data_6XYY
# 
_entry.id   6XYY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.342 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6XYY         
WWPDB D_1292106562 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2020-03-18 
_pdbx_database_PDB_obs_spr.pdb_id           6XYY 
_pdbx_database_PDB_obs_spr.replace_pdb_id   1DX4 
_pdbx_database_PDB_obs_spr.details          ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB 'earlier model'                    1DX4 re-refinement 
PDB 'native enzyme'                    6xys unspecified   
PDB 'same protein with similar ligand' 6xyu unspecified   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6XYY 
_pdbx_database_status.recvd_initial_deposition_date   2020-01-31 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Nachon, F.'    1 0000-0003-0293-2429 
'Sussman, J.L.' 2 0000-0003-0306-3878 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   CH 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Molecules 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1420-3049 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            25 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
;A Second Look at the Crystal Structures ofDrosophila melanogasterAcetylcholinesterase in Complex with Tacrine Derivatives Provides Insights Concerning Catalytic Intermediates and the Design of Specific Insecticides.
;
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.3390/molecules25051198 
_citation.pdbx_database_id_PubMed   32155891 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Nachon, F.'       1 0000-0003-0293-2429 
primary 'Rosenberry, T.L.' 2 0000-0003-3579-7681 
primary 'Silman, I.'       3 ?                   
primary 'Sussman, J.L.'    4 0000-0003-0306-3878 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6XYY 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     95.810 
_cell.length_a_esd                 ? 
_cell.length_b                     95.810 
_cell.length_b_esd                 ? 
_cell.length_c                     162.030 
_cell.length_c_esd                 ? 
_cell.volume                       1487363.475 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6XYY 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            'P 4nw 2abw' 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Acetylcholinesterase 64654.270 1   3.1.1.7 ? ? ? 
2 branched    man 
;alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
;
748.682   1   ?       ? ? ? 
3 non-polymer syn 'PROPANOIC ACID' 74.079    1   ?       ? ? ? 
4 non-polymer syn '9-(3-PHENYLMETHYLAMINO)-1,2,3,4-TETRAHYDROACRIDINE' 288.386   1   ?       ? ? ? 
5 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   1   ?       ? ? ? 
6 non-polymer syn 'SULFATE ION' 96.063    1   ?       ? ? ? 
7 non-polymer syn 'CHLORIDE ION' 35.453    1   ?       ? ? ? 
8 water       nat water 18.015    144 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;VIDRLVVQTSSGPVRGRSVTVQGREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATGLSATCVQERYEYFPGFSGE
EIWNPNTNVSEDCLYINVWAPAKARLRHGRGANGGEHPNGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLD
IYNADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQALAIRWLKDNAHAFGGNPEWMTLFGESAG
SSSVNAQLMSPVTRGLVKRGMMQSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVDAKTISVQQ
WNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMGNVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNI
FGKATQAEREAIIFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYYFTHRTSTSLWGEWMGVLH
GDEIEYFFGQPLNNSLQYRPVERELGKRMLSAVIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARC
SFWNDYLPKVRSWAGTCDGDS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;VIDRLVVQTSSGPVRGRSVTVQGREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATGLSATCVQERYEYFPGFSGE
EIWNPNTNVSEDCLYINVWAPAKARLRHGRGANGGEHPNGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLD
IYNADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQALAIRWLKDNAHAFGGNPEWMTLFGESAG
SSSVNAQLMSPVTRGLVKRGMMQSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVDAKTISVQQ
WNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMGNVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNI
FGKATQAEREAIIFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYYFTHRTSTSLWGEWMGVLH
GDEIEYFFGQPLNNSLQYRPVERELGKRMLSAVIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARC
SFWNDYLPKVRSWAGTCDGDS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   ILE n 
1 3   ASP n 
1 4   ARG n 
1 5   LEU n 
1 6   VAL n 
1 7   VAL n 
1 8   GLN n 
1 9   THR n 
1 10  SER n 
1 11  SER n 
1 12  GLY n 
1 13  PRO n 
1 14  VAL n 
1 15  ARG n 
1 16  GLY n 
1 17  ARG n 
1 18  SER n 
1 19  VAL n 
1 20  THR n 
1 21  VAL n 
1 22  GLN n 
1 23  GLY n 
1 24  ARG n 
1 25  GLU n 
1 26  VAL n 
1 27  HIS n 
1 28  VAL n 
1 29  TYR n 
1 30  THR n 
1 31  GLY n 
1 32  ILE n 
1 33  PRO n 
1 34  TYR n 
1 35  ALA n 
1 36  LYS n 
1 37  PRO n 
1 38  PRO n 
1 39  VAL n 
1 40  GLU n 
1 41  ASP n 
1 42  LEU n 
1 43  ARG n 
1 44  PHE n 
1 45  ARG n 
1 46  LYS n 
1 47  PRO n 
1 48  VAL n 
1 49  PRO n 
1 50  ALA n 
1 51  GLU n 
1 52  PRO n 
1 53  TRP n 
1 54  HIS n 
1 55  GLY n 
1 56  VAL n 
1 57  LEU n 
1 58  ASP n 
1 59  ALA n 
1 60  THR n 
1 61  GLY n 
1 62  LEU n 
1 63  SER n 
1 64  ALA n 
1 65  THR n 
1 66  CYS n 
1 67  VAL n 
1 68  GLN n 
1 69  GLU n 
1 70  ARG n 
1 71  TYR n 
1 72  GLU n 
1 73  TYR n 
1 74  PHE n 
1 75  PRO n 
1 76  GLY n 
1 77  PHE n 
1 78  SER n 
1 79  GLY n 
1 80  GLU n 
1 81  GLU n 
1 82  ILE n 
1 83  TRP n 
1 84  ASN n 
1 85  PRO n 
1 86  ASN n 
1 87  THR n 
1 88  ASN n 
1 89  VAL n 
1 90  SER n 
1 91  GLU n 
1 92  ASP n 
1 93  CYS n 
1 94  LEU n 
1 95  TYR n 
1 96  ILE n 
1 97  ASN n 
1 98  VAL n 
1 99  TRP n 
1 100 ALA n 
1 101 PRO n 
1 102 ALA n 
1 103 LYS n 
1 104 ALA n 
1 105 ARG n 
1 106 LEU n 
1 107 ARG n 
1 108 HIS n 
1 109 GLY n 
1 110 ARG n 
1 111 GLY n 
1 112 ALA n 
1 113 ASN n 
1 114 GLY n 
1 115 GLY n 
1 116 GLU n 
1 117 HIS n 
1 118 PRO n 
1 119 ASN n 
1 120 GLY n 
1 121 LYS n 
1 122 GLN n 
1 123 ALA n 
1 124 ASP n 
1 125 THR n 
1 126 ASP n 
1 127 HIS n 
1 128 LEU n 
1 129 ILE n 
1 130 HIS n 
1 131 ASN n 
1 132 GLY n 
1 133 ASN n 
1 134 PRO n 
1 135 GLN n 
1 136 ASN n 
1 137 THR n 
1 138 THR n 
1 139 ASN n 
1 140 GLY n 
1 141 LEU n 
1 142 PRO n 
1 143 ILE n 
1 144 LEU n 
1 145 ILE n 
1 146 TRP n 
1 147 ILE n 
1 148 TYR n 
1 149 GLY n 
1 150 GLY n 
1 151 GLY n 
1 152 PHE n 
1 153 MET n 
1 154 THR n 
1 155 GLY n 
1 156 SER n 
1 157 ALA n 
1 158 THR n 
1 159 LEU n 
1 160 ASP n 
1 161 ILE n 
1 162 TYR n 
1 163 ASN n 
1 164 ALA n 
1 165 ASP n 
1 166 ILE n 
1 167 MET n 
1 168 ALA n 
1 169 ALA n 
1 170 VAL n 
1 171 GLY n 
1 172 ASN n 
1 173 VAL n 
1 174 ILE n 
1 175 VAL n 
1 176 ALA n 
1 177 SER n 
1 178 PHE n 
1 179 GLN n 
1 180 TYR n 
1 181 ARG n 
1 182 VAL n 
1 183 GLY n 
1 184 ALA n 
1 185 PHE n 
1 186 GLY n 
1 187 PHE n 
1 188 LEU n 
1 189 HIS n 
1 190 LEU n 
1 191 ALA n 
1 192 PRO n 
1 193 GLU n 
1 194 MET n 
1 195 PRO n 
1 196 SER n 
1 197 GLU n 
1 198 PHE n 
1 199 ALA n 
1 200 GLU n 
1 201 GLU n 
1 202 ALA n 
1 203 PRO n 
1 204 GLY n 
1 205 ASN n 
1 206 VAL n 
1 207 GLY n 
1 208 LEU n 
1 209 TRP n 
1 210 ASP n 
1 211 GLN n 
1 212 ALA n 
1 213 LEU n 
1 214 ALA n 
1 215 ILE n 
1 216 ARG n 
1 217 TRP n 
1 218 LEU n 
1 219 LYS n 
1 220 ASP n 
1 221 ASN n 
1 222 ALA n 
1 223 HIS n 
1 224 ALA n 
1 225 PHE n 
1 226 GLY n 
1 227 GLY n 
1 228 ASN n 
1 229 PRO n 
1 230 GLU n 
1 231 TRP n 
1 232 MET n 
1 233 THR n 
1 234 LEU n 
1 235 PHE n 
1 236 GLY n 
1 237 GLU n 
1 238 SER n 
1 239 ALA n 
1 240 GLY n 
1 241 SER n 
1 242 SER n 
1 243 SER n 
1 244 VAL n 
1 245 ASN n 
1 246 ALA n 
1 247 GLN n 
1 248 LEU n 
1 249 MET n 
1 250 SER n 
1 251 PRO n 
1 252 VAL n 
1 253 THR n 
1 254 ARG n 
1 255 GLY n 
1 256 LEU n 
1 257 VAL n 
1 258 LYS n 
1 259 ARG n 
1 260 GLY n 
1 261 MET n 
1 262 MET n 
1 263 GLN n 
1 264 SER n 
1 265 GLY n 
1 266 THR n 
1 267 MET n 
1 268 ASN n 
1 269 ALA n 
1 270 PRO n 
1 271 TRP n 
1 272 SER n 
1 273 HIS n 
1 274 MET n 
1 275 THR n 
1 276 SER n 
1 277 GLU n 
1 278 LYS n 
1 279 ALA n 
1 280 VAL n 
1 281 GLU n 
1 282 ILE n 
1 283 GLY n 
1 284 LYS n 
1 285 ALA n 
1 286 LEU n 
1 287 ILE n 
1 288 ASN n 
1 289 ASP n 
1 290 CYS n 
1 291 ASN n 
1 292 CYS n 
1 293 ASN n 
1 294 ALA n 
1 295 SER n 
1 296 MET n 
1 297 LEU n 
1 298 LYS n 
1 299 THR n 
1 300 ASN n 
1 301 PRO n 
1 302 ALA n 
1 303 HIS n 
1 304 VAL n 
1 305 MET n 
1 306 SER n 
1 307 CYS n 
1 308 MET n 
1 309 ARG n 
1 310 SER n 
1 311 VAL n 
1 312 ASP n 
1 313 ALA n 
1 314 LYS n 
1 315 THR n 
1 316 ILE n 
1 317 SER n 
1 318 VAL n 
1 319 GLN n 
1 320 GLN n 
1 321 TRP n 
1 322 ASN n 
1 323 SER n 
1 324 TYR n 
1 325 SER n 
1 326 GLY n 
1 327 ILE n 
1 328 LEU n 
1 329 SER n 
1 330 PHE n 
1 331 PRO n 
1 332 SER n 
1 333 ALA n 
1 334 PRO n 
1 335 THR n 
1 336 ILE n 
1 337 ASP n 
1 338 GLY n 
1 339 ALA n 
1 340 PHE n 
1 341 LEU n 
1 342 PRO n 
1 343 ALA n 
1 344 ASP n 
1 345 PRO n 
1 346 MET n 
1 347 THR n 
1 348 LEU n 
1 349 MET n 
1 350 LYS n 
1 351 THR n 
1 352 ALA n 
1 353 ASP n 
1 354 LEU n 
1 355 LYS n 
1 356 ASP n 
1 357 TYR n 
1 358 ASP n 
1 359 ILE n 
1 360 LEU n 
1 361 MET n 
1 362 GLY n 
1 363 ASN n 
1 364 VAL n 
1 365 ARG n 
1 366 ASP n 
1 367 GLU n 
1 368 GLY n 
1 369 THR n 
1 370 TYR n 
1 371 PHE n 
1 372 LEU n 
1 373 LEU n 
1 374 TYR n 
1 375 ASP n 
1 376 PHE n 
1 377 ILE n 
1 378 ASP n 
1 379 TYR n 
1 380 PHE n 
1 381 ASP n 
1 382 LYS n 
1 383 ASP n 
1 384 ASP n 
1 385 ALA n 
1 386 THR n 
1 387 ALA n 
1 388 LEU n 
1 389 PRO n 
1 390 ARG n 
1 391 ASP n 
1 392 LYS n 
1 393 TYR n 
1 394 LEU n 
1 395 GLU n 
1 396 ILE n 
1 397 MET n 
1 398 ASN n 
1 399 ASN n 
1 400 ILE n 
1 401 PHE n 
1 402 GLY n 
1 403 LYS n 
1 404 ALA n 
1 405 THR n 
1 406 GLN n 
1 407 ALA n 
1 408 GLU n 
1 409 ARG n 
1 410 GLU n 
1 411 ALA n 
1 412 ILE n 
1 413 ILE n 
1 414 PHE n 
1 415 GLN n 
1 416 TYR n 
1 417 THR n 
1 418 SER n 
1 419 TRP n 
1 420 GLU n 
1 421 GLY n 
1 422 ASN n 
1 423 PRO n 
1 424 GLY n 
1 425 TYR n 
1 426 GLN n 
1 427 ASN n 
1 428 GLN n 
1 429 GLN n 
1 430 GLN n 
1 431 ILE n 
1 432 GLY n 
1 433 ARG n 
1 434 ALA n 
1 435 VAL n 
1 436 GLY n 
1 437 ASP n 
1 438 HIS n 
1 439 PHE n 
1 440 PHE n 
1 441 THR n 
1 442 CYS n 
1 443 PRO n 
1 444 THR n 
1 445 ASN n 
1 446 GLU n 
1 447 TYR n 
1 448 ALA n 
1 449 GLN n 
1 450 ALA n 
1 451 LEU n 
1 452 ALA n 
1 453 GLU n 
1 454 ARG n 
1 455 GLY n 
1 456 ALA n 
1 457 SER n 
1 458 VAL n 
1 459 HIS n 
1 460 TYR n 
1 461 TYR n 
1 462 TYR n 
1 463 PHE n 
1 464 THR n 
1 465 HIS n 
1 466 ARG n 
1 467 THR n 
1 468 SER n 
1 469 THR n 
1 470 SER n 
1 471 LEU n 
1 472 TRP n 
1 473 GLY n 
1 474 GLU n 
1 475 TRP n 
1 476 MET n 
1 477 GLY n 
1 478 VAL n 
1 479 LEU n 
1 480 HIS n 
1 481 GLY n 
1 482 ASP n 
1 483 GLU n 
1 484 ILE n 
1 485 GLU n 
1 486 TYR n 
1 487 PHE n 
1 488 PHE n 
1 489 GLY n 
1 490 GLN n 
1 491 PRO n 
1 492 LEU n 
1 493 ASN n 
1 494 ASN n 
1 495 SER n 
1 496 LEU n 
1 497 GLN n 
1 498 TYR n 
1 499 ARG n 
1 500 PRO n 
1 501 VAL n 
1 502 GLU n 
1 503 ARG n 
1 504 GLU n 
1 505 LEU n 
1 506 GLY n 
1 507 LYS n 
1 508 ARG n 
1 509 MET n 
1 510 LEU n 
1 511 SER n 
1 512 ALA n 
1 513 VAL n 
1 514 ILE n 
1 515 GLU n 
1 516 PHE n 
1 517 ALA n 
1 518 LYS n 
1 519 THR n 
1 520 GLY n 
1 521 ASN n 
1 522 PRO n 
1 523 ALA n 
1 524 GLN n 
1 525 ASP n 
1 526 GLY n 
1 527 GLU n 
1 528 GLU n 
1 529 TRP n 
1 530 PRO n 
1 531 ASN n 
1 532 PHE n 
1 533 SER n 
1 534 LYS n 
1 535 GLU n 
1 536 ASP n 
1 537 PRO n 
1 538 VAL n 
1 539 TYR n 
1 540 TYR n 
1 541 ILE n 
1 542 PHE n 
1 543 SER n 
1 544 THR n 
1 545 ASP n 
1 546 ASP n 
1 547 LYS n 
1 548 ILE n 
1 549 GLU n 
1 550 LYS n 
1 551 LEU n 
1 552 ALA n 
1 553 ARG n 
1 554 GLY n 
1 555 PRO n 
1 556 LEU n 
1 557 ALA n 
1 558 ALA n 
1 559 ARG n 
1 560 CYS n 
1 561 SER n 
1 562 PHE n 
1 563 TRP n 
1 564 ASN n 
1 565 ASP n 
1 566 TYR n 
1 567 LEU n 
1 568 PRO n 
1 569 LYS n 
1 570 VAL n 
1 571 ARG n 
1 572 SER n 
1 573 TRP n 
1 574 ALA n 
1 575 GLY n 
1 576 THR n 
1 577 CYS n 
1 578 ASP n 
1 579 GLY n 
1 580 ASP n 
1 581 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   581 
_entity_src_gen.gene_src_common_name               'Fruit fly' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'Ace, CG17907' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Drosophila melanogaster' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     7227 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Drosophila melanogaster' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7227 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            'SCHNEIDER LINE 2' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'S2-SEC 1/3' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_DROME 
_struct_ref.pdbx_db_accession          P07140 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;VIDRLVVQTSSGPVRGRSVTVQGREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATGLSATCVQERYEYFPGFSGE
EIWNPNTNVSEDCLYINVWAPAKARLRHGRGANGGEHPNGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLD
IYNADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQALAIRWLKDNAHAFGGNPEWMTLFGESAG
SSSVNAQLMSPVTRGLVKRGMMQSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVDAKTISVQQ
WNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMGNVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNI
FGKATQAEREAIIFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYYFTHRTSTSLWGEWMGVLH
GDEIEYFFGQPLNNSLQYRPVERELGKRMLSAVIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARC
SFWNDYLPKVRSWAGTCDGDS
;
_struct_ref.pdbx_align_begin           39 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6XYY 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 581 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P07140 
_struct_ref_seq.db_align_beg                  39 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  619 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       581 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
760 non-polymer                   . '9-(3-PHENYLMETHYLAMINO)-1,2,3,4-TETRAHYDROACRIDINE' 9-N-PHENYLMETHYLAMINO-TACRINE 
'C20 H20 N2'     288.386 
ALA 'L-peptide linking'           y ALANINE                                              ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                             ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                           ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                                      ? 'C4 H7 N O4'     133.103 
CL  non-polymer                   . 'CHLORIDE ION'                                       ? 'Cl -1'          35.453  
CYS 'L-peptide linking'           y CYSTEINE                                             ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'           y GLUTAMINE                                            ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                                      ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                              ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                            ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                                ? 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                                           ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                              ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                               ? 'C6 H15 N2 O2 1' 147.195 
MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose                                'alpha-D-mannose; D-mannose; mannose' 
'C6 H12 O6'      180.156 
MET 'L-peptide linking'           y METHIONINE                                           ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose             
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                                        ? 'C9 H11 N O2'    165.189 
PPI non-polymer                   . 'PROPANOIC ACID'                                     ? 'C3 H6 O2'       74.079  
PRO 'L-peptide linking'           y PROLINE                                              ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                               ? 'C3 H7 N O3'     105.093 
SO4 non-polymer                   . 'SULFATE ION'                                        ? 'O4 S -2'        96.063  
THR 'L-peptide linking'           y THREONINE                                            ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                                           ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                             ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                               ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6XYY 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.86 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         57.03 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              4.6 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '13% MPEG2000, 0.1 M ammonium sulfate, 0.03 M leucine, 0.1 M acetate, pH 4.6' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'Brandeis B4' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         1999-06-01 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'NSLS BEAMLINE X12C' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.98 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X12C 
_diffrn_source.pdbx_synchrotron_site       NSLS 
# 
_reflns.B_iso_Wilson_estimate            50.19 
_reflns.entry_id                         6XYY 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.7 
_reflns.d_resolution_low                 29.78 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       20596 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             95.98 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.0 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            24.3 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.038 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.7 
_reflns_shell.d_res_low                   2.796 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         3.2 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           1809 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             0.274 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_CC_star                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               56.87 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6XYY 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.70 
_refine.ls_d_res_low                             29.78 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     20577 
_refine.ls_number_reflns_R_free                  2030 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    96.10 
_refine.ls_percent_reflns_R_free                 9.87 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1780 
_refine.ls_R_factor_R_free                       0.2344 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1717 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.33 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1qon 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 26.9012 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.3542 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.70 
_refine_hist.d_res_low                        29.78 
_refine_hist.number_atoms_solvent             144 
_refine_hist.number_atoms_total               4473 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        4232 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         97 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.0078 ? 4458 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.8906 ? 6069 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.0565 ? 642  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.0062 ? 787  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 5.4400 ? 3572 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.70 2.76  . . 135 1035 84.05 . . . 0.3878 . 0.2984 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.76 2.83  . . 134 1167 92.86 . . . 0.3291 . 0.2644 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.83 2.91  . . 135 1218 97.06 . . . 0.3097 . 0.2479 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.91 2.99  . . 119 1253 97.72 . . . 0.3369 . 0.2141 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.99 3.09  . . 148 1232 97.94 . . . 0.3139 . 0.2202 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.09 3.20  . . 137 1234 98.14 . . . 0.3036 . 0.2167 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.20 3.33  . . 116 1261 98.43 . . . 0.2920 . 0.2035 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.33 3.48  . . 129 1251 97.94 . . . 0.2475 . 0.1954 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.48 3.66  . . 148 1251 98.31 . . . 0.2493 . 0.1655 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.66 3.89  . . 115 1276 98.17 . . . 0.2325 . 0.1553 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.89 4.19  . . 153 1253 98.25 . . . 0.2079 . 0.1389 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.19 4.61  . . 136 1262 97.90 . . . 0.1500 . 0.1236 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.61 5.28  . . 158 1256 97.18 . . . 0.1764 . 0.1242 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.28 6.64  . . 141 1274 96.32 . . . 0.2089 . 0.1599 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.64 29.78 . . 126 1324 91.71 . . . 0.2252 . 0.1726 . . . . . . . . . . . 
# 
_struct.entry_id                     6XYY 
_struct.title                        
'Update of ACHE FROM DROSOPHILA MELANOGASTER COMPLEX WITH TACRINE DERIVATIVE 9-(3-PHENYLMETHYLAMINO)-1,2,3,4-TETRAHYDROACRIDINE' 
_struct.pdbx_descriptor              'Acetylcholinesterase (E.C.3.1.1.7)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6XYY 
_struct_keywords.text            'acetylcholinesterase, insect, inhibitor, complex, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 7 ? 
H N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 VAL A 39  ? ARG A 43  ? VAL A 39  ARG A 43  5 ? 5  
HELX_P HELX_P2  AA2 PHE A 77  ? ILE A 82  ? PHE A 77  ILE A 82  1 ? 6  
HELX_P HELX_P3  AA3 LEU A 159 ? ASN A 163 ? LEU A 159 ASN A 163 5 ? 5  
HELX_P HELX_P4  AA4 ALA A 164 ? ASN A 172 ? ALA A 164 ASN A 172 1 ? 9  
HELX_P HELX_P5  AA5 GLY A 183 ? LEU A 188 ? GLY A 183 LEU A 188 1 ? 6  
HELX_P HELX_P6  AA6 LEU A 190 ? MET A 194 ? LEU A 190 MET A 194 5 ? 5  
HELX_P HELX_P7  AA7 PRO A 195 ? ALA A 202 ? PRO A 195 ALA A 202 5 ? 8  
HELX_P HELX_P8  AA8 ASN A 205 ? ALA A 222 ? ASN A 205 ALA A 222 1 ? 18 
HELX_P HELX_P9  AA9 HIS A 223 ? PHE A 225 ? HIS A 223 PHE A 225 5 ? 3  
HELX_P HELX_P10 AB1 SER A 238 ? SER A 250 ? SER A 238 SER A 250 1 ? 13 
HELX_P HELX_P11 AB2 ALA A 269 ? HIS A 273 ? ALA A 269 HIS A 273 5 ? 5  
HELX_P HELX_P12 AB3 THR A 275 ? CYS A 290 ? THR A 275 CYS A 290 1 ? 16 
HELX_P HELX_P13 AB4 ASN A 293 ? LYS A 298 ? ASN A 293 LYS A 298 5 ? 6  
HELX_P HELX_P14 AB5 ASN A 300 ? ARG A 309 ? ASN A 300 ARG A 309 1 ? 10 
HELX_P HELX_P15 AB6 ASP A 312 ? GLN A 320 ? ASP A 312 GLN A 320 1 ? 9  
HELX_P HELX_P16 AB7 TRP A 321 ? TYR A 324 ? TRP A 321 TYR A 324 5 ? 4  
HELX_P HELX_P17 AB8 GLY A 368 ? PHE A 376 ? GLY A 368 PHE A 376 1 ? 9  
HELX_P HELX_P18 AB9 PRO A 389 ? PHE A 401 ? PRO A 389 PHE A 401 1 ? 13 
HELX_P HELX_P19 AC1 THR A 405 ? TYR A 416 ? THR A 405 TYR A 416 1 ? 12 
HELX_P HELX_P20 AC2 ASN A 422 ? PHE A 440 ? ASN A 422 PHE A 440 1 ? 19 
HELX_P HELX_P21 AC3 PHE A 440 ? ARG A 454 ? PHE A 440 ARG A 454 1 ? 15 
HELX_P HELX_P22 AC4 GLY A 473 ? GLY A 477 ? GLY A 473 GLY A 477 5 ? 5  
HELX_P HELX_P23 AC5 GLU A 483 ? PHE A 488 ? GLU A 483 PHE A 488 1 ? 6  
HELX_P HELX_P24 AC6 GLY A 489 ? ASN A 493 ? GLY A 489 ASN A 493 5 ? 5  
HELX_P HELX_P25 AC7 ARG A 499 ? GLY A 520 ? ARG A 499 GLY A 520 1 ? 22 
HELX_P HELX_P26 AC8 ARG A 553 ? ASP A 565 ? ARG A 553 ASP A 565 1 ? 13 
HELX_P HELX_P27 AC9 TYR A 566 ? SER A 572 ? TYR A 566 SER A 572 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 66  SG  ? ? ? 1_555 A CYS 93  SG ? ? A CYS 66  A CYS 93  1_555 ? ? ? ? ? ? ? 2.076 ? ?               
disulf2 disulf ?    ? A CYS 292 SG  ? ? ? 1_555 A CYS 307 SG ? ? A CYS 292 A CYS 307 1_555 ? ? ? ? ? ? ? 2.052 ? ?               
disulf3 disulf ?    ? A CYS 442 SG  ? ? ? 1_555 A CYS 560 SG ? ? A CYS 442 A CYS 560 1_555 ? ? ? ? ? ? ? 2.028 ? ?               
covale1 covale one  ? A ASN 88  ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 88  A NAG 603 1_555 ? ? ? ? ? ? ? 1.445 ? N-Glycosylation 
covale2 covale one  ? A ASN 493 ND2 ? ? ? 1_555 B NAG .   C1 ? ? A ASN 493 B NAG 1   1_555 ? ? ? ? ? ? ? 1.440 ? N-Glycosylation 
covale3 covale both ? B NAG .   O4  ? ? ? 1_555 B NAG .   C1 ? ? B NAG 1   B NAG 2   1_555 ? ? ? ? ? ? ? 1.374 ? ?               
covale4 covale both ? B NAG .   O4  ? ? ? 1_555 B MAN .   C1 ? ? B NAG 2   B MAN 3   1_555 ? ? ? ? ? ? ? 1.374 ? ?               
covale5 covale both ? B MAN .   O3  ? ? ? 1_555 B MAN .   C1 ? ? B MAN 3   B MAN 4   1_555 ? ? ? ? ? ? ? 1.377 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 11 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? parallel      
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? parallel      
AA2 5  6  ? parallel      
AA2 6  7  ? parallel      
AA2 7  8  ? parallel      
AA2 8  9  ? parallel      
AA2 9  10 ? parallel      
AA2 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  VAL A 6   ? THR A 9   ? VAL A 6   THR A 9   
AA1 2  GLY A 12  ? ARG A 15  ? GLY A 12  ARG A 15  
AA1 3  LEU A 57  ? ASP A 58  ? LEU A 57  ASP A 58  
AA2 1  ARG A 17  ? VAL A 21  ? ARG A 17  VAL A 21  
AA2 2  ARG A 24  ? PRO A 33  ? ARG A 24  PRO A 33  
AA2 3  TYR A 95  ? PRO A 101 ? TYR A 95  PRO A 101 
AA2 4  ILE A 174 ? PHE A 178 ? ILE A 174 PHE A 178 
AA2 5  LEU A 141 ? ILE A 147 ? LEU A 141 ILE A 147 
AA2 6  GLY A 227 ? GLU A 237 ? GLY A 227 GLU A 237 
AA2 7  ARG A 259 ? GLN A 263 ? ARG A 259 GLN A 263 
AA2 8  ASP A 358 ? VAL A 364 ? ASP A 358 VAL A 364 
AA2 9  SER A 457 ? PHE A 463 ? SER A 457 PHE A 463 
AA2 10 TYR A 539 ? PHE A 542 ? TYR A 539 PHE A 542 
AA2 11 LEU A 551 ? ALA A 552 ? LEU A 551 ALA A 552 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N VAL A 7   ? N VAL A 7   O VAL A 14  ? O VAL A 14  
AA1 2  3  N PRO A 13  ? N PRO A 13  O LEU A 57  ? O LEU A 57  
AA2 1  2  N ARG A 17  ? N ARG A 17  O VAL A 28  ? O VAL A 28  
AA2 2  3  N HIS A 27  ? N HIS A 27  O ALA A 100 ? O ALA A 100 
AA2 3  4  N ASN A 97  ? N ASN A 97  O SER A 177 ? O SER A 177 
AA2 4  5  O ILE A 174 ? O ILE A 174 N LEU A 144 ? N LEU A 144 
AA2 5  6  N LEU A 141 ? N LEU A 141 O ASN A 228 ? O ASN A 228 
AA2 6  7  N GLY A 236 ? N GLY A 236 O GLN A 263 ? O GLN A 263 
AA2 7  8  N GLY A 260 ? N GLY A 260 O ASP A 358 ? O ASP A 358 
AA2 8  9  N ASN A 363 ? N ASN A 363 O PHE A 463 ? O PHE A 463 
AA2 9  10 N TYR A 462 ? N TYR A 462 O PHE A 542 ? O PHE A 542 
AA2 10 11 N TYR A 539 ? N TYR A 539 O ALA A 552 ? O ALA A 552 
# 
_atom_sites.entry_id                    6XYY 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.010437 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010437 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006172 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_a3 
_atom_type.scat_Cromer_Mann_a4 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_b3 
_atom_type.scat_Cromer_Mann_b4 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C  ? ? 3.54356 2.42580 ? ? 25.62398 1.50364  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
CL ? ? 9.50761 7.44341 ? ? 1.04373  23.83732 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N  ? ? 4.01032 2.96436 ? ? 19.97189 1.75589  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O  ? ? 7.96527 ?       ? ? 9.05267  ?        ? ? 0.0 
;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S  ? ? 9.55732 6.39887 ? ? 1.23737  29.19336 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASP A 1 3   ? 25.47668 43.99700 -22.04604 1.000 81.42975  ? 3   ASP A N   1 
ATOM   2    C  CA  . ASP A 1 3   ? 26.68463 43.94803 -21.23849 1.000 92.31574  ? 3   ASP A CA  1 
ATOM   3    C  C   . ASP A 1 3   ? 26.36459 43.25132 -19.90648 1.000 101.36315 ? 3   ASP A C   1 
ATOM   4    O  O   . ASP A 1 3   ? 25.22177 43.26859 -19.44871 1.000 100.92810 ? 3   ASP A O   1 
ATOM   5    C  CB  . ASP A 1 3   ? 27.23457 45.36809 -21.02556 1.000 95.89574  ? 3   ASP A CB  1 
ATOM   6    C  CG  . ASP A 1 3   ? 28.58055 45.38817 -20.30571 1.000 103.94987 ? 3   ASP A CG  1 
ATOM   7    O  OD1 . ASP A 1 3   ? 29.56838 45.86595 -20.90456 1.000 108.11602 ? 3   ASP A OD1 1 
ATOM   8    O  OD2 . ASP A 1 3   ? 28.66054 44.93536 -19.14369 1.000 105.56424 ? 3   ASP A OD2 1 
ATOM   9    N  N   . ARG A 1 4   ? 27.37741 42.62334 -19.30050 1.000 104.00129 ? 4   ARG A N   1 
ATOM   10   C  CA  . ARG A 1 4   ? 27.24499 41.94559 -18.01269 1.000 108.47309 ? 4   ARG A CA  1 
ATOM   11   C  C   . ARG A 1 4   ? 27.00820 42.92005 -16.85564 1.000 108.55550 ? 4   ARG A C   1 
ATOM   12   O  O   . ARG A 1 4   ? 26.73416 42.48136 -15.72808 1.000 112.20227 ? 4   ARG A O   1 
ATOM   13   C  CB  . ARG A 1 4   ? 28.50696 41.10009 -17.77014 1.000 114.42124 ? 4   ARG A CB  1 
ATOM   14   C  CG  . ARG A 1 4   ? 28.42254 40.09490 -16.63164 1.000 118.77449 ? 4   ARG A CG  1 
ATOM   15   C  CD  . ARG A 1 4   ? 28.02769 38.71160 -17.12147 1.000 126.97498 ? 4   ARG A CD  1 
ATOM   16   N  NE  . ARG A 1 4   ? 27.96024 37.75583 -16.01819 1.000 130.76711 ? 4   ARG A NE  1 
ATOM   17   C  CZ  . ARG A 1 4   ? 26.85553 37.47869 -15.32906 1.000 130.85251 ? 4   ARG A CZ  1 
ATOM   18   N  NH1 . ARG A 1 4   ? 25.71168 38.08334 -15.62854 1.000 127.37801 ? 4   ARG A NH1 1 
ATOM   19   N  NH2 . ARG A 1 4   ? 26.89366 36.59539 -14.33733 1.000 132.33201 ? 4   ARG A NH2 1 
ATOM   20   N  N   . LEU A 1 5   ? 27.08699 44.23105 -17.11268 1.000 98.67250  ? 5   LEU A N   1 
ATOM   21   C  CA  . LEU A 1 5   ? 27.03352 45.24050 -16.06811 1.000 72.35743  ? 5   LEU A CA  1 
ATOM   22   C  C   . LEU A 1 5   ? 25.96621 46.29890 -16.31388 1.000 72.72610  ? 5   LEU A C   1 
ATOM   23   O  O   . LEU A 1 5   ? 25.99241 47.34168 -15.65238 1.000 75.94492  ? 5   LEU A O   1 
ATOM   24   C  CB  . LEU A 1 5   ? 28.40564 45.90650 -15.91547 1.000 67.60105  ? 5   LEU A CB  1 
ATOM   25   C  CG  . LEU A 1 5   ? 29.57246 44.93200 -15.73050 1.000 69.69612  ? 5   LEU A CG  1 
ATOM   26   C  CD1 . LEU A 1 5   ? 30.90672 45.66600 -15.65707 1.000 71.77582  ? 5   LEU A CD1 1 
ATOM   27   C  CD2 . LEU A 1 5   ? 29.36114 44.07663 -14.48950 1.000 65.53696  ? 5   LEU A CD2 1 
ATOM   28   N  N   . VAL A 1 6   ? 25.03292 46.06864 -17.23437 1.000 64.80376  ? 6   VAL A N   1 
ATOM   29   C  CA  . VAL A 1 6   ? 23.87780 46.94550 -17.39561 1.000 71.33176  ? 6   VAL A CA  1 
ATOM   30   C  C   . VAL A 1 6   ? 22.74068 46.41810 -16.53812 1.000 74.89680  ? 6   VAL A C   1 
ATOM   31   O  O   . VAL A 1 6   ? 22.43179 45.22119 -16.55970 1.000 80.34148  ? 6   VAL A O   1 
ATOM   32   C  CB  . VAL A 1 6   ? 23.43948 47.03921 -18.86479 1.000 66.15619  ? 6   VAL A CB  1 
ATOM   33   C  CG1 . VAL A 1 6   ? 24.50682 47.71497 -19.69787 1.000 67.83155  ? 6   VAL A CG1 1 
ATOM   34   C  CG2 . VAL A 1 6   ? 23.13589 45.66034 -19.40425 1.000 78.72375  ? 6   VAL A CG2 1 
ATOM   35   N  N   . VAL A 1 7   ? 22.11032 47.30629 -15.78837 1.000 66.32724  ? 7   VAL A N   1 
ATOM   36   C  CA  . VAL A 1 7   ? 20.86683 46.97896 -15.11320 1.000 67.65035  ? 7   VAL A CA  1 
ATOM   37   C  C   . VAL A 1 7   ? 19.76795 47.88543 -15.65795 1.000 67.97229  ? 7   VAL A C   1 
ATOM   38   O  O   . VAL A 1 7   ? 20.00285 49.04136 -16.02876 1.000 64.27938  ? 7   VAL A O   1 
ATOM   39   C  CB  . VAL A 1 7   ? 21.00486 47.11373 -13.58568 1.000 71.50261  ? 7   VAL A CB  1 
ATOM   40   C  CG1 . VAL A 1 7   ? 21.26304 48.54294 -13.23403 1.000 76.12518  ? 7   VAL A CG1 1 
ATOM   41   C  CG2 . VAL A 1 7   ? 19.75498 46.61846 -12.88450 1.000 72.58559  ? 7   VAL A CG2 1 
ATOM   42   N  N   . GLN A 1 8   ? 18.55889 47.34252 -15.71520 1.000 69.28287  ? 8   GLN A N   1 
ATOM   43   C  CA  . GLN A 1 8   ? 17.41534 48.00107 -16.33717 1.000 74.79901  ? 8   GLN A CA  1 
ATOM   44   C  C   . GLN A 1 8   ? 16.57641 48.65165 -15.23474 1.000 77.31187  ? 8   GLN A C   1 
ATOM   45   O  O   . GLN A 1 8   ? 15.74278 47.99013 -14.60796 1.000 86.75576  ? 8   GLN A O   1 
ATOM   46   C  CB  . GLN A 1 8   ? 16.62429 46.97615 -17.15065 1.000 74.10648  ? 8   GLN A CB  1 
ATOM   47   C  CG  . GLN A 1 8   ? 15.38712 47.51104 -17.83464 1.000 77.86340  ? 8   GLN A CG  1 
ATOM   48   C  CD  . GLN A 1 8   ? 15.68930 48.63778 -18.81077 1.000 81.42232  ? 8   GLN A CD  1 
ATOM   49   O  OE1 . GLN A 1 8   ? 15.11338 49.73501 -18.71322 1.000 80.11627  ? 8   GLN A OE1 1 
ATOM   50   N  NE2 . GLN A 1 8   ? 16.59061 48.37190 -19.76694 1.000 75.56752  ? 8   GLN A NE2 1 
ATOM   51   N  N   . THR A 1 9   ? 16.79389 49.94862 -14.99099 1.000 69.07350  ? 9   THR A N   1 
ATOM   52   C  CA  . THR A 1 9   ? 16.07671 50.61492 -13.91063 1.000 66.00982  ? 9   THR A CA  1 
ATOM   53   C  C   . THR A 1 9   ? 14.73414 51.14484 -14.39416 1.000 63.26326  ? 9   THR A C   1 
ATOM   54   O  O   . THR A 1 9   ? 14.41662 51.13815 -15.58511 1.000 69.85848  ? 9   THR A O   1 
ATOM   55   C  CB  . THR A 1 9   ? 16.86024 51.78847 -13.32290 1.000 65.22995  ? 9   THR A CB  1 
ATOM   56   O  OG1 . THR A 1 9   ? 17.01175 52.81044 -14.31839 1.000 66.03104  ? 9   THR A OG1 1 
ATOM   57   C  CG2 . THR A 1 9   ? 18.23197 51.32716 -12.80800 1.000 60.93174  ? 9   THR A CG2 1 
ATOM   58   N  N   . SER A 1 10  ? 13.95280 51.64549 -13.43663 1.000 55.09859  ? 10  SER A N   1 
ATOM   59   C  CA  . SER A 1 10  ? 12.62697 52.16055 -13.75064 1.000 61.66418  ? 10  SER A CA  1 
ATOM   60   C  C   . SER A 1 10  ? 12.69589 53.34645 -14.70338 1.000 60.57354  ? 10  SER A C   1 
ATOM   61   O  O   . SER A 1 10  ? 11.71268 53.64385 -15.38851 1.000 55.23337  ? 10  SER A O   1 
ATOM   62   C  CB  . SER A 1 10  ? 11.90179 52.55165 -12.46261 1.000 62.05181  ? 10  SER A CB  1 
ATOM   63   O  OG  . SER A 1 10  ? 12.42824 53.75401 -11.91215 1.000 61.24020  ? 10  SER A OG  1 
ATOM   64   N  N   . SER A 1 11  ? 13.84149 54.03100 -14.75687 1.000 61.06954  ? 11  SER A N   1 
ATOM   65   C  CA  . SER A 1 11  ? 14.03977 55.19529 -15.60834 1.000 60.64729  ? 11  SER A CA  1 
ATOM   66   C  C   . SER A 1 11  ? 14.81974 54.88255 -16.87402 1.000 69.75279  ? 11  SER A C   1 
ATOM   67   O  O   . SER A 1 11  ? 14.81829 55.70286 -17.80005 1.000 76.88449  ? 11  SER A O   1 
ATOM   68   C  CB  . SER A 1 11  ? 14.77819 56.29572 -14.84240 1.000 60.36300  ? 11  SER A CB  1 
ATOM   69   O  OG  . SER A 1 11  ? 14.26978 56.46051 -13.53112 1.000 66.71985  ? 11  SER A OG  1 
ATOM   70   N  N   . GLY A 1 12  ? 15.49133 53.73187 -16.93545 1.000 70.70579  ? 12  GLY A N   1 
ATOM   71   C  CA  . GLY A 1 12  ? 16.22036 53.34458 -18.11730 1.000 69.37608  ? 12  GLY A CA  1 
ATOM   72   C  C   . GLY A 1 12  ? 17.42117 52.46085 -17.83806 1.000 74.01312  ? 12  GLY A C   1 
ATOM   73   O  O   . GLY A 1 12  ? 17.70647 52.08493 -16.69185 1.000 66.17199  ? 12  GLY A O   1 
ATOM   74   N  N   . PRO A 1 13  ? 18.15517 52.11707 -18.90165 1.000 77.99976  ? 13  PRO A N   1 
ATOM   75   C  CA  . PRO A 1 13  ? 19.33022 51.25691 -18.74979 1.000 71.21849  ? 13  PRO A CA  1 
ATOM   76   C  C   . PRO A 1 13  ? 20.53868 52.04769 -18.27761 1.000 62.50510  ? 13  PRO A C   1 
ATOM   77   O  O   . PRO A 1 13  ? 20.74301 53.20659 -18.65634 1.000 57.69242  ? 13  PRO A O   1 
ATOM   78   C  CB  . PRO A 1 13  ? 19.54716 50.71910 -20.16568 1.000 62.29222  ? 13  PRO A CB  1 
ATOM   79   C  CG  . PRO A 1 13  ? 19.11570 51.84251 -21.02506 1.000 62.85097  ? 13  PRO A CG  1 
ATOM   80   C  CD  . PRO A 1 13  ? 17.97155 52.53195 -20.30459 1.000 77.48036  ? 13  PRO A CD  1 
ATOM   81   N  N   . VAL A 1 14  ? 21.34737 51.39375 -17.44724 1.000 56.75089  ? 14  VAL A N   1 
ATOM   82   C  CA  . VAL A 1 14  ? 22.52534 51.99941 -16.83536 1.000 58.85024  ? 14  VAL A CA  1 
ATOM   83   C  C   . VAL A 1 14  ? 23.59171 50.92366 -16.64889 1.000 59.61442  ? 14  VAL A C   1 
ATOM   84   O  O   . VAL A 1 14  ? 23.29298 49.81746 -16.18666 1.000 62.87200  ? 14  VAL A O   1 
ATOM   85   C  CB  . VAL A 1 14  ? 22.16272 52.67277 -15.49827 1.000 71.14892  ? 14  VAL A CB  1 
ATOM   86   C  CG1 . VAL A 1 14  ? 21.31520 51.74266 -14.65492 1.000 73.68150  ? 14  VAL A CG1 1 
ATOM   87   C  CG2 . VAL A 1 14  ? 23.40520 52.97093 -14.74608 1.000 75.96319  ? 14  VAL A CG2 1 
ATOM   88   N  N   . ARG A 1 15  ? 24.83165 51.23668 -17.03397 1.000 57.84867  ? 15  ARG A N   1 
ATOM   89   C  CA  . ARG A 1 15  ? 25.95210 50.31708 -16.88653 1.000 62.80374  ? 15  ARG A CA  1 
ATOM   90   C  C   . ARG A 1 15  ? 26.97610 50.88848 -15.90924 1.000 65.98038  ? 15  ARG A C   1 
ATOM   91   O  O   . ARG A 1 15  ? 27.32807 52.07273 -15.97592 1.000 65.00502  ? 15  ARG A O   1 
ATOM   92   C  CB  . ARG A 1 15  ? 26.61124 50.01789 -18.23147 1.000 74.10808  ? 15  ARG A CB  1 
ATOM   93   C  CG  . ARG A 1 15  ? 27.26347 51.20235 -18.90731 1.000 85.97163  ? 15  ARG A CG  1 
ATOM   94   C  CD  . ARG A 1 15  ? 28.55136 50.81126 -19.62993 1.000 92.51329  ? 15  ARG A CD  1 
ATOM   95   N  NE  . ARG A 1 15  ? 29.30039 52.00794 -20.00411 1.000 94.28609  ? 15  ARG A NE  1 
ATOM   96   C  CZ  . ARG A 1 15  ? 30.53388 52.28569 -19.58590 1.000 94.85297  ? 15  ARG A CZ  1 
ATOM   97   N  NH1 . ARG A 1 15  ? 31.17447 51.44204 -18.78270 1.000 93.51683  ? 15  ARG A NH1 1 
ATOM   98   N  NH2 . ARG A 1 15  ? 31.12950 53.41152 -19.96900 1.000 94.00418  ? 15  ARG A NH2 1 
ATOM   99   N  N   . GLY A 1 16  ? 27.44179 50.04221 -14.99247 1.000 61.29708  ? 16  GLY A N   1 
ATOM   100  C  CA  . GLY A 1 16  ? 28.43299 50.41568 -14.03080 1.000 67.51009  ? 16  GLY A CA  1 
ATOM   101  C  C   . GLY A 1 16  ? 29.75158 49.72206 -14.28593 1.000 72.65300  ? 16  GLY A C   1 
ATOM   102  O  O   . GLY A 1 16  ? 30.06827 49.31557 -15.41258 1.000 77.59102  ? 16  GLY A O   1 
ATOM   103  N  N   . ARG A 1 17  ? 30.53818 49.59156 -13.21857 1.000 63.01619  ? 17  ARG A N   1 
ATOM   104  C  CA  . ARG A 1 17  ? 31.79493 48.86960 -13.28951 1.000 62.24975  ? 17  ARG A CA  1 
ATOM   105  C  C   . ARG A 1 17  ? 31.83646 47.78985 -12.21202 1.000 62.33388  ? 17  ARG A C   1 
ATOM   106  O  O   . ARG A 1 17  ? 31.03835 47.78009 -11.27352 1.000 62.93105  ? 17  ARG A O   1 
ATOM   107  C  CB  . ARG A 1 17  ? 32.99183 49.82500 -13.17395 1.000 61.89935  ? 17  ARG A CB  1 
ATOM   108  C  CG  . ARG A 1 17  ? 33.03723 50.62342 -11.90941 1.000 65.04628  ? 17  ARG A CG  1 
ATOM   109  C  CD  . ARG A 1 17  ? 34.34941 51.38361 -11.77159 1.000 69.85842  ? 17  ARG A CD  1 
ATOM   110  N  NE  . ARG A 1 17  ? 34.10025 52.66930 -11.14088 1.000 80.72704  ? 17  ARG A NE  1 
ATOM   111  C  CZ  . ARG A 1 17  ? 33.84996 52.81652 -9.84393  1.000 81.27986  ? 17  ARG A CZ  1 
ATOM   112  N  NH1 . ARG A 1 17  ? 33.84522 51.75092 -9.05260  1.000 74.80374  ? 17  ARG A NH1 1 
ATOM   113  N  NH2 . ARG A 1 17  ? 33.60382 54.02403 -9.34133  1.000 82.59228  ? 17  ARG A NH2 1 
ATOM   114  N  N   . SER A 1 18  ? 32.77421 46.86304 -12.36835 1.000 66.08905  ? 18  SER A N   1 
ATOM   115  C  CA  . SER A 1 18  ? 32.86845 45.67874 -11.52890 1.000 66.12750  ? 18  SER A CA  1 
ATOM   116  C  C   . SER A 1 18  ? 34.17394 45.71615 -10.73969 1.000 66.68834  ? 18  SER A C   1 
ATOM   117  O  O   . SER A 1 18  ? 35.24001 45.98269 -11.30234 1.000 63.22077  ? 18  SER A O   1 
ATOM   118  C  CB  . SER A 1 18  ? 32.77502 44.41680 -12.39098 1.000 71.44952  ? 18  SER A CB  1 
ATOM   119  O  OG  . SER A 1 18  ? 33.46533 43.32667 -11.80809 1.000 77.75903  ? 18  SER A OG  1 
ATOM   120  N  N   . VAL A 1 19  ? 34.08324 45.48228 -9.42879  1.000 64.96564  ? 19  VAL A N   1 
ATOM   121  C  CA  . VAL A 1 19  ? 35.25133 45.45087 -8.55802  1.000 67.51447  ? 19  VAL A CA  1 
ATOM   122  C  C   . VAL A 1 19  ? 35.30185 44.11870 -7.82911  1.000 70.86378  ? 19  VAL A C   1 
ATOM   123  O  O   . VAL A 1 19  ? 34.30732 43.39669 -7.72572  1.000 71.07373  ? 19  VAL A O   1 
ATOM   124  C  CB  . VAL A 1 19  ? 35.26596 46.58881 -7.52776  1.000 59.66168  ? 19  VAL A CB  1 
ATOM   125  C  CG1 . VAL A 1 19  ? 35.32362 47.93938 -8.21736  1.000 55.16241  ? 19  VAL A CG1 1 
ATOM   126  C  CG2 . VAL A 1 19  ? 34.05154 46.47307 -6.62742  1.000 57.61017  ? 19  VAL A CG2 1 
ATOM   127  N  N   . THR A 1 20  ? 36.48663 43.81392 -7.30164  1.000 69.59439  ? 20  THR A N   1 
ATOM   128  C  CA  . THR A 1 20  ? 36.75688 42.56526 -6.59046  1.000 66.57549  ? 20  THR A CA  1 
ATOM   129  C  C   . THR A 1 20  ? 37.36985 42.93914 -5.24191  1.000 65.34327  ? 20  THR A C   1 
ATOM   130  O  O   . THR A 1 20  ? 38.57895 43.15575 -5.12040  1.000 61.71688  ? 20  THR A O   1 
ATOM   131  C  CB  . THR A 1 20  ? 37.65675 41.64771 -7.41758  1.000 72.43950  ? 20  THR A CB  1 
ATOM   132  O  OG1 . THR A 1 20  ? 37.00704 41.36473 -8.65768  1.000 77.27168  ? 20  THR A OG1 1 
ATOM   133  C  CG2 . THR A 1 20  ? 37.89881 40.35087 -6.70777  1.000 68.06462  ? 20  THR A CG2 1 
ATOM   134  N  N   . VAL A 1 21  ? 36.51101 43.03592 -4.23223  1.000 67.37555  ? 21  VAL A N   1 
ATOM   135  C  CA  . VAL A 1 21  ? 36.88703 43.41127 -2.87490  1.000 70.37204  ? 21  VAL A CA  1 
ATOM   136  C  C   . VAL A 1 21  ? 36.75566 42.18030 -1.99128  1.000 67.40858  ? 21  VAL A C   1 
ATOM   137  O  O   . VAL A 1 21  ? 35.72934 41.49170 -2.03457  1.000 66.58358  ? 21  VAL A O   1 
ATOM   138  C  CB  . VAL A 1 21  ? 35.99737 44.55449 -2.35469  1.000 74.38291  ? 21  VAL A CB  1 
ATOM   139  C  CG1 . VAL A 1 21  ? 36.57649 45.17658 -1.09970  1.000 73.58139  ? 21  VAL A CG1 1 
ATOM   140  C  CG2 . VAL A 1 21  ? 35.82538 45.59668 -3.42818  1.000 78.94771  ? 21  VAL A CG2 1 
ATOM   141  N  N   . GLN A 1 22  ? 37.78892 41.90338 -1.19519  1.000 56.80826  ? 22  GLN A N   1 
ATOM   142  C  CA  . GLN A 1 22  ? 37.75555 40.81581 -0.21055  1.000 57.39089  ? 22  GLN A CA  1 
ATOM   143  C  C   . GLN A 1 22  ? 37.30463 39.49696 -0.83958  1.000 70.81359  ? 22  GLN A C   1 
ATOM   144  O  O   . GLN A 1 22  ? 36.53709 38.73670 -0.24089  1.000 71.43957  ? 22  GLN A O   1 
ATOM   145  C  CB  . GLN A 1 22  ? 36.85679 41.17673 0.98010   1.000 56.63737  ? 22  GLN A CB  1 
ATOM   146  C  CG  . GLN A 1 22  ? 37.14072 42.53909 1.61434   1.000 54.54745  ? 22  GLN A CG  1 
