
ATOM   2370 C C   . LEU A 1 348 ? 5.23651  61.86078 17.90161  1.000 110.75804 ? 348 LEU A C   1 
ATOM   2371 O O   . LEU A 1 348 ? 4.33456  61.08764 17.56144  1.000 110.98760 ? 348 LEU A O   1 
ATOM   2372 C CB  . LEU A 1 348 ? 6.49202  63.04275 16.12226  1.000 110.53951 ? 348 LEU A CB  1 
ATOM   2373 C CG  . LEU A 1 348 ? 6.50672  63.90618 14.86370  1.000 113.25698 ? 348 LEU A CG  1 
ATOM   2374 C CD1 . LEU A 1 348 ? 6.96736  65.22953 15.29486  1.000 114.48535 ? 348 LEU A CD1 1 
ATOM   2375 C CD2 . LEU A 1 348 ? 7.47325  63.41089 13.80308  1.000 110.55299 ? 348 LEU A CD2 1 
ATOM   2376 N N   . MET A 1 349 ? 6.10065  61.56377 18.87162  1.000 106.13127 ? 349 MET A N   1 
ATOM   2377 C CA  . MET A 1 349 ? 6.20123  60.21273 19.40068  1.000 98.12617  ? 349 MET A CA  1 
ATOM   2378 C C   . MET A 1 349 ? 5.07346  59.86672 20.36762  1.000 99.41554  ? 349 MET A C   1 
ATOM   2379 O O   . MET A 1 349 ? 4.68570  58.69582 20.45905  1.000 105.88438 ? 349 MET A O   1 
ATOM   2380 C CB  . MET A 1 349 ? 7.56038  60.02959 20.07156  1.000 98.31249  ? 349 MET A CB  1 
ATOM   2381 C CG  . MET A 1 349 ? 8.66281  59.61350 19.11068  1.000 102.64447 ? 349 MET A CG  1 
ATOM   2382 S SD  . MET A 1 349 ? 8.62312  57.85350 18.72954  1.000 109.62256 ? 349 MET A SD  1 
ATOM   2383 C CE  . MET A 1 349 ? 7.45903  57.77335 17.34930  1.000 111.20470 ? 349 MET A CE  1 
ATOM   2384 N N   . LYS A 1 350 ? 4.51308  60.84901 21.07336  1.000 94.55516  ? 350 LYS A N   1 
ATOM   2385 C CA  . LYS A 1 350 ? 3.50348  60.55498 22.08661  1.000 107.18829 ? 350 LYS A CA  1 
ATOM   2386 C C   . LYS A 1 350 ? 2.24844  59.89781 21.50796  1.000 117.52280 ? 350 LYS A C   1 
ATOM   2387 O O   . LYS A 1 350 ? 1.30983  59.59133 22.24824  1.000 117.19778 ? 350 LYS A O   1 
ATOM   2388 C CB  . LYS A 1 350 ? 3.13038  61.83940 22.83298  1.000 110.61366 ? 350 LYS A CB  1 
ATOM   2389 C CG  . LYS A 1 350 ? 4.31513  62.74940 23.13550  1.000 108.78856 ? 350 LYS A CG  1 
ATOM   2390 C CD  . LYS A 1 350 ? 3.88058  64.20153 23.26471  1.000 110.50329 ? 350 LYS A CD  1 
ATOM   2391 C CE  . LYS A 1 350 ? 5.03225  65.09337 23.70361  1.000 110.20302 ? 350 LYS A CE  1 
ATOM   2392 N NZ  . LYS A 1 350 ? 4.60218  66.51186 23.85127  1.000 109.92130 ? 350 LYS A NZ  1 
ATOM   2393 N N   . THR A 1 351 ? 2.21625  59.65965 20.19420  1.000 129.25714 ? 351 THR A N   1 
ATOM   2394 C CA  . THR A 1 351 ? 0.99750  59.16219 19.56577  1.000 134.52512 ? 351 THR A CA  1 
ATOM   2395 C C   . THR A 1 351 ? 1.19293  58.02142 18.57227  1.000 135.19006 ? 351 THR A C   1 
ATOM   2396 O O   . THR A 1 351 ? 0.19292  57.39650 18.20391  1.000 138.41147 ? 351 THR A O   1 
ATOM   2397 C CB  . THR A 1 351 ? 0.25961  60.31700 18.86139  1.000 131.00775 ? 351 THR A CB  1 
ATOM   2398 O OG1 . THR A 1 351 ? -0.73267 59.79032 17.96830  1.000 133.14579 ? 351 THR A OG1 1 
ATOM   2399 C CG2 . THR A 1 351 ? 1.23801  61.20276 18.09034  1.000 119.68139 ? 351 THR A CG2 1 
ATOM   2400 N N   . ALA A 1 352 ? 2.41396  57.70694 18.13819  1.000 137.44015 ? 352 ALA A N   1 
ATOM   2401 C CA  . ALA A 1 352 ? 2.64134  56.67169 17.13496  1.000 133.80624 ? 352 ALA A CA  1 
ATOM   2402 C C   . ALA A 1 352 ? 3.42893  55.50561 17.72150  1.000 118.08009 ? 352 ALA A C   1 
ATOM   2403 O O   . ALA A 1 352 ? 4.42591  55.70457 18.42048  1.000 116.23101 ? 352 ALA A O   1 
ATOM   2404 C CB  . ALA A 1 352 ? 3.38013  57.23467 15.91602  1.000 135.95495 ? 352 ALA A CB  1 
ATOM   2405 N N   . ASP A 1 353 ? 2.98302  54.28924 17.41970  1.000 107.85700 ? 353 ASP A N   1 
ATOM   2406 C CA  . ASP A 1 353 ? 3.60452  53.07898 17.93124  1.000 99.51510  ? 353 ASP A CA  1 
ATOM   2407 C C   . ASP A 1 353 ? 4.58487  52.50119 16.91842  1.000 86.58075  ? 353 ASP A C   1 
ATOM   2408 O O   . ASP A 1 353 ? 4.40263  52.60289 15.70489  1.000 83.88007  ? 353 ASP A O   1 
ATOM   2409 C CB  . ASP A 1 353 ? 2.56206  52.02000 18.29761  1.000 107.06819 ? 353 ASP A CB  1 
ATOM   2410 C CG  . ASP A 1 353 ? 2.99655  51.15454 19.47784  1.000 108.01555 ? 353 ASP A CG  1 
ATOM   2411 O OD1 . ASP A 1 353 ? 3.55078  50.05729 19.24968  1.000 107.36334 ? 353 ASP A OD1 1 
ATOM   2412 O OD2 . ASP A 1 353 ? 2.78108  51.57177 20.63471  1.000 108.36130 ? 353 ASP A OD2 1 
ATOM   2413 N N   . LEU A 1 354 ? 5.61722  51.85979 17.45112  1.000 78.59746  ? 354 LEU A N   1 
ATOM   2414 C CA  . LEU A 1 354 ? 6.82345  51.50003 16.73210  1.000 62.28069  ? 354 LEU A CA  1 
ATOM   2415 C C   . LEU A 1 354 ? 7.17940  50.03960 16.93881  1.000 66.82955  ? 354 LEU A C   1 
ATOM   2416 O O   . LEU A 1 354 ? 8.35089  49.66806 16.82287  1.000 63.59462  ? 354 LEU A O   1 
ATOM   2417 C CB  . LEU A 1 354 ? 7.98001  52.37873 17.18378  1.000 56.64230  ? 354 LEU A CB  1 
ATOM   2418 C CG  . LEU A 1 354 ? 7.69619  53.84370 16.92564  1.000 64.87000  ? 354 LEU A CG  1 
ATOM   2419 C CD1 . LEU A 1 354 ? 8.90430  54.63638 17.29217  1.000 60.18318  ? 354 LEU A CD1 1 
ATOM   2420 C CD2 . LEU A 1 354 ? 7.37683  54.00793 15.45162  1.000 73.15831  ? 354 LEU A CD2 1 
ATOM   2421 N N   . LYS A 1 355 ? 6.18677  49.19923 17.24468  1.000 75.73997  ? 355 LYS A N   1 
ATOM   2422 C CA  . LYS A 1 355 ? 6.48811  47.82330 17.62380  1.000 83.60967  ? 355 LYS A CA  1 
ATOM   2423 C C   . LYS A 1 355 ? 7.24051  47.07717 16.53055  1.000 81.80545  ? 355 LYS A C   1 
ATOM   2424 O O   . LYS A 1 355 ? 7.97782  46.13181 16.83205  1.000 84.32342  ? 355 LYS A O   1 
ATOM   2425 C CB  . LYS A 1 355 ? 5.20594  47.06931 17.99543  1.000 85.56914  ? 355 LYS A CB  1 
ATOM   2426 C CG  . LYS A 1 355 ? 5.45033  45.89501 18.94207  1.000 94.36934  ? 355 LYS A CG  1 
ATOM   2427 C CD  . LYS A 1 355 ? 5.94213  46.36406 20.32850  1.000 101.10955 ? 355 LYS A CD  1 
ATOM   2428 C CE  . LYS A 1 355 ? 4.78213  46.78702 21.24117  1.000 102.89128 ? 355 LYS A CE  1 
ATOM   2429 N NZ  . LYS A 1 355 ? 5.22118  47.11647 22.62695  1.000 99.61826  ? 355 LYS A NZ  1 
ATOM   2430 N N   . ASP A 1 356 ? 7.10768  47.49913 15.27924  1.000 73.30414  ? 356 ASP A N   1 
ATOM   2431 C CA  . ASP A 1 356 ? 7.74928  46.81203 14.17138  1.000 74.77944  ? 356 ASP A CA  1 
ATOM   2432 C C   . ASP A 1 356 ? 9.03871  47.49184 13.71885  1.000 66.18116  ? 356 ASP A C   1 
ATOM   2433 O O   . ASP A 1 356 ? 9.62035  47.09918 12.70314  1.000 65.80453  ? 356 ASP A O   1 
ATOM   2434 C CB  . ASP A 1 356 ? 6.75288  46.68301 13.02222  1.000 90.44636  ? 356 ASP A CB  1 
ATOM   2435 C CG  . ASP A 1 356 ? 5.52141  45.88893 13.42600  1.000 105.47656 ? 356 ASP A CG  1 
ATOM   2436 O OD1 . ASP A 1 356 ? 4.40255  46.19239 12.94467  1.000 104.83172 ? 356 ASP A OD1 1 
ATOM   2437 O OD2 . ASP A 1 356 ? 5.68514  44.96009 14.25094  1.000 113.31239 ? 356 ASP A OD2 1 
ATOM   2438 N N   . TYR A 1 357 ? 9.51712  48.47562 14.46455  1.000 61.32285  ? 357 TYR A N   1 
ATOM   2439 C CA  . TYR A 1 357 ? 10.71684 49.20619 14.10001  1.000 50.35080  ? 357 TYR A CA  1 
ATOM   2440 C C   . TYR A 1 357 ? 11.92662 48.61969 14.81465  1.000 56.68845  ? 357 TYR A C   1 
ATOM   2441 O O   . TYR A 1 357 ? 11.86164 48.28784 16.00194  1.000 68.12616  ? 357 TYR A O   1 
ATOM   2442 C CB  . TYR A 1 357 ? 10.55110 50.69382 14.42375  1.000 46.21374  ? 357 TYR A CB  1 
ATOM   2443 C CG  . TYR A 1 357 ? 9.69969  51.42238 13.39536  1.000 54.65001  ? 357 TYR A CG  1 
ATOM   2444 C CD1 . TYR A 1 357 ? 10.25018 52.40306 12.57605  1.000 56.43638  ? 357 TYR A CD1 1 
ATOM   2445 C CD2 . TYR A 1 357 ? 8.35649  51.11240 13.22675  1.000 61.56594  ? 357 TYR A CD2 1 
ATOM   2446 C CE1 . TYR A 1 357 ? 9.48714  53.06229 11.63318  1.000 65.32979  ? 357 TYR A CE1 1 
ATOM   2447 C CE2 . TYR A 1 357 ? 7.58101  51.76911 12.28010  1.000 72.38280  ? 357 TYR A CE2 1 
ATOM   2448 C CZ  . TYR A 1 357 ? 8.15322  52.74232 11.48548  1.000 75.31093  ? 357 TYR A CZ  1 
ATOM   2449 O OH  . TYR A 1 357 ? 7.39861  53.39814 10.53534  1.000 80.15435  ? 357 TYR A OH  1 
ATOM   2450 N N   . ASP A 1 358 ? 13.01832 48.45687 14.07233  1.000 54.90934  ? 358 ASP A N   1 
ATOM   2451 C CA  . ASP A 1 358 ? 14.30792 48.05343 14.62056  1.000 49.73245  ? 358 ASP A CA  1 
ATOM   2452 C C   . ASP A 1 358 ? 15.27012 49.21480 14.47441  1.000 54.25362  ? 358 ASP A C   1 
ATOM   2453 O O   . ASP A 1 358 ? 15.40531 49.78269 13.38887  1.000 58.77154  ? 358 ASP A O   1 
ATOM   2454 C CB  . ASP A 1 358 ? 14.87931 46.83280 13.91473  1.000 40.49993  ? 358 ASP A CB  1 
ATOM   2455 C CG  . ASP A 1 358 ? 13.97901 45.65274 14.01288  1.000 61.17907  ? 358 ASP A CG  1 
ATOM   2456 O OD1 . ASP A 1 358 ? 13.62518 45.29679 15.15924  1.000 65.76405  ? 358 ASP A OD1 1 
ATOM   2457 O OD2 . ASP A 1 358 ? 13.61664 45.09172 12.94793  1.000 70.02442  ? 358 ASP A OD2 1 
ATOM   2458 N N   . ILE A 1 359 ? 15.92004 49.57276 15.56977  1.000 47.50260  ? 359 ILE A N   1 
ATOM   2459 C CA  . ILE A 1 359 ? 16.72313 50.77403 15.63281  1.000 46.66862  ? 359 ILE A CA  1 
ATOM   2460 C C   . ILE A 1 359 ? 18.03074 50.39827 16.29445  1.000 49.82589  ? 359 ILE A C   1 
ATOM   2461 O O   . ILE A 1 359 ? 18.03543 49.82427 17.39013  1.000 51.69437  ? 359 ILE A O   1 
ATOM   2462 C CB  . ILE A 1 359 ? 16.00929 51.90102 16.39718  1.000 51.02141  ? 359 ILE A CB  1 
ATOM   2463 C CG1 . ILE A 1 359 ? 14.76521 52.30440 15.61710  1.000 52.94750  ? 359 ILE A CG1 1 
ATOM   2464 C CG2 . ILE A 1 359 ? 16.92091 53.10282 16.56060  1.000 51.49686  ? 359 ILE A CG2 1 
ATOM   2465 C CD1 . ILE A 1 359 ? 13.71482 52.90484 16.44223  1.000 65.56691  ? 359 ILE A CD1 1 
ATOM   2466 N N   . LEU A 1 360 ? 19.12520 50.66166 15.59715  1.000 48.49933  ? 360 LEU A N   1 
ATOM   2467 C CA  . LEU A 1 360 ? 20.46952 50.54909 16.12173  1.000 45.57947  ? 360 LEU A CA  1 
ATOM   2468 C C   . LEU A 1 360 ? 21.00413 51.96817 16.19875  1.000 48.19245  ? 360 LEU A C   1 
ATOM   2469 O O   . LEU A 1 360 ? 20.97172 52.68940 15.19813  1.000 48.03542  ? 360 LEU A O   1 
ATOM   2470 C CB  . LEU A 1 360 ? 21.33908 49.66560 15.21360  1.000 42.70321  ? 360 LEU A CB  1 
ATOM   2471 C CG  . LEU A 1 360 ? 22.81736 49.60905 15.61543  1.000 46.71328  ? 360 LEU A CG  1 
ATOM   2472 C CD1 . LEU A 1 360 ? 22.93761 48.99556 17.01892  1.000 48.31080  ? 360 LEU A CD1 1 
ATOM   2473 C CD2 . LEU A 1 360 ? 23.68166 48.85927 14.62047  1.000 33.78252  ? 360 LEU A CD2 1 
ATOM   2474 N N   . MET A 1 361 ? 21.44169 52.39665 17.38259  1.000 43.14209  ? 361 MET A N   1 
ATOM   2475 C CA  . MET A 1 361 ? 21.89016 53.77749 17.50131  1.000 38.13461  ? 361 MET A CA  1 
ATOM   2476 C C   . MET A 1 361 ? 22.98464 53.85836 18.54192  1.000 38.42700  ? 361 MET A C   1 
ATOM   2477 O O   . MET A 1 361 ? 23.17518 52.93553 19.33604  1.000 55.37686  ? 361 MET A O   1 
ATOM   2478 C CB  . MET A 1 361 ? 20.73993 54.71260 17.85295  1.000 37.58767  ? 361 MET A CB  1 
ATOM   2479 C CG  . MET A 1 361 ? 20.08853 54.38271 19.16553  1.000 40.73559  ? 361 MET A CG  1 
ATOM   2480 S SD  . MET A 1 361 ? 18.44289 55.08935 19.27715  1.000 53.25705  ? 361 MET A SD  1 
ATOM   2481 C CE  . MET A 1 361 ? 18.72982 56.84183 19.01852  1.000 37.89557  ? 361 MET A CE  1 
ATOM   2482 N N   . GLY A 1 362 ? 23.70711 54.97233 18.53346  1.000 34.73477  ? 362 GLY A N   1 
ATOM   2483 C CA  . GLY A 1 362 ? 24.82360 55.11701 19.45165  1.000 39.84786  ? 362 GLY A CA  1 
ATOM   2484 C C   . GLY A 1 362 ? 25.57180 56.41685 19.26737  1.000 41.12126  ? 362 GLY A C   1 
ATOM   2485 O O   . GLY A 1 362 ? 25.06411 57.37314 18.67445  1.000 35.53849  ? 362 GLY A O   1 
ATOM   2486 N N   . ASN A 1 363 ? 26.80579 56.42939 19.77031  1.000 42.27900  ? 363 ASN A N   1 
ATOM   2487 C CA  . ASN A 1 363 ? 27.56284 57.66355 19.95215  1.000 43.68090  ? 363 ASN A CA  1 
ATOM   2488 C C   . ASN A 1 363 ? 29.05043 57.32989 20.00544  1.000 40.41216  ? 363 ASN A C   1 
ATOM   2489 O O   . ASN A 1 363 ? 29.44413 56.18920 20.25772  1.000 42.22036  ? 363 ASN A O   1 
ATOM   2490 C CB  . ASN A 1 363 ? 27.15814 58.40154 21.24586  1.000 40.07836  ? 363 ASN A CB  1 
ATOM   2491 C CG  . ASN A 1 363 ? 25.75732 58.97674 21.20330  1.000 43.92746  ? 363 ASN A CG  1 
ATOM   2492 O OD1 . ASN A 1 363 ? 24.86296 58.48761 21.89161  1.000 51.54582  ? 363 ASN A OD1 1 
ATOM   2493 N ND2 . ASN A 1 363 ? 25.56186 60.03593 20.41707  1.000 44.29292  ? 363 ASN A ND2 1 
ATOM   2494 N N   . VAL A 1 364 ? 29.87777 58.34305 19.80815  1.000 38.00475  ? 364 VAL A N   1 
ATOM   2495 C CA  . VAL A 1 364 ? 31.30033 58.19934 20.01386  1.000 47.29004  ? 364 VAL A CA  1 
ATOM   2496 C C   . VAL A 1 364 ? 31.65943 58.85315 21.33850  1.000 49.01969  ? 364 VAL A C   1 
ATOM   2497 O O   . VAL A 1 364 ? 30.87325 59.59833 21.92423  1.000 56.25088  ? 364 VAL A O   1 
ATOM   2498 C CB  . VAL A 1 364 ? 32.11868 58.78824 18.84438  1.000 48.75832  ? 364 VAL A CB  1 
ATOM   2499 C CG1 . VAL A 1 364 ? 31.67305 58.15887 17.53675  1.000 36.11912  ? 364 VAL A CG1 1 
ATOM   2500 C CG2 . VAL A 1 364 ? 31.97377 60.29221 18.80482  1.000 51.81657  ? 364 VAL A CG2 1 
ATOM   2501 N N   . ARG A 1 365 ? 32.86712 58.56824 21.83127  1.000 49.27621  ? 365 ARG A N   1 
ATOM   2502 C CA  . ARG A 1 365 ? 33.22528 59.03819 23.16760  1.000 47.01130  ? 365 ARG A CA  1 
ATOM   2503 C C   . ARG A 1 365 ? 33.39817 60.55363 23.21162  1.000 42.55223  ? 365 ARG A C   1 
ATOM   2504 O O   . ARG A 1 365 ? 33.01215 61.19958 24.19470  1.000 48.46426  ? 365 ARG A O   1 
ATOM   2505 C CB  . ARG A 1 365 ? 34.48598 58.34137 23.65428  1.000 55.34220  ? 365 ARG A CB  1 
ATOM   2506 C CG  . ARG A 1 365 ? 34.69040 58.49113 25.14242  1.000 65.16869  ? 365 ARG A CG  1 
ATOM   2507 C CD  . ARG A 1 365 ? 36.02298 57.92603 25.54725  1.000 79.19382  ? 365 ARG A CD  1 
ATOM   2508 N NE  . ARG A 1 365 ? 37.12259 58.51597 24.78653  1.000 91.45209  ? 365 ARG A NE  1 
ATOM   2509 C CZ  . ARG A 1 365 ? 38.34625 57.99989 24.73300  1.000 97.89565  ? 365 ARG A CZ  1 
ATOM   2510 N NH1 . ARG A 1 365 ? 38.62123 56.87801 25.38719  1.000 106.05416 ? 365 ARG A NH1 1 
ATOM   2511 N NH2 . ARG A 1 365 ? 39.29273 58.60191 24.02808  1.000 96.10852  ? 365 ARG A NH2 1 
ATOM   2512 N N   . ASP A 1 366 ? 33.94979 61.14421 22.15591  1.000 44.38570  ? 366 ASP A N   1 
ATOM   2513 C CA  . ASP A 1 366 ? 34.24536 62.56697 22.20449  1.000 45.71257  ? 366 ASP A CA  1 
ATOM   2514 C C   . ASP A 1 366 ? 33.52946 63.29431 21.07322  1.000 38.99207  ? 366 ASP A C   1 
ATOM   2515 O O   . ASP A 1 366 ? 34.14093 63.90471 20.19252  1.000 47.63428  ? 366 ASP A O   1 
ATOM   2516 C CB  . ASP A 1 366 ? 35.76267 62.74670 22.24504  1.000 48.30585  ? 366 ASP A CB  1 
ATOM   2517 C CG  . ASP A 1 366 ? 36.36934 61.97383 23.40794  1.000 58.41854  ? 366 ASP A CG  1 
ATOM   2518 O OD1 . ASP A 1 366 ? 35.83518 62.14415 24.52117  1.000 57.98248  ? 366 ASP A OD1 1 
ATOM   2519 O OD2 . ASP A 1 366 ? 37.30973 61.16542 23.23473  1.000 59.14842  ? 366 ASP A OD2 1 
ATOM   2520 N N   . GLU A 1 367 ? 32.19830 63.24368 21.15249  1.000 39.42173  ? 367 GLU A N   1 
ATOM   2521 C CA  . GLU A 1 367 ? 31.31995 63.85757 20.16566  1.000 45.46408  ? 367 GLU A CA  1 
ATOM   2522 C C   . GLU A 1 367 ? 31.66703 65.31632 19.88103  1.000 49.30905  ? 367 GLU A C   1 
ATOM   2523 O O   . GLU A 1 367 ? 31.52068 65.77959 18.74969  1.000 56.13332  ? 367 GLU A O   1 
ATOM   2524 C CB  . GLU A 1 367 ? 29.86750 63.73580 20.64593  1.000 40.65102  ? 367 GLU A CB  1 
ATOM   2525 C CG  . GLU A 1 367 ? 29.34805 62.29691 20.70679  1.000 45.95546  ? 367 GLU A CG  1 
ATOM   2526 C CD  . GLU A 1 367 ? 28.93052 61.71224 19.31376  1.000 47.49791  ? 367 GLU A CD  1 
ATOM   2527 O OE1 . GLU A 1 367 ? 29.20250 62.33322 18.26038  1.000 42.67046  ? 367 GLU A OE1 1 
ATOM   2528 O OE2 . GLU A 1 367 ? 28.34619 60.61320 19.28734  1.000 42.20206  ? 367 GLU A OE2 1 
ATOM   2529 N N   . GLY A 1 368 ? 32.10818 66.06323 20.88322  1.000 52.57969  ? 368 GLY A N   1 
ATOM   2530 C CA  . GLY A 1 368 ? 32.14257 67.49904 20.73548  1.000 37.30447  ? 368 GLY A CA  1 
ATOM   2531 C C   . GLY A 1 368 ? 33.49204 68.09482 20.45790  1.000 52.73184  ? 368 GLY A C   1 
ATOM   2532 O O   . GLY A 1 368 ? 33.58719 69.31696 20.28700  1.000 55.88136  ? 368 GLY A O   1 
ATOM   2533 N N   . THR A 1 369 ? 34.54639 67.27817 20.38834  1.000 42.91077  ? 369 THR A N   1 
ATOM   2534 C CA  . THR A 1 369 ? 35.88415 67.85294 20.33423  1.000 48.21658  ? 369 THR A CA  1 
ATOM   2535 C C   . THR A 1 369 ? 36.11446 68.64101 19.05223  1.000 55.77581  ? 369 THR A C   1 
ATOM   2536 O O   . THR A 1 369 ? 36.66719 69.74355 19.10451  1.000 63.63252  ? 369 THR A O   1 
ATOM   2537 C CB  . THR A 1 369 ? 36.94666 66.77229 20.50504  1.000 53.05325  ? 369 THR A CB  1 
ATOM   2538 O OG1 . THR A 1 369 ? 36.65304 65.67086 19.64763  1.000 55.33929  ? 369 THR A OG1 1 
ATOM   2539 C CG2 . THR A 1 369 ? 36.96823 66.28208 21.93923  1.000 56.87750  ? 369 THR A CG2 1 
ATOM   2540 N N   . TYR A 1 370 ? 35.71010 68.11596 17.88424  1.000 63.51025  ? 370 TYR A N   1 
ATOM   2541 C CA  . TYR A 1 370 ? 36.08259 68.85493 16.67473  1.000 60.51534  ? 370 TYR A CA  1 
ATOM   2542 C C   . TYR A 1 370 ? 35.16169 70.03871 16.43470  1.000 57.93332  ? 370 TYR A C   1 
ATOM   2543 O O   . TYR A 1 370 ? 35.60405 71.05777 15.89808  1.000 63.59986  ? 370 TYR A O   1 
ATOM   2544 C CB  . TYR A 1 370 ? 36.19452 67.92708 15.44637  1.000 58.66480  ? 370 TYR A CB  1 
ATOM   2545 C CG  . TYR A 1 370 ? 34.96677 67.54133 14.62281  1.000 60.08309  ? 370 TYR A CG  1 
ATOM   2546 C CD1 . TYR A 1 370 ? 34.22549 68.48291 13.89961  1.000 61.47179  ? 370 TYR A CD1 1 
ATOM   2547 C CD2 . TYR A 1 370 ? 34.62213 66.20261 14.48298  1.000 58.86479  ? 370 TYR A CD2 1 
ATOM   2548 C CE1 . TYR A 1 370 ? 33.13109 68.09353 13.13094  1.000 62.33086  ? 370 TYR A CE1 1 
ATOM   2549 C CE2 . TYR A 1 370 ? 33.53781 65.80580 13.72481  1.000 57.89656  ? 370 TYR A CE2 1 
ATOM   2550 C CZ  . TYR A 1 370 ? 32.79760 66.74475 13.04450  1.000 65.00808  ? 370 TYR A CZ  1 
ATOM   2551 O OH  . TYR A 1 370 ? 31.72287 66.31839 12.28343  1.000 67.48555  ? 370 TYR A OH  1 
ATOM   2552 N N   . PHE A 1 371 ? 33.90978 69.95369 16.87423  1.000 58.21304  ? 371 PHE A N   1 
ATOM   2553 C CA  . PHE A 1 371 ? 33.05963 71.13618 16.85826  1.000 56.74510  ? 371 PHE A CA  1 
ATOM   2554 C C   . PHE A 1 371 ? 33.63319 72.23033 17.74883  1.000 59.62895  ? 371 PHE A C   1 
ATOM   2555 O O   . PHE A 1 371 ? 33.62739 73.41318 17.38437  1.000 63.80713  ? 371 PHE A O   1 
ATOM   2556 C CB  . PHE A 1 371 ? 31.64705 70.75015 17.28054  1.000 50.05281  ? 371 PHE A CB  1 
ATOM   2557 C CG  . PHE A 1 371 ? 30.97811 69.80104 16.31483  1.000 55.66847  ? 371 PHE A CG  1 
ATOM   2558 C CD1 . PHE A 1 371 ? 30.54599 70.24381 15.06114  1.000 49.79666  ? 371 PHE A CD1 1 
ATOM   2559 C CD2 . PHE A 1 371 ? 30.80230 68.46238 16.64483  1.000 56.05037  ? 371 PHE A CD2 1 
ATOM   2560 C CE1 . PHE A 1 371 ? 29.94417 69.37107 14.16762  1.000 51.19623  ? 371 PHE A CE1 1 
ATOM   2561 C CE2 . PHE A 1 371 ? 30.19854 67.58241 15.75436  1.000 49.93957  ? 371 PHE A CE2 1 
ATOM   2562 C CZ  . PHE A 1 371 ? 29.76801 68.03887 14.51300  1.000 55.47264  ? 371 PHE A CZ  1 
ATOM   2563 N N   . LEU A 1 372 ? 34.16985 71.85168 18.90594  1.000 56.73305  ? 372 LEU A N   1 
ATOM   2564 C CA  . LEU A 1 372 ? 34.73681 72.85359 19.79314  1.000 57.49535  ? 372 LEU A CA  1 
ATOM   2565 C C   . LEU A 1 372 ? 36.03397 73.41982 19.22308  1.000 66.49082  ? 372 LEU A C   1 
ATOM   2566 O O   . LEU A 1 372 ? 36.28298 74.62847 19.31298  1.000 78.90799  ? 372 LEU A O   1 
ATOM   2567 C CB  . LEU A 1 372 ? 34.95732 72.25416 21.17821  1.000 50.12713  ? 372 LEU A CB  1 
ATOM   2568 C CG  . LEU A 1 372 ? 35.72377 73.15674 22.15143  1.000 53.44894  ? 372 LEU A CG  1 
ATOM   2569 C CD1 . LEU A 1 372 ? 34.79873 74.23383 22.71577  1.000 50.81079  ? 372 LEU A CD1 1 
ATOM   2570 C CD2 . LEU A 1 372 ? 36.42242 72.35906 23.28054  1.000 48.77757  ? 372 LEU A CD2 1 
ATOM   2571 N N   . LEU A 1 373 ? 36.86705 72.57490 18.61214  1.000 60.93194  ? 373 LEU A N   1 
ATOM   2572 C CA  . LEU A 1 373 ? 38.08997 73.09177 18.00933  1.000 68.11943  ? 373 LEU A CA  1 
ATOM   2573 C C   . LEU A 1 373 ? 37.77915 74.03709 16.84955  1.000 70.07892  ? 373 LEU A C   1 
ATOM   2574 O O   . LEU A 1 373 ? 38.47615 75.03787 16.65660  1.000 72.80634  ? 373 LEU A O   1 
ATOM   2575 C CB  . LEU A 1 373 ? 38.98124 71.93919 17.54516  1.000 69.70996  ? 373 LEU A CB  1 
ATOM   2576 C CG  . LEU A 1 373 ? 40.01891 72.27476 16.46104  1.000 63.28006  ? 373 LEU A CG  1 
ATOM   2577 C CD1 . LEU A 1 373 ? 41.25673 72.95798 17.05161  1.000 64.02970  ? 373 LEU A CD1 1 
ATOM   2578 C CD2 . LEU A 1 373 ? 40.39934 71.02369 15.69273  1.000 54.77891  ? 373 LEU A CD2 1 
ATOM   2579 N N   . TYR A 1 374 ? 36.73113 73.74783 16.07060  1.000 63.59172  ? 374 TYR A N   1 
ATOM   2580 C CA  . TYR A 1 374 ? 36.42518 74.61728 14.93502  1.000 64.51332  ? 374 TYR A CA  1 
ATOM   2581 C C   . TYR A 1 374 ? 35.78020 75.91709 15.39015  1.000 63.46415  ? 374 TYR A C   1 
ATOM   2582 O O   . TYR A 1 374 ? 36.15987 76.99234 14.91891  1.000 60.40549  ? 374 TYR A O   1 
ATOM   2583 C CB  . TYR A 1 374 ? 35.52156 73.90589 13.91573  1.000 56.95761  ? 374 TYR A CB  1 
ATOM   2584 C CG  . TYR A 1 374 ? 36.30055 73.10827 12.89574  1.000 56.39224  ? 374 TYR A CG  1 
ATOM   2585 C CD1 . TYR A 1 374 ? 36.71442 71.80975 13.17633  1.000 55.32657  ? 374 TYR A CD1 1 
ATOM   2586 C CD2 . TYR A 1 374 ? 36.65054 73.65587 11.66898  1.000 57.19705  ? 374 TYR A CD2 1 
ATOM   2587 C CE1 . TYR A 1 374 ? 37.44594 71.07619 12.26685  1.000 59.66798  ? 374 TYR A CE1 1 
ATOM   2588 C CE2 . TYR A 1 374 ? 37.38045 72.92498 10.74450  1.000 65.85279  ? 374 TYR A CE2 1 
ATOM   2589 C CZ  . TYR A 1 374 ? 37.77934 71.63200 11.04754  1.000 67.88592  ? 374 TYR A CZ  1 
ATOM   2590 O OH  . TYR A 1 374 ? 38.50826 70.88339 10.13720  1.000 69.07605  ? 374 TYR A OH  1 
ATOM   2591 N N   . ASP A 1 375 ? 34.81875 75.85128 16.31217  1.000 59.17832  ? 375 ASP A N   1 
ATOM   2592 C CA  . ASP A 1 375 ? 34.13017 77.07542 16.68845  1.000 67.21224  ? 375 ASP A CA  1 
ATOM   2593 C C   . ASP A 1 375 ? 34.93138 77.92534 17.65576  1.000 67.52288  ? 375 ASP A C   1 
ATOM   2594 O O   . ASP A 1 375 ? 34.58777 79.09537 17.86163  1.000 69.96373  ? 375 ASP A O   1 
ATOM   2595 C CB  . ASP A 1 375 ? 32.76752 76.74670 17.27987  1.000 82.28733  ? 375 ASP A CB  1 
ATOM   2596 C CG  . ASP A 1 375 ? 31.76173 76.36116 16.21670  1.000 89.08196  ? 375 ASP A CG  1 
ATOM   2597 O OD1 . ASP A 1 375 ? 31.85435 75.23599 15.68844  1.000 88.74606  ? 375 ASP A OD1 1 
ATOM   2598 O OD2 . ASP A 1 375 ? 30.87865 77.18435 15.90913  1.000 93.08886  ? 375 ASP A OD2 1 
ATOM   2599 N N   . PHE A 1 376 ? 35.99913 77.38176 18.22932  1.000 71.77457  ? 376 PHE A N   1 
ATOM   2600 C CA  . PHE A 1 376 ? 36.84145 78.11835 19.16439  1.000 78.68028  ? 376 PHE A CA  1 
ATOM   2601 C C   . PHE A 1 376 ? 38.30482 77.93238 18.81396  1.000 79.44117  ? 376 PHE A C   1 
ATOM   2602 O O   . PHE A 1 376 ? 39.16569 77.78002 19.68840  1.000 72.74165  ? 376 PHE A O   1 
ATOM   2603 C CB  . PHE A 1 376 ? 36.53597 77.70613 20.60213  1.000 71.32056  ? 376 PHE A CB  1 
ATOM   2604 C CG  . PHE A 1 376 ? 35.13930 78.05047 21.01436  1.000 68.22593  ? 376 PHE A CG  1 
ATOM   2605 C CD1 . PHE A 1 376 ? 34.09660 77.19114 20.74386  1.000 63.70895  ? 376 PHE A CD1 1 
ATOM   2606 C CD2 . PHE A 1 376 ? 34.85403 79.27537 21.59695  1.000 75.20867  ? 376 PHE A CD2 1 
ATOM   2607 C CE1 . PHE A 1 376 ? 32.80660 77.52790 21.08124  1.000 67.25075  ? 376 PHE A CE1 1 
ATOM   2608 C CE2 . PHE A 1 376 ? 33.55260 79.61172 21.94094  1.000 56.44309  ? 376 PHE A CE2 1 
ATOM   2609 C CZ  . PHE A 1 376 ? 32.53954 78.74145 21.68439  1.000 53.70769  ? 376 PHE A CZ  1 
ATOM   2610 N N   . ILE A 1 377 ? 38.60065 77.97681 17.50916  1.000 80.74890  ? 377 ILE A N   1 
ATOM   2611 C CA  . ILE A 1 377 ? 39.95319 77.74292 17.02110  1.000 77.61085  ? 377 ILE A CA  1 
ATOM   2612 C C   . ILE A 1 377 ? 40.92931 78.78521 17.54971  1.000 81.66006  ? 377 ILE A C   1 
ATOM   2613 O O   . ILE A 1 377 ? 42.12872 78.50571 17.65184  1.000 81.82301  ? 377 ILE A O   1 
ATOM   2614 C CB  . ILE A 1 377 ? 39.95606 77.67931 15.47631  1.000 72.01359  ? 377 ILE A CB  1 
ATOM   2615 C CG1 . ILE A 1 377 ? 41.30166 77.17147 14.96799  1.000 78.34073  ? 377 ILE A CG1 1 
ATOM   2616 C CG2 . ILE A 1 377 ? 39.64576 79.03889 14.86673  1.000 67.45026  ? 377 ILE A CG2 1 
ATOM   2617 C CD1 . ILE A 1 377 ? 41.20788 76.41256 13.67869  1.000 82.95350  ? 377 ILE A CD1 1 
ATOM   2618 N N   . ASP A 1 378 ? 40.44243 79.98023 17.90767  1.000 83.50587  ? 378 ASP A N   1 
ATOM   2619 C CA  . ASP A 1 378 ? 41.30467 80.96504 18.55611  1.000 83.45167  ? 378 ASP A CA  1 
ATOM   2620 C C   . ASP A 1 378 ? 41.89359 80.40358 19.84295  1.000 77.64792  ? 378 ASP A C   1 
ATOM   2621 O O   . ASP A 1 378 ? 43.07671 80.61659 20.14184  1.000 73.99473  ? 378 ASP A O   1 
ATOM   2622 C CB  . ASP A 1 378 ? 40.52217 82.25233 18.83765  1.000 87.19516  ? 378 ASP A CB  1 
ATOM   2623 C CG  . ASP A 1 378 ? 40.12351 82.99390 17.56435  1.000 97.92714  ? 378 ASP A CG  1 
ATOM   2624 O OD1 . ASP A 1 378 ? 40.56115 82.58286 16.46606  1.000 101.05638 ? 378 ASP A OD1 1 
ATOM   2625 O OD2 . ASP A 1 378 ? 39.37186 83.99119 17.65801  1.000 100.76532 ? 378 ASP A OD2 1 
ATOM   2626 N N   . TYR A 1 379 ? 41.08878 79.64336 20.59129  1.000 77.52695  ? 379 TYR A N   1 
ATOM   2627 C CA  . TYR A 1 379 ? 41.48828 79.13503 21.90046  1.000 83.18084  ? 379 TYR A CA  1 
ATOM   2628 C C   . TYR A 1 379 ? 42.33260 77.87198 21.79784  1.000 82.48932  ? 379 TYR A C   1 
ATOM   2629 O O   . TYR A 1 379 ? 43.25142 77.66683 22.60532  1.000 74.44042  ? 379 TYR A O   1 
ATOM   2630 C CB  . TYR A 1 379 ? 40.25318 78.82727 22.73801  1.000 83.58334  ? 379 TYR A CB  1 
ATOM   2631 C CG  . TYR A 1 379 ? 39.45283 80.01840 23.18309  1.000 91.46580  ? 379 TYR A CG  1 
ATOM   2632 C CD1 . TYR A 1 379 ? 39.87387 80.79310 24.25841  1.000 97.58323  ? 379 TYR A CD1 1 
ATOM   2633 C CD2 . TYR A 1 379 ? 38.25168 80.34956 22.55894  1.000 91.40463  ? 379 TYR A CD2 1 
ATOM   2634 C CE1 . TYR A 1 379 ? 39.13611 81.86981 24.69275  1.000 97.78410  ? 379 TYR A CE1 1 
ATOM   2635 C CE2 . TYR A 1 379 ? 37.50512 81.43798 22.98811  1.000 94.12153  ? 379 TYR A CE2 1 
ATOM   2636 C CZ  . TYR A 1 379 ? 37.95879 82.19156 24.05788  1.000 96.83998  ? 379 TYR A CZ  1 
ATOM   2637 O OH  . TYR A 1 379 ? 37.23958 83.26941 24.50863  1.000 96.23010  ? 379 TYR A OH  1 
ATOM   2638 N N   . PHE A 1 380 ? 42.02974 77.01835 20.82028  1.000 79.78574  ? 380 PHE A N   1 
ATOM   2639 C CA  . PHE A 1 380 ? 42.48639 75.63968 20.81747  1.000 73.74974  ? 380 PHE A CA  1 
ATOM   2640 C C   . PHE A 1 380 ? 43.35010 75.33160 19.60886  1.000 77.40862  ? 380 PHE A C   1 
ATOM   2641 O O   . PHE A 1 380 ? 43.39053 76.08095 18.62840  1.000 81.44033  ? 380 PHE A O   1 
ATOM   2642 C CB  . PHE A 1 380 ? 41.30178 74.69251 20.85642  1.000 68.99423  ? 380 PHE A CB  1 
ATOM   2643 C CG  . PHE A 1 380 ? 40.38580 74.96336 21.99086  1.000 70.17047  ? 380 PHE A CG  1 
ATOM   2644 C CD1 . PHE A 1 380 ? 39.06289 75.29095 21.76601  1.000 62.29896  ? 380 PHE A CD1 1 
ATOM   2645 C CD2 . PHE A 1 380 ? 40.86010 74.92187 23.29174  1.000 69.24891  ? 380 PHE A CD2 1 
ATOM   2646 C CE1 . PHE A 1 380 ? 38.21857 75.54620 22.81501  1.000 65.15783  ? 380 PHE A CE1 1 
ATOM   2647 C CE2 . PHE A 1 380 ? 40.02208 75.17517 24.34145  1.000 73.11598  ? 380 PHE A CE2 1 
ATOM   2648 C CZ  . PHE A 1 380 ? 38.69639 75.49148 24.10623  1.000 70.98283  ? 380 PHE A CZ  1 
ATOM   2649 N N   . ASP A 1 381 ? 44.04953 74.20742 19.70898  1.000 74.14619  ? 381 ASP A N   1 
ATOM   2650 C CA  . ASP A 1 381 ? 44.97705 73.76688 18.68637  1.000 77.31831  ? 381 ASP A CA  1 
ATOM   2651 C C   . ASP A 1 381 ? 44.51856 72.42397 18.13761  1.000 72.57945  ? 381 ASP A C   1 
ATOM   2652 O O   . ASP A 1 381 ? 43.76938 71.68521 18.77897  1.000 66.29040  ? 381 ASP A O   1 
ATOM   2653 C CB  . ASP A 1 381 ? 46.41119 73.67201 19.22752  1.000 79.09303  ? 381 ASP A CB  1 
ATOM   2654 C CG  . ASP A 1 381 ? 47.40691 73.26434 18.16127  1.000 92.19469  ? 381 ASP A CG  1 
ATOM   2655 O OD1 . ASP A 1 381 ? 47.79340 74.12376 17.33936  1.000 99.42403  ? 381 ASP A OD1 1 
ATOM   2656 O OD2 . ASP A 1 381 ? 47.77972 72.07344 18.12324  1.000 95.02651  ? 381 ASP A OD2 1 
ATOM   2657 N N   . LYS A 1 382 ? 44.94294 72.14185 16.90841  1.000 79.61789  ? 382 LYS A N   1 
ATOM   2658 C CA  . LYS A 1 382 ? 44.56585 70.89440 16.26322  1.000 70.84557  ? 382 LYS A CA  1 
ATOM   2659 C C   . LYS A 1 382 ? 45.33345 69.71756 16.84929  1.000 67.18297  ? 382 LYS A C   1 
ATOM   2660 O O   . LYS A 1 382 ? 44.78083 68.62450 16.99654  1.000 62.37726  ? 382 LYS A O   1 
ATOM   2661 C CB  . LYS A 1 382 ? 44.82000 71.00095 14.76703  1.000 72.20044  ? 382 LYS A CB  1 
ATOM   2662 C CG  . LYS A 1 382 ? 44.65512 69.69308 14.01461  1.000 79.86518  ? 382 LYS A CG  1 
ATOM   2663 C CD  . LYS A 1 382 ? 45.93293 69.26986 13.29210  1.000 76.67600  ? 382 LYS A CD  1 
ATOM   2664 C CE  . LYS A 1 382 ? 46.28247 70.20755 12.16140  1.000 73.32406  ? 382 LYS A CE  1 
ATOM   2665 N NZ  . LYS A 1 382 ? 47.62172 69.85210 11.60256  1.000 78.32611  ? 382 LYS A NZ  1 
ATOM   2666 N N   . ASP A 1 383 ? 46.60306 69.92143 17.19623  1.000 70.14555  ? 383 ASP A N   1 
ATOM   2667 C CA  . ASP A 1 383 ? 47.50385 68.81838 17.51516  1.000 79.20633  ? 383 ASP A CA  1 
ATOM   2668 C C   . ASP A 1 383 ? 47.71994 68.60705 19.00458  1.000 87.07980  ? 383 ASP A C   1 
ATOM   2669 O O   . ASP A 1 383 ? 47.77289 67.45652 19.45334  1.000 86.89391  ? 383 ASP A O   1 
ATOM   2670 C CB  . ASP A 1 383 ? 48.86887 69.03114 16.85842  1.000 81.77782  ? 383 ASP A CB  1 
ATOM   2671 C CG  . ASP A 1 383 ? 48.77481 69.16307 15.36642  1.000 90.58393  ? 383 ASP A CG  1 
ATOM   2672 O OD1 . ASP A 1 383 ? 48.81207 70.31126 14.87049  1.000 91.79893  ? 383 ASP A OD1 1 
ATOM   2673 O OD2 . ASP A 1 383 ? 48.65396 68.11739 14.69380  1.000 95.11902  ? 383 ASP A OD2 1 
ATOM   2674 N N   . ASP A 1 384 ? 47.87514 69.67959 19.77575  1.000 91.35437  ? 384 ASP A N   1 
ATOM   2675 C CA  . ASP A 1 384 ? 48.17527 69.58510 21.19541  1.000 88.62386  ? 384 ASP A CA  1 
ATOM   2676 C C   . ASP A 1 384 ? 47.07247 70.20564 22.03829  1.000 82.55577  ? 384 ASP A C   1 
ATOM   2677 O O   . ASP A 1 384 ? 46.23178 70.97218 21.55628  1.000 81.22591  ? 384 ASP A O   1 
ATOM   2678 C CB  . ASP A 1 384 ? 49.51693 70.23992 21.50836  1.000 87.30477  ? 384 ASP A CB  1 
ATOM   2679 C CG  . ASP A 1 384 ? 50.63481 69.62109 20.72417  1.000 88.22390  ? 384 ASP A CG  1 
ATOM   2680 O OD1 . ASP A 1 384 ? 50.69518 68.37186 20.70308  1.000 85.95243  ? 384 ASP A OD1 1 
ATOM   2681 O OD2 . ASP A 1 384 ? 51.44489 70.37419 20.13534  1.000 94.84485  ? 384 ASP A OD2 1 
ATOM   2682 N N   . ALA A 1 385 ? 47.08288 69.83679 23.31168  1.000 79.76666  ? 385 ALA A N   1 
ATOM   2683 C CA  . ALA A 1 385 ? 46.03059 70.24228 24.22256  1.000 71.57747  ? 385 ALA A CA  1 
ATOM   2684 C C   . ALA A 1 385 ? 46.25852 71.67809 24.68403  1.000 72.70206  ? 385 ALA A C   1 
ATOM   2685 O O   . ALA A 1 385 ? 47.36351 72.22371 24.59914  1.000 80.83527  ? 385 ALA A O   1 
ATOM   2686 C CB  . ALA A 1 385 ? 45.96719 69.29030 25.41767  1.000 64.33024  ? 385 ALA A CB  1 
ATOM   2687 N N   . THR A 1 386 ? 45.18983 72.29406 25.16881  1.000 65.94488  ? 386 THR A N   1 
ATOM   2688 C CA  . THR A 1 386 ? 45.22901 73.66994 25.64119  1.000 73.28467  ? 386 THR A CA  1 
ATOM   2689 C C   . THR A 1 386 ? 45.01826 73.70046 27.15125  1.000 68.81390  ? 386 THR A C   1 
ATOM   2690 O O   . THR A 1 386 ? 44.00016 73.20859 27.64436  1.000 62.27907  ? 386 THR A O   1 
ATOM   2691 C CB  . THR A 1 386 ? 44.16566 74.50829 24.93734  1.000 73.58972  ? 386 THR A CB  1 
ATOM   2692 O OG1 . THR A 1 386 ? 44.56188 74.73067 23.58035  1.000 75.86736  ? 386 THR A OG1 1 
ATOM   2693 C CG2 . THR A 1 386 ? 43.98597 75.84305 25.65659  1.000 74.28349  ? 386 THR A CG2 1 
ATOM   2694 N N   . ALA A 1 387 ? 45.97709 74.27473 27.87884  1.000 68.14218  ? 387 ALA A N   1 
ATOM   2695 C CA  . ALA A 1 387 ? 45.76356 74.57257 29.29254  1.000 76.80352  ? 387 ALA A CA  1 
ATOM   2696 C C   . ALA A 1 387 ? 44.81529 75.76370 29.42639  1.000 75.74493  ? 387 ALA A C   1 
ATOM   2697 O O   . ALA A 1 387 ? 45.25140 76.91489 29.50767  1.000 73.94789  ? 387 ALA A O   1 
ATOM   2698 C CB  . ALA A 1 387 ? 47.09333 74.84208 30.01377  1.000 74.38558  ? 387 ALA A CB  1 
ATOM   2699 N N   . LEU A 1 388 ? 43.51748 75.49066 29.45060  1.000 72.83318  ? 388 LEU A N   1 
ATOM   2700 C CA  . LEU A 1 388 ? 42.50279 76.53697 29.43000  1.000 76.70368  ? 388 LEU A CA  1 
ATOM   2701 C C   . LEU A 1 388 ? 42.27389 77.08677 30.83265  1.000 87.94715  ? 388 LEU A C   1 
ATOM   2702 O O   . LEU A 1 388 ? 41.81532 76.34335 31.70993  1.000 94.84514  ? 388 LEU A O   1 
ATOM   2703 C CB  . LEU A 1 388 ? 41.20682 75.97690 28.86944  1.000 77.47797  ? 388 LEU A CB  1 
ATOM   2704 C CG  . LEU A 1 388 ? 40.11734 76.92477 28.38700  1.000 74.33397  ? 388 LEU A CG  1 
ATOM   2705 C CD1 . LEU A 1 388 ? 40.65392 77.94093 27.38979  1.000 71.82751  ? 388 LEU A CD1 1 
ATOM   2706 C CD2 . LEU A 1 388 ? 39.03799 76.09102 27.77352  1.000 57.92980  ? 388 LEU A CD2 1 
ATOM   2707 N N   . PRO A 1 389 ? 42.55173 78.38530 31.08451  1.000 85.37983  ? 389 PRO A N   1 
ATOM   2708 C CA  . PRO A 1 389 ? 42.36499 78.94329 32.43463  1.000 83.79557  ? 389 PRO A CA  1 
ATOM   2709 C C   . PRO A 1 389 ? 40.91086 78.92448 32.86826  1.000 81.68538  ? 389 PRO A C   1 
ATOM   2710 O O   . PRO A 1 389 ? 40.03495 78.54550 32.08644  1.000 85.44346  ? 389 PRO A O   1 
ATOM   2711 C CB  . PRO A 1 389 ? 42.88649 80.38061 32.30423  1.000 74.64921  ? 389 PRO A CB  1 
ATOM   2712 C CG  . PRO A 1 389 ? 43.60443 80.43615 31.00593  1.000 78.65979  ? 389 PRO A CG  1 
ATOM   2713 C CD  . PRO A 1 389 ? 42.97696 79.41118 30.12383  1.000 79.46333  ? 389 PRO A CD  1 
ATOM   2714 N N   . ARG A 1 390 ? 40.62098 79.33357 34.10100  1.000 84.63299  ? 390 ARG A N   1 
ATOM   2715 C CA  . ARG A 1 390 ? 39.23809 79.19963 34.53307  1.000 87.08026  ? 390 ARG A CA  1 
ATOM   2716 C C   . ARG A 1 390 ? 38.34874 80.28436 33.94689  1.000 91.38960  ? 390 ARG A C   1 
ATOM   2717 O O   . ARG A 1 390 ? 37.18100 80.01591 33.64666  1.000 97.08059  ? 390 ARG A O   1 
ATOM   2718 C CB  . ARG A 1 390 ? 39.13327 79.19382 36.05541  1.000 83.96715  ? 390 ARG A CB  1 
ATOM   2719 C CG  . ARG A 1 390 ? 37.91338 78.40606 36.53202  1.000 88.61622  ? 390 ARG A CG  1 
ATOM   2720 C CD  . ARG A 1 390 ? 36.81167 79.33397 37.01081  1.000 97.21852  ? 390 ARG A CD  1 
ATOM   2721 N NE  . ARG A 1 390 ? 35.49978 78.69005 37.10718  1.000 98.42555  ? 390 ARG A NE  1 
ATOM   2722 C CZ  . ARG A 1 390 ? 34.51572 79.14426 37.88168  1.000 100.30634 ? 390 ARG A CZ  1 
ATOM   2723 N NH1 . ARG A 1 390 ? 34.71037 80.23464 38.63450  1.000 104.80690 ? 390 ARG A NH1 1 
ATOM   2724 N NH2 . ARG A 1 390 ? 33.34714 78.50717 37.91374  1.000 85.61806  ? 390 ARG A NH2 1 
ATOM   2725 N N   . ASP A 1 391 ? 38.87176 81.49855 33.76181  1.000 87.63348  ? 391 ASP A N   1 
ATOM   2726 C CA  . ASP A 1 391 ? 38.05048 82.55389 33.18003  1.000 84.81792  ? 391 ASP A CA  1 
ATOM   2727 C C   . ASP A 1 391 ? 37.71888 82.25124 31.72399  1.000 82.60008  ? 391 ASP A C   1 
ATOM   2728 O O   . ASP A 1 391 ? 36.60169 82.52444 31.26606  1.000 80.90404  ? 391 ASP A O   1 
ATOM   2729 C CB  . ASP A 1 391 ? 38.74491 83.91178 33.32096  1.000 95.45936  ? 391 ASP A CB  1 
ATOM   2730 C CG  . ASP A 1 391 ? 40.02169 84.01786 32.50093  1.000 98.32964  ? 391 ASP A CG  1 
ATOM   2731 O OD1 . ASP A 1 391 ? 40.56068 82.97012 32.07848  1.000 92.89787  ? 391 ASP A OD1 1 
ATOM   2732 O OD2 . ASP A 1 391 ? 40.48716 85.16016 32.29106  1.000 99.00706  ? 391 ASP A OD2 1 
ATOM   2733 N N   . LYS A 1 392 ? 38.66468 81.66413 30.98728  1.000 82.38352  ? 392 LYS A N   1 
ATOM   2734 C CA  . LYS A 1 392 ? 38.39739 81.31034 29.60152  1.000 83.27084  ? 392 LYS A CA  1 
ATOM   2735 C C   . LYS A 1 392 ? 37.62019 80.00798 29.47734  1.000 78.37701  ? 392 LYS A C   1 
ATOM   2736 O O   . LYS A 1 392 ? 37.00745 79.77117 28.42947  1.000 82.68615  ? 392 LYS A O   1 
ATOM   2737 C CB  . LYS A 1 392 ? 39.70778 81.24296 28.80956  1.000 82.54883  ? 392 LYS A CB  1 
ATOM   2738 C CG  . LYS A 1 392 ? 40.38998 82.60402 28.73655  1.000 86.55468  ? 392 LYS A CG  1 
ATOM   2739 C CD  . LYS A 1 392 ? 41.31722 82.76878 27.53316  1.000 90.26667  ? 392 LYS A CD  1 
ATOM   2740 C CE  . LYS A 1 392 ? 41.23452 84.19177 26.91996  1.000 99.88596  ? 392 LYS A CE  1 
ATOM   2741 N NZ  . LYS A 1 392 ? 40.86002 84.16749 25.44467  1.000 108.80202 ? 392 LYS A NZ  1 
ATOM   2742 N N   . TYR A 1 393 ? 37.63181 79.16226 30.51483  1.000 69.97954  ? 393 TYR A N   1 
ATOM   2743 C CA  . TYR A 1 393 ? 36.63621 78.09999 30.59483  1.000 60.71964  ? 393 TYR A CA  1 
ATOM   2744 C C   . TYR A 1 393 ? 35.24338 78.70336 30.70222  1.000 65.07750  ? 393 TYR A C   1 
ATOM   2745 O O   . TYR A 1 393 ? 34.30579 78.24163 30.04724  1.000 70.88295  ? 393 TYR A O   1 
ATOM   2746 C CB  . TYR A 1 393 ? 36.93261 77.16316 31.78019  1.000 58.83866  ? 393 TYR A CB  1 
ATOM   2747 C CG  . TYR A 1 393 ? 35.76109 76.26257 32.17436  1.000 62.20124  ? 393 TYR A CG  1 
ATOM   2748 C CD1 . TYR A 1 393 ? 35.57650 75.02393 31.56665  1.000 61.28521  ? 393 TYR A CD1 1 
ATOM   2749 C CD2 . TYR A 1 393 ? 34.83041 76.65856 33.14293  1.000 60.90868  ? 393 TYR A CD2 1 
ATOM   2750 C CE1 . TYR A 1 393 ? 34.49514 74.20229 31.89366  1.000 59.97015  ? 393 TYR A CE1 1 
ATOM   2751 C CE2 . TYR A 1 393 ? 33.75115 75.83402 33.49295  1.000 62.17608  ? 393 TYR A CE2 1 
ATOM   2752 C CZ  . TYR A 1 393 ? 33.59356 74.60943 32.85990  1.000 64.31736  ? 393 TYR A CZ  1 
ATOM   2753 O OH  . TYR A 1 393 ? 32.53636 73.78299 33.17171  1.000 64.26290  ? 393 TYR A OH  1 
ATOM   2754 N N   . LEU A 1 394 ? 35.09948 79.76617 31.49723  1.000 74.50793  ? 394 LEU A N   1 
ATOM   2755 C CA  . LEU A 1 394 ? 33.80641 80.42763 31.62140  1.000 72.28966  ? 394 LEU A CA  1 
ATOM   2756 C C   . LEU A 1 394 ? 33.44296 81.17431 30.34309  1.000 75.99082  ? 394 LEU A C   1 
ATOM   2757 O O   . LEU A 1 394 ? 32.28141 81.15557 29.91294  1.000 71.98964  ? 394 LEU A O   1 
ATOM   2758 C CB  . LEU A 1 394 ? 33.81560 81.38291 32.81318  1.000 68.25354  ? 394 LEU A CB  1 
ATOM   2759 C CG  . LEU A 1 394 ? 33.86345 80.78760 34.23096  1.000 76.15432  ? 394 LEU A CG  1 
ATOM   2760 C CD1 . LEU A 1 394 ? 34.80646 81.55796 35.14187  1.000 67.40777  ? 394 LEU A CD1 1 
ATOM   2761 C CD2 . LEU A 1 394 ? 32.48120 80.75662 34.83374  1.000 77.18732  ? 394 LEU A CD2 1 
ATOM   2762 N N   . GLU A 1 395 ? 34.42304 81.84694 29.73609  1.000 74.41459  ? 395 GLU A N   1 
ATOM   2763 C CA  . GLU A 1 395 ? 34.19486 82.57033 28.49090  1.000 75.78047  ? 395 GLU A CA  1 
ATOM   2764 C C   . GLU A 1 395 ? 33.55787 81.67074 27.43741  1.000 78.15163  ? 395 GLU A C   1 
ATOM   2765 O O   . GLU A 1 395 ? 32.58073 82.04889 26.78002  1.000 81.89200  ? 395 GLU A O   1 
ATOM   2766 C CB  . GLU A 1 395 ? 35.52276 83.12930 27.98984  1.000 81.41831  ? 395 GLU A CB  1 
ATOM   2767 C CG  . GLU A 1 395 ? 35.41371 84.30368 27.05598  1.000 93.90529  ? 395 GLU A CG  1 
ATOM   2768 C CD  . GLU A 1 395 ? 36.74913 84.99252 26.86142  1.000 107.28195 ? 395 GLU A CD  1 
ATOM   2769 O OE1 . GLU A 1 395 ? 37.77685 84.39303 27.24253  1.000 110.26955 ? 395 GLU A OE1 1 
ATOM   2770 O OE2 . GLU A 1 395 ? 36.77715 86.12073 26.32082  1.000 113.24124 ? 395 GLU A OE2 1 
ATOM   2771 N N   . ILE A 1 396 ? 34.08825 80.46016 27.28229  1.000 75.31389  ? 396 ILE A N   1 
ATOM   2772 C CA  . ILE A 1 396 ? 33.57739 79.54516 26.27065  1.000 69.14097  ? 396 ILE A CA  1 
ATOM   2773 C C   . ILE A 1 396 ? 32.25384 78.93732 26.70656  1.000 72.22120  ? 396 ILE A C   1 
ATOM   2774 O O   . ILE A 1 396 ? 31.29526 78.88831 25.92543  1.000 69.87823  ? 396 ILE A O   1 
ATOM   2775 C CB  . ILE A 1 396 ? 34.61556 78.45459 25.96780  1.000 66.66667  ? 396 ILE A CB  1 
ATOM   2776 C CG1 . ILE A 1 396 ? 35.85172 79.06691 25.31609  1.000 71.03859  ? 396 ILE A CG1 1 
ATOM   2777 C CG2 . ILE A 1 396 ? 34.01382 77.40647 25.05604  1.000 64.01603  ? 396 ILE A CG2 1 
ATOM   2778 C CD1 . ILE A 1 396 ? 37.09576 78.22554 25.48020  1.000 73.34501  ? 396 ILE A CD1 1 
ATOM   2779 N N   . MET A 1 397 ? 32.19187 78.43463 27.94662  1.000 71.51493  ? 397 MET A N   1 
ATOM   2780 C CA  . MET A 1 397 ? 30.95625 77.83231 28.43989  1.000 63.39327  ? 397 MET A CA  1 
ATOM   2781 C C   . MET A 1 397 ? 29.80619 78.82260 28.35955  1.000 61.57749  ? 397 MET A C   1 
ATOM   2782 O O   . MET A 1 397 ? 28.71160 78.48739 27.90047  1.000 62.96547  ? 397 MET A O   1 
ATOM   2783 C CB  . MET A 1 397 ? 31.12469 77.35651 29.88303  1.000 61.12600  ? 397 MET A CB  1 
ATOM   2784 C CG  . MET A 1 397 ? 31.92956 76.09522 30.07287  1.000 54.84738  ? 397 MET A CG  1 
ATOM   2785 S SD  . MET A 1 397 ? 31.22198 74.72132 29.18429  1.000 54.10801  ? 397 MET A SD  1 
ATOM   2786 C CE  . MET A 1 397 ? 30.05731 74.00904 30.33379  1.000 50.35220  ? 397 MET A CE  1 
ATOM   2787 N N   . ASN A 1 398 ? 30.03273 80.04807 28.82339  1.000 65.33152  ? 398 ASN A N   1 
ATOM   2788 C CA  . ASN A 1 398 ? 28.94711 81.01000 28.87727  1.000 72.48020  ? 398 ASN A CA  1 
ATOM   2789 C C   . ASN A 1 398 ? 28.51556 81.42886 27.49351  1.000 77.48949  ? 398 ASN A C   1 
ATOM   2790 O O   . ASN A 1 398 ? 27.39522 81.92147 27.31785  1.000 77.23545  ? 398 ASN A O   1 
ATOM   2791 C CB  . ASN A 1 398 ? 29.36081 82.23489 29.67969  1.000 77.18227  ? 398 ASN A CB  1 
ATOM   2792 C CG  . ASN A 1 398 ? 29.16300 82.04750 31.15932  1.000 81.89352  ? 398 ASN A CG  1 
ATOM   2793 O OD1 . ASN A 1 398 ? 28.04576 81.81927 31.62779  1.000 77.21832  ? 398 ASN A OD1 1 
ATOM   2794 N ND2 . ASN A 1 398 ? 30.24527 82.15974 31.91214  1.000 93.54619  ? 398 ASN A ND2 1 
ATOM   2795 N N   . ASN A 1 399 ? 29.38024 81.23492 26.50738  1.000 79.49202  ? 399 ASN A N   1 
ATOM   2796 C CA  . ASN A 1 399 ? 29.00129 81.53168 25.13679  1.000 81.67591  ? 399 ASN A CA  1 
ATOM   2797 C C   . ASN A 1 399 ? 28.17932 80.39435 24.53927  1.000 67.81930  ? 399 ASN A C   1 
ATOM   2798 O O   . ASN A 1 399 ? 27.04186 80.60326 24.10754  1.000 62.99950  ? 399 ASN A O   1 
ATOM   2799 C CB  . ASN A 1 399 ? 30.25614 81.80247 24.31786  1.000 87.59734  ? 399 ASN A CB  1 
ATOM   2800 C CG  . ASN A 1 399 ? 29.98076 81.84916 22.86088  1.000 84.22507  ? 399 ASN A CG  1 
ATOM   2801 O OD1 . ASN A 1 399 ? 28.96285 82.38324 22.42782  1.000 97.11577  ? 399 ASN A OD1 1 
ATOM   2802 N ND2 . ASN A 1 399 ? 30.88044 81.28453 22.08258  1.000 73.80989  ? 399 ASN A ND2 1 
ATOM   2803 N N   . ILE A 1 400 ? 28.74017 79.17660 24.54107  1.000 62.04296  ? 400 ILE A N   1 
ATOM   2804 C CA  . ILE A 1 400 ? 28.07162 78.00217 23.97606  1.000 54.05008  ? 400 ILE A CA  1 
ATOM   2805 C C   . ILE A 1 400 ? 26.64298 77.89249 24.47681  1.000 55.12868  ? 400 ILE A C   1 
ATOM   2806 O O   . ILE A 1 400 ? 25.73131 77.51409 23.72842  1.000 55.26837  ? 400 ILE A O   1 
ATOM   2807 C CB  . ILE A 1 400 ? 28.86750 76.73090 24.31310  1.000 53.28163  ? 400 ILE A CB  1 
ATOM   2808 C CG1 . ILE A 1 400 ? 30.21883 76.74402 23.61733  1.000 53.47225  ? 400 ILE A CG1 1 
ATOM   2809 C CG2 . ILE A 1 400 ? 28.08234 75.48867 23.94362  1.000 51.94038  ? 400 ILE A CG2 1 
ATOM   2810 C CD1 . ILE A 1 400 ? 31.02677 75.51249 23.90659  1.000 50.73543  ? 400 ILE A CD1 1 
ATOM   2811 N N   . PHE A 1 401 ? 26.42634 78.21325 25.75481  1.000 51.47702  ? 401 PHE A N   1 
ATOM   2812 C CA  . PHE A 1 401 ? 25.11873 78.10290 26.38787  1.000 63.48828  ? 401 PHE A CA  1 
ATOM   2813 C C   . PHE A 1 401 ? 24.55217 79.46711 26.74003  1.000 77.37616  ? 401 PHE A C   1 
ATOM   2814 O O   . PHE A 1 401 ? 23.78287 79.59403 27.69950  1.000 78.33483  ? 401 PHE A O   1 
ATOM   2815 C CB  . PHE A 1 401 ? 25.19215 77.22533 27.63228  1.000 48.42677  ? 401 PHE A CB  1 
ATOM   2816 C CG  . PHE A 1 401 ? 25.83222 75.90233 27.38759  1.000 52.29126  ? 401 PHE A CG  1 
ATOM   2817 C CD1 . PHE A 1 401 ? 27.14392 75.67685 27.75713  1.000 51.52346  ? 401 PHE A CD1 1 
ATOM   2818 C CD2 . PHE A 1 401 ? 25.12926 74.88457 26.75499  1.000 57.61615  ? 401 PHE A CD2 1 
ATOM   2819 C CE1 . PHE A 1 401 ? 27.74537 74.44975 27.53218  1.000 54.71778  ? 401 PHE A CE1 1 
ATOM   2820 C CE2 . PHE A 1 401 ? 25.72342 73.65451 26.51849  1.000 58.38662  ? 401 PHE A CE2 1 
ATOM   2821 C CZ  . PHE A 1 401 ? 27.03969 73.43667 26.91311  1.000 56.67358  ? 401 PHE A CZ  1 
ATOM   2822 N N   . GLY A 1 402 ? 24.94207 80.49132 25.97133  1.000 77.46377  ? 402 GLY A N   1 
ATOM   2823 C CA  . GLY A 1 402 ? 24.45135 81.84095 26.18195  1.000 71.80884  ? 402 GLY A CA  1 
ATOM   2824 C C   . GLY A 1 402 ? 22.94940 81.96001 26.08257  1.000 66.87964  ? 402 GLY A C   1 
ATOM   2825 O O   . GLY A 1 402 ? 22.36444 82.84990 26.71259  1.000 74.40117  ? 402 GLY A O   1 
ATOM   2826 N N   . LYS A 1 403 ? 22.30640 81.06479 25.33157  1.000 66.52259  ? 403 LYS A N   1 
ATOM   2827 C CA  . LYS A 1 403 ? 20.86308 81.11167 25.14099  1.000 81.69407  ? 403 LYS A CA  1 
ATOM   2828 C C   . LYS A 1 403 ? 20.07835 80.34767 26.20991  1.000 85.58739  ? 403 LYS A C   1 
ATOM   2829 O O   . LYS A 1 403 ? 18.85812 80.52862 26.31551  1.000 85.65802  ? 403 LYS A O   1 
ATOM   2830 C CB  . LYS A 1 403 ? 20.51670 80.60002 23.73622  1.000 84.77249  ? 403 LYS A CB  1 
ATOM   2831 C CG  . LYS A 1 403 ? 21.35157 81.26516 22.64019  1.000 91.87127  ? 403 LYS A CG  1 
ATOM   2832 C CD  . LYS A 1 403 ? 21.91055 80.25642 21.65035  1.000 91.39283  ? 403 LYS A CD  1 
ATOM   2833 C CE  . LYS A 1 403 ? 20.77262 79.58077 20.90832  1.000 97.43880  ? 403 LYS A CE  1 
ATOM   2834 N NZ  . LYS A 1 403 ? 21.21707 78.52537 19.94982  1.000 97.19503  ? 403 LYS A NZ  1 
ATOM   2835 N N   . ALA A 1 404 ? 20.73982 79.52899 27.02010  1.000 80.34747  ? 404 ALA A N   1 
ATOM   2836 C CA  . ALA A 1 404 ? 20.08820 78.96243 28.18750  1.000 68.23502  ? 404 ALA A CA  1 
ATOM   2837 C C   . ALA A 1 404 ? 20.00854 80.01064 29.28672  1.000 64.96946  ? 404 ALA A C   1 
ATOM   2838 O O   . ALA A 1 404 ? 20.77727 80.97723 29.30747  1.000 70.84127  ? 404 ALA A O   1 
ATOM   2839 C CB  . ALA A 1 404 ? 20.84375 77.73234 28.68344  1.000 63.08973  ? 404 ALA A CB  1 
ATOM   2840 N N   . THR A 1 405 ? 19.06152 79.82130 30.20595  1.000 63.55533  ? 405 THR A N   1 
ATOM   2841 C CA  . THR A 1 405 ? 18.98163 80.71704 31.35892  1.000 72.11293  ? 405 THR A CA  1 
ATOM   2842 C C   . THR A 1 405 ? 20.28224 80.68062 32.16082  1.000 76.23915  ? 405 THR A C   1 
ATOM   2843 O O   . THR A 1 405 ? 21.11137 79.77496 32.01855  1.000 73.79425  ? 405 THR A O   1 
ATOM   2844 C CB  . THR A 1 405 ? 17.82669 80.33559 32.28219  1.000 73.71447  ? 405 THR A CB  1 
ATOM   2845 O OG1 . THR A 1 405 ? 18.23109 79.23805 33.11102  1.000 81.90113  ? 405 THR A OG1 1 
ATOM   2846 C CG2 . THR A 1 405 ? 16.59778 79.93781 31.48117  1.000 67.50234  ? 405 THR A CG2 1 
ATOM   2847 N N   . GLN A 1 406 ? 20.45846 81.67449 33.03400  1.000 83.89173  ? 406 GLN A N   1 
ATOM   2848 C CA  . GLN A 1 406 ? 21.67745 81.66372 33.83131  1.000 86.97748  ? 406 GLN A CA  1 
ATOM   2849 C C   . GLN A 1 406 ? 21.63525 80.58917 34.90953  1.000 79.34006  ? 406 GLN A C   1 
ATOM   2850 O O   . GLN A 1 406 ? 22.68598 80.05943 35.28266  1.000 77.93382  ? 406 GLN A O   1 
ATOM   2851 C CB  . GLN A 1 406 ? 21.94833 83.02691 34.44399  1.000 100.22806 ? 406 GLN A CB  1 
ATOM   2852 C CG  . GLN A 1 406 ? 23.43319 83.22587 34.67675  1.000 111.81103 ? 406 GLN A CG  1 
ATOM   2853 C CD  . GLN A 1 406 ? 23.74734 84.47164 35.46083  1.000 119.40537 ? 406 GLN A CD  1 
ATOM   2854 O OE1 . GLN A 1 406 ? 23.06747 84.79194 36.43516  1.000 111.45673 ? 406 GLN A OE1 1 
ATOM   2855 N NE2 . GLN A 1 406 ? 24.78464 85.18885 35.03899  1.000 129.56495 ? 406 GLN A NE2 1 
ATOM   2856 N N   . ALA A 1 407 ? 20.44136 80.23148 35.39516  1.000 72.97943  ? 407 ALA A N   1 
ATOM   2857 C CA  . ALA A 1 407 ? 20.32894 79.07843 36.28034  1.000 67.21518  ? 407 ALA A CA  1 
ATOM   2858 C C   . ALA A 1 407 ? 20.74052 77.78919 35.57787  1.000 67.61333  ? 407 ALA A C   1 
ATOM   2859 O O   . ALA A 1 407 ? 21.21581 76.85634 36.23182  1.000 75.95167  ? 407 ALA A O   1 
ATOM   2860 C CB  . ALA A 1 407 ? 18.91020 78.96112 36.83085  1.000 61.03307  ? 407 ALA A CB  1 
ATOM   2861 N N   . GLU A 1 408 ? 20.58467 77.71264 34.25427  1.000 66.88668  ? 408 GLU A N   1 
ATOM   2862 C CA  . GLU A 1 408 ? 21.12744 76.56654 33.53803  1.000 65.45519  ? 408 GLU A CA  1 
ATOM   2863 C C   . GLU A 1 408 ? 22.62331 76.71039 33.32843  1.000 69.20466  ? 408 GLU A C   1 
ATOM   2864 O O   . GLU A 1 408 ? 23.37804 75.74160 33.49108  1.000 70.24369  ? 408 GLU A O   1 
ATOM   2865 C CB  . GLU A 1 408 ? 20.45194 76.41355 32.18623  1.000 72.56476  ? 408 GLU A CB  1 
ATOM   2866 C CG  . GLU A 1 408 ? 19.08184 75.82698 32.24060  1.000 80.09336  ? 408 GLU A CG  1 
ATOM   2867 C CD  . GLU A 1 408 ? 18.33219 76.06407 30.95162  1.000 73.94630  ? 408 GLU A CD  1 
ATOM   2868 O OE1 . GLU A 1 408 ? 17.49308 76.99744 30.92115  1.000 65.49832  ? 408 GLU A OE1 1 
ATOM   2869 O OE2 . GLU A 1 408 ? 18.58994 75.31445 29.97904  1.000 65.77042  ? 408 GLU A OE2 1 
ATOM   2870 N N   . ARG A 1 409 ? 23.05307 77.90580 32.92257  1.000 69.06858  ? 409 ARG A N   1 
ATOM   2871 C CA  . ARG A 1 409 ? 24.47043 78.15421 32.69879  1.000 71.90386  ? 409 ARG A CA  1 
ATOM   2872 C C   . ARG A 1 409 ? 25.27483 77.84001 33.95045  1.000 72.55017  ? 409 ARG A C   1 
ATOM   2873 O O   . ARG A 1 409 ? 26.26467 77.09962 33.89354  1.000 73.22589  ? 409 ARG A O   1 
ATOM   2874 C CB  . ARG A 1 409 ? 24.68035 79.60530 32.27037  1.000 78.97190  ? 409 ARG A CB  1 
ATOM   2875 C CG  . ARG A 1 409 ? 25.20029 79.77467 30.85861  1.000 82.15948  ? 409 ARG A CG  1 
ATOM   2876 C CD  . ARG A 1 409 ? 25.16249 81.23871 30.44159  1.000 82.87579  ? 409 ARG A CD  1 
ATOM   2877 N NE  . ARG A 1 409 ? 23.80574 81.77934 30.44006  1.000 80.32539  ? 409 ARG A NE  1 
ATOM   2878 C CZ  . ARG A 1 409 ? 23.45085 82.90538 31.04625  1.000 89.94872  ? 409 ARG A CZ  1 
ATOM   2879 N NH1 . ARG A 1 409 ? 24.35104 83.62084 31.70915  1.000 98.85958  ? 409 ARG A NH1 1 
ATOM   2880 N NH2 . ARG A 1 409 ? 22.19474 83.31795 30.98587  1.000 93.64888  ? 409 ARG A NH2 1 
ATOM   2881 N N   . GLU A 1 410 ? 24.84580 78.38554 35.09680  1.000 67.37968  ? 410 GLU A N   1 
ATOM   2882 C CA  . GLU A 1 410 ? 25.50990 78.08931 36.36362  1.000 74.82972  ? 410 GLU A CA  1 
ATOM   2883 C C   . GLU A 1 410 ? 25.47666 76.59554 36.65691  1.000 72.11198  ? 410 GLU A C   1 
ATOM   2884 O O   . GLU A 1 410 ? 26.46896 76.02803 37.12940  1.000 80.80778  ? 410 GLU A O   1 
ATOM   2885 C CB  . GLU A 1 410 ? 24.85929 78.86546 37.51289  1.000 68.39110  ? 410 GLU A CB  1 
ATOM   2886 C CG  . GLU A 1 410 ? 24.93662 80.38867 37.43370  1.000 72.58481  ? 410 GLU A CG  1 
ATOM   2887 C CD  . GLU A 1 410 ? 24.15948 81.06687 38.58680  1.000 90.30540  ? 410 GLU A CD  1 
ATOM   2888 O OE1 . GLU A 1 410 ? 23.15102 80.48902 39.06044  1.000 92.80229  ? 410 GLU A OE1 1 
ATOM   2889 O OE2 . GLU A 1 410 ? 24.56538 82.16407 39.03862  1.000 92.14199  ? 410 GLU A OE2 1 
ATOM   2890 N N   . ALA A 1 411 ? 24.34485 75.93927 36.37579  1.000 59.18463  ? 411 ALA A N   1 
ATOM   2891 C CA  . ALA A 1 411 ? 24.25146 74.50293 36.61988  1.000 51.74387  ? 411 ALA A CA  1 
ATOM   2892 C C   . ALA A 1 411 ? 25.16097 73.72727 35.68132  1.000 58.40693  ? 411 ALA A C   1 
ATOM   2893 O O   . ALA A 1 411 ? 25.83153 72.77722 36.10347  1.000 62.95735  ? 411 ALA A O   1 
ATOM   2894 C CB  . ALA A 1 411 ? 22.81001 74.02544 36.47910  1.000 51.17889  ? 411 ALA A CB  1 
ATOM   2895 N N   . ILE A 1 412 ? 25.19142 74.11488 34.40521  1.000 54.45686  ? 412 ILE A N   1 
ATOM   2896 C CA  . ILE A 1 412 ? 26.04076 73.43275 33.43986  1.000 52.72668  ? 412 ILE A CA  1 
ATOM   2897 C C   . ILE A 1 412 ? 27.50794 73.65502 33.77846  1.000 54.70039  ? 412 ILE A C   1 
ATOM   2898 O O   . ILE A 1 412 ? 28.29113 72.70148 33.86421  1.000 55.58082  ? 412 ILE A O   1 
ATOM   2899 C CB  . ILE A 1 412 ? 25.70265 73.90669 32.01454  1.000 52.47021  ? 412 ILE A CB  1 
ATOM   2900 C CG1 . ILE A 1 412 ? 24.30453 73.42461 31.61207  1.000 52.92477  ? 412 ILE A CG1 1 
ATOM   2901 C CG2 . ILE A 1 412 ? 26.75094 73.42218 31.02406  1.000 47.61801  ? 412 ILE A CG2 1 
ATOM   2902 C CD1 . ILE A 1 412 ? 23.65339 74.23272 30.51932  1.000 51.08048  ? 412 ILE A CD1 1 
ATOM   2903 N N   . ILE A 1 413 ? 27.89627 74.91859 33.98539  1.000 49.90248  ? 413 ILE A N   1 
ATOM   2904 C CA  . ILE A 1 413 ? 29.27200 75.24245 34.36890  1.000 61.63404  ? 413 ILE A CA  1 
ATOM   2905 C C   . ILE A 1 413 ? 29.68372 74.48331 35.62436  1.000 60.91643  ? 413 ILE A C   1 
ATOM   2906 O O   . ILE A 1 413 ? 30.83009 74.03066 35.75236  1.000 60.59003  ? 413 ILE A O   1 
ATOM   2907 C CB  . ILE A 1 413 ? 29.42699 76.76198 34.56215  1.000 60.54985  ? 413 ILE A CB  1 
ATOM   2908 C CG1 . ILE A 1 413 ? 29.32793 77.46818 33.20784  1.000 54.83608  ? 413 ILE A CG1 1 
ATOM   2909 C CG2 . ILE A 1 413 ? 30.73914 77.10496 35.31586  1.000 55.88846  ? 413 ILE A CG2 1 
ATOM   2910 C CD1 . ILE A 1 413 ? 29.27670 78.96149 33.33214  1.000 58.65614  ? 413 ILE A CD1 1 
ATOM   2911 N N   . PHE A 1 414 ? 28.76377 74.33210 36.57554  1.000 57.11469  ? 414 PHE A N   1 
ATOM   2912 C CA  . PHE A 1 414 ? 29.12583 73.56541 37.75771  1.000 63.30528  ? 414 PHE A CA  1 
ATOM   2913 C C   . PHE A 1 414 ? 29.23121 72.08215 37.44182  1.000 62.35656  ? 414 PHE A C   1 
ATOM   2914 O O   . PHE A 1 414 ? 30.08255 71.38979 38.01000  1.000 67.51081  ? 414 PHE A O   1 
ATOM   2915 C CB  . PHE A 1 414 ? 28.13448 73.80186 38.90133  1.000 56.61699  ? 414 PHE A CB  1 
ATOM   2916 C CG  . PHE A 1 414 ? 28.57678 73.18714 40.19184  1.000 55.06519  ? 414 PHE A CG  1 
ATOM   2917 C CD1 . PHE A 1 414 ? 29.62205 73.73410 40.90172  1.000 57.13276  ? 414 PHE A CD1 1 
ATOM   2918 C CD2 . PHE A 1 414 ? 27.98558 72.02890 40.66029  1.000 54.20602  ? 414 PHE A CD2 1 
ATOM   2919 C CE1 . PHE A 1 414 ? 30.05321 73.15418 42.09101  1.000 64.23278  ? 414 PHE A CE1 1 
ATOM   2920 C CE2 . PHE A 1 414 ? 28.40913 71.44035 41.82411  1.000 55.40745  ? 414 PHE A CE2 1 
ATOM   2921 C CZ  . PHE A 1 414 ? 29.44668 72.00266 42.54936  1.000 62.39664  ? 414 PHE A CZ  1 
ATOM   2922 N N   . GLN A 1 415 ? 28.39548 71.58252 36.53005  1.000 53.10762  ? 415 GLN A N   1 
ATOM   2923 C CA  . GLN A 1 415 ? 28.42137 70.16007 36.21728  1.000 51.15117  ? 415 GLN A CA  1 
ATOM   2924 C C   . GLN A 1 415 ? 29.70046 69.77381 35.48445  1.000 63.83401  ? 415 GLN A C   1 
ATOM   2925 O O   . GLN A 1 415 ? 30.14176 68.62562 35.56924  1.000 71.47179  ? 415 GLN A O   1 
ATOM   2926 C CB  . GLN A 1 415 ? 27.18157 69.79478 35.40182  1.000 47.74195  ? 415 GLN A CB  1 
ATOM   2927 C CG  . GLN A 1 415 ? 27.14869 68.36731 34.84632  1.000 44.85305  ? 415 GLN A CG  1 
ATOM   2928 C CD  . GLN A 1 415 ? 26.83381 67.34403 35.90521  1.000 52.48815  ? 415 GLN A CD  1 
ATOM   2929 O OE1 . GLN A 1 415 ? 26.49657 67.69412 37.03308  1.000 55.41451  ? 415 GLN A OE1 1 
ATOM   2930 N NE2 . GLN A 1 415 ? 26.94604 66.06719 35.55545  1.000 49.38261  ? 415 GLN A NE2 1 
ATOM   2931 N N   . TYR A 1 416 ? 30.32888 70.71706 34.79120  1.000 68.49836  ? 416 TYR A N   1 
ATOM   2932 C CA  . TYR A 1 416 ? 31.52026 70.42750 34.00722  1.000 65.67686  ? 416 TYR A CA  1 
ATOM   2933 C C   . TYR A 1 416 ? 32.74922 71.13857 34.54397  1.000 72.81636  ? 416 TYR A C   1 
ATOM   2934 O O   . TYR A 1 416 ? 33.71684 71.34707 33.80697  1.000 87.69515  ? 416 TYR A O   1 
ATOM   2935 C CB  . TYR A 1 416 ? 31.27775 70.78087 32.54032  1.000 51.20113  ? 416 TYR A CB  1 
ATOM   2936 C CG  . TYR A 1 416 ? 30.33884 69.79329 31.92627  1.000 48.13123  ? 416 TYR A CG  1 
ATOM   2937 C CD1 . TYR A 1 416 ? 30.82197 68.66035 31.28099  1.000 54.56712  ? 416 TYR A CD1 1 
ATOM   2938 C CD2 . TYR A 1 416 ? 28.96902 69.95192 32.03424  1.000 48.46408  ? 416 TYR A CD2 1 
ATOM   2939 C CE1 . TYR A 1 416 ? 29.95895 67.72430 30.71270  1.000 49.86590  ? 416 TYR A CE1 1 
ATOM   2940 C CE2 . TYR A 1 416 ? 28.10467 69.02092 31.48320  1.000 54.66374  ? 416 TYR A CE2 1 
ATOM   2941 C CZ  . TYR A 1 416 ? 28.60804 67.91098 30.82475  1.000 48.73145  ? 416 TYR A CZ  1 
ATOM   2942 O OH  . TYR A 1 416 ? 27.75495 66.98124 30.28400  1.000 49.01310  ? 416 TYR A OH  1 
ATOM   2943 N N   . THR A 1 417 ? 32.73429 71.51531 35.81341  1.000 69.06110  ? 417 THR A N   1 
ATOM   2944 C CA  . THR A 1 417 ? 33.92375 72.07526 36.42884  1.000 60.03405  ? 417 THR A CA  1 
ATOM   2945 C C   . THR A 1 417 ? 34.87248 70.94868 36.79853  1.000 65.18295  ? 417 THR A C   1 
ATOM   2946 O O   . THR A 1 417 ? 34.51182 70.02950 37.54197  1.000 64.50431  ? 417 THR A O   1 
ATOM   2947 C CB  . THR A 1 417 ? 33.55263 72.90424 37.64522  1.000 60.84293  ? 417 THR A CB  1 
ATOM   2948 O OG1 . THR A 1 417 ? 33.05759 74.16829 37.19484  1.000 70.08308  ? 417 THR A OG1 1 
ATOM   2949 C CG2 . THR A 1 417 ? 34.76972 73.11822 38.54143  1.000 58.57970  ? 417 THR A CG2 1 
ATOM   2950 N N   . SER A 1 418 ? 36.07230 70.99886 36.24978  1.000 75.37053  ? 418 SER A N   1 
ATOM   2951 C CA  . SER A 1 418 ? 37.08309 70.06121 36.68514  1.000 83.68467  ? 418 SER A CA  1 
ATOM   2952 C C   . SER A 1 418 ? 37.58513 70.45234 38.06151  1.000 81.96526  ? 418 SER A C   1 
ATOM   2953 O O   . SER A 1 418 ? 37.61352 71.63097 38.42965  1.000 84.85051  ? 418 SER A O   1 
ATOM   2954 C CB  . SER A 1 418 ? 38.25092 70.02944 35.70863  1.000 93.53374  ? 418 SER A CB  1 
ATOM   2955 O OG  . SER A 1 418 ? 38.82401 68.73824 35.72650  1.000 101.15535 ? 418 SER A OG  1 
ATOM   2956 N N   . TRP A 1 419 ? 37.96784 69.45686 38.83416  1.000 80.49535  ? 419 TRP A N   1 
ATOM   2957 C CA  . TRP A 1 419 ? 38.75013 69.73197 40.02790  1.000 96.40431  ? 419 TRP A CA  1 
ATOM   2958 C C   . TRP A 1 419 ? 40.06807 68.98924 40.04341  1.000 109.81850 ? 419 TRP A C   1 
ATOM   2959 O O   . TRP A 1 419 ? 41.07408 69.55919 40.47021  1.000 115.63697 ? 419 TRP A O   1 
ATOM   2960 C CB  . TRP A 1 419 ? 37.96179 69.39269 41.30917  1.000 93.33290  ? 419 TRP A CB  1 
ATOM   2961 C CG  . TRP A 1 419 ? 37.04950 70.51468 41.79141  1.000 89.69976  ? 419 TRP A CG  1 
ATOM   2962 C CD1 . TRP A 1 419 ? 37.37296 71.54251 42.65389  1.000 90.38134  ? 419 TRP A CD1 1 
ATOM   2963 C CD2 . TRP A 1 419 ? 35.66555 70.69982 41.45248  1.000 78.19975  ? 419 TRP A CD2 1 
ATOM   2964 N NE1 . TRP A 1 419 ? 36.27485 72.35495 42.85403  1.000 86.95038  ? 419 TRP A NE1 1 
ATOM   2965 C CE2 . TRP A 1 419 ? 35.21561 71.85914 42.13265  1.000 75.52256  ? 419 TRP A CE2 1 
ATOM   2966 C CE3 . TRP A 1 419 ? 34.76347 69.99629 40.64275  1.000 71.91587  ? 419 TRP A CE3 1 
ATOM   2967 C CZ2 . TRP A 1 419 ? 33.90527 72.33016 42.01917  1.000 66.17070  ? 419 TRP A CZ2 1 
ATOM   2968 C CZ3 . TRP A 1 419 ? 33.45896 70.46614 40.52826  1.000 74.80681  ? 419 TRP A CZ3 1 
ATOM   2969 C CH2 . TRP A 1 419 ? 33.04394 71.62209 41.21544  1.000 76.17602  ? 419 TRP A CH2 1 
ATOM   2970 N N   . GLU A 1 420 ? 40.09386 67.75493 39.55591  1.000 113.81847 ? 420 GLU A N   1 
ATOM   2971 C CA  . GLU A 1 420 ? 41.27611 66.91385 39.51608  1.000 113.19423 ? 420 GLU A CA  1 
ATOM   2972 C C   . GLU A 1 420 ? 41.74263 66.75398 38.07614  1.000 111.64451 ? 420 GLU A C   1 
ATOM   2973 O O   . GLU A 1 420 ? 41.14527 67.29619 37.14144  1.000 91.65034  ? 420 GLU A O   1 
ATOM   2974 C CB  . GLU A 1 420 ? 40.97665 65.55805 40.15326  1.000 111.36038 ? 420 GLU A CB  1 
ATOM   2975 C CG  . GLU A 1 420 ? 40.25068 65.64356 41.50107  1.000 114.88520 ? 420 GLU A CG  1 
ATOM   2976 C CD  . GLU A 1 420 ? 40.98896 66.47996 42.55716  1.000 117.55732 ? 420 GLU A CD  1 
ATOM   2977 O OE1 . GLU A 1 420 ? 41.01038 67.72693 42.45715  1.000 119.81202 ? 420 GLU A OE1 1 
ATOM   2978 O OE2 . GLU A 1 420 ? 41.55150 65.88293 43.49901  1.000 113.07910 ? 420 GLU A OE2 1 
ATOM   2979 N N   . GLY A 1 421 ? 42.83532 66.01062 37.91349  1.000 133.49700 ? 421 GLY A N   1 
ATOM   2980 C CA  . GLY A 1 421 ? 43.31453 65.64599 36.59457  1.000 144.47873 ? 421 GLY A CA  1 
ATOM   2981 C C   . GLY A 1 421 ? 44.13271 66.69468 35.87539  1.000 149.20550 ? 421 GLY A C   1 
ATOM   2982 O O   . GLY A 1 421 ? 44.15522 66.70083 34.63945  1.000 153.60810 ? 421 GLY A O   1 
ATOM   2983 N N   . ASN A 1 422 ? 44.82133 67.57672 36.61764  1.000 143.62316 ? 422 ASN A N   1 
ATOM   2984 C CA  . ASN A 1 422 ? 45.63467 68.67951 36.10096  1.000 138.58518 ? 422 ASN A CA  1 
ATOM   2985 C C   . ASN A 1 422 ? 44.74013 69.71208 35.41511  1.000 131.17479 ? 422 ASN A C   1 
ATOM   2986 O O   . ASN A 1 422 ? 44.08162 69.40877 34.40884  1.000 127.47926 ? 422 ASN A O   1 
ATOM   2987 C CB  . ASN A 1 422 ? 46.73459 68.17359 35.14898  1.000 133.74798 ? 422 ASN A CB  1 
ATOM   2988 C CG  . ASN A 1 422 ? 48.16115 68.52373 35.63258  1.000 129.06742 ? 422 ASN A CG  1 
ATOM   2989 O OD1 . ASN A 1 422 ? 48.38057 68.84371 36.80569  1.000 121.99680 ? 422 ASN A OD1 1 
ATOM   2990 N ND2 . ASN A 1 422 ? 49.12930 68.45329 34.71925  1.000 127.46228 ? 422 ASN A ND2 1 
ATOM   2991 N N   . PRO A 1 423 ? 44.69914 70.94415 35.92341  1.000 123.95157 ? 423 PRO A N   1 
ATOM   2992 C CA  . PRO A 1 423 ? 43.77991 71.94361 35.36827  1.000 115.41326 ? 423 PRO A CA  1 
ATOM   2993 C C   . PRO A 1 423 ? 44.11367 72.25723 33.91737  1.000 107.67923 ? 423 PRO A C   1 
ATOM   2994 O O   . PRO A 1 423 ? 45.11974 71.81433 33.35590  1.000 111.06999 ? 423 PRO A O   1 
ATOM   2995 C CB  . PRO A 1 423 ? 43.98783 73.17105 36.26913  1.000 115.00833 ? 423 PRO A CB  1 
ATOM   2996 C CG  . PRO A 1 423 ? 44.81740 72.69250 37.43864  1.000 116.49579 ? 423 PRO A CG  1 
ATOM   2997 C CD  . PRO A 1 423 ? 45.59029 71.51773 36.94862  1.000 120.91948 ? 423 PRO A CD  1 
ATOM   2998 N N   . GLY A 1 424 ? 43.24048 73.04078 33.29921  1.000 91.85670  ? 424 GLY A N   1 
ATOM   2999 C CA  . GLY A 1 424 ? 43.54410 73.52588 31.97111  1.000 93.40793  ? 424 GLY A CA  1 
ATOM   3000 C C   . GLY A 1 424 ? 43.30904 72.48869 30.89443  1.000 86.85382  ? 424 GLY A C   1 
ATOM   3001 O O   . GLY A 1 424 ? 42.33716 72.60012 30.13460  1.000 74.98465  ? 424 GLY A O   1 
ATOM   3002 N N   . TYR A 1 425 ? 44.18908 71.48138 30.80433  1.000 84.23028  ? 425 TYR A N   1 
ATOM   3003 C CA  . TYR A 1 425 ? 43.86311 70.32564 29.97413  1.000 78.20620  ? 425 TYR A CA  1 
ATOM   3004 C C   . TYR A 1 425 ? 42.49157 69.79395 30.34468  1.000 77.18201  ? 425 TYR A C   1 
ATOM   3005 O O   . TYR A 1 425 ? 41.66121 69.51386 29.47318  1.000 79.27844  ? 425 TYR A O   1 
ATOM   3006 C CB  . TYR A 1 425 ? 44.90295 69.21799 30.13243  1.000 69.56065  ? 425 TYR A CB  1 
ATOM   3007 C CG  . TYR A 1 425 ? 46.28943 69.57680 29.67510  1.000 73.26289  ? 425 TYR A CG  1 
ATOM   3008 C CD1 . TYR A 1 425 ? 46.50498 70.61224 28.78266  1.000 64.70661  ? 425 TYR A CD1 1 
ATOM   3009 C CD2 . TYR A 1 425 ? 47.39249 68.87426 30.14648  1.000 81.09774  ? 425 TYR A CD2 1 
ATOM   3010 C CE1 . TYR A 1 425 ? 47.78417 70.94334 28.37499  1.000 67.94127  ? 425 TYR A CE1 1 
ATOM   3011 C CE2 . TYR A 1 425 ? 48.67016 69.19826 29.75077  1.000 80.21173  ? 425 TYR A CE2 1 
ATOM   3012 C CZ  . TYR A 1 425 ? 48.85883 70.22516 28.85981  1.000 79.68931  ? 425 TYR A CZ  1 
ATOM   3013 O OH  . TYR A 1 425 ? 50.13509 70.53645 28.46771  1.000 84.09932  ? 425 TYR A OH  1 
ATOM   3014 N N   . GLN A 1 426 ? 42.22644 69.70007 31.64697  1.000 75.28303  ? 426 GLN A N   1 
ATOM   3015 C CA  . GLN A 1 426 ? 40.95970 69.17011 32.12290  1.000 67.11997  ? 426 GLN A CA  1 
ATOM   3016 C C   . GLN A 1 426 ? 39.79335 70.06592 31.73571  1.000 62.68369  ? 426 GLN A C   1 
ATOM   3017 O O   . GLN A 1 426 ? 38.71857 69.57220 31.37428  1.000 56.83351  ? 426 GLN A O   1 
ATOM   3018 C CB  . GLN A 1 426 ? 41.03468 68.98630 33.63109  1.000 65.18792  ? 426 GLN A CB  1 
ATOM   3019 C CG  . GLN A 1 426 ? 41.19179 67.53757 34.01093  1.000 74.69371  ? 426 GLN A CG  1 
ATOM   3020 C CD  . GLN A 1 426 ? 40.18133 66.64374 33.29850  1.000 85.10740  ? 426 GLN A CD  1 
ATOM   3021 O OE1 . GLN A 1 426 ? 39.02764 66.52851 33.72639  1.000 94.35177  ? 426 GLN A OE1 1 
ATOM   3022 N NE2 . GLN A 1 426 ? 40.61248 66.00058 32.21310  1.000 78.64142  ? 426 GLN A NE2 1 
ATOM   3023 N N   . ASN A 1 427 ? 39.98832 71.38456 31.80186  1.000 60.82905  ? 427 ASN A N   1 
ATOM   3024 C CA  . ASN A 1 427 ? 38.92690 72.31642 31.44067  1.000 57.15187  ? 427 ASN A CA  1 
ATOM   3025 C C   . ASN A 1 427 ? 38.53224 72.16556 29.98453  1.000 55.11900  ? 427 ASN A C   1 
ATOM   3026 O O   . ASN A 1 427 ? 37.34169 72.12080 29.65687  1.000 54.53620  ? 427 ASN A O   1 
ATOM   3027 C CB  . ASN A 1 427 ? 39.37103 73.74193 31.71338  1.000 66.23373  ? 427 ASN A CB  1 
ATOM   3028 C CG  . ASN A 1 427 ? 39.13494 74.14484 33.13600  1.000 70.96688  ? 427 ASN A CG  1 
ATOM   3029 O OD1 . ASN A 1 427 ? 38.30269 73.55134 33.83133  1.000 72.91681  ? 427 ASN A OD1 1 
ATOM   3030 N ND2 . ASN A 1 427 ? 39.84211 75.17510 33.57862  1.000 60.98450  ? 427 ASN A ND2 1 
ATOM   3031 N N   . GLN A 1 428 ? 39.52312 72.10369 29.09030  1.000 58.87319  ? 428 GLN A N   1 
ATOM   3032 C CA  . GLN A 1 428 ? 39.23141 71.84365 27.68293  1.000 58.51698  ? 428 GLN A CA  1 
ATOM   3033 C C   . GLN A 1 428 ? 38.50685 70.51448 27.51986  1.000 51.26720  ? 428 GLN A C   1 
ATOM   3034 O O   . GLN A 1 428 ? 37.56685 70.39509 26.72933  1.000 54.90456  ? 428 GLN A O   1 
ATOM   3035 C CB  . GLN A 1 428 ? 40.53222 71.86713 26.87351  1.000 68.17101  ? 428 GLN A CB  1 
ATOM   3036 C CG  . GLN A 1 428 ? 40.42449 71.40661 25.40958  1.000 64.39627  ? 428 GLN A CG  1 
ATOM   3037 C CD  . GLN A 1 428 ? 41.78454 71.32166 24.75058  1.000 66.57332  ? 428 GLN A CD  1 
ATOM   3038 O OE1 . GLN A 1 428 ? 42.75640 70.86379 25.36282  1.000 72.63885  ? 428 GLN A OE1 1 
ATOM   3039 N NE2 . GLN A 1 428 ? 41.87182 71.77996 23.50774  1.000 59.76702  ? 428 GLN A NE2 1 
ATOM   3040 N N   . GLN A 1 429 ? 38.90834 69.51011 28.28760  1.000 55.65539  ? 429 GLN A N   1 
ATOM   3041 C CA  . GLN A 1 429 ? 38.25571 68.21479 28.18586  1.000 54.57457  ? 429 GLN A CA  1 
ATOM   3042 C C   . GLN A 1 429 ? 36.79570 68.29367 28.59960  1.000 56.41121  ? 429 GLN A C   1 
ATOM   3043 O O   . GLN A 1 429 ? 35.94960 67.60469 28.02081  1.000 56.43229  ? 429 GLN A O   1 
ATOM   3044 C CB  . GLN A 1 429 ? 39.01853 67.19423 29.03417  1.000 58.05172  ? 429 GLN A CB  1 
ATOM   3045 C CG  . GLN A 1 429 ? 40.31021 66.71684 28.36702  1.000 60.67511  ? 429 GLN A CG  1 
ATOM   3046 C CD  . GLN A 1 429 ? 40.06337 66.18290 26.94841  1.000 65.54597  ? 429 GLN A CD  1 
ATOM   3047 O OE1 . GLN A 1 429 ? 39.15070 65.37503 26.72049  1.000 69.29543  ? 429 GLN A OE1 1 
ATOM   3048 N NE2 . GLN A 1 429 ? 40.86917 66.64491 25.99232  1.000 57.65474  ? 429 GLN A NE2 1 
ATOM   3049 N N   . GLN A 1 430 ? 36.47587 69.14360 29.58140  1.000 66.06671  ? 430 GLN A N   1 
ATOM   3050 C CA  . GLN A 1 430 ? 35.11021 69.21931 30.08662  1.000 63.80432  ? 430 GLN A CA  1 
ATOM   3051 C C   . GLN A 1 430 ? 34.20116 70.00668 29.15115  1.000 64.28629  ? 430 GLN A C   1 
ATOM   3052 O O   . GLN A 1 430 ? 33.04309 69.62189 28.94298  1.000 64.02705  ? 430 GLN A O   1 
ATOM   3053 C CB  . GLN A 1 430 ? 35.10449 69.82256 31.48792  1.000 69.98365  ? 430 GLN A CB  1 
ATOM   3054 C CG  . GLN A 1 430 ? 35.87970 68.98123 32.49349  1.000 72.71118  ? 430 GLN A CG  1 
ATOM   3055 C CD  . GLN A 1 430 ? 35.08391 67.80288 33.03095  1.000 74.23088  ? 430 GLN A CD  1 
ATOM   3056 O OE1 . GLN A 1 430 ? 33.85718 67.78158 32.98067  1.000 64.04024  ? 430 GLN A OE1 1 
ATOM   3057 N NE2 . GLN A 1 430 ? 35.79299 66.80886 33.54657  1.000 90.11276  ? 430 GLN A NE2 1 
ATOM   3058 N N   . ILE A 1 431 ? 34.69721 71.10797 28.57702  1.000 62.90340  ? 431 ILE A N   1 
ATOM   3059 C CA  . ILE A 1 431 ? 33.89479 71.83750 27.60014  1.000 62.92983  ? 431 ILE A CA  1 
ATOM   3060 C C   . ILE A 1 431 ? 33.60203 70.95719 26.39569  1.000 64.63320  ? 431 ILE A C   1 
ATOM   3061 O O   . ILE A 1 431 ? 32.50631 71.00624 25.82662  1.000 61.20886  ? 431 ILE A O   1 
ATOM   3062 C CB  . ILE A 1 431 ? 34.58857 73.14185 27.17799  1.000 58.94458  ? 431 ILE A CB  1 
ATOM   3063 C CG1 . ILE A 1 431 ? 34.93192 73.96398 28.40631  1.000 54.44207  ? 431 ILE A CG1 1 
ATOM   3064 C CG2 . ILE A 1 431 ? 33.69543 73.92667 26.19120  1.000 49.44774  ? 431 ILE A CG2 1 
ATOM   3065 C CD1 . ILE A 1 431 ? 35.60321 75.26518 28.09457  1.000 58.56439  ? 431 ILE A CD1 1 
ATOM   3066 N N   . GLY A 1 432 ? 34.57590 70.13993 25.98841  1.000 62.99828  ? 432 GLY A N   1 
ATOM   3067 C CA  . GLY A 1 432 ? 34.31399 69.17466 24.93524  1.000 60.23927  ? 432 GLY A CA  1 
ATOM   3068 C C   . GLY A 1 432 ? 33.24058 68.18195 25.33030  1.000 56.86451  ? 432 GLY A C   1 
ATOM   3069 O O   . GLY A 1 432 ? 32.31548 67.91059 24.56111  1.000 55.93473  ? 432 GLY A O   1 
ATOM   3070 N N   . ARG A 1 433 ? 33.35877 67.61886 26.53830  1.000 53.78270  ? 433 ARG A N   1 
ATOM   3071 C CA  . ARG A 1 433 ? 32.33243 66.71709 27.04051  1.000 53.12882  ? 433 ARG A CA  1 
ATOM   3072 C C   . ARG A 1 433 ? 30.97847 67.39784 27.04040  1.000 48.96106  ? 433 ARG A C   1 
ATOM   3073 O O   . ARG A 1 433 ? 29.98139 66.81392 26.60430  1.000 54.29547  ? 433 ARG A O   1 
ATOM   3074 C CB  . ARG A 1 433 ? 32.67743 66.24204 28.45205  1.000 61.32986  ? 433 ARG A CB  1 
ATOM   3075 C CG  . ARG A 1 433 ? 33.69467 65.11116 28.54614  1.000 68.76442  ? 433 ARG A CG  1 
ATOM   3076 C CD  . ARG A 1 433 ? 34.29482 65.04730 29.96767  1.000 85.57373  ? 433 ARG A CD  1 
ATOM   3077 N NE  . ARG A 1 433 ? 34.69100 63.70125 30.38240  1.000 93.80346  ? 433 ARG A NE  1 
ATOM   3078 C CZ  . ARG A 1 433 ? 33.84716 62.77230 30.82785  1.000 98.47340  ? 433 ARG A CZ  1 
ATOM   3079 N NH1 . ARG A 1 433 ? 32.54487 63.03184 30.91654  1.000 95.85127  ? 433 ARG A NH1 1 
ATOM   3080 N NH2 . ARG A 1 433 ? 34.30563 61.57657 31.17957  1.000 101.72665 ? 433 ARG A NH2 1 
ATOM   3081 N N   . ALA A 1 434 ? 30.92372 68.64310 27.50210  1.000 46.64403  ? 434 ALA A N   1 
ATOM   3082 C CA  . ALA A 1 434 ? 29.63268 69.31031 27.59939  1.000 54.70690  ? 434 ALA A CA  1 
ATOM   3083 C C   . ALA A 1 434 ? 28.98865 69.43133 26.22127  1.000 46.57993  ? 434 ALA A C   1 
ATOM   3084 O O   . ALA A 1 434 ? 27.81053 69.10115 26.04833  1.000 45.70603  ? 434 ALA A O   1 
ATOM   3085 C CB  . ALA A 1 434 ? 29.78894 70.67236 28.28347  1.000 40.95317  ? 434 ALA A CB  1 
ATOM   3086 N N   . VAL A 1 435 ? 29.77412 69.85028 25.21913  1.000 53.53172  ? 435 VAL A N   1 
ATOM   3087 C CA  . VAL A 1 435 ? 29.28096 69.99549 23.85041  1.000 46.00051  ? 435 VAL A CA  1 
ATOM   3088 C C   . VAL A 1 435 ? 28.81531 68.64715 23.30926  1.000 47.30957  ? 435 VAL A C   1 
ATOM   3089 O O   . VAL A 1 435 ? 27.65864 68.48230 22.90184  1.000 44.63581  ? 435 VAL A O   1 
ATOM   3090 C CB  . VAL A 1 435 ? 30.36770 70.62020 22.95677  1.000 52.16593  ? 435 VAL A CB  1 
ATOM   3091 C CG1 . VAL A 1 435 ? 29.99713 70.52489 21.47391  1.000 38.83224  ? 435 VAL A CG1 1 
ATOM   3092 C CG2 . VAL A 1 435 ? 30.57273 72.07469 23.34663  1.000 49.72393  ? 435 VAL A CG2 1 
ATOM   3093 N N   . GLY A 1 436 ? 29.71282 67.65904 23.31894  1.000 50.95364  ? 436 GLY A N   1 
ATOM   3094 C CA  . GLY A 1 436 ? 29.32495 66.30885 22.94511  1.000 50.10158  ? 436 GLY A CA  1 
ATOM   3095 C C   . GLY A 1 436 ? 28.07239 65.82385 23.64793  1.000 46.22369  ? 436 GLY A C   1 
ATOM   3096 O O   . GLY A 1 436 ? 27.14838 65.30444 23.01427  1.000 51.18946  ? 436 GLY A O   1 
ATOM   3097 N N   . ASP A 1 437 ? 28.01365 66.00468 24.96748  1.000 51.05508  ? 437 ASP A N   1 
ATOM   3098 C CA  . ASP A 1 437 ? 26.89373 65.48223 25.74718  1.000 49.53905  ? 437 ASP A CA  1 
ATOM   3099 C C   . ASP A 1 437 ? 25.59557 66.21647 25.42420  1.000 48.18585  ? 437 ASP A C   1 
ATOM   3100 O O   . ASP A 1 437 ? 24.55621 65.59056 25.18027  1.000 48.94399  ? 437 ASP A O   1 
ATOM   3101 C CB  . ASP A 1 437 ? 27.21070 65.57564 27.23947  1.000 53.12917  ? 437 ASP A CB  1 
ATOM   3102 C CG  . ASP A 1 437 ? 28.22813 64.54321 27.68929  1.000 63.52673  ? 437 ASP A CG  1 
ATOM   3103 O OD1 . ASP A 1 437 ? 28.58381 63.63402 26.88814  1.000 62.72403  ? 437 ASP A OD1 1 
ATOM   3104 O OD2 . ASP A 1 437 ? 28.65524 64.64226 28.86338  1.000 68.01052  ? 437 ASP A OD2 1 
ATOM   3105 N N   . HIS A 1 438 ? 25.63044 67.54547 25.42333  1.000 46.21501  ? 438 HIS A N   1 
ATOM   3106 C CA  . HIS A 1 438 ? 24.41202 68.30471 25.15693  1.000 48.09637  ? 438 HIS A CA  1 
ATOM   3107 C C   . HIS A 1 438 ? 23.93554 68.13163 23.71121  1.000 50.04282  ? 438 HIS A C   1 
ATOM   3108 O O   . HIS A 1 438 ? 22.72730 68.06988 23.45264  1.000 47.66649  ? 438 HIS A O   1 
ATOM   3109 C CB  . HIS A 1 438 ? 24.64376 69.78307 25.47575  1.000 45.13427  ? 438 HIS A CB  1 
ATOM   3110 C CG  . HIS A 1 438 ? 23.52358 70.67822 25.04620  1.000 46.12676  ? 438 HIS A CG  1 
ATOM   3111 N ND1 . HIS A 1 438 ? 22.22071 70.47983 25.44555  1.000 54.22904  ? 438 HIS A ND1 1 
ATOM   3112 C CD2 . HIS A 1 438 ? 23.50771 71.76876 24.24469  1.000 51.24481  ? 438 HIS A CD2 1 
ATOM   3113 C CE1 . HIS A 1 438 ? 21.45095 71.41553 24.91824  1.000 53.43731  ? 438 HIS A CE1 1 
ATOM   3114 N NE2 . HIS A 1 438 ? 22.20685 72.20703 24.17952  1.000 49.34113  ? 438 HIS A NE2 1 
ATOM   3115 N N   . PHE A 1 439 ? 24.85611 68.05674 22.75381  1.000 44.82161  ? 439 PHE A N   1 
ATOM   3116 C CA  . PHE A 1 439 ? 24.42315 68.14191 21.36222  1.000 50.06836  ? 439 PHE A CA  1 
ATOM   3117 C C   . PHE A 1 439 ? 24.17290 66.79626 20.70842  1.000 47.34018  ? 439 PHE A C   1 
ATOM   3118 O O   . PHE A 1 439 ? 23.35624 66.72140 19.79180  1.000 47.93358  ? 439 PHE A O   1 
ATOM   3119 C CB  . PHE A 1 439 ? 25.43398 68.93107 20.53550  1.000 50.26017  ? 439 PHE A CB  1 
ATOM   3120 C CG  . PHE A 1 439 ? 25.33827 70.39476 20.75796  1.000 50.94041  ? 439 PHE A CG  1 
ATOM   3121 C CD1 . PHE A 1 439 ? 24.25091 71.10806 20.27687  1.000 50.59212  ? 439 PHE A CD1 1 
ATOM   3122 C CD2 . PHE A 1 439 ? 26.29966 71.05371 21.49882  1.000 50.43686  ? 439 PHE A CD2 1 
ATOM   3123 C CE1 . PHE A 1 439 ? 24.14757 72.45635 20.49326  1.000 39.09789  ? 439 PHE A CE1 1 
ATOM   3124 C CE2 . PHE A 1 439 ? 26.19781 72.39656 21.71281  1.000 52.22137  ? 439 PHE A CE2 1 
ATOM   3125 C CZ  . PHE A 1 439 ? 25.11650 73.10355 21.20194  1.000 45.35259  ? 439 PHE A CZ  1 
ATOM   3126 N N   . PHE A 1 440 ? 24.82202 65.73510 21.17228  1.000 46.98346  ? 440 PHE A N   1 
ATOM   3127 C CA  . PHE A 1 440 ? 24.65963 64.43739 20.54187  1.000 43.33257  ? 440 PHE A CA  1 
ATOM   3128 C C   . PHE A 1 440 ? 24.31152 63.34717 21.54550  1.000 46.53968  ? 440 PHE A C   1 
ATOM   3129 O O   . PHE A 1 440 ? 23.19706 62.82027 21.53165  1.000 46.26563  ? 440 PHE A O   1 
ATOM   3130 C CB  . PHE A 1 440 ? 25.93585 64.07965 19.78457  1.000 48.24855  ? 440 PHE A CB  1 
ATOM   3131 C CG  . PHE A 1 440 ? 26.31729 65.08859 18.72463  1.000 53.55643  ? 440 PHE A CG  1 
ATOM   3132 C CD1 . PHE A 1 440 ? 25.78410 65.00113 17.43207  1.000 48.74255  ? 440 PHE A CD1 1 
ATOM   3133 C CD2 . PHE A 1 440 ? 27.21647 66.11101 19.00871  1.000 49.99071  ? 440 PHE A CD2 1 
ATOM   3134 C CE1 . PHE A 1 440 ? 26.14418 65.90332 16.44907  1.000 48.55975  ? 440 PHE A CE1 1 
ATOM   3135 C CE2 . PHE A 1 440 ? 27.57361 67.03003 18.02972  1.000 52.13529  ? 440 PHE A CE2 1 
ATOM   3136 C CZ  . PHE A 1 440 ? 27.03280 66.92291 16.74163  1.000 57.27274  ? 440 PHE A CZ  1 
ATOM   3137 N N   . THR A 1 441 ? 25.24053 63.01673 22.44343  1.000 46.46481  ? 441 THR A N   1 
ATOM   3138 C CA  . THR A 1 441 ? 25.07358 61.80448 23.24457  1.000 40.14035  ? 441 THR A CA  1 
ATOM   3139 C C   . THR A 1 441 ? 23.76916 61.80905 24.03976  1.000 44.97521  ? 441 THR A C   1 
ATOM   3140 O O   . THR A 1 441 ? 23.02063 60.82299 24.00144  1.000 52.37430  ? 441 THR A O   1 
ATOM   3141 C CB  . THR A 1 441 ? 26.28315 61.60010 24.15044  1.000 45.70243  ? 441 THR A CB  1 
ATOM   3142 O OG1 . THR A 1 441 ? 27.45784 61.42212 23.33017  1.000 42.40123  ? 441 THR A OG1 1 
ATOM   3143 C CG2 . THR A 1 441 ? 26.08551 60.36614 25.05244  1.000 31.31589  ? 441 THR A CG2 1 
ATOM   3144 N N   . CYS A 1 442 ? 23.43731 62.91812 24.70510  1.000 41.17969  ? 442 CYS A N   1 
ATOM   3145 C CA  . CYS A 1 442 ? 22.22023 62.92093 25.52477  1.000 49.52809  ? 442 CYS A CA  1 
ATOM   3146 C C   . CYS A 1 442 ? 20.91159 63.05622 24.72170  1.000 53.46541  ? 442 CYS A C   1 
ATOM   3147 O O   . CYS A 1 442 ? 19.89246 62.44527 25.08493  1.000 55.81133  ? 442 CYS A O   1 
ATOM   3148 C CB  . CYS A 1 442 ? 22.34096 64.03545 26.57231  1.000 50.38397  ? 442 CYS A CB  1 
ATOM   3149 S SG  . CYS A 1 442 ? 23.65350 63.63438 27.66647  1.000 48.57224  ? 442 CYS A SG  1 
ATOM   3150 N N   . PRO A 1 443 ? 20.87679 63.82647 23.62276  1.000 51.76094  ? 443 PRO A N   1 
ATOM   3151 C CA  . PRO A 1 443 ? 19.69087 63.76530 22.73906  1.000 43.08908  ? 443 PRO A CA  1 
ATOM   3152 C C   . PRO A 1 443 ? 19.48241 62.37760 22.17877  1.000 35.22363  ? 443 PRO A C   1 
ATOM   3153 O O   . PRO A 1 443 ? 18.35523 61.87993 22.24874  1.000 39.13824  ? 443 PRO A O   1 
ATOM   3154 C CB  . PRO A 1 443 ? 20.01228 64.80413 21.67710  1.000 41.03555  ? 443 PRO A CB  1 
ATOM   3155 C CG  . PRO A 1 443 ? 20.84378 65.77969 22.37939  1.000 47.22821  ? 443 PRO A CG  1 
ATOM   3156 C CD  . PRO A 1 443 ? 21.71289 64.98678 23.30820  1.000 48.40356  ? 443 PRO A CD  1 
ATOM   3157 N N   . THR A 1 444 ? 20.55503 61.71469 21.69885  1.000 32.83874  ? 444 THR A N   1 
ATOM   3158 C CA  . THR A 1 444 ? 20.46368 60.32227 21.24421  1.000 34.70909  ? 444 THR A CA  1 
ATOM   3159 C C   . THR A 1 444 ? 19.91855 59.43560 22.34766  1.000 46.10669  ? 444 THR A C   1 
ATOM   3160 O O   . THR A 1 444 ? 18.99507 58.64090 22.12770  1.000 48.16233  ? 444 THR A O   1 
ATOM   3161 C CB  . THR A 1 444 ? 21.82973 59.76413 20.82390  1.000 38.68348  ? 444 THR A CB  1 
ATOM   3162 O OG1 . THR A 1 444 ? 22.39911 60.51513 19.74871  1.000 46.66105  ? 444 THR A OG1 1 
ATOM   3163 C CG2 . THR A 1 444 ? 21.71525 58.26487 20.44055  1.000 29.76267  ? 444 THR A CG2 1 
ATOM   3164 N N   . ASN A 1 445 ? 20.53381 59.52051 23.53504  1.000 44.57364  ? 445 ASN A N   1 
ATOM   3165 C CA  . ASN A 1 445 ? 20.04587 58.77972 24.69351  1.000 47.29375  ? 445 ASN A CA  1 
ATOM   3166 C C   . ASN A 1 445 ? 18.56621 59.03343 24.91932  1.000 43.37195  ? 445 ASN A C   1 
ATOM   3167 O O   . ASN A 1 445 ? 17.77899 58.09194 25.06869  1.000 48.42569  ? 445 ASN A O   1 
ATOM   3168 C CB  . ASN A 1 445 ? 20.83972 59.15977 25.95051  1.000 56.51281  ? 445 ASN A CB  1 
ATOM   3169 C CG  . ASN A 1 445 ? 20.78671 58.08759 27.00742  1.000 53.37188  ? 445 ASN A CG  1 
ATOM   3170 O OD1 . ASN A 1 445 ? 19.94642 58.12248 27.90532  1.000 50.63293  ? 445 ASN A OD1 1 
ATOM   3171 N ND2 . ASN A 1 445 ? 21.66578 57.10128 26.88488  1.000 61.58435  ? 445 ASN A ND2 1 
ATOM   3172 N N   . GLU A 1 446 ? 18.16704 60.30639 24.95036  1.000 47.87951  ? 446 GLU A N   1 
ATOM   3173 C CA  . GLU A 1 446 ? 16.76174 60.62424 25.19384  1.000 50.04674  ? 446 GLU A CA  1 
ATOM   3174 C C   . GLU A 1 446 ? 15.86211 60.01347 24.11744  1.000 44.63630  ? 446 GLU A C   1 
ATOM   3175 O O   . GLU A 1 446 ? 14.83052 59.40340 24.42393  1.000 43.99553  ? 446 GLU A O   1 
ATOM   3176 C CB  . GLU A 1 446 ? 16.57856 62.14068 25.28674  1.000 51.92369  ? 446 GLU A CB  1 
ATOM   3177 C CG  . GLU A 1 446 ? 15.15388 62.57183 25.53047  1.000 69.48897  ? 446 GLU A CG  1 