ATOM   147  C  CD  . GLN A 1 22  ? 38.21536 42.46337 2.69028   1.000 66.55894  ? 22  GLN A CD  1 
ATOM   148  O  OE1 . GLN A 1 22  ? 38.21121 41.55490 3.52395   1.000 74.81384  ? 22  GLN A OE1 1 
ATOM   149  N  NE2 . GLN A 1 22  ? 39.15382 43.41108 2.66382   1.000 52.30130  ? 22  GLN A NE2 1 
ATOM   150  N  N   . GLY A 1 23  ? 37.77479 39.23178 -2.06552  1.000 62.73338  ? 23  GLY A N   1 
ATOM   151  C  CA  . GLY A 1 23  ? 37.46004 37.99513 -2.75524  1.000 65.68475  ? 23  GLY A CA  1 
ATOM   152  C  C   . GLY A 1 23  ? 36.07031 37.90297 -3.34719  1.000 78.39511  ? 23  GLY A C   1 
ATOM   153  O  O   . GLY A 1 23  ? 35.63107 36.80482 -3.69897  1.000 79.33954  ? 23  GLY A O   1 
ATOM   154  N  N   . ARG A 1 24  ? 35.36512 39.02313 -3.48383  1.000 78.28587  ? 24  ARG A N   1 
ATOM   155  C  CA  . ARG A 1 24  ? 33.97978 39.04873 -3.93212  1.000 77.62135  ? 24  ARG A CA  1 
ATOM   156  C  C   . ARG A 1 24  ? 33.81640 40.09017 -5.02525  1.000 75.61132  ? 24  ARG A C   1 
ATOM   157  O  O   . ARG A 1 24  ? 34.30464 41.21544 -4.88801  1.000 66.70817  ? 24  ARG A O   1 
ATOM   158  C  CB  . ARG A 1 24  ? 33.03027 39.39510 -2.77790  1.000 80.78070  ? 24  ARG A CB  1 
ATOM   159  C  CG  . ARG A 1 24  ? 32.27069 38.23381 -2.16612  1.000 91.32846  ? 24  ARG A CG  1 
ATOM   160  C  CD  . ARG A 1 24  ? 30.91901 38.72531 -1.64788  1.000 95.21146  ? 24  ARG A CD  1 
ATOM   161  N  NE  . ARG A 1 24  ? 30.30413 37.78368 -0.71886  1.000 102.34998 ? 24  ARG A NE  1 
ATOM   162  C  CZ  . ARG A 1 24  ? 29.37117 36.89686 -1.05563  1.000 107.77166 ? 24  ARG A CZ  1 
ATOM   163  N  NH1 . ARG A 1 24  ? 28.92000 36.83416 -2.30538  1.000 105.40160 ? 24  ARG A NH1 1 
ATOM   164  N  NH2 . ARG A 1 24  ? 28.88017 36.07596 -0.13589  1.000 111.87488 ? 24  ARG A NH2 1 
ATOM   165  N  N   . GLU A 1 25  ? 33.11090 39.72417 -6.09799  1.000 80.85956  ? 25  GLU A N   1 
ATOM   166  C  CA  . GLU A 1 25  ? 32.78141 40.68336 -7.14718  1.000 79.37635  ? 25  GLU A CA  1 
ATOM   167  C  C   . GLU A 1 25  ? 31.56965 41.51381 -6.73206  1.000 70.54002  ? 25  GLU A C   1 
ATOM   168  O  O   . GLU A 1 25  ? 30.52583 40.96254 -6.37087  1.000 73.74752  ? 25  GLU A O   1 
ATOM   169  C  CB  . GLU A 1 25  ? 32.51098 39.96983 -8.47737  1.000 87.84237  ? 25  GLU A CB  1 
ATOM   170  C  CG  . GLU A 1 25  ? 32.74352 40.85371 -9.72137  1.000 92.45149  ? 25  GLU A CG  1 
ATOM   171  C  CD  . GLU A 1 25  ? 32.03026 40.36319 -10.98491 1.000 94.81504  ? 25  GLU A CD  1 
ATOM   172  O  OE1 . GLU A 1 25  ? 31.23377 39.40374 -10.91113 1.000 92.28691  ? 25  GLU A OE1 1 
ATOM   173  O  OE2 . GLU A 1 25  ? 32.26016 40.95710 -12.06001 1.000 94.31378  ? 25  GLU A OE2 1 
ATOM   174  N  N   . VAL A 1 26  ? 31.72109 42.83895 -6.76076  1.000 56.72098  ? 26  VAL A N   1 
ATOM   175  C  CA  . VAL A 1 26  ? 30.62825 43.78692 -6.55420  1.000 52.20338  ? 26  VAL A CA  1 
ATOM   176  C  C   . VAL A 1 26  ? 30.48342 44.63847 -7.80686  1.000 52.71700  ? 26  VAL A C   1 
ATOM   177  O  O   . VAL A 1 26  ? 31.48434 44.97351 -8.45051  1.000 63.86404  ? 26  VAL A O   1 
ATOM   178  C  CB  . VAL A 1 26  ? 30.86410 44.69313 -5.32120  1.000 57.58117  ? 26  VAL A CB  1 
ATOM   179  C  CG1 . VAL A 1 26  ? 29.60171 45.49024 -4.98343  1.000 55.08720  ? 26  VAL A CG1 1 
ATOM   180  C  CG2 . VAL A 1 26  ? 31.29808 43.87718 -4.11886  1.000 49.09160  ? 26  VAL A CG2 1 
ATOM   181  N  N   . HIS A 1 27  ? 29.24673 45.00655 -8.14354  1.000 51.50315  ? 27  HIS A N   1 
ATOM   182  C  CA  . HIS A 1 27  ? 28.97385 45.87043 -9.29181  1.000 57.85000  ? 27  HIS A CA  1 
ATOM   183  C  C   . HIS A 1 27  ? 28.62582 47.26683 -8.80104  1.000 48.67926  ? 27  HIS A C   1 
ATOM   184  O  O   . HIS A 1 27  ? 27.64046 47.43409 -8.08418  1.000 46.41106  ? 27  HIS A O   1 
ATOM   185  C  CB  . HIS A 1 27  ? 27.83481 45.30957 -10.14029 1.000 53.43098  ? 27  HIS A CB  1 
ATOM   186  C  CG  . HIS A 1 27  ? 28.18624 44.04003 -10.84588 1.000 60.76537  ? 27  HIS A CG  1 
ATOM   187  N  ND1 . HIS A 1 27  ? 27.25131 43.27349 -11.50468 1.000 66.19558  ? 27  HIS A ND1 1 
ATOM   188  C  CD2 . HIS A 1 27  ? 29.37121 43.40588 -10.99963 1.000 61.03452  ? 27  HIS A CD2 1 
ATOM   189  C  CE1 . HIS A 1 27  ? 27.84387 42.21862 -12.03168 1.000 69.19606  ? 27  HIS A CE1 1 
ATOM   190  N  NE2 . HIS A 1 27  ? 29.12957 42.27341 -11.73385 1.000 66.13032  ? 27  HIS A NE2 1 
ATOM   191  N  N   . VAL A 1 28  ? 29.41132 48.26541 -9.20359  1.000 48.77202  ? 28  VAL A N   1 
ATOM   192  C  CA  . VAL A 1 28  ? 29.33879 49.60783 -8.63070  1.000 47.88620  ? 28  VAL A CA  1 
ATOM   193  C  C   . VAL A 1 28  ? 28.75950 50.56042 -9.66115  1.000 52.20995  ? 28  VAL A C   1 
ATOM   194  O  O   . VAL A 1 28  ? 29.40507 50.86656 -10.67152 1.000 60.27764  ? 28  VAL A O   1 
ATOM   195  C  CB  . VAL A 1 28  ? 30.70897 50.10415 -8.15046  1.000 53.22279  ? 28  VAL A CB  1 
ATOM   196  C  CG1 . VAL A 1 28  ? 30.56818 51.47869 -7.46146  1.000 43.71679  ? 28  VAL A CG1 1 
ATOM   197  C  CG2 . VAL A 1 28  ? 31.35064 49.07667 -7.21379  1.000 57.83699  ? 28  VAL A CG2 1 
ATOM   198  N  N   . TYR A 1 29  ? 27.56239 51.06882 -9.38036  1.000 54.75097  ? 29  TYR A N   1 
ATOM   199  C  CA  . TYR A 1 29  ? 26.87434 52.02425 -10.24408 1.000 55.70060  ? 29  TYR A CA  1 
ATOM   200  C  C   . TYR A 1 29  ? 26.83157 53.35781 -9.49951  1.000 54.62821  ? 29  TYR A C   1 
ATOM   201  O  O   . TYR A 1 29  ? 26.11563 53.49583 -8.50241  1.000 39.06468  ? 29  TYR A O   1 
ATOM   202  C  CB  . TYR A 1 29  ? 25.46498 51.53845 -10.61440 1.000 45.78326  ? 29  TYR A CB  1 
ATOM   203  C  CG  . TYR A 1 29  ? 25.37245 50.09116 -11.07292 1.000 50.59769  ? 29  TYR A CG  1 
ATOM   204  C  CD1 . TYR A 1 29  ? 25.36775 49.05037 -10.15571 1.000 51.86857  ? 29  TYR A CD1 1 
ATOM   205  C  CD2 . TYR A 1 29  ? 25.26665 49.76841 -12.42043 1.000 61.16097  ? 29  TYR A CD2 1 
ATOM   206  C  CE1 . TYR A 1 29  ? 25.29343 47.72341 -10.56139 1.000 59.79631  ? 29  TYR A CE1 1 
ATOM   207  C  CE2 . TYR A 1 29  ? 25.18459 48.43797 -12.84187 1.000 70.00353  ? 29  TYR A CE2 1 
ATOM   208  C  CZ  . TYR A 1 29  ? 25.19735 47.41700 -11.90296 1.000 69.90507  ? 29  TYR A CZ  1 
ATOM   209  O  OH  . TYR A 1 29  ? 25.11925 46.09153 -12.30153 1.000 68.18751  ? 29  TYR A OH  1 
ATOM   210  N  N   . THR A 1 30  ? 27.58906 54.33700 -9.99233  1.000 58.47508  ? 30  THR A N   1 
ATOM   211  C  CA  . THR A 1 30  ? 27.65359 55.67642 -9.42113  1.000 54.47245  ? 30  THR A CA  1 
ATOM   212  C  C   . THR A 1 30  ? 27.15873 56.71840 -10.42325 1.000 55.79953  ? 30  THR A C   1 
ATOM   213  O  O   . THR A 1 30  ? 27.46084 56.63736 -11.61795 1.000 59.87508  ? 30  THR A O   1 
ATOM   214  C  CB  . THR A 1 30  ? 29.08719 56.00273 -9.01268  1.000 53.11918  ? 30  THR A CB  1 
ATOM   215  O  OG1 . THR A 1 30  ? 29.98889 55.49724 -10.01090 1.000 68.96719  ? 30  THR A OG1 1 
ATOM   216  C  CG2 . THR A 1 30  ? 29.41291 55.35269 -7.70261  1.000 41.35278  ? 30  THR A CG2 1 
ATOM   217  N  N   . GLY A 1 31  ? 26.41358 57.70878 -9.93190  1.000 52.56076  ? 31  GLY A N   1 
ATOM   218  C  CA  . GLY A 1 31  ? 26.00052 58.82923 -10.75781 1.000 43.33321  ? 31  GLY A CA  1 
ATOM   219  C  C   . GLY A 1 31  ? 24.69479 58.65924 -11.50062 1.000 46.29783  ? 31  GLY A C   1 
ATOM   220  O  O   . GLY A 1 31  ? 24.56313 59.15421 -12.62802 1.000 54.05186  ? 31  GLY A O   1 
ATOM   221  N  N   . ILE A 1 32  ? 23.71965 57.97611 -10.91293 1.000 48.16611  ? 32  ILE A N   1 
ATOM   222  C  CA  . ILE A 1 32  ? 22.42542 57.75178 -11.55818 1.000 44.56750  ? 32  ILE A CA  1 
ATOM   223  C  C   . ILE A 1 32  ? 21.48582 58.88942 -11.16340 1.000 49.38385  ? 32  ILE A C   1 
ATOM   224  O  O   . ILE A 1 32  ? 21.34131 59.17312 -9.96621  1.000 50.20921  ? 32  ILE A O   1 
ATOM   225  C  CB  . ILE A 1 32  ? 21.84776 56.38570 -11.15775 1.000 39.15831  ? 32  ILE A CB  1 
ATOM   226  C  CG1 . ILE A 1 32  ? 22.78761 55.25750 -11.57543 1.000 42.63661  ? 32  ILE A CG1 1 
ATOM   227  C  CG2 . ILE A 1 32  ? 20.48143 56.20122 -11.74899 1.000 41.96311  ? 32  ILE A CG2 1 
ATOM   228  C  CD1 . ILE A 1 32  ? 22.38217 53.90947 -11.03797 1.000 44.59909  ? 32  ILE A CD1 1 
ATOM   229  N  N   . PRO A 1 33  ? 20.83622 59.57407 -12.10818 1.000 44.85869  ? 33  PRO A N   1 
ATOM   230  C  CA  . PRO A 1 33  ? 19.96599 60.70006 -11.73188 1.000 44.72958  ? 33  PRO A CA  1 
ATOM   231  C  C   . PRO A 1 33  ? 18.64130 60.18279 -11.19425 1.000 42.32843  ? 33  PRO A C   1 
ATOM   232  O  O   . PRO A 1 33  ? 18.01131 59.30967 -11.79870 1.000 48.13212  ? 33  PRO A O   1 
ATOM   233  C  CB  . PRO A 1 33  ? 19.77260 61.46192 -13.04877 1.000 45.46027  ? 33  PRO A CB  1 
ATOM   234  C  CG  . PRO A 1 33  ? 19.91796 60.42374 -14.08636 1.000 40.86897  ? 33  PRO A CG  1 
ATOM   235  C  CD  . PRO A 1 33  ? 20.92365 59.41498 -13.56628 1.000 42.85792  ? 33  PRO A CD  1 
ATOM   236  N  N   . TYR A 1 34  ? 18.22189 60.72055 -10.05016 1.000 36.87694  ? 34  TYR A N   1 
ATOM   237  C  CA  . TYR A 1 34  ? 16.92633 60.38516 -9.48266  1.000 32.63997  ? 34  TYR A CA  1 
ATOM   238  C  C   . TYR A 1 34  ? 15.95109 61.55149 -9.50520  1.000 32.28681  ? 34  TYR A C   1 
ATOM   239  O  O   . TYR A 1 34  ? 14.80464 61.37926 -9.08792  1.000 43.03565  ? 34  TYR A O   1 
ATOM   240  C  CB  . TYR A 1 34  ? 17.08696 59.83897 -8.05916  1.000 37.82369  ? 34  TYR A CB  1 
ATOM   241  C  CG  . TYR A 1 34  ? 17.45154 60.84858 -6.97977  1.000 40.92560  ? 34  TYR A CG  1 
ATOM   242  C  CD1 . TYR A 1 34  ? 16.46567 61.42745 -6.18542  1.000 27.99525  ? 34  TYR A CD1 1 
ATOM   243  C  CD2 . TYR A 1 34  ? 18.78040 61.20011 -6.73855  1.000 36.73663  ? 34  TYR A CD2 1 
ATOM   244  C  CE1 . TYR A 1 34  ? 16.78314 62.33532 -5.19238  1.000 34.31614  ? 34  TYR A CE1 1 
ATOM   245  C  CE2 . TYR A 1 34  ? 19.11097 62.12398 -5.73277  1.000 31.64440  ? 34  TYR A CE2 1 
ATOM   246  C  CZ  . TYR A 1 34  ? 18.10079 62.67922 -4.96186  1.000 32.09494  ? 34  TYR A CZ  1 
ATOM   247  O  OH  . TYR A 1 34  ? 18.39344 63.58356 -3.95976  1.000 33.54859  ? 34  TYR A OH  1 
ATOM   248  N  N   . ALA A 1 35  ? 16.35113 62.70961 -10.03532 1.000 32.76971  ? 35  ALA A N   1 
ATOM   249  C  CA  . ALA A 1 35  ? 15.48011 63.87730 -10.12981 1.000 35.01761  ? 35  ALA A CA  1 
ATOM   250  C  C   . ALA A 1 35  ? 15.95374 64.76054 -11.27083 1.000 47.23386  ? 35  ALA A C   1 
ATOM   251  O  O   . ALA A 1 35  ? 17.11128 64.67384 -11.70769 1.000 40.74163  ? 35  ALA A O   1 
ATOM   252  C  CB  . ALA A 1 35  ? 15.46765 64.70439 -8.83548  1.000 35.91830  ? 35  ALA A CB  1 
ATOM   253  N  N   . LYS A 1 36  ? 15.05269 65.63314 -11.73946 1.000 48.04591  ? 36  LYS A N   1 
ATOM   254  C  CA  . LYS A 1 36  ? 15.47299 66.64228 -12.70016 1.000 40.73786  ? 36  LYS A CA  1 
ATOM   255  C  C   . LYS A 1 36  ? 16.50517 67.56078 -12.04477 1.000 43.82612  ? 36  LYS A C   1 
ATOM   256  O  O   . LYS A 1 36  ? 16.41953 67.84225 -10.84159 1.000 40.17824  ? 36  LYS A O   1 
ATOM   257  C  CB  . LYS A 1 36  ? 14.30269 67.47981 -13.22240 1.000 43.13431  ? 36  LYS A CB  1 
ATOM   258  C  CG  . LYS A 1 36  ? 13.17139 66.66457 -13.85236 1.000 56.14337  ? 36  LYS A CG  1 
ATOM   259  C  CD  . LYS A 1 36  ? 12.24499 67.50933 -14.75617 1.000 61.88532  ? 36  LYS A CD  1 
ATOM   260  C  CE  . LYS A 1 36  ? 13.00675 68.61422 -15.51019 1.000 65.14302  ? 36  LYS A CE  1 
ATOM   261  N  NZ  . LYS A 1 36  ? 12.12420 69.58187 -16.23653 1.000 64.12745  ? 36  LYS A NZ  1 
ATOM   262  N  N   . PRO A 1 37  ? 17.50322 68.00641 -12.78783 1.000 53.05925  ? 37  PRO A N   1 
ATOM   263  C  CA  . PRO A 1 37  ? 18.46524 68.94728 -12.23388 1.000 55.82636  ? 37  PRO A CA  1 
ATOM   264  C  C   . PRO A 1 37  ? 17.76168 70.18862 -11.70914 1.000 59.65172  ? 37  PRO A C   1 
ATOM   265  O  O   . PRO A 1 37  ? 17.17895 70.96037 -12.48748 1.000 64.49358  ? 37  PRO A O   1 
ATOM   266  C  CB  . PRO A 1 37  ? 19.36330 69.25875 -13.44052 1.000 51.39351  ? 37  PRO A CB  1 
ATOM   267  C  CG  . PRO A 1 37  ? 19.32029 68.00896 -14.22774 1.000 40.59529  ? 37  PRO A CG  1 
ATOM   268  C  CD  . PRO A 1 37  ? 17.91138 67.51768 -14.11316 1.000 39.73386  ? 37  PRO A CD  1 
ATOM   269  N  N   . PRO A 1 38  ? 17.78737 70.41011 -10.38078 1.000 50.08523  ? 38  PRO A N   1 
ATOM   270  C  CA  . PRO A 1 38  ? 17.00398 71.50589 -9.73440  1.000 50.80625  ? 38  PRO A CA  1 
ATOM   271  C  C   . PRO A 1 38  ? 17.60474 72.89771 -9.93579  1.000 52.50330  ? 38  PRO A C   1 
ATOM   272  O  O   . PRO A 1 38  ? 18.12954 73.53946 -9.02120  1.000 56.73063  ? 38  PRO A O   1 
ATOM   273  C  CB  . PRO A 1 38  ? 17.02094 71.10384 -8.25686  1.000 39.01587  ? 38  PRO A CB  1 
ATOM   274  C  CG  . PRO A 1 38  ? 18.35358 70.39769 -8.08402  1.000 37.65252  ? 38  PRO A CG  1 
ATOM   275  C  CD  . PRO A 1 38  ? 18.63285 69.68251 -9.41302  1.000 37.84892  ? 38  PRO A CD  1 
ATOM   276  N  N   . VAL A 1 39  ? 17.49858 73.39450 -11.16860 1.000 47.29172  ? 39  VAL A N   1 
ATOM   277  C  CA  . VAL A 1 39  ? 18.10639 74.64863 -11.59290 1.000 48.19455  ? 39  VAL A CA  1 
ATOM   278  C  C   . VAL A 1 39  ? 17.03565 75.48857 -12.27667 1.000 52.16166  ? 39  VAL A C   1 
ATOM   279  O  O   . VAL A 1 39  ? 15.93543 75.01311 -12.56272 1.000 52.30907  ? 39  VAL A O   1 
ATOM   280  C  CB  . VAL A 1 39  ? 19.29636 74.41764 -12.54516 1.000 48.65233  ? 39  VAL A CB  1 
ATOM   281  C  CG1 . VAL A 1 39  ? 20.30102 73.46536 -11.91673 1.000 40.37226  ? 39  VAL A CG1 1 
ATOM   282  C  CG2 . VAL A 1 39  ? 18.79410 73.85483 -13.84470 1.000 43.03240  ? 39  VAL A CG2 1 
ATOM   283  N  N   . GLU A 1 40  ? 17.37469 76.74500 -12.54809 1.000 43.13028  ? 40  GLU A N   1 
ATOM   284  C  CA  . GLU A 1 40  ? 16.43334 77.64916 -13.23005 1.000 62.34155  ? 40  GLU A CA  1 
ATOM   285  C  C   . GLU A 1 40  ? 15.20332 77.77611 -12.32493 1.000 52.14001  ? 40  GLU A C   1 
ATOM   286  O  O   . GLU A 1 40  ? 15.36111 77.89905 -11.10501 1.000 43.26051  ? 40  GLU A O   1 
ATOM   287  C  CB  . GLU A 1 40  ? 16.16247 77.14983 -14.63583 1.000 65.71549  ? 40  GLU A CB  1 
ATOM   288  C  CG  . GLU A 1 40  ? 17.36118 77.26747 -15.54698 1.000 73.37801  ? 40  GLU A CG  1 
ATOM   289  C  CD  . GLU A 1 40  ? 17.13157 78.28351 -16.62948 1.000 91.41081  ? 40  GLU A CD  1 
ATOM   290  O  OE1 . GLU A 1 40  ? 18.07146 79.05777 -16.90751 1.000 101.71119 ? 40  GLU A OE1 1 
ATOM   291  O  OE2 . GLU A 1 40  ? 16.01237 78.31167 -17.19764 1.000 91.43806  ? 40  GLU A OE2 1 
ATOM   292  N  N   . ASP A 1 41  ? 13.97992 77.73845 -12.86174 1.000 50.45077  ? 41  ASP A N   1 
ATOM   293  C  CA  . ASP A 1 41  ? 12.80122 77.83805 -12.00777 1.000 58.75671  ? 41  ASP A CA  1 
ATOM   294  C  C   . ASP A 1 41  ? 12.68918 76.67022 -11.03049 1.000 54.08489  ? 41  ASP A C   1 
ATOM   295  O  O   . ASP A 1 41  ? 11.84744 76.71372 -10.11841 1.000 57.85140  ? 41  ASP A O   1 
ATOM   296  C  CB  . ASP A 1 41  ? 11.53383 77.92512 -12.84695 1.000 66.03407  ? 41  ASP A CB  1 
ATOM   297  C  CG  . ASP A 1 41  ? 11.32107 76.67917 -13.66356 1.000 99.97462  ? 41  ASP A CG  1 
ATOM   298  O  OD1 . ASP A 1 41  ? 12.35070 76.07060 -14.04839 1.000 111.13510 ? 41  ASP A OD1 1 
ATOM   299  O  OD2 . ASP A 1 41  ? 10.14968 76.30856 -13.91444 1.000 111.53551 ? 41  ASP A OD2 1 
ATOM   300  N  N   . LEU A 1 42  ? 13.52560 75.64332 -11.16300 1.000 47.25962  ? 42  LEU A N   1 
ATOM   301  C  CA  . LEU A 1 42  ? 13.43275 74.53079 -10.23272 1.000 48.68152  ? 42  LEU A CA  1 
ATOM   302  C  C   . LEU A 1 42  ? 14.32995 74.70267 -9.01135  1.000 46.20684  ? 42  LEU A C   1 
ATOM   303  O  O   . LEU A 1 42  ? 14.36336 73.80515 -8.16535  1.000 49.91567  ? 42  LEU A O   1 
ATOM   304  C  CB  . LEU A 1 42  ? 13.73123 73.20441 -10.94316 1.000 36.95248  ? 42  LEU A CB  1 
ATOM   305  C  CG  . LEU A 1 42  ? 12.50821 72.47250 -11.52829 1.000 42.29502  ? 42  LEU A CG  1 
ATOM   306  C  CD1 . LEU A 1 42  ? 12.85678 71.09928 -12.08762 1.000 49.26394  ? 42  LEU A CD1 1 
ATOM   307  C  CD2 . LEU A 1 42  ? 11.40518 72.31853 -10.51208 1.000 40.48817  ? 42  LEU A CD2 1 
ATOM   308  N  N   . ARG A 1 43  ? 15.04255 75.82638 -8.88450  1.000 42.74784  ? 43  ARG A N   1 
ATOM   309  C  CA  . ARG A 1 43  ? 15.76571 76.10276 -7.64784  1.000 42.71107  ? 43  ARG A CA  1 
ATOM   310  C  C   . ARG A 1 43  ? 14.78512 76.34222 -6.49871  1.000 48.96123  ? 43  ARG A C   1 
ATOM   311  O  O   . ARG A 1 43  ? 13.68610 76.87184 -6.69253  1.000 51.05612  ? 43  ARG A O   1 
ATOM   312  C  CB  . ARG A 1 43  ? 16.69655 77.30974 -7.80393  1.000 45.78426  ? 43  ARG A CB  1 
ATOM   313  C  CG  . ARG A 1 43  ? 17.38641 77.74132 -6.49041  1.000 48.16317  ? 43  ARG A CG  1 
ATOM   314  C  CD  . ARG A 1 43  ? 18.22321 79.01916 -6.66185  1.000 58.27849  ? 43  ARG A CD  1 
ATOM   315  N  NE  . ARG A 1 43  ? 19.51594 78.78574 -7.32169  1.000 62.13822  ? 43  ARG A NE  1 
ATOM   316  C  CZ  . ARG A 1 43  ? 20.24852 79.73176 -7.91453  1.000 66.16833  ? 43  ARG A CZ  1 
ATOM   317  N  NH1 . ARG A 1 43  ? 19.82803 80.98917 -7.96441  1.000 64.72737  ? 43  ARG A NH1 1 
ATOM   318  N  NH2 . ARG A 1 43  ? 21.40284 79.41511 -8.47590  1.000 68.10807  ? 43  ARG A NH2 1 
ATOM   319  N  N   . PHE A 1 44  ? 15.18019 75.89460 -5.29850  1.000 46.18371  ? 44  PHE A N   1 
ATOM   320  C  CA  . PHE A 1 44  ? 14.40565 76.06048 -4.06788  1.000 36.49112  ? 44  PHE A CA  1 
ATOM   321  C  C   . PHE A 1 44  ? 13.13984 75.19912 -4.03510  1.000 34.03080  ? 44  PHE A C   1 
ATOM   322  O  O   . PHE A 1 44  ? 12.51300 75.04689 -2.97961  1.000 31.70312  ? 44  PHE A O   1 
ATOM   323  C  CB  . PHE A 1 44  ? 14.02948 77.53022 -3.86380  1.000 36.46578  ? 44  PHE A CB  1 
ATOM   324  C  CG  . PHE A 1 44  ? 15.21229 78.46451 -3.73754  1.000 40.61917  ? 44  PHE A CG  1 
ATOM   325  C  CD1 . PHE A 1 44  ? 16.32989 78.11967 -2.99382  1.000 40.64711  ? 44  PHE A CD1 1 
ATOM   326  C  CD2 . PHE A 1 44  ? 15.18972 79.70685 -4.34416  1.000 37.18338  ? 44  PHE A CD2 1 
ATOM   327  C  CE1 . PHE A 1 44  ? 17.40906 79.00288 -2.86839  1.000 36.32716  ? 44  PHE A CE1 1 
ATOM   328  C  CE2 . PHE A 1 44  ? 16.25864 80.58110 -4.22197  1.000 39.81215  ? 44  PHE A CE2 1 
ATOM   329  C  CZ  . PHE A 1 44  ? 17.36947 80.23004 -3.48494  1.000 37.27093  ? 44  PHE A CZ  1 
ATOM   330  N  N   . ARG A 1 45  ? 12.73588 74.63538 -5.16910  1.000 32.12560  ? 45  ARG A N   1 
ATOM   331  C  CA  . ARG A 1 45  ? 11.47045 73.91953 -5.18464  1.000 32.54373  ? 45  ARG A CA  1 
ATOM   332  C  C   . ARG A 1 45  ? 11.67652 72.46120 -4.81423  1.000 39.27414  ? 45  ARG A C   1 
ATOM   333  O  O   . ARG A 1 45  ? 12.80035 71.95391 -4.74246  1.000 43.33413  ? 45  ARG A O   1 
ATOM   334  C  CB  . ARG A 1 45  ? 10.80036 74.02821 -6.54941  1.000 32.99836  ? 45  ARG A CB  1 
ATOM   335  C  CG  . ARG A 1 45  ? 10.56880 75.45736 -6.97969  1.000 35.06292  ? 45  ARG A CG  1 
ATOM   336  C  CD  . ARG A 1 45  ? 9.35713  75.54438 -7.86102  1.000 37.29406  ? 45  ARG A CD  1 
ATOM   337  N  NE  . ARG A 1 45  ? 9.39219  76.73752 -8.69140  1.000 50.08684  ? 45  ARG A NE  1 
ATOM   338  C  CZ  . ARG A 1 45  ? 8.46441  77.69021 -8.67637  1.000 54.73836  ? 45  ARG A CZ  1 
ATOM   339  N  NH1 . ARG A 1 45  ? 7.40315  77.59261 -7.87659  1.000 51.28642  ? 45  ARG A NH1 1 
ATOM   340  N  NH2 . ARG A 1 45  ? 8.59866  78.73784 -9.47523  1.000 55.84591  ? 45  ARG A NH2 1 
ATOM   341  N  N   . LYS A 1 46  ? 10.56601 71.78137 -4.57167  1.000 39.09387  ? 46  LYS A N   1 
ATOM   342  C  CA  . LYS A 1 46  ? 10.63450 70.35359 -4.32246  1.000 42.86023  ? 46  LYS A CA  1 
ATOM   343  C  C   . LYS A 1 46  ? 11.24282 69.64517 -5.53944  1.000 46.31902  ? 46  LYS A C   1 
ATOM   344  O  O   . LYS A 1 46  ? 11.13020 70.12802 -6.66852  1.000 48.03544  ? 46  LYS A O   1 
ATOM   345  C  CB  . LYS A 1 46  ? 9.23773  69.81144 -4.01966  1.000 31.70861  ? 46  LYS A CB  1 
ATOM   346  C  CG  . LYS A 1 46  ? 8.65681  70.29458 -2.73017  1.000 33.36663  ? 46  LYS A CG  1 
ATOM   347  C  CD  . LYS A 1 46  ? 7.21829  69.83107 -2.59689  1.000 44.19338  ? 46  LYS A CD  1 
ATOM   348  C  CE  . LYS A 1 46  ? 6.55711  70.41243 -1.34763  1.000 50.43747  ? 46  LYS A CE  1 
ATOM   349  N  NZ  . LYS A 1 46  ? 5.09684  70.09842 -1.27117  1.000 54.63919  ? 46  LYS A NZ  1 
ATOM   350  N  N   . PRO A 1 47  ? 11.91135 68.51374 -5.34113  1.000 45.26522  ? 47  PRO A N   1 
ATOM   351  C  CA  . PRO A 1 47  ? 12.47323 67.79405 -6.48475  1.000 42.12288  ? 47  PRO A CA  1 
ATOM   352  C  C   . PRO A 1 47  ? 11.36781 67.20228 -7.33441  1.000 41.96108  ? 47  PRO A C   1 
ATOM   353  O  O   . PRO A 1 47  ? 10.27494 66.92197 -6.84234  1.000 44.93515  ? 47  PRO A O   1 
ATOM   354  C  CB  . PRO A 1 47  ? 13.30379 66.69423 -5.82733  1.000 41.42490  ? 47  PRO A CB  1 
ATOM   355  C  CG  . PRO A 1 47  ? 12.57041 66.42936 -4.55207  1.000 46.41335  ? 47  PRO A CG  1 
ATOM   356  C  CD  . PRO A 1 47  ? 12.10793 67.77716 -4.08102  1.000 45.52165  ? 47  PRO A CD  1 
ATOM   357  N  N   . VAL A 1 48  ? 11.65290 67.01715 -8.62417  1.000 36.77524  ? 48  VAL A N   1 
ATOM   358  C  CA  . VAL A 1 48  ? 10.72558 66.28833 -9.49410  1.000 43.08618  ? 48  VAL A CA  1 
ATOM   359  C  C   . VAL A 1 48  ? 11.42859 65.08657 -10.11232 1.000 41.54701  ? 48  VAL A C   1 
ATOM   360  O  O   . VAL A 1 48  ? 12.61549 65.16909 -10.47716 1.000 42.84333  ? 48  VAL A O   1 
ATOM   361  C  CB  . VAL A 1 48  ? 10.11963 67.18531 -10.58957 1.000 52.87983  ? 48  VAL A CB  1 
ATOM   362  C  CG1 . VAL A 1 48  ? 9.21319  68.23415 -9.98001  1.000 59.56857  ? 48  VAL A CG1 1 
ATOM   363  C  CG2 . VAL A 1 48  ? 11.18506 67.84326 -11.39507 1.000 56.48361  ? 48  VAL A CG2 1 
ATOM   364  N  N   . PRO A 1 49  ? 10.72672 63.95906 -10.25352 1.000 42.12208  ? 49  PRO A N   1 
ATOM   365  C  CA  . PRO A 1 49  ? 11.34048 62.74482 -10.80432 1.000 41.50086  ? 49  PRO A CA  1 
ATOM   366  C  C   . PRO A 1 49  ? 12.01262 63.00366 -12.14462 1.000 44.01999  ? 49  PRO A C   1 
ATOM   367  O  O   . PRO A 1 49  ? 11.55461 63.82145 -12.94985 1.000 39.31331  ? 49  PRO A O   1 
ATOM   368  C  CB  . PRO A 1 49  ? 10.15381 61.78728 -10.95949 1.000 41.67390  ? 49  PRO A CB  1 
ATOM   369  C  CG  . PRO A 1 49  ? 9.15418  62.27054 -9.96369  1.000 42.46682  ? 49  PRO A CG  1 
ATOM   370  C  CD  . PRO A 1 49  ? 9.30186  63.76523 -9.93560  1.000 42.72156  ? 49  PRO A CD  1 
ATOM   371  N  N   . ALA A 1 50  ? 13.09528 62.26986 -12.37933 1.000 54.55892  ? 50  ALA A N   1 
ATOM   372  C  CA  . ALA A 1 50  ? 13.95041 62.52264 -13.52702 1.000 58.16357  ? 50  ALA A CA  1 
ATOM   373  C  C   . ALA A 1 50  ? 13.29949 62.05453 -14.82428 1.000 62.23079  ? 50  ALA A C   1 
ATOM   374  O  O   . ALA A 1 50  ? 12.44918 61.16090 -14.83700 1.000 59.41847  ? 50  ALA A O   1 
ATOM   375  C  CB  . ALA A 1 50  ? 15.29716 61.83340 -13.33497 1.000 60.02394  ? 50  ALA A CB  1 
ATOM   376  N  N   . GLU A 1 51  ? 13.70247 62.68834 -15.92053 1.000 69.78130  ? 51  GLU A N   1 
ATOM   377  C  CA  . GLU A 1 51  ? 13.26353 62.31722 -17.26673 1.000 77.45981  ? 51  GLU A CA  1 
ATOM   378  C  C   . GLU A 1 51  ? 13.78597 60.92328 -17.60295 1.000 73.05055  ? 51  GLU A C   1 
ATOM   379  O  O   . GLU A 1 51  ? 15.00810 60.70485 -17.55302 1.000 71.72418  ? 51  GLU A O   1 
ATOM   380  C  CB  . GLU A 1 51  ? 13.78634 63.32650 -18.29622 1.000 86.97600  ? 51  GLU A CB  1 
ATOM   381  C  CG  . GLU A 1 51  ? 13.83018 64.77657 -17.81101 1.000 99.23267  ? 51  GLU A CG  1 
ATOM   382  C  CD  . GLU A 1 51  ? 15.09863 65.11098 -16.98586 1.000 102.07271 ? 51  GLU A CD  1 
ATOM   383  O  OE1 . GLU A 1 51  ? 15.75575 66.13710 -17.29421 1.000 101.55141 ? 51  GLU A OE1 1 
ATOM   384  O  OE2 . GLU A 1 51  ? 15.42476 64.35555 -16.02635 1.000 96.93386  ? 51  GLU A OE2 1 
ATOM   385  N  N   . PRO A 1 52  ? 12.91620 59.95499 -17.88982 1.000 75.10428  ? 52  PRO A N   1 
ATOM   386  C  CA  . PRO A 1 52  ? 13.38428 58.67350 -18.43637 1.000 73.25374  ? 52  PRO A CA  1 
ATOM   387  C  C   . PRO A 1 52  ? 14.32303 58.88729 -19.61548 1.000 68.81698  ? 52  PRO A C   1 
ATOM   388  O  O   . PRO A 1 52  ? 14.19630 59.85835 -20.36329 1.000 64.06109  ? 52  PRO A O   1 
ATOM   389  C  CB  . PRO A 1 52  ? 12.08930 57.97912 -18.87115 1.000 72.49337  ? 52  PRO A CB  1 
ATOM   390  C  CG  . PRO A 1 52  ? 11.07047 58.50385 -17.92960 1.000 78.49935  ? 52  PRO A CG  1 
ATOM   391  C  CD  . PRO A 1 52  ? 11.47870 59.92956 -17.57627 1.000 79.26183  ? 52  PRO A CD  1 
ATOM   392  N  N   . TRP A 1 53  ? 15.28295 57.97231 -19.76670 1.000 74.63111  ? 53  TRP A N   1 
ATOM   393  C  CA  . TRP A 1 53  ? 16.32088 58.08395 -20.78699 1.000 86.38934  ? 53  TRP A CA  1 
ATOM   394  C  C   . TRP A 1 53  ? 16.39418 56.81689 -21.62570 1.000 89.40422  ? 53  TRP A C   1 
ATOM   395  O  O   . TRP A 1 53  ? 16.03508 55.72335 -21.17831 1.000 85.95528  ? 53  TRP A O   1 
ATOM   396  C  CB  . TRP A 1 53  ? 17.70179 58.33754 -20.17042 1.000 88.41624  ? 53  TRP A CB  1 
ATOM   397  C  CG  . TRP A 1 53  ? 18.11056 57.27462 -19.19364 1.000 82.81866  ? 53  TRP A CG  1 
ATOM   398  C  CD1 . TRP A 1 53  ? 18.62547 56.03690 -19.48414 1.000 79.52081  ? 53  TRP A CD1 1 
ATOM   399  C  CD2 . TRP A 1 53  ? 18.03962 57.35699 -17.76897 1.000 71.98372  ? 53  TRP A CD2 1 
ATOM   400  N  NE1 . TRP A 1 53  ? 18.86879 55.34614 -18.32475 1.000 72.88497  ? 53  TRP A NE1 1 
ATOM   401  C  CE2 . TRP A 1 53  ? 18.52246 56.13429 -17.25614 1.000 73.85819  ? 53  TRP A CE2 1 
ATOM   402  C  CE3 . TRP A 1 53  ? 17.61416 58.34800 -16.87277 1.000 70.69639  ? 53  TRP A CE3 1 
ATOM   403  C  CZ2 . TRP A 1 53  ? 18.59976 55.87705 -15.87741 1.000 74.81843  ? 53  TRP A CZ2 1 
ATOM   404  C  CZ3 . TRP A 1 53  ? 17.68274 58.09025 -15.50150 1.000 67.98941  ? 53  TRP A CZ3 1 
ATOM   405  C  CH2 . TRP A 1 53  ? 18.17618 56.86535 -15.02005 1.000 69.92107  ? 53  TRP A CH2 1 
ATOM   406  N  N   . HIS A 1 54  ? 16.89634 56.97857 -22.84643 1.000 99.51823  ? 54  HIS A N   1 
ATOM   407  C  CA  . HIS A 1 54  ? 17.19819 55.86069 -23.72782 1.000 104.61471 ? 54  HIS A CA  1 
ATOM   408  C  C   . HIS A 1 54  ? 18.69054 55.84831 -24.02213 1.000 92.35909  ? 54  HIS A C   1 
ATOM   409  O  O   . HIS A 1 54  ? 19.33330 56.90160 -24.09729 1.000 96.04410  ? 54  HIS A O   1 
ATOM   410  C  CB  . HIS A 1 54  ? 16.39855 55.93452 -25.03618 1.000 123.60250 ? 54  HIS A CB  1 
ATOM   411  C  CG  . HIS A 1 54  ? 14.93751 56.19156 -24.83396 1.000 136.86539 ? 54  HIS A CG  1 
ATOM   412  N  ND1 . HIS A 1 54  ? 14.44109 57.42942 -24.48195 1.000 138.31226 ? 54  HIS A ND1 1 
ATOM   413  C  CD2 . HIS A 1 54  ? 13.86523 55.37064 -24.93205 1.000 140.83319 ? 54  HIS A CD2 1 
ATOM   414  C  CE1 . HIS A 1 54  ? 13.12700 57.35937 -24.36919 1.000 137.88849 ? 54  HIS A CE1 1 
ATOM   415  N  NE2 . HIS A 1 54  ? 12.75211 56.12167 -24.63934 1.000 139.74042 ? 54  HIS A NE2 1 
ATOM   416  N  N   . GLY A 1 55  ? 19.23991 54.64713 -24.17445 1.000 78.10143  ? 55  GLY A N   1 
ATOM   417  C  CA  . GLY A 1 55  ? 20.67342 54.50553 -24.32209 1.000 69.13139  ? 55  GLY A CA  1 
ATOM   418  C  C   . GLY A 1 55  ? 21.32515 54.37520 -22.96527 1.000 77.25296  ? 55  GLY A C   1 
ATOM   419  O  O   . GLY A 1 55  ? 21.11589 55.22760 -22.09730 1.000 77.14803  ? 55  GLY A O   1 
ATOM   420  N  N   . VAL A 1 56  ? 22.11492 53.31615 -22.76655 1.000 77.66348  ? 56  VAL A N   1 
ATOM   421  C  CA  . VAL A 1 56  ? 22.60379 53.00011 -21.43040 1.000 74.06296  ? 56  VAL A CA  1 
ATOM   422  C  C   . VAL A 1 56  ? 23.41010 54.17015 -20.89588 1.000 70.92709  ? 56  VAL A C   1 
ATOM   423  O  O   . VAL A 1 56  ? 24.28411 54.72526 -21.57825 1.000 63.89338  ? 56  VAL A O   1 
ATOM   424  C  CB  . VAL A 1 56  ? 23.40818 51.68976 -21.43708 1.000 81.76765  ? 56  VAL A CB  1 
ATOM   425  C  CG1 . VAL A 1 56  ? 22.59723 50.58131 -22.11454 1.000 88.71022  ? 56  VAL A CG1 1 
ATOM   426  C  CG2 . VAL A 1 56  ? 24.75590 51.85860 -22.12282 1.000 82.46268  ? 56  VAL A CG2 1 
ATOM   427  N  N   . LEU A 1 57  ? 23.07238 54.58076 -19.67762 1.000 67.12779  ? 57  LEU A N   1 
ATOM   428  C  CA  . LEU A 1 57  ? 23.70233 55.71080 -19.01584 1.000 63.56114  ? 57  LEU A CA  1 
ATOM   429  C  C   . LEU A 1 57  ? 24.98125 55.26160 -18.32448 1.000 60.29639  ? 57  LEU A C   1 
ATOM   430  O  O   . LEU A 1 57  ? 24.98450 54.26343 -17.59779 1.000 56.88343  ? 57  LEU A O   1 
ATOM   431  C  CB  . LEU A 1 57  ? 22.73443 56.33030 -18.00941 1.000 64.26249  ? 57  LEU A CB  1 
ATOM   432  C  CG  . LEU A 1 57  ? 22.93333 57.76188 -17.50929 1.000 59.27142  ? 57  LEU A CG  1 
ATOM   433  C  CD1 . LEU A 1 57  ? 21.69716 58.14802 -16.73990 1.000 56.37598  ? 57  LEU A CD1 1 
ATOM   434  C  CD2 . LEU A 1 57  ? 24.15189 57.88169 -16.60733 1.000 56.22992  ? 57  LEU A CD2 1 
ATOM   435  N  N   . ASP A 1 58  ? 26.05409 56.01639 -18.54583 1.000 56.83224  ? 58  ASP A N   1 
ATOM   436  C  CA  . ASP A 1 58  ? 27.35373 55.74181 -17.94849 1.000 58.64978  ? 58  ASP A CA  1 
ATOM   437  C  C   . ASP A 1 58  ? 27.28747 55.98689 -16.44438 1.000 64.13887  ? 58  ASP A C   1 
ATOM   438  O  O   . ASP A 1 58  ? 27.10514 57.12460 -15.99889 1.000 72.70122  ? 58  ASP A O   1 
ATOM   439  C  CB  . ASP A 1 58  ? 28.41059 56.62458 -18.60424 1.000 59.04966  ? 58  ASP A CB  1 
ATOM   440  C  CG  . ASP A 1 58  ? 29.80061 56.34586 -18.09414 1.000 77.93322  ? 58  ASP A CG  1 
ATOM   441  O  OD1 . ASP A 1 58  ? 29.98530 55.29194 -17.45650 1.000 78.81940  ? 58  ASP A OD1 1 
ATOM   442  O  OD2 . ASP A 1 58  ? 30.70643 57.17485 -18.33417 1.000 79.73403  ? 58  ASP A OD2 1 
ATOM   443  N  N   . ALA A 1 59  ? 27.44106 54.92645 -15.65638 1.000 59.50751  ? 59  ALA A N   1 
ATOM   444  C  CA  . ALA A 1 59  ? 27.43982 55.02564 -14.20490 1.000 59.28711  ? 59  ALA A CA  1 
ATOM   445  C  C   . ALA A 1 59  ? 28.77882 54.61859 -13.60439 1.000 64.49567  ? 59  ALA A C   1 
ATOM   446  O  O   . ALA A 1 59  ? 28.83240 54.01554 -12.52945 1.000 65.91875  ? 59  ALA A O   1 
ATOM   447  C  CB  . ALA A 1 59  ? 26.33588 54.17322 -13.59984 1.000 61.37598  ? 59  ALA A CB  1 
ATOM   448  N  N   . THR A 1 60  ? 29.87347 54.94237 -14.28925 1.000 58.76221  ? 60  THR A N   1 
ATOM   449  C  CA  . THR A 1 60  ? 31.19929 54.58937 -13.81285 1.000 57.52473  ? 60  THR A CA  1 
ATOM   450  C  C   . THR A 1 60  ? 31.95786 55.77048 -13.22388 1.000 63.29275  ? 60  THR A C   1 
ATOM   451  O  O   . THR A 1 60  ? 33.03329 55.56724 -12.65377 1.000 72.11161  ? 60  THR A O   1 
ATOM   452  C  CB  . THR A 1 60  ? 32.01811 53.94831 -14.94379 1.000 63.12996  ? 60  THR A CB  1 
ATOM   453  O  OG1 . THR A 1 60  ? 32.48540 54.96286 -15.84190 1.000 66.92290  ? 60  THR A OG1 1 
ATOM   454  C  CG2 . THR A 1 60  ? 31.16417 52.92816 -15.70285 1.000 58.62367  ? 60  THR A CG2 1 
ATOM   455  N  N   . GLY A 1 61  ? 31.42201 56.98576 -13.31930 1.000 60.90671  ? 61  GLY A N   1 
ATOM   456  C  CA  . GLY A 1 61  ? 32.06702 58.15004 -12.76087 1.000 57.40702  ? 61  GLY A CA  1 
ATOM   457  C  C   . GLY A 1 61  ? 31.44852 58.57914 -11.44520 1.000 57.27776  ? 61  GLY A C   1 
ATOM   458  O  O   . GLY A 1 61  ? 30.32947 58.20662 -11.10252 1.000 58.80282  ? 61  GLY A O   1 
ATOM   459  N  N   . LEU A 1 62  ? 32.20067 59.36980 -10.69036 1.000 60.92139  ? 62  LEU A N   1 
ATOM   460  C  CA  . LEU A 1 62  ? 31.61489 60.00259 -9.52170  1.000 50.14748  ? 62  LEU A CA  1 
ATOM   461  C  C   . LEU A 1 62  ? 30.73118 61.16662 -9.94999  1.000 51.06971  ? 62  LEU A C   1 
ATOM   462  O  O   . LEU A 1 62  ? 30.97655 61.83042 -10.96648 1.000 46.25106  ? 62  LEU A O   1 
ATOM   463  C  CB  . LEU A 1 62  ? 32.70116 60.48551 -8.56408  1.000 48.11125  ? 62  LEU A CB  1 
ATOM   464  C  CG  . LEU A 1 62  ? 33.34242 59.40811 -7.68424  1.000 52.07880  ? 62  LEU A CG  1 
ATOM   465  C  CD1 . LEU A 1 62  ? 34.43502 60.02192 -6.80781  1.000 46.57555  ? 62  LEU A CD1 1 
ATOM   466  C  CD2 . LEU A 1 62  ? 32.28831 58.69705 -6.83044  1.000 58.39354  ? 62  LEU A CD2 1 
ATOM   467  N  N   . SER A 1 63  ? 29.68872 61.40797 -9.16620  1.000 52.65183  ? 63  SER A N   1 
ATOM   468  C  CA  . SER A 1 63  ? 28.76881 62.47768 -9.50094  1.000 43.23233  ? 63  SER A CA  1 
ATOM   469  C  C   . SER A 1 63  ? 29.22847 63.77661 -8.86066  1.000 48.56398  ? 63  SER A C   1 
ATOM   470  O  O   . SER A 1 63  ? 30.12167 63.79759 -8.01391  1.000 56.86121  ? 63  SER A O   1 
ATOM   471  C  CB  . SER A 1 63  ? 27.35722 62.15362 -9.03461  1.000 44.01771  ? 63  SER A CB  1 
ATOM   472  O  OG  . SER A 1 63  ? 27.11206 62.79565 -7.80630  1.000 54.42174  ? 63  SER A OG  1 
ATOM   473  N  N   . ALA A 1 64  ? 28.58249 64.86882 -9.26034  1.000 48.15963  ? 64  ALA A N   1 
ATOM   474  C  CA  . ALA A 1 64  ? 28.89083 66.18145 -8.71806  1.000 48.51830  ? 64  ALA A CA  1 
ATOM   475  C  C   . ALA A 1 64  ? 28.44351 66.27365 -7.26417  1.000 48.32504  ? 64  ALA A C   1 
ATOM   476  O  O   . ALA A 1 64  ? 27.57458 65.52138 -6.81819  1.000 53.53780  ? 64  ALA A O   1 
ATOM   477  C  CB  . ALA A 1 64  ? 28.19920 67.26454 -9.53753  1.000 40.44285  ? 64  ALA A CB  1 
ATOM   478  N  N   . THR A 1 65  ? 29.03334 67.21405 -6.51921  1.000 41.03882  ? 65  THR A N   1 
ATOM   479  C  CA  . THR A 1 65  ? 28.55453 67.47119 -5.16313  1.000 52.46606  ? 65  THR A CA  1 
ATOM   480  C  C   . THR A 1 65  ? 27.73217 68.75007 -5.12750  1.000 47.22929  ? 65  THR A C   1 
ATOM   481  O  O   . THR A 1 65  ? 27.94492 69.67211 -5.92151  1.000 47.57413  ? 65  THR A O   1 
ATOM   482  C  CB  . THR A 1 65  ? 29.67902 67.58046 -4.13096  1.000 61.80162  ? 65  THR A CB  1 
ATOM   483  O  OG1 . THR A 1 65  ? 30.18683 68.91646 -4.11631  1.000 77.06170  ? 65  THR A OG1 1 
ATOM   484  C  CG2 . THR A 1 65  ? 30.80705 66.61709 -4.43629  1.000 58.08554  ? 65  THR A CG2 1 
ATOM   485  N  N   . CYS A 1 66  ? 26.77912 68.78763 -4.19872  1.000 38.31160  ? 66  CYS A N   1 
ATOM   486  C  CA  . CYS A 1 66  ? 25.86117 69.91274 -4.13247  1.000 31.71454  ? 66  CYS A CA  1 
ATOM   487  C  C   . CYS A 1 66  ? 26.61214 71.17200 -3.70818  1.000 46.01478  ? 66  CYS A C   1 
ATOM   488  O  O   . CYS A 1 66  ? 27.63120 71.10964 -3.01172  1.000 45.32013  ? 66  CYS A O   1 
ATOM   489  C  CB  . CYS A 1 66  ? 24.68598 69.59246 -3.20937  1.000 39.02963  ? 66  CYS A CB  1 
ATOM   490  S  SG  . CYS A 1 66  ? 23.57206 68.27254 -3.89016  1.000 50.34109  ? 66  CYS A SG  1 
ATOM   491  N  N   . VAL A 1 67  ? 26.10333 72.32262 -4.17183  1.000 48.10238  ? 67  VAL A N   1 
ATOM   492  C  CA  . VAL A 1 67  ? 26.77141 73.60311 -3.95677  1.000 44.42153  ? 67  VAL A CA  1 
ATOM   493  C  C   . VAL A 1 67  ? 27.00291 73.79348 -2.46944  1.000 42.90118  ? 67  VAL A C   1 
ATOM   494  O  O   . VAL A 1 67  ? 26.08756 73.59422 -1.65835  1.000 42.34470  ? 67  VAL A O   1 
ATOM   495  C  CB  . VAL A 1 67  ? 25.93741 74.76443 -4.52911  1.000 42.46902  ? 67  VAL A CB  1 
ATOM   496  C  CG1 . VAL A 1 67  ? 26.56215 76.10996 -4.18306  1.000 46.26985  ? 67  VAL A CG1 1 
ATOM   497  C  CG2 . VAL A 1 67  ? 25.81193 74.66931 -6.01353  1.000 38.01696  ? 67  VAL A CG2 1 
ATOM   498  N  N   . GLN A 1 68  ? 28.23706 74.14968 -2.10405  1.000 41.99444  ? 68  GLN A N   1 
ATOM   499  C  CA  . GLN A 1 68  ? 28.64464 74.30621 -0.70922  1.000 47.39725  ? 68  GLN A CA  1 
ATOM   500  C  C   . GLN A 1 68  ? 30.05219 74.87503 -0.68662  1.000 55.95080  ? 68  GLN A C   1 
ATOM   501  O  O   . GLN A 1 68  ? 30.77731 74.80700 -1.68381  1.000 59.06104  ? 68  GLN A O   1 
ATOM   502  C  CB  . GLN A 1 68  ? 28.59830 72.97625 0.06724   1.000 41.01424  ? 68  GLN A CB  1 
ATOM   503  C  CG  . GLN A 1 68  ? 29.63385 71.92823 -0.37325  1.000 42.36395  ? 68  GLN A CG  1 
ATOM   504  C  CD  . GLN A 1 68  ? 29.41300 70.55842 0.27951   1.000 48.83570  ? 68  GLN A CD  1 
ATOM   505  O  OE1 . GLN A 1 68  ? 30.11581 70.17715 1.22239   1.000 56.82181  ? 68  GLN A OE1 1 
ATOM   506  N  NE2 . GLN A 1 68  ? 28.42695 69.81838 -0.21966  1.000 45.57031  ? 68  GLN A NE2 1 
ATOM   507  N  N   . GLU A 1 69  ? 30.44101 75.41817 0.47106   1.000 57.02993  ? 69  GLU A N   1 
ATOM   508  C  CA  . GLU A 1 69  ? 31.75417 76.03448 0.63122   1.000 51.52940  ? 69  GLU A CA  1 
ATOM   509  C  C   . GLU A 1 69  ? 32.75629 75.11578 1.32694   1.000 48.38125  ? 69  GLU A C   1 
ATOM   510  O  O   . GLU A 1 69  ? 32.40866 74.27973 2.16801   1.000 41.81613  ? 69  GLU A O   1 
ATOM   511  C  CB  . GLU A 1 69  ? 31.67053 77.36466 1.38727   1.000 49.80059  ? 69  GLU A CB  1 
ATOM   512  C  CG  . GLU A 1 69  ? 30.80700 78.39267 0.67117   1.000 60.03213  ? 69  GLU A CG  1 
ATOM   513  C  CD  . GLU A 1 69  ? 31.46782 78.92023 -0.60445  1.000 74.81911  ? 69  GLU A CD  1 
ATOM   514  O  OE1 . GLU A 1 69  ? 32.69318 79.18182 -0.59205  1.000 82.29449  ? 69  GLU A OE1 1 
ATOM   515  O  OE2 . GLU A 1 69  ? 30.76367 79.04618 -1.63002  1.000 79.18737  ? 69  GLU A OE2 1 
ATOM   516  N  N   . ARG A 1 70  ? 34.01597 75.29808 0.93626   1.000 52.81500  ? 70  ARG A N   1 
ATOM   517  C  CA  . ARG A 1 70  ? 35.14834 74.53613 1.43097   1.000 58.21664  ? 70  ARG A CA  1 
ATOM   518  C  C   . ARG A 1 70  ? 35.56430 75.05603 2.80165   1.000 62.61824  ? 70  ARG A C   1 
ATOM   519  O  O   . ARG A 1 70  ? 35.75669 76.26292 2.97907   1.000 69.64650  ? 70  ARG A O   1 
ATOM   520  C  CB  . ARG A 1 70  ? 36.30964 74.68446 0.44121   1.000 68.13633  ? 70  ARG A CB  1 
ATOM   521  C  CG  . ARG A 1 70  ? 37.29388 73.53377 0.38150   1.000 76.89243  ? 70  ARG A CG  1 
ATOM   522  C  CD  . ARG A 1 70  ? 37.89236 73.34486 -1.00160  1.000 76.60694  ? 70  ARG A CD  1 
ATOM   523  N  NE  . ARG A 1 70  ? 36.90184 72.84071 -1.93169  1.000 78.21948  ? 70  ARG A NE  1 
ATOM   524  C  CZ  . ARG A 1 70  ? 36.82667 71.57014 -2.30553  1.000 87.85406  ? 70  ARG A CZ  1 
ATOM   525  N  NH1 . ARG A 1 70  ? 37.69034 70.68926 -1.80876  1.000 81.37586  ? 70  ARG A NH1 1 
ATOM   526  N  NH2 . ARG A 1 70  ? 35.88218 71.18386 -3.16236  1.000 96.69578  ? 70  ARG A NH2 1 
ATOM   527  N  N   . TYR A 1 71  ? 35.73672 74.15833 3.76502   1.000 58.25535  ? 71  TYR A N   1 
ATOM   528  C  CA  . TYR A 1 71  ? 36.34267 74.56779 5.02802   1.000 68.19321  ? 71  TYR A CA  1 
ATOM   529  C  C   . TYR A 1 71  ? 37.85766 74.66138 4.85872   1.000 70.96578  ? 71  TYR A C   1 
ATOM   530  O  O   . TYR A 1 71  ? 38.52333 73.66524 4.55207   1.000 70.02357  ? 71  TYR A O   1 
ATOM   531  C  CB  . TYR A 1 71  ? 35.97710 73.60638 6.15794   1.000 74.71913  ? 71  TYR A CB  1 
ATOM   532  C  CG  . TYR A 1 71  ? 34.68982 73.97648 6.86879   1.000 73.22812  ? 71  TYR A CG  1 
ATOM   533  C  CD1 . TYR A 1 71  ? 33.52226 73.25990 6.64734   1.000 66.27813  ? 71  TYR A CD1 1 
ATOM   534  C  CD2 . TYR A 1 71  ? 34.64030 75.05579 7.74660   1.000 80.66894  ? 71  TYR A CD2 1 
ATOM   535  C  CE1 . TYR A 1 71  ? 32.34712 73.59808 7.28535   1.000 66.67825  ? 71  TYR A CE1 1 
ATOM   536  C  CE2 . TYR A 1 71  ? 33.46293 75.40309 8.38980   1.000 76.58973  ? 71  TYR A CE2 1 
ATOM   537  C  CZ  . TYR A 1 71  ? 32.32409 74.66631 8.15434   1.000 70.69645  ? 71  TYR A CZ  1 
ATOM   538  O  OH  . TYR A 1 71  ? 31.15497 74.99388 8.78925   1.000 71.19207  ? 71  TYR A OH  1 
ATOM   539  N  N   . GLU A 1 72  ? 38.40032 75.85867 5.05492   1.000 73.43438  ? 72  GLU A N   1 
ATOM   540  C  CA  . GLU A 1 72  ? 39.82006 76.11870 4.87626   1.000 74.57194  ? 72  GLU A CA  1 
ATOM   541  C  C   . GLU A 1 72  ? 40.41212 76.75382 6.12251   1.000 73.93199  ? 72  GLU A C   1 
ATOM   542  O  O   . GLU A 1 72  ? 41.25137 77.65722 6.04399   1.000 77.53903  ? 72  GLU A O   1 
ATOM   543  C  CB  . GLU A 1 72  ? 40.05328 77.00735 3.65971   1.000 82.76409  ? 72  GLU A CB  1 
ATOM   544  C  CG  . GLU A 1 72  ? 39.51856 76.43474 2.35771   1.000 88.76747  ? 72  GLU A CG  1 
ATOM   545  C  CD  . GLU A 1 72  ? 40.44895 75.40355 1.73775   1.000 95.81298  ? 72  GLU A CD  1 
ATOM   546  O  OE1 . GLU A 1 72  ? 41.49528 75.08847 2.35078   1.000 101.80803 ? 72  GLU A OE1 1 
ATOM   547  O  OE2 . GLU A 1 72  ? 40.13517 74.91436 0.63008   1.000 91.55732  ? 72  GLU A OE2 1 
ATOM   548  N  N   . TYR A 1 73  ? 39.97939 76.29471 7.29921   1.000 70.83904  ? 73  TYR A N   1 
ATOM   549  C  CA  . TYR A 1 73  ? 40.50871 76.85322 8.53949   1.000 75.74252  ? 73  TYR A CA  1 
ATOM   550  C  C   . TYR A 1 73  ? 41.96064 76.45043 8.75172   1.000 73.43077  ? 73  TYR A C   1 
ATOM   551  O  O   . TYR A 1 73  ? 42.70788 77.16038 9.43272   1.000 71.68157  ? 73  TYR A O   1 
ATOM   552  C  CB  . TYR A 1 73  ? 39.65314 76.41606 9.73094   1.000 77.14973  ? 73  TYR A CB  1 
ATOM   553  C  CG  . TYR A 1 73  ? 38.40755 77.25426 9.94865   1.000 85.33442  ? 73  TYR A CG  1 
ATOM   554  C  CD1 . TYR A 1 73  ? 37.28567 77.09036 9.14611   1.000 86.50007  ? 73  TYR A CD1 1 
ATOM   555  C  CD2 . TYR A 1 73  ? 38.35274 78.20556 10.96153  1.000 93.68136  ? 73  TYR A CD2 1 
ATOM   556  C  CE1 . TYR A 1 73  ? 36.14318 77.85320 9.34183   1.000 91.40710  ? 73  TYR A CE1 1 
ATOM   557  C  CE2 . TYR A 1 73  ? 37.21265 78.97230 11.16711  1.000 98.16298  ? 73  TYR A CE2 1 
ATOM   558  C  CZ  . TYR A 1 73  ? 36.11159 78.79301 10.35118  1.000 97.30914  ? 73  TYR A CZ  1 
ATOM   559  O  OH  . TYR A 1 73  ? 34.97549 79.55260 10.54006  1.000 97.47971  ? 73  TYR A OH  1 
ATOM   560  N  N   . PHE A 1 74  ? 42.37378 75.32532 8.17446   1.000 72.91914  ? 74  PHE A N   1 
ATOM   561  C  CA  . PHE A 1 74  ? 43.74004 74.82096 8.27960   1.000 72.91824  ? 74  PHE A CA  1 
ATOM   562  C  C   . PHE A 1 74  ? 44.20688 74.51291 6.86900   1.000 78.16493  ? 74  PHE A C   1 
ATOM   563  O  O   . PHE A 1 74  ? 44.18883 73.34959 6.44070   1.000 70.58288  ? 74  PHE A O   1 
ATOM   564  C  CB  . PHE A 1 74  ? 43.80854 73.58313 9.17095   1.000 69.65990  ? 74  PHE A CB  1 
ATOM   565  C  CG  . PHE A 1 74  ? 43.43459 73.85186 10.59121  1.000 68.52270  ? 74  PHE A CG  1 
ATOM   566  C  CD1 . PHE A 1 74  ? 42.13288 73.64502 11.03246  1.000 68.83027  ? 74  PHE A CD1 1 
ATOM   567  C  CD2 . PHE A 1 74  ? 44.37549 74.33094 11.48066  1.000 64.66972  ? 74  PHE A CD2 1 
ATOM   568  C  CE1 . PHE A 1 74  ? 41.78422 73.90335 12.34006  1.000 68.69212  ? 74  PHE A CE1 1 
ATOM   569  C  CE2 . PHE A 1 74  ? 44.03823 74.59043 12.78370  1.000 69.46440  ? 74  PHE A CE2 1 
ATOM   570  C  CZ  . PHE A 1 74  ? 42.74007 74.37740 13.21641  1.000 73.09856  ? 74  PHE A CZ  1 
ATOM   571  N  N   . PRO A 1 75  ? 44.63197 75.53398 6.12090   1.000 92.73372  ? 75  PRO A N   1 
ATOM   572  C  CA  . PRO A 1 75  ? 44.88706 75.35523 4.68363   1.000 96.35635  ? 75  PRO A CA  1 
ATOM   573  C  C   . PRO A 1 75  ? 45.94255 74.29006 4.43263   1.000 100.58794 ? 75  PRO A C   1 
ATOM   574  O  O   . PRO A 1 75  ? 47.01107 74.28916 5.05038   1.000 107.01209 ? 75  PRO A O   1 
ATOM   575  C  CB  . PRO A 1 75  ? 45.36036 76.74300 4.23224   1.000 98.33745  ? 75  PRO A CB  1 
ATOM   576  C  CG  . PRO A 1 75  ? 44.82272 77.68758 5.26268   1.000 98.21970  ? 75  PRO A CG  1 
ATOM   577  C  CD  . PRO A 1 75  ? 44.86293 76.92306 6.55433   1.000 99.24700  ? 75  PRO A CD  1 
ATOM   578  N  N   . GLY A 1 76  ? 45.62488 73.37339 3.53557   1.000 97.21185  ? 76  GLY A N   1 
ATOM   579  C  CA  . GLY A 1 76  ? 46.51702 72.26062 3.22294   1.000 98.52062  ? 76  GLY A CA  1 
ATOM   580  C  C   . GLY A 1 76  ? 46.33224 71.02615 4.07943   1.000 96.35801  ? 76  GLY A C   1 
ATOM   581  O  O   . GLY A 1 76  ? 46.19701 69.92188 3.55241   1.000 97.89431  ? 76  GLY A O   1 
ATOM   582  N  N   . PHE A 1 77  ? 46.31961 71.21086 5.40079   1.000 92.11502  ? 77  PHE A N   1 
ATOM   583  C  CA  . PHE A 1 77  ? 46.14150 70.14985 6.38713   1.000 76.57102  ? 77  PHE A CA  1 
ATOM   584  C  C   . PHE A 1 77  ? 45.04895 69.16724 5.98850   1.000 70.16271  ? 77  PHE A C   1 
ATOM   585  O  O   . PHE A 1 77  ? 43.87939 69.53963 5.84683   1.000 71.44674  ? 77  PHE A O   1 
ATOM   586  C  CB  . PHE A 1 77  ? 45.80065 70.77228 7.73212   1.000 70.67781  ? 77  PHE A CB  1 
ATOM   587  C  CG  . PHE A 1 77  ? 45.39919 69.77278 8.76248   1.000 68.61480  ? 77  PHE A CG  1 
ATOM   588  C  CD1 . PHE A 1 77  ? 46.24800 68.72122 9.08730   1.000 65.70437  ? 77  PHE A CD1 1 
ATOM   589  C  CD2 . PHE A 1 77  ? 44.17142 69.87043 9.40338   1.000 60.25784  ? 77  PHE A CD2 1 
ATOM   590  C  CE1 . PHE A 1 77  ? 45.89058 67.79007 10.04048  1.000 58.14240  ? 77  PHE A CE1 1 
ATOM   591  C  CE2 . PHE A 1 77  ? 43.81037 68.94436 10.35760  1.000 54.71014  ? 77  PHE A CE2 1 
ATOM   592  C  CZ  . PHE A 1 77  ? 44.67438 67.89927 10.67888  1.000 53.97509  ? 77  PHE A CZ  1 
ATOM   593  N  N   . SER A 1 78  ? 45.42506 67.89799 5.83469   1.000 65.53806  ? 78  SER A N   1 
ATOM   594  C  CA  . SER A 1 78  ? 44.54469 66.96388 5.14334   1.000 69.20973  ? 78  SER A CA  1 
ATOM   595  C  C   . SER A 1 78  ? 43.35742 66.54154 5.99953   1.000 68.34995  ? 78  SER A C   1 
ATOM   596  O  O   . SER A 1 78  ? 42.28953 66.22547 5.45823   1.000 70.39802  ? 78  SER A O   1 
ATOM   597  C  CB  . SER A 1 78  ? 45.33438 65.74166 4.69902   1.000 72.19545  ? 78  SER A CB  1 
ATOM   598  O  OG  . SER A 1 78  ? 45.24804 64.72165 5.66704   1.000 76.89084  ? 78  SER A OG  1 
ATOM   599  N  N   . GLY A 1 79  ? 43.51523 66.52747 7.32414   1.000 59.60995  ? 79  GLY A N   1 
ATOM   600  C  CA  . GLY A 1 79  ? 42.41983 66.10557 8.18213   1.000 52.68503  ? 79  GLY A CA  1 
ATOM   601  C  C   . GLY A 1 79  ? 41.16194 66.92859 8.00266   1.000 51.12345  ? 79  GLY A C   1 
ATOM   602  O  O   . GLY A 1 79  ? 40.05790 66.45387 8.27548   1.000 50.25076  ? 79  GLY A O   1 
ATOM   603  N  N   . GLU A 1 80  ? 41.30555 68.16484 7.53985   1.000 58.76118  ? 80  GLU A N   1 
ATOM   604  C  CA  . GLU A 1 80  ? 40.16142 69.00939 7.23355   1.000 55.40594  ? 80  GLU A CA  1 
ATOM   605  C  C   . GLU A 1 80  ? 39.66522 68.79627 5.81145   1.000 60.84442  ? 80  GLU A C   1 
ATOM   606  O  O   . GLU A 1 80  ? 38.45022 68.79317 5.57175   1.000 60.67906  ? 80  GLU A O   1 
ATOM   607  C  CB  . GLU A 1 80  ? 40.52904 70.47949 7.45028   1.000 50.63313  ? 80  GLU A CB  1 
ATOM   608  C  CG  . GLU A 1 80  ? 39.63772 71.46916 6.74395   1.000 46.39314  ? 80  GLU A CG  1 
ATOM   609  C  CD  . GLU A 1 80  ? 39.92028 72.89856 7.16467   1.000 65.66798  ? 80  GLU A CD  1 
ATOM   610  O  OE1 . GLU A 1 80  ? 41.09379 73.33429 7.08777   1.000 68.63744  ? 80  GLU A OE1 1 
ATOM   611  O  OE2 . GLU A 1 80  ? 38.96487 73.58749 7.57839   1.000 65.26856  ? 80  GLU A OE2 1 
ATOM   612  N  N   . GLU A 1 81  ? 40.57969 68.59197 4.85902   1.000 70.17422  ? 81  GLU A N   1 
ATOM   613  C  CA  . GLU A 1 81  ? 40.17166 68.56357 3.46012   1.000 79.22551  ? 81  GLU A CA  1 
ATOM   614  C  C   . GLU A 1 81  ? 39.49857 67.25556 3.05446   1.000 68.86774  ? 81  GLU A C   1 
ATOM   615  O  O   . GLU A 1 81  ? 38.69623 67.26544 2.10930   1.000 70.07172  ? 81  GLU A O   1 
ATOM   616  C  CB  . GLU A 1 81  ? 41.36449 68.85602 2.54580   1.000 89.51018  ? 81  GLU A CB  1 
ATOM   617  C  CG  . GLU A 1 81  ? 41.60603 70.35099 2.35594   1.000 100.91804 ? 81  GLU A CG  1 
ATOM   618  C  CD  . GLU A 1 81  ? 40.98197 70.89830 1.07055   1.000 108.41126 ? 81  GLU A CD  1 
ATOM   619  O  OE1 . GLU A 1 81  ? 40.88362 72.13819 0.93571   1.000 111.32747 ? 81  GLU A OE1 1 
ATOM   620  O  OE2 . GLU A 1 81  ? 40.57623 70.09533 0.20109   1.000 108.35796 ? 81  GLU A OE2 1 
ATOM   621  N  N   . ILE A 1 82  ? 39.76907 66.14531 3.75177   1.000 57.65612  ? 82  ILE A N   1 
ATOM   622  C  CA  . ILE A 1 82  ? 39.08696 64.89258 3.44415   1.000 41.40948  ? 82  ILE A CA  1 
ATOM   623  C  C   . ILE A 1 82  ? 37.59047 64.98471 3.67825   1.000 55.45195  ? 82  ILE A C   1 
ATOM   624  O  O   . ILE A 1 82  ? 36.85874 64.04441 3.35933   1.000 57.94735  ? 82  ILE A O   1 
ATOM   625  C  CB  . ILE A 1 82  ? 39.64163 63.71051 4.26571   1.000 49.20597  ? 82  ILE A CB  1 
ATOM   626  C  CG1 . ILE A 1 82  ? 39.27182 63.88700 5.74902   1.000 56.13396  ? 82  ILE A CG1 1 
ATOM   627  C  CG2 . ILE A 1 82  ? 41.13228 63.57529 4.07705   1.000 48.53644  ? 82  ILE A CG2 1 
ATOM   628  C  CD1 . ILE A 1 82  ? 38.72203 62.62950 6.41668   1.000 51.36917  ? 82  ILE A CD1 1 
ATOM   629  N  N   . TRP A 1 83  ? 37.11684 66.08122 4.25764   1.000 50.07047  ? 83  TRP A N   1 
ATOM   630  C  CA  . TRP A 1 83  ? 35.69553 66.31294 4.40161   1.000 51.39662  ? 83  TRP A CA  1 
ATOM   631  C  C   . TRP A 1 83  ? 35.19117 67.38285 3.45042   1.000 49.69952  ? 83  TRP A C   1 
ATOM   632  O  O   . TRP A 1 83  ? 34.01613 67.73919 3.50959   1.000 58.30772  ? 83  TRP A O   1 
ATOM   633  C  CB  . TRP A 1 83  ? 35.37032 66.68069 5.85567   1.000 58.07610  ? 83  TRP A CB  1 
ATOM   634  C  CG  . TRP A 1 83  ? 35.72998 65.59071 6.83325   1.000 54.79212  ? 83  TRP A CG  1 
ATOM   635  C  CD1 . TRP A 1 83  ? 36.83085 65.54087 7.63920   1.000 57.23414  ? 83  TRP A CD1 1 
ATOM   636  C  CD2 . TRP A 1 83  ? 34.99632 64.38782 7.08731   1.000 52.43766  ? 83  TRP A CD2 1 
ATOM   637  N  NE1 . TRP A 1 83  ? 36.82094 64.38651 8.39261   1.000 51.98946  ? 83  TRP A NE1 1 
ATOM   638  C  CE2 . TRP A 1 83  ? 35.70704 63.66105 8.07096   1.000 49.34796  ? 83  TRP A CE2 1 
ATOM   639  C  CE3 . TRP A 1 83  ? 33.80411 63.85539 6.58507   1.000 56.85361  ? 83  TRP A CE3 1 
ATOM   640  C  CZ2 . TRP A 1 83  ? 35.26876 62.42831 8.55457   1.000 51.85774  ? 83  TRP A CZ2 1 
ATOM   641  C  CZ3 . TRP A 1 83  ? 33.36820 62.62772 7.06577   1.000 55.89503  ? 83  TRP A CZ3 1 
ATOM   642  C  CH2 . TRP A 1 83  ? 34.09656 61.93076 8.04576   1.000 55.55864  ? 83  TRP A CH2 1 
ATOM   643  N  N   . ASN A 1 84  ? 36.03694 67.90292 2.59849   1.000 52.67171  ? 84  ASN A N   1 
ATOM   644  C  CA  . ASN A 1 84  ? 35.65241 68.83872 1.55271   1.000 55.76595  ? 84  ASN A CA  1 
ATOM   645  C  C   . ASN A 1 84  ? 35.26398 68.09277 0.27179   1.000 51.96141  ? 84  ASN A C   1 
ATOM   646  O  O   . ASN A 1 84  ? 35.70372 66.95685 0.03544   1.000 49.27067  ? 84  ASN A O   1 
ATOM   647  C  CB  . ASN A 1 84  ? 36.80663 69.80223 1.27239   1.000 59.46017  ? 84  ASN A CB  1 
ATOM   648  C  CG  . ASN A 1 84  ? 36.99991 70.83884 2.37714   1.000 52.81117  ? 84  ASN A CG  1 
ATOM   649  O  OD1 . ASN A 1 84  ? 36.04293 71.24479 3.05911   1.000 42.93368  ? 84  ASN A OD1 1 
ATOM   650  N  ND2 . ASN A 1 84  ? 38.24720 71.29429 2.53820   1.000 45.92450  ? 84  ASN A ND2 1 
ATOM   651  N  N   . PRO A 1 85  ? 34.43677 68.70232 -0.57808  1.000 47.65529  ? 85  PRO A N   1 
ATOM   652  C  CA  . PRO A 1 85  ? 34.06342 68.04955 -1.84035  1.000 53.93052  ? 85  PRO A CA  1 
ATOM   653  C  C   . PRO A 1 85  ? 35.28451 67.51308 -2.57443  1.000 50.84804  ? 85  PRO A C   1 
ATOM   654  O  O   . PRO A 1 85  ? 36.34963 68.12910 -2.57130  1.000 43.47793  ? 85  PRO A O   1 
ATOM   655  C  CB  . PRO A 1 85  ? 33.38555 69.17314 -2.63470  1.000 52.17152  ? 85  PRO A CB  1 
ATOM   656  C  CG  . PRO A 1 85  ? 32.86500 70.09148 -1.60390  1.000 50.44402  ? 85  PRO A CG  1 
ATOM   657  C  CD  . PRO A 1 85  ? 33.81348 70.02861 -0.43591  1.000 47.39286  ? 85  PRO A CD  1 
ATOM   658  N  N   . ASN A 1 86  ? 35.13761 66.33183 -3.17403  1.000 53.52346  ? 86  ASN A N   1 
ATOM   659  C  CA  . ASN A 1 86  ? 36.19542 65.76852 -3.99599  1.000 53.49997  ? 86  ASN A CA  1 
ATOM   660  C  C   . ASN A 1 86  ? 35.77105 65.61720 -5.44986  1.000 51.28960  ? 86  ASN A C   1 
ATOM   661  O  O   . ASN A 1 86  ? 36.57500 65.17183 -6.27245  1.000 53.47579  ? 86  ASN A O   1 
ATOM   662  C  CB  . ASN A 1 86  ? 36.68312 64.42735 -3.42275  1.000 51.04599  ? 86  ASN A CB  1 
ATOM   663  C  CG  . ASN A 1 86  ? 35.65472 63.33486 -3.53457  1.000 56.76362  ? 86  ASN A CG  1 
ATOM   664  O  OD1 . ASN A 1 86  ? 34.44865 63.59255 -3.53834  1.000 59.39667  ? 86  ASN A OD1 1 
ATOM   665  N  ND2 . ASN A 1 86  ? 36.12412 62.09757 -3.61699  1.000 59.52214  ? 86  ASN A ND2 1 
ATOM   666  N  N   . THR A 1 87  ? 34.54338 65.98519 -5.78983  1.000 50.49347  ? 87  THR A N   1 
ATOM   667  C  CA  . THR A 1 87  ? 34.15671 66.25974 -7.16720  1.000 52.19697  ? 87  THR A CA  1 
ATOM   668  C  C   . THR A 1 87  ? 33.65598 67.69828 -7.24313  1.000 53.70926  ? 87  THR A C   1 
ATOM   669  O  O   . THR A 1 87  ? 33.44733 68.35046 -6.21801  1.000 66.96908  ? 87  THR A O   1 
ATOM   670  C  CB  . THR A 1 87  ? 33.09176 65.27085 -7.65951  1.000 47.97815  ? 87  THR A CB  1 
ATOM   671  O  OG1 . THR A 1 87  ? 31.87732 65.45505 -6.92463  1.000 46.25044  ? 87  THR A OG1 1 
ATOM   672  C  CG2 . THR A 1 87  ? 33.57321 63.83534 -7.45972  1.000 44.09768  ? 87  THR A CG2 1 
ATOM   673  N  N   . ASN A 1 88  ? 33.48909 68.21281 -8.45924  1.000 49.34195  ? 88  ASN A N   1 
ATOM   674  C  CA  . ASN A 1 88  ? 33.13415 69.61937 -8.60131  1.000 58.47218  ? 88  ASN A CA  1 
ATOM   675  C  C   . ASN A 1 88  ? 31.75723 69.86869 -8.01227  1.000 55.25318  ? 88  ASN A C   1 
ATOM   676  O  O   . ASN A 1 88  ? 30.88921 68.99075 -8.00816  1.000 58.08638  ? 88  ASN A O   1 
ATOM   677  C  CB  . ASN A 1 88  ? 33.12312 70.07234 -10.06833 1.000 80.27512  ? 88  ASN A CB  1 
ATOM   678  C  CG  . ASN A 1 88  ? 34.42941 69.81630 -10.79253 1.000 99.91692  ? 88  ASN A CG  1 
ATOM   679  O  OD1 . ASN A 1 88  ? 35.41953 69.37867 -10.20561 1.000 97.03284  ? 88  ASN A OD1 1 
ATOM   680  N  ND2 . ASN A 1 88  ? 34.42674 70.09647 -12.09666 1.000 121.99133 ? 88  ASN A ND2 1 
ATOM   681  N  N   . VAL A 1 89  ? 31.55715 71.08433 -7.52631  1.000 56.68291  ? 89  VAL A N   1 
ATOM   682  C  CA  . VAL A 1 89  ? 30.27450 71.49636 -6.97006  1.000 55.65585  ? 89  VAL A CA  1 
ATOM   683  C  C   . VAL A 1 89  ? 29.38321 72.02167 -8.08783  1.000 53.26258  ? 89  VAL A C   1 
ATOM   684  O  O   . VAL A 1 89  ? 29.84007 72.69081 -9.02178  1.000 62.46165  ? 89  VAL A O   1 
ATOM   685  C  CB  . VAL A 1 89  ? 30.46528 72.54450 -5.85710  1.000 41.34501  ? 89  VAL A CB  1 
ATOM   686  C  CG1 . VAL A 1 89  ? 31.08093 71.89022 -4.63682  1.000 40.15315  ? 89  VAL A CG1 1 
ATOM   687  C  CG2 . VAL A 1 89  ? 31.32465 73.68647 -6.34108  1.000 44.42240  ? 89  VAL A CG2 1 
ATOM   688  N  N   . SER A 1 90  ? 28.09854 71.70655 -7.98546  1.000 49.36654  ? 90  SER A N   1 
ATOM   689  C  CA  . SER A 1 90  ? 27.09193 72.08405 -8.96489  1.000 42.46347  ? 90  SER A CA  1 
ATOM   690  C  C   . SER A 1 90  ? 25.71362 72.01143 -8.33392  1.000 45.57755  ? 90  SER A C   1 
ATOM   691  O  O   . SER A 1 90  ? 25.45674 71.16887 -7.46871  1.000 41.69761  ? 90  SER A O   1 
ATOM   692  C  CB  . SER A 1 90  ? 27.10528 71.16522 -10.18293 1.000 43.75875  ? 90  SER A CB  1 
ATOM   693  O  OG  . SER A 1 90  ? 26.23659 71.68051 -11.16930 1.000 54.37640  ? 90  SER A OG  1 
ATOM   694  N  N   . GLU A 1 91  ? 24.80873 72.86356 -8.81436  1.000 42.98272  ? 91  GLU A N   1 
ATOM   695  C  CA  . GLU A 1 91  ? 23.40644 72.64302 -8.48328  1.000 43.04975  ? 91  GLU A CA  1 
ATOM   696  C  C   . GLU A 1 91  ? 22.91627 71.33545 -9.08020  1.000 47.45289  ? 91  GLU A C   1 
ATOM   697  O  O   . GLU A 1 91  ? 22.13259 70.62173 -8.44835  1.000 45.17915  ? 91  GLU A O   1 
ATOM   698  C  CB  . GLU A 1 91  ? 22.54942 73.80922 -8.96043  1.000 37.89024  ? 91  GLU A CB  1 
ATOM   699  C  CG  . GLU A 1 91  ? 22.91875 75.10494 -8.30215  1.000 42.24323  ? 91  GLU A CG  1 
ATOM   700  C  CD  . GLU A 1 91  ? 21.75763 76.03758 -8.20088  1.000 50.03148  ? 91  GLU A CD  1 
ATOM   701  O  OE1 . GLU A 1 91  ? 21.09030 76.04125 -7.14907  1.000 51.21336  ? 91  GLU A OE1 1 
ATOM   702  O  OE2 . GLU A 1 91  ? 21.50036 76.75679 -9.18584  1.000 58.08722  ? 91  GLU A OE2 1 
ATOM   703  N  N   . ASP A 1 92  ? 23.36735 71.00359 -10.29524 1.000 54.76932  ? 92  ASP A N   1 
ATOM   704  C  CA  . ASP A 1 92  ? 23.03063 69.71968 -10.90031 1.000 48.15027  ? 92  ASP A CA  1 
ATOM   705  C  C   . ASP A 1 92  ? 23.78684 68.62595 -10.15343 1.000 39.35632  ? 92  ASP A C   1 
ATOM   706  O  O   . ASP A 1 92  ? 24.88192 68.24913 -10.57058 1.000 45.05872  ? 92  ASP A O   1 
ATOM   707  C  CB  . ASP A 1 92  ? 23.36805 69.73050 -12.39500 1.000 40.70151  ? 92  ASP A CB  1 
ATOM   708  C  CG  . ASP A 1 92  ? 22.84653 68.50517 -13.14548 1.000 44.17760  ? 92  ASP A CG  1 
ATOM   709  O  OD1 . ASP A 1 92  ? 22.33657 67.57631 -12.49807 1.000 43.25848  ? 92  ASP A OD1 1 
ATOM   710  O  OD2 . ASP A 1 92  ? 22.98720 68.44980 -14.40165 1.000 48.57378  ? 92  ASP A OD2 1 
ATOM   711  N  N   . CYS A 1 93  ? 23.19329 68.10124 -9.05845  1.000 34.57461  ? 93  CYS A N   1 
ATOM   712  C  CA  . CYS A 1 93  ? 23.84296 67.17291 -8.12297  1.000 46.50300  ? 93  CYS A CA  1 
ATOM   713  C  C   . CYS A 1 93  ? 22.95981 66.01785 -7.63843  1.000 45.97836  ? 93  CYS A C   1 
ATOM   714  O  O   . CYS A 1 93  ? 23.46472 65.17182 -6.89264  1.000 42.71756  ? 93  CYS A O   1 
ATOM   715  C  CB  . CYS A 1 93  ? 24.40797 67.92158 -6.87419  1.000 32.48190  ? 93  CYS A CB  1 
ATOM   716  S  SG  . CYS A 1 93  ? 23.18284 68.81974 -5.85437  1.000 42.19314  ? 93  CYS A SG  1 
ATOM   717  N  N   . LEU A 1 94  ? 21.69960 65.89971 -8.07187  1.000 43.55720  ? 94  LEU A N   1 
ATOM   718  C  CA  . LEU A 1 94  ? 20.80785 64.88963 -7.49643  1.000 37.47667  ? 94  LEU A CA  1 
ATOM   719  C  C   . LEU A 1 94  ? 21.05309 63.54810 -8.18955  1.000 41.51206  ? 94  LEU A C   1 
ATOM   720  O  O   . LEU A 1 94  ? 20.41274 63.21409 -9.18111  1.000 49.37354  ? 94  LEU A O   1 
ATOM   721  C  CB  . LEU A 1 94  ? 19.36246 65.35775 -7.60997  1.000 35.96644  ? 94  LEU A CB  1 
ATOM   722  C  CG  . LEU A 1 94  ? 19.06651 66.65893 -6.82808  1.000 37.49250  ? 94  LEU A CG  1 
ATOM   723  C  CD1 . LEU A 1 94  ? 17.63243 67.08954 -6.94127  1.000 30.22461  ? 94  LEU A CD1 1 
ATOM   724  C  CD2 . LEU A 1 94  ? 19.39637 66.50940 -5.37183  1.000 38.66687  ? 94  LEU A CD2 1 
ATOM   725  N  N   . TYR A 1 95  ? 21.99194 62.76125 -7.64896  1.000 46.03868  ? 95  TYR A N   1 
ATOM   726  C  CA  . TYR A 1 95  ? 22.38150 61.47161 -8.21696  1.000 40.92014  ? 95  TYR A CA  1 
ATOM   727  C  C   . TYR A 1 95  ? 22.50132 60.41153 -7.12294  1.000 36.46149  ? 95  TYR A C   1 
ATOM   728  O  O   . TYR A 1 95  ? 22.78938 60.71953 -5.96179  1.000 39.91584  ? 95  TYR A O   1 
ATOM   729  C  CB  . TYR A 1 95  ? 23.70609 61.58129 -8.98642  1.000 37.63704  ? 95  TYR A CB  1 
ATOM   730  C  CG  . TYR A 1 95  ? 23.62879 62.54079 -10.13199 1.000 42.73531  ? 95  TYR A CG  1 
ATOM   731  C  CD1 . TYR A 1 95  ? 23.22038 62.10950 -11.39045 1.000 50.83749  ? 95  TYR A CD1 1 
ATOM   732  C  CD2 . TYR A 1 95  ? 23.91926 63.89024 -9.95698  1.000 42.07624  ? 95  TYR A CD2 1 
ATOM   733  C  CE1 . TYR A 1 95  ? 23.12874 62.98474 -12.46026 1.000 47.38628  ? 95  TYR A CE1 1 
ATOM   734  C  CE2 . TYR A 1 95  ? 23.82568 64.78779 -11.02610 1.000 51.03289  ? 95  TYR A CE2 1 
ATOM   735  C  CZ  . TYR A 1 95  ? 23.43243 64.32204 -12.27803 1.000 52.78361  ? 95  TYR A CZ  1 
ATOM   736  O  OH  . TYR A 1 95  ? 23.32661 65.18677 -13.34688 1.000 55.01547  ? 95  TYR A OH  1 
ATOM   737  N  N   . ILE A 1 96  ? 22.28741 59.15567 -7.51000  1.000 36.53154  ? 96  ILE A N   1 
ATOM   738  C  CA  . ILE A 1 96  ? 22.29705 58.01883 -6.59516  1.000 43.53605  ? 96  ILE A CA  1 
ATOM   739  C  C   . ILE A 1 96  ? 23.47790 57.12488 -6.94474  1.000 48.76701  ? 96  ILE A C   1 
ATOM   740  O  O   . ILE A 1 96  ? 23.91005 57.07430 -8.10245  1.000 51.81750  ? 96  ILE A O   1 
ATOM   741  C  CB  . ILE A 1 96  ? 20.97040 57.22739 -6.67350  1.000 40.85813  ? 96  ILE A CB  1 
ATOM   742  C  CG1 . ILE A 1 96  ? 19.94632 57.77577 -5.68761  1.000 45.74146  ? 96  ILE A CG1 1 
ATOM   743  C  CG2 . ILE A 1 96  ? 21.17823 55.74440 -6.43514  1.000 38.61096  ? 96  ILE A CG2 1 
ATOM   744  C  CD1 . ILE A 1 96  ? 18.54719 57.21937 -5.90705  1.000 47.95518  ? 96  ILE A CD1 1 
ATOM   745  N  N   . ASN A 1 97  ? 24.00589 56.42763 -5.93201  1.000 41.58356  ? 97  ASN A N   1 
ATOM   746  C  CA  . ASN A 1 97  ? 24.98310 55.36515 -6.12062  1.000 44.79311  ? 97  ASN A CA  1 
ATOM   747  C  C   . ASN A 1 97  ? 24.47360 54.07029 -5.49527  1.000 49.68161  ? 97  ASN A C   1 
ATOM   748  O  O   . ASN A 1 97  ? 23.79591 54.08896 -4.46745  1.000 54.92375  ? 97  ASN A O   1 
ATOM   749  C  CB  . ASN A 1 97  ? 26.32779 55.74244 -5.51075  1.000 41.34586  ? 97  ASN A CB  1 
ATOM   750  C  CG  . ASN A 1 97  ? 26.69140 57.17465 -5.77488  1.000 42.92586  ? 97  ASN A CG  1 
ATOM   751  O  OD1 . ASN A 1 97  ? 27.08782 57.53329 -6.89521  1.000 46.55382  ? 97  ASN A OD1 1 
ATOM   752  N  ND2 . ASN A 1 97  ? 26.55117 58.01900 -4.74988  1.000 35.14166  ? 97  ASN A ND2 1 
ATOM   753  N  N   . VAL A 1 98  ? 24.80040 52.94025 -6.12625  1.000 43.05409  ? 98  VAL A N   1 
ATOM   754  C  CA  . VAL A 1 98  ? 24.38830 51.61799 -5.65962  1.000 40.50320  ? 98  VAL A CA  1 
ATOM   755  C  C   . VAL A 1 98  ? 25.54903 50.63525 -5.79085  1.000 41.33629  ? 98  VAL A C   1 
ATOM   756  O  O   . VAL A 1 98  ? 26.13228 50.49666 -6.87310  1.000 44.32324  ? 98  VAL A O   1 
ATOM   757  C  CB  . VAL A 1 98  ? 23.16819 51.08200 -6.43713  1.000 39.36726  ? 98  VAL A CB  1 
ATOM   758  C  CG1 . VAL A 1 98  ? 22.68245 49.78785 -5.79893  1.000 41.78610  ? 98  VAL A CG1 1 
ATOM   759  C  CG2 . VAL A 1 98  ? 22.03339 52.09744 -6.46110  1.000 35.16146  ? 98  VAL A CG2 1 
ATOM   760  N  N   . TRP A 1 99  ? 25.86197 49.93227 -4.69764  1.000 39.91383  ? 99  TRP A N   1 
ATOM   761  C  CA  . TRP A 1 99  ? 26.86652 48.86718 -4.64132  1.000 40.44723  ? 99  TRP A CA  1 
ATOM   762  C  C   . TRP A 1 99  ? 26.12534 47.53778 -4.52012  1.000 46.00371  ? 99  TRP A C   1 
ATOM   763  O  O   . TRP A 1 99  ? 25.41122 47.31411 -3.53560  1.000 54.88387  ? 99  TRP A O   1 
ATOM   764  C  CB  . TRP A 1 99  ? 27.81405 49.05439 -3.44557  1.000 39.36237  ? 99  TRP A CB  1 
ATOM   765  C  CG  . TRP A 1 99  ? 28.82216 50.20253 -3.56800  1.000 46.15706  ? 99  TRP A CG  1 
ATOM   766  C  CD1 . TRP A 1 99  ? 30.12827 50.11000 -3.98359  1.000 48.68165  ? 99  TRP A CD1 1 
ATOM   767  C  CD2 . TRP A 1 99  ? 28.61127 51.59180 -3.23929  1.000 42.92514  ? 99  TRP A CD2 1 
ATOM   768  N  NE1 . TRP A 1 99  ? 30.73244 51.35432 -3.96114  1.000 43.87252  ? 99  TRP A NE1 1 
ATOM   769  C  CE2 . TRP A 1 99  ? 29.82513 52.27684 -3.50527  1.000 43.72126  ? 99  TRP A CE2 1 
ATOM   770  C  CE3 . TRP A 1 99  ? 27.51479 52.32367 -2.76448  1.000 38.95354  ? 99  TRP A CE3 1 
ATOM   771  C  CZ2 . TRP A 1 99  ? 29.96615 53.65491 -3.31382  1.000 42.28821  ? 99  TRP A CZ2 1 
ATOM   772  C  CZ3 . TRP A 1 99  ? 27.66377 53.70382 -2.56501  1.000 39.46272  ? 99  TRP A CZ3 1 
ATOM   773  C  CH2 . TRP A 1 99  ? 28.88114 54.34848 -2.84306  1.000 39.68119  ? 99  TRP A CH2 1 
ATOM   774  N  N   . ALA A 1 100 ? 26.28405 46.65874 -5.50571  1.000 47.56124  ? 100 ALA A N   1 
ATOM   775  C  CA  . ALA A 1 100 ? 25.46577 45.44931 -5.59647  1.000 46.65008  ? 100 ALA A CA  1 
ATOM   776  C  C   . ALA A 1 100 ? 26.35326 44.22809 -5.78939  1.000 48.55160  ? 100 ALA A C   1 
ATOM   777  O  O   . ALA A 1 100 ? 27.12829 44.17355 -6.76828  1.000 48.95243  ? 100 ALA A O   1 
ATOM   778  C  CB  . ALA A 1 100 ? 24.44966 45.56862 -6.73598  1.000 45.09407  ? 100 ALA A CB  1 
ATOM   779  N  N   . PRO A 1 101 ? 26.28310 43.23581 -4.90594  1.000 59.75198  ? 101 PRO A N   1 
ATOM   780  C  CA  . PRO A 1 101 ? 27.11615 42.03434 -5.07640  1.000 58.77182  ? 101 PRO A CA  1 
ATOM   781  C  C   . PRO A 1 101 ? 26.78286 41.27884 -6.35701  1.000 60.89630  ? 101 PRO A C   1 
ATOM   782  O  O   . PRO A 1 101 ? 25.65483 41.32121 -6.85398  1.000 57.49141  ? 101 PRO A O   1 
ATOM   783  C  CB  . PRO A 1 101 ? 26.79358 41.19401 -3.83429  1.000 49.89655  ? 101 PRO A CB  1 
ATOM   784  C  CG  . PRO A 1 101 ? 26.27877 42.18435 -2.82091  1.000 51.26100  ? 101 PRO A CG  1 
ATOM   785  C  CD  . PRO A 1 101 ? 25.59541 43.27343 -3.60117  1.000 51.59925  ? 101 PRO A CD  1 
ATOM   786  N  N   . ALA A 1 102 ? 27.81066 40.60931 -6.89152  1.000 71.94570  ? 102 ALA A N   1 
ATOM   787  C  CA  . ALA A 1 102 ? 27.77481 39.66105 -8.01955  1.000 59.98596  ? 102 ALA A CA  1 
ATOM   788  C  C   . ALA A 1 102 ? 26.40457 39.14752 -8.43165  1.000 65.31140  ? 102 ALA A C   1 
ATOM   789  O  O   . ALA A 1 102 ? 26.26818 37.99345 -8.84138  1.000 75.74150  ? 102 ALA A O   1 
ATOM   790  C  CB  . ALA A 1 102 ? 28.66325 38.47413 -7.68807  1.000 62.60791  ? 102 ALA A CB  1 
ATOM   791  N  N   . THR A 1 137 ? 15.38884 36.11595 3.50667   1.000 111.33411 ? 137 THR A N   1 
ATOM   792  C  CA  . THR A 1 137 ? 13.96376 35.79830 3.52700   1.000 118.86129 ? 137 THR A CA  1 
ATOM   793  C  C   . THR A 1 137 ? 13.54733 35.02514 2.26232   1.000 133.56263 ? 137 THR A C   1 
ATOM   794  O  O   . THR A 1 137 ? 12.47598 34.41114 2.25766   1.000 132.60797 ? 137 THR A O   1 
ATOM   795  C  CB  . THR A 1 137 ? 13.08905 37.08069 3.67083   1.000 107.41423 ? 137 THR A CB  1 
ATOM   796  O  OG1 . THR A 1 137 ? 13.73328 38.02726 4.53721   1.000 98.22963  ? 137 THR A OG1 1 
ATOM   797  C  CG2 . THR A 1 137 ? 11.71487 36.73822 4.24227   1.000 104.56739 ? 137 THR A CG2 1 
ATOM   798  N  N   . THR A 1 138 ? 14.40418 35.09330 1.21998   1.000 150.76716 ? 138 THR A N   1 
ATOM   799  C  CA  . THR A 1 138 ? 14.40480 34.35945 -0.06101  1.000 159.10065 ? 138 THR A CA  1 
ATOM   800  C  C   . THR A 1 138 ? 14.26688 35.27368 -1.28800  1.000 155.56720 ? 138 THR A C   1 
ATOM   801  O  O   . THR A 1 138 ? 14.74120 34.91798 -2.37324  1.000 159.49306 ? 138 THR A O   1 
ATOM   802  C  CB  . THR A 1 138 ? 13.31594 33.26885 -0.14844  1.000 167.25928 ? 138 THR A CB  1 
ATOM   803  O  OG1 . THR A 1 138 ? 13.26800 32.51409 1.07037   1.000 170.41937 ? 138 THR A OG1 1 
ATOM   804  C  CG2 . THR A 1 138 ? 13.59505 32.30646 -1.30082  1.000 170.33340 ? 138 THR A CG2 1 
ATOM   805  N  N   . ASN A 1 139 ? 13.63830 36.44779 -1.14875  1.000 144.28809 ? 139 ASN A N   1 
ATOM   806  C  CA  . ASN A 1 139 ? 13.22610 37.25746 -2.29615  1.000 122.53520 ? 139 ASN A CA  1 
ATOM   807  C  C   . ASN A 1 139 ? 14.18542 38.41249 -2.60981  1.000 97.20980  ? 139 ASN A C   1 
ATOM   808  O  O   . ASN A 1 139 ? 13.74044 39.47349 -3.06864  1.000 94.30367  ? 139 ASN A O   1 
ATOM   809  C  CB  . ASN A 1 139 ? 11.81314 37.80974 -2.07734  1.000 127.41621 ? 139 ASN A CB  1 
ATOM   810  C  CG  . ASN A 1 139 ? 10.83282 36.75993 -1.58106  1.000 136.25862 ? 139 ASN A CG  1 
ATOM   811  O  OD1 . ASN A 1 139 ? 11.14248 35.98812 -0.67311  1.000 142.42583 ? 139 ASN A OD1 1 
ATOM   812  N  ND2 . ASN A 1 139 ? 9.63143  36.74535 -2.15810  1.000 136.87679 ? 139 ASN A ND2 1 
ATOM   813  N  N   . GLY A 1 140 ? 15.48968 38.23797 -2.39018  1.000 83.21797  ? 140 GLY A N   1 
ATOM   814  C  CA  . GLY A 1 140 ? 16.43040 39.31710 -2.65117  1.000 71.37558  ? 140 GLY A CA  1 
ATOM   815  C  C   . GLY A 1 140 ? 17.23449 39.77664 -1.44273  1.000 69.80236  ? 140 GLY A C   1 
ATOM   816  O  O   . GLY A 1 140 ? 16.83570 39.52979 -0.29678  1.000 64.33550  ? 140 GLY A O   1 
ATOM   817  N  N   . LEU A 1 141 ? 18.36474 40.46726 -1.69342  1.000 63.53889  ? 141 LEU A N   1 
ATOM   818  C  CA  . LEU A 1 141 ? 19.32271 40.86150 -0.66680  1.000 52.23167  ? 141 LEU A CA  1 
ATOM   819  C  C   . LEU A 1 141 ? 18.83523 42.06589 0.13766   1.000 53.98811  ? 141 LEU A C   1 
ATOM   820  O  O   . LEU A 1 141 ? 17.98850 42.83143 -0.32970  1.000 51.81542  ? 141 LEU A O   1 
ATOM   821  C  CB  . LEU A 1 141 ? 20.66526 41.20492 -1.30347  1.000 48.37466  ? 141 LEU A CB  1 
ATOM   822  C  CG  . LEU A 1 141 ? 21.52308 40.09835 -1.92189  1.000 51.93780  ? 141 LEU A CG  1 
ATOM   823  C  CD1 . LEU A 1 141 ? 22.76970 40.69374 -2.58188  1.000 55.58188  ? 141 LEU A CD1 1 
ATOM   824  C  CD2 . LEU A 1 141 ? 21.91208 39.03930 -0.90497  1.000 49.45823  ? 141 LEU A CD2 1 
ATOM   825  N  N   . PRO A 1 142 ? 19.36738 42.26459 1.35150   1.000 46.74257  ? 142 PRO A N   1 
ATOM   826  C  CA  . PRO A 1 142 ? 19.04347 43.48242 2.10909   1.000 45.48490  ? 142 PRO A CA  1 
ATOM   827  C  C   . PRO A 1 142 ? 19.68670 44.70148 1.47178   1.000 46.79821  ? 142 PRO A C   1 
ATOM   828  O  O   . PRO A 1 142 ? 20.70782 44.60283 0.77898   1.000 42.25631  ? 142 PRO A O   1 
ATOM   829  C  CB  . PRO A 1 142 ? 19.63765 43.21829 3.50065   1.000 45.92192  ? 142 PRO A CB  1 
ATOM   830  C  CG  . PRO A 1 142 ? 19.96462 41.74437 3.53199   1.000 46.23494  ? 142 PRO A CG  1 
ATOM   831  C  CD  . PRO A 1 142 ? 20.25440 41.36874 2.11170   1.000 45.25531  ? 142 PRO A CD  1 
ATOM   832  N  N   . ILE A 1 143 ? 19.08265 45.86560 1.71844   1.000 40.67208  ? 143 ILE A N   1 
ATOM   833  C  CA  . ILE A 1 143 ? 19.52376 47.11440 1.09482   1.000 50.53793  ? 143 ILE A CA  1 
ATOM   834  C  C   . ILE A 1 143 ? 19.74668 48.14489 2.18866   1.000 46.58790  ? 143 ILE A C   1 
ATOM   835  O  O   . ILE A 1 143 ? 18.79884 48.52842 2.88454   1.000 51.46919  ? 143 ILE A O   1 
ATOM   836  C  CB  . ILE A 1 143 ? 18.52426 47.65572 0.05080   1.000 45.16998  ? 143 ILE A CB  1 
ATOM   837  C  CG1 . ILE A 1 143 ? 18.24536 46.61453 -1.01677  1.000 54.97344  ? 143 ILE A CG1 1 
ATOM   838  C  CG2 . ILE A 1 143 ? 19.09027 48.86388 -0.64860  1.000 34.22468  ? 143 ILE A CG2 1 
ATOM   839  C  CD1 . ILE A 1 143 ? 16.79760 46.42602 -1.28400  1.000 63.93103  ? 143 ILE A CD1 1 
ATOM   840  N  N   . LEU A 1 144 ? 20.98923 48.60270 2.32596   1.000 38.26928  ? 144 LEU A N   1 
ATOM   841  C  CA  . LEU A 1 144 ? 21.35164 49.65176 3.26599   1.000 30.85419  ? 144 LEU A CA  1 
ATOM   842  C  C   . LEU A 1 144 ? 21.56071 50.95312 2.51166   1.000 34.00231  ? 144 LEU A C   1 
ATOM   843  O  O   . LEU A 1 144 ? 22.26461 50.97387 1.49428   1.000 39.23965  ? 144 LEU A O   1 
ATOM   844  C  CB  . LEU A 1 144 ? 22.62144 49.28694 4.02441   1.000 31.58766  ? 144 LEU A CB  1 
ATOM   845  C  CG  . LEU A 1 144 ? 22.44904 48.33397 5.19412   1.000 34.49309  ? 144 LEU A CG  1 
ATOM   846  C  CD1 . LEU A 1 144 ? 22.23073 46.93932 4.67039   1.000 51.17819  ? 144 LEU A CD1 1 
ATOM   847  C  CD2 . LEU A 1 144 ? 23.68840 48.38942 6.01043   1.000 28.67522  ? 144 LEU A CD2 1 
ATOM   848  N  N   . ILE A 1 145 ? 20.98328 52.03659 3.03035   1.000 29.70524  ? 145 ILE A N   1 
ATOM   849  C  CA  . ILE A 1 145 ? 21.01283 53.34869 2.39072   1.000 31.41621  ? 145 ILE A CA  1 
ATOM   850  C  C   . ILE A 1 145 ? 21.70048 54.34400 3.31994   1.000 33.39520  ? 145 ILE A C   1 
ATOM   851  O  O   . ILE A 1 145 ? 21.20711 54.61437 4.42453   1.000 36.93181  ? 145 ILE A O   1 
ATOM   852  C  CB  . ILE A 1 145 ? 19.59586 53.83069 2.05619   1.000 37.14947  ? 145 ILE A CB  1 
ATOM   853  C  CG1 . ILE A 1 145 ? 18.85770 52.78746 1.23692   1.000 39.50063  ? 145 ILE A CG1 1 
ATOM   854  C  CG2 . ILE A 1 145 ? 19.61979 55.19707 1.34955   1.000 35.46749  ? 145 ILE A CG2 1 
ATOM   855  C  CD1 . ILE A 1 145 ? 17.40399 53.16045 1.01507   1.000 45.46626  ? 145 ILE A CD1 1 
ATOM   856  N  N   . TRP A 1 146 ? 22.79061 54.94277 2.84417   1.000 34.50876  ? 146 TRP A N   1 
ATOM   857  C  CA  . TRP A 1 146 ? 23.57562 55.90625 3.61944   1.000 32.97776  ? 146 TRP A CA  1 
ATOM   858  C  C   . TRP A 1 146 ? 23.13695 57.35176 3.36646   1.000 30.91812  ? 146 TRP A C   1 
ATOM   859  O  O   . TRP A 1 146 ? 22.98482 57.76955 2.21315   1.000 36.25265  ? 146 TRP A O   1 
ATOM   860  C  CB  . TRP A 1 146 ? 25.05528 55.75619 3.26841   1.000 24.06560  ? 146 TRP A CB  1 
ATOM   861  C  CG  . TRP A 1 146 ? 25.92990 56.80380 3.87758   1.000 34.47166  ? 146 TRP A CG  1 
ATOM   862  C  CD1 . TRP A 1 146 ? 26.50319 57.86253 3.24056   1.000 34.41110  ? 146 TRP A CD1 1 
ATOM   863  C  CD2 . TRP A 1 146 ? 26.34837 56.88563 5.24718   1.000 37.64799  ? 146 TRP A CD2 1 
ATOM   864  N  NE1 . TRP A 1 146 ? 27.26136 58.59797 4.12392   1.000 35.18988  ? 146 TRP A NE1 1 
ATOM   865  C  CE2 . TRP A 1 146 ? 27.18325 58.01940 5.36220   1.000 38.67258  ? 146 TRP A CE2 1 
ATOM   866  C  CE3 . TRP A 1 146 ? 26.09900 56.11210 6.38496   1.000 29.86431  ? 146 TRP A CE3 1 
ATOM   867  C  CZ2 . TRP A 1 146 ? 27.77567 58.39600 6.56812   1.000 39.77187  ? 146 TRP A CZ2 1 
ATOM   868  C  CZ3 . TRP A 1 146 ? 26.68983 56.48910 7.58819   1.000 36.39475  ? 146 TRP A CZ3 1 
ATOM   869  C  CH2 . TRP A 1 146 ? 27.51741 57.62048 7.66865   1.000 40.47274  ? 146 TRP A CH2 1 
ATOM   870  N  N   . ILE A 1 147 ? 22.97328 58.12382 4.44074   1.000 29.19332  ? 147 ILE A N   1 
ATOM   871  C  CA  . ILE A 1 147 ? 22.74301 59.56708 4.35072   1.000 30.27698  ? 147 ILE A CA  1 
ATOM   872  C  C   . ILE A 1 147 ? 23.87657 60.28673 5.06821   1.000 30.34769  ? 147 ILE A C   1 
ATOM   873  O  O   . ILE A 1 147 ? 23.95036 60.25111 6.29888   1.000 37.38340  ? 147 ILE A O   1 
ATOM   874  C  CB  . ILE A 1 147 ? 21.39893 59.98337 4.95242   1.000 27.41184  ? 147 ILE A CB  1 
ATOM   875  C  CG1 . ILE A 1 147 ? 20.25542 59.12554 4.41917   1.000 20.55651  ? 147 ILE A CG1 1 
ATOM   876  C  CG2 . ILE A 1 147 ? 21.13531 61.47652 4.70083   1.000 25.55415  ? 147 ILE A CG2 1 
ATOM   877  C  CD1 . ILE A 1 147 ? 18.89513 59.54542 5.01424   1.000 20.16503  ? 147 ILE A CD1 1 
ATOM   878  N  N   . TYR A 1 148 ? 24.72557 60.97843 4.31359   1.000 29.68858  ? 148 TYR A N   1 
ATOM   879  C  CA  . TYR A 1 148 ? 25.83424 61.70624 4.91146   1.000 26.20652  ? 148 TYR A CA  1 
ATOM   880  C  C   . TYR A 1 148 ? 25.33859 62.88866 5.73276   1.000 29.67884  ? 148 TYR A C   1 
ATOM   881  O  O   . TYR A 1 148 ? 24.22533 63.40167 5.54776   1.000 28.14299  ? 148 TYR A O   1 
ATOM   882  C  CB  . TYR A 1 148 ? 26.79205 62.23915 3.84236   1.000 36.24812  ? 148 TYR A CB  1 
ATOM   883  C  CG  . TYR A 1 148 ? 26.13862 63.16611 2.82198   1.000 38.79563  ? 148 TYR A CG  1 
ATOM   884  C  CD1 . TYR A 1 148 ? 25.97633 64.52667 3.07783   1.000 40.36347  ? 148 TYR A CD1 1 
ATOM   885  C  CD2 . TYR A 1 148 ? 25.68747 62.67164 1.59872   1.000 40.89674  ? 148 TYR A CD2 1 
ATOM   886  C  CE1 . TYR A 1 148 ? 25.37763 65.37281 2.13739   1.000 47.60562  ? 148 TYR A CE1 1 
ATOM   887  C  CE2 . TYR A 1 148 ? 25.09087 63.49933 0.65795   1.000 45.52994  ? 148 TYR A CE2 1 
ATOM   888  C  CZ  . TYR A 1 148 ? 24.93760 64.84721 0.92710   1.000 50.75422  ? 148 TYR A CZ  1 
ATOM   889  O  OH  . TYR A 1 148 ? 24.34250 65.65842 -0.01402  1.000 47.58670  ? 148 TYR A OH  1 
ATOM   890  N  N   . GLY A 1 149 ? 26.21722 63.34773 6.62384   1.000 29.50068  ? 149 GLY A N   1 
ATOM   891  C  CA  . GLY A 1 149 ? 26.00150 64.53460 7.40106   1.000 31.64433  ? 149 GLY A CA  1 
ATOM   892  C  C   . GLY A 1 149 ? 26.88681 65.68450 6.95745   1.000 35.05012  ? 149 GLY A C   1 
ATOM   893  O  O   . GLY A 1 149 ? 27.38513 65.72837 5.82486   1.000 32.99177  ? 149 GLY A O   1 
ATOM   894  N  N   . GLY A 1 150 ? 27.08669 66.63375 7.87507   1.000 33.50451  ? 150 GLY A N   1 
ATOM   895  C  CA  . GLY A 1 150 ? 27.71939 67.88991 7.51845   1.000 31.45534  ? 150 GLY A CA  1 
ATOM   896  C  C   . GLY A 1 150 ? 26.84778 69.10214 7.80083   1.000 35.11503  ? 150 GLY A C   1 
ATOM   897  O  O   . GLY A 1 150 ? 26.91066 70.11251 7.08674   1.000 26.10775  ? 150 GLY A O   1 
ATOM   898  N  N   . GLY A 1 151 ? 26.01105 68.99599 8.83454   1.000 28.00217  ? 151 GLY A N   1 
ATOM   899  C  CA  . GLY A 1 151 ? 25.31383 70.14842 9.37075   1.000 29.18064  ? 151 GLY A CA  1 
ATOM   900  C  C   . GLY A 1 151 ? 24.24051 70.75409 8.49295   1.000 34.48324  ? 151 GLY A C   1 
ATOM   901  O  O   . GLY A 1 151 ? 23.87997 71.91817 8.69417   1.000 34.30297  ? 151 GLY A O   1 
ATOM   902  N  N   . PHE A 1 152 ? 23.70094 69.99909 7.53979   1.000 33.76745  ? 152 PHE A N   1 
ATOM   903  C  CA  . PHE A 1 152 ? 22.72185 70.48889 6.57246   1.000 34.42091  ? 152 PHE A CA  1 
ATOM   904  C  C   . PHE A 1 152 ? 23.26714 71.63963 5.72920   1.000 42.67064  ? 152 PHE A C   1 
ATOM   905  O  O   . PHE A 1 152 ? 22.50000 72.31626 5.02703   1.000 44.24346  ? 152 PHE A O   1 
ATOM   906  C  CB  . PHE A 1 152 ? 21.41198 70.90463 7.25600   1.000 25.65982  ? 152 PHE A CB  1 
ATOM   907  C  CG  . PHE A 1 152 ? 20.76518 69.79377 8.03249   1.000 35.13156  ? 152 PHE A CG  1 
ATOM   908  C  CD1 . PHE A 1 152 ? 20.03453 68.80327 7.38282   1.000 32.62126  ? 152 PHE A CD1 1 
ATOM   909  C  CD2 . PHE A 1 152 ? 20.90382 69.72585 9.41748   1.000 37.25451  ? 152 PHE A CD2 1 
ATOM   910  C  CE1 . PHE A 1 152 ? 19.44952 67.76762 8.09791   1.000 30.18167  ? 152 PHE A CE1 1 
ATOM   911  C  CE2 . PHE A 1 152 ? 20.31891 68.70019 10.13761  1.000 29.88958  ? 152 PHE A CE2 1 
ATOM   912  C  CZ  . PHE A 1 152 ? 19.59702 67.71828 9.47757   1.000 33.84646  ? 152 PHE A CZ  1 
ATOM   913  N  N   . MET A 1 153 ? 24.57661 71.88168 5.78279   1.000 32.76149  ? 153 MET A N   1 
ATOM   914  C  CA  . MET A 1 153 ? 25.20072 72.92615 4.99567   1.000 36.80870  ? 153 MET A CA  1 
ATOM   915  C  C   . MET A 1 153 ? 26.18483 72.38226 3.97370   1.000 36.32945  ? 153 MET A C   1 
ATOM   916  O  O   . MET A 1 153 ? 26.46795 73.05550 2.98241   1.000 42.48628  ? 153 MET A O   1 
ATOM   917  C  CB  . MET A 1 153 ? 25.92672 73.91534 5.92489   1.000 38.26892  ? 153 MET A CB  1 
ATOM   918  C  CG  . MET A 1 153 ? 25.02192 74.54709 6.97117   1.000 37.60860  ? 153 MET A CG  1 
ATOM   919  S  SD  . MET A 1 153 ? 23.92262 75.86097 6.36546   1.000 41.30787  ? 153 MET A SD  1 
ATOM   920  C  CE  . MET A 1 153 ? 25.12304 77.08855 5.81165   1.000 32.76487  ? 153 MET A CE  1 
ATOM   921  N  N   . THR A 1 154 ? 26.69168 71.18075 4.19522   1.000 40.34670  ? 154 THR A N   1 
ATOM   922  C  CA  . THR A 1 154 ? 27.84658 70.62669 3.51130   1.000 39.95764  ? 154 THR A CA  1 
ATOM   923  C  C   . THR A 1 154 ? 27.68980 69.11367 3.47188   1.000 38.63039  ? 154 THR A C   1 
ATOM   924  O  O   . THR A 1 154 ? 26.71736 68.55016 3.98903   1.000 35.96577  ? 154 THR A O   1 
ATOM   925  C  CB  . THR A 1 154 ? 29.16666 71.01511 4.21396   1.000 42.53393  ? 154 THR A CB  1 
ATOM   926  O  OG1 . THR A 1 154 ? 29.26602 70.34304 5.48524   1.000 36.33518  ? 154 THR A OG1 1 
ATOM   927  C  CG2 . THR A 1 154 ? 29.34152 72.53412 4.38110   1.000 45.79765  ? 154 THR A CG2 1 
ATOM   928  N  N   . GLY A 1 155 ? 28.67045 68.45423 2.87946   1.000 41.82173  ? 155 GLY A N   1 
ATOM   929  C  CA  . GLY A 1 155 ? 28.68904 67.00878 2.83657   1.000 44.02424  ? 155 GLY A CA  1 
ATOM   930  C  C   . GLY A 1 155 ? 28.40258 66.48796 1.43864   1.000 42.14078  ? 155 GLY A C   1 
ATOM   931  O  O   . GLY A 1 155 ? 27.89908 67.19970 0.56374   1.000 39.84579  ? 155 GLY A O   1 
ATOM   932  N  N   . SER A 1 156 ? 28.73461 65.21508 1.23596   1.000 39.33601  ? 156 SER A N   1 
ATOM   933  C  CA  . SER A 1 156 ? 28.65261 64.60531 -0.08335  1.000 33.98104  ? 156 SER A CA  1 
ATOM   934  C  C   . SER A 1 156 ? 28.80042 63.10760 0.05838   1.000 31.79313  ? 156 SER A C   1 
ATOM   935  O  O   . SER A 1 156 ? 29.54800 62.62467 0.91237   1.000 39.83408  ? 156 SER A O   1 
ATOM   936  C  CB  . SER A 1 156 ? 29.73987 65.13216 -1.02495  1.000 37.12631  ? 156 SER A CB  1 
ATOM   937  O  OG  . SER A 1 156 ? 30.04937 64.16775 -2.00368  1.000 31.30589  ? 156 SER A OG  1 
ATOM   938  N  N   . ALA A 1 157 ? 28.12129 62.38605 -0.82805  1.000 30.07715  ? 157 ALA A N   1 
ATOM   939  C  CA  . ALA A 1 157 ? 28.16306 60.93241 -0.83867  1.000 32.79198  ? 157 ALA A CA  1 
ATOM   940  C  C   . ALA A 1 157 ? 29.41044 60.38609 -1.50810  1.000 42.36968  ? 157 ALA A C   1 
ATOM   941  O  O   . ALA A 1 157 ? 29.67249 59.18566 -1.38804  1.000 47.52813  ? 157 ALA A O   1 
ATOM   942  C  CB  . ALA A 1 157 ? 26.91892 60.37223 -1.54309  1.000 30.46099  ? 157 ALA A CB  1 
ATOM   943  N  N   . THR A 1 158 ? 30.18651 61.22914 -2.18454  1.000 31.30891  ? 158 THR A N   1 
ATOM   944  C  CA  . THR A 1 158 ? 31.29598 60.76391 -3.00724  1.000 39.66510  ? 158 THR A CA  1 
ATOM   945  C  C   . THR A 1 158 ? 32.60779 60.67490 -2.25083  1.000 41.24083  ? 158 THR A C   1 
ATOM   946  O  O   . THR A 1 158 ? 33.62135 60.29467 -2.84782  1.000 53.40484  ? 158 THR A O   1 
ATOM   947  C  CB  . THR A 1 158 ? 31.50648 61.68675 -4.22122  1.000 43.00674  ? 158 THR A CB  1 
ATOM   948  O  OG1 . THR A 1 158 ? 32.06917 62.93615 -3.78736  1.000 48.08698  ? 158 THR A OG1 1 
ATOM   949  C  CG2 . THR A 1 158 ? 30.20196 61.95418 -4.93599  1.000 38.14694  ? 158 THR A CG2 1 
ATOM   950  N  N   . LEU A 1 159 ? 32.63643 61.06582 -0.98217  1.000 45.32436  ? 159 LEU A N   1 
ATOM   951  C  CA  . LEU A 1 159 ? 33.88509 61.01636 -0.23319  1.000 46.60516  ? 159 LEU A CA  1 
ATOM   952  C  C   . LEU A 1 159 ? 34.34404 59.57419 -0.12176  1.000 45.73469  ? 159 LEU A C   1 
ATOM   953  O  O   . LEU A 1 159 ? 33.52835 58.68155 0.12552   1.000 49.15738  ? 159 LEU A O   1 
ATOM   954  C  CB  . LEU A 1 159 ? 33.69973 61.61330 1.16220   1.000 45.46603  ? 159 LEU A CB  1 
ATOM   955  C  CG  . LEU A 1 159 ? 32.99633 62.96709 1.31531   1.000 44.19689  ? 159 LEU A CG  1 
ATOM   956  C  CD1 . LEU A 1 159 ? 33.00462 63.40183 2.79240   1.000 34.35509  ? 159 LEU A CD1 1 
ATOM   957  C  CD2 . LEU A 1 159 ? 33.63382 64.02664 0.40461   1.000 33.88347  ? 159 LEU A CD2 1 
ATOM   958  N  N   . ASP A 1 160 ? 35.65356 59.34070 -0.32489  1.000 42.62619  ? 160 ASP A N   1 
ATOM   959  C  CA  . ASP A 1 160 ? 36.19528 57.98850 -0.15131  1.000 46.51696  ? 160 ASP A CA  1 
ATOM   960  C  C   . ASP A 1 160 ? 35.72065 57.32534 1.13750   1.000 48.90386  ? 160 ASP A C   1 
ATOM   961  O  O   . ASP A 1 160 ? 35.43461 56.12032 1.14481   1.000 44.82882  ? 160 ASP A O   1 
ATOM   962  C  CB  . ASP A 1 160 ? 37.71846 58.00039 -0.15854  1.000 49.34062  ? 160 ASP A CB  1 
ATOM   963  C  CG  . ASP A 1 160 ? 38.28421 58.69870 -1.35856  1.000 65.89218  ? 160 ASP A CG  1 
ATOM   964  O  OD1 . ASP A 1 160 ? 37.56402 58.79878 -2.38347  1.000 67.68401  ? 160 ASP A OD1 1 
ATOM   965  O  OD2 . ASP A 1 160 ? 39.45476 59.13342 -1.27590  1.000 73.38999  ? 160 ASP A OD2 1 
ATOM   966  N  N   . ILE A 1 161 ? 35.60537 58.09629 2.22574   1.000 44.53750  ? 161 ILE A N   1 
ATOM   967  C  CA  . ILE A 1 161 ? 35.26013 57.53629 3.52372   1.000 43.09708  ? 161 ILE A CA  1 
ATOM   968  C  C   . ILE A 1 161 ? 33.91299 56.81602 3.47289   1.000 48.14142  ? 161 ILE A C   1 
ATOM   969  O  O   . ILE A 1 161 ? 33.66011 55.90477 4.27978   1.000 42.02311  ? 161 ILE A O   1 
ATOM   970  C  CB  . ILE A 1 161 ? 35.29135 58.66755 4.57758   1.000 43.57542  ? 161 ILE A CB  1 
ATOM   971  C  CG1 . ILE A 1 161 ? 35.46011 58.10309 5.97798   1.000 49.53256  ? 161 ILE A CG1 1 
ATOM   972  C  CG2 . ILE A 1 161 ? 34.05895 59.53632 4.50553   1.000 38.00164  ? 161 ILE A CG2 1 
ATOM   973  C  CD1 . ILE A 1 161 ? 36.77808 57.46765 6.14429   1.000 54.05314  ? 161 ILE A CD1 1 
ATOM   974  N  N   . TYR A 1 162 ? 33.06195 57.16808 2.50072   1.000 44.50620  ? 162 TYR A N   1 
ATOM   975  C  CA  . TYR A 1 162 ? 31.74348 56.57237 2.32363   1.000 39.90751  ? 162 TYR A CA  1 
ATOM   976  C  C   . TYR A 1 162 ? 31.72533 55.47737 1.25006   1.000 40.37380  ? 162 TYR A C   1 
ATOM   977  O  O   . TYR A 1 162 ? 30.65330 54.94085 0.92498   1.000 32.62993  ? 162 TYR A O   1 
ATOM   978  C  CB  . TYR A 1 162 ? 30.71995 57.65480 1.97767   1.000 32.00701  ? 162 TYR A CB  1 
ATOM   979  C  CG  . TYR A 1 162 ? 30.60244 58.77737 2.98318   1.000 32.05738  ? 162 TYR A CG  1 
ATOM   980  C  CD1 . TYR A 1 162 ? 30.90002 58.58252 4.32486   1.000 38.87993  ? 162 TYR A CD1 1 
ATOM   981  C  CD2 . TYR A 1 162 ? 30.17229 60.03581 2.58867   1.000 29.44432  ? 162 TYR A CD2 1 
ATOM   982  C  CE1 . TYR A 1 162 ? 30.77706 59.62818 5.24754   1.000 41.05909  ? 162 TYR A CE1 1 
ATOM   983  C  CE2 . TYR A 1 162 ? 30.04050 61.06755 3.49151   1.000 32.38512  ? 162 TYR A CE2 1 
ATOM   984  C  CZ  . TYR A 1 162 ? 30.34912 60.86692 4.81333   1.000 39.27574  ? 162 TYR A CZ  1 
ATOM   985  O  OH  . TYR A 1 162 ? 30.21608 61.92024 5.68875   1.000 38.29847  ? 162 TYR A OH  1 
ATOM   986  N  N   . ASN A 1 163 ? 32.87757 55.13607 0.69253   1.000 35.98068  ? 163 ASN A N   1 
ATOM   987  C  CA  . ASN A 1 163 ? 32.93591 54.01910 -0.23299  1.000 39.14696  ? 163 ASN A CA  1 
ATOM   988  C  C   . ASN A 1 163 ? 32.36114 52.76254 0.41934   1.000 43.94303  ? 163 ASN A C   1 
ATOM   989  O  O   . ASN A 1 163 ? 32.82624 52.32659 1.47782   1.000 41.76693  ? 163 ASN A O   1 
ATOM   990  C  CB  . ASN A 1 163 ? 34.38020 53.80681 -0.66880  1.000 41.73394  ? 163 ASN A CB  1 
ATOM   991  C  CG  . ASN A 1 163 ? 34.53781 52.64938 -1.59298  1.000 42.38923  ? 163 ASN A CG  1 
ATOM   992  O  OD1 . ASN A 1 163 ? 33.56463 52.13369 -2.12508  1.000 48.46010  ? 163 ASN A OD1 1 
ATOM   993  N  ND2 . ASN A 1 163 ? 35.77889 52.25591 -1.83438  1.000 48.17510  ? 163 ASN A ND2 1 
ATOM   994  N  N   . ALA A 1 164 ? 31.33025 52.19128 -0.20439  1.000 44.33722  ? 164 ALA A N   1 
ATOM   995  C  CA  . ALA A 1 164 ? 30.67761 50.99332 0.31001   1.000 44.51675  ? 164 ALA A CA  1 
ATOM   996  C  C   . ALA A 1 164 ? 31.19192 49.71393 -0.33911  1.000 48.64621  ? 164 ALA A C   1 
ATOM   997  O  O   . ALA A 1 164 ? 30.52349 48.67571 -0.24535  1.000 50.90339  ? 164 ALA A O   1 
ATOM   998  C  CB  . ALA A 1 164 ? 29.16270 51.08738 0.12698   1.000 41.56210  ? 164 ALA A CB  1 
ATOM   999  N  N   . ASP A 1 165 ? 32.35313 49.76758 -1.00423  1.000 40.68728  ? 165 ASP A N   1 
ATOM   1000 C  CA  . ASP A 1 165 ? 32.93151 48.56115 -1.59076  1.000 45.42813  ? 165 ASP A CA  1 
ATOM   1001 C  C   . ASP A 1 165 ? 33.05376 47.45275 -0.55685  1.000 47.78500  ? 165 ASP A C   1 
ATOM   1002 O  O   . ASP A 1 165 ? 32.48953 46.36539 -0.72497  1.000 48.65260  ? 165 ASP A O   1 
ATOM   1003 C  CB  . ASP A 1 165 ? 34.30327 48.85524 -2.18977  1.000 52.77442  ? 165 ASP A CB  1 
ATOM   1004 C  CG  . ASP A 1 165 ? 34.22040 49.55567 -3.51673  1.000 57.23096  ? 165 ASP A CG  1 
ATOM   1005 O  OD1 . ASP A 1 165 ? 33.09415 49.86030 -3.96187  1.000 59.07065  ? 165 ASP A OD1 1 