ATOM   3178 C CD  . GLU A 1 446 ? 15.03380 64.06498 25.75204  1.000 97.07524  ? 446 GLU A CD  1 
ATOM   3179 O OE1 . GLU A 1 446 ? 14.81583 64.47489 26.91859  1.000 107.88515 ? 446 GLU A OE1 1 
ATOM   3180 O OE2 . GLU A 1 446 ? 15.15476 64.82612 24.75903  1.000 100.67717 ? 446 GLU A OE2 1 
ATOM   3181 N N   . TYR A 1 447 ? 16.25762 60.13441 22.84769  1.000 49.27399  ? 447 TYR A N   1 
ATOM   3182 C CA  . TYR A 1 447 ? 15.43908 59.58001 21.76992  1.000 52.85065  ? 447 TYR A CA  1 
ATOM   3183 C C   . TYR A 1 447 ? 15.41985 58.05781 21.81177  1.000 49.14606  ? 447 TYR A C   1 
ATOM   3184 O O   . TYR A 1 447 ? 14.38649 57.43345 21.53945  1.000 43.25007  ? 447 TYR A O   1 
ATOM   3185 C CB  . TYR A 1 447 ? 15.95185 60.06456 20.42447  1.000 46.02061  ? 447 TYR A CB  1 
ATOM   3186 C CG  . TYR A 1 447 ? 14.94557 59.95135 19.32353  1.000 55.55674  ? 447 TYR A CG  1 
ATOM   3187 C CD1 . TYR A 1 447 ? 13.76075 60.65889 19.37408  1.000 64.96384  ? 447 TYR A CD1 1 
ATOM   3188 C CD2 . TYR A 1 447 ? 15.17857 59.13376 18.22143  1.000 52.35852  ? 447 TYR A CD2 1 
ATOM   3189 C CE1 . TYR A 1 447 ? 12.83681 60.56749 18.35493  1.000 70.14310  ? 447 TYR A CE1 1 
ATOM   3190 C CE2 . TYR A 1 447 ? 14.25805 59.03456 17.20310  1.000 51.06399  ? 447 TYR A CE2 1 
ATOM   3191 C CZ  . TYR A 1 447 ? 13.09184 59.75311 17.27371  1.000 62.41189  ? 447 TYR A CZ  1 
ATOM   3192 O OH  . TYR A 1 447 ? 12.15803 59.66275 16.27055  1.000 73.06748  ? 447 TYR A OH  1 
ATOM   3193 N N   . ALA A 1 448 ? 16.55326 57.44485 22.15472  1.000 44.25523  ? 448 ALA A N   1 
ATOM   3194 C CA  . ALA A 1 448 ? 16.58664 55.99736 22.31688  1.000 38.84795  ? 448 ALA A CA  1 
ATOM   3195 C C   . ALA A 1 448 ? 15.60545 55.54190 23.39491  1.000 48.26172  ? 448 ALA A C   1 
ATOM   3196 O O   . ALA A 1 448 ? 14.90074 54.54070 23.22587  1.000 50.13918  ? 448 ALA A O   1 
ATOM   3197 C CB  . ALA A 1 448 ? 18.01346 55.54603 22.63624  1.000 39.94099  ? 448 ALA A CB  1 
ATOM   3198 N N   . GLN A 1 449 ? 15.51109 56.27816 24.49946  1.000 57.27560  ? 449 GLN A N   1 
ATOM   3199 C CA  . GLN A 1 449 ? 14.55967 55.85937 25.51854  1.000 57.05665  ? 449 GLN A CA  1 
ATOM   3200 C C   . GLN A 1 449 ? 13.13231 56.03907 25.03288  1.000 51.27942  ? 449 GLN A C   1 
ATOM   3201 O O   . GLN A 1 449 ? 12.28750 55.15963 25.24022  1.000 58.24075  ? 449 GLN A O   1 
ATOM   3202 C CB  . GLN A 1 449 ? 14.80024 56.61557 26.81582  1.000 55.27002  ? 449 GLN A CB  1 
ATOM   3203 C CG  . GLN A 1 449 ? 15.96053 56.09008 27.62000  1.000 55.05428  ? 449 GLN A CG  1 
ATOM   3204 C CD  . GLN A 1 449 ? 16.27074 57.00923 28.76682  1.000 59.07414  ? 449 GLN A CD  1 
ATOM   3205 O OE1 . GLN A 1 449 ? 15.51624 57.06022 29.73733  1.000 72.02077  ? 449 GLN A OE1 1 
ATOM   3206 N NE2 . GLN A 1 449 ? 17.36146 57.77396 28.65312  1.000 46.76146  ? 449 GLN A NE2 1 
ATOM   3207 N N   . ALA A 1 450 ? 12.85055 57.16285 24.37004  1.000 50.99332  ? 450 ALA A N   1 
ATOM   3208 C CA  . ALA A 1 450 ? 11.50992 57.39749 23.83626  1.000 47.27818  ? 450 ALA A CA  1 
ATOM   3209 C C   . ALA A 1 450 ? 11.15079 56.40266 22.74022  1.000 50.98089  ? 450 ALA A C   1 
ATOM   3210 O O   . ALA A 1 450 ? 9.97933  56.02663 22.61103  1.000 53.73880  ? 450 ALA A O   1 
ATOM   3211 C CB  . ALA A 1 450 ? 11.38894 58.81973 23.30122  1.000 46.20516  ? 450 ALA A CB  1 
ATOM   3212 N N   . LEU A 1 451 ? 12.12980 55.95769 21.94303  1.000 45.57723  ? 451 LEU A N   1 
ATOM   3213 C CA  . LEU A 1 451 ? 11.80374 54.97149 20.91915  1.000 54.47396  ? 451 LEU A CA  1 
ATOM   3214 C C   . LEU A 1 451 ? 11.46338 53.63401 21.55362  1.000 59.46428  ? 451 LEU A C   1 
ATOM   3215 O O   . LEU A 1 451 ? 10.49860 52.97361 21.14793  1.000 63.66418  ? 451 LEU A O   1 
ATOM   3216 C CB  . LEU A 1 451 ? 12.95077 54.81655 19.93136  1.000 48.00518  ? 451 LEU A CB  1 
ATOM   3217 C CG  . LEU A 1 451 ? 13.16182 55.91603 18.89575  1.000 45.35042  ? 451 LEU A CG  1 
ATOM   3218 C CD1 . LEU A 1 451 ? 14.51861 55.71253 18.24689  1.000 38.11131  ? 451 LEU A CD1 1 
ATOM   3219 C CD2 . LEU A 1 451 ? 12.09554 55.85009 17.85382  1.000 53.53336  ? 451 LEU A CD2 1 
ATOM   3220 N N   . ALA A 1 452 ? 12.23265 53.22799 22.56530  1.000 57.42684  ? 452 ALA A N   1 
ATOM   3221 C CA  . ALA A 1 452 ? 11.94193 51.97013 23.24377  1.000 58.06050  ? 452 ALA A CA  1 
ATOM   3222 C C   . ALA A 1 452 ? 10.56968 52.00516 23.89583  1.000 55.77636  ? 452 ALA A C   1 
ATOM   3223 O O   . ALA A 1 452 ? 9.82888  51.01627 23.85067  1.000 61.04483  ? 452 ALA A O   1 
ATOM   3224 C CB  . ALA A 1 452 ? 13.01777 51.65717 24.28080  1.000 57.16078  ? 452 ALA A CB  1 
ATOM   3225 N N   . GLU A 1 453 ? 10.19433 53.14454 24.47990  1.000 56.04832  ? 453 GLU A N   1 
ATOM   3226 C CA  . GLU A 1 453 ? 8.92220  53.19194 25.19339  1.000 62.46913  ? 453 GLU A CA  1 
ATOM   3227 C C   . GLU A 1 453 ? 7.74722  52.96955 24.25464  1.000 67.18021  ? 453 GLU A C   1 
ATOM   3228 O O   . GLU A 1 453 ? 6.70796  52.44977 24.67644  1.000 74.17032  ? 453 GLU A O   1 
ATOM   3229 C CB  . GLU A 1 453 ? 8.76808  54.51865 25.94736  1.000 69.20359  ? 453 GLU A CB  1 
ATOM   3230 C CG  . GLU A 1 453 ? 9.80027  54.74264 27.07118  1.000 84.06446  ? 453 GLU A CG  1 
ATOM   3231 C CD  . GLU A 1 453 ? 9.42764  54.09370 28.40490  1.000 99.46393  ? 453 GLU A CD  1 
ATOM   3232 O OE1 . GLU A 1 453 ? 8.60340  53.15253 28.42267  1.000 104.31045 ? 453 GLU A OE1 1 
ATOM   3233 O OE2 . GLU A 1 453 ? 9.96957  54.53213 29.44578  1.000 103.99146 ? 453 GLU A OE2 1 
ATOM   3234 N N   . ARG A 1 454 ? 7.88804  53.32157 22.97782  1.000 67.78655  ? 454 ARG A N   1 
ATOM   3235 C CA  . ARG A 1 454 ? 6.77815  53.15759 22.05637  1.000 68.89350  ? 454 ARG A CA  1 
ATOM   3236 C C   . ARG A 1 454 ? 6.91536  51.90867 21.19802  1.000 68.20111  ? 454 ARG A C   1 
ATOM   3237 O O   . ARG A 1 454 ? 6.22089  51.77886 20.18641  1.000 68.30810  ? 454 ARG A O   1 
ATOM   3238 C CB  . ARG A 1 454 ? 6.59046  54.42278 21.21881  1.000 74.09322  ? 454 ARG A CB  1 
ATOM   3239 C CG  . ARG A 1 454 ? 5.86278  55.52591 22.01917  1.000 91.60270  ? 454 ARG A CG  1 
ATOM   3240 C CD  . ARG A 1 454 ? 4.39198  55.77641 21.59571  1.000 103.31759 ? 454 ARG A CD  1 
ATOM   3241 N NE  . ARG A 1 454 ? 3.35409  55.06174 22.35108  1.000 111.74599 ? 454 ARG A NE  1 
ATOM   3242 C CZ  . ARG A 1 454 ? 2.16563  54.74718 21.83473  1.000 126.68747 ? 454 ARG A CZ  1 
ATOM   3243 N NH1 . ARG A 1 454 ? 1.89197  55.08911 20.58298  1.000 130.98750 ? 454 ARG A NH1 1 
ATOM   3244 N NH2 . ARG A 1 454 ? 1.24518  54.10779 22.55246  1.000 131.66652 ? 454 ARG A NH2 1 
ATOM   3245 N N   . GLY A 1 455 ? 7.75186  50.95853 21.62043  1.000 71.95197  ? 455 GLY A N   1 
ATOM   3246 C CA  . GLY A 1 455 ? 7.74991  49.60966 21.09084  1.000 77.73808  ? 455 GLY A CA  1 
ATOM   3247 C C   . GLY A 1 455 ? 8.94732  49.23578 20.24004  1.000 69.61180  ? 455 GLY A C   1 
ATOM   3248 O O   . GLY A 1 455 ? 9.17269  48.03804 20.02259  1.000 73.55705  ? 455 GLY A O   1 
ATOM   3249 N N   . ALA A 1 456 ? 9.71287  50.21374 19.74619  1.000 59.09142  ? 456 ALA A N   1 
ATOM   3250 C CA  . ALA A 1 456 ? 10.84198 49.92684 18.86383  1.000 49.37270  ? 456 ALA A CA  1 
ATOM   3251 C C   . ALA A 1 456 ? 11.90125 49.10000 19.57692  1.000 54.43035  ? 456 ALA A C   1 
ATOM   3252 O O   . ALA A 1 456 ? 12.23036 49.34454 20.73674  1.000 65.33680  ? 456 ALA A O   1 
ATOM   3253 C CB  . ALA A 1 456 ? 11.46984 51.22472 18.35967  1.000 41.20490  ? 456 ALA A CB  1 
ATOM   3254 N N   . SER A 1 457 ? 12.43491 48.11062 18.87908  1.000 57.11130  ? 457 SER A N   1 
ATOM   3255 C CA  . SER A 1 457 ? 13.50881 47.29439 19.42862  1.000 55.15028  ? 457 SER A CA  1 
ATOM   3256 C C   . SER A 1 457 ? 14.81091 48.05542 19.21213  1.000 56.46239  ? 457 SER A C   1 
ATOM   3257 O O   . SER A 1 457 ? 15.36688 48.05946 18.11153  1.000 60.51688  ? 457 SER A O   1 
ATOM   3258 C CB  . SER A 1 457 ? 13.52007 45.92147 18.77198  1.000 53.87362  ? 457 SER A CB  1 
ATOM   3259 O OG  . SER A 1 457 ? 14.83787 45.41445 18.69768  1.000 64.43986  ? 457 SER A OG  1 
ATOM   3260 N N   . VAL A 1 458 ? 15.28226 48.73179 20.26087  1.000 49.18383  ? 458 VAL A N   1 
ATOM   3261 C CA  . VAL A 1 458 ? 16.43699 49.61931 20.19008  1.000 45.68468  ? 458 VAL A CA  1 
ATOM   3262 C C   . VAL A 1 458 ? 17.66800 48.87698 20.67869  1.000 52.98496  ? 458 VAL A C   1 
ATOM   3263 O O   . VAL A 1 458 ? 17.62617 48.15349 21.68097  1.000 53.73138  ? 458 VAL A O   1 
ATOM   3264 C CB  . VAL A 1 458 ? 16.21978 50.90372 21.01557  1.000 47.80747  ? 458 VAL A CB  1 
ATOM   3265 C CG1 . VAL A 1 458 ? 17.54312 51.61420 21.24701  1.000 42.01120  ? 458 VAL A CG1 1 
ATOM   3266 C CG2 . VAL A 1 458 ? 15.20163 51.84535 20.32734  1.000 46.79385  ? 458 VAL A CG2 1 
ATOM   3267 N N   . HIS A 1 459 ? 18.76723 49.04238 19.95976  1.000 53.68885  ? 459 HIS A N   1 
ATOM   3268 C CA  . HIS A 1 459 ? 20.05921 48.56451 20.40432  1.000 47.29755  ? 459 HIS A CA  1 
ATOM   3269 C C   . HIS A 1 459 ? 21.01690 49.74334 20.38268  1.000 49.65720  ? 459 HIS A C   1 
ATOM   3270 O O   . HIS A 1 459 ? 21.03351 50.51396 19.42372  1.000 55.72916  ? 459 HIS A O   1 
ATOM   3271 C CB  . HIS A 1 459 ? 20.53519 47.42080 19.52742  1.000 41.51269  ? 459 HIS A CB  1 
ATOM   3272 C CG  . HIS A 1 459 ? 20.09341 46.07429 20.00501  1.000 43.26686  ? 459 HIS A CG  1 
ATOM   3273 N ND1 . HIS A 1 459 ? 18.92344 45.47980 19.58239  1.000 46.64166  ? 459 HIS A ND1 1 
ATOM   3274 C CD2 . HIS A 1 459 ? 20.67263 45.19614 20.85840  1.000 45.33511  ? 459 HIS A CD2 1 
ATOM   3275 C CE1 . HIS A 1 459 ? 18.79972 44.29376 20.15268  1.000 47.08764  ? 459 HIS A CE1 1 
ATOM   3276 N NE2 . HIS A 1 459 ? 19.85175 44.09508 20.92977  1.000 48.61513  ? 459 HIS A NE2 1 
ATOM   3277 N N   . TYR A 1 460 ? 21.77884 49.90315 21.45497  1.000 53.00913  ? 460 TYR A N   1 
ATOM   3278 C CA  . TYR A 1 460 ? 22.58516 51.09074 21.69105  1.000 44.76138  ? 460 TYR A CA  1 
ATOM   3279 C C   . TYR A 1 460 ? 24.04969 50.68374 21.72274  1.000 42.96426  ? 460 TYR A C   1 
ATOM   3280 O O   . TYR A 1 460 ? 24.39306 49.63845 22.28813  1.000 54.73222  ? 460 TYR A O   1 
ATOM   3281 C CB  . TYR A 1 460 ? 22.17233 51.75522 23.02167  1.000 46.00560  ? 460 TYR A CB  1 
ATOM   3282 C CG  . TYR A 1 460 ? 22.44422 53.24033 23.11201  1.000 38.20586  ? 460 TYR A CG  1 
ATOM   3283 C CD1 . TYR A 1 460 ? 23.73409 53.72682 23.26721  1.000 33.13426  ? 460 TYR A CD1 1 
ATOM   3284 C CD2 . TYR A 1 460 ? 21.40273 54.15643 23.06272  1.000 40.10887  ? 460 TYR A CD2 1 
ATOM   3285 C CE1 . TYR A 1 460 ? 23.97721 55.09187 23.34000  1.000 34.30054  ? 460 TYR A CE1 1 
ATOM   3286 C CE2 . TYR A 1 460 ? 21.63320 55.50589 23.15850  1.000 35.83389  ? 460 TYR A CE2 1 
ATOM   3287 C CZ  . TYR A 1 460 ? 22.92040 55.97449 23.28983  1.000 39.32152  ? 460 TYR A CZ  1 
ATOM   3288 O OH  . TYR A 1 460 ? 23.13488 57.34007 23.37095  1.000 45.34053  ? 460 TYR A OH  1 
ATOM   3289 N N   . TYR A 1 461 ? 24.91251 51.49167 21.10611  1.000 36.54577  ? 461 TYR A N   1 
ATOM   3290 C CA  . TYR A 1 461 ? 26.34950 51.22656 21.09853  1.000 39.19717  ? 461 TYR A CA  1 
ATOM   3291 C C   . TYR A 1 461 ? 27.06153 52.49736 21.53350  1.000 40.70796  ? 461 TYR A C   1 
ATOM   3292 O O   . TYR A 1 461 ? 26.50494 53.59493 21.46298  1.000 38.41875  ? 461 TYR A O   1 
ATOM   3293 C CB  . TYR A 1 461 ? 26.88884 50.75811 19.69796  1.000 42.19314  ? 461 TYR A CB  1 
ATOM   3294 C CG  . TYR A 1 461 ? 26.83648 51.88477 18.67996  1.000 49.64732  ? 461 TYR A CG  1 
ATOM   3295 C CD1 . TYR A 1 461 ? 27.80637 52.89501 18.67093  1.000 47.93033  ? 461 TYR A CD1 1 
ATOM   3296 C CD2 . TYR A 1 461 ? 25.77816 51.98130 17.78129  1.000 47.74611  ? 461 TYR A CD2 1 
ATOM   3297 C CE1 . TYR A 1 461 ? 27.71788 53.95793 17.79782  1.000 48.39372  ? 461 TYR A CE1 1 
ATOM   3298 C CE2 . TYR A 1 461 ? 25.68798 53.03948 16.89190  1.000 48.79875  ? 461 TYR A CE2 1 
ATOM   3299 C CZ  . TYR A 1 461 ? 26.66308 54.01611 16.90340  1.000 45.63638  ? 461 TYR A CZ  1 
ATOM   3300 O OH  . TYR A 1 461 ? 26.57486 55.07795 16.05892  1.000 37.40952  ? 461 TYR A OH  1 
ATOM   3301 N N   . TYR A 1 462 ? 28.31466 52.33611 21.95645  1.000 47.64931  ? 462 TYR A N   1 
ATOM   3302 C CA  . TYR A 1 462 ? 29.17163 53.44876 22.35501  1.000 45.64541  ? 462 TYR A CA  1 
ATOM   3303 C C   . TYR A 1 462 ? 30.56993 53.16891 21.83737  1.000 41.33072  ? 462 TYR A C   1 
ATOM   3304 O O   . TYR A 1 462 ? 31.17877 52.16167 22.21523  1.000 50.49123  ? 462 TYR A O   1 
ATOM   3305 C CB  . TYR A 1 462 ? 29.19392 53.61286 23.87731  1.000 50.06694  ? 462 TYR A CB  1 
ATOM   3306 C CG  . TYR A 1 462 ? 29.70423 54.95370 24.37692  1.000 54.00130  ? 462 TYR A CG  1 
ATOM   3307 C CD1 . TYR A 1 462 ? 29.21523 56.14633 23.85692  1.000 44.91523  ? 462 TYR A CD1 1 
ATOM   3308 C CD2 . TYR A 1 462 ? 30.65713 55.02174 25.40293  1.000 58.82071  ? 462 TYR A CD2 1 
ATOM   3309 C CE1 . TYR A 1 462 ? 29.66221 57.36060 24.33322  1.000 49.86781  ? 462 TYR A CE1 1 
ATOM   3310 C CE2 . TYR A 1 462 ? 31.11228 56.23712 25.88821  1.000 49.53602  ? 462 TYR A CE2 1 
ATOM   3311 C CZ  . TYR A 1 462 ? 30.60942 57.40484 25.35324  1.000 58.10696  ? 462 TYR A CZ  1 
ATOM   3312 O OH  . TYR A 1 462 ? 31.05505 58.62757 25.82660  1.000 65.45672  ? 462 TYR A OH  1 
ATOM   3313 N N   . PHE A 1 463 ? 31.08001 54.05066 20.98276  1.000 37.83131  ? 463 PHE A N   1 
ATOM   3314 C CA  . PHE A 1 463 ? 32.32337 53.80593 20.25817  1.000 38.99002  ? 463 PHE A CA  1 
ATOM   3315 C C   . PHE A 1 463 ? 33.45937 54.53609 20.96381  1.000 42.72358  ? 463 PHE A C   1 
ATOM   3316 O O   . PHE A 1 463 ? 33.43960 55.76676 21.07312  1.000 47.79999  ? 463 PHE A O   1 
ATOM   3317 C CB  . PHE A 1 463 ? 32.18697 54.25001 18.79519  1.000 37.74007  ? 463 PHE A CB  1 
ATOM   3318 C CG  . PHE A 1 463 ? 33.44258 54.06330 17.97755  1.000 40.44364  ? 463 PHE A CG  1 
ATOM   3319 C CD1 . PHE A 1 463 ? 33.86951 52.79427 17.60188  1.000 45.92648  ? 463 PHE A CD1 1 
ATOM   3320 C CD2 . PHE A 1 463 ? 34.19511 55.15363 17.59339  1.000 42.92062  ? 463 PHE A CD2 1 
ATOM   3321 C CE1 . PHE A 1 463 ? 35.03617 52.61724 16.85131  1.000 46.59979  ? 463 PHE A CE1 1 
ATOM   3322 C CE2 . PHE A 1 463 ? 35.35590 54.98865 16.83602  1.000 48.60193  ? 463 PHE A CE2 1 
ATOM   3323 C CZ  . PHE A 1 463 ? 35.77496 53.71986 16.46844  1.000 48.06504  ? 463 PHE A CZ  1 
ATOM   3324 N N   . THR A 1 464 ? 34.44609 53.78854 21.45127  1.000 43.43755  ? 464 THR A N   1 
ATOM   3325 C CA  . THR A 1 464 ? 35.44852 54.42088 22.30540  1.000 56.16451  ? 464 THR A CA  1 
ATOM   3326 C C   . THR A 1 464 ? 36.86285 54.17076 21.82113  1.000 63.88258  ? 464 THR A C   1 
ATOM   3327 O O   . THR A 1 464 ? 37.81056 54.40148 22.57565  1.000 67.09917  ? 464 THR A O   1 
ATOM   3328 C CB  . THR A 1 464 ? 35.32061 53.97910 23.77527  1.000 56.16390  ? 464 THR A CB  1 
ATOM   3329 O OG1 . THR A 1 464 ? 35.37284 52.55255 23.87107  1.000 63.10572  ? 464 THR A OG1 1 
ATOM   3330 C CG2 . THR A 1 464 ? 34.02767 54.43696 24.34500  1.000 36.12931  ? 464 THR A CG2 1 
ATOM   3331 N N   . HIS A 1 465 ? 37.03157 53.71242 20.58426  1.000 72.25534  ? 465 HIS A N   1 
ATOM   3332 C CA  . HIS A 1 465 ? 38.36695 53.48852 20.04958  1.000 65.04222  ? 465 HIS A CA  1 
ATOM   3333 C C   . HIS A 1 465 ? 38.84061 54.72485 19.30637  1.000 61.03985  ? 465 HIS A C   1 
ATOM   3334 O O   . HIS A 1 465 ? 38.15279 55.21638 18.40708  1.000 63.80139  ? 465 HIS A O   1 
ATOM   3335 C CB  . HIS A 1 465 ? 38.43603 52.28413 19.12042  1.000 54.84932  ? 465 HIS A CB  1 
ATOM   3336 C CG  . HIS A 1 465 ? 39.83042 51.99239 18.67931  1.000 66.10892  ? 465 HIS A CG  1 
ATOM   3337 N ND1 . HIS A 1 465 ? 40.78315 51.48632 19.53461  1.000 77.10784  ? 465 HIS A ND1 1 
ATOM   3338 C CD2 . HIS A 1 465 ? 40.45876 52.20846 17.50121  1.000 75.07050  ? 465 HIS A CD2 1 
ATOM   3339 C CE1 . HIS A 1 465 ? 41.93165 51.36594 18.89184  1.000 79.34219  ? 465 HIS A CE1 1 
ATOM   3340 N NE2 . HIS A 1 465 ? 41.76121 51.79693 17.65608  1.000 77.72781  ? 465 HIS A NE2 1 
ATOM   3341 N N   . ARG A 1 466 ? 40.00701 55.22821 19.69548  1.000 61.02280  ? 466 ARG A N   1 
ATOM   3342 C CA  . ARG A 1 466 ? 40.70500 56.24871 18.93049  1.000 64.58913  ? 466 ARG A CA  1 
ATOM   3343 C C   . ARG A 1 466 ? 41.62556 55.52732 17.95584  1.000 63.90242  ? 466 ARG A C   1 
ATOM   3344 O O   . ARG A 1 466 ? 42.56281 54.83678 18.37967  1.000 53.66704  ? 466 ARG A O   1 
ATOM   3345 C CB  . ARG A 1 466 ? 41.49208 57.19530 19.82967  1.000 45.33901  ? 466 ARG A CB  1 
ATOM   3346 C CG  . ARG A 1 466 ? 42.52496 57.94530 19.04046  1.000 51.40224  ? 466 ARG A CG  1 
ATOM   3347 C CD  . ARG A 1 466 ? 43.05132 59.14559 19.72857  1.000 53.71701  ? 466 ARG A CD  1 
ATOM   3348 N NE  . ARG A 1 466 ? 44.11527 59.79892 18.96174  1.000 60.19504  ? 466 ARG A NE  1 
ATOM   3349 C CZ  . ARG A 1 466 ? 44.03910 61.04547 18.50318  1.000 62.62145  ? 466 ARG A CZ  1 
ATOM   3350 N NH1 . ARG A 1 466 ? 42.94570 61.79715 18.71667  1.000 49.17875  ? 466 ARG A NH1 1 
ATOM   3351 N NH2 . ARG A 1 466 ? 45.06406 61.54253 17.83987  1.000 60.59422  ? 466 ARG A NH2 1 
ATOM   3352 N N   . THR A 1 467 ? 41.34200 55.66627 16.65511  1.000 65.77882  ? 467 THR A N   1 
ATOM   3353 C CA  . THR A 1 467 ? 42.12871 54.95276 15.65848  1.000 64.74067  ? 467 THR A CA  1 
ATOM   3354 C C   . THR A 1 467 ? 43.59590 55.32873 15.78209  1.000 58.86605  ? 467 THR A C   1 
ATOM   3355 O O   . THR A 1 467 ? 43.93430 56.47605 16.08508  1.000 58.70450  ? 467 THR A O   1 
ATOM   3356 C CB  . THR A 1 467 ? 41.63381 55.23162 14.23119  1.000 66.04400  ? 467 THR A CB  1 
ATOM   3357 O OG1 . THR A 1 467 ? 40.19929 55.19998 14.17572  1.000 64.36640  ? 467 THR A OG1 1 
ATOM   3358 C CG2 . THR A 1 467 ? 42.17700 54.18457 13.29233  1.000 69.94689  ? 467 THR A CG2 1 
ATOM   3359 N N   . SER A 1 468 ? 44.46440 54.33557 15.57138  1.000 55.15440  ? 468 SER A N   1 
ATOM   3360 C CA  . SER A 1 468 ? 45.88925 54.52289 15.80107  1.000 66.79837  ? 468 SER A CA  1 
ATOM   3361 C C   . SER A 1 468 ? 46.47049 55.56623 14.85687  1.000 85.04557  ? 468 SER A C   1 
ATOM   3362 O O   . SER A 1 468 ? 47.34972 56.34657 15.24499  1.000 93.24301  ? 468 SER A O   1 
ATOM   3363 C CB  . SER A 1 468 ? 46.60868 53.18807 15.64051  1.000 73.97953  ? 468 SER A CB  1 
ATOM   3364 O OG  . SER A 1 468 ? 46.24074 52.58948 14.40639  1.000 83.57010  ? 468 SER A OG  1 
ATOM   3365 N N   . THR A 1 469 ? 45.99602 55.59879 13.61438  1.000 82.33133  ? 469 THR A N   1 
ATOM   3366 C CA  . THR A 1 469 ? 46.54494 56.53958 12.65120  1.000 78.32823  ? 469 THR A CA  1 
ATOM   3367 C C   . THR A 1 469 ? 45.91064 57.91483 12.73772  1.000 75.52605  ? 469 THR A C   1 
ATOM   3368 O O   . THR A 1 469 ? 46.34047 58.81120 12.00897  1.000 81.46104  ? 469 THR A O   1 
ATOM   3369 C CB  . THR A 1 469 ? 46.38896 56.00634 11.22767  1.000 78.19895  ? 469 THR A CB  1 
ATOM   3370 O OG1 . THR A 1 469 ? 44.99312 55.86589 10.92790  1.000 78.90473  ? 469 THR A OG1 1 
ATOM   3371 C CG2 . THR A 1 469 ? 47.10219 54.67594 11.07808  1.000 72.17862  ? 469 THR A CG2 1 
ATOM   3372 N N   . SER A 1 470 ? 44.91035 58.10474 13.59182  1.000 69.59273  ? 470 SER A N   1 
ATOM   3373 C CA  . SER A 1 470 ? 44.28729 59.41379 13.71829  1.000 63.87812  ? 470 SER A CA  1 
ATOM   3374 C C   . SER A 1 470 ? 45.34089 60.48266 13.91069  1.000 76.37271  ? 470 SER A C   1 
ATOM   3375 O O   . SER A 1 470 ? 46.12882 60.42852 14.86419  1.000 83.15075  ? 470 SER A O   1 
ATOM   3376 C CB  . SER A 1 470 ? 43.32043 59.43410 14.88482  1.000 68.70639  ? 470 SER A CB  1 
ATOM   3377 O OG  . SER A 1 470 ? 42.64420 60.67636 14.92089  1.000 74.66221  ? 470 SER A OG  1 
ATOM   3378 N N   . LEU A 1 471 ? 45.37913 61.44453 12.99000  1.000 74.80648  ? 471 LEU A N   1 
ATOM   3379 C CA  . LEU A 1 471 ? 46.29140 62.56393 13.15233  1.000 83.57577  ? 471 LEU A CA  1 
ATOM   3380 C C   . LEU A 1 471 ? 45.59407 63.81973 13.65704  1.000 75.07923  ? 471 LEU A C   1 
ATOM   3381 O O   . LEU A 1 471 ? 46.19059 64.89951 13.64097  1.000 79.05593  ? 471 LEU A O   1 
ATOM   3382 C CB  . LEU A 1 471 ? 47.04572 62.83180 11.85016  1.000 92.33132  ? 471 LEU A CB  1 
ATOM   3383 C CG  . LEU A 1 471 ? 48.43713 62.18821 11.96291  1.000 92.93748  ? 471 LEU A CG  1 
ATOM   3384 C CD1 . LEU A 1 471 ? 49.21309 62.28599 10.66692  1.000 89.37327  ? 471 LEU A CD1 1 
ATOM   3385 C CD2 . LEU A 1 471 ? 49.26253 62.72887 13.16149  1.000 87.29154  ? 471 LEU A CD2 1 
ATOM   3386 N N   . TRP A 1 472 ? 44.36409 63.69481 14.14272  1.000 69.77677  ? 472 TRP A N   1 
ATOM   3387 C CA  . TRP A 1 472 ? 43.80632 64.73423 14.99004  1.000 63.20048  ? 472 TRP A CA  1 
ATOM   3388 C C   . TRP A 1 472 ? 44.55162 64.74428 16.31357  1.000 63.41898  ? 472 TRP A C   1 
ATOM   3389 O O   . TRP A 1 472 ? 45.27100 63.80162 16.64603  1.000 69.20249  ? 472 TRP A O   1 
ATOM   3390 C CB  . TRP A 1 472 ? 42.31134 64.51732 15.20928  1.000 54.60151  ? 472 TRP A CB  1 
ATOM   3391 C CG  . TRP A 1 472 ? 41.53775 64.89319 14.01990  1.000 58.00964  ? 472 TRP A CG  1 
ATOM   3392 C CD1 . TRP A 1 472 ? 40.85212 64.05639 13.18818  1.000 55.96876  ? 472 TRP A CD1 1 
ATOM   3393 C CD2 . TRP A 1 472 ? 41.39431 66.21200 13.47593  1.000 66.93907  ? 472 TRP A CD2 1 
ATOM   3394 N NE1 . TRP A 1 472 ? 40.28764 64.77814 12.16277  1.000 63.18801  ? 472 TRP A NE1 1 
ATOM   3395 C CE2 . TRP A 1 472 ? 40.60150 66.10221 12.32012  1.000 67.75183  ? 472 TRP A CE2 1 
ATOM   3396 C CE3 . TRP A 1 472 ? 41.85598 67.47365 13.85695  1.000 74.02594  ? 472 TRP A CE3 1 
ATOM   3397 C CZ2 . TRP A 1 472 ? 40.25946 67.20321 11.54439  1.000 71.65720  ? 472 TRP A CZ2 1 
ATOM   3398 C CZ3 . TRP A 1 472 ? 41.50903 68.56771 13.08357  1.000 79.63121  ? 472 TRP A CZ3 1 
ATOM   3399 C CH2 . TRP A 1 472 ? 40.72074 68.42394 11.94099  1.000 76.72906  ? 472 TRP A CH2 1 
ATOM   3400 N N   . GLY A 1 473 ? 44.41930 65.84494 17.04971  1.000 67.22962  ? 473 GLY A N   1 
ATOM   3401 C CA  . GLY A 1 473 ? 45.11680 65.95249 18.32277  1.000 69.08944  ? 473 GLY A CA  1 
ATOM   3402 C C   . GLY A 1 473 ? 44.63213 64.91806 19.31580  1.000 64.39068  ? 473 GLY A C   1 
ATOM   3403 O O   . GLY A 1 473 ? 43.46045 64.52823 19.31704  1.000 59.00491  ? 473 GLY A O   1 
ATOM   3404 N N   . GLU A 1 474 ? 45.55795 64.45513 20.16357  1.000 71.85928  ? 474 GLU A N   1 
ATOM   3405 C CA  . GLU A 1 474 ? 45.21089 63.41022 21.12405  1.000 74.97390  ? 474 GLU A CA  1 
ATOM   3406 C C   . GLU A 1 474 ? 44.09222 63.87092 22.04746  1.000 66.96495  ? 474 GLU A C   1 
ATOM   3407 O O   . GLU A 1 474 ? 43.17599 63.10128 22.35209  1.000 66.34327  ? 474 GLU A O   1 
ATOM   3408 C CB  . GLU A 1 474 ? 46.43362 62.98353 21.94162  1.000 74.37178  ? 474 GLU A CB  1 
ATOM   3409 C CG  . GLU A 1 474 ? 46.20215 61.68451 22.72049  1.000 84.51796  ? 474 GLU A CG  1 
ATOM   3410 C CD  . GLU A 1 474 ? 46.34589 60.41638 21.85850  1.000 96.89867  ? 474 GLU A CD  1 
ATOM   3411 O OE1 . GLU A 1 474 ? 45.42011 59.56647 21.88111  1.000 96.72915  ? 474 GLU A OE1 1 
ATOM   3412 O OE2 . GLU A 1 474 ? 47.38229 60.25927 21.17008  1.000 101.07596 ? 474 GLU A OE2 1 
ATOM   3413 N N   . TRP A 1 475 ? 44.13293 65.13930 22.47023  1.000 64.05054  ? 475 TRP A N   1 
ATOM   3414 C CA  . TRP A 1 475 ? 43.09664 65.67562 23.34821  1.000 60.01152  ? 475 TRP A CA  1 
ATOM   3415 C C   . TRP A 1 475 ? 41.71422 65.60363 22.73841  1.000 54.74296  ? 475 TRP A C   1 
ATOM   3416 O O   . TRP A 1 475 ? 40.72820 65.63141 23.48330  1.000 49.15414  ? 475 TRP A O   1 
ATOM   3417 C CB  . TRP A 1 475 ? 43.38448 67.12506 23.69931  1.000 69.35764  ? 475 TRP A CB  1 
ATOM   3418 C CG  . TRP A 1 475 ? 43.22947 68.10229 22.56662  1.000 65.72521  ? 475 TRP A CG  1 
ATOM   3419 C CD1 . TRP A 1 475 ? 44.21721 68.53436 21.73007  1.000 68.21975  ? 475 TRP A CD1 1 
ATOM   3420 C CD2 . TRP A 1 475 ? 42.03783 68.81103 22.18016  1.000 53.63425  ? 475 TRP A CD2 1 
ATOM   3421 N NE1 . TRP A 1 475 ? 43.71723 69.45192 20.84554  1.000 66.23857  ? 475 TRP A NE1 1 
ATOM   3422 C CE2 . TRP A 1 475 ? 42.38286 69.64052 21.09546  1.000 58.25216  ? 475 TRP A CE2 1 
ATOM   3423 C CE3 . TRP A 1 475 ? 40.71437 68.81629 22.63651  1.000 58.08505  ? 475 TRP A CE3 1 
ATOM   3424 C CZ2 . TRP A 1 475 ? 41.45252 70.46864 20.45226  1.000 60.17542  ? 475 TRP A CZ2 1 
ATOM   3425 C CZ3 . TRP A 1 475 ? 39.78062 69.64494 21.98849  1.000 60.56018  ? 475 TRP A CZ3 1 
ATOM   3426 C CH2 . TRP A 1 475 ? 40.16284 70.45886 20.91544  1.000 59.00535  ? 475 TRP A CH2 1 
ATOM   3427 N N   . MET A 1 476 ? 41.61052 65.55549 21.40388  1.000 57.12797  ? 476 MET A N   1 
ATOM   3428 C CA  . MET A 1 476 ? 40.30574 65.49419 20.75735  1.000 56.89290  ? 476 MET A CA  1 
ATOM   3429 C C   . MET A 1 476 ? 39.68964 64.10711 20.82588  1.000 54.84802  ? 476 MET A C   1 
ATOM   3430 O O   . MET A 1 476 ? 38.58138 63.91683 20.31310  1.000 52.12908  ? 476 MET A O   1 
ATOM   3431 C CB  . MET A 1 476 ? 40.40671 65.94265 19.30259  1.000 57.54364  ? 476 MET A CB  1 
ATOM   3432 C CG  . MET A 1 476 ? 40.87114 67.36193 19.12001  1.000 64.17200  ? 476 MET A CG  1 
ATOM   3433 S SD  . MET A 1 476 ? 41.12238 67.76656 17.36856  1.000 72.60557  ? 476 MET A SD  1 
ATOM   3434 C CE  . MET A 1 476 ? 39.45512 67.57648 16.76255  1.000 59.19191  ? 476 MET A CE  1 
ATOM   3435 N N   . GLY A 1 477 ? 40.40707 63.14160 21.40282  1.000 50.89085  ? 477 GLY A N   1 
ATOM   3436 C CA  . GLY A 1 477 ? 39.83265 61.84655 21.72748  1.000 49.72338  ? 477 GLY A CA  1 
ATOM   3437 C C   . GLY A 1 477 ? 39.31533 61.07540 20.52454  1.000 54.91866  ? 477 GLY A C   1 
ATOM   3438 O O   . GLY A 1 477 ? 39.98752 60.94005 19.49537  1.000 50.87773  ? 477 GLY A O   1 
ATOM   3439 N N   . VAL A 1 478 ? 38.10978 60.53959 20.68359  1.000 50.88683  ? 478 VAL A N   1 
ATOM   3440 C CA  . VAL A 1 478 ? 37.43429 59.73158 19.68121  1.000 44.60215  ? 478 VAL A CA  1 
ATOM   3441 C C   . VAL A 1 478 ? 36.42579 60.63922 18.98893  1.000 45.08212  ? 478 VAL A C   1 
ATOM   3442 O O   . VAL A 1 478 ? 35.30983 60.82711 19.47586  1.000 44.93448  ? 478 VAL A O   1 
ATOM   3443 C CB  . VAL A 1 478 ? 36.75827 58.51741 20.31490  1.000 46.00534  ? 478 VAL A CB  1 
ATOM   3444 C CG1 . VAL A 1 478 ? 36.07669 57.70321 19.25774  1.000 43.35025  ? 478 VAL A CG1 1 
ATOM   3445 C CG2 . VAL A 1 478 ? 37.77694 57.66795 21.08346  1.000 39.33856  ? 478 VAL A CG2 1 
ATOM   3446 N N   . LEU A 1 479 ? 36.81330 61.18376 17.83562  1.000 47.50589  ? 479 LEU A N   1 
ATOM   3447 C CA  . LEU A 1 479 ? 36.04520 62.23793 17.17612  1.000 55.80703  ? 479 LEU A CA  1 
ATOM   3448 C C   . LEU A 1 479 ? 34.66395 61.77133 16.72225  1.000 54.43392  ? 479 LEU A C   1 
ATOM   3449 O O   . LEU A 1 479 ? 34.45363 60.61596 16.33839  1.000 49.87460  ? 479 LEU A O   1 
ATOM   3450 C CB  . LEU A 1 479 ? 36.80246 62.76744 15.95852  1.000 52.88845  ? 479 LEU A CB  1 
ATOM   3451 C CG  . LEU A 1 479 ? 37.68189 63.98257 16.21203  1.000 56.86036  ? 479 LEU A CG  1 
ATOM   3452 C CD1 . LEU A 1 479 ? 38.96442 63.59336 16.96716  1.000 54.49802  ? 479 LEU A CD1 1 
ATOM   3453 C CD2 . LEU A 1 479 ? 37.97793 64.62928 14.85969  1.000 62.09628  ? 479 LEU A CD2 1 
ATOM   3454 N N   . HIS A 1 480 ? 33.71728 62.69748 16.78477  1.000 47.04324  ? 480 HIS A N   1 
ATOM   3455 C CA  . HIS A 1 480 ? 32.48077 62.58604 16.02941  1.000 51.71806  ? 480 HIS A CA  1 
ATOM   3456 C C   . HIS A 1 480 ? 32.78145 62.16797 14.59151  1.000 63.52343  ? 480 HIS A C   1 
ATOM   3457 O O   . HIS A 1 480 ? 33.53462 62.84201 13.88240  1.000 64.58821  ? 480 HIS A O   1 
ATOM   3458 C CB  . HIS A 1 480 ? 31.78384 63.94580 16.08289  1.000 48.27393  ? 480 HIS A CB  1 
ATOM   3459 C CG  . HIS A 1 480 ? 30.52343 64.03716 15.28427  1.000 57.00216  ? 480 HIS A CG  1 
ATOM   3460 N ND1 . HIS A 1 480 ? 29.28501 63.73119 15.80732  1.000 59.58509  ? 480 HIS A ND1 1 
ATOM   3461 C CD2 . HIS A 1 480 ? 30.30353 64.45380 14.01549  1.000 58.24227  ? 480 HIS A CD2 1 
ATOM   3462 C CE1 . HIS A 1 480 ? 28.35818 63.94704 14.89347  1.000 61.00356  ? 480 HIS A CE1 1 
ATOM   3463 N NE2 . HIS A 1 480 ? 28.95098 64.37848 13.79483  1.000 59.18118  ? 480 HIS A NE2 1 
ATOM   3464 N N   . GLY A 1 481 ? 32.23186 61.03028 14.16587  1.000 63.45433  ? 481 GLY A N   1 
ATOM   3465 C CA  . GLY A 1 481 ? 32.45238 60.52661 12.82291  1.000 51.45467  ? 481 GLY A CA  1 
ATOM   3466 C C   . GLY A 1 481 ? 33.56480 59.50099 12.69869  1.000 51.79936  ? 481 GLY A C   1 
ATOM   3467 O O   . GLY A 1 481 ? 33.60530 58.77442 11.69813  1.000 59.16901  ? 481 GLY A O   1 
ATOM   3468 N N   . ASP A 1 482 ? 34.48029 59.44595 13.67434  1.000 47.24401  ? 482 ASP A N   1 
ATOM   3469 C CA  . ASP A 1 482 ? 35.51753 58.41462 13.74247  1.000 48.07192  ? 482 ASP A CA  1 
ATOM   3470 C C   . ASP A 1 482 ? 34.96474 57.00932 13.58779  1.000 37.10455  ? 482 ASP A C   1 
ATOM   3471 O O   . ASP A 1 482 ? 35.73071 56.08837 13.30339  1.000 43.17379  ? 482 ASP A O   1 
ATOM   3472 C CB  . ASP A 1 482 ? 36.24278 58.45230 15.10457  1.000 55.22706  ? 482 ASP A CB  1 
ATOM   3473 C CG  . ASP A 1 482 ? 37.57761 59.13501 15.04735  1.000 62.19125  ? 482 ASP A CG  1 
ATOM   3474 O OD1 . ASP A 1 482 ? 37.74759 59.95520 14.11617  1.000 64.52553  ? 482 ASP A OD1 1 
ATOM   3475 O OD2 . ASP A 1 482 ? 38.44204 58.84726 15.93425  1.000 60.89173  ? 482 ASP A OD2 1 
ATOM   3476 N N   . GLU A 1 483 ? 33.67568 56.79759 13.85695  1.000 39.38171  ? 483 GLU A N   1 
ATOM   3477 C CA  . GLU A 1 483 ? 33.13328 55.44856 13.82307  1.000 44.49010  ? 483 GLU A CA  1 
ATOM   3478 C C   . GLU A 1 483 ? 32.69524 55.02886 12.42563  1.000 49.03897  ? 483 GLU A C   1 
ATOM   3479 O O   . GLU A 1 483 ? 32.58468 53.83208 12.16074  1.000 53.10794  ? 483 GLU A O   1 
ATOM   3480 C CB  . GLU A 1 483 ? 31.96334 55.33487 14.81315  1.000 33.67183  ? 483 GLU A CB  1 
ATOM   3481 C CG  . GLU A 1 483 ? 30.60676 55.80448 14.30843  1.000 38.52244  ? 483 GLU A CG  1 
ATOM   3482 C CD  . GLU A 1 483 ? 30.49676 57.29708 14.25463  1.000 40.53174  ? 483 GLU A CD  1 
ATOM   3483 O OE1 . GLU A 1 483 ? 31.54627 57.95782 14.18173  1.000 44.46210  ? 483 GLU A OE1 1 
ATOM   3484 O OE2 . GLU A 1 483 ? 29.36887 57.81840 14.27432  1.000 41.29155  ? 483 GLU A OE2 1 
ATOM   3485 N N   . ILE A 1 484 ? 32.48456 55.98581 11.52218  1.000 55.72045  ? 484 ILE A N   1 
ATOM   3486 C CA  . ILE A 1 484 ? 31.87920 55.68588 10.22928  1.000 50.26160  ? 484 ILE A CA  1 
ATOM   3487 C C   . ILE A 1 484 ? 32.68184 54.62022 9.49525   1.000 49.09430  ? 484 ILE A C   1 
ATOM   3488 O O   . ILE A 1 484 ? 32.13471 53.60136 9.06079   1.000 57.24187  ? 484 ILE A O   1 
ATOM   3489 C CB  . ILE A 1 484 ? 31.73809 56.97621 9.40512   1.000 50.56275  ? 484 ILE A CB  1 
ATOM   3490 C CG1 . ILE A 1 484 ? 30.75946 57.92261 10.10500  1.000 43.36039  ? 484 ILE A CG1 1 
ATOM   3491 C CG2 . ILE A 1 484 ? 31.27171 56.67659 7.98998   1.000 51.76188  ? 484 ILE A CG2 1 
ATOM   3492 C CD1 . ILE A 1 484 ? 30.66023 59.28884 9.42901   1.000 43.66175  ? 484 ILE A CD1 1 
ATOM   3493 N N   . GLU A 1 485 ? 33.99557 54.82300 9.37829   1.000 50.55128  ? 485 GLU A N   1 
ATOM   3494 C CA  . GLU A 1 485 ? 34.83982 53.87891 8.64867   1.000 51.65349  ? 485 GLU A CA  1 
ATOM   3495 C C   . GLU A 1 485 ? 34.77402 52.48244 9.24508   1.000 61.00461  ? 485 GLU A C   1 
ATOM   3496 O O   . GLU A 1 485 ? 34.82439 51.48643 8.51293   1.000 69.02037  ? 485 GLU A O   1 
ATOM   3497 C CB  . GLU A 1 485 ? 36.28632 54.36084 8.63750   1.000 61.22427  ? 485 GLU A CB  1 
ATOM   3498 C CG  . GLU A 1 485 ? 36.87744 54.66752 9.99733   1.000 73.87511  ? 485 GLU A CG  1 
ATOM   3499 C CD  . GLU A 1 485 ? 38.26419 55.26478 9.89368   1.000 87.41437  ? 485 GLU A CD  1 
ATOM   3500 O OE1 . GLU A 1 485 ? 39.24987 54.49715 9.98124   1.000 81.17796  ? 485 GLU A OE1 1 
ATOM   3501 O OE2 . GLU A 1 485 ? 38.36147 56.50204 9.71730   1.000 97.97839  ? 485 GLU A OE2 1 
ATOM   3502 N N   . TYR A 1 486 ? 34.67720 52.38550 10.57405  1.000 57.82072  ? 486 TYR A N   1 
ATOM   3503 C CA  . TYR A 1 486 ? 34.62898 51.07560 11.20670  1.000 54.97743  ? 486 TYR A CA  1 
ATOM   3504 C C   . TYR A 1 486 ? 33.35861 50.33394 10.81907  1.000 51.61669  ? 486 TYR A C   1 
ATOM   3505 O O   . TYR A 1 486 ? 33.41566 49.19232 10.34314  1.000 55.25546  ? 486 TYR A O   1 
ATOM   3506 C CB  . TYR A 1 486 ? 34.76011 51.22944 12.72259  1.000 58.56461  ? 486 TYR A CB  1 
ATOM   3507 C CG  . TYR A 1 486 ? 36.19341 51.46921 13.12875  1.000 54.28437  ? 486 TYR A CG  1 
ATOM   3508 C CD1 . TYR A 1 486 ? 36.70461 52.75877 13.23798  1.000 45.62721  ? 486 TYR A CD1 1 
ATOM   3509 C CD2 . TYR A 1 486 ? 37.04669 50.40418 13.33240  1.000 45.53621  ? 486 TYR A CD2 1 
ATOM   3510 C CE1 . TYR A 1 486 ? 38.01769 52.97241 13.56749  1.000 42.03404  ? 486 TYR A CE1 1 
ATOM   3511 C CE2 . TYR A 1 486 ? 38.34289 50.60724 13.66373  1.000 49.62957  ? 486 TYR A CE2 1 
ATOM   3512 C CZ  . TYR A 1 486 ? 38.82728 51.88763 13.78615  1.000 43.65344  ? 486 TYR A CZ  1 
ATOM   3513 O OH  . TYR A 1 486 ? 40.14757 52.03662 14.12037  1.000 49.95463  ? 486 TYR A OH  1 
ATOM   3514 N N   . PHE A 1 487 ? 32.20977 51.00214 10.94643  1.000 43.33943  ? 487 PHE A N   1 
ATOM   3515 C CA  . PHE A 1 487 ? 30.93783 50.41856 10.53417  1.000 43.24046  ? 487 PHE A CA  1 
ATOM   3516 C C   . PHE A 1 487 ? 30.89528 50.09160 9.03727   1.000 49.98057  ? 487 PHE A C   1 
ATOM   3517 O O   . PHE A 1 487 ? 30.13639 49.20665 8.62761   1.000 57.98169  ? 487 PHE A O   1 
ATOM   3518 C CB  . PHE A 1 487 ? 29.80421 51.36925 10.89462  1.000 41.13828  ? 487 PHE A CB  1 
ATOM   3519 C CG  . PHE A 1 487 ? 29.43417 51.35854 12.35984  1.000 43.21837  ? 487 PHE A CG  1 
ATOM   3520 C CD1 . PHE A 1 487 ? 29.28294 50.16757 13.03899  1.000 45.08306  ? 487 PHE A CD1 1 
ATOM   3521 C CD2 . PHE A 1 487 ? 29.22502 52.53822 13.03706  1.000 49.16871  ? 487 PHE A CD2 1 
ATOM   3522 C CE1 . PHE A 1 487 ? 28.94152 50.15341 14.34846  1.000 56.22613  ? 487 PHE A CE1 1 
ATOM   3523 C CE2 . PHE A 1 487 ? 28.88510 52.53423 14.37237  1.000 57.93558  ? 487 PHE A CE2 1 
ATOM   3524 C CZ  . PHE A 1 487 ? 28.74024 51.34232 15.02827  1.000 62.07927  ? 487 PHE A CZ  1 
ATOM   3525 N N   . PHE A 1 488 ? 31.67645 50.79669 8.20536   1.000 44.96545  ? 488 PHE A N   1 
ATOM   3526 C CA  . PHE A 1 488 ? 31.78042 50.44995 6.79096   1.000 57.12412  ? 488 PHE A CA  1 
ATOM   3527 C C   . PHE A 1 488 ? 32.77999 49.34230 6.53652   1.000 65.11337  ? 488 PHE A C   1 
ATOM   3528 O O   . PHE A 1 488 ? 32.90619 48.89864 5.39391   1.000 74.94069  ? 488 PHE A O   1 
ATOM   3529 C CB  . PHE A 1 488 ? 32.17366 51.66634 5.93822   1.000 47.17249  ? 488 PHE A CB  1 
ATOM   3530 C CG  . PHE A 1 488 ? 31.00555 52.41838 5.39290   1.000 43.52861  ? 488 PHE A CG  1 
ATOM   3531 C CD1 . PHE A 1 488 ? 30.26867 51.90997 4.34177   1.000 53.62685  ? 488 PHE A CD1 1 
ATOM   3532 C CD2 . PHE A 1 488 ? 30.62688 53.63793 5.94383   1.000 38.32818  ? 488 PHE A CD2 1 
ATOM   3533 C CE1 . PHE A 1 488 ? 29.17143 52.62234 3.82832   1.000 57.99368  ? 488 PHE A CE1 1 
ATOM   3534 C CE2 . PHE A 1 488 ? 29.52178 54.33735 5.45720   1.000 37.74700  ? 488 PHE A CE2 1 
ATOM   3535 C CZ  . PHE A 1 488 ? 28.79938 53.83228 4.39748   1.000 52.95214  ? 488 PHE A CZ  1 
ATOM   3536 N N   . GLY A 1 489 ? 33.49714 48.89951 7.55951   1.000 64.65555  ? 489 GLY A N   1 
ATOM   3537 C CA  . GLY A 1 489 ? 34.46389 47.84315 7.37352   1.000 55.13502  ? 489 GLY A CA  1 
ATOM   3538 C C   . GLY A 1 489 ? 35.76996 48.28109 6.76877   1.000 53.42239  ? 489 GLY A C   1 
ATOM   3539 O O   . GLY A 1 489 ? 36.50985 47.43617 6.25274   1.000 67.00272  ? 489 GLY A O   1 
ATOM   3540 N N   . GLN A 1 490 ? 36.08879 49.57339 6.79847   1.000 45.45921  ? 490 GLN A N   1 
ATOM   3541 C CA  . GLN A 1 490 ? 37.32188 50.00376 6.14737   1.000 51.04053  ? 490 GLN A CA  1 
ATOM   3542 C C   . GLN A 1 490 ? 38.57657 49.40400 6.77468   1.000 57.98173  ? 490 GLN A C   1 
ATOM   3543 O O   . GLN A 1 490 ? 39.51830 49.13306 6.01507   1.000 56.47978  ? 490 GLN A O   1 
ATOM   3544 C CB  . GLN A 1 490 ? 37.40927 51.54088 6.08669   1.000 46.97162  ? 490 GLN A CB  1 
ATOM   3545 C CG  . GLN A 1 490 ? 36.11196 52.23996 5.61609   1.000 68.67903  ? 490 GLN A CG  1 
ATOM   3546 C CD  . GLN A 1 490 ? 35.72904 51.99703 4.13024   1.000 74.12709  ? 490 GLN A CD  1 
ATOM   3547 O OE1 . GLN A 1 490 ? 36.13196 51.01054 3.51363   1.000 74.26545  ? 490 GLN A OE1 1 
ATOM   3548 N NE2 . GLN A 1 490 ? 34.93544 52.90880 3.56931   1.000 73.01154  ? 490 GLN A NE2 1 
ATOM   3549 N N   . PRO A 1 491 ? 38.66867 49.14857 8.08776   1.000 59.64689  ? 491 PRO A N   1 
ATOM   3550 C CA  . PRO A 1 491 ? 39.87229 48.46733 8.58989   1.000 56.13700  ? 491 PRO A CA  1 
ATOM   3551 C C   . PRO A 1 491 ? 40.12327 47.12301 7.94172   1.000 61.23919  ? 491 PRO A C   1 
ATOM   3552 O O   . PRO A 1 491 ? 41.25680 46.62804 8.01042   1.000 69.15252  ? 491 PRO A O   1 
ATOM   3553 C CB  . PRO A 1 491 ? 39.60113 48.33297 10.09505  1.000 54.11691  ? 491 PRO A CB  1 
ATOM   3554 C CG  . PRO A 1 491 ? 38.78248 49.50015 10.40261  1.000 51.46129  ? 491 PRO A CG  1 
ATOM   3555 C CD  . PRO A 1 491 ? 37.87453 49.68997 9.20704   1.000 54.55606  ? 491 PRO A CD  1 
ATOM   3556 N N   . LEU A 1 492 ? 39.12326 46.52450 7.28907   1.000 57.80697  ? 492 LEU A N   1 
ATOM   3557 C CA  . LEU A 1 492 ? 39.38567 45.30536 6.53121   1.000 62.16322  ? 492 LEU A CA  1 
ATOM   3558 C C   . LEU A 1 492 ? 40.19054 45.57524 5.26883   1.000 69.58086  ? 492 LEU A C   1 
ATOM   3559 O O   . LEU A 1 492 ? 40.72807 44.63509 4.67782   1.000 73.51952  ? 492 LEU A O   1 
ATOM   3560 C CB  . LEU A 1 492 ? 38.08386 44.60303 6.15036   1.000 58.21435  ? 492 LEU A CB  1 
ATOM   3561 C CG  . LEU A 1 492 ? 37.15965 44.22429 7.30008   1.000 60.48889  ? 492 LEU A CG  1 
ATOM   3562 C CD1 . LEU A 1 492 ? 36.28216 43.06412 6.87519   1.000 61.55355  ? 492 LEU A CD1 1 
ATOM   3563 C CD2 . LEU A 1 492 ? 37.98414 43.85263 8.49199   1.000 60.74188  ? 492 LEU A CD2 1 
ATOM   3564 N N   . ASN A 1 493 ? 40.26512 46.82586 4.83583   1.000 70.72570  ? 493 ASN A N   1 
ATOM   3565 C CA  . ASN A 1 493 ? 41.07128 47.19218 3.68302   1.000 68.45295  ? 493 ASN A CA  1 
ATOM   3566 C C   . ASN A 1 493 ? 42.53756 47.04451 4.05886   1.000 68.78464  ? 493 ASN A C   1 
ATOM   3567 O O   . ASN A 1 493 ? 43.08536 47.87307 4.79205   1.000 66.48047  ? 493 ASN A O   1 
ATOM   3568 C CB  . ASN A 1 493 ? 40.74611 48.61980 3.25190   1.000 75.49711  ? 493 ASN A CB  1 
ATOM   3569 C CG  . ASN A 1 493 ? 41.39426 49.01036 1.93230   1.000 85.79749  ? 493 ASN A CG  1 
ATOM   3570 O OD1 . ASN A 1 493 ? 42.34613 48.38287 1.46269   1.000 77.94037  ? 493 ASN A OD1 1 
ATOM   3571 N ND2 . ASN A 1 493 ? 40.87336 50.06533 1.33351   1.000 103.58163 ? 493 ASN A ND2 1 
ATOM   3572 N N   . ASN A 1 494 ? 43.17868 45.99208 3.54827   1.000 72.81434  ? 494 ASN A N   1 
ATOM   3573 C CA  . ASN A 1 494 ? 44.55640 45.70512 3.91260   1.000 77.09020  ? 494 ASN A CA  1 
ATOM   3574 C C   . ASN A 1 494 ? 45.53318 46.74093 3.38548   1.000 78.85104  ? 494 ASN A C   1 
ATOM   3575 O O   . ASN A 1 494 ? 46.70559 46.71224 3.77860   1.000 79.29512  ? 494 ASN A O   1 
ATOM   3576 C CB  . ASN A 1 494 ? 44.95176 44.31468 3.40886   1.000 83.79818  ? 494 ASN A CB  1 
ATOM   3577 C CG  . ASN A 1 494 ? 44.47887 43.19929 4.33354   1.000 91.65696  ? 494 ASN A CG  1 
ATOM   3578 O OD1 . ASN A 1 494 ? 43.85920 42.22898 3.88884   1.000 85.11717  ? 494 ASN A OD1 1 
ATOM   3579 N ND2 . ASN A 1 494 ? 44.76393 43.33873 5.63116   1.000 95.47257  ? 494 ASN A ND2 1 
ATOM   3580 N N   . SER A 1 495 ? 45.08467 47.64873 2.51682   1.000 77.69807  ? 495 SER A N   1 
ATOM   3581 C CA  . SER A 1 495 ? 45.96448 48.66247 1.95284   1.000 80.68531  ? 495 SER A CA  1 
ATOM   3582 C C   . SER A 1 495 ? 46.04608 49.92088 2.80051   1.000 79.82592  ? 495 SER A C   1 
ATOM   3583 O O   . SER A 1 495 ? 47.00832 50.68438 2.65060   1.000 81.38738  ? 495 SER A O   1 
ATOM   3584 C CB  . SER A 1 495 ? 45.52043 49.01832 0.52976   1.000 81.58938  ? 495 SER A CB  1 
ATOM   3585 O OG  . SER A 1 495 ? 45.21751 47.84704 -0.21946  1.000 86.98026  ? 495 SER A OG  1 
ATOM   3586 N N   . LEU A 1 496 ? 45.07278 50.14700 3.68519   1.000 79.52643  ? 496 LEU A N   1 
ATOM   3587 C CA  . LEU A 1 496 ? 45.15492 51.20280 4.68333   1.000 80.22699  ? 496 LEU A CA  1 
ATOM   3588 C C   . LEU A 1 496 ? 45.79324 50.66247 5.95189   1.000 78.31034  ? 496 LEU A C   1 
ATOM   3589 O O   . LEU A 1 496 ? 45.67017 49.47898 6.27649   1.000 80.47031  ? 496 LEU A O   1 
ATOM   3590 C CB  . LEU A 1 496 ? 43.78256 51.77282 5.01298   1.000 75.21289  ? 496 LEU A CB  1 
ATOM   3591 C CG  . LEU A 1 496 ? 42.98403 52.42670 3.89710   1.000 73.99314  ? 496 LEU A CG  1 
ATOM   3592 C CD1 . LEU A 1 496 ? 41.50641 52.40250 4.27806   1.000 63.81980  ? 496 LEU A CD1 1 
ATOM   3593 C CD2 . LEU A 1 496 ? 43.47035 53.83612 3.68092   1.000 76.22223  ? 496 LEU A CD2 1 
ATOM   3594 N N   . GLN A 1 497 ? 46.48347 51.54175 6.66660   1.000 72.40958  ? 497 GLN A N   1 
ATOM   3595 C CA  . GLN A 1 497 ? 47.24875 51.14234 7.84102   1.000 73.21340  ? 497 GLN A CA  1 
ATOM   3596 C C   . GLN A 1 497 ? 46.33865 51.07860 9.06371   1.000 72.94242  ? 497 GLN A C   1 
ATOM   3597 O O   . GLN A 1 497 ? 45.74648 52.08761 9.46742   1.000 67.32630  ? 497 GLN A O   1 
ATOM   3598 C CB  . GLN A 1 497 ? 48.40034 52.10645 8.08551   1.000 73.91442  ? 497 GLN A CB  1 
ATOM   3599 C CG  . GLN A 1 497 ? 49.30179 51.69088 9.20216   1.000 80.58914  ? 497 GLN A CG  1 
ATOM   3600 C CD  . GLN A 1 497 ? 50.28182 52.77792 9.55202   1.000 96.25891  ? 497 GLN A CD  1 
ATOM   3601 O OE1 . GLN A 1 497 ? 50.45112 53.73176 8.79484   1.000 106.33724 ? 497 GLN A OE1 1 
ATOM   3602 N NE2 . GLN A 1 497 ? 50.93317 52.65014 10.70396  1.000 100.71557 ? 497 GLN A NE2 1 
ATOM   3603 N N   . TYR A 1 498 ? 46.21728 49.88252 9.63084   1.000 73.02058  ? 498 TYR A N   1 
ATOM   3604 C CA  . TYR A 1 498 ? 45.46876 49.64241 10.85182  1.000 64.92795  ? 498 TYR A CA  1 
ATOM   3605 C C   . TYR A 1 498 ? 46.17571 48.53912 11.62573  1.000 67.85379  ? 498 TYR A C   1 
ATOM   3606 O O   . TYR A 1 498 ? 46.91653 47.72991 11.05716  1.000 79.29221  ? 498 TYR A O   1 
ATOM   3607 C CB  . TYR A 1 498 ? 44.02199 49.21860 10.57849  1.000 60.54358  ? 498 TYR A CB  1 
ATOM   3608 C CG  . TYR A 1 498 ? 43.08233 50.27929 10.05295  1.000 63.50763  ? 498 TYR A CG  1 
ATOM   3609 C CD1 . TYR A 1 498 ? 43.07285 50.61487 8.71187   1.000 72.22331  ? 498 TYR A CD1 1 
ATOM   3610 C CD2 . TYR A 1 498 ? 42.15916 50.89989 10.88629  1.000 56.02814  ? 498 TYR A CD2 1 
ATOM   3611 C CE1 . TYR A 1 498 ? 42.20019 51.55603 8.21442   1.000 72.08895  ? 498 TYR A CE1 1 
ATOM   3612 C CE2 . TYR A 1 498 ? 41.27672 51.85454 10.39165  1.000 59.34222  ? 498 TYR A CE2 1 
ATOM   3613 C CZ  . TYR A 1 498 ? 41.30991 52.16955 9.04633   1.000 69.27842  ? 498 TYR A CZ  1 
ATOM   3614 O OH  . TYR A 1 498 ? 40.46260 53.10167 8.51326   1.000 78.71372  ? 498 TYR A OH  1 
ATOM   3615 N N   . ARG A 1 499 ? 45.93807 48.51048 12.92010  1.000 60.61404  ? 499 ARG A N   1 
ATOM   3616 C CA  . ARG A 1 499 ? 46.46761 47.44002 13.74406  1.000 64.95204  ? 499 ARG A CA  1 
ATOM   3617 C C   . ARG A 1 499 ? 45.53574 46.24039 13.68005  1.000 67.51170  ? 499 ARG A C   1 
ATOM   3618 O O   . ARG A 1 499 ? 44.34781 46.38114 13.35404  1.000 64.78153  ? 499 ARG A O   1 
ATOM   3619 C CB  . ARG A 1 499 ? 46.63005 47.92306 15.18907  1.000 69.93658  ? 499 ARG A CB  1 
ATOM   3620 C CG  . ARG A 1 499 ? 47.39267 49.23783 15.31173  1.000 77.44161  ? 499 ARG A CG  1 
ATOM   3621 C CD  . ARG A 1 499 ? 48.24600 49.30130 16.56867  1.000 92.45081  ? 499 ARG A CD  1 
ATOM   3622 N NE  . ARG A 1 499 ? 47.43881 49.08678 17.76433  1.000 101.32806 ? 499 ARG A NE  1 
ATOM   3623 C CZ  . ARG A 1 499 ? 47.46691 47.98123 18.50425  1.000 102.82440 ? 499 ARG A CZ  1 
ATOM   3624 N NH1 . ARG A 1 499 ? 48.28024 46.97356 18.18038  1.000 102.44892 ? 499 ARG A NH1 1 
ATOM   3625 N NH2 . ARG A 1 499 ? 46.67842 47.88950 19.57173  1.000 93.20997  ? 499 ARG A NH2 1 
ATOM   3626 N N   . PRO A 1 500 ? 46.04592 45.03505 13.96042  1.000 69.85402  ? 500 PRO A N   1 
ATOM   3627 C CA  . PRO A 1 500 ? 45.17006 43.84907 13.91484  1.000 73.54108  ? 500 PRO A CA  1 
ATOM   3628 C C   . PRO A 1 500 ? 43.88799 43.97725 14.73828  1.000 74.00793  ? 500 PRO A C   1 
ATOM   3629 O O   . PRO A 1 500 ? 42.82492 43.57028 14.25464  1.000 82.22655  ? 500 PRO A O   1 
ATOM   3630 C CB  . PRO A 1 500 ? 46.08966 42.73260 14.42479  1.000 65.45859  ? 500 PRO A CB  1 
ATOM   3631 C CG  . PRO A 1 500 ? 47.44437 43.17874 14.05589  1.000 68.23011  ? 500 PRO A CG  1 
ATOM   3632 C CD  . PRO A 1 500 ? 47.46275 44.67109 14.13468  1.000 66.10823  ? 500 PRO A CD  1 
ATOM   3633 N N   . VAL A 1 501 ? 43.93630 44.55059 15.94420  1.000 65.22402  ? 501 VAL A N   1 
ATOM   3634 C CA  . VAL A 1 501 ? 42.69717 44.68205 16.71430  1.000 61.05701  ? 501 VAL A CA  1 
ATOM   3635 C C   . VAL A 1 501 ? 41.76918 45.68987 16.07211  1.000 58.87613  ? 501 VAL A C   1 
ATOM   3636 O O   . VAL A 1 501 ? 40.54185 45.57937 16.19241  1.000 60.07502  ? 501 VAL A O   1 
ATOM   3637 C CB  . VAL A 1 501 ? 42.95890 45.05078 18.19202  1.000 61.69665  ? 501 VAL A CB  1 
ATOM   3638 C CG1 . VAL A 1 501 ? 43.43461 43.84096 18.94386  1.000 70.13996  ? 501 VAL A CG1 1 
ATOM   3639 C CG2 . VAL A 1 501 ? 43.95608 46.19532 18.31641  1.000 54.89429  ? 501 VAL A CG2 1 
ATOM   3640 N N   . GLU A 1 502 ? 42.31757 46.68907 15.38459  1.000 62.00538  ? 502 GLU A N   1 
ATOM   3641 C CA  . GLU A 1 502 ? 41.44306 47.61887 14.68124  1.000 58.11795  ? 502 GLU A CA  1 
ATOM   3642 C C   . GLU A 1 502 ? 40.72075 46.93460 13.53002  1.000 58.91409  ? 502 GLU A C   1 
ATOM   3643 O O   . GLU A 1 502 ? 39.53388 47.19462 13.30277  1.000 64.37177  ? 502 GLU A O   1 
ATOM   3644 C CB  . GLU A 1 502 ? 42.23311 48.82028 14.18866  1.000 61.98983  ? 502 GLU A CB  1 
ATOM   3645 C CG  . GLU A 1 502 ? 42.20835 49.96226 15.15619  1.000 57.43160  ? 502 GLU A CG  1 
ATOM   3646 C CD  . GLU A 1 502 ? 43.45227 50.79162 15.08739  1.000 59.19651  ? 502 GLU A CD  1 
ATOM   3647 O OE1 . GLU A 1 502 ? 44.44474 50.29881 14.52798  1.000 65.45127  ? 502 GLU A OE1 1 
ATOM   3648 O OE2 . GLU A 1 502 ? 43.45917 51.91493 15.62181  1.000 59.88848  ? 502 GLU A OE2 1 
ATOM   3649 N N   . ARG A 1 503 ? 41.41005 46.04921 12.79706  1.000 60.19260  ? 503 ARG A N   1 
ATOM   3650 C CA  . ARG A 1 503 ? 40.72219 45.26829 11.77071  1.000 63.35019  ? 503 ARG A CA  1 
ATOM   3651 C C   . ARG A 1 503 ? 39.70028 44.33159 12.39956  1.000 70.19619  ? 503 ARG A C   1 
ATOM   3652 O O   . ARG A 1 503 ? 38.62786 44.09463 11.83117  1.000 67.44802  ? 503 ARG A O   1 
ATOM   3653 C CB  . ARG A 1 503 ? 41.72579 44.47947 10.93837  1.000 67.68241  ? 503 ARG A CB  1 
ATOM   3654 C CG  . ARG A 1 503 ? 42.88671 45.30740 10.41855  1.000 73.44983  ? 503 ARG A CG  1 
ATOM   3655 C CD  . ARG A 1 503 ? 43.57055 44.64793 9.21569   1.000 80.11159  ? 503 ARG A CD  1 
ATOM   3656 N NE  . ARG A 1 503 ? 44.76087 45.39293 8.80458   1.000 83.08538  ? 503 ARG A NE  1 
ATOM   3657 C CZ  . ARG A 1 503 ? 44.73506 46.46010 8.01336   1.000 79.57266  ? 503 ARG A CZ  1 
ATOM   3658 N NH1 . ARG A 1 503 ? 43.58112 46.90815 7.53672   1.000 74.62668  ? 503 ARG A NH1 1 
ATOM   3659 N NH2 . ARG A 1 503 ? 45.86022 47.08598 7.70931   1.000 83.10516  ? 503 ARG A NH2 1 
ATOM   3660 N N   . GLU A 1 504 ? 40.01592 43.78913 13.57602  1.000 77.87429  ? 504 GLU A N   1 
ATOM   3661 C CA  . GLU A 1 504 ? 39.02314 43.02624 14.31960  1.000 77.70623  ? 504 GLU A CA  1 
ATOM   3662 C C   . GLU A 1 504 ? 37.81452 43.89468 14.64647  1.000 60.20794  ? 504 GLU A C   1 
ATOM   3663 O O   . GLU A 1 504 ? 36.67178 43.48651 14.42294  1.000 65.13666  ? 504 GLU A O   1 
ATOM   3664 C CB  . GLU A 1 504 ? 39.65031 42.44097 15.58789  1.000 89.45169  ? 504 GLU A CB  1 
ATOM   3665 C CG  . GLU A 1 504 ? 38.79882 41.38488 16.28657  1.000 103.69732 ? 504 GLU A CG  1 
ATOM   3666 C CD  . GLU A 1 504 ? 38.28015 40.32640 15.33293  1.000 119.05373 ? 504 GLU A CD  1 
ATOM   3667 O OE1 . GLU A 1 504 ? 37.07050 40.01009 15.39063  1.000 122.04018 ? 504 GLU A OE1 1 
ATOM   3668 O OE2 . GLU A 1 504 ? 39.08378 39.81040 14.52523  1.000 127.09085 ? 504 GLU A OE2 1 
ATOM   3669 N N   . LEU A 1 505 ? 38.04833 45.11840 15.13409  1.000 53.80852  ? 505 LEU A N   1 
ATOM   3670 C CA  . LEU A 1 505 ? 36.93377 46.00468 15.47633  1.000 53.78721  ? 505 LEU A CA  1 
ATOM   3671 C C   . LEU A 1 505 ? 36.10395 46.36334 14.24488  1.000 58.83948  ? 505 LEU A C   1 
ATOM   3672 O O   . LEU A 1 505 ? 34.86597 46.35410 14.29834  1.000 60.97005  ? 505 LEU A O   1 
ATOM   3673 C CB  . LEU A 1 505 ? 37.45101 47.26805 16.17192  1.000 50.39929  ? 505 LEU A CB  1 
ATOM   3674 C CG  . LEU A 1 505 ? 36.38200 48.22163 16.73555  1.000 55.12975  ? 505 LEU A CG  1 
ATOM   3675 C CD1 . LEU A 1 505 ? 35.43844 47.51752 17.68389  1.000 47.97701  ? 505 LEU A CD1 1 
ATOM   3676 C CD2 . LEU A 1 505 ? 37.00015 49.41471 17.42635  1.000 58.68549  ? 505 LEU A CD2 1 
ATOM   3677 N N   . GLY A 1 506 ? 36.76521 46.69035 13.12768  1.000 61.17465  ? 506 GLY A N   1 
ATOM   3678 C CA  . GLY A 1 506 ? 36.03612 46.92563 11.88770  1.000 51.81159  ? 506 GLY A CA  1 
ATOM   3679 C C   . GLY A 1 506 ? 35.22475 45.71703 11.45955  1.000 48.89657  ? 506 GLY A C   1 
ATOM   3680 O O   . GLY A 1 506 ? 34.05727 45.83780 11.07973  1.000 50.59812  ? 506 GLY A O   1 
ATOM   3681 N N   . LYS A 1 507 ? 35.82998 44.53252 11.52465  1.000 48.63554  ? 507 LYS A N   1 
ATOM   3682 C CA  . LYS A 1 507 ? 35.09266 43.32219 11.20285  1.000 53.17059  ? 507 LYS A CA  1 
ATOM   3683 C C   . LYS A 1 507 ? 33.93128 43.11543 12.16428  1.000 60.74006  ? 507 LYS A C   1 
ATOM   3684 O O   . LYS A 1 507 ? 32.88743 42.58682 11.76669  1.000 72.49276  ? 507 LYS A O   1 
ATOM   3685 C CB  . LYS A 1 507 ? 36.03984 42.11950 11.21121  1.000 51.90105  ? 507 LYS A CB  1 
ATOM   3686 C CG  . LYS A 1 507 ? 35.37321 40.79089 10.89302  1.000 50.68636  ? 507 LYS A CG  1 
ATOM   3687 C CD  . LYS A 1 507 ? 36.29623 39.63697 11.21620  1.000 60.49492  ? 507 LYS A CD  1 
ATOM   3688 C CE  . LYS A 1 507 ? 35.55692 38.30230 11.29887  1.000 72.64427  ? 507 LYS A CE  1 
ATOM   3689 N NZ  . LYS A 1 507 ? 36.19693 37.38441 12.30501  1.000 80.00611  ? 507 LYS A NZ  1 
ATOM   3690 N N   . ARG A 1 508 ? 34.08585 43.53864 13.42360  1.000 55.01068  ? 508 ARG A N   1 
ATOM   3691 C CA  . ARG A 1 508 ? 32.99577 43.44158 14.38978  1.000 53.82936  ? 508 ARG A CA  1 
ATOM   3692 C C   . ARG A 1 508 ? 31.94363 44.51191 14.14784  1.000 50.49557  ? 508 ARG A C   1 
ATOM   3693 O O   . ARG A 1 508 ? 30.74101 44.24802 14.26834  1.000 45.22129  ? 508 ARG A O   1 
ATOM   3694 C CB  . ARG A 1 508 ? 33.52557 43.56161 15.82713  1.000 55.95416  ? 508 ARG A CB  1 
ATOM   3695 C CG  . ARG A 1 508 ? 34.09242 42.26205 16.39215  1.000 65.21725  ? 508 ARG A CG  1 
ATOM   3696 C CD  . ARG A 1 508 ? 34.20284 42.28226 17.89362  1.000 68.68356  ? 508 ARG A CD  1 
ATOM   3697 N NE  . ARG A 1 508 ? 35.15458 43.27379 18.38281  1.000 71.84886  ? 508 ARG A NE  1 
ATOM   3698 C CZ  . ARG A 1 508 ? 34.93161 44.05323 19.43956  1.000 62.90816  ? 508 ARG A CZ  1 
ATOM   3699 N NH1 . ARG A 1 508 ? 33.77960 43.97157 20.09216  1.000 54.07714  ? 508 ARG A NH1 1 
ATOM   3700 N NH2 . ARG A 1 508 ? 35.84565 44.93198 19.82806  1.000 61.80049  ? 508 ARG A NH2 1 
ATOM   3701 N N   . MET A 1 509 ? 32.37354 45.73128 13.83266  1.000 46.42599  ? 509 MET A N   1 
ATOM   3702 C CA  . MET A 1 509 ? 31.39894 46.79439 13.67978  1.000 48.82611  ? 509 MET A CA  1 
ATOM   3703 C C   . MET A 1 509 ? 30.66334 46.68935 12.34883  1.000 57.70051  ? 509 MET A C   1 
ATOM   3704 O O   . MET A 1 509 ? 29.45100 46.93729 12.28623  1.000 56.53075  ? 509 MET A O   1 
ATOM   3705 C CB  . MET A 1 509 ? 32.09049 48.13407 13.85467  1.000 53.09014  ? 509 MET A CB  1 
ATOM   3706 C CG  . MET A 1 509 ? 32.51170 48.33505 15.28947  1.000 48.06906  ? 509 MET A CG  1 
ATOM   3707 S SD  . MET A 1 509 ? 33.37857 49.87154 15.58975  1.000 49.53908  ? 509 MET A SD  1 
ATOM   3708 C CE  . MET A 1 509 ? 32.15428 51.08747 15.10055  1.000 41.49828  ? 509 MET A CE  1 
ATOM   3709 N N   . LEU A 1 510 ? 31.35661 46.27820 11.28326  1.000 61.63200  ? 510 LEU A N   1 
ATOM   3710 C CA  . LEU A 1 510 ? 30.64047 45.98274 10.04930  1.000 57.42210  ? 510 LEU A CA  1 
ATOM   3711 C C   . LEU A 1 510 ? 29.64346 44.85866 10.27006  1.000 53.27469  ? 510 LEU A C   1 
ATOM   3712 O O   . LEU A 1 510 ? 28.51329 44.90490 9.77403   1.000 65.78151  ? 510 LEU A O   1 
ATOM   3713 C CB  . LEU A 1 510 ? 31.61511 45.61650 8.93187   1.000 51.77607  ? 510 LEU A CB  1 
ATOM   3714 C CG  . LEU A 1 510 ? 30.90424 45.09857 7.67225   1.000 52.71279  ? 510 LEU A CG  1 
ATOM   3715 C CD1 . LEU A 1 510 ? 30.37638 46.26492 6.87099   1.000 49.84394  ? 510 LEU A CD1 1 
ATOM   3716 C CD2 . LEU A 1 510 ? 31.80964 44.22452 6.82629   1.000 58.02421  ? 510 LEU A CD2 1 
ATOM   3717 N N   . SER A 1 511 ? 30.04190 43.84840 11.02642  1.000 46.21406  ? 511 SER A N   1 
ATOM   3718 C CA  . SER A 1 511 ? 29.18007 42.69757 11.23752  1.000 51.40667  ? 511 SER A CA  1 
ATOM   3719 C C   . SER A 1 511 ? 27.96432 43.05171 12.09064  1.000 57.41629  ? 511 SER A C   1 
ATOM   3720 O O   . SER A 1 511 ? 26.87998 42.48852 11.88416  1.000 60.13883  ? 511 SER A O   1 
ATOM   3721 C CB  . SER A 1 511 ? 29.99477 41.56740 11.85665  1.000 48.10029  ? 511 SER A CB  1 
ATOM   3722 O OG  . SER A 1 511 ? 29.14116 40.57742 12.37594  1.000 73.03343  ? 511 SER A OG  1 
ATOM   3723 N N   . ALA A 1 512 ? 28.11208 43.99142 13.03070  1.000 53.39199  ? 512 ALA A N   1 
ATOM   3724 C CA  . ALA A 1 512 ? 26.94212 44.52232 13.72481  1.000 54.16238  ? 512 ALA A CA  1 
ATOM   3725 C C   . ALA A 1 512 ? 25.97987 45.18324 12.74247  1.000 48.98117  ? 512 ALA A C   1 
ATOM   3726 O O   . ALA A 1 512 ? 24.76362 45.00912 12.85009  1.000 50.01848  ? 512 ALA A O   1 
ATOM   3727 C CB  . ALA A 1 512 ? 27.36176 45.50682 14.83171  1.000 40.80569  ? 512 ALA A CB  1 
ATOM   3728 N N   . VAL A 1 513 ? 26.49932 45.92990 11.76569  1.000 49.99855  ? 513 VAL A N   1 
ATOM   3729 C CA  . VAL A 1 513 ? 25.62230 46.54800 10.76618  1.000 49.82323  ? 513 VAL A CA  1 
ATOM   3730 C C   . VAL A 1 513 ? 24.96244 45.49059 9.88157   1.000 49.93128  ? 513 VAL A C   1 
ATOM   3731 O O   . VAL A 1 513 ? 23.73689 45.48819 9.71560   1.000 55.63296  ? 513 VAL A O   1 
ATOM   3732 C CB  . VAL A 1 513 ? 26.38969 47.58342 9.93200   1.000 45.87704  ? 513 VAL A CB  1 
ATOM   3733 C CG1 . VAL A 1 513 ? 25.42537 48.37861 9.10058   1.000 54.39250  ? 513 VAL A CG1 1 
ATOM   3734 C CG2 . VAL A 1 513 ? 27.11778 48.52604 10.85059  1.000 39.90677  ? 513 VAL A CG2 1 
ATOM   3735 N N   . ILE A 1 514 ? 25.75362 44.56143 9.32567   1.000 46.26495  ? 514 ILE A N   1 
ATOM   3736 C CA  . ILE A 1 514 ? 25.19456 43.53135 8.44294   1.000 43.90878  ? 514 ILE A CA  1 
ATOM   3737 C C   . ILE A 1 514 ? 24.18621 42.66012 9.19277   1.000 54.87683  ? 514 ILE A C   1 
ATOM   3738 O O   . ILE A 1 514 ? 23.11690 42.32844 8.66490   1.000 59.93402  ? 514 ILE A O   1 
ATOM   3739 C CB  . ILE A 1 514 ? 26.31733 42.68212 7.81018   1.000 46.22378  ? 514 ILE A CB  1 
ATOM   3740 C CG1 . ILE A 1 514 ? 27.31010 43.54289 7.00774   1.000 45.57924  ? 514 ILE A CG1 1 
ATOM   3741 C CG2 . ILE A 1 514 ? 25.73252 41.58471 6.92792   1.000 43.10381  ? 514 ILE A CG2 1 
ATOM   3742 C CD1 . ILE A 1 514 ? 26.67189 44.46365 5.99960   1.000 42.30487  ? 514 ILE A CD1 1 
ATOM   3743 N N   . GLU A 1 515 ? 24.49716 42.27900 10.43600  1.000 59.22401  ? 515 GLU A N   1 
ATOM   3744 C CA  . GLU A 1 515 ? 23.52797 41.49385 11.19693  1.000 57.58659  ? 515 GLU A CA  1 
ATOM   3745 C C   . GLU A 1 515 ? 22.30082 42.31778 11.55058  1.000 52.94582  ? 515 GLU A C   1 
ATOM   3746 O O   . GLU A 1 515 ? 21.18535 41.79036 11.59505  1.000 50.63462  ? 515 GLU A O   1 
ATOM   3747 C CB  . GLU A 1 515 ? 24.16693 40.92716 12.46323  1.000 62.26046  ? 515 GLU A CB  1 
ATOM   3748 C CG  . GLU A 1 515 ? 23.87969 39.44803 12.71177  1.000 71.97617  ? 515 GLU A CG  1 
ATOM   3749 C CD  . GLU A 1 515 ? 24.01360 38.59965 11.45307  1.000 90.60705  ? 515 GLU A CD  1 
ATOM   3750 O OE1 . GLU A 1 515 ? 24.95470 38.81379 10.64785  1.000 93.28405  ? 515 GLU A OE1 1 
ATOM   3751 O OE2 . GLU A 1 515 ? 23.16305 37.70777 11.27090  1.000 98.91702  ? 515 GLU A OE2 1 
ATOM   3752 N N   . PHE A 1 516 ? 22.47571 43.60839 11.79966  1.000 59.29338  ? 516 PHE A N   1 
ATOM   3753 C CA  . PHE A 1 516 ? 21.30812 44.43301 12.06433  1.000 59.73873  ? 516 PHE A CA  1 
ATOM   3754 C C   . PHE A 1 516 ? 20.45021 44.55568 10.82347  1.000 53.85772  ? 516 PHE A C   1 
ATOM   3755 O O   . PHE A 1 516 ? 19.22027 44.45979 10.89779  1.000 44.44184  ? 516 PHE A O   1 
ATOM   3756 C CB  . PHE A 1 516 ? 21.72531 45.81244 12.53872  1.000 53.19733  ? 516 PHE A CB  1 
ATOM   3757 C CG  . PHE A 1 516 ? 20.57907 46.74532 12.71663  1.000 43.65380  ? 516 PHE A CG  1 
ATOM   3758 C CD1 . PHE A 1 516 ? 19.63394 46.51410 13.70991  1.000 39.07684  ? 516 PHE A CD1 1 
ATOM   3759 C CD2 . PHE A 1 516 ? 20.44195 47.85299 11.89034  1.000 44.10079  ? 516 PHE A CD2 1 
ATOM   3760 C CE1 . PHE A 1 516 ? 18.57014 47.37768 13.88510  1.000 40.71105  ? 516 PHE A CE1 1 
ATOM   3761 C CE2 . PHE A 1 516 ? 19.39015 48.71713 12.05017  1.000 47.58984  ? 516 PHE A CE2 1 
ATOM   3762 C CZ  . PHE A 1 516 ? 18.45078 48.48632 13.05938  1.000 46.07102  ? 516 PHE A CZ  1 
ATOM   3763 N N   . ALA A 1 517 ? 21.09732 44.78665 9.67978   1.000 49.92790  ? 517 ALA A N   1 
ATOM   3764 C CA  . ALA A 1 517 ? 20.39356 44.86009 8.40608   1.000 43.86040  ? 517 ALA A CA  1 
ATOM   3765 C C   . ALA A 1 517 ? 19.64963 43.57358 8.12594   1.000 49.14416  ? 517 ALA A C   1 
ATOM   3766 O O   . ALA A 1 517 ? 18.49082 43.60332 7.69911   1.000 58.15367  ? 517 ALA A O   1 
ATOM   3767 C CB  . ALA A 1 517 ? 21.38716 45.15145 7.28314   1.000 36.97998  ? 517 ALA A CB  1 
ATOM   3768 N N   . LYS A 1 518 ? 20.29302 42.42952 8.38470   1.000 47.59865  ? 518 LYS A N   1 
ATOM   3769 C CA  . LYS A 1 518 ? 19.70386 41.14756 8.01824   1.000 53.59218  ? 518 LYS A CA  1 
ATOM   3770 C C   . LYS A 1 518 ? 18.60821 40.71453 8.98800   1.000 63.33006  ? 518 LYS A C   1 
ATOM   3771 O O   . LYS A 1 518 ? 17.60894 40.12283 8.56663   1.000 68.99869  ? 518 LYS A O   1 
ATOM   3772 C CB  . LYS A 1 518 ? 20.78898 40.08163 7.94499   1.000 51.00647  ? 518 LYS A CB  1 
ATOM   3773 C CG  . LYS A 1 518 ? 21.58791 40.09326 6.66334   1.000 58.17546  ? 518 LYS A CG  1 
ATOM   3774 C CD  . LYS A 1 518 ? 22.76940 39.14442 6.76879   1.000 65.31307  ? 518 LYS A CD  1 
ATOM   3775 C CE  . LYS A 1 518 ? 23.23484 38.64399 5.41937   1.000 68.93633  ? 518 LYS A CE  1 
ATOM   3776 N NZ  . LYS A 1 518 ? 24.64998 39.03173 5.14809   1.000 70.89041  ? 518 LYS A NZ  1 
ATOM   3777 N N   . THR A 1 519 ? 18.77233 40.98405 10.28767  1.000 64.01448  ? 519 THR A N   1 
ATOM   3778 C CA  . THR A 1 519 ? 17.83811 40.47803 11.28968  1.000 62.72294  ? 519 THR A CA  1 
ATOM   3779 C C   . THR A 1 519 ? 17.23328 41.53161 12.21013  1.000 58.74276  ? 519 THR A C   1 
ATOM   3780 O O   . THR A 1 519 ? 16.43037 41.17621 13.06979  1.000 65.23226  ? 519 THR A O   1 
ATOM   3781 C CB  . THR A 1 519 ? 18.51692 39.41983 12.17076  1.000 61.16147  ? 519 THR A CB  1 
ATOM   3782 O OG1 . THR A 1 519 ? 19.41059 40.06915 13.08372  1.000 61.79913  ? 519 THR A OG1 1 
ATOM   3783 C CG2 . THR A 1 519 ? 19.29104 38.43188 11.33103  1.000 52.29904  ? 519 THR A CG2 1 
ATOM   3784 N N   . GLY A 1 520 ? 17.58617 42.80002 12.07517  1.000 62.77531  ? 520 GLY A N   1 
ATOM   3785 C CA  . GLY A 1 520 ? 17.07492 43.76931 13.02044  1.000 64.89346  ? 520 GLY A CA  1 
ATOM   3786 C C   . GLY A 1 520 ? 17.73219 43.68845 14.37038  1.000 67.07201  ? 520 GLY A C   1 
ATOM   3787 O O   . GLY A 1 520 ? 17.31774 44.38548 15.30219  1.000 70.84211  ? 520 GLY A O   1 
ATOM   3788 N N   . ASN A 1 521 ? 18.74714 42.87431 14.49317  1.000 68.69217  ? 521 ASN A N   1 
ATOM   3789 C CA  . ASN A 1 521 ? 19.45085 42.68352 15.73723  1.000 63.62130  ? 521 ASN A CA  1 
ATOM   3790 C C   . ASN A 1 521 ? 20.94234 42.65259 15.42360  1.000 59.11741  ? 521 ASN A C   1 
ATOM   3791 O O   . ASN A 1 521 ? 21.38274 41.83520 14.60778  1.000 52.08636  ? 521 ASN A O   1 
ATOM   3792 C CB  . ASN A 1 521 ? 18.95363 41.39660 16.39070  1.000 68.86875  ? 521 ASN A CB  1 
ATOM   3793 C CG  . ASN A 1 521 ? 19.57145 41.14986 17.72691  1.000 71.11163  ? 521 ASN A CG  1 
ATOM   3794 O OD1 . ASN A 1 521 ? 20.16575 42.04534 18.31836  1.000 70.30685  ? 521 ASN A OD1 1 
ATOM   3795 N ND2 . ASN A 1 521 ? 19.44871 39.92291 18.21551  1.000 77.09035  ? 521 ASN A ND2 1 
ATOM   3796 N N   . PRO A 1 522 ? 21.74364 43.54101 16.02080  1.000 58.51576  ? 522 PRO A N   1 
ATOM   3797 C CA  . PRO A 1 522 ? 23.18305 43.55291 15.72463  1.000 57.56327  ? 522 PRO A CA  1 
ATOM   3798 C C   . PRO A 1 522 ? 23.95196 42.41267 16.37326  1.000 53.81525  ? 522 PRO A C   1 
ATOM   3799 O O   . PRO A 1 522 ? 25.11306 42.18046 16.00828  1.000 53.48250  ? 522 PRO A O   1 
ATOM   3800 C CB  . PRO A 1 522 ? 23.63370 44.90604 16.28672  1.000 65.15839  ? 522 PRO A CB  1 
ATOM   3801 C CG  . PRO A 1 522 ? 22.71763 45.12184 17.45680  1.000 64.95516  ? 522 PRO A CG  1 
ATOM   3802 C CD  . PRO A 1 522 ? 21.37592 44.57174 17.01022  1.000 61.41144  ? 522 PRO A CD  1 
ATOM   3803 N N   . ALA A 1 523 ? 23.34257 41.68274 17.29557  1.000 57.43232  ? 523 ALA A N   1 
ATOM   3804 C CA  . ALA A 1 523 ? 24.09385 40.75394 18.12728  1.000 70.59834  ? 523 ALA A CA  1 
ATOM   3805 C C   . ALA A 1 523 ? 24.55142 39.53643 17.33883  1.000 80.67037  ? 523 ALA A C   1 
ATOM   3806 O O   . ALA A 1 523 ? 23.75586 38.88814 16.65217  1.000 80.22116  ? 523 ALA A O   1 
ATOM   3807 C CB  . ALA A 1 523 ? 23.25169 40.31126 19.32422  1.000 77.83127  ? 523 ALA A CB  1 
ATOM   3808 N N   . GLN A 1 524 ? 25.83344 39.20447 17.48109  1.000 94.51367  ? 524 GLN A N   1 
ATOM   3809 C CA  . GLN A 1 524 ? 26.39509 38.00825 16.87610  1.000 106.62521 ? 524 GLN A CA  1 
ATOM   3810 C C   . GLN A 1 524 ? 25.93756 36.75379 17.63091  1.000 110.52053 ? 524 GLN A C   1 
ATOM   3811 O O   . GLN A 1 524 ? 25.25887 36.81289 18.66125  1.000 109.33488 ? 524 GLN A O   1 
ATOM   3812 C CB  . GLN A 1 524 ? 27.92484 38.09468 16.85344  1.000 109.09828 ? 524 GLN A CB  1 
ATOM   3813 C CG  . GLN A 1 524 ? 28.51004 39.52225 16.80968  1.000 112.66167 ? 524 GLN A CG  1 
ATOM   3814 C CD  . GLN A 1 524 ? 28.21109 40.30084 15.51331  1.000 112.83953 ? 524 GLN A CD  1 
ATOM   3815 O OE1 . GLN A 1 524 ? 27.28697 39.97100 14.76640  1.000 115.86401 ? 524 GLN A OE1 1 
ATOM   3816 N NE2 . GLN A 1 524 ? 29.00177 41.34385 15.25415  1.000 101.32042 ? 524 GLN A NE2 1 
ATOM   3817 N N   . ASP A 1 525 ? 26.31209 35.60028 17.08838  1.000 113.36695 ? 525 ASP A N   1 
ATOM   3818 C CA  . ASP A 1 525 ? 26.03023 34.32754 17.74016  1.000 117.87056 ? 525 ASP A CA  1 
ATOM   3819 C C   . ASP A 1 525 ? 26.78325 34.25243 19.06138  1.000 104.80783 ? 525 ASP A C   1 
ATOM   3820 O O   . ASP A 1 525 ? 28.01144 34.39899 19.09928  1.000 102.71562 ? 525 ASP A O   1 
ATOM   3821 C CB  . ASP A 1 525 ? 26.44237 33.16510 16.84303  1.000 134.33798 ? 525 ASP A CB  1 
ATOM   3822 C CG  . ASP A 1 525 ? 25.25029 32.46053 16.20801  1.000 145.64610 ? 525 ASP A CG  1 
ATOM   3823 O OD1 . ASP A 1 525 ? 24.17381 32.36912 16.83887  1.000 148.22622 ? 525 ASP A OD1 1 
ATOM   3824 O OD2 . ASP A 1 525 ? 25.40267 31.99828 15.05486  1.000 148.95657 ? 525 ASP A OD2 1 
ATOM   3825 N N   . GLY A 1 526 ? 26.04258 34.02567 20.14787  1.000 93.32037  ? 526 GLY A N   1 
ATOM   3826 C CA  . GLY A 1 526 ? 26.61201 33.95373 21.47717  1.000 86.89176  ? 526 GLY A CA  1 
ATOM   3827 C C   . GLY A 1 526 ? 27.07766 35.27199 22.04794  1.000 83.00883  ? 526 GLY A C   1 
ATOM   3828 O O   . GLY A 1 526 ? 27.35782 35.34762 23.24911  1.000 92.69817  ? 526 GLY A O   1 
ATOM   3829 N N   . GLU A 1 527 ? 27.19258 36.30727 21.22779  1.000 77.48793  ? 527 GLU A N   1 
ATOM   3830 C CA  . GLU A 1 527 ? 27.47732 37.63751 21.73466  1.000 76.67161  ? 527 GLU A CA  1 
ATOM   3831 C C   . GLU A 1 527 ? 26.23531 38.19801 22.41919  1.000 69.92582  ? 527 GLU A C   1 
ATOM   3832 O O   . GLU A 1 527 ? 25.13880 38.19968 21.84483  1.000 73.01147  ? 527 GLU A O   1 
ATOM   3833 C CB  . GLU A 1 527 ? 27.92269 38.54254 20.58792  1.000 84.68332  ? 527 GLU A CB  1 
ATOM   3834 C CG  . GLU A 1 527 ? 28.35264 39.93972 20.99225  1.000 94.62780  ? 527 GLU A CG  1 
ATOM   3835 C CD  . GLU A 1 527 ? 28.17630 40.94329 19.85921  1.000 109.27701 ? 527 GLU A CD  1 
ATOM   3836 O OE1 . GLU A 1 527 ? 27.06590 41.01698 19.29667  1.000 113.05753 ? 527 GLU A OE1 1 
ATOM   3837 O OE2 . GLU A 1 527 ? 29.14752 41.65063 19.51410  1.000 116.43919 ? 527 GLU A OE2 1 
ATOM   3838 N N   . GLU A 1 528 ? 26.40971 38.66645 23.64947  1.000 55.57428  ? 528 GLU A N   1 
ATOM   3839 C CA  . GLU A 1 528 ? 25.32964 39.27047 24.41194  1.000 56.25047  ? 528 GLU A CA  1 
ATOM   3840 C C   . GLU A 1 528 ? 25.26635 40.74389 24.08258  1.000 57.10331  ? 528 GLU A C   1 
ATOM   3841 O O   . GLU A 1 528 ? 26.23982 41.47341 24.29493  1.000 64.30589  ? 528 GLU A O   1 
ATOM   3842 C CB  . GLU A 1 528 ? 25.53853 39.09533 25.91315  1.000 56.71062  ? 528 GLU A CB  1 
ATOM   3843 C CG  . GLU A 1 528 ? 25.05020 37.76190 26.41404  1.000 74.90722  ? 528 GLU A CG  1 
ATOM   3844 C CD  . GLU A 1 528 ? 23.66455 37.44225 25.89956  1.000 77.09118  ? 528 GLU A CD  1 
ATOM   3845 O OE1 . GLU A 1 528 ? 22.73149 38.22950 26.17950  1.000 63.48349  ? 528 GLU A OE1 1 
ATOM   3846 O OE2 . GLU A 1 528 ? 23.51744 36.41038 25.20506  1.000 81.77113  ? 528 GLU A OE2 1 
ATOM   3847 N N   . TRP A 1 529 ? 24.11976 41.18679 23.58070  1.000 51.10037  ? 529 TRP A N   1 
ATOM   3848 C CA  . TRP A 1 529 ? 23.90034 42.61030 23.34321  1.000 55.11856  ? 529 TRP A CA  1 
ATOM   3849 C C   . TRP A 1 529 ? 22.41441 42.85010 23.49617  1.000 67.90086  ? 529 TRP A C   1 
ATOM   3850 O O   . TRP A 1 529 ? 21.64947 42.79075 22.52273  1.000 73.60813  ? 529 TRP A O   1 
ATOM   3851 C CB  . TRP A 1 529 ? 24.41217 43.05677 21.97418  1.000 50.30186  ? 529 TRP A CB  1 
ATOM   3852 C CG  . TRP A 1 529 ? 24.29357 44.54369 21.72704  1.000 50.75455  ? 529 TRP A CG  1 
ATOM   3853 C CD1 . TRP A 1 529 ? 23.60247 45.45282 22.47578  1.000 45.33407  ? 529 TRP A CD1 1 
ATOM   3854 C CD2 . TRP A 1 529 ? 24.87346 45.28440 20.63777  1.000 49.51905  ? 529 TRP A CD2 1 
ATOM   3855 N NE1 . TRP A 1 529 ? 23.71436 46.70721 21.92434  1.000 48.95132  ? 529 TRP A NE1 1 
ATOM   3856 C CE2 . TRP A 1 529 ? 24.48501 46.62973 20.79369  1.000 43.94951  ? 529 TRP A CE2 1 
ATOM   3857 C CE3 . TRP A 1 529 ? 25.68775 44.93890 19.55550  1.000 35.70003  ? 529 TRP A CE3 1 
ATOM   3858 C CZ2 . TRP A 1 529 ? 24.88570 47.62654 19.91198  1.000 45.39548  ? 529 TRP A CZ2 1 
ATOM   3859 C CZ3 . TRP A 1 529 ? 26.08633 45.92912 18.68612  1.000 44.04513  ? 529 TRP A CZ3 1 
ATOM   3860 C CH2 . TRP A 1 529 ? 25.68023 47.25364 18.86287  1.000 46.88902  ? 529 TRP A CH2 1 
ATOM   3861 N N   . PRO A 1 530 ? 21.96412 43.12150 24.71613  1.000 61.94027  ? 530 PRO A N   1 
ATOM   3862 C CA  . PRO A 1 530 ? 20.52950 43.20165 24.97671  1.000 56.58564  ? 530 PRO A CA  1 
ATOM   3863 C C   . PRO A 1 530 ? 19.93240 44.53206 24.54639  1.000 57.64412  ? 530 PRO A C   1 
ATOM   3864 O O   . PRO A 1 530 ? 20.62354 45.52725 24.32404  1.000 51.03415  ? 530 PRO A O   1 
ATOM   3865 C CB  . PRO A 1 530 ? 20.43854 43.00440 26.49433  1.000 56.40003  ? 530 PRO A CB  1 
ATOM   3866 C CG  . PRO A 1 530 ? 21.74040 43.44214 26.99998  1.000 56.84850  ? 530 PRO A CG  1 
ATOM   3867 C CD  . PRO A 1 530 ? 22.75616 43.13576 25.95380  1.000 54.35065  ? 530 PRO A CD  1 
ATOM   3868 N N   . ASN A 1 531 ? 18.60842 44.50495 24.40982  1.000 63.34699  ? 531 ASN A N   1 
ATOM   3869 C CA  . ASN A 1 531 ? 17.83291 45.68101 24.05165  1.000 59.26667  ? 531 ASN A CA  1 
ATOM   3870 C C   . ASN A 1 531 ? 18.04322 46.82119 25.04199  1.000 61.15862  ? 531 ASN A C   1 
ATOM   3871 O O   . ASN A 1 531 ? 18.17466 46.60867 26.24837  1.000 62.41906  ? 531 ASN A O   1 
ATOM   3872 C CB  . ASN A 1 531 ? 16.35463 45.31382 23.99711  1.000 56.34653  ? 531 ASN A CB  1 
ATOM   3873 C CG  . ASN A 1 531 ? 15.94943 44.79334 22.64712  1.000 64.66205  ? 531 ASN A CG  1 
ATOM   3874 O OD1 . ASN A 1 531 ? 15.98408 43.58995 22.39210  1.000 66.95582  ? 531 ASN A OD1 1 
ATOM   3875 N ND2 . ASN A 1 531 ? 15.59182 45.70614 21.75166  1.000 66.07351  ? 531 ASN A ND2 1 
ATOM   3876 N N   . PHE A 1 532 ? 18.04867 48.04107 24.52167  1.000 57.77244  ? 532 PHE A N   1 
ATOM   3877 C CA  . PHE A 1 532 ? 18.17166 49.25040 25.31931  1.000 52.17980  ? 532 PHE A CA  1 
ATOM   3878 C C   . PHE A 1 532 ? 16.77673 49.78474 25.61526  1.000 59.00125  ? 532 PHE A C   1 
ATOM   3879 O O   . PHE A 1 532 ? 15.94481 49.88875 24.71109  1.000 61.06790  ? 532 PHE A O   1 
ATOM   3880 C CB  . PHE A 1 532 ? 19.01291 50.28442 24.56586  1.000 53.34716  ? 532 PHE A CB  1 
ATOM   3881 C CG  . PHE A 1 532 ? 19.06705 51.64082 25.20523  1.000 54.52269  ? 532 PHE A CG  1 
ATOM   3882 C CD1 . PHE A 1 532 ? 18.00018 52.53323 25.09945  1.000 49.45087  ? 532 PHE A CD1 1 
ATOM   3883 C CD2 . PHE A 1 532 ? 20.21677 52.05037 25.87019  1.000 57.11845  ? 532 PHE A CD2 1 
ATOM   3884 C CE1 . PHE A 1 532 ? 18.06914 53.79415 25.67988  1.000 54.10791  ? 532 PHE A CE1 1 
ATOM   3885 C CE2 . PHE A 1 532 ? 20.29849 53.30879 26.44223  1.000 53.01816  ? 532 PHE A CE2 1 
ATOM   3886 C CZ  . PHE A 1 532 ? 19.21897 54.18391 26.35251  1.000 49.51347  ? 532 PHE A CZ  1 
ATOM   3887 N N   . SER A 1 533 ? 16.52544 50.11132 26.88294  1.000 67.28878  ? 533 SER A N   1 
ATOM   3888 C CA  . SER A 1 533 ? 15.28116 50.72954 27.31876  1.000 57.93325  ? 533 SER A CA  1 
ATOM   3889 C C   . SER A 1 533 ? 15.59637 51.61477 28.51062  1.000 60.34705  ? 533 SER A C   1 
ATOM   3890 O O   . SER A 1 533 ? 16.67430 51.52473 29.09442  1.000 63.91668  ? 533 SER A O   1 
ATOM   3891 C CB  . SER A 1 533 ? 14.24301 49.68602 27.69727  1.000 56.48026  ? 533 SER A CB  1 
ATOM   3892 O OG  . SER A 1 533 ? 14.50319 49.24283 29.00447  1.000 60.35031  ? 533 SER A OG  1 
ATOM   3893 N N   . LYS A 1 534 ? 14.64798 52.48755 28.86146  1.000 62.35934  ? 534 LYS A N   1 
ATOM   3894 C CA  . LYS A 1 534 ? 14.79632 53.31022 30.06394  1.000 62.28156  ? 534 LYS A CA  1 
ATOM   3895 C C   . LYS A 1 534 ? 15.03840 52.44784 31.29585  1.000 60.10380  ? 534 LYS A C   1 
ATOM   3896 O O   . LYS A 1 534 ? 15.89442 52.76186 32.13368  1.000 55.49926  ? 534 LYS A O   1 
ATOM   3897 C CB  . LYS A 1 534 ? 13.54478 54.16722 30.25802  1.000 71.62926  ? 534 LYS A CB  1 
ATOM   3898 C CG  . LYS A 1 534 ? 13.60513 55.15210 31.40045  1.000 73.89322  ? 534 LYS A CG  1 
ATOM   3899 C CD  . LYS A 1 534 ? 12.26407 55.83602 31.60932  1.000 82.21184  ? 534 LYS A CD  1 
ATOM   3900 C CE  . LYS A 1 534 ? 12.10099 57.01441 30.66845  1.000 98.77891  ? 534 LYS A CE  1 
ATOM   3901 N NZ  . LYS A 1 534 ? 13.04231 58.12929 31.00043  1.000 105.87833 ? 534 LYS A NZ  1 
ATOM   3902 N N   . GLU A 1 535 ? 14.29827 51.34076 31.40512  1.000 56.06199  ? 535 GLU A N   1 
ATOM   3903 C CA  . GLU A 1 535 ? 14.43804 50.42480 32.53559  1.000 57.25878  ? 535 GLU A CA  1 
ATOM   3904 C C   . GLU A 1 535 ? 15.82512 49.81217 32.60631  1.000 61.16530  ? 535 GLU A C   1 
ATOM   3905 O O   . GLU A 1 535 ? 16.30747 49.50460 33.70126  1.000 60.61694  ? 535 GLU A O   1 
ATOM   3906 C CB  . GLU A 1 535 ? 13.39293 49.30629 32.45288  1.000 64.55379  ? 535 GLU A CB  1 
ATOM   3907 C CG  . GLU A 1 535 ? 11.95669 49.77786 32.15496  1.000 86.70388  ? 535 GLU A CG  1 
ATOM   3908 C CD  . GLU A 1 535 ? 11.74654 50.20870 30.70001  1.000 98.95298  ? 535 GLU A CD  1 
ATOM   3909 O OE1 . GLU A 1 535 ? 11.50332 51.41377 30.45911  1.000 99.88094  ? 535 GLU A OE1 1 
ATOM   3910 O OE2 . GLU A 1 535 ? 11.84009 49.34421 29.80007  1.000 104.74700 ? 535 GLU A OE2 1 
ATOM   3911 N N   . ASP A 1 536 ? 16.46933 49.60522 31.45725  1.000 62.93639  ? 536 ASP A N   1 
ATOM   3912 C CA  . ASP A 1 536 ? 17.77145 48.94250 31.38292  1.000 60.81716  ? 536 ASP A CA  1 
ATOM   3913 C C   . ASP A 1 536 ? 18.55593 49.58568 30.25262  1.000 57.39374  ? 536 ASP A C   1 
ATOM   3914 O O   . ASP A 1 536 ? 18.73594 49.00087 29.17899  1.000 62.31995  ? 536 ASP A O   1 
ATOM   3915 C CB  . ASP A 1 536 ? 17.61007 47.42910 31.18300  1.000 61.10046  ? 536 ASP A CB  1 
ATOM   3916 C CG  . ASP A 1 536 ? 18.93925 46.68674 31.20744  1.000 59.01363  ? 536 ASP A CG  1 
ATOM   3917 O OD1 . ASP A 1 536 ? 19.91886 47.27059 31.68475  1.000 64.43527  ? 536 ASP A OD1 1 
ATOM   3918 O OD2 . ASP A 1 536 ? 19.02258 45.53445 30.73950  1.000 59.92708  ? 536 ASP A OD2 1 
ATOM   3919 N N   . PRO A 1 537 ? 19.04142 50.80195 30.46336  1.000 51.85781  ? 537 PRO A N   1 
ATOM   3920 C CA  . PRO A 1 537 ? 19.73274 51.54668 29.39588  1.000 56.77294  ? 537 PRO A CA  1 
ATOM   3921 C C   . PRO A 1 537 ? 21.12951 50.99669 29.13048  1.000 52.48100  ? 537 PRO A C   1 
ATOM   3922 O O   . PRO A 1 537 ? 22.13237 51.70415 29.24750  1.000 49.56147  ? 537 PRO A O   1 
ATOM   3923 C CB  . PRO A 1 537 ? 19.75277 52.97400 29.95993  1.000 48.90563  ? 537 PRO A CB  1 
ATOM   3924 C CG  . PRO A 1 537 ? 19.87109 52.74240 31.45079  1.000 45.58092  ? 537 PRO A CG  1 
ATOM   3925 C CD  . PRO A 1 537 ? 19.11507 51.49178 31.75462  1.000 46.40669  ? 537 PRO A CD  1 
ATOM   3926 N N   . VAL A 1 538 ? 21.18908 49.69865 28.79711  1.000 51.13449  ? 538 VAL A N   1 
ATOM   3927 C CA  . VAL A 1 538 ? 22.44258 48.99855 28.52573  1.000 51.86457  ? 538 VAL A CA  1 
ATOM   3928 C C   . VAL A 1 538 ? 22.89807 49.30881 27.10261  1.000 51.49317  ? 538 VAL A C   1 
ATOM   3929 O O   . VAL A 1 538 ? 22.08931 49.38222 26.16823  1.000 50.94582  ? 538 VAL A O   1 
ATOM   3930 C CB  . VAL A 1 538 ? 22.27546 47.47754 28.77135  1.000 52.98791  ? 538 VAL A CB  1 
ATOM   3931 C CG1 . VAL A 1 538 ? 21.14149 46.88035 27.92760  1.000 47.45605  ? 538 VAL A CG1 1 
ATOM   3932 C CG2 . VAL A 1 538 ? 23.58569 46.71219 28.53704  1.000 49.07951  ? 538 VAL A CG2 1 
ATOM   3933 N N   . TYR A 1 539 ? 24.19583 49.53516 26.93535  1.000 50.26551  ? 539 TYR A N   1 
ATOM   3934 C CA  . TYR A 1 539 ? 24.76509 49.76122 25.61569  1.000 50.74971  ? 539 TYR A CA  1 
ATOM   3935 C C   . TYR A 1 539 ? 25.99360 48.88113 25.42467  1.000 53.81088  ? 539 TYR A C   1 
ATOM   3936 O O   . TYR A 1 539 ? 26.56689 48.35751 26.38386  1.000 61.15904  ? 539 TYR A O   1 
ATOM   3937 C CB  . TYR A 1 539 ? 25.12024 51.23110 25.40328  1.000 50.33733  ? 539 TYR A CB  1 
ATOM   3938 C CG  . TYR A 1 539 ? 25.90383 51.84474 26.53992  1.000 55.84571  ? 539 TYR A CG  1 
ATOM   3939 C CD1 . TYR A 1 539 ? 25.26122 52.32334 27.69460  1.000 48.32892  ? 539 TYR A CD1 1 
ATOM   3940 C CD2 . TYR A 1 539 ? 27.28684 51.96402 26.45566  1.000 47.29775  ? 539 TYR A CD2 1 
ATOM   3941 C CE1 . TYR A 1 539 ? 25.98979 52.89917 28.73225  1.000 43.67677  ? 539 TYR A CE1 1 
ATOM   3942 C CE2 . TYR A 1 539 ? 28.01708 52.54327 27.46612  1.000 47.56325  ? 539 TYR A CE2 1 
ATOM   3943 C CZ  . TYR A 1 539 ? 27.37672 53.01105 28.60649  1.000 48.54576  ? 539 TYR A CZ  1 
ATOM   3944 O OH  . TYR A 1 539 ? 28.16387 53.56586 29.59727  1.000 49.39556  ? 539 TYR A OH  1 
ATOM   3945 N N   . TYR A 1 540 ? 26.36511 48.68749 24.16226  1.000 48.70133  ? 540 TYR A N   1 
ATOM   3946 C CA  . TYR A 1 540 ? 27.52864 47.89047 23.79787  1.000 45.31912  ? 540 TYR A CA  1 
ATOM   3947 C C   . TYR A 1 540 ? 28.68677 48.83996 23.56495  1.000 46.54657  ? 540 TYR A C   1 
ATOM   3948 O O   . TYR A 1 540 ? 28.50495 49.91439 22.97980  1.000 43.40885  ? 540 TYR A O   1 
ATOM   3949 C CB  . TYR A 1 540 ? 27.25116 47.06143 22.53847  1.000 43.87887  ? 540 TYR A CB  1 
ATOM   3950 C CG  . TYR A 1 540 ? 28.25280 45.96950 22.25471  1.000 45.03585  ? 540 TYR A CG  1 
ATOM   3951 C CD1 . TYR A 1 540 ? 28.06726 44.68907 22.73187  1.000 48.76784  ? 540 TYR A CD1 1 
ATOM   3952 C CD2 . TYR A 1 540 ? 29.37741 46.22344 21.49675  1.000 47.78657  ? 540 TYR A CD2 1 
ATOM   3953 C CE1 . TYR A 1 540 ? 28.98134 43.70002 22.46701  1.000 58.93748  ? 540 TYR A CE1 1 
ATOM   3954 C CE2 . TYR A 1 540 ? 30.29017 45.24361 21.22221  1.000 54.11301  ? 540 TYR A CE2 1 
ATOM   3955 C CZ  . TYR A 1 540 ? 30.09471 43.98553 21.70305  1.000 61.31851  ? 540 TYR A CZ  1 
ATOM   3956 O OH  . TYR A 1 540 ? 31.03002 43.01362 21.41662  1.000 67.13221  ? 540 TYR A OH  1 
ATOM   3957 N N   . ILE A 1 541 ? 29.87150 48.48089 24.05189  1.000 47.35191  ? 541 ILE A N   1 
ATOM   3958 C CA  . ILE A 1 541 ? 31.03167 49.34834 23.87384  1.000 48.79441  ? 541 ILE A CA  1 
ATOM   3959 C C   . ILE A 1 541 ? 31.92801 48.74493 22.81026  1.000 58.50712  ? 541 ILE A C   1 
ATOM   3960 O O   . ILE A 1 541 ? 32.37386 47.59827 22.94012  1.000 60.87352  ? 541 ILE A O   1 
ATOM   3961 C CB  . ILE A 1 541 ? 31.80933 49.57414 25.17025  1.000 52.51909  ? 541 ILE A CB  1 
ATOM   3962 C CG1 . ILE A 1 541 ? 30.95199 50.32445 26.20693  1.000 50.16552  ? 541 ILE A CG1 1 
ATOM   3963 C CG2 . ILE A 1 541 ? 33.06707 50.34939 24.86177  1.000 35.53060  ? 541 ILE A CG2 1 
ATOM   3964 C CD1 . ILE A 1 541 ? 31.65198 50.45178 27.53399  1.000 39.79786  ? 541 ILE A CD1 1 
ATOM   3965 N N   . PHE A 1 542 ? 32.18699 49.51544 21.75445  1.000 52.19297  ? 542 PHE A N   1 
ATOM   3966 C CA  . PHE A 1 542 ? 33.11300 49.09979 20.71540  1.000 48.22840  ? 542 PHE A CA  1 
ATOM   3967 C C   . PHE A 1 542 ? 34.48336 49.65287 21.06893  1.000 42.79606  ? 542 PHE A C   1 
ATOM   3968 O O   . PHE A 1 542 ? 34.69823 50.87226 21.04308  1.000 40.70074  ? 542 PHE A O   1 
ATOM   3969 C CB  . PHE A 1 542 ? 32.64365 49.57605 19.34266  1.000 50.70179  ? 542 PHE A CB  1 
ATOM   3970 C CG  . PHE A 1 542 ? 31.54702 48.73906 18.76388  1.000 43.41884  ? 542 PHE A CG  1 
ATOM   3971 C CD1 . PHE A 1 542 ? 31.73370 47.37128 18.57192  1.000 41.49203  ? 542 PHE A CD1 1 
ATOM   3972 C CD2 . PHE A 1 542 ? 30.33136 49.31784 18.40790  1.000 36.48349  ? 542 PHE A CD2 1 
ATOM   3973 C CE1 . PHE A 1 542 ? 30.72342 46.59081 18.03255  1.000 44.50946  ? 542 PHE A CE1 1 
ATOM   3974 C CE2 . PHE A 1 542 ? 29.30016 48.54902 17.86988  1.000 36.66459  ? 542 PHE A CE2 1 
ATOM   3975 C CZ  . PHE A 1 542 ? 29.49144 47.18404 17.69257  1.000 45.45940  ? 542 PHE A CZ  1 
ATOM   3976 N N   . SER A 1 543 ? 35.40595 48.75320 21.39889  1.000 40.32479  ? 543 SER A N   1 
ATOM   3977 C CA  . SER A 1 543 ? 36.75688 49.13548 21.77746  1.000 49.71310  ? 543 SER A CA  1 
ATOM   3978 C C   . SER A 1 543 ? 37.71289 48.04478 21.30707  1.000 55.43154  ? 543 SER A C   1 
ATOM   3979 O O   . SER A 1 543 ? 37.30482 46.90801 21.05287  1.000 45.40607  ? 543 SER A O   1 
ATOM   3980 C CB  . SER A 1 543 ? 36.85119 49.35392 23.29632  1.000 63.63644  ? 543 SER A CB  1 
ATOM   3981 O OG  . SER A 1 543 ? 38.04871 50.01078 23.67339  1.000 83.06792  ? 543 SER A OG  1 
ATOM   3982 N N   . THR A 1 544 ? 38.99329 48.39446 21.16250  1.000 60.77389  ? 544 THR A N   1 
ATOM   3983 C CA  . THR A 1 544 ? 39.95726 47.34143 20.87623  1.000 67.74749  ? 544 THR A CA  1 
ATOM   3984 C C   . THR A 1 544 ? 40.45629 46.69109 22.14139  1.000 69.93083  ? 544 THR A C   1 
ATOM   3985 O O   . THR A 1 544 ? 40.98292 45.57086 22.08216  1.000 61.40315  ? 544 THR A O   1 