ATOM   1006 O  OD2 . ASP A 1 165 ? 35.28827 49.80077 -4.11208  1.000 59.35468  ? 165 ASP A OD2 1 
ATOM   1007 N  N   . ILE A 1 166 ? 33.79100 47.71966 0.53090   1.000 48.92014  ? 166 ILE A N   1 
ATOM   1008 C  CA  . ILE A 1 166 ? 34.06223 46.67589 1.52214   1.000 49.09139  ? 166 ILE A CA  1 
ATOM   1009 C  C   . ILE A 1 166 ? 32.76378 46.20663 2.16858   1.000 49.57690  ? 166 ILE A C   1 
ATOM   1010 O  O   . ILE A 1 166 ? 32.50979 44.99998 2.28546   1.000 41.32515  ? 166 ILE A O   1 
ATOM   1011 C  CB  . ILE A 1 166 ? 35.07906 47.16915 2.57038   1.000 44.16830  ? 166 ILE A CB  1 
ATOM   1012 C  CG1 . ILE A 1 166 ? 36.49777 47.05469 2.03369   1.000 43.93784  ? 166 ILE A CG1 1 
ATOM   1013 C  CG2 . ILE A 1 166 ? 34.98706 46.35215 3.85703   1.000 42.25559  ? 166 ILE A CG2 1 
ATOM   1014 C  CD1 . ILE A 1 166 ? 37.45268 48.03761 2.63643   1.000 43.73321  ? 166 ILE A CD1 1 
ATOM   1015 N  N   . MET A 1 167 ? 31.91413 47.15274 2.57794   1.000 37.58027  ? 167 MET A N   1 
ATOM   1016 C  CA  . MET A 1 167 ? 30.68245 46.78295 3.26443   1.000 36.30208  ? 167 MET A CA  1 
ATOM   1017 C  C   . MET A 1 167 ? 29.85795 45.81037 2.43140   1.000 48.15653  ? 167 MET A C   1 
ATOM   1018 O  O   . MET A 1 167 ? 29.39847 44.77993 2.93675   1.000 45.38243  ? 167 MET A O   1 
ATOM   1019 C  CB  . MET A 1 167 ? 29.85161 48.01982 3.59421   1.000 36.37631  ? 167 MET A CB  1 
ATOM   1020 C  CG  . MET A 1 167 ? 28.54254 47.65745 4.27322   1.000 39.90090  ? 167 MET A CG  1 
ATOM   1021 S  SD  . MET A 1 167 ? 27.47855 49.04998 4.71427   1.000 41.88937  ? 167 MET A SD  1 
ATOM   1022 C  CE  . MET A 1 167 ? 28.10072 49.52013 6.34449   1.000 29.24322  ? 167 MET A CE  1 
ATOM   1023 N  N   . ALA A 1 168 ? 29.66102 46.11817 1.14637   1.000 48.32674  ? 168 ALA A N   1 
ATOM   1024 C  CA  . ALA A 1 168 ? 28.85104 45.24602 0.30421   1.000 43.33790  ? 168 ALA A CA  1 
ATOM   1025 C  C   . ALA A 1 168 ? 29.50301 43.87748 0.15045   1.000 46.23545  ? 168 ALA A C   1 
ATOM   1026 O  O   . ALA A 1 168 ? 28.83948 42.84329 0.27698   1.000 52.68209  ? 168 ALA A O   1 
ATOM   1027 C  CB  . ALA A 1 168 ? 28.62558 45.89275 -1.05869  1.000 39.79949  ? 168 ALA A CB  1 
ATOM   1028 N  N   . ALA A 1 169 ? 30.81226 43.85223 -0.09871  1.000 43.69748  ? 169 ALA A N   1 
ATOM   1029 C  CA  . ALA A 1 169 ? 31.49885 42.59339 -0.37564  1.000 46.71313  ? 169 ALA A CA  1 
ATOM   1030 C  C   . ALA A 1 169 ? 31.46114 41.66731 0.83185   1.000 57.79291  ? 169 ALA A C   1 
ATOM   1031 O  O   . ALA A 1 169 ? 31.03287 40.51323 0.73448   1.000 63.00033  ? 169 ALA A O   1 
ATOM   1032 C  CB  . ALA A 1 169 ? 32.94436 42.86996 -0.79531  1.000 48.23644  ? 169 ALA A CB  1 
ATOM   1033 N  N   . VAL A 1 170 ? 31.91393 42.16705 1.98621   1.000 56.02680  ? 170 VAL A N   1 
ATOM   1034 C  CA  . VAL A 1 170 ? 31.97467 41.37106 3.20826   1.000 51.39335  ? 170 VAL A CA  1 
ATOM   1035 C  C   . VAL A 1 170 ? 30.58844 41.16045 3.79812   1.000 49.34607  ? 170 VAL A C   1 
ATOM   1036 O  O   . VAL A 1 170 ? 30.31501 40.11782 4.40352   1.000 49.51992  ? 170 VAL A O   1 
ATOM   1037 C  CB  . VAL A 1 170 ? 32.91623 42.05518 4.21140   1.000 50.57364  ? 170 VAL A CB  1 
ATOM   1038 C  CG1 . VAL A 1 170 ? 32.80555 41.41720 5.58245   1.000 44.71697  ? 170 VAL A CG1 1 
ATOM   1039 C  CG2 . VAL A 1 170 ? 34.33437 41.97831 3.70626   1.000 63.40673  ? 170 VAL A CG2 1 
ATOM   1040 N  N   . GLY A 1 171 ? 29.69196 42.13181 3.63365   1.000 42.19823  ? 171 GLY A N   1 
ATOM   1041 C  CA  . GLY A 1 171 ? 28.34474 41.96278 4.12950   1.000 55.53997  ? 171 GLY A CA  1 
ATOM   1042 C  C   . GLY A 1 171 ? 27.44672 41.14250 3.23413   1.000 60.44605  ? 171 GLY A C   1 
ATOM   1043 O  O   . GLY A 1 171 ? 26.44523 40.60148 3.71389   1.000 66.18072  ? 171 GLY A O   1 
ATOM   1044 N  N   . ASN A 1 172 ? 27.79038 41.01851 1.95315   1.000 57.88850  ? 172 ASN A N   1 
ATOM   1045 C  CA  . ASN A 1 172 ? 26.89829 40.42341 0.95780   1.000 54.03948  ? 172 ASN A CA  1 
ATOM   1046 C  C   . ASN A 1 172 ? 25.52937 41.09309 1.02954   1.000 51.38169  ? 172 ASN A C   1 
ATOM   1047 O  O   . ASN A 1 172 ? 24.49130 40.45183 1.19394   1.000 52.36572  ? 172 ASN A O   1 
ATOM   1048 C  CB  . ASN A 1 172 ? 26.79442 38.90591 1.13419   1.000 54.77206  ? 172 ASN A CB  1 
ATOM   1049 C  CG  . ASN A 1 172 ? 26.11656 38.22801 -0.03473  1.000 64.33030  ? 172 ASN A CG  1 
ATOM   1050 O  OD1 . ASN A 1 172 ? 26.21435 38.68597 -1.17382  1.000 68.41207  ? 172 ASN A OD1 1 
ATOM   1051 N  ND2 . ASN A 1 172 ? 25.42791 37.12192 0.23827   1.000 73.16151  ? 172 ASN A ND2 1 
ATOM   1052 N  N   . VAL A 1 173 ? 25.54669 42.41858 0.95115   1.000 48.21755  ? 173 VAL A N   1 
ATOM   1053 C  CA  . VAL A 1 173 ? 24.34110 43.22880 0.99849   1.000 52.59185  ? 173 VAL A CA  1 
ATOM   1054 C  C   . VAL A 1 173 ? 24.44425 44.29326 -0.08129  1.000 46.41351  ? 173 VAL A C   1 
ATOM   1055 O  O   . VAL A 1 173 ? 25.49308 44.50054 -0.68495  1.000 51.21671  ? 173 VAL A O   1 
ATOM   1056 C  CB  . VAL A 1 173 ? 24.12960 43.91031 2.36709   1.000 48.12068  ? 173 VAL A CB  1 
ATOM   1057 C  CG1 . VAL A 1 173 ? 23.77298 42.88412 3.43832   1.000 50.05599  ? 173 VAL A CG1 1 
ATOM   1058 C  CG2 . VAL A 1 173 ? 25.35576 44.71811 2.72387   1.000 42.66805  ? 173 VAL A CG2 1 
ATOM   1059 N  N   . ILE A 1 174 ? 23.34376 44.99402 -0.28961  1.000 44.20046  ? 174 ILE A N   1 
ATOM   1060 C  CA  . ILE A 1 174 ? 23.28844 46.12205 -1.20254  1.000 46.17422  ? 174 ILE A CA  1 
ATOM   1061 C  C   . ILE A 1 174 ? 23.40341 47.39620 -0.38309  1.000 48.36334  ? 174 ILE A C   1 
ATOM   1062 O  O   . ILE A 1 174 ? 22.74841 47.52932 0.65794   1.000 43.64199  ? 174 ILE A O   1 
ATOM   1063 C  CB  . ILE A 1 174 ? 21.98807 46.09074 -2.01898  1.000 44.13561  ? 174 ILE A CB  1 
ATOM   1064 C  CG1 . ILE A 1 174 ? 21.99478 44.84953 -2.91648  1.000 40.46214  ? 174 ILE A CG1 1 
ATOM   1065 C  CG2 . ILE A 1 174 ? 21.77428 47.40174 -2.75267  1.000 36.28859  ? 174 ILE A CG2 1 
ATOM   1066 C  CD1 . ILE A 1 174 ? 21.12387 44.95321 -4.11225  1.000 55.66381  ? 174 ILE A CD1 1 
ATOM   1067 N  N   . VAL A 1 175 ? 24.25485 48.31927 -0.83301  1.000 49.44092  ? 175 VAL A N   1 
ATOM   1068 C  CA  . VAL A 1 175 ? 24.43026 49.62057 -0.19731  1.000 47.14502  ? 175 VAL A CA  1 
ATOM   1069 C  C   . VAL A 1 175 ? 24.20652 50.71924 -1.22845  1.000 44.75575  ? 175 VAL A C   1 
ATOM   1070 O  O   . VAL A 1 175 ? 24.73031 50.65444 -2.34472  1.000 56.93523  ? 175 VAL A O   1 
ATOM   1071 C  CB  . VAL A 1 175 ? 25.82812 49.77243 0.43699   1.000 39.62246  ? 175 VAL A CB  1 
ATOM   1072 C  CG1 . VAL A 1 175 ? 25.86375 51.01539 1.31905   1.000 29.63171  ? 175 VAL A CG1 1 
ATOM   1073 C  CG2 . VAL A 1 175 ? 26.20234 48.52914 1.22134   1.000 36.45285  ? 175 VAL A CG2 1 
ATOM   1074 N  N   . ALA A 1 176 ? 23.45654 51.74330 -0.84606  1.000 35.92601  ? 176 ALA A N   1 
ATOM   1075 C  CA  . ALA A 1 176 ? 23.21328 52.87438 -1.72443  1.000 35.07416  ? 176 ALA A CA  1 
ATOM   1076 C  C   . ALA A 1 176 ? 23.46868 54.19565 -1.00238  1.000 38.90582  ? 176 ALA A C   1 
ATOM   1077 O  O   . ALA A 1 176 ? 23.36672 54.30133 0.22405   1.000 43.64840  ? 176 ALA A O   1 
ATOM   1078 C  CB  . ALA A 1 176 ? 21.78904 52.84951 -2.26704  1.000 30.94576  ? 176 ALA A CB  1 
ATOM   1079 N  N   . SER A 1 177 ? 23.79884 55.21478 -1.79100  1.000 36.97008  ? 177 SER A N   1 
ATOM   1080 C  CA  . SER A 1 177 ? 23.98313 56.56061 -1.26799  1.000 39.50004  ? 177 SER A CA  1 
ATOM   1081 C  C   . SER A 1 177 ? 23.58128 57.54635 -2.35228  1.000 40.42215  ? 177 SER A C   1 
ATOM   1082 O  O   . SER A 1 177 ? 23.41407 57.17797 -3.52147  1.000 45.04258  ? 177 SER A O   1 
ATOM   1083 C  CB  . SER A 1 177 ? 25.42613 56.81612 -0.80943  1.000 34.69062  ? 177 SER A CB  1 
ATOM   1084 O  OG  . SER A 1 177 ? 26.32987 56.69296 -1.89158  1.000 41.63879  ? 177 SER A OG  1 
ATOM   1085 N  N   . PHE A 1 178 ? 23.43862 58.81081 -1.95497  1.000 34.92943  ? 178 PHE A N   1 
ATOM   1086 C  CA  . PHE A 1 178 ? 22.90839 59.81532 -2.86612  1.000 32.97056  ? 178 PHE A CA  1 
ATOM   1087 C  C   . PHE A 1 178 ? 23.16313 61.20777 -2.31053  1.000 35.04412  ? 178 PHE A C   1 
ATOM   1088 O  O   . PHE A 1 178 ? 23.18847 61.40414 -1.08818  1.000 34.71575  ? 178 PHE A O   1 
ATOM   1089 C  CB  . PHE A 1 178 ? 21.41721 59.61062 -3.04528  1.000 26.69235  ? 178 PHE A CB  1 
ATOM   1090 C  CG  . PHE A 1 178 ? 20.66221 59.74566 -1.77211  1.000 27.73089  ? 178 PHE A CG  1 
ATOM   1091 C  CD1 . PHE A 1 178 ? 20.21868 60.98823 -1.34340  1.000 34.39349  ? 178 PHE A CD1 1 
ATOM   1092 C  CD2 . PHE A 1 178 ? 20.41534 58.64429 -0.99170  1.000 26.51680  ? 178 PHE A CD2 1 
ATOM   1093 C  CE1 . PHE A 1 178 ? 19.53385 61.12575 -0.18118  1.000 33.17826  ? 178 PHE A CE1 1 
ATOM   1094 C  CE2 . PHE A 1 178 ? 19.72820 58.77881 0.18514   1.000 30.52629  ? 178 PHE A CE2 1 
ATOM   1095 C  CZ  . PHE A 1 178 ? 19.28419 60.02307 0.58882   1.000 33.07135  ? 178 PHE A CZ  1 
ATOM   1096 N  N   . GLN A 1 179 ? 23.28912 62.18085 -3.21447  1.000 30.57094  ? 179 GLN A N   1 
ATOM   1097 C  CA  . GLN A 1 179 ? 23.33647 63.57765 -2.79505  1.000 36.59973  ? 179 GLN A CA  1 
ATOM   1098 C  C   . GLN A 1 179 ? 21.93952 64.12650 -2.52653  1.000 33.06387  ? 179 GLN A C   1 
ATOM   1099 O  O   . GLN A 1 179 ? 20.98001 63.81168 -3.23331  1.000 35.76022  ? 179 GLN A O   1 
ATOM   1100 C  CB  . GLN A 1 179 ? 24.02394 64.43372 -3.85114  1.000 43.22456  ? 179 GLN A CB  1 
ATOM   1101 C  CG  . GLN A 1 179 ? 25.30573 63.83490 -4.37954  1.000 43.50861  ? 179 GLN A CG  1 
ATOM   1102 C  CD  . GLN A 1 179 ? 26.44099 63.99738 -3.40569  1.000 42.85962  ? 179 GLN A CD  1 
ATOM   1103 O  OE1 . GLN A 1 179 ? 26.29674 63.72743 -2.21057  1.000 43.13785  ? 179 GLN A OE1 1 
ATOM   1104 N  NE2 . GLN A 1 179 ? 27.57424 64.48157 -3.90114  1.000 38.52019  ? 179 GLN A NE2 1 
ATOM   1105 N  N   . TYR A 1 180 ? 21.83404 64.94612 -1.49041  1.000 34.04682  ? 180 TYR A N   1 
ATOM   1106 C  CA  . TYR A 1 180 ? 20.63650 65.71821 -1.20475  1.000 27.79568  ? 180 TYR A CA  1 
ATOM   1107 C  C   . TYR A 1 180 ? 21.05724 67.17462 -1.03984  1.000 29.15455  ? 180 TYR A C   1 
ATOM   1108 O  O   . TYR A 1 180 ? 22.18465 67.46116 -0.61833  1.000 30.43833  ? 180 TYR A O   1 
ATOM   1109 C  CB  . TYR A 1 180 ? 19.90864 65.18149 0.04904   1.000 22.50179  ? 180 TYR A CB  1 
ATOM   1110 C  CG  . TYR A 1 180 ? 20.68246 65.32872 1.34110   1.000 27.14404  ? 180 TYR A CG  1 
ATOM   1111 C  CD1 . TYR A 1 180 ? 21.53529 64.32600 1.79195   1.000 30.86470  ? 180 TYR A CD1 1 
ATOM   1112 C  CD2 . TYR A 1 180 ? 20.55784 66.47351 2.11200   1.000 22.53066  ? 180 TYR A CD2 1 
ATOM   1113 C  CE1 . TYR A 1 180 ? 22.24177 64.46515 2.97668   1.000 31.14649  ? 180 TYR A CE1 1 
ATOM   1114 C  CE2 . TYR A 1 180 ? 21.25570 66.62137 3.28268   1.000 31.88527  ? 180 TYR A CE2 1 
ATOM   1115 C  CZ  . TYR A 1 180 ? 22.09547 65.62019 3.71926   1.000 31.70476  ? 180 TYR A CZ  1 
ATOM   1116 O  OH  . TYR A 1 180 ? 22.78727 65.79958 4.90443   1.000 28.71404  ? 180 TYR A OH  1 
ATOM   1117 N  N   . ARG A 1 181 ? 20.16473 68.09665 -1.40593  1.000 27.84150  ? 181 ARG A N   1 
ATOM   1118 C  CA  . ARG A 1 181 ? 20.52871 69.51334 -1.42454  1.000 29.16378  ? 181 ARG A CA  1 
ATOM   1119 C  C   . ARG A 1 181 ? 20.79646 70.00905 -0.00918  1.000 34.61856  ? 181 ARG A C   1 
ATOM   1120 O  O   . ARG A 1 181 ? 20.07904 69.65389 0.92980   1.000 37.26371  ? 181 ARG A O   1 
ATOM   1121 C  CB  . ARG A 1 181 ? 19.42056 70.35342 -2.06878  1.000 26.11559  ? 181 ARG A CB  1 
ATOM   1122 C  CG  . ARG A 1 181 ? 19.51815 70.56468 -3.57251  1.000 27.54971  ? 181 ARG A CG  1 
ATOM   1123 C  CD  . ARG A 1 181 ? 18.24552 71.22324 -4.11623  1.000 32.21711  ? 181 ARG A CD  1 
ATOM   1124 N  NE  . ARG A 1 181 ? 17.09724 70.29386 -4.13279  1.000 40.76409  ? 181 ARG A NE  1 
ATOM   1125 C  CZ  . ARG A 1 181 ? 15.84421 70.62253 -4.46489  1.000 43.51141  ? 181 ARG A CZ  1 
ATOM   1126 N  NH1 . ARG A 1 181 ? 15.53903 71.86959 -4.80756  1.000 28.85832  ? 181 ARG A NH1 1 
ATOM   1127 N  NH2 . ARG A 1 181 ? 14.89096 69.69958 -4.44934  1.000 41.77319  ? 181 ARG A NH2 1 
ATOM   1128 N  N   . VAL A 1 182 ? 21.85188 70.81146 0.14514   1.000 34.59319  ? 182 VAL A N   1 
ATOM   1129 C  CA  . VAL A 1 182 ? 22.26361 71.34491 1.43984   1.000 30.37814  ? 182 VAL A CA  1 
ATOM   1130 C  C   . VAL A 1 182 ? 22.30287 72.86372 1.36589   1.000 34.16807  ? 182 VAL A C   1 
ATOM   1131 O  O   . VAL A 1 182 ? 22.29109 73.46463 0.28969   1.000 43.58931  ? 182 VAL A O   1 
ATOM   1132 C  CB  . VAL A 1 182 ? 23.63530 70.81560 1.91476   1.000 28.81977  ? 182 VAL A CB  1 
ATOM   1133 C  CG1 . VAL A 1 182 ? 23.53382 69.37197 2.40602   1.000 31.53523  ? 182 VAL A CG1 1 
ATOM   1134 C  CG2 . VAL A 1 182 ? 24.68072 70.96329 0.85275   1.000 27.36353  ? 182 VAL A CG2 1 
ATOM   1135 N  N   . GLY A 1 183 ? 22.37839 73.47755 2.54228   1.000 31.12081  ? 183 GLY A N   1 
ATOM   1136 C  CA  . GLY A 1 183 ? 22.34739 74.91607 2.65898   1.000 31.43990  ? 183 GLY A CA  1 
ATOM   1137 C  C   . GLY A 1 183 ? 21.00514 75.48386 2.22050   1.000 35.45031  ? 183 GLY A C   1 
ATOM   1138 O  O   . GLY A 1 183 ? 19.97461 74.79863 2.13812   1.000 37.18114  ? 183 GLY A O   1 
ATOM   1139 N  N   . ALA A 1 184 ? 21.03437 76.78363 1.94591   1.000 34.15661  ? 184 ALA A N   1 
ATOM   1140 C  CA  . ALA A 1 184 ? 19.84219 77.46351 1.46517   1.000 34.63152  ? 184 ALA A CA  1 
ATOM   1141 C  C   . ALA A 1 184 ? 19.23712 76.79211 0.23792   1.000 37.15522  ? 184 ALA A C   1 
ATOM   1142 O  O   . ALA A 1 184 ? 18.05057 76.99111 -0.03918  1.000 36.41137  ? 184 ALA A O   1 
ATOM   1143 C  CB  . ALA A 1 184 ? 20.17648 78.91272 1.14272   1.000 36.27174  ? 184 ALA A CB  1 
ATOM   1144 N  N   . PHE A 1 185 ? 20.02315 76.02441 -0.52005  1.000 42.23673  ? 185 PHE A N   1 
ATOM   1145 C  CA  . PHE A 1 185 ? 19.46315 75.33298 -1.67390  1.000 44.56005  ? 185 PHE A CA  1 
ATOM   1146 C  C   . PHE A 1 185 ? 18.49873 74.23413 -1.24925  1.000 50.01106  ? 185 PHE A C   1 
ATOM   1147 O  O   . PHE A 1 185 ? 17.62468 73.85342 -2.03526  1.000 60.92833  ? 185 PHE A O   1 
ATOM   1148 C  CB  . PHE A 1 185 ? 20.58279 74.76446 -2.56869  1.000 30.77370  ? 185 PHE A CB  1 
ATOM   1149 C  CG  . PHE A 1 185 ? 21.63381 75.77003 -2.92438  1.000 32.77533  ? 185 PHE A CG  1 
ATOM   1150 C  CD1 . PHE A 1 185 ? 21.48912 76.57146 -4.04706  1.000 36.96706  ? 185 PHE A CD1 1 
ATOM   1151 C  CD2 . PHE A 1 185 ? 22.76117 75.93102 -2.13706  1.000 40.21656  ? 185 PHE A CD2 1 
ATOM   1152 C  CE1 . PHE A 1 185 ? 22.45728 77.52523 -4.38510  1.000 42.18783  ? 185 PHE A CE1 1 
ATOM   1153 C  CE2 . PHE A 1 185 ? 23.73471 76.87856 -2.47050  1.000 51.10109  ? 185 PHE A CE2 1 
ATOM   1154 C  CZ  . PHE A 1 185 ? 23.58334 77.67561 -3.60300  1.000 44.27470  ? 185 PHE A CZ  1 
ATOM   1155 N  N   . GLY A 1 186 ? 18.61457 73.74277 -0.01969  1.000 44.07844  ? 186 GLY A N   1 
ATOM   1156 C  CA  . GLY A 1 186 ? 17.74587 72.68385 0.45322   1.000 42.87335  ? 186 GLY A CA  1 
ATOM   1157 C  C   . GLY A 1 186 ? 16.75146 73.11901 1.51526   1.000 41.13735  ? 186 GLY A C   1 
ATOM   1158 O  O   . GLY A 1 186 ? 15.78712 72.39131 1.80719   1.000 34.11880  ? 186 GLY A O   1 
ATOM   1159 N  N   . PHE A 1 187 ? 16.96053 74.31325 2.09550   1.000 33.35187  ? 187 PHE A N   1 
ATOM   1160 C  CA  . PHE A 1 187 ? 16.17197 74.68809 3.26010   1.000 31.26582  ? 187 PHE A CA  1 
ATOM   1161 C  C   . PHE A 1 187 ? 15.69204 76.12647 3.24346   1.000 40.05910  ? 187 PHE A C   1 
ATOM   1162 O  O   . PHE A 1 187 ? 15.13663 76.57582 4.25231   1.000 44.02169  ? 187 PHE A O   1 
ATOM   1163 C  CB  . PHE A 1 187 ? 16.96540 74.38973 4.54156   1.000 26.17975  ? 187 PHE A CB  1 
ATOM   1164 C  CG  . PHE A 1 187 ? 17.25792 72.93893 4.68551   1.000 28.34983  ? 187 PHE A CG  1 
ATOM   1165 C  CD1 . PHE A 1 187 ? 16.31510 72.08764 5.23019   1.000 23.73127  ? 187 PHE A CD1 1 
ATOM   1166 C  CD2 . PHE A 1 187 ? 18.42089 72.39916 4.15929   1.000 29.26355  ? 187 PHE A CD2 1 
ATOM   1167 C  CE1 . PHE A 1 187 ? 16.56317 70.74631 5.29516   1.000 29.57629  ? 187 PHE A CE1 1 
ATOM   1168 C  CE2 . PHE A 1 187 ? 18.67436 71.04626 4.22786   1.000 23.19381  ? 187 PHE A CE2 1 
ATOM   1169 C  CZ  . PHE A 1 187 ? 17.75555 70.22676 4.77756   1.000 24.55516  ? 187 PHE A CZ  1 
ATOM   1170 N  N   . LEU A 1 188 ? 15.85503 76.85239 2.13734   1.000 37.76429  ? 188 LEU A N   1 
ATOM   1171 C  CA  . LEU A 1 188 ? 15.23154 78.16454 2.03983   1.000 33.15886  ? 188 LEU A CA  1 
ATOM   1172 C  C   . LEU A 1 188 ? 13.73785 78.01308 2.24069   1.000 35.14621  ? 188 LEU A C   1 
ATOM   1173 O  O   . LEU A 1 188 ? 13.09081 77.26203 1.51033   1.000 37.92450  ? 188 LEU A O   1 
ATOM   1174 C  CB  . LEU A 1 188 ? 15.51533 78.81289 0.69141   1.000 32.45692  ? 188 LEU A CB  1 
ATOM   1175 C  CG  . LEU A 1 188 ? 14.91255 80.22100 0.56831   1.000 38.13008  ? 188 LEU A CG  1 
ATOM   1176 C  CD1 . LEU A 1 188 ? 15.32813 81.09710 1.76241   1.000 37.21435  ? 188 LEU A CD1 1 
ATOM   1177 C  CD2 . LEU A 1 188 ? 15.27150 80.89044 -0.77295  1.000 36.19038  ? 188 LEU A CD2 1 
ATOM   1178 N  N   . HIS A 1 189 ? 13.19739 78.71739 3.24002   1.000 42.64473  ? 189 HIS A N   1 
ATOM   1179 C  CA  . HIS A 1 189 ? 11.82191 78.53629 3.71773   1.000 41.32985  ? 189 HIS A CA  1 
ATOM   1180 C  C   . HIS A 1 189 ? 11.17455 79.91799 3.76778   1.000 46.57138  ? 189 HIS A C   1 
ATOM   1181 O  O   . HIS A 1 189 ? 11.44759 80.70386 4.67969   1.000 52.01716  ? 189 HIS A O   1 
ATOM   1182 C  CB  . HIS A 1 189 ? 11.83197 77.83667 5.08245   1.000 38.40196  ? 189 HIS A CB  1 
ATOM   1183 C  CG  . HIS A 1 189 ? 10.51365 77.81861 5.80380   1.000 46.48350  ? 189 HIS A CG  1 
ATOM   1184 N  ND1 . HIS A 1 189 ? 9.50592  76.92073 5.50724   1.000 38.97839  ? 189 HIS A ND1 1 
ATOM   1185 C  CD2 . HIS A 1 189 ? 10.06286 78.55773 6.85449   1.000 45.09787  ? 189 HIS A CD2 1 
ATOM   1186 C  CE1 . HIS A 1 189 ? 8.48688  77.12317 6.33071   1.000 41.74239  ? 189 HIS A CE1 1 
ATOM   1187 N  NE2 . HIS A 1 189 ? 8.79540  78.11360 7.15375   1.000 34.76491  ? 189 HIS A NE2 1 
ATOM   1188 N  N   . LEU A 1 190 ? 10.33261 80.22897 2.77505   1.000 39.18944  ? 190 LEU A N   1 
ATOM   1189 C  CA  . LEU A 1 190 ? 9.67318  81.52290 2.72843   1.000 37.26811  ? 190 LEU A CA  1 
ATOM   1190 C  C   . LEU A 1 190 ? 8.15637  81.45278 2.63995   1.000 39.60129  ? 190 LEU A C   1 
ATOM   1191 O  O   . LEU A 1 190 ? 7.51295  82.50537 2.68219   1.000 47.24120  ? 190 LEU A O   1 
ATOM   1192 C  CB  . LEU A 1 190 ? 10.19665 82.34184 1.54541   1.000 44.78182  ? 190 LEU A CB  1 
ATOM   1193 C  CG  . LEU A 1 190 ? 11.70781 82.56248 1.47682   1.000 49.45515  ? 190 LEU A CG  1 
ATOM   1194 C  CD1 . LEU A 1 190 ? 12.10355 83.26130 0.16688   1.000 43.22229  ? 190 LEU A CD1 1 
ATOM   1195 C  CD2 . LEU A 1 190 ? 12.18333 83.35535 2.68180   1.000 50.94075  ? 190 LEU A CD2 1 
ATOM   1196 N  N   . ALA A 1 191 ? 7.56754  80.26114 2.53936   1.000 44.18830  ? 191 ALA A N   1 
ATOM   1197 C  CA  . ALA A 1 191 ? 6.12964  80.13976 2.28409   1.000 37.64612  ? 191 ALA A CA  1 
ATOM   1198 C  C   . ALA A 1 191 ? 5.23456  80.95477 3.21401   1.000 42.65936  ? 191 ALA A C   1 
ATOM   1199 O  O   . ALA A 1 191 ? 4.28335  81.57494 2.71227   1.000 56.41179  ? 191 ALA A O   1 
ATOM   1200 C  CB  . ALA A 1 191 ? 5.71468  78.66449 2.32880   1.000 36.06400  ? 191 ALA A CB  1 
ATOM   1201 N  N   . PRO A 1 192 ? 5.44375  80.98949 4.53183   1.000 45.02951  ? 192 PRO A N   1 
ATOM   1202 C  CA  . PRO A 1 192 ? 4.58569  81.83904 5.37014   1.000 41.62642  ? 192 PRO A CA  1 
ATOM   1203 C  C   . PRO A 1 192 ? 4.54780  83.29364 4.93299   1.000 55.34864  ? 192 PRO A C   1 
ATOM   1204 O  O   . PRO A 1 192 ? 3.54061  83.97750 5.15563   1.000 56.27234  ? 192 PRO A O   1 
ATOM   1205 C  CB  . PRO A 1 192 ? 5.21530  81.69053 6.75796   1.000 41.07517  ? 192 PRO A CB  1 
ATOM   1206 C  CG  . PRO A 1 192 ? 5.87647  80.35760 6.72942   1.000 40.50838  ? 192 PRO A CG  1 
ATOM   1207 C  CD  . PRO A 1 192 ? 6.34721  80.14384 5.34354   1.000 44.96637  ? 192 PRO A CD  1 
ATOM   1208 N  N   . GLU A 1 193 ? 5.60897  83.78558 4.30375   1.000 55.95542  ? 193 GLU A N   1 
ATOM   1209 C  CA  . GLU A 1 193 ? 5.70739  85.19528 3.95908   1.000 56.98813  ? 193 GLU A CA  1 
ATOM   1210 C  C   . GLU A 1 193 ? 4.99368  85.56278 2.66425   1.000 55.64840  ? 193 GLU A C   1 
ATOM   1211 O  O   . GLU A 1 193 ? 4.93755  86.75213 2.33776   1.000 57.96304  ? 193 GLU A O   1 
ATOM   1212 C  CB  . GLU A 1 193 ? 7.17951  85.60242 3.86502   1.000 62.57153  ? 193 GLU A CB  1 
ATOM   1213 C  CG  . GLU A 1 193 ? 7.41566  87.06444 4.17986   1.000 74.57579  ? 193 GLU A CG  1 
ATOM   1214 C  CD  . GLU A 1 193 ? 7.47724  87.34232 5.66843   1.000 81.33455  ? 193 GLU A CD  1 
ATOM   1215 O  OE1 . GLU A 1 193 ? 7.32894  86.38637 6.47528   1.000 79.71043  ? 193 GLU A OE1 1 
ATOM   1216 O  OE2 . GLU A 1 193 ? 7.63400  88.53187 6.01814   1.000 82.38672  ? 193 GLU A OE2 1 
ATOM   1217 N  N   . MET A 1 194 ? 4.44885  84.58898 1.92026   1.000 50.27561  ? 194 MET A N   1 
ATOM   1218 C  CA  . MET A 1 194 ? 3.80430  84.85659 0.63222   1.000 52.03860  ? 194 MET A CA  1 
ATOM   1219 C  C   . MET A 1 194 ? 2.34096  84.42829 0.66227   1.000 50.77522  ? 194 MET A C   1 
ATOM   1220 O  O   . MET A 1 194 ? 1.93676  83.70256 1.58046   1.000 50.92950  ? 194 MET A O   1 
ATOM   1221 C  CB  . MET A 1 194 ? 4.54732  84.12234 -0.48850  1.000 52.76639  ? 194 MET A CB  1 
ATOM   1222 C  CG  . MET A 1 194 ? 6.02617  84.40132 -0.48912  1.000 57.23649  ? 194 MET A CG  1 
ATOM   1223 S  SD  . MET A 1 194 ? 7.00615  83.37940 -1.59096  1.000 53.33346  ? 194 MET A SD  1 
ATOM   1224 C  CE  . MET A 1 194 ? 6.80024  81.74391 -0.88218  1.000 59.28412  ? 194 MET A CE  1 
ATOM   1225 N  N   . PRO A 1 195 ? 1.51531  84.84231 -0.30403  1.000 56.78494  ? 195 PRO A N   1 
ATOM   1226 C  CA  . PRO A 1 195 ? 0.16783  84.27072 -0.39712  1.000 51.52129  ? 195 PRO A CA  1 
ATOM   1227 C  C   . PRO A 1 195 ? 0.24326  82.78951 -0.72204  1.000 48.36758  ? 195 PRO A C   1 
ATOM   1228 O  O   . PRO A 1 195 ? 1.26461  82.27661 -1.17960  1.000 61.10113  ? 195 PRO A O   1 
ATOM   1229 C  CB  . PRO A 1 195 ? -0.48817 85.06352 -1.53456  1.000 53.18404  ? 195 PRO A CB  1 
ATOM   1230 C  CG  . PRO A 1 195 ? 0.31438  86.30569 -1.64045  1.000 54.37024  ? 195 PRO A CG  1 
ATOM   1231 C  CD  . PRO A 1 195 ? 1.71194  85.92570 -1.28432  1.000 59.75105  ? 195 PRO A CD  1 
ATOM   1232 N  N   . SER A 1 196 ? -0.86935 82.09689 -0.47756  1.000 52.40956  ? 196 SER A N   1 
ATOM   1233 C  CA  . SER A 1 196 ? -0.86855 80.64130 -0.58505  1.000 51.12102  ? 196 SER A CA  1 
ATOM   1234 C  C   . SER A 1 196 ? -0.70068 80.17352 -2.02654  1.000 51.50354  ? 196 SER A C   1 
ATOM   1235 O  O   . SER A 1 196 ? -0.18337 79.07303 -2.25591  1.000 45.79013  ? 196 SER A O   1 
ATOM   1236 C  CB  . SER A 1 196 ? -2.14955 80.07606 0.01638   1.000 58.85631  ? 196 SER A CB  1 
ATOM   1237 O  OG  . SER A 1 196 ? -3.17026 79.99712 -0.96528  1.000 69.27509  ? 196 SER A OG  1 
ATOM   1238 N  N   . GLU A 1 197 ? -1.12340 80.99450 -2.99972  1.000 56.65654  ? 197 GLU A N   1 
ATOM   1239 C  CA  . GLU A 1 197 ? -0.86968 80.71207 -4.41014  1.000 48.50790  ? 197 GLU A CA  1 
ATOM   1240 C  C   . GLU A 1 197 ? 0.59334  80.36667 -4.65382  1.000 55.39969  ? 197 GLU A C   1 
ATOM   1241 O  O   . GLU A 1 197 ? 0.89791  79.51446 -5.49614  1.000 57.80337  ? 197 GLU A O   1 
ATOM   1242 C  CB  . GLU A 1 197 ? -1.30560 81.91656 -5.26554  1.000 51.18608  ? 197 GLU A CB  1 
ATOM   1243 C  CG  . GLU A 1 197 ? -0.74055 81.95593 -6.67762  1.000 66.66166  ? 197 GLU A CG  1 
ATOM   1244 C  CD  . GLU A 1 197 ? -1.16031 83.19328 -7.48447  1.000 71.56111  ? 197 GLU A CD  1 
ATOM   1245 O  OE1 . GLU A 1 197 ? -1.21609 83.10433 -8.74599  1.000 63.86479  ? 197 GLU A OE1 1 
ATOM   1246 O  OE2 . GLU A 1 197 ? -1.43103 84.24415 -6.85193  1.000 79.58527  ? 197 GLU A OE2 1 
ATOM   1247 N  N   . PHE A 1 198 ? 1.50696  80.97357 -3.89120  1.000 55.52290  ? 198 PHE A N   1 
ATOM   1248 C  CA  . PHE A 1 198 ? 2.93986  80.83072 -4.10520  1.000 43.86974  ? 198 PHE A CA  1 
ATOM   1249 C  C   . PHE A 1 198 ? 3.58067  79.83288 -3.15383  1.000 41.38888  ? 198 PHE A C   1 
ATOM   1250 O  O   . PHE A 1 198 ? 4.80090  79.87656 -2.95915  1.000 42.64094  ? 198 PHE A O   1 
ATOM   1251 C  CB  . PHE A 1 198 ? 3.63944  82.18156 -3.97433  1.000 44.98902  ? 198 PHE A CB  1 
ATOM   1252 C  CG  . PHE A 1 198 ? 3.15028  83.22840 -4.94569  1.000 47.62434  ? 198 PHE A CG  1 
ATOM   1253 C  CD1 . PHE A 1 198 ? 2.06618  84.02146 -4.63824  1.000 49.78101  ? 198 PHE A CD1 1 
ATOM   1254 C  CD2 . PHE A 1 198 ? 3.78866  83.43443 -6.14913  1.000 51.67919  ? 198 PHE A CD2 1 
ATOM   1255 C  CE1 . PHE A 1 198 ? 1.61650  84.98401 -5.52142  1.000 52.38294  ? 198 PHE A CE1 1 
ATOM   1256 C  CE2 . PHE A 1 198 ? 3.33955  84.40474 -7.03525  1.000 50.81966  ? 198 PHE A CE2 1 
ATOM   1257 C  CZ  . PHE A 1 198 ? 2.25931  85.17819 -6.71321  1.000 52.87676  ? 198 PHE A CZ  1 
ATOM   1258 N  N   . ALA A 1 199 ? 2.79756  78.89548 -2.61064  1.000 43.08657  ? 199 ALA A N   1 
ATOM   1259 C  CA  . ALA A 1 199 ? 3.30113  78.01386 -1.55770  1.000 43.87399  ? 199 ALA A CA  1 
ATOM   1260 C  C   . ALA A 1 199 ? 4.51496  77.20426 -2.00398  1.000 45.57268  ? 199 ALA A C   1 
ATOM   1261 O  O   . ALA A 1 199 ? 5.43709  76.97519 -1.21503  1.000 57.35809  ? 199 ALA A O   1 
ATOM   1262 C  CB  . ALA A 1 199 ? 2.19059  77.08416 -1.07734  1.000 38.87373  ? 199 ALA A CB  1 
ATOM   1263 N  N   . GLU A 1 200 ? 4.53633  76.75107 -3.24642  1.000 46.32266  ? 200 GLU A N   1 
ATOM   1264 C  CA  . GLU A 1 200 ? 5.61690  75.87194 -3.68368  1.000 49.51370  ? 200 GLU A CA  1 
ATOM   1265 C  C   . GLU A 1 200 ? 6.86821  76.62426 -4.13537  1.000 51.26886  ? 200 GLU A C   1 
ATOM   1266 O  O   . GLU A 1 200 ? 7.75777  75.98696 -4.71426  1.000 41.07751  ? 200 GLU A O   1 
ATOM   1267 C  CB  . GLU A 1 200 ? 5.14231  74.95858 -4.82275  1.000 35.89830  ? 200 GLU A CB  1 
ATOM   1268 C  CG  . GLU A 1 200 ? 4.24909  73.81359 -4.40979  1.000 35.59102  ? 200 GLU A CG  1 
ATOM   1269 C  CD  . GLU A 1 200 ? 4.83045  73.00128 -3.26491  1.000 52.18182  ? 200 GLU A CD  1 
ATOM   1270 O  OE1 . GLU A 1 200 ? 6.07228  72.91469 -3.15279  1.000 55.10915  ? 200 GLU A OE1 1 
ATOM   1271 O  OE2 . GLU A 1 200 ? 4.04493  72.42791 -2.48300  1.000 54.43181  ? 200 GLU A OE2 1 
ATOM   1272 N  N   . GLU A 1 201 ? 6.95210  77.94448 -3.89782  1.000 50.15785  ? 201 GLU A N   1 
ATOM   1273 C  CA  . GLU A 1 201 ? 8.11588  78.71264 -4.34260  1.000 44.50283  ? 201 GLU A CA  1 
ATOM   1274 C  C   . GLU A 1 201 ? 9.34713  78.38673 -3.50814  1.000 45.99104  ? 201 GLU A C   1 
ATOM   1275 O  O   . GLU A 1 201 ? 10.45779 78.27468 -4.04043  1.000 48.04380  ? 201 GLU A O   1 
ATOM   1276 C  CB  . GLU A 1 201 ? 7.82354  80.21453 -4.28267  1.000 41.37631  ? 201 GLU A CB  1 
ATOM   1277 C  CG  . GLU A 1 201 ? 6.96558  80.73607 -5.42510  1.000 50.01131  ? 201 GLU A CG  1 
ATOM   1278 C  CD  . GLU A 1 201 ? 7.67618  80.71587 -6.77885  1.000 51.19616  ? 201 GLU A CD  1 
ATOM   1279 O  OE1 . GLU A 1 201 ? 6.97761  80.58708 -7.80512  1.000 49.75984  ? 201 GLU A OE1 1 
ATOM   1280 O  OE2 . GLU A 1 201 ? 8.92101  80.84684 -6.82031  1.000 48.16291  ? 201 GLU A OE2 1 
ATOM   1281 N  N   . ALA A 1 202 ? 9.17306  78.25546 -2.20305  1.000 47.52082  ? 202 ALA A N   1 
ATOM   1282 C  CA  . ALA A 1 202 ? 10.24204 77.91276 -1.27252  1.000 44.96395  ? 202 ALA A CA  1 
ATOM   1283 C  C   . ALA A 1 202 ? 9.58359  77.32727 -0.03752  1.000 44.23492  ? 202 ALA A C   1 
ATOM   1284 O  O   . ALA A 1 202 ? 9.48795  78.00138 0.99248   1.000 43.84217  ? 202 ALA A O   1 
ATOM   1285 C  CB  . ALA A 1 202 ? 11.09095 79.13036 -0.89749  1.000 39.82092  ? 202 ALA A CB  1 
ATOM   1286 N  N   . PRO A 1 203 ? 9.09391  76.09987 -0.11437  1.000 45.04391  ? 203 PRO A N   1 
ATOM   1287 C  CA  . PRO A 1 203 ? 8.34556  75.52710 1.00987   1.000 39.48233  ? 203 PRO A CA  1 
ATOM   1288 C  C   . PRO A 1 203 ? 9.25733  75.19655 2.17740   1.000 40.08030  ? 203 PRO A C   1 
ATOM   1289 O  O   . PRO A 1 203 ? 8.84736  75.21701 3.34652   1.000 39.32182  ? 203 PRO A O   1 
ATOM   1290 C  CB  . PRO A 1 203 ? 7.74245  74.26123 0.40415   1.000 40.20565  ? 203 PRO A CB  1 
ATOM   1291 C  CG  . PRO A 1 203 ? 8.75451  73.84464 -0.63750  1.000 35.38277  ? 203 PRO A CG  1 
ATOM   1292 C  CD  . PRO A 1 203 ? 9.35928  75.11273 -1.17901  1.000 40.00202  ? 203 PRO A CD  1 
ATOM   1293 N  N   . GLY A 1 204 ? 10.51068 74.90429 1.85237   1.000 34.92074  ? 204 GLY A N   1 
ATOM   1294 C  CA  . GLY A 1 204 ? 11.49441 74.48269 2.82346   1.000 28.32365  ? 204 GLY A CA  1 
ATOM   1295 C  C   . GLY A 1 204 ? 11.58327 72.97240 2.90844   1.000 26.09709  ? 204 GLY A C   1 
ATOM   1296 O  O   . GLY A 1 204 ? 10.70486 72.23011 2.46095   1.000 40.59323  ? 204 GLY A O   1 
ATOM   1297 N  N   . ASN A 1 205 ? 12.68077 72.52827 3.50026   1.000 25.15591  ? 205 ASN A N   1 
ATOM   1298 C  CA  . ASN A 1 205 ? 12.97165 71.12495 3.74115   1.000 23.95983  ? 205 ASN A CA  1 
ATOM   1299 C  C   . ASN A 1 205 ? 13.16608 70.34333 2.43589   1.000 39.46226  ? 205 ASN A C   1 
ATOM   1300 O  O   . ASN A 1 205 ? 13.16559 69.10323 2.45375   1.000 46.98098  ? 205 ASN A O   1 
ATOM   1301 C  CB  . ASN A 1 205 ? 11.87074 70.47676 4.61291   1.000 31.71591  ? 205 ASN A CB  1 
ATOM   1302 C  CG  . ASN A 1 205 ? 11.80782 71.05370 6.05643   1.000 35.45661  ? 205 ASN A CG  1 
ATOM   1303 O  OD1 . ASN A 1 205 ? 12.82053 71.21863 6.72418   1.000 38.63813  ? 205 ASN A OD1 1 
ATOM   1304 N  ND2 . ASN A 1 205 ? 10.60410 71.34777 6.52209   1.000 39.42189  ? 205 ASN A ND2 1 
ATOM   1305 N  N   . VAL A 1 206 ? 13.34851 71.02319 1.29557   1.000 26.46628  ? 206 VAL A N   1 
ATOM   1306 C  CA  . VAL A 1 206 ? 13.35346 70.29184 0.02965   1.000 37.41575  ? 206 VAL A CA  1 
ATOM   1307 C  C   . VAL A 1 206 ? 14.52286 69.31621 -0.01846  1.000 44.21052  ? 206 VAL A C   1 
ATOM   1308 O  O   . VAL A 1 206 ? 14.46356 68.30630 -0.74302  1.000 39.97888  ? 206 VAL A O   1 
ATOM   1309 C  CB  . VAL A 1 206 ? 13.35585 71.22984 -1.21808  1.000 39.40007  ? 206 VAL A CB  1 
ATOM   1310 C  CG1 . VAL A 1 206 ? 12.06450 72.04720 -1.31245  1.000 26.93558  ? 206 VAL A CG1 1 
ATOM   1311 C  CG2 . VAL A 1 206 ? 14.60429 72.11980 -1.29897  1.000 26.87534  ? 206 VAL A CG2 1 
ATOM   1312 N  N   . GLY A 1 207 ? 15.57347 69.57178 0.77139   1.000 36.81671  ? 207 GLY A N   1 
ATOM   1313 C  CA  . GLY A 1 207 ? 16.62613 68.58209 0.92783   1.000 33.09399  ? 207 GLY A CA  1 
ATOM   1314 C  C   . GLY A 1 207 ? 16.14994 67.30275 1.58974   1.000 31.97073  ? 207 GLY A C   1 
ATOM   1315 O  O   . GLY A 1 207 ? 16.64790 66.21703 1.26979   1.000 36.50451  ? 207 GLY A O   1 
ATOM   1316 N  N   . LEU A 1 208 ? 15.19636 67.40470 2.52901   1.000 23.10807  ? 208 LEU A N   1 
ATOM   1317 C  CA  . LEU A 1 208 ? 14.54408 66.19810 3.03314   1.000 27.72395  ? 208 LEU A CA  1 
ATOM   1318 C  C   . LEU A 1 208 ? 13.68689 65.54110 1.94856   1.000 35.72206  ? 208 LEU A C   1 
ATOM   1319 O  O   . LEU A 1 208 ? 13.61348 64.30676 1.87181   1.000 39.40104  ? 208 LEU A O   1 
ATOM   1320 C  CB  . LEU A 1 208 ? 13.69408 66.52409 4.26324   1.000 25.65873  ? 208 LEU A CB  1 
ATOM   1321 C  CG  . LEU A 1 208 ? 14.41406 67.28419 5.38262   1.000 34.88203  ? 208 LEU A CG  1 
ATOM   1322 C  CD1 . LEU A 1 208 ? 13.53686 67.41103 6.63326   1.000 29.85290  ? 208 LEU A CD1 1 
ATOM   1323 C  CD2 . LEU A 1 208 ? 15.75848 66.62012 5.72124   1.000 30.28715  ? 208 LEU A CD2 1 
ATOM   1324 N  N   . TRP A 1 209 ? 13.02908 66.34457 1.10155   1.000 25.54239  ? 209 TRP A N   1 
ATOM   1325 C  CA  . TRP A 1 209 ? 12.24523 65.76145 0.01865   1.000 33.18054  ? 209 TRP A CA  1 
ATOM   1326 C  C   . TRP A 1 209 ? 13.14249 65.02888 -0.97627  1.000 38.30469  ? 209 TRP A C   1 
ATOM   1327 O  O   . TRP A 1 209 ? 12.75774 63.97653 -1.51142  1.000 30.56842  ? 209 TRP A O   1 
ATOM   1328 C  CB  . TRP A 1 209 ? 11.42961 66.83850 -0.68894  1.000 34.81376  ? 209 TRP A CB  1 
ATOM   1329 C  CG  . TRP A 1 209 ? 10.28982 67.39687 0.13292   1.000 42.73332  ? 209 TRP A CG  1 
ATOM   1330 C  CD1 . TRP A 1 209 ? 10.29527 68.55396 0.87220   1.000 42.59577  ? 209 TRP A CD1 1 
ATOM   1331 C  CD2 . TRP A 1 209 ? 8.97493  66.84091 0.27511   1.000 40.40426  ? 209 TRP A CD2 1 
ATOM   1332 N  NE1 . TRP A 1 209 ? 9.06616  68.74578 1.46912   1.000 32.31800  ? 209 TRP A NE1 1 
ATOM   1333 C  CE2 . TRP A 1 209 ? 8.24181  67.70674 1.12550   1.000 35.77188  ? 209 TRP A CE2 1 
ATOM   1334 C  CE3 . TRP A 1 209 ? 8.34645  65.69636 -0.22952  1.000 36.98363  ? 209 TRP A CE3 1 
ATOM   1335 C  CZ2 . TRP A 1 209 ? 6.91208  67.45976 1.47894   1.000 31.17121  ? 209 TRP A CZ2 1 
ATOM   1336 C  CZ3 . TRP A 1 209 ? 7.03279  65.45165 0.11822   1.000 35.56416  ? 209 TRP A CZ3 1 
ATOM   1337 C  CH2 . TRP A 1 209 ? 6.32572  66.33175 0.96476   1.000 35.23395  ? 209 TRP A CH2 1 
ATOM   1338 N  N   . ASP A 1 210 ? 14.34229 65.56827 -1.22743  1.000 37.58209  ? 210 ASP A N   1 
ATOM   1339 C  CA  . ASP A 1 210 ? 15.31638 64.87237 -2.06489  1.000 38.53955  ? 210 ASP A CA  1 
ATOM   1340 C  C   . ASP A 1 210 ? 15.57144 63.46458 -1.53999  1.000 40.91255  ? 210 ASP A C   1 
ATOM   1341 O  O   . ASP A 1 210 ? 15.47961 62.48114 -2.28704  1.000 40.57729  ? 210 ASP A O   1 
ATOM   1342 C  CB  . ASP A 1 210 ? 16.63248 65.65977 -2.12134  1.000 33.27722  ? 210 ASP A CB  1 
ATOM   1343 C  CG  . ASP A 1 210 ? 16.49251 67.01179 -2.81922  1.000 34.16072  ? 210 ASP A CG  1 
ATOM   1344 O  OD1 . ASP A 1 210 ? 15.53785 67.22083 -3.60683  1.000 29.70572  ? 210 ASP A OD1 1 
ATOM   1345 O  OD2 . ASP A 1 210 ? 17.36956 67.86695 -2.58966  1.000 36.34071  ? 210 ASP A OD2 1 
ATOM   1346 N  N   . GLN A 1 211 ? 15.89381 63.35340 -0.24774  1.000 41.10548  ? 211 GLN A N   1 
ATOM   1347 C  CA  . GLN A 1 211 ? 16.14009 62.04541 0.35383   1.000 38.89700  ? 211 GLN A CA  1 
ATOM   1348 C  C   . GLN A 1 211 ? 14.93184 61.14332 0.18843   1.000 36.07017  ? 211 GLN A C   1 
ATOM   1349 O  O   . GLN A 1 211 ? 15.05837 59.98456 -0.22335  1.000 38.60091  ? 211 GLN A O   1 
ATOM   1350 C  CB  . GLN A 1 211 ? 16.49524 62.19934 1.83603   1.000 31.28127  ? 211 GLN A CB  1 
ATOM   1351 C  CG  . GLN A 1 211 ? 17.49748 63.29293 2.10227   1.000 30.98991  ? 211 GLN A CG  1 
ATOM   1352 C  CD  . GLN A 1 211 ? 17.67787 63.58706 3.58155   1.000 40.24319  ? 211 GLN A CD  1 
ATOM   1353 O  OE1 . GLN A 1 211 ? 16.81380 63.25967 4.40138   1.000 42.02235  ? 211 GLN A OE1 1 
ATOM   1354 N  NE2 . GLN A 1 211 ? 18.80101 64.23239 3.93054   1.000 35.46122  ? 211 GLN A NE2 1 
ATOM   1355 N  N   . ALA A 1 212 ? 13.74597 61.66641 0.49744   1.000 29.80573  ? 212 ALA A N   1 
ATOM   1356 C  CA  . ALA A 1 212 ? 12.53403 60.88001 0.33065   1.000 30.91213  ? 212 ALA A CA  1 
ATOM   1357 C  C   . ALA A 1 212 ? 12.44093 60.34355 -1.08802  1.000 32.72598  ? 212 ALA A C   1 
ATOM   1358 O  O   . ALA A 1 212 ? 12.21552 59.14830 -1.29631  1.000 36.52396  ? 212 ALA A O   1 
ATOM   1359 C  CB  . ALA A 1 212 ? 11.30440 61.71863 0.68437   1.000 32.22167  ? 212 ALA A CB  1 
ATOM   1360 N  N   . LEU A 1 213 ? 12.67305 61.20764 -2.07752  1.000 32.40549  ? 213 LEU A N   1 
ATOM   1361 C  CA  . LEU A 1 213 ? 12.57387 60.77732 -3.47100  1.000 35.02963  ? 213 LEU A CA  1 
ATOM   1362 C  C   . LEU A 1 213 ? 13.63713 59.74031 -3.81297  1.000 37.87652  ? 213 LEU A C   1 
ATOM   1363 O  O   . LEU A 1 213 ? 13.35139 58.74998 -4.50082  1.000 37.56995  ? 213 LEU A O   1 
ATOM   1364 C  CB  . LEU A 1 213 ? 12.68101 61.98055 -4.40944  1.000 34.20173  ? 213 LEU A CB  1 
ATOM   1365 C  CG  . LEU A 1 213 ? 12.42032 61.67937 -5.88616  1.000 38.58710  ? 213 LEU A CG  1 
ATOM   1366 C  CD1 . LEU A 1 213 ? 10.93251 61.40762 -6.13201  1.000 44.63180  ? 213 LEU A CD1 1 
ATOM   1367 C  CD2 . LEU A 1 213 ? 12.93615 62.80782 -6.78750  1.000 37.63901  ? 213 LEU A CD2 1 
ATOM   1368 N  N   . ALA A 1 214 ? 14.86925 59.94501 -3.33958  1.000 36.92848  ? 214 ALA A N   1 
ATOM   1369 C  CA  . ALA A 1 214 ? 15.91912 58.96128 -3.59794  1.000 37.43673  ? 214 ALA A CA  1 
ATOM   1370 C  C   . ALA A 1 214 ? 15.61851 57.64386 -2.89175  1.000 34.37685  ? 214 ALA A C   1 
ATOM   1371 O  O   . ALA A 1 214 ? 15.89460 56.56490 -3.42735  1.000 34.00179  ? 214 ALA A O   1 
ATOM   1372 C  CB  . ALA A 1 214 ? 17.28717 59.51284 -3.16871  1.000 29.22556  ? 214 ALA A CB  1 
ATOM   1373 N  N   . ILE A 1 215 ? 15.04475 57.70545 -1.69238  1.000 36.71086  ? 215 ILE A N   1 
ATOM   1374 C  CA  . ILE A 1 215 ? 14.67917 56.47179 -1.01429  1.000 36.35905  ? 215 ILE A CA  1 
ATOM   1375 C  C   . ILE A 1 215 ? 13.55703 55.77797 -1.77201  1.000 35.40000  ? 215 ILE A C   1 
ATOM   1376 O  O   . ILE A 1 215 ? 13.60377 54.56593 -2.00493  1.000 40.80447  ? 215 ILE A O   1 
ATOM   1377 C  CB  . ILE A 1 215 ? 14.31433 56.74585 0.45625   1.000 31.36458  ? 215 ILE A CB  1 
ATOM   1378 C  CG1 . ILE A 1 215 ? 15.57428 57.10915 1.24562   1.000 27.40562  ? 215 ILE A CG1 1 
ATOM   1379 C  CG2 . ILE A 1 215 ? 13.63947 55.53992 1.08559   1.000 25.44256  ? 215 ILE A CG2 1 
ATOM   1380 C  CD1 . ILE A 1 215 ? 15.29217 57.58521 2.72154   1.000 24.55665  ? 215 ILE A CD1 1 
ATOM   1381 N  N   . ARG A 1 216 ? 12.55065 56.53440 -2.20532  1.000 33.64200  ? 216 ARG A N   1 
ATOM   1382 C  CA  . ARG A 1 216 ? 11.48330 55.90704 -2.97243  1.000 41.77429  ? 216 ARG A CA  1 
ATOM   1383 C  C   . ARG A 1 216 ? 12.03730 55.28888 -4.24654  1.000 45.77461  ? 216 ARG A C   1 
ATOM   1384 O  O   . ARG A 1 216 ? 11.62117 54.19314 -4.64770  1.000 40.39447  ? 216 ARG A O   1 
ATOM   1385 C  CB  . ARG A 1 216 ? 10.38378 56.91310 -3.28919  1.000 43.20463  ? 216 ARG A CB  1 
ATOM   1386 C  CG  . ARG A 1 216 ? 9.09816  56.27222 -3.77374  1.000 60.92376  ? 216 ARG A CG  1 
ATOM   1387 C  CD  . ARG A 1 216 ? 7.95952  57.29632 -3.75688  1.000 82.64587  ? 216 ARG A CD  1 
ATOM   1388 N  NE  . ARG A 1 216 ? 7.92731  58.08783 -2.51955  1.000 89.94216  ? 216 ARG A NE  1 
ATOM   1389 C  CZ  . ARG A 1 216 ? 7.02459  57.94963 -1.54516  1.000 84.83872  ? 216 ARG A CZ  1 
ATOM   1390 N  NH1 . ARG A 1 216 ? 6.04847  57.04739 -1.65127  1.000 77.58258  ? 216 ARG A NH1 1 
ATOM   1391 N  NH2 . ARG A 1 216 ? 7.09422  58.72753 -0.46437  1.000 76.52331  ? 216 ARG A NH2 1 
ATOM   1392 N  N   . TRP A 1 217 ? 13.02021 55.95398 -4.86250  1.000 43.89711  ? 217 TRP A N   1 
ATOM   1393 C  CA  . TRP A 1 217 ? 13.61536 55.42220 -6.07801  1.000 36.46825  ? 217 TRP A CA  1 
ATOM   1394 C  C   . TRP A 1 217 ? 14.22606 54.05795 -5.82568  1.000 46.20907  ? 217 TRP A C   1 
ATOM   1395 O  O   . TRP A 1 217 ? 14.02933 53.12183 -6.61520  1.000 49.76869  ? 217 TRP A O   1 
ATOM   1396 C  CB  . TRP A 1 217 ? 14.67395 56.38081 -6.61053  1.000 44.70728  ? 217 TRP A CB  1 
ATOM   1397 C  CG  . TRP A 1 217 ? 15.14782 56.02793 -8.01174  1.000 48.18206  ? 217 TRP A CG  1 
ATOM   1398 C  CD1 . TRP A 1 217 ? 14.65406 56.51029 -9.18735  1.000 45.39866  ? 217 TRP A CD1 1 
ATOM   1399 C  CD2 . TRP A 1 217 ? 16.19729 55.11220 -8.36447  1.000 43.36477  ? 217 TRP A CD2 1 
ATOM   1400 N  NE1 . TRP A 1 217 ? 15.32833 55.95528 -10.24821 1.000 45.84765  ? 217 TRP A NE1 1 
ATOM   1401 C  CE2 . TRP A 1 217 ? 16.28154 55.09532 -9.76897  1.000 46.00068  ? 217 TRP A CE2 1 
ATOM   1402 C  CE3 . TRP A 1 217 ? 17.07688 54.31318 -7.62873  1.000 44.38007  ? 217 TRP A CE3 1 
ATOM   1403 C  CZ2 . TRP A 1 217 ? 17.20242 54.30236 -10.45290 1.000 44.11603  ? 217 TRP A CZ2 1 
ATOM   1404 C  CZ3 . TRP A 1 217 ? 17.99704 53.52377 -8.31715  1.000 41.03872  ? 217 TRP A CZ3 1 
ATOM   1405 C  CH2 . TRP A 1 217 ? 18.04950 53.52821 -9.70688  1.000 40.32076  ? 217 TRP A CH2 1 
ATOM   1406 N  N   . LEU A 1 218 ? 14.97450 53.92586 -4.72819  1.000 44.46380  ? 218 LEU A N   1 
ATOM   1407 C  CA  . LEU A 1 218 ? 15.61091 52.65064 -4.43449  1.000 40.76207  ? 218 LEU A CA  1 
ATOM   1408 C  C   . LEU A 1 218 ? 14.57206 51.57700 -4.14038  1.000 44.56575  ? 218 LEU A C   1 
ATOM   1409 O  O   . LEU A 1 218 ? 14.71758 50.42606 -4.57877  1.000 43.41409  ? 218 LEU A O   1 
ATOM   1410 C  CB  . LEU A 1 218 ? 16.57757 52.81048 -3.27085  1.000 36.80666  ? 218 LEU A CB  1 
ATOM   1411 C  CG  . LEU A 1 218 ? 17.80512 53.63893 -3.63321  1.000 45.06736  ? 218 LEU A CG  1 
ATOM   1412 C  CD1 . LEU A 1 218 ? 18.43409 54.25980 -2.37082  1.000 38.64952  ? 218 LEU A CD1 1 
ATOM   1413 C  CD2 . LEU A 1 218 ? 18.80111 52.78785 -4.40116  1.000 31.33484  ? 218 LEU A CD2 1 
ATOM   1414 N  N   . LYS A 1 219 ? 13.50916 51.92579 -3.41021  1.000 42.26038  ? 219 LYS A N   1 
ATOM   1415 C  CA  . LYS A 1 219 ? 12.50126 50.90629 -3.16373  1.000 53.04308  ? 219 LYS A CA  1 
ATOM   1416 C  C   . LYS A 1 219 ? 11.86228 50.45638 -4.47950  1.000 51.32454  ? 219 LYS A C   1 
ATOM   1417 O  O   . LYS A 1 219 ? 11.59957 49.26163 -4.66936  1.000 42.52520  ? 219 LYS A O   1 
ATOM   1418 C  CB  . LYS A 1 219 ? 11.46193 51.40687 -2.14592  1.000 54.16218  ? 219 LYS A CB  1 
ATOM   1419 C  CG  . LYS A 1 219 ? 10.32356 50.40819 -1.89951  1.000 70.89372  ? 219 LYS A CG  1 
ATOM   1420 C  CD  . LYS A 1 219 ? 9.42438  50.72720 -0.69552  1.000 81.40550  ? 219 LYS A CD  1 
ATOM   1421 C  CE  . LYS A 1 219 ? 9.88673  50.02305 0.58546   1.000 84.44564  ? 219 LYS A CE  1 
ATOM   1422 N  NZ  . LYS A 1 219 ? 11.30837 50.27182 0.92700   1.000 85.57016  ? 219 LYS A NZ  1 
ATOM   1423 N  N   . ASP A 1 220 ? 11.66664 51.38154 -5.41745  1.000 44.65740  ? 220 ASP A N   1 
ATOM   1424 C  CA  . ASP A 1 220 ? 11.13892 51.00517 -6.71912  1.000 46.31169  ? 220 ASP A CA  1 
ATOM   1425 C  C   . ASP A 1 220 ? 12.11672 50.13698 -7.49915  1.000 49.59251  ? 220 ASP A C   1 
ATOM   1426 O  O   . ASP A 1 220 ? 11.68695 49.28533 -8.28740  1.000 54.89642  ? 220 ASP A O   1 
ATOM   1427 C  CB  . ASP A 1 220 ? 10.79890 52.25653 -7.52252  1.000 53.62249  ? 220 ASP A CB  1 
ATOM   1428 C  CG  . ASP A 1 220 ? 9.49249  52.88533 -7.09607  1.000 61.39872  ? 220 ASP A CG  1 
ATOM   1429 O  OD1 . ASP A 1 220 ? 8.58795  52.13595 -6.66445  1.000 68.59182  ? 220 ASP A OD1 1 
ATOM   1430 O  OD2 . ASP A 1 220 ? 9.37311  54.12755 -7.20089  1.000 60.73071  ? 220 ASP A OD2 1 
ATOM   1431 N  N   . ASN A 1 221 ? 13.42292 50.33309 -7.30442  1.000 44.79877  ? 221 ASN A N   1 
ATOM   1432 C  CA  . ASN A 1 221 ? 14.43387 49.64608 -8.09975  1.000 40.70106  ? 221 ASN A CA  1 
ATOM   1433 C  C   . ASN A 1 221 ? 15.20925 48.60692 -7.31482  1.000 50.69580  ? 221 ASN A C   1 
ATOM   1434 O  O   . ASN A 1 221 ? 16.19217 48.05665 -7.83158  1.000 50.85346  ? 221 ASN A O   1 
ATOM   1435 C  CB  . ASN A 1 221 ? 15.39764 50.64807 -8.72668  1.000 39.92475  ? 221 ASN A CB  1 
ATOM   1436 C  CG  . ASN A 1 221 ? 14.78847 51.33910 -9.92592  1.000 53.37247  ? 221 ASN A CG  1 
ATOM   1437 O  OD1 . ASN A 1 221 ? 14.54104 50.70307 -10.95704 1.000 61.97846  ? 221 ASN A OD1 1 
ATOM   1438 N  ND2 . ASN A 1 221 ? 14.52354 52.63618 -9.79905  1.000 45.73840  ? 221 ASN A ND2 1 
ATOM   1439 N  N   . ALA A 1 222 ? 14.78316 48.31085 -6.08810  1.000 53.31391  ? 222 ALA A N   1 
ATOM   1440 C  CA  . ALA A 1 222 ? 15.47816 47.31441 -5.28479  1.000 52.31397  ? 222 ALA A CA  1 
ATOM   1441 C  C   . ALA A 1 222 ? 15.54815 45.98294 -6.01193  1.000 48.91415  ? 222 ALA A C   1 
ATOM   1442 O  O   . ALA A 1 222 ? 16.63070 45.41977 -6.18334  1.000 49.31055  ? 222 ALA A O   1 
ATOM   1443 C  CB  . ALA A 1 222 ? 14.78460 47.15715 -3.93603  1.000 55.47372  ? 222 ALA A CB  1 
ATOM   1444 N  N   . HIS A 1 223 ? 14.40195 45.47609 -6.47447  1.000 59.45137  ? 223 HIS A N   1 
ATOM   1445 C  CA  . HIS A 1 223 ? 14.38960 44.16128 -7.10847  1.000 66.25332  ? 223 HIS A CA  1 
ATOM   1446 C  C   . HIS A 1 223 ? 15.28874 44.11811 -8.33108  1.000 63.06034  ? 223 HIS A C   1 
ATOM   1447 O  O   . HIS A 1 223 ? 15.89087 43.07951 -8.61916  1.000 65.26999  ? 223 HIS A O   1 
ATOM   1448 C  CB  . HIS A 1 223 ? 12.96432 43.76071 -7.48595  1.000 81.88208  ? 223 HIS A CB  1 
ATOM   1449 C  CG  . HIS A 1 223 ? 12.35050 42.78037 -6.53786  1.000 96.45378  ? 223 HIS A CG  1 
ATOM   1450 N  ND1 . HIS A 1 223 ? 12.96651 41.59604 -6.19226  1.000 100.76816 ? 223 HIS A ND1 1 
ATOM   1451 C  CD2 . HIS A 1 223 ? 11.18433 42.81301 -5.85051  1.000 99.46878  ? 223 HIS A CD2 1 
ATOM   1452 C  CE1 . HIS A 1 223 ? 12.20348 40.93820 -5.33743  1.000 101.86704 ? 223 HIS A CE1 1 
ATOM   1453 N  NE2 . HIS A 1 223 ? 11.11728 41.65558 -5.11185  1.000 101.27108 ? 223 HIS A NE2 1 
ATOM   1454 N  N   . ALA A 1 224 ? 15.41189 45.23413 -9.04954  1.000 62.31549  ? 224 ALA A N   1 
ATOM   1455 C  CA  . ALA A 1 224 ? 16.22972 45.23940 -10.25530 1.000 57.55274  ? 224 ALA A CA  1 
ATOM   1456 C  C   . ALA A 1 224 ? 17.71244 45.09005 -9.95182  1.000 57.39268  ? 224 ALA A C   1 
ATOM   1457 O  O   . ALA A 1 224 ? 18.48199 44.76755 -10.85641 1.000 59.99579  ? 224 ALA A O   1 
ATOM   1458 C  CB  . ALA A 1 224 ? 15.99052 46.52197 -11.05536 1.000 54.40443  ? 224 ALA A CB  1 
ATOM   1459 N  N   . PHE A 1 225 ? 18.13287 45.30915 -8.70904  1.000 58.82605  ? 225 PHE A N   1 
ATOM   1460 C  CA  . PHE A 1 225 ? 19.54032 45.22912 -8.34386  1.000 54.30160  ? 225 PHE A CA  1 
ATOM   1461 C  C   . PHE A 1 225 ? 19.86936 43.97540 -7.54479  1.000 59.68855  ? 225 PHE A C   1 
ATOM   1462 O  O   . PHE A 1 225 ? 21.01380 43.82410 -7.08955  1.000 47.64166  ? 225 PHE A O   1 
ATOM   1463 C  CB  . PHE A 1 225 ? 19.94932 46.47417 -7.55695  1.000 52.01216  ? 225 PHE A CB  1 
ATOM   1464 C  CG  . PHE A 1 225 ? 20.26694 47.65960 -8.42287  1.000 50.13032  ? 225 PHE A CG  1 
ATOM   1465 C  CD1 . PHE A 1 225 ? 19.38008 48.73404 -8.50677  1.000 47.37646  ? 225 PHE A CD1 1 
ATOM   1466 C  CD2 . PHE A 1 225 ? 21.44983 47.69749 -9.16350  1.000 45.20818  ? 225 PHE A CD2 1 
ATOM   1467 C  CE1 . PHE A 1 225 ? 19.66039 49.83153 -9.31357  1.000 44.29459  ? 225 PHE A CE1 1 
ATOM   1468 C  CE2 . PHE A 1 225 ? 21.74916 48.79102 -9.96533  1.000 50.81811  ? 225 PHE A CE2 1 
ATOM   1469 C  CZ  . PHE A 1 225 ? 20.84465 49.86640 -10.04576 1.000 48.75405  ? 225 PHE A CZ  1 
ATOM   1470 N  N   . GLY A 1 226 ? 18.90350 43.06510 -7.38781  1.000 60.92138  ? 226 GLY A N   1 
ATOM   1471 C  CA  . GLY A 1 226 ? 19.04449 41.91696 -6.51215  1.000 65.34187  ? 226 GLY A CA  1 
ATOM   1472 C  C   . GLY A 1 226 ? 18.59812 42.15048 -5.08315  1.000 62.93316  ? 226 GLY A C   1 
ATOM   1473 O  O   . GLY A 1 226 ? 18.79081 41.26719 -4.23609  1.000 62.77517  ? 226 GLY A O   1 
ATOM   1474 N  N   . GLY A 1 227 ? 18.00768 43.30613 -4.79012  1.000 55.95624  ? 227 GLY A N   1 
ATOM   1475 C  CA  . GLY A 1 227 ? 17.62446 43.66560 -3.44339  1.000 52.94560  ? 227 GLY A CA  1 
ATOM   1476 C  C   . GLY A 1 227 ? 16.16748 43.36976 -3.14740  1.000 57.27728  ? 227 GLY A C   1 
ATOM   1477 O  O   . GLY A 1 227 ? 15.32226 43.36138 -4.03863  1.000 58.93798  ? 227 GLY A O   1 
ATOM   1478 N  N   . ASN A 1 228 ? 15.88502 43.11840 -1.87035  1.000 59.41187  ? 228 ASN A N   1 
ATOM   1479 C  CA  . ASN A 1 228 ? 14.51864 42.90224 -1.41921  1.000 57.78171  ? 228 ASN A CA  1 
ATOM   1480 C  C   . ASN A 1 228 ? 13.94026 44.24561 -1.00173  1.000 50.79220  ? 228 ASN A C   1 
ATOM   1481 O  O   . ASN A 1 228 ? 14.34982 44.78102 0.03247   1.000 50.42080  ? 228 ASN A O   1 
ATOM   1482 C  CB  . ASN A 1 228 ? 14.48047 41.91680 -0.26075  1.000 53.32574  ? 228 ASN A CB  1 
ATOM   1483 C  CG  . ASN A 1 228 ? 13.07164 41.55559 0.15446   1.000 52.56636  ? 228 ASN A CG  1 
ATOM   1484 O  OD1 . ASN A 1 228 ? 12.17730 42.40011 0.16068   1.000 59.67423  ? 228 ASN A OD1 1 
ATOM   1485 N  ND2 . ASN A 1 228 ? 12.86645 40.29378 0.51607   1.000 49.02275  ? 228 ASN A ND2 1 
ATOM   1486 N  N   . PRO A 1 229 ? 12.98550 44.80535 -1.74122  1.000 55.26802  ? 229 PRO A N   1 
ATOM   1487 C  CA  . PRO A 1 229 ? 12.47479 46.14446 -1.40287  1.000 51.77048  ? 229 PRO A CA  1 
ATOM   1488 C  C   . PRO A 1 229 ? 11.92686 46.26462 0.00870   1.000 52.60867  ? 229 PRO A C   1 
ATOM   1489 O  O   . PRO A 1 229 ? 11.81398 47.38349 0.51376   1.000 56.33529  ? 229 PRO A O   1 
ATOM   1490 C  CB  . PRO A 1 229 ? 11.36754 46.37242 -2.44345  1.000 54.38307  ? 229 PRO A CB  1 
ATOM   1491 C  CG  . PRO A 1 229 ? 11.66091 45.40882 -3.54808  1.000 60.49530  ? 229 PRO A CG  1 
ATOM   1492 C  CD  . PRO A 1 229 ? 12.30167 44.22145 -2.90522  1.000 61.73459  ? 229 PRO A CD  1 
ATOM   1493 N  N   . GLU A 1 230 ? 11.57911 45.16306 0.66359   1.000 58.57873  ? 230 GLU A N   1 
ATOM   1494 C  CA  . GLU A 1 230 ? 11.04764 45.20201 2.01911   1.000 67.35058  ? 230 GLU A CA  1 
ATOM   1495 C  C   . GLU A 1 230 ? 12.12762 45.00877 3.08297   1.000 62.42254  ? 230 GLU A C   1 
ATOM   1496 O  O   . GLU A 1 230 ? 11.82094 44.98527 4.27777   1.000 57.19629  ? 230 GLU A O   1 
ATOM   1497 C  CB  . GLU A 1 230 ? 9.94446  44.15162 2.16699   1.000 77.33640  ? 230 GLU A CB  1 
ATOM   1498 C  CG  . GLU A 1 230 ? 8.69296  44.49804 1.37459   1.000 84.25495  ? 230 GLU A CG  1 
ATOM   1499 C  CD  . GLU A 1 230 ? 7.87345  45.56458 2.06717   1.000 93.66810  ? 230 GLU A CD  1 
ATOM   1500 O  OE1 . GLU A 1 230 ? 7.17224  45.21191 3.03983   1.000 100.64190 ? 230 GLU A OE1 1 
ATOM   1501 O  OE2 . GLU A 1 230 ? 7.94666  46.75046 1.65750   1.000 92.10696  ? 230 GLU A OE2 1 
ATOM   1502 N  N   . TRP A 1 231 ? 13.38499 44.90033 2.67547   1.000 59.75141  ? 231 TRP A N   1 
ATOM   1503 C  CA  . TRP A 1 231 ? 14.47436 44.66012 3.60408   1.000 54.20856  ? 231 TRP A CA  1 
ATOM   1504 C  C   . TRP A 1 231 ? 15.44926 45.83388 3.62884   1.000 51.14895  ? 231 TRP A C   1 
ATOM   1505 O  O   . TRP A 1 231 ? 16.65581 45.64145 3.43255   1.000 53.69030  ? 231 TRP A O   1 
ATOM   1506 C  CB  . TRP A 1 231 ? 15.19047 43.37897 3.20182   1.000 56.46262  ? 231 TRP A CB  1 
ATOM   1507 C  CG  . TRP A 1 231 ? 15.76192 42.62373 4.32967   1.000 62.60217  ? 231 TRP A CG  1 
ATOM   1508 C  CD1 . TRP A 1 231 ? 15.85609 43.02136 5.63370   1.000 67.90336  ? 231 TRP A CD1 1 
ATOM   1509 C  CD2 . TRP A 1 231 ? 16.33901 41.32566 4.26134   1.000 59.90425  ? 231 TRP A CD2 1 
ATOM   1510 N  NE1 . TRP A 1 231 ? 16.46223 42.03735 6.38457   1.000 66.43166  ? 231 TRP A NE1 1 
ATOM   1511 C  CE2 . TRP A 1 231 ? 16.76753 40.98696 5.56080   1.000 62.67689  ? 231 TRP A CE2 1 
ATOM   1512 C  CE3 . TRP A 1 231 ? 16.54111 40.41604 3.22435   1.000 60.74805  ? 231 TRP A CE3 1 
ATOM   1513 C  CZ2 . TRP A 1 231 ? 17.37816 39.77885 5.84646   1.000 68.58504  ? 231 TRP A CZ2 1 
ATOM   1514 C  CZ3 . TRP A 1 231 ? 17.14809 39.21343 3.50803   1.000 71.13662  ? 231 TRP A CZ3 1 
ATOM   1515 C  CH2 . TRP A 1 231 ? 17.56182 38.90298 4.80690   1.000 74.58962  ? 231 TRP A CH2 1 
ATOM   1516 N  N   . MET A 1 232 ? 14.94711 47.04979 3.85605   1.000 39.19187  ? 232 MET A N   1 
ATOM   1517 C  CA  . MET A 1 232 ? 15.77092 48.24905 3.76706   1.000 36.16739  ? 232 MET A CA  1 
ATOM   1518 C  C   . MET A 1 232 ? 16.12273 48.78011 5.15236   1.000 40.10567  ? 232 MET A C   1 
ATOM   1519 O  O   . MET A 1 232 ? 15.32104 48.71367 6.08889   1.000 45.55714  ? 232 MET A O   1 
ATOM   1520 C  CB  . MET A 1 232 ? 15.07850 49.34817 2.95087   1.000 33.27915  ? 232 MET A CB  1 
ATOM   1521 C  CG  . MET A 1 232 ? 14.64943 48.90974 1.54608   1.000 50.74730  ? 232 MET A CG  1 
ATOM   1522 S  SD  . MET A 1 232 ? 14.43085 50.26505 0.36412   1.000 47.14722  ? 232 MET A SD  1 
ATOM   1523 C  CE  . MET A 1 232 ? 14.17150 51.61068 1.53194   1.000 30.88787  ? 232 MET A CE  1 
ATOM   1524 N  N   . THR A 1 233 ? 17.33202 49.30408 5.27397   1.000 34.25908  ? 233 THR A N   1 
ATOM   1525 C  CA  . THR A 1 233 ? 17.78186 49.96409 6.48664   1.000 41.15932  ? 233 THR A CA  1 
ATOM   1526 C  C   . THR A 1 233 ? 18.34205 51.31642 6.08876   1.000 42.74737  ? 233 THR A C   1 
ATOM   1527 O  O   . THR A 1 233 ? 19.11325 51.40709 5.12678   1.000 51.17191  ? 233 THR A O   1 
ATOM   1528 C  CB  . THR A 1 233 ? 18.85606 49.12888 7.20795   1.000 40.56335  ? 233 THR A CB  1 
ATOM   1529 O  OG1 . THR A 1 233 ? 18.29008 47.89011 7.63496   1.000 33.90545  ? 233 THR A OG1 1 
ATOM   1530 C  CG2 . THR A 1 233 ? 19.41666 49.86505 8.41361   1.000 38.51969  ? 233 THR A CG2 1 
ATOM   1531 N  N   . LEU A 1 234 ? 17.93907 52.36245 6.80038   1.000 33.00792  ? 234 LEU A N   1 
ATOM   1532 C  CA  . LEU A 1 234 ? 18.60981 53.64646 6.68494   1.000 35.97246  ? 234 LEU A CA  1 
ATOM   1533 C  C   . LEU A 1 234 ? 19.72463 53.73355 7.72213   1.000 39.97091  ? 234 LEU A C   1 
ATOM   1534 O  O   . LEU A 1 234 ? 19.56780 53.27463 8.85897   1.000 42.32020  ? 234 LEU A O   1 
ATOM   1535 C  CB  . LEU A 1 234 ? 17.62768 54.79782 6.88594   1.000 38.56941  ? 234 LEU A CB  1 
ATOM   1536 C  CG  . LEU A 1 234 ? 16.47429 54.97569 5.89413   1.000 44.08012  ? 234 LEU A CG  1 
ATOM   1537 C  CD1 . LEU A 1 234 ? 15.79870 56.28457 6.19075   1.000 41.29485  ? 234 LEU A CD1 1 
ATOM   1538 C  CD2 . LEU A 1 234 ? 16.97088 54.96701 4.47327   1.000 44.89407  ? 234 LEU A CD2 1 
ATOM   1539 N  N   . PHE A 1 235 ? 20.85896 54.30737 7.32607   1.000 34.78892  ? 235 PHE A N   1 
ATOM   1540 C  CA  . PHE A 1 235 ? 21.84366 54.69859 8.32199   1.000 36.98096  ? 235 PHE A CA  1 
ATOM   1541 C  C   . PHE A 1 235 ? 22.57812 55.95018 7.87977   1.000 39.10577  ? 235 PHE A C   1 
ATOM   1542 O  O   . PHE A 1 235 ? 22.73212 56.21408 6.68490   1.000 40.79013  ? 235 PHE A O   1 
ATOM   1543 C  CB  . PHE A 1 235 ? 22.82811 53.57604 8.65175   1.000 28.02548  ? 235 PHE A CB  1 
ATOM   1544 C  CG  . PHE A 1 235 ? 23.81095 53.24887 7.56710   1.000 27.58209  ? 235 PHE A CG  1 
ATOM   1545 C  CD1 . PHE A 1 235 ? 23.39835 53.02012 6.25014   1.000 28.62986  ? 235 PHE A CD1 1 
ATOM   1546 C  CD2 . PHE A 1 235 ? 25.15684 53.05585 7.89057   1.000 29.78846  ? 235 PHE A CD2 1 
ATOM   1547 C  CE1 . PHE A 1 235 ? 24.33827 52.65339 5.26578   1.000 35.77553  ? 235 PHE A CE1 1 
ATOM   1548 C  CE2 . PHE A 1 235 ? 26.10326 52.69974 6.91484   1.000 36.77150  ? 235 PHE A CE2 1 
ATOM   1549 C  CZ  . PHE A 1 235 ? 25.69771 52.50440 5.60242   1.000 37.08823  ? 235 PHE A CZ  1 
ATOM   1550 N  N   . GLY A 1 236 ? 23.00537 56.72314 8.87275   1.000 24.03217  ? 236 GLY A N   1 
ATOM   1551 C  CA  . GLY A 1 236 ? 23.67283 57.99278 8.65435   1.000 28.41891  ? 236 GLY A CA  1 
ATOM   1552 C  C   . GLY A 1 236 ? 24.29873 58.50890 9.93418   1.000 34.33274  ? 236 GLY A C   1 
ATOM   1553 O  O   . GLY A 1 236 ? 24.09672 57.97018 11.02985  1.000 35.82729  ? 236 GLY A O   1 
ATOM   1554 N  N   . GLU A 1 237 ? 25.05012 59.59030 9.78505   1.000 33.76018  ? 237 GLU A N   1 
ATOM   1555 C  CA  . GLU A 1 237 ? 25.78599 60.16088 10.89896  1.000 28.88278  ? 237 GLU A CA  1 
ATOM   1556 C  C   . GLU A 1 237 ? 25.57653 61.67151 10.95117  1.000 33.35616  ? 237 GLU A C   1 
ATOM   1557 O  O   . GLU A 1 237 ? 25.45166 62.32925 9.91339   1.000 36.18223  ? 237 GLU A O   1 
ATOM   1558 C  CB  . GLU A 1 237 ? 27.24955 59.80313 10.76886  1.000 22.12076  ? 237 GLU A CB  1 
ATOM   1559 C  CG  . GLU A 1 237 ? 28.06571 60.13138 11.96308  1.000 30.79193  ? 237 GLU A CG  1 
ATOM   1560 C  CD  . GLU A 1 237 ? 28.78512 61.43911 11.78668  1.000 35.85879  ? 237 GLU A CD  1 
ATOM   1561 O  OE1 . GLU A 1 237 ? 28.76292 61.98887 10.66496  1.000 41.50302  ? 237 GLU A OE1 1 
ATOM   1562 O  OE2 . GLU A 1 237 ? 29.38327 61.91273 12.76312  1.000 36.68593  ? 237 GLU A OE2 1 
ATOM   1563 N  N   . SER A 1 238 ? 25.53590 62.20980 12.17075  1.000 32.90545  ? 238 SER A N   1 
ATOM   1564 C  CA  . SER A 1 238 ? 25.32059 63.63255 12.41368  1.000 28.67351  ? 238 SER A CA  1 
ATOM   1565 C  C   . SER A 1 238 ? 24.04981 64.04790 11.68246  1.000 23.29180  ? 238 SER A C   1 
ATOM   1566 O  O   . SER A 1 238 ? 23.00015 63.42871 11.86836  1.000 30.39834  ? 238 SER A O   1 
ATOM   1567 C  CB  . SER A 1 238 ? 26.53722 64.47135 11.97869  1.000 32.14714  ? 238 SER A CB  1 
ATOM   1568 O  OG  . SER A 1 238 ? 26.51983 65.75824 12.59799  1.000 37.62444  ? 238 SER A OG  1 
ATOM   1569 N  N   . ALA A 1 239 ? 24.13047 65.06401 10.82679  1.000 28.20720  ? 239 ALA A N   1 
ATOM   1570 C  CA  . ALA A 1 239 ? 22.94528 65.49328 10.08620  1.000 30.10791  ? 239 ALA A CA  1 
ATOM   1571 C  C   . ALA A 1 239 ? 22.32589 64.33786 9.29402   1.000 28.02313  ? 239 ALA A C   1 
ATOM   1572 O  O   . ALA A 1 239 ? 21.09746 64.17674 9.27821   1.000 27.02219  ? 239 ALA A O   1 
ATOM   1573 C  CB  . ALA A 1 239 ? 23.30419 66.66593 9.17793   1.000 29.49871  ? 239 ALA A CB  1 
ATOM   1574 N  N   . GLY A 1 240 ? 23.15429 63.49329 8.66850   1.000 25.44582  ? 240 GLY A N   1 
ATOM   1575 C  CA  . GLY A 1 240 ? 22.61337 62.29027 8.04441   1.000 34.00983  ? 240 GLY A CA  1 
ATOM   1576 C  C   . GLY A 1 240 ? 21.85403 61.40438 9.02392   1.000 36.65417  ? 240 GLY A C   1 
ATOM   1577 O  O   . GLY A 1 240 ? 20.79248 60.85385 8.70196   1.000 38.10838  ? 240 GLY A O   1 
ATOM   1578 N  N   . SER A 1 241 ? 22.39551 61.24275 10.22643  1.000 29.56977  ? 241 SER A N   1 
ATOM   1579 C  CA  . SER A 1 241 ? 21.68879 60.49645 11.25154  1.000 28.36158  ? 241 SER A CA  1 
ATOM   1580 C  C   . SER A 1 241 ? 20.36678 61.17387 11.59247  1.000 29.30265  ? 241 SER A C   1 
ATOM   1581 O  O   . SER A 1 241 ? 19.31187 60.52645 11.65947  1.000 27.84368  ? 241 SER A O   1 
ATOM   1582 C  CB  . SER A 1 241 ? 22.58992 60.36080 12.47866  1.000 29.76608  ? 241 SER A CB  1 
ATOM   1583 O  OG  . SER A 1 241 ? 21.86158 59.99579 13.62257  1.000 32.69852  ? 241 SER A OG  1 
ATOM   1584 N  N   . SER A 1 242 ? 20.39408 62.48280 11.79944  1.000 25.42893  ? 242 SER A N   1 
ATOM   1585 C  CA  . SER A 1 242 ? 19.13639 63.17606 12.04394  1.000 27.69481  ? 242 SER A CA  1 
ATOM   1586 C  C   . SER A 1 242 ? 18.18805 63.02304 10.86619  1.000 31.32361  ? 242 SER A C   1 
ATOM   1587 O  O   . SER A 1 242 ? 16.97393 62.89037 11.06015  1.000 26.37913  ? 242 SER A O   1 
ATOM   1588 C  CB  . SER A 1 242 ? 19.38742 64.64933 12.33537  1.000 30.54905  ? 242 SER A CB  1 
ATOM   1589 O  OG  . SER A 1 242 ? 19.45779 64.83631 13.73008  1.000 43.00995  ? 242 SER A OG  1 
ATOM   1590 N  N   . SER A 1 243 ? 18.71294 63.03601 9.63448   1.000 27.36458  ? 243 SER A N   1 
ATOM   1591 C  CA  . SER A 1 243 ? 17.82791 62.81663 8.49192   1.000 26.92986  ? 243 SER A CA  1 
ATOM   1592 C  C   . SER A 1 243 ? 17.19143 61.42995 8.53887   1.000 31.93705  ? 243 SER A C   1 
ATOM   1593 O  O   . SER A 1 243 ? 15.98092 61.29569 8.28657   1.000 32.13278  ? 243 SER A O   1 
ATOM   1594 C  CB  . SER A 1 243 ? 18.56165 63.04421 7.16866   1.000 32.17791  ? 243 SER A CB  1 
ATOM   1595 O  OG  . SER A 1 243 ? 19.37487 64.20802 7.20165   1.000 37.75485  ? 243 SER A OG  1 
ATOM   1596 N  N   . VAL A 1 244 ? 17.97831 60.39254 8.88380   1.000 22.89411  ? 244 VAL A N   1 
ATOM   1597 C  CA  . VAL A 1 244 ? 17.38830 59.06795 9.08667   1.000 19.93763  ? 244 VAL A CA  1 
ATOM   1598 C  C   . VAL A 1 244 ? 16.19124 59.17269 10.01898  1.000 28.27069  ? 244 VAL A C   1 
ATOM   1599 O  O   . VAL A 1 244 ? 15.09243 58.70236 9.70562   1.000 34.60566  ? 244 VAL A O   1 
ATOM   1600 C  CB  . VAL A 1 244 ? 18.41924 58.07067 9.64195   1.000 28.28560  ? 244 VAL A CB  1 
ATOM   1601 C  CG1 . VAL A 1 244 ? 17.70881 56.74366 10.03046  1.000 26.84326  ? 244 VAL A CG1 1 
ATOM   1602 C  CG2 . VAL A 1 244 ? 19.52173 57.82838 8.66085   1.000 24.18063  ? 244 VAL A CG2 1 
ATOM   1603 N  N   . ASN A 1 245 ? 16.39387 59.80439 11.17574  1.000 27.67064  ? 245 ASN A N   1 
ATOM   1604 C  CA  . ASN A 1 245 ? 15.30162 60.08570 12.10899  1.000 34.77285  ? 245 ASN A CA  1 
ATOM   1605 C  C   . ASN A 1 245 ? 14.10078 60.69060 11.39103  1.000 27.87031  ? 245 ASN A C   1 
ATOM   1606 O  O   . ASN A 1 245 ? 12.96927 60.20222 11.51457  1.000 29.54933  ? 245 ASN A O   1 
ATOM   1607 C  CB  . ASN A 1 245 ? 15.82108 61.03750 13.19110  1.000 39.64689  ? 245 ASN A CB  1 
ATOM   1608 C  CG  . ASN A 1 245 ? 14.89374 61.18551 14.37216  1.000 38.64518  ? 245 ASN A CG  1 
ATOM   1609 O  OD1 . ASN A 1 245 ? 15.25259 61.84764 15.34783  1.000 44.74074  ? 245 ASN A OD1 1 
ATOM   1610 N  ND2 . ASN A 1 245 ? 13.70811 60.58790 14.30519  1.000 32.35886  ? 245 ASN A ND2 1 
ATOM   1611 N  N   . ALA A 1 246 ? 14.33816 61.75175 10.62139  1.000 29.08101  ? 246 ALA A N   1 
ATOM   1612 C  CA  . ALA A 1 246 ? 13.25506 62.42644 9.90916   1.000 32.50100  ? 246 ALA A CA  1 
ATOM   1613 C  C   . ALA A 1 246 ? 12.60244 61.51501 8.87249   1.000 34.42572  ? 246 ALA A C   1 
ATOM   1614 O  O   . ALA A 1 246 ? 11.37301 61.49458 8.74492   1.000 40.42013  ? 246 ALA A O   1 
ATOM   1615 C  CB  . ALA A 1 246 ? 13.78642 63.69447 9.24187   1.000 29.16473  ? 246 ALA A CB  1 
ATOM   1616 N  N   . GLN A 1 247 ? 13.39856 60.74723 8.12229   1.000 27.08768  ? 247 GLN A N   1 
ATOM   1617 C  CA  . GLN A 1 247 ? 12.78577 59.88474 7.11000   1.000 28.51141  ? 247 GLN A CA  1 
ATOM   1618 C  C   . GLN A 1 247 ? 11.95120 58.78126 7.73551   1.000 32.12519  ? 247 GLN A C   1 
ATOM   1619 O  O   . GLN A 1 247 ? 10.99508 58.31306 7.11030   1.000 35.35051  ? 247 GLN A O   1 
ATOM   1620 C  CB  . GLN A 1 247 ? 13.84312 59.27080 6.19762   1.000 28.40189  ? 247 GLN A CB  1 
ATOM   1621 C  CG  . GLN A 1 247 ? 14.58131 60.27972 5.33317   1.000 35.85848  ? 247 GLN A CG  1 
ATOM   1622 C  CD  . GLN A 1 247 ? 13.64435 61.05946 4.41996   1.000 43.66919  ? 247 GLN A CD  1 
ATOM   1623 O  OE1 . GLN A 1 247 ? 12.60971 60.54542 3.97640   1.000 53.24725  ? 247 GLN A OE1 1 
ATOM   1624 N  NE2 . GLN A 1 247 ? 14.01090 62.30230 4.12380   1.000 36.65726  ? 247 GLN A NE2 1 
ATOM   1625 N  N   . LEU A 1 248 ? 12.28142 58.35549 8.96348   1.000 33.57318  ? 248 LEU A N   1 
ATOM   1626 C  CA  . LEU A 1 248 ? 11.52394 57.27533 9.58646   1.000 32.28227  ? 248 LEU A CA  1 
ATOM   1627 C  C   . LEU A 1 248 ? 10.20170 57.75928 10.16798  1.000 39.79200  ? 248 LEU A C   1 
ATOM   1628 O  O   . LEU A 1 248 ? 9.22672  56.99162 10.18014  1.000 45.39963  ? 248 LEU A O   1 
ATOM   1629 C  CB  . LEU A 1 248 ? 12.33116 56.59550 10.69165  1.000 37.23215  ? 248 LEU A CB  1 
ATOM   1630 C  CG  . LEU A 1 248 ? 13.60086 55.75607 10.48636  1.000 48.27589  ? 248 LEU A CG  1 
ATOM   1631 C  CD1 . LEU A 1 248 ? 14.22931 55.43157 11.84361  1.000 53.16611  ? 248 LEU A CD1 1 
ATOM   1632 C  CD2 . LEU A 1 248 ? 13.34864 54.48179 9.73180   1.000 47.31723  ? 248 LEU A CD2 1 
ATOM   1633 N  N   . MET A 1 249 ? 10.14196 59.01182 10.65093  1.000 41.21327  ? 249 MET A N   1 
ATOM   1634 C  CA  . MET A 1 249 ? 8.98750  59.49835 11.41697  1.000 47.92015  ? 249 MET A CA  1 
ATOM   1635 C  C   . MET A 1 249 ? 8.11567  60.50281 10.67229  1.000 46.18521  ? 249 MET A C   1 
ATOM   1636 O  O   . MET A 1 249 ? 7.01668  60.80479 11.14485  1.000 43.25492  ? 249 MET A O   1 
ATOM   1637 C  CB  . MET A 1 249 ? 9.43256  60.15432 12.73954  1.000 44.15808  ? 249 MET A CB  1 
ATOM   1638 C  CG  . MET A 1 249 ? 10.31944 59.31085 13.61456  1.000 46.93179  ? 249 MET A CG  1 
ATOM   1639 S  SD  . MET A 1 249 ? 9.48221  57.84943 14.22111  1.000 56.72488  ? 249 MET A SD  1 
ATOM   1640 C  CE  . MET A 1 249 ? 10.87983 56.87974 14.79662  1.000 49.02383  ? 249 MET A CE  1 
ATOM   1641 N  N   . SER A 1 250 ? 8.57858  61.05302 9.55833   1.000 41.53880  ? 250 SER A N   1 
ATOM   1642 C  CA  . SER A 1 250 ? 7.75790  61.99367 8.81190   1.000 43.21406  ? 250 SER A CA  1 
ATOM   1643 C  C   . SER A 1 250 ? 6.45058  61.34237 8.37291   1.000 38.84236  ? 250 SER A C   1 
ATOM   1644 O  O   . SER A 1 250 ? 6.45795  60.20168 7.90532   1.000 39.90095  ? 250 SER A O   1 
ATOM   1645 C  CB  . SER A 1 250 ? 8.49426  62.49337 7.57268   1.000 40.68731  ? 250 SER A CB  1 
ATOM   1646 O  OG  . SER A 1 250 ? 7.86636  63.67107 7.10691   1.000 41.08448  ? 250 SER A OG  1 
ATOM   1647 N  N   . PRO A 1 251 ? 5.32147  62.04379 8.47440   1.000 35.13390  ? 251 PRO A N   1 
ATOM   1648 C  CA  . PRO A 1 251 ? 4.09260  61.51657 7.86321   1.000 35.15833  ? 251 PRO A CA  1 
ATOM   1649 C  C   . PRO A 1 251 ? 4.24155  61.26370 6.37557   1.000 41.60962  ? 251 PRO A C   1 
ATOM   1650 O  O   . PRO A 1 251 ? 3.72636  60.25842 5.86798   1.000 55.12407  ? 251 PRO A O   1 
ATOM   1651 C  CB  . PRO A 1 251 ? 3.05700  62.61722 8.15008   1.000 33.29837  ? 251 PRO A CB  1 
ATOM   1652 C  CG  . PRO A 1 251 ? 3.60493  63.37197 9.27178   1.000 34.69403  ? 251 PRO A CG  1 
ATOM   1653 C  CD  . PRO A 1 251 ? 5.09676  63.34610 9.11452   1.000 36.88849  ? 251 PRO A CD  1 
ATOM   1654 N  N   . VAL A 1 252 ? 4.94976  62.14218 5.66033   1.000 39.97977  ? 252 VAL A N   1 
ATOM   1655 C  CA  . VAL A 1 252 ? 5.14127  61.94998 4.22238   1.000 46.34507  ? 252 VAL A CA  1 
ATOM   1656 C  C   . VAL A 1 252 ? 5.66027  60.55187 3.91038   1.000 53.61779  ? 252 VAL A C   1 
ATOM   1657 O  O   . VAL A 1 252 ? 5.27413  59.93604 2.90940   1.000 60.29582  ? 252 VAL A O   1 
ATOM   1658 C  CB  . VAL A 1 252 ? 6.08915  63.02149 3.66351   1.000 38.16231  ? 252 VAL A CB  1 
ATOM   1659 C  CG1 . VAL A 1 252 ? 6.34280  62.76056 2.19020   1.000 43.77114  ? 252 VAL A CG1 1 
ATOM   1660 C  CG2 . VAL A 1 252 ? 5.50799  64.40260 3.88151   1.000 31.35977  ? 252 VAL A CG2 1 
ATOM   1661 N  N   . THR A 1 253 ? 6.52077  60.02403 4.77226   1.000 49.94499  ? 253 THR A N   1 
ATOM   1662 C  CA  . THR A 1 253 ? 7.28496  58.82935 4.47399   1.000 52.01576  ? 253 THR A CA  1 
ATOM   1663 C  C   . THR A 1 253 ? 7.11415  57.71009 5.48885   1.000 64.20797  ? 253 THR A C   1 
ATOM   1664 O  O   . THR A 1 253 ? 7.58830  56.59454 5.23137   1.000 62.65906  ? 253 THR A O   1 
ATOM   1665 C  CB  . THR A 1 253 ? 8.77502  59.17663 4.39201   1.000 44.94680  ? 253 THR A CB  1 
ATOM   1666 O  OG1 . THR A 1 253 ? 9.17502  59.75236 5.64473   1.000 44.97829  ? 253 THR A OG1 1 
ATOM   1667 C  CG2 . THR A 1 253 ? 9.02773  60.16898 3.27771   1.000 43.05868  ? 253 THR A CG2 1 
ATOM   1668 N  N   . ARG A 1 254 ? 6.47847  57.97455 6.63042   1.000 70.36989  ? 254 ARG A N   1 
ATOM   1669 C  CA  . ARG A 1 254 ? 6.34754  56.97323 7.68289   1.000 74.07146  ? 254 ARG A CA  1 
ATOM   1670 C  C   . ARG A 1 254 ? 5.76876  55.68159 7.12290   1.000 75.48191  ? 254 ARG A C   1 
ATOM   1671 O  O   . ARG A 1 254 ? 4.75520  55.69031 6.41572   1.000 72.39145  ? 254 ARG A O   1 
ATOM   1672 C  CB  . ARG A 1 254 ? 5.46734  57.51278 8.81429   1.000 73.56070  ? 254 ARG A CB  1 
ATOM   1673 C  CG  . ARG A 1 254 ? 4.77057  56.46726 9.64603   1.000 77.78491  ? 254 ARG A CG  1 
ATOM   1674 C  CD  . ARG A 1 254 ? 3.73403  57.10466 10.55260  1.000 88.37114  ? 254 ARG A CD  1 
ATOM   1675 N  NE  . ARG A 1 254 ? 4.33461  58.02097 11.52293  1.000 97.66807  ? 254 ARG A NE  1 
ATOM   1676 C  CZ  . ARG A 1 254 ? 4.97144  57.63931 12.63089  1.000 102.73527 ? 254 ARG A CZ  1 
ATOM   1677 N  NH1 . ARG A 1 254 ? 5.10773  56.34965 12.91831  1.000 104.22382 ? 254 ARG A NH1 1 
ATOM   1678 N  NH2 . ARG A 1 254 ? 5.48034  58.54982 13.45343  1.000 102.14928 ? 254 ARG A NH2 1 
ATOM   1679 N  N   . GLY A 1 255 ? 6.45842  54.57058 7.40185   1.000 71.72233  ? 255 GLY A N   1 
ATOM   1680 C  CA  . GLY A 1 255 ? 6.02285  53.24649 7.00245   1.000 73.64639  ? 255 GLY A CA  1 
ATOM   1681 C  C   . GLY A 1 255 ? 6.95148  52.55077 6.02469   1.000 75.01082  ? 255 GLY A C   1 
ATOM   1682 O  O   . GLY A 1 255 ? 7.06027  51.32210 6.05627   1.000 86.21329  ? 255 GLY A O   1 
ATOM   1683 N  N   . LEU A 1 256 ? 7.61644  53.30501 5.14348   1.000 65.15178  ? 256 LEU A N   1 
ATOM   1684 C  CA  . LEU A 1 256 ? 8.42678  52.63609 4.12624   1.000 61.13678  ? 256 LEU A CA  1 
ATOM   1685 C  C   . LEU A 1 256 ? 9.63486  51.92854 4.74245   1.000 61.56093  ? 256 LEU A C   1 
ATOM   1686 O  O   . LEU A 1 256 ? 9.95450  50.79765 4.35966   1.000 72.05894  ? 256 LEU A O   1 
ATOM   1687 C  CB  . LEU A 1 256 ? 8.86623  53.61916 3.03295   1.000 57.72858  ? 256 LEU A CB  1 
ATOM   1688 C  CG  . LEU A 1 256 ? 7.76369  54.28952 2.18827   1.000 62.03947  ? 256 LEU A CG  1 
ATOM   1689 C  CD1 . LEU A 1 256 ? 8.13090  55.73066 1.83721   1.000 57.99752  ? 256 LEU A CD1 1 
ATOM   1690 C  CD2 . LEU A 1 256 ? 7.39169  53.48875 0.92141   1.000 66.38136  ? 256 LEU A CD2 1 
ATOM   1691 N  N   . VAL A 1 257 ? 10.31416 52.56309 5.69708   1.000 50.05451  ? 257 VAL A N   1 
ATOM   1692 C  CA  . VAL A 1 257 ? 11.45660 51.96737 6.38508   1.000 39.96014  ? 257 VAL A CA  1 
ATOM   1693 C  C   . VAL A 1 257 ? 11.19874 52.02146 7.88556   1.000 40.41102  ? 257 VAL A C   1 
ATOM   1694 O  O   . VAL A 1 257 ? 10.83220 53.07380 8.41636   1.000 43.26574  ? 257 VAL A O   1 
ATOM   1695 C  CB  . VAL A 1 257 ? 12.77475 52.68522 6.05118   1.000 41.72347  ? 257 VAL A CB  1 
ATOM   1696 C  CG1 . VAL A 1 257 ? 13.94637 51.77888 6.35056   1.000 51.73400  ? 257 VAL A CG1 1 
ATOM   1697 C  CG2 . VAL A 1 257 ? 12.79234 53.13567 4.60031   1.000 37.78604  ? 257 VAL A CG2 1 
ATOM   1698 N  N   . LYS A 1 258 ? 11.36702 50.88426 8.56619   1.000 40.24760  ? 258 LYS A N   1 
ATOM   1699 C  CA  . LYS A 1 258 ? 11.17012 50.81495 10.01138  1.000 39.00063  ? 258 LYS A CA  1 
ATOM   1700 C  C   . LYS A 1 258 ? 12.42104 50.31676 10.72208  1.000 48.47971  ? 258 LYS A C   1 
ATOM   1701 O  O   . LYS A 1 258 ? 12.32596 49.78042 11.82818  1.000 56.00061  ? 258 LYS A O   1 
ATOM   1702 C  CB  . LYS A 1 258 ? 9.98075  49.91842 10.36768  1.000 39.06740  ? 258 LYS A CB  1 
ATOM   1703 C  CG  . LYS A 1 258 ? 8.63660  50.50875 10.00981  1.000 50.71952  ? 258 LYS A CG  1 
ATOM   1704 C  CD  . LYS A 1 258 ? 7.74938  49.46175 9.38459   1.000 60.69167  ? 258 LYS A CD  1 
ATOM   1705 C  CE  . LYS A 1 258 ? 6.37365  50.01254 9.07226   1.000 69.33004  ? 258 LYS A CE  1 
ATOM   1706 N  NZ  . LYS A 1 258 ? 5.42340  49.86015 10.21736  1.000 74.05592  ? 258 LYS A NZ  1 
ATOM   1707 N  N   . ARG A 1 259 ? 13.58867 50.46911 10.10561  1.000 45.32397  ? 259 ARG A N   1 
ATOM   1708 C  CA  . ARG A 1 259 ? 14.82182 49.92670 10.65961  1.000 44.90633  ? 259 ARG A CA  1 
ATOM   1709 C  C   . ARG A 1 259 ? 15.93794 50.89837 10.30771  1.000 43.31759  ? 259 ARG A C   1 
ATOM   1710 O  O   . ARG A 1 259 ? 16.17427 51.15202 9.11842   1.000 40.85221  ? 259 ARG A O   1 
ATOM   1711 C  CB  . ARG A 1 259 ? 15.08675 48.52375 10.10322  1.000 29.41510  ? 259 ARG A CB  1 
ATOM   1712 C  CG  . ARG A 1 259 ? 16.42848 47.93464 10.47909  1.000 35.81103  ? 259 ARG A CG  1 
ATOM   1713 C  CD  . ARG A 1 259 ? 16.55069 46.47158 10.04725  1.000 31.41364  ? 259 ARG A CD  1 
ATOM   1714 N  NE  . ARG A 1 259 ? 15.57861 45.61589 10.71009  1.000 33.28551  ? 259 ARG A NE  1 
ATOM   1715 C  CZ  . ARG A 1 259 ? 15.36284 44.34739 10.38976  1.000 40.53855  ? 259 ARG A CZ  1 
ATOM   1716 N  NH1 . ARG A 1 259 ? 16.05825 43.77582 9.41889   1.000 44.22259  ? 259 ARG A NH1 1 
ATOM   1717 N  NH2 . ARG A 1 259 ? 14.46259 43.63990 11.05074  1.000 44.89168  ? 259 ARG A NH2 1 
ATOM   1718 N  N   . GLY A 1 260 ? 16.60219 51.45183 11.32545  1.000 33.86515  ? 260 GLY A N   1 
ATOM   1719 C  CA  . GLY A 1 260 ? 17.51459 52.56525 11.10592  1.000 32.56176  ? 260 GLY A CA  1 
ATOM   1720 C  C   . GLY A 1 260 ? 18.60428 52.69167 12.15044  1.000 35.28944  ? 260 GLY A C   1 
ATOM   1721 O  O   . GLY A 1 260 ? 18.40678 52.39572 13.33678  1.000 37.02277  ? 260 GLY A O   1 
ATOM   1722 N  N   . MET A 1 261 ? 19.76250 53.16026 11.69919  1.000 31.35335  ? 261 MET A N   1 
ATOM   1723 C  CA  . MET A 1 261 ? 20.91390 53.39126 12.55519  1.000 33.01335  ? 261 MET A CA  1 
ATOM   1724 C  C   . MET A 1 261 ? 21.25171 54.87023 12.52970  1.000 36.75203  ? 261 MET A C   1 
ATOM   1725 O  O   . MET A 1 261 ? 21.57282 55.41999 11.46767  1.000 39.46912  ? 261 MET A O   1 
ATOM   1726 C  CB  . MET A 1 261 ? 22.11008 52.55897 12.10579  1.000 23.41542  ? 261 MET A CB  1 
ATOM   1727 C  CG  . MET A 1 261 ? 23.38533 52.86505 12.83235  1.000 23.46007  ? 261 MET A CG  1 
ATOM   1728 S  SD  . MET A 1 261 ? 24.81772 52.11677 12.02062  1.000 35.68005  ? 261 MET A SD  1 
ATOM   1729 C  CE  . MET A 1 261 ? 26.01575 52.25918 13.33633  1.000 35.68906  ? 261 MET A CE  1 
ATOM   1730 N  N   . MET A 1 262 ? 21.18554 55.50443 13.69422  1.000 38.73902  ? 262 MET A N   1 
ATOM   1731 C  CA  . MET A 1 262 ? 21.45774 56.93109 13.84931  1.000 39.17891  ? 262 MET A CA  1 
ATOM   1732 C  C   . MET A 1 262 ? 22.75178 57.10945 14.64607  1.000 36.78661  ? 262 MET A C   1 
ATOM   1733 O  O   . MET A 1 262 ? 22.75425 56.97225 15.86825  1.000 33.70085  ? 262 MET A O   1 
ATOM   1734 C  CB  . MET A 1 262 ? 20.28672 57.61915 14.54395  1.000 33.70768  ? 262 MET A CB  1 
ATOM   1735 C  CG  . MET A 1 262 ? 18.97274 57.58988 13.77262  1.000 35.01626  ? 262 MET A CG  1 
ATOM   1736 S  SD  . MET A 1 262 ? 17.60672 58.21295 14.77136  1.000 37.88751  ? 262 MET A SD  1 
ATOM   1737 C  CE  . MET A 1 262 ? 16.86018 56.68822 15.25075  1.000 38.16070  ? 262 MET A CE  1 
ATOM   1738 N  N   . GLN A 1 263 ? 23.84710 57.43865 13.96061  1.000 35.82885  ? 263 GLN A N   1 
ATOM   1739 C  CA  . GLN A 1 263 ? 25.12795 57.71569 14.61799  1.000 28.92372  ? 263 GLN A CA  1 
ATOM   1740 C  C   . GLN A 1 263 ? 25.20050 59.20093 14.96498  1.000 36.42426  ? 263 GLN A C   1 
ATOM   1741 O  O   . GLN A 1 263 ? 25.26120 60.05490 14.06887  1.000 40.62076  ? 263 GLN A O   1 
ATOM   1742 C  CB  . GLN A 1 263 ? 26.30266 57.31402 13.72126  1.000 24.04590  ? 263 GLN A CB  1 
ATOM   1743 C  CG  . GLN A 1 263 ? 26.01875 56.05853 12.86983  1.000 24.32373  ? 263 GLN A CG  1 
ATOM   1744 C  CD  . GLN A 1 263 ? 27.17028 55.68194 11.93696  1.000 25.91041  ? 263 GLN A CD  1 
ATOM   1745 O  OE1 . GLN A 1 263 ? 28.22226 56.33408 11.91770  1.000 23.57639  ? 263 GLN A OE1 1 
ATOM   1746 N  NE2 . GLN A 1 263 ? 26.97236 54.62179 11.15614  1.000 27.04152  ? 263 GLN A NE2 1 
ATOM   1747 N  N   . SER A 1 264 ? 25.18752 59.51021 16.26458  1.000 36.41081  ? 264 SER A N   1 
ATOM   1748 C  CA  . SER A 1 264 ? 25.46931 60.85729 16.76551  1.000 24.45410  ? 264 SER A CA  1 
ATOM   1749 C  C   . SER A 1 264 ? 24.57046 61.91952 16.13499  1.000 33.42621  ? 264 SER A C   1 
ATOM   1750 O  O   . SER A 1 264 ? 25.02610 62.99582 15.75200  1.000 45.35857  ? 264 SER A O   1 
ATOM   1751 C  CB  . SER A 1 264 ? 26.93706 61.20759 16.54388  1.000 24.31999  ? 264 SER A CB  1 
ATOM   1752 O  OG  . SER A 1 264 ? 27.77724 60.30878 17.25430  1.000 36.55443  ? 264 SER A OG  1 
ATOM   1753 N  N   . GLY A 1 265 ? 23.28323 61.62364 16.02784  1.000 28.87810  ? 265 GLY A N   1 
ATOM   1754 C  CA  . GLY A 1 265 ? 22.39740 62.59416 15.41259  1.000 23.38929  ? 265 GLY A CA  1 
ATOM   1755 C  C   . GLY A 1 265 ? 20.92875 62.24811 15.54412  1.000 33.53047  ? 265 GLY A C   1 
ATOM   1756 O  O   . GLY A 1 265 ? 20.46827 61.22273 15.01785  1.000 36.93319  ? 265 GLY A O   1 
ATOM   1757 N  N   . THR A 1 266 ? 20.18294 63.09644 16.25233  1.000 26.60169  ? 266 THR A N   1 
ATOM   1758 C  CA  . THR A 1 266 ? 18.75617 62.89556 16.45236  1.000 28.94735  ? 266 THR A CA  1 
ATOM   1759 C  C   . THR A 1 266 ? 18.06342 64.24547 16.33040  1.000 32.07668  ? 266 THR A C   1 
ATOM   1760 O  O   . THR A 1 266 ? 18.62560 65.27886 16.70881  1.000 25.91319  ? 266 THR A O   1 
ATOM   1761 C  CB  . THR A 1 266 ? 18.44730 62.24513 17.82559  1.000 30.39175  ? 266 THR A CB  1 
ATOM   1762 O  OG1 . THR A 1 266 ? 19.04846 63.00722 18.87790  1.000 39.09392  ? 266 THR A OG1 1 
ATOM   1763 C  CG2 . THR A 1 266 ? 18.99734 60.83309 17.90769  1.000 23.47439  ? 266 THR A CG2 1 
ATOM   1764 N  N   . MET A 1 267 ? 16.82553 64.22102 15.81633  1.000 37.92855  ? 267 MET A N   1 
ATOM   1765 C  CA  . MET A 1 267 ? 16.07848 65.44197 15.49481  1.000 39.09811  ? 267 MET A CA  1 
ATOM   1766 C  C   . MET A 1 267 ? 15.75686 66.31390 16.71358  1.000 44.38774  ? 267 MET A C   1 
ATOM   1767 O  O   . MET A 1 267 ? 15.37656 67.47706 16.53800  1.000 51.69354  ? 267 MET A O   1 
ATOM   1768 C  CB  . MET A 1 267 ? 14.76557 65.07403 14.80685  1.000 40.51103  ? 267 MET A CB  1 
ATOM   1769 C  CG  . MET A 1 267 ? 14.89498 64.58959 13.39174  1.000 51.41155  ? 267 MET A CG  1 
ATOM   1770 S  SD  . MET A 1 267 ? 15.01505 65.97072 12.25399  1.000 53.20229  ? 267 MET A SD  1 
ATOM   1771 C  CE  . MET A 1 267 ? 13.73707 67.03094 12.92321  1.000 52.44749  ? 267 MET A CE  1 
ATOM   1772 N  N   . ASN A 1 268 ? 15.85723 65.78711 17.93838  1.000 34.35781  ? 268 ASN A N   1 
ATOM   1773 C  CA  . ASN A 1 268 ? 15.60780 66.61474 19.12094  1.000 34.91648  ? 268 ASN A CA  1 
ATOM   1774 C  C   . ASN A 1 268 ? 16.80897 67.46167 19.51308  1.000 29.59864  ? 268 ASN A C   1 
ATOM   1775 O  O   . ASN A 1 268 ? 16.63903 68.40332 20.29495  1.000 34.28827  ? 268 ASN A O   1 
ATOM   1776 C  CB  . ASN A 1 268 ? 15.17693 65.75878 20.32680  1.000 27.20382  ? 268 ASN A CB  1 
ATOM   1777 C  CG  . ASN A 1 268 ? 16.22835 64.74475 20.73568  1.000 40.85195  ? 268 ASN A CG  1 
ATOM   1778 O  OD1 . ASN A 1 268 ? 16.89491 64.13419 19.88596  1.000 49.97694  ? 268 ASN A OD1 1 
ATOM   1779 N  ND2 . ASN A 1 268 ? 16.37712 64.54559 22.03895  1.000 32.37750  ? 268 ASN A ND2 1 
ATOM   1780 N  N   . ALA A 1 269 ? 17.99773 67.14923 18.99252  1.000 25.58693  ? 269 ALA A N   1 
ATOM   1781 C  CA  . ALA A 1 269 ? 19.18195 67.95952 19.23390  1.000 35.17244  ? 269 ALA A CA  1 
ATOM   1782 C  C   . ALA A 1 269 ? 18.94985 69.40303 18.77270  1.000 39.92717  ? 269 ALA A C   1 
ATOM   1783 O  O   . ALA A 1 269 ? 18.22989 69.63886 17.79508  1.000 39.62558  ? 269 ALA A O   1 
ATOM   1784 C  CB  . ALA A 1 269 ? 20.38399 67.35250 18.50075  1.000 25.10358  ? 269 ALA A CB  1 
ATOM   1785 N  N   . PRO A 1 270 ? 19.56982 70.39067 19.44270  1.000 40.47457  ? 270 PRO A N   1 
ATOM   1786 C  CA  . PRO A 1 270 ? 19.28735 71.80681 19.10184  1.000 35.40325  ? 270 PRO A CA  1 
ATOM   1787 C  C   . PRO A 1 270 ? 19.64108 72.19683 17.67947  1.000 38.33987  ? 270 PRO A C   1 
ATOM   1788 O  O   . PRO A 1 270 ? 18.93961 73.01004 17.06785  1.000 50.22710  ? 270 PRO A O   1 
ATOM   1789 C  CB  . PRO A 1 270 ? 20.14318 72.58590 20.10607  1.000 32.26534  ? 270 PRO A CB  1 
ATOM   1790 C  CG  . PRO A 1 270 ? 20.37494 71.61481 21.24759  1.000 34.02995  ? 270 PRO A CG  1 
ATOM   1791 C  CD  . PRO A 1 270 ? 20.47991 70.26697 20.59371  1.000 39.63714  ? 270 PRO A CD  1 
ATOM   1792 N  N   . TRP A 1 271 ? 20.72531 71.66022 17.14064  1.000 38.18780  ? 271 TRP A N   1 
ATOM   1793 C  CA  . TRP A 1 271 ? 21.17841 72.04546 15.81528  1.000 37.72064  ? 271 TRP A CA  1 
ATOM   1794 C  C   . TRP A 1 271 ? 20.35413 71.41949 14.70760  1.000 42.26678  ? 271 TRP A C   1 
ATOM   1795 O  O   . TRP A 1 271 ? 20.56211 71.75961 13.53856  1.000 40.82141  ? 271 TRP A O   1 
ATOM   1796 C  CB  . TRP A 1 271 ? 22.63580 71.63998 15.62966  1.000 41.81787  ? 271 TRP A CB  1 
ATOM   1797 C  CG  . TRP A 1 271 ? 22.90729 70.19200 15.98301  1.000 47.76274  ? 271 TRP A CG  1 
ATOM   1798 C  CD1 . TRP A 1 271 ? 23.34478 69.69951 17.18865  1.000 45.15143  ? 271 TRP A CD1 1 
ATOM   1799 C  CD2 . TRP A 1 271 ? 22.77055 69.06152 15.11929  1.000 46.50796  ? 271 TRP A CD2 1 
ATOM   1800 N  NE1 . TRP A 1 271 ? 23.48240 68.33088 17.12230  1.000 41.74204  ? 271 TRP A NE1 1 
ATOM   1801 C  CE2 . TRP A 1 271 ? 23.14352 67.91655 15.86138  1.000 41.02915  ? 271 TRP A CE2 1 
ATOM   1802 C  CE3 . TRP A 1 271 ? 22.36362 68.90241 13.79276  1.000 42.90722  ? 271 TRP A CE3 1 
ATOM   1803 C  CZ2 . TRP A 1 271 ? 23.11972 66.63559 15.31784  1.000 40.12122  ? 271 TRP A CZ2 1 
ATOM   1804 C  CZ3 . TRP A 1 271 ? 22.34254 67.62693 13.25628  1.000 42.52982  ? 271 TRP A CZ3 1 
ATOM   1805 C  CH2 . TRP A 1 271 ? 22.72386 66.51152 14.01501  1.000 41.02988  ? 271 TRP A CH2 1 
ATOM   1806 N  N   . SER A 1 272 ? 19.43274 70.52604 15.05040  1.000 38.83283  ? 272 SER A N   1 
ATOM   1807 C  CA  . SER A 1 272 ? 18.77380 69.65125 14.09805  1.000 28.76577  ? 272 SER A CA  1 
ATOM   1808 C  C   . SER A 1 272 ? 17.34247 70.06364 13.78728  1.000 36.15553  ? 272 SER A C   1 
ATOM   1809 O  O   . SER A 1 272 ? 16.63916 69.33530 13.07843  1.000 39.55026  ? 272 SER A O   1 
ATOM   1810 C  CB  . SER A 1 272 ? 18.78851 68.22387 14.63905  1.000 30.83681  ? 272 SER A CB  1 
ATOM   1811 O  OG  . SER A 1 272 ? 18.57728 67.30485 13.60140  1.000 39.62588  ? 272 SER A OG  1 
ATOM   1812 N  N   . HIS A 1 273 ? 16.87595 71.18754 14.31809  1.000 42.56490  ? 273 HIS A N   1 
ATOM   1813 C  CA  . HIS A 1 273 ? 15.52954 71.63697 14.00086  1.000 41.46750  ? 273 HIS A CA  1 
ATOM   1814 C  C   . HIS A 1 273 ? 15.46960 73.13836 14.20382  1.000 40.11990  ? 273 HIS A C   1 
ATOM   1815 O  O   . HIS A 1 273 ? 16.30569 73.72378 14.89959  1.000 34.94098  ? 273 HIS A O   1 
ATOM   1816 C  CB  . HIS A 1 273 ? 14.46791 70.91760 14.84206  1.000 36.13284  ? 273 HIS A CB  1 
ATOM   1817 C  CG  . HIS A 1 273 ? 14.55848 71.20616 16.29548  1.000 41.85178  ? 273 HIS A CG  1 
ATOM   1818 N  ND1 . HIS A 1 273 ? 15.52086 70.64126 17.10262  1.000 45.08938  ? 273 HIS A ND1 1 
ATOM   1819 C  CD2 . HIS A 1 273 ? 13.81332 72.00443 17.09589  1.000 49.41319  ? 273 HIS A CD2 1 
ATOM   1820 C  CE1 . HIS A 1 273 ? 15.36856 71.08255 18.34162  1.000 44.54982  ? 273 HIS A CE1 1 
ATOM   1821 N  NE2 . HIS A 1 273 ? 14.33976 71.91030 18.36353  1.000 44.49108  ? 273 HIS A NE2 1 
ATOM   1822 N  N   . MET A 1 274 ? 14.49024 73.75628 13.55191  1.000 40.90902  ? 274 MET A N   1 
ATOM   1823 C  CA  . MET A 1 274 ? 14.38092 75.20417 13.55207  1.000 41.47847  ? 274 MET A CA  1 
ATOM   1824 C  C   . MET A 1 274 ? 12.92980 75.58221 13.29631  1.000 53.60280  ? 274 MET A C   1 
ATOM   1825 O  O   . MET A 1 274 ? 12.25588 74.95554 12.46814  1.000 57.51379  ? 274 MET A O   1 
ATOM   1826 C  CB  . MET A 1 274 ? 15.29912 75.80732 12.49033  1.000 37.71241  ? 274 MET A CB  1 
ATOM   1827 C  CG  . MET A 1 274 ? 15.15976 77.29990 12.30606  1.000 43.92698  ? 274 MET A CG  1 
ATOM   1828 S  SD  . MET A 1 274 ? 16.25608 77.89414 11.00349  1.000 50.84705  ? 274 MET A SD  1 
ATOM   1829 C  CE  . MET A 1 274 ? 17.87050 77.58788 11.71031  1.000 49.14227  ? 274 MET A CE  1 
ATOM   1830 N  N   . THR A 1 275 ? 12.45317 76.59405 14.02033  1.000 54.48632  ? 275 THR A N   1 
ATOM   1831 C  CA  . THR A 1 275 ? 11.08625 77.06537 13.83523  1.000 52.93324  ? 275 THR A CA  1 
ATOM   1832 C  C   . THR A 1 275 ? 10.87467 77.61572 12.43084  1.000 43.12401  ? 275 THR A C   1 
ATOM   1833 O  O   . THR A 1 275 ? 11.79894 78.12173 11.79100  1.000 38.56216  ? 275 THR A O   1 
ATOM   1834 C  CB  . THR A 1 275 ? 10.76874 78.17342 14.82174  1.000 54.59210  ? 275 THR A CB  1 
ATOM   1835 O  OG1 . THR A 1 275 ? 11.76465 79.19941 14.68666  1.000 61.14376  ? 275 THR A OG1 1 
ATOM   1836 C  CG2 . THR A 1 275 ? 10.74674 77.63626 16.23929  1.000 36.23669  ? 275 THR A CG2 1 
ATOM   1837 N  N   . SER A 1 276 ? 9.62982  77.52439 11.96208  1.000 40.82978  ? 276 SER A N   1 
ATOM   1838 C  CA  . SER A 1 276 ? 9.20394  78.31168 10.80715  1.000 43.39824  ? 276 SER A CA  1 
ATOM   1839 C  C   . SER A 1 276 ? 9.69411  79.75098 10.90356  1.000 46.77620  ? 276 SER A C   1 
ATOM   1840 O  O   . SER A 1 276 ? 10.33301 80.26119 9.97812   1.000 47.26503  ? 276 SER A O   1 
ATOM   1841 C  CB  . SER A 1 276 ? 7.67889  78.28219 10.68352  1.000 41.48707  ? 276 SER A CB  1 
ATOM   1842 O  OG  . SER A 1 276 ? 7.24838  78.77810 9.43169   1.000 43.51130  ? 276 SER A OG  1 
ATOM   1843 N  N   . GLU A 1 277 ? 9.41731  80.41459 12.03346  1.000 50.30432  ? 277 GLU A N   1 
ATOM   1844 C  CA  . GLU A 1 277 ? 9.69480  81.84457 12.15039  1.000 48.72378  ? 277 GLU A CA  1 
ATOM   1845 C  C   . GLU A 1 277 ? 11.17882 82.15111 12.04017  1.000 40.63935  ? 277 GLU A C   1 
ATOM   1846 O  O   . GLU A 1 277 ? 11.55266 83.15929 11.43222  1.000 42.74050  ? 277 GLU A O   1 
ATOM   1847 C  CB  . GLU A 1 277 ? 9.14275  82.38836 13.46885  1.000 63.55710  ? 277 GLU A CB  1 
ATOM   1848 C  CG  . GLU A 1 277 ? 7.62834  82.47012 13.50508  1.000 75.77066  ? 277 GLU A CG  1 
ATOM   1849 C  CD  . GLU A 1 277 ? 6.95829  81.16256 13.92637  1.000 82.27219  ? 277 GLU A CD  1 
ATOM   1850 O  OE1 . GLU A 1 277 ? 5.77894  81.22630 14.33122  1.000 87.18710  ? 277 GLU A OE1 1 
ATOM   1851 O  OE2 . GLU A 1 277 ? 7.59139  80.08006 13.84849  1.000 79.71377  ? 277 GLU A OE2 1 
ATOM   1852 N  N   . LYS A 1 278 ? 12.04093 81.31081 12.60981  1.000 45.44566  ? 278 LYS A N   1 
ATOM   1853 C  CA  . LYS A 1 278 ? 13.46671 81.57893 12.47962  1.000 51.64430  ? 278 LYS A CA  1 
ATOM   1854 C  C   . LYS A 1 278 ? 13.90387 81.41716 11.03406  1.000 46.55555  ? 278 LYS A C   1 
ATOM   1855 O  O   . LYS A 1 278 ? 14.59180 82.28588 10.48640  1.000 52.34794  ? 278 LYS A O   1 
ATOM   1856 C  CB  . LYS A 1 278 ? 14.28180 80.66873 13.40167  1.000 51.95968  ? 278 LYS A CB  1 
ATOM   1857 C  CG  . LYS A 1 278 ? 15.56129 81.32871 13.92398  1.000 55.41179  ? 278 LYS A CG  1 
ATOM   1858 C  CD  . LYS A 1 278 ? 15.34990 81.87447 15.33176  1.000 68.36644  ? 278 LYS A CD  1 
ATOM   1859 C  CE  . LYS A 1 278 ? 14.82569 80.76056 16.26479  1.000 74.86118  ? 278 LYS A CE  1 
ATOM   1860 N  NZ  . LYS A 1 278 ? 14.64333 81.15504 17.70007  1.000 75.04326  ? 278 LYS A NZ  1 
ATOM   1861 N  N   . ALA A 1 279 ? 13.49010 80.31590 10.39544  1.000 35.49648  ? 279 ALA A N   1 
ATOM   1862 C  CA  . ALA A 1 279 ? 13.81843 80.10120 8.98890   1.000 47.16267  ? 279 ALA A CA  1 
ATOM   1863 C  C   . ALA A 1 279 ? 13.35797 81.27514 8.12471   1.000 52.43329  ? 279 ALA A C   1 
ATOM   1864 O  O   . ALA A 1 279 ? 14.10062 81.73193 7.24541   1.000 44.42264  ? 279 ALA A O   1 