ATOM   3986 C CB  . THR A 1 544 ? 41.16743 47.85586 20.09644  1.000 66.10322  ? 544 THR A CB  1 
ATOM   3987 O OG1 . THR A 1 544 ? 41.71973 48.99749 20.75957  1.000 69.62418  ? 544 THR A OG1 1 
ATOM   3988 C CG2 . THR A 1 544 ? 40.77246 48.19596 18.69313  1.000 62.96228  ? 544 THR A CG2 1 
ATOM   3989 N N   . ASP A 1 545 ? 40.31201 47.40151 23.26225  1.000 72.60261  ? 545 ASP A N   1 
ATOM   3990 C CA  . ASP A 1 545 ? 40.62505 46.95055 24.60820  1.000 72.25337  ? 545 ASP A CA  1 
ATOM   3991 C C   . ASP A 1 545 ? 39.75757 45.75764 24.97404  1.000 67.02668  ? 545 ASP A C   1 
ATOM   3992 O O   . ASP A 1 545 ? 38.53376 45.87353 25.11918  1.000 71.13425  ? 545 ASP A O   1 
ATOM   3993 C CB  . ASP A 1 545 ? 40.41484 48.09868 25.59367  1.000 71.30851  ? 545 ASP A CB  1 
ATOM   3994 C CG  . ASP A 1 545 ? 41.19992 47.93330 26.88334  1.000 65.45056  ? 545 ASP A CG  1 
ATOM   3995 O OD1 . ASP A 1 545 ? 41.92297 46.92455 27.05699  1.000 61.68171  ? 545 ASP A OD1 1 
ATOM   3996 O OD2 . ASP A 1 545 ? 41.08677 48.84807 27.72337  1.000 62.12539  ? 545 ASP A OD2 1 
ATOM   3997 N N   . ASP A 1 546 ? 40.38718 44.60166 25.08744  1.000 63.68207  ? 546 ASP A N   1 
ATOM   3998 C CA  . ASP A 1 546 ? 39.69270 43.38900 25.46893  1.000 72.52475  ? 546 ASP A CA  1 
ATOM   3999 C C   . ASP A 1 546 ? 39.50606 43.27662 26.97958  1.000 72.05951  ? 546 ASP A C   1 
ATOM   4000 O O   . ASP A 1 546 ? 38.90329 42.30175 27.43886  1.000 73.73867  ? 546 ASP A O   1 
ATOM   4001 C CB  . ASP A 1 546 ? 40.45862 42.18048 24.92736  1.000 81.51157  ? 546 ASP A CB  1 
ATOM   4002 C CG  . ASP A 1 546 ? 41.88099 42.11013 25.45390  1.000 95.61891  ? 546 ASP A CG  1 
ATOM   4003 O OD1 . ASP A 1 546 ? 42.32755 43.06751 26.12784  1.000 99.35799  ? 546 ASP A OD1 1 
ATOM   4004 O OD2 . ASP A 1 546 ? 42.55105 41.08584 25.20720  1.000 102.03750 ? 546 ASP A OD2 1 
ATOM   4005 N N   . LYS A 1 547 ? 39.99739 44.25851 27.74641  1.000 65.17728  ? 547 LYS A N   1 
ATOM   4006 C CA  . LYS A 1 547 ? 39.93549 44.26789 29.20482  1.000 60.56037  ? 547 LYS A CA  1 
ATOM   4007 C C   . LYS A 1 547 ? 38.67441 44.91574 29.76625  1.000 60.64338  ? 547 LYS A C   1 
ATOM   4008 O O   . LYS A 1 547 ? 38.38855 44.75158 30.96007  1.000 67.62858  ? 547 LYS A O   1 
ATOM   4009 C CB  . LYS A 1 547 ? 41.15928 44.99869 29.78098  1.000 54.19365  ? 547 LYS A CB  1 
ATOM   4010 C CG  . LYS A 1 547 ? 42.45948 44.19498 29.76833  1.000 60.49380  ? 547 LYS A CG  1 
ATOM   4011 C CD  . LYS A 1 547 ? 43.64836 45.04176 30.22864  1.000 80.05635  ? 547 LYS A CD  1 
ATOM   4012 C CE  . LYS A 1 547 ? 44.14880 45.99198 29.13522  1.000 98.13030  ? 547 LYS A CE  1 
ATOM   4013 N NZ  . LYS A 1 547 ? 45.08231 45.32524 28.17416  1.000 108.35292 ? 547 LYS A NZ  1 
ATOM   4014 N N   . ILE A 1 548 ? 37.92511 45.66385 28.96133  1.000 55.43181  ? 548 ILE A N   1 
ATOM   4015 C CA  . ILE A 1 548 ? 36.77651 46.39284 29.48732  1.000 55.24715  ? 548 ILE A CA  1 
ATOM   4016 C C   . ILE A 1 548 ? 35.55604 45.48675 29.45872  1.000 61.54260  ? 548 ILE A C   1 
ATOM   4017 O O   . ILE A 1 548 ? 35.56532 44.42593 28.82440  1.000 72.95413  ? 548 ILE A O   1 
ATOM   4018 C CB  . ILE A 1 548 ? 36.52908 47.69938 28.70840  1.000 53.30893  ? 548 ILE A CB  1 
ATOM   4019 C CG1 . ILE A 1 548 ? 36.29499 47.41716 27.23240  1.000 54.69751  ? 548 ILE A CG1 1 
ATOM   4020 C CG2 . ILE A 1 548 ? 37.71416 48.64946 28.85235  1.000 50.87765  ? 548 ILE A CG2 1 
ATOM   4021 C CD1 . ILE A 1 548 ? 34.87945 47.65238 26.76587  1.000 53.21620  ? 548 ILE A CD1 1 
ATOM   4022 N N   . GLU A 1 549 ? 34.50858 45.87563 30.16789  1.000 59.61480  ? 549 GLU A N   1 
ATOM   4023 C CA  . GLU A 1 549 ? 33.24451 45.16892 30.08494  1.000 60.61405  ? 549 GLU A CA  1 
ATOM   4024 C C   . GLU A 1 549 ? 32.48117 45.75638 28.91333  1.000 57.41129  ? 549 GLU A C   1 
ATOM   4025 O O   . GLU A 1 549 ? 32.22051 46.96418 28.88868  1.000 57.46299  ? 549 GLU A O   1 
ATOM   4026 C CB  . GLU A 1 549 ? 32.44341 45.30134 31.38063  1.000 62.64858  ? 549 GLU A CB  1 
ATOM   4027 C CG  . GLU A 1 549 ? 31.29088 44.32731 31.48968  1.000 45.42365  ? 549 GLU A CG  1 
ATOM   4028 C CD  . GLU A 1 549 ? 31.75436 42.97237 31.95551  1.000 62.41461  ? 549 GLU A CD  1 
ATOM   4029 O OE1 . GLU A 1 549 ? 32.97038 42.70915 31.88203  1.000 64.41712  ? 549 GLU A OE1 1 
ATOM   4030 O OE2 . GLU A 1 549 ? 30.92010 42.17181 32.42415  1.000 63.80778  ? 549 GLU A OE2 1 
ATOM   4031 N N   . LYS A 1 550 ? 32.14035 44.91425 27.93816  1.000 60.38420  ? 550 LYS A N   1 
ATOM   4032 C CA  . LYS A 1 550 ? 31.51409 45.43485 26.72610  1.000 59.75387  ? 550 LYS A CA  1 
ATOM   4033 C C   . LYS A 1 550 ? 30.15507 46.06445 27.02956  1.000 58.58351  ? 550 LYS A C   1 
ATOM   4034 O O   . LYS A 1 550 ? 29.84039 47.14606 26.52033  1.000 61.95041  ? 550 LYS A O   1 
ATOM   4035 C CB  . LYS A 1 550 ? 31.40771 44.32483 25.68098  1.000 61.24816  ? 550 LYS A CB  1 
ATOM   4036 C CG  . LYS A 1 550 ? 32.70966 43.56690 25.52366  1.000 65.32230  ? 550 LYS A CG  1 
ATOM   4037 C CD  . LYS A 1 550 ? 32.77708 42.68912 24.28607  1.000 66.94835  ? 550 LYS A CD  1 
ATOM   4038 C CE  . LYS A 1 550 ? 34.20564 42.62960 23.76231  1.000 76.48951  ? 550 LYS A CE  1 
ATOM   4039 N NZ  . LYS A 1 550 ? 35.20806 43.21522 24.73272  1.000 89.07126  ? 550 LYS A NZ  1 
ATOM   4040 N N   . LEU A 1 551 ? 29.35729 45.43288 27.89096  1.000 57.30109  ? 551 LEU A N   1 
ATOM   4041 C CA  . LEU A 1 551 ? 28.05334 45.96712 28.27338  1.000 58.84324  ? 551 LEU A CA  1 
ATOM   4042 C C   . LEU A 1 551 ? 28.17367 46.88370 29.48901  1.000 61.18213  ? 551 LEU A C   1 
ATOM   4043 O O   . LEU A 1 551 ? 28.83193 46.53986 30.48218  1.000 68.85226  ? 551 LEU A O   1 
ATOM   4044 C CB  . LEU A 1 551 ? 27.06969 44.83683 28.57935  1.000 55.55243  ? 551 LEU A CB  1 
ATOM   4045 C CG  . LEU A 1 551 ? 26.83862 43.79865 27.48265  1.000 57.46152  ? 551 LEU A CG  1 
ATOM   4046 C CD1 . LEU A 1 551 ? 25.83722 42.74922 27.94685  1.000 42.99615  ? 551 LEU A CD1 1 
ATOM   4047 C CD2 . LEU A 1 551 ? 26.40691 44.45558 26.14931  1.000 45.20635  ? 551 LEU A CD2 1 
ATOM   4048 N N   . ALA A 1 552 ? 27.50248 48.03117 29.41787  1.000 45.80448  ? 552 ALA A N   1 
ATOM   4049 C CA  . ALA A 1 552 ? 27.53475 49.03278 30.46714  1.000 46.92951  ? 552 ALA A CA  1 
ATOM   4050 C C   . ALA A 1 552 ? 26.21120 49.78324 30.47885  1.000 54.83076  ? 552 ALA A C   1 
ATOM   4051 O O   . ALA A 1 552 ? 25.54154 49.89154 29.45153  1.000 61.84045  ? 552 ALA A O   1 
ATOM   4052 C CB  . ALA A 1 552 ? 28.69383 50.01465 30.27231  1.000 50.14563  ? 552 ALA A CB  1 
ATOM   4053 N N   . ARG A 1 553 ? 25.84811 50.31196 31.65344  1.000 58.67933  ? 553 ARG A N   1 
ATOM   4054 C CA  . ARG A 1 553 ? 24.59666 51.04012 31.83766  1.000 52.24279  ? 553 ARG A CA  1 
ATOM   4055 C C   . ARG A 1 553 ? 24.83609 52.40569 32.47046  1.000 54.43900  ? 553 ARG A C   1 
ATOM   4056 O O   . ARG A 1 553 ? 24.37061 53.43347 31.95752  1.000 57.74474  ? 553 ARG A O   1 
ATOM   4057 C CB  . ARG A 1 553 ? 23.63553 50.20646 32.68899  1.000 38.35537  ? 553 ARG A CB  1 
ATOM   4058 C CG  . ARG A 1 553 ? 23.39985 48.82139 32.06384  1.000 56.16435  ? 553 ARG A CG  1 
ATOM   4059 C CD  . ARG A 1 553 ? 22.84219 47.77956 33.00934  1.000 62.93812  ? 553 ARG A CD  1 
ATOM   4060 N NE  . ARG A 1 553 ? 22.16108 46.67910 32.31315  1.000 74.21099  ? 553 ARG A NE  1 
ATOM   4061 C CZ  . ARG A 1 553 ? 22.74562 45.56441 31.86434  1.000 73.99712  ? 553 ARG A CZ  1 
ATOM   4062 N NH1 . ARG A 1 553 ? 24.05293 45.37295 32.01950  1.000 60.68511  ? 553 ARG A NH1 1 
ATOM   4063 N NH2 . ARG A 1 553 ? 22.01320 44.63006 31.25597  1.000 72.06591  ? 553 ARG A NH2 1 
ATOM   4064 N N   . GLY A 1 554 ? 25.60244 52.41884 33.56376  1.000 57.47939  ? 554 GLY A N   1 
ATOM   4065 C CA  . GLY A 1 554 ? 25.72561 53.57121 34.43642  1.000 53.08528  ? 554 GLY A CA  1 
ATOM   4066 C C   . GLY A 1 554 ? 26.36389 54.81103 33.86469  1.000 59.99859  ? 554 GLY A C   1 
ATOM   4067 O O   . GLY A 1 554 ? 25.88212 55.92687 34.12792  1.000 58.63923  ? 554 GLY A O   1 
ATOM   4068 N N   . PRO A 1 555 ? 27.46787 54.70362 33.12283  1.000 56.28015  ? 555 PRO A N   1 
ATOM   4069 C CA  . PRO A 1 555 ? 28.20220 55.93123 32.79037  1.000 54.19125  ? 555 PRO A CA  1 
ATOM   4070 C C   . PRO A 1 555 ? 27.48075 56.86776 31.83418  1.000 59.79888  ? 555 PRO A C   1 
ATOM   4071 O O   . PRO A 1 555 ? 27.50999 58.08953 32.04901  1.000 61.97065  ? 555 PRO A O   1 
ATOM   4072 C CB  . PRO A 1 555 ? 29.51920 55.39177 32.22588  1.000 41.67961  ? 555 PRO A CB  1 
ATOM   4073 C CG  . PRO A 1 555 ? 29.73537 54.13708 33.03725  1.000 41.41348  ? 555 PRO A CG  1 
ATOM   4074 C CD  . PRO A 1 555 ? 28.35635 53.52547 33.07375  1.000 52.02343  ? 555 PRO A CD  1 
ATOM   4075 N N   . LEU A 1 556 ? 26.83461 56.34974 30.79092  1.000 54.79866  ? 556 LEU A N   1 
ATOM   4076 C CA  . LEU A 1 556 ? 25.98007 57.20678 29.97804  1.000 48.58356  ? 556 LEU A CA  1 
ATOM   4077 C C   . LEU A 1 556 ? 24.76473 57.66862 30.76924  1.000 53.01791  ? 556 LEU A C   1 
ATOM   4078 O O   . LEU A 1 556 ? 24.33103 58.82350 30.64223  1.000 56.52564  ? 556 LEU A O   1 
ATOM   4079 C CB  . LEU A 1 556 ? 25.54314 56.47183 28.70915  1.000 53.02317  ? 556 LEU A CB  1 
ATOM   4080 C CG  . LEU A 1 556 ? 26.57046 56.41439 27.57400  1.000 68.90614  ? 556 LEU A CG  1 
ATOM   4081 C CD1 . LEU A 1 556 ? 25.95600 55.78852 26.32160  1.000 73.59857  ? 556 LEU A CD1 1 
ATOM   4082 C CD2 . LEU A 1 556 ? 27.12352 57.78828 27.25823  1.000 63.33300  ? 556 LEU A CD2 1 
ATOM   4083 N N   . ALA A 1 557 ? 24.20695 56.78218 31.59875  1.000 56.17158  ? 557 ALA A N   1 
ATOM   4084 C CA  . ALA A 1 557 ? 23.01204 57.14226 32.35645  1.000 53.24351  ? 557 ALA A CA  1 
ATOM   4085 C C   . ALA A 1 557 ? 23.26341 58.35820 33.23343  1.000 54.46256  ? 557 ALA A C   1 
ATOM   4086 O O   . ALA A 1 557 ? 22.41018 59.24825 33.33580  1.000 51.42277  ? 557 ALA A O   1 
ATOM   4087 C CB  . ALA A 1 557 ? 22.54220 55.95628 33.18952  1.000 35.93530  ? 557 ALA A CB  1 
ATOM   4088 N N   . ALA A 1 558 ? 24.44606 58.42866 33.84519  1.000 57.35059  ? 558 ALA A N   1 
ATOM   4089 C CA  . ALA A 1 558 ? 24.77002 59.54849 34.71971  1.000 56.79631  ? 558 ALA A CA  1 
ATOM   4090 C C   . ALA A 1 558 ? 25.06684 60.80043 33.91135  1.000 52.38921  ? 558 ALA A C   1 
ATOM   4091 O O   . ALA A 1 558 ? 24.51470 61.86612 34.19237  1.000 61.42698  ? 558 ALA A O   1 
ATOM   4092 C CB  . ALA A 1 558 ? 25.96027 59.19708 35.62544  1.000 54.92638  ? 558 ALA A CB  1 
ATOM   4093 N N   . ARG A 1 559 ? 25.95792 60.68691 32.92129  1.000 46.98852  ? 559 ARG A N   1 
ATOM   4094 C CA  . ARG A 1 559 ? 26.26017 61.79281 32.00951  1.000 59.50189  ? 559 ARG A CA  1 
ATOM   4095 C C   . ARG A 1 559 ? 25.01222 62.58302 31.61910  1.000 50.43187  ? 559 ARG A C   1 
ATOM   4096 O O   . ARG A 1 559 ? 24.96329 63.81371 31.77444  1.000 53.79575  ? 559 ARG A O   1 
ATOM   4097 C CB  . ARG A 1 559 ? 26.94404 61.24916 30.74202  1.000 66.55220  ? 559 ARG A CB  1 
ATOM   4098 C CG  . ARG A 1 559 ? 28.44287 61.45979 30.66015  1.000 67.52534  ? 559 ARG A CG  1 
ATOM   4099 C CD  . ARG A 1 559 ? 29.01856 60.84075 29.39756  1.000 73.94050  ? 559 ARG A CD  1 
ATOM   4100 N NE  . ARG A 1 559 ? 30.03394 61.69956 28.80258  1.000 84.06006  ? 559 ARG A NE  1 
ATOM   4101 C CZ  . ARG A 1 559 ? 31.24810 61.29309 28.45610  1.000 90.60800  ? 559 ARG A CZ  1 
ATOM   4102 N NH1 . ARG A 1 559 ? 31.60833 60.02838 28.63674  1.000 88.75125  ? 559 ARG A NH1 1 
ATOM   4103 N NH2 . ARG A 1 559 ? 32.09952 62.15713 27.92469  1.000 96.15654  ? 559 ARG A NH2 1 
ATOM   4104 N N   . CYS A 1 560 ? 23.98102 61.86592 31.14018  1.000 44.07163  ? 560 CYS A N   1 
ATOM   4105 C CA  . CYS A 1 560 ? 22.83437 62.45550 30.44976  1.000 49.97714  ? 560 CYS A CA  1 
ATOM   4106 C C   . CYS A 1 560 ? 21.64696 62.69071 31.36601  1.000 48.58760  ? 560 CYS A C   1 
ATOM   4107 O O   . CYS A 1 560 ? 20.70542 63.42568 30.99472  1.000 45.76797  ? 560 CYS A O   1 
ATOM   4108 C CB  . CYS A 1 560 ? 22.36248 61.51771 29.33625  1.000 48.90311  ? 560 CYS A CB  1 
ATOM   4109 S SG  . CYS A 1 560 ? 23.48724 61.59328 28.01270  1.000 48.55999  ? 560 CYS A SG  1 
ATOM   4110 N N   . SER A 1 561 ? 21.68372 62.06028 32.54787  1.000 45.12663  ? 561 SER A N   1 
ATOM   4111 C CA  . SER A 1 561 ? 20.76027 62.37634 33.62601  1.000 51.01061  ? 561 SER A CA  1 
ATOM   4112 C C   . SER A 1 561 ? 20.71870 63.86421 33.86107  1.000 49.87404  ? 561 SER A C   1 
ATOM   4113 O O   . SER A 1 561 ? 19.64008 64.44720 34.02114  1.000 51.44522  ? 561 SER A O   1 
ATOM   4114 C CB  . SER A 1 561 ? 21.20355 61.66588 34.89827  1.000 52.40098  ? 561 SER A CB  1 
ATOM   4115 O OG  . SER A 1 561 ? 20.17616 61.68629 35.85558  1.000 59.82126  ? 561 SER A OG  1 
ATOM   4116 N N   . PHE A 1 562 ? 21.89294 64.49483 33.87224  1.000 43.97775  ? 562 PHE A N   1 
ATOM   4117 C CA  . PHE A 1 562 ? 21.95163 65.93479 34.01887  1.000 43.68800  ? 562 PHE A CA  1 
ATOM   4118 C C   . PHE A 1 562 ? 21.12815 66.61648 32.93451  1.000 49.94667  ? 562 PHE A C   1 
ATOM   4119 O O   . PHE A 1 562 ? 20.23709 67.41393 33.23621  1.000 51.00459  ? 562 PHE A O   1 
ATOM   4120 C CB  . PHE A 1 562 ? 23.41038 66.38362 33.99308  1.000 46.65267  ? 562 PHE A CB  1 
ATOM   4121 C CG  . PHE A 1 562 ? 23.59366 67.87440 33.94691  1.000 55.62904  ? 562 PHE A CG  1 
ATOM   4122 C CD1 . PHE A 1 562 ? 23.38429 68.64409 35.09054  1.000 49.91808  ? 562 PHE A CD1 1 
ATOM   4123 C CD2 . PHE A 1 562 ? 23.96127 68.51499 32.74977  1.000 52.55376  ? 562 PHE A CD2 1 
ATOM   4124 C CE1 . PHE A 1 562 ? 23.54446 70.01916 35.05891  1.000 50.91271  ? 562 PHE A CE1 1 
ATOM   4125 C CE2 . PHE A 1 562 ? 24.12388 69.89621 32.70434  1.000 57.35784  ? 562 PHE A CE2 1 
ATOM   4126 C CZ  . PHE A 1 562 ? 23.91636 70.65893 33.87509  1.000 55.65055  ? 562 PHE A CZ  1 
ATOM   4127 N N   . TRP A 1 563 ? 21.37345 66.27163 31.66196  1.000 59.52678  ? 563 TRP A N   1 
ATOM   4128 C CA  . TRP A 1 563 ? 20.73203 66.99879 30.56307  1.000 54.88957  ? 563 TRP A CA  1 
ATOM   4129 C C   . TRP A 1 563 ? 19.26274 66.62821 30.41705  1.000 52.87492  ? 563 TRP A C   1 
ATOM   4130 O O   . TRP A 1 563 ? 18.41690 67.49754 30.16511  1.000 53.49425  ? 563 TRP A O   1 
ATOM   4131 C CB  . TRP A 1 563 ? 21.46985 66.74175 29.25459  1.000 38.07847  ? 563 TRP A CB  1 
ATOM   4132 C CG  . TRP A 1 563 ? 22.84103 67.31288 29.25171  1.000 38.43225  ? 563 TRP A CG  1 
ATOM   4133 C CD1 . TRP A 1 563 ? 24.00877 66.64174 29.45835  1.000 43.73383  ? 563 TRP A CD1 1 
ATOM   4134 C CD2 . TRP A 1 563 ? 23.19715 68.67662 29.01367  1.000 36.43104  ? 563 TRP A CD2 1 
ATOM   4135 N NE1 . TRP A 1 563 ? 25.07677 67.50713 29.36533  1.000 43.56533  ? 563 TRP A NE1 1 
ATOM   4136 C CE2 . TRP A 1 563 ? 24.60082 68.76466 29.10124  1.000 45.60315  ? 563 TRP A CE2 1 
ATOM   4137 C CE3 . TRP A 1 563 ? 22.46339 69.83568 28.74648  1.000 39.25756  ? 563 TRP A CE3 1 
ATOM   4138 C CZ2 . TRP A 1 563 ? 25.28106 69.96380 28.94438  1.000 37.58508  ? 563 TRP A CZ2 1 
ATOM   4139 C CZ3 . TRP A 1 563 ? 23.13322 71.01677 28.57704  1.000 39.20284  ? 563 TRP A CZ3 1 
ATOM   4140 C CH2 . TRP A 1 563 ? 24.53127 71.07864 28.68741  1.000 44.38185  ? 563 TRP A CH2 1 
ATOM   4141 N N   . ASN A 1 564 ? 18.93480 65.35221 30.58349  1.000 43.85669  ? 564 ASN A N   1 
ATOM   4142 C CA  . ASN A 1 564 ? 17.58622 64.90178 30.29225  1.000 46.28733  ? 564 ASN A CA  1 
ATOM   4143 C C   . ASN A 1 564 ? 16.66237 64.84632 31.51253  1.000 57.07016  ? 564 ASN A C   1 
ATOM   4144 O O   . ASN A 1 564 ? 15.43854 64.81500 31.33618  1.000 67.57712  ? 564 ASN A O   1 
ATOM   4145 C CB  . ASN A 1 564 ? 17.65181 63.53732 29.59482  1.000 44.71260  ? 564 ASN A CB  1 
ATOM   4146 C CG  . ASN A 1 564 ? 18.53395 63.56831 28.33390  1.000 50.34643  ? 564 ASN A CG  1 
ATOM   4147 O OD1 . ASN A 1 564 ? 18.64124 64.60346 27.66548  1.000 54.26082  ? 564 ASN A OD1 1 
ATOM   4148 N ND2 . ASN A 1 564 ? 19.17418 62.43940 28.01562  1.000 43.57811  ? 564 ASN A ND2 1 
ATOM   4149 N N   . ASP A 1 565 ? 17.18466 64.86246 32.73780  1.000 52.22640  ? 565 ASP A N   1 
ATOM   4150 C CA  . ASP A 1 565 ? 16.30824 64.84816 33.90399  1.000 54.95738  ? 565 ASP A CA  1 
ATOM   4151 C C   . ASP A 1 565 ? 16.41919 66.10962 34.73823  1.000 52.99811  ? 565 ASP A C   1 
ATOM   4152 O O   . ASP A 1 565 ? 15.40454 66.76525 35.01327  1.000 54.26184  ? 565 ASP A O   1 
ATOM   4153 C CB  . ASP A 1 565 ? 16.60209 63.62862 34.78477  1.000 60.07245  ? 565 ASP A CB  1 
ATOM   4154 C CG  . ASP A 1 565 ? 16.67669 62.35499 33.99304  1.000 69.10693  ? 565 ASP A CG  1 
ATOM   4155 O OD1 . ASP A 1 565 ? 15.91785 62.23674 33.01024  1.000 73.54180  ? 565 ASP A OD1 1 
ATOM   4156 O OD2 . ASP A 1 565 ? 17.49964 61.48158 34.34235  1.000 70.43710  ? 565 ASP A OD2 1 
ATOM   4157 N N   . TYR A 1 566 ? 17.62904 66.47777 35.14216  1.000 57.15188  ? 566 TYR A N   1 
ATOM   4158 C CA  . TYR A 1 566 ? 17.77401 67.51589 36.15388  1.000 61.96757  ? 566 TYR A CA  1 
ATOM   4159 C C   . TYR A 1 566 ? 17.63104 68.90613 35.54605  1.000 59.56973  ? 566 TYR A C   1 
ATOM   4160 O O   . TYR A 1 566 ? 16.89335 69.74275 36.07857  1.000 60.14639  ? 566 TYR A O   1 
ATOM   4161 C CB  . TYR A 1 566 ? 19.11462 67.33980 36.88033  1.000 52.22704  ? 566 TYR A CB  1 
ATOM   4162 C CG  . TYR A 1 566 ? 19.55894 68.51021 37.74097  1.000 53.88344  ? 566 TYR A CG  1 
ATOM   4163 C CD1 . TYR A 1 566 ? 19.01954 68.72989 39.00240  1.000 55.44809  ? 566 TYR A CD1 1 
ATOM   4164 C CD2 . TYR A 1 566 ? 20.54340 69.38227 37.29358  1.000 55.24862  ? 566 TYR A CD2 1 
ATOM   4165 C CE1 . TYR A 1 566 ? 19.45343 69.80413 39.80583  1.000 56.00111  ? 566 TYR A CE1 1 
ATOM   4166 C CE2 . TYR A 1 566 ? 20.96496 70.44317 38.06437  1.000 62.05763  ? 566 TYR A CE2 1 
ATOM   4167 C CZ  . TYR A 1 566 ? 20.42291 70.65397 39.32042  1.000 58.26504  ? 566 TYR A CZ  1 
ATOM   4168 O OH  . TYR A 1 566 ? 20.87686 71.71989 40.06007  1.000 56.39146  ? 566 TYR A OH  1 
ATOM   4169 N N   . LEU A 1 567 ? 18.31563 69.15918 34.42515  1.000 56.30499  ? 567 LEU A N   1 
ATOM   4170 C CA  . LEU A 1 567 ? 18.31271 70.49526 33.83141  1.000 57.76177  ? 567 LEU A CA  1 
ATOM   4171 C C   . LEU A 1 567 ? 16.92444 70.96350 33.42089  1.000 64.58692  ? 567 LEU A C   1 
ATOM   4172 O O   . LEU A 1 567 ? 16.62116 72.15472 33.62503  1.000 64.87085  ? 567 LEU A O   1 
ATOM   4173 C CB  . LEU A 1 567 ? 19.26990 70.54232 32.63382  1.000 53.48661  ? 567 LEU A CB  1 
ATOM   4174 C CG  . LEU A 1 567 ? 20.00523 71.87341 32.47436  1.000 56.81600  ? 567 LEU A CG  1 
ATOM   4175 C CD1 . LEU A 1 567 ? 20.69149 72.30824 33.79119  1.000 54.99246  ? 567 LEU A CD1 1 
ATOM   4176 C CD2 . LEU A 1 567 ? 21.00705 71.79488 31.33327  1.000 51.87267  ? 567 LEU A CD2 1 
ATOM   4177 N N   . PRO A 1 568 ? 16.05968 70.12002 32.84048  1.000 61.07970  ? 568 PRO A N   1 
ATOM   4178 C CA  . PRO A 1 568 ? 14.65648 70.52415 32.66206  1.000 58.37683  ? 568 PRO A CA  1 
ATOM   4179 C C   . PRO A 1 568 ? 14.03769 71.15668 33.89690  1.000 68.44629  ? 568 PRO A C   1 
ATOM   4180 O O   . PRO A 1 568 ? 13.30372 72.14394 33.77059  1.000 76.10838  ? 568 PRO A O   1 
ATOM   4181 C CB  . PRO A 1 568 ? 13.97075 69.20331 32.30440  1.000 50.98655  ? 568 PRO A CB  1 
ATOM   4182 C CG  . PRO A 1 568 ? 15.00238 68.43944 31.59711  1.000 52.40462  ? 568 PRO A CG  1 
ATOM   4183 C CD  . PRO A 1 568 ? 16.32699 68.81094 32.22032  1.000 53.35976  ? 568 PRO A CD  1 
ATOM   4184 N N   . LYS A 1 569 ? 14.31864 70.61702 35.08902  1.000 67.80820  ? 569 LYS A N   1 
ATOM   4185 C CA  . LYS A 1 569 ? 13.74432 71.16512 36.31696  1.000 68.46280  ? 569 LYS A CA  1 
ATOM   4186 C C   . LYS A 1 569 ? 14.34600 72.52386 36.64930  1.000 76.72140  ? 569 LYS A C   1 
ATOM   4187 O O   . LYS A 1 569 ? 13.65340 73.40865 37.16820  1.000 88.27712  ? 569 LYS A O   1 
ATOM   4188 C CB  . LYS A 1 569 ? 13.94787 70.18967 37.48601  1.000 70.52287  ? 569 LYS A CB  1 
ATOM   4189 C CG  . LYS A 1 569 ? 13.74243 68.71442 37.14261  1.000 66.53590  ? 569 LYS A CG  1 
ATOM   4190 C CD  . LYS A 1 569 ? 13.72274 67.85905 38.38618  1.000 73.12221  ? 569 LYS A CD  1 
ATOM   4191 C CE  . LYS A 1 569 ? 13.94153 66.38268 38.07609  1.000 73.95097  ? 569 LYS A CE  1 
ATOM   4192 N NZ  . LYS A 1 569 ? 13.32072 65.55097 39.15535  1.000 82.15844  ? 569 LYS A NZ  1 
ATOM   4193 N N   . VAL A 1 570 ? 15.63918 72.70320 36.37767  1.000 74.99014  ? 570 VAL A N   1 
ATOM   4194 C CA  . VAL A 1 570 ? 16.24456 74.01526 36.56541  1.000 70.76222  ? 570 VAL A CA  1 
ATOM   4195 C C   . VAL A 1 570 ? 15.52052 75.03917 35.71533  1.000 78.38566  ? 570 VAL A C   1 
ATOM   4196 O O   . VAL A 1 570 ? 15.23981 76.15644 36.16392  1.000 83.85935  ? 570 VAL A O   1 
ATOM   4197 C CB  . VAL A 1 570 ? 17.74432 73.96782 36.23451  1.000 63.56627  ? 570 VAL A CB  1 
ATOM   4198 C CG1 . VAL A 1 570 ? 18.31089 75.37824 36.19943  1.000 60.67513  ? 570 VAL A CG1 1 
ATOM   4199 C CG2 . VAL A 1 570 ? 18.46793 73.11839 37.25980  1.000 53.13848  ? 570 VAL A CG2 1 
ATOM   4200 N N   . ARG A 1 571 ? 15.15695 74.64646 34.48896  1.000 83.81980  ? 571 ARG A N   1 
ATOM   4201 C CA  . ARG A 1 571 ? 14.47152 75.53124 33.55331  1.000 79.75041  ? 571 ARG A CA  1 
ATOM   4202 C C   . ARG A 1 571 ? 13.14752 76.05558 34.09340  1.000 85.72803  ? 571 ARG A C   1 
ATOM   4203 O O   . ARG A 1 571 ? 12.63465 77.05133 33.57286  1.000 90.43088  ? 571 ARG A O   1 
ATOM   4204 C CB  . ARG A 1 571 ? 14.24964 74.80364 32.22347  1.000 76.41706  ? 571 ARG A CB  1 
ATOM   4205 C CG  . ARG A 1 571 ? 15.53168 74.56062 31.46158  1.000 78.33046  ? 571 ARG A CG  1 
ATOM   4206 C CD  . ARG A 1 571 ? 15.46276 73.37246 30.50697  1.000 81.58595  ? 571 ARG A CD  1 
ATOM   4207 N NE  . ARG A 1 571 ? 16.77298 73.10622 29.91139  1.000 84.73579  ? 571 ARG A NE  1 
ATOM   4208 C CZ  . ARG A 1 571 ? 17.14590 71.94081 29.38503  1.000 92.88224  ? 571 ARG A CZ  1 
ATOM   4209 N NH1 . ARG A 1 571 ? 16.30595 70.91516 29.37363  1.000 93.92338  ? 571 ARG A NH1 1 
ATOM   4210 N NH2 . ARG A 1 571 ? 18.36246 71.79826 28.86403  1.000 94.81795  ? 571 ARG A NH2 1 
ATOM   4211 N N   . SER A 1 572 ? 12.58516 75.42240 35.12248  1.000 94.50814  ? 572 SER A N   1 
ATOM   4212 C CA  . SER A 1 572 ? 11.36991 75.91724 35.76666  1.000 103.23842 ? 572 SER A CA  1 
ATOM   4213 C C   . SER A 1 572 ? 11.75880 77.03879 36.72595  1.000 104.44599 ? 572 SER A C   1 
ATOM   4214 O O   . SER A 1 572 ? 11.92944 76.84600 37.93488  1.000 91.84343  ? 572 SER A O   1 
ATOM   4215 C CB  . SER A 1 572 ? 10.62748 74.77662 36.45092  1.000 104.42396 ? 572 SER A CB  1 
ATOM   4216 O OG  . SER A 1 572 ? 10.65529 73.61069 35.63258  1.000 96.82494  ? 572 SER A OG  1 
ATOM   4217 N N   . TRP A 1 573 ? 11.95582 78.21954 36.13053  1.000 117.54883 ? 573 TRP A N   1 
ATOM   4218 C CA  . TRP A 1 573 ? 12.00164 79.53733 36.78702  1.000 130.21460 ? 573 TRP A CA  1 
ATOM   4219 C C   . TRP A 1 573 ? 12.41970 79.54562 38.25717  1.000 132.11815 ? 573 TRP A C   1 
ATOM   4220 O O   . TRP A 1 573 ? 12.84603 80.57519 38.78821  1.000 133.00837 ? 573 TRP A O   1 
ATOM   4221 C CB  . TRP A 1 573 ? 10.62795 80.22545 36.65059  1.000 138.07319 ? 573 TRP A CB  1 
ATOM   4222 C CG  . TRP A 1 573 ? 10.06774 80.25395 35.22953  1.000 142.20269 ? 573 TRP A CG  1 
ATOM   4223 C CD1 . TRP A 1 573 ? 9.79174  79.17337 34.43044  1.000 139.99164 ? 573 TRP A CD1 1 
ATOM   4224 C CD2 . TRP A 1 573 ? 9.70801  81.41799 34.45656  1.000 145.77348 ? 573 TRP A CD2 1 
ATOM   4225 N NE1 . TRP A 1 573 ? 9.29427  79.59048 33.21658  1.000 139.28330 ? 573 TRP A NE1 1 
ATOM   4226 C CE2 . TRP A 1 573 ? 9.23276  80.95953 33.20426  1.000 141.71342 ? 573 TRP A CE2 1 
ATOM   4227 C CE3 . TRP A 1 573 ? 9.74341  82.79833 34.69959  1.000 149.43935 ? 573 TRP A CE3 1 
ATOM   4228 C CZ2 . TRP A 1 573 ? 8.80049  81.83143 32.19911  1.000 140.80256 ? 573 TRP A CZ2 1 
ATOM   4229 C CZ3 . TRP A 1 573 ? 9.30999  83.66393 33.69785  1.000 150.11502 ? 573 TRP A CZ3 1 
ATOM   4230 C CH2 . TRP A 1 573 ? 8.84692  83.17393 32.46305  1.000 145.82138 ? 573 TRP A CH2 1 
HETATM 4231 C C1  . NAG B 2 .   ? 41.38203 50.54460 0.08488   1.000 62.51642  ? 1   NAG B C1  1 
HETATM 4232 C C2  . NAG B 2 .   ? 40.29146 51.07976 -0.80040  1.000 65.98292  ? 1   NAG B C2  1 
HETATM 4233 C C3  . NAG B 2 .   ? 40.85867 51.39437 -2.17578  1.000 54.85683  ? 1   NAG B C3  1 
HETATM 4234 C C4  . NAG B 2 .   ? 41.98385 52.41228 -2.01891  1.000 68.69495  ? 1   NAG B C4  1 
HETATM 4235 C C5  . NAG B 2 .   ? 43.00367 51.90906 -0.99223  1.000 79.55611  ? 1   NAG B C5  1 
HETATM 4236 C C6  . NAG B 2 .   ? 44.02965 52.94587 -0.61612  1.000 89.80251  ? 1   NAG B C6  1 
HETATM 4237 C C7  . NAG B 2 .   ? 39.17949 48.90299 -1.19404  1.000 72.25353  ? 1   NAG B C7  1 
HETATM 4238 C C8  . NAG B 2 .   ? 37.85987 48.19130 -1.19411  1.000 56.36296  ? 1   NAG B C8  1 
HETATM 4239 N N2  . NAG B 2 .   ? 39.13409 50.19754 -0.86993  1.000 71.90452  ? 1   NAG B N2  1 
HETATM 4240 O O3  . NAG B 2 .   ? 39.82026 51.89468 -3.01062  1.000 56.97897  ? 1   NAG B O3  1 
HETATM 4241 O O4  . NAG B 2 .   ? 42.67951 52.63263 -3.24410  1.000 85.78233  ? 1   NAG B O4  1 
HETATM 4242 O O5  . NAG B 2 .   ? 42.37205 51.51976 0.23810   1.000 75.44475  ? 1   NAG B O5  1 
HETATM 4243 O O6  . NAG B 2 .   ? 45.01159 52.38420 0.24287   1.000 97.43217  ? 1   NAG B O6  1 
HETATM 4244 O O7  . NAG B 2 .   ? 40.23134 48.33614 -1.49912  1.000 81.91519  ? 1   NAG B O7  1 
HETATM 4245 C C1  . NAG B 2 .   ? 42.15604 53.73744 -4.01834  1.000 92.08770  ? 2   NAG B C1  1 
HETATM 4246 C C2  . NAG B 2 .   ? 43.25499 54.56416 -4.68583  1.000 91.12890  ? 2   NAG B C2  1 
HETATM 4247 C C3  . NAG B 2 .   ? 42.63611 55.69298 -5.51098  1.000 94.85312  ? 2   NAG B C3  1 
HETATM 4248 C C4  . NAG B 2 .   ? 41.59855 55.14721 -6.48502  1.000 102.86944 ? 2   NAG B C4  1 
HETATM 4249 C C5  . NAG B 2 .   ? 40.58531 54.27151 -5.74479  1.000 100.79117 ? 2   NAG B C5  1 
HETATM 4250 C C6  . NAG B 2 .   ? 39.60757 53.57095 -6.66228  1.000 99.75439  ? 2   NAG B C6  1 
HETATM 4251 C C7  . NAG B 2 .   ? 45.28213 54.43606 -3.30111  1.000 91.45937  ? 2   NAG B C7  1 
HETATM 4252 C C8  . NAG B 2 .   ? 46.16072 55.15720 -2.32240  1.000 89.04164  ? 2   NAG B C8  1 
HETATM 4253 N N2  . NAG B 2 .   ? 44.19778 55.10076 -3.71664  1.000 90.62740  ? 2   NAG B N2  1 
HETATM 4254 O O3  . NAG B 2 .   ? 43.65434 56.38672 -6.22429  1.000 92.88643  ? 2   NAG B O3  1 
HETATM 4255 O O4  . NAG B 2 .   ? 40.92644 56.23275 -7.11942  1.000 108.58014 ? 2   NAG B O4  1 
HETATM 4256 O O5  . NAG B 2 .   ? 41.26525 53.24162 -5.01263  1.000 96.25706  ? 2   NAG B O5  1 
HETATM 4257 O O6  . NAG B 2 .   ? 39.99394 52.22431 -6.89952  1.000 96.36564  ? 2   NAG B O6  1 
HETATM 4258 O O7  . NAG B 2 .   ? 45.53427 53.29720 -3.68387  1.000 92.60314  ? 2   NAG B O7  1 
HETATM 4259 C C1  . BMA B 2 .   ? 40.99881 56.12790 -8.55656  1.000 108.48057 ? 3   BMA B C1  1 
HETATM 4260 C C2  . BMA B 2 .   ? 39.64135 56.52393 -9.18449  1.000 112.40311 ? 3   BMA B C2  1 
HETATM 4261 C C3  . BMA B 2 .   ? 39.71014 56.30837 -10.70379 1.000 103.80745 ? 3   BMA B C3  1 
HETATM 4262 C C4  . BMA B 2 .   ? 40.95127 57.02762 -11.29756 1.000 111.84699 ? 3   BMA B C4  1 
HETATM 4263 C C5  . BMA B 2 .   ? 42.25959 56.64641 -10.51910 1.000 110.06373 ? 3   BMA B C5  1 
HETATM 4264 C C6  . BMA B 2 .   ? 43.47640 57.46450 -10.94207 1.000 108.49785 ? 3   BMA B C6  1 
HETATM 4265 O O2  . BMA B 2 .   ? 39.34453 57.91300 -8.95822  1.000 117.69259 ? 3   BMA B O2  1 
HETATM 4266 O O3  . BMA B 2 .   ? 38.49361 56.70203 -11.37634 1.000 86.34850  ? 3   BMA B O3  1 
HETATM 4267 O O4  . BMA B 2 .   ? 41.09517 56.69425 -12.66949 1.000 117.47672 ? 3   BMA B O4  1 
HETATM 4268 O O5  . BMA B 2 .   ? 42.06526 56.85829 -9.10698  1.000 108.31729 ? 3   BMA B O5  1 
HETATM 4269 O O6  . BMA B 2 .   ? 44.34570 57.61552 -9.81530  1.000 106.82039 ? 3   BMA B O6  1 
HETATM 4270 C C1  . I40 C 3 .   ? 31.74314 63.65744 9.61857   1.000 71.78176  ? 601 I40 A C1  1 
HETATM 4271 C C2  . I40 C 3 .   ? 30.31587 64.02203 9.02236   1.000 68.98725  ? 601 I40 A C2  1 
HETATM 4272 C C3  . I40 C 3 .   ? 30.10837 65.49059 8.67839   1.000 67.52174  ? 601 I40 A C3  1 
HETATM 4273 C C4  . I40 C 3 .   ? 31.38567 66.18101 8.08840   1.000 66.45527  ? 601 I40 A C4  1 
HETATM 4274 C C5  . I40 C 3 .   ? 33.65088 67.08049 8.97480   1.000 63.12742  ? 601 I40 A C5  1 
HETATM 4275 C C6  . I40 C 3 .   ? 35.92055 67.73994 9.98115   1.000 72.77486  ? 601 I40 A C6  1 
HETATM 4276 C C7  . I40 C 3 .   ? 37.03680 67.43605 10.82376  1.000 85.79157  ? 601 I40 A C7  1 
HETATM 4277 C C8  . I40 C 3 .   ? 37.10394 66.20000 11.50680  1.000 84.69484  ? 601 I40 A C8  1 
HETATM 4278 C C9  . I40 C 3 .   ? 36.04975 65.23540 11.37057  1.000 76.04380  ? 601 I40 A C9  1 
HETATM 4279 N N1  . I40 C 3 .   ? 33.92444 64.56103 10.44850  1.000 66.68988  ? 601 I40 A N1  1 
HETATM 4280 C C10 . I40 C 3 .   ? 32.81784 64.81811 9.65266   1.000 71.99967  ? 601 I40 A C10 1 
HETATM 4281 C C11 . I40 C 3 .   ? 32.65526 66.03482 8.91502   1.000 66.27227  ? 601 I40 A C11 1 
HETATM 4282 C C12 . I40 C 3 .   ? 34.84525 66.76742 9.84759   1.000 67.20986  ? 601 I40 A C12 1 
HETATM 4283 C C13 . I40 C 3 .   ? 34.92615 65.57204 10.52323  1.000 68.55512  ? 601 I40 A C13 1 
HETATM 4284 N N2  . I40 C 3 .   ? 33.50874 68.34914 8.22734   1.000 62.49630  ? 601 I40 A N2  1 
HETATM 4285 I I1  . I40 C 3 .   ? 28.75317 70.68325 9.97624   0.673 108.55467 ? 601 I40 A I1  1 
HETATM 4286 C C14 . I40 C 3 .   ? 33.99914 69.72406 8.62526   1.000 68.24416  ? 601 I40 A C14 1 
HETATM 4287 C C15 . I40 C 3 .   ? 33.06679 70.43611 9.65165   1.000 78.99865  ? 601 I40 A C15 1 
HETATM 4288 C C16 . I40 C 3 .   ? 31.68131 70.30719 9.46664   1.000 90.71341  ? 601 I40 A C16 1 
HETATM 4289 C C17 . I40 C 3 .   ? 30.80416 70.93535 10.35000  1.000 97.32604  ? 601 I40 A C17 1 
HETATM 4290 C C18 . I40 C 3 .   ? 31.25324 71.71259 11.44990  1.000 85.92250  ? 601 I40 A C18 1 
HETATM 4291 C C19 . I40 C 3 .   ? 32.65395 71.84625 11.63910  1.000 70.54825  ? 601 I40 A C19 1 
HETATM 4292 C C20 . I40 C 3 .   ? 33.56970 71.21172 10.74666  1.000 69.74934  ? 601 I40 A C20 1 
HETATM 4293 I I   . IOD D 4 .   ? 26.63810 66.27474 11.98087  0.917 88.64061  ? 602 IOD A I   1 
HETATM 4294 O O   . HOH E 5 .   ? 4.30004  87.31507 -7.23807  1.000 60.25387  ? 701 HOH A O   1 
HETATM 4295 O O   . HOH E 5 .   ? 33.69647 61.87202 26.50851  1.000 70.29067  ? 702 HOH A O   1 
HETATM 4296 O O   . HOH E 5 .   ? 44.39144 45.16199 26.08004  1.000 96.66732  ? 703 HOH A O   1 
HETATM 4297 O O   . HOH E 5 .   ? 1.05202  51.91431 22.13796  1.000 115.12214 ? 704 HOH A O   1 
HETATM 4298 O O   . HOH E 5 .   ? 29.99825 74.29621 14.74161  1.000 72.16634  ? 705 HOH A O   1 
HETATM 4299 O O   . HOH E 5 .   ? 25.05087 34.74776 25.02661  1.000 51.79085  ? 706 HOH A O   1 
HETATM 4300 O O   . HOH E 5 .   ? 32.21200 64.84992 -3.34254  1.000 127.60473 ? 707 HOH A O   1 
HETATM 4301 O O   . HOH E 5 .   ? 46.84772 70.34319 32.91277  1.000 57.73783  ? 708 HOH A O   1 
HETATM 4302 O O   . HOH E 5 .   ? 29.47988 60.00754 15.03385  1.000 41.37348  ? 709 HOH A O   1 
HETATM 4303 O O   . HOH E 5 .   ? 27.64294 57.07815 16.57196  1.000 45.99108  ? 710 HOH A O   1 
HETATM 4304 O O   . HOH E 5 .   ? 28.55453 56.67064 -0.52619  1.000 41.39523  ? 711 HOH A O   1 
HETATM 4305 O O   . HOH E 5 .   ? 31.31549 42.04749 18.67315  1.000 66.63749  ? 712 HOH A O   1 
HETATM 4306 O O   . HOH E 5 .   ? -0.24505 55.14892 19.42369  1.000 67.44160  ? 713 HOH A O   1 
HETATM 4307 O O   . HOH E 5 .   ? 21.55570 47.68925 23.68942  1.000 39.61590  ? 714 HOH A O   1 
HETATM 4308 O O   . HOH E 5 .   ? 23.51097 71.75150 -4.70943  1.000 48.49618  ? 715 HOH A O   1 
HETATM 4309 O O   . HOH E 5 .   ? 28.88902 59.27266 -7.26939  1.000 66.71662  ? 716 HOH A O   1 
HETATM 4310 O O   . HOH E 5 .   ? 23.59095 72.01495 -1.45269  1.000 49.57789  ? 717 HOH A O   1 
HETATM 4311 O O   . HOH E 5 .   ? 14.28618 67.81646 -9.31275  1.000 46.79584  ? 718 HOH A O   1 
HETATM 4312 O O   . HOH E 5 .   ? 7.60621  75.66788 13.47385  1.000 54.17582  ? 719 HOH A O   1 
HETATM 4313 O O   . HOH E 5 .   ? 31.62388 68.51353 5.41956   1.000 67.43131  ? 720 HOH A O   1 
HETATM 4314 O O   . HOH E 5 .   ? 29.57897 63.76724 4.75340   1.000 40.22132  ? 721 HOH A O   1 
HETATM 4315 O O   . HOH E 5 .   ? 14.76206 48.23851 23.20211  1.000 55.09668  ? 722 HOH A O   1 
HETATM 4316 O O   . HOH E 5 .   ? 22.98823 54.06387 29.92673  1.000 48.25139  ? 723 HOH A O   1 
HETATM 4317 O O   . HOH E 5 .   ? 14.26164 94.36221 -6.60169  1.000 69.42068  ? 724 HOH A O   1 
HETATM 4318 O O   . HOH E 5 .   ? 31.08257 40.67004 22.40172  1.000 55.63746  ? 725 HOH A O   1 
HETATM 4319 O O   . HOH E 5 .   ? 49.43306 69.80884 9.79492   1.000 62.35130  ? 726 HOH A O   1 
HETATM 4320 O O   . HOH E 5 .   ? 48.14090 75.08465 26.77235  1.000 67.59397  ? 727 HOH A O   1 
HETATM 4321 O O   . HOH E 5 .   ? 26.79467 65.57367 32.26034  1.000 53.14093  ? 728 HOH A O   1 
HETATM 4322 O O   . HOH E 5 .   ? 11.25846 47.18827 3.95860   1.000 54.94675  ? 729 HOH A O   1 
HETATM 4323 O O   . HOH E 5 .   ? 17.20864 73.68636 -4.68166  1.000 60.25986  ? 730 HOH A O   1 
HETATM 4324 O O   . HOH E 5 .   ? 6.56322  80.46894 10.26914  1.000 47.59346  ? 731 HOH A O   1 
HETATM 4325 O O   . HOH E 5 .   ? 26.10228 69.49041 38.87117  1.000 41.43403  ? 732 HOH A O   1 
HETATM 4326 O O   . HOH E 5 .   ? 43.92871 72.73030 21.85226  1.000 51.73885  ? 733 HOH A O   1 
HETATM 4327 O O   . HOH E 5 .   ? 31.98101 70.82574 2.19129   1.000 61.90728  ? 734 HOH A O   1 
HETATM 4328 O O   . HOH E 5 .   ? 8.35669  72.59575 -4.33246  1.000 48.01557  ? 735 HOH A O   1 
HETATM 4329 O O   . HOH E 5 .   ? 13.26599 73.97624 5.37650   1.000 48.28329  ? 736 HOH A O   1 
HETATM 4330 O O   . HOH E 5 .   ? 10.28658 63.09253 -2.54921  1.000 48.97904  ? 737 HOH A O   1 
HETATM 4331 O O   . HOH E 5 .   ? 20.44818 39.19316 25.26538  1.000 58.45686  ? 738 HOH A O   1 
HETATM 4332 O O   . HOH E 5 .   ? 32.19987 49.27461 2.60503   1.000 45.12114  ? 739 HOH A O   1 
HETATM 4333 O O   . HOH E 5 .   ? 12.42967 74.50046 -0.02927  1.000 50.74387  ? 740 HOH A O   1 
HETATM 4334 O O   . HOH E 5 .   ? 17.65709 46.94357 17.38696  1.000 50.71411  ? 741 HOH A O   1 
HETATM 4335 O O   . HOH E 5 .   ? 15.61157 58.14973 -12.17186 1.000 50.78950  ? 742 HOH A O   1 
HETATM 4336 O O   . HOH E 5 .   ? 43.72131 69.14032 40.58555  1.000 83.27704  ? 743 HOH A O   1 
HETATM 4337 O O   . HOH E 5 .   ? 10.09979 87.82974 13.41269  1.000 63.00126  ? 744 HOH A O   1 
HETATM 4338 O O   . HOH E 5 .   ? 35.05116 57.29504 9.98431   1.000 49.62640  ? 745 HOH A O   1 
HETATM 4339 O O   . HOH E 5 .   ? 15.46113 64.28477 -15.79017 1.000 65.58358  ? 746 HOH A O   1 
HETATM 4340 O O   . HOH E 5 .   ? 24.61466 67.13587 5.80406   1.000 48.66957  ? 747 HOH A O   1 
HETATM 4341 O O   . HOH E 5 .   ? 21.33608 77.96680 5.07099   1.000 60.46437  ? 748 HOH A O   1 
HETATM 4342 O O   . HOH E 5 .   ? 38.45763 51.45488 2.16593   1.000 54.27094  ? 749 HOH A O   1 
HETATM 4343 O O   . HOH E 5 .   ? 13.97145 70.43008 -7.70041  1.000 56.79182  ? 750 HOH A O   1 
HETATM 4344 O O   . HOH E 5 .   ? 38.63782 56.75464 12.54873  1.000 68.59243  ? 751 HOH A O   1 
HETATM 4345 O O   . HOH E 5 .   ? 25.49941 74.24588 1.02232   1.000 56.87952  ? 752 HOH A O   1 
HETATM 4346 O O   . HOH E 5 .   ? 26.44434 66.25331 -1.79368  1.000 53.38304  ? 753 HOH A O   1 
HETATM 4347 O O   . HOH E 5 .   ? 31.42076 56.68068 -1.41405  1.000 59.07645  ? 754 HOH A O   1 
HETATM 4348 O O   . HOH E 5 .   ? 21.36954 39.01240 15.30593  1.000 72.05946  ? 755 HOH A O   1 
HETATM 4349 O O   . HOH E 5 .   ? 29.87912 61.14634 24.60979  1.000 58.11085  ? 756 HOH A O   1 
HETATM 4350 O O   . HOH E 5 .   ? 18.26646 76.67990 4.64140   1.000 48.71268  ? 757 HOH A O   1 
HETATM 4351 O O   . HOH E 5 .   ? 8.70226  70.39194 -7.46720  1.000 50.63633  ? 758 HOH A O   1 
HETATM 4352 O O   . HOH E 5 .   ? 18.58629 58.90362 -23.96358 1.000 62.29614  ? 759 HOH A O   1 
HETATM 4353 O O   . HOH E 5 .   ? 18.08092 45.20340 5.34796   1.000 54.43118  ? 760 HOH A O   1 
HETATM 4354 O O   . HOH E 5 .   ? 14.97313 40.92721 8.88464   1.000 61.09368  ? 761 HOH A O   1 
HETATM 4355 O O   . HOH E 5 .   ? 19.41220 73.57695 -6.33375  1.000 55.94197  ? 762 HOH A O   1 
HETATM 4356 O O   . HOH E 5 .   ? 16.32946 77.20020 6.88018   1.000 41.47284  ? 763 HOH A O   1 
HETATM 4357 O O   . HOH E 5 .   ? 7.14155  87.30615 8.74519   1.000 62.23991  ? 764 HOH A O   1 
HETATM 4358 O O   . HOH E 5 .   ? 19.20380 77.41647 -10.22145 1.000 46.24716  ? 765 HOH A O   1 
HETATM 4359 O O   . HOH E 5 .   ? 15.97124 74.96682 8.37726   1.000 53.18155  ? 766 HOH A O   1 
HETATM 4360 O O   . HOH E 5 .   ? 28.21977 61.31340 7.83407   1.000 51.07690  ? 767 HOH A O   1 
HETATM 4361 O O   . HOH E 5 .   ? 20.16017 74.39668 13.55086  1.000 47.93384  ? 768 HOH A O   1 
HETATM 4362 O O   . HOH E 5 .   ? 42.87310 68.40712 26.99656  1.000 56.20227  ? 769 HOH A O   1 
HETATM 4363 O O   . HOH E 5 .   ? 11.98397 67.69160 19.86416  1.000 60.44278  ? 770 HOH A O   1 
HETATM 4364 O O   . HOH E 5 .   ? 34.17556 65.41686 17.73298  1.000 46.10318  ? 771 HOH A O   1 
HETATM 4365 O O   . HOH E 5 .   ? 14.96128 78.91106 5.38041   1.000 50.91008  ? 772 HOH A O   1 
HETATM 4366 O O   . HOH E 5 .   ? 32.53527 65.00987 23.51843  1.000 62.36806  ? 773 HOH A O   1 
HETATM 4367 O O   . HOH E 5 .   ? 35.05742 64.86886 24.99217  1.000 53.81318  ? 774 HOH A O   1 
HETATM 4368 O O   . HOH E 5 .   ? 40.27142 59.27690 12.92145  1.000 58.02941  ? 775 HOH A O   1 
HETATM 4369 O O   . HOH E 5 .   ? 20.14597 64.92652 -10.94868 1.000 55.72849  ? 776 HOH A O   1 
HETATM 4370 O O   . HOH E 5 .   ? 35.29901 62.30286 11.66503  1.000 56.59354  ? 777 HOH A O   1 
HETATM 4371 O O   . HOH E 5 .   ? 19.83279 66.26048 25.58837  1.000 65.54560  ? 778 HOH A O   1 
HETATM 4372 O O   . HOH E 5 .   ? 17.74747 74.97448 14.69870  1.000 53.48801  ? 779 HOH A O   1 
HETATM 4373 O O   . HOH E 5 .   ? 43.58222 46.00744 23.33460  1.000 93.31023  ? 780 HOH A O   1 
HETATM 4374 O O   . HOH E 5 .   ? 2.42058  78.70821 1.15232   1.000 65.86340  ? 781 HOH A O   1 
HETATM 4375 O O   . HOH E 5 .   ? 19.46402 79.48075 17.77790  1.000 74.80050  ? 782 HOH A O   1 
HETATM 4376 O O   . HOH E 5 .   ? 28.31221 54.13449 -21.40133 1.000 70.56003  ? 783 HOH A O   1 
HETATM 4377 O O   . HOH E 5 .   ? 38.71866 63.09702 -7.11625  1.000 72.87090  ? 784 HOH A O   1 
HETATM 4378 O O   . HOH E 5 .   ? 18.82582 93.15093 0.44792   1.000 91.55655  ? 785 HOH A O   1 
HETATM 4379 O O   . HOH E 5 .   ? 32.63713 48.94390 -17.02160 1.000 66.99242  ? 786 HOH A O   1 
HETATM 4380 O O   . HOH E 5 .   ? 35.28733 49.73561 0.67296   1.000 59.08016  ? 787 HOH A O   1 
HETATM 4381 O O   . HOH E 5 .   ? 20.45628 83.03279 5.76453   1.000 75.41474  ? 788 HOH A O   1 
HETATM 4382 O O   . HOH E 5 .   ? 11.73038 46.63377 28.55189  1.000 76.54731  ? 789 HOH A O   1 
HETATM 4383 O O   . HOH E 5 .   ? 23.60923 35.24548 21.37771  1.000 80.79015  ? 790 HOH A O   1 
HETATM 4384 O O   . HOH E 5 .   ? 1.08073  64.85762 20.41153  1.000 74.93698  ? 791 HOH A O   1 
HETATM 4385 O O   . HOH E 5 .   ? -1.04322 77.42659 -7.11642  1.000 66.60501  ? 792 HOH A O   1 
HETATM 4386 O O   . HOH E 5 .   ? 8.88801  82.88093 -9.86315  1.000 62.82746  ? 793 HOH A O   1 
HETATM 4387 O O   . HOH E 5 .   ? 7.47498  66.78677 -7.17758  1.000 60.17885  ? 794 HOH A O   1 
HETATM 4388 O O   . HOH E 5 .   ? 34.866   41.527   29.236    1.000 64.13748  ? 795 HOH A O   1 
HETATM 4389 O O   . HOH E 5 .   ? 28.92615 40.45239 25.21872  1.000 85.16672  ? 796 HOH A O   1 
HETATM 4390 O O   . HOH E 5 .   ? 21.05655 71.50155 -5.75343  1.000 38.59542  ? 797 HOH A O   1 
HETATM 4391 O O   . HOH E 5 .   ? 37.54517 80.89290 17.73447  1.000 84.52413  ? 798 HOH A O   1 
HETATM 4392 O O   . HOH E 5 .   ? 30.31475 63.60971 24.37679  1.000 38.76340  ? 799 HOH A O   1 
HETATM 4393 O O   . HOH E 5 .   ? 32.200   41.897   28.449    1.000 52.04444  ? 800 HOH A O   1 
HETATM 4394 O O   . HOH E 5 .   ? 49.25423 73.32121 14.47143  1.000 81.36149  ? 801 HOH A O   1 
HETATM 4395 O O   . HOH E 5 .   ? 37.61484 53.92811 0.18400   1.000 73.54082  ? 802 HOH A O   1 
HETATM 4396 O O   . HOH E 5 .   ? 31.24499 65.72847 4.86640   1.000 42.93466  ? 803 HOH A O   1 
HETATM 4397 O O   . HOH E 5 .   ? 17.57143 69.23543 27.08969  1.000 82.16906  ? 804 HOH A O   1 
HETATM 4398 O O   . HOH E 5 .   ? 37.10243 63.58799 0.15489   1.000 65.57040  ? 805 HOH A O   1 
HETATM 4399 O O   . HOH E 5 .   ? 47.88913 65.10336 6.46544   1.000 73.84981  ? 806 HOH A O   1 
HETATM 4400 O O   . HOH E 5 .   ? 15.71397 58.86475 -23.75096 1.000 60.93488  ? 807 HOH A O   1 
HETATM 4401 O O   . HOH E 5 .   ? 46.97859 77.18746 17.34943  1.000 63.80024  ? 808 HOH A O   1 
HETATM 4402 O O   . HOH E 5 .   ? 41.52460 53.87357 22.14782  1.000 44.58366  ? 809 HOH A O   1 
HETATM 4403 O O   . HOH E 5 .   ? 43.64819 49.79156 23.19511  1.000 50.88813  ? 810 HOH A O   1 
HETATM 4404 O O   . HOH E 5 .   ? 36.67067 53.41245 26.72148  1.000 54.37450  ? 811 HOH A O   1 
HETATM 4405 O O   . HOH E 5 .   ? 31.03267 76.54894 39.08588  1.000 46.82331  ? 812 HOH A O   1 
HETATM 4406 O O   . HOH E 5 .   ? 6.67345  76.37410 -12.19384 1.000 69.97880  ? 813 HOH A O   1 
HETATM 4407 O O   . HOH E 5 .   ? 34.93597 59.58352 28.66126  1.000 65.53690  ? 814 HOH A O   1 
HETATM 4408 O O   . HOH E 5 .   ? 22.90853 87.55248 8.13422   1.000 83.41098  ? 815 HOH A O   1 
HETATM 4409 O O   . HOH E 5 .   ? 11.85482 57.70342 -7.53268  1.000 65.27855  ? 816 HOH A O   1 
HETATM 4410 O O   . HOH E 5 .   ? 20.52023 73.65883 27.18291  1.000 88.88076  ? 817 HOH A O   1 
HETATM 4411 O O   . HOH E 5 .   ? 9.46820  84.97995 10.50890  1.000 68.05322  ? 818 HOH A O   1 
HETATM 4412 O O   . HOH E 5 .   ? 14.90193 74.91323 39.86051  1.000 62.72691  ? 819 HOH A O   1 
HETATM 4413 O O   . HOH E 5 .   ? 37.47243 60.32320 10.81847  1.000 55.14616  ? 820 HOH A O   1 
HETATM 4414 O O   . HOH E 5 .   ? 31.36103 74.63565 12.10035  1.000 83.04006  ? 821 HOH A O   1 
HETATM 4415 O O   . HOH E 5 .   ? 16.97922 53.27752 -26.91440 1.000 62.92673  ? 822 HOH A O   1 
HETATM 4416 O O   . HOH E 5 .   ? 29.17995 68.00033 10.86800  1.000 37.85730  ? 823 HOH A O   1 
HETATM 4417 O O   . HOH E 5 .   ? 20.11316 42.09768 30.01780  1.000 52.91808  ? 824 HOH A O   1 
HETATM 4418 O O   . HOH E 5 .   ? 29.07082 39.03548 7.10381   1.000 74.16067  ? 825 HOH A O   1 
HETATM 4419 O O   . HOH E 5 .   ? 46.27556 43.05275 25.86369  1.000 80.59203  ? 826 HOH A O   1 
HETATM 4420 O O   . HOH E 5 .   ? -4.57888 82.08071 -0.35735  1.000 81.22238  ? 827 HOH A O   1 
HETATM 4421 O O   . HOH E 5 .   ? 28.91865 86.60844 -12.35943 1.000 74.36312  ? 828 HOH A O   1 
HETATM 4422 O O   . HOH E 5 .   ? 37.92604 43.48773 22.37946  1.000 43.62653  ? 829 HOH A O   1 
HETATM 4423 O O   . HOH E 5 .   ? 38.81667 54.59999 5.68601   1.000 84.08186  ? 830 HOH A O   1 
HETATM 4424 O O   . HOH E 5 .   ? 48.97497 66.77338 23.85322  1.000 65.57893  ? 831 HOH A O   1 
HETATM 4425 O O   . HOH E 5 .   ? 49.11963 69.17690 7.10740   1.000 76.64243  ? 832 HOH A O   1 
HETATM 4426 O O   . HOH E 5 .   ? 37.91098 65.57283 43.82277  1.000 62.58376  ? 833 HOH A O   1 
HETATM 4427 O O   . HOH E 5 .   ? 28.45443 72.89680 -12.59577 1.000 86.11823  ? 834 HOH A O   1 
HETATM 4428 O O   . HOH E 5 .   ? 14.03989 55.71318 -24.56876 1.000 62.76852  ? 835 HOH A O   1 
HETATM 4429 O O   . HOH E 5 .   ? 38.58240 56.17827 3.80980   1.000 59.05199  ? 836 HOH A O   1 
HETATM 4430 O O   . HOH E 5 .   ? 41.68705 41.68705 0.00000   0.50  38.16761  ? 837 HOH A O   1 
HETATM 4431 O O   . HOH E 5 .   ? 29.72620 82.13496 15.52395  1.000 75.61236  ? 838 HOH A O   1 
HETATM 4432 O O   . HOH E 5 .   ? 21.163   44.496   35.311    1.000 76.06003  ? 839 HOH A O   1 
HETATM 4433 O O   . HOH E 5 .   ? 18.38729 55.79729 32.01195  1.000 53.44459  ? 840 HOH A O   1 
HETATM 4434 O O   . HOH E 5 .   ? 37.68631 87.32256 16.06117  1.000 66.12764  ? 841 HOH A O   1 
HETATM 4435 O O   . HOH E 5 .   ? 42.48062 52.51286 26.41300  1.000 70.97092  ? 842 HOH A O   1 
HETATM 4436 O O   . HOH E 5 .   ? 17.70323 79.25901 4.13639   1.000 59.62321  ? 843 HOH A O   1 
HETATM 4437 O O   . HOH E 5 .   ? 48.33916 67.06492 26.85923  1.000 81.43955  ? 844 HOH A O   1 
HETATM 4438 O O   . HOH E 5 .   ? 17.66402 71.40658 24.68663  1.000 78.43018  ? 845 HOH A O   1 
HETATM 4439 O O   . HOH E 5 .   ? 44.06001 52.23466 22.31110  1.000 58.80868  ? 846 HOH A O   1 
HETATM 4440 O O   . HOH E 5 .   ? 33.44599 77.51336 6.13596   1.000 68.20263  ? 847 HOH A O   1 
HETATM 4441 O O   . HOH E 5 .   ? 1.67868  45.35540 20.76087  1.000 105.34242 ? 848 HOH A O   1 
HETATM 4442 O O   . HOH E 5 .   ? 34.36761 56.22567 27.79056  1.000 52.20237  ? 849 HOH A O   1 
HETATM 4443 O O   . HOH E 5 .   ? 19.03790 54.28966 35.03943  1.000 60.42023  ? 850 HOH A O   1 
HETATM 4444 O O   . HOH E 5 .   ? 20.69052 52.52203 35.07674  1.000 61.24663  ? 851 HOH A O   1 
HETATM 4445 O O   . HOH E 5 .   ? 45.75873 54.07229 24.59971  1.000 59.08806  ? 852 HOH A O   1 
HETATM 4446 O O   . HOH E 5 .   ? 33.20895 62.43533 38.24084  1.000 79.94698  ? 853 HOH A O   1 
HETATM 4447 O O   . HOH E 5 .   ? 10.05240 53.04683 -26.75478 1.000 70.79406  ? 854 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ASP A 3   ? 1.63836 1.30745 0.89918 0.46741  -0.05888 -0.30108 3   ASP A N   
2    C CA  . ASP A 3   ? 1.72235 1.43125 1.02166 0.47153  -0.03595 -0.29164 3   ASP A CA  
3    C C   . ASP A 3   ? 1.77373 1.45175 1.11073 0.45444  -0.05616 -0.29544 3   ASP A C   
4    O O   . ASP A 3   ? 1.82483 1.47320 1.17213 0.43007  -0.07791 -0.29687 3   ASP A O   
5    C CB  . ASP A 3   ? 1.77625 1.55055 1.09796 0.45974  -0.00286 -0.26929 3   ASP A CB  
6    C CG  . ASP A 3   ? 2.02237 1.82361 1.30737 0.46862  0.01515  -0.26177 3   ASP A CG  
7    O OD1 . ASP A 3   ? 2.00312 1.84248 1.29899 0.45123  0.03387  -0.24325 3   ASP A OD1 
8    O OD2 . ASP A 3   ? 2.24916 2.03254 1.49356 0.49278  0.01064  -0.27360 3   ASP A OD2 
9    N N   . ARG A 4   ? 1.73256 1.41765 1.09054 0.46742  -0.04967 -0.29642 4   ARG A N   
10   C CA  . ARG A 4   ? 1.66632 1.32839 1.06313 0.45086  -0.06438 -0.29611 4   ARG A CA  
11   C C   . ARG A 4   ? 1.58117 1.28942 1.02216 0.43081  -0.04488 -0.27833 4   ARG A C   
12   O O   . ARG A 4   ? 1.64772 1.33909 1.12243 0.41342  -0.05643 -0.27602 4   ARG A O   
13   C CB  . ARG A 4   ? 1.70620 1.35481 1.10658 0.47291  -0.06658 -0.30308 4   ARG A CB  
14   C CG  . ARG A 4   ? 1.78518 1.48757 1.18055 0.50072  -0.03626 -0.29771 4   ARG A CG  
15   C CD  . ARG A 4   ? 1.87307 1.55320 1.26328 0.52582  -0.04347 -0.30759 4   ARG A CD  
16   N NE  . ARG A 4   ? 1.84487 1.50623 1.27284 0.51267  -0.05454 -0.30403 4   ARG A NE  
17   C CZ  . ARG A 4   ? 1.85778 1.56584 1.32800 0.50890  -0.03528 -0.28948 4   ARG A CZ  
18   N NH1 . ARG A 4   ? 1.80292 1.58134 1.28612 0.51513  -0.00427 -0.27680 4   ARG A NH1 
19   N NH2 . ARG A 4   ? 1.88758 1.57279 1.38809 0.49766  -0.04752 -0.28637 4   ARG A NH2 
20   N N   . LEU A 5   ? 1.44366 1.20949 0.88526 0.43241  -0.01568 -0.26483 5   LEU A N   
21   C CA  . LEU A 5   ? 1.28056 1.08947 0.75812 0.41125  0.00186  -0.24762 5   LEU A CA  
22   C C   . LEU A 5   ? 1.31241 1.10488 0.78037 0.38740  -0.00952 -0.24535 5   LEU A C   
23   O O   . LEU A 5   ? 1.32955 1.15840 0.83041 0.36327  0.00322  -0.22597 5   LEU A O   
24   C CB  . LEU A 5   ? 1.22912 1.10958 0.71482 0.42040  0.03805  -0.23144 5   LEU A CB  
25   C CG  . LEU A 5   ? 1.30617 1.21491 0.80394 0.44498  0.05196  -0.23148 5   LEU A CG  
26   C CD1 . LEU A 5   ? 1.35999 1.34437 0.87061 0.44770  0.08679  -0.21283 5   LEU A CD1 
27   C CD2 . LEU A 5   ? 1.23475 1.13587 0.77282 0.44139  0.04395  -0.23159 5   LEU A CD2 
28   N N   . VAL A 6   ? 1.29083 1.03393 0.72546 0.38675  -0.03547 -0.25860 6   VAL A N   
29   C CA  . VAL A 6   ? 1.22833 0.95541 0.65119 0.36611  -0.04942 -0.25691 6   VAL A CA  
30   C C   . VAL A 6   ? 1.17897 0.86148 0.62832 0.34391  -0.08102 -0.26336 6   VAL A C   
31   O O   . VAL A 6   ? 1.13684 0.77603 0.58248 0.34985  -0.10315 -0.27739 6   VAL A O   
32   C CB  . VAL A 6   ? 1.29220 1.00115 0.66435 0.37804  -0.05770 -0.26422 6   VAL A CB  
33   C CG1 . VAL A 6   ? 1.17653 0.84596 0.53969 0.35816  -0.08859 -0.26978 6   VAL A CG1 
34   C CG2 . VAL A 6   ? 1.31092 1.07109 0.66454 0.38552  -0.02554 -0.24882 6   VAL A CG2 
35   N N   . VAL A 7   ? 1.16189 0.86347 0.65215 0.31055  -0.08254 -0.24420 7   VAL A N   
36   C CA  . VAL A 7   ? 1.21315 0.88496 0.73816 0.28419  -0.10971 -0.24380 7   VAL A CA  
37   C C   . VAL A 7   ? 1.24879 0.91819 0.76960 0.26500  -0.12289 -0.23815 7   VAL A C   
38   O O   . VAL A 7   ? 1.21885 0.92532 0.74377 0.25681  -0.10444 -0.22131 7   VAL A O   
39   C CB  . VAL A 7   ? 1.10930 0.80887 0.69583 0.26373  -0.09901 -0.22554 7   VAL A CB  
40   C CG1 . VAL A 7   ? 1.02099 0.70626 0.64665 0.23207  -0.12037 -0.21813 7   VAL A CG1 
41   C CG2 . VAL A 7   ? 1.16489 0.84920 0.75469 0.28189  -0.09811 -0.23481 7   VAL A CG2 
42   N N   . GLN A 8   ? 1.27727 0.90196 0.78930 0.25826  -0.15600 -0.25218 8   GLN A N   
43   C CA  . GLN A 8   ? 1.29218 0.91156 0.80268 0.24128  -0.17423 -0.24895 8   GLN A CA  
44   C C   . GLN A 8   ? 1.25518 0.89697 0.82965 0.20915  -0.17575 -0.22961 8   GLN A C   
45   O O   . GLN A 8   ? 1.26938 0.89149 0.87650 0.19443  -0.19445 -0.23229 8   GLN A O   
46   C CB  . GLN A 8   ? 1.35594 0.92045 0.83332 0.24750  -0.21095 -0.27304 8   GLN A CB  
47   C CG  . GLN A 8   ? 1.41809 0.97511 0.89329 0.23195  -0.23513 -0.27238 8   GLN A CG  
48   C CD  . GLN A 8   ? 1.49820 1.07851 0.93589 0.24213  -0.22001 -0.26455 8   GLN A CD  
49   O OE1 . GLN A 8   ? 1.48354 1.06830 0.87443 0.26725  -0.20100 -0.26943 8   GLN A OE1 
50   N NE2 . GLN A 8   ? 1.49714 1.09325 0.95518 0.22331  -0.22777 -0.25120 8   GLN A NE2 
51   N N   . THR A 9   ? 1.16450 0.84632 0.75597 0.19816  -0.15622 -0.20967 9   THR A N   
52   C CA  . THR A 9   ? 1.13883 0.84199 0.78603 0.17105  -0.15687 -0.19252 9   THR A CA  
53   C C   . THR A 9   ? 1.18229 0.87656 0.83213 0.15817  -0.18026 -0.19208 9   THR A C   
54   O O   . THR A 9   ? 1.28882 0.96160 0.89632 0.16916  -0.19591 -0.20377 9   THR A O   
55   C CB  . THR A 9   ? 1.08033 0.82802 0.74832 0.16449  -0.12617 -0.17158 9   THR A CB  
56   O OG1 . THR A 9   ? 0.97832 0.73705 0.62365 0.16386  -0.12173 -0.16343 9   THR A OG1 
57   C CG2 . THR A 9   ? 1.12892 0.89407 0.78706 0.18075  -0.10093 -0.17124 9   THR A CG2 
58   N N   . SER A 10  ? 1.09792 0.81163 0.79784 0.13604  -0.18210 -0.17802 10  SER A N   
59   C CA  . SER A 10  ? 1.01922 0.73305 0.73067 0.12401  -0.20246 -0.17513 10  SER A CA  
60   C C   . SER A 10  ? 0.98412 0.70252 0.65536 0.13414  -0.19838 -0.17172 10  SER A C   
61   O O   . SER A 10  ? 1.02238 0.72931 0.68237 0.13305  -0.22123 -0.17616 10  SER A O   
62   C CB  . SER A 10  ? 1.05644 0.79947 0.82615 0.10295  -0.19636 -0.15786 10  SER A CB  
63   O OG  . SER A 10  ? 1.05877 0.83023 0.83076 0.10235  -0.17166 -0.14192 10  SER A OG  
64   N N   . SER A 11  ? 1.02407 0.76082 0.67561 0.14268  -0.17005 -0.16206 11  SER A N   
65   C CA  . SER A 11  ? 1.04580 0.78906 0.66244 0.14902  -0.16226 -0.15339 11  SER A CA  
66   C C   . SER A 11  ? 1.11443 0.84580 0.67034 0.17160  -0.15367 -0.16241 11  SER A C   
67   O O   . SER A 11  ? 1.14875 0.88794 0.67176 0.17756  -0.14133 -0.15240 11  SER A O   
68   C CB  . SER A 11  ? 1.03041 0.80527 0.67182 0.13803  -0.13628 -0.13188 11  SER A CB  
69   O OG  . SER A 11  ? 1.19415 0.98192 0.89011 0.12028  -0.14023 -0.12468 11  SER A OG  
70   N N   . GLY A 12  ? 1.06668 0.77874 0.60543 0.18511  -0.15906 -0.18034 12  GLY A N   
71   C CA  . GLY A 12  ? 1.20335 0.90658 0.68404 0.20993  -0.14881 -0.19013 12  GLY A CA  
72   C C   . GLY A 12  ? 1.25537 0.96446 0.73938 0.22234  -0.13144 -0.19697 12  GLY A C   
73   O O   . GLY A 12  ? 1.13000 0.85390 0.66204 0.21029  -0.12370 -0.19053 12  GLY A O   
74   N N   . PRO A 13  ? 1.26826 0.96522 0.69863 0.24905  -0.12579 -0.21080 13  PRO A N   
75   C CA  . PRO A 13  ? 1.10596 0.81135 0.53575 0.26606  -0.10763 -0.21758 13  PRO A CA  
76   C C   . PRO A 13  ? 1.10429 0.86104 0.55516 0.26253  -0.07079 -0.19594 13  PRO A C   
77   O O   . PRO A 13  ? 1.13172 0.91159 0.56848 0.25824  -0.05518 -0.18002 13  PRO A O   
78   C CB  . PRO A 13  ? 1.15950 0.83834 0.51978 0.29789  -0.11251 -0.23856 13  PRO A CB  
79   C CG  . PRO A 13  ? 1.21653 0.89386 0.53926 0.29683  -0.11715 -0.23234 13  PRO A CG  
80   C CD  . PRO A 13  ? 1.18511 0.85751 0.55068 0.26735  -0.13839 -0.22285 13  PRO A CD  
81   N N   . VAL A 14  ? 1.02658 0.79984 0.51186 0.26346  -0.05846 -0.19481 14  VAL A N   
82   C CA  . VAL A 14  ? 1.05285 0.87639 0.56124 0.26156  -0.02554 -0.17686 14  VAL A CA  
83   C C   . VAL A 14  ? 1.08839 0.91913 0.58287 0.28956  -0.01254 -0.18908 14  VAL A C   
84   O O   . VAL A 14  ? 1.05313 0.84979 0.54445 0.30157  -0.02997 -0.20759 14  VAL A O   
85   C CB  . VAL A 14  ? 1.03530 0.88042 0.60737 0.23348  -0.02232 -0.16017 14  VAL A CB  
86   C CG1 . VAL A 14  ? 1.10698 0.94233 0.69388 0.20893  -0.03714 -0.15029 14  VAL A CG1 
87   C CG2 . VAL A 14  ? 0.88114 0.70900 0.48282 0.23460  -0.03446 -0.17060 14  VAL A CG2 
88   N N   . ARG A 15  ? 1.10576 0.98153 0.59263 0.30002  0.01808  -0.17789 15  ARG A N   
89   C CA  . ARG A 15  ? 1.13375 1.02970 0.61300 0.32806  0.03546  -0.18613 15  ARG A CA  
90   C C   . ARG A 15  ? 1.13231 1.07923 0.66707 0.31483  0.05660  -0.16769 15  ARG A C   
91   O O   . ARG A 15  ? 1.13619 1.11792 0.69496 0.29156  0.07089  -0.14584 15  ARG A O   
92   C CB  . ARG A 15  ? 1.12473 1.03968 0.55043 0.35410  0.05573  -0.18815 15  ARG A CB  
93   C CG  . ARG A 15  ? 1.34380 1.27413 0.76359 0.38400  0.06802  -0.19763 15  ARG A CG  
94   C CD  . ARG A 15  ? 1.60357 1.55658 0.98708 0.39971  0.08562  -0.19205 15  ARG A CD  
95   N NE  . ARG A 15  ? 1.65334 1.65222 1.04128 0.38211  0.11035  -0.16728 15  ARG A NE  
96   C CZ  . ARG A 15  ? 1.53713 1.59719 0.96161 0.37438  0.13885  -0.14762 15  ARG A CZ  
97   N NH1 . ARG A 15  ? 1.49657 1.58220 0.95636 0.38497  0.14638  -0.15052 15  ARG A NH1 
98   N NH2 . ARG A 15  ? 1.41877 1.51371 0.84537 0.35485  0.15833  -0.12392 15  ARG A NH2 
99   N N   . GLY A 16  ? 1.07716 1.02613 0.63044 0.33008  0.05703  -0.17671 16  GLY A N   
100  C CA  . GLY A 16  ? 1.11920 1.11624 0.72412 0.31932  0.07430  -0.16062 16  GLY A CA  
101  C C   . GLY A 16  ? 1.22370 1.25902 0.82597 0.34986  0.09578  -0.16444 16  GLY A C   
102  O O   . GLY A 16  ? 1.25462 1.29013 0.81182 0.37964  0.10472  -0.17603 16  GLY A O   
103  N N   . ARG A 17  ? 1.16647 1.23593 0.81639 0.34416  0.10391  -0.15490 17  ARG A N   
104  C CA  . ARG A 17  ? 1.12004 1.23085 0.77818 0.37260  0.12235  -0.15736 17  ARG A CA  
105  C C   . ARG A 17  ? 1.13646 1.20960 0.80073 0.39105  0.10395  -0.17378 17  ARG A C   
106  O O   . ARG A 17  ? 1.17633 1.20232 0.85165 0.37394  0.07993  -0.17735 17  ARG A O   
107  C CB  . ARG A 17  ? 1.04136 1.22168 0.75065 0.35320  0.14353  -0.13376 17  ARG A CB  
108  C CG  . ARG A 17  ? 0.90461 1.14030 0.60654 0.35008  0.17118  -0.11819 17  ARG A CG  
109  C CD  . ARG A 17  ? 0.94453 1.22446 0.69656 0.31259  0.18038  -0.09310 17  ARG A CD  
110  N NE  . ARG A 17  ? 1.03687 1.33411 0.83708 0.30811  0.17483  -0.09079 17  ARG A NE  
111  C CZ  . ARG A 17  ? 1.02609 1.32315 0.86440 0.27549  0.16546  -0.07876 17  ARG A CZ  
112  N NH1 . ARG A 17  ? 1.01538 1.29439 0.85122 0.24486  0.16021  -0.06848 17  ARG A NH1 
113  N NH2 . ARG A 17  ? 0.99684 1.30972 0.87301 0.27557  0.16053  -0.07761 17  ARG A NH2 
114  N N   . SER A 18  ? 1.08392 1.17810 0.74877 0.41769  0.11252  -0.17771 18  SER A N   
115  C CA  . SER A 18  ? 1.04710 1.11450 0.72430 0.43339  0.09761  -0.18736 18  SER A CA  
116  C C   . SER A 18  ? 1.04070 1.17341 0.76427 0.43512  0.11534  -0.17230 18  SER A C   
117  O O   . SER A 18  ? 0.89230 1.07635 0.61961 0.44558  0.13492  -0.16463 18  SER A O   
118  C CB  . SER A 18  ? 1.14783 1.17457 0.78408 0.46215  0.08602  -0.20492 18  SER A CB  
119  O OG  . SER A 18  ? 1.11518 1.10792 0.76050 0.47492  0.06924  -0.21333 18  SER A OG  
120  N N   . VAL A 19  ? 1.00231 1.13441 0.76208 0.42380  0.10777  -0.16729 19  VAL A N   
121  C CA  . VAL A 19  ? 0.99390 1.17865 0.79723 0.42697  0.11769  -0.15521 19  VAL A CA  
122  C C   . VAL A 19  ? 1.03510 1.17595 0.83594 0.44703  0.09852  -0.16615 19  VAL A C   
123  O O   . VAL A 19  ? 1.10559 1.17744 0.88553 0.44700  0.07650  -0.17841 19  VAL A O   
124  C CB  . VAL A 19  ? 0.86523 1.08818 0.71420 0.39591  0.12321  -0.13735 19  VAL A CB  
125  C CG1 . VAL A 19  ? 0.89934 1.15644 0.74924 0.36957  0.13874  -0.12367 19  VAL A CG1 
126  C CG2 . VAL A 19  ? 0.83923 1.00247 0.69514 0.37256  0.09766  -0.13777 19  VAL A CG2 
127  N N   . THR A 20  ? 0.98082 1.16078 0.80254 0.46335  0.10603  -0.16096 20  THR A N   
128  C CA  . THR A 20  ? 1.00356 1.14992 0.82811 0.48128  0.08959  -0.16725 20  THR A CA  
129  C C   . THR A 20  ? 0.95963 1.15855 0.83473 0.47253  0.09536  -0.15102 20  THR A C   
130  O O   . THR A 20  ? 0.98971 1.25027 0.88687 0.48054  0.11016  -0.14245 20  THR A O   
131  C CB  . THR A 20  ? 1.10265 1.23911 0.89787 0.51449  0.08954  -0.17884 20  THR A CB  
132  O OG1 . THR A 20  ? 1.08206 1.16997 0.82890 0.52109  0.08258  -0.19390 20  THR A OG1 
133  C CG2 . THR A 20  ? 1.13579 1.23197 0.93123 0.53211  0.07130  -0.18469 20  THR A CG2 
134  N N   . VAL A 21  ? 0.89811 1.07378 0.79199 0.45555  0.08285  -0.14636 21  VAL A N   
135  C CA  . VAL A 21  ? 0.92853 1.14787 0.86754 0.44622  0.08462  -0.13132 21  VAL A CA  
136  C C   . VAL A 21  ? 0.88115 1.04619 0.81851 0.45509  0.06303  -0.13427 21  VAL A C   
137  O O   . VAL A 21  ? 0.82297 0.91857 0.73645 0.45188  0.04644  -0.14295 21  VAL A O   
138  C CB  . VAL A 21  ? 0.93523 1.18815 0.90273 0.41261  0.09186  -0.11809 21  VAL A CB  
139  C CG1 . VAL A 21  ? 1.07741 1.38998 1.05046 0.40314  0.11435  -0.11135 21  VAL A CG1 
140  C CG2 . VAL A 21  ? 0.78860 0.97340 0.73584 0.38633  0.07529  -0.12080 21  VAL A CG2 
141  N N   . GLN A 22  ? 0.75270 0.94889 0.71570 0.46471  0.06235  -0.12585 22  GLN A N   
142  C CA  . GLN A 22  ? 0.84462 0.99304 0.80575 0.47428  0.04290  -0.12564 22  GLN A CA  
143  C C   . GLN A 22  ? 0.95379 1.02709 0.87126 0.49507  0.02846  -0.14187 22  GLN A C   
144  O O   . GLN A 22  ? 1.08213 1.09061 0.98736 0.49396  0.00913  -0.14350 22  GLN A O   
145  C CB  . GLN A 22  ? 0.80047 0.92599 0.77721 0.45003  0.03236  -0.11662 22  GLN A CB  
146  C CG  . GLN A 22  ? 0.71516 0.90853 0.73157 0.42071  0.04387  -0.10001 22  GLN A CG  
147  C CD  . GLN A 22  ? 0.78110 1.02234 0.82914 0.43266  0.04377  -0.08975 22  GLN A CD  
148  O OE1 . GLN A 22  ? 0.88025 1.08766 0.92782 0.43835  0.02842  -0.08547 22  GLN A OE1 
149  N NE2 . GLN A 22  ? 0.66914 0.98488 0.74290 0.42932  0.05910  -0.08341 22  GLN A NE2 
150  N N   . GLY A 23  ? 0.90492 0.98621 0.79813 0.51264  0.03732  -0.15302 23  GLY A N   
151  C CA  . GLY A 23  ? 1.05520 1.07053 0.90591 0.53415  0.02349  -0.16930 23  GLY A CA  
152  C C   . GLY A 23  ? 1.12275 1.06598 0.94208 0.52078  0.00833  -0.18020 23  GLY A C   
153  O O   . GLY A 23  ? 1.16711 1.04387 0.95464 0.53283  -0.00947 -0.19199 23  GLY A O   
154  N N   . ARG A 24  ? 1.21109 1.16444 1.03835 0.49547  0.01350  -0.17673 24  ARG A N   
155  C CA  . ARG A 24  ? 1.31427 1.20434 1.11145 0.48269  -0.00094 -0.18804 24  ARG A CA  
156  C C   . ARG A 24  ? 1.16815 1.09074 0.95716 0.47220  0.01415  -0.19041 24  ARG A C   
157  O O   . ARG A 24  ? 0.91881 0.90703 0.73619 0.46135  0.03352  -0.17832 24  ARG A O   
158  C CB  . ARG A 24  ? 1.35254 1.19745 1.16423 0.45865  -0.01838 -0.18118 24  ARG A CB  
159  C CG  . ARG A 24  ? 1.58628 1.35796 1.36700 0.44682  -0.03860 -0.19358 24  ARG A CG  
160  C CD  . ARG A 24  ? 1.60603 1.35049 1.40610 0.41226  -0.05099 -0.18325 24  ARG A CD  
161  N NE  . ARG A 24  ? 1.71535 1.38573 1.50455 0.41261  -0.07549 -0.18583 24  ARG A NE  
162  C CZ  . ARG A 24  ? 1.71556 1.38038 1.52923 0.40259  -0.08076 -0.16940 24  ARG A CZ  
163  N NH1 . ARG A 24  ? 1.64489 1.37412 1.49359 0.39217  -0.06433 -0.15173 24  ARG A NH1 
164  N NH2 . ARG A 24  ? 1.78324 1.37862 1.58563 0.40060  -0.10278 -0.16956 24  ARG A NH2 
165  N N   . GLU A 25  ? 1.14047 1.01596 0.88928 0.47480  0.00409  -0.20545 25  GLU A N   
166  C CA  . GLU A 25  ? 1.13729 1.03227 0.87055 0.46529  0.01502  -0.20833 25  GLU A CA  
167  C C   . GLU A 25  ? 1.01712 0.89998 0.76537 0.43486  0.00941  -0.20297 25  GLU A C   
168  O O   . GLU A 25  ? 1.08968 0.91450 0.83656 0.41927  -0.01322 -0.20534 25  GLU A O   
169  C CB  . GLU A 25  ? 1.30754 1.15339 0.99078 0.47904  0.00288  -0.22642 25  GLU A CB  
170  C CG  . GLU A 25  ? 1.38704 1.26346 1.04794 0.47925  0.01832  -0.22854 25  GLU A CG  
171  C CD  . GLU A 25  ? 1.53623 1.35760 1.14618 0.49049  0.00196  -0.24667 25  GLU A CD  
172  O OE1 . GLU A 25  ? 1.59997 1.35734 1.19296 0.49530  -0.02273 -0.25813 25  GLU A OE1 
173  O OE2 . GLU A 25  ? 1.56261 1.40483 1.14901 0.49356  0.01333  -0.24848 25  GLU A OE2 
174  N N   . VAL A 26  ? 0.90285 0.84354 0.67051 0.41556  0.02846  -0.18960 26  VAL A N   
175  C CA  . VAL A 26  ? 0.83393 0.77038 0.61578 0.37451  0.02319  -0.17815 26  VAL A CA  
176  C C   . VAL A 26  ? 0.91622 0.86716 0.67047 0.37307  0.03378  -0.18189 26  VAL A C   
177  O O   . VAL A 26  ? 1.04275 1.03721 0.78551 0.39378  0.05462  -0.18300 26  VAL A O   
178  C CB  . VAL A 26  ? 0.80589 0.79287 0.63717 0.34680  0.03341  -0.15549 26  VAL A CB  
179  C CG1 . VAL A 26  ? 0.80351 0.77247 0.64770 0.30821  0.02324  -0.14606 26  VAL A CG1 
180  C CG2 . VAL A 26  ? 0.79215 0.77876 0.64751 0.35637  0.02800  -0.15092 26  VAL A CG2 
181  N N   . HIS A 27  ? 0.91413 0.83100 0.65838 0.34870  0.01974  -0.18252 27  HIS A N   
182  C CA  . HIS A 27  ? 0.92541 0.85063 0.64276 0.34369  0.02659  -0.18391 27  HIS A CA  
183  C C   . HIS A 27  ? 0.92240 0.88021 0.67170 0.30682  0.03376  -0.16321 27  HIS A C   
184  O O   . HIS A 27  ? 0.93309 0.86556 0.70113 0.28127  0.01786  -0.15814 27  HIS A O   
185  C CB  . HIS A 27  ? 0.93612 0.79492 0.61338 0.34746  0.00213  -0.20247 27  HIS A CB  
186  C CG  . HIS A 27  ? 1.05161 0.87747 0.68535 0.38710  -0.00326 -0.22543 27  HIS A CG  
187  N ND1 . HIS A 27  ? 1.12886 0.89138 0.72027 0.39602  -0.02699 -0.24600 27  HIS A ND1 
188  C CD2 . HIS A 27  ? 1.00823 0.85739 0.63621 0.41822  0.01077  -0.22956 27  HIS A CD2 
189  C CE1 . HIS A 27  ? 1.13064 0.88243 0.69930 0.42126  -0.02820 -0.25471 27  HIS A CE1 
190  N NE2 . HIS A 27  ? 1.10514 0.90833 0.69508 0.43580  -0.00539 -0.24524 27  HIS A NE2 
191  N N   . VAL A 28  ? 0.92226 0.93533 0.67712 0.30435  0.05749  -0.15111 28  VAL A N   
192  C CA  . VAL A 28  ? 0.87024 0.91955 0.65978 0.27183  0.06656  -0.13024 28  VAL A CA  
193  C C   . VAL A 28  ? 0.80255 0.85049 0.56767 0.25913  0.07021  -0.12585 28  VAL A C   
194  O O   . VAL A 28  ? 0.84292 0.92411 0.59051 0.26826  0.08953  -0.12142 28  VAL A O   
195  C CB  . VAL A 28  ? 0.86471 0.97872 0.68588 0.27367  0.08876  -0.11682 28  VAL A CB  
196  C CG1 . VAL A 28  ? 0.73829 0.88149 0.59218 0.23862  0.09456  -0.09696 28  VAL A CG1 
197  C CG2 . VAL A 28  ? 0.90201 1.01746 0.74461 0.28984  0.08404  -0.12119 28  VAL A CG2 
198  N N   . TYR A 29  ? 0.84868 0.86198 0.61533 0.23706  0.05254  -0.12474 29  TYR A N   
199  C CA  . TYR A 29  ? 0.91394 0.91947 0.65909 0.22369  0.05140  -0.11993 29  TYR A CA  
200  C C   . TYR A 29  ? 0.88523 0.91967 0.66355 0.19385  0.05959  -0.09945 29  TYR A C   
201  O O   . TYR A 29  ? 0.89178 0.91394 0.69855 0.17514  0.04775  -0.09530 29  TYR A O   
202  C CB  . TYR A 29  ? 0.91020 0.86006 0.63667 0.22055  0.02452  -0.13282 29  TYR A CB  
203  C CG  . TYR A 29  ? 1.00257 0.91458 0.70056 0.24692  0.01100  -0.15452 29  TYR A CG  
204  C CD1 . TYR A 29  ? 1.04770 0.94114 0.76632 0.25133  0.00042  -0.16076 29  TYR A CD1 
205  C CD2 . TYR A 29  ? 1.05610 0.94841 0.70335 0.26836  0.00848  -0.16867 29  TYR A CD2 
206  C CE1 . TYR A 29  ? 1.12545 0.97830 0.81598 0.27547  -0.01342 -0.18075 29  TYR A CE1 
207  C CE2 . TYR A 29  ? 1.24514 1.09820 0.86280 0.29368  -0.00541 -0.19035 29  TYR A CE2 
208  C CZ  . TYR A 29  ? 1.30789 1.13970 0.94779 0.29678  -0.01683 -0.19647 29  TYR A CZ  
209  O OH  . TYR A 29  ? 1.48562 1.27181 1.09363 0.32212  -0.03243 -0.21845 29  TYR A OH  
210  N N   . THR A 30  ? 0.92679 0.99806 0.69988 0.18936  0.07963  -0.08647 30  THR A N   
211  C CA  . THR A 30  ? 0.85644 0.95290 0.65714 0.16150  0.08754  -0.06721 30  THR A CA  
212  C C   . THR A 30  ? 0.95883 1.04351 0.73186 0.15058  0.08832  -0.05918 30  THR A C   
213  O O   . THR A 30  ? 1.10108 1.18974 0.83767 0.16477  0.09790  -0.06040 30  THR A O   
214  C CB  . THR A 30  ? 0.79269 0.94529 0.61738 0.16096  0.10984  -0.05534 30  THR A CB  
215  O OG1 . THR A 30  ? 0.94650 1.11918 0.74464 0.18724  0.12474  -0.06101 30  THR A OG1 
216  C CG2 . THR A 30  ? 0.69381 0.85963 0.55776 0.16043  0.10582  -0.05687 30  THR A CG2 
217  N N   . GLY A 31  ? 0.88435 0.95366 0.67215 0.12737  0.07825  -0.05092 31  GLY A N   
218  C CA  . GLY A 31  ? 0.76942 0.82757 0.53451 0.11554  0.07858  -0.04051 31  GLY A CA  
219  C C   . GLY A 31  ? 0.74611 0.76100 0.47813 0.12339  0.05943  -0.05139 31  GLY A C   
220  O O   . GLY A 31  ? 0.86179 0.86914 0.55550 0.12935  0.06274  -0.04854 31  GLY A O   
221  N N   . ILE A 32  ? 0.73805 0.72591 0.48441 0.12309  0.03903  -0.06304 32  ILE A N   
222  C CA  . ILE A 32  ? 0.81003 0.75908 0.53173 0.12864  0.01726  -0.07415 32  ILE A CA  
223  C C   . ILE A 32  ? 0.81076 0.74927 0.54489 0.10949  0.00783  -0.06381 32  ILE A C   
224  O O   . ILE A 32  ? 0.75618 0.70040 0.52773 0.09548  0.00510  -0.05924 32  ILE A O   
225  C CB  . ILE A 32  ? 0.78231 0.70883 0.51548 0.13695  -0.00062 -0.09124 32  ILE A CB  
226  C CG1 . ILE A 32  ? 0.88444 0.81431 0.59901 0.16018  0.00673  -0.10350 32  ILE A CG1 
227  C CG2 . ILE A 32  ? 0.68858 0.57839 0.40531 0.13738  -0.02598 -0.10132 32  ILE A CG2 
228  C CD1 . ILE A 32  ? 0.87014 0.78134 0.60446 0.16538  -0.00702 -0.11612 32  ILE A CD1 
229  N N   . PRO A 33  ? 0.88742 0.81084 0.58965 0.10984  0.00319  -0.05940 33  PRO A N   
230  C CA  . PRO A 33  ? 0.78489 0.69624 0.49862 0.09474  -0.00714 -0.05027 33  PRO A CA  
231  C C   . PRO A 33  ? 0.78775 0.68185 0.52625 0.09275  -0.02949 -0.06121 33  PRO A C   
232  O O   . PRO A 33  ? 0.83148 0.70752 0.55699 0.10372  -0.04498 -0.07570 33  PRO A O   
233  C CB  . PRO A 33  ? 0.74676 0.64145 0.41396 0.10101  -0.01011 -0.04560 33  PRO A CB  
234  C CG  . PRO A 33  ? 0.78920 0.68236 0.42049 0.12059  -0.00642 -0.05657 33  PRO A CG  
235  C CD  . PRO A 33  ? 0.88184 0.80019 0.53411 0.12521  0.00888  -0.06097 33  PRO A CD  
236  N N   . TYR A 34  ? 0.71812 0.61875 0.49301 0.07833  -0.03097 -0.05417 34  TYR A N   
237  C CA  . TYR A 34  ? 0.66173 0.55181 0.46326 0.07456  -0.05001 -0.06080 34  TYR A CA  
238  C C   . TYR A 34  ? 0.68494 0.56665 0.48981 0.06810  -0.05968 -0.05337 34  TYR A C   
239  O O   . TYR A 34  ? 0.65109 0.52743 0.47673 0.06639  -0.07622 -0.05801 34  TYR A O   
240  C CB  . TYR A 34  ? 0.71745 0.62340 0.56005 0.06704  -0.04461 -0.06079 34  TYR A CB  
241  C CG  . TYR A 34  ? 0.64625 0.56822 0.51334 0.05415  -0.03362 -0.04866 34  TYR A CG  
242  C CD1 . TYR A 34  ? 0.58309 0.50220 0.47181 0.04702  -0.04258 -0.04546 34  TYR A CD1 
243  C CD2 . TYR A 34  ? 0.64655 0.58763 0.51565 0.04994  -0.01509 -0.04127 34  TYR A CD2 
244  C CE1 . TYR A 34  ? 0.66884 0.59868 0.57543 0.03732  -0.03348 -0.03647 34  TYR A CE1 
245  C CE2 . TYR A 34  ? 0.69067 0.64314 0.58036 0.03748  -0.00769 -0.03183 34  TYR A CE2 
246  C CZ  . TYR A 34  ? 0.67486 0.61914 0.58085 0.03186  -0.01706 -0.03019 34  TYR A CZ  
247  O OH  . TYR A 34  ? 0.58573 0.53743 0.50722 0.02155  -0.01064 -0.02284 34  TYR A OH  
248  N N   . ALA A 35  ? 0.76164 0.64186 0.54608 0.06507  -0.05029 -0.04150 35  ALA A N   
249  C CA  . ALA A 35  ? 0.83873 0.70604 0.62023 0.06191  -0.05975 -0.03410 35  ALA A CA  
250  C C   . ALA A 35  ? 0.92667 0.78172 0.66455 0.06477  -0.05363 -0.02420 35  ALA A C   
251  O O   . ALA A 35  ? 0.65922 0.52383 0.37862 0.06481  -0.03679 -0.01976 35  ALA A O   
252  C CB  . ALA A 35  ? 0.73457 0.61115 0.54841 0.05026  -0.05323 -0.02631 35  ALA A CB  
253  N N   . LYS A 36  ? 0.86816 0.70361 0.58974 0.06801  -0.06729 -0.01988 36  LYS A N   
254  C CA  . LYS A 36  ? 0.89316 0.71356 0.57440 0.06814  -0.06105 -0.00614 36  LYS A CA  
255  C C   . LYS A 36  ? 0.92119 0.74820 0.61311 0.05282  -0.04266 0.00842  36  LYS A C   
256  O O   . LYS A 36  ? 0.84810 0.68197 0.57545 0.04466  -0.04230 0.00772  36  LYS A O   
257  C CB  . LYS A 36  ? 0.78950 0.58536 0.45251 0.07578  -0.08133 -0.00371 36  LYS A CB  
258  C CG  . LYS A 36  ? 1.02237 0.81403 0.68001 0.08884  -0.10297 -0.01917 36  LYS A CG  
259  C CD  . LYS A 36  ? 1.11481 0.88496 0.74965 0.09914  -0.12532 -0.01742 36  LYS A CD  
260  C CE  . LYS A 36  ? 1.25786 1.00781 0.86244 0.09750  -0.11905 0.00125  36  LYS A CE  
261  N NZ  . LYS A 36  ? 1.35859 1.08863 0.94959 0.10895  -0.14291 0.00292  36  LYS A NZ  
262  N N   . PRO A 37  ? 0.89008 0.71751 0.55328 0.04791  -0.02684 0.02151  37  PRO A N   
263  C CA  . PRO A 37  ? 0.94611 0.78022 0.62106 0.03028  -0.01104 0.03586  37  PRO A CA  
264  C C   . PRO A 37  ? 0.95560 0.76551 0.63975 0.02368  -0.02177 0.04185  37  PRO A C   
265  O O   . PRO A 37  ? 0.94751 0.72872 0.60379 0.02875  -0.03256 0.04885  37  PRO A O   
266  C CB  . PRO A 37  ? 0.75666 0.59023 0.39190 0.02741  0.00381  0.05140  37  PRO A CB  
267  C CG  . PRO A 37  ? 0.77959 0.61471 0.38535 0.04624  -0.00002 0.04116  37  PRO A CG  
268  C CD  . PRO A 37  ? 0.84682 0.67824 0.47222 0.05809  -0.01968 0.02094  37  PRO A CD  
269  N N   . PRO A 38  ? 0.86248 0.68167 0.58283 0.01432  -0.01971 0.03892  38  PRO A N   
270  C CA  . PRO A 38  ? 0.88693 0.68255 0.61617 0.01261  -0.03124 0.04070  38  PRO A CA  
271  C C   . PRO A 38  ? 0.96150 0.72976 0.66500 0.00067  -0.02740 0.05845  38  PRO A C   
272  O O   . PRO A 38  ? 0.95796 0.71815 0.67440 -0.01229 -0.02465 0.06309  38  PRO A O   
273  C CB  . PRO A 38  ? 0.74544 0.56174 0.51613 0.00626  -0.02728 0.03229  38  PRO A CB  
274  C CG  . PRO A 38  ? 0.86250 0.70792 0.64116 -0.00317 -0.01000 0.03416  38  PRO A CG  
275  C CD  . PRO A 38  ? 0.90178 0.75255 0.65219 0.00552  -0.00583 0.03518  38  PRO A CD  
276  N N   . VAL A 39  ? 0.88868 0.63921 0.55287 0.00512  -0.02872 0.06859  39  VAL A N   
277  C CA  . VAL A 39  ? 0.96523 0.69422 0.60119 -0.00932 -0.02056 0.08917  39  VAL A CA  
278  C C   . VAL A 39  ? 0.98840 0.67334 0.59080 0.00012  -0.03673 0.09710  39  VAL A C   
279  O O   . VAL A 39  ? 1.05340 0.73127 0.64990 0.01940  -0.05272 0.08724  39  VAL A O   
280  C CB  . VAL A 39  ? 1.00531 0.75694 0.62090 -0.01464 -0.00211 0.09902  39  VAL A CB  
281  C CG1 . VAL A 39  ? 0.86818 0.60509 0.44047 0.00219  -0.00871 0.10131  39  VAL A CG1 
282  C CG2 . VAL A 39  ? 1.15564 0.90310 0.76529 -0.03856 0.01218  0.11989  39  VAL A CG2 
283  N N   . GLU A 40  ? 0.92025 0.57497 0.50149 -0.01442 -0.03354 0.11579  40  GLU A N   
284  C CA  . GLU A 40  ? 1.03046 0.63591 0.58103 -0.00729 -0.04942 0.12526  40  GLU A CA  
285  C C   . GLU A 40  ? 1.07900 0.67290 0.64847 0.01179  -0.06947 0.10892  40  GLU A C   
286  O O   . GLU A 40  ? 1.11908 0.71281 0.71789 0.00755  -0.07111 0.10092  40  GLU A O   
287  C CB  . GLU A 40  ? 1.23909 0.83204 0.74346 0.00275  -0.05122 0.13634  40  GLU A CB  
288  C CG  . GLU A 40  ? 1.41430 0.98885 0.88605 -0.01672 -0.03747 0.16234  40  GLU A CG  
289  C CD  . GLU A 40  ? 1.57041 1.15317 1.00170 -0.00878 -0.03016 0.17152  40  GLU A CD  
290  O OE1 . GLU A 40  ? 1.64674 1.26625 1.08113 -0.01825 -0.00922 0.17539  40  GLU A OE1 
291  O OE2 . GLU A 40  ? 1.59413 1.14814 0.99014 0.00898  -0.04589 0.17394  40  GLU A OE2 
292  N N   . ASP A 41  ? 1.02967 0.61588 0.58245 0.03337  -0.08495 0.10405  41  ASP A N   
293  C CA  . ASP A 41  ? 1.13638 0.71559 0.70860 0.05228  -0.10396 0.09079  41  ASP A CA  
294  C C   . ASP A 41  ? 1.08034 0.70041 0.70298 0.05373  -0.10111 0.07148  41  ASP A C   
295  O O   . ASP A 41  ? 0.98183 0.60076 0.62861 0.06399  -0.11082 0.06204  41  ASP A O   
296  C CB  . ASP A 41  ? 1.25530 0.82652 0.80448 0.07420  -0.12214 0.08890  41  ASP A CB  
297  C CG  . ASP A 41  ? 1.42053 0.98896 0.99233 0.09439  -0.14186 0.07721  41  ASP A CG  
298  O OD1 . ASP A 41  ? 1.45510 0.99219 1.02355 0.09752  -0.14738 0.08190  41  ASP A OD1 
299  O OD2 . ASP A 41  ? 1.50616 1.10437 1.10022 0.10704  -0.15188 0.06322  41  ASP A OD2 
300  N N   . LEU A 42  ? 0.97733 0.63304 0.61494 0.04485  -0.08750 0.06620  42  LEU A N   
301  C CA  . LEU A 42  ? 0.94583 0.63840 0.62784 0.04582  -0.08477 0.04977  42  LEU A CA  
302  C C   . LEU A 42  ? 0.90041 0.60272 0.60679 0.02930  -0.07103 0.04979  42  LEU A C   
303  O O   . LEU A 42  ? 0.83308 0.56553 0.57414 0.02884  -0.06696 0.03806  42  LEU A O   
304  C CB  . LEU A 42  ? 0.93000 0.65222 0.61391 0.04796  -0.08018 0.04231  42  LEU A CB  
305  C CG  . LEU A 42  ? 0.84746 0.56912 0.52092 0.06575  -0.09821 0.03460  42  LEU A CG  
306  C CD1 . LEU A 42  ? 0.85921 0.60196 0.52611 0.06585  -0.09201 0.02789  42  LEU A CD1 
307  C CD2 . LEU A 42  ? 0.87848 0.61329 0.58974 0.07621  -0.11279 0.02197  42  LEU A CD2 
308  N N   . ARG A 43  ? 0.94861 0.62550 0.63689 0.01484  -0.06480 0.06322  43  ARG A N   
309  C CA  . ARG A 43  ? 0.97889 0.65914 0.68905 -0.00005 -0.05698 0.06203  43  ARG A CA  
310  C C   . ARG A 43  ? 0.97197 0.64612 0.70360 0.01273  -0.06796 0.04961  43  ARG A C   
311  O O   . ARG A 43  ? 0.99746 0.64783 0.71744 0.02915  -0.08202 0.04859  43  ARG A O   
312  C CB  . ARG A 43  ? 0.99511 0.64150 0.67955 -0.01837 -0.05308 0.07929  43  ARG A CB  
313  C CG  . ARG A 43  ? 0.93805 0.57981 0.64089 -0.03401 -0.04988 0.07745  43  ARG A CG  
314  C CD  . ARG A 43  ? 1.03953 0.64378 0.71646 -0.05491 -0.04859 0.09575  43  ARG A CD  
315  N NE  . ARG A 43  ? 0.99211 0.62071 0.66631 -0.07578 -0.03190 0.11000  43  ARG A NE  
316  C CZ  . ARG A 43  ? 0.97829 0.58248 0.63029 -0.09701 -0.02764 0.13032  43  ARG A CZ  
317  N NH1 . ARG A 43  ? 1.01845 0.56638 0.64586 -0.10086 -0.04040 0.13869  43  ARG A NH1 
318  N NH2 . ARG A 43  ? 0.95577 0.59207 0.61050 -0.11437 -0.01039 0.14299  43  ARG A NH2 
319  N N   . PHE A 44  ? 0.89172 0.59004 0.65446 0.00701  -0.06124 0.04027  44  PHE A N   
320  C CA  . PHE A 44  ? 0.76587 0.46592 0.55056 0.01859  -0.06756 0.02828  44  PHE A CA  
321  C C   . PHE A 44  ? 0.70684 0.43028 0.51141 0.03858  -0.07520 0.01818  44  PHE A C   
322  O O   . PHE A 44  ? 0.80546 0.53788 0.63100 0.04957  -0.07854 0.00918  44  PHE A O   
323  C CB  . PHE A 44  ? 0.77647 0.43003 0.54031 0.02343  -0.07774 0.03108  44  PHE A CB  
324  C CG  . PHE A 44  ? 0.82506 0.44857 0.56842 0.00143  -0.07370 0.04215  44  PHE A CG  
325  C CD1 . PHE A 44  ? 0.79338 0.43730 0.55369 -0.01800 -0.06291 0.04112  44  PHE A CD1 
326  C CD2 . PHE A 44  ? 0.89147 0.46605 0.59935 -0.00062 -0.08189 0.05456  44  PHE A CD2 
327  C CE1 . PHE A 44  ? 0.86795 0.48742 0.61364 -0.04099 -0.06067 0.05194  44  PHE A CE1 
328  C CE2 . PHE A 44  ? 1.00603 0.55201 0.69700 -0.02426 -0.07897 0.06647  44  PHE A CE2 
329  C CZ  . PHE A 44  ? 0.97614 0.54627 0.68776 -0.04543 -0.06851 0.06501  44  PHE A CZ  
330  N N   . ARG A 45  ? 0.71940 0.45415 0.51827 0.04331  -0.07831 0.01939  45  ARG A N   
331  C CA  . ARG A 45  ? 0.72611 0.48004 0.54394 0.06025  -0.08911 0.01074  45  ARG A CA  
332  C C   . ARG A 45  ? 0.73404 0.52720 0.58128 0.05554  -0.08225 0.00286  45  ARG A C   
333  O O   . ARG A 45  ? 0.68750 0.49118 0.53399 0.04227  -0.07005 0.00455  45  ARG A O   
334  C CB  . ARG A 45  ? 0.75577 0.49321 0.54668 0.07028  -0.10185 0.01556  45  ARG A CB  
335  C CG  . ARG A 45  ? 0.77205 0.46544 0.52897 0.07572  -0.10982 0.02557  45  ARG A CG  
336  C CD  . ARG A 45  ? 0.84902 0.53161 0.58403 0.09039  -0.12561 0.02846  45  ARG A CD  
337  N NE  . ARG A 45  ? 0.97115 0.60814 0.66938 0.09732  -0.13475 0.03975  45  ARG A NE  
338  C CZ  . ARG A 45  ? 0.98351 0.60469 0.68324 0.11667  -0.14940 0.03754  45  ARG A CZ  
339  N NH1 . ARG A 45  ? 0.90550 0.55853 0.64435 0.13008  -0.15493 0.02499  45  ARG A NH1 
340  N NH2 . ARG A 45  ? 0.93872 0.51301 0.60104 0.12319  -0.15824 0.04879  45  ARG A NH2 
341  N N   . LYS A 46  ? 0.72766 0.54279 0.60184 0.06667  -0.09071 -0.00506 46  LYS A N   
342  C CA  . LYS A 46  ? 0.75499 0.60171 0.65521 0.06224  -0.08733 -0.01167 46  LYS A CA  
343  C C   . LYS A 46  ? 0.75616 0.59898 0.63376 0.05767  -0.08719 -0.01058 46  LYS A C   
344  O O   . LYS A 46  ? 0.76825 0.58953 0.61426 0.06218  -0.09417 -0.00568 46  LYS A O   
345  C CB  . LYS A 46  ? 0.76288 0.63158 0.69377 0.07319  -0.09925 -0.01791 46  LYS A CB  
346  C CG  . LYS A 46  ? 0.74688 0.62742 0.70266 0.08006  -0.09651 -0.01952 46  LYS A CG  
347  C CD  . LYS A 46  ? 0.75443 0.66567 0.74620 0.08895  -0.10626 -0.02373 46  LYS A CD  
348  C CE  . LYS A 46  ? 0.78778 0.71456 0.80248 0.09870  -0.10122 -0.02472 46  LYS A CE  
349  N NZ  . LYS A 46  ? 0.79841 0.75709 0.84785 0.10975  -0.11123 -0.02643 46  LYS A NZ  
350  N N   . PRO A 47  ? 0.73723 0.59879 0.62681 0.05026  -0.07888 -0.01476 47  PRO A N   
351  C CA  . PRO A 47  ? 0.64314 0.50120 0.50897 0.04954  -0.07835 -0.01562 47  PRO A CA  
352  C C   . PRO A 47  ? 0.67461 0.53181 0.53868 0.05955  -0.09663 -0.02255 47  PRO A C   
353  O O   . PRO A 47  ? 0.65363 0.52508 0.54820 0.06278  -0.10690 -0.02828 47  PRO A O   
354  C CB  . PRO A 47  ? 0.66219 0.54091 0.54607 0.04185  -0.06580 -0.01970 47  PRO A CB  
355  C CG  . PRO A 47  ? 0.63232 0.52847 0.55543 0.04110  -0.06726 -0.02361 47  PRO A CG  
356  C CD  . PRO A 47  ? 0.68002 0.56519 0.60227 0.04415  -0.06969 -0.01880 47  PRO A CD  
357  N N   . VAL A 48  ? 0.76178 0.60338 0.58942 0.06412  -0.10118 -0.02155 48  VAL A N   
358  C CA  . VAL A 48  ? 0.84204 0.68176 0.66536 0.07320  -0.12089 -0.03005 48  VAL A CA  
359  C C   . VAL A 48  ? 0.86097 0.70213 0.66890 0.07299  -0.11771 -0.03782 48  VAL A C   
360  O O   . VAL A 48  ? 0.86882 0.70716 0.65308 0.07036  -0.10136 -0.03333 48  VAL A O   
361  C CB  . VAL A 48  ? 0.97134 0.78914 0.76274 0.08336  -0.13468 -0.02465 48  VAL A CB  
362  C CG1 . VAL A 48  ? 1.06274 0.87440 0.86482 0.08499  -0.13432 -0.01637 48  VAL A CG1 
363  C CG2 . VAL A 48  ? 0.99538 0.79469 0.73990 0.08340  -0.12524 -0.01723 48  VAL A CG2 
364  N N   . PRO A 49  ? 0.84917 0.69603 0.67266 0.07534  -0.13245 -0.04951 49  PRO A N   
365  C CA  . PRO A 49  ? 0.84182 0.68584 0.65078 0.07700  -0.13069 -0.05916 49  PRO A CA  
366  C C   . PRO A 49  ? 0.84614 0.67282 0.60162 0.08592  -0.12740 -0.05807 49  PRO A C   
367  O O   . PRO A 49  ? 0.94951 0.76206 0.67800 0.09220  -0.13687 -0.05338 49  PRO A O   
368  C CB  . PRO A 49  ? 0.75061 0.59494 0.57973 0.07812  -0.15453 -0.07104 49  PRO A CB  