ATOM   1865 C  CB  . ALA A 1 279 ? 13.20724 78.78585 8.49471   1.000 32.65840  ? 279 ALA A CB  1 
ATOM   1866 N  N   . VAL A 1 280 ? 12.15352 81.80097 8.37297   1.000 37.16585  ? 280 VAL A N   1 
ATOM   1867 C  CA  . VAL A 1 280 ? 11.69192 82.92908 7.57411   1.000 47.15800  ? 280 VAL A CA  1 
ATOM   1868 C  C   . VAL A 1 280 ? 12.63612 84.10690 7.74593   1.000 47.85971  ? 280 VAL A C   1 
ATOM   1869 O  O   . VAL A 1 280 ? 13.06174 84.72124 6.76450   1.000 49.36657  ? 280 VAL A O   1 
ATOM   1870 C  CB  . VAL A 1 280 ? 10.24108 83.30119 7.92369   1.000 49.52704  ? 280 VAL A CB  1 
ATOM   1871 C  CG1 . VAL A 1 280 ? 9.84496  84.63847 7.25004   1.000 42.93481  ? 280 VAL A CG1 1 
ATOM   1872 C  CG2 . VAL A 1 280 ? 9.29983  82.19072 7.48889   1.000 45.21419  ? 280 VAL A CG2 1 
ATOM   1873 N  N   . GLU A 1 281 ? 13.02187 84.40478 8.99178   1.000 49.79693  ? 281 GLU A N   1 
ATOM   1874 C  CA  . GLU A 1 281 ? 13.93158 85.52429 9.21958   1.000 57.28082  ? 281 GLU A CA  1 
ATOM   1875 C  C   . GLU A 1 281 ? 15.28973 85.27236 8.57571   1.000 50.33441  ? 281 GLU A C   1 
ATOM   1876 O  O   . GLU A 1 281 ? 15.82067 86.14436 7.87832   1.000 55.18967  ? 281 GLU A O   1 
ATOM   1877 C  CB  . GLU A 1 281 ? 14.07560 85.81751 10.71830  1.000 71.81577  ? 281 GLU A CB  1 
ATOM   1878 C  CG  . GLU A 1 281 ? 12.73356 85.98207 11.46669  1.000 96.78218  ? 281 GLU A CG  1 
ATOM   1879 C  CD  . GLU A 1 281 ? 12.80303 85.77490 13.00461  1.000 108.70781 ? 281 GLU A CD  1 
ATOM   1880 O  OE1 . GLU A 1 281 ? 13.85634 85.35431 13.53639  1.000 106.88214 ? 281 GLU A OE1 1 
ATOM   1881 O  OE2 . GLU A 1 281 ? 11.77424 86.01595 13.68323  1.000 108.50535 ? 281 GLU A OE2 1 
ATOM   1882 N  N   . ILE A 1 282 ? 15.85638 84.08134 8.77243   1.000 40.90347  ? 282 ILE A N   1 
ATOM   1883 C  CA  . ILE A 1 282 ? 17.11827 83.74187 8.11464   1.000 48.73746  ? 282 ILE A CA  1 
ATOM   1884 C  C   . ILE A 1 282 ? 16.96525 83.80579 6.60496   1.000 52.65735  ? 282 ILE A C   1 
ATOM   1885 O  O   . ILE A 1 282 ? 17.83883 84.32139 5.88970   1.000 49.87712  ? 282 ILE A O   1 
ATOM   1886 C  CB  . ILE A 1 282 ? 17.59023 82.34692 8.55188   1.000 46.57035  ? 282 ILE A CB  1 
ATOM   1887 C  CG1 . ILE A 1 282 ? 18.32133 82.42781 9.89680   1.000 43.53250  ? 282 ILE A CG1 1 
ATOM   1888 C  CG2 . ILE A 1 282 ? 18.44031 81.70377 7.43178   1.000 43.16620  ? 282 ILE A CG2 1 
ATOM   1889 C  CD1 . ILE A 1 282 ? 18.20182 81.17386 10.69791  1.000 40.58132  ? 282 ILE A CD1 1 
ATOM   1890 N  N   . GLY A 1 283 ? 15.85489 83.27490 6.09972   1.000 51.12494  ? 283 GLY A N   1 
ATOM   1891 C  CA  . GLY A 1 283 ? 15.55785 83.30797 4.68789   1.000 50.68720  ? 283 GLY A CA  1 
ATOM   1892 C  C   . GLY A 1 283 ? 15.54325 84.70418 4.11006   1.000 47.51909  ? 283 GLY A C   1 
ATOM   1893 O  O   . GLY A 1 283 ? 16.19904 84.95480 3.09340   1.000 47.44870  ? 283 GLY A O   1 
ATOM   1894 N  N   . LYS A 1 284 ? 14.81241 85.62758 4.74246   1.000 47.86882  ? 284 LYS A N   1 
ATOM   1895 C  CA  . LYS A 1 284 ? 14.66761 86.94211 4.13372   1.000 55.06210  ? 284 LYS A CA  1 
ATOM   1896 C  C   . LYS A 1 284 ? 15.94128 87.76271 4.27798   1.000 60.52030  ? 284 LYS A C   1 
ATOM   1897 O  O   . LYS A 1 284 ? 16.18234 88.67347 3.47027   1.000 60.11555  ? 284 LYS A O   1 
ATOM   1898 C  CB  . LYS A 1 284 ? 13.44321 87.67943 4.70119   1.000 47.79893  ? 284 LYS A CB  1 
ATOM   1899 C  CG  . LYS A 1 284 ? 13.59696 88.22518 6.06960   1.000 76.53550  ? 284 LYS A CG  1 
ATOM   1900 C  CD  . LYS A 1 284 ? 12.47681 89.21032 6.38657   1.000 86.93850  ? 284 LYS A CD  1 
ATOM   1901 C  CE  . LYS A 1 284 ? 11.10414 88.75519 5.91194   1.000 82.39523  ? 284 LYS A CE  1 
ATOM   1902 N  NZ  . LYS A 1 284 ? 10.04437 89.39831 6.76009   1.000 86.42537  ? 284 LYS A NZ  1 
ATOM   1903 N  N   . ALA A 1 285 ? 16.78067 87.42603 5.25843   1.000 56.95108  ? 285 ALA A N   1 
ATOM   1904 C  CA  . ALA A 1 285 ? 18.08906 88.06017 5.35985   1.000 60.37425  ? 285 ALA A CA  1 
ATOM   1905 C  C   . ALA A 1 285 ? 18.96888 87.66044 4.18070   1.000 53.01389  ? 285 ALA A C   1 
ATOM   1906 O  O   . ALA A 1 285 ? 19.61365 88.51315 3.56150   1.000 51.19842  ? 285 ALA A O   1 
ATOM   1907 C  CB  . ALA A 1 285 ? 18.74820 87.70220 6.69767   1.000 48.87249  ? 285 ALA A CB  1 
ATOM   1908 N  N   . LEU A 1 286 ? 18.99432 86.36481 3.84873   1.000 48.42039  ? 286 LEU A N   1 
ATOM   1909 C  CA  . LEU A 1 286 ? 19.67756 85.91256 2.63700   1.000 52.01472  ? 286 LEU A CA  1 
ATOM   1910 C  C   . LEU A 1 286 ? 19.15766 86.64201 1.40152   1.000 56.60479  ? 286 LEU A C   1 
ATOM   1911 O  O   . LEU A 1 286 ? 19.93818 87.06213 0.53793   1.000 53.69736  ? 286 LEU A O   1 
ATOM   1912 C  CB  . LEU A 1 286 ? 19.50804 84.39890 2.47747   1.000 44.21169  ? 286 LEU A CB  1 
ATOM   1913 C  CG  . LEU A 1 286 ? 19.94031 83.77361 1.15127   1.000 45.49082  ? 286 LEU A CG  1 
ATOM   1914 C  CD1 . LEU A 1 286 ? 21.41947 83.95939 0.89138   1.000 50.29788  ? 286 LEU A CD1 1 
ATOM   1915 C  CD2 . LEU A 1 286 ? 19.59394 82.29927 1.15268   1.000 39.53298  ? 286 LEU A CD2 1 
ATOM   1916 N  N   . ILE A 1 287 ? 17.83763 86.81259 1.31328   1.000 57.63809  ? 287 ILE A N   1 
ATOM   1917 C  CA  . ILE A 1 287 ? 17.24441 87.62208 0.25277   1.000 59.71491  ? 287 ILE A CA  1 
ATOM   1918 C  C   . ILE A 1 287 ? 17.88727 89.00271 0.21949   1.000 61.38174  ? 287 ILE A C   1 
ATOM   1919 O  O   . ILE A 1 287 ? 18.42522 89.43493 -0.80551  1.000 65.54629  ? 287 ILE A O   1 
ATOM   1920 C  CB  . ILE A 1 287 ? 15.72169 87.71985 0.44031   1.000 59.65546  ? 287 ILE A CB  1 
ATOM   1921 C  CG1 . ILE A 1 287 ? 15.11801 86.32237 0.57355   1.000 53.08355  ? 287 ILE A CG1 1 
ATOM   1922 C  CG2 . ILE A 1 287 ? 15.09161 88.45952 -0.71015  1.000 50.77484  ? 287 ILE A CG2 1 
ATOM   1923 C  CD1 . ILE A 1 287 ? 14.76616 85.69388 -0.71827  1.000 46.72626  ? 287 ILE A CD1 1 
ATOM   1924 N  N   . ASN A 1 288 ? 17.84512 89.71868 1.34299   1.000 60.54231  ? 288 ASN A N   1 
ATOM   1925 C  CA  . ASN A 1 288 ? 18.45640 91.04454 1.35795   1.000 60.65291  ? 288 ASN A CA  1 
ATOM   1926 C  C   . ASN A 1 288 ? 19.94620 90.95950 1.06260   1.000 61.81629  ? 288 ASN A C   1 
ATOM   1927 O  O   . ASN A 1 288 ? 20.48988 91.80051 0.34002   1.000 62.13966  ? 288 ASN A O   1 
ATOM   1928 C  CB  . ASN A 1 288 ? 18.22465 91.73306 2.69953   1.000 63.53363  ? 288 ASN A CB  1 
ATOM   1929 C  CG  . ASN A 1 288 ? 16.84650 92.35117 2.81417   1.000 64.67569  ? 288 ASN A CG  1 
ATOM   1930 O  OD1 . ASN A 1 288 ? 16.35169 92.98266 1.87654   1.000 64.89761  ? 288 ASN A OD1 1 
ATOM   1931 N  ND2 . ASN A 1 288 ? 16.21741 92.18001 3.98026   1.000 68.03091  ? 288 ASN A ND2 1 
ATOM   1932 N  N   . ASP A 1 289 ? 20.61736 89.93054 1.59049   1.000 65.03279  ? 289 ASP A N   1 
ATOM   1933 C  CA  . ASP A 1 289 ? 22.05837 89.77800 1.39400   1.000 73.88281  ? 289 ASP A CA  1 
ATOM   1934 C  C   . ASP A 1 289 ? 22.43076 89.51670 -0.06369  1.000 81.43285  ? 289 ASP A C   1 
ATOM   1935 O  O   . ASP A 1 289 ? 23.59407 89.70920 -0.43706  1.000 81.71375  ? 289 ASP A O   1 
ATOM   1936 C  CB  . ASP A 1 289 ? 22.60000 88.64964 2.27840   1.000 73.17862  ? 289 ASP A CB  1 
ATOM   1937 C  CG  . ASP A 1 289 ? 22.65951 89.03772 3.75086   1.000 81.51672  ? 289 ASP A CG  1 
ATOM   1938 O  OD1 . ASP A 1 289 ? 22.51960 90.24418 4.05458   1.000 79.91096  ? 289 ASP A OD1 1 
ATOM   1939 O  OD2 . ASP A 1 289 ? 22.82600 88.13273 4.60495   1.000 87.26269  ? 289 ASP A OD2 1 
ATOM   1940 N  N   . CYS A 1 290 ? 21.47889 89.08195 -0.89496  1.000 80.42223  ? 290 CYS A N   1 
ATOM   1941 C  CA  . CYS A 1 290 ? 21.69619 88.92768 -2.32943  1.000 74.51568  ? 290 CYS A CA  1 
ATOM   1942 C  C   . CYS A 1 290 ? 21.06840 90.04894 -3.15743  1.000 75.81504  ? 290 CYS A C   1 
ATOM   1943 O  O   . CYS A 1 290 ? 20.91266 89.89251 -4.37521  1.000 73.30789  ? 290 CYS A O   1 
ATOM   1944 C  CB  . CYS A 1 290 ? 21.16849 87.57765 -2.80537  1.000 67.43876  ? 290 CYS A CB  1 
ATOM   1945 S  SG  . CYS A 1 290 ? 21.79451 86.15319 -1.90209  1.000 61.95080  ? 290 CYS A SG  1 
ATOM   1946 N  N   . ASN A 1 291 ? 20.70383 91.16960 -2.52165  1.000 75.97632  ? 291 ASN A N   1 
ATOM   1947 C  CA  . ASN A 1 291 ? 20.18679 92.35696 -3.21384  1.000 82.78894  ? 291 ASN A CA  1 
ATOM   1948 C  C   . ASN A 1 291 ? 18.95032 92.03541 -4.05085  1.000 81.19250  ? 291 ASN A C   1 
ATOM   1949 O  O   . ASN A 1 291 ? 18.85288 92.41609 -5.22204  1.000 80.08312  ? 291 ASN A O   1 
ATOM   1950 C  CB  . ASN A 1 291 ? 21.26349 93.02222 -4.07393  1.000 92.24311  ? 291 ASN A CB  1 
ATOM   1951 C  CG  . ASN A 1 291 ? 22.56373 93.22034 -3.33039  1.000 103.31607 ? 291 ASN A CG  1 
ATOM   1952 O  OD1 . ASN A 1 291 ? 22.57490 93.48465 -2.12660  1.000 109.18725 ? 291 ASN A OD1 1 
ATOM   1953 N  ND2 . ASN A 1 291 ? 23.67450 93.09615 -4.04698  1.000 106.72896 ? 291 ASN A ND2 1 
ATOM   1954 N  N   . CYS A 1 292 ? 18.01574 91.30254 -3.44548  1.000 77.46241  ? 292 CYS A N   1 
ATOM   1955 C  CA  . CYS A 1 292 ? 16.61861 91.26175 -3.85949  1.000 72.45761  ? 292 CYS A CA  1 
ATOM   1956 C  C   . CYS A 1 292 ? 15.80695 91.83959 -2.70765  1.000 77.09419  ? 292 CYS A C   1 
ATOM   1957 O  O   . CYS A 1 292 ? 15.92705 91.37448 -1.56882  1.000 84.58971  ? 292 CYS A O   1 
ATOM   1958 C  CB  . CYS A 1 292 ? 16.18756 89.83573 -4.18887  1.000 63.95011  ? 292 CYS A CB  1 
ATOM   1959 S  SG  . CYS A 1 292 ? 17.40789 88.90997 -5.18802  1.000 65.20641  ? 292 CYS A SG  1 
ATOM   1960 N  N   . ASN A 1 293 ? 15.03290 92.88609 -2.98206  1.000 77.50361  ? 293 ASN A N   1 
ATOM   1961 C  CA  . ASN A 1 293 ? 14.35655 93.59775 -1.90160  1.000 76.94626  ? 293 ASN A CA  1 
ATOM   1962 C  C   . ASN A 1 293 ? 13.42126 92.66510 -1.12646  1.000 70.21089  ? 293 ASN A C   1 
ATOM   1963 O  O   . ASN A 1 293 ? 12.28364 92.42983 -1.54941  1.000 67.74404  ? 293 ASN A O   1 
ATOM   1964 C  CB  . ASN A 1 293 ? 13.57997 94.80021 -2.46114  1.000 85.80785  ? 293 ASN A CB  1 
ATOM   1965 C  CG  . ASN A 1 293 ? 14.49244 95.90861 -3.01983  1.000 93.17651  ? 293 ASN A CG  1 
ATOM   1966 O  OD1 . ASN A 1 293 ? 15.69971 95.92691 -2.76500  1.000 99.51835  ? 293 ASN A OD1 1 
ATOM   1967 N  ND2 . ASN A 1 293 ? 13.89867 96.85549 -3.76436  1.000 89.84358  ? 293 ASN A ND2 1 
ATOM   1968 N  N   . ALA A 1 294 ? 13.88599 92.11795 0.00594   1.000 64.69318  ? 294 ALA A N   1 
ATOM   1969 C  CA  . ALA A 1 294 ? 13.04405 91.21503 0.79002   1.000 58.99994  ? 294 ALA A CA  1 
ATOM   1970 C  C   . ALA A 1 294 ? 11.81264 91.91799 1.35236   1.000 66.66646  ? 294 ALA A C   1 
ATOM   1971 O  O   . ALA A 1 294 ? 10.81780 91.25495 1.66929   1.000 61.61750  ? 294 ALA A O   1 
ATOM   1972 C  CB  . ALA A 1 294 ? 13.84750 90.58096 1.92945   1.000 56.75899  ? 294 ALA A CB  1 
ATOM   1973 N  N   . SER A 1 295 ? 11.85029 93.24496 1.48208   1.000 73.10181  ? 295 SER A N   1 
ATOM   1974 C  CA  . SER A 1 295 ? 10.63529 93.97406 1.81847   1.000 77.90156  ? 295 SER A CA  1 
ATOM   1975 C  C   . SER A 1 295 ? 9.53940  93.74538 0.77835   1.000 76.79063  ? 295 SER A C   1 
ATOM   1976 O  O   . SER A 1 295 ? 8.34767  93.85755 1.09336   1.000 79.91138  ? 295 SER A O   1 
ATOM   1977 C  CB  . SER A 1 295 ? 10.94534 95.46607 1.95417   1.000 83.07158  ? 295 SER A CB  1 
ATOM   1978 O  OG  . SER A 1 295 ? 11.35310 96.02939 0.71460   1.000 83.97285  ? 295 SER A OG  1 
ATOM   1979 N  N   . MET A 1 296 ? 9.91085  93.41704 -0.45792  1.000 68.62032  ? 296 MET A N   1 
ATOM   1980 C  CA  . MET A 1 296 ? 8.90740  93.23520 -1.49477  1.000 66.50222  ? 296 MET A CA  1 
ATOM   1981 C  C   . MET A 1 296 ? 8.31062  91.83582 -1.49769  1.000 66.76194  ? 296 MET A C   1 
ATOM   1982 O  O   . MET A 1 296 ? 7.39233  91.57379 -2.28026  1.000 70.50894  ? 296 MET A O   1 
ATOM   1983 C  CB  . MET A 1 296 ? 9.50590  93.57422 -2.86198  1.000 69.22607  ? 296 MET A CB  1 
ATOM   1984 C  CG  . MET A 1 296 ? 9.26285  95.02230 -3.27731  1.000 83.14374  ? 296 MET A CG  1 
ATOM   1985 S  SD  . MET A 1 296 ? 10.10489 95.53512 -4.79152  1.000 93.60765  ? 296 MET A SD  1 
ATOM   1986 C  CE  . MET A 1 296 ? 9.62824  94.22398 -5.92434  1.000 88.59886  ? 296 MET A CE  1 
ATOM   1987 N  N   . LEU A 1 297 ? 8.78111  90.95400 -0.61413  1.000 68.49349  ? 297 LEU A N   1 
ATOM   1988 C  CA  . LEU A 1 297 ? 8.33220  89.56262 -0.61083  1.000 67.37774  ? 297 LEU A CA  1 
ATOM   1989 C  C   . LEU A 1 297 ? 6.81978  89.44725 -0.48493  1.000 74.19790  ? 297 LEU A C   1 
ATOM   1990 O  O   . LEU A 1 297 ? 6.20671  88.57660 -1.11082  1.000 64.84436  ? 297 LEU A O   1 
ATOM   1991 C  CB  . LEU A 1 297 ? 9.00221  88.80146 0.53314   1.000 60.94506  ? 297 LEU A CB  1 
ATOM   1992 C  CG  . LEU A 1 297 ? 9.88664  87.63335 0.12516   1.000 64.36644  ? 297 LEU A CG  1 
ATOM   1993 C  CD1 . LEU A 1 297 ? 10.23320 86.78648 1.30697   1.000 60.41525  ? 297 LEU A CD1 1 
ATOM   1994 C  CD2 . LEU A 1 297 ? 9.18097  86.80114 -0.93382  1.000 73.95398  ? 297 LEU A CD2 1 
ATOM   1995 N  N   . LYS A 1 298 ? 6.20128  90.30502 0.33277   1.000 89.06541  ? 298 LYS A N   1 
ATOM   1996 C  CA  . LYS A 1 298 ? 4.79573  90.10625 0.67944   1.000 92.31772  ? 298 LYS A CA  1 
ATOM   1997 C  C   . LYS A 1 298 ? 3.87116  90.52073 -0.46166  1.000 86.74240  ? 298 LYS A C   1 
ATOM   1998 O  O   . LYS A 1 298 ? 2.84401  89.87178 -0.69871  1.000 82.21464  ? 298 LYS A O   1 
ATOM   1999 C  CB  . LYS A 1 298 ? 4.45698  90.86683 1.96891   1.000 93.12196  ? 298 LYS A CB  1 
ATOM   2000 C  CG  . LYS A 1 298 ? 4.01018  89.97370 3.13314   1.000 90.12263  ? 298 LYS A CG  1 
ATOM   2001 C  CD  . LYS A 1 298 ? 2.86367  89.05954 2.69978   1.000 98.29511  ? 298 LYS A CD  1 
ATOM   2002 C  CE  . LYS A 1 298 ? 2.61114  87.92012 3.68834   1.000 106.16448 ? 298 LYS A CE  1 
ATOM   2003 N  NZ  . LYS A 1 298 ? 1.49279  87.01545 3.25093   1.000 103.52159 ? 298 LYS A NZ  1 
ATOM   2004 N  N   . THR A 1 299 ? 4.22646  91.57789 -1.19355  1.000 87.14558  ? 299 THR A N   1 
ATOM   2005 C  CA  . THR A 1 299 ? 3.33814  92.15675 -2.19673  1.000 83.61667  ? 299 THR A CA  1 
ATOM   2006 C  C   . THR A 1 299 ? 3.62626  91.68479 -3.61508  1.000 80.58788  ? 299 THR A C   1 
ATOM   2007 O  O   . THR A 1 299 ? 2.69395  91.54695 -4.40955  1.000 78.38235  ? 299 THR A O   1 
ATOM   2008 C  CB  . THR A 1 299 ? 3.40689  93.68622 -2.15289  1.000 80.46766  ? 299 THR A CB  1 
ATOM   2009 O  OG1 . THR A 1 299 ? 4.69109  94.12973 -2.61674  1.000 80.03643  ? 299 THR A OG1 1 
ATOM   2010 C  CG2 . THR A 1 299 ? 3.18121  94.16828 -0.73380  1.000 77.49323  ? 299 THR A CG2 1 
ATOM   2011 N  N   . ASN A 1 300 ? 4.88633  91.45503 -3.97251  1.000 78.27634  ? 300 ASN A N   1 
ATOM   2012 C  CA  . ASN A 1 300 ? 5.23600  90.91502 -5.28459  1.000 79.44840  ? 300 ASN A CA  1 
ATOM   2013 C  C   . ASN A 1 300 ? 6.19672  89.75069 -5.07105  1.000 63.77585  ? 300 ASN A C   1 
ATOM   2014 O  O   . ASN A 1 300 ? 7.40460  89.85743 -5.33113  1.000 59.19901  ? 300 ASN A O   1 
ATOM   2015 C  CB  . ASN A 1 300 ? 5.80333  91.99974 -6.20688  1.000 95.49399  ? 300 ASN A CB  1 
ATOM   2016 C  CG  . ASN A 1 300 ? 5.81365  91.57759 -7.68310  1.000 108.57528 ? 300 ASN A CG  1 
ATOM   2017 O  OD1 . ASN A 1 300 ? 6.12465  92.37944 -8.56700  1.000 113.39706 ? 300 ASN A OD1 1 
ATOM   2018 N  ND2 . ASN A 1 300 ? 5.48719  90.31060 -7.94810  1.000 107.56752 ? 300 ASN A ND2 1 
ATOM   2019 N  N   . PRO A 1 301 ? 5.67877  88.60438 -4.61775  1.000 56.01970  ? 301 PRO A N   1 
ATOM   2020 C  CA  . PRO A 1 301 ? 6.53206  87.41133 -4.48895  1.000 52.11117  ? 301 PRO A CA  1 
ATOM   2021 C  C   . PRO A 1 301 ? 7.22289  87.02136 -5.77632  1.000 61.64581  ? 301 PRO A C   1 
ATOM   2022 O  O   . PRO A 1 301 ? 8.43327  86.78036 -5.77768  1.000 67.02694  ? 301 PRO A O   1 
ATOM   2023 C  CB  . PRO A 1 301 ? 5.54575  86.31912 -4.04658  1.000 51.54929  ? 301 PRO A CB  1 
ATOM   2024 C  CG  . PRO A 1 301 ? 4.33379  87.02801 -3.56942  1.000 56.11623  ? 301 PRO A CG  1 
ATOM   2025 C  CD  . PRO A 1 301 ? 4.27054  88.32785 -4.29251  1.000 59.31990  ? 301 PRO A CD  1 
ATOM   2026 N  N   . ALA A 1 302 ? 6.47171  86.92458 -6.87444  1.000 65.10033  ? 302 ALA A N   1 
ATOM   2027 C  CA  . ALA A 1 302 ? 7.03759  86.41488 -8.11732  1.000 62.27421  ? 302 ALA A CA  1 
ATOM   2028 C  C   . ALA A 1 302 ? 8.32692  87.13940 -8.47681  1.000 67.95951  ? 302 ALA A C   1 
ATOM   2029 O  O   . ALA A 1 302 ? 9.29929  86.51063 -8.91324  1.000 74.46286  ? 302 ALA A O   1 
ATOM   2030 C  CB  . ALA A 1 302 ? 6.01356  86.53454 -9.24816  1.000 57.70584  ? 302 ALA A CB  1 
ATOM   2031 N  N   . HIS A 1 303 ? 8.37002  88.45583 -8.25126  1.000 66.06998  ? 303 HIS A N   1 
ATOM   2032 C  CA  . HIS A 1 303 ? 9.53962  89.23591 -8.63623  1.000 66.04916  ? 303 HIS A CA  1 
ATOM   2033 C  C   . HIS A 1 303 ? 10.75472 88.88567 -7.78400  1.000 64.71391  ? 303 HIS A C   1 
ATOM   2034 O  O   . HIS A 1 303 ? 11.86219 88.70452 -8.30811  1.000 65.21772  ? 303 HIS A O   1 
ATOM   2035 C  CB  . HIS A 1 303 ? 9.22925  90.72153 -8.52661  1.000 78.71580  ? 303 HIS A CB  1 
ATOM   2036 C  CG  . HIS A 1 303 ? 10.22329 91.58656 -9.22995  1.000 99.83673  ? 303 HIS A CG  1 
ATOM   2037 N  ND1 . HIS A 1 303 ? 11.35085 92.08007 -8.60944  1.000 104.98400 ? 303 HIS A ND1 1 
ATOM   2038 C  CD2 . HIS A 1 303 ? 10.26589 92.03722 -10.50624 1.000 106.27641 ? 303 HIS A CD2 1 
ATOM   2039 C  CE1 . HIS A 1 303 ? 12.04275 92.80215 -9.47252  1.000 109.66303 ? 303 HIS A CE1 1 
ATOM   2040 N  NE2 . HIS A 1 303 ? 11.40556 92.79296 -10.63035 1.000 108.59108 ? 303 HIS A NE2 1 
ATOM   2041 N  N   . VAL A 1 304 ? 10.56627 88.80311 -6.46315  1.000 57.12535  ? 304 VAL A N   1 
ATOM   2042 C  CA  . VAL A 1 304 ? 11.68114 88.55121 -5.54797  1.000 54.90991  ? 304 VAL A CA  1 
ATOM   2043 C  C   . VAL A 1 304 ? 12.27286 87.16838 -5.79697  1.000 58.02079  ? 304 VAL A C   1 
ATOM   2044 O  O   . VAL A 1 304 ? 13.49653 86.98099 -5.78946  1.000 56.93293  ? 304 VAL A O   1 
ATOM   2045 C  CB  . VAL A 1 304 ? 11.21371 88.72541 -4.08447  1.000 52.91754  ? 304 VAL A CB  1 
ATOM   2046 C  CG1 . VAL A 1 304 ? 12.19578 88.11733 -3.10830  1.000 50.91043  ? 304 VAL A CG1 1 
ATOM   2047 C  CG2 . VAL A 1 304 ? 10.99997 90.19709 -3.76903  1.000 59.13527  ? 304 VAL A CG2 1 
ATOM   2048 N  N   . MET A 1 305 ? 11.41624 86.17797 -6.02625  1.000 58.01144  ? 305 MET A N   1 
ATOM   2049 C  CA  . MET A 1 305 ? 11.91830 84.83956 -6.28453  1.000 52.43234  ? 305 MET A CA  1 
ATOM   2050 C  C   . MET A 1 305 ? 12.68766 84.80103 -7.58833  1.000 53.70536  ? 305 MET A C   1 
ATOM   2051 O  O   . MET A 1 305 ? 13.77444 84.21819 -7.64956  1.000 54.76526  ? 305 MET A O   1 
ATOM   2052 C  CB  . MET A 1 305 ? 10.76222 83.84581 -6.29554  1.000 52.38739  ? 305 MET A CB  1 
ATOM   2053 C  CG  . MET A 1 305 ? 10.11121 83.71539 -4.92594  1.000 55.89183  ? 305 MET A CG  1 
ATOM   2054 S  SD  . MET A 1 305 ? 11.27324 83.13602 -3.67432  1.000 54.10326  ? 305 MET A SD  1 
ATOM   2055 C  CE  . MET A 1 305 ? 11.70683 81.52054 -4.30165  1.000 49.48850  ? 305 MET A CE  1 
ATOM   2056 N  N   . SER A 1 306 ? 12.14121 85.42530 -8.63832  1.000 60.52316  ? 306 SER A N   1 
ATOM   2057 C  CA  . SER A 1 306 ? 12.85418 85.50595 -9.91022  1.000 66.47763  ? 306 SER A CA  1 
ATOM   2058 C  C   . SER A 1 306 ? 14.24730 86.08478 -9.71819  1.000 65.15514  ? 306 SER A C   1 
ATOM   2059 O  O   . SER A 1 306 ? 15.22208 85.59744 -10.30377 1.000 68.60487  ? 306 SER A O   1 
ATOM   2060 C  CB  . SER A 1 306 ? 12.06733 86.34824 -10.91289 1.000 69.78738  ? 306 SER A CB  1 
ATOM   2061 O  OG  . SER A 1 306 ? 12.87948 86.65713 -12.03297 1.000 77.82541  ? 306 SER A OG  1 
ATOM   2062 N  N   . CYS A 1 307 ? 14.36193 87.11547 -8.88213  1.000 58.56178  ? 307 CYS A N   1 
ATOM   2063 C  CA  . CYS A 1 307 ? 15.67203 87.66599 -8.55869  1.000 61.98357  ? 307 CYS A CA  1 
ATOM   2064 C  C   . CYS A 1 307 ? 16.57369 86.61488 -7.91277  1.000 66.40814  ? 307 CYS A C   1 
ATOM   2065 O  O   . CYS A 1 307 ? 17.74333 86.47461 -8.28642  1.000 68.71647  ? 307 CYS A O   1 
ATOM   2066 C  CB  . CYS A 1 307 ? 15.50647 88.87366 -7.63716  1.000 59.60291  ? 307 CYS A CB  1 
ATOM   2067 S  SG  . CYS A 1 307 ? 17.06695 89.61723 -7.08438  1.000 66.63585  ? 307 CYS A SG  1 
ATOM   2068 N  N   . MET A 1 308 ? 16.03512 85.85190 -6.95451  1.000 59.85506  ? 308 MET A N   1 
ATOM   2069 C  CA  . MET A 1 308 ? 16.82600 84.85094 -6.24436  1.000 60.99284  ? 308 MET A CA  1 
ATOM   2070 C  C   . MET A 1 308 ? 17.24464 83.69714 -7.14619  1.000 64.06284  ? 308 MET A C   1 
ATOM   2071 O  O   . MET A 1 308 ? 18.31180 83.10755 -6.93701  1.000 68.20031  ? 308 MET A O   1 
ATOM   2072 C  CB  . MET A 1 308 ? 16.03446 84.32476 -5.05351  1.000 58.68123  ? 308 MET A CB  1 
ATOM   2073 C  CG  . MET A 1 308 ? 15.88173 85.34519 -3.96560  1.000 57.69500  ? 308 MET A CG  1 
ATOM   2074 S  SD  . MET A 1 308 ? 17.49201 85.87164 -3.37458  1.000 51.82072  ? 308 MET A SD  1 
ATOM   2075 C  CE  . MET A 1 308 ? 18.02556 84.36547 -2.55147  1.000 43.92925  ? 308 MET A CE  1 
ATOM   2076 N  N   . ARG A 1 309 ? 16.42932 83.35805 -8.14329  1.000 62.66032  ? 309 ARG A N   1 
ATOM   2077 C  CA  . ARG A 1 309 ? 16.80648 82.34771 -9.12248  1.000 60.95056  ? 309 ARG A CA  1 
ATOM   2078 C  C   . ARG A 1 309 ? 17.74971 82.88293 -10.18828 1.000 62.23701  ? 309 ARG A C   1 
ATOM   2079 O  O   . ARG A 1 309 ? 18.20434 82.09904 -11.02632 1.000 61.37316  ? 309 ARG A O   1 
ATOM   2080 C  CB  . ARG A 1 309 ? 15.55871 81.76049 -9.77946  1.000 59.39630  ? 309 ARG A CB  1 
ATOM   2081 C  CG  . ARG A 1 309 ? 14.59613 81.18584 -8.77233  1.000 58.27059  ? 309 ARG A CG  1 
ATOM   2082 C  CD  . ARG A 1 309 ? 13.87534 79.97037 -9.31058  1.000 56.72215  ? 309 ARG A CD  1 
ATOM   2083 N  NE  . ARG A 1 309 ? 13.10155 79.30381 -8.26813  1.000 52.18999  ? 309 ARG A NE  1 
ATOM   2084 C  CZ  . ARG A 1 309 ? 11.87821 79.67697 -7.90571  1.000 52.54279  ? 309 ARG A CZ  1 
ATOM   2085 N  NH1 . ARG A 1 309 ? 11.30085 80.70663 -8.51019  1.000 50.40646  ? 309 ARG A NH1 1 
ATOM   2086 N  NH2 . ARG A 1 309 ? 11.23203 79.02536 -6.94356  1.000 54.59873  ? 309 ARG A NH2 1 
ATOM   2087 N  N   . SER A 1 310 ? 18.05185 84.18608 -10.17942 1.000 64.38323  ? 310 SER A N   1 
ATOM   2088 C  CA  . SER A 1 310 ? 19.02009 84.76719 -11.10349 1.000 66.96884  ? 310 SER A CA  1 
ATOM   2089 C  C   . SER A 1 310 ? 20.40815 84.91418 -10.50032 1.000 66.57137  ? 310 SER A C   1 
ATOM   2090 O  O   . SER A 1 310 ? 21.37197 85.08985 -11.25541 1.000 62.13337  ? 310 SER A O   1 
ATOM   2091 C  CB  . SER A 1 310 ? 18.54350 86.14197 -11.58782 1.000 73.09522  ? 310 SER A CB  1 
ATOM   2092 O  OG  . SER A 1 310 ? 17.14792 86.11894 -11.82907 1.000 83.73114  ? 310 SER A OG  1 
ATOM   2093 N  N   . VAL A 1 311 ? 20.52196 84.85949 -9.16663  1.000 62.33134  ? 311 VAL A N   1 
ATOM   2094 C  CA  . VAL A 1 311 ? 21.80831 84.99388 -8.49493  1.000 61.12375  ? 311 VAL A CA  1 
ATOM   2095 C  C   . VAL A 1 311 ? 22.68411 83.78528 -8.79789  1.000 64.90683  ? 311 VAL A C   1 
ATOM   2096 O  O   . VAL A 1 311 ? 22.21778 82.63659 -8.76616  1.000 61.27689  ? 311 VAL A O   1 
ATOM   2097 C  CB  . VAL A 1 311 ? 21.60064 85.13342 -6.97667  1.000 60.04651  ? 311 VAL A CB  1 
ATOM   2098 C  CG1 . VAL A 1 311 ? 22.91465 85.36242 -6.28498  1.000 64.09232  ? 311 VAL A CG1 1 
ATOM   2099 C  CG2 . VAL A 1 311 ? 20.63206 86.24795 -6.65172  1.000 58.58416  ? 311 VAL A CG2 1 
ATOM   2100 N  N   . ASP A 1 312 ? 23.96641 84.03545 -9.07981  1.000 65.79810  ? 312 ASP A N   1 
ATOM   2101 C  CA  . ASP A 1 312 ? 24.93986 82.95075 -9.15898  1.000 63.70220  ? 312 ASP A CA  1 
ATOM   2102 C  C   . ASP A 1 312 ? 24.92605 82.13314 -7.87300  1.000 51.91583  ? 312 ASP A C   1 
ATOM   2103 O  O   . ASP A 1 312 ? 24.89783 82.68286 -6.76689  1.000 52.41626  ? 312 ASP A O   1 
ATOM   2104 C  CB  . ASP A 1 312 ? 26.34461 83.50899 -9.39868  1.000 73.88711  ? 312 ASP A CB  1 
ATOM   2105 C  CG  . ASP A 1 312 ? 26.56488 83.93959 -10.82957 1.000 86.72524  ? 312 ASP A CG  1 
ATOM   2106 O  OD1 . ASP A 1 312 ? 25.96821 84.95504 -11.23253 1.000 96.16192  ? 312 ASP A OD1 1 
ATOM   2107 O  OD2 . ASP A 1 312 ? 27.33544 83.27409 -11.55269 1.000 92.95898  ? 312 ASP A OD2 1 
ATOM   2108 N  N   . ALA A 1 313 ? 24.94690 80.80905 -8.02580  1.000 47.94143  ? 313 ALA A N   1 
ATOM   2109 C  CA  . ALA A 1 313 ? 24.89568 79.93077 -6.86020  1.000 45.08655  ? 313 ALA A CA  1 
ATOM   2110 C  C   . ALA A 1 313 ? 26.03494 80.20900 -5.88942  1.000 59.11528  ? 313 ALA A C   1 
ATOM   2111 O  O   . ALA A 1 313 ? 25.83942 80.13787 -4.66759  1.000 53.93159  ? 313 ALA A O   1 
ATOM   2112 C  CB  . ALA A 1 313 ? 24.93007 78.46544 -7.29449  1.000 43.43376  ? 313 ALA A CB  1 
ATOM   2113 N  N   . LYS A 1 314 ? 27.22788 80.52320 -6.41119  1.000 59.19109  ? 314 LYS A N   1 
ATOM   2114 C  CA  . LYS A 1 314 ? 28.35294 80.84886 -5.54393  1.000 61.39930  ? 314 LYS A CA  1 
ATOM   2115 C  C   . LYS A 1 314 ? 27.98737 81.95236 -4.55637  1.000 63.88531  ? 314 LYS A C   1 
ATOM   2116 O  O   . LYS A 1 314 ? 28.41780 81.91719 -3.39484  1.000 61.83893  ? 314 LYS A O   1 
ATOM   2117 C  CB  . LYS A 1 314 ? 29.56772 81.24593 -6.38833  1.000 59.49899  ? 314 LYS A CB  1 
ATOM   2118 C  CG  . LYS A 1 314 ? 30.85279 81.46405 -5.59280  1.000 73.27814  ? 314 LYS A CG  1 
ATOM   2119 C  CD  . LYS A 1 314 ? 31.53890 80.14736 -5.19918  1.000 81.48819  ? 314 LYS A CD  1 
ATOM   2120 C  CE  . LYS A 1 314 ? 32.74623 80.40734 -4.28107  1.000 86.06009  ? 314 LYS A CE  1 
ATOM   2121 N  NZ  . LYS A 1 314 ? 33.54346 79.18483 -3.93206  1.000 81.30097  ? 314 LYS A NZ  1 
ATOM   2122 N  N   . THR A 1 315 ? 27.15657 82.90931 -4.98144  1.000 62.17828  ? 315 THR A N   1 
ATOM   2123 C  CA  . THR A 1 315 ? 26.78077 84.00769 -4.09779  1.000 63.52158  ? 315 THR A CA  1 
ATOM   2124 C  C   . THR A 1 315 ? 25.87106 83.53177 -2.97046  1.000 59.35040  ? 315 THR A C   1 
ATOM   2125 O  O   . THR A 1 315 ? 26.09596 83.86473 -1.80255  1.000 57.12979  ? 315 THR A O   1 
ATOM   2126 C  CB  . THR A 1 315 ? 26.12167 85.12520 -4.90160  1.000 60.33329  ? 315 THR A CB  1 
ATOM   2127 O  OG1 . THR A 1 315 ? 27.09922 85.71654 -5.76640  1.000 65.41771  ? 315 THR A OG1 1 
ATOM   2128 C  CG2 . THR A 1 315 ? 25.54851 86.19157 -3.97302  1.000 54.67145  ? 315 THR A CG2 1 
ATOM   2129 N  N   . ILE A 1 316 ? 24.83242 82.75930 -3.29602  1.000 56.32338  ? 316 ILE A N   1 
ATOM   2130 C  CA  . ILE A 1 316 ? 24.01236 82.17108 -2.24095  1.000 52.85595  ? 316 ILE A CA  1 
ATOM   2131 C  C   . ILE A 1 316 ? 24.87901 81.32543 -1.32347  1.000 55.11514  ? 316 ILE A C   1 
ATOM   2132 O  O   . ILE A 1 316 ? 24.76125 81.37769 -0.08988  1.000 49.74319  ? 316 ILE A O   1 
ATOM   2133 C  CB  . ILE A 1 316 ? 22.87779 81.32565 -2.84321  1.000 46.32817  ? 316 ILE A CB  1 
ATOM   2134 C  CG1 . ILE A 1 316 ? 21.92060 82.17874 -3.67293  1.000 44.20967  ? 316 ILE A CG1 1 
ATOM   2135 C  CG2 . ILE A 1 316 ? 22.14022 80.56730 -1.74318  1.000 38.97340  ? 316 ILE A CG2 1 
ATOM   2136 C  CD1 . ILE A 1 316 ? 20.98016 81.31695 -4.52454  1.000 45.30949  ? 316 ILE A CD1 1 
ATOM   2137 N  N   . SER A 1 317 ? 25.77519 80.54070 -1.91593  1.000 56.02295  ? 317 SER A N   1 
ATOM   2138 C  CA  . SER A 1 317 ? 26.56312 79.61103 -1.13116  1.000 53.53523  ? 317 SER A CA  1 
ATOM   2139 C  C   . SER A 1 317 ? 27.42180 80.34698 -0.11133  1.000 56.79417  ? 317 SER A C   1 
ATOM   2140 O  O   . SER A 1 317 ? 27.67237 79.82025 0.98199   1.000 60.57641  ? 317 SER A O   1 
ATOM   2141 C  CB  . SER A 1 317 ? 27.39949 78.74982 -2.07377  1.000 57.45544  ? 317 SER A CB  1 
ATOM   2142 O  OG  . SER A 1 317 ? 28.59251 78.30136 -1.47581  1.000 71.27505  ? 317 SER A OG  1 
ATOM   2143 N  N   . VAL A 1 318 ? 27.82845 81.58242 -0.41972  1.000 53.28607  ? 318 VAL A N   1 
ATOM   2144 C  CA  . VAL A 1 318 ? 28.60943 82.37952 0.52071   1.000 54.35583  ? 318 VAL A CA  1 
ATOM   2145 C  C   . VAL A 1 318 ? 27.70284 83.12271 1.49880   1.000 58.33568  ? 318 VAL A C   1 
ATOM   2146 O  O   . VAL A 1 318 ? 27.84309 82.98290 2.72113   1.000 58.81372  ? 318 VAL A O   1 
ATOM   2147 C  CB  . VAL A 1 318 ? 29.53227 83.36707 -0.21086  1.000 54.85266  ? 318 VAL A CB  1 
ATOM   2148 C  CG1 . VAL A 1 318 ? 30.07334 84.37979 0.77613   1.000 53.38580  ? 318 VAL A CG1 1 
ATOM   2149 C  CG2 . VAL A 1 318 ? 30.68975 82.63199 -0.87636  1.000 51.77804  ? 318 VAL A CG2 1 
ATOM   2150 N  N   . GLN A 1 319 ? 26.76558 83.91714 0.97593   1.000 55.16919  ? 319 GLN A N   1 
ATOM   2151 C  CA  . GLN A 1 319 ? 26.01581 84.82913 1.83633   1.000 56.38541  ? 319 GLN A CA  1 
ATOM   2152 C  C   . GLN A 1 319 ? 25.07718 84.12837 2.80990   1.000 55.51949  ? 319 GLN A C   1 
ATOM   2153 O  O   . GLN A 1 319 ? 24.64794 84.76232 3.78517   1.000 59.61446  ? 319 GLN A O   1 
ATOM   2154 C  CB  . GLN A 1 319 ? 25.22169 85.83024 0.99869   1.000 54.97163  ? 319 GLN A CB  1 
ATOM   2155 C  CG  . GLN A 1 319 ? 26.05927 86.49209 -0.06422  1.000 59.03227  ? 319 GLN A CG  1 
ATOM   2156 C  CD  . GLN A 1 319 ? 27.01332 87.50580 0.52999   1.000 61.88096  ? 319 GLN A CD  1 
ATOM   2157 O  OE1 . GLN A 1 319 ? 28.03420 87.84781 -0.07151  1.000 64.64358  ? 319 GLN A OE1 1 
ATOM   2158 N  NE2 . GLN A 1 319 ? 26.68323 87.99543 1.71899   1.000 56.62404  ? 319 GLN A NE2 1 
ATOM   2159 N  N   . GLN A 1 320 ? 24.74063 82.85350 2.58322   1.000 49.41204  ? 320 GLN A N   1 
ATOM   2160 C  CA  . GLN A 1 320 ? 23.90913 82.16742 3.56552   1.000 47.37513  ? 320 GLN A CA  1 
ATOM   2161 C  C   . GLN A 1 320 ? 24.61060 82.10556 4.91231   1.000 54.14463  ? 320 GLN A C   1 
ATOM   2162 O  O   . GLN A 1 320 ? 23.95169 82.06824 5.95560   1.000 54.45462  ? 320 GLN A O   1 
ATOM   2163 C  CB  . GLN A 1 320 ? 23.54832 80.75709 3.09685   1.000 38.82806  ? 320 GLN A CB  1 
ATOM   2164 C  CG  . GLN A 1 320 ? 24.74385 79.82222 2.97590   1.000 39.02699  ? 320 GLN A CG  1 
ATOM   2165 C  CD  . GLN A 1 320 ? 24.33528 78.42658 2.55116   1.000 39.85440  ? 320 GLN A CD  1 
ATOM   2166 O  OE1 . GLN A 1 320 ? 23.18303 78.02438 2.72093   1.000 43.73027  ? 320 GLN A OE1 1 
ATOM   2167 N  NE2 . GLN A 1 320 ? 25.27139 77.68734 1.97214   1.000 36.65793  ? 320 GLN A NE2 1 
ATOM   2168 N  N   . TRP A 1 321 ? 25.94411 82.12954 4.91052   1.000 57.01080  ? 321 TRP A N   1 
ATOM   2169 C  CA  . TRP A 1 321 ? 26.71609 82.00595 6.13979   1.000 53.11067  ? 321 TRP A CA  1 
ATOM   2170 C  C   . TRP A 1 321 ? 26.70368 83.26766 6.99096   1.000 54.71668  ? 321 TRP A C   1 
ATOM   2171 O  O   . TRP A 1 321 ? 27.17165 83.21506 8.12931   1.000 52.69889  ? 321 TRP A O   1 
ATOM   2172 C  CB  . TRP A 1 321 ? 28.15879 81.62133 5.81125   1.000 57.15112  ? 321 TRP A CB  1 
ATOM   2173 C  CG  . TRP A 1 321 ? 28.31018 80.17144 5.43211   1.000 59.91723  ? 321 TRP A CG  1 
ATOM   2174 C  CD1 . TRP A 1 321 ? 28.44922 79.66229 4.16918   1.000 59.65643  ? 321 TRP A CD1 1 
ATOM   2175 C  CD2 . TRP A 1 321 ? 28.33006 79.04362 6.32442   1.000 57.20532  ? 321 TRP A CD2 1 
ATOM   2176 N  NE1 . TRP A 1 321 ? 28.55547 78.29204 4.22133   1.000 58.78152  ? 321 TRP A NE1 1 
ATOM   2177 C  CE2 . TRP A 1 321 ? 28.48619 77.88628 5.52948   1.000 61.91756  ? 321 TRP A CE2 1 
ATOM   2178 C  CE3 . TRP A 1 321 ? 28.23322 78.90172 7.71525   1.000 51.08614  ? 321 TRP A CE3 1 
ATOM   2179 C  CZ2 . TRP A 1 321 ? 28.54670 76.60179 6.07919   1.000 63.78686  ? 321 TRP A CZ2 1 
ATOM   2180 C  CZ3 . TRP A 1 321 ? 28.28950 77.62736 8.25935   1.000 53.70799  ? 321 TRP A CZ3 1 
ATOM   2181 C  CH2 . TRP A 1 321 ? 28.44436 76.49460 7.44047   1.000 60.22309  ? 321 TRP A CH2 1 
ATOM   2182 N  N   . ASN A 1 322 ? 26.18725 84.39205 6.48601   1.000 57.94133  ? 322 ASN A N   1 
ATOM   2183 C  CA  . ASN A 1 322 ? 26.06180 85.57115 7.33855   1.000 58.05445  ? 322 ASN A CA  1 
ATOM   2184 C  C   . ASN A 1 322 ? 25.21614 85.27984 8.56866   1.000 62.13035  ? 322 ASN A C   1 
ATOM   2185 O  O   . ASN A 1 322 ? 25.51573 85.77056 9.66163   1.000 76.46913  ? 322 ASN A O   1 
ATOM   2186 C  CB  . ASN A 1 322 ? 25.46682 86.74233 6.56201   1.000 62.65100  ? 322 ASN A CB  1 
ATOM   2187 C  CG  . ASN A 1 322 ? 26.38491 87.23889 5.48583   1.000 64.54048  ? 322 ASN A CG  1 
ATOM   2188 O  OD1 . ASN A 1 322 ? 27.56064 86.87942 5.46068   1.000 65.17079  ? 322 ASN A OD1 1 
ATOM   2189 N  ND2 . ASN A 1 322 ? 25.86610 88.08215 4.59320   1.000 64.36412  ? 322 ASN A ND2 1 
ATOM   2190 N  N   . SER A 1 323 ? 24.16303 84.47535 8.41676   1.000 60.08200  ? 323 SER A N   1 
ATOM   2191 C  CA  . SER A 1 323 ? 23.26580 84.14510 9.51688   1.000 65.35725  ? 323 SER A CA  1 
ATOM   2192 C  C   . SER A 1 323 ? 23.80378 83.05903 10.42340  1.000 66.00126  ? 323 SER A C   1 
ATOM   2193 O  O   . SER A 1 323 ? 23.01544 82.43207 11.14179  1.000 69.63414  ? 323 SER A O   1 
ATOM   2194 C  CB  . SER A 1 323 ? 21.89484 83.73836 8.97731   1.000 71.88985  ? 323 SER A CB  1 
ATOM   2195 O  OG  . SER A 1 323 ? 21.52976 84.54371 7.86983   1.000 84.11054  ? 323 SER A OG  1 
ATOM   2196 N  N   . TYR A 1 324 ? 25.11145 82.81623 10.41465  1.000 69.40555  ? 324 TYR A N   1 
ATOM   2197 C  CA  . TYR A 1 324 ? 25.73207 81.90036 11.36799  1.000 77.14131  ? 324 TYR A CA  1 
ATOM   2198 C  C   . TYR A 1 324 ? 26.04727 82.67238 12.64652  1.000 83.28304  ? 324 TYR A C   1 
ATOM   2199 O  O   . TYR A 1 324 ? 26.95249 83.51532 12.66042  1.000 79.80512  ? 324 TYR A O   1 
ATOM   2200 C  CB  . TYR A 1 324 ? 26.98756 81.28545 10.76053  1.000 77.23617  ? 324 TYR A CB  1 
ATOM   2201 C  CG  . TYR A 1 324 ? 27.64513 80.23350 11.61665  1.000 77.45085  ? 324 TYR A CG  1 
ATOM   2202 C  CD1 . TYR A 1 324 ? 27.30610 78.89354 11.48902  1.000 70.85194  ? 324 TYR A CD1 1 
ATOM   2203 C  CD2 . TYR A 1 324 ? 28.60528 80.58081 12.56163  1.000 83.65189  ? 324 TYR A CD2 1 
ATOM   2204 C  CE1 . TYR A 1 324 ? 27.90830 77.92638 12.27395  1.000 68.67795  ? 324 TYR A CE1 1 
ATOM   2205 C  CE2 . TYR A 1 324 ? 29.21362 79.61819 13.35514  1.000 80.79805  ? 324 TYR A CE2 1 
ATOM   2206 C  CZ  . TYR A 1 324 ? 28.86212 78.29340 13.20375  1.000 71.64049  ? 324 TYR A CZ  1 
ATOM   2207 O  OH  . TYR A 1 324 ? 29.46847 77.33697 13.98089  1.000 67.27703  ? 324 TYR A OH  1 
ATOM   2208 N  N   . SER A 1 325 ? 25.30983 82.37447 13.72484  1.000 87.25791  ? 325 SER A N   1 
ATOM   2209 C  CA  . SER A 1 325 ? 25.30659 83.21827 14.93210  1.000 94.63637  ? 325 SER A CA  1 
ATOM   2210 C  C   . SER A 1 325 ? 26.32798 82.73410 15.96475  1.000 92.44473  ? 325 SER A C   1 
ATOM   2211 O  O   . SER A 1 325 ? 27.34232 83.39200 16.20931  1.000 86.99861  ? 325 SER A O   1 
ATOM   2212 C  CB  . SER A 1 325 ? 23.88915 83.26931 15.51181  1.000 96.66832  ? 325 SER A CB  1 
ATOM   2213 O  OG  . SER A 1 325 ? 23.42148 81.96485 15.83862  1.000 97.51743  ? 325 SER A OG  1 
ATOM   2214 N  N   . GLY A 1 326 ? 26.05941 81.58786 16.58345  1.000 87.52144  ? 326 GLY A N   1 
ATOM   2215 C  CA  . GLY A 1 326 ? 27.01514 80.98396 17.48763  1.000 79.91237  ? 326 GLY A CA  1 
ATOM   2216 C  C   . GLY A 1 326 ? 27.30639 79.53113 17.16030  1.000 70.07659  ? 326 GLY A C   1 
ATOM   2217 O  O   . GLY A 1 326 ? 26.85284 79.00746 16.12914  1.000 71.15820  ? 326 GLY A O   1 
ATOM   2218 N  N   . ILE A 1 327 ? 28.04874 78.87210 18.05761  1.000 58.12018  ? 327 ILE A N   1 
ATOM   2219 C  CA  . ILE A 1 327 ? 28.50003 77.50492 17.82608  1.000 56.45938  ? 327 ILE A CA  1 
ATOM   2220 C  C   . ILE A 1 327 ? 27.31174 76.57529 17.60534  1.000 63.78383  ? 327 ILE A C   1 
ATOM   2221 O  O   . ILE A 1 327 ? 26.29529 76.64650 18.31314  1.000 64.86024  ? 327 ILE A O   1 
ATOM   2222 C  CB  . ILE A 1 327 ? 29.37170 77.03460 19.00500  1.000 53.96386  ? 327 ILE A CB  1 
ATOM   2223 C  CG1 . ILE A 1 327 ? 29.94832 75.63642 18.75329  1.000 50.19848  ? 327 ILE A CG1 1 
ATOM   2224 C  CG2 . ILE A 1 327 ? 28.58611 77.05781 20.30495  1.000 56.47943  ? 327 ILE A CG2 1 
ATOM   2225 C  CD1 . ILE A 1 327 ? 31.05863 75.23784 19.73752  1.000 48.97432  ? 327 ILE A CD1 1 
ATOM   2226 N  N   . LEU A 1 328 ? 27.43321 75.71199 16.58776  1.000 57.07943  ? 328 LEU A N   1 
ATOM   2227 C  CA  . LEU A 1 328 ? 26.49251 74.61484 16.33429  1.000 52.88456  ? 328 LEU A CA  1 
ATOM   2228 C  C   . LEU A 1 328 ? 25.06687 75.10985 16.10563  1.000 51.49829  ? 328 LEU A C   1 
ATOM   2229 O  O   . LEU A 1 328 ? 24.09695 74.45879 16.50884  1.000 43.80356  ? 328 LEU A O   1 
ATOM   2230 C  CB  . LEU A 1 328 ? 26.51908 73.58475 17.46906  1.000 44.27646  ? 328 LEU A CB  1 
ATOM   2231 C  CG  . LEU A 1 328 ? 27.59461 72.50551 17.33855  1.000 49.16818  ? 328 LEU A CG  1 
ATOM   2232 C  CD1 . LEU A 1 328 ? 27.70419 71.66546 18.58385  1.000 47.02630  ? 328 LEU A CD1 1 
ATOM   2233 C  CD2 . LEU A 1 328 ? 27.29537 71.62232 16.15107  1.000 54.52130  ? 328 LEU A CD2 1 
ATOM   2234 N  N   . SER A 1 329 ? 24.91627 76.25801 15.45269  1.000 51.38717  ? 329 SER A N   1 
ATOM   2235 C  CA  . SER A 1 329 ? 23.58951 76.79830 15.17751  1.000 51.44626  ? 329 SER A CA  1 
ATOM   2236 C  C   . SER A 1 329 ? 23.60145 77.24443 13.70127  1.000 51.94402  ? 329 SER A C   1 
ATOM   2237 O  O   . SER A 1 329 ? 23.75503 78.41710 13.34659  1.000 49.71210  ? 329 SER A O   1 
ATOM   2238 C  CB  . SER A 1 329 ? 23.26333 77.91132 16.16338  1.000 45.50524  ? 329 SER A CB  1 
ATOM   2239 O  OG  . SER A 1 329 ? 21.97955 78.42015 15.92020  1.000 48.61853  ? 329 SER A OG  1 
ATOM   2240 N  N   . PHE A 1 330 ? 23.46491 76.28654 12.83109  1.000 46.66298  ? 330 PHE A N   1 
ATOM   2241 C  CA  . PHE A 1 330 ? 23.64550 76.62255 11.43835  1.000 46.47657  ? 330 PHE A CA  1 
ATOM   2242 C  C   . PHE A 1 330 ? 22.37802 77.26186 10.87352  1.000 39.87950  ? 330 PHE A C   1 
ATOM   2243 O  O   . PHE A 1 330 ? 21.28816 77.07697 11.41349  1.000 41.46274  ? 330 PHE A O   1 
ATOM   2244 C  CB  . PHE A 1 330 ? 24.02870 75.37108 10.66045  1.000 51.46550  ? 330 PHE A CB  1 
ATOM   2245 C  CG  . PHE A 1 330 ? 25.30623 74.75196 11.14659  1.000 55.84474  ? 330 PHE A CG  1 
ATOM   2246 C  CD1 . PHE A 1 330 ? 25.28149 73.69546 12.03212  1.000 53.37152  ? 330 PHE A CD1 1 
ATOM   2247 C  CD2 . PHE A 1 330 ? 26.53191 75.25027 10.74269  1.000 58.55380  ? 330 PHE A CD2 1 
ATOM   2248 C  CE1 . PHE A 1 330 ? 26.44998 73.13918 12.49181  1.000 54.32878  ? 330 PHE A CE1 1 
ATOM   2249 C  CE2 . PHE A 1 330 ? 27.70738 74.69502 11.20150  1.000 56.83513  ? 330 PHE A CE2 1 
ATOM   2250 C  CZ  . PHE A 1 330 ? 27.66413 73.63856 12.07583  1.000 55.34137  ? 330 PHE A CZ  1 
ATOM   2251 N  N   . PRO A 1 331 ? 22.49481 78.05147 9.80188   1.000 38.55756  ? 331 PRO A N   1 
ATOM   2252 C  CA  . PRO A 1 331 ? 21.30520 78.73043 9.26390   1.000 42.90939  ? 331 PRO A CA  1 
ATOM   2253 C  C   . PRO A 1 331 ? 20.36720 77.82180 8.49144   1.000 45.49351  ? 331 PRO A C   1 
ATOM   2254 O  O   . PRO A 1 331 ? 19.30110 78.28561 8.06981   1.000 45.00168  ? 331 PRO A O   1 
ATOM   2255 C  CB  . PRO A 1 331 ? 21.90523 79.80913 8.35251   1.000 42.24301  ? 331 PRO A CB  1 
ATOM   2256 C  CG  . PRO A 1 331 ? 23.22043 79.25487 7.94140   1.000 37.29748  ? 331 PRO A CG  1 
ATOM   2257 C  CD  . PRO A 1 331 ? 23.73233 78.46939 9.11427   1.000 33.95657  ? 331 PRO A CD  1 
ATOM   2258 N  N   . SER A 1 332 ? 20.72386 76.55276 8.29460   1.000 43.98483  ? 332 SER A N   1 
ATOM   2259 C  CA  . SER A 1 332 ? 19.86849 75.57655 7.63118   1.000 39.90919  ? 332 SER A CA  1 
ATOM   2260 C  C   . SER A 1 332 ? 19.65694 74.38002 8.54711   1.000 33.84072  ? 332 SER A C   1 
ATOM   2261 O  O   . SER A 1 332 ? 20.61941 73.83286 9.09080   1.000 38.55724  ? 332 SER A O   1 
ATOM   2262 C  CB  . SER A 1 332 ? 20.47919 75.12092 6.28934   1.000 39.64252  ? 332 SER A CB  1 
ATOM   2263 O  OG  . SER A 1 332 ? 20.37656 76.13146 5.27887   1.000 41.52923  ? 332 SER A OG  1 
ATOM   2264 N  N   . ALA A 1 333 ? 18.40673 73.97376 8.72488   1.000 28.13641  ? 333 ALA A N   1 
ATOM   2265 C  CA  . ALA A 1 333 ? 18.11683 72.76509 9.48148   1.000 33.00919  ? 333 ALA A CA  1 
ATOM   2266 C  C   . ALA A 1 333 ? 16.70437 72.32165 9.15076   1.000 30.01508  ? 333 ALA A C   1 
ATOM   2267 O  O   . ALA A 1 333 ? 15.91946 73.11310 8.60604   1.000 31.98434  ? 333 ALA A O   1 
ATOM   2268 C  CB  . ALA A 1 333 ? 18.26759 72.99752 10.99674  1.000 37.17652  ? 333 ALA A CB  1 
ATOM   2269 N  N   . PRO A 1 334 ? 16.34368 71.08060 9.46700   1.000 26.21035  ? 334 PRO A N   1 
ATOM   2270 C  CA  . PRO A 1 334 ? 14.95742 70.64986 9.25636   1.000 30.69526  ? 334 PRO A CA  1 
ATOM   2271 C  C   . PRO A 1 334 ? 14.00838 71.57629 9.99574   1.000 35.18802  ? 334 PRO A C   1 
ATOM   2272 O  O   . PRO A 1 334 ? 14.19935 71.87943 11.17909  1.000 42.43510  ? 334 PRO A O   1 
ATOM   2273 C  CB  . PRO A 1 334 ? 14.93208 69.22269 9.81924   1.000 34.46073  ? 334 PRO A CB  1 
ATOM   2274 C  CG  . PRO A 1 334 ? 16.35160 68.74659 9.69880   1.000 22.99644  ? 334 PRO A CG  1 
ATOM   2275 C  CD  . PRO A 1 334 ? 17.18767 69.98097 9.97898   1.000 22.69128  ? 334 PRO A CD  1 
ATOM   2276 N  N   . THR A 1 335 ? 12.99480 72.03660 9.27465   1.000 32.27705  ? 335 THR A N   1 
ATOM   2277 C  CA  . THR A 1 335 ? 12.14155 73.13160 9.69571   1.000 32.07435  ? 335 THR A CA  1 
ATOM   2278 C  C   . THR A 1 335 ? 10.73130 72.63665 9.94518   1.000 31.81137  ? 335 THR A C   1 
ATOM   2279 O  O   . THR A 1 335 ? 10.19200 71.86551 9.14405   1.000 26.25010  ? 335 THR A O   1 
ATOM   2280 C  CB  . THR A 1 335 ? 12.11734 74.21076 8.62679   1.000 34.58746  ? 335 THR A CB  1 
ATOM   2281 O  OG1 . THR A 1 335 ? 13.44110 74.35795 8.10168   1.000 39.67218  ? 335 THR A OG1 1 
ATOM   2282 C  CG2 . THR A 1 335 ? 11.60920 75.53823 9.18899   1.000 37.09216  ? 335 THR A CG2 1 
ATOM   2283 N  N   . ILE A 1 336 ? 10.13480 73.09636 11.05409  1.000 36.15011  ? 336 ILE A N   1 
ATOM   2284 C  CA  . ILE A 1 336 ? 8.74364  72.77726 11.36037  1.000 42.73965  ? 336 ILE A CA  1 
ATOM   2285 C  C   . ILE A 1 336 ? 7.84963  73.46431 10.33487  1.000 37.38753  ? 336 ILE A C   1 
ATOM   2286 O  O   . ILE A 1 336 ? 7.61675  74.67574 10.40148  1.000 42.83218  ? 336 ILE A O   1 
ATOM   2287 C  CB  . ILE A 1 336 ? 8.38687  73.17816 12.80356  1.000 50.45057  ? 336 ILE A CB  1 
ATOM   2288 C  CG1 . ILE A 1 336 ? 9.12367  72.26466 13.78098  1.000 47.26562  ? 336 ILE A CG1 1 
ATOM   2289 C  CG2 . ILE A 1 336 ? 6.88278  73.07728 13.05671  1.000 51.51489  ? 336 ILE A CG2 1 
ATOM   2290 C  CD1 . ILE A 1 336 ? 9.70373  73.00084 14.92332  1.000 53.17892  ? 336 ILE A CD1 1 
ATOM   2291 N  N   . ASP A 1 337 ? 7.36478  72.70242 9.35567   1.000 34.85455  ? 337 ASP A N   1 
ATOM   2292 C  CA  . ASP A 1 337 ? 6.64175  73.28050 8.22667   1.000 39.79931  ? 337 ASP A CA  1 
ATOM   2293 C  C   . ASP A 1 337 ? 5.22177  72.75593 8.09447   1.000 43.43960  ? 337 ASP A C   1 