369  C CG  . PRO A 49  ? 0.63887 0.50159 0.51316 0.07189  -0.15824 -0.06572 49  PRO A CG  
370  C CD  . PRO A 49  ? 0.67370 0.53201 0.53377 0.07540  -0.15065 -0.05410 49  PRO A CD  
371  N N   . ALA A 50  ? 0.92891 0.75803 0.66847 0.08777  -0.11313 -0.06164 50  ALA A N   
372  C CA  . ALA A 50  ? 1.05979 0.87928 0.74936 0.09631  -0.10353 -0.05834 50  ALA A CA  
373  C C   . ALA A 50  ? 1.02460 0.82358 0.67746 0.10990  -0.12455 -0.07000 50  ALA A C   
374  O O   . ALA A 50  ? 1.02260 0.81607 0.68759 0.11266  -0.14275 -0.08498 50  ALA A O   
375  C CB  . ALA A 50  ? 1.06730 0.90150 0.75476 0.09668  -0.08148 -0.05941 50  ALA A CB  
376  N N   . GLU A 51  ? 1.00554 0.79136 0.61222 0.11757  -0.12341 -0.06254 51  GLU A N   
377  C CA  . GLU A 51  ? 1.19657 0.96170 0.76202 0.13199  -0.14410 -0.07378 51  GLU A CA  
378  C C   . GLU A 51  ? 1.22655 0.98895 0.77227 0.14208  -0.14095 -0.08962 51  GLU A C   
379  O O   . GLU A 51  ? 1.18854 0.96384 0.72490 0.14370  -0.11574 -0.08526 51  GLU A O   
380  C CB  . GLU A 51  ? 1.19720 0.94772 0.71139 0.13940  -0.14183 -0.06073 51  GLU A CB  
381  C CG  . GLU A 51  ? 1.38761 1.12649 0.90873 0.13936  -0.16495 -0.05601 51  GLU A CG  
382  C CD  . GLU A 51  ? 1.72286 1.43841 1.18723 0.15437  -0.18194 -0.05628 51  GLU A CD  
383  O OE1 . GLU A 51  ? 1.85614 1.56400 1.26980 0.16183  -0.16699 -0.04977 51  GLU A OE1 
384  O OE2 . GLU A 51  ? 1.83972 1.54687 1.31017 0.15922  -0.21035 -0.06249 51  GLU A OE2 
385  N N   . PRO A 52  ? 1.26201 1.00898 0.80520 0.14858  -0.16624 -0.10850 52  PRO A N   
386  C CA  . PRO A 52  ? 1.23566 0.97252 0.75488 0.16076  -0.16604 -0.12578 52  PRO A CA  
387  C C   . PRO A 52  ? 1.18149 0.91132 0.63621 0.17836  -0.15235 -0.12466 52  PRO A C   
388  O O   . PRO A 52  ? 1.10429 0.82714 0.52414 0.18265  -0.15414 -0.11467 52  PRO A O   
389  C CB  . PRO A 52  ? 1.27869 0.99346 0.80119 0.16266  -0.20200 -0.14458 52  PRO A CB  
390  C CG  . PRO A 52  ? 1.33284 1.06030 0.90783 0.14612  -0.21468 -0.13596 52  PRO A CG  
391  C CD  . PRO A 52  ? 1.32952 1.06997 0.90020 0.14314  -0.19673 -0.11483 52  PRO A CD  
392  N N   . TRP A 53  ? 1.23956 0.97165 0.67766 0.18990  -0.13828 -0.13448 53  TRP A N   
393  C CA  . TRP A 53  ? 1.34430 1.07680 0.72383 0.20870  -0.12023 -0.13380 53  TRP A CA  
394  C C   . TRP A 53  ? 1.41511 1.12272 0.75793 0.22975  -0.13509 -0.15985 53  TRP A C   
395  O O   . TRP A 53  ? 1.32431 1.01575 0.69264 0.22696  -0.15592 -0.17664 53  TRP A O   
396  C CB  . TRP A 53  ? 1.39121 1.15795 0.78572 0.20538  -0.08310 -0.11910 53  TRP A CB  
397  C CG  . TRP A 53  ? 1.38377 1.16151 0.82070 0.20314  -0.07797 -0.12894 53  TRP A CG  
398  C CD1 . TRP A 53  ? 1.28518 1.05538 0.70494 0.22180  -0.07719 -0.14754 53  TRP A CD1 
399  C CD2 . TRP A 53  ? 1.32268 1.11794 0.82261 0.18281  -0.07397 -0.12068 53  TRP A CD2 
400  N NE1 . TRP A 53  ? 1.26913 1.05032 0.73805 0.21368  -0.07341 -0.15002 53  TRP A NE1 
401  C CE2 . TRP A 53  ? 1.32830 1.12618 0.84644 0.18949  -0.07096 -0.13348 53  TRP A CE2 
402  C CE3 . TRP A 53  ? 1.33104 1.13804 0.87038 0.16151  -0.07297 -0.10423 53  TRP A CE3 
403  C CZ2 . TRP A 53  ? 1.28367 1.09707 0.85773 0.17447  -0.06667 -0.12883 53  TRP A CZ2 
404  C CZ3 . TRP A 53  ? 1.31808 1.14094 0.91183 0.14744  -0.06839 -0.10127 53  TRP A CZ3 
405  C CH2 . TRP A 53  ? 1.29145 1.11809 0.90181 0.15348  -0.06516 -0.11284 53  TRP A CH2 
406  N N   . HIS A 54  ? 1.61351 1.31658 0.89416 0.25118  -0.12411 -0.16294 54  HIS A N   
407  C CA  . HIS A 54  ? 1.77029 1.45633 1.01648 0.27464  -0.12738 -0.18671 54  HIS A CA  
408  C C   . HIS A 54  ? 1.53732 1.24663 0.74176 0.29386  -0.09272 -0.17962 54  HIS A C   
409  O O   . HIS A 54  ? 1.43216 1.16189 0.61818 0.29062  -0.07237 -0.15792 54  HIS A O   
410  C CB  . HIS A 54  ? 2.07173 1.71692 1.28009 0.28630  -0.16290 -0.20795 54  HIS A CB  
411  C CG  . HIS A 54  ? 2.28629 1.90831 1.51343 0.29052  -0.18130 -0.23071 54  HIS A CG  
412  N ND1 . HIS A 54  ? 2.35100 1.97722 1.57097 0.30736  -0.16335 -0.23916 54  HIS A ND1 
413  C CD2 . HIS A 54  ? 2.33293 1.92837 1.58886 0.27886  -0.21556 -0.24460 54  HIS A CD2 
414  C CE1 . HIS A 54  ? 2.37328 1.97099 1.61206 0.30677  -0.18680 -0.25747 54  HIS A CE1 
415  N NE2 . HIS A 54  ? 2.34862 1.92785 1.61033 0.28815  -0.21815 -0.26049 54  HIS A NE2 
416  N N   . GLY A 55  ? 1.47443 1.18300 0.67362 0.31157  -0.08579 -0.19543 55  GLY A N   
417  C CA  . GLY A 55  ? 1.51529 1.26077 0.70670 0.32472  -0.04870 -0.18606 55  GLY A CA  
418  C C   . GLY A 55  ? 1.42280 1.18915 0.66312 0.31804  -0.03623 -0.18628 55  GLY A C   
419  O O   . GLY A 55  ? 1.35982 1.13032 0.65567 0.29132  -0.04449 -0.17620 55  GLY A O   
420  N N   . VAL A 56  ? 1.44993 1.23409 0.69259 0.33615  -0.01800 -0.19279 56  VAL A N   
421  C CA  . VAL A 56  ? 1.34582 1.15553 0.63772 0.33056  -0.00380 -0.19000 56  VAL A CA  
422  C C   . VAL A 56  ? 1.22816 1.08480 0.55851 0.30553  0.02154  -0.15905 56  VAL A C   
423  O O   . VAL A 56  ? 1.23622 1.12216 0.54099 0.30959  0.04623  -0.14324 56  VAL A O   
424  C CB  . VAL A 56  ? 1.51885 1.34292 0.80562 0.35653  0.01159  -0.20001 56  VAL A CB  
425  C CG1 . VAL A 56  ? 1.57974 1.35725 0.83241 0.37495  -0.01443 -0.22249 56  VAL A CG1 
426  C CG2 . VAL A 56  ? 1.60661 1.48312 0.88317 0.36500  0.04852  -0.18133 56  VAL A CG2 
427  N N   . LEU A 57  ? 1.18363 1.04403 0.57261 0.27815  0.01362  -0.14969 57  LEU A N   
428  C CA  . LEU A 57  ? 1.09392 0.99440 0.52286 0.25376  0.03485  -0.12287 57  LEU A CA  
429  C C   . LEU A 57  ? 1.13446 1.07744 0.59431 0.25914  0.05990  -0.11858 57  LEU A C   
430  O O   . LEU A 57  ? 1.09100 1.02712 0.57704 0.26476  0.05173  -0.13164 57  LEU A O   
431  C CB  . LEU A 57  ? 1.06309 0.94968 0.53825 0.22553  0.01581  -0.11643 57  LEU A CB  
432  C CG  . LEU A 57  ? 1.04168 0.95851 0.55605 0.19871  0.03131  -0.09106 57  LEU A CG  
433  C CD1 . LEU A 57  ? 0.99671 0.88932 0.51233 0.18126  0.01268  -0.08345 57  LEU A CD1 
434  C CD2 . LEU A 57  ? 1.02343 0.95999 0.59516 0.18694  0.03543  -0.08949 57  LEU A CD2 
435  N N   . ASP A 58  ? 1.17265 1.15987 0.62901 0.25763  0.08972  -0.09955 58  ASP A N   
436  C CA  . ASP A 58  ? 1.18098 1.21826 0.67219 0.25987  0.11467  -0.09175 58  ASP A CA  
437  C C   . ASP A 58  ? 1.13489 1.18115 0.68975 0.23458  0.10850  -0.08451 58  ASP A C   
438  O O   . ASP A 58  ? 1.12778 1.18994 0.70902 0.20737  0.11423  -0.06443 58  ASP A O   
439  C CB  . ASP A 58  ? 1.11523 1.20000 0.59593 0.25526  0.14602  -0.06828 58  ASP A CB  
440  C CG  . ASP A 58  ? 1.18968 1.33276 0.70146 0.26273  0.17265  -0.06174 58  ASP A CG  
441  O OD1 . ASP A 58  ? 1.31883 1.47110 0.80932 0.29499  0.18026  -0.07744 58  ASP A OD1 
442  O OD2 . ASP A 58  ? 1.20544 1.38534 0.76231 0.23739  0.18511  -0.04144 58  ASP A OD2 
443  N N   . ALA A 59  ? 1.05784 1.09056 0.63458 0.24369  0.09591  -0.10069 59  ALA A N   
444  C CA  . ALA A 59  ? 1.05078 1.09625 0.68472 0.22322  0.09272  -0.09357 59  ALA A CA  
445  C C   . ALA A 59  ? 1.06382 1.15222 0.72241 0.23650  0.11135  -0.09296 59  ALA A C   
446  O O   . ALA A 59  ? 1.10559 1.18456 0.78684 0.24341  0.10157  -0.10343 59  ALA A O   
447  C CB  . ALA A 59  ? 0.99448 0.99335 0.64061 0.21879  0.06350  -0.10806 59  ALA A CB  
448  N N   . THR A 60  ? 1.00091 1.13777 0.65497 0.24069  0.13814  -0.07978 60  THR A N   
449  C CA  . THR A 60  ? 0.88035 1.06759 0.55824 0.25519  0.15792  -0.07770 60  THR A CA  
450  C C   . THR A 60  ? 0.90911 1.15173 0.62987 0.22939  0.17671  -0.05315 60  THR A C   
451  O O   . THR A 60  ? 1.01224 1.29994 0.76536 0.23616  0.18926  -0.05007 60  THR A O   
452  C CB  . THR A 60  ? 0.97479 1.17935 0.60920 0.29029  0.17528  -0.08643 60  THR A CB  
453  O OG1 . THR A 60  ? 0.97821 1.21462 0.59427 0.28135  0.19678  -0.06759 60  THR A OG1 
454  C CG2 . THR A 60  ? 0.94165 1.08559 0.52444 0.31495  0.15470  -0.11160 60  THR A CG2 
455  N N   . GLY A 61  ? 0.87020 1.10944 0.59212 0.20042  0.17739  -0.03594 61  GLY A N   
456  C CA  . GLY A 61  ? 0.86296 1.14425 0.62583 0.17164  0.18986  -0.01366 61  GLY A CA  
457  C C   . GLY A 61  ? 0.92358 1.17835 0.71907 0.14520  0.16998  -0.01163 61  GLY A C   
458  O O   . GLY A 61  ? 0.87617 1.08239 0.66225 0.14664  0.14840  -0.02438 61  GLY A O   
459  N N   . LEU A 62  ? 0.92487 1.21424 0.75971 0.12065  0.17752  0.00484  62  LEU A N   
460  C CA  . LEU A 62  ? 0.84930 1.11457 0.71067 0.09594  0.16038  0.00755  62  LEU A CA  
461  C C   . LEU A 62  ? 0.78885 1.02061 0.62873 0.07579  0.15410  0.01756  62  LEU A C   
462  O O   . LEU A 62  ? 0.71509 0.95789 0.53336 0.07000  0.16759  0.03114  62  LEU A O   
463  C CB  . LEU A 62  ? 0.79843 1.10817 0.70712 0.07750  0.16721  0.01935  62  LEU A CB  
464  C CG  . LEU A 62  ? 0.92143 1.26878 0.85530 0.09760  0.17268  0.01129  62  LEU A CG  
465  C CD1 . LEU A 62  ? 0.83855 1.21887 0.81933 0.07732  0.17134  0.02049  62  LEU A CD1 
466  C CD2 . LEU A 62  ? 1.04142 1.34873 0.96261 0.12138  0.15642  -0.00976 62  LEU A CD2 
467  N N   . SER A 63  ? 0.83110 1.02247 0.67691 0.06592  0.13382  0.01172  63  SER A N   
468  C CA  . SER A 63  ? 0.73414 0.89114 0.56154 0.04960  0.12520  0.01977  63  SER A CA  
469  C C   . SER A 63  ? 0.78387 0.95567 0.63520 0.02049  0.13014  0.03787  63  SER A C   
470  O O   . SER A 63  ? 0.79213 1.00132 0.67697 0.01144  0.13814  0.04320  63  SER A O   
471  C CB  . SER A 63  ? 0.73880 0.85096 0.56502 0.05224  0.10203  0.00642  63  SER A CB  
472  O OG  . SER A 63  ? 0.91732 1.02582 0.77480 0.03272  0.09435  0.01103  63  SER A OG  
473  N N   . ALA A 64  ? 0.77100 0.91034 0.60386 0.00623  0.12313  0.04675  64  ALA A N   
474  C CA  . ALA A 64  ? 0.77480 0.91623 0.62229 -0.02178 0.12510  0.06374  64  ALA A CA  
475  C C   . ALA A 64  ? 0.81130 0.94657 0.69322 -0.03239 0.11203  0.05736  64  ALA A C   
476  O O   . ALA A 64  ? 0.91690 1.03965 0.80730 -0.01919 0.10055  0.04178  64  ALA A O   
477  C CB  . ALA A 64  ? 0.70642 0.80658 0.52012 -0.03010 0.11861  0.07347  64  ALA A CB  
478  N N   . THR A 65  ? 0.79646 0.93974 0.69697 -0.05710 0.11345  0.07001  65  THR A N   
479  C CA  . THR A 65  ? 0.79642 0.92762 0.72212 -0.06817 0.09987  0.06461  65  THR A CA  
480  C C   . THR A 65  ? 0.70492 0.78742 0.61219 -0.07953 0.08697  0.06862  65  THR A C   
481  O O   . THR A 65  ? 0.75739 0.82785 0.64695 -0.09397 0.09114  0.08374  65  THR A O   
482  C CB  . THR A 65  ? 0.92980 1.10004 0.88875 -0.08717 0.10627  0.07313  65  THR A CB  
483  O OG1 . THR A 65  ? 0.96610 1.18342 0.94406 -0.07283 0.11723  0.06845  65  THR A OG1 
484  C CG2 . THR A 65  ? 0.90882 1.06142 0.88707 -0.09823 0.09061  0.06682  65  THR A CG2 
485  N N   . CYS A 66  ? 0.60959 0.66465 0.52057 -0.07205 0.07183  0.05597  66  CYS A N   
486  C CA  . CYS A 66  ? 0.59944 0.61021 0.49623 -0.07912 0.05866  0.05760  66  CYS A CA  
487  C C   . CYS A 66  ? 0.67275 0.67887 0.57744 -0.10453 0.05799  0.06913  66  CYS A C   
488  O O   . CYS A 66  ? 0.66271 0.69920 0.59370 -0.11584 0.06195  0.07023  66  CYS A O   
489  C CB  . CYS A 66  ? 0.58167 0.57613 0.48911 -0.06671 0.04525  0.04227  66  CYS A CB  
490  S SG  . CYS A 66  ? 0.79144 0.77653 0.68665 -0.04119 0.03946  0.02973  66  CYS A SG  
491  N N   . VAL A 67  ? 0.73949 0.70533 0.62028 -0.11357 0.05131  0.07786  67  VAL A N   
492  C CA  . VAL A 67  ? 0.80422 0.75995 0.68646 -0.14027 0.05073  0.09168  67  VAL A CA  
493  C C   . VAL A 67  ? 0.81874 0.77848 0.72716 -0.14926 0.04174  0.08276  67  VAL A C   
494  O O   . VAL A 67  ? 0.78645 0.72831 0.69722 -0.13600 0.03074  0.06828  67  VAL A O   
495  C CB  . VAL A 67  ? 0.80982 0.71132 0.65861 -0.14513 0.04162  0.10076  67  VAL A CB  
496  C CG1 . VAL A 67  ? 0.78934 0.67291 0.63937 -0.17457 0.03818  0.11437  67  VAL A CG1 
497  C CG2 . VAL A 67  ? 0.76383 0.66253 0.58286 -0.13688 0.05055  0.11143  67  VAL A CG2 
498  N N   . GLN A 68  ? 0.86677 0.85376 0.79564 -0.17151 0.04664  0.09165  68  GLN A N   
499  C CA  . GLN A 68  ? 0.80115 0.79236 0.75251 -0.18269 0.03655  0.08417  68  GLN A CA  
500  C C   . GLN A 68  ? 0.90385 0.91718 0.87170 -0.21344 0.04029  0.09956  68  GLN A C   
501  O O   . GLN A 68  ? 0.95826 0.99056 0.92337 -0.22424 0.05359  0.11639  68  GLN A O   
502  C CB  . GLN A 68  ? 0.72102 0.74883 0.69654 -0.16503 0.03833  0.06955  68  GLN A CB  
503  C CG  . GLN A 68  ? 0.78397 0.86440 0.77519 -0.15789 0.05477  0.07372  68  GLN A CG  
504  C CD  . GLN A 68  ? 0.77026 0.87457 0.77762 -0.13575 0.05503  0.05906  68  GLN A CD  
505  O OE1 . GLN A 68  ? 0.77776 0.91456 0.81109 -0.13908 0.05436  0.05600  68  GLN A OE1 
506  N NE2 . GLN A 68  ? 0.62896 0.71641 0.62096 -0.11357 0.05472  0.05054  68  GLN A NE2 
507  N N   . GLU A 69  ? 0.91498 0.92670 0.89976 -0.22786 0.02805  0.09397  69  GLU A N   
508  C CA  . GLU A 69  ? 0.88587 0.92061 0.89260 -0.25953 0.02715  0.10636  69  GLU A CA  
509  C C   . GLU A 69  ? 0.77060 0.86855 0.81533 -0.25698 0.03190  0.10094  69  GLU A C   
510  O O   . GLU A 69  ? 0.83080 0.93690 0.88148 -0.23508 0.02819  0.08464  69  GLU A O   
511  C CB  . GLU A 69  ? 0.91639 0.89992 0.91266 -0.27924 0.00620  0.10327  69  GLU A CB  
512  C CG  . GLU A 69  ? 1.16095 1.08148 1.12067 -0.28599 0.00090  0.11261  69  GLU A CG  
513  C CD  . GLU A 69  ? 1.36520 1.29916 1.32390 -0.30906 0.01417  0.13816  69  GLU A CD  
514  O OE1 . GLU A 69  ? 1.36604 1.33349 1.35169 -0.33784 0.01623  0.15029  69  GLU A OE1 
515  O OE2 . GLU A 69  ? 1.46535 1.37882 1.39672 -0.29856 0.02251  0.14684  69  GLU A OE2 
516  N N   . ARG A 70  ? 0.75491 0.89934 0.82608 -0.27911 0.04035  0.11593  70  ARG A N   
517  C CA  . ARG A 70  ? 0.83278 1.04223 0.94224 -0.27595 0.04492  0.11250  70  ARG A CA  
518  C C   . ARG A 70  ? 0.89617 1.10828 1.02709 -0.30041 0.02640  0.10970  70  ARG A C   
519  O O   . ARG A 70  ? 0.97751 1.17175 1.10924 -0.33216 0.01867  0.12152  70  ARG A O   
520  C CB  . ARG A 70  ? 0.86734 1.13845 0.99766 -0.28081 0.06687  0.12962  70  ARG A CB  
521  C CG  . ARG A 70  ? 0.93621 1.20794 1.06791 -0.31497 0.07234  0.15316  70  ARG A CG  
522  C CD  . ARG A 70  ? 0.96995 1.30101 1.11331 -0.31059 0.09884  0.16928  70  ARG A CD  
523  N NE  . ARG A 70  ? 0.90918 1.24915 1.03731 -0.27093 0.11038  0.15652  70  ARG A NE  
524  C CZ  . ARG A 70  ? 0.80945 1.20789 0.96233 -0.25047 0.12119  0.15046  70  ARG A CZ  
525  N NH1 . ARG A 70  ? 0.78545 1.24387 0.98162 -0.26491 0.12279  0.15665  70  ARG A NH1 
526  N NH2 . ARG A 70  ? 0.79322 1.18915 0.92786 -0.21555 0.12888  0.13806  70  ARG A NH2 
527  N N   . TYR A 71  ? 0.88840 1.11988 1.03454 -0.28598 0.01805  0.09429  71  TYR A N   
528  C CA  . TYR A 71  ? 0.90356 1.14750 1.07211 -0.30684 0.00016  0.09073  71  TYR A CA  
529  C C   . TYR A 71  ? 0.78955 1.10316 1.00042 -0.32887 0.00861  0.10713  71  TYR A C   
530  O O   . TYR A 71  ? 0.75705 1.12926 0.99060 -0.31188 0.02442  0.10961  71  TYR A O   
531  C CB  . TYR A 71  ? 0.96248 1.21241 1.13378 -0.28278 -0.00943 0.07147  71  TYR A CB  
532  C CG  . TYR A 71  ? 0.90900 1.09597 1.04254 -0.26287 -0.01779 0.05614  71  TYR A CG  
533  C CD1 . TYR A 71  ? 0.76271 0.93766 0.87849 -0.23459 -0.00530 0.05195  71  TYR A CD1 
534  C CD2 . TYR A 71  ? 0.98423 1.12522 1.10030 -0.27208 -0.03869 0.04556  71  TYR A CD2 
535  C CE1 . TYR A 71  ? 0.77718 0.90217 0.86383 -0.21721 -0.01228 0.03938  71  TYR A CE1 
536  C CE2 . TYR A 71  ? 0.92567 1.01492 1.00884 -0.25163 -0.04452 0.03190  71  TYR A CE2 
537  C CZ  . TYR A 71  ? 0.92045 1.00491 0.99153 -0.22493 -0.03072 0.02978  71  TYR A CZ  
538  O OH  . TYR A 71  ? 1.04342 1.08333 1.08676 -0.20542 -0.03586 0.01760  71  TYR A OH  
539  N N   . GLU A 72  ? 0.74161 1.04886 0.96335 -0.36646 -0.00174 0.11887  72  GLU A N   
540  C CA  . GLU A 72  ? 0.79548 1.17193 1.06285 -0.39260 0.00377  0.13571  72  GLU A CA  
541  C C   . GLU A 72  ? 0.80020 1.18343 1.09119 -0.41741 -0.02219 0.12963  72  GLU A C   
542  O O   . GLU A 72  ? 0.85677 1.25141 1.16756 -0.44210 -0.02695 0.14032  72  GLU A O   
543  C CB  . GLU A 72  ? 0.98619 1.35904 1.25123 -0.42021 0.01660  0.16016  72  GLU A CB  
544  C CG  . GLU A 72  ? 1.07463 1.43972 1.31237 -0.39719 0.04105  0.16708  72  GLU A CG  
545  C CD  . GLU A 72  ? 1.08643 1.53073 1.35095 -0.37662 0.06570  0.17271  72  GLU A CD  
546  O OE1 . GLU A 72  ? 1.05434 1.55669 1.35701 -0.37175 0.06336  0.16756  72  GLU A OE1 
547  O OE2 . GLU A 72  ? 1.09414 1.53890 1.33804 -0.36208 0.08649  0.18106  72  GLU A OE2 
548  N N   . TYR A 73  ? 0.80632 1.17019 1.08641 -0.39737 -0.03861 0.10780  73  TYR A N   
549  C CA  . TYR A 73  ? 0.80985 1.17672 1.10662 -0.41801 -0.06557 0.09956  73  TYR A CA  
550  C C   . TYR A 73  ? 0.72053 1.16903 1.06795 -0.42178 -0.06206 0.10678  73  TYR A C   
551  O O   . TYR A 73  ? 0.66812 1.12010 1.03269 -0.44182 -0.07992 0.10583  73  TYR A O   
552  C CB  . TYR A 73  ? 0.83561 1.16583 1.10500 -0.39020 -0.08099 0.07499  73  TYR A CB  
553  C CG  . TYR A 73  ? 0.95528 1.19612 1.17274 -0.38340 -0.09008 0.06350  73  TYR A CG  
554  C CD1 . TYR A 73  ? 0.98350 1.18882 1.17353 -0.37118 -0.07316 0.06913  73  TYR A CD1 
555  C CD2 . TYR A 73  ? 0.99873 1.19212 1.19332 -0.38641 -0.11606 0.04611  73  TYR A CD2 
556  C CE1 . TYR A 73  ? 1.03138 1.15926 1.17650 -0.36225 -0.08181 0.05858  73  TYR A CE1 
557  C CE2 . TYR A 73  ? 1.01072 1.12536 1.15801 -0.37634 -0.12347 0.03478  73  TYR A CE2 
558  C CZ  . TYR A 73  ? 1.06169 1.14549 1.18641 -0.36424 -0.10624 0.04146  73  TYR A CZ  
559  O OH  . TYR A 73  ? 1.12085 1.13060 1.20138 -0.35237 -0.11405 0.03045  73  TYR A OH  
560  N N   . PHE A 74  ? 0.70035 1.20989 1.06906 -0.39855 -0.03922 0.11251  74  PHE A N   
561  C CA  . PHE A 74  ? 0.73602 1.32086 1.14946 -0.39331 -0.03294 0.11834  74  PHE A CA  
562  C C   . PHE A 74  ? 0.79217 1.41421 1.21610 -0.38626 -0.00251 0.13562  74  PHE A C   
563  O O   . PHE A 74  ? 0.70638 1.36218 1.13241 -0.35596 0.01618  0.13430  74  PHE A O   
564  C CB  . PHE A 74  ? 0.74977 1.37229 1.17600 -0.36405 -0.03794 0.10448  74  PHE A CB  
565  C CG  . PHE A 74  ? 0.75391 1.33582 1.16060 -0.36651 -0.06584 0.08677  74  PHE A CG  
566  C CD1 . PHE A 74  ? 0.73344 1.25712 1.09611 -0.34314 -0.06575 0.07318  74  PHE A CD1 
567  C CD2 . PHE A 74  ? 0.64827 1.23440 1.07016 -0.38285 -0.09066 0.08076  74  PHE A CD2 
568  C CE1 . PHE A 74  ? 0.67734 1.15515 1.01357 -0.33763 -0.08850 0.05547  74  PHE A CE1 
569  C CE2 . PHE A 74  ? 0.63757 1.18342 1.03554 -0.38326 -0.11661 0.06344  74  PHE A CE2 
570  C CZ  . PHE A 74  ? 0.66821 1.15970 1.02196 -0.35951 -0.11458 0.05078  74  PHE A CZ  
571  N N   . PRO A 75  ? 0.92003 1.53469 1.34810 -0.41261 0.00285  0.15167  75  PRO A N   
572  C CA  . PRO A 75  ? 0.89845 1.54475 1.33075 -0.40647 0.03230  0.16885  75  PRO A CA  
573  C C   . PRO A 75  ? 0.80576 1.53300 1.27572 -0.38395 0.04698  0.17049  75  PRO A C   
574  O O   . PRO A 75  ? 0.79517 1.56396 1.30210 -0.39392 0.03743  0.17160  75  PRO A O   
575  C CB  . PRO A 75  ? 0.95538 1.58139 1.39113 -0.44340 0.02918  0.18526  75  PRO A CB  
576  C CG  . PRO A 75  ? 0.97196 1.53322 1.38999 -0.46558 -0.00134 0.17457  75  PRO A CG  
577  C CD  . PRO A 75  ? 0.99770 1.57601 1.42689 -0.44864 -0.01834 0.15476  75  PRO A CD  
578  N N   . GLY A 76  ? 0.72951 1.47680 1.18836 -0.35195 0.06922  0.16958  76  GLY A N   
579  C CA  . GLY A 76  ? 0.78640 1.60272 1.27357 -0.32490 0.08436  0.16963  76  GLY A CA  
580  C C   . GLY A 76  ? 0.82591 1.66065 1.32169 -0.29584 0.07405  0.15210  76  GLY A C   
581  O O   . GLY A 76  ? 0.92384 1.80407 1.43227 -0.26492 0.08811  0.14975  76  GLY A O   
582  N N   . PHE A 77  ? 0.67820 1.47704 1.16523 -0.30351 0.04960  0.13963  77  PHE A N   
583  C CA  . PHE A 77  ? 0.53863 1.35144 1.02983 -0.27520 0.03982  0.12402  77  PHE A CA  
584  C C   . PHE A 77  ? 0.54487 1.34459 1.00870 -0.24195 0.05658  0.11774  77  PHE A C   
585  O O   . PHE A 77  ? 0.55075 1.30039 0.98183 -0.24666 0.05776  0.11557  77  PHE A O   
586  C CB  . PHE A 77  ? 0.60027 1.37307 1.08182 -0.29102 0.01054  0.11219  77  PHE A CB  
587  C CG  . PHE A 77  ? 0.55728 1.34411 1.04188 -0.26353 -0.00111 0.09758  77  PHE A CG  
588  C CD1 . PHE A 77  ? 0.49576 1.23766 0.95131 -0.25787 -0.01391 0.08488  77  PHE A CD1 
589  C CD2 . PHE A 77  ? 0.61735 1.46194 1.13303 -0.24286 0.00052  0.09717  77  PHE A CD2 
590  C CE1 . PHE A 77  ? 0.50467 1.25025 0.95643 -0.22952 -0.02419 0.07196  77  PHE A CE1 
591  C CE2 . PHE A 77  ? 0.61754 1.47135 1.13324 -0.21655 -0.01105 0.08508  77  PHE A CE2 
592  C CZ  . PHE A 77  ? 0.54076 1.34927 1.02627 -0.21132 -0.02340 0.07343  77  PHE A CZ  
593  N N   . SER A 78  ? 0.56819 1.41083 1.04459 -0.20791 0.06886  0.11450  78  SER A N   
594  C CA  . SER A 78  ? 0.53009 1.35912 0.98013 -0.17430 0.08413  0.10746  78  SER A CA  
595  C C   . SER A 78  ? 0.55147 1.33010 0.97523 -0.16650 0.06924  0.09337  78  SER A C   
596  O O   . SER A 78  ? 0.65563 1.37886 1.03943 -0.15286 0.07624  0.08747  78  SER A O   
597  C CB  . SER A 78  ? 0.54627 1.42278 1.01250 -0.13763 0.09507  0.10396  78  SER A CB  
598  O OG  . SER A 78  ? 0.69647 1.57094 1.16370 -0.11424 0.08121  0.09084  78  SER A OG  
599  N N   . GLY A 79  ? 0.49098 1.26666 0.92522 -0.17171 0.04622  0.08549  79  GLY A N   
600  C CA  . GLY A 79  ? 0.33743 1.04866 0.73623 -0.15709 0.03165  0.07001  79  GLY A CA  
601  C C   . GLY A 79  ? 0.49040 1.12623 0.84921 -0.17205 0.02819  0.06691  79  GLY A C   
602  O O   . GLY A 79  ? 0.49649 1.07981 0.82181 -0.15341 0.02570  0.05601  79  GLY A O   
603  N N   . GLU A 80  ? 0.56517 1.19459 0.92760 -0.20567 0.02753  0.07716  80  GLU A N   
604  C CA  . GLU A 80  ? 0.66359 1.22066 0.98687 -0.21706 0.02470  0.07489  80  GLU A CA  
605  C C   . GLU A 80  ? 0.70720 1.24838 1.00827 -0.20417 0.04631  0.08010  80  GLU A C   
606  O O   . GLU A 80  ? 0.71722 1.20099 0.98200 -0.19166 0.04592  0.07203  80  GLU A O   
607  C CB  . GLU A 80  ? 0.65304 1.19812 0.98335 -0.25809 0.01262  0.08354  80  GLU A CB  
608  C CG  . GLU A 80  ? 0.59595 1.06689 0.88553 -0.26861 0.01100  0.08317  80  GLU A CG  
609  C CD  . GLU A 80  ? 0.75657 1.21081 1.05134 -0.30948 -0.00136 0.09285  80  GLU A CD  
610  O OE1 . GLU A 80  ? 0.79245 1.29682 1.11985 -0.33251 0.00622  0.10965  80  GLU A OE1 
611  O OE2 . GLU A 80  ? 0.78380 1.17470 1.05001 -0.31844 -0.01861 0.08401  80  GLU A OE2 
612  N N   . GLU A 81  ? 0.80387 1.39670 1.12568 -0.20664 0.06504  0.09362  81  GLU A N   
613  C CA  . GLU A 81  ? 0.98932 1.56267 1.28526 -0.20072 0.08382  0.10041  81  GLU A CA  
614  C C   . GLU A 81  ? 0.82140 1.38999 1.09843 -0.16111 0.09560  0.09014  81  GLU A C   
615  O O   . GLU A 81  ? 0.85085 1.38909 1.09759 -0.15269 0.10657  0.09136  81  GLU A O   
616  C CB  . GLU A 81  ? 1.10733 1.73479 1.42777 -0.22108 0.10086  0.12094  81  GLU A CB  
617  C CG  . GLU A 81  ? 1.23634 1.83634 1.55332 -0.26235 0.09359  0.13447  81  GLU A CG  
618  C CD  . GLU A 81  ? 1.36208 1.93384 1.64768 -0.26657 0.11012  0.14674  81  GLU A CD  
619  O OE1 . GLU A 81  ? 1.40285 1.97090 1.66572 -0.23659 0.12515  0.14206  81  GLU A OE1 
620  O OE2 . GLU A 81  ? 1.43828 1.98709 1.71902 -0.29975 0.10645  0.16083  81  GLU A OE2 
621  N N   . ILE A 82  ? 0.55268 1.14580 0.84426 -0.13682 0.09168  0.07991  82  ILE A N   
622  C CA  . ILE A 82  ? 0.48360 1.05797 0.75301 -0.10085 0.09827  0.06851  82  ILE A CA  
623  C C   . ILE A 82  ? 0.62951 1.13024 0.86162 -0.09632 0.08814  0.05803  82  ILE A C   
624  O O   . ILE A 82  ? 0.70409 1.18031 0.91386 -0.07168 0.09304  0.04993  82  ILE A O   
625  C CB  . ILE A 82  ? 0.46197 1.07274 0.75354 -0.07620 0.09418  0.06086  82  ILE A CB  
626  C CG1 . ILE A 82  ? 0.47229 1.06486 0.76951 -0.08349 0.07217  0.05375  82  ILE A CG1 
627  C CG2 . ILE A 82  ? 0.42428 1.11346 0.75492 -0.07651 0.10522  0.07094  82  ILE A CG2 
628  C CD1 . ILE A 82  ? 0.38237 0.95564 0.66814 -0.05300 0.06614  0.04174  82  ILE A CD1 
629  N N   . TRP A 83  ? 0.62794 1.09344 0.85317 -0.11922 0.07360  0.05771  83  TRP A N   
630  C CA  . TRP A 83  ? 0.69040 1.09011 0.88198 -0.11732 0.06551  0.04988  83  TRP A CA  
631  C C   . TRP A 83  ? 0.49767 0.86668 0.66788 -0.13433 0.07047  0.05828  83  TRP A C   
632  O O   . TRP A 83  ? 0.58597 0.90277 0.72820 -0.13104 0.06490  0.05274  83  TRP A O   
633  C CB  . TRP A 83  ? 0.66601 1.04195 0.85799 -0.12668 0.04612  0.04246  83  TRP A CB  
634  C CG  . TRP A 83  ? 0.64657 1.05081 0.85611 -0.11014 0.04082  0.03607  83  TRP A CG  
635  C CD1 . TRP A 83  ? 0.74247 1.19164 0.98171 -0.11822 0.03394  0.03870  83  TRP A CD1 
636  C CD2 . TRP A 83  ? 0.57796 0.96887 0.77715 -0.08212 0.04132  0.02716  83  TRP A CD2 
637  N NE1 . TRP A 83  ? 0.68840 1.15155 0.93394 -0.09478 0.03011  0.03187  83  TRP A NE1 
638  C CE2 . TRP A 83  ? 0.55639 0.98258 0.77719 -0.07313 0.03494  0.02530  83  TRP A CE2 
639  C CE3 . TRP A 83  ? 0.56367 0.91593 0.73818 -0.06480 0.04530  0.02126  83  TRP A CE3 
640  C CZ2 . TRP A 83  ? 0.52058 0.94055 0.73642 -0.04747 0.03325  0.01884  83  TRP A CZ2 
641  C CZ3 . TRP A 83  ? 0.52982 0.87761 0.70227 -0.04154 0.04332  0.01461  83  TRP A CZ3 
642  C CH2 . TRP A 83  ? 0.55753 0.93692 0.74919 -0.03308 0.03772  0.01395  83  TRP A CH2 
643  N N   . ASN A 84  ? 0.42860 0.82917 0.61185 -0.15248 0.08020  0.07241  84  ASN A N   
644  C CA  . ASN A 84  ? 0.67627 1.04731 0.83639 -0.16738 0.08609  0.08277  84  ASN A CA  
645  C C   . ASN A 84  ? 0.66222 1.03060 0.79958 -0.14427 0.10202  0.08269  84  ASN A C   
646  O O   . ASN A 84  ? 0.61904 1.02099 0.76502 -0.12082 0.11147  0.07763  84  ASN A O   
647  C CB  . ASN A 84  ? 0.68997 1.09585 0.87288 -0.19896 0.09070  0.10068  84  ASN A CB  
648  C CG  . ASN A 84  ? 0.61887 0.99879 0.80793 -0.22745 0.07079  0.10086  84  ASN A CG  
649  O OD1 . ASN A 84  ? 0.66493 0.98544 0.82732 -0.22743 0.05758  0.09226  84  ASN A OD1 
650  N ND2 . ASN A 84  ? 0.56718 0.99184 0.79130 -0.25106 0.06773  0.10999  84  ASN A ND2 
651  N N   . PRO A 85  ? 0.70734 1.03281 0.81284 -0.14871 0.10351  0.08719  85  PRO A N   
652  C CA  . PRO A 85  ? 0.76421 1.08462 0.84384 -0.12731 0.11660  0.08664  85  PRO A CA  
653  C C   . PRO A 85  ? 0.64388 1.02439 0.73767 -0.12237 0.13725  0.09673  85  PRO A C   
654  O O   . PRO A 85  ? 0.55263 0.96748 0.66545 -0.14549 0.14517  0.11300  85  PRO A O   
655  C CB  . PRO A 85  ? 0.76663 1.03780 0.81416 -0.14110 0.11365  0.09506  85  PRO A CB  
656  C CG  . PRO A 85  ? 0.75445 0.98833 0.80510 -0.15762 0.09462  0.09088  85  PRO A CG  
657  C CD  . PRO A 85  ? 0.71039 0.98501 0.79857 -0.17067 0.09101  0.09130  85  PRO A CD  
658  N N   . ASN A 86  ? 0.63193 1.02623 0.71741 -0.09166 0.14567  0.08680  86  ASN A N   
659  C CA  . ASN A 86  ? 0.61718 1.06801 0.71157 -0.07957 0.16652  0.09364  86  ASN A CA  
660  C C   . ASN A 86  ? 0.60638 1.04180 0.66089 -0.06443 0.17957  0.09579  86  ASN A C   
661  O O   . ASN A 86  ? 0.64660 1.12548 0.70095 -0.04870 0.19823  0.09938  86  ASN A O   
662  C CB  . ASN A 86  ? 0.58379 1.06802 0.69948 -0.05278 0.16679  0.08031  86  ASN A CB  
663  C CG  . ASN A 86  ? 0.62134 1.06389 0.70923 -0.02260 0.15956  0.06158  86  ASN A CG  
664  O OD1 . ASN A 86  ? 0.64969 1.03877 0.70729 -0.02293 0.15111  0.05681  86  ASN A OD1 
665  N ND2 . ASN A 86  ? 0.65639 1.12342 0.75575 0.00357  0.16168  0.05116  86  ASN A ND2 
666  N N   . THR A 87  ? 0.64670 1.02267 0.66643 -0.06620 0.16972  0.09275  87  THR A N   
667  C CA  . THR A 87  ? 0.61830 0.97543 0.59744 -0.05958 0.17959  0.09900  87  THR A CA  
668  C C   . THR A 87  ? 0.67056 0.98954 0.63441 -0.08785 0.17314  0.11354  87  THR A C   
669  O O   . THR A 87  ? 0.75816 1.06090 0.74069 -0.10998 0.15995  0.11585  87  THR A O   
670  C CB  . THR A 87  ? 0.61512 0.93309 0.56106 -0.02956 0.17161  0.08002  87  THR A CB  
671  O OG1 . THR A 87  ? 0.69704 0.95974 0.63419 -0.03540 0.15052  0.07182  87  THR A OG1 
672  C CG2 . THR A 87  ? 0.55185 0.89469 0.51195 -0.00223 0.17310  0.06390  87  THR A CG2 
673  N N   . ASN A 88  ? 0.78140 1.08353 0.70763 -0.08535 0.18188  0.12305  88  ASN A N   
674  C CA  . ASN A 88  ? 0.80892 1.07317 0.71599 -0.11024 0.17692  0.13920  88  ASN A CA  
675  C C   . ASN A 88  ? 0.81405 1.01844 0.71310 -0.11121 0.15240  0.12654  88  ASN A C   
676  O O   . ASN A 88  ? 0.76354 0.94696 0.65380 -0.08810 0.14197  0.10740  88  ASN A O   
677  C CB  . ASN A 88  ? 0.96238 1.21647 0.82446 -0.10191 0.18983  0.15045  88  ASN A CB  
678  C CG  . ASN A 88  ? 1.09818 1.40511 0.96748 -0.11675 0.21506  0.17452  88  ASN A CG  
679  O OD1 . ASN A 88  ? 1.05432 1.41244 0.96642 -0.13052 0.22325  0.18093  88  ASN A OD1 
680  N ND2 . ASN A 88  ? 1.18439 1.48130 1.01211 -0.11416 0.22740  0.18897  88  ASN A ND2 
681  N N   . VAL A 89  ? 0.84720 1.02595 0.75142 -0.13846 0.14313  0.13742  89  VAL A N   
682  C CA  . VAL A 89  ? 0.79993 0.92144 0.69398 -0.14026 0.12129  0.12802  89  VAL A CA  
683  C C   . VAL A 89  ? 0.84030 0.91466 0.68932 -0.13464 0.11753  0.13416  89  VAL A C   
684  O O   . VAL A 89  ? 0.87336 0.94617 0.70275 -0.14817 0.12785  0.15428  89  VAL A O   
685  C CB  . VAL A 89  ? 0.77009 0.88174 0.68636 -0.16995 0.11166  0.13535  89  VAL A CB  
686  C CG1 . VAL A 89  ? 0.85411 0.89973 0.74546 -0.17515 0.09357  0.13427  89  VAL A CG1 
687  C CG2 . VAL A 89  ? 0.76695 0.90653 0.72124 -0.16767 0.10552  0.12101  89  VAL A CG2 
688  N N   . SER A 90  ? 0.76834 0.80613 0.60160 -0.11492 0.10260  0.11805  90  SER A N   
689  C CA  . SER A 90  ? 0.83433 0.82612 0.62677 -0.10784 0.09494  0.12221  90  SER A CA  
690  C C   . SER A 90  ? 0.84237 0.79927 0.63245 -0.09095 0.07505  0.10361  90  SER A C   
691  O O   . SER A 90  ? 0.84308 0.81579 0.65674 -0.07909 0.07083  0.08683  90  SER A O   
692  C CB  . SER A 90  ? 0.90713 0.91321 0.66890 -0.09162 0.10806  0.12632  90  SER A CB  
693  O OG  . SER A 90  ? 0.93991 0.90604 0.66945 -0.07303 0.09421  0.11787  90  SER A OG  
694  N N   . GLU A 91  ? 0.77112 0.68151 0.53201 -0.08920 0.06312  0.10804  91  GLU A N   
695  C CA  . GLU A 91  ? 0.73096 0.61307 0.49013 -0.07169 0.04488  0.09187  91  GLU A CA  
696  C C   . GLU A 91  ? 0.79978 0.69468 0.55115 -0.04799 0.04390  0.07844  91  GLU A C   
697  O O   . GLU A 91  ? 0.91731 0.81095 0.68535 -0.03540 0.03295  0.06217  91  GLU A O   
698  C CB  . GLU A 91  ? 0.73759 0.56936 0.46742 -0.07266 0.03182  0.10002  91  GLU A CB  
699  C CG  . GLU A 91  ? 0.81546 0.62118 0.55579 -0.08964 0.02397  0.10431  91  GLU A CG  
700  C CD  . GLU A 91  ? 1.03403 0.78629 0.74312 -0.08669 0.00995  0.11143  91  GLU A CD  
701  O OE1 . GLU A 91  ? 1.00118 0.72914 0.71764 -0.07869 -0.00463 0.10068  91  GLU A OE1 
702  O OE2 . GLU A 91  ? 1.23397 0.96919 0.90988 -0.09069 0.01389  0.12815  91  GLU A OE2 
703  N N   . ASP A 92  ? 0.91943 0.82574 0.64441 -0.04190 0.05487  0.08515  92  ASP A N   
704  C CA  . ASP A 92  ? 0.91671 0.83617 0.63298 -0.01977 0.05437  0.07082  92  ASP A CA  
705  C C   . ASP A 92  ? 0.85324 0.81203 0.60406 -0.01772 0.06335  0.06054  92  ASP A C   
706  O O   . ASP A 92  ? 0.84992 0.84228 0.60265 -0.01998 0.08115  0.06691  92  ASP A O   
707  C CB  . ASP A 92  ? 0.90972 0.83076 0.58395 -0.01251 0.06492  0.08069  92  ASP A CB  
708  C CG  . ASP A 92  ? 0.93313 0.85423 0.58798 0.01248  0.05879  0.06392  92  ASP A CG  
709  O OD1 . ASP A 92  ? 0.93532 0.86059 0.61404 0.02198  0.04884  0.04578  92  ASP A OD1 
710  O OD2 . ASP A 92  ? 1.11101 1.02645 0.72446 0.02227  0.06358  0.06935  92  ASP A OD2 
711  N N   . CYS A 93  ? 0.81247 0.76897 0.59119 -0.01308 0.05164  0.04593  93  CYS A N   
712  C CA  . CYS A 93  ? 0.76410 0.75339 0.57587 -0.01179 0.05813  0.03754  93  CYS A CA  
713  C C   . CYS A 93  ? 0.76683 0.75105 0.59202 0.00365  0.04579  0.01944  93  CYS A C   
714  O O   . CYS A 93  ? 0.81860 0.82621 0.66761 0.00710  0.05016  0.01255  93  CYS A O   
715  C CB  . CYS A 93  ? 0.66833 0.66767 0.51010 -0.03148 0.06023  0.04400  93  CYS A CB  
716  S SG  . CYS A 93  ? 0.88977 0.85142 0.73906 -0.03763 0.04178  0.04066  93  CYS A SG  
717  N N   . LEU A 94  ? 0.71916 0.67479 0.53080 0.01259  0.03012  0.01252  94  LEU A N   
718  C CA  . LEU A 94  ? 0.69900 0.64986 0.52729 0.02329  0.01716  -0.00259 94  LEU A CA  
719  C C   . LEU A 94  ? 0.68551 0.64387 0.50105 0.03908  0.01890  -0.01305 94  LEU A C   
720  O O   . LEU A 94  ? 0.91734 0.85763 0.70660 0.05051  0.00933  -0.01939 94  LEU A O   
721  C CB  . LEU A 94  ? 0.67748 0.60028 0.49958 0.02626  -0.00068 -0.00530 94  LEU A CB  
722  C CG  . LEU A 94  ? 0.72122 0.63333 0.55284 0.01409  -0.00243 0.00363  94  LEU A CG  
723  C CD1 . LEU A 94  ? 0.76846 0.65957 0.60197 0.02048  -0.01992 -0.00080 94  LEU A CD1 
724  C CD2 . LEU A 94  ? 0.64427 0.57539 0.50836 0.00421  0.00472  0.00356  94  LEU A CD2 
725  N N   . TYR A 95  ? 0.67420 0.65809 0.50743 0.04110  0.02976  -0.01583 95  TYR A N   
726  C CA  . TYR A 95  ? 0.68251 0.67270 0.50475 0.05829  0.03204  -0.02688 95  TYR A CA  
727  C C   . TYR A 95  ? 0.67863 0.67818 0.53191 0.06142  0.02928  -0.03535 95  TYR A C   
728  O O   . TYR A 95  ? 0.69354 0.70775 0.57604 0.05013  0.03292  -0.02983 95  TYR A O   
729  C CB  . TYR A 95  ? 0.59963 0.61515 0.40356 0.06286  0.05195  -0.01979 95  TYR A CB  
730  C CG  . TYR A 95  ? 0.66055 0.66514 0.43063 0.05926  0.05547  -0.00907 95  TYR A CG  
731  C CD1 . TYR A 95  ? 0.63064 0.64178 0.40641 0.04002  0.06358  0.00815  95  TYR A CD1 
732  C CD2 . TYR A 95  ? 0.65419 0.63766 0.38400 0.07483  0.04867  -0.01605 95  TYR A CD2 
733  C CE1 . TYR A 95  ? 0.79214 0.78892 0.53564 0.03582  0.06605  0.02004  95  TYR A CE1 
734  C CE2 . TYR A 95  ? 0.67879 0.65077 0.37424 0.07221  0.05160  -0.00460 95  TYR A CE2 
735  C CZ  . TYR A 95  ? 0.87947 0.85792 0.58241 0.05234  0.06088  0.01446  95  TYR A CZ  
736  O OH  . TYR A 95  ? 0.85975 0.82337 0.52846 0.04792  0.06367  0.02857  95  TYR A OH  
737  N N   . ILE A 96  ? 0.66202 0.64979 0.50540 0.07735  0.02168  -0.04887 96  ILE A N   
738  C CA  . ILE A 96  ? 0.78534 0.77248 0.65210 0.08221  0.01587  -0.05728 96  ILE A CA  
739  C C   . ILE A 96  ? 0.81608 0.82064 0.67477 0.09851  0.02774  -0.06226 96  ILE A C   
740  O O   . ILE A 96  ? 0.87705 0.88734 0.70663 0.10978  0.03659  -0.06348 96  ILE A O   
741  C CB  . ILE A 96  ? 0.84258 0.79728 0.70634 0.08634  -0.00537 -0.06888 96  ILE A CB  
742  C CG1 . ILE A 96  ? 0.91314 0.86161 0.80192 0.07096  -0.01553 -0.06354 96  ILE A CG1 
743  C CG2 . ILE A 96  ? 0.84447 0.79121 0.71771 0.09650  -0.01099 -0.07910 96  ILE A CG2 
744  C CD1 . ILE A 96  ? 1.05073 0.97391 0.94222 0.07251  -0.03633 -0.07302 96  ILE A CD1 
745  N N   . ASN A 97  ? 0.75239 0.76738 0.63629 0.10103  0.02884  -0.06420 97  ASN A N   
746  C CA  . ASN A 97  ? 0.73135 0.76007 0.61045 0.12018  0.03712  -0.07069 97  ASN A CA  
747  C C   . ASN A 97  ? 0.75395 0.75650 0.64075 0.12901  0.02251  -0.08161 97  ASN A C   
748  O O   . ASN A 97  ? 0.70257 0.69694 0.61432 0.11616  0.01376  -0.07792 97  ASN A O   
749  C CB  . ASN A 97  ? 0.61240 0.68461 0.51540 0.11532  0.05408  -0.05970 97  ASN A CB  
750  C CG  . ASN A 97  ? 0.64435 0.73859 0.54445 0.10030  0.06628  -0.04638 97  ASN A CG  
751  O OD1 . ASN A 97  ? 0.75883 0.86221 0.63394 0.10774  0.07654  -0.04490 97  ASN A OD1 
752  N ND2 . ASN A 97  ? 0.67121 0.77119 0.59405 0.07914  0.06484  -0.03632 97  ASN A ND2 
753  N N   . VAL A 98  ? 0.66473 0.65208 0.52794 0.15125  0.01973  -0.09475 98  VAL A N   
754  C CA  . VAL A 98  ? 0.75502 0.71119 0.62124 0.16053  0.00469  -0.10535 98  VAL A CA  
755  C C   . VAL A 98  ? 0.84733 0.81687 0.70779 0.18481  0.01432  -0.11128 98  VAL A C   
756  O O   . VAL A 98  ? 0.78286 0.76437 0.61698 0.20317  0.02496  -0.11710 98  VAL A O   
757  C CB  . VAL A 98  ? 0.77303 0.68364 0.61196 0.16512  -0.01530 -0.11921 98  VAL A CB  
758  C CG1 . VAL A 98  ? 0.82373 0.69834 0.66930 0.16998  -0.03268 -0.12812 98  VAL A CG1 
759  C CG2 . VAL A 98  ? 0.67135 0.57530 0.51579 0.14412  -0.02404 -0.11307 98  VAL A CG2 
760  N N   . TRP A 99  ? 0.84099 0.81081 0.72542 0.18630  0.01148  -0.10891 99  TRP A N   
761  C CA  . TRP A 99  ? 0.79885 0.77168 0.67754 0.21259  0.01539  -0.11639 99  TRP A CA  
762  C C   . TRP A 99  ? 0.85464 0.77250 0.72323 0.21974  -0.00601 -0.12780 99  TRP A C   
763  O O   . TRP A 99  ? 0.90029 0.80073 0.79082 0.20204  -0.01727 -0.12107 99  TRP A O   
764  C CB  . TRP A 99  ? 0.75395 0.76766 0.66578 0.21072  0.02679  -0.10431 99  TRP A CB  
765  C CG  . TRP A 99  ? 0.68824 0.75892 0.61327 0.20440  0.04725  -0.09308 99  TRP A CG  
766  C CD1 . TRP A 99  ? 0.66576 0.77837 0.59114 0.22320  0.06376  -0.09281 99  TRP A CD1 
767  C CD2 . TRP A 99  ? 0.59667 0.68864 0.53852 0.17672  0.05254  -0.07979 99  TRP A CD2 
768  N NE1 . TRP A 99  ? 0.61435 0.77359 0.55732 0.20578  0.07865  -0.07907 99  TRP A NE1 
769  C CE2 . TRP A 99  ? 0.53745 0.68119 0.48883 0.17741  0.07126  -0.07147 99  TRP A CE2 
770  C CE3 . TRP A 99  ? 0.58786 0.66029 0.53790 0.15224  0.04303  -0.07416 99  TRP A CE3 
771  C CZ2 . TRP A 99  ? 0.50120 0.67099 0.46762 0.15270  0.07886  -0.05804 99  TRP A CZ2 
772  C CZ3 . TRP A 99  ? 0.62714 0.72543 0.59004 0.13131  0.05126  -0.06211 99  TRP A CZ3 
773  C CH2 . TRP A 99  ? 0.61492 0.75834 0.58493 0.13076  0.06813  -0.05426 99  TRP A CH2 
774  N N   . ALA A 100 ? 0.93572 0.82484 0.76979 0.24490  -0.01197 -0.14477 100 ALA A N   
775  C CA  . ALA A 100 ? 0.89891 0.72744 0.71799 0.24958  -0.03569 -0.15735 100 ALA A CA  
776  C C   . ALA A 100 ? 0.85214 0.66375 0.65107 0.28353  -0.03623 -0.17022 100 ALA A C   
777  O O   . ALA A 100 ? 0.89696 0.72432 0.66873 0.30935  -0.02440 -0.18023 100 ALA A O   
778  C CB  . ALA A 100 ? 0.76634 0.56147 0.55641 0.24455  -0.05015 -0.16889 100 ALA A CB  
779  N N   . PRO A 101 ? 0.97345 0.75594 0.78419 0.28628  -0.04802 -0.16924 101 PRO A N   
780  C CA  . PRO A 101 ? 0.97520 0.73385 0.76318 0.32154  -0.05114 -0.18280 101 PRO A CA  
781  C C   . PRO A 101 ? 1.05713 0.76362 0.79782 0.34048  -0.06627 -0.20605 101 PRO A C   
782  O O   . PRO A 101 ? 1.11894 0.79478 0.84843 0.32238  -0.08158 -0.21112 101 PRO A O   
783  C CB  . PRO A 101 ? 0.98545 0.71222 0.79462 0.31321  -0.06528 -0.17447 101 PRO A CB  
784  C CG  . PRO A 101 ? 0.92317 0.68837 0.77353 0.27987  -0.05737 -0.15262 101 PRO A CG  
785  C CD  . PRO A 101 ? 0.93584 0.71653 0.78355 0.25972  -0.05419 -0.15250 101 PRO A CD  
786  N N   . ALA A 102 ? 1.12069 0.81863 0.83311 0.37908  -0.06243 -0.22083 102 ALA A N   
787  C CA  . ALA A 102 ? 1.08082 0.73760 0.74513 0.40082  -0.07379 -0.24192 102 ALA A CA  
788  C C   . ALA A 102 ? 1.10258 0.68807 0.75144 0.38248  -0.10533 -0.25108 102 ALA A C   
789  O O   . ALA A 102 ? 1.24998 0.78961 0.87544 0.39297  -0.12249 -0.26109 102 ALA A O   
790  C CB  . ALA A 102 ? 1.16045 0.81879 0.81439 0.43026  -0.06989 -0.24538 102 ALA A CB  
791  N N   . THR A 137 ? 1.63570 1.12270 1.71572 -0.02233 -0.21042 -0.01843 137 THR A N   
792  C CA  . THR A 137 ? 1.72048 1.17297 1.76755 0.00629  -0.20936 -0.02492 137 THR A CA  
793  C C   . THR A 137 ? 1.79102 1.19811 1.79856 0.03043  -0.22628 -0.05445 137 THR A C   
794  O O   . THR A 137 ? 1.81054 1.22437 1.79127 0.06221  -0.21593 -0.06755 137 THR A O   
795  C CB  . THR A 137 ? 1.79747 1.20504 1.84864 -0.00465 -0.21814 -0.00539 137 THR A CB  
796  O OG1 . THR A 137 ? 1.80427 1.25378 1.89059 -0.02830 -0.20248 0.02308  137 THR A OG1 
797  C CG2 . THR A 137 ? 1.76647 1.14762 1.78575 0.02859  -0.21413 -0.00983 137 THR A CG2 
798  N N   . THR A 138 ? 1.77793 1.14055 1.78197 0.01553  -0.25254 -0.06491 138 THR A N   
799  C CA  . THR A 138 ? 1.74823 1.05203 1.70962 0.03788  -0.27337 -0.09256 138 THR A CA  
800  C C   . THR A 138 ? 1.66760 0.98135 1.61586 0.04050  -0.28219 -0.11507 138 THR A C   
801  O O   . THR A 138 ? 1.73679 1.01064 1.64751 0.05808  -0.29777 -0.13766 138 THR A O   
802  C CB  . THR A 138 ? 1.79724 1.04079 1.75483 0.02198  -0.29696 -0.08820 138 THR A CB  
803  O OG1 . THR A 138 ? 1.80726 1.05569 1.79027 -0.01210 -0.31304 -0.08493 138 THR A OG1 
804  C CG2 . THR A 138 ? 1.76328 0.99849 1.73917 0.01183  -0.28906 -0.06051 138 THR A CG2 
805  N N   . ASN A 139 ? 1.53106 0.90561 1.50658 0.02529  -0.26952 -0.10802 139 ASN A N   
806  C CA  . ASN A 139 ? 1.42503 0.80944 1.38992 0.02522  -0.27941 -0.12630 139 ASN A CA  
807  C C   . ASN A 139 ? 1.30603 0.74152 1.25510 0.04918  -0.25457 -0.13375 139 ASN A C   
808  O O   . ASN A 139 ? 1.21096 0.69026 1.17504 0.03952  -0.24775 -0.13161 139 ASN A O   
809  C CB  . ASN A 139 ? 1.47284 0.88283 1.48198 -0.01194 -0.28857 -0.11249 139 ASN A CB  
810  C CG  . ASN A 139 ? 1.57887 0.99879 1.57900 -0.01323 -0.30198 -0.12999 139 ASN A CG  
811  O OD1 . ASN A 139 ? 1.67620 1.06551 1.63250 0.00956  -0.31256 -0.15436 139 ASN A OD1 
812  N ND2 . ASN A 139 ? 1.53035 0.99491 1.57055 -0.03791 -0.30100 -0.11728 139 ASN A ND2 
813  N N   . GLY A 140 ? 1.23488 0.66562 1.15448 0.08043  -0.24134 -0.14177 140 GLY A N   
814  C CA  . GLY A 140 ? 1.13633 0.61765 1.04458 0.10099  -0.21625 -0.14547 140 GLY A CA  
815  C C   . GLY A 140 ? 1.09773 0.61939 1.02547 0.10580  -0.19071 -0.12712 140 GLY A C   
816  O O   . GLY A 140 ? 1.11791 0.63594 1.07071 0.09084  -0.19021 -0.10899 140 GLY A O   
817  N N   . LEU A 141 ? 0.99076 0.55229 0.90572 0.12650  -0.16973 -0.13164 141 LEU A N   
818  C CA  . LEU A 141 ? 0.99206 0.59400 0.92044 0.13532  -0.14670 -0.11827 141 LEU A CA  
819  C C   . LEU A 141 ? 0.97729 0.63082 0.94139 0.11152  -0.13213 -0.09932 141 LEU A C   
820  O O   . LEU A 141 ? 0.96766 0.63560 0.94125 0.09525  -0.13498 -0.09948 141 LEU A O   
821  C CB  . LEU A 141 ? 0.99924 0.62469 0.90124 0.16578  -0.13134 -0.13100 141 LEU A CB  
822  C CG  . LEU A 141 ? 1.02902 0.61756 0.89616 0.19915  -0.13722 -0.14777 141 LEU A CG  
823  C CD1 . LEU A 141 ? 0.99383 0.62703 0.84666 0.22610  -0.11511 -0.15398 141 LEU A CD1 
824  C CD2 . LEU A 141 ? 0.86972 0.42602 0.74336 0.20362  -0.14449 -0.13942 141 LEU A CD2 
825  N N   . PRO A 142 ? 0.89085 0.57174 0.87338 0.11073  -0.11743 -0.08344 142 PRO A N   
826  C CA  . PRO A 142 ? 0.87560 0.60510 0.88628 0.09237  -0.10271 -0.06800 142 PRO A CA  
827  C C   . PRO A 142 ? 0.85959 0.62930 0.86229 0.10056  -0.08792 -0.07460 142 PRO A C   
828  O O   . PRO A 142 ? 0.87075 0.64541 0.85196 0.12271  -0.08149 -0.08520 142 PRO A O   
829  C CB  . PRO A 142 ? 0.78945 0.53159 0.81298 0.09477  -0.09285 -0.05234 142 PRO A CB  
830  C CG  . PRO A 142 ? 0.82090 0.51153 0.82865 0.10730  -0.10710 -0.05602 142 PRO A CG  
831  C CD  . PRO A 142 ? 0.83384 0.49762 0.81160 0.12592  -0.11646 -0.07844 142 PRO A CD  
832  N N   . ILE A 143 ? 0.70824 0.50706 0.72847 0.08283  -0.08224 -0.06746 143 ILE A N   
833  C CA  . ILE A 143 ? 0.73332 0.56718 0.74718 0.08647  -0.06906 -0.07078 143 ILE A CA  
834  C C   . ILE A 143 ? 0.66410 0.53713 0.69966 0.07738  -0.05374 -0.05621 143 ILE A C   
835  O O   . ILE A 143 ? 0.73364 0.61300 0.79067 0.06041  -0.05478 -0.04524 143 ILE A O   
836  C CB  . ILE A 143 ? 0.73340 0.56360 0.74325 0.07646  -0.07740 -0.07687 143 ILE A CB  
837  C CG1 . ILE A 143 ? 0.79536 0.58588 0.77833 0.08688  -0.09421 -0.09363 143 ILE A CG1 
838  C CG2 . ILE A 143 ? 0.64133 0.50443 0.64335 0.07941  -0.06327 -0.07731 143 ILE A CG2 
839  C CD1 . ILE A 143 ? 0.89955 0.66446 0.89411 0.06972  -0.11451 -0.09429 143 ILE A CD1 
840  N N   . LEU A 144 ? 0.64536 0.54587 0.67523 0.08882  -0.03988 -0.05637 144 LEU A N   
841  C CA  . LEU A 144 ? 0.47961 0.41720 0.52539 0.08084  -0.02671 -0.04548 144 LEU A CA  
842  C C   . LEU A 144 ? 0.55661 0.51627 0.59548 0.07774  -0.01878 -0.04871 144 LEU A C   
843  O O   . LEU A 144 ? 0.61147 0.57322 0.63199 0.08972  -0.01550 -0.05725 144 LEU A O   
844  C CB  . LEU A 144 ? 0.59514 0.54982 0.64261 0.09370  -0.01883 -0.04202 144 LEU A CB  
845  C CG  . LEU A 144 ? 0.70370 0.64148 0.76022 0.09386  -0.02464 -0.03345 144 LEU A CG  
846  C CD1 . LEU A 144 ? 0.71365 0.61288 0.75451 0.10878  -0.03582 -0.04223 144 LEU A CD1 
847  C CD2 . LEU A 144 ? 0.63133 0.59979 0.69590 0.09963  -0.01530 -0.02570 144 LEU A CD2 
848  N N   . ILE A 145 ? 0.50758 0.48285 0.55924 0.06283  -0.01522 -0.04134 145 ILE A N   
849  C CA  . ILE A 145 ? 0.56275 0.55351 0.60746 0.05797  -0.00917 -0.04244 145 ILE A CA  
850  C C   . ILE A 145 ? 0.58495 0.60505 0.64011 0.05195  0.00181  -0.03441 145 ILE A C   
851  O O   . ILE A 145 ? 0.59425 0.61947 0.66373 0.04339  0.00189  -0.02733 145 ILE A O   
852  C CB  . ILE A 145 ? 0.63125 0.60977 0.67875 0.04723  -0.01751 -0.04265 145 ILE A CB  
853  C CG1 . ILE A 145 ? 0.57139 0.51994 0.61332 0.05012  -0.03220 -0.05006 145 ILE A CG1 
854  C CG2 . ILE A 145 ? 0.38708 0.37413 0.42134 0.04491  -0.01310 -0.04411 145 ILE A CG2 
855  C CD1 . ILE A 145 ? 0.64280 0.58419 0.69144 0.03986  -0.04214 -0.05009 145 ILE A CD1 
856  N N   . TRP A 146 ? 0.61161 0.65130 0.65884 0.05559  0.01072  -0.03544 146 TRP A N   
857  C CA  . TRP A 146 ? 0.59221 0.65941 0.64861 0.04832  0.01911  -0.02889 146 TRP A CA  
858  C C   . TRP A 146 ? 0.56201 0.63091 0.61357 0.03573  0.02114  -0.02653 146 TRP A C   
859  O O   . TRP A 146 ? 0.69573 0.75947 0.73228 0.03649  0.02256  -0.02914 146 TRP A O   
860  C CB  . TRP A 146 ? 0.43681 0.52848 0.49193 0.05802  0.02729  -0.02970 146 TRP A CB  
861  C CG  . TRP A 146 ? 0.55258 0.67434 0.61787 0.04816  0.03426  -0.02338 146 TRP A CG  
862  C CD1 . TRP A 146 ? 0.58089 0.71871 0.64173 0.04026  0.04136  -0.02082 146 TRP A CD1 
863  C CD2 . TRP A 146 ? 0.58934 0.72746 0.67003 0.04384  0.03339  -0.01833 146 TRP A CD2 
864  N NE1 . TRP A 146 ? 0.58458 0.74724 0.65941 0.02975  0.04392  -0.01498 146 TRP A NE1 
865  C CE2 . TRP A 146 ? 0.59254 0.75622 0.67877 0.03270  0.03858  -0.01431 146 TRP A CE2 
866  C CE3 . TRP A 146 ? 0.63416 0.76706 0.72292 0.04803  0.02820  -0.01611 146 TRP A CE3 
867  C CZ2 . TRP A 146 ? 0.56230 0.74590 0.66171 0.02583  0.03679  -0.01020 146 TRP A CZ2 
868  C CZ3 . TRP A 146 ? 0.57789 0.73160 0.67731 0.04313  0.02792  -0.01124 146 TRP A CZ3 
869  C CH2 . TRP A 146 ? 0.56912 0.74774 0.67372 0.03238  0.03129  -0.00939 146 TRP A CH2 
870  N N   . ILE A 147 ? 0.43923 0.51333 0.50039 0.02558  0.02103  -0.02158 147 ILE A N   
871  C CA  . ILE A 147 ? 0.36274 0.43686 0.41874 0.01442  0.02245  -0.01914 147 ILE A CA  
872  C C   . ILE A 147 ? 0.45024 0.54658 0.51255 0.00725  0.02735  -0.01512 147 ILE A C   
873  O O   . ILE A 147 ? 0.58489 0.68965 0.65726 0.00658  0.02601  -0.01344 147 ILE A O   
874  C CB  . ILE A 147 ? 0.40885 0.46836 0.46826 0.01007  0.01690  -0.01848 147 ILE A CB  
875  C CG1 . ILE A 147 ? 0.42429 0.46757 0.48567 0.01554  0.01015  -0.02136 147 ILE A CG1 
876  C CG2 . ILE A 147 ? 0.40278 0.45449 0.45173 0.00216  0.01663  -0.01746 147 ILE A CG2 
877  C CD1 . ILE A 147 ? 0.42199 0.45860 0.49162 0.01206  0.00586  -0.01954 147 ILE A CD1 
878  N N   . TYR A 148 ? 0.58915 0.69492 0.64515 0.00067  0.03223  -0.01281 148 TYR A N   
879  C CA  . TYR A 148 ? 0.54672 0.67600 0.61190 -0.00882 0.03527  -0.00859 148 TYR A CA  
880  C C   . TYR A 148 ? 0.46756 0.58436 0.53095 -0.02065 0.02973  -0.00770 148 TYR A C   
881  O O   . TYR A 148 ? 0.51142 0.60333 0.56489 -0.02133 0.02575  -0.00941 148 TYR A O   
882  C CB  . TYR A 148 ? 0.54468 0.69054 0.60591 -0.01473 0.04307  -0.00416 148 TYR A CB  
883  C CG  . TYR A 148 ? 0.55482 0.67737 0.59737 -0.02169 0.04298  -0.00203 148 TYR A CG  
884  C CD1 . TYR A 148 ? 0.54185 0.65115 0.57962 -0.03707 0.03928  0.00189  148 TYR A CD1 
885  C CD2 . TYR A 148 ? 0.61460 0.72456 0.64136 -0.01159 0.04485  -0.00450 148 TYR A CD2 
886  C CE1 . TYR A 148 ? 0.66749 0.75181 0.68604 -0.04185 0.03808  0.00479  148 TYR A CE1 
887  C CE2 . TYR A 148 ? 0.61546 0.70326 0.62265 -0.01657 0.04350  -0.00181 148 TYR A CE2 
888  C CZ  . TYR A 148 ? 0.70131 0.77649 0.70492 -0.03146 0.04043  0.00355  148 TYR A CZ  
889  O OH  . TYR A 148 ? 0.70229 0.75231 0.68471 -0.03489 0.03805  0.00712  148 TYR A OH  
890  N N   . GLY A 149 ? 0.43702 0.57183 0.50957 -0.02898 0.02854  -0.00569 149 GLY A N   
891  C CA  . GLY A 149 ? 0.48361 0.60549 0.55092 -0.04069 0.02224  -0.00619 149 GLY A CA  
892  C C   . GLY A 149 ? 0.54756 0.67427 0.61339 -0.05807 0.02256  -0.00139 149 GLY A C   
893  O O   . GLY A 149 ? 0.61838 0.76138 0.68746 -0.06137 0.02974  0.00384  149 GLY A O   
894  N N   . GLY A 150 ? 0.66351 0.77591 0.72372 -0.06941 0.01456  -0.00293 150 GLY A N   
895  C CA  . GLY A 150 ? 0.56835 0.67499 0.62466 -0.08906 0.01204  0.00208  150 GLY A CA  
896  C C   . GLY A 150 ? 0.56093 0.62610 0.59722 -0.09339 0.00285  -0.00222 150 GLY A C   
897  O O   . GLY A 150 ? 0.53415 0.57760 0.55872 -0.10620 0.00064  0.00229  150 GLY A O   
898  N N   . GLY A 151 ? 0.60958 0.66300 0.64047 -0.08136 -0.00201 -0.01036 151 GLY A N   
899  C CA  . GLY A 151 ? 0.63548 0.65307 0.64706 -0.08193 -0.01113 -0.01664 151 GLY A CA  
900  C C   . GLY A 151 ? 0.70305 0.68777 0.69799 -0.07732 -0.01097 -0.01602 151 GLY A C   
901  O O   . GLY A 151 ? 0.74999 0.70091 0.72687 -0.08187 -0.01921 -0.01902 151 GLY A O   
902  N N   . PHE A 152 ? 0.73016 0.72212 0.72935 -0.06769 -0.00334 -0.01265 152 PHE A N   
903  C CA  . PHE A 152 ? 0.62577 0.59208 0.61087 -0.06266 -0.00364 -0.01075 152 PHE A CA  
904  C C   . PHE A 152 ? 0.68225 0.62738 0.65313 -0.07888 -0.00627 -0.00344 152 PHE A C   
905  O O   . PHE A 152 ? 0.74808 0.66354 0.70164 -0.07516 -0.00950 -0.00171 152 PHE A O   
906  C CB  . PHE A 152 ? 0.60453 0.54819 0.58008 -0.04816 -0.00891 -0.01823 152 PHE A CB  
907  C CG  . PHE A 152 ? 0.63609 0.60155 0.62609 -0.03430 -0.00501 -0.02249 152 PHE A CG  
908  C CD1 . PHE A 152 ? 0.70882 0.68092 0.70003 -0.03182 -0.00669 -0.02761 152 PHE A CD1 
909  C CD2 . PHE A 152 ? 0.51418 0.49220 0.51506 -0.02466 -0.00043 -0.02073 152 PHE A CD2 
910  C CE1 . PHE A 152 ? 0.57770 0.56947 0.58063 -0.02016 -0.00204 -0.02883 152 PHE A CE1 
911  C CE2 . PHE A 152 ? 0.52482 0.52109 0.53993 -0.01486 0.00288  -0.02238 152 PHE A CE2 
912  C CZ  . PHE A 152 ? 0.56187 0.56570 0.57803 -0.01273 0.00301  -0.02541 152 PHE A CZ  
913  N N   . MET A 153 ? 0.54879 0.50934 0.52742 -0.09736 -0.00548 0.00209  153 MET A N   
914  C CA  . MET A 153 ? 0.63064 0.57670 0.59951 -0.11658 -0.00613 0.01253  153 MET A CA  
915  C C   . MET A 153 ? 0.59965 0.58238 0.58230 -0.12583 0.00558  0.02331  153 MET A C   
916  O O   . MET A 153 ? 0.70507 0.67866 0.67846 -0.14032 0.00827  0.03474  153 MET A O   
917  C CB  . MET A 153 ? 0.77099 0.70030 0.73678 -0.13620 -0.01704 0.01203  153 MET A CB  
918  C CG  . MET A 153 ? 0.74435 0.64695 0.69900 -0.12776 -0.02874 -0.00102 153 MET A CG  
919  S SD  . MET A 153 ? 0.80301 0.64864 0.72643 -0.11366 -0.03584 -0.00496 153 MET A SD  
920  C CE  . MET A 153 ? 0.61338 0.41792 0.51760 -0.13906 -0.04396 0.00632  153 MET A CE  
921  N N   . THR A 154 ? 0.57905 0.60271 0.58269 -0.11808 0.01263  0.02077  154 THR A N   
922  C CA  . THR A 154 ? 0.55848 0.62294 0.57767 -0.12416 0.02413  0.02950  154 THR A CA  
923  C C   . THR A 154 ? 0.55444 0.64414 0.58351 -0.10245 0.03125  0.02342  154 THR A C   
924  O O   . THR A 154 ? 0.54624 0.62152 0.57163 -0.08681 0.02695  0.01443  154 THR A O   
925  C CB  . THR A 154 ? 0.60310 0.69625 0.64372 -0.14384 0.02158  0.03364  154 THR A CB  
926  O OG1 . THR A 154 ? 0.61454 0.73081 0.67233 -0.13405 0.01775  0.02450  154 THR A OG1 
927  C CG2 . THR A 154 ? 0.47877 0.53900 0.50918 -0.16602 0.00956  0.03648  154 THR A CG2 
928  N N   . GLY A 155 ? 0.52479 0.65257 0.56696 -0.10156 0.04208  0.02877  155 GLY A N   
929  C CA  . GLY A 155 ? 0.55966 0.70910 0.61019 -0.08086 0.04769  0.02268  155 GLY A CA  
930  C C   . GLY A 155 ? 0.56218 0.70919 0.59696 -0.06928 0.05675  0.02451  155 GLY A C   
931  O O   . GLY A 155 ? 0.56730 0.68753 0.58073 -0.07310 0.05643  0.02850  155 GLY A O   
932  N N   . SER A 156 ? 0.54422 0.71733 0.58708 -0.05316 0.06374  0.02085  156 SER A N   
933  C CA  . SER A 156 ? 0.62077 0.79378 0.64646 -0.03951 0.07206  0.02047  156 SER A CA  
934  C C   . SER A 156 ? 0.61713 0.80398 0.65005 -0.01757 0.07344  0.01111  156 SER A C   
935  O O   . SER A 156 ? 0.56584 0.78321 0.62048 -0.01484 0.07555  0.01082  156 SER A O   
936  C CB  . SER A 156 ? 0.60452 0.80558 0.62847 -0.04926 0.08573  0.03271  156 SER A CB  
937  O OG  . SER A 156 ? 0.59781 0.81827 0.61341 -0.03031 0.09675  0.03028  156 SER A OG  
938  N N   . ALA A 157 ? 0.60119 0.76376 0.61511 -0.00193 0.07065  0.00346  157 ALA A N   
939  C CA  . ALA A 157 ? 0.61879 0.78754 0.63409 0.01940  0.07122  -0.00563 157 ALA A CA  
940  C C   . ALA A 157 ? 0.58130 0.78830 0.59933 0.02949  0.08519  -0.00328 157 ALA A C   
941  O O   . ALA A 157 ? 0.64026 0.85642 0.66281 0.04834  0.08577  -0.01064 157 ALA A O   
942  C CB  . ALA A 157 ? 0.40312 0.53625 0.39501 0.03198  0.06379  -0.01450 157 ALA A CB  
943  N N   . THR A 158 ? 0.45874 0.68890 0.47468 0.01802  0.09668  0.00748  158 THR A N   
944  C CA  . THR A 158 ? 0.53823 0.80841 0.55452 0.02958  0.11266  0.01064  158 THR A CA  
945  C C   . THR A 158 ? 0.56842 0.88862 0.61927 0.02636  0.11874  0.01597  158 THR A C   
946  O O   . THR A 158 ? 0.61174 0.97285 0.66825 0.03781  0.13284  0.01884  158 THR A O   
947  C CB  . THR A 158 ? 0.62228 0.89874 0.61931 0.01904  0.12467  0.02236  158 THR A CB  
948  O OG1 . THR A 158 ? 0.54785 0.83952 0.56317 -0.00909 0.12631  0.03656  158 THR A OG1 
949  C CG2 . THR A 158 ? 0.67514 0.90263 0.63681 0.02170  0.11683  0.01818  158 THR A CG2 
950  N N   . LEU A 159 ? 0.66726 0.98812 0.74087 0.01192  0.10859  0.01751  159 LEU A N   
951  C CA  . LEU A 159 ? 0.71522 1.08548 0.82211 0.00776  0.11199  0.02278  159 LEU A CA  
952  C C   . LEU A 159 ? 0.62701 1.01948 0.74093 0.03693  0.11554  0.01453  159 LEU A C   
953  O O   . LEU A 159 ? 0.68638 1.04508 0.78495 0.05540  0.10809  0.00330  159 LEU A O   
954  C CB  . LEU A 159 ? 0.76114 1.12074 0.88467 -0.00937 0.09740  0.02301  159 LEU A CB  
955  C CG  . LEU A 159 ? 0.75158 1.07852 0.86446 -0.03475 0.09046  0.02811  159 LEU A CG  
956  C CD1 . LEU A 159 ? 0.52675 0.84724 0.65462 -0.04770 0.07633  0.02633  159 LEU A CD1 
957  C CD2 . LEU A 159 ? 0.72880 1.07516 0.84178 -0.05445 0.10111  0.04184  159 LEU A CD2 
958  N N   . ASP A 160 ? 0.45970 0.90923 0.59719 0.04140  0.12675  0.02056  160 ASP A N   
959  C CA  . ASP A 160 ? 0.54412 1.01637 0.69002 0.07148  0.12910  0.01269  160 ASP A CA  
960  C C   . ASP A 160 ? 0.58392 1.02799 0.73426 0.07909  0.11214  0.00448  160 ASP A C   
961  O O   . ASP A 160 ? 0.57936 1.00388 0.71766 0.10497  0.10878  -0.00559 160 ASP A O   
962  C CB  . ASP A 160 ? 0.59267 1.13687 0.77314 0.07176  0.14021  0.02173  160 ASP A CB  
963  C CG  . ASP A 160 ? 0.72149 1.29981 0.89841 0.06765  0.15996  0.03134  160 ASP A CG  
964  O OD1 . ASP A 160 ? 0.90363 1.50039 1.09403 0.03730  0.16346  0.04507  160 ASP A OD1 
965  O OD2 . ASP A 160 ? 0.73402 1.31766 0.89188 0.09492  0.17170  0.02527  160 ASP A OD2 
966  N N   . ILE A 161 ? 0.56378 1.00260 0.72867 0.05670  0.10097  0.00893  161 ILE A N   
967  C CA  . ILE A 161 ? 0.58439 1.00495 0.75502 0.06289  0.08655  0.00394  161 ILE A CA  
968  C C   . ILE A 161 ? 0.60392 0.96678 0.74740 0.07437  0.07937  -0.00511 161 ILE A C   
969  O O   . ILE A 161 ? 0.62705 0.97444 0.77015 0.08991  0.07129  -0.00990 161 ILE A O   
970  C CB  . ILE A 161 ? 0.66730 1.09185 0.85305 0.03598  0.07663  0.00987  161 ILE A CB  
971  C CG1 . ILE A 161 ? 0.57653 1.00394 0.77418 0.04407  0.06430  0.00754  161 ILE A CG1 
972  C CG2 . ILE A 161 ? 0.79087 1.16964 0.95642 0.01714  0.07175  0.00963  161 ILE A CG2 
973  C CD1 . ILE A 161 ? 0.58607 1.05640 0.80242 0.06532  0.06801  0.00766  161 ILE A CD1 
974  N N   . TYR A 162 ? 0.61947 0.95084 0.74035 0.06734  0.08175  -0.00675 162 TYR A N   
975  C CA  . TYR A 162 ? 0.58788 0.86774 0.68564 0.07538  0.07400  -0.01486 162 TYR A CA  
976  C C   . TYR A 162 ? 0.59333 0.86308 0.67237 0.10049  0.07837  -0.02357 162 TYR A C   
977  O O   . TYR A 162 ? 0.59789 0.82497 0.65614 0.10569  0.07131  -0.03081 162 TYR A O   
978  C CB  . TYR A 162 ? 0.47179 0.72217 0.55486 0.05594  0.07147  -0.01285 162 TYR A CB  
979  C CG  . TYR A 162 ? 0.51837 0.77187 0.61421 0.03273  0.06642  -0.00617 162 TYR A CG  
980  C CD1 . TYR A 162 ? 0.57135 0.83630 0.68490 0.03090  0.05952  -0.00502 162 TYR A CD1 
981  C CD2 . TYR A 162 ? 0.52491 0.76631 0.61167 0.01409  0.06729  -0.00152 162 TYR A CD2 
982  C CE1 . TYR A 162 ? 0.53584 0.80048 0.65658 0.01137  0.05354  -0.00100 162 TYR A CE1 
983  C CE2 . TYR A 162 ? 0.61584 0.85435 0.71063 -0.00535 0.06111  0.00274  162 TYR A CE2 
984  C CZ  . TYR A 162 ? 0.58918 0.83935 0.70039 -0.00646 0.05415  0.00215  162 TYR A CZ  
985  O OH  . TYR A 162 ? 0.50938 0.75373 0.62414 -0.02421 0.04685  0.00441  162 TYR A OH  
986  N N   . ASN A 163 ? 0.55417 0.86293 0.64009 0.11665  0.08916  -0.02356 163 ASN A N   
987  C CA  . ASN A 163 ? 0.52326 0.82167 0.58863 0.14495  0.09289  -0.03385 163 ASN A CA  
988  C C   . ASN A 163 ? 0.61621 0.87334 0.67440 0.16009  0.07857  -0.04266 163 ASN A C   
989  O O   . ASN A 163 ? 0.62017 0.88859 0.69637 0.16676  0.07361  -0.04062 163 ASN A O   
990  C CB  . ASN A 163 ? 0.64267 0.99660 0.72206 0.16243  0.10702  -0.03179 163 ASN A CB  
991  C CG  . ASN A 163 ? 0.69618 1.04244 0.74866 0.19269  0.11416  -0.04291 163 ASN A CG  
992  O OD1 . ASN A 163 ? 0.63372 0.92827 0.65746 0.20198  0.10493  -0.05380 163 ASN A OD1 
993  N ND2 . ASN A 163 ? 0.70007 1.09932 0.76176 0.20860  0.13035  -0.04053 163 ASN A ND2 
994  N N   . ALA A 164 ? 0.56780 0.77638 0.59953 0.16444  0.07080  -0.05155 164 ALA A N   
995  C CA  . ALA A 164 ? 0.54617 0.71032 0.56954 0.17607  0.05626  -0.05918 164 ALA A CA  
996  C C   . ALA A 164 ? 0.59306 0.74830 0.59960 0.20859  0.05653  -0.07072 164 ALA A C   
997  O O   . ALA A 164 ? 0.68843 0.79637 0.67993 0.21851  0.04316  -0.07905 164 ALA A O   
998  C CB  . ALA A 164 ? 0.61674 0.73317 0.62343 0.16304  0.04498  -0.06311 164 ALA A CB  
999  N N   . ASP A 165 ? 0.50674 0.70576 0.51545 0.22562  0.07112  -0.07133 165 ASP A N   
1000 C CA  . ASP A 165 ? 0.63682 0.82692 0.62551 0.26081  0.07233  -0.08415 165 ASP A CA  
1001 C C   . ASP A 165 ? 0.69604 0.86332 0.69166 0.27646  0.05960  -0.08674 165 ASP A C   
1002 O O   . ASP A 165 ? 0.74881 0.86388 0.72062 0.29265  0.04710  -0.09825 165 ASP A O   
1003 C CB  . ASP A 165 ? 0.71049 0.96312 0.70726 0.27684  0.09252  -0.08177 165 ASP A CB  
1004 C CG  . ASP A 165 ? 0.81561 1.07424 0.78589 0.27969  0.10492  -0.08569 165 ASP A CG  
1005 O OD1 . ASP A 165 ? 0.86917 1.08772 0.81710 0.26491  0.09769  -0.08872 165 ASP A OD1 
1006 O OD2 . ASP A 165 ? 0.73439 1.04248 0.70749 0.29736  0.12260  -0.08460 165 ASP A OD2 
1007 N N   . ILE A 166 ? 0.68593 0.89014 0.71277 0.27164  0.06134  -0.07574 166 ILE A N   
1008 C CA  . ILE A 166 ? 0.74361 0.93080 0.77633 0.28886  0.05015  -0.07605 166 ILE A CA  
1009 C C   . ILE A 166 ? 0.68404 0.80959 0.70777 0.27385  0.03260  -0.07499 166 ILE A C   
1010 O O   . ILE A 166 ? 0.65810 0.73760 0.66577 0.29140  0.02047  -0.08159 166 ILE A O   
1011 C CB  . ILE A 166 ? 0.75033 0.99465 0.81808 0.28553  0.05490  -0.06385 166 ILE A CB  
1012 C CG1 . ILE A 166 ? 0.67787 0.98344 0.75654 0.30760  0.07093  -0.06567 166 ILE A CG1 
1013 C CG2 . ILE A 166 ? 0.70409 0.92510 0.77747 0.29600  0.04049  -0.06023 166 ILE A CG2 
1014 C CD1 . ILE A 166 ? 0.54288 0.91635 0.66055 0.29450  0.07733  -0.05254 166 ILE A CD1 
1015 N N   . MET A 167 ? 0.51533 0.63898 0.54933 0.24155  0.03105  -0.06625 167 MET A N   
1016 C CA  . MET A 167 ? 0.51580 0.59033 0.54614 0.22590  0.01672  -0.06291 167 MET A CA  
1017 C C   . MET A 167 ? 0.75673 0.77460 0.75952 0.23507  0.00598  -0.07515 167 MET A C   
1018 O O   . MET A 167 ? 0.69387 0.66757 0.68998 0.24005  -0.00756 -0.07558 167 MET A O   
1019 C CB  . MET A 167 ? 0.47869 0.56163 0.52047 0.19350  0.01862  -0.05445 167 MET A CB  
1020 C CG  . MET A 167 ? 0.58579 0.62187 0.62370 0.17762  0.00590  -0.05166 167 MET A CG  
1021 S SD  . MET A 167 ? 0.57954 0.62884 0.63209 0.14434  0.00861  -0.04170 167 MET A SD  
1022 C CE  . MET A 167 ? 0.57507 0.65711 0.64878 0.14059  0.01112  -0.02909 167 MET A CE  
1023 N N   . ALA A 168 ? 0.73752 0.75407 0.72283 0.23582  0.01072  -0.08458 168 ALA A N   
1024 C CA  . ALA A 168 ? 0.73299 0.69611 0.68899 0.24524  -0.00130 -0.09851 168 ALA A CA  
1025 C C   . ALA A 168 ? 0.77683 0.71564 0.71582 0.27852  -0.00712 -0.10904 168 ALA A C   
1026 O O   . ALA A 168 ? 0.85721 0.74073 0.78389 0.28204  -0.02411 -0.11368 168 ALA A O   
1027 C CB  . ALA A 168 ? 0.82841 0.80084 0.76491 0.24478  0.00624  -0.10682 168 ALA A CB  
1028 N N   . ALA A 169 ? 0.65824 0.63870 0.59806 0.30320  0.00655  -0.11195 169 ALA A N   
1029 C CA  . ALA A 169 ? 0.71222 0.67144 0.63272 0.34042  0.00215  -0.12407 169 ALA A CA  
1030 C C   . ALA A 169 ? 0.85944 0.78756 0.78911 0.34420  -0.01180 -0.11742 169 ALA A C   
1031 O O   . ALA A 169 ? 0.96696 0.83386 0.87391 0.35755  -0.02808 -0.12652 169 ALA A O   
1032 C CB  . ALA A 169 ? 0.80223 0.82451 0.72959 0.36552  0.02166  -0.12550 169 ALA A CB  
1033 N N   . VAL A 170 ? 0.95128 0.91860 0.91220 0.33211  -0.00666 -0.10114 170 VAL A N   
1034 C CA  . VAL A 170 ? 0.87061 0.81448 0.83897 0.33785  -0.01826 -0.09248 170 VAL A CA  
1035 C C   . VAL A 170 ? 0.77112 0.66164 0.73756 0.31044  -0.03317 -0.08504 170 VAL A C   
1036 O O   . VAL A 170 ? 0.83430 0.67112 0.78826 0.31858  -0.04827 -0.08481 170 VAL A O   
1037 C CB  . VAL A 170 ? 0.80913 0.81526 0.80908 0.33480  -0.00867 -0.07823 170 VAL A CB  
1038 C CG1 . VAL A 170 ? 0.80599 0.78549 0.81138 0.33488  -0.02135 -0.06652 170 VAL A CG1 
1039 C CG2 . VAL A 170 ? 0.85648 0.91287 0.86109 0.36648  0.00336  -0.08479 170 VAL A CG2 
1040 N N   . GLY A 171 ? 0.68974 0.59449 0.66898 0.27790  -0.02914 -0.07807 171 GLY A N   
1041 C CA  . GLY A 171 ? 0.79457 0.65734 0.77588 0.25167  -0.04127 -0.07023 171 GLY A CA  
1042 C C   . GLY A 171 ? 0.87843 0.68045 0.83513 0.25365  -0.05605 -0.08312 171 GLY A C   
1043 O O   . GLY A 171 ? 0.77989 0.53499 0.73564 0.24048  -0.07053 -0.07731 171 GLY A O   
1044 N N   . ASN A 172 ? 0.93532 0.73701 0.87081 0.27047  -0.05322 -0.10041 172 ASN A N   
1045 C CA  . ASN A 172 ? 0.85050 0.59814 0.75935 0.27136  -0.06796 -0.11553 172 ASN A CA  
1046 C C   . ASN A 172 ? 0.86541 0.60393 0.78681 0.23540  -0.07426 -0.10874 172 ASN A C   
1047 O O   . ASN A 172 ? 0.93325 0.62350 0.85301 0.22118  -0.09166 -0.10752 172 ASN A O   
1048 C CB  . ASN A 172 ? 0.82394 0.50685 0.71297 0.28902  -0.08666 -0.12199 172 ASN A CB  
1049 C CG  . ASN A 172 ? 1.05851 0.68751 0.91424 0.29727  -0.10227 -0.14228 172 ASN A CG  
1050 O OD1 . ASN A 172 ? 0.95983 0.60613 0.79835 0.30654  -0.09526 -0.15582 172 ASN A OD1 
1051 N ND2 . ASN A 172 ? 1.12452 0.68589 0.96925 0.29294  -0.12452 -0.14414 172 ASN A ND2 
1052 N N   . VAL A 173 ? 0.81003 0.59791 0.74595 0.22063  -0.05978 -0.10333 173 VAL A N   
1053 C CA  . VAL A 173 ? 0.82093 0.61027 0.77018 0.19001  -0.06302 -0.09699 173 VAL A CA  
1054 C C   . VAL A 173 ? 0.82638 0.64467 0.76583 0.18952  -0.05300 -0.10442 173 VAL A C   
1055 O O   . VAL A 173 ? 0.77679 0.62966 0.70946 0.20611  -0.03832 -0.10788 173 VAL A O   
1056 C CB  . VAL A 173 ? 0.72476 0.54436 0.70603 0.16763  -0.05566 -0.07702 173 VAL A CB  
1057 C CG1 . VAL A 173 ? 0.65626 0.44329 0.64592 0.16295  -0.06645 -0.06653 173 VAL A CG1 
1058 C CG2 . VAL A 173 ? 0.59549 0.47043 0.58770 0.17516  -0.03731 -0.07139 173 VAL A CG2 
1059 N N   . ILE A 174 ? 0.85621 0.66206 0.79652 0.16948  -0.06108 -0.10520 174 ILE A N   
1060 C CA  . ILE A 174 ? 0.84020 0.67425 0.77463 0.16378  -0.05185 -0.10737 174 ILE A CA  
1061 C C   . ILE A 174 ? 0.84268 0.72383 0.80430 0.14788  -0.03654 -0.09155 174 ILE A C   
1062 O O   . ILE A 174 ? 0.78721 0.66970 0.77232 0.12974  -0.03939 -0.07985 174 ILE A O   
1063 C CB  . ILE A 174 ? 0.81298 0.61842 0.74050 0.14867  -0.06774 -0.11297 174 ILE A CB  
1064 C CG1 . ILE A 174 ? 0.80479 0.55611 0.70630 0.16105  -0.08779 -0.12913 174 ILE A CG1 
1065 C CG2 . ILE A 174 ? 0.78960 0.61980 0.70598 0.14594  -0.05915 -0.11493 174 ILE A CG2 
1066 C CD1 . ILE A 174 ? 0.90290 0.64999 0.77027 0.19031  -0.08263 -0.14421 174 ILE A CD1 
1067 N N   . VAL A 175 ? 0.82441 0.74395 0.78210 0.15438  -0.02039 -0.09090 175 VAL A N   
1068 C CA  . VAL A 175 ? 0.74470 0.70410 0.72343 0.13747  -0.00816 -0.07805 175 VAL A CA  
1069 C C   . VAL A 175 ? 0.78949 0.75985 0.75490 0.13095  -0.00280 -0.07990 175 VAL A C   
1070 O O   . VAL A 175 ? 0.83772 0.81002 0.77924 0.14573  0.00205  -0.08827 175 VAL A O   
1071 C CB  . VAL A 175 ? 0.61924 0.61860 0.61124 0.14602  0.00566  -0.07162 175 VAL A CB  
1072 C CG1 . VAL A 175 ? 0.44712 0.47798 0.46063 0.12531  0.01332  -0.05911 175 VAL A CG1 
1073 C CG2 . VAL A 175 ? 0.60065 0.58628 0.59911 0.15873  -0.00041 -0.07095 175 VAL A CG2 
1074 N N   . ALA A 176 ? 0.66667 0.64443 0.64579 0.11032  -0.00304 -0.07146 176 ALA A N   
1075 C CA  . ALA A 176 ? 0.61925 0.60426 0.58672 0.10251  0.00072  -0.07068 176 ALA A CA  
1076 C C   . ALA A 176 ? 0.63806 0.65314 0.62385 0.08675  0.01099  -0.05841 176 ALA A C   
1077 O O   . ALA A 176 ? 0.68360 0.70458 0.69109 0.07736  0.00986  -0.05162 176 ALA A O   
1078 C CB  . ALA A 176 ? 0.68030 0.63446 0.64165 0.09435  -0.01496 -0.07506 176 ALA A CB  
1079 N N   . SER A 177 ? 0.69478 0.72670 0.66918 0.08392  0.02059  -0.05543 177 SER A N   
1080 C CA  . SER A 177 ? 0.56839 0.62011 0.55511 0.06717  0.02741  -0.04482 177 SER A CA  
1081 C C   . SER A 177 ? 0.59531 0.63812 0.56145 0.06185  0.02776  -0.04356 177 SER A C   
1082 O O   . SER A 177 ? 0.75758 0.78508 0.69972 0.07235  0.02460  -0.05061 177 SER A O   
1083 C CB  . SER A 177 ? 0.48936 0.57803 0.48802 0.06706  0.04071  -0.03852 177 SER A CB  
1084 O OG  . SER A 177 ? 0.56932 0.67238 0.55084 0.07829  0.05074  -0.04048 177 SER A OG  
1085 N N   . PHE A 178 ? 0.55079 0.60071 0.52327 0.04649  0.03076  -0.03474 178 PHE A N   
1086 C CA  . PHE A 178 ? 0.60831 0.64414 0.56054 0.04124  0.02894  -0.03209 178 PHE A CA  
1087 C C   . PHE A 178 ? 0.61901 0.66380 0.57853 0.02466  0.03397  -0.02143 178 PHE A C   
1088 O O   . PHE A 178 ? 0.73338 0.78737 0.71404 0.01677  0.03385  -0.01871 178 PHE A O   
1089 C CB  . PHE A 178 ? 0.56557 0.57238 0.51380 0.04272  0.01330  -0.03813 178 PHE A CB  
1090 C CG  . PHE A 178 ? 0.51914 0.52355 0.49217 0.03419  0.00698  -0.03603 178 PHE A CG  
1091 C CD1 . PHE A 178 ? 0.59251 0.59700 0.57038 0.02310  0.00760  -0.02918 178 PHE A CD1 
1092 C CD2 . PHE A 178 ? 0.53947 0.54000 0.52911 0.03787  0.00060  -0.04043 178 PHE A CD2 
1093 C CE1 . PHE A 178 ? 0.56401 0.56816 0.56178 0.01810  0.00329  -0.02791 178 PHE A CE1 
1094 C CE2 . PHE A 178 ? 0.45429 0.45619 0.46573 0.03044  -0.00297 -0.03682 178 PHE A CE2 
1095 C CZ  . PHE A 178 ? 0.51855 0.52393 0.53363 0.02169  -0.00101 -0.03115 178 PHE A CZ  
1096 N N   . GLN A 179 ? 0.64634 0.68394 0.58515 0.01966  0.03681  -0.01556 179 GLN A N   
1097 C CA  . GLN A 179 ? 0.67151 0.70623 0.61276 0.00344  0.03797  -0.00591 179 GLN A CA  
1098 C C   . GLN A 179 ? 0.66360 0.67018 0.60310 0.00165  0.02483  -0.00800 179 GLN A C   
1099 O O   . GLN A 179 ? 0.59921 0.58789 0.52732 0.01069  0.01559  -0.01361 179 GLN A O   
1100 C CB  . GLN A 179 ? 0.69698 0.73518 0.61674 -0.00303 0.04743  0.00438  179 GLN A CB  
1101 C CG  . GLN A 179 ? 0.67629 0.74631 0.59491 0.00217  0.06213  0.00683  179 GLN A CG  
1102 C CD  . GLN A 179 ? 0.64073 0.74389 0.58747 -0.00837 0.07018  0.01224  179 GLN A CD  
1103 O OE1 . GLN A 179 ? 0.71961 0.82394 0.68832 -0.01141 0.06356  0.00816  179 GLN A OE1 
1104 N NE2 . GLN A 179 ? 0.51870 0.65161 0.46516 -0.01396 0.08450  0.02209  179 GLN A NE2 
1105 N N   . TYR A 180 ? 0.63470 0.63872 0.58575 -0.00934 0.02333  -0.00395 180 TYR A N   
1106 C CA  . TYR A 180 ? 0.55095 0.53140 0.50028 -0.01007 0.01293  -0.00488 180 TYR A CA  
1107 C C   . TYR A 180 ? 0.60147 0.57105 0.54253 -0.02339 0.01443  0.00342  180 TYR A C   
1108 O O   . TYR A 180 ? 0.60357 0.58870 0.55218 -0.03461 0.02161  0.00819  180 TYR A O   
1109 C CB  . TYR A 180 ? 0.44704 0.43240 0.42005 -0.00602 0.00781  -0.01127 180 TYR A CB  
1110 C CG  . TYR A 180 ? 0.54518 0.54665 0.53464 -0.01334 0.01288  -0.00997 180 TYR A CG  
1111 C CD1 . TYR A 180 ? 0.57036 0.59517 0.57347 -0.01141 0.01874  -0.01131 180 TYR A CD1 
1112 C CD2 . TYR A 180 ? 0.53882 0.53023 0.52810 -0.02054 0.01026  -0.00824 180 TYR A CD2 
1113 C CE1 . TYR A 180 ? 0.60918 0.64964 0.62631 -0.01732 0.02146  -0.01008 180 TYR A CE1 
1114 C CE2 . TYR A 180 ? 0.65167 0.65650 0.65311 -0.02682 0.01269  -0.00834 180 TYR A CE2 
1115 C CZ  . TYR A 180 ? 0.66600 0.69663 0.68188 -0.02558 0.01804  -0.00887 180 TYR A CZ  
1116 O OH  . TYR A 180 ? 0.61255 0.65691 0.63912 -0.03115 0.01856  -0.00888 180 TYR A OH  
1117 N N   . ARG A 181 ? 0.61383 0.55563 0.53903 -0.02225 0.00634  0.00537  181 ARG A N   
1118 C CA  . ARG A 181 ? 0.64908 0.57177 0.56145 -0.03472 0.00586  0.01364  181 ARG A CA  
1119 C C   . ARG A 181 ? 0.72770 0.65258 0.65649 -0.04193 0.00432  0.01063  181 ARG A C   
1120 O O   . ARG A 181 ? 0.62576 0.55158 0.56749 -0.03302 -0.00057 0.00256  181 ARG A O   
1121 C CB  . ARG A 181 ? 0.62918 0.51813 0.52002 -0.02820 -0.00442 0.01546  181 ARG A CB  
1122 C CG  . ARG A 181 ? 0.78965 0.66698 0.65217 -0.02835 -0.00257 0.02427  181 ARG A CG  
1123 C CD  . ARG A 181 ? 0.56458 0.40976 0.40614 -0.01768 -0.01540 0.02495  181 ARG A CD  
1124 N NE  . ARG A 181 ? 0.76837 0.62091 0.62327 -0.00162 -0.02449 0.01364  181 ARG A NE  
1125 C CZ  . ARG A 181 ? 0.73055 0.56428 0.57793 0.01023  -0.03760 0.01150  181 ARG A CZ  
1126 N NH1 . ARG A 181 ? 0.62250 0.42464 0.44548 0.00989  -0.04322 0.01957  181 ARG A NH1 
1127 N NH2 . ARG A 181 ? 0.66439 0.51099 0.52975 0.02198  -0.04581 0.00207  181 ARG A NH2 
1128 N N   . VAL A 182 ? 0.73545 0.66232 0.66322 -0.05864 0.00832  0.01759  182 VAL A N   
1129 C CA  . VAL A 182 ? 0.60681 0.53265 0.54538 -0.06716 0.00478  0.01438  182 VAL A CA  
1130 C C   . VAL A 182 ? 0.78989 0.67845 0.70885 -0.07880 -0.00253 0.01981  182 VAL A C   
1131 O O   . VAL A 182 ? 0.76576 0.63344 0.66456 -0.08288 -0.00283 0.02886  182 VAL A O   
1132 C CB  . VAL A 182 ? 0.57603 0.53758 0.53422 -0.07814 0.01236  0.01647  182 VAL A CB  
1133 C CG1 . VAL A 182 ? 0.54834 0.53901 0.52503 -0.06412 0.01660  0.00923  182 VAL A CG1 
1134 C CG2 . VAL A 182 ? 0.55351 0.52741 0.50654 -0.09146 0.02108  0.02872  182 VAL A CG2 
1135 N N   . GLY A 183 ? 0.81527 0.69263 0.73753 -0.08362 -0.00933 0.01412  183 GLY A N   
1136 C CA  . GLY A 183 ? 0.84446 0.68042 0.74658 -0.09408 -0.01866 0.01726  183 GLY A CA  
1137 C C   . GLY A 183 ? 0.83101 0.62896 0.71130 -0.07850 -0.02631 0.01560  183 GLY A C   
1138 O O   . GLY A 183 ? 0.76460 0.57010 0.64983 -0.05842 -0.02654 0.00875  183 GLY A O   
1139 N N   . ALA A 184 ? 0.69478 0.45092 0.55145 -0.08873 -0.03369 0.02286  184 ALA A N   
1140 C CA  . ALA A 184 ? 0.75957 0.47553 0.59342 -0.07263 -0.04300 0.02153  184 ALA A CA  
1141 C C   . ALA A 184 ? 0.85184 0.57957 0.68236 -0.05986 -0.03887 0.02627  184 ALA A C   
1142 O O   . ALA A 184 ? 0.90055 0.61370 0.72385 -0.03976 -0.04591 0.02126  184 ALA A O   
1143 C CB  . ALA A 184 ? 0.84251 0.50732 0.64912 -0.08739 -0.05223 0.03042  184 ALA A CB  
1144 N N   . PHE A 185 ? 0.88448 0.64084 0.72064 -0.06995 -0.02804 0.03497  185 PHE A N   
1145 C CA  . PHE A 185 ? 0.86566 0.63444 0.69646 -0.05742 -0.02478 0.03737  185 PHE A CA  
1146 C C   . PHE A 185 ? 0.83751 0.63008 0.68877 -0.03769 -0.02640 0.02397  185 PHE A C   
1147 O O   . PHE A 185 ? 0.84906 0.63646 0.69391 -0.02220 -0.03218 0.02183  185 PHE A O   
1148 C CB  . PHE A 185 ? 0.73530 0.53388 0.56843 -0.07014 -0.01130 0.04702  185 PHE A CB  
1149 C CG  . PHE A 185 ? 0.80229 0.58635 0.62175 -0.09359 -0.00740 0.06269  185 PHE A CG  
1150 C CD1 . PHE A 185 ? 0.89687 0.65260 0.68566 -0.09712 -0.00818 0.07682  185 PHE A CD1 
1151 C CD2 . PHE A 185 ? 0.82732 0.62578 0.66463 -0.11314 -0.00399 0.06436  185 PHE A CD2 
1152 C CE1 . PHE A 185 ? 0.98359 0.72574 0.76083 -0.12140 -0.00406 0.09388  185 PHE A CE1 
1153 C CE2 . PHE A 185 ? 0.86613 0.65308 0.69465 -0.13809 -0.00135 0.08020  185 PHE A CE2 
1154 C CZ  . PHE A 185 ? 0.92032 0.67906 0.71938 -0.14307 -0.00065 0.09570  185 PHE A CZ  
1155 N N   . GLY A 186 ? 0.77820 0.59717 0.65439 -0.03888 -0.02221 0.01579  186 GLY A N   
1156 C CA  . GLY A 186 ? 0.67887 0.52127 0.57600 -0.02337 -0.02259 0.00564  186 GLY A CA  
1157 C C   . GLY A 186 ? 0.73903 0.56908 0.64078 -0.01100 -0.02998 -0.00260 186 GLY A C   
1158 O O   . GLY A 186 ? 0.71901 0.56566 0.63692 0.00292  -0.03143 -0.00879 186 GLY A O   
1159 N N   . PHE A 187 ? 0.77546 0.57652 0.66306 -0.01564 -0.03486 -0.00280 187 PHE A N   
1160 C CA  . PHE A 187 ? 0.78028 0.57539 0.67263 -0.00244 -0.03928 -0.01269 187 PHE A CA  
1161 C C   . PHE A 187 ? 0.79489 0.54472 0.66236 0.00518  -0.04993 -0.01411 187 PHE A C   
1162 O O   . PHE A 187 ? 0.75904 0.50214 0.62671 0.01810  -0.05308 -0.02344 187 PHE A O   
1163 C CB  . PHE A 187 ? 0.69256 0.50518 0.59703 -0.01141 -0.03429 -0.01753 187 PHE A CB  
1164 C CG  . PHE A 187 ? 0.58367 0.43916 0.51346 -0.01225 -0.02517 -0.01792 187 PHE A CG  
1165 C CD1 . PHE A 187 ? 0.54729 0.42490 0.49513 0.00232  -0.02285 -0.02348 187 PHE A CD1 
1166 C CD2 . PHE A 187 ? 0.57672 0.45031 0.51225 -0.02685 -0.01881 -0.01171 187 PHE A CD2 
1167 C CE1 . PHE A 187 ? 0.59477 0.50567 0.56379 0.00093  -0.01587 -0.02276 187 PHE A CE1 
1168 C CE2 . PHE A 187 ? 0.57276 0.48111 0.52897 -0.02520 -0.01161 -0.01258 187 PHE A CE2 
1169 C CZ  . PHE A 187 ? 0.58991 0.51381 0.56177 -0.01188 -0.01093 -0.01803 187 PHE A CZ  
1170 N N   . LEU A 188 ? 0.80718 0.52469 0.65121 -0.00048 -0.05546 -0.00505 188 LEU A N   
1171 C CA  . LEU A 188 ? 0.76150 0.43134 0.57996 0.01012  -0.06727 -0.00609 188 LEU A CA  
1172 C C   . LEU A 188 ? 0.71770 0.39700 0.54568 0.03819  -0.07138 -0.01470 188 LEU A C   
1173 O O   . LEU A 188 ? 0.70302 0.40951 0.54592 0.04666  -0.06987 -0.01316 188 LEU A O   
1174 C CB  . LEU A 188 ? 0.80009 0.43672 0.59206 0.00148  -0.07212 0.00766  188 LEU A CB  
1175 C CG  . LEU A 188 ? 0.92428 0.50443 0.68568 0.01277  -0.08599 0.00858  188 LEU A CG  
1176 C CD1 . LEU A 188 ? 0.95260 0.49788 0.70120 0.00474  -0.09175 0.00274  188 LEU A CD1 
1177 C CD2 . LEU A 188 ? 0.93974 0.49001 0.67423 0.00362  -0.08961 0.02501  188 LEU A CD2 
1178 N N   . HIS A 189 ? 0.94113 0.60079 0.76183 0.05289  -0.07667 -0.02439 189 HIS A N   
1179 C CA  . HIS A 189 ? 0.88615 0.56572 0.72202 0.08019  -0.07747 -0.03311 189 HIS A CA  
1180 C C   . HIS A 189 ? 0.86575 0.49804 0.67460 0.09955  -0.08947 -0.03752 189 HIS A C   
1181 O O   . HIS A 189 ? 0.97922 0.58116 0.76992 0.10034  -0.09276 -0.04494 189 HIS A O   
1182 C CB  . HIS A 189 ? 0.78925 0.50481 0.64727 0.08301  -0.06770 -0.04216 189 HIS A CB  
1183 C CG  . HIS A 189 ? 0.83312 0.56990 0.70569 0.11054  -0.06649 -0.05018 189 HIS A CG  
1184 N ND1 . HIS A 189 ? 0.74967 0.53064 0.65323 0.11947  -0.06238 -0.04780 189 HIS A ND1 
1185 C CD2 . HIS A 189 ? 0.81052 0.53282 0.67171 0.13121  -0.06842 -0.06046 189 HIS A CD2 
1186 C CE1 . HIS A 189 ? 0.70260 0.50010 0.61681 0.14316  -0.06057 -0.05459 189 HIS A CE1 
1187 N NE2 . HIS A 189 ? 0.76228 0.52499 0.64975 0.15254  -0.06345 -0.06279 189 HIS A NE2 
1188 N N   . LEU A 190 ? 0.89029 0.51370 0.69433 0.11599  -0.09763 -0.03351 190 LEU A N   
1189 C CA  . LEU A 190 ? 0.88645 0.46186 0.66295 0.13739  -0.11052 -0.03675 190 LEU A CA  
1190 C C   . LEU A 190 ? 0.87706 0.47416 0.66872 0.16862  -0.11541 -0.04024 190 LEU A C   
1191 O O   . LEU A 190 ? 0.90017 0.45939 0.66981 0.19090  -0.12679 -0.04316 190 LEU A O   
1192 C CB  . LEU A 190 ? 0.92283 0.44361 0.66412 0.12383  -0.12061 -0.02440 190 LEU A CB  
1193 C CG  . LEU A 190 ? 0.99680 0.50201 0.72689 0.08899  -0.11590 -0.01598 190 LEU A CG  
1194 C CD1 . LEU A 190 ? 0.99503 0.47373 0.70298 0.07584  -0.12051 0.00101  190 LEU A CD1 
1195 C CD2 . LEU A 190 ? 0.95758 0.41806 0.66576 0.08232  -0.12136 -0.02314 190 LEU A CD2 
1196 N N   . ALA A 191 ? 0.83166 0.48693 0.66027 0.17091  -0.10861 -0.03962 191 ALA A N   
1197 C CA  . ALA A 191 ? 0.81340 0.49337 0.66050 0.19751  -0.11525 -0.04100 191 ALA A CA  
1198 C C   . ALA A 191 ? 0.87198 0.54748 0.71799 0.22895  -0.11709 -0.05177 191 ALA A C   
1199 O O   . ALA A 191 ? 0.98753 0.65082 0.82745 0.25383  -0.12883 -0.05179 191 ALA A O   
1200 C CB  . ALA A 191 ? 0.68949 0.43440 0.58029 0.19114  -0.10751 -0.03942 191 ALA A CB  
1201 N N   . PRO A 192 ? 0.88331 0.56746 0.73241 0.23196  -0.10669 -0.06130 192 PRO A N   
1202 C CA  . PRO A 192 ? 0.86904 0.54610 0.71143 0.26595  -0.10825 -0.07258 192 PRO A CA  
1203 C C   . PRO A 192 ? 1.02215 0.62618 0.81908 0.28055  -0.12408 -0.07521 192 PRO A C   
1204 O O   . PRO A 192 ? 1.05922 0.65605 0.85114 0.31498  -0.13033 -0.08199 192 PRO A O   
1205 C CB  . PRO A 192 ? 0.79963 0.49158 0.64441 0.26088  -0.09432 -0.08159 192 PRO A CB  
1206 C CG  . PRO A 192 ? 0.85632 0.55483 0.70587 0.22402  -0.08814 -0.07467 192 PRO A CG  
1207 C CD  . PRO A 192 ? 0.73927 0.45396 0.60502 0.20975  -0.09205 -0.06249 192 PRO A CD  
1208 N N   . GLU A 193 ? 1.06116 0.61098 0.82540 0.25554  -0.13090 -0.06908 193 GLU A N   
1209 C CA  . GLU A 193 ? 1.04794 0.52117 0.76659 0.26470  -0.14709 -0.06908 193 GLU A CA  
1210 C C   . GLU A 193 ? 1.11957 0.57854 0.83152 0.27918  -0.16044 -0.05918 193 GLU A C   
1211 O O   . GLU A 193 ? 1.14697 0.54089 0.82044 0.29106  -0.17525 -0.05779 193 GLU A O   
1212 C CB  . GLU A 193 ? 1.07268 0.49832 0.76328 0.22853  -0.14926 -0.06269 193 GLU A CB  
1213 C CG  . GLU A 193 ? 1.25632 0.59841 0.89887 0.23358  -0.16433 -0.06652 193 GLU A CG  
1214 C CD  . GLU A 193 ? 1.29732 0.62584 0.92859 0.25308  -0.16368 -0.08599 193 GLU A CD  
1215 O OE1 . GLU A 193 ? 1.33319 0.59331 0.92497 0.26947  -0.17823 -0.09316 193 GLU A OE1 
1216 O OE2 . GLU A 193 ? 1.21370 0.59737 0.87278 0.25271  -0.14911 -0.09398 193 GLU A OE2 
1217 N N   . MET A 194 ? 1.09567 0.61072 0.84209 0.27909  -0.15728 -0.05253 194 MET A N   
1218 C CA  . MET A 194 ? 1.08426 0.59053 0.82461 0.28796  -0.17080 -0.04203 194 MET A CA  
1219 C C   . MET A 194 ? 0.99965 0.56609 0.77971 0.31636  -0.17230 -0.04599 194 MET A C   
1220 O O   . MET A 194 ? 1.09724 0.72377 0.91687 0.31845  -0.15920 -0.05267 194 MET A O   
1221 C CB  . MET A 194 ? 1.14356 0.65914 0.88519 0.25370  -0.16755 -0.02871 194 MET A CB  
1222 C CG  . MET A 194 ? 1.18400 0.64329 0.88822 0.22593  -0.16752 -0.02097 194 MET A CG  
1223 S SD  . MET A 194 ? 1.06423 0.55680 0.78008 0.19462  -0.16052 -0.00718 194 MET A SD  
1224 C CE  . MET A 194 ? 1.15115 0.67524 0.88794 0.16283  -0.14110 -0.01105 194 MET A CE  
1225 N N   . PRO A 195 ? 1.02185 0.57608 0.79385 0.33708  -0.18851 -0.04055 195 PRO A N   
1226 C CA  . PRO A 195 ? 0.94413 0.56011 0.75813 0.36315  -0.19220 -0.04344 195 PRO A CA  
1227 C C   . PRO A 195 ? 0.87724 0.56134 0.73581 0.34142  -0.18439 -0.03955 195 PRO A C   
1228 O O   . PRO A 195 ? 0.85789 0.53983 0.71197 0.30866  -0.17757 -0.03401 195 PRO A O   
1229 C CB  . PRO A 195 ? 1.01779 0.59550 0.80517 0.38374  -0.21417 -0.03602 195 PRO A CB  
1230 C CG  . PRO A 195 ? 1.06131 0.55570 0.79393 0.38283  -0.21899 -0.03530 195 PRO A CG  
1231 C CD  . PRO A 195 ? 1.20008 0.67792 0.92167 0.34452  -0.20559 -0.03312 195 PRO A CD  
1232 N N   . SER A 196 ? 0.94730 0.69422 0.85122 0.36124  -0.18569 -0.04279 196 SER A N   
1233 C CA  . SER A 196 ? 0.87104 0.68368 0.82138 0.34242  -0.18050 -0.03986 196 SER A CA  
1234 C C   . SER A 196 ? 0.88813 0.68346 0.82201 0.31948  -0.19117 -0.03068 196 SER A C   
1235 O O   . SER A 196 ? 0.79587 0.61097 0.74204 0.29072  -0.18248 -0.02851 196 SER A O   
1236 C CB  . SER A 196 ? 1.02649 0.90372 1.02590 0.36882  -0.18558 -0.04240 196 SER A CB  
1237 O OG  . SER A 196 ? 1.14916 1.07472 1.18504 0.35242  -0.19162 -0.03735 196 SER A OG  
1238 N N   . GLU A 197 ? 0.95531 0.70978 0.85668 0.33344  -0.20983 -0.02520 197 GLU A N   
1239 C CA  . GLU A 197 ? 0.92775 0.66572 0.80855 0.31762  -0.22176 -0.01618 197 GLU A CA  
1240 C C   . GLU A 197 ? 0.90452 0.61383 0.75872 0.28304  -0.20899 -0.01143 197 GLU A C   
1241 O O   . GLU A 197 ? 0.99141 0.71512 0.84767 0.26344  -0.20985 -0.00754 197 GLU A O   
1242 C CB  . GLU A 197 ? 1.01130 0.69924 0.85224 0.34103  -0.24217 -0.00999 197 GLU A CB  
1243 C CG  . GLU A 197 ? 1.28158 0.91793 1.07301 0.32383  -0.24943 0.00184  197 GLU A CG  
1244 C CD  . GLU A 197 ? 1.48344 1.06473 1.23211 0.34845  -0.26913 0.00951  197 GLU A CD  
1245 O OE1 . GLU A 197 ? 1.57289 1.13037 1.31481 0.37351  -0.27223 0.00525  197 GLU A OE1 
1246 O OE2 . GLU A 197 ? 1.53472 1.09531 1.25432 0.34443  -0.28201 0.01968  197 GLU A OE2 
1247 N N   . PHE A 198 ? 0.91952 0.59141 0.75062 0.27562  -0.19721 -0.01264 198 PHE A N   
1248 C CA  . PHE A 198 ? 0.89768 0.54086 0.70283 0.24412  -0.18615 -0.00685 198 PHE A CA  
1249 C C   . PHE A 198 ? 0.89655 0.57939 0.73269 0.22354  -0.16710 -0.01291 198 PHE A C   
1250 O O   . PHE A 198 ? 0.95513 0.61596 0.77338 0.20069  -0.15637 -0.01014 198 PHE A O   
1251 C CB  . PHE A 198 ? 0.92842 0.50287 0.68803 0.24418  -0.18758 -0.00291 198 PHE A CB  
1252 C CG  . PHE A 198 ? 1.00849 0.53610 0.73287 0.26475  -0.20669 0.00466  198 PHE A CG  
1253 C CD1 . PHE A 198 ? 1.02661 0.54643 0.75359 0.29935  -0.21769 -0.00181 198 PHE A CD1 
1254 C CD2 . PHE A 198 ? 1.08787 0.58022 0.77524 0.25128  -0.21337 0.01890  198 PHE A CD2 
1255 C CE1 . PHE A 198 ? 1.06908 0.54307 0.76187 0.32020  -0.23673 0.00576  198 PHE A CE1 
1256 C CE2 . PHE A 198 ? 1.05424 0.50091 0.70591 0.27061  -0.23167 0.02765  198 PHE A CE2 
1257 C CZ  . PHE A 198 ? 1.12460 0.56069 0.77908 0.30497  -0.24408 0.02101  198 PHE A CZ  
1258 N N   . ALA A 199 ? 0.76624 0.50830 0.64915 0.23008  -0.16331 -0.01964 199 ALA A N   
1259 C CA  . ALA A 199 ? 0.73564 0.51444 0.64729 0.21215  -0.14581 -0.02410 199 ALA A CA  
1260 C C   . ALA A 199 ? 0.86425 0.63545 0.76313 0.18218  -0.13861 -0.01888 199 ALA A C   
1261 O O   . ALA A 199 ? 1.02669 0.78884 0.91881 0.16571  -0.12551 -0.01964 199 ALA A O   
1262 C CB  . ALA A 199 ? 0.69994 0.54320 0.66329 0.21988  -0.14536 -0.02801 199 ALA A CB  
1263 N N   . GLU A 200 ? 0.89386 0.66978 0.78856 0.17628  -0.14756 -0.01411 200 GLU A N   
1264 C CA  . GLU A 200 ? 0.87315 0.64819 0.75739 0.15178  -0.14037 -0.01022 200 GLU A CA  
1265 C C   . GLU A 200 ? 0.87467 0.60075 0.71396 0.13927  -0.13682 -0.00174 200 GLU A C   
1266 O O   . GLU A 200 ? 0.78112 0.50590 0.60753 0.12110  -0.13046 0.00301  200 GLU A O   
1267 C CB  . GLU A 200 ? 0.66072 0.45492 0.55134 0.15223  -0.15244 -0.00958 200 GLU A CB  
1268 C CG  . GLU A 200 ? 0.77635 0.62277 0.71572 0.15378  -0.15370 -0.01649 200 GLU A CG  
1269 C CD  . GLU A 200 ? 0.83507 0.70498 0.79872 0.13884  -0.13533 -0.01985 200 GLU A CD  
1270 O OE1 . GLU A 200 ? 0.88644 0.74071 0.83153 0.12212  -0.12407 -0.01778 200 GLU A OE1 
1271 O OE2 . GLU A 200 ? 0.93523 0.84153 0.93714 0.14435  -0.13193 -0.02364 200 GLU A OE2 
1272 N N   . GLU A 201 ? 0.79746 0.48338 0.61283 0.14834  -0.14047 0.00061  201 GLU A N   
1273 C CA  . GLU A 201 ? 0.83921 0.47714 0.61387 0.13338  -0.13778 0.01064  201 GLU A CA  
1274 C C   . GLU A 201 ? 0.89653 0.53900 0.67698 0.11035  -0.12138 0.00953  201 GLU A C   
1275 O O   . GLU A 201 ? 0.88529 0.51785 0.64858 0.08947  -0.11411 0.01820  201 GLU A O   
1276 C CB  . GLU A 201 ? 0.83016 0.41790 0.57609 0.15024  -0.14964 0.01351  201 GLU A CB  
1277 C CG  . GLU A 201 ? 1.09874 0.63247 0.79883 0.13618  -0.15185 0.02802  201 GLU A CG  
1278 C CD  . GLU A 201 ? 1.15779 0.68171 0.83296 0.13908  -0.16113 0.03931  201 GLU A CD  
1279 O OE1 . GLU A 201 ? 1.23219 0.75222 0.90374 0.16288  -0.17671 0.03840  201 GLU A OE1 
1280 O OE2 . GLU A 201 ? 1.20879 0.72918 0.86603 0.11841  -0.15296 0.04956  201 GLU A OE2 
1281 N N   . ALA A 202 ? 0.98403 0.64422 0.78845 0.11438  -0.11519 -0.00058 202 ALA A N   
1282 C CA  . ALA A 202 ? 0.95316 0.62176 0.76520 0.09430  -0.10157 -0.00276 202 ALA A CA  
1283 C C   . ALA A 202 ? 0.96337 0.67276 0.81118 0.10325  -0.09491 -0.01419 202 ALA A C   
1284 O O   . ALA A 202 ? 0.94577 0.64535 0.79282 0.10993  -0.09308 -0.02110 202 ALA A O   
1285 C CB  . ALA A 202 ? 0.91124 0.52952 0.69295 0.08581  -0.10350 0.00043  202 ALA A CB  
1286 N N   . PRO A 203 ? 0.88939 0.64364 0.76728 0.10383  -0.09163 -0.01614 203 PRO A N   
1287 C CA  . PRO A 203 ? 0.74972 0.54383 0.66254 0.11402  -0.08611 -0.02420 203 PRO A CA  
1288 C C   . PRO A 203 ? 0.73609 0.54185 0.65703 0.10122  -0.07295 -0.02775 203 PRO A C   
1289 O O   . PRO A 203 ? 0.67324 0.49982 0.61188 0.11151  -0.06757 -0.03400 203 PRO A O   
1290 C CB  . PRO A 203 ? 0.67119 0.50295 0.61047 0.11270  -0.08844 -0.02300 203 PRO A CB  
1291 C CG  . PRO A 203 ? 0.69442 0.51196 0.61342 0.09435  -0.08733 -0.01684 203 PRO A CG  
1292 C CD  . PRO A 203 ? 0.82273 0.59200 0.70231 0.09294  -0.09180 -0.01089 203 PRO A CD  
1293 N N   . GLY A 204 ? 0.69236 0.48646 0.59987 0.08024  -0.06770 -0.02342 204 GLY A N   
1294 C CA  . GLY A 204 ? 0.55219 0.36076 0.46866 0.06716  -0.05693 -0.02606 204 GLY A CA  
1295 C C   . GLY A 204 ? 0.60857 0.45908 0.55331 0.06001  -0.04920 -0.02552 204 GLY A C   
1296 O O   . GLY A 204 ? 0.57201 0.44423 0.53508 0.06732  -0.05229 -0.02541 204 GLY A O   
1297 N N   . ASN A 205 ? 0.48890 0.34908 0.43682 0.04516  -0.04058 -0.02513 205 ASN A N   
1298 C CA  . ASN A 205 ? 0.67629 0.57102 0.64789 0.03862  -0.03323 -0.02467 205 ASN A CA  
1299 C C   . ASN A 205 ? 0.72295 0.62267 0.69468 0.03414  -0.03577 -0.02077 205 ASN A C   
1300 O O   . ASN A 205 ? 0.77032 0.69458 0.76197 0.03325  -0.03349 -0.02165 205 ASN A O   
1301 C CB  . ASN A 205 ? 0.65375 0.57740 0.65224 0.05012  -0.03045 -0.02820 205 ASN A CB  
1302 C CG  . ASN A 205 ? 0.71522 0.63750 0.71083 0.05702  -0.02603 -0.03296 205 ASN A CG  
1303 O OD1 . ASN A 205 ? 0.77303 0.68405 0.75538 0.04817  -0.02313 -0.03440 205 ASN A OD1 
1304 N ND2 . ASN A 205 ? 0.70194 0.63758 0.70994 0.07354  -0.02592 -0.03566 205 ASN A ND2 
1305 N N   . VAL A 206 ? 0.66709 0.54177 0.61434 0.03159  -0.04089 -0.01634 206 VAL A N   
1306 C CA  . VAL A 206 ? 0.71289 0.59206 0.65573 0.03015  -0.04352 -0.01388 206 VAL A CA  
1307 C C   . VAL A 206 ? 0.71177 0.60950 0.66068 0.01880  -0.03373 -0.01320 206 VAL A C   
1308 O O   . VAL A 206 ? 0.63704 0.54776 0.59248 0.02066  -0.03487 -0.01526 206 VAL A O   
1309 C CB  . VAL A 206 ? 0.67859 0.52681 0.58965 0.03096  -0.05025 -0.00767 206 VAL A CB  
1310 C CG1 . VAL A 206 ? 0.58781 0.41757 0.49372 0.04573  -0.06142 -0.00888 206 VAL A CG1 
1311 C CG2 . VAL A 206 ? 0.71224 0.54225 0.60178 0.01607  -0.04328 -0.00023 206 VAL A CG2 
1312 N N   . GLY A 207 ? 0.74679 0.64673 0.69508 0.00819  -0.02534 -0.01136 207 GLY A N   
1313 C CA  . GLY A 207 ? 0.64628 0.56927 0.60559 0.00048  -0.01628 -0.01135 207 GLY A CA  
1314 C C   . GLY A 207 ? 0.58278 0.52858 0.56711 0.00645  -0.01564 -0.01653 207 GLY A C   
1315 O O   . GLY A 207 ? 0.64118 0.60059 0.63118 0.00539  -0.01212 -0.01739 207 GLY A O   
1316 N N   . LEU A 208 ? 0.61054 0.56034 0.60941 0.01328  -0.01865 -0.01941 208 LEU A N   
1317 C CA  . LEU A 208 ? 0.60310 0.57366 0.62659 0.01741  -0.01854 -0.02163 208 LEU A CA  
1318 C C   . LEU A 208 ? 0.58407 0.55381 0.61240 0.02302  -0.02801 -0.02321 208 LEU A C   
1319 O O   . LEU A 208 ? 0.56073 0.54252 0.60499 0.02245  -0.02964 -0.02455 208 LEU A O   
1320 C CB  . LEU A 208 ? 0.51666 0.49669 0.55433 0.02260  -0.01632 -0.02248 208 LEU A CB  
1321 C CG  . LEU A 208 ? 0.54970 0.52470 0.57712 0.01865  -0.01062 -0.02294 208 LEU A CG  
1322 C CD1 . LEU A 208 ? 0.51373 0.49564 0.54881 0.02746  -0.00857 -0.02514 208 LEU A CD1 
1323 C CD2 . LEU A 208 ? 0.52136 0.50974 0.55318 0.00990  -0.00416 -0.02141 208 LEU A CD2 
1324 N N   . TRP A 209 ? 0.48024 0.43381 0.49429 0.02834  -0.03605 -0.02305 209 TRP A N   
1325 C CA  . TRP A 209 ? 0.57545 0.52627 0.58855 0.03285  -0.04722 -0.02507 209 TRP A CA  
1326 C C   . TRP A 209 ? 0.58233 0.52771 0.57901 0.02865  -0.04591 -0.02625 209 TRP A C   
1327 O O   . TRP A 209 ? 0.51690 0.46629 0.52039 0.03013  -0.05277 -0.03043 209 TRP A O   
1328 C CB  . TRP A 209 ? 0.50736 0.44049 0.50437 0.04086  -0.05664 -0.02386 209 TRP A CB  
1329 C CG  . TRP A 209 ? 0.68860 0.63066 0.70421 0.04972  -0.05970 -0.02441 209 TRP A CG  
1330 C CD1 . TRP A 209 ? 0.63642 0.56904 0.64534 0.05417  -0.05545 -0.02358 209 TRP A CD1 
1331 C CD2 . TRP A 209 ? 0.67570 0.63947 0.72014 0.05615  -0.06769 -0.02612 209 TRP A CD2 
1332 N NE1 . TRP A 209 ? 0.64463 0.59289 0.67474 0.06597  -0.05893 -0.02522 209 TRP A NE1 
1333 C CE2 . TRP A 209 ? 0.63138 0.60223 0.68621 0.06640  -0.06577 -0.02576 209 TRP A CE2 
1334 C CE3 . TRP A 209 ? 0.61075 0.58881 0.67372 0.05386  -0.07698 -0.02805 209 TRP A CE3 
1335 C CZ2 . TRP A 209 ? 0.57133 0.56924 0.65730 0.07483  -0.07074 -0.02583 209 TRP A CZ2 
1336 C CZ3 . TRP A 209 ? 0.62999 0.63273 0.72529 0.05901  -0.08388 -0.02772 209 TRP A CZ3 
1337 C CH2 . TRP A 209 ? 0.65590 0.67153 0.76400 0.06961  -0.07965 -0.02591 209 TRP A CH2 
1338 N N   . ASP A 210 ? 0.57883 0.51591 0.55443 0.02343  -0.03716 -0.02273 210 ASP A N   
1339 C CA  . ASP A 210 ? 0.67600 0.61389 0.63677 0.02148  -0.03243 -0.02343 210 ASP A CA  
1340 C C   . ASP A 210 ? 0.71816 0.67184 0.69848 0.02156  -0.03006 -0.02818 210 ASP A C   
1341 O O   . ASP A 210 ? 0.71481 0.66521 0.69039 0.02619  -0.03603 -0.03354 210 ASP A O   
1342 C CB  . ASP A 210 ? 0.65480 0.59169 0.60015 0.01337  -0.02053 -0.01692 210 ASP A CB  
1343 C CG  . ASP A 210 ? 0.67216 0.58724 0.59267 0.01167  -0.02314 -0.01034 210 ASP A CG  
1344 O OD1 . ASP A 210 ? 0.59606 0.49626 0.50459 0.01952  -0.03404 -0.01126 210 ASP A OD1 
1345 O OD2 . ASP A 210 ? 0.70489 0.61686 0.61796 0.00182  -0.01537 -0.00364 210 ASP A OD2 
1346 N N   . GLN A 211 ? 0.60689 0.57458 0.60642 0.01710  -0.02246 -0.02642 211 GLN A N   
1347 C CA  . GLN A 211 ? 0.61224 0.59231 0.62894 0.01735  -0.02006 -0.02893 211 GLN A CA  
1348 C C   . GLN A 211 ? 0.61632 0.59403 0.64796 0.02034  -0.03150 -0.03267 211 GLN A C   
1349 O O   . GLN A 211 ? 0.64309 0.61703 0.67499 0.02250  -0.03554 -0.03703 211 GLN A O   
1350 C CB  . GLN A 211 ? 0.54799 0.54224 0.58113 0.01297  -0.01203 -0.02535 211 GLN A CB  
1351 C CG  . GLN A 211 ? 0.51099 0.50735 0.53313 0.00735  -0.00401 -0.02185 211 GLN A CG  
1352 C CD  . GLN A 211 ? 0.61645 0.62170 0.65064 0.00416  -0.00019 -0.01999 211 GLN A CD  
1353 O OE1 . GLN A 211 ? 0.73367 0.74362 0.78260 0.00745  -0.00218 -0.02027 211 GLN A OE1 
1354 N NE2 . GLN A 211 ? 0.56784 0.57662 0.59549 -0.00265 0.00509  -0.01774 211 GLN A NE2 
1355 N N   . ALA A 212 ? 0.52770 0.50799 0.57295 0.02058  -0.03737 -0.03100 212 ALA A N   
1356 C CA  . ALA A 212 ? 0.44651 0.42849 0.50942 0.02132  -0.04980 -0.03326 212 ALA A CA  
1357 C C   . ALA A 212 ? 0.60476 0.57031 0.64921 0.02469  -0.06148 -0.03988 212 ALA A C   
1358 O O   . ALA A 212 ? 0.56693 0.52867 0.62025 0.02328  -0.07059 -0.04411 212 ALA A O   
1359 C CB  . ALA A 212 ? 0.50754 0.49737 0.58376 0.02410  -0.05439 -0.03059 212 ALA A CB  
1360 N N   . LEU A 213 ? 0.71716 0.67029 0.73288 0.02901  -0.06170 -0.04067 213 LEU A N   
1361 C CA  . LEU A 213 ? 0.64907 0.58590 0.64113 0.03438  -0.07289 -0.04712 213 LEU A CA  
1362 C C   . LEU A 213 ? 0.63737 0.56858 0.61542 0.03672  -0.06818 -0.05250 213 LEU A C   
1363 O O   . LEU A 213 ? 0.71049 0.62854 0.67843 0.04107  -0.08023 -0.06084 213 LEU A O   
1364 C CB  . LEU A 213 ? 0.66210 0.58696 0.62429 0.03874  -0.07287 -0.04404 213 LEU A CB  
1365 C CG  . LEU A 213 ? 0.68537 0.59331 0.62075 0.04607  -0.08709 -0.05017 213 LEU A CG  
1366 C CD1 . LEU A 213 ? 0.74451 0.65441 0.70120 0.04696  -0.10693 -0.05441 213 LEU A CD1 
1367 C CD2 . LEU A 213 ? 0.58455 0.47880 0.48414 0.05018  -0.08396 -0.04441 213 LEU A CD2 
1368 N N   . ALA A 214 ? 0.61832 0.55914 0.59512 0.03508  -0.05200 -0.04871 214 ALA A N   
1369 C CA  . ALA A 214 ? 0.65810 0.59676 0.62279 0.04063  -0.04695 -0.05399 214 ALA A CA  
1370 C C   . ALA A 214 ? 0.73909 0.67572 0.72546 0.03970  -0.05330 -0.05800 214 ALA A C   
1371 O O   . ALA A 214 ? 0.81308 0.73579 0.78727 0.04677  -0.05922 -0.06642 214 ALA A O   
1372 C CB  . ALA A 214 ? 0.58364 0.53809 0.54388 0.03936  -0.02873 -0.04804 214 ALA A CB  
1373 N N   . ILE A 215 ? 0.70832 0.65655 0.72459 0.03163  -0.05230 -0.05180 215 ILE A N   
1374 C CA  . ILE A 215 ? 0.66212 0.60712 0.69951 0.02842  -0.05851 -0.05255 215 ILE A CA  
1375 C C   . ILE A 215 ? 0.61752 0.54608 0.65722 0.02696  -0.07812 -0.05908 215 ILE A C   
1376 O O   . ILE A 215 ? 0.66034 0.57219 0.70036 0.02747  -0.08752 -0.06472 215 ILE A O   
1377 C CB  . ILE A 215 ? 0.62106 0.58517 0.68745 0.02039  -0.05098 -0.04255 215 ILE A CB  
1378 C CG1 . ILE A 215 ? 0.50474 0.48153 0.56668 0.02215  -0.03505 -0.03833 215 ILE A CG1 
1379 C CG2 . ILE A 215 ? 0.38805 0.34892 0.47780 0.01447  -0.05795 -0.03998 215 ILE A CG2 
1380 C CD1 . ILE A 215 ? 0.36921 0.36396 0.44801 0.01667  -0.02662 -0.03005 215 ILE A CD1 
1381 N N   . ARG A 216 ? 0.50470 0.43568 0.54467 0.02561  -0.08633 -0.05892 216 ARG A N   
1382 C CA  . ARG A 216 ? 0.67845 0.59608 0.72019 0.02418  -0.10751 -0.06582 216 ARG A CA  
1383 C C   . ARG A 216 ? 0.76070 0.65227 0.76696 0.03373  -0.11570 -0.07811 216 ARG A C   
1384 O O   . ARG A 216 ? 0.81473 0.68737 0.82192 0.03230  -0.13132 -0.08606 216 ARG A O   
1385 C CB  . ARG A 216 ? 0.83721 0.76390 0.88273 0.02431  -0.11506 -0.06348 216 ARG A CB  
1386 C CG  . ARG A 216 ? 1.07475 1.02148 1.16212 0.01494  -0.12183 -0.05706 216 ARG A CG  
1387 C CD  . ARG A 216 ? 1.27947 1.22738 1.37349 0.01513  -0.14261 -0.06067 216 ARG A CD  
1388 N NE  . ARG A 216 ? 1.38900 1.36643 1.52620 0.00818  -0.14415 -0.05207 216 ARG A NE  
1389 C CZ  . ARG A 216 ? 1.40449 1.39409 1.57758 -0.00425 -0.14947 -0.04784 216 ARG A CZ  
1390 N NH1 . ARG A 216 ? 1.37601 1.34467 1.54543 -0.01132 -0.15602 -0.05222 216 ARG A NH1 
1391 N NH2 . ARG A 216 ? 1.39197 1.41443 1.60426 -0.00914 -0.14807 -0.03862 216 ARG A NH2 
1392 N N   . TRP A 217 ? 0.65594 0.54576 0.62967 0.04350  -0.10485 -0.07947 217 TRP A N   
1393 C CA  . TRP A 217 ? 0.67773 0.54701 0.61351 0.05583  -0.10815 -0.09060 217 TRP A CA  
1394 C C   . TRP A 217 ? 0.76149 0.61897 0.69859 0.05973  -0.10751 -0.09685 217 TRP A C   
1395 O O   . TRP A 217 ? 0.86286 0.69449 0.77865 0.06771  -0.12112 -0.10959 217 TRP A O   
1396 C CB  . TRP A 217 ? 0.75121 0.62930 0.65852 0.06345  -0.09048 -0.08642 217 TRP A CB  
1397 C CG  . TRP A 217 ? 0.77209 0.63259 0.63507 0.07788  -0.09366 -0.09654 217 TRP A CG  
1398 C CD1 . TRP A 217 ? 0.69730 0.54573 0.53057 0.08331  -0.10359 -0.09955 217 TRP A CD1 
1399 C CD2 . TRP A 217 ? 0.86711 0.72058 0.70825 0.09100  -0.08677 -0.10504 217 TRP A CD2 
1400 N NE1 . TRP A 217 ? 0.88264 0.71682 0.67474 0.09864  -0.10269 -0.10952 217 TRP A NE1 
1401 C CE2 . TRP A 217 ? 0.96044 0.79829 0.75721 0.10435  -0.09182 -0.11346 217 TRP A CE2 
1402 C CE3 . TRP A 217 ? 0.87041 0.72942 0.72352 0.09485  -0.07697 -0.10637 217 TRP A CE3 
1403 C CZ2 . TRP A 217 ? 0.92853 0.75791 0.69278 0.12221  -0.08580 -0.12378 217 TRP A CZ2 
1404 C CZ3 . TRP A 217 ? 0.88086 0.73073 0.70367 0.11301  -0.07233 -0.11675 217 TRP A CZ3 
1405 C CH2 . TRP A 217 ? 0.93655 0.77257 0.71573 0.12678  -0.07607 -0.12565 217 TRP A CH2 
1406 N N   . LEU A 218 ? 0.72381 0.59716 0.68345 0.05542  -0.09325 -0.08857 218 LEU A N   
1407 C CA  . LEU A 218 ? 0.69806 0.55911 0.65695 0.06147  -0.09224 -0.09332 218 LEU A CA  
1408 C C   . LEU A 218 ? 0.68316 0.52284 0.66116 0.05269  -0.11153 -0.09637 218 LEU A C   
1409 O O   . LEU A 218 ? 0.78677 0.59882 0.75098 0.06009  -0.12098 -0.10618 218 LEU A O   
1410 C CB  . LEU A 218 ? 0.73869 0.62391 0.71430 0.06017  -0.07258 -0.08287 218 LEU A CB  
1411 C CG  . LEU A 218 ? 0.75485 0.65793 0.70923 0.06946  -0.05515 -0.08169 218 LEU A CG  
1412 C CD1 . LEU A 218 ? 0.68465 0.61736 0.65995 0.06209  -0.03847 -0.06927 218 LEU A CD1 
1413 C CD2 . LEU A 218 ? 0.52936 0.42101 0.45677 0.08797  -0.05267 -0.09238 218 LEU A CD2 
1414 N N   . LYS A 219 ? 0.72368 0.57534 0.73339 0.03711  -0.11795 -0.08790 219 LYS A N   
1415 C CA  . LYS A 219 ? 0.80060 0.63542 0.83190 0.02529  -0.13728 -0.08890 219 LYS A CA  
1416 C C   . LYS A 219 ? 0.79238 0.59748 0.79983 0.02950  -0.16035 -0.10427 219 LYS A C   
1417 O O   . LYS A 219 ? 0.74479 0.51840 0.74810 0.02800  -0.17688 -0.11254 219 LYS A O   
1418 C CB  . LYS A 219 ? 0.79413 0.65622 0.86546 0.00909  -0.13769 -0.07597 219 LYS A CB  
1419 C CG  . LYS A 219 ? 0.86180 0.73892 0.96346 -0.00042 -0.12605 -0.06204 219 LYS A CG  
1420 C CD  . LYS A 219 ? 0.92900 0.79973 1.06255 -0.01752 -0.14146 -0.05640 219 LYS A CD  
1421 C CE  . LYS A 219 ? 0.94509 0.83861 1.10939 -0.02738 -0.12660 -0.03880 219 LYS A CE  
1422 N NZ  . LYS A 219 ? 0.94988 0.83680 1.14519 -0.04581 -0.13907 -0.03001 219 LYS A NZ  
1423 N N   . ASP A 220 ? 0.76615 0.57824 0.75562 0.03485  -0.16307 -0.10817 220 ASP A N   
1424 C CA  . ASP A 220 ? 0.76054 0.54654 0.72329 0.04013  -0.18579 -0.12285 220 ASP A CA  
1425 C C   . ASP A 220 ? 0.88182 0.63445 0.80342 0.05688  -0.18833 -0.13802 220 ASP A C   
1426 O O   . ASP A 220 ? 1.06798 0.78694 0.97297 0.05872  -0.21168 -0.15218 220 ASP A O   
1427 C CB  . ASP A 220 ? 0.77932 0.57948 0.72362 0.04632  -0.18391 -0.12207 220 ASP A CB  
1428 C CG  . ASP A 220 ? 0.84837 0.67564 0.83005 0.03319  -0.18830 -0.11089 220 ASP A CG  
1429 O OD1 . ASP A 220 ? 0.85850 0.69254 0.87935 0.01837  -0.19865 -0.10638 220 ASP A OD1 
1430 O OD2 . ASP A 220 ? 0.78087 0.62251 0.75189 0.03844  -0.18148 -0.10618 220 ASP A OD2 
1431 N N   . ASN A 221 ? 0.80958 0.57172 0.71497 0.06982  -0.16521 -0.13574 221 ASN A N   
1432 C CA  . ASN A 221 ? 0.78792 0.52742 0.65075 0.09104  -0.16257 -0.14963 221 ASN A CA  
1433 C C   . ASN A 221 ? 0.88361 0.61414 0.75386 0.09656  -0.15470 -0.14953 221 ASN A C   
1434 O O   . ASN A 221 ? 0.95769 0.67534 0.79569 0.11734  -0.14849 -0.15992 221 ASN A O   
1435 C CB  . ASN A 221 ? 0.96322 0.72489 0.79792 0.10410  -0.14230 -0.14707 221 ASN A CB  
1436 C CG  . ASN A 221 ? 1.21758 0.97780 1.03330 0.10324  -0.15317 -0.14933 221 ASN A CG  
1437 O OD1 . ASN A 221 ? 1.36859 1.11149 1.19056 0.09513  -0.17753 -0.15531 221 ASN A OD1 
1438 N ND2 . ASN A 221 ? 1.25878 1.03778 1.05293 0.11043  -0.13627 -0.14332 221 ASN A ND2 
1439 N N   . ALA A 222 ? 0.87957 0.61714 0.79042 0.07993  -0.15479 -0.13761 222 ALA A N   
1440 C CA  . ALA A 222 ? 0.95314 0.67894 0.87126 0.08458  -0.14961 -0.13574 222 ALA A CA  
1441 C C   . ALA A 222 ? 0.98546 0.66218 0.87262 0.09870  -0.16780 -0.15393 222 ALA A C   
1442 O O   . ALA A 222 ? 0.99396 0.66125 0.85911 0.11936  -0.15883 -0.16053 222 ALA A O   
1443 C CB  . ALA A 222 ? 0.97596 0.71030 0.93908 0.06237  -0.15185 -0.12003 222 ALA A CB  
1444 N N   . HIS A 223 ? 1.03944 0.68427 0.92441 0.08856  -0.19471 -0.16294 223 HIS A N   
1445 C CA  . HIS A 223 ? 1.13847 0.72884 0.99357 0.09989  -0.21618 -0.18142 223 HIS A CA  
1446 C C   . HIS A 223 ? 1.14871 0.72730 0.95007 0.13034  -0.21117 -0.19976 223 HIS A C   
1447 O O   . HIS A 223 ? 1.22744 0.77091 1.00042 0.15030  -0.21580 -0.21329 223 HIS A O   
1448 C CB  . HIS A 223 ? 1.34168 0.90304 1.20627 0.08032  -0.24821 -0.18763 223 HIS A CB  
1449 C CG  . HIS A 223 ? 1.50720 1.05789 1.41499 0.05499  -0.25910 -0.17454 223 HIS A CG  
1450 N ND1 . HIS A 223 ? 1.56980 1.08369 1.47515 0.05812  -0.26354 -0.17504 223 HIS A ND1 
1451 C CD2 . HIS A 223 ? 1.50963 1.08281 1.46389 0.02656  -0.26566 -0.15927 223 HIS A CD2 
1452 C CE1 . HIS A 223 ? 1.55073 1.06353 1.49828 0.03077  -0.27209 -0.15935 223 HIS A CE1 
1453 N NE2 . HIS A 223 ? 1.52744 1.07857 1.50642 0.01134  -0.27276 -0.14963 223 HIS A NE2 
1454 N N   . ALA A 224 ? 1.08974 0.69713 0.87501 0.13570  -0.20075 -0.19971 224 ALA A N   
1455 C CA  . ALA A 224 ? 1.07372 0.67426 0.80653 0.16447  -0.19354 -0.21499 224 ALA A CA  
1456 C C   . ALA A 224 ? 1.17567 0.79684 0.90154 0.18523  -0.16667 -0.21190 224 ALA A C   
1457 O O   . ALA A 224 ? 1.19840 0.81093 0.88141 0.21272  -0.16045 -0.22581 224 ALA A O   
1458 C CB  . ALA A 224 ? 0.97440 0.60253 0.69211 0.16373  -0.18678 -0.21169 224 ALA A CB  
1459 N N   . PHE A 225 ? 1.10197 0.75277 0.86832 0.17401  -0.15064 -0.19416 225 PHE A N   
1460 C CA  . PHE A 225 ? 0.97733 0.65068 0.74210 0.19275  -0.12762 -0.19066 225 PHE A CA  
1461 C C   . PHE A 225 ? 0.97729 0.62066 0.75278 0.19756  -0.13593 -0.19256 225 PHE A C   
1462 O O   . PHE A 225 ? 0.92488 0.58698 0.70453 0.21280  -0.11918 -0.18846 225 PHE A O   
1463 C CB  . PHE A 225 ? 0.93641 0.66649 0.73276 0.18015  -0.10288 -0.17010 225 PHE A CB  
1464 C CG  . PHE A 225 ? 0.90806 0.66655 0.68595 0.18192  -0.09029 -0.16793 225 PHE A CG  
1465 C CD1 . PHE A 225 ? 0.87354 0.63881 0.66250 0.16153  -0.09699 -0.16071 225 PHE A CD1 
1466 C CD2 . PHE A 225 ? 0.88812 0.66600 0.63627 0.20508  -0.07201 -0.17258 225 PHE A CD2 
1467 C CE1 . PHE A 225 ? 0.89770 0.68347 0.66603 0.16346  -0.08682 -0.15755 225 PHE A CE1 
1468 C CE2 . PHE A 225 ? 0.90329 0.70539 0.63220 0.20518  -0.06000 -0.16817 225 PHE A CE2 
1469 C CZ  . PHE A 225 ? 0.85791 0.66100 0.59559 0.18400  -0.06816 -0.16045 225 PHE A CZ  
1470 N N   . GLY A 226 ? 1.01932 0.61495 0.79749 0.18579  -0.16272 -0.19892 226 GLY A N   
1471 C CA  . GLY A 226 ? 1.07162 0.63428 0.86298 0.18474  -0.17262 -0.19685 226 GLY A CA  
1472 C C   . GLY A 226 ? 1.11916 0.70649 0.96027 0.15845  -0.16609 -0.17339 226 GLY A C   
1473 O O   . GLY A 226 ? 1.21353 0.78233 1.06625 0.15922  -0.16831 -0.16718 226 GLY A O   
1474 N N   . GLY A 227 ? 1.02663 0.65357 0.89462 0.13702  -0.15817 -0.16019 227 GLY A N   
1475 C CA  . GLY A 227 ? 0.97075 0.62599 0.88262 0.11467  -0.14934 -0.13847 227 GLY A CA  
1476 C C   . GLY A 227 ? 1.00149 0.63957 0.93979 0.08688  -0.16900 -0.13208 227 GLY A C   
1477 O O   . GLY A 227 ? 1.06546 0.69090 0.99640 0.07966  -0.18534 -0.14122 227 GLY A O   
1478 N N   . ASN A 228 ? 1.00455 0.64391 0.97389 0.07157  -0.16752 -0.11554 228 ASN A N   
1479 C CA  . ASN A 228 ? 0.94072 0.57588 0.94363 0.04271  -0.18115 -0.10412 228 ASN A CA  
1480 C C   . ASN A 228 ? 0.91699 0.60650 0.94873 0.02882  -0.16585 -0.09045 228 ASN A C   
1481 O O   . ASN A 228 ? 0.92787 0.64924 0.97523 0.02838  -0.14595 -0.07637 228 ASN A O   
1482 C CB  . ASN A 228 ? 0.91149 0.52535 0.93205 0.03348  -0.18372 -0.09016 228 ASN A CB  
1483 C CG  . ASN A 228 ? 0.87189 0.48169 0.92857 0.00229  -0.19736 -0.07646 228 ASN A CG  
1484 O OD1 . ASN A 228 ? 0.95778 0.60135 1.03843 -0.01325 -0.19618 -0.07085 228 ASN A OD1 
1485 N ND2 . ASN A 228 ? 0.85011 0.41880 0.91160 -0.00680 -0.21044 -0.07001 228 ASN A ND2 
1486 N N   . PRO A 229 ? 0.91195 0.61180 0.95066 0.01828  -0.17577 -0.09427 229 PRO A N   
1487 C CA  . PRO A 229 ? 0.84220 0.59106 0.90443 0.00925  -0.16143 -0.08281 229 PRO A CA  
1488 C C   . PRO A 229 ? 0.82779 0.60166 0.93158 -0.01000 -0.15356 -0.06197 229 PRO A C   
1489 O O   . PRO A 229 ? 0.81660 0.63023 0.93508 -0.01179 -0.13625 -0.05195 229 PRO A O   
1490 C CB  . PRO A 229 ? 0.81263 0.55848 0.87242 0.00325  -0.17967 -0.09245 229 PRO A CB  
1491 C CG  . PRO A 229 ? 0.85374 0.54965 0.88644 0.00906  -0.20302 -0.10977 229 PRO A CG  
1492 C CD  . PRO A 229 ? 0.86320 0.52856 0.89322 0.01164  -0.20352 -0.10760 229 PRO A CD  
1493 N N   . GLU A 230 ? 0.78643 0.53750 0.90849 -0.02481 -0.16602 -0.05473 230 GLU A N   
1494 C CA  . GLU A 230 ? 0.94015 0.71726 1.09899 -0.04191 -0.15561 -0.03292 230 GLU A CA  
1495 C C   . GLU A 230 ? 0.89517 0.67581 1.04693 -0.03205 -0.13703 -0.02321 230 GLU A C   
1496 O O   . GLU A 230 ? 0.82167 0.62328 0.99765 -0.04322 -0.12616 -0.00463 230 GLU A O   
1497 C CB  . GLU A 230 ? 1.12650 0.88117 1.31091 -0.06512 -0.17564 -0.02546 230 GLU A CB  
1498 C CG  . GLU A 230 ? 1.25371 1.02427 1.46103 -0.08024 -0.19153 -0.02856 230 GLU A CG  
1499 C CD  . GLU A 230 ? 1.34977 1.17192 1.60212 -0.09715 -0.17957 -0.00840 230 GLU A CD  
1500 O OE1 . GLU A 230 ? 1.39093 1.21687 1.66876 -0.11300 -0.17513 0.01018  230 GLU A OE1 
1501 O OE2 . GLU A 230 ? 1.35274 1.21120 1.61324 -0.09319 -0.17401 -0.01063 230 GLU A OE2 
1502 N N   . TRP A 231 ? 0.85417 0.61909 0.97320 -0.01022 -0.13253 -0.03511 231 TRP A N   
1503 C CA  . TRP A 231 ? 0.74670 0.51397 0.85759 0.00170  -0.11814 -0.02796 231 TRP A CA  
1504 C C   . TRP A 231 ? 0.74826 0.55087 0.84692 0.01708  -0.09914 -0.03188 231 TRP A C   
1505 O O   . TRP A 231 ? 0.82070 0.61639 0.89598 0.03655  -0.09444 -0.04058 231 TRP A O   
1506 C CB  . TRP A 231 ? 0.86114 0.57898 0.94673 0.01533  -0.13069 -0.03787 231 TRP A CB  
1507 C CG  . TRP A 231 ? 0.97826 0.68653 1.06492 0.01986  -0.12422 -0.02503 231 TRP A CG  
1508 C CD1 . TRP A 231 ? 0.96173 0.70195 1.06669 0.01356  -0.10812 -0.00626 231 TRP A CD1 
1509 C CD2 . TRP A 231 ? 0.98076 0.64223 1.04614 0.03386  -0.13462 -0.03013 231 TRP A CD2 
1510 N NE1 . TRP A 231 ? 0.91725 0.63426 1.01368 0.02217  -0.10821 0.00165  231 TRP A NE1 
1511 C CE2 . TRP A 231 ? 1.00162 0.66962 1.07472 0.03491  -0.12442 -0.01248 231 TRP A CE2 
1512 C CE3 . TRP A 231 ? 1.03167 0.64422 1.06929 0.04757  -0.15225 -0.04863 231 TRP A CE3 
1513 C CZ2 . TRP A 231 ? 1.04344 0.67056 1.09904 0.04919  -0.13168 -0.01174 231 TRP A CZ2 
1514 C CZ3 . TRP A 231 ? 1.12968 0.70036 1.14945 0.06252  -0.15912 -0.04922 231 TRP A CZ3 
1515 C CH2 . TRP A 231 ? 1.09586 0.67402 1.12553 0.06322  -0.14899 -0.03033 231 TRP A CH2 
1516 N N   . MET A 232 ? 0.68814 0.52891 0.80300 0.00874  -0.08843 -0.02530 232 MET A N   
1517 C CA  . MET A 232 ? 0.67237 0.54317 0.77638 0.01946  -0.07297 -0.02882 232 MET A CA  
1518 C C   . MET A 232 ? 0.67155 0.57196 0.78837 0.01732  -0.05669 -0.01494 232 MET A C   
1519 O O   . MET A 232 ? 0.77097 0.68156 0.90919 0.00458  -0.05453 -0.00167 232 MET A O   
1520 C CB  . MET A 232 ? 0.70855 0.59430 0.81403 0.01456  -0.07498 -0.03431 232 MET A CB  
1521 C CG  . MET A 232 ? 0.83604 0.69297 0.92654 0.01666  -0.09300 -0.04833 232 MET A CG  
1522 S SD  . MET A 232 ? 0.84788 0.71839 0.92017 0.02270  -0.09193 -0.05840 232 MET A SD  
1523 C CE  . MET A 232 ? 0.58615 0.49805 0.68208 0.01402  -0.07533 -0.04411 232 MET A CE  
1524 N N   . THR A 233 ? 0.59413 0.51031 0.69752 0.02980  -0.04538 -0.01797 233 THR A N   
1525 C CA  . THR A 233 ? 0.67142 0.61477 0.78236 0.02935  -0.03201 -0.00752 233 THR A CA  
1526 C C   . THR A 233 ? 0.60584 0.57419 0.70856 0.03325  -0.02254 -0.01310 233 THR A C   
1527 O O   . THR A 233 ? 0.75739 0.72526 0.84447 0.04409  -0.02110 -0.02209 233 THR A O   
1528 C CB  . THR A 233 ? 0.60417 0.53985 0.70883 0.04019  -0.03029 -0.00350 233 THR A CB  
1529 O OG1 . THR A 233 ? 0.57674 0.48218 0.68640 0.03576  -0.04043 0.00274  233 THR A OG1 
1530 C CG2 . THR A 233 ? 0.45617 0.42008 0.56686 0.03948  -0.01873 0.00683  233 THR A CG2 
1531 N N   . LEU A 234 ? 0.50111 0.49048 0.61354 0.02481  -0.01600 -0.00748 234 LEU A N   
1532 C CA  . LEU A 234 ? 0.54572 0.55549 0.65026 0.02661  -0.00753 -0.01065 234 LEU A CA  
1533 C C   . LEU A 234 ? 0.55625 0.58330 0.66027 0.03070  0.00036  -0.00571 234 LEU A C   
1534 O O   . LEU A 234 ? 0.56000 0.58870 0.67145 0.02968  0.00147  0.00294  234 LEU A O   
1535 C CB  . LEU A 234 ? 0.62877 0.64893 0.74049 0.01813  -0.00564 -0.00834 234 LEU A CB  
1536 C CG  . LEU A 234 ? 0.64057 0.64964 0.75620 0.01385  -0.01453 -0.01218 234 LEU A CG  
1537 C CD1 . LEU A 234 ? 0.59758 0.61997 0.71877 0.00967  -0.01149 -0.01019 234 LEU A CD1 
1538 C CD2 . LEU A 234 ? 0.65554 0.65137 0.75281 0.01993  -0.01940 -0.02242 234 LEU A CD2 
1539 N N   . PHE A 235 ? 0.58399 0.62515 0.67930 0.03479  0.00536  -0.01032 235 PHE A N   
1540 C CA  . PHE A 235 ? 0.52154 0.58358 0.61848 0.03659  0.01095  -0.00636 235 PHE A CA  
1541 C C   . PHE A 235 ? 0.54535 0.62437 0.63699 0.03282  0.01575  -0.01013 235 PHE A C   
1542 O O   . PHE A 235 ? 0.56419 0.63974 0.64808 0.03358  0.01636  -0.01545 235 PHE A O   
1543 C CB  . PHE A 235 ? 0.40012 0.46249 0.49685 0.04858  0.00974  -0.00520 235 PHE A CB  
1544 C CG  . PHE A 235 ? 0.45219 0.51603 0.54124 0.05947  0.01041  -0.01310 235 PHE A CG  
1545 C CD1 . PHE A 235 ? 0.55738 0.60088 0.63705 0.06215  0.00660  -0.02060 235 PHE A CD1 
1546 C CD2 . PHE A 235 ? 0.42100 0.50793 0.51184 0.06903  0.01433  -0.01312 235 PHE A CD2 
1547 C CE1 . PHE A 235 ? 0.55466 0.59978 0.62311 0.07513  0.00845  -0.02846 235 PHE A CE1 
1548 C CE2 . PHE A 235 ? 0.55547 0.64871 0.63976 0.08180  0.01708  -0.02009 235 PHE A CE2 
1549 C CZ  . PHE A 235 ? 0.55332 0.62460 0.62443 0.08554  0.01491  -0.02798 235 PHE A CZ  
1550 N N   . GLY A 236 ? 0.50107 0.59653 0.59531 0.02788  0.01840  -0.00678 236 GLY A N   
1551 C CA  . GLY A 236 ? 0.45203 0.56142 0.54281 0.02055  0.02125  -0.00875 236 GLY A CA  
1552 C C   . GLY A 236 ? 0.59696 0.72261 0.69071 0.01670  0.02082  -0.00585 236 GLY A C   
1553 O O   . GLY A 236 ? 0.53875 0.66556 0.63491 0.02113  0.01922  -0.00196 236 GLY A O   
1554 N N   . GLU A 237 ? 0.60628 0.74236 0.69795 0.00736  0.02131  -0.00736 237 GLU A N   
1555 C CA  . GLU A 237 ? 0.51988 0.67245 0.61375 0.00183  0.01833  -0.00645 237 GLU A CA  
1556 C C   . GLU A 237 ? 0.64625 0.78831 0.73109 -0.01101 0.01591  -0.00905 237 GLU A C   
1557 O O   . GLU A 237 ? 0.57222 0.70332 0.65212 -0.01654 0.01791  -0.00998 237 GLU A O   
1558 C CB  . GLU A 237 ? 0.31790 0.49943 0.42309 0.00338  0.01948  -0.00518 237 GLU A CB  
1559 C CG  . GLU A 237 ? 0.51095 0.71350 0.62218 0.00106  0.01386  -0.00385 237 GLU A CG  
1560 C CD  . GLU A 237 ? 0.58201 0.79130 0.69305 -0.01605 0.01006  -0.00532 237 GLU A CD  
1561 O OE1 . GLU A 237 ? 0.61958 0.82368 0.72900 -0.02537 0.01387  -0.00528 237 GLU A OE1 
1562 O OE2 . GLU A 237 ? 0.61788 0.83490 0.72830 -0.02054 0.00225  -0.00630 237 GLU A OE2 
1563 N N   . SER A 238 ? 0.64371 0.78594 0.72318 -0.01464 0.01060  -0.01048 238 SER A N   
1564 C CA  . SER A 238 ? 0.66949 0.79519 0.73645 -0.02491 0.00603  -0.01460 238 SER A CA  
1565 C C   . SER A 238 ? 0.58456 0.68500 0.64288 -0.02192 0.00891  -0.01604 238 SER A C   
1566 O O   . SER A 238 ? 0.47253 0.56710 0.53104 -0.01204 0.01162  -0.01525 238 SER A O   
1567 C CB  . SER A 238 ? 1.10734 1.24299 1.17855 -0.04030 0.00319  -0.01407 238 SER A CB  
1568 N N   . ALA A 239 ? 0.52956 0.61666 0.58168 -0.03072 0.00814  -0.01679 239 ALA A N   
1569 C CA  . ALA A 239 ? 0.55833 0.62232 0.60199 -0.02668 0.00905  -0.01804 239 ALA A CA  
1570 C C   . ALA A 239 ? 0.53280 0.60079 0.58515 -0.01778 0.01371  -0.01572 239 ALA A C   
1571 O O   . ALA A 239 ? 0.53461 0.59133 0.58641 -0.01084 0.01352  -0.01658 239 ALA A O   
1572 C CB  . ALA A 239 ? 0.53324 0.58028 0.56598 -0.03800 0.00640  -0.01760 239 ALA A CB  
1573 N N   . GLY A 240 ? 0.54045 0.62506 0.60144 -0.01699 0.01707  -0.01330 240 GLY A N   
1574 C CA  . GLY A 240 ? 0.64078 0.72425 0.70709 -0.00767 0.01911  -0.01292 240 GLY A CA  
1575 C C   . GLY A 240 ? 0.67699 0.76030 0.75086 -0.00013 0.01842  -0.01172 240 GLY A C   
1576 O O   . GLY A 240 ? 0.62023 0.69315 0.69716 0.00401  0.01728  -0.01158 240 GLY A O   
1577 N N   . SER A 241 ? 0.64511 0.74106 0.72234 0.00088  0.01858  -0.00980 241 SER A N   
1578 C CA  . SER A 241 ? 0.56328 0.65938 0.64447 0.00685  0.01915  -0.00625 241 SER A CA  
1579 C C   . SER A 241 ? 0.50767 0.59288 0.58532 0.00720  0.01959  -0.00700 241 SER A C   
1580 O O   . SER A 241 ? 0.43830 0.52063 0.52416 0.01071  0.02090  -0.00355 241 SER A O   
1581 C CB  . SER A 241 ? 0.61105 0.72143 0.69044 0.00784  0.01822  -0.00440 241 SER A CB  
1582 O OG  . SER A 241 ? 0.51634 0.62642 0.59514 0.01342  0.01997  0.00051  241 SER A OG  
1583 N N   . SER A 242 ? 0.50285 0.58197 0.56917 0.00383  0.01794  -0.01140 242 SER A N   
1584 C CA  . SER A 242 ? 0.55265 0.62176 0.61529 0.00787  0.01852  -0.01306 242 SER A CA  
1585 C C   . SER A 242 ? 0.59756 0.65844 0.66729 0.00859  0.01731  -0.01291 242 SER A C   
1586 O O   . SER A 242 ? 0.64879 0.70992 0.72525 0.01372  0.01827  -0.01161 242 SER A O   
1587 C CB  . SER A 242 ? 0.62911 0.68532 0.67469 0.00577  0.01499  -0.01939 242 SER A CB  
1588 O OG  . SER A 242 ? 0.72843 0.79009 0.76546 0.00324  0.01285  -0.02129 242 SER A OG  
1589 N N   . SER A 243 ? 0.51658 0.57237 0.58476 0.00416  0.01506  -0.01410 243 SER A N   
1590 C CA  . SER A 243 ? 0.55737 0.60396 0.62871 0.00590  0.01200  -0.01475 243 SER A CA  
1591 C C   . SER A 243 ? 0.59976 0.65217 0.68674 0.00888  0.01157  -0.01148 243 SER A C   
1592 O O   . SER A 243 ? 0.60693 0.65680 0.70293 0.01075  0.00827  -0.01087 243 SER A O   
1593 C CB  . SER A 243 ? 0.49580 0.53434 0.55627 0.00165  0.01037  -0.01661 243 SER A CB  
1594 O OG  . SER A 243 ? 0.57477 0.60679 0.62223 -0.00450 0.01033  -0.01749 243 SER A OG  
1595 N N   . VAL A 244 ? 0.42362 0.48326 0.51477 0.00914  0.01364  -0.00898 244 VAL A N   
1596 C CA  . VAL A 244 ? 0.44207 0.50253 0.54678 0.01089  0.01249  -0.00441 244 VAL A CA  
1597 C C   . VAL A 244 ? 0.45820 0.52600 0.57399 0.01101  0.01494  0.00097  244 VAL A C   
1598 O O   . VAL A 244 ? 0.54014 0.60725 0.66992 0.00952  0.01180  0.00379  244 VAL A O   
1599 C CB  . VAL A 244 ? 0.42295 0.48892 0.52795 0.01334  0.01458  -0.00124 244 VAL A CB  
1600 C CG1 . VAL A 244 ? 0.40370 0.46728 0.52103 0.01378  0.01376  0.00634  244 VAL A CG1 
1601 C CG2 . VAL A 244 ? 0.39537 0.45720 0.49367 0.01623  0.01267  -0.00624 244 VAL A CG2 
1602 N N   . ASN A 245 ? 0.58982 0.66644 0.69942 0.01296  0.02035  0.00230  245 ASN A N   
1603 C CA  . ASN A 245 ? 0.54588 0.63281 0.66192 0.01611  0.02517  0.00665  245 ASN A CA  
1604 C C   . ASN A 245 ? 0.47513 0.56083 0.59895 0.01768  0.02223  0.00397  245 ASN A C   
1605 O O   . ASN A 245 ? 0.49061 0.58782 0.63293 0.01778  0.02358  0.00991  245 ASN A O   
1606 C CB  . ASN A 245 ? 0.58970 0.67988 0.68876 0.02005  0.02906  0.00369  245 ASN A CB  
1607 C CG  . ASN A 245 ? 0.58556 0.68899 0.68608 0.02641  0.03646  0.00863  245 ASN A CG  
1608 O OD1 . ASN A 245 ? 0.67945 0.78439 0.76335 0.03100  0.03901  0.00600  245 ASN A OD1 
1609 N ND2 . ASN A 245 ? 0.30374 0.41827 0.42361 0.02677  0.03974  0.01573  245 ASN A ND2 
1610 N N   . ALA A 246 ? 0.57870 0.65191 0.68938 0.01877  0.01793  -0.00383 246 ALA A N   
1611 C CA  . ALA A 246 ? 0.50573 0.57669 0.62133 0.02279  0.01383  -0.00634 246 ALA A CA  
1612 C C   . ALA A 246 ? 0.57348 0.64550 0.70666 0.01901  0.00702  -0.00418 246 ALA A C   
1613 O O   . ALA A 246 ? 0.61663 0.70051 0.76780 0.02129  0.00509  -0.00146 246 ALA A O   
1614 C CB  . ALA A 246 ? 0.54912 0.60074 0.64363 0.02379  0.00931  -0.01352 246 ALA A CB  
1615 N N   . GLN A 247 ? 0.52594 0.58677 0.65445 0.01388  0.00262  -0.00583 247 GLN A N   
1616 C CA  . GLN A 247 ? 0.38978 0.44576 0.52998 0.01062  -0.00650 -0.00612 247 GLN A CA  
1617 C C   . GLN A 247 ? 0.50441 0.57314 0.66947 0.00590  -0.00597 0.00215  247 GLN A C   
1618 O O   . GLN A 247 ? 0.61833 0.68937 0.80059 0.00226  -0.01445 0.00319  247 GLN A O   
1619 C CB  . GLN A 247 ? 0.38678 0.42653 0.51210 0.00921  -0.01038 -0.01095 247 GLN A CB  
1620 C CG  . GLN A 247 ? 0.41881 0.44808 0.52064 0.01150  -0.01001 -0.01660 247 GLN A CG  
1621 C CD  . GLN A 247 ? 0.52630 0.54761 0.62286 0.01404  -0.01756 -0.01968 247 GLN A CD  
1622 O OE1 . GLN A 247 ? 0.58485 0.60489 0.69203 0.01425  -0.02686 -0.02073 247 GLN A OE1 
1623 N NE2 . GLN A 247 ? 0.59290 0.60739 0.67278 0.01560  -0.01517 -0.02081 247 GLN A NE2 
1624 N N   . LEU A 248 ? 0.51310 0.59019 0.68052 0.00492  0.00294  0.00906  248 LEU A N   
1625 C CA  . LEU A 248 ? 0.47086 0.55944 0.66111 -0.00113 0.00467  0.02005  248 LEU A CA  
1626 C C   . LEU A 248 ? 0.49750 0.61124 0.70718 0.00029  0.00981  0.02603  248 LEU A C   
1627 O O   . LEU A 248 ? 0.55496 0.68124 0.79079 -0.00717 0.00745  0.03443  248 LEU A O   
1628 C CB  . LEU A 248 ? 0.42760 0.51734 0.61174 -0.00128 0.01288  0.02753  248 LEU A CB  
1629 C CG  . LEU A 248 ? 0.58995 0.66147 0.75900 -0.00031 0.00998  0.02465  248 LEU A CG  
1630 C CD1 . LEU A 248 ? 0.60660 0.68626 0.76768 0.00295  0.01893  0.03176  248 LEU A CD1 
1631 C CD2 . LEU A 248 ? 0.63579 0.68938 0.81370 -0.00602 0.00031  0.02653  248 LEU A CD2 
1632 N N   . MET A 249 ? 0.53933 0.66117 0.73735 0.00995  0.01656  0.02200  249 MET A N   
1633 C CA  . MET A 249 ? 0.54377 0.69247 0.75662 0.01585  0.02494  0.02771  249 MET A CA  
1634 C C   . MET A 249 ? 0.67222 0.82690 0.89230 0.02300  0.01894  0.02150  249 MET A C   
1635 O O   . MET A 249 ? 0.73191 0.91412 0.97190 0.02849  0.02448  0.02680  249 MET A O   
1636 C CB  . MET A 249 ? 0.55824 0.71126 0.75010 0.02538  0.03679  0.02701  249 MET A CB  
1637 C CG  . MET A 249 ? 0.53625 0.68706 0.71957 0.02102  0.04284  0.03418  249 MET A CG  
1638 S SD  . MET A 249 ? 0.63271 0.80461 0.84685 0.01110  0.04819  0.05263  249 MET A SD  
1639 C CE  . MET A 249 ? 0.63543 0.78758 0.83513 0.00509  0.04719  0.05806  249 MET A CE  
1640 N N   . SER A 250 ? 0.59886 0.73028 0.80276 0.02431  0.00844  0.01137  250 SER A N   
1641 C CA  . SER A 250 ? 0.61639 0.74922 0.82295 0.03258  0.00107  0.00591  250 SER A CA  
1642 C C   . SER A 250 ? 0.57157 0.72573 0.81264 0.02758  -0.00673 0.01131  250 SER A C   
1643 O O   . SER A 250 ? 0.60677 0.75438 0.85825 0.01518  -0.01493 0.01348  250 SER A O   
1644 C CB  . SER A 250 ? 0.65089 0.75251 0.83104 0.03279  -0.00878 -0.00344 250 SER A CB  
1645 O OG  . SER A 250 ? 0.70762 0.80603 0.88504 0.04227  -0.01648 -0.00794 250 SER A OG  
1646 N N   . PRO A 251 ? 0.49388 0.67350 0.75397 0.03706  -0.00588 0.01311  251 PRO A N   
1647 C CA  . PRO A 251 ? 0.42146 0.62302 0.71667 0.03132  -0.01687 0.01734  251 PRO A CA  
1648 C C   . PRO A 251 ? 0.60059 0.77624 0.88566 0.02708  -0.03608 0.00907  251 PRO A C   
1649 O O   . PRO A 251 ? 0.72688 0.90865 1.03490 0.01541  -0.04835 0.01154  251 PRO A O   
1650 C CB  . PRO A 251 ? 0.37946 0.61187 0.69043 0.04792  -0.01217 0.01828  251 PRO A CB  
1651 C CG  . PRO A 251 ? 0.41430 0.62462 0.68803 0.06355  -0.00488 0.00995  251 PRO A CG  
1652 C CD  . PRO A 251 ? 0.43335 0.62231 0.68326 0.05483  0.00356  0.01024  251 PRO A CD  
1653 N N   . VAL A 252 ? 0.52982 0.67524 0.77932 0.03549  -0.03947 -0.00030 252 VAL A N   
1654 C CA  . VAL A 252 ? 0.50865 0.62913 0.74248 0.03345  -0.05609 -0.00750 252 VAL A CA  
1655 C C   . VAL A 252 ? 0.59288 0.69860 0.82591 0.01890  -0.06212 -0.00802 252 VAL A C   
1656 O O   . VAL A 252 ? 0.57750 0.67281 0.81095 0.01485  -0.07848 -0.01251 252 VAL A O   
1657 C CB  . VAL A 252 ? 0.55317 0.64320 0.74635 0.04266  -0.05459 -0.01426 252 VAL A CB  
1658 C CG1 . VAL A 252 ? 0.57648 0.63846 0.74602 0.03923  -0.06772 -0.02018 252 VAL A CG1 
1659 C CG2 . VAL A 252 ? 0.47446 0.57088 0.66617 0.05884  -0.05485 -0.01543 252 VAL A CG2 
1660 N N   . THR A 253 ? 0.62973 0.73297 0.86013 0.01237  -0.05037 -0.00401 253 THR A N   
1661 C CA  . THR A 253 ? 0.67644 0.75931 0.89861 0.00259  -0.05484 -0.00576 253 THR A CA  
1662 C C   . THR A 253 ? 0.82736 0.92244 1.07434 -0.00858 -0.05018 0.00391  253 THR A C   
1663 O O   . THR A 253 ? 0.91466 0.99074 1.15873 -0.01654 -0.05767 0.00247  253 THR A O   
1664 C CB  . THR A 253 ? 0.64315 0.70407 0.83079 0.00663  -0.04622 -0.01045 253 THR A CB  
1665 O OG1 . THR A 253 ? 0.68600 0.75979 0.87458 0.00877  -0.03047 -0.00477 253 THR A OG1 
1666 C CG2 . THR A 253 ? 0.45395 0.49889 0.61397 0.01514  -0.05027 -0.01781 253 THR A CG2 
1667 N N   . ARG A 254 ? 0.88768 1.01137 1.15570 -0.00842 -0.03779 0.01396  254 ARG A N   
1668 C CA  . ARG A 254 ? 0.92791 1.05984 1.21121 -0.01826 -0.02955 0.02547  254 ARG A CA  
1669 C C   . ARG A 254 ? 0.85349 0.98246 1.16220 -0.03381 -0.04365 0.03002  254 ARG A C   
1670 O O   . ARG A 254 ? 0.68122 0.81790 1.00799 -0.03729 -0.05770 0.02716  254 ARG A O   
1671 C CB  . ARG A 254 ? 0.98890 1.15594 1.28954 -0.01412 -0.01321 0.03630  254 ARG A CB  
1672 C CG  . ARG A 254 ? 1.07150 1.27335 1.40721 -0.01414 -0.01627 0.04132  254 ARG A CG  
1673 C CD  . ARG A 254 ? 1.08326 1.32280 1.44719 -0.01811 -0.00101 0.05773  254 ARG A CD  
1674 N NE  . ARG A 254 ? 1.21533 1.45666 1.55587 -0.00757 0.01748  0.05997  254 ARG A NE  
1675 C CZ  . ARG A 254 ? 1.33634 1.57815 1.67442 -0.01441 0.02821  0.07139  254 ARG A CZ  
1676 N NH1 . ARG A 254 ? 1.36237 1.60026 1.72023 -0.03240 0.02285  0.08250  254 ARG A NH1 
1677 N NH2 . ARG A 254 ? 1.32830 1.57172 1.64215 -0.00319 0.04287  0.07176  254 ARG A NH2 
1678 N N   . GLY A 255 ? 0.89536 1.01077 1.20428 -0.04317 -0.04142 0.03708  255 GLY A N   
1679 C CA  . GLY A 255 ? 0.98737 1.08780 1.31334 -0.05892 -0.05624 0.04059  255 GLY A CA  
1680 C C   . GLY A 255 ? 1.03825 1.09546 1.33545 -0.05686 -0.07022 0.02691  255 GLY A C   
1681 O O   . GLY A 255 ? 1.21033 1.24318 1.50854 -0.06626 -0.07835 0.02951  255 GLY A O   
1682 N N   . LEU A 256 ? 0.94431 0.99044 1.21417 -0.04392 -0.07279 0.01284  256 LEU A N   
1683 C CA  . LEU A 256 ? 0.86963 0.87885 1.10939 -0.03904 -0.08376 -0.00048 256 LEU A CA  
1684 C C   . LEU A 256 ? 0.93629 0.92709 1.15868 -0.03578 -0.07501 0.00151  256 LEU A C   
1685 O O   . LEU A 256 ? 0.98741 0.94964 1.20380 -0.03922 -0.08538 -0.00127 256 LEU A O   
1686 C CB  . LEU A 256 ? 0.82358 0.82998 1.03653 -0.02569 -0.08340 -0.01216 256 LEU A CB  
1687 C CG  . LEU A 256 ? 0.88594 0.89482 1.10253 -0.02504 -0.09924 -0.01915 256 LEU A CG  
1688 C CD1 . LEU A 256 ? 0.90827 0.94872 1.16646 -0.03434 -0.10375 -0.00979 256 LEU A CD1 
1689 C CD2 . LEU A 256 ? 0.81041 0.81895 0.99977 -0.01166 -0.09365 -0.02563 256 LEU A CD2 
1690 N N   . VAL A 257 ? 0.87980 0.88564 1.09359 -0.02837 -0.05737 0.00595  257 VAL A N   
1691 C CA  . VAL A 257 ? 0.74477 0.74004 0.94414 -0.02371 -0.04851 0.00897  257 VAL A CA  
1692 C C   . VAL A 257 ? 0.65044 0.66903 0.86682 -0.02833 -0.03498 0.02456  257 VAL A C   
1693 O O   . VAL A 257 ? 0.75618 0.80114 0.97971 -0.02633 -0.02545 0.02789  257 VAL A O   
1694 C CB  . VAL A 257 ? 0.69587 0.68912 0.86670 -0.01044 -0.04098 -0.00051 257 VAL A CB  
1695 C CG1 . VAL A 257 ? 0.70110 0.67911 0.85708 -0.00398 -0.03806 -0.00101 257 VAL A CG1 
1696 C CG2 . VAL A 257 ? 0.67325 0.65507 0.82886 -0.00594 -0.05070 -0.01336 257 VAL A CG2 
1697 N N   . LYS A 258 ? 0.58317 0.58996 0.80354 -0.03329 -0.03464 0.03411  258 LYS A N   
1698 C CA  . LYS A 258 ? 0.56475 0.59145 0.79799 -0.03780 -0.02184 0.05093  258 LYS A CA  
1699 C C   . LYS A 258 ? 0.60497 0.61780 0.81923 -0.03066 -0.01628 0.05491  258 LYS A C   
1700 O O   . LYS A 258 ? 0.73409 0.75015 0.95533 -0.03575 -0.01028 0.07044  258 LYS A O   
1701 C CB  . LYS A 258 ? 0.63778 0.66866 0.90167 -0.05496 -0.02703 0.06502  258 LYS A CB  
1702 C CG  . LYS A 258 ? 0.79006 0.83894 1.07778 -0.06223 -0.03490 0.06159  258 LYS A CG  
1703 C CD  . LYS A 258 ? 0.86628 0.92498 1.18975 -0.08187 -0.04016 0.07728  258 LYS A CD  
1704 C CE  . LYS A 258 ? 0.98144 1.01037 1.31130 -0.09252 -0.06390 0.06871  258 LYS A CE  
1705 N NZ  . LYS A 258 ? 0.97130 0.98708 1.32478 -0.11363 -0.07232 0.08429  258 LYS A NZ  
1706 N N   . ARG A 259 ? 0.54759 0.54631 0.73844 -0.01866 -0.01843 0.04214  259 ARG A N   
1707 C CA  . ARG A 259 ? 0.56528 0.55436 0.73969 -0.00947 -0.01466 0.04462  259 ARG A CA  
1708 C C   . ARG A 259 ? 0.66673 0.66586 0.82272 0.00273  -0.00987 0.03226  259 ARG A C   
1709 O O   . ARG A 259 ? 0.78647 0.77573 0.93332 0.00720  -0.01584 0.01940  259 ARG A O   
1710 C CB  . ARG A 259 ? 0.45174 0.40460 0.62071 -0.00857 -0.02693 0.04352  259 ARG A CB  
1711 C CG  . ARG A 259 ? 0.49677 0.44023 0.64852 0.00457  -0.02426 0.04495  259 ARG A CG  
1712 C CD  . ARG A 259 ? 0.52900 0.43203 0.67363 0.00768  -0.03716 0.04394  259 ARG A CD  
1713 N NE  . ARG A 259 ? 0.53069 0.41640 0.69082 -0.00822 -0.04285 0.05921  259 ARG A NE  
1714 C CZ  . ARG A 259 ? 0.62351 0.46732 0.77982 -0.01040 -0.05704 0.05974  259 ARG A CZ  
1715 N NH1 . ARG A 259 ? 0.67751 0.49346 0.81273 0.00583  -0.06607 0.04436  259 ARG A NH1 
1716 N NH2 . ARG A 259 ? 0.65885 0.48800 0.83171 -0.02845 -0.06220 0.07588  259 ARG A NH2 
1717 N N   . GLY A 260 ? 0.55064 0.56957 0.70068 0.00724  0.00040  0.03660  260 GLY A N   
1718 C CA  . GLY A 260 ? 0.50207 0.53446 0.63912 0.01433  0.00474  0.02672  260 GLY A CA  
1719 C C   . GLY A 260 ? 0.56643 0.60928 0.69399 0.02152  0.00988  0.03070  260 GLY A C   
1720 O O   . GLY A 260 ? 0.67962 0.72453 0.80881 0.02111  0.01285  0.04234  260 GLY A O   
1721 N N   . MET A 261 ? 0.47016 0.52109 0.58794 0.02778  0.01053  0.02177  261 MET A N   
1722 C CA  . MET A 261 ? 0.48153 0.54736 0.59237 0.03421  0.01330  0.02355  261 MET A CA  
1723 C C   . MET A 261 ? 0.57418 0.65778 0.68035 0.03066  0.01684  0.01718  261 MET A C   
1724 O O   . MET A 261 ? 0.52606 0.61049 0.63019 0.02924  0.01632  0.00889  261 MET A O   
1725 C CB  . MET A 261 ? 0.44309 0.50484 0.55009 0.04527  0.00951  0.01981  261 MET A CB  
1726 C CG  . MET A 261 ? 0.45682 0.54275 0.56050 0.05114  0.01138  0.01842  261 MET A CG  
1727 S SD  . MET A 261 ? 0.54195 0.62952 0.64451 0.06815  0.00792  0.01487  261 MET A SD  
1728 C CE  . MET A 261 ? 0.44004 0.55417 0.54311 0.07391  0.00708  0.02116  261 MET A CE  
1729 N N   . MET A 262 ? 0.55379 0.64893 0.65586 0.02915  0.01998  0.02133  262 MET A N   
1730 C CA  . MET A 262 ? 0.50926 0.61496 0.60444 0.02496  0.02131  0.01505  262 MET A CA  
1731 C C   . MET A 262 ? 0.60934 0.73071 0.69847 0.02790  0.01912  0.01474  262 MET A C   
1732 O O   . MET A 262 ? 0.77536 0.90139 0.85909 0.03209  0.01914  0.02109  262 MET A O   
1733 C CB  . MET A 262 ? 0.46148 0.56595 0.55423 0.02234  0.02521  0.01734  262 MET A CB  
1734 C CG  . MET A 262 ? 0.48121 0.57601 0.58344 0.01891  0.02577  0.01669  262 MET A CG  
1735 S SD  . MET A 262 ? 0.64197 0.74279 0.75050 0.01913  0.03223  0.02549  262 MET A SD  
1736 C CE  . MET A 262 ? 0.64580 0.75320 0.73658 0.02270  0.03486  0.01826  262 MET A CE  
1737 N N   . GLN A 263 ? 0.54920 0.68048 0.63957 0.02531  0.01695  0.00828  263 GLN A N   
1738 C CA  . GLN A 263 ? 0.49582 0.64709 0.58575 0.02627  0.01306  0.00753  263 GLN A CA  
1739 C C   . GLN A 263 ? 0.56451 0.71917 0.64672 0.01632  0.01046  0.00189  263 GLN A C   
1740 O O   . GLN A 263 ? 0.67013 0.82320 0.75380 0.00788  0.01074  -0.00291 263 GLN A O   
1741 C CB  . GLN A 263 ? 0.45402 0.61945 0.55421 0.02971  0.01272  0.00545  263 GLN A CB  
1742 C CG  . GLN A 263 ? 0.43055 0.58499 0.53457 0.04087  0.01406  0.00793  263 GLN A CG  
1743 C CD  . GLN A 263 ? 0.44547 0.61434 0.55659 0.04769  0.01535  0.00411  263 GLN A CD  
1744 O OE1 . GLN A 263 ? 0.40030 0.59530 0.51800 0.04406  0.01577  0.00216  263 GLN A OE1 
1745 N NE2 . GLN A 263 ? 0.33981 0.49222 0.44964 0.05777  0.01581  0.00308  263 GLN A NE2 
1746 N N   . SER A 264 ? 0.48844 0.64540 0.55980 0.01774  0.00720  0.00268  264 SER A N   
1747 C CA  . SER A 264 ? 0.43499 0.59069 0.49449 0.00996  0.00182  -0.00412 264 SER A CA  
1748 C C   . SER A 264 ? 0.43917 0.57491 0.49241 0.00391  0.00452  -0.00935 264 SER A C   
1749 O O   . SER A 264 ? 0.58392 0.71472 0.63306 -0.00605 -0.00015 -0.01525 264 SER A O   
1750 C CB  . SER A 264 ? 0.39017 0.56549 0.45748 0.00187  -0.00583 -0.00731 264 SER A CB  
1751 O OG  . SER A 264 ? 0.47795 0.67399 0.55265 0.01019  -0.00906 -0.00242 264 SER A OG  
1752 N N   . GLY A 265 ? 0.42830 0.55221 0.48110 0.00963  0.01111  -0.00650 265 GLY A N   
1753 C CA  . GLY A 265 ? 0.32452 0.43141 0.37198 0.00641  0.01244  -0.01144 265 GLY A CA  
1754 C C   . GLY A 265 ? 0.56539 0.66605 0.61493 0.01381  0.01905  -0.00772 265 GLY A C   
1755 O O   . GLY A 265 ? 0.57428 0.67699 0.63743 0.01573  0.02263  -0.00175 265 GLY A O   
1756 N N   . THR A 266 ? 0.49128 0.58442 0.52753 0.01814  0.02002  -0.01166 266 THR A N   
1757 C CA  . THR A 266 ? 0.53396 0.62828 0.57376 0.02617  0.02743  -0.00759 266 THR A CA  
1758 C C   . THR A 266 ? 0.61944 0.69919 0.64766 0.02942  0.02598  -0.01615 266 THR A C   
1759 O O   . THR A 266 ? 0.64496 0.71123 0.65637 0.02651  0.01917  -0.02467 266 THR A O   
1760 C CB  . THR A 266 ? 0.57172 0.67874 0.60482 0.03415  0.03317  -0.00074 266 THR A CB  
1761 O OG1 . THR A 266 ? 0.62432 0.72859 0.63428 0.03697  0.02836  -0.00771 266 THR A OG1 
1762 C CG2 . THR A 266 ? 0.47321 0.58995 0.51802 0.03234  0.03413  0.00964  266 THR A CG2 
1763 N N   . MET A 267 ? 0.60716 0.68870 0.64546 0.03511  0.03103  -0.01371 267 MET A N   
1764 C CA  . MET A 267 ? 0.52086 0.58743 0.55012 0.04050  0.02868  -0.02153 267 MET A CA  
1765 C C   . MET A 267 ? 0.61372 0.67564 0.62054 0.05238  0.03035  -0.02825 267 MET A C   
1766 O O   . MET A 267 ? 0.70863 0.74946 0.69942 0.05685  0.02502  -0.03765 267 MET A O   
1767 C CB  . MET A 267 ? 0.60568 0.68044 0.65528 0.04447  0.03237  -0.01679 267 MET A CB  
1768 C CG  . MET A 267 ? 0.72734 0.79887 0.79221 0.03455  0.02779  -0.01383 267 MET A CG  
1769 S SD  . MET A 267 ? 0.81699 0.86452 0.87147 0.03457  0.01965  -0.02156 267 MET A SD  
1770 C CE  . MET A 267 ? 0.76024 0.82030 0.82935 0.04790  0.02297  -0.01987 267 MET A CE  
1771 N N   . ASN A 268 ? 0.63806 0.71665 0.64039 0.05888  0.03734  -0.02364 268 ASN A N   
1772 C CA  . ASN A 268 ? 0.63535 0.70836 0.61027 0.07191  0.03854  -0.03154 268 ASN A CA  
1773 C C   . ASN A 268 ? 0.59356 0.64354 0.54386 0.06566  0.02572  -0.04278 268 ASN A C   
1774 O O   . ASN A 268 ? 0.69311 0.72693 0.61603 0.07567  0.02209  -0.05369 268 ASN A O   
1775 C CB  . ASN A 268 ? 0.50776 0.60490 0.48054 0.07997  0.04954  -0.02223 268 ASN A CB  
1776 C CG  . ASN A 268 ? 0.64012 0.74489 0.61680 0.06948  0.04668  -0.01449 268 ASN A CG  
1777 O OD1 . ASN A 268 ? 0.67204 0.77419 0.66606 0.05681  0.04111  -0.01180 268 ASN A OD1 
1778 N ND2 . ASN A 268 ? 0.59020 0.70452 0.54873 0.07672  0.05037  -0.01096 268 ASN A ND2 
1779 N N   . ALA A 269 ? 0.54338 0.59216 0.50337 0.04962  0.01838  -0.04062 269 ALA A N   
1780 C CA  . ALA A 269 ? 0.61092 0.64400 0.55392 0.04018  0.00553  -0.04926 269 ALA A CA  
1781 C C   . ALA A 269 ? 0.71344 0.71382 0.63942 0.03926  -0.00304 -0.06055 269 ALA A C   
1782 O O   . ALA A 269 ? 0.84317 0.83465 0.77810 0.04033  -0.00066 -0.05930 269 ALA A O   
1783 C CB  . ALA A 269 ? 0.55370 0.59796 0.51645 0.02392  0.00144  -0.04319 269 ALA A CB  
1784 N N   . PRO A 270 ? 0.80637 0.78560 0.70606 0.03761  -0.01464 -0.07175 270 PRO A N   
1785 C CA  . PRO A 270 ? 0.81806 0.75853 0.69671 0.03848  -0.02409 -0.08297 270 PRO A CA  
1786 C C   . PRO A 270 ? 0.83517 0.76078 0.72684 0.02153  -0.02925 -0.07918 270 PRO A C   
1787 O O   . PRO A 270 ? 1.01754 0.91461 0.89862 0.02603  -0.03231 -0.08341 270 PRO A O   
1788 C CB  . PRO A 270 ? 0.83266 0.75421 0.68253 0.03528  -0.03842 -0.09499 270 PRO A CB  
1789 C CG  . PRO A 270 ? 0.86603 0.82071 0.72544 0.03106  -0.03692 -0.08878 270 PRO A CG  
1790 C CD  . PRO A 270 ? 0.82278 0.81002 0.70569 0.04000  -0.01952 -0.07551 270 PRO A CD  
1791 N N   . TRP A 271 ? 0.65595 0.60041 0.56874 0.00384  -0.02990 -0.07086 271 TRP A N   
1792 C CA  . TRP A 271 ? 0.67125 0.60544 0.59467 -0.01257 -0.03305 -0.06575 271 TRP A CA  
1793 C C   . TRP A 271 ? 0.69999 0.64577 0.64231 -0.00739 -0.02230 -0.05710 271 TRP A C   
1794 O O   . TRP A 271 ? 0.78028 0.71686 0.72777 -0.01815 -0.02366 -0.05238 271 TRP A O   
1795 C CB  . TRP A 271 ? 0.66597 0.62052 0.60442 -0.03220 -0.03741 -0.06068 271 TRP A CB  
1796 C CG  . TRP A 271 ? 0.68660 0.68053 0.64473 -0.02708 -0.02899 -0.05401 271 TRP A CG  
1797 C CD1 . TRP A 271 ? 0.73879 0.74882 0.69274 -0.02209 -0.03140 -0.05623 271 TRP A CD1 
1798 C CD2 . TRP A 271 ? 0.73527 0.75280 0.71699 -0.02562 -0.01833 -0.04417 271 TRP A CD2 
1799 N NE1 . TRP A 271 ? 0.70005 0.74121 0.67424 -0.01769 -0.02265 -0.04719 271 TRP A NE1 
1800 C CE2 . TRP A 271 ? 0.63120 0.67624 0.62259 -0.01980 -0.01488 -0.04047 271 TRP A CE2 
1801 C CE3 . TRP A 271 ? 0.68339 0.69869 0.67603 -0.02784 -0.01260 -0.03860 271 TRP A CE3 
1802 C CZ2 . TRP A 271 ? 0.60253 0.66953 0.61435 -0.01635 -0.00641 -0.03196 271 TRP A CZ2 
1803 C CZ3 . TRP A 271 ? 0.60419 0.64283 0.61612 -0.02411 -0.00439 -0.03146 271 TRP A CZ3 
1804 C CH2 . TRP A 271 ? 0.56031 0.62304 0.58188 -0.01860 -0.00159 -0.02845 271 TRP A CH2 
1805 N N   . SER A 272 ? 0.64641 0.61188 0.59832 0.00789  -0.01234 -0.05438 272 SER A N   
1806 C CA  . SER A 272 ? 0.60818 0.58933 0.58160 0.01041  -0.00419 -0.04607 272 SER A CA  
1807 C C   . SER A 272 ? 0.56119 0.53498 0.53343 0.02607  -0.00073 -0.04766 272 SER A C   
1808 O O   . SER A 272 ? 0.61157 0.59927 0.60233 0.02908  0.00439  -0.04157 272 SER A O   
1809 C CB  . SER A 272 ? 0.66545 0.67881 0.65749 0.01131  0.00319  -0.03897 272 SER A CB  
1810 O OG  . SER A 272 ? 0.76337 0.78918 0.77299 0.01788  0.01031  -0.03285 272 SER A OG  
1811 N N   . HIS A 273 ? 0.66560 0.61871 0.61680 0.03721  -0.00426 -0.05631 273 HIS A N   
1812 C CA  . HIS A 273 ? 0.69625 0.64229 0.64696 0.05334  -0.00224 -0.05819 273 HIS A CA  
1813 C C   . HIS A 273 ? 0.72446 0.63063 0.64504 0.05967  -0.01193 -0.06902 273 HIS A C   
1814 O O   . HIS A 273 ? 0.65206 0.53992 0.55225 0.05351  -0.01908 -0.07594 273 HIS A O   
1815 C CB  . HIS A 273 ? 0.61143 0.58697 0.57375 0.06987  0.00895  -0.05594 273 HIS A CB  
1816 C CG  . HIS A 273 ? 0.73093 0.70564 0.67198 0.07992  0.01087  -0.06302 273 HIS A CG  
1817 N ND1 . HIS A 273 ? 0.68802 0.67278 0.62468 0.07126  0.01094  -0.06177 273 HIS A ND1 
1818 C CD2 . HIS A 273 ? 0.74739 0.71090 0.66698 0.09964  0.01180  -0.07239 273 HIS A CD2 
1819 C CE1 . HIS A 273 ? 0.70177 0.68096 0.61376 0.08427  0.01134  -0.06998 273 HIS A CE1 
1820 N NE2 . HIS A 273 ? 0.69992 0.66570 0.60033 0.10200  0.01241  -0.07701 273 HIS A NE2 
1821 N N   . MET A 274 ? 0.68599 0.57659 0.60358 0.07161  -0.01406 -0.07051 274 MET A N   
1822 C CA  . MET A 274 ? 0.60417 0.44970 0.49193 0.07871  -0.02488 -0.08000 274 MET A CA  
1823 C C   . MET A 274 ? 0.77336 0.61949 0.66393 0.10266  -0.02250 -0.08177 274 MET A C   
1824 O O   . MET A 274 ? 0.88060 0.75152 0.79670 0.10413  -0.01775 -0.07338 274 MET A O   
1825 C CB  . MET A 274 ? 0.72401 0.53801 0.60311 0.05761  -0.03536 -0.07612 274 MET A CB  
1826 C CG  . MET A 274 ? 0.85866 0.61865 0.70463 0.06100  -0.04866 -0.08453 274 MET A CG  
1827 S SD  . MET A 274 ? 0.93148 0.65485 0.76814 0.03483  -0.05934 -0.07560 274 MET A SD  
1828 C CE  . MET A 274 ? 0.90166 0.66145 0.76075 0.00664  -0.05396 -0.06720 274 MET A CE  
1829 N N   . THR A 275 ? 0.74425 0.56431 0.60878 0.12255  -0.02663 -0.09342 275 THR A N   
1830 C CA  . THR A 275 ? 0.82847 0.65042 0.69571 0.14847  -0.02492 -0.09580 275 THR A CA  
1831 C C   . THR A 275 ? 0.90092 0.69386 0.76578 0.14429  -0.03552 -0.09128 275 THR A C   
1832 O O   . THR A 275 ? 0.88347 0.64568 0.73619 0.12294  -0.04451 -0.08794 275 THR A O   
1833 C CB  . THR A 275 ? 0.79277 0.58793 0.62763 0.17384  -0.02786 -0.11087 275 THR A CB  
1834 O OG1 . THR A 275 ? 0.90256 0.63826 0.70199 0.16335  -0.04400 -0.11894 275 THR A OG1 
1835 C CG2 . THR A 275 ? 0.68612 0.51346 0.52061 0.18254  -0.01580 -0.11472 275 THR A CG2 
1836 N N   . SER A 276 ? 0.86855 0.67326 0.74493 0.16577  -0.03437 -0.09042 276 SER A N   
1837 C CA  . SER A 276 ? 0.91870 0.69383 0.78850 0.16668  -0.04575 -0.08650 276 SER A CA  
1838 C C   . SER A 276 ? 0.95655 0.66643 0.78379 0.17292  -0.05957 -0.09557 276 SER A C   
1839 O O   . SER A 276 ? 0.98211 0.65301 0.79345 0.15707  -0.07026 -0.09017 276 SER A O   
1840 C CB  . SER A 276 ? 0.84696 0.65462 0.74172 0.18976  -0.04283 -0.08381 276 SER A CB  
1841 O OG  . SER A 276 ? 0.91485 0.68477 0.79155 0.20391  -0.05575 -0.08517 276 SER A OG  
1842 N N   . GLU A 277 ? 1.02064 0.71590 0.82674 0.19512  -0.05955 -0.10912 277 GLU A N   
1843 C CA  . GLU A 277 ? 1.11937 0.74648 0.88212 0.20391  -0.07477 -0.11969 277 GLU A CA  
1844 C C   . GLU A 277 ? 1.08892 0.67633 0.83060 0.17179  -0.08438 -0.11903 277 GLU A C   
1845 O O   . GLU A 277 ? 1.18036 0.70901 0.89402 0.16472  -0.09933 -0.11911 277 GLU A O   
1846 C CB  . GLU A 277 ? 1.20841 0.82943 0.95039 0.23646  -0.07229 -0.13642 277 GLU A CB  
1847 C CG  . GLU A 277 ? 1.27593 0.92378 1.03168 0.27298  -0.06624 -0.13851 277 GLU A CG  
1848 C CD  . GLU A 277 ? 1.27760 1.00444 1.07649 0.27745  -0.04656 -0.13157 277 GLU A CD  
1849 O OE1 . GLU A 277 ? 1.27435 1.03455 1.09076 0.30655  -0.03947 -0.13242 277 GLU A OE1 
1850 O OE2 . GLU A 277 ? 1.15918 0.91461 0.97472 0.25199  -0.03855 -0.12478 277 GLU A OE2 
1851 N N   . LYS A 278 ? 1.03473 0.65343 0.79013 0.15159  -0.07672 -0.11736 278 LYS A N   
1852 C CA  . LYS A 278 ? 1.04654 0.63632 0.78886 0.11937  -0.08599 -0.11514 278 LYS A CA  
1853 C C   . LYS A 278 ? 0.97581 0.56749 0.73372 0.09428  -0.08692 -0.09838 278 LYS A C   
1854 O O   . LYS A 278 ? 1.07054 0.61956 0.81015 0.07363  -0.09827 -0.09431 278 LYS A O   
1855 C CB  . LYS A 278 ? 0.95117 0.57556 0.70412 0.10634  -0.07895 -0.11771 278 LYS A CB  
1856 C CG  . LYS A 278 ? 1.12668 0.71198 0.85836 0.07902  -0.09334 -0.12094 278 LYS A CG  
1857 C CD  . LYS A 278 ? 1.43467 1.01704 1.14713 0.08451  -0.09692 -0.13606 278 LYS A CD  
1858 C CE  . LYS A 278 ? 1.45134 1.09324 1.18414 0.10160  -0.07921 -0.13640 278 LYS A CE  
1859 N NZ  . LYS A 278 ? 1.37644 1.01808 1.08735 0.10895  -0.08169 -0.15001 278 LYS A NZ  
1860 N N   . ALA A 279 ? 0.91808 0.55900 0.70887 0.09528  -0.07512 -0.08830 279 ALA A N   
1861 C CA  . ALA A 279 ? 0.83669 0.48130 0.63912 0.07636  -0.07517 -0.07354 279 ALA A CA  
1862 C C   . ALA A 279 ? 0.87898 0.47084 0.65550 0.08128  -0.08773 -0.07024 279 ALA A C   
1863 O O   . ALA A 279 ? 1.00369 0.56592 0.76710 0.05846  -0.09400 -0.06111 279 ALA A O   
1864 C CB  . ALA A 279 ? 0.70539 0.40481 0.54243 0.08337  -0.06346 -0.06699 279 ALA A CB  
1865 N N   . VAL A 280 ? 0.97309 0.55258 0.74131 0.11162  -0.09152 -0.07684 280 VAL A N   
1866 C CA  . VAL A 280 ? 1.04021 0.56483 0.78034 0.12073  -0.10518 -0.07424 280 VAL A CA  
1867 C C   . VAL A 280 ? 1.15797 0.61855 0.86244 0.10381  -0.11818 -0.07651 280 VAL A C   
1868 O O   . VAL A 280 ? 1.11287 0.53392 0.79986 0.08738  -0.12676 -0.06512 280 VAL A O   
1869 C CB  . VAL A 280 ? 0.93942 0.46171 0.67552 0.16024  -0.10777 -0.08418 280 VAL A CB  
1870 C CG1 . VAL A 280 ? 0.95436 0.40677 0.65270 0.17188  -0.12477 -0.08438 280 VAL A CG1 
1871 C CG2 . VAL A 280 ? 0.87284 0.45192 0.64478 0.17254  -0.09925 -0.07784 280 VAL A CG2 
1872 N N   . GLU A 281 ? 1.23153 0.67996 0.92343 0.10704  -0.12055 -0.09084 281 GLU A N   
1873 C CA  . GLU A 281 ? 1.28253 0.66683 0.94007 0.09057  -0.13601 -0.09517 281 GLU A CA  
1874 C C   . GLU A 281 ? 1.15317 0.53971 0.81955 0.04843  -0.13610 -0.08018 281 GLU A C   
1875 O O   . GLU A 281 ? 1.15260 0.48605 0.79610 0.02989  -0.14834 -0.07220 281 GLU A O   
1876 C CB  . GLU A 281 ? 1.35099 0.72886 0.99440 0.10174  -0.13862 -0.11470 281 GLU A CB  
1877 C CG  . GLU A 281 ? 1.52223 0.89224 1.15069 0.14611  -0.13854 -0.13048 281 GLU A CG  
1878 C CD  . GLU A 281 ? 1.63334 1.01147 1.24965 0.16084  -0.13634 -0.14953 281 GLU A CD  
1879 O OE1 . GLU A 281 ? 1.64683 1.00369 1.23994 0.19658  -0.13916 -0.16462 281 GLU A OE1 
1880 O OE2 . GLU A 281 ? 1.60449 1.01081 1.23273 0.13898  -0.13183 -0.14956 281 GLU A OE2 
1881 N N   . ILE A 282 ? 1.05062 0.49892 0.75048 0.03337  -0.12218 -0.07514 282 ILE A N   
1882 C CA  . ILE A 282 ? 1.09877 0.56105 0.81236 -0.00285 -0.11915 -0.05975 282 ILE A CA  
1883 C C   . ILE A 282 ? 1.22208 0.67048 0.93161 -0.00861 -0.11885 -0.04272 282 ILE A C   
1884 O O   . ILE A 282 ? 1.27458 0.69163 0.97127 -0.03442 -0.12485 -0.03020 282 ILE A O   
1885 C CB  . ILE A 282 ? 1.05216 0.58555 0.80262 -0.01005 -0.10343 -0.05785 282 ILE A CB  
1886 C CG1 . ILE A 282 ? 0.96686 0.51261 0.71840 -0.00950 -0.10477 -0.07194 282 ILE A CG1 
1887 C CG2 . ILE A 282 ? 1.10626 0.66069 0.87288 -0.04044 -0.09752 -0.04059 282 ILE A CG2 
1888 C CD1 . ILE A 282 ? 1.20388 0.72884 0.94769 -0.03962 -0.11513 -0.07106 282 ILE A CD1 
1889 N N   . GLY A 283 ? 1.15720 0.63119 0.87814 0.01450  -0.11191 -0.04111 283 GLY A N   
1890 C CA  . GLY A 283 ? 1.20058 0.66151 0.91408 0.01304  -0.11301 -0.02617 283 GLY A CA  
1891 C C   . GLY A 283 ? 1.22728 0.61416 0.90199 0.01277  -0.12899 -0.02196 283 GLY A C   
1892 O O   . GLY A 283 ? 1.23620 0.59918 0.89782 -0.00839 -0.13135 -0.00531 283 GLY A O   
1893 N N   . LYS A 284 ? 0.99563 0.34379 0.64960 0.03695  -0.13992 -0.03660 284 LYS A N   
1894 C CA  . LYS A 284 ? 1.07378 0.34367 0.68735 0.04038  -0.15732 -0.03432 284 LYS A CA  
1895 C C   . LYS A 284 ? 1.27153 0.50047 0.86891 0.00261  -0.16531 -0.02639 284 LYS A C   
1896 O O   . LYS A 284 ? 1.40354 0.57866 0.97472 -0.01092 -0.17529 -0.01237 284 LYS A O   
1897 C CB  . LYS A 284 ? 1.12703 0.36613 0.72159 0.07598  -0.16682 -0.05460 284 LYS A CB  
1898 C CG  . LYS A 284 ? 1.20427 0.45282 0.80058 0.11449  -0.16690 -0.05685 284 LYS A CG  
1899 C CD  . LYS A 284 ? 1.37870 0.56529 0.93956 0.14649  -0.18237 -0.07098 284 LYS A CD  
1900 C CE  . LYS A 284 ? 1.49302 0.72156 1.07020 0.18308  -0.17443 -0.08997 284 LYS A CE  
1901 N NZ  . LYS A 284 ? 1.61205 0.78920 1.15524 0.21164  -0.18640 -0.10789 284 LYS A NZ  
1902 N N   . ALA A 285 ? 1.23630 0.49133 0.84992 -0.01595 -0.16157 -0.03381 285 ALA A N   
1903 C CA  . ALA A 285 ? 1.26972 0.49547 0.87528 -0.05501 -0.16956 -0.02567 285 ALA A CA  
1904 C C   . ALA A 285 ? 1.21948 0.47092 0.84029 -0.08500 -0.15914 -0.00094 285 ALA A C   
1905 O O   . ALA A 285 ? 1.25143 0.45809 0.85355 -0.11057 -0.16731 0.01454  285 ALA A O   
1906 C CB  . ALA A 285 ? 1.09863 0.35442 0.72097 -0.06572 -0.16859 -0.03982 285 ALA A CB  
1907 N N   . LEU A 286 ? 1.11540 0.43779 0.76863 -0.08163 -0.14091 0.00337  286 LEU A N   
1908 C CA  . LEU A 286 ? 1.12741 0.47910 0.79330 -0.10473 -0.12903 0.02503  286 LEU A CA  
1909 C C   . LEU A 286 ? 1.25995 0.56519 0.89604 -0.10159 -0.13445 0.04114  286 LEU A C   
1910 O O   . LEU A 286 ? 1.26026 0.54593 0.88587 -0.12992 -0.13425 0.06106  286 LEU A O   
1911 C CB  . LEU A 286 ? 1.05621 0.48313 0.75572 -0.09295 -0.11116 0.02290  286 LEU A CB  
1912 C CG  . LEU A 286 ? 1.03979 0.49827 0.74798 -0.10708 -0.09800 0.04232  286 LEU A CG  
1913 C CD1 . LEU A 286 ? 0.95293 0.43640 0.67777 -0.14294 -0.09086 0.05357  286 LEU A CD1 
1914 C CD2 . LEU A 286 ? 1.01982 0.53408 0.75099 -0.08546 -0.08585 0.03663  286 LEU A CD2 
1915 N N   . ILE A 287 ? 1.29913 0.58827 0.92172 -0.06705 -0.13930 0.03390  287 ILE A N   
1916 C CA  . ILE A 287 ? 1.28953 0.53129 0.88066 -0.05957 -0.14703 0.04821  287 ILE A CA  
1917 C C   . ILE A 287 ? 1.44650 0.61063 1.00337 -0.07996 -0.16274 0.05711  287 ILE A C   
1918 O O   . ILE A 287 ? 1.55378 0.68826 1.09070 -0.09902 -0.16386 0.07936  287 ILE A O   
1919 C CB  . ILE A 287 ? 1.28843 0.52355 0.87253 -0.01655 -0.15343 0.03548  287 ILE A CB  
1920 C CG1 . ILE A 287 ? 1.21331 0.52472 0.83307 -0.00123 -0.13886 0.02960  287 ILE A CG1 
1921 C CG2 . ILE A 287 ? 1.40768 0.58861 0.95623 -0.00674 -0.16451 0.04969  287 ILE A CG2 
1922 C CD1 . ILE A 287 ? 1.27014 0.58652 0.89165 0.03880  -0.14444 0.01741  287 ILE A CD1 
1923 N N   . ASN A 288 ? 1.49566 0.62336 1.04296 -0.07628 -0.17568 0.04005  288 ASN A N   
1924 C CA  . ASN A 288 ? 1.52763 0.57940 1.04404 -0.09993 -0.19275 0.04673  288 ASN A CA  
1925 C C   . ASN A 288 ? 1.53797 0.61031 1.07117 -0.14784 -0.18560 0.06498  288 ASN A C   
1926 O O   . ASN A 288 ? 1.54977 0.59700 1.07058 -0.17102 -0.18815 0.08468  288 ASN A O   
1927 C CB  . ASN A 288 ? 1.53564 0.56472 1.04530 -0.08451 -0.20550 0.02112  288 ASN A CB  
1928 C CG  . ASN A 288 ? 1.54643 0.54536 1.03352 -0.04059 -0.21462 0.00774  288 ASN A CG  
1929 O OD1 . ASN A 288 ? 1.49571 0.46569 0.96290 -0.03152 -0.21931 0.01995  288 ASN A OD1 
1930 N ND2 . ASN A 288 ? 1.59427 0.60276 1.08426 -0.01227 -0.21673 -0.01712 288 ASN A ND2 
1931 N N   . ASP A 289 ? 1.57442 0.71684 1.14619 -0.15889 -0.17259 0.05786  289 ASP A N   
1932 C CA  . ASP A 289 ? 1.62975 0.80245 1.22405 -0.20215 -0.16539 0.07308  289 ASP A CA  
1933 C C   . ASP A 289 ? 1.55573 0.74758 1.15106 -0.21991 -0.15117 0.10163  289 ASP A C   
1934 O O   . ASP A 289 ? 1.56298 0.74925 1.16132 -0.25825 -0.15000 0.12142  289 ASP A O   
1935 C CB  . ASP A 289 ? 1.64636 0.89635 1.28205 -0.20253 -0.15319 0.05942  289 ASP A CB  
1936 C CG  . ASP A 289 ? 1.66527 0.89642 1.29897 -0.19756 -0.16787 0.03521  289 ASP A CG  
1937 O OD1 . ASP A 289 ? 1.57099 0.85747 1.23513 -0.20402 -0.16104 0.02645  289 ASP A OD1 
1938 O OD2 . ASP A 289 ? 1.71528 0.87564 1.31481 -0.18563 -0.18660 0.02461  289 ASP A OD2 
1939 N N   . CYS A 290 ? 1.46618 0.68261 1.05913 -0.19327 -0.14037 0.10456  290 CYS A N   
1940 C CA  . CYS A 290 ? 1.54578 0.77229 1.13002 -0.20487 -0.12844 0.13053  290 CYS A CA  
1941 C C   . CYS A 290 ? 1.71743 0.86698 1.25582 -0.19869 -0.14167 0.14459  290 CYS A C   
1942 O O   . CYS A 290 ? 1.78295 0.93790 1.30686 -0.19590 -0.13314 0.16293  290 CYS A O   
1943 C CB  . CYS A 290 ? 1.41699 0.70950 1.01992 -0.18140 -0.11133 0.12707  290 CYS A CB  
1944 S SG  . CYS A 290 ? 1.38740 0.75942 1.03837 -0.17637 -0.09938 0.10638  290 CYS A SG  
1945 N N   . ASN A 291 ? 1.76857 0.84962 1.28313 -0.19335 -0.16228 0.13513  291 ASN A N   
1946 C CA  . ASN A 291 ? 1.84464 0.87245 1.32742 -0.18844 -0.17282 0.14622  291 ASN A CA  
1947 C C   . ASN A 291 ? 1.77752 0.79223 1.23697 -0.15099 -0.17438 0.14715  291 ASN A C   
1948 O O   . ASN A 291 ? 1.80581 0.81278 1.24641 -0.15391 -0.16985 0.16854  291 ASN A O   
1949 C CB  . ASN A 291 ? 1.95301 0.98695 1.43732 -0.22821 -0.16387 0.17492  291 ASN A CB  
1950 C CG  . ASN A 291 ? 2.17555 1.14994 1.62793 -0.22866 -0.17588 0.18708  291 ASN A CG  
1951 O OD1 . ASN A 291 ? 2.29168 1.21646 1.72593 -0.21033 -0.19411 0.17153  291 ASN A OD1 
1952 N ND2 . ASN A 291 ? 2.20800 1.18765 1.65204 -0.24856 -0.16503 0.21527  291 ASN A ND2 
1953 N N   . CYS A 292 ? 1.65877 0.67423 1.12072 -0.11437 -0.18110 0.12327  292 CYS A N   
1954 C CA  . CYS A 292 ? 1.57821 0.59370 1.02694 -0.07652 -0.18314 0.12129  292 CYS A CA  
1955 C C   . CYS A 292 ? 1.65200 0.64328 1.09420 -0.03712 -0.19776 0.09676  292 CYS A C   
1956 O O   . CYS A 292 ? 1.62302 0.62839 1.06594 -0.00183 -0.19948 0.08903  292 CYS A O   
1957 C CB  . CYS A 292 ? 1.41248 0.51241 0.89673 -0.06739 -0.16495 0.11568  292 CYS A CB  
1958 S SG  . CYS A 292 ? 1.44617 0.59124 0.93290 -0.09035 -0.14554 0.14244  292 CYS A SG  
1959 N N   . ASN A 293 ? 1.81708 0.77497 1.25302 -0.04157 -0.20850 0.08471  293 ASN A N   
1960 C CA  . ASN A 293 ? 1.99129 0.91799 1.41303 -0.00636 -0.22282 0.06413  293 ASN A CA  
1961 C C   . ASN A 293 ? 1.96769 0.92696 1.40912 0.02627  -0.22087 0.03781  293 ASN A C   
1962 O O   . ASN A 293 ? 2.16549 1.10821 1.60278 0.03727  -0.22849 0.01866  293 ASN A O   
1963 C CB  . ASN A 293 ? 2.06273 0.96085 1.45875 0.01772  -0.23100 0.07345  293 ASN A CB  
1964 C CG  . ASN A 293 ? 2.21839 1.07262 1.58917 -0.01059 -0.23571 0.09659  293 ASN A CG  
1965 O OD1 . ASN A 293 ? 2.34832 1.18705 1.69941 -0.00259 -0.23793 0.11230  293 ASN A OD1 
1966 N ND2 . ASN A 293 ? 2.20956 1.04520 1.58173 -0.04459 -0.23760 0.09922  293 ASN A ND2 
1967 N N   . ALA A 294 ? 1.74557 0.75080 1.20702 0.04370  -0.21113 0.03648  294 ALA A N   
1968 C CA  . ALA A 294 ? 1.61375 0.65855 1.09981 0.06969  -0.20607 0.01380  294 ALA A CA  
1969 C C   . ALA A 294 ? 1.57036 0.60432 1.04882 0.11094  -0.21496 -0.00591 294 ALA A C   
1970 O O   . ALA A 294 ? 1.44902 0.52344 0.94829 0.14164  -0.20972 -0.01954 294 ALA A O   
1971 C CB  . ALA A 294 ? 1.43655 0.50683 0.94299 0.04358  -0.19838 0.00441  294 ALA A CB  
1972 N N   . SER A 295 ? 1.62330 0.60545 1.07314 0.11235  -0.22789 -0.00716 295 SER A N   
1973 C CA  . SER A 295 ? 1.69345 0.66462 1.13271 0.15355  -0.23620 -0.02299 295 SER A CA  
1974 C C   . SER A 295 ? 1.69256 0.67190 1.12977 0.18089  -0.23934 -0.01476 295 SER A C   
1975 O O   . SER A 295 ? 1.76746 0.74647 1.20048 0.21721  -0.24525 -0.02694 295 SER A O   
1976 C CB  . SER A 295 ? 1.78076 0.68943 1.18693 0.14780  -0.25079 -0.02716 295 SER A CB  
1977 O OG  . SER A 295 ? 1.83768 0.70297 1.21812 0.14293  -0.26064 -0.00971 295 SER A OG  
1978 N N   . MET A 296 ? 1.56067 0.54920 1.00005 0.16544  -0.23592 0.00534  296 MET A N   
1979 C CA  . MET A 296 ? 1.59718 0.60134 1.03750 0.19223  -0.23960 0.01174  296 MET A CA  
1980 C C   . MET A 296 ? 1.54961 0.62100 1.02694 0.20755  -0.22951 0.00724  296 MET A C   
1981 O O   . MET A 296 ? 1.56022 0.65305 1.04341 0.22772  -0.23315 0.01267  296 MET A O   
1982 C CB  . MET A 296 ? 1.69853 0.66988 1.11331 0.17054  -0.24397 0.03670  296 MET A CB  
1983 C CG  . MET A 296 ? 1.87149 0.77556 1.24934 0.16358  -0.25681 0.04225  296 MET A CG  
1984 S SD  . MET A 296 ? 1.98176 0.85152 1.32908 0.14400  -0.26096 0.07273  296 MET A SD  
1985 C CE  . MET A 296 ? 1.85450 0.78137 1.22541 0.12420  -0.24440 0.08632  296 MET A CE  
1986 N N   . LEU A 297 ? 1.49022 0.59549 0.99298 0.19921  -0.21820 -0.00331 297 LEU A N   
1987 C CA  . LEU A 297 ? 1.43750 0.61383 0.98013 0.20726  -0.20671 -0.00660 297 LEU A CA  
1988 C C   . LEU A 297 ? 1.47355 0.68140 1.03390 0.25100  -0.21143 -0.01657 297 LEU A C   
1989 O O   . LEU A 297 ? 1.43413 0.70398 1.02699 0.25533  -0.20538 -0.01378 297 LEU A O   
1990 C CB  . LEU A 297 ? 1.36424 0.58475 0.93595 0.19115  -0.19141 -0.01921 297 LEU A CB  
1991 C CG  . LEU A 297 ? 1.33822 0.58976 0.92580 0.14934  -0.17795 -0.00863 297 LEU A CG  
1992 C CD1 . LEU A 297 ? 1.35013 0.64247 0.96447 0.14151  -0.16581 -0.02290 297 LEU A CD1 
1993 C CD2 . LEU A 297 ? 1.34900 0.65289 0.95914 0.14602  -0.17063 0.00230  297 LEU A CD2 
1994 N N   . LYS A 298 ? 1.56278 0.75490 1.11358 0.27590  -0.21729 -0.02911 298 LYS A N   
1995 C CA  . LYS A 298 ? 1.60438 0.83881 1.17787 0.31505  -0.21890 -0.03865 298 LYS A CA  
1996 C C   . LYS A 298 ? 1.57281 0.78522 1.12775 0.32992  -0.23289 -0.02874 298 LYS A C   
1997 O O   . LYS A 298 ? 1.42493 0.68244 1.00462 0.35099  -0.23523 -0.02770 298 LYS A O   
1998 C CB  . LYS A 298 ? 1.69769 0.93405 1.27146 0.33768  -0.21587 -0.05828 298 LYS A CB  
1999 C CG  . LYS A 298 ? 1.74739 0.99879 1.33214 0.32494  -0.20325 -0.06998 298 LYS A CG  
2000 C CD  . LYS A 298 ? 1.74879 1.05799 1.36368 0.35663  -0.19265 -0.08637 298 LYS A CD  
2001 C CE  . LYS A 298 ? 1.83188 1.11317 1.42220 0.38018  -0.19718 -0.10038 298 LYS A CE  
2002 N NZ  . LYS A 298 ? 1.86042 1.17306 1.46260 0.38812  -0.18362 -0.11644 298 LYS A NZ  
2003 N N   . THR A 299 ? 1.59239 0.73717 1.10511 0.31864  -0.24299 -0.02134 299 THR A N   
2004 C CA  . THR A 299 ? 1.68652 0.80375 1.17671 0.33343  -0.25689 -0.01190 299 THR A CA  
2005 C C   . THR A 299 ? 1.58890 0.71440 1.07713 0.31856  -0.25929 0.00748  299 THR A C   
2006 O O   . THR A 299 ? 1.57503 0.71552 1.06569 0.33916  -0.26812 0.01190  299 THR A O   
2007 C CB  . THR A 299 ? 1.80803 0.84867 1.25328 0.32436  -0.26692 -0.00923 299 THR A CB  
2008 O OG1 . THR A 299 ? 1.78148 0.78312 1.20258 0.28669  -0.26769 0.01052  299 THR A OG1 
2009 C CG2 . THR A 299 ? 1.88103 0.90937 1.32456 0.32407  -0.26251 -0.02693 299 THR A CG2 
2010 N N   . ASN A 300 ? 1.51431 0.63045 0.99642 0.28319  -0.25190 0.01934  300 ASN A N   
2011 C CA  . ASN A 300 ? 1.49916 0.62798 0.97816 0.26899  -0.25195 0.03720  300 ASN A CA  
2012 C C   . ASN A 300 ? 1.39647 0.54511 0.88928 0.23897  -0.23833 0.04123  300 ASN A C   
2013 O O   . ASN A 300 ? 1.31909 0.43276 0.78936 0.20585  -0.23370 0.05405  300 ASN A O   
2014 C CB  . ASN A 300 ? 1.71527 0.78753 1.15027 0.25564  -0.26075 0.05651  300 ASN A CB  
2015 C CG  . ASN A 300 ? 1.85181 0.93871 1.27885 0.24257  -0.25978 0.07506  300 ASN A CG  
2016 O OD1 . ASN A 300 ? 1.87862 1.01623 1.33238 0.24390  -0.25438 0.07280  300 ASN A OD1 
2017 N ND2 . ASN A 300 ? 1.97482 1.01731 1.36352 0.23108  -0.26548 0.09337  300 ASN A ND2 
2018 N N   . PRO A 301 ? 1.31899 0.52879 0.85185 0.24815  -0.23086 0.03113  301 PRO A N   
2019 C CA  . PRO A 301 ? 1.36050 0.61590 0.91853 0.21315  -0.21179 0.03192  301 PRO A CA  
2020 C C   . PRO A 301 ? 1.42161 0.68304 0.96714 0.18868  -0.20792 0.05026  301 PRO A C   
2021 O O   . PRO A 301 ? 1.41440 0.67861 0.95853 0.15525  -0.19507 0.05738  301 PRO A O   
2022 C CB  . PRO A 301 ? 1.26924 0.60295 0.87937 0.22847  -0.20320 0.01585  301 PRO A CB  
2023 C CG  . PRO A 301 ? 1.28674 0.62555 0.90113 0.26858  -0.21824 0.01133  301 PRO A CG  
2024 C CD  . PRO A 301 ? 1.32984 0.58888 0.89789 0.28401  -0.23350 0.01524  301 PRO A CD  
2025 N N   . ALA A 302 ? 1.50972 0.77554 1.04575 0.20570  -0.21886 0.05781  302 ALA A N   
2026 C CA  . ALA A 302 ? 1.39420 0.67306 0.91789 0.18603  -0.21432 0.07304  302 ALA A CA  
2027 C C   . ALA A 302 ? 1.34913 0.57486 0.83309 0.15585  -0.20925 0.09196  302 ALA A C   
2028 O O   . ALA A 302 ? 1.26410 0.51346 0.75098 0.12752  -0.19434 0.10033  302 ALA A O   
2029 C CB  . ALA A 302 ? 1.29754 0.57658 0.80758 0.21177  -0.23128 0.07849  302 ALA A CB  
2030 N N   . HIS A 303 ? 1.35802 0.51250 0.80644 0.16111  -0.22115 0.09868  303 HIS A N   
2031 C CA  . HIS A 303 ? 1.48876 0.58926 0.90039 0.12996  -0.21775 0.11880  303 HIS A CA  
2032 C C   . HIS A 303 ? 1.52819 0.64390 0.96143 0.09745  -0.20182 0.11404  303 HIS A C   
2033 O O   . HIS A 303 ? 1.54968 0.66687 0.97493 0.06408  -0.18974 0.12996  303 HIS A O   
2034 C CB  . HIS A 303 ? 1.65139 0.69296 1.03370 0.13997  -0.23140 0.12166  303 HIS A CB  
2035 C CG  . HIS A 303 ? 1.86969 0.86603 1.22373 0.10493  -0.22688 0.14057  303 HIS A CG  
2036 N ND1 . HIS A 303 ? 1.93856 0.90780 1.29527 0.08447  -0.22497 0.13561  303 HIS A ND1 
2037 C CD2 . HIS A 303 ? 1.90516 0.88298 1.22993 0.08564  -0.22349 0.16480  303 HIS A CD2 
2038 C CE1 . HIS A 303 ? 1.98156 0.91858 1.31521 0.05299  -0.22138 0.15641  303 HIS A CE1 
2039 N NE2 . HIS A 303 ? 1.98629 0.92855 1.30035 0.05329  -0.21915 0.17502  303 HIS A NE2 
2040 N N   . VAL A 304 ? 1.50038 0.63006 0.96087 0.10741  -0.20146 0.09274  304 VAL A N   
2041 C CA  . VAL A 304 ? 1.36372 0.51150 0.84585 0.07896  -0.18830 0.08637  304 VAL A CA  
2042 C C   . VAL A 304 ? 1.25674 0.47760 0.77158 0.06005  -0.16915 0.08776  304 VAL A C   
2043 O O   . VAL A 304 ? 1.22997 0.46196 0.75107 0.02768  -0.15692 0.09520  304 VAL A O   
2044 C CB  . VAL A 304 ? 1.32580 0.47710 0.82728 0.09896  -0.19217 0.06216  304 VAL A CB  
2045 C CG1 . VAL A 304 ? 1.32059 0.50203 0.84799 0.07261  -0.17889 0.05380  304 VAL A CG1 
2046 C CG2 . VAL A 304 ? 1.42963 0.49930 0.89296 0.11538  -0.21117 0.06020  304 VAL A CG2 
2047 N N   . MET A 305 ? 1.27452 0.54502 0.81013 0.08002  -0.16743 0.08113  305 MET A N   
2048 C CA  . MET A 305 ? 1.30644 0.64057 0.86947 0.06525  -0.15131 0.08116  305 MET A CA  
2049 C C   . MET A 305 ? 1.35183 0.67918 0.88838 0.04574  -0.14512 0.10264  305 MET A C   
2050 O O   . MET A 305 ? 1.35772 0.72071 0.90798 0.02258  -0.12894 0.10696  305 MET A O   
2051 C CB  . MET A 305 ? 1.29727 0.68152 0.88971 0.09168  -0.15401 0.06713  305 MET A CB  
2052 C CG  . MET A 305 ? 1.26082 0.66153 0.88222 0.11132  -0.15667 0.04756  305 MET A CG  
2053 S SD  . MET A 305 ? 1.18223 0.60685 0.83167 0.09120  -0.14179 0.03589  305 MET A SD  
2054 C CE  . MET A 305 ? 0.90463 0.38175 0.57375 0.06363  -0.12418 0.04267  305 MET A CE  
2055 N N   . SER A 306 ? 1.39312 0.67837 0.89129 0.05679  -0.15715 0.11644  306 SER A N   
2056 C CA  . SER A 306 ? 1.42454 0.69818 0.89139 0.03729  -0.14995 0.13931  306 SER A CA  
2057 C C   . SER A 306 ? 1.30326 0.55880 0.76542 0.00128  -0.13826 0.15213  306 SER A C   
2058 O O   . SER A 306 ? 1.19075 0.48195 0.66094 -0.02177 -0.12074 0.16100  306 SER A O   
2059 C CB  . SER A 306 ? 1.58561 0.80393 1.00579 0.05375  -0.16658 0.15432  306 SER A CB  
2060 O OG  . SER A 306 ? 1.66839 0.90202 1.09605 0.08841  -0.18093 0.14149  306 SER A OG  
2061 N N   . CYS A 307 ? 1.24384 0.44481 0.69430 -0.00309 -0.14874 0.15217  307 CYS A N   
2062 C CA  . CYS A 307 ? 1.36493 0.54289 0.81267 -0.03878 -0.14217 0.16320  307 CYS A CA  
2063 C C   . CYS A 307 ? 1.37065 0.61500 0.86136 -0.05869 -0.12367 0.15432  307 CYS A C   
2064 O O   . CYS A 307 ? 1.43500 0.69554 0.92740 -0.08906 -0.10969 0.17027  307 CYS A O   
2065 C CB  . CYS A 307 ? 1.40809 0.52192 0.84316 -0.03425 -0.15950 0.15529  307 CYS A CB  
2066 S SG  . CYS A 307 ? 1.55605 0.62298 0.98011 -0.07732 -0.15972 0.16937  307 CYS A SG  
2067 N N   . MET A 308 ? 1.19011 0.47704 0.71633 -0.04062 -0.12273 0.13015  308 MET A N   
2068 C CA  . MET A 308 ? 1.20803 0.55456 0.77444 -0.05556 -0.10745 0.12017  308 MET A CA  
2069 C C   . MET A 308 ? 1.21645 0.61970 0.79460 -0.05948 -0.09128 0.12596  308 MET A C   
2070 O O   . MET A 308 ? 1.15693 0.60491 0.76167 -0.07727 -0.07674 0.12452  308 MET A O   
2071 C CB  . MET A 308 ? 1.15962 0.52888 0.75546 -0.03326 -0.11202 0.09456  308 MET A CB  
2072 C CG  . MET A 308 ? 1.21074 0.53649 0.80145 -0.03449 -0.12326 0.08492  308 MET A CG  
2073 S SD  . MET A 308 ? 1.25813 0.58394 0.85828 -0.07707 -0.11582 0.09227  308 MET A SD  
2074 C CE  . MET A 308 ? 1.05227 0.46217 0.70154 -0.07744 -0.09956 0.07686  308 MET A CE  
2075 N N   . ARG A 309 ? 1.25158 0.65341 0.80922 -0.04175 -0.09455 0.13152  309 ARG A N   
2076 C CA  . ARG A 309 ? 1.25776 0.70500 0.81766 -0.04533 -0.08027 0.13752  309 ARG A CA  
2077 C C   . ARG A 309 ? 1.39610 0.82657 0.92433 -0.06761 -0.07060 0.16380  309 ARG A C   
2078 O O   . ARG A 309 ? 1.44310 0.91353 0.97218 -0.07329 -0.05533 0.16982  309 ARG A O   
2079 C CB  . ARG A 309 ? 1.12372 0.58340 0.67798 -0.01560 -0.08912 0.12873  309 ARG A CB  
2080 C CG  . ARG A 309 ? 1.22690 0.72597 0.82167 0.00098  -0.09162 0.10499  309 ARG A CG  
2081 C CD  . ARG A 309 ? 1.25135 0.76054 0.84281 0.02784  -0.10339 0.09731  309 ARG A CD  
2082 N NE  . ARG A 309 ? 1.11486 0.61758 0.72388 0.04971  -0.11768 0.08298  309 ARG A NE  
2083 C CZ  . ARG A 309 ? 1.10290 0.64685 0.75177 0.05833  -0.11615 0.06568  309 ARG A CZ  
2084 N NH1 . ARG A 309 ? 1.19784 0.74006 0.86289 0.07886  -0.12726 0.05432  309 ARG A NH1 
2085 N NH2 . ARG A 309 ? 1.08166 0.66920 0.75385 0.04692  -0.10284 0.06062  309 ARG A NH2 
2086 N N   . SER A 310 ? 1.39117 0.76282 0.89030 -0.07962 -0.07892 0.17993  310 SER A N   
2087 C CA  . SER A 310 ? 1.44966 0.80551 0.92281 -0.10711 -0.06812 0.20794  310 SER A CA  
2088 C C   . SER A 310 ? 1.41480 0.79002 0.91505 -0.14169 -0.05583 0.21345  310 SER A C   
2089 O O   . SER A 310 ? 1.45959 0.84659 0.95156 -0.16697 -0.04088 0.23588  310 SER A O   
2090 C CB  . SER A 310 ? 1.50686 0.78596 0.93480 -0.10632 -0.08397 0.22525  310 SER A CB  