ATOM   2294 O  O   . ASP A 1 337 ? 4.55320  73.06414 7.10531   1.000 46.70891  ? 337 ASP A O   1 
ATOM   2295 C  CB  . ASP A 1 337 ? 7.39596  73.02527 6.92383   1.000 30.25290  ? 337 ASP A CB  1 
ATOM   2296 C  CG  . ASP A 1 337 ? 7.52081  71.55214 6.61145   1.000 38.76297  ? 337 ASP A CG  1 
ATOM   2297 O  OD1 . ASP A 1 337 ? 7.12672  70.71302 7.45574   1.000 39.81056  ? 337 ASP A OD1 1 
ATOM   2298 O  OD2 . ASP A 1 337 ? 8.03905  71.22806 5.52323   1.000 46.90119  ? 337 ASP A OD2 1 
ATOM   2299 N  N   . GLY A 1 338 ? 4.74367  71.97151 9.05526   1.000 52.02945  ? 338 GLY A N   1 
ATOM   2300 C  CA  . GLY A 1 338 ? 3.42734  71.39000 8.92397   1.000 54.76902  ? 338 GLY A CA  1 
ATOM   2301 C  C   . GLY A 1 338 ? 3.26662  70.50906 7.71428   1.000 55.14207  ? 338 GLY A C   1 
ATOM   2302 O  O   . GLY A 1 338 ? 2.13567  70.20278 7.33366   1.000 56.45805  ? 338 GLY A O   1 
ATOM   2303 N  N   . ALA A 1 339 ? 4.37045  70.11191 7.08387   1.000 55.09996  ? 339 ALA A N   1 
ATOM   2304 C  CA  . ALA A 1 339 ? 4.32865  69.20880 5.94185   1.000 47.24599  ? 339 ALA A CA  1 
ATOM   2305 C  C   . ALA A 1 339 ? 5.24595  68.02577 6.20614   1.000 48.72512  ? 339 ALA A C   1 
ATOM   2306 O  O   . ALA A 1 339 ? 4.79975  67.00044 6.72761   1.000 57.98322  ? 339 ALA A O   1 
ATOM   2307 C  CB  . ALA A 1 339 ? 4.72217  69.93353 4.65370   1.000 38.39845  ? 339 ALA A CB  1 
ATOM   2308 N  N   . PHE A 1 340 ? 6.53134  68.15452 5.87023   1.000 50.95769  ? 340 PHE A N   1 
ATOM   2309 C  CA  . PHE A 1 340 ? 7.47166  67.08588 6.19704   1.000 45.08328  ? 340 PHE A CA  1 
ATOM   2310 C  C   . PHE A 1 340 ? 7.68147  66.98072 7.70252   1.000 41.79004  ? 340 PHE A C   1 
ATOM   2311 O  O   . PHE A 1 340 ? 7.76129  65.87254 8.24252   1.000 37.35258  ? 340 PHE A O   1 
ATOM   2312 C  CB  . PHE A 1 340 ? 8.80772  67.29648 5.48133   1.000 35.50489  ? 340 PHE A CB  1 
ATOM   2313 C  CG  . PHE A 1 340 ? 9.52159  66.01273 5.16527   1.000 41.46533  ? 340 PHE A CG  1 
ATOM   2314 C  CD1 . PHE A 1 340 ? 9.27716  65.34225 3.96753   1.000 44.06610  ? 340 PHE A CD1 1 
ATOM   2315 C  CD2 . PHE A 1 340 ? 10.42218 65.45729 6.07296   1.000 32.23119  ? 340 PHE A CD2 1 
ATOM   2316 C  CE1 . PHE A 1 340 ? 9.91723  64.13427 3.68746   1.000 43.49351  ? 340 PHE A CE1 1 
ATOM   2317 C  CE2 . PHE A 1 340 ? 11.07395 64.26435 5.79316   1.000 29.83208  ? 340 PHE A CE2 1 
ATOM   2318 C  CZ  . PHE A 1 340 ? 10.82047 63.59612 4.59868   1.000 35.37759  ? 340 PHE A CZ  1 
ATOM   2319 N  N   . LEU A 1 341 ? 7.76212  68.11956 8.39665   1.000 46.16251  ? 341 LEU A N   1 
ATOM   2320 C  CA  . LEU A 1 341 ? 7.86259  68.17101 9.85479   1.000 53.15590  ? 341 LEU A CA  1 
ATOM   2321 C  C   . LEU A 1 341 ? 6.61230  68.80759 10.44077  1.000 59.57141  ? 341 LEU A C   1 
ATOM   2322 O  O   . LEU A 1 341 ? 6.56232  70.03345 10.62328  1.000 61.35932  ? 341 LEU A O   1 
ATOM   2323 C  CB  . LEU A 1 341 ? 9.09659  68.95870 10.27852  1.000 58.93679  ? 341 LEU A CB  1 
ATOM   2324 C  CG  . LEU A 1 341 ? 10.39278 68.18123 10.24351  1.000 62.85917  ? 341 LEU A CG  1 
ATOM   2325 C  CD1 . LEU A 1 341 ? 10.77234 67.90166 8.79182   1.000 61.08345  ? 341 LEU A CD1 1 
ATOM   2326 C  CD2 . LEU A 1 341 ? 11.44985 68.99551 10.97809  1.000 72.94202  ? 341 LEU A CD2 1 
ATOM   2327 N  N   . PRO A 1 342 ? 5.58803  68.02475 10.78102  1.000 65.38211  ? 342 PRO A N   1 
ATOM   2328 C  CA  . PRO A 1 342 ? 4.32818  68.63689 11.22898  1.000 67.59984  ? 342 PRO A CA  1 
ATOM   2329 C  C   . PRO A 1 342 ? 4.42165  69.33144 12.57233  1.000 63.14779  ? 342 PRO A C   1 
ATOM   2330 O  O   . PRO A 1 342 ? 3.69463  70.30826 12.78632  1.000 74.97362  ? 342 PRO A O   1 
ATOM   2331 C  CB  . PRO A 1 342 ? 3.35763  67.44910 11.27859  1.000 68.00039  ? 342 PRO A CB  1 
ATOM   2332 C  CG  . PRO A 1 342 ? 3.94998  66.46088 10.36795  1.000 66.94452  ? 342 PRO A CG  1 
ATOM   2333 C  CD  . PRO A 1 342 ? 5.43242  66.58457 10.54646  1.000 65.05168  ? 342 PRO A CD  1 
ATOM   2334 N  N   . ALA A 1 343 ? 5.27465  68.87614 13.48465  1.000 57.81716  ? 343 ALA A N   1 
ATOM   2335 C  CA  . ALA A 1 343 ? 5.38043  69.54346 14.77663  1.000 69.22069  ? 343 ALA A CA  1 
ATOM   2336 C  C   . ALA A 1 343 ? 6.81628  69.42250 15.27981  1.000 92.09396  ? 343 ALA A C   1 
ATOM   2337 O  O   . ALA A 1 343 ? 7.73382  69.09967 14.51526  1.000 92.45843  ? 343 ALA A O   1 
ATOM   2338 C  CB  . ALA A 1 343 ? 4.35132  68.97791 15.76132  1.000 53.61744  ? 343 ALA A CB  1 
ATOM   2339 N  N   . ASP A 1 344 ? 7.00411  69.71077 16.57510  1.000 134.67147 ? 344 ASP A N   1 
ATOM   2340 C  CA  . ASP A 1 344 ? 8.32440  69.71218 17.19571  1.000 142.90303 ? 344 ASP A CA  1 
ATOM   2341 C  C   . ASP A 1 344 ? 8.81060  68.28495 17.43830  1.000 152.87252 ? 344 ASP A C   1 
ATOM   2342 O  O   . ASP A 1 344 ? 8.02001  67.40229 17.77757  1.000 155.24253 ? 344 ASP A O   1 
ATOM   2343 C  CB  . ASP A 1 344 ? 8.29851  70.46489 18.52670  1.000 143.40817 ? 344 ASP A CB  1 
ATOM   2344 C  CG  . ASP A 1 344 ? 8.31699  71.97181 18.35458  1.000 144.42260 ? 344 ASP A CG  1 
ATOM   2345 O  OD1 . ASP A 1 344 ? 9.42676  72.55200 18.34923  1.000 141.88414 ? 344 ASP A OD1 1 
ATOM   2346 O  OD2 . ASP A 1 344 ? 7.22708  72.57645 18.22992  1.000 146.44773 ? 344 ASP A OD2 1 
ATOM   2347 N  N   . PRO A 1 345 ? 10.11630 68.03869 17.28867  1.000 158.83066 ? 345 PRO A N   1 
ATOM   2348 C  CA  . PRO A 1 345 ? 10.64526 66.67286 17.44083  1.000 163.75302 ? 345 PRO A CA  1 
ATOM   2349 C  C   . PRO A 1 345 ? 10.44813 66.00708 18.80210  1.000 170.38338 ? 345 PRO A C   1 
ATOM   2350 O  O   . PRO A 1 345 ? 10.95397 64.89688 19.00395  1.000 174.62826 ? 345 PRO A O   1 
ATOM   2351 C  CB  . PRO A 1 345 ? 12.13570 66.85332 17.12967  1.000 161.83939 ? 345 PRO A CB  1 
ATOM   2352 C  CG  . PRO A 1 345 ? 12.15316 67.97636 16.15484  1.000 161.38294 ? 345 PRO A CG  1 
ATOM   2353 C  CD  . PRO A 1 345 ? 11.07838 68.92715 16.61662  1.000 161.91860 ? 345 PRO A CD  1 
ATOM   2354 N  N   . MET A 1 346 ? 9.73678  66.64167 19.74063  1.000 169.99160 ? 346 MET A N   1 
ATOM   2355 C  CA  . MET A 1 346 ? 9.32244  65.97426 20.97286  1.000 162.45869 ? 346 MET A CA  1 
ATOM   2356 C  C   . MET A 1 346 ? 7.81208  65.79443 21.08319  1.000 162.66086 ? 346 MET A C   1 
ATOM   2357 O  O   . MET A 1 346 ? 7.34832  65.12251 22.01554  1.000 156.67254 ? 346 MET A O   1 
ATOM   2358 C  CB  . MET A 1 346 ? 9.84657  66.72338 22.20722  1.000 160.15470 ? 346 MET A CB  1 
ATOM   2359 C  CG  . MET A 1 346 ? 11.29393 67.17456 22.13263  1.000 159.91806 ? 346 MET A CG  1 
ATOM   2360 S  SD  . MET A 1 346 ? 12.44664 65.91972 22.72340  1.000 159.15306 ? 346 MET A SD  1 
ATOM   2361 C  CE  . MET A 1 346 ? 13.73772 66.97683 23.37909  1.000 153.60059 ? 346 MET A CE  1 
ATOM   2362 N  N   . THR A 1 347 ? 7.03554  66.35650 20.15375  1.000 164.03875 ? 347 THR A N   1 
ATOM   2363 C  CA  . THR A 1 347 ? 5.60870  66.07776 20.05030  1.000 166.01772 ? 347 THR A CA  1 
ATOM   2364 C  C   . THR A 1 347 ? 5.27962  65.05854 18.96280  1.000 169.28050 ? 347 THR A C   1 
ATOM   2365 O  O   . THR A 1 347 ? 4.10093  64.71773 18.79333  1.000 169.53945 ? 347 THR A O   1 
ATOM   2366 C  CB  . THR A 1 347 ? 4.83635  67.36552 19.77407  1.000 161.96199 ? 347 THR A CB  1 
ATOM   2367 O  OG1 . THR A 1 347 ? 4.85316  67.62266 18.36834  1.000 160.57522 ? 347 THR A OG1 1 
ATOM   2368 C  CG2 . THR A 1 347 ? 5.48979  68.53577 20.48976  1.000 158.47114 ? 347 THR A CG2 1 
ATOM   2369 N  N   . LEU A 1 348 ? 6.28995  64.59797 18.20972  1.000 164.22306 ? 348 LEU A N   1 
ATOM   2370 C  CA  . LEU A 1 348 ? 6.11826  63.49142 17.26750  1.000 164.48375 ? 348 LEU A CA  1 
ATOM   2371 C  C   . LEU A 1 348 ? 5.63966  62.23745 17.97864  1.000 167.94237 ? 348 LEU A C   1 
ATOM   2372 O  O   . LEU A 1 348 ? 4.73609  61.53932 17.49971  1.000 159.86179 ? 348 LEU A O   1 
ATOM   2373 C  CB  . LEU A 1 348 ? 7.44921  63.16806 16.58075  1.000 160.67600 ? 348 LEU A CB  1 
ATOM   2374 C  CG  . LEU A 1 348 ? 8.40232  64.28421 16.18425  1.000 156.20912 ? 348 LEU A CG  1 
ATOM   2375 C  CD1 . LEU A 1 348 ? 9.58062  63.64221 15.47782  1.000 151.34335 ? 348 LEU A CD1 1 
ATOM   2376 C  CD2 . LEU A 1 348 ? 7.72136  65.32260 15.28207  1.000 156.17992 ? 348 LEU A CD2 1 
ATOM   2377 N  N   . MET A 1 349 ? 6.28299  61.91333 19.09862  1.000 174.83798 ? 349 MET A N   1 
ATOM   2378 C  CA  . MET A 1 349 ? 6.21248  60.59226 19.70173  1.000 178.30902 ? 349 MET A CA  1 
ATOM   2379 C  C   . MET A 1 349 ? 5.25930  60.50271 20.89287  1.000 172.64948 ? 349 MET A C   1 
ATOM   2380 O  O   . MET A 1 349 ? 5.12543  59.42419 21.48730  1.000 174.48159 ? 349 MET A O   1 
ATOM   2381 C  CB  . MET A 1 349 ? 7.61527  60.12466 20.10994  1.000 187.23914 ? 349 MET A CB  1 
ATOM   2382 C  CG  . MET A 1 349 ? 8.33463  60.86404 21.22242  1.000 196.01976 ? 349 MET A CG  1 
ATOM   2383 S  SD  . MET A 1 349 ? 9.40824  62.18424 20.63367  1.000 198.12249 ? 349 MET A SD  1 
ATOM   2384 C  CE  . MET A 1 349 ? 10.40941 62.44034 22.10078  1.000 196.20859 ? 349 MET A CE  1 
ATOM   2385 N  N   . LYS A 1 350 ? 4.58888  61.59741 21.24820  1.000 168.08603 ? 350 LYS A N   1 
ATOM   2386 C  CA  . LYS A 1 350 ? 3.42761  61.53859 22.12664  1.000 161.34907 ? 350 LYS A CA  1 
ATOM   2387 C  C   . LYS A 1 350 ? 2.51879  60.40030 21.67786  1.000 167.95586 ? 350 LYS A C   1 
ATOM   2388 O  O   . LYS A 1 350 ? 2.02943  59.61684 22.49840  1.000 171.03527 ? 350 LYS A O   1 
ATOM   2389 C  CB  . LYS A 1 350 ? 2.65492  62.86666 22.08772  1.000 150.12205 ? 350 LYS A CB  1 
ATOM   2390 C  CG  . LYS A 1 350 ? 2.73887  63.73165 23.33988  1.000 139.79322 ? 350 LYS A CG  1 
ATOM   2391 C  CD  . LYS A 1 350 ? 3.76283  64.84199 23.15416  1.000 132.25886 ? 350 LYS A CD  1 
ATOM   2392 C  CE  . LYS A 1 350 ? 3.86198  65.72504 24.39232  1.000 129.57695 ? 350 LYS A CE  1 
ATOM   2393 N  NZ  . LYS A 1 350 ? 5.11740  66.53566 24.39198  1.000 123.64738 ? 350 LYS A NZ  1 
ATOM   2394 N  N   . THR A 1 351 ? 2.33048  60.28953 20.35970  1.000 174.26800 ? 351 THR A N   1 
ATOM   2395 C  CA  . THR A 1 351 ? 1.26108  59.49750 19.76355  1.000 176.52546 ? 351 THR A CA  1 
ATOM   2396 C  C   . THR A 1 351 ? 1.70901  58.10561 19.32500  1.000 169.36097 ? 351 THR A C   1 
ATOM   2397 O  O   . THR A 1 351 ? 1.37060  57.10739 19.97182  1.000 172.76299 ? 351 THR A O   1 
ATOM   2398 C  CB  . THR A 1 351 ? 0.67831  60.24776 18.55989  1.000 178.74854 ? 351 THR A CB  1 
ATOM   2399 O  OG1 . THR A 1 351 ? 0.71003  61.65851 18.81245  1.000 179.27814 ? 351 THR A OG1 1 
ATOM   2400 C  CG2 . THR A 1 351 ? -0.76035 59.81878 18.30081  1.000 179.89682 ? 351 THR A CG2 1 
ATOM   2401 N  N   . ALA A 1 352 ? 2.47659  58.03718 18.23540  1.000 149.22761 ? 352 ALA A N   1 
ATOM   2402 C  CA  . ALA A 1 352 ? 2.64915  56.79612 17.48714  1.000 127.39593 ? 352 ALA A CA  1 
ATOM   2403 C  C   . ALA A 1 352 ? 3.35524  55.71873 18.31594  1.000 104.26885 ? 352 ALA A C   1 
ATOM   2404 O  O   . ALA A 1 352 ? 4.06009  55.99417 19.29248  1.000 93.82315  ? 352 ALA A O   1 
ATOM   2405 C  CB  . ALA A 1 352 ? 3.41684  57.05823 16.18752  1.000 118.28709 ? 352 ALA A CB  1 
ATOM   2406 N  N   . ASP A 1 353 ? 3.13556  54.46772 17.91219  1.000 91.19463  ? 353 ASP A N   1 
ATOM   2407 C  CA  . ASP A 1 353 ? 3.70040  53.30128 18.57253  1.000 83.10093  ? 353 ASP A CA  1 
ATOM   2408 C  C   . ASP A 1 353 ? 4.64706  52.58377 17.61751  1.000 70.43157  ? 353 ASP A C   1 
ATOM   2409 O  O   . ASP A 1 353 ? 4.31862  52.35907 16.44895  1.000 61.12493  ? 353 ASP A O   1 
ATOM   2410 C  CB  . ASP A 1 353 ? 2.59991  52.34776 19.05527  1.000 84.07552  ? 353 ASP A CB  1 
ATOM   2411 C  CG  . ASP A 1 353 ? 2.99048  51.60410 20.31714  1.000 86.31891  ? 353 ASP A CG  1 
ATOM   2412 O  OD1 . ASP A 1 353 ? 2.85010  52.17918 21.42464  1.000 88.52439  ? 353 ASP A OD1 1 
ATOM   2413 O  OD2 . ASP A 1 353 ? 3.45867  50.44961 20.18990  1.000 84.54178  ? 353 ASP A OD2 1 
ATOM   2414 N  N   . LEU A 1 354 ? 5.81981  52.22066 18.12787  1.000 65.45678  ? 354 LEU A N   1 
ATOM   2415 C  CA  . LEU A 1 354 ? 6.91861  51.71809 17.31745  1.000 56.21814  ? 354 LEU A CA  1 
ATOM   2416 C  C   . LEU A 1 354 ? 7.22224  50.24586 17.56779  1.000 49.62345  ? 354 LEU A C   1 
ATOM   2417 O  O   . LEU A 1 354 ? 8.38142  49.83699 17.52966  1.000 50.86947  ? 354 LEU A O   1 
ATOM   2418 C  CB  . LEU A 1 354 ? 8.17107  52.54494 17.56663  1.000 56.81326  ? 354 LEU A CB  1 
ATOM   2419 C  CG  . LEU A 1 354 ? 7.91498  54.04030 17.59297  1.000 56.25487  ? 354 LEU A CG  1 
ATOM   2420 C  CD1 . LEU A 1 354 ? 9.11082  54.68107 18.21996  1.000 49.58869  ? 354 LEU A CD1 1 
ATOM   2421 C  CD2 . LEU A 1 354 ? 7.70380  54.54065 16.17429  1.000 59.32706  ? 354 LEU A CD2 1 
ATOM   2422 N  N   . LYS A 1 355 ? 6.19606  49.42541 17.79911  1.000 56.60799  ? 355 LYS A N   1 
ATOM   2423 C  CA  . LYS A 1 355 ? 6.44501  48.00424 18.02110  1.000 62.25435  ? 355 LYS A CA  1 
ATOM   2424 C  C   . LYS A 1 355 ? 7.28230  47.37982 16.90140  1.000 63.05655  ? 355 LYS A C   1 
ATOM   2425 O  O   . LYS A 1 355 ? 8.06517  46.46089 17.16455  1.000 70.65586  ? 355 LYS A O   1 
ATOM   2426 C  CB  . LYS A 1 355 ? 5.10762  47.25202 18.21209  1.000 66.28512  ? 355 LYS A CB  1 
ATOM   2427 C  CG  . LYS A 1 355 ? 4.15109  47.25987 17.01494  1.000 78.98841  ? 355 LYS A CG  1 
ATOM   2428 C  CD  . LYS A 1 355 ? 3.22034  46.03170 16.99608  1.000 87.42914  ? 355 LYS A CD  1 
ATOM   2429 C  CE  . LYS A 1 355 ? 2.62315  45.73068 15.59554  1.000 90.47160  ? 355 LYS A CE  1 
ATOM   2430 N  NZ  . LYS A 1 355 ? 2.46920  46.89835 14.65256  1.000 88.43172  ? 355 LYS A NZ  1 
ATOM   2431 N  N   . ASP A 1 356 ? 7.18168  47.89030 15.67680  1.000 58.93858  ? 356 ASP A N   1 
ATOM   2432 C  CA  . ASP A 1 356 ? 7.82722  47.28456 14.51823  1.000 57.65664  ? 356 ASP A CA  1 
ATOM   2433 C  C   . ASP A 1 356 ? 9.18173  47.88320 14.16636  1.000 51.88336  ? 356 ASP A C   1 
ATOM   2434 O  O   . ASP A 1 356 ? 9.81633  47.41521 13.21317  1.000 50.44112  ? 356 ASP A O   1 
ATOM   2435 C  CB  . ASP A 1 356 ? 6.90768  47.38049 13.30143  1.000 62.68937  ? 356 ASP A CB  1 
ATOM   2436 C  CG  . ASP A 1 356 ? 5.62416  46.62642 13.49691  1.000 72.54866  ? 356 ASP A CG  1 
ATOM   2437 O  OD1 . ASP A 1 356 ? 5.63421  45.67876 14.31623  1.000 77.63117  ? 356 ASP A OD1 1 
ATOM   2438 O  OD2 . ASP A 1 356 ? 4.61363  46.97719 12.84668  1.000 77.41209  ? 356 ASP A OD2 1 
ATOM   2439 N  N   . TYR A 1 357 ? 9.65264  48.87912 14.90584  1.000 49.40563  ? 357 TYR A N   1 
ATOM   2440 C  CA  . TYR A 1 357 ? 10.87850 49.56373 14.53917  1.000 46.65680  ? 357 TYR A CA  1 
ATOM   2441 C  C   . TYR A 1 357 ? 12.08522 48.94695 15.23377  1.000 50.86379  ? 357 TYR A C   1 
ATOM   2442 O  O   . TYR A 1 357 ? 12.02473 48.57439 16.41144  1.000 49.29455  ? 357 TYR A O   1 
ATOM   2443 C  CB  . TYR A 1 357 ? 10.77053 51.04742 14.86679  1.000 40.78097  ? 357 TYR A CB  1 
ATOM   2444 C  CG  . TYR A 1 357 ? 9.87053  51.80159 13.91299  1.000 42.97781  ? 357 TYR A CG  1 
ATOM   2445 C  CD1 . TYR A 1 357 ? 8.51535  51.53277 13.86045  1.000 46.60056  ? 357 TYR A CD1 1 
ATOM   2446 C  CD2 . TYR A 1 357 ? 10.36567 52.81094 13.09331  1.000 43.44953  ? 357 TYR A CD2 1 
ATOM   2447 C  CE1 . TYR A 1 357 ? 7.67776  52.22666 13.00738  1.000 53.45237  ? 357 TYR A CE1 1 
ATOM   2448 C  CE2 . TYR A 1 357 ? 9.52657  53.51878 12.23956  1.000 48.13424  ? 357 TYR A CE2 1 
ATOM   2449 C  CZ  . TYR A 1 357 ? 8.18157  53.21287 12.20091  1.000 51.94088  ? 357 TYR A CZ  1 
ATOM   2450 O  OH  . TYR A 1 357 ? 7.32560  53.88780 11.36244  1.000 56.96655  ? 357 TYR A OH  1 
ATOM   2451 N  N   . ASP A 1 358 ? 13.17670 48.82609 14.47592  1.000 53.60362  ? 358 ASP A N   1 
ATOM   2452 C  CA  . ASP A 1 358 ? 14.47857 48.39890 14.97627  1.000 48.68158  ? 358 ASP A CA  1 
ATOM   2453 C  C   . ASP A 1 358 ? 15.44792 49.55614 14.81644  1.000 43.35301  ? 358 ASP A C   1 
ATOM   2454 O  O   . ASP A 1 358 ? 15.63954 50.05842 13.70266  1.000 48.07622  ? 358 ASP A O   1 
ATOM   2455 C  CB  . ASP A 1 358 ? 14.99307 47.17928 14.21930  1.000 37.02000  ? 358 ASP A CB  1 
ATOM   2456 C  CG  . ASP A 1 358 ? 14.03293 46.03817 14.26680  1.000 56.49855  ? 358 ASP A CG  1 
ATOM   2457 O  OD1 . ASP A 1 358 ? 13.70091 45.59452 15.39160  1.000 45.84887  ? 358 ASP A OD1 1 
ATOM   2458 O  OD2 . ASP A 1 358 ? 13.59034 45.60654 13.17787  1.000 66.59266  ? 358 ASP A OD2 1 
ATOM   2459 N  N   . ILE A 1 359 ? 16.06405 49.96542 15.91903  1.000 34.37987  ? 359 ILE A N   1 
ATOM   2460 C  CA  . ILE A 1 359 ? 16.87623 51.17028 15.96737  1.000 36.03138  ? 359 ILE A CA  1 
ATOM   2461 C  C   . ILE A 1 359 ? 18.21739 50.81088 16.57816  1.000 39.90564  ? 359 ILE A C   1 
ATOM   2462 O  O   . ILE A 1 359 ? 18.26657 50.18596 17.64583  1.000 37.87785  ? 359 ILE A O   1 
ATOM   2463 C  CB  . ILE A 1 359 ? 16.20732 52.28500 16.79641  1.000 37.41541  ? 359 ILE A CB  1 
ATOM   2464 C  CG1 . ILE A 1 359 ? 14.80273 52.59684 16.28736  1.000 34.96543  ? 359 ILE A CG1 1 
ATOM   2465 C  CG2 . ILE A 1 359 ? 17.05253 53.53441 16.75889  1.000 39.22228  ? 359 ILE A CG2 1 
ATOM   2466 C  CD1 . ILE A 1 359 ? 14.77883 53.32259 14.98947  1.000 34.69411  ? 359 ILE A CD1 1 
ATOM   2467 N  N   . LEU A 1 360 ? 19.29768 51.21827 15.91118  1.000 34.95854  ? 360 LEU A N   1 
ATOM   2468 C  CA  . LEU A 1 360 ? 20.65182 51.13608 16.44411  1.000 34.50025  ? 360 LEU A CA  1 
ATOM   2469 C  C   . LEU A 1 360 ? 21.21951 52.55108 16.49006  1.000 39.39750  ? 360 LEU A C   1 
ATOM   2470 O  O   . LEU A 1 360 ? 21.24704 53.22762 15.45943  1.000 40.59553  ? 360 LEU A O   1 
ATOM   2471 C  CB  . LEU A 1 360 ? 21.51795 50.21650 15.57232  1.000 30.14104  ? 360 LEU A CB  1 
ATOM   2472 C  CG  . LEU A 1 360 ? 22.99546 50.23214 15.97416  1.000 33.94929  ? 360 LEU A CG  1 
ATOM   2473 C  CD1 . LEU A 1 360 ? 23.19875 49.69937 17.39383  1.000 34.17233  ? 360 LEU A CD1 1 
ATOM   2474 C  CD2 . LEU A 1 360 ? 23.86656 49.48991 15.00354  1.000 29.37731  ? 360 LEU A CD2 1 
ATOM   2475 N  N   . MET A 1 361 ? 21.66608 53.00871 17.66869  1.000 28.55512  ? 361 MET A N   1 
ATOM   2476 C  CA  . MET A 1 361 ? 22.13607 54.38826 17.78836  1.000 27.97058  ? 361 MET A CA  1 
ATOM   2477 C  C   . MET A 1 361 ? 23.24601 54.47739 18.82219  1.000 32.35622  ? 361 MET A C   1 
ATOM   2478 O  O   . MET A 1 361 ? 23.42452 53.57416 19.64433  1.000 36.67718  ? 361 MET A O   1 
ATOM   2479 C  CB  . MET A 1 361 ? 20.99773 55.35202 18.13229  1.000 28.65104  ? 361 MET A CB  1 
ATOM   2480 C  CG  . MET A 1 361 ? 20.26154 55.03896 19.41506  1.000 34.40504  ? 361 MET A CG  1 
ATOM   2481 S  SD  . MET A 1 361 ? 18.58048 55.73980 19.48104  1.000 37.31509  ? 361 MET A SD  1 
ATOM   2482 C  CE  . MET A 1 361 ? 18.92328 57.50182 19.44347  1.000 30.68374  ? 361 MET A CE  1 
ATOM   2483 N  N   . GLY A 1 362 ? 23.99627 55.57633 18.77362  1.000 27.28896  ? 362 GLY A N   1 
ATOM   2484 C  CA  . GLY A 1 362 ? 25.11161 55.74673 19.69296  1.000 26.40288  ? 362 GLY A CA  1 
ATOM   2485 C  C   . GLY A 1 362 ? 25.82786 57.06585 19.49838  1.000 29.87886  ? 362 GLY A C   1 
ATOM   2486 O  O   . GLY A 1 362 ? 25.29589 57.99011 18.88179  1.000 27.45789  ? 362 GLY A O   1 
ATOM   2487 N  N   . ASN A 1 363 ? 27.06108 57.13214 20.01217  1.000 26.61153  ? 363 ASN A N   1 
ATOM   2488 C  CA  . ASN A 1 363 ? 27.81263 58.37457 20.16033  1.000 25.63912  ? 363 ASN A CA  1 
ATOM   2489 C  C   . ASN A 1 363 ? 29.30306 58.05116 20.20605  1.000 25.42199  ? 363 ASN A C   1 
ATOM   2490 O  O   . ASN A 1 363 ? 29.69667 56.89481 20.38101  1.000 45.11231  ? 363 ASN A O   1 
ATOM   2491 C  CB  . ASN A 1 363 ? 27.42012 59.12469 21.44454  1.000 28.71269  ? 363 ASN A CB  1 
ATOM   2492 C  CG  . ASN A 1 363 ? 26.01696 59.68760 21.40263  1.000 35.69231  ? 363 ASN A CG  1 
ATOM   2493 O  OD1 . ASN A 1 363 ? 25.09732 59.12757 21.99896  1.000 32.86375  ? 363 ASN A OD1 1 
ATOM   2494 N  ND2 . ASN A 1 363 ? 25.84125 60.80108 20.69295  1.000 41.69763  ? 363 ASN A ND2 1 
ATOM   2495 N  N   . VAL A 1 364 ? 30.14059 59.08428 20.07421  1.000 25.51183  ? 364 VAL A N   1 
ATOM   2496 C  CA  . VAL A 1 364 ? 31.57834 58.95081 20.30011  1.000 31.02650  ? 364 VAL A CA  1 
ATOM   2497 C  C   . VAL A 1 364 ? 31.95701 59.64500 21.60720  1.000 31.76392  ? 364 VAL A C   1 
ATOM   2498 O  O   . VAL A 1 364 ? 31.19906 60.44425 22.17062  1.000 37.49468  ? 364 VAL A O   1 
ATOM   2499 C  CB  . VAL A 1 364 ? 32.42571 59.51232 19.13821  1.000 38.47988  ? 364 VAL A CB  1 
ATOM   2500 C  CG1 . VAL A 1 364 ? 32.08843 58.81483 17.82644  1.000 26.07391  ? 364 VAL A CG1 1 
ATOM   2501 C  CG2 . VAL A 1 364 ? 32.26574 61.01602 19.03783  1.000 37.87572  ? 364 VAL A CG2 1 
ATOM   2502 N  N   . ARG A 1 365 ? 33.16985 59.34833 22.08320  1.000 34.00624  ? 365 ARG A N   1 
ATOM   2503 C  CA  . ARG A 1 365 ? 33.59722 59.83749 23.39562  1.000 36.49524  ? 365 ARG A CA  1 
ATOM   2504 C  C   . ARG A 1 365 ? 33.67715 61.36363 23.45332  1.000 38.76449  ? 365 ARG A C   1 
ATOM   2505 O  O   . ARG A 1 365 ? 33.27196 61.97279 24.45141  1.000 42.12247  ? 365 ARG A O   1 
ATOM   2506 C  CB  . ARG A 1 365 ? 34.94274 59.21529 23.76637  1.000 38.88171  ? 365 ARG A CB  1 
ATOM   2507 C  CG  . ARG A 1 365 ? 35.27990 59.28866 25.25215  1.000 39.52057  ? 365 ARG A CG  1 
ATOM   2508 C  CD  . ARG A 1 365 ? 36.68975 58.80378 25.52170  1.000 51.96879  ? 365 ARG A CD  1 
ATOM   2509 N  NE  . ARG A 1 365 ? 37.67225 59.72765 24.95565  1.000 68.28820  ? 365 ARG A NE  1 
ATOM   2510 C  CZ  . ARG A 1 365 ? 38.96013 59.44271 24.78474  1.000 66.15032  ? 365 ARG A CZ  1 
ATOM   2511 N  NH1 . ARG A 1 365 ? 39.42717 58.25172 25.13957  1.000 68.70791  ? 365 ARG A NH1 1 
ATOM   2512 N  NH2 . ARG A 1 365 ? 39.77880 60.34908 24.26497  1.000 57.40391  ? 365 ARG A NH2 1 
ATOM   2513 N  N   . ASP A 1 366 ? 34.17578 62.00136 22.39843  1.000 40.09902  ? 366 ASP A N   1 
ATOM   2514 C  CA  . ASP A 1 366 ? 34.44583 63.43904 22.40222  1.000 38.20439  ? 366 ASP A CA  1 
ATOM   2515 C  C   . ASP A 1 366 ? 33.73173 64.11629 21.22980  1.000 36.20569  ? 366 ASP A C   1 
ATOM   2516 O  O   . ASP A 1 366 ? 34.36831 64.69430 20.34844  1.000 36.30296  ? 366 ASP A O   1 
ATOM   2517 C  CB  . ASP A 1 366 ? 35.94257 63.67180 22.37128  1.000 38.95556  ? 366 ASP A CB  1 
ATOM   2518 C  CG  . ASP A 1 366 ? 36.65857 62.83186 23.39475  1.000 50.10725  ? 366 ASP A CG  1 
ATOM   2519 O  OD1 . ASP A 1 366 ? 36.52050 63.12476 24.60088  1.000 58.67702  ? 366 ASP A OD1 1 
ATOM   2520 O  OD2 . ASP A 1 366 ? 37.32791 61.85607 23.00565  1.000 53.53921  ? 366 ASP A OD2 1 
ATOM   2521 N  N   . GLU A 1 367 ? 32.39669 64.08009 21.25249  1.000 37.15640  ? 367 GLU A N   1 
ATOM   2522 C  CA  . GLU A 1 367 ? 31.60846 64.71167 20.19601  1.000 37.11111  ? 367 GLU A CA  1 
ATOM   2523 C  C   . GLU A 1 367 ? 31.96011 66.19223 20.01769  1.000 40.74507  ? 367 GLU A C   1 
ATOM   2524 O  O   . GLU A 1 367 ? 31.97232 66.70657 18.89342  1.000 44.49875  ? 367 GLU A O   1 
ATOM   2525 C  CB  . GLU A 1 367 ? 30.11893 64.55531 20.50597  1.000 37.42614  ? 367 GLU A CB  1 
ATOM   2526 C  CG  . GLU A 1 367 ? 29.64967 63.11230 20.71532  1.000 43.92771  ? 367 GLU A CG  1 
ATOM   2527 C  CD  . GLU A 1 367 ? 29.12749 62.46206 19.41994  1.000 43.15423  ? 367 GLU A CD  1 
ATOM   2528 O  OE1 . GLU A 1 367 ? 29.35927 63.03443 18.32947  1.000 35.58815  ? 367 GLU A OE1 1 
ATOM   2529 O  OE2 . GLU A 1 367 ? 28.46585 61.39223 19.49250  1.000 35.85970  ? 367 GLU A OE2 1 
ATOM   2530 N  N   . GLY A 1 368 ? 32.26763 66.89274 21.10307  1.000 41.19066  ? 368 GLY A N   1 
ATOM   2531 C  CA  . GLY A 1 368 ? 32.33011 68.33603 21.00032  1.000 35.02900  ? 368 GLY A CA  1 
ATOM   2532 C  C   . GLY A 1 368 ? 33.67157 68.95680 20.69993  1.000 35.43429  ? 368 GLY A C   1 
ATOM   2533 O  O   . GLY A 1 368 ? 33.71711 70.14763 20.36970  1.000 42.35977  ? 368 GLY A O   1 
ATOM   2534 N  N   . THR A 1 369 ? 34.77663 68.21562 20.80756  1.000 33.52105  ? 369 THR A N   1 
ATOM   2535 C  CA  . THR A 1 369 ? 36.08018 68.86447 20.68811  1.000 39.85584  ? 369 THR A CA  1 
ATOM   2536 C  C   . THR A 1 369 ? 36.21941 69.58087 19.35481  1.000 44.82440  ? 369 THR A C   1 
ATOM   2537 O  O   . THR A 1 369 ? 36.63791 70.74049 19.30880  1.000 51.95933  ? 369 THR A O   1 
ATOM   2538 C  CB  . THR A 1 369 ? 37.20499 67.85149 20.87850  1.000 47.23639  ? 369 THR A CB  1 
ATOM   2539 O  OG1 . THR A 1 369 ? 37.09568 66.80746 19.90076  1.000 47.64309  ? 369 THR A OG1 1 
ATOM   2540 C  CG2 . THR A 1 369 ? 37.12570 67.25937 22.27926  1.000 51.30114  ? 369 THR A CG2 1 
ATOM   2541 N  N   . TYR A 1 370 ? 35.83562 68.91538 18.26021  1.000 53.66269  ? 370 TYR A N   1 
ATOM   2542 C  CA  . TYR A 1 370 ? 36.00502 69.49293 16.92665  1.000 55.01800  ? 370 TYR A CA  1 
ATOM   2543 C  C   . TYR A 1 370 ? 35.30317 70.83973 16.81739  1.000 48.93991  ? 370 TYR A C   1 
ATOM   2544 O  O   . TYR A 1 370 ? 35.87579 71.81674 16.32225  1.000 46.00969  ? 370 TYR A O   1 
ATOM   2545 C  CB  . TYR A 1 370 ? 35.47152 68.53105 15.86116  1.000 57.05681  ? 370 TYR A CB  1 
ATOM   2546 C  CG  . TYR A 1 370 ? 35.16269 69.22666 14.56713  1.000 60.64552  ? 370 TYR A CG  1 
ATOM   2547 C  CD1 . TYR A 1 370 ? 36.18667 69.66084 13.74436  1.000 73.94958  ? 370 TYR A CD1 1 
ATOM   2548 C  CD2 . TYR A 1 370 ? 33.85333 69.50233 14.19065  1.000 63.13710  ? 370 TYR A CD2 1 
ATOM   2549 C  CE1 . TYR A 1 370 ? 35.92831 70.32795 12.56807  1.000 80.07478  ? 370 TYR A CE1 1 
ATOM   2550 C  CE2 . TYR A 1 370 ? 33.57486 70.16978 13.00749  1.000 72.84436  ? 370 TYR A CE2 1 
ATOM   2551 C  CZ  . TYR A 1 370 ? 34.62622 70.58427 12.18948  1.000 83.08763  ? 370 TYR A CZ  1 
ATOM   2552 O  OH  . TYR A 1 370 ? 34.40165 71.25807 10.99292  1.000 84.83636  ? 370 TYR A OH  1 
ATOM   2553 N  N   . PHE A 1 371 ? 34.05937 70.90896 17.28760  1.000 45.12112  ? 371 PHE A N   1 
ATOM   2554 C  CA  . PHE A 1 371 ? 33.29953 72.14771 17.19658  1.000 43.91376  ? 371 PHE A CA  1 
ATOM   2555 C  C   . PHE A 1 371 ? 33.86881 73.21566 18.12311  1.000 47.25432  ? 371 PHE A C   1 
ATOM   2556 O  O   . PHE A 1 371 ? 33.89351 74.40396 17.77684  1.000 45.61808  ? 371 PHE A O   1 
ATOM   2557 C  CB  . PHE A 1 371 ? 31.82804 71.86671 17.50747  1.000 36.28935  ? 371 PHE A CB  1 
ATOM   2558 C  CG  . PHE A 1 371 ? 31.17878 70.88907 16.54807  1.000 40.38547  ? 371 PHE A CG  1 
ATOM   2559 C  CD1 . PHE A 1 371 ? 30.74639 71.30270 15.28972  1.000 43.33071  ? 371 PHE A CD1 1 
ATOM   2560 C  CD2 . PHE A 1 371 ? 31.01523 69.55594 16.89602  1.000 41.40302  ? 371 PHE A CD2 1 
ATOM   2561 C  CE1 . PHE A 1 371 ? 30.15476 70.41136 14.41154  1.000 40.00014  ? 371 PHE A CE1 1 
ATOM   2562 C  CE2 . PHE A 1 371 ? 30.42234 68.65677 16.01998  1.000 39.51958  ? 371 PHE A CE2 1 
ATOM   2563 C  CZ  . PHE A 1 371 ? 29.99251 69.08569 14.77279  1.000 35.98272  ? 371 PHE A CZ  1 
ATOM   2564 N  N   . LEU A 1 372 ? 34.33719 72.81664 19.30398  1.000 47.74629  ? 372 LEU A N   1 
ATOM   2565 C  CA  . LEU A 1 372 ? 34.94506 73.79499 20.19727  1.000 46.51237  ? 372 LEU A CA  1 
ATOM   2566 C  C   . LEU A 1 372 ? 36.21380 74.37849 19.58406  1.000 48.22934  ? 372 LEU A C   1 
ATOM   2567 O  O   . LEU A 1 372 ? 36.42463 75.59775 19.62080  1.000 54.67345  ? 372 LEU A O   1 
ATOM   2568 C  CB  . LEU A 1 372 ? 35.23102 73.15873 21.55331  1.000 35.57708  ? 372 LEU A CB  1 
ATOM   2569 C  CG  . LEU A 1 372 ? 36.02626 73.99917 22.55592  1.000 39.37399  ? 372 LEU A CG  1 
ATOM   2570 C  CD1 . LEU A 1 372 ? 35.12410 75.01110 23.25608  1.000 37.78449  ? 372 LEU A CD1 1 
ATOM   2571 C  CD2 . LEU A 1 372 ? 36.73674 73.10558 23.57481  1.000 37.06793  ? 372 LEU A CD2 1 
ATOM   2572 N  N   . LEU A 1 373 ? 37.05867 73.52879 18.98918  1.000 43.14166  ? 373 LEU A N   1 
ATOM   2573 C  CA  . LEU A 1 373 ? 38.25479 74.03819 18.32526  1.000 50.19466  ? 373 LEU A CA  1 
ATOM   2574 C  C   . LEU A 1 373 ? 37.89682 75.05125 17.24101  1.000 51.08914  ? 373 LEU A C   1 
ATOM   2575 O  O   . LEU A 1 373 ? 38.54525 76.09556 17.12879  1.000 52.63945  ? 373 LEU A O   1 
ATOM   2576 C  CB  . LEU A 1 373 ? 39.07897 72.88668 17.73801  1.000 49.62218  ? 373 LEU A CB  1 
ATOM   2577 C  CG  . LEU A 1 373 ? 40.17563 73.27809 16.72559  1.000 48.26488  ? 373 LEU A CG  1 
ATOM   2578 C  CD1 . LEU A 1 373 ? 41.34732 74.04746 17.36788  1.000 43.80295  ? 373 LEU A CD1 1 
ATOM   2579 C  CD2 . LEU A 1 373 ? 40.69540 72.07039 15.94598  1.000 45.88636  ? 373 LEU A CD2 1 
ATOM   2580 N  N   . TYR A 1 374 ? 36.84824 74.78215 16.45460  1.000 50.04563  ? 374 TYR A N   1 
ATOM   2581 C  CA  . TYR A 1 374 ? 36.54857 75.65959 15.32238  1.000 53.41867  ? 374 TYR A CA  1 
ATOM   2582 C  C   . TYR A 1 374 ? 35.90411 76.97146 15.75877  1.000 58.14781  ? 374 TYR A C   1 
ATOM   2583 O  O   . TYR A 1 374 ? 36.24565 78.03135 15.22547  1.000 65.21985  ? 374 TYR A O   1 
ATOM   2584 C  CB  . TYR A 1 374 ? 35.65222 74.95077 14.29906  1.000 53.02752  ? 374 TYR A CB  1 
ATOM   2585 C  CG  . TYR A 1 374 ? 36.43235 74.27758 13.19296  1.000 59.22444  ? 374 TYR A CG  1 
ATOM   2586 C  CD1 . TYR A 1 374 ? 37.33893 73.27040 13.48572  1.000 61.57368  ? 374 TYR A CD1 1 
ATOM   2587 C  CD2 . TYR A 1 374 ? 36.27900 74.65438 11.86258  1.000 62.19933  ? 374 TYR A CD2 1 
ATOM   2588 C  CE1 . TYR A 1 374 ? 38.07476 72.65080 12.49624  1.000 62.77279  ? 374 TYR A CE1 1 
ATOM   2589 C  CE2 . TYR A 1 374 ? 37.01372 74.03280 10.85470  1.000 65.16905  ? 374 TYR A CE2 1 
ATOM   2590 C  CZ  . TYR A 1 374 ? 37.91227 73.02566 11.18609  1.000 64.47979  ? 374 TYR A CZ  1 
ATOM   2591 O  OH  . TYR A 1 374 ? 38.66577 72.38945 10.21860  1.000 62.36246  ? 374 TYR A OH  1 
ATOM   2592 N  N   . ASP A 1 375 ? 34.97761 76.93751 16.71611  1.000 58.14372  ? 375 ASP A N   1 
ATOM   2593 C  CA  . ASP A 1 375 ? 34.25944 78.16276 17.04670  1.000 68.05862  ? 375 ASP A CA  1 
ATOM   2594 C  C   . ASP A 1 375 ? 34.99926 79.04615 18.03725  1.000 63.24920  ? 375 ASP A C   1 
ATOM   2595 O  O   . ASP A 1 375 ? 34.53675 80.15876 18.30888  1.000 58.41615  ? 375 ASP A O   1 
ATOM   2596 C  CB  . ASP A 1 375 ? 32.86930 77.83604 17.58800  1.000 79.52490  ? 375 ASP A CB  1 
ATOM   2597 C  CG  . ASP A 1 375 ? 31.83798 77.71372 16.47896  1.000 85.58528  ? 375 ASP A CG  1 
ATOM   2598 O  OD1 . ASP A 1 375 ? 31.67175 76.59279 15.94999  1.000 82.83606  ? 375 ASP A OD1 1 
ATOM   2599 O  OD2 . ASP A 1 375 ? 31.20885 78.73806 16.12496  1.000 89.36026  ? 375 ASP A OD2 1 
ATOM   2600 N  N   . PHE A 1 376 ? 36.12098 78.58000 18.58175  1.000 65.06265  ? 376 PHE A N   1 
ATOM   2601 C  CA  . PHE A 1 376 ? 36.93612 79.34137 19.52529  1.000 68.40795  ? 376 PHE A CA  1 
ATOM   2602 C  C   . PHE A 1 376 ? 38.39981 79.18434 19.16811  1.000 69.12378  ? 376 PHE A C   1 
ATOM   2603 O  O   . PHE A 1 376 ? 39.27021 79.02509 20.03369  1.000 61.10770  ? 376 PHE A O   1 
ATOM   2604 C  CB  . PHE A 1 376 ? 36.64097 78.91945 20.96504  1.000 62.43304  ? 376 PHE A CB  1 
ATOM   2605 C  CG  . PHE A 1 376 ? 35.26602 79.30412 21.40026  1.000 58.18420  ? 376 PHE A CG  1 
ATOM   2606 C  CD1 . PHE A 1 376 ? 34.17413 78.53094 21.04300  1.000 52.70688  ? 376 PHE A CD1 1 
ATOM   2607 C  CD2 . PHE A 1 376 ? 35.04907 80.47999 22.08672  1.000 61.56774  ? 376 PHE A CD2 1 
ATOM   2608 C  CE1 . PHE A 1 376 ? 32.89699 78.90505 21.39650  1.000 49.11922  ? 376 PHE A CE1 1 
ATOM   2609 C  CE2 . PHE A 1 376 ? 33.76876 80.85490 22.44990  1.000 62.14972  ? 376 PHE A CE2 1 
ATOM   2610 C  CZ  . PHE A 1 376 ? 32.69247 80.06532 22.10647  1.000 50.27671  ? 376 PHE A CZ  1 
ATOM   2611 N  N   . ILE A 1 377 ? 38.67696 79.24127 17.86404  1.000 70.16296  ? 377 ILE A N   1 
ATOM   2612 C  CA  . ILE A 1 377 ? 40.00263 78.94896 17.35243  1.000 70.84385  ? 377 ILE A CA  1 
ATOM   2613 C  C   . ILE A 1 377 ? 41.00519 79.98631 17.81658  1.000 77.00753  ? 377 ILE A C   1 
ATOM   2614 O  O   . ILE A 1 377 ? 42.21556 79.75302 17.75240  1.000 83.14578  ? 377 ILE A O   1 
ATOM   2615 C  CB  . ILE A 1 377 ? 39.94471 78.83211 15.81145  1.000 65.78227  ? 377 ILE A CB  1 
ATOM   2616 C  CG1 . ILE A 1 377 ? 41.26420 78.28815 15.25516  1.000 62.77646  ? 377 ILE A CG1 1 
ATOM   2617 C  CG2 . ILE A 1 377 ? 39.58700 80.17341 15.17484  1.000 67.79605  ? 377 ILE A CG2 1 
ATOM   2618 C  CD1 . ILE A 1 377 ? 41.10080 77.45201 14.02415  1.000 60.66312  ? 377 ILE A CD1 1 
ATOM   2619 N  N   . ASP A 1 378 ? 40.53042 81.12786 18.31151  1.000 84.69090  ? 378 ASP A N   1 
ATOM   2620 C  CA  . ASP A 1 378 ? 41.44867 82.09904 18.89286  1.000 91.39241  ? 378 ASP A CA  1 
ATOM   2621 C  C   . ASP A 1 378 ? 42.11564 81.55462 20.15120  1.000 83.07269  ? 378 ASP A C   1 
ATOM   2622 O  O   . ASP A 1 378 ? 43.25133 81.92947 20.45269  1.000 85.06953  ? 378 ASP A O   1 
ATOM   2623 C  CB  . ASP A 1 378 ? 40.71086 83.40319 19.19298  1.000 97.88632  ? 378 ASP A CB  1 
ATOM   2624 C  CG  . ASP A 1 378 ? 39.99933 83.95889 17.97680  1.000 103.04323 ? 378 ASP A CG  1 
ATOM   2625 O  OD1 . ASP A 1 378 ? 40.69673 84.43004 17.05528  1.000 101.92793 ? 378 ASP A OD1 1 
ATOM   2626 O  OD2 . ASP A 1 378 ? 38.74755 83.90989 17.93727  1.000 105.41265 ? 378 ASP A OD2 1 
ATOM   2627 N  N   . TYR A 1 379 ? 41.44442 80.66605 20.88771  1.000 74.04258  ? 379 TYR A N   1 
ATOM   2628 C  CA  . TYR A 1 379 ? 42.03465 80.10982 22.10114  1.000 75.91047  ? 379 TYR A CA  1 
ATOM   2629 C  C   . TYR A 1 379 ? 42.81365 78.83050 21.85469  1.000 74.94049  ? 379 TYR A C   1 
ATOM   2630 O  O   . TYR A 1 379 ? 43.74030 78.52039 22.61259  1.000 73.96281  ? 379 TYR A O   1 
ATOM   2631 C  CB  . TYR A 1 379 ? 40.96026 79.79860 23.15040  1.000 74.93954  ? 379 TYR A CB  1 
ATOM   2632 C  CG  . TYR A 1 379 ? 40.00592 80.92547 23.43636  1.000 80.55243  ? 379 TYR A CG  1 
ATOM   2633 C  CD1 . TYR A 1 379 ? 40.22988 81.80628 24.49207  1.000 79.90982  ? 379 TYR A CD1 1 
ATOM   2634 C  CD2 . TYR A 1 379 ? 38.87216 81.10824 22.65146  1.000 84.60772  ? 379 TYR A CD2 1 
ATOM   2635 C  CE1 . TYR A 1 379 ? 39.34912 82.84171 24.75447  1.000 82.28528  ? 379 TYR A CE1 1 
ATOM   2636 C  CE2 . TYR A 1 379 ? 37.98842 82.13893 22.90234  1.000 86.69481  ? 379 TYR A CE2 1 
ATOM   2637 C  CZ  . TYR A 1 379 ? 38.22889 83.00316 23.95433  1.000 82.21608  ? 379 TYR A CZ  1 
ATOM   2638 O  OH  . TYR A 1 379 ? 37.33550 84.02327 24.18654  1.000 78.67810  ? 379 TYR A OH  1 
ATOM   2639 N  N   . PHE A 1 380 ? 42.45819 78.07050 20.83034  1.000 72.09347  ? 380 PHE A N   1 
ATOM   2640 C  CA  . PHE A 1 380 ? 42.83987 76.67138 20.79739  1.000 67.48544  ? 380 PHE A CA  1 
ATOM   2641 C  C   . PHE A 1 380 ? 43.70022 76.35161 19.58494  1.000 64.94390  ? 380 PHE A C   1 
ATOM   2642 O  O   . PHE A 1 380 ? 43.89579 77.16773 18.67907  1.000 63.32036  ? 380 PHE A O   1 
ATOM   2643 C  CB  . PHE A 1 380 ? 41.59285 75.78975 20.84970  1.000 61.92918  ? 380 PHE A CB  1 
ATOM   2644 C  CG  . PHE A 1 380 ? 40.81669 75.96322 22.11708  1.000 61.03462  ? 380 PHE A CG  1 
ATOM   2645 C  CD1 . PHE A 1 380 ? 41.48620 76.14151 23.32072  1.000 57.89240  ? 380 PHE A CD1 1 
ATOM   2646 C  CD2 . PHE A 1 380 ? 39.43078 75.98074 22.11476  1.000 56.97734  ? 380 PHE A CD2 1 
ATOM   2647 C  CE1 . PHE A 1 380 ? 40.78754 76.31247 24.49195  1.000 55.50486  ? 380 PHE A CE1 1 
ATOM   2648 C  CE2 . PHE A 1 380 ? 38.72581 76.14705 23.29648  1.000 53.80169  ? 380 PHE A CE2 1 
ATOM   2649 C  CZ  . PHE A 1 380 ? 39.40590 76.31582 24.48237  1.000 52.31808  ? 380 PHE A CZ  1 
ATOM   2650 N  N   . ASP A 1 381 ? 44.24305 75.14170 19.61079  1.000 63.24758  ? 381 ASP A N   1 
ATOM   2651 C  CA  . ASP A 1 381 ? 45.23428 74.71344 18.64255  1.000 68.83617  ? 381 ASP A CA  1 
ATOM   2652 C  C   . ASP A 1 381 ? 44.95444 73.26190 18.29879  1.000 69.29247  ? 381 ASP A C   1 
ATOM   2653 O  O   . ASP A 1 381 ? 44.78691 72.43252 19.19624  1.000 74.51714  ? 381 ASP A O   1 
ATOM   2654 C  CB  . ASP A 1 381 ? 46.64826 74.87751 19.20489  1.000 69.95721  ? 381 ASP A CB  1 
ATOM   2655 C  CG  . ASP A 1 381 ? 47.71957 74.51141 18.20326  1.000 73.84698  ? 381 ASP A CG  1 
ATOM   2656 O  OD1 . ASP A 1 381 ? 47.94790 75.27772 17.22534  1.000 64.40245  ? 381 ASP A OD1 1 
ATOM   2657 O  OD2 . ASP A 1 381 ? 48.30856 73.42362 18.38868  1.000 78.90121  ? 381 ASP A OD2 1 
ATOM   2658 N  N   . LYS A 1 382 ? 44.89047 72.96269 17.00232  1.000 66.46881  ? 382 LYS A N   1 
ATOM   2659 C  CA  . LYS A 1 382 ? 44.55343 71.61460 16.56851  1.000 60.65331  ? 382 LYS A CA  1 
ATOM   2660 C  C   . LYS A 1 382 ? 45.60299 70.59475 16.97840  1.000 61.13559  ? 382 LYS A C   1 
ATOM   2661 O  O   . LYS A 1 382 ? 45.31121 69.39826 16.98030  1.000 52.26898  ? 382 LYS A O   1 
ATOM   2662 C  CB  . LYS A 1 382 ? 44.37178 71.57973 15.05094  1.000 56.52080  ? 382 LYS A CB  1 
ATOM   2663 C  CG  . LYS A 1 382 ? 45.67870 71.53584 14.28794  1.000 57.24398  ? 382 LYS A CG  1 
ATOM   2664 C  CD  . LYS A 1 382 ? 45.45554 71.38828 12.79564  1.000 61.55210  ? 382 LYS A CD  1 
ATOM   2665 C  CE  . LYS A 1 382 ? 46.68802 70.84469 12.10498  1.000 72.52719  ? 382 LYS A CE  1 
ATOM   2666 N  NZ  . LYS A 1 382 ? 46.94063 69.43969 12.54132  1.000 81.42912  ? 382 LYS A NZ  1 
ATOM   2667 N  N   . ASP A 1 383 ? 46.81461 71.02819 17.32659  1.000 65.49624  ? 383 ASP A N   1 
ATOM   2668 C  CA  . ASP A 1 383 ? 47.87640 70.08570 17.65686  1.000 67.07139  ? 383 ASP A CA  1 
ATOM   2669 C  C   . ASP A 1 383 ? 48.09006 69.93145 19.15737  1.000 69.10000  ? 383 ASP A C   1 
ATOM   2670 O  O   . ASP A 1 383 ? 48.22391 68.80547 19.64933  1.000 70.51665  ? 383 ASP A O   1 
ATOM   2671 C  CB  . ASP A 1 383 ? 49.19358 70.49964 16.98990  1.000 75.59426  ? 383 ASP A CB  1 
ATOM   2672 C  CG  . ASP A 1 383 ? 49.23865 70.14527 15.51874  1.000 80.10828  ? 383 ASP A CG  1 
ATOM   2673 O  OD1 . ASP A 1 383 ? 49.79274 70.93952 14.71303  1.000 81.65356  ? 383 ASP A OD1 1 
ATOM   2674 O  OD2 . ASP A 1 383 ? 48.70222 69.07187 15.17416  1.000 75.85354  ? 383 ASP A OD2 1 
ATOM   2675 N  N   . ASP A 1 384 ? 48.13013 71.03303 19.89990  1.000 67.38634  ? 384 ASP A N   1 
ATOM   2676 C  CA  . ASP A 1 384 ? 48.49753 70.99095 21.30642  1.000 60.78347  ? 384 ASP A CA  1 
ATOM   2677 C  C   . ASP A 1 384 ? 47.30109 71.31226 22.18354  1.000 55.77736  ? 384 ASP A C   1 
ATOM   2678 O  O   . ASP A 1 384 ? 46.36700 72.00387 21.76751  1.000 50.40191  ? 384 ASP A O   1 
ATOM   2679 C  CB  . ASP A 1 384 ? 49.63220 71.96835 21.61325  1.000 64.49671  ? 384 ASP A CB  1 
ATOM   2680 C  CG  . ASP A 1 384 ? 50.86396 71.69212 20.78653  1.000 78.47238  ? 384 ASP A CG  1 
ATOM   2681 O  OD1 . ASP A 1 384 ? 51.27369 70.51190 20.73333  1.000 82.04187  ? 384 ASP A OD1 1 
ATOM   2682 O  OD2 . ASP A 1 384 ? 51.40888 72.64157 20.17868  1.000 85.18680  ? 384 ASP A OD2 1 
ATOM   2683 N  N   . ALA A 1 385 ? 47.34229 70.79544 23.40615  1.000 57.18980  ? 385 ALA A N   1 
ATOM   2684 C  CA  . ALA A 1 385 ? 46.34325 71.15801 24.39674  1.000 56.05902  ? 385 ALA A CA  1 
ATOM   2685 C  C   . ALA A 1 385 ? 46.57798 72.58875 24.87827  1.000 58.84487  ? 385 ALA A C   1 
ATOM   2686 O  O   . ALA A 1 385 ? 47.67734 73.14057 24.76757  1.000 62.59037  ? 385 ALA A O   1 
ATOM   2687 C  CB  . ALA A 1 385 ? 46.37536 70.17739 25.56795  1.000 48.65042  ? 385 ALA A CB  1 
ATOM   2688 N  N   . THR A 1 386 ? 45.52665 73.19790 25.40018  1.000 50.57122  ? 386 THR A N   1 
ATOM   2689 C  CA  . THR A 1 386 ? 45.58322 74.56792 25.87933  1.000 56.48547  ? 386 THR A CA  1 
ATOM   2690 C  C   . THR A 1 386 ? 45.33308 74.58588 27.38753  1.000 58.81293  ? 386 THR A C   1 
ATOM   2691 O  O   . THR A 1 386 ? 44.29561 74.10601 27.85715  1.000 54.41302  ? 386 THR A O   1 
ATOM   2692 C  CB  . THR A 1 386 ? 44.56886 75.42240 25.11968  1.000 56.04995  ? 386 THR A CB  1 
ATOM   2693 O  OG1 . THR A 1 386 ? 45.12813 75.79097 23.85396  1.000 61.98984  ? 386 THR A OG1 1 
ATOM   2694 C  CG2 . THR A 1 386 ? 44.19801 76.67721 25.89643  1.000 54.28917  ? 386 THR A CG2 1 
ATOM   2695 N  N   . ALA A 1 387 ? 46.29409 75.11000 28.14742  1.000 55.70164  ? 387 ALA A N   1 
ATOM   2696 C  CA  . ALA A 1 387 ? 46.07744 75.34340 29.57423  1.000 63.75623  ? 387 ALA A CA  1 
ATOM   2697 C  C   . ALA A 1 387 ? 45.24285 76.61450 29.72678  1.000 67.30797  ? 387 ALA A C   1 
ATOM   2698 O  O   . ALA A 1 387 ? 45.75786 77.73392 29.66218  1.000 68.07647  ? 387 ALA A O   1 
ATOM   2699 C  CB  . ALA A 1 387 ? 47.40066 75.43524 30.32067  1.000 59.53417  ? 387 ALA A CB  1 
ATOM   2700 N  N   . LEU A 1 388 ? 43.94045 76.43629 29.93560  1.000 62.33726  ? 388 LEU A N   1 
ATOM   2701 C  CA  . LEU A 1 388 ? 42.98512 77.52657 29.88442  1.000 62.89561  ? 388 LEU A CA  1 
ATOM   2702 C  C   . LEU A 1 388 ? 42.68716 78.02553 31.29011  1.000 65.68402  ? 388 LEU A C   1 
ATOM   2703 O  O   . LEU A 1 388 ? 42.28376 77.22216 32.14595  1.000 69.76714  ? 388 LEU A O   1 
ATOM   2704 C  CB  . LEU A 1 388 ? 41.71602 77.04684 29.19060  1.000 66.83442  ? 388 LEU A CB  1 
ATOM   2705 C  CG  . LEU A 1 388 ? 40.52885 77.96568 28.95595  1.000 68.37113  ? 388 LEU A CG  1 
ATOM   2706 C  CD1 . LEU A 1 388 ? 40.65461 78.50984 27.56333  1.000 64.70308  ? 388 LEU A CD1 1 
ATOM   2707 C  CD2 . LEU A 1 388 ? 39.24532 77.14263 29.05779  1.000 65.94853  ? 388 LEU A CD2 1 
ATOM   2708 N  N   . PRO A 1 389 ? 42.88558 79.31024 31.58541  1.000 64.68502  ? 389 PRO A N   1 
ATOM   2709 C  CA  . PRO A 1 389 ? 42.67613 79.79990 32.95237  1.000 61.68530  ? 389 PRO A CA  1 
ATOM   2710 C  C   . PRO A 1 389 ? 41.20162 79.93535 33.30477  1.000 63.83805  ? 389 PRO A C   1 
ATOM   2711 O  O   . PRO A 1 389 ? 40.32317 79.94134 32.44119  1.000 72.61823  ? 389 PRO A O   1 
ATOM   2712 C  CB  . PRO A 1 389 ? 43.36264 81.17028 32.94960  1.000 63.67021  ? 389 PRO A CB  1 
ATOM   2713 C  CG  . PRO A 1 389 ? 44.10183 81.26054 31.66353  1.000 64.24271  ? 389 PRO A CG  1 
ATOM   2714 C  CD  . PRO A 1 389 ? 43.40358 80.36433 30.70519  1.000 66.29755  ? 389 PRO A CD  1 
ATOM   2715 N  N   . ARG A 1 390 ? 40.94535 80.07781 34.61087  1.000 65.68284  ? 390 ARG A N   1 
ATOM   2716 C  CA  . ARG A 1 390 ? 39.57147 80.07620 35.11086  1.000 63.00184  ? 390 ARG A CA  1 
ATOM   2717 C  C   . ARG A 1 390 ? 38.74246 81.16584 34.44756  1.000 67.53198  ? 390 ARG A C   1 
ATOM   2718 O  O   . ARG A 1 390 ? 37.63343 80.90847 33.96342  1.000 69.11681  ? 390 ARG A O   1 
ATOM   2719 C  CB  . ARG A 1 390 ? 39.55298 80.24309 36.63304  1.000 59.59609  ? 390 ARG A CB  1 
ATOM   2720 C  CG  . ARG A 1 390 ? 38.43211 79.48104 37.35416  1.000 59.49588  ? 390 ARG A CG  1 
ATOM   2721 C  CD  . ARG A 1 390 ? 37.08234 80.17674 37.19561  1.000 69.89755  ? 390 ARG A CD  1 
ATOM   2722 N  NE  . ARG A 1 390 ? 36.00075 79.71034 38.07949  1.000 73.70909  ? 390 ARG A NE  1 
ATOM   2723 C  CZ  . ARG A 1 390 ? 35.26045 78.61244 37.88337  1.000 66.57482  ? 390 ARG A CZ  1 