2091 O OG  . SER A 310 ? 1.62062 0.87879 1.03182 -0.07072 -0.10104 0.21436  310 SER A OG  
2092 N N   . VAL A 311 ? 1.26751 0.64779 0.79950 -0.14301 -0.06212 0.19416  311 VAL A N   
2093 C CA  . VAL A 311 ? 1.22955 0.62917 0.78900 -0.17493 -0.05390 0.19727  311 VAL A CA  
2094 C C   . VAL A 311 ? 1.24651 0.72133 0.83357 -0.18328 -0.03143 0.19908  311 VAL A C   
2095 O O   . VAL A 311 ? 1.23973 0.75587 0.84018 -0.16009 -0.02619 0.18400  311 VAL A O   
2096 C CB  . VAL A 311 ? 1.19789 0.58959 0.78195 -0.16859 -0.06644 0.17309  311 VAL A CB  
2097 C CG1 . VAL A 311 ? 1.18128 0.60635 0.79891 -0.19850 -0.05827 0.17271  311 VAL A CG1 
2098 C CG2 . VAL A 311 ? 1.20403 0.51673 0.75796 -0.16168 -0.08841 0.17185  311 VAL A CG2 
2099 N N   . ASP A 312 ? 1.08792 0.58113 0.68422 -0.21633 -0.01846 0.21788  312 ASP A N   
2100 C CA  . ASP A 312 ? 1.10944 0.67723 0.73549 -0.22272 0.00304  0.21832  312 ASP A CA  
2101 C C   . ASP A 312 ? 1.08643 0.69321 0.75436 -0.21343 0.00121  0.19212  312 ASP A C   
2102 O O   . ASP A 312 ? 1.12058 0.70330 0.80091 -0.21833 -0.01276 0.18028  312 ASP A O   
2103 C CB  . ASP A 312 ? 1.28258 0.86708 0.91599 -0.26099 0.01694  0.24426  312 ASP A CB  
2104 C CG  . ASP A 312 ? 1.54488 1.11322 1.13848 -0.26757 0.02745  0.27289  312 ASP A CG  
2105 O OD1 . ASP A 312 ? 1.65406 1.18354 1.23167 -0.29603 0.02467  0.29641  312 ASP A OD1 
2106 O OD2 . ASP A 312 ? 1.58375 1.17559 1.15964 -0.24463 0.03768  0.27233  312 ASP A OD2 
2107 N N   . ALA A 313 ? 1.00998 0.67394 0.69612 -0.19805 0.01462  0.18260  313 ALA A N   
2108 C CA  . ALA A 313 ? 1.00847 0.70915 0.73200 -0.18788 0.01349  0.15954  313 ALA A CA  
2109 C C   . ALA A 313 ? 1.12722 0.84530 0.88154 -0.21551 0.01431  0.16120  313 ALA A C   
2110 O O   . ALA A 313 ? 1.24789 0.96604 1.02265 -0.21139 0.00433  0.14341  313 ALA A O   
2111 C CB  . ALA A 313 ? 0.82142 0.57794 0.55739 -0.17005 0.02825  0.15209  313 ALA A CB  
2112 N N   . LYS A 314 ? 1.15157 0.88618 0.90964 -0.24420 0.02573  0.18302  314 LYS A N   
2113 C CA  . LYS A 314 ? 1.16960 0.92417 0.95985 -0.27290 0.02461  0.18549  314 LYS A CA  
2114 C C   . LYS A 314 ? 1.25638 0.94994 1.03802 -0.28286 0.00169  0.17844  314 LYS A C   
2115 O O   . LYS A 314 ? 1.34611 1.05040 1.15338 -0.29147 -0.00657 0.16589  314 LYS A O   
2116 C CB  . LYS A 314 ? 1.14026 0.92228 0.93615 -0.30401 0.04052  0.21332  314 LYS A CB  
2117 C CG  . LYS A 314 ? 1.23865 1.05104 1.07364 -0.33585 0.03923  0.21719  314 LYS A CG  
2118 C CD  . LYS A 314 ? 1.21898 1.10805 1.09512 -0.32565 0.05141  0.20469  314 LYS A CD  
2119 C CE  . LYS A 314 ? 1.14398 1.07029 1.06109 -0.35803 0.04994  0.21074  314 LYS A CE  
2120 N NZ  . LYS A 314 ? 1.04142 1.05031 0.99729 -0.34973 0.06643  0.20632  314 LYS A NZ  
2121 N N   . THR A 315 ? 1.23165 0.85901 0.97470 -0.27932 -0.00988 0.18522  315 THR A N   
2122 C CA  . THR A 315 ? 1.22870 0.79200 0.95850 -0.28523 -0.03247 0.17726  315 THR A CA  
2123 C C   . THR A 315 ? 1.21431 0.77654 0.95336 -0.25618 -0.04315 0.14773  315 THR A C   
2124 O O   . THR A 315 ? 1.24571 0.79610 0.99671 -0.26391 -0.05537 0.13489  315 THR A O   
2125 C CB  . THR A 315 ? 1.24759 0.73904 0.93175 -0.28357 -0.04246 0.19136  315 THR A CB  
2126 O OG1 . THR A 315 ? 1.32300 0.81314 0.99869 -0.31555 -0.03262 0.22151  315 THR A OG1 
2127 C CG2 . THR A 315 ? 1.21895 0.63921 0.88573 -0.28363 -0.06710 0.17990  315 THR A CG2 
2128 N N   . ILE A 316 ? 1.09703 0.67218 0.83021 -0.22316 -0.03905 0.13707  316 ILE A N   
2129 C CA  . ILE A 316 ? 1.05396 0.64169 0.80214 -0.19708 -0.04498 0.11162  316 ILE A CA  
2130 C C   . ILE A 316 ? 1.07218 0.71624 0.85908 -0.20702 -0.03755 0.10310  316 ILE A C   
2131 O O   . ILE A 316 ? 1.06592 0.70564 0.86387 -0.20372 -0.04724 0.08688  316 ILE A O   
2132 C CB  . ILE A 316 ? 0.97664 0.57976 0.71877 -0.16491 -0.04016 0.10465  316 ILE A CB  
2133 C CG1 . ILE A 316 ? 0.96417 0.51027 0.66837 -0.15069 -0.05135 0.11037  316 ILE A CG1 
2134 C CG2 . ILE A 316 ? 0.92110 0.55097 0.68648 -0.14198 -0.04226 0.08140  316 ILE A CG2 
2135 C CD1 . ILE A 316 ? 0.92376 0.48867 0.62027 -0.12531 -0.04643 0.10905  316 ILE A CD1 
2136 N N   . SER A 317 ? 1.05495 0.75257 0.86083 -0.21787 -0.02029 0.11426  317 SER A N   
2137 C CA  . SER A 317 ? 1.07713 0.83312 0.92050 -0.22443 -0.01241 0.10759  317 SER A CA  
2138 C C   . SER A 317 ? 1.13986 0.88478 0.99633 -0.24839 -0.02459 0.10478  317 SER A C   
2139 O O   . SER A 317 ? 1.18808 0.96341 1.06903 -0.24514 -0.02673 0.09098  317 SER A O   
2140 C CB  . SER A 317 ? 1.08010 0.88901 0.93738 -0.23487 0.00765  0.12369  317 SER A CB  
2141 O OG  . SER A 317 ? 1.01739 0.88325 0.91191 -0.24171 0.01450  0.11889  317 SER A OG  
2142 N N   . VAL A 318 ? 1.04810 0.74609 0.88633 -0.27218 -0.03446 0.11733  318 VAL A N   
2143 C CA  . VAL A 318 ? 1.00738 0.68888 0.85548 -0.29836 -0.04906 0.11504  318 VAL A CA  
2144 C C   . VAL A 318 ? 1.16360 0.78154 0.98677 -0.28480 -0.07037 0.09662  318 VAL A C   
2145 O O   . VAL A 318 ? 1.17173 0.79397 1.00617 -0.28305 -0.08060 0.07959  318 VAL A O   
2146 C CB  . VAL A 318 ? 1.03881 0.70677 0.88383 -0.33625 -0.04801 0.14083  318 VAL A CB  
2147 C CG1 . VAL A 318 ? 1.08096 0.72331 0.93371 -0.36594 -0.06698 0.13855  318 VAL A CG1 
2148 C CG2 . VAL A 318 ? 1.00344 0.74467 0.87673 -0.34734 -0.02471 0.15775  318 VAL A CG2 
2149 N N   . GLN A 319 ? 1.24282 0.80175 1.03001 -0.27248 -0.07731 0.09942  319 GLN A N   
2150 C CA  . GLN A 319 ? 1.23978 0.73275 0.99935 -0.25912 -0.09778 0.08360  319 GLN A CA  
2151 C C   . GLN A 319 ? 1.18280 0.69240 0.94843 -0.22476 -0.09893 0.05862  319 GLN A C   
2152 O O   . GLN A 319 ? 1.16569 0.63429 0.91509 -0.21481 -0.11472 0.04212  319 GLN A O   
2153 C CB  . GLN A 319 ? 1.16641 0.59761 0.88713 -0.24963 -0.10360 0.09368  319 GLN A CB  
2154 C CG  . GLN A 319 ? 1.21111 0.61080 0.91868 -0.28462 -0.10574 0.11907  319 GLN A CG  
2155 C CD  . GLN A 319 ? 1.30873 0.68014 1.02059 -0.31728 -0.12200 0.11817  319 GLN A CD  
2156 O OE1 . GLN A 319 ? 1.44811 0.75476 1.13467 -0.31192 -0.14292 0.10503  319 GLN A OE1 
2157 N NE2 . GLN A 319 ? 1.21741 0.63745 0.96121 -0.35084 -0.11336 0.13177  319 GLN A NE2 
2158 N N   . GLN A 320 ? 1.08192 0.64770 0.86799 -0.20572 -0.08281 0.05576  320 GLN A N   
2159 C CA  . GLN A 320 ? 1.07751 0.66312 0.87277 -0.17702 -0.08281 0.03479  320 GLN A CA  
2160 C C   . GLN A 320 ? 1.03089 0.63345 0.84252 -0.18757 -0.08924 0.02278  320 GLN A C   
2161 O O   . GLN A 320 ? 1.09113 0.68479 0.89725 -0.16770 -0.09598 0.00466  320 GLN A O   
2162 C CB  . GLN A 320 ? 0.96244 0.60413 0.77843 -0.15983 -0.06558 0.03572  320 GLN A CB  
2163 C CG  . GLN A 320 ? 0.91027 0.61214 0.75834 -0.17623 -0.05342 0.04116  320 GLN A CG  
2164 C CD  . GLN A 320 ? 0.88470 0.63407 0.74859 -0.16017 -0.03774 0.04257  320 GLN A CD  
2165 O OE1 . GLN A 320 ? 0.91854 0.66588 0.77780 -0.13468 -0.03712 0.03400  320 GLN A OE1 
2166 N NE2 . GLN A 320 ? 0.77858 0.57170 0.66175 -0.17493 -0.02538 0.05346  320 GLN A NE2 
2167 N N   . TRP A 321 ? 0.96712 0.59458 0.79798 -0.21848 -0.08781 0.03310  321 TRP A N   
2168 C CA  . TRP A 321 ? 1.05893 0.70760 0.90729 -0.22954 -0.09534 0.02254  321 TRP A CA  
2169 C C   . TRP A 321 ? 1.12887 0.71625 0.95213 -0.23874 -0.11811 0.01200  321 TRP A C   
2170 O O   . TRP A 321 ? 1.19087 0.78716 1.02023 -0.24002 -0.12757 -0.00205 321 TRP A O   
2171 C CB  . TRP A 321 ? 1.04595 0.74714 0.92707 -0.25887 -0.08705 0.03738  321 TRP A CB  
2172 C CG  . TRP A 321 ? 0.97280 0.74131 0.88146 -0.24426 -0.06762 0.03909  321 TRP A CG  
2173 C CD1 . TRP A 321 ? 0.92295 0.72174 0.84006 -0.24356 -0.05017 0.05376  321 TRP A CD1 
2174 C CD2 . TRP A 321 ? 0.96886 0.77823 0.89633 -0.22673 -0.06454 0.02527  321 TRP A CD2 
2175 N NE1 . TRP A 321 ? 0.90385 0.75763 0.84418 -0.22662 -0.03745 0.04867  321 TRP A NE1 
2176 C CE2 . TRP A 321 ? 0.96246 0.82327 0.91027 -0.21674 -0.04590 0.03227  321 TRP A CE2 
2177 C CE3 . TRP A 321 ? 0.85033 0.65601 0.77668 -0.21812 -0.07598 0.00809  321 TRP A CE3 
2178 C CZ2 . TRP A 321 ? 0.92135 0.82644 0.88933 -0.19948 -0.03926 0.02342  321 TRP A CZ2 
2179 C CZ3 . TRP A 321 ? 0.72698 0.57993 0.67326 -0.20145 -0.06812 0.00081  321 TRP A CZ3 
2180 C CH2 . TRP A 321 ? 0.80612 0.70667 0.77355 -0.19276 -0.05032 0.00883  321 TRP A CH2 
2181 N N   . ASN A 322 ? 1.07620 0.59867 0.86836 -0.24340 -0.12830 0.01766  322 ASN A N   
2182 C CA  . ASN A 322 ? 1.15284 0.60768 0.91509 -0.24686 -0.15170 0.00466  322 ASN A CA  
2183 C C   . ASN A 322 ? 1.27661 0.72414 1.02548 -0.21227 -0.15676 -0.02065 322 ASN A C   
2184 O O   . ASN A 322 ? 1.35662 0.76805 1.08752 -0.21428 -0.17494 -0.03622 322 ASN A O   
2185 C CB  . ASN A 322 ? 1.18436 0.56679 0.91131 -0.24866 -0.16084 0.01395  322 ASN A CB  
2186 C CG  . ASN A 322 ? 1.29231 0.67394 1.02711 -0.28569 -0.15735 0.04049  322 ASN A CG  
2187 O OD1 . ASN A 322 ? 1.32871 0.76929 1.09802 -0.30903 -0.14654 0.05188  322 ASN A OD1 
2188 N ND2 . ASN A 322 ? 1.38252 0.69859 1.08514 -0.29055 -0.16587 0.05167  322 ASN A ND2 
2189 N N   . SER A 323 ? 1.29330 0.77439 1.04970 -0.18083 -0.14126 -0.02483 323 SER A N   
2190 C CA  . SER A 323 ? 1.36438 0.84589 1.11073 -0.14707 -0.14225 -0.04569 323 SER A CA  
2191 C C   . SER A 323 ? 1.37526 0.91570 1.14776 -0.14600 -0.13564 -0.05356 323 SER A C   
2192 O O   . SER A 323 ? 1.31611 0.87567 1.08831 -0.11762 -0.12943 -0.06592 323 SER A O   
2193 C CB  . SER A 323 ? 1.40546 0.89323 1.14869 -0.11521 -0.13030 -0.04492 323 SER A CB  
2194 O OG  . SER A 323 ? 1.52584 0.94765 1.23438 -0.10227 -0.14212 -0.04771 323 SER A OG  
2195 N N   . TYR A 324 ? 1.42339 0.99424 1.21896 -0.17606 -0.13685 -0.04553 324 TYR A N   
2196 C CA  . TYR A 324 ? 1.38492 1.01034 1.20483 -0.17638 -0.13293 -0.05171 324 TYR A CA  
2197 C C   . TYR A 324 ? 1.45289 1.05059 1.25864 -0.19121 -0.15471 -0.06445 324 TYR A C   
2198 O O   . TYR A 324 ? 1.49840 1.09738 1.31635 -0.22444 -0.16459 -0.05650 324 TYR A O   
2199 C CB  . TYR A 324 ? 1.31286 0.99885 1.17119 -0.19587 -0.11897 -0.03441 324 TYR A CB  
2200 C CG  . TYR A 324 ? 1.30058 1.04324 1.18551 -0.19699 -0.11613 -0.03881 324 TYR A CG  
2201 C CD1 . TYR A 324 ? 1.31432 1.08765 1.20464 -0.16907 -0.10581 -0.04703 324 TYR A CD1 
2202 C CD2 . TYR A 324 ? 1.34727 1.11328 1.25276 -0.22642 -0.12454 -0.03357 324 TYR A CD2 
2203 C CE1 . TYR A 324 ? 1.33227 1.15357 1.24394 -0.16896 -0.10412 -0.04979 324 TYR A CE1 
2204 C CE2 . TYR A 324 ? 1.33408 1.15218 1.26343 -0.22539 -0.12352 -0.03739 324 TYR A CE2 
2205 C CZ  . TYR A 324 ? 1.33573 1.17899 1.26614 -0.19593 -0.11342 -0.04543 324 TYR A CZ  
2206 O OH  . TYR A 324 ? 1.31676 1.20797 1.26809 -0.19413 -0.11331 -0.04790 324 TYR A OH  
2207 N N   . SER A 325 ? 1.46569 1.03873 1.24505 -0.16657 -0.16275 -0.08437 325 SER A N   
2208 C CA  . SER A 325 ? 1.54734 1.10353 1.31238 -0.17511 -0.18274 -0.09971 325 SER A CA  
2209 C C   . SER A 325 ? 1.42622 1.01622 1.18933 -0.14634 -0.17568 -0.11320 325 SER A C   
2210 O O   . SER A 325 ? 1.43842 1.01995 1.18469 -0.11379 -0.16629 -0.12089 325 SER A O   
2211 C CB  . SER A 325 ? 1.67984 1.15361 1.40136 -0.17567 -0.20514 -0.11263 325 SER A CB  
2212 O OG  . SER A 325 ? 1.74911 1.20907 1.46471 -0.19848 -0.22748 -0.12203 325 SER A OG  
2213 N N   . GLY A 326 ? 1.25448 0.88523 1.03598 -0.15832 -0.17985 -0.11458 326 GLY A N   
2214 C CA  . GLY A 326 ? 1.16239 0.83770 0.95001 -0.13432 -0.16870 -0.12042 326 GLY A CA  
2215 C C   . GLY A 326 ? 1.08377 0.82739 0.91585 -0.14368 -0.15275 -0.10393 326 GLY A C   
2216 O O   . GLY A 326 ? 0.96399 0.72435 0.81608 -0.14526 -0.13705 -0.08964 326 GLY A O   
2217 N N   . ILE A 327 ? 1.00378 0.78518 0.84953 -0.14942 -0.15825 -0.10628 327 ILE A N   
2218 C CA  . ILE A 327 ? 0.94353 0.78966 0.82834 -0.15153 -0.14326 -0.09281 327 ILE A CA  
2219 C C   . ILE A 327 ? 0.97940 0.84323 0.86526 -0.12163 -0.12190 -0.09030 327 ILE A C   
2220 O O   . ILE A 327 ? 1.07145 0.91766 0.93152 -0.09747 -0.12052 -0.10118 327 ILE A O   
2221 C CB  . ILE A 327 ? 0.94873 0.82823 0.84336 -0.15845 -0.15548 -0.09740 327 ILE A CB  
2222 C CG1 . ILE A 327 ? 0.89020 0.83516 0.82641 -0.16095 -0.14161 -0.08294 327 ILE A CG1 
2223 C CG2 . ILE A 327 ? 0.98093 0.84751 0.84278 -0.13207 -0.16004 -0.11317 327 ILE A CG2 
2224 C CD1 . ILE A 327 ? 0.88222 0.86444 0.82941 -0.16343 -0.15327 -0.08640 327 ILE A CD1 
2225 N N   . LEU A 328 ? 0.92244 0.81972 0.83735 -0.12342 -0.10521 -0.07576 328 LEU A N   
2226 C CA  . LEU A 328 ? 0.90214 0.82116 0.82454 -0.09961 -0.08641 -0.07159 328 LEU A CA  
2227 C C   . LEU A 328 ? 0.93897 0.82155 0.83901 -0.08119 -0.08130 -0.07644 328 LEU A C   
2228 O O   . LEU A 328 ? 1.03545 0.92842 0.93268 -0.05858 -0.07083 -0.07832 328 LEU A O   
2229 C CB  . LEU A 328 ? 0.90704 0.85511 0.83005 -0.08364 -0.08420 -0.07561 328 LEU A CB  
2230 C CG  . LEU A 328 ? 0.97271 0.97165 0.92601 -0.08879 -0.07980 -0.06648 328 LEU A CG  
2231 C CD1 . LEU A 328 ? 0.91276 0.93501 0.88682 -0.07922 -0.06138 -0.05559 328 LEU A CD1 
2232 C CD2 . LEU A 328 ? 1.08392 1.09499 1.05527 -0.11545 -0.08982 -0.06205 328 LEU A CD2 
2233 N N   . SER A 329 ? 0.90945 0.75023 0.79426 -0.09008 -0.08870 -0.07760 329 SER A N   
2234 C CA  . SER A 329 ? 0.95977 0.76724 0.82421 -0.06999 -0.08486 -0.08221 329 SER A CA  
2235 C C   . SER A 329 ? 0.89728 0.68541 0.76564 -0.08234 -0.08323 -0.07159 329 SER A C   
2236 O O   . SER A 329 ? 0.85373 0.59548 0.70140 -0.09155 -0.09497 -0.07374 329 SER A O   
2237 C CB  . SER A 329 ? 0.91544 0.67883 0.74336 -0.05930 -0.09885 -0.09898 329 SER A CB  
2238 O OG  . SER A 329 ? 1.02299 0.74323 0.82988 -0.04730 -0.10066 -0.10261 329 SER A OG  
2239 N N   . PHE A 330 ? 0.93572 0.75678 0.82792 -0.08173 -0.06914 -0.05987 330 PHE A N   
2240 C CA  . PHE A 330 ? 0.92903 0.73887 0.82479 -0.09405 -0.06630 -0.04812 330 PHE A CA  
2241 C C   . PHE A 330 ? 0.84462 0.61553 0.71938 -0.07748 -0.06731 -0.05048 330 PHE A C   
2242 O O   . PHE A 330 ? 0.78396 0.55510 0.65313 -0.05322 -0.06392 -0.05855 330 PHE A O   
2243 C CB  . PHE A 330 ? 0.86053 0.71702 0.78431 -0.09527 -0.05168 -0.03707 330 PHE A CB  
2244 C CG  . PHE A 330 ? 0.87246 0.77144 0.81757 -0.10213 -0.04952 -0.03652 330 PHE A CG  
2245 C CD1 . PHE A 330 ? 0.86812 0.77552 0.82157 -0.12626 -0.05691 -0.03269 330 PHE A CD1 
2246 C CD2 . PHE A 330 ? 0.76419 0.69428 0.72137 -0.08492 -0.04143 -0.03924 330 PHE A CD2 
2247 C CE1 . PHE A 330 ? 0.79491 0.74423 0.76945 -0.13098 -0.05646 -0.03225 330 PHE A CE1 
2248 C CE2 . PHE A 330 ? 0.65331 0.62027 0.62821 -0.08943 -0.04074 -0.03816 330 PHE A CE2 
2249 C CZ  . PHE A 330 ? 0.72064 0.69835 0.70441 -0.11132 -0.04855 -0.03521 330 PHE A CZ  
2250 N N   . PRO A 331 ? 0.91654 0.65530 0.77990 -0.09001 -0.07190 -0.04239 331 PRO A N   
2251 C CA  . PRO A 331 ? 0.93130 0.63228 0.77420 -0.07301 -0.07421 -0.04333 331 PRO A CA  
2252 C C   . PRO A 331 ? 0.80838 0.53762 0.66584 -0.05487 -0.06180 -0.03892 331 PRO A C   
2253 O O   . PRO A 331 ? 0.87088 0.57663 0.71530 -0.03702 -0.06409 -0.04089 331 PRO A O   
2254 C CB  . PRO A 331 ? 0.97281 0.63707 0.80179 -0.09537 -0.08146 -0.03180 331 PRO A CB  
2255 C CG  . PRO A 331 ? 0.99999 0.67617 0.83960 -0.12441 -0.08604 -0.02828 331 PRO A CG  
2256 C CD  . PRO A 331 ? 0.92099 0.65603 0.78896 -0.12071 -0.07599 -0.03113 331 PRO A CD  
2257 N N   . SER A 332 ? 0.76385 0.54086 0.64742 -0.05851 -0.05035 -0.03328 332 SER A N   
2258 C CA  . SER A 332 ? 0.81408 0.61550 0.71129 -0.04318 -0.04097 -0.03011 332 SER A CA  
2259 C C   . SER A 332 ? 0.76279 0.60414 0.68080 -0.03283 -0.03329 -0.03523 332 SER A C   
2260 O O   . SER A 332 ? 0.81551 0.68078 0.74527 -0.04342 -0.03085 -0.03479 332 SER A O   
2261 C CB  . SER A 332 ? 0.81194 0.62733 0.71660 -0.05563 -0.03469 -0.01752 332 SER A CB  
2262 O OG  . SER A 332 ? 0.82435 0.60649 0.71031 -0.07192 -0.04049 -0.00933 332 SER A OG  
2263 N N   . ALA A 333 ? 0.71981 0.56921 0.64322 -0.01278 -0.02995 -0.03880 333 ALA A N   
2264 C CA  . ALA A 333 ? 0.71307 0.59812 0.65558 -0.00366 -0.02220 -0.04125 333 ALA A CA  
2265 C C   . ALA A 333 ? 0.65396 0.54959 0.60716 0.01403  -0.01851 -0.04097 333 ALA A C   
2266 O O   . ALA A 333 ? 0.69524 0.56823 0.63732 0.02388  -0.02362 -0.04259 333 ALA A O   
2267 C CB  . ALA A 333 ? 0.72887 0.60992 0.66116 0.00147  -0.02476 -0.05017 333 ALA A CB  
2268 N N   . PRO A 334 ? 0.59888 0.52763 0.57397 0.01808  -0.01099 -0.03845 334 PRO A N   
2269 C CA  . PRO A 334 ? 0.54663 0.48934 0.53585 0.03336  -0.00828 -0.03807 334 PRO A CA  
2270 C C   . PRO A 334 ? 0.67538 0.60442 0.65259 0.05021  -0.01040 -0.04483 334 PRO A C   
2271 O O   . PRO A 334 ? 0.70759 0.63466 0.67416 0.05493  -0.00866 -0.05049 334 PRO A O   
2272 C CB  . PRO A 334 ? 0.51557 0.49196 0.52603 0.03264  -0.00004 -0.03467 334 PRO A CB  
2273 C CG  . PRO A 334 ? 0.38088 0.36128 0.39172 0.01747  0.00050  -0.03167 334 PRO A CG  
2274 C CD  . PRO A 334 ? 0.62317 0.57835 0.61249 0.00873  -0.00541 -0.03499 334 PRO A CD  
2275 N N   . THR A 335 ? 0.73363 0.65191 0.70988 0.06099  -0.01509 -0.04497 335 THR A N   
2276 C CA  . THR A 335 ? 0.68826 0.58672 0.64903 0.07948  -0.01912 -0.05196 335 THR A CA  
2277 C C   . THR A 335 ? 0.67841 0.60827 0.66244 0.09779  -0.01398 -0.05110 335 THR A C   
2278 O O   . THR A 335 ? 0.63162 0.58250 0.63861 0.09524  -0.01416 -0.04482 335 THR A O   
2279 C CB  . THR A 335 ? 0.75227 0.60998 0.69118 0.07874  -0.03038 -0.05187 335 THR A CB  
2280 O OG1 . THR A 335 ? 0.69120 0.52413 0.61240 0.05827  -0.03412 -0.05013 335 THR A OG1 
2281 C CG2 . THR A 335 ? 0.75867 0.58942 0.67801 0.10102  -0.03630 -0.06016 335 THR A CG2 
2282 N N   . ILE A 336 ? 0.72077 0.65530 0.69904 0.11629  -0.00963 -0.05751 336 ILE A N   
2283 C CA  . ILE A 336 ? 0.67036 0.63935 0.67251 0.13521  -0.00344 -0.05588 336 ILE A CA  
2284 C C   . ILE A 336 ? 0.66263 0.61958 0.66693 0.14602  -0.01355 -0.05576 336 ILE A C   
2285 O O   . ILE A 336 ? 0.73309 0.65578 0.71192 0.16020  -0.02105 -0.06284 336 ILE A O   
2286 C CB  . ILE A 336 ? 0.81003 0.78577 0.80041 0.15625  0.00453  -0.06346 336 ILE A CB  
2287 C CG1 . ILE A 336 ? 0.84696 0.82249 0.82335 0.14636  0.01065  -0.06546 336 ILE A CG1 
2288 C CG2 . ILE A 336 ? 0.70457 0.73037 0.72769 0.17193  0.01542  -0.05809 336 ILE A CG2 
2289 C CD1 . ILE A 336 ? 0.77272 0.78592 0.77703 0.13107  0.01974  -0.05443 336 ILE A CD1 
2290 N N   . ASP A 337 ? 0.65979 0.64184 0.69246 0.14006  -0.01557 -0.04806 337 ASP A N   
2291 C CA  . ASP A 337 ? 0.68343 0.65395 0.71693 0.14837  -0.02761 -0.04720 337 ASP A CA  
2292 C C   . ASP A 337 ? 0.75053 0.76478 0.82042 0.16246  -0.02686 -0.04380 337 ASP A C   
2293 O O   . ASP A 337 ? 0.78773 0.79696 0.86076 0.17180  -0.03835 -0.04327 337 ASP A O   
2294 C CB  . ASP A 337 ? 0.65144 0.60477 0.67939 0.12815  -0.03565 -0.04205 337 ASP A CB  
2295 C CG  . ASP A 337 ? 0.75563 0.74122 0.81054 0.11102  -0.03015 -0.03604 337 ASP A CG  
2296 O OD1 . ASP A 337 ? 0.77055 0.79416 0.85418 0.11407  -0.02229 -0.03349 337 ASP A OD1 
2297 O OD2 . ASP A 337 ? 0.80803 0.78002 0.85434 0.09477  -0.03341 -0.03337 337 ASP A OD2 
2298 N N   . GLY A 338 ? 0.80699 0.86489 0.90452 0.16432  -0.01414 -0.04052 338 GLY A N   
2299 C CA  . GLY A 338 ? 0.77565 0.88134 0.91424 0.17332  -0.01326 -0.03493 338 GLY A CA  
2300 C C   . GLY A 338 ? 0.68977 0.80261 0.84888 0.15706  -0.02495 -0.02907 338 GLY A C   
2301 O O   . GLY A 338 ? 0.62904 0.75866 0.80814 0.16644  -0.03502 -0.02771 338 GLY A O   
2302 N N   . ALA A 339 ? 0.65173 0.75082 0.80412 0.13430  -0.02499 -0.02655 339 ALA A N   
2303 C CA  . ALA A 339 ? 0.57196 0.66614 0.73186 0.11959  -0.03714 -0.02373 339 ALA A CA  
2304 C C   . ALA A 339 ? 0.65337 0.74712 0.81467 0.09829  -0.03094 -0.02039 339 ALA A C   
2305 O O   . ALA A 339 ? 0.71822 0.84341 0.90938 0.09031  -0.02532 -0.01436 339 ALA A O   
2306 C CB  . ALA A 339 ? 0.49059 0.54102 0.61594 0.12242  -0.04983 -0.02800 339 ALA A CB  
2307 N N   . PHE A 340 ? 0.67731 0.73619 0.80709 0.08916  -0.03179 -0.02331 340 PHE A N   
2308 C CA  . PHE A 340 ? 0.57384 0.63348 0.70407 0.07247  -0.02535 -0.02074 340 PHE A CA  
2309 C C   . PHE A 340 ? 0.71258 0.78795 0.84719 0.07351  -0.01108 -0.01887 340 PHE A C   
2310 O O   . PHE A 340 ? 0.77755 0.87289 0.93078 0.06440  -0.00496 -0.01319 340 PHE A O   
2311 C CB  . PHE A 340 ? 0.52124 0.54693 0.61986 0.06353  -0.02826 -0.02347 340 PHE A CB  
2312 C CG  . PHE A 340 ? 0.63547 0.66419 0.73895 0.04912  -0.02700 -0.02131 340 PHE A CG  
2313 C CD1 . PHE A 340 ? 0.56375 0.58978 0.67155 0.04469  -0.03709 -0.02157 340 PHE A CD1 
2314 C CD2 . PHE A 340 ? 0.58644 0.62122 0.69023 0.04208  -0.01682 -0.01959 340 PHE A CD2 
2315 C CE1 . PHE A 340 ? 0.60459 0.63080 0.71503 0.03443  -0.03644 -0.02106 340 PHE A CE1 
2316 C CE2 . PHE A 340 ? 0.56223 0.59891 0.67039 0.03194  -0.01617 -0.01786 340 PHE A CE2 
2317 C CZ  . PHE A 340 ? 0.57248 0.60385 0.68361 0.02863  -0.02567 -0.01899 340 PHE A CZ  
2318 N N   . LEU A 341 ? 0.72155 0.78568 0.83675 0.08535  -0.00662 -0.02360 341 LEU A N   
2319 C CA  . LEU A 341 ? 0.71815 0.79453 0.83066 0.08946  0.00591  -0.02345 341 LEU A CA  
2320 C C   . LEU A 341 ? 0.72981 0.82133 0.84740 0.11076  0.00968  -0.02597 341 LEU A C   
2321 O O   . LEU A 341 ? 0.77501 0.84144 0.86588 0.12376  0.00746  -0.03412 341 LEU A O   
2322 C CB  . LEU A 341 ? 0.81576 0.86156 0.89557 0.08369  0.00641  -0.02884 341 LEU A CB  
2323 C CG  . LEU A 341 ? 1.04543 1.09854 1.11542 0.08735  0.01657  -0.03030 341 LEU A CG  
2324 C CD1 . LEU A 341 ? 1.05601 1.14370 1.15020 0.08175  0.02687  -0.02090 341 LEU A CD1 
2325 C CD2 . LEU A 341 ? 1.10358 1.12655 1.14513 0.07734  0.01263  -0.03549 341 LEU A CD2 
2326 N N   . PRO A 342 ? 0.73982 0.87231 0.89171 0.11550  0.01511  -0.01904 342 PRO A N   
2327 C CA  . PRO A 342 ? 0.81170 0.96535 0.97308 0.13839  0.01872  -0.02102 342 PRO A CA  
2328 C C   . PRO A 342 ? 0.77980 0.94052 0.92497 0.15407  0.03271  -0.02454 342 PRO A C   
2329 O O   . PRO A 342 ? 0.78429 0.95584 0.92895 0.17753  0.03563  -0.02904 342 PRO A O   
2330 C CB  . PRO A 342 ? 0.77326 0.97489 0.98230 0.13363  0.02038  -0.01013 342 PRO A CB  
2331 C CG  . PRO A 342 ? 0.70473 0.89896 0.92312 0.10876  0.01397  -0.00475 342 PRO A CG  
2332 C CD  . PRO A 342 ? 0.71023 0.87173 0.89550 0.09981  0.01719  -0.00855 342 PRO A CD  
2333 N N   . ALA A 343 ? 0.67611 0.83243 0.80728 0.14423  0.04101  -0.02302 343 ALA A N   
2334 C CA  . ALA A 343 ? 0.76496 0.92393 0.87402 0.15995  0.05259  -0.02782 343 ALA A CA  
2335 C C   . ALA A 343 ? 0.99116 1.11937 1.06932 0.14707  0.05100  -0.03193 343 ALA A C   
2336 O O   . ALA A 343 ? 0.93492 1.04622 1.01354 0.12700  0.04318  -0.02967 343 ALA A O   
2337 C CB  . ALA A 343 ? 0.56141 0.77349 0.69863 0.16614  0.06988  -0.01645 343 ALA A CB  
2338 N N   . ASP A 344 ? 1.15192 1.27383 1.20215 0.16040  0.05780  -0.03883 344 ASP A N   
2339 C CA  . ASP A 344 ? 1.23159 1.33137 1.25463 0.14943  0.05607  -0.04239 344 ASP A CA  
2340 C C   . ASP A 344 ? 1.17210 1.29970 1.21617 0.13293  0.06410  -0.02843 344 ASP A C   
2341 O O   . ASP A 344 ? 1.24028 1.40564 1.30482 0.13817  0.07732  -0.01792 344 ASP A O   
2342 C CB  . ASP A 344 ? 1.38606 1.47571 1.37383 0.16940  0.06084  -0.05326 344 ASP A CB  
2343 C CG  . ASP A 344 ? 1.45612 1.53169 1.41899 0.15853  0.05910  -0.05559 344 ASP A CG  
2344 O OD1 . ASP A 344 ? 1.47915 1.52065 1.42646 0.14414  0.04558  -0.06189 344 ASP A OD1 
2345 O OD2 . ASP A 344 ? 1.44654 1.54729 1.40625 0.16406  0.07115  -0.05002 344 ASP A OD2 
2346 N N   . PRO A 345 ? 1.03445 1.14445 1.07355 0.11336  0.05669  -0.02721 345 PRO A N   
2347 C CA  . PRO A 345 ? 0.99567 1.12660 1.05649 0.09808  0.06152  -0.01380 345 PRO A CA  
2348 C C   . PRO A 345 ? 1.13816 1.29966 1.20328 0.10366  0.07623  -0.00329 345 PRO A C   
2349 O O   . PRO A 345 ? 1.16017 1.34173 1.25022 0.09259  0.08099  0.01061  345 PRO A O   
2350 C CB  . PRO A 345 ? 0.87896 0.98435 0.92227 0.08407  0.05213  -0.01817 345 PRO A CB  
2351 C CG  . PRO A 345 ? 0.92120 0.99563 0.95026 0.08381  0.04062  -0.02936 345 PRO A CG  
2352 C CD  . PRO A 345 ? 0.95268 1.02354 0.96933 0.10426  0.04299  -0.03707 345 PRO A CD  
2353 N N   . MET A 346 ? 1.20789 1.37182 1.24756 0.12065  0.08341  -0.00896 346 MET A N   
2354 C CA  . MET A 346 ? 1.17138 1.36634 1.21281 0.12637  0.09910  0.00314  346 MET A CA  
2355 C C   . MET A 346 ? 1.14458 1.37755 1.21000 0.13936  0.11330  0.01128  346 MET A C   
2356 O O   . MET A 346 ? 1.08016 1.34606 1.16197 0.13694  0.12719  0.02777  346 MET A O   
2357 C CB  . MET A 346 ? 1.16875 1.35069 1.16738 0.13841  0.10064  -0.00573 346 MET A CB  
2358 C CG  . MET A 346 ? 1.23905 1.39688 1.21973 0.12399  0.08895  -0.00870 346 MET A CG  
2359 S SD  . MET A 346 ? 1.29292 1.46173 1.30432 0.10109  0.08803  0.00907  346 MET A SD  
2360 C CE  . MET A 346 ? 1.11593 1.30615 1.11380 0.10583  0.10080  0.02374  346 MET A CE  
2361 N N   . THR A 347 ? 1.25069 1.48172 1.32076 0.15259  0.11006  0.00170  347 THR A N   
2362 C CA  . THR A 347 ? 1.28676 1.56018 1.38866 0.16359  0.12195  0.01042  347 THR A CA  
2363 C C   . THR A 347 ? 1.26069 1.55267 1.40931 0.14387  0.11739  0.02326  347 THR A C   
2364 O O   . THR A 347 ? 1.17966 1.51447 1.36303 0.14670  0.12740  0.03503  347 THR A O   
2365 C CB  . THR A 347 ? 1.30785 1.57344 1.39737 0.18857  0.11920  -0.00482 347 THR A CB  
2366 O OG1 . THR A 347 ? 1.36094 1.59441 1.45362 0.18110  0.10085  -0.01363 347 THR A OG1 
2367 C CG2 . THR A 347 ? 1.28456 1.52411 1.32354 0.20870  0.12070  -0.02028 347 THR A CG2 
2368 N N   . LEU A 348 ? 1.32169 1.58368 1.47166 0.12433  0.10228  0.02102  348 LEU A N   
2369 C CA  . LEU A 348 ? 1.28644 1.56037 1.47485 0.10473  0.09634  0.03216  348 LEU A CA  
2370 C C   . LEU A 348 ? 1.23299 1.53375 1.44156 0.09175  0.10759  0.05136  348 LEU A C   
2371 O O   . LEU A 348 ? 1.21345 1.54252 1.46105 0.08153  0.10929  0.06427  348 LEU A O   
2372 C CB  . LEU A 348 ? 1.26228 1.49694 1.44078 0.08937  0.07951  0.02491  348 LEU A CB  
2373 C CG  . LEU A 348 ? 1.30655 1.51654 1.48016 0.09200  0.06477  0.01254  348 LEU A CG  
2374 C CD1 . LEU A 348 ? 1.34236 1.52811 1.47944 0.10740  0.06409  -0.00099 348 LEU A CD1 
2375 C CD2 . LEU A 348 ? 1.28307 1.46458 1.45286 0.07468  0.05181  0.01021  348 LEU A CD2 
2376 N N   . MET A 349 ? 1.18656 1.47726 1.36869 0.09098  0.11386  0.05413  349 MET A N   
2377 C CA  . MET A 349 ? 1.07649 1.38007 1.27179 0.07606  0.12085  0.07278  349 MET A CA  
2378 C C   . MET A 349 ? 1.07118 1.42079 1.28537 0.08140  0.14047  0.09004  349 MET A C   
2379 O O   . MET A 349 ? 1.13808 1.50535 1.37970 0.06491  0.14503  0.10927  349 MET A O   
2380 C CB  . MET A 349 ? 1.09978 1.37655 1.25910 0.07483  0.11902  0.07001  349 MET A CB  
2381 C CG  . MET A 349 ? 1.16710 1.40959 1.32333 0.06054  0.10236  0.06363  349 MET A CG  
2382 S SD  . MET A 349 ? 1.24536 1.48879 1.43101 0.03883  0.09941  0.08209  349 MET A SD  
2383 C CE  . MET A 349 ? 1.24846 1.50231 1.47450 0.03014  0.09094  0.08140  349 MET A CE  
2384 N N   . LYS A 350 ? 1.00755 1.37710 1.20801 0.10412  0.15236  0.08424  350 LYS A N   
2385 C CA  . LYS A 350 ? 1.14663 1.56444 1.36159 0.11172  0.17425  0.10134  350 LYS A CA  
2386 C C   . LYS A 350 ? 1.24497 1.70394 1.51642 0.09884  0.17751  0.11747  350 LYS A C   
2387 O O   . LYS A 350 ? 1.21802 1.72455 1.51041 0.10207  0.19655  0.13472  350 LYS A O   
2388 C CB  . LYS A 350 ? 1.19543 1.62489 1.38249 0.14279  0.18518  0.08835  350 LYS A CB  
2389 C CG  . LYS A 350 ? 1.20601 1.58833 1.33913 0.15500  0.17534  0.06693  350 LYS A CG  
2390 C CD  . LYS A 350 ? 1.23609 1.61511 1.34742 0.18380  0.17634  0.04769  350 LYS A CD  
2391 C CE  . LYS A 350 ? 1.26646 1.59780 1.32296 0.19410  0.16601  0.02735  350 LYS A CE  
2392 N NZ  . LYS A 350 ? 1.27475 1.59551 1.30624 0.22284  0.16533  0.00786  350 LYS A NZ  
2393 N N   . THR A 351 ? 1.39043 1.83356 1.68719 0.08361  0.15892  0.11274  351 THR A N   
2394 C CA  . THR A 351 ? 1.42638 1.90782 1.77714 0.07189  0.15791  0.12503  351 THR A CA  
2395 C C   . THR A 351 ? 1.43287 1.89438 1.80936 0.04281  0.14049  0.13167  351 THR A C   
2396 O O   . THR A 351 ? 1.44729 1.94144 1.87028 0.02839  0.13928  0.14521  351 THR A O   
2397 C CB  . THR A 351 ? 1.37388 1.86815 1.73566 0.09057  0.15174  0.10989  351 THR A CB  
2398 O OG1 . THR A 351 ? 1.37388 1.89689 1.78816 0.07569  0.14301  0.11870  351 THR A OG1 
2399 C CG2 . THR A 351 ? 1.26108 1.70072 1.58554 0.09839  0.13376  0.08607  351 THR A CG2 
2400 N N   . ALA A 352 ? 1.38103 1.99422 1.84685 0.09121  0.03789  -0.10807 352 ALA A N   
2401 C CA  . ALA A 352 ? 1.34152 1.93436 1.80815 0.06870  0.02730  -0.10464 352 ALA A CA  
2402 C C   . ALA A 352 ? 1.15763 1.72062 1.60825 0.04043  0.04525  -0.08949 352 ALA A C   
2403 O O   . ALA A 352 ? 1.15788 1.68445 1.57392 0.04399  0.05600  -0.07907 352 ALA A O   
2404 C CB  . ALA A 352 ? 1.39710 1.94023 1.82834 0.08371  0.00378  -0.10546 352 ALA A CB  
2405 N N   . ASP A 353 ? 1.01562 1.59202 1.49044 0.01272  0.04658  -0.08874 353 ASP A N   
2406 C CA  . ASP A 353 ? 0.92476 1.47088 1.38548 -0.01453 0.06163  -0.07471 353 ASP A CA  
2407 C C   . ASP A 353 ? 0.79020 1.27904 1.22043 -0.02015 0.04745  -0.07123 353 ASP A C   
2408 O O   . ASP A 353 ? 0.75617 1.24153 1.18937 -0.01492 0.02684  -0.08095 353 ASP A O   
2409 C CB  . ASP A 353 ? 0.99250 1.58119 1.49441 -0.04480 0.07328  -0.07471 353 ASP A CB  
2410 C CG  . ASP A 353 ? 1.01606 1.58547 1.50257 -0.06675 0.09757  -0.05778 353 ASP A CG  
2411 O OD1 . ASP A 353 ? 1.02768 1.55417 1.49747 -0.08760 0.09678  -0.04901 353 ASP A OD1 
2412 O OD2 . ASP A 353 ? 1.01125 1.60637 1.49962 -0.06183 0.11685  -0.05353 353 ASP A OD2 
2413 N N   . LEU A 354 ? 0.71364 1.15893 1.11377 -0.03011 0.05887  -0.05764 354 LEU A N   
2414 C CA  . LEU A 354 ? 0.53770 0.92670 0.90198 -0.02857 0.04956  -0.05338 354 LEU A CA  
2415 C C   . LEU A 354 ? 0.60748 0.96679 0.96495 -0.05358 0.05710  -0.04434 354 LEU A C   
2416 O O   . LEU A 354 ? 0.59306 0.90542 0.91783 -0.05102 0.05653  -0.03744 354 LEU A O   
2417 C CB  . LEU A 354 ? 0.48783 0.84804 0.81628 -0.00846 0.05347  -0.04642 354 LEU A CB  
2418 C CG  . LEU A 354 ? 0.58589 0.96417 0.91471 0.01647  0.04399  -0.05503 354 LEU A CG  
2419 C CD1 . LEU A 354 ? 0.55006 0.89451 0.84212 0.03171  0.04635  -0.04823 354 LEU A CD1 
2420 C CD2 . LEU A 354 ? 0.69004 1.06691 1.02273 0.02198  0.02217  -0.06582 354 LEU A CD2 
2421 N N   . LYS A 355 ? 0.70133 1.08709 1.08935 -0.07792 0.06393  -0.04441 355 LYS A N   
2422 C CA  . LYS A 355 ? 0.81563 1.16765 1.19350 -0.10289 0.07255  -0.03358 355 LYS A CA  
2423 C C   . LYS A 355 ? 0.81719 1.11872 1.17232 -0.10482 0.05699  -0.03708 355 LYS A C   
2424 O O   . LYS A 355 ? 0.87205 1.12854 1.20331 -0.11426 0.06212  -0.02721 355 LYS A O   
2425 C CB  . LYS A 355 ? 0.81506 1.20480 1.23138 -0.13259 0.08107  -0.03387 355 LYS A CB  
2426 C CG  . LYS A 355 ? 0.94176 1.30036 1.34348 -0.15775 0.09781  -0.01698 355 LYS A CG  
2427 C CD  . LYS A 355 ? 1.03433 1.39263 1.41474 -0.14757 0.11803  -0.00265 355 LYS A CD  
2428 C CE  . LYS A 355 ? 1.02451 1.44713 1.43776 -0.15593 0.13613  -0.00241 355 LYS A CE  
2429 N NZ  . LYS A 355 ? 0.99258 1.41182 1.38065 -0.14853 0.15641  0.01141  355 LYS A NZ  
2430 N N   . ASP A 356 ? 0.70682 1.01302 1.06539 -0.09378 0.03788  -0.05104 356 ASP A N   
2431 C CA  . ASP A 356 ? 0.74769 1.00974 1.08386 -0.09460 0.02338  -0.05678 356 ASP A CA  
2432 C C   . ASP A 356 ? 0.66124 0.89267 0.96067 -0.06899 0.01894  -0.05582 356 ASP A C   
2433 O O   . ASP A 356 ? 0.67393 0.87359 0.95275 -0.06511 0.00741  -0.06228 356 ASP A O   
2434 C CB  . ASP A 356 ? 0.93034 1.21534 1.29088 -0.10229 0.00445  -0.07319 356 ASP A CB  
2435 C CG  . ASP A 356 ? 1.09719 1.41346 1.49698 -0.13232 0.00864  -0.07462 356 ASP A CG  
2436 O OD1 . ASP A 356 ? 1.06154 1.42495 1.49664 -0.13650 -0.00222 -0.08692 356 ASP A OD1 
2437 O OD2 . ASP A 356 ? 1.20552 1.49940 1.60044 -0.15223 0.02283  -0.06280 356 ASP A OD2 
2438 N N   . TYR A 357 ? 0.59993 0.84013 0.88993 -0.05265 0.02848  -0.04828 357 TYR A N   
2439 C CA  . TYR A 357 ? 0.47954 0.69562 0.73794 -0.03151 0.02527  -0.04678 357 TYR A CA  
2440 C C   . TYR A 357 ? 0.57991 0.76049 0.81350 -0.03129 0.03641  -0.03494 357 TYR A C   
2441 O O   . TYR A 357 ? 0.72280 0.90560 0.96008 -0.03930 0.04979  -0.02448 357 TYR A O   
2442 C CB  . TYR A 357 ? 0.41731 0.66029 0.67831 -0.01372 0.02606  -0.04700 357 TYR A CB  
2443 C CG  . TYR A 357 ? 0.51194 0.77859 0.78592 -0.00533 0.00950  -0.05960 357 TYR A CG  
2444 C CD1 . TYR A 357 ? 0.54710 0.79999 0.79724 0.01288  -0.00131 -0.06262 357 TYR A CD1 
2445 C CD2 . TYR A 357 ? 0.57583 0.87833 0.88507 -0.01629 0.00390  -0.06807 357 TYR A CD2 
2446 C CE1 . TYR A 357 ? 0.65193 0.92151 0.90879 0.02217  -0.01823 -0.07291 357 TYR A CE1 
2447 C CE2 . TYR A 357 ? 0.70134 1.02654 1.02234 -0.00627 -0.01389 -0.08011 357 TYR A CE2 
2448 C CZ  . TYR A 357 ? 0.75429 1.06039 1.04679 0.01406  -0.02550 -0.08210 357 TYR A CZ  
2449 O OH  . TYR A 357 ? 0.80762 1.13132 1.10656 0.02568  -0.04495 -0.09287 357 TYR A OH  
2450 N N   . ASP A 358 ? 0.57643 0.72562 0.78425 -0.02168 0.03063  -0.03693 358 ASP A N   
2451 C CA  . ASP A 358 ? 0.52850 0.64803 0.71307 -0.01576 0.03849  -0.02772 358 ASP A CA  
2452 C C   . ASP A 358 ? 0.59059 0.71264 0.75816 0.00256  0.03824  -0.02670 358 ASP A C   
2453 O O   . ASP A 358 ? 0.65008 0.77311 0.80986 0.01036  0.02910  -0.03466 358 ASP A O   
2454 C CB  . ASP A 358 ? 0.42873 0.51148 0.59860 -0.01880 0.03311  -0.03194 358 ASP A CB  
2455 C CG  . ASP A 358 ? 0.68947 0.76216 0.87290 -0.03951 0.03184  -0.03301 358 ASP A CG  
2456 O OD1 . ASP A 358 ? 0.74398 0.81925 0.93551 -0.05107 0.04239  -0.02195 358 ASP A OD1 
2457 O OD2 . ASP A 358 ? 0.80493 0.86645 0.98923 -0.04547 0.02025  -0.04484 358 ASP A OD2 
2458 N N   . ILE A 359 ? 0.50750 0.62972 0.66767 0.00797  0.04783  -0.01664 359 ILE A N   
2459 C CA  . ILE A 359 ? 0.49944 0.62707 0.64668 0.02162  0.04803  -0.01503 359 ILE A CA  
2460 C C   . ILE A 359 ? 0.55049 0.66067 0.68199 0.02687  0.05408  -0.00704 359 ILE A C   
2461 O O   . ILE A 359 ? 0.57570 0.68081 0.70765 0.02258  0.06130  0.00147  359 ILE A O   
2462 C CB  . ILE A 359 ? 0.54277 0.69594 0.69987 0.02452  0.05118  -0.01336 359 ILE A CB  
2463 C CG1 . ILE A 359 ? 0.55483 0.72799 0.72895 0.02318  0.04254  -0.02291 359 ILE A CG1 
2464 C CG2 . ILE A 359 ? 0.55501 0.70629 0.69534 0.03651  0.05068  -0.01119 359 ILE A CG2 
2465 C CD1 . ILE A 359 ? 0.69867 0.90120 0.89138 0.02350  0.04709  -0.02315 359 ILE A CD1 
2466 N N   . LEU A 360 ? 0.54113 0.64311 0.65851 0.03584  0.05094  -0.00981 360 LEU A N   
2467 C CA  . LEU A 360 ? 0.51064 0.60484 0.61634 0.04350  0.05493  -0.00419 360 LEU A CA  
2468 C C   . LEU A 360 ? 0.54104 0.64933 0.64073 0.04903  0.05467  -0.00327 360 LEU A C   
2469 O O   . LEU A 360 ? 0.53942 0.65124 0.63446 0.05028  0.05004  -0.00880 360 LEU A O   
2470 C CB  . LEU A 360 ? 0.48265 0.56033 0.57955 0.04894  0.05244  -0.00968 360 LEU A CB  
2471 C CG  . LEU A 360 ? 0.53633 0.61352 0.62504 0.05952  0.05547  -0.00602 360 LEU A CG  
2472 C CD1 . LEU A 360 ? 0.55953 0.62793 0.64813 0.06001  0.05874  0.00409  360 LEU A CD1 
2473 C CD2 . LEU A 360 ? 0.37836 0.44549 0.45973 0.06804  0.05396  -0.01396 360 LEU A CD2 
2474 N N   . MET A 361 ? 0.47618 0.58975 0.57327 0.05138  0.05869  0.00381  361 MET A N   
2475 C CA  . MET A 361 ? 0.41185 0.53486 0.50223 0.05443  0.05713  0.00396  361 MET A CA  
2476 C C   . MET A 361 ? 0.41692 0.54176 0.50137 0.05816  0.05957  0.00995  361 MET A C   
2477 O O   . MET A 361 ? 0.63340 0.75263 0.71804 0.05969  0.06241  0.01515  361 MET A O   
2478 C CB  . MET A 361 ? 0.40070 0.53233 0.49513 0.05327  0.05604  0.00264  361 MET A CB  
2479 C CG  . MET A 361 ? 0.43668 0.57408 0.53701 0.05153  0.06234  0.00750  361 MET A CG  
2480 S SD  . MET A 361 ? 0.58527 0.73982 0.69843 0.05125  0.06228  0.00231  361 MET A SD  
2481 C CE  . MET A 361 ? 0.39582 0.54840 0.49564 0.06009  0.05473  -0.00210 361 MET A CE  
2482 N N   . GLY A 362 ? 0.37038 0.50134 0.44804 0.05897  0.05723  0.00944  362 GLY A N   
2483 C CA  . GLY A 362 ? 0.43470 0.57096 0.50837 0.06168  0.05724  0.01352  362 GLY A CA  
2484 C C   . GLY A 362 ? 0.45092 0.59328 0.51822 0.05841  0.05379  0.01186  362 GLY A C   
2485 O O   . GLY A 362 ? 0.38370 0.52118 0.44542 0.05475  0.05133  0.00913  362 GLY A O   
2486 N N   . ASN A 363 ? 0.46211 0.61434 0.52995 0.05944  0.05256  0.01364  363 ASN A N   
2487 C CA  . ASN A 363 ? 0.47967 0.63798 0.54202 0.05324  0.04862  0.01291  363 ASN A CA  
2488 C C   . ASN A 363 ? 0.42889 0.60667 0.49992 0.05382  0.04795  0.01297  363 ASN A C   
2489 O O   . ASN A 363 ? 0.44723 0.63110 0.52585 0.06282  0.04900  0.01408  363 ASN A O   
2490 C CB  . ASN A 363 ? 0.43932 0.59138 0.49210 0.05368  0.04498  0.01401  363 ASN A CB  
2491 C CG  . ASN A 363 ? 0.49476 0.63341 0.54088 0.05460  0.04540  0.01194  363 ASN A CG  
2492 O OD1 . ASN A 363 ? 0.59136 0.72869 0.63846 0.05964  0.04887  0.01320  363 ASN A OD1 
2493 N ND2 . ASN A 363 ? 0.50496 0.63423 0.54374 0.04994  0.04182  0.00897  363 ASN A ND2 
2494 N N   . VAL A 364 ? 0.39548 0.58297 0.46556 0.04419  0.04550  0.01168  364 VAL A N   
2495 C CA  . VAL A 364 ? 0.50030 0.71384 0.58266 0.04323  0.04397  0.01079  364 VAL A CA  
2496 C C   . VAL A 364 ? 0.52290 0.73868 0.60095 0.04066  0.03562  0.01153  364 VAL A C   
2497 O O   . VAL A 364 ? 0.62611 0.82191 0.68926 0.03812  0.03227  0.01187  364 VAL A O   
2498 C CB  . VAL A 364 ? 0.51212 0.74131 0.59916 0.03113  0.04818  0.00869  364 VAL A CB  
2499 C CG1 . VAL A 364 ? 0.35434 0.57816 0.43986 0.03490  0.05590  0.00705  364 VAL A CG1 
2500 C CG2 . VAL A 364 ? 0.56041 0.77519 0.63319 0.01501  0.04440  0.00989  364 VAL A CG2 
2501 N N   . ARG A 365 ? 0.51318 0.75489 0.60420 0.04284  0.03130  0.01051  365 ARG A N   
2502 C CA  . ARG A 365 ? 0.48556 0.72969 0.57096 0.04224  0.02121  0.01041  365 ARG A CA  
2503 C C   . ARG A 365 ? 0.43402 0.67208 0.51069 0.02443  0.01616  0.00766  365 ARG A C   
2504 O O   . ARG A 365 ? 0.51998 0.74116 0.58028 0.02358  0.00907  0.00654  365 ARG A O   
2505 C CB  . ARG A 365 ? 0.57478 0.85045 0.67752 0.05037  0.01531  0.00928  365 ARG A CB  
2506 C CG  . ARG A 365 ? 0.70311 0.97735 0.79566 0.05499  0.00348  0.00991  365 ARG A CG  
2507 C CD  . ARG A 365 ? 0.86274 1.17198 0.97429 0.06318  -0.00517 0.00785  365 ARG A CD  
2508 N NE  . ARG A 365 ? 0.99809 1.34301 1.13367 0.04941  -0.00481 0.00222  365 ARG A NE  
2509 C CZ  . ARG A 365 ? 1.05713 1.44369 1.21877 0.05615  -0.00902 -0.00154 365 ARG A CZ  
2510 N NH1 . ARG A 365 ? 1.15777 1.54991 1.32190 0.07879  -0.01588 -0.00002 365 ARG A NH1 
2511 N NH2 . ARG A 365 ? 1.01465 1.43758 1.19945 0.04049  -0.00637 -0.00659 365 ARG A NH2 
2512 N N   . ASP A 366 ? 0.45132 0.69968 0.53545 0.00978  0.01996  0.00651  366 ASP A N   
2513 C CA  . ASP A 366 ? 0.47451 0.71350 0.54886 -0.00974 0.01407  0.00482  366 ASP A CA  
2514 C C   . ASP A 366 ? 0.40348 0.61546 0.46258 -0.01941 0.01991  0.00710  366 ASP A C   
2515 O O   . ASP A 366 ? 0.51036 0.72846 0.57106 -0.03667 0.02323  0.00844  366 ASP A O   
2516 C CB  . ASP A 366 ? 0.48712 0.76521 0.58307 -0.02236 0.01045  0.00223  366 ASP A CB  
2517 C CG  . ASP A 366 ? 0.60279 0.90538 0.71146 -0.00835 0.00176  -0.00015 366 ASP A CG  
2518 O OD1 . ASP A 366 ? 0.61035 0.89152 0.70121 -0.00150 -0.00668 -0.00068 366 ASP A OD1 
2519 O OD2 . ASP A 366 ? 0.59077 0.93210 0.72449 -0.00169 0.00314  -0.00161 366 ASP A OD2 
2520 N N   . GLU A 367 ? 0.42415 0.60641 0.46729 -0.00812 0.02066  0.00780  367 GLU A N   
2521 C CA  . GLU A 367 ? 0.51551 0.66960 0.54232 -0.01187 0.02344  0.00953  367 GLU A CA  
2522 C C   . GLU A 367 ? 0.57685 0.70993 0.58673 -0.03122 0.01767  0.01014  367 GLU A C   
2523 O O   . GLU A 367 ? 0.67181 0.79029 0.67071 -0.04002 0.02107  0.01374  367 GLU A O   
2524 C CB  . GLU A 367 ? 0.46618 0.59687 0.48150 0.00374  0.02208  0.00814  367 GLU A CB  
2525 C CG  . GLU A 367 ? 0.52422 0.66867 0.55321 0.01896  0.02891  0.00914  367 GLU A CG  
2526 C CD  . GLU A 367 ? 0.54229 0.68681 0.57560 0.02059  0.03596  0.01044  367 GLU A CD  
2527 O OE1 . GLU A 367 ? 0.48551 0.62423 0.51154 0.01031  0.03687  0.01151  367 GLU A OE1 
2528 O OE2 . GLU A 367 ? 0.47099 0.61975 0.51274 0.03128  0.04025  0.01050  367 GLU A OE2 
2529 N N   . GLY A 368 ? 0.62220 0.74940 0.62620 -0.03858 0.00807  0.00687  368 GLY A N   
2530 C CA  . GLY A 368 ? 0.44760 0.54101 0.42879 -0.05507 0.00038  0.00679  368 GLY A CA  
2531 C C   . GLY A 368 ? 0.63572 0.74408 0.62376 -0.08137 -0.00099 0.00854  368 GLY A C   
2532 O O   . GLY A 368 ? 0.69368 0.76917 0.66038 -0.09894 -0.00771 0.00960  368 GLY A O   
2533 N N   . THR A 369 ? 0.48530 0.64235 0.50276 -0.08502 0.00500  0.00871  369 THR A N   
2534 C CA  . THR A 369 ? 0.54049 0.72112 0.57040 -0.11098 0.00291  0.00865  369 THR A CA  
2535 C C   . THR A 369 ? 0.64559 0.81109 0.66255 -0.13455 0.01004  0.01584  369 THR A C   
2536 O O   . THR A 369 ? 0.75376 0.90370 0.76028 -0.16028 0.00378  0.01701  369 THR A O   
2537 C CB  . THR A 369 ? 0.56901 0.81051 0.63626 -0.10629 0.00770  0.00611  369 THR A CB  
2538 O OG1 . THR A 369 ? 0.58911 0.84700 0.66653 -0.09019 0.02094  0.00869  369 THR A OG1 
2539 C CG2 . THR A 369 ? 0.61171 0.86343 0.68595 -0.08943 -0.00355 0.00007  369 THR A CG2 
2540 N N   . TYR A 370 ? 0.74395 0.91089 0.75827 -0.12783 0.02260  0.02102  370 TYR A N   
2541 C CA  . TYR A 370 ? 0.71472 0.87042 0.71417 -0.15236 0.03020  0.02904  370 TYR A CA  
2542 C C   . TYR A 370 ? 0.71833 0.80702 0.67585 -0.15782 0.02137  0.03374  370 TYR A C   
2543 O O   . TYR A 370 ? 0.80408 0.86998 0.74244 -0.18465 0.02104  0.04048  370 TYR A O   
2544 C CB  . TYR A 370 ? 0.67827 0.86312 0.68760 -0.14604 0.04701  0.03226  370 TYR A CB  
2545 C CG  . TYR A 370 ? 0.71341 0.86831 0.70117 -0.12710 0.05036  0.03488  370 TYR A CG  
2546 C CD1 . TYR A 370 ? 0.76081 0.86406 0.71077 -0.13428 0.04676  0.04193  370 TYR A CD1 
2547 C CD2 . TYR A 370 ? 0.68400 0.86344 0.68916 -0.10295 0.05660  0.03025  370 TYR A CD2 
2548 C CE1 . TYR A 370 ? 0.78460 0.86609 0.71760 -0.11627 0.04798  0.04323  370 TYR A CE1 
2549 C CE2 . TYR A 370 ? 0.68508 0.84122 0.67351 -0.08757 0.05848  0.03131  370 TYR A CE2 
2550 C CZ  . TYR A 370 ? 0.80194 0.91223 0.75584 -0.09398 0.05400  0.03743  370 TYR A CZ  
2551 O OH  . TYR A 370 ? 0.84437 0.93592 0.78386 -0.07784 0.05396  0.03741  370 TYR A OH  
2552 N N   . PHE A 371 ? 0.73747 0.79402 0.68034 -0.13325 0.01361  0.03014  371 PHE A N   
2553 C CA  . PHE A 371 ? 0.75249 0.74619 0.65737 -0.13431 0.00207  0.03194  371 PHE A CA  
2554 C C   . PHE A 371 ? 0.79995 0.77125 0.69443 -0.15328 -0.01059 0.02865  371 PHE A C   
2555 O O   . PHE A 371 ? 0.87932 0.80254 0.74252 -0.17114 -0.01756 0.03358  371 PHE A O   
2556 C CB  . PHE A 371 ? 0.67577 0.65145 0.57456 -0.10246 -0.00293 0.02634  371 PHE A CB  
2557 C CG  . PHE A 371 ? 0.74027 0.72982 0.64506 -0.08659 0.00680  0.02920  371 PHE A CG  
2558 C CD1 . PHE A 371 ? 0.68422 0.64443 0.56339 -0.09050 0.00787  0.03657  371 PHE A CD1 
2559 C CD2 . PHE A 371 ? 0.72257 0.75141 0.65568 -0.06857 0.01374  0.02467  371 PHE A CD2 
2560 C CE1 . PHE A 371 ? 0.69634 0.66927 0.57962 -0.07642 0.01502  0.03774  371 PHE A CE1 
2561 C CE2 . PHE A 371 ? 0.64034 0.67910 0.57803 -0.05574 0.02127  0.02601  371 PHE A CE2 
2562 C CZ  . PHE A 371 ? 0.72729 0.73964 0.64079 -0.05960 0.02163  0.03177  371 PHE A CZ  
2563 N N   . LEU A 372 ? 0.74479 0.74795 0.66287 -0.15054 -0.01482 0.02042  372 LEU A N   
2564 C CA  . LEU A 372 ? 0.76437 0.74761 0.67258 -0.16877 -0.02864 0.01533  372 LEU A CA  
2565 C C   . LEU A 372 ? 0.87108 0.86900 0.78626 -0.20690 -0.02535 0.02148  372 LEU A C   
2566 O O   . LEU A 372 ? 1.05061 1.00627 0.94127 -0.23044 -0.03568 0.02254  372 LEU A O   
2567 C CB  . LEU A 372 ? 0.65353 0.66834 0.58273 -0.15456 -0.03509 0.00483  372 LEU A CB  
2568 C CG  . LEU A 372 ? 0.70111 0.70521 0.62450 -0.17453 -0.05053 -0.00245 372 LEU A CG  
2569 C CD1 . LEU A 372 ? 0.70398 0.64031 0.58628 -0.16680 -0.06477 -0.00863 372 LEU A CD1 
2570 C CD2 . LEU A 372 ? 0.61486 0.67051 0.56796 -0.16692 -0.05484 -0.01046 372 LEU A CD2 
2571 N N   . LEU A 373 ? 0.77016 0.82703 0.71794 -0.21414 -0.01065 0.02530  373 LEU A N   
2572 C CA  . LEU A 373 ? 0.85078 0.92925 0.80820 -0.25164 -0.00451 0.03131  373 LEU A CA  
2573 C C   . LEU A 373 ? 0.90611 0.93189 0.82468 -0.27131 -0.00050 0.04369  373 LEU A C   
2574 O O   . LEU A 373 ? 0.95082 0.95832 0.85717 -0.30670 -0.00325 0.04897  373 LEU A O   
2575 C CB  . LEU A 373 ? 0.83065 0.98667 0.83134 -0.25054 0.01202  0.03141  373 LEU A CB  
2576 C CG  . LEU A 373 ? 0.73699 0.92117 0.74619 -0.28510 0.02678  0.04008  373 LEU A CG  
2577 C CD1 . LEU A 373 ? 0.73046 0.94181 0.76056 -0.31954 0.01983  0.03678  373 LEU A CD1 
2578 C CD2 . LEU A 373 ? 0.59853 0.84471 0.63811 -0.27124 0.04605  0.04013  373 LEU A CD2 
2579 N N   . TYR A 374 ? 0.84015 0.83894 0.73711 -0.24979 0.00489  0.04885  374 TYR A N   
2580 C CA  . TYR A 374 ? 0.88290 0.82954 0.73877 -0.26622 0.00728  0.06165  374 TYR A CA  
2581 C C   . TYR A 374 ? 0.91023 0.77756 0.72355 -0.26961 -0.01212 0.06155  374 TYR A C   
2582 O O   . TYR A 374 ? 0.89547 0.72053 0.67913 -0.30013 -0.01521 0.07096  374 TYR A O   
2583 C CB  . TYR A 374 ? 0.79186 0.73543 0.63684 -0.24168 0.01687  0.06639  374 TYR A CB  
2584 C CG  . TYR A 374 ? 0.75919 0.75837 0.62509 -0.25166 0.03794  0.07176  374 TYR A CG  
2585 C CD1 . TYR A 374 ? 0.70837 0.77525 0.61854 -0.23535 0.04751  0.06317  374 TYR A CD1 
2586 C CD2 . TYR A 374 ? 0.78378 0.76662 0.62282 -0.27687 0.04840  0.08521  374 TYR A CD2 
2587 C CE1 . TYR A 374 ? 0.73983 0.85825 0.66903 -0.24152 0.06668  0.06573  374 TYR A CE1 
2588 C CE2 . TYR A 374 ? 0.86933 0.90637 0.72641 -0.28493 0.06939  0.08866  374 TYR A CE2 
2589 C CZ  . TYR A 374 ? 0.85667 0.96262 0.76007 -0.26612 0.07845  0.07784  374 TYR A CZ  
2590 O OH  . TYR A 374 ? 0.84759 1.00814 0.76884 -0.27065 0.09931  0.07896  374 TYR A OH  
2591 N N   . ASP A 375 ? 0.86514 0.71002 0.67334 -0.23904 -0.02506 0.05086  375 ASP A N   
2592 C CA  . ASP A 375 ? 1.00683 0.77453 0.77240 -0.23715 -0.04343 0.04897  375 ASP A CA  
2593 C C   . ASP A 375 ? 1.01662 0.76910 0.77985 -0.26200 -0.05630 0.04251  375 ASP A C   
2594 O O   . ASP A 375 ? 1.08434 0.76619 0.80777 -0.26813 -0.07193 0.04171  375 ASP A O   
2595 C CB  . ASP A 375 ? 1.20493 0.95645 0.96517 -0.19486 -0.05121 0.03890  375 ASP A CB  
2596 C CG  . ASP A 375 ? 1.29890 1.03935 1.04645 -0.17356 -0.04529 0.04567  375 ASP A CG  
2597 O OD1 . ASP A 375 ? 1.26827 1.06050 1.04318 -0.16658 -0.03059 0.04816  375 ASP A OD1 
2598 O OD2 . ASP A 375 ? 1.38289 1.06179 1.09227 -0.16278 -0.05676 0.04763  375 ASP A OD2 
2599 N N   . PHE A 376 ? 1.03613 0.85123 0.83974 -0.27612 -0.05161 0.03731  376 PHE A N   
2600 C CA  . PHE A 376 ? 1.12505 0.93364 0.93080 -0.30150 -0.06512 0.02978  376 PHE A CA  
2601 C C   . PHE A 376 ? 1.10328 0.97143 0.94369 -0.33878 -0.05440 0.03499  376 PHE A C   
2602 O O   . PHE A 376 ? 0.99423 0.90477 0.86485 -0.34993 -0.06038 0.02564  376 PHE A O   
2603 C CB  . PHE A 376 ? 1.02205 0.84636 0.84144 -0.27461 -0.07639 0.01322  376 PHE A CB  
2604 C CG  . PHE A 376 ? 1.01369 0.78011 0.79847 -0.24115 -0.08669 0.00664  376 PHE A CG  
2605 C CD1 . PHE A 376 ? 0.95019 0.72990 0.74056 -0.20591 -0.07753 0.00740  376 PHE A CD1 
2606 C CD2 . PHE A 376 ? 1.13821 0.83536 0.88402 -0.24571 -0.10558 -0.00065 376 PHE A CD2 
2607 C CE1 . PHE A 376 ? 1.01982 0.75304 0.78236 -0.17570 -0.08603 0.00083  376 PHE A CE1 
2608 C CE2 . PHE A 376 ? 0.92747 0.57457 0.64254 -0.21214 -0.11430 -0.00806 376 PHE A CE2 
2609 C CZ  . PHE A 376 ? 0.88217 0.55083 0.60765 -0.17752 -0.10401 -0.00723 376 PHE A CZ  
2610 N N   . ILE A 377 ? 1.12001 0.99287 0.95521 -0.35863 -0.03860 0.04979  377 ILE A N   
2611 C CA  . ILE A 377 ? 1.04716 0.98436 0.91735 -0.39303 -0.02402 0.05527  377 ILE A CA  
2612 C C   . ILE A 377 ? 1.10242 1.02794 0.97235 -0.43597 -0.03595 0.05321  377 ILE A C   
2613 O O   . ILE A 377 ? 1.06725 1.06179 0.97986 -0.46061 -0.02917 0.05099  377 ILE A O   
2614 C CB  . ILE A 377 ? 0.98176 0.91767 0.83677 -0.40523 -0.00389 0.07203  377 ILE A CB  
2615 C CG1 . ILE A 377 ? 1.01943 1.03884 0.91832 -0.43286 0.01572  0.07539  377 ILE A CG1 
2616 C CG2 . ILE A 377 ? 0.97231 0.82042 0.77007 -0.43075 -0.01098 0.08508  377 ILE A CG2 
2617 C CD1 . ILE A 377 ? 1.06730 1.11674 0.96782 -0.42406 0.03894  0.08485  377 ILE A CD1 
2618 N N   . ASP A 378 ? 1.16972 1.00979 0.99333 -0.44488 -0.05477 0.05262  378 ASP A N   
2619 C CA  . ASP A 378 ? 1.17551 0.99826 0.99701 -0.48448 -0.06985 0.04784  378 ASP A CA  
2620 C C   . ASP A 378 ? 1.06683 0.95100 0.93244 -0.47597 -0.07997 0.02992  378 ASP A C   
2621 O O   . ASP A 378 ? 0.99613 0.92331 0.89202 -0.51138 -0.08284 0.02644  378 ASP A O   
2622 C CB  . ASP A 378 ? 1.27995 0.99294 1.04013 -0.48594 -0.09107 0.04701  378 ASP A CB  
2623 C CG  . ASP A 378 ? 1.45470 1.09975 1.16633 -0.50192 -0.08458 0.06651  378 ASP A CG  
2624 O OD1 . ASP A 378 ? 1.47671 1.16146 1.20151 -0.51802 -0.06275 0.08109  378 ASP A OD1 
2625 O OD2 . ASP A 378 ? 1.54017 1.09056 1.19789 -0.49699 -0.10173 0.06704  378 ASP A OD2 
2626 N N   . TYR A 379 ? 1.06085 0.95340 0.93143 -0.42951 -0.08504 0.01895  379 TYR A N   
2627 C CA  . TYR A 379 ? 1.10671 1.04535 1.00843 -0.41626 -0.09722 0.00241  379 TYR A CA  
2628 C C   . TYR A 379 ? 1.04426 1.08481 1.00515 -0.41118 -0.08260 0.00183  379 TYR A C   
2629 O O   . TYR A 379 ? 0.91349 1.00618 0.90873 -0.42109 -0.09184 -0.00837 379 TYR A O   
2630 C CB  . TYR A 379 ? 1.13069 1.03526 1.00983 -0.36925 -0.10675 -0.00764 379 TYR A CB  
2631 C CG  . TYR A 379 ? 1.27980 1.09083 1.10465 -0.36654 -0.12527 -0.01335 379 TYR A CG  
2632 C CD1 . TYR A 379 ? 1.36967 1.15558 1.18247 -0.38175 -0.14716 -0.02708 379 TYR A CD1 
2633 C CD2 . TYR A 379 ? 1.31332 1.06124 1.09839 -0.34577 -0.12244 -0.00675 379 TYR A CD2 
2634 C CE1 . TYR A 379 ? 1.41885 1.11664 1.17986 -0.37608 -0.16474 -0.03452 379 TYR A CE1 
2635 C CE2 . TYR A 379 ? 1.39292 1.05500 1.12827 -0.33887 -0.14044 -0.01370 379 TYR A CE2 
2636 C CZ  . TYR A 379 ? 1.44012 1.07639 1.16298 -0.35378 -0.16106 -0.02787 379 TYR A CZ  
2637 O OH  . TYR A 379 ? 1.47853 1.02751 1.15026 -0.34490 -0.17954 -0.03688 379 TYR A OH  
2638 N N   . PHE A 380 ? 0.99692 1.06550 0.96907 -0.39413 -0.06140 0.01157  380 PHE A N   
2639 C CA  . PHE A 380 ? 0.87595 1.02937 0.89683 -0.37359 -0.04895 0.00867  380 PHE A CA  
2640 C C   . PHE A 380 ? 0.89457 1.10296 0.94364 -0.39688 -0.02685 0.01870  380 PHE A C   
2641 O O   . PHE A 380 ? 0.96425 1.14056 0.98955 -0.42511 -0.01775 0.03078  380 PHE A O   
2642 C CB  . PHE A 380 ? 0.82267 0.96496 0.83383 -0.32628 -0.04378 0.00805  380 PHE A CB  
2643 C CG  . PHE A 380 ? 0.86361 0.95601 0.84654 -0.30220 -0.06180 -0.00143 380 PHE A CG  
2644 C CD1 . PHE A 380 ? 0.79939 0.82622 0.74147 -0.28189 -0.06276 0.00149  380 PHE A CD1 
2645 C CD2 . PHE A 380 ? 0.84058 0.95346 0.83710 -0.29964 -0.07828 -0.01408 380 PHE A CD2 
2646 C CE1 . PHE A 380 ? 0.85744 0.84344 0.77481 -0.25874 -0.07743 -0.00847 380 PHE A CE1 
2647 C CE2 . PHE A 380 ? 0.91416 0.98234 0.88157 -0.27717 -0.09322 -0.02338 380 PHE A CE2 
2648 C CZ  . PHE A 380 ? 0.92093 0.92669 0.84940 -0.25667 -0.09178 -0.02083 380 PHE A CZ  
2649 N N   . ASP A 381 ? 0.80920 1.10054 0.90748 -0.38344 -0.01841 0.01334  381 ASP A N   
2650 C CA  . ASP A 381 ? 0.81546 1.17406 0.94823 -0.40071 0.00330  0.01913  381 ASP A CA  
2651 C C   . ASP A 381 ? 0.74126 1.13009 0.88634 -0.36138 0.01926  0.01987  381 ASP A C   
2652 O O   . ASP A 381 ? 0.66669 1.04399 0.80806 -0.32322 0.01165  0.01397  381 ASP A O   
2653 C CB  . ASP A 381 ? 0.79327 1.23252 0.97939 -0.42258 -0.00124 0.01007  381 ASP A CB  
2654 C CG  . ASP A 381 ? 0.92107 1.43637 1.14553 -0.44103 0.02307  0.01479  381 ASP A CG  
2655 O OD1 . ASP A 381 ? 1.02016 1.52469 1.23281 -0.48220 0.03428  0.02516  381 ASP A OD1 
2656 O OD2 . ASP A 381 ? 0.92105 1.50471 1.18482 -0.41344 0.03170  0.00833  381 ASP A OD2 
2657 N N   . LYS A 382 ? 0.81515 1.23883 0.97114 -0.37253 0.04209  0.02748  382 LYS A N   
2658 C CA  . LYS A 382 ? 0.69207 1.14237 0.85737 -0.33783 0.05770  0.02730  382 LYS A CA  
2659 C C   . LYS A 382 ? 0.60152 1.13155 0.81958 -0.31462 0.05725  0.01512  382 LYS A C   
2660 O O   . LYS A 382 ? 0.53817 1.07205 0.75984 -0.27561 0.05784  0.01084  382 LYS A O   
2661 C CB  . LYS A 382 ? 0.70833 1.17023 0.86473 -0.35709 0.08209  0.03807  382 LYS A CB  
2662 C CG  . LYS A 382 ? 0.78850 1.28762 0.95839 -0.32469 0.09945  0.03560  382 LYS A CG  
2663 C CD  . LYS A 382 ? 0.70575 1.29087 0.91672 -0.33930 0.12078  0.03339  382 LYS A CD  
2664 C CE  . LYS A 382 ? 0.67426 1.24946 0.86226 -0.38092 0.13824  0.04679  382 LYS A CE  
2665 N NZ  . LYS A 382 ? 0.69607 1.35407 0.92589 -0.39115 0.15690  0.04230  382 LYS A NZ  
2666 N N   . ASP A 383 ? 0.60428 1.19751 0.86343 -0.33810 0.05500  0.00934  383 ASP A N   
2667 C CA  . ASP A 383 ? 0.67247 1.35149 0.98552 -0.31748 0.05697  -0.00180 383 ASP A CA  
2668 C C   . ASP A 383 ? 0.76179 1.45347 1.09337 -0.30200 0.03159  -0.01282 383 ASP A C   
2669 O O   . ASP A 383 ? 0.74136 1.46557 1.09465 -0.26507 0.02779  -0.02020 383 ASP A O   
2670 C CB  . ASP A 383 ? 0.66452 1.42291 1.01975 -0.35011 0.07270  -0.00270 383 ASP A CB  
2671 C CG  . ASP A 383 ? 0.78388 1.53738 1.12051 -0.36490 0.09992  0.00813  383 ASP A CG  
2672 O OD1 . ASP A 383 ? 0.82191 1.53585 1.13019 -0.40267 0.10410  0.01883  383 ASP A OD1 
2673 O OD2 . ASP A 383 ? 0.83162 1.60807 1.17440 -0.33395 0.11502  0.00577  383 ASP A OD2 
2674 N N   . ASP A 384 ? 0.82826 1.49337 1.14942 -0.32933 0.01343  -0.01428 384 ASP A N   
2675 C CA  . ASP A 384 ? 0.78408 1.46294 1.12028 -0.31851 -0.01192 -0.02546 384 ASP A CA  
2676 C C   . ASP A 384 ? 0.75306 1.34495 1.03873 -0.31164 -0.03003 -0.02482 384 ASP A C   
2677 O O   . ASP A 384 ? 0.77370 1.29626 1.01626 -0.32347 -0.02562 -0.01640 384 ASP A O   
2678 C CB  . ASP A 384 ? 0.73439 1.47248 1.11031 -0.35636 -0.02047 -0.03216 384 ASP A CB  
2679 C CG  . ASP A 384 ? 0.69613 1.52933 1.12664 -0.36156 -0.00178 -0.03457 384 ASP A CG  
2680 O OD1 . ASP A 384 ? 0.64628 1.52005 1.09948 -0.32190 0.00326  -0.03941 384 ASP A OD1 
2681 O OD2 . ASP A 384 ? 0.77271 1.61878 1.21218 -0.39537 0.00793  -0.03106 384 ASP A OD2 
2682 N N   . ALA A 385 ? 0.71431 1.31176 1.00470 -0.28986 -0.05067 -0.03425 385 ALA A N   
2683 C CA  . ALA A 385 ? 0.65063 1.17401 0.89498 -0.27635 -0.06669 -0.03575 385 ALA A CA  
2684 C C   . ALA A 385 ? 0.68374 1.17018 0.90843 -0.31365 -0.08301 -0.03936 385 ALA A C   
2685 O O   . ALA A 385 ? 0.76331 1.29121 1.01685 -0.34854 -0.08692 -0.04268 385 ALA A O   
2686 C CB  . ALA A 385 ? 0.55022 1.09201 0.80202 -0.23953 -0.08171 -0.04362 385 ALA A CB  
2687 N N   . THR A 386 ? 0.64092 1.04854 0.81615 -0.30628 -0.09257 -0.03944 386 THR A N   
2688 C CA  . THR A 386 ? 0.76030 1.11705 0.90714 -0.33689 -0.10965 -0.04404 386 THR A CA  
2689 C C   . THR A 386 ? 0.71516 1.05405 0.84540 -0.31834 -0.13394 -0.05694 386 THR A C   
2690 O O   . THR A 386 ? 0.65191 0.95857 0.75584 -0.28259 -0.13434 -0.05748 386 THR A O   
2691 C CB  . THR A 386 ? 0.80819 1.08197 0.90592 -0.34339 -0.10225 -0.03504 386 THR A CB  
2692 O OG1 . THR A 386 ? 0.82882 1.11644 0.93736 -0.37042 -0.08291 -0.02311 386 THR A OG1 
2693 C CG2 . THR A 386 ? 0.85216 1.05903 0.91125 -0.36407 -0.12371 -0.04235 386 THR A CG2 
2694 N N   . ALA A 387 ? 0.69429 1.05555 0.83926 -0.34363 -0.15390 -0.06749 387 ALA A N   
2695 C CA  . ALA A 387 ? 0.82255 1.15436 0.94127 -0.33179 -0.17917 -0.08076 387 ALA A CA  
2696 C C   . ALA A 387 ? 0.86022 1.09671 0.92103 -0.33996 -0.18609 -0.08250 387 ALA A C   
2697 O O   . ALA A 387 ? 0.85138 1.05837 0.89993 -0.37616 -0.19938 -0.08772 387 ALA A O   
2698 C CB  . ALA A 387 ? 0.76304 1.14832 0.91496 -0.35705 -0.20089 -0.09302 387 ALA A CB  
2699 N N   . LEU A 388 ? 0.85118 1.03937 0.87678 -0.30628 -0.17768 -0.07877 388 LEU A N   
2700 C CA  . LEU A 388 ? 0.94749 1.04719 0.91971 -0.30742 -0.18149 -0.07998 388 LEU A CA  
2701 C C   . LEU A 388 ? 1.11407 1.17555 1.05197 -0.29852 -0.20564 -0.09663 388 LEU A C   
2702 O O   . LEU A 388 ? 1.20007 1.27276 1.13085 -0.26400 -0.20828 -0.10179 388 LEU A O   
2703 C CB  . LEU A 388 ? 0.97230 1.04524 0.92627 -0.27379 -0.16251 -0.07047 388 LEU A CB  
2704 C CG  . LEU A 388 ? 0.97546 0.96615 0.88274 -0.27274 -0.16037 -0.06756 388 LEU A CG  
2705 C CD1 . LEU A 388 ? 0.95385 0.91856 0.85671 -0.31469 -0.15921 -0.05997 388 LEU A CD1 
2706 C CD2 . LEU A 388 ? 0.76858 0.75855 0.67394 -0.24004 -0.14084 -0.05804 388 LEU A CD2 
2707 N N   . PRO A 389 ? 1.10666 1.11869 1.01870 -0.32883 -0.22353 -0.10543 389 PRO A N   
2708 C CA  . PRO A 389 ? 1.11152 1.08495 0.98738 -0.32021 -0.24781 -0.12372 389 PRO A CA  
2709 C C   . PRO A 389 ? 1.11902 1.03610 0.94855 -0.27957 -0.24364 -0.12727 389 PRO A C   
2710 O O   . PRO A 389 ? 1.17136 1.07713 0.99797 -0.26050 -0.22340 -0.11545 389 PRO A O   
2711 C CB  . PRO A 389 ? 1.01908 0.94190 0.87534 -0.36434 -0.26458 -0.13005 389 PRO A CB  
2712 C CG  . PRO A 389 ? 1.04748 1.00162 0.93961 -0.39991 -0.24944 -0.11446 389 PRO A CG  
2713 C CD  . PRO A 389 ? 1.04273 1.02480 0.95172 -0.37186 -0.22190 -0.09863 389 PRO A CD  
2714 N N   . ARG A 390 ? 1.17973 1.06313 0.97281 -0.26568 -0.26236 -0.14429 390 ARG A N   
2715 C CA  . ARG A 390 ? 1.23744 1.07961 0.99160 -0.22475 -0.25512 -0.14790 390 ARG A CA  
2716 C C   . ARG A 390 ? 1.33207 1.09358 1.04674 -0.22612 -0.25348 -0.14849 390 ARG A C   
2717 O O   . ARG A 390 ? 1.41548 1.15733 1.11581 -0.19586 -0.23812 -0.14352 390 ARG A O   
2718 C CB  . ARG A 390 ? 1.21017 1.04540 0.93480 -0.20460 -0.27261 -0.16588 390 ARG A CB  
2719 C CG  . ARG A 390 ? 1.27547 1.11033 0.98121 -0.15890 -0.25740 -0.16455 390 ARG A CG  
2720 C CD  . ARG A 390 ? 1.42755 1.18846 1.07785 -0.13996 -0.26208 -0.17855 390 ARG A CD  
2721 N NE  . ARG A 390 ? 1.44715 1.20731 1.08526 -0.10036 -0.24190 -0.17446 390 ARG A NE  
2722 C CZ  . ARG A 390 ? 1.50020 1.21758 1.09340 -0.07351 -0.24376 -0.18875 390 ARG A CZ  
2723 N NH1 . ARG A 390 ? 1.58727 1.25469 1.14023 -0.08034 -0.26603 -0.20879 390 ARG A NH1 
2724 N NH2 . ARG A 390 ? 1.31277 1.03871 0.90161 -0.04033 -0.22342 -0.18405 390 ARG A NH2 
2725 N N   . ASP A 391 ? 1.30630 1.02012 1.00326 -0.26077 -0.26977 -0.15426 391 ASP A N   
2726 C CA  . ASP A 391 ? 1.31222 0.94261 0.96786 -0.26096 -0.27035 -0.15405 391 ASP A CA  
2727 C C   . ASP A 391 ? 1.27532 0.91289 0.95022 -0.26395 -0.24792 -0.13258 391 ASP A C   
2728 O O   . ASP A 391 ? 1.27885 0.86872 0.92641 -0.24112 -0.24042 -0.12949 391 ASP A O   
2729 C CB  . ASP A 391 ? 1.47514 1.04732 1.10456 -0.30035 -0.29430 -0.16425 391 ASP A CB  
2730 C CG  . ASP A 391 ? 1.48644 1.09458 1.15506 -0.35070 -0.29329 -0.15170 391 ASP A CG  
2731 O OD1 . ASP A 391 ? 1.37340 1.06318 1.09312 -0.35330 -0.27746 -0.13947 391 ASP A OD1 
2732 O OD2 . ASP A 391 ? 1.52024 1.07404 1.16753 -0.38795 -0.30827 -0.15461 391 ASP A OD2 
2733 N N   . LYS A 392 ? 1.23622 0.93588 0.95810 -0.28982 -0.23722 -0.11856 392 LYS A N   
2734 C CA  . LYS A 392 ? 1.23829 0.94863 0.97699 -0.29227 -0.21537 -0.09881 392 LYS A CA  
2735 C C   . LYS A 392 ? 1.15433 0.91023 0.91341 -0.25235 -0.19546 -0.09215 392 LYS A C   
2736 O O   . LYS A 392 ? 1.21061 0.95983 0.97126 -0.24382 -0.17911 -0.07901 392 LYS A O   
2737 C CB  . LYS A 392 ? 1.19983 0.95813 0.97851 -0.33616 -0.20995 -0.08731 392 LYS A CB  
2738 C CG  . LYS A 392 ? 1.27559 0.98122 1.03188 -0.38126 -0.22744 -0.09077 392 LYS A CG  
2739 C CD  . LYS A 392 ? 1.30506 1.03640 1.08827 -0.42576 -0.21551 -0.07395 392 LYS A CD  
2740 C CE  . LYS A 392 ? 1.47237 1.11283 1.21001 -0.45894 -0.22412 -0.06831 392 LYS A CE  
2741 N NZ  . LYS A 392 ? 1.59273 1.21759 1.32366 -0.46388 -0.20289 -0.04645 392 LYS A NZ  
2742 N N   . TYR A 393 ? 1.02903 0.82848 0.80139 -0.22888 -0.19733 -0.10053 393 TYR A N   
2743 C CA  . TYR A 393 ? 0.90226 0.72460 0.68020 -0.18859 -0.18114 -0.09654 393 TYR A CA  
2744 C C   . TYR A 393 ? 0.99359 0.75090 0.72816 -0.16192 -0.18129 -0.10249 393 TYR A C   
2745 O O   . TYR A 393 ? 1.06629 0.82352 0.80343 -0.14041 -0.16544 -0.09396 393 TYR A O   
2746 C CB  . TYR A 393 ? 0.85671 0.72953 0.64936 -0.17037 -0.18500 -0.10381 393 TYR A CB  
2747 C CG  . TYR A 393 ? 0.89912 0.77990 0.68435 -0.12911 -0.17154 -0.10265 393 TYR A CG  
2748 C CD1 . TYR A 393 ? 0.86111 0.78880 0.67865 -0.11586 -0.15225 -0.08911 393 TYR A CD1 
2749 C CD2 . TYR A 393 ? 0.90928 0.75041 0.65456 -0.10436 -0.17754 -0.11563 393 TYR A CD2 
2750 C CE1 . TYR A 393 ? 0.84439 0.77824 0.65596 -0.08237 -0.13958 -0.08718 393 TYR A CE1 
2751 C CE2 . TYR A 393 ? 0.92294 0.77590 0.66357 -0.06975 -0.16309 -0.11384 393 TYR A CE2 
2752 C CZ  . TYR A 393 ? 0.92348 0.82231 0.69798 -0.06066 -0.14440 -0.09897 393 TYR A CZ  
2753 O OH  . TYR A 393 ? 0.92006 0.83026 0.69138 -0.03074 -0.12991 -0.09628 393 TYR A OH  
2754 N N   . LEU A 394 ? 1.14492 0.84640 0.83964 -0.16289 -0.20007 -0.11828 394 LEU A N   
2755 C CA  . LEU A 394 ? 1.15158 0.79058 0.80452 -0.13548 -0.20163 -0.12642 394 LEU A CA  
2756 C C   . LEU A 394 ? 1.21961 0.80879 0.85890 -0.14648 -0.19896 -0.11604 394 LEU A C   
2757 O O   . LEU A 394 ? 1.18052 0.74766 0.80710 -0.11889 -0.19023 -0.11370 394 LEU A O   
2758 C CB  . LEU A 394 ? 1.13071 0.72069 0.74192 -0.13282 -0.22353 -0.14798 394 LEU A CB  
2759 C CG  . LEU A 394 ? 1.22036 0.84455 0.82861 -0.11301 -0.22775 -0.16117 394 LEU A CG  
2760 C CD1 . LEU A 394 ? 1.12334 0.72622 0.71163 -0.13585 -0.25312 -0.17737 394 LEU A CD1 
2761 C CD2 . LEU A 394 ? 1.25081 0.85279 0.82917 -0.07020 -0.22082 -0.17149 394 LEU A CD2 
2762 N N   . GLU A 395 ? 1.20506 0.77645 0.84590 -0.18722 -0.20693 -0.10959 395 GLU A N   
2763 C CA  . GLU A 395 ? 1.24487 0.76601 0.86843 -0.20192 -0.20483 -0.09717 395 GLU A CA  
2764 C C   . GLU A 395 ? 1.25570 0.81112 0.90258 -0.18430 -0.18273 -0.08101 395 GLU A C   
2765 O O   . GLU A 395 ? 1.32588 0.83682 0.94883 -0.16667 -0.18056 -0.07693 395 GLU A O   
2766 C CB  . GLU A 395 ? 1.31400 0.83288 0.94665 -0.25347 -0.21137 -0.08931 395 GLU A CB  
2767 C CG  . GLU A 395 ? 1.51058 0.95108 1.10631 -0.27557 -0.21788 -0.08064 395 GLU A CG  
2768 C CD  . GLU A 395 ? 1.68117 1.11409 1.28096 -0.33011 -0.22732 -0.07652 395 GLU A CD  
2769 O OE1 . GLU A 395 ? 1.68133 1.18537 1.32304 -0.34959 -0.22507 -0.07816 395 GLU A OE1 
2770 O OE2 . GLU A 395 ? 1.79469 1.15157 1.35639 -0.35389 -0.23723 -0.07135 395 GLU A OE2 
2771 N N   . ILE A 396 ? 1.17827 0.81219 0.87112 -0.18700 -0.16767 -0.07280 396 ILE A N   
2772 C CA  . ILE A 396 ? 1.08112 0.74907 0.79685 -0.17275 -0.14745 -0.05853 396 ILE A CA  
2773 C C   . ILE A 396 ? 1.11962 0.79295 0.83150 -0.12844 -0.14072 -0.06464 396 ILE A C   
2774 O O   . ILE A 396 ? 1.09840 0.75411 0.80255 -0.11065 -0.13320 -0.05850 396 ILE A O   
2775 C CB  . ILE A 396 ? 1.00706 0.75425 0.77172 -0.18919 -0.13445 -0.04938 396 ILE A CB  
2776 C CG1 . ILE A 396 ? 1.05992 0.80735 0.83187 -0.23469 -0.13721 -0.04156 396 ILE A CG1 
2777 C CG2 . ILE A 396 ? 0.95501 0.73631 0.74100 -0.17001 -0.11455 -0.03772 396 ILE A CG2 
2778 C CD1 . ILE A 396 ? 1.04671 0.87358 0.86648 -0.25206 -0.13147 -0.03999 396 ILE A CD1 
2779 N N   . MET A 397 ? 1.09944 0.80045 0.81735 -0.11097 -0.14302 -0.07634 397 MET A N   
2780 C CA  . MET A 397 ? 0.99421 0.70506 0.70939 -0.07174 -0.13462 -0.08187 397 MET A CA  
2781 C C   . MET A 397 ? 1.00543 0.65206 0.68217 -0.05132 -0.14171 -0.08996 397 MET A C   
2782 O O   . MET A 397 ? 1.02128 0.67034 0.70078 -0.02634 -0.13176 -0.08707 397 MET A O   
2783 C CB  . MET A 397 ? 0.95555 0.69480 0.67215 -0.05929 -0.13817 -0.09361 397 MET A CB  
2784 C CG  . MET A 397 ? 0.84018 0.64826 0.59552 -0.06547 -0.12951 -0.08595 397 MET A CG  
2785 S SD  . MET A 397 ? 0.80528 0.65743 0.59315 -0.04745 -0.10606 -0.07118 397 MET A SD  
2786 C CE  . MET A 397 ? 0.75635 0.62168 0.53513 -0.01061 -0.09839 -0.07877 397 MET A CE  
2787 N N   . ASN A 398 ? 1.08430 0.67292 0.72507 -0.06064 -0.16021 -0.10136 398 ASN A N   
2788 C CA  . ASN A 398 ? 1.20919 0.73401 0.81072 -0.03653 -0.16905 -0.11189 398 ASN A CA  
2789 C C   . ASN A 398 ? 1.28691 0.77697 0.88037 -0.03928 -0.16756 -0.09904 398 ASN A C   
2790 O O   . ASN A 398 ? 1.30419 0.75572 0.87469 -0.01108 -0.17104 -0.10483 398 ASN A O   
2791 C CB  . ASN A 398 ? 1.30229 0.76659 0.86370 -0.04695 -0.19105 -0.12792 398 ASN A CB  
2792 C CG  . ASN A 398 ? 1.36008 0.83974 0.91176 -0.02595 -0.19446 -0.14662 398 ASN A CG  
2793 O OD1 . ASN A 398 ? 1.30144 0.78679 0.84571 0.01087  -0.18716 -0.15572 398 ASN A OD1 
2794 N ND2 . ASN A 398 ? 1.50517 0.99312 1.05604 -0.04958 -0.20575 -0.15291 398 ASN A ND2 
2795 N N   . ASN A 399 ? 1.30135 0.80633 0.91266 -0.07143 -0.16246 -0.08203 399 ASN A N   
2796 C CA  . ASN A 399 ? 1.34202 0.81755 0.94374 -0.07472 -0.15968 -0.06780 399 ASN A CA  
2797 C C   . ASN A 399 ? 1.13958 0.66600 0.77125 -0.05049 -0.14183 -0.06009 399 ASN A C   
2798 O O   . ASN A 399 ? 1.09140 0.59313 0.70916 -0.02361 -0.14291 -0.06125 399 ASN A O   
2799 C CB  . ASN A 399 ? 1.41685 0.88877 1.02268 -0.12013 -0.15963 -0.05283 399 ASN A CB  
2800 C CG  . ASN A 399 ? 1.38162 0.83732 0.98123 -0.12538 -0.15265 -0.03546 399 ASN A CG  
2801 O OD1 . ASN A 399 ? 1.57101 0.97739 1.14156 -0.10260 -0.15910 -0.03576 399 ASN A OD1 
2802 N ND2 . ASN A 399 ? 1.22666 0.72510 0.85268 -0.15377 -0.13974 -0.02075 399 ASN A ND2 
2803 N N   . ILE A 400 ? 1.02887 0.62648 0.70201 -0.05880 -0.12670 -0.05336 400 ILE A N   
2804 C CA  . ILE A 400 ? 0.90140 0.54797 0.60429 -0.03994 -0.11002 -0.04610 400 ILE A CA  
2805 C C   . ILE A 400 ? 0.91822 0.56111 0.61530 -0.00054 -0.10934 -0.05713 400 ILE A C   
2806 O O   . ILE A 400 ? 0.91458 0.56579 0.61958 0.01722  -0.10278 -0.05250 400 ILE A O   
2807 C CB  . ILE A 400 ? 0.85423 0.57224 0.59799 -0.04931 -0.09709 -0.04222 400 ILE A CB  
2808 C CG1 . ILE A 400 ? 0.84750 0.58022 0.60398 -0.08611 -0.09488 -0.03096 400 ILE A CG1 
2809 C CG2 . ILE A 400 ? 0.81300 0.57618 0.58432 -0.02752 -0.08144 -0.03755 400 ILE A CG2 
2810 C CD1 . ILE A 400 ? 0.77603 0.57863 0.57306 -0.09197 -0.08382 -0.02821 400 ILE A CD1 
2811 N N   . PHE A 401 ? 0.87950 0.51313 0.56326 0.01355  -0.11594 -0.07268 401 PHE A N   
2812 C CA  . PHE A 401 ? 1.03150 0.66936 0.71140 0.05065  -0.11307 -0.08501 401 PHE A CA  
2813 C C   . PHE A 401 ? 1.24391 0.81464 0.88140 0.06663  -0.12989 -0.09933 401 PHE A C   
2814 O O   . PHE A 401 ? 1.25913 0.83030 0.88694 0.09412  -0.13014 -0.11504 401 PHE A O   
2815 C CB  . PHE A 401 ? 0.81851 0.50562 0.51587 0.05919  -0.10384 -0.09201 401 PHE A CB  
2816 C CG  . PHE A 401 ? 0.83495 0.58164 0.57024 0.04478  -0.08984 -0.07894 401 PHE A CG  
2817 C CD1 . PHE A 401 ? 0.81645 0.58091 0.56029 0.01997  -0.09270 -0.07572 401 PHE A CD1 
2818 C CD2 . PHE A 401 ? 0.88061 0.66509 0.64346 0.05648  -0.07515 -0.07068 401 PHE A CD2 
2819 C CE1 . PHE A 401 ? 0.82744 0.64581 0.60578 0.01030  -0.08088 -0.06480 401 PHE A CE1 
2820 C CE2 . PHE A 401 ? 0.86326 0.69701 0.65815 0.04483  -0.06332 -0.05965 401 PHE A CE2 
2821 C CZ  . PHE A 401 ? 0.83365 0.68386 0.63583 0.02315  -0.06612 -0.05678 401 PHE A CZ  
2822 N N   . GLY A 402 ? 1.27405 0.78527 0.88394 0.04950  -0.14366 -0.09401 402 GLY A N   
2823 C CA  . GLY A 402 ? 1.24234 0.67876 0.80731 0.06409  -0.16213 -0.10659 402 GLY A CA  
2824 C C   . GLY A 402 ? 1.18355 0.61383 0.74374 0.10679  -0.16179 -0.11566 402 GLY A C   
2825 O O   . GLY A 402 ? 1.30415 0.68974 0.83302 0.13075  -0.17401 -0.13295 402 GLY A O   
2826 N N   . LYS A 403 ? 1.15292 0.62985 0.74479 0.11777  -0.14844 -0.10595 403 LYS A N   
2827 C CA  . LYS A 403 ? 1.34296 0.82364 0.93740 0.15708  -0.14821 -0.11414 403 LYS A CA  
2828 C C   . LYS A 403 ? 1.36406 0.90385 0.98402 0.18324  -0.13378 -0.12762 403 LYS A C   
2829 O O   . LYS A 403 ? 1.36297 0.90754 0.98411 0.21815  -0.13403 -0.13926 403 LYS A O   
2830 C CB  . LYS A 403 ? 1.36992 0.86787 0.98318 0.15487  -0.14356 -0.09776 403 LYS A CB  
2831 C CG  . LYS A 403 ? 1.48683 0.93061 1.07325 0.12565  -0.15452 -0.08174 403 LYS A CG  
2832 C CD  . LYS A 403 ? 1.45619 0.94453 1.07179 0.10085  -0.14070 -0.06261 403 LYS A CD  
2833 C CE  . LYS A 403 ? 1.51371 1.03653 1.15200 0.12566  -0.13491 -0.06041 403 LYS A CE  
2834 N NZ  . LYS A 403 ? 1.48693 1.05355 1.15249 0.10529  -0.12151 -0.04428 403 LYS A NZ  
2835 N N   . ALA A 404 ? 1.27647 0.86097 0.91540 0.16779  -0.12159 -0.12646 404 ALA A N   
2836 C CA  . ALA A 404 ? 1.10373 0.73316 0.75572 0.19008  -0.10897 -0.13927 404 ALA A CA  
2837 C C   . ALA A 404 ? 1.08999 0.67570 0.70285 0.20583  -0.12078 -0.15992 404 ALA A C   
2838 O O   . ALA A 404 ? 1.19527 0.72160 0.77478 0.19044  -0.13807 -0.16264 404 ALA A O   
2839 C CB  . ALA A 404 ? 1.01054 0.69629 0.69029 0.16923  -0.09379 -0.12984 404 ALA A CB  
2840 N N   . THR A 405 ? 1.06129 0.67632 0.67721 0.23605  -0.11101 -0.17517 405 THR A N   
2841 C CA  . THR A 405 ? 1.19456 0.77342 0.77198 0.25323  -0.12013 -0.19700 405 THR A CA  
2842 C C   . THR A 405 ? 1.25506 0.82499 0.81668 0.22485  -0.12498 -0.19642 405 THR A C   
2843 O O   . THR A 405 ? 1.20347 0.81033 0.79005 0.19733  -0.11711 -0.18038 405 THR A O   
2844 C CB  . THR A 405 ? 1.19631 0.82154 0.78296 0.28759  -0.10387 -0.21228 405 THR A CB  
2845 O OG1 . THR A 405 ? 1.27593 0.95616 0.87979 0.27408  -0.08665 -0.20635 405 THR A OG1 
2846 C CG2 . THR A 405 ? 1.09422 0.75635 0.71421 0.30965  -0.09409 -0.20912 405 THR A CG2 
2847 N N   . GLN A 406 ? 1.38245 0.90324 0.90182 0.23318  -0.13932 -0.21558 406 GLN A N   
2848 C CA  . GLN A 406 ? 1.42874 0.94286 0.93314 0.20663  -0.14639 -0.21682 406 GLN A CA  
2849 C C   . GLN A 406 ? 1.30567 0.88398 0.82491 0.21201  -0.12845 -0.21805 406 GLN A C   
2850 O O   . GLN A 406 ? 1.27902 0.87723 0.80488 0.18620  -0.12929 -0.21000 406 GLN A O   
2851 C CB  . GLN A 406 ? 1.63881 1.07810 1.09130 0.21074  -0.16907 -0.23743 406 GLN A CB  
2852 C CG  . GLN A 406 ? 1.79600 1.21461 1.23770 0.17073  -0.18350 -0.23302 406 GLN A CG  
2853 C CD  . GLN A 406 ? 1.93316 1.28099 1.32270 0.17237  -0.20631 -0.25535 406 GLN A CD  
2854 O OE1 . GLN A 406 ? 1.84475 1.18324 1.20687 0.20380  -0.20617 -0.27713 406 GLN A OE1 
2855 N NE2 . GLN A 406 ? 2.08372 1.38091 1.45825 0.13752  -0.22580 -0.25069 406 GLN A NE2 
2856 N N   . ALA A 407 ? 1.21149 0.82457 0.73683 0.24466  -0.11198 -0.22708 407 ALA A N   
2857 C CA  . ALA A 407 ? 1.11215 0.78845 0.65326 0.24720  -0.09180 -0.22342 407 ALA A CA  
2858 C C   . ALA A 407 ? 1.08537 0.81221 0.67142 0.22366  -0.07900 -0.19812 407 ALA A C   
2859 O O   . ALA A 407 ? 1.17552 0.94042 0.76987 0.21299  -0.06953 -0.19038 407 ALA A O   
2860 C CB  . ALA A 407 ? 1.02349 0.73024 0.56524 0.28440  -0.07437 -0.23689 407 ALA A CB  
2861 N N   . GLU A 408 ? 1.06801 0.79319 0.68020 0.21629  -0.07954 -0.18531 408 GLU A N   
2862 C CA  . GLU A 408 ? 1.02371 0.78921 0.67408 0.19249  -0.07010 -0.16299 408 GLU A CA  
2863 C C   . GLU A 408 ? 1.07936 0.82477 0.72534 0.15949  -0.08412 -0.15449 408 GLU A C   
2864 O O   . GLU A 408 ? 1.07369 0.85584 0.73942 0.14207  -0.07780 -0.14247 408 GLU A O   
2865 C CB  . GLU A 408 ? 1.10255 0.87455 0.78003 0.19616  -0.06606 -0.15322 408 GLU A CB  
2866 C CG  . GLU A 408 ? 1.17624 0.99113 0.87582 0.22149  -0.04852 -0.15615 408 GLU A CG  
2867 C CD  . GLU A 408 ? 1.09504 0.90293 0.81165 0.23039  -0.05169 -0.15243 408 GLU A CD  
2868 O OE1 . GLU A 408 ? 1.00234 0.78363 0.70267 0.25630  -0.05939 -0.16707 408 GLU A OE1 
2869 O OE2 . GLU A 408 ? 0.97541 0.80367 0.71990 0.21303  -0.04742 -0.13564 408 GLU A OE2 
2870 N N   . ARG A 409 ? 1.10511 0.79272 0.72646 0.15042  -0.10332 -0.16025 409 ARG A N   
2871 C CA  . ARG A 409 ? 1.14799 0.81753 0.76650 0.11624  -0.11678 -0.15315 409 ARG A CA  
2872 C C   . ARG A 409 ? 1.15316 0.84104 0.76237 0.10805  -0.12004 -0.15910 409 ARG A C   
2873 O O   . ARG A 409 ? 1.14311 0.86421 0.77493 0.08563  -0.11858 -0.14716 409 ARG A O   
2874 C CB  . ARG A 409 ? 1.27282 0.86961 0.85814 0.10884  -0.13741 -0.16085 409 ARG A CB  
2875 C CG  . ARG A 409 ? 1.31419 0.89477 0.91272 0.08357  -0.14115 -0.14386 409 ARG A CG  
2876 C CD  . ARG A 409 ? 1.36297 0.86362 0.92232 0.08063  -0.16083 -0.15080 409 ARG A CD  
2877 N NE  . ARG A 409 ? 1.34658 0.81878 0.88664 0.11850  -0.16224 -0.16292 409 ARG A NE  
2878 C CZ  . ARG A 409 ? 1.50216 0.91528 1.00020 0.13587  -0.17770 -0.18221 409 ARG A CZ  
2879 N NH1 . ARG A 409 ? 1.63818 1.01094 1.10709 0.11633  -0.19384 -0.19153 409 ARG A NH1 
2880 N NH2 . ARG A 409 ? 1.55920 0.95419 1.04485 0.17348  -0.17797 -0.19338 409 ARG A NH2 
2881 N N   . GLU A 410 ? 1.10589 0.77351 0.68072 0.12827  -0.12493 -0.17840 410 GLU A N   
2882 C CA  . GLU A 410 ? 1.19970 0.88369 0.75980 0.12405  -0.12884 -0.18527 410 GLU A CA  
2883 C C   . GLU A 410 ? 1.13359 0.88317 0.72317 0.12630  -0.10964 -0.17125 410 GLU A C   
2884 O O   . GLU A 410 ? 1.23385 1.00695 0.82953 0.11005  -0.11400 -0.16545 410 GLU A O   
2885 C CB  . GLU A 410 ? 1.14335 0.79650 0.65870 0.15036  -0.13409 -0.20926 410 GLU A CB  
2886 C CG  . GLU A 410 ? 1.23392 0.81274 0.71122 0.15023  -0.15629 -0.22647 410 GLU A CG  
2887 C CD  . GLU A 410 ? 1.48229 1.03408 0.91483 0.18259  -0.15900 -0.25246 410 GLU A CD  
2888 O OE1 . GLU A 410 ? 1.49979 1.08950 0.93677 0.21074  -0.13905 -0.25576 410 GLU A OE1 
2889 O OE2 . GLU A 410 ? 1.53838 1.03193 0.93067 0.17918  -0.18059 -0.27019 410 GLU A OE2 
2890 N N   . ALA A 411 ? 0.95389 0.73280 0.56206 0.14610  -0.08941 -0.16568 411 ALA A N   
2891 C CA  . ALA A 411 ? 0.83242 0.66739 0.46623 0.14683  -0.07103 -0.15137 411 ALA A CA  
2892 C C   . ALA A 411 ? 0.89687 0.75515 0.56718 0.12185  -0.07098 -0.13191 411 ALA A C   
2893 O O   . ALA A 411 ? 0.94016 0.83041 0.62153 0.11324  -0.06796 -0.12239 411 ALA A O   
2894 C CB  . ALA A 411 ? 0.81216 0.67283 0.45958 0.17028  -0.04989 -0.15047 411 ALA A CB  
2895 N N   . ILE A 412 ? 0.84669 0.68864 0.53379 0.11161  -0.07444 -0.12606 412 ILE A N   
2896 C CA  . ILE A 412 ? 0.80620 0.67067 0.52651 0.08893  -0.07308 -0.10908 412 ILE A CA  
2897 C C   . ILE A 412 ? 0.83354 0.69491 0.54991 0.06527  -0.08884 -0.10938 412 ILE A C   
2898 O O   . ILE A 412 ? 0.82499 0.72359 0.56324 0.05506  -0.08605 -0.09927 412 ILE A O   
2899 C CB  . ILE A 412 ? 0.80596 0.64973 0.53794 0.08395  -0.07348 -0.10365 412 ILE A CB  
2900 C CG1 . ILE A 412 ? 0.80146 0.66226 0.54719 0.10630  -0.05776 -0.10166 412 ILE A CG1 
2901 C CG2 . ILE A 412 ? 0.72931 0.59090 0.48905 0.05806  -0.07380 -0.08861 412 ILE A CG2 
2902 C CD1 . ILE A 412 ? 0.78996 0.61847 0.53240 0.11169  -0.06252 -0.10294 412 ILE A CD1 
2903 N N   . ILE A 413 ? 0.79689 0.61359 0.48559 0.05663  -0.10670 -0.12176 413 ILE A N   
2904 C CA  . ILE A 413 ? 0.94755 0.76161 0.63266 0.03206  -0.12380 -0.12448 413 ILE A CA  
2905 C C   . ILE A 413 ? 0.92893 0.77585 0.60977 0.03856  -0.12481 -0.12705 413 ILE A C   
2906 O O   . ILE A 413 ? 0.90953 0.78457 0.60804 0.02116  -0.13218 -0.12164 413 ILE A O   
2907 C CB  . ILE A 413 ? 0.96609 0.71946 0.61506 0.02407  -0.14348 -0.14002 413 ILE A CB  
2908 C CG1 . ILE A 413 ? 0.90355 0.62304 0.55693 0.01073  -0.14510 -0.13317 413 ILE A CG1 
2909 C CG2 . ILE A 413 ? 0.91019 0.66272 0.55059 0.00118  -0.16312 -0.14747 413 ILE A CG2 
2910 C CD1 . ILE A 413 ? 0.98863 0.63833 0.60171 0.00633  -0.16379 -0.14750 413 ILE A CD1 
2911 N N   . PHE A 414 ? 0.88940 0.73477 0.54593 0.06433  -0.11754 -0.13532 414 PHE A N   
2912 C CA  . PHE A 414 ? 0.96131 0.83535 0.60865 0.07084  -0.11790 -0.13558 414 PHE A CA  
2913 C C   . PHE A 414 ? 0.92147 0.84451 0.60328 0.07146  -0.10257 -0.11642 414 PHE A C   
2914 O O   . PHE A 414 ? 0.97640 0.92569 0.66301 0.06639  -0.10855 -0.11139 414 PHE A O   
2915 C CB  . PHE A 414 ? 0.89450 0.75436 0.50233 0.09723  -0.11248 -0.14930 414 PHE A CB  
2916 C CG  . PHE A 414 ? 0.87467 0.75515 0.46241 0.10262  -0.11600 -0.15059 414 PHE A CG  
2917 C CD1 . PHE A 414 ? 0.91245 0.77921 0.47913 0.09055  -0.13935 -0.16147 414 PHE A CD1 
2918 C CD2 . PHE A 414 ? 0.85216 0.76543 0.44199 0.11784  -0.09698 -0.13975 414 PHE A CD2 
2919 C CE1 . PHE A 414 ? 1.00327 0.88864 0.54865 0.09671  -0.14485 -0.16232 414 PHE A CE1 
2920 C CE2 . PHE A 414 ? 0.86992 0.79842 0.43689 0.12282  -0.10088 -0.13876 414 PHE A CE2 
2921 C CZ  . PHE A 414 ? 0.97070 0.88558 0.51450 0.11359  -0.12545 -0.15023 414 PHE A CZ  
2922 N N   . GLN A 415 ? 0.79293 0.72688 0.49804 0.07808  -0.08469 -0.10619 415 GLN A N   
2923 C CA  . GLN A 415 ? 0.74471 0.71915 0.47965 0.07919  -0.07043 -0.08906 415 GLN A CA  
2924 C C   . GLN A 415 ? 0.88805 0.88305 0.65430 0.05819  -0.07830 -0.07947 415 GLN A C   
2925 O O   . GLN A 415 ? 0.96805 0.99515 0.75240 0.05890  -0.07377 -0.06830 415 GLN A O   
2926 C CB  . GLN A 415 ? 0.69435 0.67372 0.44590 0.09009  -0.05130 -0.08279 415 GLN A CB  
2927 C CG  . GLN A 415 ? 0.63535 0.64975 0.41912 0.08878  -0.03712 -0.06556 415 GLN A CG  
2928 C CD  . GLN A 415 ? 0.72921 0.76335 0.50175 0.10073  -0.02719 -0.05984 415 GLN A CD  
2929 O OE1 . GLN A 415 ? 0.78009 0.80499 0.52042 0.11163  -0.02799 -0.06869 415 GLN A OE1 
2930 N NE2 . GLN A 415 ? 0.67403 0.73260 0.46968 0.09880  -0.01779 -0.04491 415 GLN A NE2 
2931 N N   . TYR A 416 ? 0.95138 0.92817 0.72307 0.03956  -0.09009 -0.08383 416 TYR A N   
2932 C CA  . TYR A 416 ? 0.89685 0.89781 0.70076 0.01833  -0.09509 -0.07554 416 TYR A CA  
2933 C C   . TYR A 416 ? 0.99038 0.98867 0.78764 -0.00028 -0.11635 -0.08452 416 TYR A C   
2934 O O   . TYR A 416 ? 1.16651 1.17768 0.98783 -0.02285 -0.12214 -0.08121 416 TYR A O   
2935 C CB  . TYR A 416 ? 0.71144 0.70105 0.53292 0.00766  -0.08786 -0.06957 416 TYR A CB  
2936 C CG  . TYR A 416 ? 0.66163 0.66741 0.49973 0.02266  -0.06869 -0.05924 416 TYR A CG  
2937 C CD1 . TYR A 416 ? 0.72034 0.76232 0.59064 0.01897  -0.06022 -0.04718 416 TYR A CD1 
2938 C CD2 . TYR A 416 ? 0.67729 0.66438 0.49974 0.04132  -0.05954 -0.06278 416 TYR A CD2 
2939 C CE1 . TYR A 416 ? 0.65213 0.70599 0.53655 0.03116  -0.04399 -0.03859 416 TYR A CE1 
2940 C CE2 . TYR A 416 ? 0.74389 0.74884 0.58424 0.05259  -0.04296 -0.05391 416 TYR A CE2 
2941 C CZ  . TYR A 416 ? 0.64855 0.68442 0.51860 0.04640  -0.03580 -0.04175 416 TYR A CZ  
2942 O OH  . TYR A 416 ? 0.64203 0.69206 0.52818 0.05593  -0.02092 -0.03400 416 TYR A OH  
2943 N N   . THR A 417 ? 0.95841 0.94218 0.72341 0.00779  -0.12795 -0.09638 417 THR A N   
2944 C CA  . THR A 417 ? 0.84535 0.83092 0.60475 -0.00963 -0.15031 -0.10586 417 THR A CA  
2945 C C   . THR A 417 ? 0.88556 0.92170 0.66940 -0.00922 -0.15409 -0.09810 417 THR A C   
2946 O O   . THR A 417 ? 0.87564 0.92610 0.64912 0.01158  -0.14819 -0.09354 417 THR A O   
2947 C CB  . THR A 417 ? 0.88361 0.83248 0.59567 0.00016  -0.16290 -0.12312 417 THR A CB  
2948 O OG1 . THR A 417 ? 1.02382 0.92259 0.71642 -0.00622 -0.16644 -0.13260 417 THR A OG1 
2949 C CG2 . THR A 417 ? 0.85296 0.81413 0.55867 -0.01300 -0.18678 -0.13242 417 THR A CG2 
2950 N N   . SER A 418 ? 0.99455 1.05823 0.81096 -0.03180 -0.16329 -0.09597 418 SER A N   
2951 C CA  . SER A 418 ? 1.07604 1.18827 0.91533 -0.02990 -0.17149 -0.09181 418 SER A CA  
2952 C C   . SER A 418 ? 1.06537 1.17275 0.87618 -0.02858 -0.19450 -0.10505 418 SER A C   
2953 O O   . SER A 418 ? 1.12179 1.19497 0.90717 -0.04096 -0.20820 -0.11911 418 SER A O   
2954 C CB  . SER A 418 ? 1.17250 1.32304 1.05832 -0.05389 -0.17426 -0.08760 418 SER A CB  
2955 O OG  . SER A 418 ? 1.24301 1.44259 1.15784 -0.04159 -0.17169 -0.07864 418 SER A OG  
2956 N N   . TRP A 419 ? 1.03635 1.17424 0.84787 -0.01262 -0.19997 -0.10083 419 TRP A N   
2957 C CA  . TRP A 419 ? 1.24202 1.38664 1.03427 -0.01413 -0.22576 -0.11273 419 TRP A CA  
2958 C C   . TRP A 419 ? 1.38014 1.58138 1.21108 -0.01816 -0.23950 -0.10886 419 TRP A C   
2959 O O   . TRP A 419 ? 1.44626 1.66364 1.28378 -0.03464 -0.26337 -0.12063 419 TRP A O   
2960 C CB  . TRP A 419 ? 1.22779 1.34943 0.96900 0.01251  -0.22549 -0.11469 419 TRP A CB  
2961 C CG  . TRP A 419 ? 1.21505 1.28355 0.90958 0.01444  -0.22519 -0.12889 419 TRP A CG  
2962 C CD1 . TRP A 419 ? 1.24342 1.28647 0.90419 0.00683  -0.24761 -0.14794 419 TRP A CD1 
2963 C CD2 . TRP A 419 ? 1.08638 1.12185 0.76300 0.02676  -0.20236 -0.12667 419 TRP A CD2 
2964 N NE1 . TRP A 419 ? 1.22943 1.22323 0.85106 0.01534  -0.23932 -0.15795 419 TRP A NE1 
2965 C CE2 . TRP A 419 ? 1.08207 1.07312 0.71433 0.02820  -0.21162 -0.14514 419 TRP A CE2 
2966 C CE3 . TRP A 419 ? 0.99924 1.03957 0.69367 0.03722  -0.17614 -0.11207 419 TRP A CE3 
2967 C CZ2 . TRP A 419 ? 0.98382 0.93880 0.59156 0.04192  -0.19492 -0.14941 419 TRP A CZ2 
2968 C CZ3 . TRP A 419 ? 1.05458 1.06132 0.72642 0.04850  -0.16024 -0.11588 419 TRP A CZ3 
2969 C CH2 . TRP A 419 ? 1.09945 1.06559 0.72930 0.05189  -0.16942 -0.13443 419 TRP A CH2 
2970 N N   . GLU A 420 ? 1.41149 1.64351 1.26958 -0.00371 -0.22586 -0.09380 420 GLU A N   
2971 C CA  . GLU A 420 ? 1.37241 1.65970 1.26875 -0.00115 -0.23722 -0.08976 420 GLU A CA  
2972 C C   . GLU A 420 ? 1.32414 1.64402 1.27382 -0.01634 -0.22391 -0.08362 420 GLU A C   
2973 O O   . GLU A 420 ? 1.07757 1.37406 1.03066 -0.02942 -0.20705 -0.08150 420 GLU A O   
2974 C CB  . GLU A 420 ? 1.35281 1.64537 1.23301 0.03048  -0.23358 -0.07771 420 GLU A CB  
2975 C CG  . GLU A 420 ? 1.43031 1.68477 1.25004 0.04700  -0.23933 -0.08065 420 GLU A CG  
2976 C CD  . GLU A 420 ? 1.47131 1.72632 1.26902 0.03852  -0.26919 -0.09750 420 GLU A CD  
2977 O OE1 . GLU A 420 ? 1.50826 1.74374 1.30031 0.01699  -0.27579 -0.11155 420 GLU A OE1 
2978 O OE2 . GLU A 420 ? 1.41355 1.68579 1.19715 0.05372  -0.28764 -0.09686 420 GLU A OE2 
2979 N N   . GLY A 421 ? 1.56905 1.94421 1.55902 -0.01313 -0.23234 -0.08137 421 GLY A N   
2980 C CA  . GLY A 421 ? 1.67884 2.09169 1.71900 -0.02219 -0.21796 -0.07540 421 GLY A CA  
2981 C C   . GLY A 421 ? 1.72012 2.15620 1.79281 -0.05797 -0.22204 -0.08379 421 GLY A C   
2982 O O   . GLY A 421 ? 1.76246 2.21076 1.86319 -0.07019 -0.20362 -0.07817 421 GLY A O   
2983 N N   . ASN A 422 ? 1.64895 2.09099 1.71708 -0.07653 -0.24599 -0.09703 422 ASN A N   
2984 C CA  . ASN A 422 ? 1.57025 2.03027 1.66509 -0.11565 -0.25306 -0.10580 422 ASN A CA  
2985 C C   . ASN A 422 ? 1.50496 1.90521 1.57387 -0.13540 -0.23808 -0.10413 422 ASN A C   
2986 O O   . ASN A 422 ? 1.46112 1.84831 1.53420 -0.13062 -0.21385 -0.09299 422 ASN A O   
2987 C CB  . ASN A 422 ? 1.46334 1.99670 1.62177 -0.12584 -0.24658 -0.10275 422 ASN A CB  
2988 C CG  . ASN A 422 ? 1.37188 1.96532 1.56677 -0.14570 -0.27247 -0.11567 422 ASN A CG  
2989 O OD1 . ASN A 422 ? 1.29252 1.87766 1.46514 -0.14385 -0.29823 -0.12615 422 ASN A OD1 
2990 N ND2 . ASN A 422 ? 1.31153 1.96846 1.56300 -0.16474 -0.26540 -0.11557 422 ASN A ND2 
2991 N N   . PRO A 423 ? 1.43616 1.79700 1.47644 -0.15688 -0.25348 -0.11561 423 PRO A N   
2992 C CA  . PRO A 423 ? 1.36028 1.65582 1.36908 -0.17083 -0.24208 -0.11462 423 PRO A CA  
2993 C C   . PRO A 423 ? 1.24636 1.55649 1.28847 -0.19838 -0.22529 -0.10625 423 PRO A C   
2994 O O   . PRO A 423 ? 1.25183 1.62539 1.34293 -0.21038 -0.22225 -0.10311 423 PRO A O   
2995 C CB  . PRO A 423 ? 1.37828 1.63652 1.35499 -0.19038 -0.26725 -0.13117 423 PRO A CB  
2996 C CG  . PRO A 423 ? 1.38041 1.68126 1.36464 -0.18049 -0.29133 -0.14051 423 PRO A CG  
2997 C CD  . PRO A 423 ? 1.39346 1.76929 1.43164 -0.17149 -0.28393 -0.13105 423 PRO A CD  
2998 N N   . GLY A 424 ? 1.07548 1.32594 1.08872 -0.20722 -0.21407 -0.10276 424 GLY A N   
2999 C CA  . GLY A 424 ? 1.08687 1.34072 1.12148 -0.23696 -0.20027 -0.09471 424 GLY A CA  
3000 C C   . GLY A 424 ? 0.98433 1.26997 1.04575 -0.22155 -0.17473 -0.08045 424 GLY A C   
3001 O O   . GLY A 424 ? 0.85455 1.09903 0.89550 -0.21493 -0.15831 -0.07209 424 GLY A O   
3002 N N   . TYR A 425 ? 0.91191 1.27001 1.01845 -0.21453 -0.17234 -0.07860 425 TYR A N   
3003 C CA  . TYR A 425 ? 0.82073 1.20411 0.94663 -0.19166 -0.15014 -0.06734 425 TYR A CA  
3004 C C   . TYR A 425 ? 0.83553 1.17249 0.92455 -0.15717 -0.14331 -0.06323 425 TYR A C   
3005 O O   . TYR A 425 ? 0.87170 1.18721 0.95331 -0.14802 -0.12429 -0.05415 425 TYR A O   
3006 C CB  . TYR A 425 ? 0.66984 1.13095 0.84220 -0.17899 -0.15300 -0.06872 425 TYR A CB  
3007 C CG  . TYR A 425 ? 0.68070 1.20348 0.89948 -0.21090 -0.15639 -0.07290 425 TYR A CG  
3008 C CD1 . TYR A 425 ? 0.57579 1.08601 0.79675 -0.24944 -0.14808 -0.07017 425 TYR A CD1 
3009 C CD2 . TYR A 425 ? 0.74182 1.33704 1.00248 -0.20256 -0.16821 -0.07936 425 TYR A CD2 
3010 C CE1 . TYR A 425 ? 0.58169 1.15282 0.84695 -0.28201 -0.14937 -0.07355 425 TYR A CE1 
3011 C CE2 . TYR A 425 ? 0.69309 1.35325 1.00135 -0.23208 -0.17092 -0.08442 425 TYR A CE2 
3012 C CZ  . TYR A 425 ? 0.68898 1.33852 1.00033 -0.27307 -0.16024 -0.08131 425 TYR A CZ  
3013 O OH  . TYR A 425 ? 0.70538 1.42401 1.06600 -0.30529 -0.16098 -0.08582 425 TYR A OH  
3014 N N   . GLN A 426 ? 0.82510 1.14612 0.88918 -0.13940 -0.15898 -0.07028 426 GLN A N   
3015 C CA  . GLN A 426 ? 0.74571 1.02875 0.77580 -0.10804 -0.15189 -0.06665 426 GLN A CA  
3016 C C   . GLN A 426 ? 0.72263 0.94198 0.71708 -0.11206 -0.14360 -0.06600 426 GLN A C   
3017 O O   . GLN A 426 ? 0.65942 0.85808 0.64192 -0.09236 -0.12781 -0.05881 426 GLN A O   
3018 C CB  . GLN A 426 ? 0.72928 1.01045 0.73712 -0.09164 -0.17079 -0.07469 426 GLN A CB  
3019 C CG  . GLN A 426 ? 0.83287 1.15032 0.85483 -0.06330 -0.16863 -0.06812 426 GLN A CG  
3020 C CD  . GLN A 426 ? 0.96972 1.27392 0.99005 -0.04344 -0.14497 -0.05574 426 GLN A CD  
3021 O OE1 . GLN A 426 ? 1.11115 1.37626 1.09753 -0.02692 -0.13805 -0.05324 426 GLN A OE1 
3022 N NE2 . GLN A 426 ? 0.86389 1.20277 0.92136 -0.04527 -0.13241 -0.04892 426 GLN A NE2 
3023 N N   . ASN A 427 ? 0.71562 0.90267 0.69294 -0.13724 -0.15525 -0.07391 427 ASN A N   
3024 C CA  . ASN A 427 ? 0.70246 0.82515 0.64390 -0.13935 -0.15029 -0.07434 427 ASN A CA  
3025 C C   . ASN A 427 ? 0.67339 0.79305 0.62783 -0.14380 -0.13001 -0.06194 427 ASN A C   
3026 O O   . ASN A 427 ? 0.68445 0.76955 0.61812 -0.12614 -0.11909 -0.05803 427 ASN A O   
3027 C CB  . ASN A 427 ? 0.83618 0.92285 0.75755 -0.16808 -0.16839 -0.08486 427 ASN A CB  
3028 C CG  . ASN A 427 ? 0.91702 0.97611 0.80329 -0.15621 -0.18694 -0.09930 427 ASN A CG  
3029 O OD1 . ASN A 427 ? 0.95057 1.00261 0.81733 -0.12493 -0.18262 -0.10036 427 ASN A OD1 
3030 N ND2 . ASN A 427 ? 0.79998 0.84157 0.67559 -0.18220 -0.20739 -0.11082 427 ASN A ND2 
3031 N N   . GLN A 428 ? 0.69679 0.85467 0.68546 -0.16753 -0.12486 -0.05628 428 GLN A N   
3032 C CA  . GLN A 428 ? 0.68757 0.84798 0.68782 -0.17073 -0.10488 -0.04438 428 GLN A CA  
3033 C C   . GLN A 428 ? 0.58678 0.76530 0.59584 -0.13782 -0.09029 -0.03814 428 GLN A C   
3034 O O   . GLN A 428 ? 0.64499 0.79851 0.64263 -0.12812 -0.07714 -0.03145 428 GLN A O   
3035 C CB  . GLN A 428 ? 0.78084 0.99050 0.81885 -0.20026 -0.10041 -0.04048 428 GLN A CB  
3036 C CG  . GLN A 428 ? 0.72287 0.94779 0.77610 -0.20244 -0.07835 -0.02863 428 GLN A CG  
3037 C CD  . GLN A 428 ? 0.71703 1.00182 0.81063 -0.22909 -0.07242 -0.02647 428 GLN A CD  
3038 O OE1 . GLN A 428 ? 0.76463 1.10452 0.89080 -0.22959 -0.08042 -0.03293 428 GLN A OE1 
3039 N NE2 . GLN A 428 ? 0.63446 0.91069 0.72572 -0.25125 -0.05860 -0.01756 428 GLN A NE2 
3040 N N   . GLN A 429 ? 0.62286 0.84174 0.65005 -0.12031 -0.09404 -0.04034 429 GLN A N   
3041 C CA  . GLN A 429 ? 0.60287 0.83440 0.63631 -0.09104 -0.08137 -0.03401 429 GLN A CA  
3042 C C   . GLN A 429 ? 0.65393 0.83732 0.65212 -0.07095 -0.07800 -0.03402 429 GLN A C   
3043 O O   . GLN A 429 ? 0.65579 0.83377 0.65461 -0.05551 -0.06371 -0.02730 429 GLN A O   
3044 C CB  . GLN A 429 ? 0.62477 0.90198 0.67895 -0.07627 -0.08918 -0.03603 429 GLN A CB  
3045 C CG  . GLN A 429 ? 0.62344 0.96018 0.72176 -0.08701 -0.08661 -0.03485 429 GLN A CG  
3046 C CD  . GLN A 429 ? 0.67701 1.02260 0.79084 -0.08557 -0.06562 -0.02660 429 GLN A CD  
3047 O OE1 . GLN A 429 ? 0.73308 1.06230 0.83754 -0.06373 -0.05493 -0.02119 429 GLN A OE1 
3048 N NE2 . GLN A 429 ? 0.56105 0.93240 0.69716 -0.11029 -0.05958 -0.02588 429 GLN A NE2 
3049 N N   . GLN A 430 ? 0.79761 0.94722 0.76540 -0.07113 -0.09098 -0.04266 430 GLN A N   
3050 C CA  . GLN A 430 ? 0.79250 0.90331 0.72846 -0.05006 -0.08716 -0.04459 430 GLN A CA  
3051 C C   . GLN A 430 ? 0.81744 0.88724 0.73791 -0.05403 -0.07984 -0.04291 430 GLN A C   
3052 O O   . GLN A 430 ? 0.82125 0.87769 0.73379 -0.03521 -0.06876 -0.03977 430 GLN A O   
3053 C CB  . GLN A 430 ? 0.88725 0.97799 0.79382 -0.04594 -0.10323 -0.05615 430 GLN A CB  
3054 C CG  . GLN A 430 ? 0.90610 1.03438 0.82221 -0.03761 -0.11203 -0.05718 430 GLN A CG  
3055 C CD  . GLN A 430 ? 0.92561 1.06051 0.83431 -0.00982 -0.10143 -0.05080 430 GLN A CD  
3056 O OE1 . GLN A 430 ? 0.81100 0.92031 0.70193 0.00352  -0.08967 -0.04919 430 GLN A OE1 
3057 N NE2 . GLN A 430 ? 1.11040 1.28036 1.03312 -0.00138 -0.10607 -0.04692 430 GLN A NE2 
3058 N N   . ILE A 431 ? 0.80853 0.85753 0.72398 -0.07876 -0.08659 -0.04461 431 ILE A N   
3059 C CA  . ILE A 431 ? 0.82842 0.83581 0.72682 -0.08195 -0.08110 -0.04127 431 ILE A CA  
3060 C C   . ILE A 431 ? 0.83527 0.86500 0.75549 -0.07657 -0.06386 -0.02986 431 ILE A C   
3061 O O   . ILE A 431 ? 0.80428 0.80910 0.71227 -0.06373 -0.05677 -0.02709 431 ILE A O   
3062 C CB  . ILE A 431 ? 0.79182 0.76961 0.67819 -0.11276 -0.09174 -0.04292 431 ILE A CB  
3063 C CG1 . ILE A 431 ? 0.74956 0.70484 0.61414 -0.11885 -0.11079 -0.05610 431 ILE A CG1 
3064 C CG2 . ILE A 431 ? 0.69682 0.62340 0.55858 -0.11312 -0.08814 -0.03846 431 ILE A CG2 
3065 C CD1 . ILE A 431 ? 0.81817 0.73865 0.66836 -0.15151 -0.12315 -0.05850 431 ILE A CD1 
3066 N N   . GLY A 432 ? 0.78759 0.86563 0.74043 -0.08506 -0.05781 -0.02441 432 GLY A N   
3067 C CA  . GLY A 432 ? 0.73888 0.83907 0.71086 -0.07692 -0.04187 -0.01565 432 GLY A CA  
3068 C C   . GLY A 432 ? 0.69608 0.79784 0.66667 -0.04825 -0.03484 -0.01499 432 GLY A C   
3069 O O   . GLY A 432 ? 0.68947 0.77885 0.65695 -0.03861 -0.02540 -0.01081 432 GLY A O   
3070 N N   . ARG A 433 ? 0.65137 0.76872 0.62341 -0.03552 -0.03981 -0.01875 433 ARG A N   
3071 C CA  . ARG A 433 ? 0.64496 0.76141 0.61229 -0.01141 -0.03266 -0.01719 433 ARG A CA  
3072 C C   . ARG A 433 ? 0.61331 0.69099 0.55599 -0.00217 -0.03082 -0.02047 433 ARG A C   
3073 O O   . ARG A 433 ? 0.68025 0.75650 0.62623 0.01071  -0.02035 -0.01682 433 ARG A O   
3074 C CB  . ARG A 433 ? 0.74556 0.87629 0.70840 -0.00133 -0.04018 -0.02038 433 ARG A CB  
3075 C CG  . ARG A 433 ? 0.81727 0.98952 0.80594 0.00133  -0.04038 -0.01590 433 ARG A CG  
3076 C CD  . ARG A 433 ? 1.03022 1.21216 1.00903 0.00638  -0.05427 -0.02054 433 ARG A CD  
3077 N NE  . ARG A 433 ? 1.12106 1.33042 1.11262 0.02147  -0.05350 -0.01472 433 ARG A NE  
3078 C CZ  . ARG A 433 ? 1.18724 1.38729 1.16701 0.03965  -0.04555 -0.00861 433 ARG A CZ  
3079 N NH1 . ARG A 433 ? 1.17025 1.34187 1.12979 0.04498  -0.03644 -0.00845 433 ARG A NH1 
3080 N NH2 . ARG A 433 ? 1.21910 1.43850 1.20755 0.05245  -0.04686 -0.00257 433 ARG A NH2 
3081 N N   . ALA A 434 ? 0.60253 0.64867 0.52106 -0.00823 -0.04180 -0.02836 434 ALA A N   
3082 C CA  . ALA A 434 ? 0.72448 0.73489 0.61924 0.00505  -0.04129 -0.03361 434 ALA A CA  
3083 C C   . ALA A 434 ? 0.62430 0.62203 0.52349 0.00446  -0.03428 -0.02797 434 ALA A C   
3084 O O   . ALA A 434 ? 0.61433 0.60909 0.51320 0.02151  -0.02683 -0.02789 434 ALA A O   
3085 C CB  . ALA A 434 ? 0.57243 0.54585 0.43776 -0.00100 -0.05624 -0.04446 434 ALA A CB  
3086 N N   . VAL A 435 ? 0.71199 0.70580 0.61617 -0.01591 -0.03624 -0.02287 435 VAL A N   
3087 C CA  . VAL A 435 ? 0.62144 0.60137 0.52501 -0.01805 -0.03076 -0.01656 435 VAL A CA  
3088 C C   . VAL A 435 ? 0.61963 0.63137 0.54655 -0.00592 -0.01749 -0.01083 435 VAL A C   
3089 O O   . VAL A 435 ? 0.58981 0.59220 0.51395 0.00855  -0.01344 -0.01086 435 VAL A O   
3090 C CB  . VAL A 435 ? 0.70168 0.67573 0.60466 -0.04526 -0.03339 -0.01088 435 VAL A CB  
3091 C CG1 . VAL A 435 ? 0.53533 0.50232 0.43780 -0.04770 -0.02566 -0.00245 435 VAL A CG1 
3092 C CG2 . VAL A 435 ? 0.69543 0.62451 0.56935 -0.05804 -0.04776 -0.01631 435 VAL A CG2 
3093 N N   . GLY A 436 ? 0.64521 0.69496 0.59584 -0.01106 -0.01180 -0.00687 436 GLY A N   
3094 C CA  . GLY A 436 ? 0.61922 0.69480 0.58962 0.00098  -0.00070 -0.00262 436 GLY A CA  
3095 C C   . GLY A 436 ? 0.57246 0.64439 0.53944 0.02086  0.00266  -0.00523 436 GLY A C   
3096 O O   . GLY A 436 ? 0.63317 0.70569 0.60610 0.02959  0.00934  -0.00336 436 GLY A O   
3097 N N   . ASP A 437 ? 0.63788 0.70736 0.59463 0.02726  -0.00184 -0.01003 437 ASP A N   
3098 C CA  . ASP A 437 ? 0.61900 0.69069 0.57257 0.04449  0.00399  -0.01185 437 ASP A CA  
3099 C C   . ASP A 437 ? 0.61294 0.66258 0.55532 0.05399  0.00420  -0.01690 437 ASP A C   
3100 O O   . ASP A 437 ? 0.61603 0.67510 0.56851 0.06419  0.01243  -0.01577 437 ASP A O   
3101 C CB  . ASP A 437 ? 0.66839 0.74191 0.60837 0.04881  -0.00082 -0.01598 437 ASP A CB  
3102 C CG  . ASP A 437 ? 0.78712 0.88680 0.73981 0.04634  -0.00068 -0.01031 437 ASP A CG  
3103 O OD1 . ASP A 437 ? 0.76414 0.88142 0.73767 0.04385  0.00497  -0.00372 437 ASP A OD1 
3104 O OD2 . ASP A 437 ? 0.84767 0.94902 0.78740 0.04878  -0.00722 -0.01329 437 ASP A OD2 
3105 N N   . HIS A 438 ? 0.60478 0.62460 0.52658 0.05108  -0.00585 -0.02305 438 HIS A N   
3106 C CA  . HIS A 438 ? 0.64029 0.63725 0.54991 0.06405  -0.00797 -0.02911 438 HIS A CA  
3107 C C   . HIS A 438 ? 0.66200 0.65743 0.58197 0.06321  -0.00566 -0.02384 438 HIS A C   
3108 O O   . HIS A 438 ? 0.63006 0.62689 0.55416 0.07774  -0.00316 -0.02695 438 HIS A O   
3109 C CB  . HIS A 438 ? 0.62552 0.58303 0.50634 0.06159  -0.02145 -0.03704 438 HIS A CB  
3110 C CG  . HIS A 438 ? 0.65291 0.58094 0.51875 0.07623  -0.02670 -0.04334 438 HIS A CG  
3111 N ND1 . HIS A 438 ? 0.75011 0.68979 0.62056 0.09853  -0.02090 -0.05007 438 HIS A ND1 
3112 C CD2 . HIS A 438 ? 0.73771 0.62549 0.58387 0.07253  -0.03767 -0.04373 438 HIS A CD2 
3113 C CE1 . HIS A 438 ? 0.75452 0.66492 0.61094 0.11055  -0.02919 -0.05574 438 HIS A CE1 
3114 N NE2 . HIS A 438 ? 0.72025 0.59514 0.55935 0.09546  -0.04007 -0.05137 438 HIS A NE2 
3115 N N   . PHE A 439 ? 0.59456 0.58968 0.51878 0.04665  -0.00652 -0.01655 439 PHE A N   
3116 C CA  . PHE A 439 ? 0.66423 0.64957 0.58857 0.04581  -0.00670 -0.01241 439 PHE A CA  
3117 C C   . PHE A 439 ? 0.61144 0.62731 0.55996 0.04794  0.00351  -0.00764 439 PHE A C   
3118 O O   . PHE A 439 ? 0.61989 0.63158 0.56978 0.05421  0.00308  -0.00727 439 PHE A O   
3119 C CB  . PHE A 439 ? 0.67890 0.64228 0.58848 0.02615  -0.01241 -0.00702 439 PHE A CB  
3120 C CG  . PHE A 439 ? 0.71228 0.63119 0.59203 0.02478  -0.02500 -0.01123 439 PHE A CG  
3121 C CD1 . PHE A 439 ? 0.72408 0.61193 0.58626 0.03909  -0.03230 -0.01410 439 PHE A CD1 
3122 C CD2 . PHE A 439 ? 0.71358 0.62043 0.58236 0.01075  -0.03124 -0.01351 439 PHE A CD2 
3123 C CE1 . PHE A 439 ? 0.60452 0.44506 0.43596 0.04026  -0.04534 -0.01859 439 PHE A CE1 
3124 C CE2 . PHE A 439 ? 0.76197 0.62174 0.60046 0.00907  -0.04406 -0.01828 439 PHE A CE2 
3125 C CZ  . PHE A 439 ? 0.69366 0.51756 0.51197 0.02457  -0.05104 -0.02065 439 PHE A CZ  
3126 N N   . PHE A 440 ? 0.59178 0.63572 0.55765 0.04414  0.01100  -0.00472 440 PHE A N   
3127 C CA  . PHE A 440 ? 0.53126 0.59805 0.51714 0.04577  0.01952  -0.00089 440 PHE A CA  
3128 C C   . PHE A 440 ? 0.56026 0.64794 0.56010 0.05397  0.02657  -0.00088 440 PHE A C   
3129 O O   . PHE A 440 ? 0.55170 0.64595 0.56024 0.06254  0.03090  -0.00223 440 PHE A O   
3130 C CB  . PHE A 440 ? 0.58795 0.66549 0.57978 0.03236  0.02214  0.00411  440 PHE A CB  
3131 C CG  . PHE A 440 ? 0.66732 0.72463 0.64295 0.02079  0.01762  0.00636  440 PHE A CG  
3132 C CD1 . PHE A 440 ? 0.61048 0.65999 0.58153 0.02193  0.01848  0.00824  440 PHE A CD1 
3133 C CD2 . PHE A 440 ? 0.63070 0.67525 0.59347 0.00730  0.01200  0.00706  440 PHE A CD2 
3134 C CE1 . PHE A 440 ? 0.62204 0.64997 0.57304 0.01062  0.01489  0.01224  440 PHE A CE1 
3135 C CE2 . PHE A 440 ? 0.67123 0.69363 0.61604 -0.00635 0.00876  0.01110  440 PHE A CE2 
3136 C CZ  . PHE A 440 ? 0.74185 0.75508 0.67918 -0.00427 0.01073  0.01446  440 PHE A CZ  
3137 N N   . THR A 441 ? 0.55537 0.65351 0.55657 0.05077  0.02718  0.00097  441 THR A N   
3138 C CA  . THR A 441 ? 0.46641 0.58108 0.47765 0.05706  0.03396  0.00397  441 THR A CA  
3139 C C   . THR A 441 ? 0.52916 0.64292 0.53678 0.06706  0.03818  0.00122  441 THR A C   
3140 O O   . THR A 441 ? 0.61548 0.73951 0.63499 0.07022  0.04587  0.00393  441 THR A O   
3141 C CB  . THR A 441 ? 0.53459 0.65826 0.54363 0.05426  0.03084  0.00605  441 THR A CB  
3142 O OG1 . THR A 441 ? 0.48598 0.61987 0.50520 0.04568  0.02920  0.00804  441 THR A OG1 
3143 C CG2 . THR A 441 ? 0.34776 0.48165 0.36045 0.06187  0.03662  0.01089  441 THR A CG2 
3144 N N   . CYS A 442 ? 0.49042 0.59220 0.48202 0.07171  0.03364  -0.00495 442 CYS A N   
3145 C CA  . CYS A 442 ? 0.59528 0.70225 0.58432 0.08274  0.03971  -0.00886 442 CYS A CA  
3146 C C   . CYS A 442 ? 0.64027 0.75043 0.64075 0.08918  0.04190  -0.01287 442 CYS A C   
3147 O O   . CYS A 442 ? 0.66027 0.78809 0.67222 0.09436  0.05102  -0.01320 442 CYS A O   
3148 C CB  . CYS A 442 ? 0.61843 0.71163 0.58430 0.08826  0.03390  -0.01628 442 CYS A CB  
3149 S SG  . CYS A 442 ? 0.59771 0.69483 0.55298 0.08246  0.03116  -0.01199 442 CYS A SG  
3150 N N   . PRO A 443 ? 0.62469 0.71951 0.62248 0.08850  0.03349  -0.01561 443 PRO A N   
3151 C CA  . PRO A 443 ? 0.50837 0.60948 0.51933 0.09504  0.03351  -0.01872 443 PRO A CA  
3152 C C   . PRO A 443 ? 0.39502 0.51556 0.42776 0.08869  0.04082  -0.01320 443 PRO A C   
3153 O O   . PRO A 443 ? 0.43300 0.57205 0.48203 0.09320  0.04635  -0.01560 443 PRO A O   
3154 C CB  . PRO A 443 ? 0.49598 0.57065 0.49254 0.09343  0.02161  -0.01994 443 PRO A CB  
3155 C CG  . PRO A 443 ? 0.58900 0.64215 0.56331 0.09083  0.01572  -0.02173 443 PRO A CG  
3156 C CD  . PRO A 443 ? 0.59726 0.66596 0.57590 0.08338  0.02253  -0.01728 443 PRO A CD  
3157 N N   . THR A 444 ? 0.36522 0.48332 0.39919 0.07827  0.04126  -0.00670 444 THR A N   
3158 C CA  . THR A 444 ? 0.37897 0.50986 0.42996 0.07314  0.04745  -0.00237 444 THR A CA  
3159 C C   . THR A 444 ? 0.51571 0.66108 0.57505 0.07403  0.05723  0.00045  444 THR A C   
3160 O O   . THR A 444 ? 0.53245 0.68974 0.60776 0.07228  0.06230  0.00052  444 THR A O   
3161 C CB  . THR A 444 ? 0.43119 0.55839 0.48022 0.06551  0.04715  0.00279  444 THR A CB  
3162 O OG1 . THR A 444 ? 0.53885 0.65486 0.57919 0.06159  0.04068  0.00160  444 THR A OG1 
3163 C CG2 . THR A 444 ? 0.31087 0.44568 0.37430 0.06272  0.05273  0.00593  444 THR A CG2 
3164 N N   . ASN A 445 ? 0.50093 0.64462 0.54804 0.07502  0.05962  0.00343  445 ASN A N   
3165 C CA  . ASN A 445 ? 0.53170 0.68583 0.57942 0.07564  0.06953  0.00764  445 ASN A CA  
3166 C C   . ASN A 445 ? 0.47354 0.64338 0.53102 0.08035  0.07580  0.00221  445 ASN A C   
3167 O O   . ASN A 445 ? 0.52825 0.71208 0.59962 0.07538  0.08501  0.00567  445 ASN A O   
3168 C CB  . ASN A 445 ? 0.65720 0.80572 0.68431 0.07865  0.06855  0.00948  445 ASN A CB  
3169 C CG  . ASN A 445 ? 0.61758 0.77072 0.63959 0.07702  0.07757  0.01813  445 ASN A CG  
3170 O OD1 . ASN A 445 ? 0.58179 0.74380 0.59823 0.07979  0.08638  0.01794  445 ASN A OD1 
3171 N ND2 . ASN A 445 ? 0.72354 0.87021 0.74618 0.07314  0.07582  0.02595  445 ASN A ND2 
3172 N N   . GLU A 446 ? 0.53345 0.70147 0.58429 0.08991  0.07068  -0.00678 446 GLU A N   
3173 C CA  . GLU A 446 ? 0.55033 0.73850 0.61272 0.09811  0.07628  -0.01409 446 GLU A CA  
3174 C C   . GLU A 446 ? 0.46769 0.67151 0.55678 0.09397  0.07633  -0.01531 446 GLU A C   
3175 O O   . GLU A 446 ? 0.44470 0.67430 0.55262 0.09139  0.08629  -0.01573 446 GLU A O   
3176 C CB  . GLU A 446 ? 0.58249 0.75973 0.63064 0.11232  0.06766  -0.02482 446 GLU A CB  
3177 C CG  . GLU A 446 ? 0.79277 0.99365 0.85384 0.12546  0.07233  -0.03478 446 GLU A CG  
3178 C CD  . GLU A 446 ? 1.15423 1.33800 1.19618 0.14267  0.06292  -0.04627 446 GLU A CD  
3179 O OE1 . GLU A 446 ? 1.29376 1.48273 1.32265 0.15203  0.06942  -0.05201 446 GLU A OE1 
3180 O OE2 . GLU A 446 ? 1.20878 1.37090 1.24559 0.14709  0.04877  -0.04955 446 GLU A OE2 
3181 N N   . TYR A 447 ? 0.53074 0.72029 0.62115 0.09169  0.06543  -0.01583 447 TYR A N   
3182 C CA  . TYR A 447 ? 0.56439 0.76671 0.67698 0.08817  0.06279  -0.01830 447 TYR A CA  
3183 C C   . TYR A 447 ? 0.51035 0.72046 0.63651 0.07402  0.07143  -0.01104 447 TYR A C   
3184 O O   . TYR A 447 ? 0.42127 0.65191 0.57013 0.06880  0.07464  -0.01340 447 TYR A O   
3185 C CB  . TYR A 447 ? 0.48766 0.66944 0.59147 0.08911  0.04943  -0.01990 447 TYR A CB  
3186 C CG  . TYR A 447 ? 0.59879 0.79233 0.71979 0.09122  0.04222  -0.02589 447 TYR A CG  
3187 C CD1 . TYR A 447 ? 0.70814 0.91950 0.84069 0.10379  0.03823  -0.03472 447 TYR A CD1 
3188 C CD2 . TYR A 447 ? 0.55871 0.74662 0.68405 0.08222  0.03827  -0.02405 447 TYR A CD2 
3189 C CE1 . TYR A 447 ? 0.76356 0.98847 0.91308 0.10684  0.02906  -0.04096 447 TYR A CE1 
3190 C CE2 . TYR A 447 ? 0.53424 0.73263 0.67334 0.08412  0.02950  -0.03048 447 TYR A CE2 
3191 C CZ  . TYR A 447 ? 0.66724 0.88495 0.81918 0.09611  0.02425  -0.03859 447 TYR A CZ  
3192 O OH  . TYR A 447 ? 0.79253 1.02393 0.95977 0.09915  0.01323  -0.04574 447 TYR A OH  
3193 N N   . ALA A 448 ? 0.45854 0.65176 0.57120 0.06773  0.07416  -0.00260 448 ALA A N   
3194 C CA  . ALA A 448 ? 0.38773 0.58049 0.50783 0.05612  0.08146  0.00497  448 ALA A CA  
3195 C C   . ALA A 448 ? 0.49730 0.70995 0.62648 0.05126  0.09454  0.00805  448 ALA A C   
3196 O O   . ALA A 448 ? 0.51270 0.73394 0.65842 0.03963  0.09985  0.01049  448 ALA A O   
3197 C CB  . ALA A 448 ? 0.41458 0.58633 0.51667 0.05499  0.08071  0.01278  448 ALA A CB  
3198 N N   . GLN A 449 ? 0.61262 0.83318 0.73041 0.05891  0.10030  0.00745  449 GLN A N   
3199 C CA  . GLN A 449 ? 0.60005 0.84300 0.72484 0.05381  0.11524  0.01047  449 GLN A CA  
3200 C C   . GLN A 449 ? 0.50587 0.78179 0.66073 0.05338  0.11756  0.00129  449 GLN A C   
3201 O O   . GLN A 449 ? 0.58131 0.87705 0.75453 0.03998  0.12818  0.00483  449 GLN A O   
3202 C CB  . GLN A 449 ? 0.58462 0.82868 0.68671 0.06371  0.12108  0.01043  449 GLN A CB  
3203 C CG  . GLN A 449 ? 0.59884 0.81882 0.67416 0.06078  0.12206  0.02170  449 GLN A CG  
3204 C CD  . GLN A 449 ? 0.65847 0.87734 0.70874 0.07202  0.12368  0.01881  449 GLN A CD  
3205 O OE1 . GLN A 449 ? 0.81813 1.05486 0.86347 0.07333  0.13672  0.01875  449 GLN A OE1 
3206 N NE2 . GLN A 449 ? 0.51444 0.71375 0.54853 0.07949  0.11070  0.01541  449 GLN A NE2 
3207 N N   . ALA A 450 ? 0.49847 0.78029 0.65876 0.06738  0.10679  -0.01032 450 ALA A N   
3208 C CA  . ALA A 450 ? 0.43007 0.74567 0.62061 0.07061  0.10560  -0.02057 450 ALA A CA  
3209 C C   . ALA A 450 ? 0.46837 0.78749 0.68118 0.05610  0.10032  -0.01980 450 ALA A C   
3210 O O   . ALA A 450 ? 0.48178 0.83529 0.72476 0.04937  0.10457  -0.02446 450 ALA A O   
3211 C CB  . ALA A 450 ? 0.41920 0.73149 0.60489 0.09116  0.09183  -0.03229 450 ALA A CB  
3212 N N   . LEU A 451 ? 0.41539 0.70166 0.61468 0.05093  0.09109  -0.01514 451 LEU A N   
3213 C CA  . LEU A 451 ? 0.52243 0.80839 0.73894 0.03773  0.08559  -0.01594 451 LEU A CA  
3214 C C   . LEU A 451 ? 0.58055 0.87173 0.80709 0.01786  0.09874  -0.00735 451 LEU A C   
3215 O O   . LEU A 451 ? 0.61817 0.92973 0.87105 0.00480  0.09920  -0.01074 451 LEU A O   
3216 C CB  . LEU A 451 ? 0.45873 0.70926 0.65599 0.03877  0.07416  -0.01428 451 LEU A CB  
3217 C CG  . LEU A 451 ? 0.43084 0.67308 0.61919 0.05245  0.05939  -0.02197 451 LEU A CG  
3218 C CD1 . LEU A 451 ? 0.35774 0.56721 0.52311 0.05145  0.05421  -0.01762 451 LEU A CD1 
3219 C CD2 . LEU A 451 ? 0.52116 0.78171 0.73115 0.05184  0.04926  -0.03136 451 LEU A CD2 
3220 N N   . ALA A 452 ? 0.56846 0.84037 0.77313 0.01456  0.10860  0.00410  452 ALA A N   
3221 C CA  . ALA A 452 ? 0.57632 0.84595 0.78377 -0.00461 0.12117  0.01474  452 ALA A CA  
3222 C C   . ALA A 452 ? 0.52460 0.83772 0.75693 -0.01309 0.13482  0.01274  452 ALA A C   
3223 O O   . ALA A 452 ? 0.58162 0.90510 0.83270 -0.03379 0.14118  0.01614  452 ALA A O   
3224 C CB  . ALA A 452 ? 0.58527 0.82606 0.76052 -0.00293 0.12764  0.02768  452 ALA A CB  
3225 N N   . GLU A 453 ? 0.51855 0.85869 0.75233 0.00234  0.13944  0.00620  453 GLU A N   
3226 C CA  . GLU A 453 ? 0.57613 0.96349 0.83393 -0.00372 0.15509  0.00349  453 GLU A CA  
3227 C C   . GLU A 453 ? 0.60977 1.03301 0.90976 -0.01250 0.14971  -0.00685 453 GLU A C   
3228 O O   . GLU A 453 ? 0.67688 1.13796 1.00329 -0.02891 0.16346  -0.00603 453 GLU A O   
3229 C CB  . GLU A 453 ? 0.65733 1.06530 0.90679 0.01888  0.15964  -0.00451 453 GLU A CB  
3230 C CG  . GLU A 453 ? 0.86909 1.24774 1.07723 0.02588  0.16605  0.00470  453 GLU A CG  
3231 C CD  . GLU A 453 ? 1.06253 1.45506 1.26158 0.01268  0.18855  0.01584  453 GLU A CD  
3232 O OE1 . GLU A 453 ? 1.10946 1.52311 1.33076 -0.00876 0.19990  0.02127  453 GLU A OE1 
3233 O OE2 . GLU A 453 ? 1.13423 1.51533 1.30164 0.02263  0.19467  0.01941  453 GLU A OE2 
3234 N N   . ARG A 454 ? 0.61851 1.03192 0.92515 -0.00340 0.12982  -0.01635 454 ARG A N   
3235 C CA  . ARG A 454 ? 0.60801 1.05616 0.95346 -0.00987 0.12146  -0.02746 454 ARG A CA  
3236 C C   . ARG A 454 ? 0.60568 1.02984 0.95581 -0.03178 0.11364  -0.02391 454 ARG A C   
3237 O O   . ARG A 454 ? 0.59221 1.03481 0.96837 -0.03591 0.10075  -0.03435 454 ARG A O   
3238 C CB  . ARG A 454 ? 0.66887 1.12710 1.01924 0.01583  0.10369  -0.04182 454 ARG A CB  
3239 C CG  . ARG A 454 ? 0.87329 1.37223 1.23496 0.03530  0.11169  -0.05026 454 ARG A CG  
3240 C CD  . ARG A 454 ? 0.98587 1.54518 1.39455 0.03934  0.10745  -0.06497 454 ARG A CD  
3241 N NE  . ARG A 454 ? 1.06342 1.67521 1.50721 0.01969  0.12731  -0.06407 454 ARG A NE  
3242 C CZ  . ARG A 454 ? 1.21979 1.88325 1.71050 0.01035  0.12364  -0.07399 454 ARG A CZ  
3243 N NH1 . ARG A 454 ? 1.26888 1.93483 1.77321 0.02134  0.09941  -0.08549 454 ARG A NH1 
3244 N NH2 . ARG A 454 ? 1.25497 1.96906 1.77870 -0.01049 0.14364  -0.07248 454 ARG A NH2 
3245 N N   . GLY A 455 ? 0.67519 1.05855 1.00011 -0.04534 0.12050  -0.01009 455 GLY A N   
3246 C CA  . GLY A 455 ? 0.75516 1.11479 1.08374 -0.06884 0.11703  -0.00580 455 GLY A CA  
3247 C C   . GLY A 455 ? 0.67933 0.98592 0.97969 -0.06294 0.10284  -0.00467 455 GLY A C   
3248 O O   . GLY A 455 ? 0.74188 1.01739 1.03557 -0.08004 0.10168  0.00071  455 GLY A O   
3249 N N   . ALA A 456 ? 0.55573 0.85065 0.83882 -0.03974 0.09239  -0.00987 456 ALA A N   
3250 C CA  . ALA A 456 ? 0.45504 0.70719 0.71371 -0.03348 0.08037  -0.01023 456 ALA A CA  
3251 C C   . ALA A 456 ? 0.54107 0.75428 0.77275 -0.03761 0.08816  0.00313  456 ALA A C   
3252 O O   . ALA A 456 ? 0.68330 0.89691 0.90230 -0.03392 0.09952  0.01259  456 ALA A O   
3253 C CB  . ALA A 456 ? 0.35718 0.60711 0.60130 -0.01034 0.07092  -0.01609 456 ALA A CB  
3254 N N   . SER A 457 ? 0.59011 0.76862 0.81123 -0.04359 0.08087  0.00306  457 SER A N   
3255 C CA  . SER A 457 ? 0.58748 0.72593 0.78205 -0.04331 0.08496  0.01433  457 SER A CA  
3256 C C   . SER A 457 ? 0.61500 0.74181 0.78851 -0.02148 0.07974  0.01315  457 SER A C   
3257 O O   . SER A 457 ? 0.67274 0.78648 0.84014 -0.01383 0.06940  0.00508  457 SER A O   
3258 C CB  . SER A 457 ? 0.58367 0.68812 0.77516 -0.05668 0.07865  0.01300  457 SER A CB  
3259 O OG  . SER A 457 ? 0.73985 0.80451 0.90406 -0.04494 0.07504  0.01683  457 SER A OG  
3260 N N   . VAL A 458 ? 0.52430 0.65798 0.68648 -0.01245 0.08718  0.02064  458 VAL A N   
3261 C CA  . VAL A 458 ? 0.48681 0.61628 0.63272 0.00532  0.08278  0.01945  458 VAL A CA  
3262 C C   . VAL A 458 ? 0.59630 0.69610 0.72079 0.01023  0.08344  0.02823  458 VAL A C   
3263 O O   . VAL A 458 ? 0.61283 0.70006 0.72866 0.00399  0.09050  0.03912  458 VAL A O   
3264 C CB  . VAL A 458 ? 0.50545 0.65977 0.65125 0.01318  0.08776  0.01989  458 VAL A CB  
3265 C CG1 . VAL A 458 ? 0.44205 0.58626 0.56792 0.02692  0.08427  0.02165  458 VAL A CG1 
3266 C CG2 . VAL A 458 ? 0.47708 0.65896 0.64192 0.01565  0.08303  0.00872  458 VAL A CG2 
3267 N N   . HIS A 459 ? 0.61175 0.70113 0.72706 0.02183  0.07601  0.02366  459 HIS A N   
3268 C CA  . HIS A 459 ? 0.54303 0.61282 0.64124 0.03131  0.07504  0.02980  459 HIS A CA  
3269 C C   . HIS A 459 ? 0.56958 0.65445 0.66271 0.04331  0.07219  0.02697  459 HIS A C   
3270 O O   . HIS A 459 ? 0.64107 0.73712 0.73927 0.04548  0.06809  0.01852  459 HIS A O   
3271 C CB  . HIS A 459 ? 0.47988 0.52347 0.57395 0.03326  0.06937  0.02577  459 HIS A CB  
3272 C CG  . HIS A 459 ? 0.51341 0.52842 0.60212 0.02338  0.07151  0.03327  459 HIS A CG  
3273 N ND1 . HIS A 459 ? 0.55422 0.56380 0.65415 0.00672  0.07185  0.03043  459 HIS A ND1 
3274 C CD2 . HIS A 459 ? 0.55442 0.54202 0.62609 0.02699  0.07233  0.04397  459 HIS A CD2 
3275 C CE1 . HIS A 459 ? 0.57395 0.55179 0.66338 -0.00180 0.07382  0.03959  459 HIS A CE1 
3276 N NE2 . HIS A 459 ? 0.60505 0.56678 0.67531 0.01140  0.07390  0.04841  459 HIS A NE2 
3277 N N   . TYR A 460 ? 0.61615 0.70025 0.69770 0.04969  0.07372  0.03443  460 TYR A N   
3278 C CA  . TYR A 460 ? 0.50799 0.60755 0.58518 0.05731  0.07106  0.03250  460 TYR A CA  
3279 C C   . TYR A 460 ? 0.48941 0.58324 0.55980 0.06760  0.06632  0.03385  460 TYR A C   
3280 O O   . TYR A 460 ? 0.64667 0.72370 0.70920 0.07170  0.06587  0.04051  460 TYR A O   
3281 C CB  . TYR A 460 ? 0.52320 0.63173 0.59308 0.05625  0.07564  0.03800  460 TYR A CB  
3282 C CG  . TYR A 460 ? 0.42019 0.54375 0.48770 0.06000  0.07253  0.03270  460 TYR A CG  
3283 C CD1 . TYR A 460 ? 0.35749 0.48354 0.41792 0.06591  0.06667  0.03220  460 TYR A CD1 
3284 C CD2 . TYR A 460 ? 0.43885 0.57366 0.51145 0.05765  0.07461  0.02767  460 TYR A CD2 
3285 C CE1 . TYR A 460 ? 0.37073 0.50540 0.42713 0.06639  0.06294  0.02742  460 TYR A CE1 
3286 C CE2 . TYR A 460 ? 0.38476 0.52551 0.45126 0.06166  0.07042  0.02270  460 TYR A CE2 
3287 C CZ  . TYR A 460 ? 0.43284 0.57110 0.49010 0.06458  0.06456  0.02291  460 TYR A CZ  
3288 O OH  . TYR A 460 ? 0.51135 0.65064 0.56074 0.06580  0.05951  0.01793  460 TYR A OH  
3289 N N   . TYR A 461 ? 0.40242 0.51039 0.47576 0.07176  0.06260  0.02772  461 TYR A N   
3290 C CA  . TYR A 461 ? 0.43465 0.54754 0.50712 0.08164  0.05855  0.02721  461 TYR A CA  
3291 C C   . TYR A 461 ? 0.44750 0.58010 0.51911 0.08111  0.05577  0.02638  461 TYR A C   
3292 O O   . TYR A 461 ? 0.41718 0.55496 0.48759 0.07398  0.05650  0.02420  461 TYR A O   
3293 C CB  . TYR A 461 ? 0.47007 0.58392 0.54916 0.08583  0.05791  0.01889  461 TYR A CB  
3294 C CG  . TYR A 461 ? 0.55848 0.68696 0.64093 0.07921  0.05883  0.01231  461 TYR A CG  
3295 C CD1 . TYR A 461 ? 0.52960 0.67809 0.61345 0.07828  0.05779  0.01114  461 TYR A CD1 
3296 C CD2 . TYR A 461 ? 0.53683 0.65779 0.61951 0.07259  0.05969  0.00805  461 TYR A CD2 
3297 C CE1 . TYR A 461 ? 0.53386 0.68920 0.61567 0.07032  0.05852  0.00744  461 TYR A CE1 
3298 C CE2 . TYR A 461 ? 0.54810 0.67744 0.62859 0.06749  0.05907  0.00371  461 TYR A CE2 
3299 C CZ  . TYR A 461 ? 0.50390 0.64786 0.58221 0.06611  0.05898  0.00419  461 TYR A CZ  
3300 O OH  . TYR A 461 ? 0.40121 0.54741 0.47277 0.05953  0.05823  0.00191  461 TYR A OH  
3301 N N   . TYR A 462 ? 0.53170 0.67459 0.60416 0.08917  0.05125  0.02729  462 TYR A N   
3302 C CA  . TYR A 462 ? 0.49918 0.66230 0.57284 0.08698  0.04689  0.02559  462 TYR A CA  
3303 C C   . TYR A 462 ? 0.43349 0.61734 0.51955 0.09383  0.04406  0.02123  462 TYR A C   
3304 O O   . TYR A 462 ? 0.54914 0.73239 0.63691 0.10667  0.04053  0.02307  462 TYR A O   
3305 C CB  . TYR A 462 ? 0.56026 0.72037 0.62168 0.08958  0.04263  0.03168  462 TYR A CB  
3306 C CG  . TYR A 462 ? 0.60622 0.78074 0.66485 0.08366  0.03730  0.02867  462 TYR A CG  
3307 C CD1 . TYR A 462 ? 0.49168 0.66563 0.54926 0.07313  0.03906  0.02409  462 TYR A CD1 
3308 C CD2 . TYR A 462 ? 0.66495 0.85030 0.71966 0.08894  0.02867  0.03019  462 TYR A CD2 
3309 C CE1 . TYR A 462 ? 0.55430 0.73432 0.60613 0.06674  0.03303  0.02104  462 TYR A CE1 
3310 C CE2 . TYR A 462 ? 0.54509 0.74097 0.59609 0.08175  0.02223  0.02629  462 TYR A CE2 
3311 C CZ  . TYR A 462 ? 0.65585 0.84708 0.70487 0.06999  0.02474  0.02168  462 TYR A CZ  
3312 O OH  . TYR A 462 ? 0.74982 0.94494 0.79230 0.06172  0.01723  0.01733  462 TYR A OH  
3313 N N   . PHE A 463 ? 0.38038 0.58267 0.47437 0.08575  0.04572  0.01566  463 PHE A N   
3314 C CA  . PHE A 463 ? 0.38143 0.60977 0.49024 0.09039  0.04662  0.01016  463 PHE A CA  
3315 C C   . PHE A 463 ? 0.41645 0.67281 0.53404 0.08724  0.04027  0.00964  463 PHE A C   
3316 O O   . PHE A 463 ? 0.48074 0.74074 0.59470 0.07260  0.03895  0.00966  463 PHE A O   
3317 C CB  . PHE A 463 ? 0.36384 0.59617 0.47393 0.08138  0.05412  0.00509  463 PHE A CB  
3318 C CG  . PHE A 463 ? 0.38269 0.64650 0.50749 0.08478  0.05829  -0.00119 463 PHE A CG  
3319 C CD1 . PHE A 463 ? 0.44843 0.71628 0.58029 0.10194  0.06003  -0.00608 463 PHE A CD1 
3320 C CD2 . PHE A 463 ? 0.40354 0.69269 0.53456 0.07067  0.06088  -0.00257 463 PHE A CD2 
3321 C CE1 . PHE A 463 ? 0.44042 0.74271 0.58745 0.10746  0.06530  -0.01361 463 PHE A CE1 
3322 C CE2 . PHE A 463 ? 0.45833 0.78315 0.60517 0.07235  0.06717  -0.00852 463 PHE A CE2 
3323 C CZ  . PHE A 463 ? 0.44543 0.77951 0.60131 0.09200  0.06986  -0.01468 463 PHE A CZ  
3324 N N   . THR A 464 ? 0.41567 0.69046 0.54430 0.10125  0.03478  0.00862  464 THR A N   
3325 C CA  . THR A 464 ? 0.56480 0.86693 0.70227 0.09866  0.02574  0.00789  464 THR A CA  
3326 C C   . THR A 464 ? 0.63921 0.98529 0.80275 0.10498  0.02524  0.00091  464 THR A C   
3327 O O   . THR A 464 ? 0.66653 1.04069 0.84224 0.10699  0.01550  -0.00069 464 THR A O   
3328 C CB  . THR A 464 ? 0.57407 0.86151 0.69839 0.10971  0.01518  0.01394  464 THR A CB  
3329 O OG1 . THR A 464 ? 0.66659 0.94186 0.78928 0.12993  0.01364  0.01635  464 THR A OG1 
3330 C CG2 . THR A 464 ? 0.33923 0.59326 0.44026 0.10133  0.01717  0.01958  464 THR A CG2 
3331 N N   . HIS A 465 ? 0.73898 1.09459 0.91180 0.10858  0.03530  -0.00430 465 HIS A N   
3332 C CA  . HIS A 465 ? 0.62275 1.02624 0.82232 0.11534  0.03755  -0.01241 465 HIS A CA  
3333 C C   . HIS A 465 ? 0.55900 0.99146 0.76878 0.09100  0.04547  -0.01499 465 HIS A C   
3334 O O   . HIS A 465 ? 0.60502 1.01824 0.80090 0.07733  0.05504  -0.01349 465 HIS A O   
3335 C CB  . HIS A 465 ? 0.49316 0.89465 0.69621 0.13459  0.04480  -0.01852 465 HIS A CB  
3336 C CG  . HIS A 465 ? 0.60807 1.06349 0.84028 0.14582  0.04732  -0.02834 465 HIS A CG  
3337 N ND1 . HIS A 465 ? 0.73213 1.21515 0.98246 0.16447  0.03544  -0.03101 465 HIS A ND1 
3338 C CD2 . HIS A 465 ? 0.70450 1.19606 0.95178 0.14056  0.06053  -0.03632 465 HIS A CD2 
3339 C CE1 . HIS A 465 ? 0.73280 1.26982 1.01203 0.17167  0.04118  -0.04139 465 HIS A CE1 
3340 N NE2 . HIS A 465 ? 0.71072 1.25439 0.98819 0.15660  0.05767  -0.04463 465 HIS A NE2 
3341 N N   . ARG A 466 ? 0.53601 1.01361 0.76897 0.08478  0.04050  -0.01840 466 ARG A N   
3342 C CA  . ARG A 466 ? 0.56468 1.07747 0.81194 0.06094  0.04928  -0.02113 466 ARG A CA  
3343 C C   . ARG A 466 ? 0.53270 1.09084 0.80446 0.07293  0.06058  -0.02989 466 ARG A C   
3344 O O   . ARG A 466 ? 0.38170 0.97843 0.67897 0.09188  0.05445  -0.03631 466 ARG A O   
3345 C CB  . ARG A 466 ? 0.30672 0.84753 0.56842 0.04447  0.03814  -0.02129 466 ARG A CB  
3346 C CG  . ARG A 466 ? 0.35902 0.94945 0.64459 0.02218  0.04776  -0.02531 466 ARG A CG  
3347 C CD  . ARG A 466 ? 0.38106 0.98620 0.67375 -0.00372 0.03794  -0.02442 466 ARG A CD  
3348 N NE  . ARG A 466 ? 0.43704 1.09437 0.75574 -0.02793 0.04837  -0.02773 466 ARG A NE  
3349 C CZ  . ARG A 466 ? 0.47634 1.12049 0.78250 -0.06175 0.05394  -0.02265 466 ARG A CZ  
3350 N NH1 . ARG A 466 ? 0.33994 0.92021 0.60841 -0.07237 0.04892  -0.01536 466 ARG A NH1 
3351 N NH2 . ARG A 466 ? 0.42541 1.12045 0.75645 -0.08480 0.06455  -0.02487 466 ARG A NH2 
3352 N N   . THR A 467 ? 0.56131 1.11445 0.82353 0.06415  0.07648  -0.03079 467 THR A N   
3353 C CA  . THR A 467 ? 0.52837 1.12229 0.80919 0.07721  0.08939  -0.04042 467 THR A CA  
3354 C C   . THR A 467 ? 0.41721 1.08289 0.73655 0.06986  0.09117  -0.04646 467 THR A C   
3355 O O   . THR A 467 ? 0.40782 1.08898 0.73370 0.04198  0.08901  -0.04203 467 THR A O   
3356 C CB  . THR A 467 ? 0.55679 1.13561 0.81696 0.06477  0.10647  -0.03993 467 THR A CB  
3357 O OG1 . THR A 467 ? 0.56840 1.08286 0.79437 0.06448  0.10258  -0.03338 467 THR A OG1 
3358 C CG2 . THR A 467 ? 0.59319 1.20040 0.86407 0.08688  0.11842  -0.05155 467 THR A CG2 
3359 N N   . SER A 468 ? 0.34682 1.05632 0.69248 0.09576  0.09405  -0.05750 468 SER A N   
3360 C CA  . SER A 468 ? 0.45551 1.23906 0.84347 0.09386  0.09336  -0.06499 468 SER A CA  
3361 C C   . SER A 468 ? 0.67453 1.48821 1.06860 0.05956  0.11031  -0.06382 468 SER A C   
3362 O O   . SER A 468 ? 0.75786 1.60973 1.17522 0.03831  0.10654  -0.06351 468 SER A O   
3363 C CB  . SER A 468 ? 0.53879 1.33348 0.93862 0.12886  0.09101  -0.07577 468 SER A CB  
3364 O OG  . SER A 468 ? 0.67318 1.44776 1.05434 0.13842  0.10686  -0.08036 468 SER A OG  
3365 N N   . THR A 469 ? 0.65385 1.44916 1.02521 0.05295  0.12843  -0.06285 469 THR A N   
3366 C CA  . THR A 469 ? 0.59518 1.41432 0.96662 0.02108  0.14548  -0.06010 469 THR A CA  
3367 C C   . THR A 469 ? 0.57246 1.37131 0.92588 -0.01650 0.14676  -0.04756 469 THR A C   
3368 O O   . THR A 469 ? 0.64473 1.45645 0.99397 -0.04695 0.15957  -0.04277 469 THR A O   
3369 C CB  . THR A 469 ? 0.60377 1.41264 0.95479 0.02996  0.16420  -0.06440 469 THR A CB  
3370 O OG1 . THR A 469 ? 0.64216 1.39824 0.95762 0.03475  0.16536  -0.05977 469 THR A OG1 
3371 C CG2 . THR A 469 ? 0.51506 1.34411 0.88329 0.06583  0.16335  -0.07795 469 THR A CG2 
3372 N N   . SER A 470 ? 0.52413 1.26546 0.85461 -0.01483 0.12997  -0.04039 470 SER A N   
3373 C CA  . SER A 470 ? 0.47562 1.17292 0.77855 -0.04721 0.12587  -0.02843 470 SER A CA  
3374 C C   . SER A 470 ? 0.61066 1.35349 0.93767 -0.08067 0.12725  -0.02688 470 SER A C   
3375 O O   . SER A 470 ? 0.67207 1.45512 1.03216 -0.07820 0.11517  -0.03240 470 SER A O   
3376 C CB  . SER A 470 ? 0.56162 1.20340 0.84550 -0.03759 0.10542  -0.02390 470 SER A CB  
3377 O OG  . SER A 470 ? 0.66229 1.25784 0.91670 -0.06480 0.10179  -0.01404 470 SER A OG  
3378 N N   . LEU A 471 ? 0.59864 1.33534 0.90833 -0.11291 0.14135  -0.01923 471 LEU A N   
3379 C CA  . LEU A 471 ? 0.69218 1.46318 1.02013 -0.15097 0.14251  -0.01593 471 LEU A CA  
3380 C C   . LEU A 471 ? 0.61723 1.32369 0.91175 -0.17754 0.12891  -0.00510 471 LEU A C   
3381 O O   . LEU A 471 ? 0.66229 1.38046 0.96102 -0.21463 0.13015  -0.00025 471 LEU A O   
3382 C CB  . LEU A 471 ? 0.79015 1.59682 1.12120 -0.17121 0.16651  -0.01429 471 LEU A CB  
3383 C CG  . LEU A 471 ? 0.76197 1.63208 1.13715 -0.15656 0.16748  -0.02626 471 LEU A CG  
3384 C CD1 . LEU A 471 ? 0.70869 1.60405 1.08304 -0.16816 0.18968  -0.02594 471 LEU A CD1 
3385 C CD2 . LEU A 471 ? 0.66841 1.57068 1.07758 -0.17163 0.14983  -0.02929 471 LEU A CD2 
3386 N N   . TRP A 472 ? 0.58290 1.22276 0.84554 -0.15930 0.11557  -0.00207 472 TRP A N   
3387 C CA  . TRP A 472 ? 0.52494 1.11218 0.76421 -0.17567 0.09809  0.00364  472 TRP A CA  
3388 C C   . TRP A 472 ? 0.50557 1.12715 0.77691 -0.17514 0.08095  -0.00384 472 TRP A C   
3389 O O   . TRP A 472 ? 0.54809 1.22522 0.85606 -0.15476 0.08009  -0.01275 472 TRP A O   
3390 C CB  . TRP A 472 ? 0.45195 0.96885 0.65381 -0.15333 0.08941  0.00698  472 TRP A CB  
3391 C CG  . TRP A 472 ? 0.52144 0.99609 0.68658 -0.16107 0.10063  0.01533  472 TRP A CG  
3392 C CD1 . TRP A 472 ? 0.50446 0.96628 0.65583 -0.13931 0.10997  0.01490  472 TRP A CD1 
3393 C CD2 . TRP A 472 ? 0.65708 1.09462 0.79168 -0.19328 0.10260  0.02552  472 TRP A CD2 
3394 N NE1 . TRP A 472 ? 0.62149 1.04341 0.73596 -0.15502 0.11706  0.02400  472 TRP A NE1 
3395 C CE2 . TRP A 472 ? 0.68916 1.09361 0.79149 -0.18753 0.11280  0.03141  472 TRP A CE2 
3396 C CE3 . TRP A 472 ? 0.75274 1.17813 0.88178 -0.22666 0.09535  0.03017  472 TRP A CE3 
3397 C CZ2 . TRP A 472 ? 0.76664 1.12598 0.83003 -0.21211 0.11572  0.04288  472 TRP A CZ2 
3398 C CZ3 . TRP A 472 ? 0.85292 1.22988 0.94283 -0.25236 0.09885  0.04167  472 TRP A CZ3 
3399 C CH2 . TRP A 472 ? 0.83804 1.18239 0.89492 -0.24410 0.10889  0.04847  472 TRP A CH2 
3400 N N   . GLY A 473 ? 0.57011 1.15809 0.82622 -0.19751 0.06618  -0.00089 473 GLY A N   
3401 C CA  . GLY A 473 ? 0.57516 1.19255 0.85737 -0.19927 0.04768  -0.00861 473 GLY A CA  
3402 C C   . GLY A 473 ? 0.51761 1.12748 0.80146 -0.15985 0.03459  -0.01419 473 GLY A C   
3403 O O   . GLY A 473 ? 0.47645 1.03518 0.73029 -0.13858 0.03465  -0.01056 473 GLY A O   
3404 N N   . GLU A 474 ? 0.58255 1.24565 0.90212 -0.15056 0.02300  -0.02279 474 GLU A N   
3405 C CA  . GLU A 474 ? 0.62393 1.28123 0.94350 -0.11310 0.01027  -0.02677 474 GLU A CA  
3406 C C   . GLU A 474 ? 0.55934 1.14718 0.83784 -0.10908 -0.00377 -0.02325 474 GLU A C   
3407 O O   . GLU A 474 ? 0.56921 1.12347 0.82806 -0.08135 -0.00478 -0.02096 474 GLU A O   
3408 C CB  . GLU A 474 ? 0.58018 1.30391 0.94170 -0.10508 -0.00346 -0.03628 474 GLU A CB  
3409 C CG  . GLU A 474 ? 0.70903 1.43124 1.07103 -0.06274 -0.01383 -0.03898 474 GLU A CG  
3410 C CD  . GLU A 474 ? 0.85113 1.60026 1.23032 -0.03513 0.00128  -0.04089 474 GLU A CD  
3411 O OE1 . GLU A 474 ? 0.87161 1.57750 1.22616 -0.00883 0.00320  -0.03701 474 GLU A OE1 
3412 O OE2 . GLU A 474 ? 0.86980 1.68363 1.28699 -0.03978 0.01126  -0.04704 474 GLU A OE2 
3413 N N   . TRP A 475 ? 0.53497 1.09959 0.79908 -0.13743 -0.01386 -0.02316 475 TRP A N   
3414 C CA  . TRP A 475 ? 0.51866 1.01874 0.74277 -0.13324 -0.02672 -0.02188 475 TRP A CA  
3415 C C   . TRP A 475 ? 0.48264 0.92535 0.67200 -0.12200 -0.01554 -0.01456 475 TRP A C   
3416 O O   . TRP A 475 ? 0.43627 0.83413 0.59723 -0.10720 -0.02331 -0.01425 475 TRP A O   
3417 C CB  . TRP A 475 ? 0.64793 1.12765 0.85970 -0.16730 -0.03819 -0.02397 475 TRP A CB  
3418 C CG  . TRP A 475 ? 0.61599 1.06890 0.81237 -0.19724 -0.02589 -0.01698 475 TRP A CG  
3419 C CD1 . TRP A 475 ? 0.62662 1.11870 0.84672 -0.22779 -0.01611 -0.01508 475 TRP A CD1 
3420 C CD2 . TRP A 475 ? 0.50169 0.88242 0.65374 -0.20012 -0.02298 -0.01056 475 TRP A CD2 
3421 N NE1 . TRP A 475 ? 0.62782 1.07188 0.81706 -0.25029 -0.00725 -0.00637 475 TRP A NE1 
3422 C CE2 . TRP A 475 ? 0.56368 0.93849 0.71115 -0.23241 -0.01247 -0.00384 475 TRP A CE2 
3423 C CE3 . TRP A 475 ? 0.58913 0.91222 0.70562 -0.17802 -0.02796 -0.00990 475 TRP A CE3 
3424 C CZ2 . TRP A 475 ? 0.62403 0.93255 0.72981 -0.24120 -0.00905 0.00393  475 TRP A CZ2 
3425 C CZ3 . TRP A 475 ? 0.65264 0.91574 0.73263 -0.18588 -0.02413 -0.00384 475 TRP A CZ3 
3426 C CH2 . TRP A 475 ? 0.63801 0.89219 0.71173 -0.21627 -0.01600 0.00313  475 TRP A CH2 
3427 N N   . MET A 476 ? 0.51195 0.95650 0.70215 -0.12938 0.00228  -0.00916 476 MET A N   
3428 C CA  . MET A 476 ? 0.53664 0.92976 0.69527 -0.11890 0.01110  -0.00294 476 MET A CA  
3429 C C   . MET A 476 ? 0.50905 0.90408 0.67085 -0.08484 0.01557  -0.00325 476 MET A C   
3430 O O   . MET A 476 ? 0.49438 0.85214 0.63415 -0.07468 0.02215  0.00081  476 MET A O   
3431 C CB  . MET A 476 ? 0.54721 0.93865 0.70054 -0.13885 0.02702  0.00317  476 MET A CB  
3432 C CG  . MET A 476 ? 0.63955 1.01662 0.78208 -0.17561 0.02380  0.00621  476 MET A CG  
3433 S SD  . MET A 476 ? 0.74803 1.12819 0.88246 -0.19985 0.04484  0.01557  476 MET A SD  
3434 C CE  . MET A 476 ? 0.61345 0.92891 0.70666 -0.17704 0.04790  0.02122  476 MET A CE  
3435 N N   . GLY A 477 ? 0.43585 0.87318 0.62459 -0.06784 0.01135  -0.00800 477 GLY A N   
3436 C CA  . GLY A 477 ? 0.42385 0.85441 0.61100 -0.03617 0.01175  -0.00777 477 GLY A CA  
3437 C C   . GLY A 477 ? 0.49249 0.91671 0.67746 -0.02517 0.02760  -0.00535 477 GLY A C   
3438 O O   . GLY A 477 ? 0.42496 0.88126 0.62691 -0.03166 0.03925  -0.00694 477 GLY A O   
3439 N N   . VAL A 478 ? 0.46177 0.84610 0.62560 -0.00848 0.02805  -0.00222 478 VAL A N   
3440 C CA  . VAL A 478 ? 0.38844 0.75956 0.54667 0.00351  0.03982  -0.00087 478 VAL A CA  
3441 C C   . VAL A 478 ? 0.41640 0.74790 0.54861 -0.01040 0.04418  0.00330  478 VAL A C   
3442 O O   . VAL A 478 ? 0.43368 0.72780 0.54582 -0.00537 0.03939  0.00566  478 VAL A O   
3443 C CB  . VAL A 478 ? 0.41365 0.76734 0.56701 0.02875  0.03642  -0.00000 478 VAL A CB  
3444 C CG1 . VAL A 478 ? 0.38685 0.72560 0.53467 0.03856  0.04696  -0.00001 478 VAL A CG1 
3445 C CG2 . VAL A 478 ? 0.31088 0.69832 0.48549 0.04468  0.02894  -0.00324 478 VAL A CG2 
3446 N N   . LEU A 479 ? 0.44411 0.78495 0.57595 -0.02688 0.05351  0.00425  479 LEU A N   
3447 C CA  . LEU A 479 ? 0.57104 0.87377 0.67561 -0.04230 0.05512  0.00914  479 LEU A CA  
3448 C C   . LEU A 479 ? 0.57172 0.83900 0.65752 -0.02753 0.05709  0.01056  479 LEU A C   
3449 O O   . LEU A 479 ? 0.50871 0.78421 0.60209 -0.01111 0.06258  0.00804  479 LEU A O   
3450 C CB  . LEU A 479 ? 0.52777 0.84872 0.63303 -0.06269 0.06631  0.01140  479 LEU A CB  
3451 C CG  . LEU A 479 ? 0.57404 0.90468 0.68172 -0.09069 0.06273  0.01354  479 LEU A CG  
3452 C CD1 . LEU A 479 ? 0.51383 0.89915 0.65769 -0.09104 0.05973  0.00758  479 LEU A CD1 
3453 C CD2 . LEU A 479 ? 0.64521 0.97466 0.73951 -0.11275 0.07520  0.01937  479 LEU A CD2 
3454 N N   . HIS A 480 ? 0.49956 0.72684 0.56103 -0.03330 0.05130  0.01370  480 HIS A N   
3455 C CA  . HIS A 480 ? 0.57500 0.77193 0.61812 -0.02532 0.05307  0.01518  480 HIS A CA  
3456 C C   . HIS A 480 ? 0.72085 0.93004 0.76271 -0.02800 0.06415  0.01566  480 HIS A C   
3457 O O   . HIS A 480 ? 0.73350 0.95090 0.76966 -0.04578 0.06966  0.01884  480 HIS A O   
3458 C CB  . HIS A 480 ? 0.55335 0.71054 0.57029 -0.03498 0.04505  0.01836  480 HIS A CB  
3459 C CG  . HIS A 480 ? 0.68048 0.80732 0.67803 -0.02710 0.04408  0.01963  480 HIS A CG  
3460 N ND1 . HIS A 480 ? 0.71879 0.83019 0.71498 -0.01060 0.03895  0.01674  480 HIS A ND1 
3461 C CD2 . HIS A 480 ? 0.70826 0.81845 0.68623 -0.03387 0.04666  0.02348  480 HIS A CD2 
3462 C CE1 . HIS A 480 ? 0.74935 0.83887 0.72964 -0.00678 0.03722  0.01768  480 HIS A CE1 
3463 N NE2 . HIS A 480 ? 0.73192 0.81794 0.69875 -0.01992 0.04109  0.02202  480 HIS A NE2 
3464 N N   . GLY A 481 ? 0.71807 0.92881 0.76410 -0.01144 0.06792  0.01224  481 GLY A N   
3465 C CA  . GLY A 481 ? 0.56419 0.78482 0.60604 -0.01081 0.07786  0.01052  481 GLY A CA  
3466 C C   . GLY A 481 ? 0.54709 0.80859 0.61245 -0.00336 0.08659  0.00489  481 GLY A C   
3467 O O   . GLY A 481 ? 0.63909 0.90752 0.70154 0.00394  0.09451  0.00056  481 GLY A O   
3468 N N   . ASP A 482 ? 0.47286 0.76181 0.56038 -0.00373 0.08434  0.00380  482 ASP A N   
3469 C CA  . ASP A 482 ? 0.46133 0.79073 0.57446 0.00853  0.08968  -0.00265 482 ASP A CA  
3470 C C   . ASP A 482 ? 0.32551 0.64449 0.43980 0.03179  0.08990  -0.00803 482 ASP A C   
3471 O O   . ASP A 482 ? 0.38820 0.73437 0.51784 0.04493  0.09541  -0.01482 482 ASP A O   
3472 C CB  . ASP A 482 ? 0.53760 0.88885 0.67193 0.01027  0.08108  -0.00296 482 ASP A CB  
3473 C CG  . ASP A 482 ? 0.60572 0.99918 0.75808 -0.00665 0.08494  -0.00374 482 ASP A CG  
3474 O OD1 . ASP A 482 ? 0.63874 1.03282 0.78011 -0.02640 0.09342  -0.00057 482 ASP A OD1 
3475 O OD2 . ASP A 482 ? 0.57033 0.99620 0.74708 -0.00080 0.07894  -0.00714 482 ASP A OD2 
3476 N N   . GLU A 483 ? 0.37168 0.65287 0.47178 0.03763  0.08328  -0.00579 483 GLU A N   
3477 C CA  . GLU A 483 ? 0.44036 0.70829 0.54176 0.05634  0.08224  -0.01027 483 GLU A CA  
3478 C C   . GLU A 483 ? 0.50623 0.76325 0.59378 0.05892  0.08848  -0.01548 483 GLU A C   
3479 O O   . GLU A 483 ? 0.55889 0.81042 0.64854 0.07407  0.08916  -0.02193 483 GLU A O   
3480 C CB  . GLU A 483 ? 0.31546 0.55297 0.41094 0.05948  0.07333  -0.00566 483 GLU A CB  
3481 C CG  . GLU A 483 ? 0.39258 0.60055 0.47054 0.05301  0.07127  -0.00388 483 GLU A CG  
3482 C CD  . GLU A 483 ? 0.42357 0.62626 0.49019 0.03776  0.06926  0.00074  483 GLU A CD  
3483 O OE1 . GLU A 483 ? 0.46571 0.68797 0.53568 0.02804  0.07224  0.00199  483 GLU A OE1 
3484 O OE2 . GLU A 483 ? 0.44509 0.62409 0.49971 0.03534  0.06430  0.00276  483 GLU A OE2 
3485 N N   . ILE A 484 ? 0.59845 0.84968 0.66899 0.04468  0.09210  -0.01298 484 ILE A N   
3486 C CA  . ILE A 484 ? 0.54102 0.77633 0.59236 0.04678  0.09534  -0.01733 484 ILE A CA  
3487 C C   . ILE A 484 ? 0.51731 0.77372 0.57433 0.05973  0.10435  -0.02735 484 ILE A C   
3488 O O   . ILE A 484 ? 0.62817 0.86756 0.67920 0.07247  0.10238  -0.03472 484 ILE A O   
3489 C CB  . ILE A 484 ? 0.55527 0.78198 0.58390 0.02927  0.09762  -0.01133 484 ILE A CB  
3490 C CG1 . ILE A 484 ? 0.47592 0.67495 0.49662 0.02191  0.08648  -0.00384 484 ILE A CG1 
3491 C CG2 . ILE A 484 ? 0.58265 0.79621 0.58785 0.03196  0.10091  -0.01605 484 ILE A CG2 
3492 C CD1 . ILE A 484 ? 0.49334 0.67677 0.48883 0.00543  0.08612  0.00343  484 ILE A CD1 
3493 N N   . GLU A 485 ? 0.51866 0.81353 0.58853 0.05699  0.11398  -0.02886 485 GLU A N   
3494 C CA  . GLU A 485 ? 0.52182 0.84263 0.59815 0.07151  0.12408  -0.04008 485 GLU A CA  
3495 C C   . GLU A 485 ? 0.63869 0.95112 0.72808 0.09514  0.11754  -0.04762 485 GLU A C   
3496 O O   . GLU A 485 ? 0.74374 1.05190 0.82682 0.11092  0.12102  -0.05861 485 GLU A O   
3497 C CB  . GLU A 485 ? 0.61950 0.99153 0.71521 0.06436  0.13518  -0.04043 485 GLU A CB  
3498 C CG  . GLU A 485 ? 0.76400 1.15638 0.88653 0.06173  0.12804  -0.03561 485 GLU A CG  
3499 C CD  . GLU A 485 ? 0.91034 1.35711 1.05389 0.04998  0.13846  -0.03621 485 GLU A CD  
3500 O OE1 . GLU A 485 ? 0.80940 1.29687 0.97812 0.06644  0.14290  -0.04552 485 GLU A OE1 
3501 O OE2 . GLU A 485 ? 1.04638 1.49493 1.18143 0.02416  0.14176  -0.02760 485 GLU A OE2 
3502 N N   . TYR A 486 ? 0.59530 0.90211 0.69951 0.09812  0.10768  -0.04190 486 TYR A N   
3503 C CA  . TYR A 486 ? 0.56108 0.85436 0.67345 0.11945  0.10071  -0.04654 486 TYR A CA  
3504 C C   . TYR A 486 ? 0.53992 0.78793 0.63334 0.12346  0.09537  -0.04912 486 TYR A C   
3505 O O   . TYR A 486 ? 0.59143 0.82748 0.68054 0.14000  0.09545  -0.05912 486 TYR A O   
3506 C CB  . TYR A 486 ? 0.60118 0.89620 0.72780 0.11964  0.09133  -0.03803 486 TYR A CB  
3507 C CG  . TYR A 486 ? 0.52305 0.86602 0.67349 0.12340  0.09376  -0.03993 486 TYR A CG  
3508 C CD1 . TYR A 486 ? 0.40158 0.77247 0.55957 0.10318  0.09699  -0.03480 486 TYR A CD1 
3509 C CD2 . TYR A 486 ? 0.40132 0.76198 0.56686 0.14720  0.09220  -0.04781 486 TYR A CD2 
3510 C CE1 . TYR A 486 ? 0.33142 0.75100 0.51468 0.10421  0.09879  -0.03758 486 TYR A CE1 
3511 C CE2 . TYR A 486 ? 0.42807 0.83851 0.61911 0.15178  0.09347  -0.05095 486 TYR A CE2 
3512 C CZ  . TYR A 486 ? 0.33825 0.78057 0.53981 0.12913  0.09694  -0.04595 486 TYR A CZ  
3513 O OH  . TYR A 486 ? 0.38996 0.88701 0.62109 0.13265  0.09743  -0.05022 486 TYR A OH  
3514 N N   . PHE A 487 ? 0.44699 0.67067 0.52904 0.10829  0.09041  -0.04151 487 PHE A N   
3515 C CA  . PHE A 487 ? 0.46286 0.64966 0.53043 0.10852  0.08476  -0.04426 487 PHE A CA  
3516 C C   . PHE A 487 ? 0.55522 0.73803 0.60579 0.11192  0.08954  -0.05531 487 PHE A C   
3517 O O   . PHE A 487 ? 0.66920 0.82382 0.71002 0.11738  0.08421  -0.06216 487 PHE A O   
3518 C CB  . PHE A 487 ? 0.44305 0.61487 0.50515 0.09261  0.07920  -0.03518 487 PHE A CB  
3519 C CG  . PHE A 487 ? 0.46823 0.63259 0.54129 0.09155  0.07336  -0.02652 487 PHE A CG  
3520 C CD1 . PHE A 487 ? 0.49568 0.64362 0.57365 0.10186  0.06959  -0.02678 487 PHE A CD1 
3521 C CD2 . PHE A 487 ? 0.54116 0.71142 0.61561 0.08033  0.07160  -0.01822 487 PHE A CD2 
3522 C CE1 . PHE A 487 ? 0.63752 0.77803 0.72079 0.10018  0.06555  -0.01795 487 PHE A CE1 
3523 C CE2 . PHE A 487 ? 0.65206 0.81624 0.73298 0.08023  0.06723  -0.01129 487 PHE A CE2 
3524 C CZ  . PHE A 487 ? 0.70772 0.85837 0.79264 0.08971  0.06486  -0.01060 487 PHE A CZ  
3525 N N   . PHE A 488 ? 0.48468 0.69429 0.52951 0.10724  0.09950  -0.05720 488 PHE A N   
3526 C CA  . PHE A 488 ? 0.64544 0.85433 0.67068 0.11225  0.10583  -0.06832 488 PHE A CA  
3527 C C   . PHE A 488 ? 0.73899 0.96360 0.77142 0.13328  0.11226  -0.08128 488 PHE A C   
3528 O O   . PHE A 488 ? 0.86979 1.09301 0.88460 0.14101  0.11790  -0.09311 488 PHE A O   
3529 C CB  . PHE A 488 ? 0.51745 0.74662 0.52827 0.09723  0.11556  -0.06389 488 PHE A CB  
3530 C CG  . PHE A 488 ? 0.48843 0.68990 0.47556 0.08386  0.10841  -0.05833 488 PHE A CG  
3531 C CD1 . PHE A 488 ? 0.63183 0.81032 0.59542 0.08851  0.10436  -0.06722 488 PHE A CD1 
3532 C CD2 . PHE A 488 ? 0.42388 0.62099 0.41142 0.06813  0.10390  -0.04523 488 PHE A CD2 
3533 C CE1 . PHE A 488 ? 0.70201 0.85709 0.64439 0.07806  0.09531  -0.06247 488 PHE A CE1 
3534 C CE2 . PHE A 488 ? 0.43241 0.60340 0.39841 0.05937  0.09534  -0.04073 488 PHE A CE2 
3535 C CZ  . PHE A 488 ? 0.63856 0.79038 0.58300 0.06458  0.09075  -0.04902 488 PHE A CZ  
3536 N N   . GLY A 489 ? 0.72049 0.95975 0.77638 0.14442  0.11082  -0.08008 489 GLY A N   
3537 C CA  . GLY A 489 ? 0.59217 0.84651 0.65620 0.16834  0.11517  -0.09312 489 GLY A CA  
3538 C C   . GLY A 489 ? 0.54959 0.85707 0.62315 0.17095  0.13066  -0.09876 489 GLY A C   
3539 O O   . GLY A 489 ? 0.71574 1.03862 0.79144 0.19246  0.13686  -0.11325 489 GLY A O   
3540 N N   . GLN A 490 ? 0.43728 0.77363 0.51633 0.14949  0.13759  -0.08839 490 GLN A N   
3541 C CA  . GLN A 490 ? 0.48699 0.87699 0.57533 0.14776  0.15445  -0.09326 490 GLN A CA  
3542 C C   . GLN A 490 ? 0.54922 0.98269 0.67114 0.16785  0.15673  -0.10074 490 GLN A C   
3543 O O   . GLN A 490 ? 0.51450 0.98860 0.64288 0.17902  0.17088  -0.11271 490 GLN A O   
3544 C CB  . GLN A 490 ? 0.43062 0.83774 0.51635 0.11719  0.16050  -0.07924 490 GLN A CB  
3545 C CG  . GLN A 490 ? 0.73169 1.09311 0.78469 0.09922  0.15452  -0.07027 490 GLN A CG  
3546 C CD  . GLN A 490 ? 0.81704 1.16346 0.83599 0.10167  0.16175  -0.07848 490 GLN A CD  
3547 O OE1 . GLN A 490 ? 0.81669 1.17233 0.83273 0.12130  0.16812  -0.09334 490 GLN A OE1 
3548 N NE2 . GLN A 490 ? 0.82080 1.14176 0.81154 0.08317  0.15937  -0.06932 490 GLN A NE2 
3549 N N   . PRO A 491 ? 0.56462 0.99423 0.70746 0.17511  0.14373  -0.09533 491 PRO A N   
3550 C CA  . PRO A 491 ? 0.49653 0.96698 0.66944 0.19910  0.14368  -0.10427 491 PRO A CA  
3551 C C   . PRO A 491 ? 0.56587 1.02859 0.73234 0.23113  0.14581  -0.12214 491 PRO A C   
3552 O O   . PRO A 491 ? 0.64546 1.14730 0.83472 0.25110  0.14861  -0.13188 491 PRO A O   
3553 C CB  . PRO A 491 ? 0.47439 0.92335 0.65846 0.20178  0.12580  -0.09383 491 PRO A CB  
3554 C CG  . PRO A 491 ? 0.45094 0.88056 0.62380 0.17128  0.12316  -0.07880 491 PRO A CG  
3555 C CD  . PRO A 491 ? 0.51018 0.90994 0.65276 0.16003  0.13011  -0.08021 491 PRO A CD  
3556 N N   . LEU A 492 ? 0.55050 0.96031 0.68559 0.23485  0.14268  -0.12685 492 LEU A N   
3557 C CA  . LEU A 492 ? 0.61252 1.01248 0.73691 0.26440  0.14532  -0.14616 492 LEU A CA  
3558 C C   . LEU A 492 ? 0.69224 1.13756 0.81395 0.26466  0.16521  -0.15771 492 LEU A C   
3559 O O   . LEU A 492 ? 0.74487 1.18684 0.86169 0.28574  0.16691  -0.17208 492 LEU A O   
3560 C CB  . LEU A 492 ? 0.59729 0.92668 0.68791 0.26495  0.13513  -0.14885 492 LEU A CB  
3561 C CG  . LEU A 492 ? 0.64395 0.92161 0.73274 0.26103  0.11657  -0.13667 492 LEU A CG  
3562 C CD1 . LEU A 492 ? 0.68701 0.90283 0.74891 0.27211  0.10703  -0.14633 492 LEU A CD1 
3563 C CD2 . LEU A 492 ? 0.63264 0.92784 0.74743 0.27848  0.10919  -0.13325 492 LEU A CD2 
3564 N N   . ASN A 493 ? 0.69681 1.17330 0.81715 0.23673  0.17810  -0.14867 493 ASN A N   
3565 C CA  . ASN A 493 ? 0.65792 1.17007 0.77291 0.22809  0.19611  -0.15367 493 ASN A CA  
3566 C C   . ASN A 493 ? 0.63337 1.19508 0.78506 0.23574  0.19906  -0.15615 493 ASN A C   
3567 O O   . ASN A 493 ? 0.58350 1.18015 0.76230 0.21887  0.19881  -0.14497 493 ASN A O   
3568 C CB  . ASN A 493 ? 0.74688 1.27317 0.84849 0.19397  0.20737  -0.14024 493 ASN A CB  
3569 C CG  . ASN A 493 ? 0.87357 1.42682 0.95953 0.18303  0.22701  -0.14378 493 ASN A CG  
3570 O OD1 . ASN A 493 ? 0.76274 1.34011 0.85853 0.19834  0.23449  -0.15524 493 ASN A OD1 
3571 N ND2 . ASN A 493 ? 1.10932 1.65750 1.16881 0.15660  0.23546  -0.13325 493 ASN A ND2 
3572 N N   . ASN A 494 ? 0.68316 1.24820 0.83526 0.26147  0.20106  -0.17180 494 ASN A N   
3573 C CA  . ASN A 494 ? 0.70991 1.32189 0.89727 0.27388  0.20204  -0.17647 494 ASN A CA  
3574 C C   . ASN A 494 ? 0.70663 1.37898 0.91037 0.25016  0.22064  -0.17188 494 ASN A C   
3575 O O   . ASN A 494 ? 0.68504 1.40463 0.92318 0.25549  0.22147  -0.17421 494 ASN A O   
3576 C CB  . ASN A 494 ? 0.80186 1.39998 0.98211 0.30849  0.20000  -0.19533 494 ASN A CB  
3577 C CG  . ASN A 494 ? 0.91839 1.46738 1.09677 0.33484  0.17807  -0.19846 494 ASN A CG  
3578 O OD1 . ASN A 494 ? 0.86138 1.36062 1.01206 0.35329  0.17236  -0.20939 494 ASN A OD1 
3579 N ND2 . ASN A 494 ? 0.95407 1.51396 1.15950 0.33569  0.16505  -0.18855 494 ASN A ND2 
3580 N N   . SER A 495 ? 0.70080 1.37165 0.87972 0.22396  0.23487  -0.16515 495 SER A N   
3581 C CA  . SER A 495 ? 0.71815 1.44003 0.90750 0.19842  0.25355  -0.15908 495 SER A CA  
3582 C C   . SER A 495 ? 0.69405 1.43562 0.90334 0.16727  0.25051  -0.14140 495 SER A C   
3583 O O   . SER A 495 ? 0.69119 1.48060 0.92056 0.14736  0.26221  -0.13659 495 SER A O   
3584 C CB  . SER A 495 ? 0.74829 1.45607 0.89567 0.18538  0.27082  -0.15972 495 SER A CB  
3585 O OG  . SER A 495 ? 0.83451 1.51330 0.95704 0.21385  0.27055  -0.17685 495 SER A OG  
3586 N N   . LEU A 496 ? 0.70387 1.40976 0.90802 0.16240  0.23516  -0.13225 496 LEU A N   
3587 C CA  . LEU A 496 ? 0.70065 1.42201 0.92560 0.13751  0.22853  -0.11754 496 LEU A CA  
3588 C C   . LEU A 496 ? 0.65745 1.39775 0.92023 0.15583  0.21233  -0.12079 496 LEU A C   
3589 O O   . LEU A 496 ? 0.69129 1.41086 0.95536 0.18756  0.20129  -0.13050 496 LEU A O   
3590 C CB  . LEU A 496 ? 0.66083 1.33656 0.86036 0.12322  0.22068  -0.10610 496 LEU A CB  
3591 C CG  . LEU A 496 ? 0.66764 1.31853 0.82523 0.10375  0.23276  -0.10045 496 LEU A CG  
3592 C CD1 . LEU A 496 ? 0.56356 1.16389 0.69741 0.10619  0.22051  -0.09588 496 LEU A CD1 
3593 C CD2 . LEU A 496 ? 0.68706 1.36354 0.84550 0.06641  0.24387  -0.08656 496 LEU A CD2 
3594 N N   . GLN A 497 ? 0.56095 1.33826 0.85202 0.13518  0.20997  -0.11251 497 GLN A N   
3595 C CA  . GLN A 497 ? 0.55048 1.35349 0.87781 0.15053  0.19461  -0.11564 497 GLN A CA  
3596 C C   . GLN A 497 ? 0.56114 1.32589 0.88445 0.15566  0.17483  -0.10816 497 GLN A C   
3597 O O   . GLN A 497 ? 0.49601 1.24963 0.81245 0.12998  0.17257  -0.09602 497 GLN A O   
3598 C CB  . GLN A 497 ? 0.52936 1.39013 0.88892 0.12570  0.19941  -0.11146 497 GLN A CB  
3599 C CG  . GLN A 497 ? 0.59048 1.48392 0.98762 0.14234  0.18354  -0.11640 497 GLN A CG  
3600 C CD  . GLN A 497 ? 0.76102 1.70746 1.18893 0.11312  0.18573  -0.11142 497 GLN A CD  
3601 O OE1 . GLN A 497 ? 0.88538 1.84747 1.30748 0.08203  0.20211  -0.10549 497 GLN A OE1 
3602 N NE2 . GLN A 497 ? 0.79848 1.77085 1.25741 0.12208  0.16849  -0.11350 497 GLN A NE2 
3603 N N   . TYR A 498 ? 0.56897 1.31136 0.89412 0.18902  0.16085  -0.11518 498 TYR A N   
3604 C CA  . TYR A 498 ? 0.47925 1.18656 0.80116 0.19842  0.14179  -0.10850 498 TYR A CA  
3605 C C   . TYR A 498 ? 0.50837 1.22130 0.84846 0.23113  0.12655  -0.11596 498 TYR A C   
3606 O O   . TYR A 498 ? 0.64585 1.37426 0.99264 0.25181  0.13078  -0.12803 498 TYR A O   
3607 C CB  . TYR A 498 ? 0.45564 1.10229 0.74244 0.20520  0.14060  -0.10663 498 TYR A CB  
3608 C CG  . TYR A 498 ? 0.50555 1.13711 0.77034 0.17592  0.15062  -0.09748 498 TYR A CG  
3609 C CD1 . TYR A 498 ? 0.61989 1.25721 0.86706 0.16309  0.16828  -0.10061 498 TYR A CD1 
3610 C CD2 . TYR A 498 ? 0.42580 1.02323 0.67979 0.16014  0.13969  -0.08416 498 TYR A CD2 
3611 C CE1 . TYR A 498 ? 0.63262 1.25146 0.85497 0.13777  0.17576  -0.09159 498 TYR A CE1 
3612 C CE2 . TYR A 498 ? 0.48741 1.05312 0.71420 0.13185  0.14426  -0.07405 498 TYR A CE2 
3613 C CZ  . TYR A 498 ? 0.61531 1.19083 0.82613 0.12129  0.16143  -0.07751 498 TYR A CZ  
3614 O OH  . TYR A 498 ? 0.75575 1.29807 0.93694 0.09576  0.16434  -0.06731 498 TYR A OH  
3615 N N   . ARG A 499 ? 0.41946 1.11854 0.76506 0.23651  0.10854  -0.10863 499 ARG A N   
3616 C CA  . ARG A 499 ? 0.47274 1.16682 0.82832 0.26856  0.09148  -0.11340 499 ARG A CA  
3617 C C   . ARG A 499 ? 0.53649 1.16642 0.86222 0.29436  0.08508  -0.11559 499 ARG A C   
3618 O O   . ARG A 499 ? 0.52374 1.11346 0.82420 0.28500  0.08989  -0.11083 499 ARG A O   
3619 C CB  . ARG A 499 ? 0.52742 1.23227 0.89758 0.26346  0.07381  -0.10398 499 ARG A CB  
3620 C CG  . ARG A 499 ? 0.59455 1.35631 0.99157 0.23260  0.07860  -0.10110 499 ARG A CG  
3621 C CD  . ARG A 499 ? 0.76626 1.55820 1.18825 0.23943  0.05949  -0.10026 499 ARG A CD  
3622 N NE  . ARG A 499 ? 0.89849 1.64847 1.30304 0.24927  0.04112  -0.09087 499 ARG A NE  
3623 C CZ  . ARG A 499 ? 0.92955 1.65169 1.32562 0.28148  0.02438  -0.09128 499 ARG A CZ  
3624 N NH1 . ARG A 499 ? 0.91850 1.65057 1.32352 0.30822  0.02261  -0.10178 499 ARG A NH1 
3625 N NH2 . ARG A 499 ? 0.82743 1.51026 1.20386 0.28704  0.00941  -0.08064 499 ARG A NH2 
3626 N N   . PRO A 500 ? 0.57711 1.25980 0.81723 0.32873  0.07846  -0.06486 500 PRO A N   
3627 C CA  . PRO A 500 ? 0.66034 1.26476 0.86912 0.35807  0.07809  -0.06885 500 PRO A CA  
3628 C C   . PRO A 500 ? 0.68968 1.23622 0.88606 0.34973  0.07180  -0.05523 500 PRO A C   
3629 O O   . PRO A 500 ? 0.82577 1.30394 0.99453 0.34312  0.07544  -0.05570 500 PRO A O   
3630 C CB  . PRO A 500 ? 0.56211 1.16083 0.76419 0.39965  0.06877  -0.07486 500 PRO A CB  
3631 C CG  . PRO A 500 ? 0.56065 1.24228 0.78950 0.39522  0.07219  -0.08140 500 PRO A CG  
3632 C CD  . PRO A 500 ? 0.50846 1.24087 0.76249 0.35020  0.07423  -0.07165 500 PRO A CD  
3633 N N   . VAL A 501 ? 0.57028 1.12882 0.77912 0.33964  0.06042  -0.04178 501 VAL A N   
3634 C CA  . VAL A 501 ? 0.54788 1.03604 0.73596 0.32075  0.05344  -0.02703 501 VAL A CA  
3635 C C   . VAL A 501 ? 0.52473 1.00062 0.71167 0.27460  0.06048  -0.02254 501 VAL A C   
3636 O O   . VAL A 501 ? 0.57042 0.97766 0.73450 0.25866  0.05918  -0.01498 501 VAL A O   
3637 C CB  . VAL A 501 ? 0.54846 1.05014 0.74559 0.32210  0.03936  -0.01444 501 VAL A CB  
3638 C CG1 . VAL A 501 ? 0.66754 1.14645 0.85102 0.36814  0.02946  -0.01478 501 VAL A CG1 
3639 C CG2 . VAL A 501 ? 0.41926 1.01275 0.65373 0.30563  0.03781  -0.01526 501 VAL A CG2 
3640 N N   . GLU A 502 ? 0.53435 1.07632 0.74525 0.25189  0.06750  -0.02638 502 GLU A N   
3641 C CA  . GLU A 502 ? 0.49233 1.01781 0.69808 0.21052  0.07304  -0.02211 502 GLU A CA  
3642 C C   . GLU A 502 ? 0.52665 1.00401 0.70781 0.21264  0.08197  -0.03029 502 GLU A C   
3643 O O   . GLU A 502 ? 0.61853 1.04411 0.78320 0.18838  0.08147  -0.02431 502 GLU A O   
3644 C CB  . GLU A 502 ? 0.50676 1.10937 0.73920 0.18440  0.07780  -0.02295 502 GLU A CB  
3645 C CG  . GLU A 502 ? 0.43957 1.05757 0.68500 0.15810  0.06729  -0.01094 502 GLU A CG  
3646 C CD  . GLU A 502 ? 0.42240 1.12804 0.69875 0.14579  0.06774  -0.01269 502 GLU A CD  
3647 O OE1 . GLU A 502 ? 0.48725 1.22943 0.77017 0.16207  0.07341  -0.02247 502 GLU A OE1 
3648 O OE2 . GLU A 502 ? 0.42345 1.14340 0.70864 0.11641  0.05977  -0.00421 502 GLU A OE2 
3649 N N   . ARG A 503 ? 0.53834 1.03256 0.71614 0.24261  0.08946  -0.04494 503 ARG A N   
3650 C CA  . ARG A 503 ? 0.60583 1.04630 0.75489 0.24789  0.09594  -0.05443 503 ARG A CA  
3651 C C   . ARG A 503 ? 0.73163 1.08300 0.85250 0.25810  0.08709  -0.04890 503 ARG A C   
3652 O O   . ARG A 503 ? 0.72351 1.01764 0.82157 0.24259  0.08814  -0.04911 503 ARG A O   
3653 C CB  . ARG A 503 ? 0.64897 1.12498 0.79767 0.28231  0.10540  -0.07310 503 ARG A CB  
3654 C CG  . ARG A 503 ? 0.67849 1.25390 0.85837 0.27488  0.11539  -0.07819 503 ARG A CG  
3655 C CD  . ARG A 503 ? 0.75538 1.36024 0.92825 0.29979  0.12908  -0.09803 503 ARG A CD  
3656 N NE  . ARG A 503 ? 0.75938 1.44151 0.95598 0.28211  0.13378  -0.09801 503 ARG A NE  
3657 C CZ  . ARG A 503 ? 0.70109 1.41860 0.90371 0.24366  0.14244  -0.09389 503 ARG A CZ  
3658 N NH1 . ARG A 503 ? 0.65397 1.33991 0.84159 0.21948  0.14722  -0.09003 503 ARG A NH1 
3659 N NH2 . ARG A 503 ? 0.71766 1.50047 0.93949 0.22873  0.14555  -0.09289 503 ARG A NH2 
3660 N N   . GLU A 504 ? 0.83269 1.17221 0.95396 0.28273  0.07772  -0.04316 504 GLU A N   
3661 C CA  . GLU A 504 ? 0.86710 1.12396 0.96142 0.28617  0.06924  -0.03381 504 GLU A CA  
3662 C C   . GLU A 504 ? 0.65399 0.88542 0.74822 0.24510  0.06721  -0.01954 504 GLU A C   
3663 O O   . GLU A 504 ? 0.74457 0.91341 0.81691 0.23195  0.06672  -0.01656 504 GLU A O   
3664 C CB  . GLU A 504 ? 1.01655 1.27141 1.11080 0.31780  0.05893  -0.02781 504 GLU A CB  
3665 C CG  . GLU A 504 ? 1.23816 1.40379 1.29807 0.32787  0.05088  -0.01897 504 GLU A CG  
3666 C CD  . GLU A 504 ? 1.46421 1.56616 1.49313 0.33710  0.05408  -0.02983 504 GLU A CD  
3667 O OE1 . GLU A 504 ? 1.53217 1.56652 1.53828 0.31636  0.05215  -0.02201 504 GLU A OE1 
3668 O OE2 . GLU A 504 ? 1.56015 1.68138 1.58735 0.36492  0.05843  -0.04691 504 GLU A OE2 
3669 N N   . LEU A 505 ? 0.54826 0.82924 0.66698 0.22414  0.06565  -0.01160 505 LEU A N   
3670 C CA  . LEU A 505 ? 0.55533 0.81438 0.67396 0.18898  0.06326  0.00052  505 LEU A CA  
3671 C C   . LEU A 505 ? 0.62702 0.86971 0.73890 0.16309  0.06956  -0.00361 505 LEU A C   
3672 O O   . LEU A 505 ? 0.67419 0.86884 0.77356 0.14522  0.06761  0.00296  505 LEU A O   
3673 C CB  . LEU A 505 ? 0.48622 0.79959 0.62913 0.17348  0.05917  0.00736  505 LEU A CB  
3674 C CG  . LEU A 505 ? 0.55383 0.84518 0.69567 0.14302  0.05515  0.01911  505 LEU A CG  
3675 C CD1 . LEU A 505 ? 0.48933 0.72181 0.61177 0.14926  0.05102  0.02852  505 LEU A CD1 
3676 C CD2 . LEU A 505 ? 0.57606 0.91627 0.73745 0.13030  0.04946  0.02364  505 LEU A CD2 
3677 N N   . GLY A 506 ? 0.63970 0.92498 0.75968 0.16037  0.07704  -0.01410 506 GLY A N   
3678 C CA  . GLY A 506 ? 0.53071 0.79850 0.63939 0.13886  0.08219  -0.01863 506 GLY A CA  
3679 C C   . GLY A 506 ? 0.52507 0.72666 0.60611 0.14909  0.08184  -0.02433 506 GLY A C   
3680 O O   . GLY A 506 ? 0.56332 0.72608 0.63310 0.12702  0.07983  -0.02088 506 GLY A O   
3681 N N   . LYS A 507 ? 0.53061 0.71753 0.59979 0.18293  0.08247  -0.03338 507 LYS A N   
3682 C CA  . LYS A 507 ? 0.62187 0.73766 0.66071 0.19254  0.08013  -0.03878 507 LYS A CA  
3683 C C   . LYS A 507 ? 0.73899 0.79964 0.76922 0.17841  0.07221  -0.02388 507 LYS A C   
3684 O O   . LYS A 507 ? 0.91266 0.91874 0.92299 0.16575  0.06994  -0.02421 507 LYS A O   
3685 C CB  . LYS A 507 ? 0.61307 0.72020 0.63873 0.23520  0.08057  -0.05106 507 LYS A CB  
3686 C CG  . LYS A 507 ? 0.63710 0.66264 0.62611 0.24703  0.07646  -0.05779 507 LYS A CG  
3687 C CD  . LYS A 507 ? 0.77158 0.78084 0.74611 0.29275  0.07366  -0.06689 507 LYS A CD  
3688 C CE  . LYS A 507 ? 0.97081 0.88410 0.90524 0.30244  0.06558  -0.06822 507 LYS A CE  
3689 N NZ  . LYS A 507 ? 1.07715 0.96339 0.99932 0.34035  0.05755  -0.06492 507 LYS A NZ  
3690 N N   . ARG A 508 ? 0.65626 0.73299 0.70090 0.17890  0.06806  -0.01092 508 ARG A N   
3691 C CA  . ARG A 508 ? 0.65836 0.69119 0.69572 0.16422  0.06264  0.00399  508 ARG A CA  
3692 C C   . ARG A 508 ? 0.60992 0.64993 0.65875 0.12807  0.06339  0.01054  508 ARG A C   
3693 O O   . ARG A 508 ? 0.56065 0.55807 0.59948 0.11128  0.06128  0.01710  508 ARG A O   
3694 C CB  . ARG A 508 ? 0.67732 0.72596 0.72272 0.17798  0.05795  0.01498  508 ARG A CB  
3695 C CG  . ARG A 508 ? 0.81286 0.82724 0.83785 0.21263  0.05331  0.01437  508 ARG A CG  
3696 C CD  . ARG A 508 ? 0.85783 0.86963 0.88220 0.22022  0.04698  0.02904  508 ARG A CD  
3697 N NE  . ARG A 508 ? 0.86594 0.94683 0.91716 0.22397  0.04550  0.02951  508 ARG A NE  
3698 C CZ  . ARG A 508 ? 0.74462 0.84118 0.80443 0.21077  0.04200  0.04140  508 ARG A CZ  
3699 N NH1 . ARG A 508 ? 0.65206 0.70512 0.69751 0.19399  0.04163  0.05375  508 ARG A NH1 
3700 N NH2 . ARG A 508 ? 0.70276 0.86017 0.78521 0.21304  0.03904  0.04032  508 ARG A NH2 
3701 N N   . MET A 509 ? 0.53351 0.62730 0.60317 0.11557  0.06566  0.00937  509 MET A N   
3702 C CA  . MET A 509 ? 0.55969 0.65713 0.63835 0.08482  0.06439  0.01599  509 MET A CA  
3703 C C   . MET A 509 ? 0.68229 0.75959 0.75048 0.06938  0.06582  0.00883  509 MET A C   
3704 O O   . MET A 509 ? 0.67562 0.72953 0.74277 0.04886  0.06265  0.01448  509 MET A O   
3705 C CB  . MET A 509 ? 0.58837 0.74095 0.68787 0.07562  0.06415  0.01830  509 MET A CB  
3706 C CG  . MET A 509 ? 0.51751 0.68345 0.62545 0.08542  0.06007  0.02670  509 MET A CG  
3707 S SD  . MET A 509 ? 0.50865 0.73506 0.63855 0.07297  0.05729  0.02873  509 MET A SD  
3708 C CE  . MET A 509 ? 0.41094 0.62423 0.54157 0.03991  0.05505  0.03343  509 MET A CE  
3709 N N   . LEU A 510 ? 0.73175 0.81873 0.79125 0.08014  0.07031  -0.00418 510 LEU A N   
3710 C CA  . LEU A 510 ? 0.69276 0.75301 0.73601 0.06796  0.07046  -0.01205 510 LEU A CA  
3711 C C   . LEU A 510 ? 0.66718 0.66501 0.69200 0.06806  0.06581  -0.01078 510 LEU A C   
3712 O O   . LEU A 510 ? 0.83570 0.80867 0.85503 0.04674  0.06185  -0.00949 510 LEU A O   
3713 C CB  . LEU A 510 ? 0.61815 0.69820 0.65091 0.08321  0.07721  -0.02770 510 LEU A CB  
3714 C CG  . LEU A 510 ? 0.64981 0.69435 0.65868 0.07430  0.07639  -0.03799 510 LEU A CG  
3715 C CD1 . LEU A 510 ? 0.60452 0.67060 0.61873 0.04547  0.07522  -0.03447 510 LEU A CD1 
3716 C CD2 . LEU A 510 ? 0.72313 0.76858 0.71295 0.09954  0.08291  -0.05589 510 LEU A CD2 
3717 N N   . SER A 511 ? 0.58978 0.56170 0.60444 0.09090  0.06520  -0.01035 511 SER A N   
3718 C CA  . SER A 511 ? 0.68437 0.59168 0.67717 0.08974  0.06046  -0.00838 511 SER A CA  
3719 C C   . SER A 511 ? 0.76172 0.65547 0.76437 0.06561  0.05701  0.00765  511 SER A C   
3720 O O   . SER A 511 ? 0.81398 0.66604 0.80498 0.04900  0.05323  0.00960  511 SER A O   
3721 C CB  . SER A 511 ? 0.65707 0.53740 0.63312 0.12212  0.05963  -0.01078 511 SER A CB  
3722 O OG  . SER A 511 ? 1.00126 0.81729 0.95639 0.11716  0.05421  -0.00348 511 SER A OG  
3723 N N   . ALA A 512 ? 0.69140 0.62193 0.71533 0.06264  0.05821  0.01838  512 ALA A N   
3724 C CA  . ALA A 512 ? 0.69825 0.62603 0.73364 0.04015  0.05651  0.03141  512 ALA A CA  
3725 C C   . ALA A 512 ? 0.62748 0.56269 0.67089 0.01503  0.05431  0.02848  512 ALA A C   
3726 O O   . ALA A 512 ? 0.64724 0.56157 0.69167 -0.00337 0.05169  0.03440  512 ALA A O   
3727 C CB  . ALA A 512 ? 0.50995 0.47681 0.56367 0.04364  0.05767  0.04049  512 ALA A CB  
3728 N N   . VAL A 513 ? 0.62826 0.59452 0.67693 0.01340  0.05494  0.01993  513 VAL A N   
3729 C CA  . VAL A 513 ? 0.62338 0.59402 0.67566 -0.00870 0.05100  0.01747  513 VAL A CA  
3730 C C   . VAL A 513 ? 0.64529 0.57411 0.67776 -0.01523 0.04748  0.00959  513 VAL A C   
3731 O O   . VAL A 513 ? 0.72116 0.63556 0.75707 -0.03517 0.04208  0.01329  513 VAL A O   
3732 C CB  . VAL A 513 ? 0.55851 0.56874 0.61587 -0.01013 0.05242  0.01190  513 VAL A CB  
3733 C CG1 . VAL A 513 ? 0.66399 0.67797 0.72470 -0.03243 0.04632  0.01279  513 VAL A CG1 
3734 C CG2 . VAL A 513 ? 0.46508 0.51182 0.53938 -0.00482 0.05448  0.01893  513 VAL A CG2 
3735 N N   . ILE A 514 ? 0.61246 0.52164 0.62376 0.00206  0.04979  -0.00213 514 ILE A N   
3736 C CA  . ILE A 514 ? 0.60578 0.46955 0.59300 -0.00341 0.04517  -0.01195 514 ILE A CA  
3737 C C   . ILE A 514 ? 0.76141 0.58030 0.74335 -0.01416 0.04064  -0.00326 514 ILE A C   
3738 O O   . ILE A 514 ? 0.83569 0.62981 0.81172 -0.03520 0.03395  -0.00457 514 ILE A O   
3739 C CB  . ILE A 514 ? 0.64796 0.49742 0.61090 0.02228  0.04900  -0.02764 514 ILE A CB  
3740 C CG1 . ILE A 514 ? 0.62081 0.52147 0.58952 0.02972  0.05539  -0.03578 514 ILE A CG1 
3741 C CG2 . ILE A 514 ? 0.63663 0.43153 0.56959 0.01712  0.04282  -0.03942 514 ILE A CG2 
3742 C CD1 . ILE A 514 ? 0.57189 0.49159 0.54391 0.00537  0.05204  -0.03648 514 ILE A CD1 
3743 N N   . GLU A 515 ? 0.81929 0.62836 0.80260 -0.00174 0.04373  0.00650  515 GLU A N   
3744 C CA  . GLU A 515 ? 0.81434 0.58248 0.79121 -0.01529 0.04064  0.01732  515 GLU A CA  
3745 C C   . GLU A 515 ? 0.73827 0.53248 0.74095 -0.04220 0.03958  0.02883  515 GLU A C   
3746 O O   . GLU A 515 ? 0.71818 0.48698 0.71873 -0.06378 0.03562  0.03386  515 GLU A O   
3747 C CB  . GLU A 515 ? 0.88192 0.63315 0.85054 0.00473  0.04396  0.02656  515 GLU A CB  
3748 C CG  . GLU A 515 ? 1.03873 0.72003 0.97600 0.00558  0.03964  0.02861  515 GLU A CG  
3749 C CD  . GLU A 515 ? 1.29759 0.93755 1.20751 0.00975  0.03413  0.01093  515 GLU A CD  
3750 O OE1 . GLU A 515 ? 1.32573 0.98617 1.23247 0.02996  0.03622  -0.00408 515 GLU A OE1 
3751 O OE2 . GLU A 515 ? 1.42703 1.01403 1.31733 -0.00844 0.02775  0.01182  515 GLU A OE2 
3752 N N   . PHE A 516 ? 0.79360 0.63871 0.82057 -0.04143 0.04255  0.03267  516 PHE A N   
3753 C CA  . PHE A 516 ? 0.78281 0.65340 0.83358 -0.06280 0.04089  0.04134  516 PHE A CA  
3754 C C   . PHE A 516 ? 0.70816 0.57768 0.76051 -0.08217 0.03313  0.03394  516 PHE A C   
3755 O O   . PHE A 516 ? 0.58588 0.45362 0.64909 -0.10294 0.02924  0.03937  516 PHE A O   
3756 C CB  . PHE A 516 ? 0.67724 0.59535 0.74866 -0.05597 0.04384  0.04527  516 PHE A CB  
3757 C CG  . PHE A 516 ? 0.53991 0.48448 0.63425 -0.07292 0.04128  0.05162  516 PHE A CG  
3758 C CD1 . PHE A 516 ? 0.47920 0.42225 0.58330 -0.08246 0.04417  0.06249  516 PHE A CD1 
3759 C CD2 . PHE A 516 ? 0.53314 0.50454 0.63795 -0.07846 0.03601  0.04696  516 PHE A CD2 
3760 C CE1 . PHE A 516 ? 0.48231 0.45507 0.60945 -0.09465 0.04241  0.06693  516 PHE A CE1 
3761 C CE2 . PHE A 516 ? 0.56286 0.55734 0.68800 -0.08989 0.03224  0.05192  516 PHE A CE2 
3762 C CZ  . PHE A 516 ? 0.53825 0.53598 0.67626 -0.09665 0.03574  0.06111  516 PHE A CZ  
3763 N N   . ALA A 517 ? 0.66022 0.53478 0.70204 -0.07577 0.03082  0.02169  517 ALA A N   
3764 C CA  . ALA A 517 ? 0.58615 0.45692 0.62343 -0.09232 0.02218  0.01356  517 ALA A CA  
3765 C C   . ALA A 517 ? 0.67418 0.49856 0.69451 -0.10562 0.01643  0.01010  517 ALA A C   
3766 O O   . ALA A 517 ? 0.78523 0.61040 0.81394 -0.12804 0.00810  0.01096  517 ALA A O   
3767 C CB  . ALA A 517 ? 0.50135 0.38096 0.52276 -0.08094 0.02286  0.00096  517 ALA A CB  
3768 N N   . LYS A 518 ? 0.67666 0.45924 0.67263 -0.09215 0.01953  0.00630  518 LYS A N   
3769 C CA  . LYS A 518 ? 0.77863 0.50669 0.75094 -0.10473 0.01250  0.00127  518 LYS A CA  
3770 C C   . LYS A 518 ? 0.90249 0.61739 0.88637 -0.12624 0.01145  0.01617  518 LYS A C   
3771 O O   . LYS A 518 ? 0.98394 0.67484 0.96285 -0.15090 0.00292  0.01499  518 LYS A O   
3772 C CB  . LYS A 518 ? 0.77231 0.45490 0.71081 -0.08009 0.01500  -0.00858 518 LYS A CB  
3773 C CG  . LYS A 518 ? 0.86973 0.55257 0.78810 -0.06515 0.01427  -0.02755 518 LYS A CG  
3774 C CD  . LYS A 518 ? 0.98139 0.62905 0.87115 -0.03383 0.01853  -0.03717 518 LYS A CD  
3775 C CE  . LYS A 518 ? 1.04519 0.67047 0.90361 -0.02308 0.01576  -0.05893 518 LYS A CE  
3776 N NZ  . LYS A 518 ? 1.05798 0.71985 0.91568 0.00816  0.02601  -0.06833 518 LYS A NZ  
3777 N N   . THR A 519 ? 0.90077 0.63242 0.89907 -0.11883 0.01997  0.03030  519 THR A N   
3778 C CA  . THR A 519 ? 0.88670 0.60503 0.89146 -0.13811 0.02155  0.04548  519 THR A CA  
3779 C C   . THR A 519 ? 0.80635 0.57932 0.84629 -0.14490 0.02797  0.05884  519 THR A C   
3780 O O   . THR A 519 ? 0.88715 0.65722 0.93416 -0.16146 0.03137  0.07193  519 THR A O   
3781 C CB  . THR A 519 ? 0.89251 0.56172 0.86963 -0.12343 0.02567  0.05170  519 THR A CB  
3782 O OG1 . THR A 519 ? 0.88747 0.58671 0.87390 -0.09899 0.03434  0.05790  519 THR A OG1 
3783 C CG2 . THR A 519 ? 0.81077 0.42546 0.75089 -0.10820 0.01981  0.03653  519 THR A CG2 
3784 N N   . GLY A 520 ? 0.83486 0.65562 0.89470 -0.13304 0.02989  0.05600  520 GLY A N   
3785 C CA  . GLY A 520 ? 0.83705 0.70319 0.92542 -0.13547 0.03564  0.06707  520 GLY A CA  
3786 C C   . GLY A 520 ? 0.86723 0.73110 0.95010 -0.11932 0.04524  0.07721  520 GLY A C   
3787 O O   . GLY A 520 ? 0.89762 0.79462 0.99943 -0.12030 0.05107  0.08642  520 GLY A O   
3788 N N   . ASN A 521 ? 0.90907 0.73554 0.96539 -0.10268 0.04634  0.07498  521 ASN A N   
3789 C CA  . ASN A 521 ? 0.85019 0.67013 0.89700 -0.08546 0.05318  0.08450  521 ASN A CA  
3790 C C   . ASN A 521 ? 0.80003 0.61392 0.83225 -0.05710 0.05221  0.07460  521 ASN A C   
3791 O O   . ASN A 521 ? 0.72965 0.50849 0.74090 -0.05064 0.04793  0.06460  521 ASN A O   
3792 C CB  . ASN A 521 ? 0.93960 0.71161 0.96548 -0.09724 0.05450  0.09581  521 ASN A CB  
3793 C CG  . ASN A 521 ? 0.97580 0.73792 0.98819 -0.08086 0.06056  0.10787  521 ASN A CG  
3794 O OD1 . ASN A 521 ? 0.94938 0.74842 0.97353 -0.06436 0.06438  0.10889  521 ASN A OD1 
3795 N ND2 . ASN A 521 ? 1.07861 0.78735 1.06312 -0.08585 0.06018  0.11738  521 ASN A ND2 
3796 N N   . PRO A 522 ? 0.77688 0.62656 0.81989 -0.03988 0.05579  0.07595  522 PRO A N   
3797 C CA  . PRO A 522 ? 0.76633 0.62053 0.80028 -0.01422 0.05517  0.06661  522 PRO A CA  
3798 C C   . PRO A 522 ? 0.74021 0.55576 0.74877 0.00632  0.05533  0.06990  522 PRO A C   
3799 O O   . PRO A 522 ? 0.73891 0.55470 0.73849 0.02958  0.05418  0.06037  522 PRO A O   
3800 C CB  . PRO A 522 ? 0.83843 0.74381 0.89348 -0.00793 0.05755  0.06898  522 PRO A CB  
3801 C CG  . PRO A 522 ? 0.83170 0.74191 0.89439 -0.01902 0.06110  0.08269  522 PRO A CG  
3802 C CD  . PRO A 522 ? 0.79371 0.68251 0.85714 -0.04310 0.06023  0.08525  522 PRO A CD  
3803 N N   . ALA A 523 ? 0.80118 0.58406 0.79693 -0.00114 0.05652  0.08325  523 ALA A N   
3804 C CA  . ALA A 523 ? 0.98830 0.73563 0.95848 0.02025  0.05560  0.08966  523 ALA A CA  
3805 C C   . ALA A 523 ? 1.14315 0.83710 1.08486 0.03300  0.04997  0.07963  523 ALA A C   
3806 O O   . ALA A 523 ? 1.15381 0.81029 1.08393 0.01423  0.04687  0.07664  523 ALA A O   
3807 C CB  . ALA A 523 ? 1.09108 0.81506 1.05109 0.00562  0.05880  0.10866  523 ALA A CB  
3808 N N   . GLN A 524 ? 1.32379 1.01395 1.25334 0.06591  0.04784  0.07401  524 GLN A N   
3809 C CA  . GLN A 524 ? 1.50500 1.14225 1.40403 0.08582  0.04225  0.06363  524 GLN A CA  
3810 C C   . GLN A 524 ? 1.59043 1.15432 1.45453 0.08281  0.03772  0.07718  524 GLN A C   
3811 O O   . GLN A 524 ? 1.57682 1.13633 1.44108 0.06574  0.04032  0.09549  524 GLN A O   
3812 C CB  . GLN A 524 ? 1.52662 1.19138 1.42723 0.12467  0.04157  0.05344  524 GLN A CB  
3813 C CG  . GLN A 524 ? 1.53240 1.27865 1.46958 0.12636  0.04667  0.04957  524 GLN A CG  
3814 C CD  . GLN A 524 ? 1.51751 1.29680 1.47308 0.10843  0.04990  0.03690  524 GLN A CD  
3815 O OE1 . GLN A 524 ? 1.56885 1.31769 1.51577 0.08789  0.04853  0.03346  524 GLN A OE1 
3816 N NE2 . GLN A 524 ? 1.34290 1.18435 1.32246 0.11487  0.05325  0.03069  524 GLN A NE2 
3817 N N   . ASP A 525 ? 1.65762 1.16115 1.48866 0.09943  0.03090  0.06781  525 ASP A N   
3818 C CA  . ASP A 525 ? 1.75489 1.17806 1.54559 0.09964  0.02442  0.08009  525 ASP A CA  
3819 C C   . ASP A 525 ? 1.59131 1.01722 1.37369 0.12502  0.02355  0.09427  525 ASP A C   
3820 O O   . ASP A 525 ? 1.55448 1.00713 1.34112 0.16191  0.02169  0.08541  525 ASP A O   
3821 C CB  . ASP A 525 ? 1.99802 1.35406 1.75215 0.11885  0.01568  0.06395  525 ASP A CB  
3822 C CG  . ASP A 525 ? 2.16788 1.46442 1.90159 0.08346  0.01093  0.06333  525 ASP A CG  
3823 O OD1 . ASP A 525 ? 2.20589 1.48660 1.93943 0.04847  0.01221  0.08184  525 ASP A OD1 
3824 O OD2 . ASP A 525 ? 2.22464 1.49275 1.94228 0.09036  0.00591  0.04346  525 ASP A OD2 
3825 N N   . GLY A 526 ? 1.45790 0.85946 1.22839 0.10461  0.02484  0.11651  526 GLY A N   
3826 C CA  . GLY A 526 ? 1.38071 0.78175 1.13903 0.12445  0.02351  0.13246  526 GLY A CA  
3827 C C   . GLY A 526 ? 1.29086 0.77691 1.08619 0.13189  0.02984  0.13347  526 GLY A C   
3828 O O   . GLY A 526 ? 1.41463 0.90602 1.20146 0.14171  0.02928  0.14836  526 GLY A O   
3829 N N   . GLU A 527 ? 1.18744 0.73666 1.02009 0.12740  0.03476  0.11822  527 GLU A N   
3830 C CA  . GLU A 527 ? 1.14050 0.76560 1.00707 0.12763  0.04010  0.11946  527 GLU A CA  
3831 C C   . GLU A 527 ? 1.04675 0.68603 0.92409 0.09337  0.04769  0.13451  527 GLU A C   
3832 O O   . GLU A 527 ? 1.08625 0.71707 0.97079 0.06362  0.05141  0.13418  527 GLU A O   
3833 C CB  . GLU A 527 ? 1.21275 0.89349 1.11134 0.13009  0.04247  0.09985  527 GLU A CB  
3834 C CG  . GLU A 527 ? 1.30306 1.05801 1.23435 0.13089  0.04594  0.09912  527 GLU A CG  
3835 C CD  . GLU A 527 ? 1.46365 1.26396 1.42442 0.11538  0.04989  0.08555  527 GLU A CD  
3836 O OE1 . GLU A 527 ? 1.51429 1.30229 1.47909 0.08849  0.05262  0.08564  527 GLU A OE1 
3837 O OE2 . GLU A 527 ? 1.53208 1.38077 1.51131 0.12916  0.04965  0.07535  527 GLU A OE2 
3838 N N   . GLU A 528 ? 0.85670 0.51998 0.73489 0.09860  0.04966  0.14694  528 GLU A N   
3839 C CA  . GLU A 528 ? 0.85499 0.53920 0.74307 0.07122  0.05819  0.16007  528 GLU A CA  
3840 C C   . GLU A 528 ? 0.82955 0.58326 0.75685 0.06428  0.06246  0.14947  528 GLU A C   
3841 O O   . GLU A 528 ? 0.90364 0.69667 0.84302 0.08385  0.05943  0.14296  528 GLU A O   
3842 C CB  . GLU A 528 ? 0.87134 0.54661 0.73680 0.08083  0.05835  0.17782  528 GLU A CB  
3843 C CG  . GLU A 528 ? 1.13931 0.74274 0.96408 0.07282  0.05714  0.19510  528 GLU A CG  
3844 C CD  . GLU A 528 ? 1.17265 0.75561 1.00086 0.03488  0.06385  0.19925  528 GLU A CD  
3845 O OE1 . GLU A 528 ? 0.97853 0.60369 0.82986 0.01083  0.07387  0.20352  528 GLU A OE1 
3846 O OE2 . GLU A 528 ? 1.25776 0.78350 1.06567 0.02995  0.05832  0.19720  528 GLU A OE2 
3847 N N   . TRP A 529 ? 0.74233 0.51053 0.68873 0.03608  0.06831  0.14811  529 TRP A N   
3848 C CA  . TRP A 529 ? 0.76227 0.58981 0.74217 0.02842  0.07152  0.13999  529 TRP A CA  
3849 C C   . TRP A 529 ? 0.91754 0.75338 0.90900 -0.00089 0.07910  0.14754  529 TRP A C   
3850 O O   . TRP A 529 ? 0.98641 0.81993 0.99043 -0.01947 0.07898  0.14179  529 TRP A O   
3851 C CB  . TRP A 529 ? 0.68881 0.53575 0.68668 0.03287  0.06714  0.12202  529 TRP A CB  
3852 C CG  . TRP A 529 ? 0.66656 0.56792 0.69396 0.02607  0.06840  0.11474  529 TRP A CG  
3853 C CD1 . TRP A 529 ? 0.58409 0.51416 0.62423 0.01571  0.07280  0.12058  529 TRP A CD1 
3854 C CD2 . TRP A 529 ? 0.63585 0.56546 0.68019 0.02930  0.06484  0.10033  529 TRP A CD2 
3855 N NE1 . TRP A 529 ? 0.60950 0.57839 0.67204 0.01320  0.07057  0.11056  529 TRP A NE1 
3856 C CE2 . TRP A 529 ? 0.54515 0.51439 0.61034 0.01959  0.06582  0.09920  529 TRP A CE2 
3857 C CE3 . TRP A 529 ? 0.46337 0.38810 0.50497 0.03984  0.06131  0.08832  529 TRP A CE3 
3858 C CZ2 . TRP A 529 ? 0.54800 0.54741 0.62941 0.01779  0.06239  0.08842  529 TRP A CZ2 
3859 C CZ3 . TRP A 529 ? 0.55098 0.51214 0.61040 0.03742  0.05982  0.07762  529 TRP A CZ3 
3860 C CH2 . TRP A 529 ? 0.56917 0.56496 0.64744 0.02521  0.05988  0.07864  529 TRP A CH2 
3861 N N   . PRO A 530 ? 0.83898 0.68789 0.82658 -0.00526 0.08579  0.16011  530 PRO A N   
3862 C CA  . PRO A 530 ? 0.76430 0.62375 0.76195 -0.03214 0.09476  0.16868  530 PRO A CA  
3863 C C   . PRO A 530 ? 0.74849 0.66084 0.78089 -0.03980 0.09687  0.15852  530 PRO A C   
3864 O O   . PRO A 530 ? 0.65108 0.59182 0.69616 -0.02533 0.09232  0.14756  530 PRO A O   
3865 C CB  . PRO A 530 ? 0.77043 0.62585 0.74666 -0.02943 0.10183  0.18530  530 PRO A CB  
3866 C CG  . PRO A 530 ? 0.77579 0.64088 0.74332 -0.00087 0.09564  0.18103  530 PRO A CG  
3867 C CD  . PRO A 530 ? 0.74922 0.59822 0.71764 0.01463  0.08524  0.16838  530 PRO A CD  
3868 N N   . ASN A 531 ? 0.81191 0.73598 0.85901 -0.06389 0.10301  0.16278  531 ASN A N   
3869 C CA  . ASN A 531 ? 0.73341 0.70572 0.81274 -0.07105 0.10465  0.15463  531 ASN A CA  
3870 C C   . ASN A 531 ? 0.74388 0.75230 0.82758 -0.05604 0.10868  0.15375  531 ASN A C   
3871 O O   . ASN A 531 ? 0.76729 0.77200 0.83234 -0.05033 0.11527  0.16417  531 ASN A O   
3872 C CB  . ASN A 531 ? 0.68826 0.67100 0.78165 -0.09832 0.11160  0.16194  531 ASN A CB  
3873 C CG  . ASN A 531 ? 0.79621 0.76195 0.89870 -0.11477 0.10383  0.15526  531 ASN A CG  
3874 O OD1 . ASN A 531 ? 0.84697 0.76746 0.92959 -0.12557 0.10150  0.16048  531 ASN A OD1 
3875 N ND2 . ASN A 531 ? 0.79445 0.79237 0.92367 -0.11595 0.09824  0.14316  531 ASN A ND2 
3876 N N   . PHE A 532 ? 0.68319 0.72342 0.78848 -0.05021 0.10385  0.14124  532 PHE A N   
3877 C CA  . PHE A 532 ? 0.60060 0.67203 0.70996 -0.03689 0.10543  0.13739  532 PHE A CA  
3878 C C   . PHE A 532 ? 0.66896 0.77470 0.79812 -0.04694 0.11369  0.13851  532 PHE A C   
3879 O O   . PHE A 532 ? 0.68345 0.80186 0.83499 -0.05952 0.11153  0.13432  532 PHE A O   
3880 C CB  . PHE A 532 ? 0.60931 0.69028 0.72736 -0.02553 0.09408  0.12352  532 PHE A CB  
3881 C CG  . PHE A 532 ? 0.61397 0.72172 0.73592 -0.01426 0.09277  0.11729  532 PHE A CG  
3882 C CD1 . PHE A 532 ? 0.53462 0.66880 0.67549 -0.01772 0.09428  0.11237  532 PHE A CD1 
3883 C CD2 . PHE A 532 ? 0.65280 0.75850 0.75893 0.00084  0.08819  0.11509  532 PHE A CD2 
3884 C CE1 . PHE A 532 ? 0.58798 0.73978 0.72809 -0.00518 0.09167  0.10505  532 PHE A CE1 
3885 C CE2 . PHE A 532 ? 0.59468 0.71914 0.70063 0.01002  0.08508  0.10807  532 PHE A CE2 
3886 C CZ  . PHE A 532 ? 0.53857 0.68299 0.65973 0.00757  0.08691  0.10275  532 PHE A CZ  
3887 N N   . SER A 533 ? 0.77105 0.89413 0.89149 -0.04022 0.12294  0.14366  533 SER A N   
3888 C CA  . SER A 533 ? 0.63329 0.79610 0.77181 -0.04422 0.13234  0.14304  533 SER A CA  
3889 C C   . SER A 533 ? 0.66347 0.84184 0.78760 -0.02524 0.13600  0.13991  533 SER A C   
3890 O O   . SER A 533 ? 0.72392 0.88152 0.82311 -0.01362 0.13234  0.14168  533 SER A O   
3891 C CB  . SER A 533 ? 0.61275 0.78035 0.75289 -0.06524 0.14567  0.15735  533 SER A CB  
3892 O OG  . SER A 533 ? 0.67425 0.83273 0.78605 -0.06138 0.15574  0.16924  533 SER A OG  
3893 N N   . LYS A 534 ? 0.67121 0.88732 0.81084 -0.02076 0.14228  0.13408  534 LYS A N   
3894 C CA  . LYS A 534 ? 0.67095 0.90166 0.79381 -0.00259 0.14702  0.12988  534 LYS A CA  
3895 C C   . LYS A 534 ? 0.65722 0.87667 0.74977 -0.00431 0.15857  0.14443  534 LYS A C   
3896 O O   . LYS A 534 ? 0.61162 0.81958 0.67752 0.01065  0.15551  0.14297  534 LYS A O   
3897 C CB  . LYS A 534 ? 0.76740 1.04230 0.91188 0.00259  0.15477  0.12214  534 LYS A CB  
3898 C CG  . LYS A 534 ? 0.79708 1.08672 0.92380 0.02402  0.15875  0.11383  534 LYS A CG  
3899 C CD  . LYS A 534 ? 0.87937 1.21605 1.02825 0.03095  0.16873  0.10643  534 LYS A CD  
3900 C CE  . LYS A 534 ? 1.08104 1.42164 1.25048 0.04319  0.15335  0.08988  534 LYS A CE  
3901 N NZ  . LYS A 534 ? 1.18742 1.50308 1.33239 0.06356  0.14036  0.07689  534 LYS A NZ  
3902 N N   . GLU A 535 ? 0.60503 0.82570 0.69937 -0.02409 0.17068  0.15931  535 GLU A N   
3903 C CA  . GLU A 535 ? 0.63601 0.84140 0.69817 -0.02902 0.18186  0.17629  535 GLU A CA  
3904 C C   . GLU A 535 ? 0.71111 0.86881 0.74408 -0.02150 0.17036  0.18140  535 GLU A C   
3905 O O   . GLU A 535 ? 0.71963 0.86401 0.71953 -0.01401 0.17405  0.19065  535 GLU A O   
3906 C CB  . GLU A 535 ? 0.72429 0.93412 0.79433 -0.05682 0.19490  0.19228  535 GLU A CB  
3907 C CG  . GLU A 535 ? 0.97416 1.23816 1.08204 -0.06730 0.20498  0.18728  535 GLU A CG  
3908 C CD  . GLU A 535 ? 1.11530 1.38568 1.25878 -0.06964 0.19126  0.17380  535 GLU A CD  
3909 O OE1 . GLU A 535 ? 1.11055 1.41072 1.27375 -0.05317 0.18668  0.15810  535 GLU A OE1 
3910 O OE2 . GLU A 535 ? 1.19660 1.43856 1.34475 -0.08713 0.18414  0.17873  535 GLU A OE2 
3911 N N   . ASP A 536 ? 0.73790 0.87161 0.78179 -0.02241 0.15647  0.17557  536 ASP A N   
3912 C CA  . ASP A 536 ? 0.73242 0.82510 0.75326 -0.01385 0.14545  0.17929  536 ASP A CA  
3913 C C   . ASP A 536 ? 0.68346 0.77471 0.72253 -0.00512 0.13023  0.16340  536 ASP A C   
3914 O O   . ASP A 536 ? 0.74931 0.82088 0.79768 -0.01267 0.12417  0.16210  536 ASP A O   
3915 C CB  . ASP A 536 ? 0.75315 0.80805 0.76034 -0.03034 0.14852  0.19512  536 ASP A CB  
3916 C CG  . ASP A 536 ? 0.74998 0.76171 0.73055 -0.01672 0.13720  0.19903  536 ASP A CG  
3917 O OD1 . ASP A 536 ? 0.82032 0.83751 0.79041 0.00378  0.12970  0.19307  536 ASP A OD1 
3918 O OD2 . ASP A 536 ? 0.77808 0.75073 0.74815 -0.02553 0.13468  0.20711  536 ASP A OD2 
3919 N N   . PRO A 537 ? 0.60593 0.71647 0.64796 0.00980  0.12368  0.15098  537 PRO A N   
3920 C CA  . PRO A 537 ? 0.66193 0.77433 0.72085 0.01483  0.10998  0.13677  537 PRO A CA  
3921 C C   . PRO A 537 ? 0.61970 0.70836 0.66597 0.02335  0.09966  0.13725  537 PRO A C   
3922 O O   . PRO A 537 ? 0.58170 0.67698 0.62443 0.03518  0.08984  0.12924  537 PRO A O   
3923 C CB  . PRO A 537 ? 0.55436 0.69031 0.61352 0.02650  0.10690  0.12557  537 PRO A CB  
3924 C CG  . PRO A 537 ? 0.52190 0.65743 0.55254 0.03506  0.11404  0.13375  537 PRO A CG  
3925 C CD  . PRO A 537 ? 0.53777 0.66401 0.56146 0.02255  0.12750  0.15006  537 PRO A CD  
3926 N N   . VAL A 538 ? 0.61441 0.67537 0.65310 0.01738  0.10157  0.14661  538 VAL A N   
3927 C CA  . VAL A 538 ? 0.63560 0.67315 0.66187 0.02852  0.09268  0.14714  538 VAL A CA  
3928 C C   . VAL A 538 ? 0.62251 0.66441 0.66958 0.02689  0.08450  0.13452  538 VAL A C   
3929 O O   . VAL A 538 ? 0.60888 0.65321 0.67362 0.01283  0.08651  0.13074  538 VAL A O   
3930 C CB  . VAL A 538 ? 0.66992 0.66889 0.67449 0.02452  0.09726  0.16188  538 VAL A CB  
3931 C CG1 . VAL A 538 ? 0.59973 0.58656 0.61683 0.00265  0.10335  0.16458  538 VAL A CG1 
3932 C CG2 . VAL A 538 ? 0.63390 0.60720 0.62370 0.04148  0.08726  0.16153  538 VAL A CG2 
3933 N N   . TYR A 539 ? 0.60589 0.65282 0.65115 0.04075  0.07507  0.12793  539 TYR A N   
3934 C CA  . TYR A 539 ? 0.60459 0.65761 0.66606 0.03956  0.06862  0.11694  539 TYR A CA  
3935 C C   . TYR A 539 ? 0.65123 0.69110 0.70224 0.05507  0.06330  0.11666  539 TYR A C   
3936 O O   . TYR A 539 ? 0.75342 0.78420 0.78615 0.06921  0.06151  0.12377  539 TYR A O   
3937 C CB  . TYR A 539 ? 0.58438 0.66799 0.66022 0.03856  0.06229  0.10637  539 TYR A CB  
3938 C CG  . TYR A 539 ? 0.65263 0.75128 0.71797 0.05027  0.05712  0.10615  539 TYR A CG  
3939 C CD1 . TYR A 539 ? 0.55949 0.66219 0.61459 0.05102  0.06093  0.10987  539 TYR A CD1 
3940 C CD2 . TYR A 539 ? 0.53975 0.65187 0.60548 0.06042  0.04822  0.10134  539 TYR A CD2 
3941 C CE1 . TYR A 539 ? 0.50100 0.61542 0.54310 0.06142  0.05467  0.10835  539 TYR A CE1 
3942 C CE2 . TYR A 539 ? 0.54087 0.66862 0.59769 0.06919  0.04135  0.10041  539 TYR A CE2 
3943 C CZ  . TYR A 539 ? 0.55832 0.68458 0.60162 0.06962  0.04386  0.10368  539 TYR A CZ  
3944 O OH  . TYR A 539 ? 0.56853 0.70844 0.59983 0.07839  0.03530  0.10159  539 TYR A OH  
3945 N N   . TYR A 540 ? 0.58345 0.62225 0.64473 0.05373  0.06070  0.10822  540 TYR A N   
3946 C CA  . TYR A 540 ? 0.54546 0.57666 0.59981 0.07088  0.05627  0.10486  540 TYR A CA  
3947 C C   . TYR A 540 ? 0.54279 0.61428 0.61149 0.07769  0.04981  0.09535  540 TYR A C   
3948 O O   . TYR A 540 ? 0.49035 0.58414 0.57485 0.06418  0.04890  0.08880  540 TYR A O   
3949 C CB  . TYR A 540 ? 0.53557 0.54197 0.58966 0.06592  0.05818  0.09997  540 TYR A CB  
3950 C CG  . TYR A 540 ? 0.56090 0.54859 0.60167 0.08701  0.05492  0.09691  540 TYR A CG  
3951 C CD1 . TYR A 540 ? 0.63167 0.57350 0.64779 0.09539  0.05513  0.10570  540 TYR A CD1 
3952 C CD2 . TYR A 540 ? 0.58272 0.59848 0.63447 0.09883  0.05163  0.08520  540 TYR A CD2 
3953 C CE1 . TYR A 540 ? 0.77225 0.69312 0.77399 0.11847  0.05078  0.10175  540 TYR A CE1 
3954 C CE2 . TYR A 540 ? 0.67067 0.67376 0.71162 0.12176  0.04906  0.08060  540 TYR A CE2 
3955 C CZ  . TYR A 540 ? 0.78680 0.74070 0.80232 0.13332  0.04797  0.08822  540 TYR A CZ  
3956 O OH  . TYR A 540 ? 0.86995 0.80804 0.87272 0.16029  0.04404  0.08231  540 TYR A OH  
3957 N N   . ILE A 541 ? 0.55154 0.63321 0.61440 0.09779  0.04439  0.09523  541 ILE A N   
3958 C CA  . ILE A 541 ? 0.54986 0.67567 0.62843 0.10200  0.03794  0.08676  541 ILE A CA  
3959 C C   . ILE A 541 ? 0.66726 0.80289 0.75285 0.11347  0.03782  0.07822  541 ILE A C   
3960 O O   . ILE A 541 ? 0.70759 0.82447 0.78085 0.13417  0.03694  0.07973  541 ILE A O   
3961 C CB  . ILE A 541 ? 0.59323 0.73710 0.66515 0.11557  0.03040  0.09081  541 ILE A CB  
3962 C CG1 . ILE A 541 ? 0.56825 0.70633 0.63148 0.10449  0.03110  0.09683  541 ILE A CG1 
3963 C CG2 . ILE A 541 ? 0.35570 0.54794 0.44635 0.11754  0.02314  0.08169  541 ILE A CG2 
3964 C CD1 . ILE A 541 ? 0.43690 0.58754 0.48770 0.11813  0.02308  0.10097  541 ILE A CD1 
3965 N N   . PHE A 542 ? 0.57226 0.73571 0.67513 0.10092  0.03870  0.06922  542 PHE A N   
3966 C CA  . PHE A 542 ? 0.51293 0.69590 0.62362 0.11108  0.04013  0.05970  542 PHE A CA  
3967 C C   . PHE A 542 ? 0.42175 0.65713 0.54718 0.11998  0.03410  0.05597  542 PHE A C   
3968 O O   . PHE A 542 ? 0.38042 0.64719 0.51883 0.10226  0.03103  0.05442  542 PHE A O   
3969 C CB  . PHE A 542 ? 0.54100 0.72624 0.65920 0.09131  0.04503  0.05309  542 PHE A CB  
3970 C CG  . PHE A 542 ? 0.46874 0.60736 0.57362 0.08689  0.04978  0.05382  542 PHE A CG  
3971 C CD1 . PHE A 542 ? 0.45911 0.56819 0.54921 0.10595  0.05149  0.05155  542 PHE A CD1 
3972 C CD2 . PHE A 542 ? 0.38540 0.50893 0.49188 0.06401  0.05114  0.05627  542 PHE A CD2 
3973 C CE1 . PHE A 542 ? 0.51729 0.58052 0.59334 0.09872  0.05434  0.05184  542 PHE A CE1 
3974 C CE2 . PHE A 542 ? 0.40402 0.48871 0.50035 0.05736  0.05418  0.05682  542 PHE A CE2 
3975 C CZ  . PHE A 542 ? 0.53107 0.58453 0.61165 0.07289  0.05570  0.05476  542 PHE A CZ  
3976 N N   . SER A 543 ? 0.38849 0.63239 0.51128 0.14730  0.03125  0.05454  543 SER A N   
3977 C CA  . SER A 543 ? 0.48340 0.78276 0.62271 0.15845  0.02442  0.05085  543 SER A CA  
3978 C C   . SER A 543 ? 0.55053 0.86351 0.69211 0.18872  0.02553  0.04346  543 SER A C   
3979 O O   . SER A 543 ? 0.44496 0.71223 0.56803 0.20449  0.02890  0.04336  543 SER A O   
3980 C CB  . SER A 543 ? 0.66257 0.96134 0.79399 0.16433  0.01477  0.05953  543 SER A CB  
3981 O OG  . SER A 543 ? 0.88318 1.23995 1.03307 0.16694  0.00612  0.05583  543 SER A OG  
3982 N N   . THR A 544 ? 0.58936 0.96615 0.75362 0.19677  0.02245  0.03651  544 THR A N   
3983 C CA  . THR A 544 ? 0.67062 1.06548 0.83799 0.23163  0.02252  0.02880  544 THR A CA  
3984 C C   . THR A 544 ? 0.70302 1.09264 0.86140 0.26082  0.01081  0.03498  544 THR A C   
3985 O O   . THR A 544 ? 0.60056 0.98125 0.75123 0.29549  0.00896  0.03092  544 THR A O   
3986 C CB  . THR A 544 ? 0.61341 1.08688 0.81133 0.23113  0.02573  0.01782  544 THR A CB  
3987 O OG1 . THR A 544 ? 0.63451 1.15866 0.85223 0.21287  0.01760  0.02140  544 THR A OG1 
3988 C CG2 . THR A 544 ? 0.57271 1.04650 0.77307 0.20956  0.03821  0.01106  544 THR A CG2 
3989 N N   . ASP A 545 ? 0.73583 1.12987 0.89287 0.24826  0.00215  0.04410  545 ASP A N   
3990 C CA  . ASP A 545 ? 0.73916 1.12370 0.88244 0.27050  -0.01030 0.05251  545 ASP A CA  
3991 C C   . ASP A 545 ? 0.71110 1.01701 0.81860 0.28602  -0.00893 0.06146  545 ASP A C   
3992 O O   . ASP A 545 ? 0.78539 1.04229 0.87510 0.26471  -0.00324 0.06924  545 ASP A O   
3993 C CB  . ASP A 545 ? 0.72222 1.12048 0.86669 0.24685  -0.01772 0.05917  545 ASP A CB  
3994 C CG  . ASP A 545 ? 0.64274 1.06154 0.78254 0.26840  -0.03330 0.06423  545 ASP A CG  
3995 O OD1 . ASP A 545 ? 0.59459 1.01790 0.73114 0.30344  -0.03934 0.06367  545 ASP A OD1 
3996 O OD2 . ASP A 545 ? 0.59778 1.02720 0.73550 0.25076  -0.04056 0.06818  545 ASP A OD2 
3997 N N   . ASP A 546 ? 0.67623 0.97031 0.77309 0.32298  -0.01431 0.06028  546 ASP A N   
3998 C CA  . ASP A 546 ? 0.82710 1.04241 0.88610 0.33885  -0.01520 0.06980  546 ASP A CA  
3999 C C   . ASP A 546 ? 0.83762 1.02791 0.87240 0.34431  -0.02578 0.08562  546 ASP A C   
4000 O O   . ASP A 546 ? 0.89327 1.01572 0.89274 0.35419  -0.02703 0.09674  546 ASP A O   
4001 C CB  . ASP A 546 ? 0.94618 1.15189 0.99900 0.37877  -0.01790 0.06121  546 ASP A CB  
4002 C CG  . ASP A 546 ? 1.09931 1.36462 1.16915 0.41229  -0.03080 0.05710  546 ASP A CG  
4003 O OD1 . ASP A 546 ? 1.12193 1.44164 1.21158 0.40056  -0.03747 0.05968  546 ASP A OD1 
4004 O OD2 . ASP A 546 ? 1.18678 1.44178 1.24841 0.44771  -0.03507 0.05031  546 ASP A OD2 
4005 N N   . LYS A 547 ? 0.72818 0.96975 0.77851 0.33618  -0.03359 0.08701  547 LYS A N   
4006 C CA  . LYS A 547 ? 0.68249 0.90904 0.70950 0.34172  -0.04460 0.10047  547 LYS A CA  
4007 C C   . LYS A 547 ? 0.69979 0.89407 0.71031 0.30888  -0.03754 0.11019  547 LYS A C   
4008 O O   . LYS A 547 ? 0.80636 0.97447 0.78875 0.31269  -0.04349 0.12299  547 LYS A O   
4009 C CB  . LYS A 547 ? 0.56930 0.86975 0.62006 0.35040  -0.05871 0.09540  547 LYS A CB  
4010 C CG  . LYS A 547 ? 0.63535 0.96783 0.69531 0.39228  -0.07069 0.09020  547 LYS A CG  
4011 C CD  . LYS A 547 ? 0.84692 1.25896 0.93590 0.38998  -0.08319 0.08283  547 LYS A CD  
4012 C CE  . LYS A 547 ? 1.03838 1.51878 1.17135 0.36776  -0.07529 0.06805  547 LYS A CE  
4013 N NZ  . LYS A 547 ? 1.15348 1.65922 1.30422 0.38516  -0.07037 0.05444  547 LYS A NZ  
4014 N N   . ILE A 548 ? 0.62739 0.82511 0.65365 0.27819  -0.02534 0.10440  548 ILE A N   
4015 C CA  . ILE A 548 ? 0.63579 0.81256 0.65079 0.24974  -0.01912 0.11144  548 ILE A CA  
4016 C C   . ILE A 548 ? 0.74730 0.85621 0.73482 0.24444  -0.00909 0.12211  548 ILE A C   
4017 O O   . ILE A 548 ? 0.90539 0.98179 0.88475 0.25780  -0.00674 0.12184  548 ILE A O   
4018 C CB  . ILE A 548 ? 0.59007 0.80195 0.63348 0.22018  -0.01304 0.10089  548 ILE A CB  
4019 C CG1 . ILE A 548 ? 0.60473 0.81048 0.66305 0.21363  -0.00283 0.09270  548 ILE A CG1 
4020 C CG2 . ILE A 548 ? 0.52944 0.80646 0.59721 0.21997  -0.02395 0.09217  548 ILE A CG2 
4021 C CD1 . ILE A 548 ? 0.59957 0.76968 0.65272 0.18779  0.00880  0.09523  548 ILE A CD1 
4022 N N   . GLU A 549 ? 0.73531 0.82261 0.70718 0.22510  -0.00345 0.13124  549 GLU A N   
4023 C CA  . GLU A 549 ? 0.77327 0.80523 0.72455 0.21268  0.00763  0.14127  549 GLU A CA  
4024 C C   . GLU A 549 ? 0.72214 0.76169 0.69753 0.18761  0.01817  0.13192  549 GLU A C   
4025 O O   . GLU A 549 ? 0.70643 0.77773 0.69917 0.17006  0.02011  0.12612  549 GLU A O   
4026 C CB  . GLU A 549 ? 0.81460 0.82662 0.73914 0.20355  0.01059  0.15546  549 GLU A CB  
4027 C CG  . GLU A 549 ? 0.62418 0.57884 0.52286 0.19322  0.02068  0.16945  549 GLU A CG  
4028 C CD  . GLU A 549 ? 0.86566 0.77478 0.73103 0.21656  0.01323  0.18153  549 GLU A CD  
4029 O OE1 . GLU A 549 ? 0.88497 0.80879 0.75380 0.24361  0.00088  0.17579  549 GLU A OE1 
4030 O OE2 . GLU A 549 ? 0.91013 0.76931 0.74496 0.20825  0.01909  0.19730  549 GLU A OE2 
4031 N N   . LYS A 550 ? 0.77077 0.77875 0.74481 0.18676  0.02340  0.12999  550 LYS A N   
4032 C CA  . LYS A 550 ? 0.75233 0.76942 0.74862 0.16498  0.03133  0.12029  550 LYS A CA  
4033 C C   . LYS A 550 ? 0.73969 0.74992 0.73629 0.13831  0.03978  0.12618  550 LYS A C   
4034 O O   . LYS A 550 ? 0.76556 0.80447 0.78380 0.12184  0.04223  0.11820  550 LYS A O   
4035 C CB  . LYS A 550 ? 0.78569 0.76611 0.77535 0.17031  0.03393  0.11658  550 LYS A CB  
4036 C CG  . LYS A 550 ? 0.83793 0.82114 0.82288 0.20253  0.02580  0.11102  550 LYS A CG  
4037 C CD  . LYS A 550 ? 0.86857 0.82485 0.85032 0.21001  0.02809  0.10147  550 LYS A CD  
4038 C CE  . LYS A 550 ? 0.97115 0.96738 0.96772 0.23754  0.02284  0.08804  550 LYS A CE  
4039 N NZ  . LYS A 550 ? 1.11063 1.15557 1.11811 0.25226  0.01438  0.09029  550 LYS A NZ  
4040 N N   . LEU A 551 ? 0.74360 0.71793 0.71566 0.13444  0.04410  0.14044  551 LEU A N   
4041 C CA  . LEU A 551 ? 0.76296 0.73681 0.73600 0.11143  0.05347  0.14627  551 LEU A CA  
4042 C C   . LEU A 551 ? 0.78528 0.78612 0.75324 0.11398  0.05168  0.14896  551 LEU A C   
4043 O O   . LEU A 551 ? 0.89126 0.88687 0.83795 0.13068  0.04558  0.15622  551 LEU A O   
4044 C CB  . LEU A 551 ? 0.74517 0.67098 0.69459 0.10188  0.06081  0.16089  551 LEU A CB  
4045 C CG  . LEU A 551 ? 0.78277 0.67076 0.72975 0.09757  0.06142  0.15899  551 LEU A CG  
4046 C CD1 . LEU A 551 ? 0.62441 0.46386 0.54540 0.08347  0.06775  0.17543  551 LEU A CD1 
4047 C CD2 . LEU A 551 ? 0.61000 0.52030 0.58733 0.08160  0.06410  0.14494  551 LEU A CD2 
4048 N N   . ALA A 552 ? 0.57640 0.60295 0.56102 0.09845  0.05608  0.14288  552 ALA A N   
4049 C CA  . ALA A 552 ? 0.58449 0.63495 0.56367 0.09996  0.05420  0.14202  552 ALA A CA  
4050 C C   . ALA A 552 ? 0.67882 0.73747 0.66703 0.08215  0.06421  0.14056  552 ALA A C   
4051 O O   . ALA A 552 ? 0.76102 0.81970 0.76893 0.06885  0.06855  0.13588  552 ALA A O   
4052 C CB  . ALA A 552 ? 0.60870 0.69375 0.60286 0.10706  0.04219  0.12925  552 ALA A CB  
4053 N N   . ARG A 553 ? 0.72975 0.79718 0.70262 0.08373  0.06725  0.14379  553 ARG A N   
4054 C CA  . ARG A 553 ? 0.64195 0.72145 0.62159 0.07168  0.07730  0.14168  553 ARG A CA  
4055 C C   . ARG A 553 ? 0.66277 0.76573 0.63993 0.07735  0.07136  0.13085  553 ARG A C   
4056 O O   . ARG A 553 ? 0.69392 0.81126 0.68886 0.07084  0.07073  0.11986  553 ARG A O   
4057 C CB  . ARG A 553 ? 0.47800 0.54218 0.43716 0.06634  0.09092  0.15719  553 ARG A CB  
4058 C CG  . ARG A 553 ? 0.71456 0.74737 0.67206 0.05820  0.09490  0.16817  553 ARG A CG  
4059 C CD  . ARG A 553 ? 0.81834 0.82654 0.74649 0.05352  0.10485  0.18714  553 ARG A CD  
4060 N NE  . ARG A 553 ? 0.96969 0.94944 0.90055 0.03715  0.11085  0.19610  553 ARG A NE  
4061 C CZ  . ARG A 553 ? 0.98422 0.92483 0.90250 0.04136  0.10420  0.20163  553 ARG A CZ  
4062 N NH1 . ARG A 553 ? 0.82344 0.75363 0.72869 0.06370  0.09174  0.19937  553 ARG A NH1 
4063 N NH2 . ARG A 553 ? 0.96923 0.88123 0.88772 0.02361  0.10924  0.20875  553 ARG A NH2 
4064 N N   . GLY A 554 ? 0.70917 0.81282 0.66197 0.09010  0.06502  0.13352  554 GLY A N   
4065 C CA  . GLY A 554 ? 0.65229 0.77172 0.59299 0.09556  0.05994  0.12460  554 GLY A CA  
4066 C C   . GLY A 554 ? 0.72908 0.86412 0.68647 0.09345  0.04666  0.10846  554 GLY A C   
4067 O O   . GLY A 554 ? 0.71016 0.85222 0.66565 0.09179  0.04603  0.09843  554 GLY A O   
4068 N N   . PRO A 555 ? 0.67528 0.81608 0.64703 0.09369  0.03549  0.10517  555 PRO A N   
4069 C CA  . PRO A 555 ? 0.64008 0.79684 0.62210 0.08921  0.02176  0.09152  555 PRO A CA  
4070 C C   . PRO A 555 ? 0.70491 0.86142 0.70575 0.07636  0.02346  0.08250  555 PRO A C   
4071 O O   . PRO A 555 ? 0.73319 0.89214 0.72927 0.07333  0.01531  0.07203  555 PRO A O   
4072 C CB  . PRO A 555 ? 0.47354 0.64226 0.46784 0.09254  0.01238  0.09236  555 PRO A CB  
4073 C CG  . PRO A 555 ? 0.48031 0.63826 0.45495 0.10744  0.01523  0.10501  555 PRO A CG  
4074 C CD  . PRO A 555 ? 0.62442 0.75968 0.59255 0.10306  0.03188  0.11401  555 PRO A CD  
4075 N N   . LEU A 556 ? 0.63738 0.78797 0.65675 0.06906  0.03217  0.08597  556 LEU A N   
4076 C CA  . LEU A 556 ? 0.55421 0.70335 0.58839 0.05896  0.03354  0.07875  556 LEU A CA  
4077 C C   . LEU A 556 ? 0.61467 0.76128 0.63849 0.06311  0.04163  0.07725  556 LEU A C   
4078 O O   . LEU A 556 ? 0.65877 0.80484 0.68411 0.06178  0.03700  0.06727  556 LEU A O   
4079 C CB  . LEU A 556 ? 0.60521 0.74970 0.65973 0.05043  0.04011  0.08284  556 LEU A CB  
4080 C CG  . LEU A 556 ? 0.79974 0.95015 0.86823 0.04450  0.03237  0.07959  556 LEU A CG  
4081 C CD1 . LEU A 556 ? 0.85643 0.99922 0.94076 0.03608  0.03885  0.08174  556 LEU A CD1 
4082 C CD2 . LEU A 556 ? 0.72541 0.88410 0.79686 0.03699  0.02011  0.06972  556 LEU A CD2 
4083 N N   . ALA A 557 ? 0.65931 0.80407 0.67089 0.06872  0.05378  0.08718  557 ALA A N   
4084 C CA  . ALA A 557 ? 0.62335 0.77311 0.62654 0.07279  0.06446  0.08614  557 ALA A CA  
4085 C C   . ALA A 557 ? 0.64481 0.79629 0.62823 0.08219  0.05609  0.07425  557 ALA A C   
4086 O O   . ALA A 557 ? 0.60496 0.75986 0.58901 0.08593  0.05840  0.06510  557 ALA A O   
4087 C CB  . ALA A 557 ? 0.40959 0.55757 0.39822 0.07473  0.07884  0.10073  557 ALA A CB  
4088 N N   . ALA A 558 ? 0.68827 0.83706 0.65374 0.08691  0.04483  0.07315  558 ALA A N   
4089 C CA  . ALA A 558 ? 0.68949 0.83635 0.63216 0.09429  0.03461  0.06109  558 ALA A CA  
4090 C C   . ALA A 558 ? 0.63225 0.77255 0.58575 0.08701  0.02012  0.04760  558 ALA A C   
4091 O O   . ALA A 558 ? 0.75291 0.88519 0.69584 0.09193  0.01710  0.03589  558 ALA A O   
4092 C CB  . ALA A 558 ? 0.67277 0.82103 0.59315 0.10015  0.02505  0.06453  558 ALA A CB  
4093 N N   . ARG A 559 ? 0.55703 0.69936 0.52895 0.07577  0.01094  0.04914  559 ARG A N   
4094 C CA  . ARG A 559 ? 0.71472 0.84946 0.69662 0.06455  -0.00210 0.03945  559 ARG A CA  
4095 C C   . ARG A 559 ? 0.60261 0.72530 0.58827 0.06642  0.00150  0.03253  559 ARG A C   
4096 O O   . ARG A 559 ? 0.65514 0.76179 0.62707 0.06739  -0.00973 0.02074  559 ARG A O   
4097 C CB  . ARG A 559 ? 0.79274 0.93623 0.79971 0.05198  -0.00397 0.04543  559 ARG A CB  
4098 C CG  . ARG A 559 ? 0.80096 0.95613 0.80856 0.04407  -0.01821 0.04344  559 ARG A CG  
4099 C CD  . ARG A 559 ? 0.86954 1.03797 0.90189 0.03445  -0.01649 0.04881  559 ARG A CD  
4100 N NE  . ARG A 559 ? 0.99284 1.16992 1.03114 0.01872  -0.03031 0.04327  559 ARG A NE  
4101 C CZ  . ARG A 559 ? 1.06291 1.26594 1.11384 0.01383  -0.03465 0.04548  559 ARG A CZ  
4102 N NH1 . ARG A 559 ? 1.03220 1.25045 1.08950 0.02681  -0.02755 0.05232  559 ARG A NH1 
4103 N NH2 . ARG A 559 ? 1.12773 1.34155 1.18424 -0.00402 -0.04629 0.04097  559 ARG A NH2 
4104 N N   . CYS A 560 ? 0.51390 0.64349 0.51713 0.06767  0.01617  0.03958  560 CYS A N   
4105 C CA  . CYS A 560 ? 0.58598 0.71096 0.60196 0.06829  0.01860  0.03470  560 CYS A CA  
4106 C C   . CYS A 560 ? 0.56957 0.70062 0.57592 0.08391  0.02930  0.03022  560 CYS A C   
4107 O O   . CYS A 560 ? 0.53231 0.66086 0.54580 0.08972  0.02870  0.02278  560 CYS A O   
4108 C CB  . CYS A 560 ? 0.56038 0.69420 0.60351 0.05907  0.02746  0.04431  560 CYS A CB  
4109 S SG  . CYS A 560 ? 0.55424 0.68169 0.60913 0.04270  0.01517  0.04539  560 CYS A SG  
4110 N N   . SER A 561 ? 0.52808 0.66882 0.51770 0.09169  0.03913  0.03497  561 SER A N   
4111 C CA  . SER A 561 ? 0.60525 0.75435 0.57857 0.10739  0.04940  0.02936  561 SER A CA  
4112 C C   . SER A 561 ? 0.60259 0.73396 0.55843 0.11797  0.03617  0.01151  561 SER A C   
4113 O O   . SER A 561 ? 0.62060 0.75714 0.57695 0.13144  0.04185  0.00284  561 SER A O   
4114 C CB  . SER A 561 ? 0.62941 0.78418 0.57740 0.11248  0.05642  0.03638  561 SER A CB  
4115 O OG  . SER A 561 ? 0.72278 0.89240 0.65776 0.12531  0.07184  0.03456  561 SER A OG  
4116 N N   . PHE A 562 ? 0.54015 0.65051 0.48030 0.11202  0.01771  0.00547  562 PHE A N   
4117 C CA  . PHE A 562 ? 0.55204 0.63610 0.47180 0.11868  0.00189  -0.01142 562 PHE A CA  
4118 C C   . PHE A 562 ? 0.62866 0.70245 0.56664 0.11964  -0.00183 -0.01635 562 PHE A C   
4119 O O   . PHE A 562 ? 0.64790 0.71404 0.57601 0.13723  -0.00158 -0.02836 562 PHE A O   
4120 C CB  . PHE A 562 ? 0.60031 0.66618 0.50610 0.10470  -0.01815 -0.01419 562 PHE A CB  
4121 C CG  . PHE A 562 ? 0.73304 0.76348 0.61713 0.10500  -0.03783 -0.03014 562 PHE A CG  
4122 C CD1 . PHE A 562 ? 0.67813 0.69154 0.52699 0.12136  -0.04251 -0.04502 562 PHE A CD1 
4123 C CD2 . PHE A 562 ? 0.69706 0.70748 0.59226 0.08855  -0.05203 -0.03029 562 PHE A CD2 
4124 C CE1 . PHE A 562 ? 0.71240 0.68523 0.53682 0.12186  -0.06229 -0.06057 562 PHE A CE1 
4125 C CE2 . PHE A 562 ? 0.77941 0.74965 0.65028 0.08695  -0.07156 -0.04373 562 PHE A CE2 
4126 C CZ  . PHE A 562 ? 0.77694 0.72583 0.61169 0.10400  -0.07750 -0.05949 562 PHE A CZ  
4127 N N   . TRP A 563 ? 0.74093 0.81593 0.70489 0.10289  -0.00494 -0.00726 563 TRP A N   
4128 C CA  . TRP A 563 ? 0.68260 0.74331 0.65964 0.10231  -0.01249 -0.01130 563 TRP A CA  
4129 C C   . TRP A 563 ? 0.64188 0.72691 0.64022 0.11548  0.00287  -0.00989 563 TRP A C   
4130 O O   . TRP A 563 ? 0.65289 0.72835 0.65130 0.12904  -0.00237 -0.01945 563 TRP A O   
4131 C CB  . TRP A 563 ? 0.46532 0.52140 0.46008 0.07978  -0.02017 -0.00208 563 TRP A CB  
4132 C CG  . TRP A 563 ? 0.48230 0.51833 0.45963 0.06509  -0.03673 -0.00451 563 TRP A CG  
4133 C CD1 . TRP A 563 ? 0.54429 0.59458 0.52282 0.05306  -0.03672 0.00220  563 TRP A CD1 
4134 C CD2 . TRP A 563 ? 0.47622 0.47530 0.43270 0.05972  -0.05673 -0.01402 563 TRP A CD2 
4135 N NE1 . TRP A 563 ? 0.55363 0.58483 0.51682 0.03897  -0.05480 -0.00269 563 TRP A NE1 
4136 C CE2 . TRP A 563 ? 0.59615 0.59273 0.54383 0.04108  -0.06738 -0.01222 563 TRP A CE2 
4137 C CE3 . TRP A 563 ? 0.52733 0.49376 0.47052 0.06929  -0.06763 -0.02383 563 TRP A CE3 
4138 C CZ2 . TRP A 563 ? 0.51321 0.47580 0.43905 0.02777  -0.08789 -0.01915 563 TRP A CZ2 
4139 C CZ3 . TRP A 563 ? 0.54858 0.47429 0.46666 0.05826  -0.08870 -0.03057 563 TRP A CZ3 
4140 C CH2 . TRP A 563 ? 0.61778 0.54151 0.52701 0.03569  -0.09847 -0.02793 563 TRP A CH2 
4141 N N   . ASN A 564 ? 0.51127 0.62775 0.52734 0.11179  0.02097  0.00194  564 ASN A N   
4142 C CA  . ASN A 564 ? 0.52418 0.66874 0.56579 0.11785  0.03502  0.00529  564 ASN A CA  
4143 C C   . ASN A 564 ? 0.65490 0.82461 0.68890 0.13672  0.05115  0.00069  564 ASN A C   
4144 O O   . ASN A 564 ? 0.77216 0.96844 0.82702 0.14542  0.06077  -0.00062 564 ASN A O   
4145 C CB  . ASN A 564 ? 0.49035 0.65194 0.55659 0.09927  0.04464  0.02123  564 ASN A CB  
4146 C CG  . ASN A 564 ? 0.56602 0.70735 0.63957 0.08196  0.03067  0.02482  564 ASN A CG  
4147 O OD1 . ASN A 564 ? 0.62382 0.74413 0.69371 0.08208  0.01547  0.01746  564 ASN A OD1 
4148 N ND2 . ASN A 564 ? 0.47613 0.62229 0.55735 0.06770  0.03582  0.03616  564 ASN A ND2 
4149 N N   . ASP A 565 ? 0.60470 0.77020 0.60946 0.14366  0.05432  -0.00223 565 ASP A N   
4150 C CA  . ASP A 565 ? 0.63454 0.82526 0.62833 0.16187  0.07088  -0.00702 565 ASP A CA  
4151 C C   . ASP A 565 ? 0.62838 0.79743 0.58787 0.18309  0.06122  -0.02622 565 ASP A C   
4152 O O   . ASP A 565 ? 0.64031 0.82172 0.59967 0.20455  0.06629  -0.03849 565 ASP A O   
4153 C CB  . ASP A 565 ? 0.69690 0.90473 0.68085 0.15376  0.08685  0.00723  565 ASP A CB  
4154 C CG  . ASP A 565 ? 0.79914 1.01689 0.80972 0.13226  0.09339  0.02556  565 ASP A CG  
4155 O OD1 . ASP A 565 ? 0.84052 1.07138 0.88235 0.12654  0.09527  0.02769  565 ASP A OD1 
4156 O OD2 . ASP A 565 ? 0.82235 1.03290 0.82104 0.12219  0.09521  0.03713  565 ASP A OD2 
4157 N N   . TYR A 566 ? 0.70130 0.83878 0.63143 0.17828  0.04651  -0.03016 566 TYR A N   
4158 C CA  . TYR A 566 ? 0.78255 0.89846 0.67348 0.19706  0.03849  -0.04824 566 TYR A CA  
4159 C C   . TYR A 566 ? 0.76653 0.84629 0.65056 0.20672  0.01867  -0.06468 566 TYR A C   
4160 O O   . TYR A 566 ? 0.78146 0.85565 0.64818 0.23187  0.01909  -0.08134 566 TYR A O   
4161 C CB  . TYR A 566 ? 0.67484 0.77322 0.53633 0.18678  0.02904  -0.04602 566 TYR A CB  
4162 C CG  . TYR A 566 ? 0.72144 0.78651 0.53937 0.19979  0.01331  -0.06565 566 TYR A CG  
4163 C CD1 . TYR A 566 ? 0.74861 0.82210 0.53607 0.22207  0.02378  -0.07677 566 TYR A CD1 
4164 C CD2 . TYR A 566 ? 0.75648 0.78113 0.56158 0.18794  -0.01220 -0.07305 566 TYR A CD2 
4165 C CE1 . TYR A 566 ? 0.78218 0.82051 0.52510 0.23415  0.00779  -0.09661 566 TYR A CE1 
4166 C CE2 . TYR A 566 ? 0.86838 0.85798 0.63155 0.19690  -0.02857 -0.09131 566 TYR A CE2 
4167 C CZ  . TYR A 566 ? 0.82936 0.82391 0.56054 0.22083  -0.01925 -0.10387 566 TYR A CZ  
4168 O OH  . TYR A 566 ? 0.83392 0.78874 0.51996 0.22927  -0.03747 -0.12360 566 TYR A OH  
4169 N N   . LEU A 567 ? 0.72994 0.78400 0.62540 0.18777  0.00142  -0.06007 567 LEU A N   
4170 C CA  . LEU A 567 ? 0.76712 0.77778 0.64978 0.19326  -0.02010 -0.07335 567 LEU A CA  
4171 C C   . LEU A 567 ? 0.84533 0.86506 0.74362 0.21601  -0.01573 -0.08104 567 LEU A C   
4172 O O   . LEU A 567 ? 0.86860 0.85441 0.74179 0.23629  -0.02886 -0.09855 567 LEU A O   
4173 C CB  . LEU A 567 ? 0.71665 0.70481 0.61079 0.16518  -0.03627 -0.06344 567 LEU A CB  
4174 C CG  . LEU A 567 ? 0.78805 0.72032 0.65038 0.15972  -0.06268 -0.07503 567 LEU A CG  
4175 C CD1 . LEU A 567 ? 0.78449 0.69834 0.60664 0.16477  -0.06972 -0.08720 567 LEU A CD1 
4176 C CD2 . LEU A 567 ? 0.72541 0.64509 0.60042 0.12846  -0.07503 -0.06285 567 LEU A CD2 
4177 N N   . PRO A 568 ? 0.77357 0.83594 0.71124 0.21450  0.00031  -0.06973 568 PRO A N   
4178 C CA  . PRO A 568 ? 0.72694 0.80989 0.68122 0.23986  0.00619  -0.07839 568 PRO A CA  
4179 C C   . PRO A 568 ? 0.86145 0.94954 0.78966 0.27210  0.01311  -0.09689 568 PRO A C   
4180 O O   . PRO A 568 ? 0.96508 1.03930 0.88739 0.29828  0.00460  -0.11231 568 PRO A O   
4181 C CB  . PRO A 568 ? 0.60033 0.73976 0.59717 0.22858  0.02768  -0.06183 568 PRO A CB  
4182 C CG  . PRO A 568 ? 0.61903 0.74735 0.62476 0.19686  0.02302  -0.04557 568 PRO A CG  
4183 C CD  . PRO A 568 ? 0.65574 0.74693 0.62475 0.18943  0.01119  -0.04945 568 PRO A CD  
4184 N N   . LYS A 569 ? 0.85331 0.95984 0.76326 0.27255  0.02787  -0.09611 569 LYS A N   
4185 C CA  . LYS A 569 ? 0.86844 0.98286 0.74998 0.30341  0.03661  -0.11417 569 LYS A CA  
4186 C C   . LYS A 569 ? 1.00988 1.06044 0.84474 0.31691  0.01224  -0.13468 569 LYS A C   
4187 O O   . LYS A 569 ? 1.16615 1.20774 0.98024 0.34956  0.01095  -0.15515 569 LYS A O   
4188 C CB  . LYS A 569 ? 0.88730 1.03534 0.75691 0.29758  0.05809  -0.10586 569 LYS A CB  
4189 C CG  . LYS A 569 ? 0.80853 1.00338 0.71615 0.27403  0.07775  -0.08153 569 LYS A CG  
4190 C CD  . LYS A 569 ? 0.88711 1.11340 0.77779 0.27326  0.09979  -0.07413 569 LYS A CD  
4191 C CE  . LYS A 569 ? 0.88097 1.13192 0.79691 0.24437  0.11259  -0.04837 569 LYS A CE  
4192 N NZ  . LYS A 569 ? 0.97270 1.26741 0.88154 0.24721  0.13984  -0.04000 569 LYS A NZ  
4193 N N   . VAL A 570 ? 1.00870 1.01492 0.82567 0.29212  -0.00743 -0.13015 570 VAL A N   
4194 C CA  . VAL A 570 ? 0.99167 0.93216 0.76482 0.29886  -0.03350 -0.14828 570 VAL A CA  
4195 C C   . VAL A 570 ? 1.09735 1.00697 0.87398 0.31703  -0.04823 -0.15888 570 VAL A C   
4196 O O   . VAL A 570 ? 1.19193 1.06138 0.93296 0.34355  -0.06065 -0.18046 570 VAL A O   
4197 C CB  . VAL A 570 ? 0.91531 0.82231 0.67761 0.26363  -0.05187 -0.13860 570 VAL A CB  
4198 C CG1 . VAL A 570 ? 0.91651 0.75178 0.63709 0.26483  -0.08133 -0.15541 570 VAL A CG1 
4199 C CG2 . VAL A 570 ? 0.77889 0.71086 0.52927 0.25288  -0.04100 -0.13199 570 VAL A CG2 
4200 N N   . ARG A 571 ? 1.14642 1.07403 0.96432 0.30522  -0.04721 -0.14427 571 ARG A N   
4201 C CA  . ARG A 571 ? 1.10215 1.00215 0.92585 0.32105  -0.06259 -0.15100 571 ARG A CA  
4202 C C   . ARG A 571 ? 1.17226 1.09125 0.99376 0.36575  -0.05423 -0.16977 571 ARG A C   
4203 O O   . ARG A 571 ? 1.24686 1.12981 1.05929 0.38751  -0.07148 -0.18116 571 ARG A O   
4204 C CB  . ARG A 571 ? 1.03488 0.96308 0.90554 0.30017  -0.05930 -0.13072 571 ARG A CB  
4205 C CG  . ARG A 571 ? 1.06868 0.96914 0.93837 0.26031  -0.07205 -0.11526 571 ARG A CG  
4206 C CD  . ARG A 571 ? 1.07997 1.02454 0.99539 0.23676  -0.05964 -0.09401 571 ARG A CD  
4207 N NE  . ARG A 571 ? 1.12807 1.05126 1.04024 0.20111  -0.06945 -0.08109 571 ARG A NE  
4208 C CZ  . ARG A 571 ? 1.21021 1.16716 1.15173 0.17717  -0.05794 -0.06376 571 ARG A CZ  
4209 N NH1 . ARG A 571 ? 1.19497 1.20390 1.16979 0.18187  -0.03724 -0.05618 571 ARG A NH1 
4210 N NH2 . ARG A 571 ? 1.24215 1.18125 1.17925 0.14818  -0.06728 -0.05435 571 ARG A NH2 
4211 N N   . SER A 572 ? 1.26264 1.23744 1.09080 0.38081  -0.02837 -0.17313 572 SER A N   
4212 C CA  . SER A 572 ? 1.36584 1.36634 1.19041 0.42489  -0.01768 -0.19276 572 SER A CA  
4213 C C   . SER A 572 ? 1.42098 1.36251 1.18498 0.44782  -0.03216 -0.21755 572 SER A C   
4214 O O   . SER A 572 ? 1.26549 1.22089 1.00325 0.45505  -0.01896 -0.22561 572 SER A O   
4215 C CB  . SER A 572 ? 1.34224 1.42822 1.19717 0.42793  0.01691  -0.18486 572 SER A CB  
4216 O OG  . SER A 572 ? 1.21723 1.34302 1.11866 0.39526  0.02706  -0.15948 572 SER A OG  
4217 N N   . TRP A 573 ? 1.61958 1.48890 1.35785 0.45656  -0.06159 -0.22871 573 TRP A N   
4218 C CA  . TRP A 573 ? 1.82131 1.62385 1.50241 0.48721  -0.08058 -0.25636 573 TRP A CA  
4219 C C   . TRP A 573 ? 1.86044 1.66070 1.49875 0.49493  -0.07169 -0.27091 573 TRP A C   
4220 O O   . TRP A 573 ? 1.91306 1.64443 1.49623 0.50785  -0.09209 -0.29170 573 TRP A O   
4221 C CB  . TRP A 573 ? 1.91247 1.72944 1.60424 0.53000  -0.07999 -0.27029 573 TRP A CB  
4222 C CG  . TRP A 573 ? 1.94916 1.77216 1.68174 0.52801  -0.08949 -0.25774 573 TRP A CG  
4223 C CD1 . TRP A 573 ? 1.88237 1.76597 1.67070 0.51091  -0.07461 -0.23754 573 TRP A CD1 
4224 C CD2 . TRP A 573 ? 2.01766 1.78467 1.73640 0.54035  -0.11671 -0.26257 573 TRP A CD2 
4225 N NE1 . TRP A 573 ? 1.87160 1.73991 1.68062 0.51567  -0.09142 -0.23209 573 TRP A NE1 
4226 C CE2 . TRP A 573 ? 1.94009 1.73760 1.70678 0.53233  -0.11698 -0.24600 573 TRP A CE2 
4227 C CE3 . TRP A 573 ? 2.10535 1.79861 1.77405 0.55664  -0.14145 -0.27843 573 TRP A CE3 
4228 C CZ2 . TRP A 573 ? 1.94285 1.69984 1.70717 0.54033  -0.14085 -0.24470 573 TRP A CZ2 
4229 C CZ3 . TRP A 573 ? 2.12829 1.78046 1.79493 0.56470  -0.16471 -0.27661 573 TRP A CZ3 
4230 C CH2 . TRP A 573 ? 2.04754 1.73195 1.76106 0.55664  -0.16408 -0.25977 573 TRP A CH2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   VAL 1   1   ?   ?   ?   A . n 
A 1 2   ILE 2   2   ?   ?   ?   A . n 
A 1 3   ASP 3   3   3   ASP ASP A . n 
A 1 4   ARG 4   4   4   ARG ARG A . n 
A 1 5   LEU 5   5   5   LEU LEU A . n 
A 1 6   VAL 6   6   6   VAL VAL A . n 
A 1 7   VAL 7   7   7   VAL VAL A . n 
A 1 8   GLN 8   8   8   GLN GLN A . n 
A 1 9   THR 9   9   9   THR THR A . n 
A 1 10  SER 10  10  10  SER SER A . n 
A 1 11  SER 11  11  11  SER SER A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  PRO 13  13  13  PRO PRO A . n 
A 1 14  VAL 14  14  14  VAL VAL A . n 
A 1 15  ARG 15  15  15  ARG ARG A . n 
A 1 16  GLY 16  16  16  GLY GLY A . n 
A 1 17  ARG 17  17  17  ARG ARG A . n 
A 1 18  SER 18  18  18  SER SER A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  THR 20  20  20  THR THR A . n 
A 1 21  VAL 21  21  21  VAL VAL A . n 
A 1 22  GLN 22  22  22  GLN GLN A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  ARG 24  24  24  ARG ARG A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  VAL 26  26  26  VAL VAL A . n 
A 1 27  HIS 27  27  27  HIS HIS A . n 
A 1 28  VAL 28  28  28  VAL VAL A . n 
A 1 29  TYR 29  29  29  TYR TYR A . n 
A 1 30  THR 30  30  30  THR THR A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  ILE 32  32  32  ILE ILE A . n 
A 1 33  PRO 33  33  33  PRO PRO A . n 
A 1 34  TYR 34  34  34  TYR TYR A . n 
A 1 35  ALA 35  35  35  ALA ALA A . n 
A 1 36  LYS 36  36  36  LYS LYS A . n 
A 1 37  PRO 37  37  37  PRO PRO A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  VAL 39  39  39  VAL VAL A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  ASP 41  41  41  ASP ASP A . n 
A 1 42  LEU 42  42  42  LEU LEU A . n 
A 1 43  ARG 43  43  43  ARG ARG A . n 
A 1 44  PHE 44  44  44  PHE PHE A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  PRO 47  47  47  PRO PRO A . n 
A 1 48  VAL 48  48  48  VAL VAL A . n 
A 1 49  PRO 49  49  49  PRO PRO A . n 
A 1 50  ALA 50  50  50  ALA ALA A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  TRP 53  53  53  TRP TRP A . n 
A 1 54  HIS 54  54  54  HIS HIS A . n 
A 1 55  GLY 55  55  55  GLY GLY A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  LEU 57  57  57  LEU LEU A . n 
A 1 58  ASP 58  58  58  ASP ASP A . n 
A 1 59  ALA 59  59  59  ALA ALA A . n 
A 1 60  THR 60  60  60  THR THR A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  SER 63  63  63  SER SER A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  THR 65  65  65  THR THR A . n 
A 1 66  CYS 66  66  66  CYS CYS A . n 
A 1 67  VAL 67  67  67  VAL VAL A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLU 69  69  69  GLU GLU A . n 
A 1 70  ARG 70  70  70  ARG ARG A . n 
A 1 71  TYR 71  71  71  TYR TYR A . n 
A 1 72  GLU 72  72  72  GLU GLU A . n 
A 1 73  TYR 73  73  73  TYR TYR A . n 
A 1 74  PHE 74  74  74  PHE PHE A . n 
A 1 75  PRO 75  75  75  PRO PRO A . n 
A 1 76  GLY 76  76  76  GLY GLY A . n 
A 1 77  PHE 77  77  77  PHE PHE A . n 
A 1 78  SER 78  78  78  SER SER A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  GLU 80  80  80  GLU GLU A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  ILE 82  82  82  ILE ILE A . n 
A 1 83  TRP 83  83  83  TRP TRP A . n 
A 1 84  ASN 84  84  84  ASN ASN A . n 
A 1 85  PRO 85  85  85  PRO PRO A . n 
A 1 86  ASN 86  86  86  ASN ASN A . n 
A 1 87  THR 87  87  87  THR THR A . n 
A 1 88  ASN 88  88  88  ASN ASN A . n 
A 1 89  VAL 89  89  89  VAL VAL A . n 
A 1 90  SER 90  90  90  SER SER A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  ASP 92  92  92  ASP ASP A . n 
A 1 93  CYS 93  93  93  CYS CYS A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  TYR 95  95  95  TYR TYR A . n 
A 1 96  ILE 96  96  96  ILE ILE A . n 
A 1 97  ASN 97  97  97  ASN ASN A . n 
A 1 98  VAL 98  98  98  VAL VAL A . n 
A 1 99  TRP 99  99  99  TRP TRP A . n 
A 1 100 ALA 100 100 100 ALA ALA A . n 
A 1 101 PRO 101 101 101 PRO PRO A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 LYS 103 103 ?   ?   ?   A . n 
A 1 104 ALA 104 104 ?   ?   ?   A . n 
A 1 105 ARG 105 105 ?   ?   ?   A . n 
A 1 106 LEU 106 106 ?   ?   ?   A . n 
A 1 107 ARG 107 107 ?   ?   ?   A . n 
A 1 108 HIS 108 108 ?   ?   ?   A . n 
A 1 109 GLY 109 109 ?   ?   ?   A . n 
A 1 110 ARG 110 110 ?   ?   ?   A . n 
A 1 111 GLY 111 111 ?   ?   ?   A . n 
A 1 112 ALA 112 112 ?   ?   ?   A . n 
A 1 113 ASN 113 113 ?   ?   ?   A . n 
A 1 114 GLY 114 114 ?   ?   ?   A . n 
A 1 115 GLY 115 115 ?   ?   ?   A . n 
A 1 116 GLU 116 116 ?   ?   ?   A . n 
A 1 117 HIS 117 117 ?   ?   ?   A . n 
A 1 118 PRO 118 118 ?   ?   ?   A . n 
A 1 119 ASN 119 119 ?   ?   ?   A . n 
A 1 120 GLY 120 120 ?   ?   ?   A . n 
A 1 121 LYS 121 121 ?   ?   ?   A . n 
A 1 122 GLN 122 122 ?   ?   ?   A . n 
A 1 123 ALA 123 123 ?   ?   ?   A . n 
A 1 124 ASP 124 124 ?   ?   ?   A . n 
A 1 125 THR 125 125 ?   ?   ?   A . n 
A 1 126 ASP 126 126 ?   ?   ?   A . n 
A 1 127 HIS 127 127 ?   ?   ?   A . n 
A 1 128 LEU 128 128 ?   ?   ?   A . n 
A 1 129 ILE 129 129 ?   ?   ?   A . n 
A 1 130 HIS 130 130 ?   ?   ?   A . n 
A 1 131 ASN 131 131 ?   ?   ?   A . n 
A 1 132 GLY 132 132 ?   ?   ?   A . n 
A 1 133 ASN 133 133 ?   ?   ?   A . n 
A 1 134 PRO 134 134 ?   ?   ?   A . n 
A 1 135 GLN 135 135 ?   ?   ?   A . n 
A 1 136 ASN 136 136 ?   ?   ?   A . n 
A 1 137 THR 137 137 137 THR THR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 ASN 139 139 139 ASN ASN A . n 
A 1 140 GLY 140 140 140 GLY GLY A . n 
A 1 141 LEU 141 141 141 LEU LEU A . n 
A 1 142 PRO 142 142 142 PRO PRO A . n 
A 1 143 ILE 143 143 143 ILE ILE A . n 
A 1 144 LEU 144 144 144 LEU LEU A . n 
A 1 145 ILE 145 145 145 ILE ILE A . n 
A 1 146 TRP 146 146 146 TRP TRP A . n 
A 1 147 ILE 147 147 147 ILE ILE A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 GLY 149 149 149 GLY GLY A . n 
A 1 150 GLY 150 150 150 GLY GLY A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 PHE 152 152 152 PHE PHE A . n 
A 1 153 MET 153 153 153 MET MET A . n 
A 1 154 THR 154 154 154 THR THR A . n 
A 1 155 GLY 155 155 155 GLY GLY A . n 
A 1 156 SER 156 156 156 SER SER A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 THR 158 158 158 THR THR A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 ASP 160 160 160 ASP ASP A . n 
A 1 161 ILE 161 161 161 ILE ILE A . n 
A 1 162 TYR 162 162 162 TYR TYR A . n 
A 1 163 ASN 163 163 163 ASN ASN A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 ASP 165 165 165 ASP ASP A . n 
A 1 166 ILE 166 166 166 ILE ILE A . n 
A 1 167 MET 167 167 167 MET MET A . n 
A 1 168 ALA 168 168 168 ALA ALA A . n 
A 1 169 ALA 169 169 169 ALA ALA A . n 
A 1 170 VAL 170 170 170 VAL VAL A . n 
A 1 171 GLY 171 171 171 GLY GLY A . n 
A 1 172 ASN 172 172 172 ASN ASN A . n 
A 1 173 VAL 173 173 173 VAL VAL A . n 
A 1 174 ILE 174 174 174 ILE ILE A . n 
A 1 175 VAL 175 175 175 VAL VAL A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 SER 177 177 177 SER SER A . n 
A 1 178 PHE 178 178 178 PHE PHE A . n 
A 1 179 GLN 179 179 179 GLN GLN A . n 
A 1 180 TYR 180 180 180 TYR TYR A . n 
A 1 181 ARG 181 181 181 ARG ARG A . n 
A 1 182 VAL 182 182 182 VAL VAL A . n 
A 1 183 GLY 183 183 183 GLY GLY A . n 
A 1 184 ALA 184 184 184 ALA ALA A . n 
A 1 185 PHE 185 185 185 PHE PHE A . n 
A 1 186 GLY 186 186 186 GLY GLY A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 LEU 188 188 188 LEU LEU A . n 
A 1 189 HIS 189 189 189 HIS HIS A . n 
A 1 190 LEU 190 190 190 LEU LEU A . n 
A 1 191 ALA 191 191 191 ALA ALA A . n 
A 1 192 PRO 192 192 192 PRO PRO A . n 
A 1 193 GLU 193 193 193 GLU GLU A . n 
A 1 194 MET 194 194 194 MET MET A . n 
A 1 195 PRO 195 195 195 PRO PRO A . n 
A 1 196 SER 196 196 196 SER SER A . n 
A 1 197 GLU 197 197 197 GLU GLU A . n 
A 1 198 PHE 198 198 198 PHE PHE A . n 
A 1 199 ALA 199 199 199 ALA ALA A . n 
A 1 200 GLU 200 200 200 GLU GLU A . n 
A 1 201 GLU 201 201 201 GLU GLU A . n 
A 1 202 ALA 202 202 202 ALA ALA A . n 
A 1 203 PRO 203 203 203 PRO PRO A . n 
A 1 204 GLY 204 204 204 GLY GLY A . n 
A 1 205 ASN 205 205 205 ASN ASN A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 LEU 208 208 208 LEU LEU A . n 
A 1 209 TRP 209 209 209 TRP TRP A . n 
A 1 210 ASP 210 210 210 ASP ASP A . n 
A 1 211 GLN 211 211 211 GLN GLN A . n 
A 1 212 ALA 212 212 212 ALA ALA A . n 
A 1 213 LEU 213 213 213 LEU LEU A . n 
A 1 214 ALA 214 214 214 ALA ALA A . n 
A 1 215 ILE 215 215 215 ILE ILE A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 TRP 217 217 217 TRP TRP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 LYS 219 219 219 LYS LYS A . n 
A 1 220 ASP 220 220 220 ASP ASP A . n 
A 1 221 ASN 221 221 221 ASN ASN A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 HIS 223 223 223 HIS HIS A . n 
A 1 224 ALA 224 224 224 ALA ALA A . n 
A 1 225 PHE 225 225 225 PHE PHE A . n 
A 1 226 GLY 226 226 226 GLY GLY A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 ASN 228 228 228 ASN ASN A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 GLU 230 230 230 GLU GLU A . n 
A 1 231 TRP 231 231 231 TRP TRP A . n 
A 1 232 MET 232 232 232 MET MET A . n 
A 1 233 THR 233 233 233 THR THR A . n 
A 1 234 LEU 234 234 234 LEU LEU A . n 
A 1 235 PHE 235 235 235 PHE PHE A . n 
A 1 236 GLY 236 236 236 GLY GLY A . n 
A 1 237 GLU 237 237 237 GLU GLU A . n 
A 1 238 SER 238 238 238 SER SER A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLY 240 240 240 GLY GLY A . n 
A 1 241 SER 241 241 241 SER SER A . n 
A 1 242 SER 242 242 242 SER SER A . n 
A 1 243 SER 243 243 243 SER SER A . n 
A 1 244 VAL 244 244 244 VAL VAL A . n 
A 1 245 ASN 245 245 245 ASN ASN A . n 
A 1 246 ALA 246 246 246 ALA ALA A . n 
A 1 247 GLN 247 247 247 GLN GLN A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 MET 249 249 249 MET MET A . n 
A 1 250 SER 250 250 250 SER SER A . n 
A 1 251 PRO 251 251 251 PRO PRO A . n 
A 1 252 VAL 252 252 252 VAL VAL A . n 
A 1 253 THR 253 253 253 THR THR A . n 
A 1 254 ARG 254 254 254 ARG ARG A . n 
A 1 255 GLY 255 255 255 GLY GLY A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 VAL 257 257 257 VAL VAL A . n 
A 1 258 LYS 258 258 258 LYS LYS A . n 
A 1 259 ARG 259 259 259 ARG ARG A . n 
A 1 260 GLY 260 260 260 GLY GLY A . n 
A 1 261 MET 261 261 261 MET MET A . n 
A 1 262 MET 262 262 262 MET MET A . n 
A 1 263 GLN 263 263 263 GLN GLN A . n 
A 1 264 SER 264 264 264 SER SER A . n 
A 1 265 GLY 265 265 265 GLY GLY A . n 
A 1 266 THR 266 266 266 THR THR A . n 
A 1 267 MET 267 267 267 MET MET A . n 
A 1 268 ASN 268 268 268 ASN ASN A . n 
A 1 269 ALA 269 269 269 ALA ALA A . n 
A 1 270 PRO 270 270 270 PRO PRO A . n 
A 1 271 TRP 271 271 271 TRP TRP A . n 
A 1 272 SER 272 272 272 SER SER A . n 
A 1 273 HIS 273 273 273 HIS HIS A . n 
A 1 274 MET 274 274 274 MET MET A . n 
A 1 275 THR 275 275 275 THR THR A . n 
A 1 276 SER 276 276 276 SER SER A . n 
A 1 277 GLU 277 277 277 GLU GLU A . n 
A 1 278 LYS 278 278 278 LYS LYS A . n 
A 1 279 ALA 279 279 279 ALA ALA A . n 
A 1 280 VAL 280 280 280 VAL VAL A . n 
A 1 281 GLU 281 281 281 GLU GLU A . n 
A 1 282 ILE 282 282 282 ILE ILE A . n 
A 1 283 GLY 283 283 283 GLY GLY A . n 
A 1 284 LYS 284 284 284 LYS LYS A . n 
A 1 285 ALA 285 285 285 ALA ALA A . n 
A 1 286 LEU 286 286 286 LEU LEU A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 ASN 288 288 288 ASN ASN A . n 
A 1 289 ASP 289 289 289 ASP ASP A . n 
A 1 290 CYS 290 290 290 CYS CYS A . n 
A 1 291 ASN 291 291 291 ASN ASN A . n 
A 1 292 CYS 292 292 292 CYS CYS A . n 
A 1 293 ASN 293 293 293 ASN ASN A . n 
A 1 294 ALA 294 294 294 ALA ALA A . n 
A 1 295 SER 295 295 295 SER SER A . n 
A 1 296 MET 296 296 296 MET MET A . n 
A 1 297 LEU 297 297 297 LEU LEU A . n 
A 1 298 LYS 298 298 298 LYS LYS A . n 
A 1 299 THR 299 299 299 THR THR A . n 
A 1 300 ASN 300 300 300 ASN ASN A . n 
A 1 301 PRO 301 301 301 PRO PRO A . n 
A 1 302 ALA 302 302 302 ALA ALA A . n 
A 1 303 HIS 303 303 303 HIS HIS A . n 
A 1 304 VAL 304 304 304 VAL VAL A . n 
A 1 305 MET 305 305 305 MET MET A . n 
A 1 306 SER 306 306 306 SER SER A . n 
A 1 307 CYS 307 307 307 CYS CYS A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 ARG 309 309 309 ARG ARG A . n 
A 1 310 SER 310 310 310 SER SER A . n 
A 1 311 VAL 311 311 311 VAL VAL A . n 
A 1 312 ASP 312 312 312 ASP ASP A . n 
A 1 313 ALA 313 313 313 ALA ALA A . n 
A 1 314 LYS 314 314 314 LYS LYS A . n 
A 1 315 THR 315 315 315 THR THR A . n 
A 1 316 ILE 316 316 316 ILE ILE A . n 
A 1 317 SER 317 317 317 SER SER A . n 
A 1 318 VAL 318 318 318 VAL VAL A . n 
A 1 319 GLN 319 319 319 GLN GLN A . n 
A 1 320 GLN 320 320 320 GLN GLN A . n 
A 1 321 TRP 321 321 321 TRP TRP A . n 
A 1 322 ASN 322 322 322 ASN ASN A . n 
A 1 323 SER 323 323 323 SER SER A . n 
A 1 324 TYR 324 324 324 TYR TYR A . n 
A 1 325 SER 325 325 325 SER SER A . n 
A 1 326 GLY 326 326 326 GLY GLY A . n 
A 1 327 ILE 327 327 327 ILE ILE A . n 
A 1 328 LEU 328 328 328 LEU LEU A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PRO 331 331 331 PRO PRO A . n 
A 1 332 SER 332 332 332 SER SER A . n 
A 1 333 ALA 333 333 333 ALA ALA A . n 
A 1 334 PRO 334 334 334 PRO PRO A . n 
A 1 335 THR 335 335 335 THR THR A . n 
A 1 336 ILE 336 336 336 ILE ILE A . n 
A 1 337 ASP 337 337 337 ASP ASP A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 ALA 339 339 339 ALA ALA A . n 
A 1 340 PHE 340 340 340 PHE PHE A . n 
A 1 341 LEU 341 341 341 LEU LEU A . n 
A 1 342 PRO 342 342 342 PRO PRO A . n 
A 1 343 ALA 343 343 343 ALA ALA A . n 
A 1 344 ASP 344 344 344 ASP ASP A . n 
A 1 345 PRO 345 345 345 PRO PRO A . n 
A 1 346 MET 346 346 346 MET MET A . n 
A 1 347 THR 347 347 347 THR THR A . n 
A 1 348 LEU 348 348 348 LEU LEU A . n 
A 1 349 MET 349 349 349 MET MET A . n 
A 1 350 LYS 350 350 350 LYS LYS A . n 
A 1 351 THR 351 351 351 THR THR A . n 
A 1 352 ALA 352 352 352 ALA ALA A . n 
A 1 353 ASP 353 353 353 ASP ASP A . n 
A 1 354 LEU 354 354 354 LEU LEU A . n 
A 1 355 LYS 355 355 355 LYS LYS A . n 
A 1 356 ASP 356 356 356 ASP ASP A . n 
A 1 357 TYR 357 357 357 TYR TYR A . n 
A 1 358 ASP 358 358 358 ASP ASP A . n 
A 1 359 ILE 359 359 359 ILE ILE A . n 
A 1 360 LEU 360 360 360 LEU LEU A . n 
A 1 361 MET 361 361 361 MET MET A . n 
A 1 362 GLY 362 362 362 GLY GLY A . n 
A 1 363 ASN 363 363 363 ASN ASN A . n 
A 1 364 VAL 364 364 364 VAL VAL A . n 
A 1 365 ARG 365 365 365 ARG ARG A . n 
A 1 366 ASP 366 366 366 ASP ASP A . n 
A 1 367 GLU 367 367 367 GLU GLU A . n 
A 1 368 GLY 368 368 368 GLY GLY A . n 
A 1 369 THR 369 369 369 THR THR A . n 
A 1 370 TYR 370 370 370 TYR TYR A . n 
A 1 371 PHE 371 371 371 PHE PHE A . n 
A 1 372 LEU 372 372 372 LEU LEU A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 TYR 374 374 374 TYR TYR A . n 
A 1 375 ASP 375 375 375 ASP ASP A . n 
A 1 376 PHE 376 376 376 PHE PHE A . n 
A 1 377 ILE 377 377 377 ILE ILE A . n 
A 1 378 ASP 378 378 378 ASP ASP A . n 
A 1 379 TYR 379 379 379 TYR TYR A . n 
A 1 380 PHE 380 380 380 PHE PHE A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 LYS 382 382 382 LYS LYS A . n 
A 1 383 ASP 383 383 383 ASP ASP A . n 
A 1 384 ASP 384 384 384 ASP ASP A . n 
A 1 385 ALA 385 385 385 ALA ALA A . n 
A 1 386 THR 386 386 386 THR THR A . n 
A 1 387 ALA 387 387 387 ALA ALA A . n 
A 1 388 LEU 388 388 388 LEU LEU A . n 
A 1 389 PRO 389 389 389 PRO PRO A . n 
A 1 390 ARG 390 390 390 ARG ARG A . n 
A 1 391 ASP 391 391 391 ASP ASP A . n 
A 1 392 LYS 392 392 392 LYS LYS A . n 
A 1 393 TYR 393 393 393 TYR TYR A . n 
A 1 394 LEU 394 394 394 LEU LEU A . n 
A 1 395 GLU 395 395 395 GLU GLU A . n 
A 1 396 ILE 396 396 396 ILE ILE A . n 
A 1 397 MET 397 397 397 MET MET A . n 
A 1 398 ASN 398 398 398 ASN ASN A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 ILE 400 400 400 ILE ILE A . n 
A 1 401 PHE 401 401 401 PHE PHE A . n 
A 1 402 GLY 402 402 402 GLY GLY A . n 
A 1 403 LYS 403 403 403 LYS LYS A . n 
A 1 404 ALA 404 404 404 ALA ALA A . n 
A 1 405 THR 405 405 405 THR THR A . n 
A 1 406 GLN 406 406 406 GLN GLN A . n 
A 1 407 ALA 407 407 407 ALA ALA A . n 
A 1 408 GLU 408 408 408 GLU GLU A . n 
A 1 409 ARG 409 409 409 ARG ARG A . n 
A 1 410 GLU 410 410 410 GLU GLU A . n 
A 1 411 ALA 411 411 411 ALA ALA A . n 
A 1 412 ILE 412 412 412 ILE ILE A . n 
A 1 413 ILE 413 413 413 ILE ILE A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLN 415 415 415 GLN GLN A . n 
A 1 416 TYR 416 416 416 TYR TYR A . n 
A 1 417 THR 417 417 417 THR THR A . n 
A 1 418 SER 418 418 418 SER SER A . n 
A 1 419 TRP 419 419 419 TRP TRP A . n 
A 1 420 GLU 420 420 420 GLU GLU A . n 
A 1 421 GLY 421 421 421 GLY GLY A . n 
A 1 422 ASN 422 422 422 ASN ASN A . n 
A 1 423 PRO 423 423 423 PRO PRO A . n 
A 1 424 GLY 424 424 424 GLY GLY A . n 
A 1 425 TYR 425 425 425 TYR TYR A . n 
A 1 426 GLN 426 426 426 GLN GLN A . n 
A 1 427 ASN 427 427 427 ASN ASN A . n 
A 1 428 GLN 428 428 428 GLN GLN A . n 
A 1 429 GLN 429 429 429 GLN GLN A . n 
A 1 430 GLN 430 430 430 GLN GLN A . n 
A 1 431 ILE 431 431 431 ILE ILE A . n 
A 1 432 GLY 432 432 432 GLY GLY A . n 
A 1 433 ARG 433 433 433 ARG ARG A . n 
A 1 434 ALA 434 434 434 ALA ALA A . n 
A 1 435 VAL 435 435 435 VAL VAL A . n 
A 1 436 GLY 436 436 436 GLY GLY A . n 
A 1 437 ASP 437 437 437 ASP ASP A . n 
A 1 438 HIS 438 438 438 HIS HIS A . n 
A 1 439 PHE 439 439 439 PHE PHE A . n 
A 1 440 PHE 440 440 440 PHE PHE A . n 
A 1 441 THR 441 441 441 THR THR A . n 
A 1 442 CYS 442 442 442 CYS CYS A . n 
A 1 443 PRO 443 443 443 PRO PRO A . n 
A 1 444 THR 444 444 444 THR THR A . n 
A 1 445 ASN 445 445 445 ASN ASN A . n 
A 1 446 GLU 446 446 446 GLU GLU A . n 
A 1 447 TYR 447 447 447 TYR TYR A . n 
A 1 448 ALA 448 448 448 ALA ALA A . n 
A 1 449 GLN 449 449 449 GLN GLN A . n 
A 1 450 ALA 450 450 450 ALA ALA A . n 
A 1 451 LEU 451 451 451 LEU LEU A . n 
A 1 452 ALA 452 452 452 ALA ALA A . n 
A 1 453 GLU 453 453 453 GLU GLU A . n 
A 1 454 ARG 454 454 454 ARG ARG A . n 
A 1 455 GLY 455 455 455 GLY GLY A . n 
A 1 456 ALA 456 456 456 ALA ALA A . n 
A 1 457 SER 457 457 457 SER SER A . n 
A 1 458 VAL 458 458 458 VAL VAL A . n 
A 1 459 HIS 459 459 459 HIS HIS A . n 
A 1 460 TYR 460 460 460 TYR TYR A . n 
A 1 461 TYR 461 461 461 TYR TYR A . n 
A 1 462 TYR 462 462 462 TYR TYR A . n 
A 1 463 PHE 463 463 463 PHE PHE A . n 
A 1 464 THR 464 464 464 THR THR A . n 
A 1 465 HIS 465 465 465 HIS HIS A . n 
A 1 466 ARG 466 466 466 ARG ARG A . n 
A 1 467 THR 467 467 467 THR THR A . n 
A 1 468 SER 468 468 468 SER SER A . n 
A 1 469 THR 469 469 469 THR THR A . n 
A 1 470 SER 470 470 470 SER SER A . n 
A 1 471 LEU 471 471 471 LEU LEU A . n 
A 1 472 TRP 472 472 472 TRP TRP A . n 
A 1 473 GLY 473 473 473 GLY GLY A . n 
A 1 474 GLU 474 474 474 GLU GLU A . n 
A 1 475 TRP 475 475 475 TRP TRP A . n 
A 1 476 MET 476 476 476 MET MET A . n 
A 1 477 GLY 477 477 477 GLY GLY A . n 
A 1 478 VAL 478 478 478 VAL VAL A . n 
A 1 479 LEU 479 479 479 LEU LEU A . n 
A 1 480 HIS 480 480 480 HIS HIS A . n 
A 1 481 GLY 481 481 481 GLY GLY A . n 
A 1 482 ASP 482 482 482 ASP ASP A . n 
A 1 483 GLU 483 483 483 GLU GLU A . n 
A 1 484 ILE 484 484 484 ILE ILE A . n 
A 1 485 GLU 485 485 485 GLU GLU A . n 
A 1 486 TYR 486 486 486 TYR TYR A . n 
A 1 487 PHE 487 487 487 PHE PHE A . n 
A 1 488 PHE 488 488 488 PHE PHE A . n 
A 1 489 GLY 489 489 489 GLY GLY A . n 
A 1 490 GLN 490 490 490 GLN GLN A . n 
A 1 491 PRO 491 491 491 PRO PRO A . n 
A 1 492 LEU 492 492 492 LEU LEU A . n 
A 1 493 ASN 493 493 493 ASN ASN A . n 
A 1 494 ASN 494 494 494 ASN ASN A . n 
A 1 495 SER 495 495 495 SER SER A . n 
A 1 496 LEU 496 496 496 LEU LEU A . n 
A 1 497 GLN 497 497 497 GLN GLN A . n 
A 1 498 TYR 498 498 498 TYR TYR A . n 
A 1 499 ARG 499 499 499 ARG ARG A . n 
A 1 500 PRO 500 500 500 PRO PRO A . n 
A 1 501 VAL 501 501 501 VAL VAL A . n 
A 1 502 GLU 502 502 502 GLU GLU A . n 
A 1 503 ARG 503 503 503 ARG ARG A . n 
A 1 504 GLU 504 504 504 GLU GLU A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 GLY 506 506 506 GLY GLY A . n 
A 1 507 LYS 507 507 507 LYS LYS A . n 
A 1 508 ARG 508 508 508 ARG ARG A . n 
A 1 509 MET 509 509 509 MET MET A . n 
A 1 510 LEU 510 510 510 LEU LEU A . n 
A 1 511 SER 511 511 511 SER SER A . n 
A 1 512 ALA 512 512 512 ALA ALA A . n 
A 1 513 VAL 513 513 513 VAL VAL A . n 
A 1 514 ILE 514 514 514 ILE ILE A . n 
A 1 515 GLU 515 515 515 GLU GLU A . n 
A 1 516 PHE 516 516 516 PHE PHE A . n 
A 1 517 ALA 517 517 517 ALA ALA A . n 
A 1 518 LYS 518 518 518 LYS LYS A . n 
A 1 519 THR 519 519 519 THR THR A . n 
A 1 520 GLY 520 520 520 GLY GLY A . n 
A 1 521 ASN 521 521 521 ASN ASN A . n 
A 1 522 PRO 522 522 522 PRO PRO A . n 
A 1 523 ALA 523 523 523 ALA ALA A . n 
A 1 524 GLN 524 524 524 GLN GLN A . n 
A 1 525 ASP 525 525 525 ASP ASP A . n 
A 1 526 GLY 526 526 526 GLY GLY A . n 
A 1 527 GLU 527 527 527 GLU GLU A . n 
A 1 528 GLU 528 528 528 GLU GLU A . n 
A 1 529 TRP 529 529 529 TRP TRP A . n 
A 1 530 PRO 530 530 530 PRO PRO A . n 
A 1 531 ASN 531 531 531 ASN ASN A . n 
A 1 532 PHE 532 532 532 PHE PHE A . n 
A 1 533 SER 533 533 533 SER SER A . n 
A 1 534 LYS 534 534 534 LYS LYS A . n 
A 1 535 GLU 535 535 535 GLU GLU A . n 
A 1 536 ASP 536 536 536 ASP ASP A . n 
A 1 537 PRO 537 537 537 PRO PRO A . n 
A 1 538 VAL 538 538 538 VAL VAL A . n 
A 1 539 TYR 539 539 539 TYR TYR A . n 
A 1 540 TYR 540 540 540 TYR TYR A . n 
A 1 541 ILE 541 541 541 ILE ILE A . n 
A 1 542 PHE 542 542 542 PHE PHE A . n 
A 1 543 SER 543 543 543 SER SER A . n 
A 1 544 THR 544 544 544 THR THR A . n 
A 1 545 ASP 545 545 545 ASP ASP A . n 
A 1 546 ASP 546 546 546 ASP ASP A . n 
A 1 547 LYS 547 547 547 LYS LYS A . n 
A 1 548 ILE 548 548 548 ILE ILE A . n 
A 1 549 GLU 549 549 549 GLU GLU A . n 
A 1 550 LYS 550 550 550 LYS LYS A . n 
A 1 551 LEU 551 551 551 LEU LEU A . n 
A 1 552 ALA 552 552 552 ALA ALA A . n 
A 1 553 ARG 553 553 553 ARG ARG A . n 
A 1 554 GLY 554 554 554 GLY GLY A . n 
A 1 555 PRO 555 555 555 PRO PRO A . n 
A 1 556 LEU 556 556 556 LEU LEU A . n 
A 1 557 ALA 557 557 557 ALA ALA A . n 
A 1 558 ALA 558 558 558 ALA ALA A . n 
A 1 559 ARG 559 559 559 ARG ARG A . n 
A 1 560 CYS 560 560 560 CYS CYS A . n 
A 1 561 SER 561 561 561 SER SER A . n 
A 1 562 PHE 562 562 562 PHE PHE A . n 
A 1 563 TRP 563 563 563 TRP TRP A . n 
A 1 564 ASN 564 564 564 ASN ASN A . n 
A 1 565 ASP 565 565 565 ASP ASP A . n 
A 1 566 TYR 566 566 566 TYR TYR A . n 
A 1 567 LEU 567 567 567 LEU LEU A . n 
A 1 568 PRO 568 568 568 PRO PRO A . n 
A 1 569 LYS 569 569 569 LYS LYS A . n 
A 1 570 VAL 570 570 570 VAL VAL A . n 
A 1 571 ARG 571 571 571 ARG ARG A . n 
A 1 572 SER 572 572 572 SER SER A . n 
A 1 573 TRP 573 573 573 TRP TRP A . n 
A 1 574 ALA 574 574 ?   ?   ?   A . n 
A 1 575 GLY 575 575 ?   ?   ?   A . n 
A 1 576 THR 576 576 ?   ?   ?   A . n 
A 1 577 CYS 577 577 ?   ?   ?   A . n 
A 1 578 ASP 578 578 ?   ?   ?   A . n 
A 1 579 GLY 579 579 ?   ?   ?   A . n 
A 1 580 ASP 580 580 ?   ?   ?   A . n 
A 1 581 SER 581 581 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 I40 1   601 997 I40 I40 A . 
D 4 IOD 1   602 998 IOD IDO A . 
E 5 HOH 1   701 128 HOH HOH A . 
E 5 HOH 2   702 53  HOH HOH A . 
E 5 HOH 3   703 84  HOH HOH A . 
E 5 HOH 4   704 49  HOH HOH A . 
E 5 HOH 5   705 146 HOH HOH A . 
E 5 HOH 6   706 75  HOH HOH A . 
E 5 HOH 7   707 99  HOH HOH A . 
E 5 HOH 8   708 144 HOH HOH A . 
E 5 HOH 9   709 35  HOH HOH A . 
E 5 HOH 10  710 37  HOH HOH A . 
E 5 HOH 11  711 92  HOH HOH A . 
E 5 HOH 12  712 137 HOH HOH A . 
E 5 HOH 13  713 50  HOH HOH A . 
E 5 HOH 14  714 68  HOH HOH A . 
E 5 HOH 15  715 13  HOH HOH A . 
E 5 HOH 16  716 97  HOH HOH A . 
E 5 HOH 17  717 116 HOH HOH A . 
E 5 HOH 18  718 134 HOH HOH A . 
E 5 HOH 19  719 40  HOH HOH A . 
E 5 HOH 20  720 95  HOH HOH A . 
E 5 HOH 21  721 23  HOH HOH A . 
E 5 HOH 22  722 109 HOH HOH A . 
E 5 HOH 23  723 120 HOH HOH A . 
E 5 HOH 24  724 44  HOH HOH A . 
E 5 HOH 25  725 108 HOH HOH A . 
E 5 HOH 26  726 57  HOH HOH A . 
E 5 HOH 27  727 59  HOH HOH A . 
E 5 HOH 28  728 63  HOH HOH A . 
E 5 HOH 29  729 121 HOH HOH A . 
E 5 HOH 30  730 5   HOH HOH A . 
E 5 HOH 31  731 41  HOH HOH A . 
E 5 HOH 32  732 62  HOH HOH A . 
E 5 HOH 33  733 117 HOH HOH A . 
E 5 HOH 34  734 14  HOH HOH A . 
E 5 HOH 35  735 7   HOH HOH A . 
E 5 HOH 36  736 105 HOH HOH A . 
E 5 HOH 37  737 33  HOH HOH A . 
E 5 HOH 38  738 76  HOH HOH A . 
E 5 HOH 39  739 91  HOH HOH A . 
E 5 HOH 40  740 6   HOH HOH A . 
E 5 HOH 41  741 52  HOH HOH A . 
E 5 HOH 42  742 103 HOH HOH A . 
E 5 HOH 43  743 64  HOH HOH A . 
E 5 HOH 44  744 43  HOH HOH A . 
E 5 HOH 45  745 70  HOH HOH A . 
E 5 HOH 46  746 112 HOH HOH A . 
E 5 HOH 47  747 24  HOH HOH A . 
E 5 HOH 48  748 125 HOH HOH A . 
E 5 HOH 49  749 72  HOH HOH A . 
E 5 HOH 50  750 111 HOH HOH A . 
E 5 HOH 51  751 71  HOH HOH A . 
E 5 HOH 52  752 152 HOH HOH A . 
E 5 HOH 53  753 96  HOH HOH A . 
E 5 HOH 54  754 25  HOH HOH A . 
E 5 HOH 55  755 138 HOH HOH A . 
E 5 HOH 56  756 154 HOH HOH A . 
E 5 HOH 57  757 115 HOH HOH A . 
E 5 HOH 58  758 133 HOH HOH A . 
E 5 HOH 59  759 143 HOH HOH A . 
E 5 HOH 60  760 118 HOH HOH A . 
E 5 HOH 61  761 139 HOH HOH A . 
E 5 HOH 62  762 102 HOH HOH A . 
E 5 HOH 63  763 30  HOH HOH A . 
E 5 HOH 64  764 153 HOH HOH A . 
E 5 HOH 65  765 4   HOH HOH A . 
E 5 HOH 66  766 47  HOH HOH A . 
E 5 HOH 67  767 113 HOH HOH A . 
E 5 HOH 68  768 38  HOH HOH A . 
E 5 HOH 69  769 65  HOH HOH A . 
E 5 HOH 70  770 48  HOH HOH A . 
E 5 HOH 71  771 100 HOH HOH A . 
E 5 HOH 72  772 142 HOH HOH A . 
E 5 HOH 73  773 140 HOH HOH A . 
E 5 HOH 74  774 141 HOH HOH A . 
E 5 HOH 75  775 151 HOH HOH A . 
E 5 HOH 76  776 3   HOH HOH A . 
E 5 HOH 77  777 122 HOH HOH A . 
E 5 HOH 78  778 66  HOH HOH A . 
E 5 HOH 79  779 39  HOH HOH A . 
E 5 HOH 80  780 83  HOH HOH A . 
E 5 HOH 81  781 149 HOH HOH A . 
E 5 HOH 82  782 42  HOH HOH A . 
E 5 HOH 83  783 1   HOH HOH A . 
E 5 HOH 84  784 20  HOH HOH A . 
E 5 HOH 85  785 106 HOH HOH A . 
E 5 HOH 86  786 2   HOH HOH A . 
E 5 HOH 87  787 135 HOH HOH A . 
E 5 HOH 88  788 126 HOH HOH A . 
E 5 HOH 89  789 79  HOH HOH A . 
E 5 HOH 90  790 74  HOH HOH A . 
E 5 HOH 91  791 110 HOH HOH A . 
E 5 HOH 92  792 107 HOH HOH A . 
E 5 HOH 93  793 129 HOH HOH A . 
E 5 HOH 94  794 9   HOH HOH A . 
E 5 HOH 95  795 130 HOH HOH A . 
E 5 HOH 96  796 77  HOH HOH A . 
E 5 HOH 97  797 22  HOH HOH A . 
E 5 HOH 98  798 101 HOH HOH A . 
E 5 HOH 99  799 104 HOH HOH A . 
E 5 HOH 100 800 131 HOH HOH A . 
E 5 HOH 101 801 56  HOH HOH A . 
E 5 HOH 102 802 136 HOH HOH A . 
E 5 HOH 103 803 94  HOH HOH A . 
E 5 HOH 104 804 90  HOH HOH A . 
E 5 HOH 105 805 19  HOH HOH A . 
E 5 HOH 106 806 18  HOH HOH A . 
E 5 HOH 107 807 11  HOH HOH A . 
E 5 HOH 108 808 55  HOH HOH A . 
E 5 HOH 109 809 69  HOH HOH A . 
E 5 HOH 110 810 114 HOH HOH A . 
E 5 HOH 111 811 80  HOH HOH A . 
E 5 HOH 112 812 60  HOH HOH A . 
E 5 HOH 113 813 132 HOH HOH A . 
E 5 HOH 114 814 88  HOH HOH A . 
E 5 HOH 115 815 46  HOH HOH A . 
E 5 HOH 116 816 34  HOH HOH A . 
E 5 HOH 117 817 61  HOH HOH A . 
E 5 HOH 118 818 127 HOH HOH A . 
E 5 HOH 119 819 89  HOH HOH A . 
E 5 HOH 120 820 124 HOH HOH A . 
E 5 HOH 121 821 147 HOH HOH A . 
E 5 HOH 122 822 12  HOH HOH A . 
E 5 HOH 123 823 123 HOH HOH A . 
E 5 HOH 124 824 86  HOH HOH A . 
E 5 HOH 125 825 26  HOH HOH A . 
E 5 HOH 126 826 82  HOH HOH A . 
E 5 HOH 127 827 31  HOH HOH A . 
E 5 HOH 128 828 45  HOH HOH A . 
E 5 HOH 129 829 85  HOH HOH A . 
E 5 HOH 130 830 98  HOH HOH A . 
E 5 HOH 131 831 58  HOH HOH A . 
E 5 HOH 132 832 17  HOH HOH A . 
E 5 HOH 133 833 119 HOH HOH A . 
E 5 HOH 134 834 21  HOH HOH A . 
E 5 HOH 135 835 145 HOH HOH A . 
E 5 HOH 136 836 73  HOH HOH A . 
E 5 HOH 137 837 93  HOH HOH A . 
E 5 HOH 138 838 150 HOH HOH A . 
E 5 HOH 139 839 8   HOH HOH A . 
E 5 HOH 140 840 67  HOH HOH A . 
E 5 HOH 141 841 54  HOH HOH A . 
E 5 HOH 142 842 81  HOH HOH A . 
E 5 HOH 143 843 148 HOH HOH A . 
E 5 HOH 144 844 27  HOH HOH A . 
E 5 HOH 145 845 28  HOH HOH A . 
E 5 HOH 146 846 32  HOH HOH A . 
E 5 HOH 147 847 15  HOH HOH A . 
E 5 HOH 148 848 51  HOH HOH A . 
E 5 HOH 149 849 36  HOH HOH A . 
E 5 HOH 150 850 78  HOH HOH A . 
E 5 HOH 151 851 87  HOH HOH A . 
E 5 HOH 152 852 16  HOH HOH A . 
E 5 HOH 153 853 29  HOH HOH A . 
E 5 HOH 154 854 10  HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D,E 
1 2 A,C,D,E   
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z            1.0000000000 0.0000000000  0.0000000000 0.0000000000  0.0000000000  
1.0000000000 0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 8_665 -y+1,-x+1,-z+1/2 0.0000000000 -1.0000000000 0.0000000000 94.9100000000 -1.0000000000 
0.0000000000 0.0000000000 94.9100000000 0.0000000000 0.0000000000 -1.0000000000 80.0200000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     837 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   E 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2020-03-18 
2 'Structure model' 2 0 2020-07-29 
3 'Structure model' 3 0 2021-05-05 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 2 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Atomic model'         
2 2 'Structure model' 'Data collection'      
3 2 'Structure model' 'Derived calculations' 
4 2 'Structure model' 'Structure summary'    
5 3 'Structure model' 'Atomic model'         
6 3 'Structure model' 'Data collection'      
7 3 'Structure model' 'Derived calculations' 
8 3 'Structure model' 'Structure summary'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  2 'Structure model' atom_site                     
2  2 'Structure model' chem_comp                     
3  2 'Structure model' entity                        
4  2 'Structure model' pdbx_branch_scheme            
5  2 'Structure model' pdbx_chem_comp_identifier     
6  2 'Structure model' pdbx_entity_branch            
7  2 'Structure model' pdbx_entity_branch_descriptor 
8  2 'Structure model' pdbx_entity_branch_link       
9  2 'Structure model' pdbx_entity_branch_list       
10 2 'Structure model' pdbx_entity_nonpoly           
11 2 'Structure model' pdbx_nonpoly_scheme           
12 2 'Structure model' pdbx_struct_assembly_gen      
13 2 'Structure model' pdbx_struct_special_symmetry  
14 2 'Structure model' struct_asym                   
15 2 'Structure model' struct_conn                   
16 2 'Structure model' struct_site                   
17 2 'Structure model' struct_site_gen               
18 3 'Structure model' atom_site                     
19 3 'Structure model' chem_comp                     
20 3 'Structure model' pdbx_nonpoly_scheme           
21 3 'Structure model' pdbx_struct_assembly          
22 3 'Structure model' pdbx_struct_assembly_gen      
23 3 'Structure model' pdbx_struct_assembly_prop     
24 3 'Structure model' pdbx_struct_oper_list         
25 3 'Structure model' struct_conn                   
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_atom_site.auth_asym_id'                     
2  2 'Structure model' '_atom_site.auth_seq_id'                      
3  2 'Structure model' '_atom_site.label_asym_id'                    
4  2 'Structure model' '_atom_site.label_entity_id'                  
5  2 'Structure model' '_chem_comp.name'                             
6  2 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'      
7  2 'Structure model' '_pdbx_struct_special_symmetry.label_asym_id' 
8  2 'Structure model' '_struct_conn.pdbx_role'                      
9  2 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
10 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
11 2 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
12 2 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
13 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
14 2 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
15 3 'Structure model' '_atom_site.auth_seq_id'                      
16 3 'Structure model' '_chem_comp.pdbx_synonyms'                    
17 3 'Structure model' '_pdbx_nonpoly_scheme.pdb_seq_num'            
18 3 'Structure model' '_pdbx_struct_assembly.oligomeric_count'      
19 3 'Structure model' '_pdbx_struct_assembly.oligomeric_details'    
20 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[1][1]_esd 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][2]_esd 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[1][3]_esd 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[2][2]_esd 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.T[2][3]_esd 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[3][3]_esd 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[1][1]_esd 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][2]_esd 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[1][3]_esd 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[2][2]_esd 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.L[2][3]_esd 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[3][3]_esd 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][1]_esd 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][2]_esd 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[1][3]_esd 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][1]_esd 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][2]_esd 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][3]_esd 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][1]_esd 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][2]_esd 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[3][3]_esd 
1 'X-RAY DIFFRACTION' ? refined 19.9800663406 64.6405677002 0.158818410022 0.397314894327 ? -0.00776847738117 ? 0.00932012962758 ? 
0.38582158843  ? -0.0106315946755 ? 0.372385387388 ? 2.16291245274 ? -0.774796864091  ? 0.894832244603 ? 2.43046258876 ? 
-0.42065820961 ? 3.43325631992 ? 0.0340968237743 ? 0.222717377675  ? 0.0547378752208 ? -0.403663755803 ? -0.101598072966 ? 
0.00828598112535 ? -0.285235699087 ? 0.342645884911 ? 0.0943372733126  ? 
2 'X-RAY DIFFRACTION' ? refined 31.5273585336 64.4727162515 22.1139942028  0.382985494192 ? -0.0102267830832  ? 0.0102855930944  ? 
0.530992777245 ? 0.00463186239959 ? 0.40140711002  ? 1.97853300143 ? -0.225166722638  ? 0.73044586064  ? 2.53604704933 ? 
0.580606344947 ? 3.88711347959 ? -0.194921910142 ? -0.079224490534 ? 0.140910328347  ? 0.0762258631262 ? 0.0958825209259 ? 
-0.299368191299  ? -0.515873660345 ? 0.552002013396 ? 0.117752655115   ? 
3 'X-RAY DIFFRACTION' ? refined 25.9271493774 51.2719811165 23.8179593442  0.328328743378 ? 0.0362326709667   ? 0.0562477129109  ? 
0.417710984806 ? 0.0960582458064  ? 0.418207921205 ? 1.92304842818 ? -0.0147934986667 ? 0.892168233184 ? 2.07468997608 ? 
0.155822319852 ? 4.32208965175 ? -0.172013855238 ? -0.254406519047 ? -0.283874048963 ? 0.254580155835  ? 0.166091240978  ? 
0.0547930287703  ? 0.5029800867    ? 0.229740664289 ? -0.0714465001697 ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid    3  through  351 )
;
2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid  352  through  499 )
;
3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid  500  through  573 )
;
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data processing' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .         1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? .         2 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? .         3 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.16_3549 4 
? 'model building'  ? ? ? ? ? ? ? ? ? ? ? Coot   ? ? ? .         5 
# 
_pdbx_entry_details.entry_id                 6XYU 
_pdbx_entry_details.has_ligand_of_interest   Y 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OD1 A ASN 300 ? ? O   A HOH 701 ? ? 2.06 
2 1 OE2 A GLU 201 ? ? NH1 A ARG 309 ? ? 2.08 
3 1 O   A ARG 43  ? ? NH2 A ARG 309 ? ? 2.14 
4 1 NH2 A ARG 559 ? ? O   A HOH 702 ? ? 2.15 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 40  ? ? 43.16   -111.33 
2  1 PHE A 44  ? ? 67.42   -1.19   
3  1 ASP A 58  ? ? -59.53  97.48   
4  1 ALA A 59  ? ? -108.81 55.50   
5  1 ASP A 92  ? ? -69.22  90.79   
6  1 CYS A 93  ? ? -141.46 -3.20   
7  1 PHE A 152 ? ? 56.37   14.64   
8  1 ALA A 202 ? ? -152.62 70.40   
9  1 TRP A 231 ? ? -116.48 58.34   
10 1 SER A 238 ? ? 50.55   -121.47 
11 1 CYS A 292 ? ? -141.74 18.34   
12 1 ASN A 293 ? ? 73.32   -50.61  
13 1 ALA A 294 ? ? 63.03   -30.34  
14 1 ASN A 300 ? ? -150.97 86.80   
15 1 ALA A 339 ? ? -160.45 -95.48  
16 1 LYS A 350 ? ? -62.05  0.67    
17 1 ASN A 422 ? ? 66.48   117.53  
18 1 PHE A 440 ? ? -128.70 -66.73  
19 1 TRP A 529 ? ? -150.66 87.97   
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 852 ? 6.14 . 
2 1 O ? A HOH 853 ? 6.92 . 
3 1 O ? A HOH 854 ? 6.97 . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A VAL 1   ? A VAL 1   
2  1 Y 1 A ILE 2   ? A ILE 2   
3  1 Y 1 A LYS 103 ? A LYS 103 
4  1 Y 1 A ALA 104 ? A ALA 104 
5  1 Y 1 A ARG 105 ? A ARG 105 
6  1 Y 1 A LEU 106 ? A LEU 106 
7  1 Y 1 A ARG 107 ? A ARG 107 
8  1 Y 1 A HIS 108 ? A HIS 108 
9  1 Y 1 A GLY 109 ? A GLY 109 
10 1 Y 1 A ARG 110 ? A ARG 110 
11 1 Y 1 A GLY 111 ? A GLY 111 
12 1 Y 1 A ALA 112 ? A ALA 112 
13 1 Y 1 A ASN 113 ? A ASN 113 
14 1 Y 1 A GLY 114 ? A GLY 114 
15 1 Y 1 A GLY 115 ? A GLY 115 
16 1 Y 1 A GLU 116 ? A GLU 116 
17 1 Y 1 A HIS 117 ? A HIS 117 
18 1 Y 1 A PRO 118 ? A PRO 118 
19 1 Y 1 A ASN 119 ? A ASN 119 
20 1 Y 1 A GLY 120 ? A GLY 120 
21 1 Y 1 A LYS 121 ? A LYS 121 
22 1 Y 1 A GLN 122 ? A GLN 122 
23 1 Y 1 A ALA 123 ? A ALA 123 
24 1 Y 1 A ASP 124 ? A ASP 124 
25 1 Y 1 A THR 125 ? A THR 125 
26 1 Y 1 A ASP 126 ? A ASP 126 
27 1 Y 1 A HIS 127 ? A HIS 127 
28 1 Y 1 A LEU 128 ? A LEU 128 
29 1 Y 1 A ILE 129 ? A ILE 129 
30 1 Y 1 A HIS 130 ? A HIS 130 
31 1 Y 1 A ASN 131 ? A ASN 131 
32 1 Y 1 A GLY 132 ? A GLY 132 
33 1 Y 1 A ASN 133 ? A ASN 133 
34 1 Y 1 A PRO 134 ? A PRO 134 
35 1 Y 1 A GLN 135 ? A GLN 135 
36 1 Y 1 A ASN 136 ? A ASN 136 
37 1 Y 1 A ALA 574 ? A ALA 574 
38 1 Y 1 A GLY 575 ? A GLY 575 
39 1 Y 1 A THR 576 ? A THR 576 
40 1 Y 1 A CYS 577 ? A CYS 577 
41 1 Y 1 A ASP 578 ? A ASP 578 
42 1 Y 1 A GLY 579 ? A GLY 579 
43 1 Y 1 A ASP 580 ? A ASP 580 
44 1 Y 1 A SER 581 ? A SER 581 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
B 2 NAG 1 B NAG 1 A NAG 991 n 
B 2 NAG 2 B NAG 2 A NAG 992 n 
B 2 BMA 3 B BMA 3 A BMA 993 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
BMA 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DManpb                         
BMA 'COMMON NAME'                         GMML     1.0 b-D-mannopyranose              
BMA 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-Manp                       
BMA 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Man                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 DManpb1-4DGlcpNAcb1-4DGlcpNAcb1-                                             'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/2,3,2/[a2122h-1b_1-5_2*NCC/3=O][a1122h-1b_1-5]/1-1-2/a4-b1_b4-c1' WURCS                       PDB2Glycan 1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-Manp]{}}}}'        LINUCS                      PDB-CARE   ?     
# 
loop_
_pdbx_entity_branch_link.link_id 
_pdbx_entity_branch_link.entity_id 
_pdbx_entity_branch_link.entity_branch_list_num_1 
_pdbx_entity_branch_link.comp_id_1 
_pdbx_entity_branch_link.atom_id_1 
_pdbx_entity_branch_link.leaving_atom_id_1 
_pdbx_entity_branch_link.entity_branch_list_num_2 
_pdbx_entity_branch_link.comp_id_2 
_pdbx_entity_branch_link.atom_id_2 
_pdbx_entity_branch_link.leaving_atom_id_2 
_pdbx_entity_branch_link.value_order 
_pdbx_entity_branch_link.details 
1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
2 2 3 BMA C1 O1 2 NAG O4 HO4 sing ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NAG 2 n 
2 BMA 3 n 
# 
loop_
_pdbx_entity_instance_feature.ordinal 
_pdbx_entity_instance_feature.comp_id 
_pdbx_entity_instance_feature.asym_id 
_pdbx_entity_instance_feature.seq_num 
_pdbx_entity_instance_feature.auth_comp_id 
_pdbx_entity_instance_feature.auth_asym_id 
_pdbx_entity_instance_feature.auth_seq_num 
_pdbx_entity_instance_feature.feature_type 
_pdbx_entity_instance_feature.details 
1 IOD ? ? IOD ? ? 'SUBJECT OF INVESTIGATION' ? 
2 I40 ? ? I40 ? ? 'SUBJECT OF INVESTIGATION' ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 '9-(3-IODOBENZYLAMINO)-1,2,3,4-TETRAHYDROACRIDINE' I40 
4 'IODIDE ION'                                       IOD 
5 water                                              HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
_space_group.name_H-M_alt     'P 43 21 2' 
_space_group.name_Hall        'P 4nw 2abw' 
_space_group.IT_number        96 
_space_group.crystal_system   tetragonal 
_space_group.id               1 
# 
loop_
_space_group_symop.id 
_space_group_symop.operation_xyz 
1 x,y,z               
2 -y+1/2,x+1/2,z+3/4  
3 y+1/2,-x+1/2,z+1/4  
4 x+1/2,-y+1/2,-z+1/4 
5 -x+1/2,y+1/2,-z+3/4 
6 -x,-y,z+1/2         
7 y,x,-z              
8 -y,-x,-z+1/2        
#