ATOM   2724 N  NH1 . ARG A 1 390 ? 35.50273 77.79044 36.85525  1.000 56.92498  ? 390 ARG A NH1 1 
ATOM   2725 N  NH2 . ARG A 1 390 ? 34.28173 78.31952 38.73840  1.000 59.87948  ? 390 ARG A NH2 1 
ATOM   2726 N  N   . ASP A 1 391 ? 39.26914 82.39097 34.40850  1.000 68.08685  ? 391 ASP A N   1 
ATOM   2727 C  CA  . ASP A 1 391 ? 38.51835 83.50116 33.82984  1.000 71.19511  ? 391 ASP A CA  1 
ATOM   2728 C  C   . ASP A 1 391 ? 38.09667 83.20275 32.39593  1.000 65.03938  ? 391 ASP A C   1 
ATOM   2729 O  O   . ASP A 1 391 ? 36.97431 83.52829 31.98693  1.000 59.56011  ? 391 ASP A O   1 
ATOM   2730 C  CB  . ASP A 1 391 ? 39.35639 84.77926 33.88696  1.000 84.92205  ? 391 ASP A CB  1 
ATOM   2731 C  CG  . ASP A 1 391 ? 40.57388 84.72185 32.97480  1.000 93.34559  ? 391 ASP A CG  1 
ATOM   2732 O  OD1 . ASP A 1 391 ? 40.98901 83.60387 32.59008  1.000 92.72085  ? 391 ASP A OD1 1 
ATOM   2733 O  OD2 . ASP A 1 391 ? 41.11868 85.79558 32.64615  1.000 99.53255  ? 391 ASP A OD2 1 
ATOM   2734 N  N   . LYS A 1 392 ? 38.98247 82.57223 31.61924  1.000 67.13805  ? 392 LYS A N   1 
ATOM   2735 C  CA  . LYS A 1 392 ? 38.67867 82.29119 30.22256  1.000 76.55711  ? 392 LYS A CA  1 
ATOM   2736 C  C   . LYS A 1 392 ? 37.85285 81.02860 30.05105  1.000 72.58579  ? 392 LYS A C   1 
ATOM   2737 O  O   . LYS A 1 392 ? 37.23630 80.84815 28.99232  1.000 84.51015  ? 392 LYS A O   1 
ATOM   2738 C  CB  . LYS A 1 392 ? 39.96998 82.22874 29.40076  1.000 81.11957  ? 392 LYS A CB  1 
ATOM   2739 C  CG  . LYS A 1 392 ? 40.24148 83.57704 28.72085  1.000 94.16122  ? 392 LYS A CG  1 
ATOM   2740 C  CD  . LYS A 1 392 ? 41.68091 83.80511 28.27474  1.000 102.25029 ? 392 LYS A CD  1 
ATOM   2741 C  CE  . LYS A 1 392 ? 41.82020 85.10416 27.44547  1.000 111.16369 ? 392 LYS A CE  1 
ATOM   2742 N  NZ  . LYS A 1 392 ? 40.56225 85.92090 27.30582  1.000 111.82376 ? 392 LYS A NZ  1 
ATOM   2743 N  N   . TYR A 1 393 ? 37.79928 80.17367 31.07346  1.000 58.19484  ? 393 TYR A N   1 
ATOM   2744 C  CA  . TYR A 1 393 ? 36.78044 79.13083 31.10628  1.000 50.79793  ? 393 TYR A CA  1 
ATOM   2745 C  C   . TYR A 1 393 ? 35.39013 79.75061 31.25756  1.000 53.96814  ? 393 TYR A C   1 
ATOM   2746 O  O   . TYR A 1 393 ? 34.46002 79.40979 30.51818  1.000 51.05888  ? 393 TYR A O   1 
ATOM   2747 C  CB  . TYR A 1 393 ? 37.08723 78.14650 32.23904  1.000 51.55819  ? 393 TYR A CB  1 
ATOM   2748 C  CG  . TYR A 1 393 ? 35.96256 77.19604 32.60550  1.000 53.53003  ? 393 TYR A CG  1 
ATOM   2749 C  CD1 . TYR A 1 393 ? 35.75913 76.01330 31.90292  1.000 54.56091  ? 393 TYR A CD1 1 
ATOM   2750 C  CD2 . TYR A 1 393 ? 35.10585 77.48155 33.65684  1.000 56.71032  ? 393 TYR A CD2 1 
ATOM   2751 C  CE1 . TYR A 1 393 ? 34.73224 75.14591 32.23882  1.000 49.02617  ? 393 TYR A CE1 1 
ATOM   2752 C  CE2 . TYR A 1 393 ? 34.08132 76.61657 34.00459  1.000 57.25537  ? 393 TYR A CE2 1 
ATOM   2753 C  CZ  . TYR A 1 393 ? 33.89566 75.45967 33.28936  1.000 54.60758  ? 393 TYR A CZ  1 
ATOM   2754 O  OH  . TYR A 1 393 ? 32.87109 74.61649 33.63932  1.000 56.39699  ? 393 TYR A OH  1 
ATOM   2755 N  N   . LEU A 1 394 ? 35.24173 80.69215 32.19638  1.000 55.29426  ? 394 LEU A N   1 
ATOM   2756 C  CA  . LEU A 1 394 ? 33.96172 81.37879 32.35432  1.000 52.56537  ? 394 LEU A CA  1 
ATOM   2757 C  C   . LEU A 1 394 ? 33.58893 82.11538 31.06956  1.000 62.63355  ? 394 LEU A C   1 
ATOM   2758 O  O   . LEU A 1 394 ? 32.45606 82.01683 30.57255  1.000 56.53826  ? 394 LEU A O   1 
ATOM   2759 C  CB  . LEU A 1 394 ? 34.03591 82.35425 33.53081  1.000 54.85025  ? 394 LEU A CB  1 
ATOM   2760 C  CG  . LEU A 1 394 ? 34.44368 81.81625 34.91077  1.000 63.09911  ? 394 LEU A CG  1 
ATOM   2761 C  CD1 . LEU A 1 394 ? 35.32636 82.84855 35.58610  1.000 65.31065  ? 394 LEU A CD1 1 
ATOM   2762 C  CD2 . LEU A 1 394 ? 33.26290 81.48855 35.81491  1.000 62.06206  ? 394 LEU A CD2 1 
ATOM   2763 N  N   . GLU A 1 395 ? 34.54338 82.86519 30.51933  1.000 69.20597  ? 395 GLU A N   1 
ATOM   2764 C  CA  . GLU A 1 395 ? 34.31098 83.63531 29.30956  1.000 69.46809  ? 395 GLU A CA  1 
ATOM   2765 C  C   . GLU A 1 395 ? 33.82054 82.74973 28.16423  1.000 67.38138  ? 395 GLU A C   1 
ATOM   2766 O  O   . GLU A 1 395 ? 32.95298 83.16068 27.38425  1.000 68.28398  ? 395 GLU A O   1 
ATOM   2767 C  CB  . GLU A 1 395 ? 35.60855 84.35495 28.95328  1.000 75.60320  ? 395 GLU A CB  1 
ATOM   2768 C  CG  . GLU A 1 395 ? 35.50885 85.49091 27.97286  1.000 78.23300  ? 395 GLU A CG  1 
ATOM   2769 C  CD  . GLU A 1 395 ? 36.79471 85.63178 27.17842  1.000 79.54619  ? 395 GLU A CD  1 
ATOM   2770 O  OE1 . GLU A 1 395 ? 36.90888 84.96651 26.13110  1.000 77.39324  ? 395 GLU A OE1 1 
ATOM   2771 O  OE2 . GLU A 1 395 ? 37.70166 86.37318 27.61233  1.000 83.00596  ? 395 GLU A OE2 1 
ATOM   2772 N  N   . ILE A 1 396 ? 34.34597 81.52295 28.05672  1.000 61.95934  ? 396 ILE A N   1 
ATOM   2773 C  CA  . ILE A 1 396 ? 33.96526 80.65190 26.94311  1.000 61.47685  ? 396 ILE A CA  1 
ATOM   2774 C  C   . ILE A 1 396 ? 32.64372 79.95313 27.22007  1.000 59.30062  ? 396 ILE A C   1 
ATOM   2775 O  O   . ILE A 1 396 ? 31.77260 79.88323 26.34472  1.000 56.04850  ? 396 ILE A O   1 
ATOM   2776 C  CB  . ILE A 1 396 ? 35.07172 79.62934 26.64467  1.000 58.10932  ? 396 ILE A CB  1 
ATOM   2777 C  CG1 . ILE A 1 396 ? 36.24107 80.30428 25.93350  1.000 64.01103  ? 396 ILE A CG1 1 
ATOM   2778 C  CG2 . ILE A 1 396 ? 34.51083 78.48788 25.80862  1.000 49.19726  ? 396 ILE A CG2 1 
ATOM   2779 C  CD1 . ILE A 1 396 ? 37.45724 79.41111 25.79240  1.000 66.25666  ? 396 ILE A CD1 1 
ATOM   2780 N  N   . MET A 1 397 ? 32.49170 79.39828 28.42707  1.000 61.52272  ? 397 MET A N   1 
ATOM   2781 C  CA  . MET A 1 397 ? 31.22864 78.77331 28.81556  1.000 53.98699  ? 397 MET A CA  1 
ATOM   2782 C  C   . MET A 1 397 ? 30.07771 79.76362 28.71917  1.000 49.04516  ? 397 MET A C   1 
ATOM   2783 O  O   . MET A 1 397 ? 29.01205 79.44537 28.18065  1.000 42.42406  ? 397 MET A O   1 
ATOM   2784 C  CB  . MET A 1 397 ? 31.32198 78.22789 30.24147  1.000 47.45514  ? 397 MET A CB  1 
ATOM   2785 C  CG  . MET A 1 397 ? 32.26866 77.07213 30.39618  1.000 45.90390  ? 397 MET A CG  1 
ATOM   2786 S  SD  . MET A 1 397 ? 31.70724 75.61141 29.51779  1.000 43.66859  ? 397 MET A SD  1 
ATOM   2787 C  CE  . MET A 1 397 ? 30.28530 75.12466 30.49138  1.000 42.01871  ? 397 MET A CE  1 
ATOM   2788 N  N   . ASN A 1 398 ? 30.26788 80.96522 29.26947  1.000 46.42708  ? 398 ASN A N   1 
ATOM   2789 C  CA  . ASN A 1 398 ? 29.22377 81.97761 29.20510  1.000 51.40516  ? 398 ASN A CA  1 
ATOM   2790 C  C   . ASN A 1 398 ? 28.87573 82.31380 27.76984  1.000 57.02250  ? 398 ASN A C   1 
ATOM   2791 O  O   . ASN A 1 398 ? 27.75059 82.74138 27.48750  1.000 62.26958  ? 398 ASN A O   1 
ATOM   2792 C  CB  . ASN A 1 398 ? 29.66271 83.24210 29.93667  1.000 61.45785  ? 398 ASN A CB  1 
ATOM   2793 C  CG  . ASN A 1 398 ? 29.47821 83.14349 31.42990  1.000 63.50403  ? 398 ASN A CG  1 
ATOM   2794 O  OD1 . ASN A 1 398 ? 28.51795 82.54525 31.91902  1.000 58.14956  ? 398 ASN A OD1 1 
ATOM   2795 N  ND2 . ASN A 1 398 ? 30.39287 83.74938 32.16879  1.000 70.72467  ? 398 ASN A ND2 1 
ATOM   2796 N  N   . ASN A 1 399 ? 29.82709 82.13319 26.85100  1.000 56.35761  ? 399 ASN A N   1 
ATOM   2797 C  CA  . ASN A 1 399 ? 29.54901 82.37566 25.44191  1.000 54.46668  ? 399 ASN A CA  1 
ATOM   2798 C  C   . ASN A 1 399 ? 28.67080 81.27886 24.85673  1.000 48.77544  ? 399 ASN A C   1 
ATOM   2799 O  O   . ASN A 1 399 ? 27.64179 81.56061 24.23258  1.000 47.03754  ? 399 ASN A O   1 
ATOM   2800 C  CB  . ASN A 1 399 ? 30.85852 82.49041 24.66430  1.000 61.64278  ? 399 ASN A CB  1 
ATOM   2801 C  CG  . ASN A 1 399 ? 30.64233 82.93102 23.22113  1.000 63.86605  ? 399 ASN A CG  1 
ATOM   2802 O  OD1 . ASN A 1 399 ? 30.06641 82.19364 22.41022  1.000 56.64079  ? 399 ASN A OD1 1 
ATOM   2803 N  ND2 . ASN A 1 399 ? 31.09049 84.14282 22.89992  1.000 67.23212  ? 399 ASN A ND2 1 
ATOM   2804 N  N   . ILE A 1 400 ? 29.07726 80.02266 25.03693  1.000 43.80744  ? 400 ILE A N   1 
ATOM   2805 C  CA  . ILE A 1 400 ? 28.36968 78.89385 24.43878  1.000 48.85259  ? 400 ILE A CA  1 
ATOM   2806 C  C   . ILE A 1 400 ? 26.92324 78.83761 24.91767  1.000 54.76302  ? 400 ILE A C   1 
ATOM   2807 O  O   . ILE A 1 400 ? 25.99665 78.60193 24.12713  1.000 52.41633  ? 400 ILE A O   1 
ATOM   2808 C  CB  . ILE A 1 400 ? 29.12271 77.58853 24.75150  1.000 48.90735  ? 400 ILE A CB  1 
ATOM   2809 C  CG1 . ILE A 1 400 ? 30.46233 77.54348 24.01677  1.000 37.99723  ? 400 ILE A CG1 1 
ATOM   2810 C  CG2 . ILE A 1 400 ? 28.27778 76.37400 24.42682  1.000 42.42726  ? 400 ILE A CG2 1 
ATOM   2811 C  CD1 . ILE A 1 400 ? 31.36894 76.45738 24.54951  1.000 38.79323  ? 400 ILE A CD1 1 
ATOM   2812 N  N   . PHE A 1 401 ? 26.70129 79.06607 26.21040  1.000 52.61243  ? 401 PHE A N   1 
ATOM   2813 C  CA  . PHE A 1 401 ? 25.37303 78.96735 26.80270  1.000 53.17263  ? 401 PHE A CA  1 
ATOM   2814 C  C   . PHE A 1 401 ? 24.78680 80.34094 27.11311  1.000 65.87283  ? 401 PHE A C   1 
ATOM   2815 O  O   . PHE A 1 401 ? 23.95140 80.48005 28.01369  1.000 67.39089  ? 401 PHE A O   1 
ATOM   2816 C  CB  . PHE A 1 401 ? 25.41981 78.08526 28.04912  1.000 42.16639  ? 401 PHE A CB  1 
ATOM   2817 C  CG  . PHE A 1 401 ? 26.02432 76.73770 27.79442  1.000 38.58469  ? 401 PHE A CG  1 
ATOM   2818 C  CD1 . PHE A 1 401 ? 27.37139 76.51419 28.02293  1.000 41.44488  ? 401 PHE A CD1 1 
ATOM   2819 C  CD2 . PHE A 1 401 ? 25.25802 75.71018 27.28003  1.000 42.11386  ? 401 PHE A CD2 1 
ATOM   2820 C  CE1 . PHE A 1 401 ? 27.94215 75.28229 27.75911  1.000 40.91522  ? 401 PHE A CE1 1 
ATOM   2821 C  CE2 . PHE A 1 401 ? 25.82171 74.47385 27.00475  1.000 45.31874  ? 401 PHE A CE2 1 
ATOM   2822 C  CZ  . PHE A 1 401 ? 27.16686 74.26028 27.25082  1.000 43.20707  ? 401 PHE A CZ  1 
ATOM   2823 N  N   . GLY A 1 402 ? 25.19400 81.35514 26.34105  1.000 70.64314  ? 402 GLY A N   1 
ATOM   2824 C  CA  . GLY A 1 402 ? 24.75963 82.72489 26.57679  1.000 74.74742  ? 402 GLY A CA  1 
ATOM   2825 C  C   . GLY A 1 402 ? 23.26799 82.95818 26.42852  1.000 76.20799  ? 402 GLY A C   1 
ATOM   2826 O  O   . GLY A 1 402 ? 22.75265 83.95142 26.95308  1.000 76.73974  ? 402 GLY A O   1 
ATOM   2827 N  N   . LYS A 1 403 ? 22.56375 82.07728 25.71376  1.000 78.80521  ? 403 LYS A N   1 
ATOM   2828 C  CA  . LYS A 1 403 ? 21.12063 82.19785 25.52421  1.000 90.00027  ? 403 LYS A CA  1 
ATOM   2829 C  C   . LYS A 1 403 ? 20.30262 81.44152 26.56434  1.000 85.90324  ? 403 LYS A C   1 
ATOM   2830 O  O   . LYS A 1 403 ? 19.07178 81.60123 26.60466  1.000 85.51453  ? 403 LYS A O   1 
ATOM   2831 C  CB  . LYS A 1 403 ? 20.72107 81.73151 24.12113  1.000 93.31726  ? 403 LYS A CB  1 
ATOM   2832 C  CG  . LYS A 1 403 ? 20.93652 82.77351 23.02833  1.000 97.73177  ? 403 LYS A CG  1 
ATOM   2833 C  CD  . LYS A 1 403 ? 21.42723 82.15639 21.72734  1.000 99.53234  ? 403 LYS A CD  1 
ATOM   2834 C  CE  . LYS A 1 403 ? 22.60013 81.20503 21.97275  1.000 93.82672  ? 403 LYS A CE  1 
ATOM   2835 N  NZ  . LYS A 1 403 ? 23.12927 80.65446 20.69524  1.000 93.61027  ? 403 LYS A NZ  1 
ATOM   2836 N  N   . ALA A 1 404 ? 20.94843 80.64135 27.40291  1.000 80.43890  ? 404 ALA A N   1 
ATOM   2837 C  CA  . ALA A 1 404 ? 20.26604 80.01505 28.51709  1.000 66.03843  ? 404 ALA A CA  1 
ATOM   2838 C  C   . ALA A 1 404 ? 20.20004 80.98123 29.68686  1.000 56.01150  ? 404 ALA A C   1 
ATOM   2839 O  O   . ALA A 1 404 ? 20.98666 81.92530 29.77877  1.000 55.88469  ? 404 ALA A O   1 
ATOM   2840 C  CB  . ALA A 1 404 ? 20.97887 78.73639 28.93073  1.000 62.01528  ? 404 ALA A CB  1 
ATOM   2841 N  N   . THR A 1 405 ? 19.22711 80.74387 30.57118  1.000 52.55053  ? 405 THR A N   1 
ATOM   2842 C  CA  . THR A 1 405 ? 19.14271 81.46472 31.83803  1.000 60.45620  ? 405 THR A CA  1 
ATOM   2843 C  C   . THR A 1 405 ? 20.49820 81.47743 32.53119  1.000 69.42139  ? 405 THR A C   1 
ATOM   2844 O  O   . THR A 1 405 ? 21.30006 80.55109 32.38383  1.000 72.43244  ? 405 THR A O   1 
ATOM   2845 C  CB  . THR A 1 405 ? 18.09167 80.79619 32.73602  1.000 64.15545  ? 405 THR A CB  1 
ATOM   2846 O  OG1 . THR A 1 405 ? 16.79689 80.92838 32.14149  1.000 61.88418  ? 405 THR A OG1 1 
ATOM   2847 C  CG2 . THR A 1 405 ? 18.05931 81.37478 34.14414  1.000 77.34299  ? 405 THR A CG2 1 
ATOM   2848 N  N   . GLN A 1 406 ? 20.77608 82.54290 33.28485  1.000 77.89086  ? 406 GLN A N   1 
ATOM   2849 C  CA  . GLN A 1 406 ? 22.02740 82.53539 34.03179  1.000 82.27085  ? 406 GLN A CA  1 
ATOM   2850 C  C   . GLN A 1 406 ? 22.01073 81.49009 35.14778  1.000 71.93738  ? 406 GLN A C   1 
ATOM   2851 O  O   . GLN A 1 406 ? 23.05440 80.90288 35.45970  1.000 66.95954  ? 406 GLN A O   1 
ATOM   2852 C  CB  . GLN A 1 406 ? 22.34737 83.91800 34.58868  1.000 91.81334  ? 406 GLN A CB  1 
ATOM   2853 C  CG  . GLN A 1 406 ? 23.80767 83.99092 35.01720  1.000 102.77772 ? 406 GLN A CG  1 
ATOM   2854 C  CD  . GLN A 1 406 ? 24.26286 85.37524 35.41142  1.000 110.79073 ? 406 GLN A CD  1 
ATOM   2855 O  OE1 . GLN A 1 406 ? 23.87604 85.89201 36.45943  1.000 112.72096 ? 406 GLN A OE1 1 
ATOM   2856 N  NE2 . GLN A 1 406 ? 25.09845 85.98567 34.57238  1.000 109.49839 ? 406 GLN A NE2 1 
ATOM   2857 N  N   . ALA A 1 407 ? 20.84284 81.21418 35.73270  1.000 64.18247  ? 407 ALA A N   1 
ATOM   2858 C  CA  . ALA A 1 407 ? 20.74398 80.08731 36.65064  1.000 58.01040  ? 407 ALA A CA  1 
ATOM   2859 C  C   . ALA A 1 407 ? 20.97669 78.74755 35.96000  1.000 61.45315  ? 407 ALA A C   1 
ATOM   2860 O  O   . ALA A 1 407 ? 21.34372 77.78395 36.63257  1.000 67.65604  ? 407 ALA A O   1 
ATOM   2861 C  CB  . ALA A 1 407 ? 19.39268 80.07090 37.35317  1.000 54.53097  ? 407 ALA A CB  1 
ATOM   2862 N  N   . GLU A 1 408 ? 20.77045 78.64013 34.64594  1.000 47.76733  ? 408 GLU A N   1 
ATOM   2863 C  CA  . GLU A 1 408 ? 21.26636 77.43623 33.98876  1.000 52.90360  ? 408 GLU A CA  1 
ATOM   2864 C  C   . GLU A 1 408 ? 22.74799 77.55649 33.68972  1.000 61.41230  ? 408 GLU A C   1 
ATOM   2865 O  O   . GLU A 1 408 ? 23.50397 76.60085 33.89294  1.000 63.72683  ? 408 GLU A O   1 
ATOM   2866 C  CB  . GLU A 1 408 ? 20.51880 77.16210 32.69920  1.000 56.08064  ? 408 GLU A CB  1 
ATOM   2867 C  CG  . GLU A 1 408 ? 19.02983 77.16174 32.82208  1.000 64.40961  ? 408 GLU A CG  1 
ATOM   2868 C  CD  . GLU A 1 408 ? 18.37536 77.18481 31.46403  1.000 59.95380  ? 408 GLU A CD  1 
ATOM   2869 O  OE1 . GLU A 1 408 ? 17.51398 78.06511 31.24212  1.000 52.31515  ? 408 GLU A OE1 1 
ATOM   2870 O  OE2 . GLU A 1 408 ? 18.74877 76.33395 30.61685  1.000 59.71988  ? 408 GLU A OE2 1 
ATOM   2871 N  N   . ARG A 1 409 ? 23.16183 78.71930 33.17847  1.000 64.48371  ? 409 ARG A N   1 
ATOM   2872 C  CA  . ARG A 1 409 ? 24.57782 79.01706 32.99896  1.000 62.22998  ? 409 ARG A CA  1 
ATOM   2873 C  C   . ARG A 1 409 ? 25.36218 78.71811 34.26917  1.000 64.56047  ? 409 ARG A C   1 
ATOM   2874 O  O   . ARG A 1 409 ? 26.38940 78.03234 34.22512  1.000 68.82798  ? 409 ARG A O   1 
ATOM   2875 C  CB  . ARG A 1 409 ? 24.75224 80.48242 32.59629  1.000 64.82381  ? 409 ARG A CB  1 
ATOM   2876 C  CG  . ARG A 1 409 ? 25.38420 80.72297 31.23593  1.000 64.64332  ? 409 ARG A CG  1 
ATOM   2877 C  CD  . ARG A 1 409 ? 25.51200 82.21845 30.98127  1.000 69.17294  ? 409 ARG A CD  1 
ATOM   2878 N  NE  . ARG A 1 409 ? 24.20710 82.85596 30.86989  1.000 73.44772  ? 409 ARG A NE  1 
ATOM   2879 C  CZ  . ARG A 1 409 ? 23.91397 84.06028 31.34959  1.000 83.15974  ? 409 ARG A CZ  1 
ATOM   2880 N  NH1 . ARG A 1 409 ? 24.83730 84.77156 31.98820  1.000 82.76163  ? 409 ARG A NH1 1 
ATOM   2881 N  NH2 . ARG A 1 409 ? 22.68936 84.55233 31.19265  1.000 89.44828  ? 409 ARG A NH2 1 
ATOM   2882 N  N   . GLU A 1 410 ? 24.88094 79.21823 35.41813  1.000 62.73266  ? 410 GLU A N   1 
ATOM   2883 C  CA  . GLU A 1 410 ? 25.55024 78.94588 36.69129  1.000 63.09835  ? 410 GLU A CA  1 
ATOM   2884 C  C   . GLU A 1 410 ? 25.62600 77.44380 36.96958  1.000 56.11438  ? 410 GLU A C   1 
ATOM   2885 O  O   . GLU A 1 410 ? 26.63947 76.95128 37.47766  1.000 59.42101  ? 410 GLU A O   1 
ATOM   2886 C  CB  . GLU A 1 410 ? 24.83349 79.66203 37.84774  1.000 58.76235  ? 410 GLU A CB  1 
ATOM   2887 C  CG  . GLU A 1 410 ? 25.09193 81.17097 37.98784  1.000 61.88485  ? 410 GLU A CG  1 
ATOM   2888 C  CD  . GLU A 1 410 ? 24.25018 81.83945 39.11540  1.000 79.77677  ? 410 GLU A CD  1 
ATOM   2889 O  OE1 . GLU A 1 410 ? 23.19103 81.29236 39.51885  1.000 82.72902  ? 410 GLU A OE1 1 
ATOM   2890 O  OE2 . GLU A 1 410 ? 24.65025 82.92323 39.60532  1.000 85.46892  ? 410 GLU A OE2 1 
ATOM   2891 N  N   . ALA A 1 411 ? 24.56631 76.69751 36.64059  1.000 50.14964  ? 411 ALA A N   1 
ATOM   2892 C  CA  . ALA A 1 411 ? 24.51976 75.27971 36.99281  1.000 50.45044  ? 411 ALA A CA  1 
ATOM   2893 C  C   . ALA A 1 411 ? 25.38285 74.44192 36.06377  1.000 49.21834  ? 411 ALA A C   1 
ATOM   2894 O  O   . ALA A 1 411 ? 26.02561 73.48459 36.49867  1.000 62.09826  ? 411 ALA A O   1 
ATOM   2895 C  CB  . ALA A 1 411 ? 23.08316 74.76854 36.96336  1.000 44.18701  ? 411 ALA A CB  1 
ATOM   2896 N  N   . ILE A 1 412 ? 25.38157 74.76951 34.78014  1.000 40.78355  ? 412 ILE A N   1 
ATOM   2897 C  CA  . ILE A 1 412 ? 26.28666 74.11773 33.85562  1.000 46.39006  ? 412 ILE A CA  1 
ATOM   2898 C  C   . ILE A 1 412 ? 27.71938 74.37747 34.27716  1.000 51.37908  ? 412 ILE A C   1 
ATOM   2899 O  O   . ILE A 1 412 ? 28.52877 73.44927 34.40122  1.000 59.90218  ? 412 ILE A O   1 
ATOM   2900 C  CB  . ILE A 1 412 ? 26.02029 74.60894 32.42274  1.000 48.82015  ? 412 ILE A CB  1 
ATOM   2901 C  CG1 . ILE A 1 412 ? 24.57851 74.28333 32.01828  1.000 46.27114  ? 412 ILE A CG1 1 
ATOM   2902 C  CG2 . ILE A 1 412 ? 27.02473 73.98089 31.44947  1.000 42.80238  ? 412 ILE A CG2 1 
ATOM   2903 C  CD1 . ILE A 1 412 ? 23.99579 75.24211 31.01649  1.000 47.77906  ? 412 ILE A CD1 1 
ATOM   2904 N  N   . ILE A 1 413 ? 28.04506 75.64766 34.52760  1.000 49.97372  ? 413 ILE A N   1 
ATOM   2905 C  CA  . ILE A 1 413 ? 29.41179 76.02079 34.88815  1.000 55.60931  ? 413 ILE A CA  1 
ATOM   2906 C  C   . ILE A 1 413 ? 29.88335 75.26153 36.12637  1.000 54.35708  ? 413 ILE A C   1 
ATOM   2907 O  O   . ILE A 1 413 ? 31.03289 74.80858 36.18876  1.000 61.75924  ? 413 ILE A O   1 
ATOM   2908 C  CB  . ILE A 1 413 ? 29.50874 77.54254 35.08323  1.000 57.44317  ? 413 ILE A CB  1 
ATOM   2909 C  CG1 . ILE A 1 413 ? 29.39607 78.24708 33.72981  1.000 50.87007  ? 413 ILE A CG1 1 
ATOM   2910 C  CG2 . ILE A 1 413 ? 30.79751 77.91236 35.81018  1.000 47.22001  ? 413 ILE A CG2 1 
ATOM   2911 C  CD1 . ILE A 1 413 ? 29.61246 79.73211 33.82393  1.000 59.32813  ? 413 ILE A CD1 1 
ATOM   2912 N  N   . PHE A 1 414 ? 29.01103 75.09275 37.12447  1.000 46.70648  ? 414 PHE A N   1 
ATOM   2913 C  CA  . PHE A 1 414 ? 29.41610 74.31442 38.29265  1.000 49.77606  ? 414 PHE A CA  1 
ATOM   2914 C  C   . PHE A 1 414 ? 29.51980 72.83145 37.95635  1.000 49.81709  ? 414 PHE A C   1 
ATOM   2915 O  O   . PHE A 1 414 ? 30.43845 72.14667 38.42009  1.000 50.79116  ? 414 PHE A O   1 
ATOM   2916 C  CB  . PHE A 1 414 ? 28.45039 74.53844 39.45971  1.000 51.22936  ? 414 PHE A CB  1 
ATOM   2917 C  CG  . PHE A 1 414 ? 28.84733 73.81920 40.72305  1.000 47.90416  ? 414 PHE A CG  1 
ATOM   2918 C  CD1 . PHE A 1 414 ? 29.81962 74.34380 41.55958  1.000 50.05057  ? 414 PHE A CD1 1 
ATOM   2919 C  CD2 . PHE A 1 414 ? 28.24574 72.62644 41.07640  1.000 47.12138  ? 414 PHE A CD2 1 
ATOM   2920 C  CE1 . PHE A 1 414 ? 30.19551 73.68496 42.74246  1.000 51.37675  ? 414 PHE A CE1 1 
ATOM   2921 C  CE2 . PHE A 1 414 ? 28.61254 71.96160 42.24818  1.000 48.51354  ? 414 PHE A CE2 1 
ATOM   2922 C  CZ  . PHE A 1 414 ? 29.59254 72.49479 43.08101  1.000 50.57843  ? 414 PHE A CZ  1 
ATOM   2923 N  N   . GLN A 1 415 ? 28.59521 72.31726 37.14870  1.000 40.94794  ? 415 GLN A N   1 
ATOM   2924 C  CA  . GLN A 1 415 ? 28.64076 70.90746 36.78722  1.000 39.09042  ? 415 GLN A CA  1 
ATOM   2925 C  C   . GLN A 1 415 ? 29.90945 70.55166 36.01593  1.000 53.92335  ? 415 GLN A C   1 
ATOM   2926 O  O   . GLN A 1 415 ? 30.25592 69.36982 35.93521  1.000 58.09867  ? 415 GLN A O   1 
ATOM   2927 C  CB  . GLN A 1 415 ? 27.38725 70.54293 35.97833  1.000 39.09434  ? 415 GLN A CB  1 
ATOM   2928 C  CG  . GLN A 1 415 ? 27.37358 69.14230 35.36149  1.000 40.92228  ? 415 GLN A CG  1 
ATOM   2929 C  CD  . GLN A 1 415 ? 26.96791 68.07003 36.35248  1.000 44.11626  ? 415 GLN A CD  1 
ATOM   2930 O  OE1 . GLN A 1 415 ? 26.74244 68.34123 37.53897  1.000 43.00886  ? 415 GLN A OE1 1 
ATOM   2931 N  NE2 . GLN A 1 415 ? 26.86766 66.83777 35.86723  1.000 39.90094  ? 415 GLN A NE2 1 
ATOM   2932 N  N   . TYR A 1 416 ? 30.63063 71.53795 35.46749  1.000 49.22783  ? 416 TYR A N   1 
ATOM   2933 C  CA  . TYR A 1 416 ? 31.84219 71.25587 34.69875  1.000 49.50737  ? 416 TYR A CA  1 
ATOM   2934 C  C   . TYR A 1 416 ? 33.08046 71.95939 35.24788  1.000 59.54282  ? 416 TYR A C   1 
ATOM   2935 O  O   . TYR A 1 416 ? 34.06280 72.11370 34.51264  1.000 74.08188  ? 416 TYR A O   1 
ATOM   2936 C  CB  . TYR A 1 416 ? 31.66101 71.60545 33.21636  1.000 39.51219  ? 416 TYR A CB  1 
ATOM   2937 C  CG  . TYR A 1 416 ? 30.72869 70.64013 32.54226  1.000 41.41009  ? 416 TYR A CG  1 
ATOM   2938 C  CD1 . TYR A 1 416 ? 29.35795 70.87229 32.53141  1.000 42.28647  ? 416 TYR A CD1 1 
ATOM   2939 C  CD2 . TYR A 1 416 ? 31.20371 69.46629 31.96506  1.000 40.15913  ? 416 TYR A CD2 1 
ATOM   2940 C  CE1 . TYR A 1 416 ? 28.48217 69.97242 31.94318  1.000 42.26531  ? 416 TYR A CE1 1 
ATOM   2941 C  CE2 . TYR A 1 416 ? 30.32784 68.55769 31.35797  1.000 34.39702  ? 416 TYR A CE2 1 
ATOM   2942 C  CZ  . TYR A 1 416 ? 28.96828 68.81915 31.36456  1.000 34.90140  ? 416 TYR A CZ  1 
ATOM   2943 O  OH  . TYR A 1 416 ? 28.07991 67.92849 30.80982  1.000 33.54100  ? 416 TYR A OH  1 
ATOM   2944 N  N   . THR A 1 417 ? 33.07733 72.37574 36.51656  1.000 49.50377  ? 417 THR A N   1 
ATOM   2945 C  CA  . THR A 1 417 ? 34.31287 72.87398 37.11095  1.000 57.07990  ? 417 THR A CA  1 
ATOM   2946 C  C   . THR A 1 417 ? 35.24570 71.71232 37.44620  1.000 60.47815  ? 417 THR A C   1 
ATOM   2947 O  O   . THR A 1 417 ? 34.81945 70.68687 37.98784  1.000 53.88842  ? 417 THR A O   1 
ATOM   2948 C  CB  . THR A 1 417 ? 34.03428 73.70257 38.36332  1.000 58.51922  ? 417 THR A CB  1 
ATOM   2949 O  OG1 . THR A 1 417 ? 32.94314 73.12413 39.08084  1.000 74.83556  ? 417 THR A OG1 1 
ATOM   2950 C  CG2 . THR A 1 417 ? 33.68028 75.13358 37.99363  1.000 54.25563  ? 417 THR A CG2 1 
ATOM   2951 N  N   . SER A 1 418 ? 36.51554 71.86631 37.08716  1.000 66.29983  ? 418 SER A N   1 
ATOM   2952 C  CA  . SER A 1 418 ? 37.53431 70.88697 37.41828  1.000 63.70583  ? 418 SER A CA  1 
ATOM   2953 C  C   . SER A 1 418 ? 38.02464 71.10222 38.83345  1.000 61.51908  ? 418 SER A C   1 
ATOM   2954 O  O   . SER A 1 418 ? 38.00707 72.22199 39.35093  1.000 62.38935  ? 418 SER A O   1 
ATOM   2955 C  CB  . SER A 1 418 ? 38.72213 70.98859 36.46093  1.000 75.53073  ? 418 SER A CB  1 
ATOM   2956 O  OG  . SER A 1 418 ? 38.59139 70.07539 35.39221  1.000 86.11330  ? 418 SER A OG  1 
ATOM   2957 N  N   . TRP A 1 419 ? 38.45681 70.00949 39.46153  1.000 69.76263  ? 419 TRP A N   1 
ATOM   2958 C  CA  . TRP A 1 419 ? 39.16312 70.08854 40.73783  1.000 85.87126  ? 419 TRP A CA  1 
ATOM   2959 C  C   . TRP A 1 419 ? 40.34489 69.13835 40.82335  1.000 98.97768  ? 419 TRP A C   1 
ATOM   2960 O  O   . TRP A 1 419 ? 41.15695 69.28053 41.74267  1.000 101.33747 ? 419 TRP A O   1 
ATOM   2961 C  CB  . TRP A 1 419 ? 38.21480 69.80891 41.91693  1.000 78.76753  ? 419 TRP A CB  1 
ATOM   2962 C  CG  . TRP A 1 419 ? 37.31113 70.96638 42.25722  1.000 74.21785  ? 419 TRP A CG  1 
ATOM   2963 C  CD1 . TRP A 1 419 ? 37.65845 72.13202 42.90626  1.000 76.89269  ? 419 TRP A CD1 1 
ATOM   2964 C  CD2 . TRP A 1 419 ? 35.90495 71.06536 41.98119  1.000 61.78441  ? 419 TRP A CD2 1 
ATOM   2965 N  NE1 . TRP A 1 419 ? 36.55167 72.94415 43.04322  1.000 73.35016  ? 419 TRP A NE1 1 
ATOM   2966 C  CE2 . TRP A 1 419 ? 35.46582 72.31716 42.48044  1.000 64.66559  ? 419 TRP A CE2 1 
ATOM   2967 C  CE3 . TRP A 1 419 ? 34.97291 70.21444 41.37168  1.000 57.14456  ? 419 TRP A CE3 1 
ATOM   2968 C  CZ2 . TRP A 1 419 ? 34.13488 72.74063 42.37506  1.000 56.59652  ? 419 TRP A CZ2 1 
ATOM   2969 C  CZ3 . TRP A 1 419 ? 33.64656 70.64042 41.26300  1.000 59.24777  ? 419 TRP A CZ3 1 
ATOM   2970 C  CH2 . TRP A 1 419 ? 33.24471 71.89024 41.76750  1.000 60.42942  ? 419 TRP A CH2 1 
ATOM   2971 N  N   . GLU A 1 420 ? 40.47770 68.18989 39.90149  1.000 111.54526 ? 420 GLU A N   1 
ATOM   2972 C  CA  . GLU A 1 420 ? 41.53931 67.19888 39.92104  1.000 127.03728 ? 420 GLU A CA  1 
ATOM   2973 C  C   . GLU A 1 420 ? 42.38348 67.32058 38.65946  1.000 140.60128 ? 420 GLU A C   1 
ATOM   2974 O  O   . GLU A 1 420 ? 41.90720 67.76863 37.60995  1.000 123.20255 ? 420 GLU A O   1 
ATOM   2975 C  CB  . GLU A 1 420 ? 40.96346 65.78090 40.04018  1.000 130.16342 ? 420 GLU A CB  1 
ATOM   2976 C  CG  . GLU A 1 420 ? 39.86850 65.49043 39.02322  1.000 132.39794 ? 420 GLU A CG  1 
ATOM   2977 C  CD  . GLU A 1 420 ? 39.69379 64.01208 38.73814  1.000 131.36592 ? 420 GLU A CD  1 
ATOM   2978 O  OE1 . GLU A 1 420 ? 38.82654 63.67365 37.90184  1.000 125.49088 ? 420 GLU A OE1 1 
ATOM   2979 O  OE2 . GLU A 1 420 ? 40.41343 63.19386 39.35296  1.000 131.77371 ? 420 GLU A OE2 1 
ATOM   2980 N  N   . GLY A 1 421 ? 43.64413 66.90943 38.77562  1.000 159.56783 ? 421 GLY A N   1 
ATOM   2981 C  CA  . GLY A 1 421 ? 44.59169 67.04244 37.69092  1.000 164.13560 ? 421 GLY A CA  1 
ATOM   2982 C  C   . GLY A 1 421 ? 45.17873 68.43974 37.62276  1.000 167.23405 ? 421 GLY A C   1 
ATOM   2983 O  O   . GLY A 1 421 ? 44.96904 69.28721 38.49869  1.000 173.25508 ? 421 GLY A O   1 
ATOM   2984 N  N   . ASN A 1 422 ? 45.94243 68.67436 36.56037  1.000 159.37938 ? 422 ASN A N   1 
ATOM   2985 C  CA  . ASN A 1 422 ? 46.42234 70.02168 36.28078  1.000 145.95311 ? 422 ASN A CA  1 
ATOM   2986 C  C   . ASN A 1 422 ? 45.27063 70.83496 35.70476  1.000 127.30821 ? 422 ASN A C   1 
ATOM   2987 O  O   . ASN A 1 422 ? 44.68485 70.43358 34.68775  1.000 116.69080 ? 422 ASN A O   1 
ATOM   2988 C  CB  . ASN A 1 422 ? 47.61599 69.99840 35.32501  1.000 144.98636 ? 422 ASN A CB  1 
ATOM   2989 C  CG  . ASN A 1 422 ? 48.96275 69.96329 36.05805  1.000 141.54839 ? 422 ASN A CG  1 
ATOM   2990 O  OD1 . ASN A 1 422 ? 49.11952 70.53763 37.14171  1.000 138.13090 ? 422 ASN A OD1 1 
ATOM   2991 N  ND2 . ASN A 1 422 ? 49.94174 69.29470 35.45577  1.000 138.54669 ? 422 ASN A ND2 1 
ATOM   2992 N  N   . PRO A 1 423 ? 44.90175 71.96590 36.31876  1.000 115.18290 ? 423 PRO A N   1 
ATOM   2993 C  CA  . PRO A 1 423 ? 43.59401 72.56971 36.02090  1.000 103.85343 ? 423 PRO A CA  1 
ATOM   2994 C  C   . PRO A 1 423 ? 43.48597 73.15044 34.62095  1.000 95.95583  ? 423 PRO A C   1 
ATOM   2995 O  O   . PRO A 1 423 ? 42.36563 73.26431 34.10985  1.000 92.78339  ? 423 PRO A O   1 
ATOM   2996 C  CB  . PRO A 1 423 ? 43.45373 73.66304 37.09586  1.000 104.71047 ? 423 PRO A CB  1 
ATOM   2997 C  CG  . PRO A 1 423 ? 44.55730 73.38135 38.11332  1.000 105.73545 ? 423 PRO A CG  1 
ATOM   2998 C  CD  . PRO A 1 423 ? 45.65032 72.73467 37.33012  1.000 109.24304 ? 423 PRO A CD  1 
ATOM   2999 N  N   . GLY A 1 424 ? 44.60066 73.50619 33.98186  1.000 94.26943  ? 424 GLY A N   1 
ATOM   3000 C  CA  . GLY A 1 424 ? 44.56480 74.14371 32.67733  1.000 87.35977  ? 424 GLY A CA  1 
ATOM   3001 C  C   . GLY A 1 424 ? 44.02342 73.25682 31.57669  1.000 81.99464  ? 424 GLY A C   1 
ATOM   3002 O  O   . GLY A 1 424 ? 43.03770 73.60632 30.90894  1.000 74.71968  ? 424 GLY A O   1 
ATOM   3003 N  N   . TYR A 1 425 ? 44.66266 72.09746 31.37970  1.000 75.67720  ? 425 TYR A N   1 
ATOM   3004 C  CA  . TYR A 1 425 ? 44.19481 71.17269 30.35204  1.000 66.86216  ? 425 TYR A CA  1 
ATOM   3005 C  C   . TYR A 1 425 ? 42.80173 70.65068 30.66983  1.000 62.29841  ? 425 TYR A C   1 
ATOM   3006 O  O   . TYR A 1 425 ? 42.03851 70.31746 29.75828  1.000 59.79355  ? 425 TYR A O   1 
ATOM   3007 C  CB  . TYR A 1 425 ? 45.17158 70.00675 30.19403  1.000 63.22683  ? 425 TYR A CB  1 
ATOM   3008 C  CG  . TYR A 1 425 ? 46.55559 70.39225 29.70513  1.000 67.66264  ? 425 TYR A CG  1 
ATOM   3009 C  CD1 . TYR A 1 425 ? 46.79345 71.62283 29.08518  1.000 68.04835  ? 425 TYR A CD1 1 
ATOM   3010 C  CD2 . TYR A 1 425 ? 47.62460 69.51349 29.84068  1.000 67.48822  ? 425 TYR A CD2 1 
ATOM   3011 C  CE1 . TYR A 1 425 ? 48.06250 71.96625 28.63308  1.000 63.25378  ? 425 TYR A CE1 1 
ATOM   3012 C  CE2 . TYR A 1 425 ? 48.88989 69.84854 29.39340  1.000 64.95326  ? 425 TYR A CE2 1 
ATOM   3013 C  CZ  . TYR A 1 425 ? 49.10252 71.07064 28.79078  1.000 63.92128  ? 425 TYR A CZ  1 
ATOM   3014 O  OH  . TYR A 1 425 ? 50.36502 71.39227 28.35535  1.000 65.50946  ? 425 TYR A OH  1 
ATOM   3015 N  N   . GLN A 1 426 ? 42.44448 70.58605 31.95037  1.000 63.91163  ? 426 GLN A N   1 
ATOM   3016 C  CA  . GLN A 1 426 ? 41.14233 70.04118 32.30915  1.000 61.17255  ? 426 GLN A CA  1 
ATOM   3017 C  C   . GLN A 1 426 ? 40.01562 71.00551 31.96482  1.000 52.76286  ? 426 GLN A C   1 
ATOM   3018 O  O   . GLN A 1 426 ? 38.93642 70.57410 31.54546  1.000 48.67166  ? 426 GLN A O   1 
ATOM   3019 C  CB  . GLN A 1 426 ? 41.13198 69.67080 33.78723  1.000 66.94731  ? 426 GLN A CB  1 
ATOM   3020 C  CG  . GLN A 1 426 ? 41.94925 68.42111 34.06853  1.000 79.79885  ? 426 GLN A CG  1 
ATOM   3021 C  CD  . GLN A 1 426 ? 41.66320 67.31069 33.05631  1.000 83.55481  ? 426 GLN A CD  1 
ATOM   3022 O  OE1 . GLN A 1 426 ? 42.57748 66.80169 32.39615  1.000 84.29143  ? 426 GLN A OE1 1 
ATOM   3023 N  NE2 . GLN A 1 426 ? 40.38438 66.94072 32.92277  1.000 77.99383  ? 426 GLN A NE2 1 
ATOM   3024 N  N   . ASN A 1 427 ? 40.24088 72.30983 32.12970  1.000 47.60806  ? 427 ASN A N   1 
ATOM   3025 C  CA  . ASN A 1 427 ? 39.21654 73.27344 31.75046  1.000 47.92795  ? 427 ASN A CA  1 
ATOM   3026 C  C   . ASN A 1 427 ? 38.80722 73.07524 30.30314  1.000 50.69683  ? 427 ASN A C   1 
ATOM   3027 O  O   . ASN A 1 427 ? 37.61785 72.93784 29.99454  1.000 50.26803  ? 427 ASN A O   1 
ATOM   3028 C  CB  . ASN A 1 427 ? 39.71428 74.69850 31.97230  1.000 53.44108  ? 427 ASN A CB  1 
ATOM   3029 C  CG  . ASN A 1 427 ? 39.56315 75.14577 33.41160  1.000 55.56969  ? 427 ASN A CG  1 
ATOM   3030 O  OD1 . ASN A 1 427 ? 38.64393 74.71590 34.11888  1.000 52.86245  ? 427 ASN A OD1 1 
ATOM   3031 N  ND2 . ASN A 1 427 ? 40.46252 76.01640 33.85452  1.000 50.91529  ? 427 ASN A ND2 1 
ATOM   3032 N  N   . GLN A 1 428 ? 39.78974 73.04293 29.40076  1.000 55.26363  ? 428 GLN A N   1 
ATOM   3033 C  CA  . GLN A 1 428 ? 39.50794 72.78375 27.99145  1.000 45.17638  ? 428 GLN A CA  1 
ATOM   3034 C  C   . GLN A 1 428 ? 38.78111 71.46058 27.81832  1.000 43.36806  ? 428 GLN A C   1 
ATOM   3035 O  O   . GLN A 1 428 ? 37.78848 71.37116 27.08599  1.000 37.19216  ? 428 GLN A O   1 
ATOM   3036 C  CB  . GLN A 1 428 ? 40.81286 72.78322 27.19741  1.000 46.27360  ? 428 GLN A CB  1 
ATOM   3037 C  CG  . GLN A 1 428 ? 40.70853 72.30970 25.75198  1.000 47.93277  ? 428 GLN A CG  1 
ATOM   3038 C  CD  . GLN A 1 428 ? 42.06996 72.27430 25.08161  1.000 51.02825  ? 428 GLN A CD  1 
ATOM   3039 O  OE1 . GLN A 1 428 ? 43.05175 71.79508 25.66412  1.000 52.29453  ? 428 GLN A OE1 1 
ATOM   3040 N  NE2 . GLN A 1 428 ? 42.14603 72.80833 23.86418  1.000 46.40223  ? 428 GLN A NE2 1 
ATOM   3041 N  N   . GLN A 1 429 ? 39.26355 70.41595 28.49391  1.000 47.90148  ? 429 GLN A N   1 
ATOM   3042 C  CA  . GLN A 1 429 ? 38.59142 69.12653 28.41458  1.000 45.97859  ? 429 GLN A CA  1 
ATOM   3043 C  C   . GLN A 1 429 ? 37.13636 69.23732 28.84566  1.000 47.43636  ? 429 GLN A C   1 
ATOM   3044 O  O   . GLN A 1 429 ? 36.24234 68.67911 28.19779  1.000 58.94739  ? 429 GLN A O   1 
ATOM   3045 C  CB  . GLN A 1 429 ? 39.33417 68.09265 29.25961  1.000 40.74935  ? 429 GLN A CB  1 
ATOM   3046 C  CG  . GLN A 1 429 ? 40.57172 67.53897 28.57043  1.000 43.81792  ? 429 GLN A CG  1 
ATOM   3047 C  CD  . GLN A 1 429 ? 40.35096 67.31130 27.07566  1.000 51.14083  ? 429 GLN A CD  1 
ATOM   3048 O  OE1 . GLN A 1 429 ? 41.09259 67.84422 26.24052  1.000 53.45225  ? 429 GLN A OE1 1 
ATOM   3049 N  NE2 . GLN A 1 429 ? 39.32515 66.51942 26.73127  1.000 50.04403  ? 429 GLN A NE2 1 
ATOM   3050 N  N   . GLN A 1 430 ? 36.87143 69.99225 29.90610  1.000 42.21044  ? 430 GLN A N   1 
ATOM   3051 C  CA  . GLN A 1 430 ? 35.51612 70.02805 30.42888  1.000 44.19929  ? 430 GLN A CA  1 
ATOM   3052 C  C   . GLN A 1 430 ? 34.59064 70.82169 29.51949  1.000 47.93255  ? 430 GLN A C   1 
ATOM   3053 O  O   . GLN A 1 430 ? 33.41026 70.47683 29.38399  1.000 53.21830  ? 430 GLN A O   1 
ATOM   3054 C  CB  . GLN A 1 430 ? 35.51786 70.58126 31.85567  1.000 45.46337  ? 430 GLN A CB  1 
ATOM   3055 C  CG  . GLN A 1 430 ? 36.02526 69.54315 32.84451  1.000 47.07308  ? 430 GLN A CG  1 
ATOM   3056 C  CD  . GLN A 1 430 ? 34.89400 68.69841 33.38932  1.000 58.33576  ? 430 GLN A CD  1 
ATOM   3057 O  OE1 . GLN A 1 430 ? 34.00676 69.20471 34.06115  1.000 69.20369  ? 430 GLN A OE1 1 
ATOM   3058 N  NE2 . GLN A 1 430 ? 34.87601 67.41580 33.02691  1.000 61.20329  ? 430 GLN A NE2 1 
ATOM   3059 N  N   . ILE A 1 431 ? 35.09549 71.88607 28.88779  1.000 41.64469  ? 431 ILE A N   1 
ATOM   3060 C  CA  . ILE A 1 431 ? 34.25808 72.60196 27.93129  1.000 42.94985  ? 431 ILE A CA  1 
ATOM   3061 C  C   . ILE A 1 431 ? 33.91234 71.69206 26.76870  1.000 46.23545  ? 431 ILE A C   1 
ATOM   3062 O  O   . ILE A 1 431 ? 32.78923 71.71625 26.25652  1.000 47.45871  ? 431 ILE A O   1 
ATOM   3063 C  CB  . ILE A 1 431 ? 34.93365 73.89241 27.43650  1.000 46.30849  ? 431 ILE A CB  1 
ATOM   3064 C  CG1 . ILE A 1 431 ? 35.43397 74.72524 28.61593  1.000 44.73272  ? 431 ILE A CG1 1 
ATOM   3065 C  CG2 . ILE A 1 431 ? 33.94515 74.67867 26.57464  1.000 36.88153  ? 431 ILE A CG2 1 
ATOM   3066 C  CD1 . ILE A 1 431 ? 35.90215 76.10730 28.22996  1.000 44.70120  ? 431 ILE A CD1 1 
ATOM   3067 N  N   . GLY A 1 432 ? 34.87002 70.86803 26.34095  1.000 49.36639  ? 432 GLY A N   1 
ATOM   3068 C  CA  . GLY A 1 432 ? 34.59255 69.91564 25.27937  1.000 44.47947  ? 432 GLY A CA  1 
ATOM   3069 C  C   . GLY A 1 432 ? 33.47083 68.95974 25.64058  1.000 41.77081  ? 432 GLY A C   1 
ATOM   3070 O  O   . GLY A 1 432 ? 32.55191 68.74281 24.84967  1.000 46.99562  ? 432 GLY A O   1 
ATOM   3071 N  N   . ARG A 1 433 ? 33.53497 68.37257 26.84267  1.000 37.24320  ? 433 ARG A N   1 
ATOM   3072 C  CA  . ARG A 1 433 ? 32.46675 67.48684 27.30043  1.000 37.42300  ? 433 ARG A CA  1 
ATOM   3073 C  C   . ARG A 1 433 ? 31.13196 68.20977 27.32768  1.000 36.51288  ? 433 ARG A C   1 
ATOM   3074 O  O   . ARG A 1 433 ? 30.12190 67.67713 26.86055  1.000 42.10839  ? 433 ARG A O   1 
ATOM   3075 C  CB  . ARG A 1 433 ? 32.76431 66.92309 28.69271  1.000 47.52532  ? 433 ARG A CB  1 
ATOM   3076 C  CG  . ARG A 1 433 ? 34.12919 66.29529 28.89970  1.000 56.73747  ? 433 ARG A CG  1 
ATOM   3077 C  CD  . ARG A 1 433 ? 34.06598 65.20258 29.98569  1.000 65.59923  ? 433 ARG A CD  1 
ATOM   3078 N  NE  . ARG A 1 433 ? 35.31430 65.07356 30.73637  1.000 76.56180  ? 433 ARG A NE  1 
ATOM   3079 C  CZ  . ARG A 1 433 ? 36.47672 64.67226 30.21710  1.000 90.59986  ? 433 ARG A CZ  1 
ATOM   3080 N  NH1 . ARG A 1 433 ? 36.57658 64.36173 28.92515  1.000 93.56225  ? 433 ARG A NH1 1 
ATOM   3081 N  NH2 . ARG A 1 433 ? 37.55324 64.58873 30.99219  1.000 95.71168  ? 433 ARG A NH2 1 
ATOM   3082 N  N   . ALA A 1 434 ? 31.10392 69.41920 27.89201  1.000 37.06842  ? 434 ALA A N   1 
ATOM   3083 C  CA  . ALA A 1 434 ? 29.86528 70.18713 27.94269  1.000 33.47672  ? 434 ALA A CA  1 
ATOM   3084 C  C   . ALA A 1 434 ? 29.26043 70.35008 26.55308  1.000 40.70814  ? 434 ALA A C   1 
ATOM   3085 O  O   . ALA A 1 434 ? 28.05684 70.14341 26.36063  1.000 44.03802  ? 434 ALA A O   1 
ATOM   3086 C  CB  . ALA A 1 434 ? 30.12123 71.54893 28.57780  1.000 31.87722  ? 434 ALA A CB  1 
ATOM   3087 N  N   . VAL A 1 435 ? 30.08824 70.71771 25.56712  1.000 42.54206  ? 435 VAL A N   1 
ATOM   3088 C  CA  . VAL A 1 435 ? 29.59920 70.88556 24.20077  1.000 42.15195  ? 435 VAL A CA  1 
ATOM   3089 C  C   . VAL A 1 435 ? 29.01847 69.57546 23.68674  1.000 38.46189  ? 435 VAL A C   1 
ATOM   3090 O  O   . VAL A 1 435 ? 27.84692 69.50397 23.28657  1.000 32.75945  ? 435 VAL A O   1 
ATOM   3091 C  CB  . VAL A 1 435 ? 30.71608 71.39764 23.27553  1.000 41.54185  ? 435 VAL A CB  1 
ATOM   3092 C  CG1 . VAL A 1 435 ? 30.26447 71.30889 21.82614  1.000 28.87576  ? 435 VAL A CG1 1 
ATOM   3093 C  CG2 . VAL A 1 435 ? 31.04686 72.83748 23.60775  1.000 49.10277  ? 435 VAL A CG2 1 
ATOM   3094 N  N   . GLY A 1 436 ? 29.83469 68.51808 23.70376  1.000 36.19571  ? 436 GLY A N   1 
ATOM   3095 C  CA  . GLY A 1 436 ? 29.39055 67.23881 23.18053  1.000 35.24114  ? 436 GLY A CA  1 
ATOM   3096 C  C   . GLY A 1 436 ? 28.20033 66.67582 23.93072  1.000 34.81572  ? 436 GLY A C   1 
ATOM   3097 O  O   . GLY A 1 436 ? 27.25880 66.15350 23.31677  1.000 32.60393  ? 436 GLY A O   1 
ATOM   3098 N  N   . ASP A 1 437 ? 28.22009 66.78300 25.26323  1.000 36.75764  ? 437 ASP A N   1 
ATOM   3099 C  CA  . ASP A 1 437 ? 27.11365 66.28648 26.08176  1.000 39.92098  ? 437 ASP A CA  1 
ATOM   3100 C  C   . ASP A 1 437 ? 25.80206 66.98088 25.72913  1.000 44.14666  ? 437 ASP A C   1 
ATOM   3101 O  O   . ASP A 1 437 ? 24.77411 66.32772 25.50421  1.000 50.98138  ? 437 ASP A O   1 
ATOM   3102 C  CB  . ASP A 1 437 ? 27.43002 66.47917 27.56729  1.000 36.00171  ? 437 ASP A CB  1 
ATOM   3103 C  CG  . ASP A 1 437 ? 28.47696 65.51540 28.05949  1.000 43.87538  ? 437 ASP A CG  1 
ATOM   3104 O  OD1 . ASP A 1 437 ? 28.93830 64.69244 27.23084  1.000 44.15377  ? 437 ASP A OD1 1 
ATOM   3105 O  OD2 . ASP A 1 437 ? 28.82951 65.57468 29.26671  1.000 51.23343  ? 437 ASP A OD2 1 
ATOM   3106 N  N   . HIS A 1 438 ? 25.81334 68.30899 25.68518  1.000 39.40598  ? 438 HIS A N   1 
ATOM   3107 C  CA  . HIS A 1 438 ? 24.55736 69.02743 25.51565  1.000 38.73135  ? 438 HIS A CA  1 
ATOM   3108 C  C   . HIS A 1 438 ? 24.03782 68.92001 24.08330  1.000 40.18941  ? 438 HIS A C   1 
ATOM   3109 O  O   . HIS A 1 438 ? 22.81970 68.87086 23.87052  1.000 42.79175  ? 438 HIS A O   1 
ATOM   3110 C  CB  . HIS A 1 438 ? 24.74246 70.49128 25.94005  1.000 28.48814  ? 438 HIS A CB  1 
ATOM   3111 C  CG  . HIS A 1 438 ? 23.71510 71.42069 25.37706  1.000 34.46803  ? 438 HIS A CG  1 
ATOM   3112 N  ND1 . HIS A 1 438 ? 22.39190 71.38614 25.75534  1.000 41.30809  ? 438 HIS A ND1 1 
ATOM   3113 C  CD2 . HIS A 1 438 ? 23.80947 72.39029 24.43545  1.000 37.08241  ? 438 HIS A CD2 1 
ATOM   3114 C  CE1 . HIS A 1 438 ? 21.71850 72.31012 25.09159  1.000 33.35588  ? 438 HIS A CE1 1 
ATOM   3115 N  NE2 . HIS A 1 438 ? 22.55709 72.93516 24.28661  1.000 36.30776  ? 438 HIS A NE2 1 
ATOM   3116 N  N   . PHE A 1 439 ? 24.93172 68.85804 23.09632  1.000 35.29566  ? 439 PHE A N   1 
ATOM   3117 C  CA  . PHE A 1 439 ? 24.52416 68.96363 21.70088  1.000 37.45008  ? 439 PHE A CA  1 
ATOM   3118 C  C   . PHE A 1 439 ? 24.36211 67.62816 20.99998  1.000 41.72500  ? 439 PHE A C   1 
ATOM   3119 O  O   . PHE A 1 439 ? 23.72167 67.58448 19.93987  1.000 39.43358  ? 439 PHE A O   1 
ATOM   3120 C  CB  . PHE A 1 439 ? 25.54158 69.77726 20.89606  1.000 32.63584  ? 439 PHE A CB  1 
ATOM   3121 C  CG  . PHE A 1 439 ? 25.48173 71.23562 21.15077  1.000 37.85245  ? 439 PHE A CG  1 
ATOM   3122 C  CD1 . PHE A 1 439 ? 24.48817 71.99786 20.59097  1.000 28.26292  ? 439 PHE A CD1 1 
ATOM   3123 C  CD2 . PHE A 1 439 ? 26.41900 71.84591 21.97123  1.000 41.76766  ? 439 PHE A CD2 1 
ATOM   3124 C  CE1 . PHE A 1 439 ? 24.42598 73.35096 20.83081  1.000 32.65458  ? 439 PHE A CE1 1 
ATOM   3125 C  CE2 . PHE A 1 439 ? 26.36103 73.19865 22.20842  1.000 45.66895  ? 439 PHE A CE2 1 
ATOM   3126 C  CZ  . PHE A 1 439 ? 25.35527 73.95821 21.63348  1.000 38.53397  ? 439 PHE A CZ  1 
ATOM   3127 N  N   . PHE A 1 440 ? 24.95266 66.55556 21.52943  1.000 39.98071  ? 440 PHE A N   1 
ATOM   3128 C  CA  . PHE A 1 440 ? 24.90452 65.28362 20.82476  1.000 22.79117  ? 440 PHE A CA  1 
ATOM   3129 C  C   . PHE A 1 440 ? 24.51425 64.12926 21.73620  1.000 22.71373  ? 440 PHE A C   1 
ATOM   3130 O  O   . PHE A 1 440 ? 23.41520 63.58690 21.59965  1.000 30.18555  ? 440 PHE A O   1 
ATOM   3131 C  CB  . PHE A 1 440 ? 26.25235 64.99989 20.15461  1.000 22.52705  ? 440 PHE A CB  1 
ATOM   3132 C  CG  . PHE A 1 440 ? 26.58211 65.94283 19.03152  1.000 26.92363  ? 440 PHE A CG  1 
ATOM   3133 C  CD1 . PHE A 1 440 ? 26.14166 65.68033 17.73259  1.000 27.53830  ? 440 PHE A CD1 1 
ATOM   3134 C  CD2 . PHE A 1 440 ? 27.33462 67.07880 19.26709  1.000 23.83938  ? 440 PHE A CD2 1 
ATOM   3135 C  CE1 . PHE A 1 440 ? 26.44859 66.53519 16.69345  1.000 27.88920  ? 440 PHE A CE1 1 
ATOM   3136 C  CE2 . PHE A 1 440 ? 27.64354 67.95313 18.24234  1.000 33.70265  ? 440 PHE A CE2 1 
ATOM   3137 C  CZ  . PHE A 1 440 ? 27.20301 67.68386 16.94642  1.000 36.97701  ? 440 PHE A CZ  1 
ATOM   3138 N  N   . THR A 1 441 ? 25.38952 63.76508 22.68122  1.000 24.09283  ? 441 THR A N   1 
ATOM   3139 C  CA  . THR A 1 441 ? 25.22812 62.51634 23.42109  1.000 31.12841  ? 441 THR A CA  1 
ATOM   3140 C  C   . THR A 1 441 ? 23.92584 62.49168 24.21969  1.000 33.22214  ? 441 THR A C   1 
ATOM   3141 O  O   . THR A 1 441 ? 23.18394 61.49842 24.18858  1.000 34.12392  ? 441 THR A O   1 
ATOM   3142 C  CB  . THR A 1 441 ? 26.42779 62.30965 24.34340  1.000 36.38573  ? 441 THR A CB  1 
ATOM   3143 O  OG1 . THR A 1 441 ? 27.62950 62.31960 23.55809  1.000 26.65889  ? 441 THR A OG1 1 
ATOM   3144 C  CG2 . THR A 1 441 ? 26.31265 60.97570 25.10447  1.000 23.04577  ? 441 THR A CG2 1 
ATOM   3145 N  N   . CYS A 1 442 ? 23.61401 63.58134 24.93087  1.000 29.26731  ? 442 CYS A N   1 
ATOM   3146 C  CA  . CYS A 1 442 ? 22.43198 63.50760 25.78267  1.000 33.27308  ? 442 CYS A CA  1 
ATOM   3147 C  C   . CYS A 1 442 ? 21.12973 63.74653 25.00846  1.000 42.75218  ? 442 CYS A C   1 
ATOM   3148 O  O   . CYS A 1 442 ? 20.10478 63.15293 25.36279  1.000 42.72912  ? 442 CYS A O   1 
ATOM   3149 C  CB  . CYS A 1 442 ? 22.58053 64.46615 26.94851  1.000 26.51473  ? 442 CYS A CB  1 
ATOM   3150 S  SG  . CYS A 1 442 ? 23.95752 63.92638 28.02654  1.000 41.62555  ? 442 CYS A SG  1 
ATOM   3151 N  N   . PRO A 1 443 ? 21.09808 64.56494 23.93035  1.000 44.79760  ? 443 PRO A N   1 
ATOM   3152 C  CA  . PRO A 1 443 ? 19.94825 64.48751 22.99713  1.000 34.56541  ? 443 PRO A CA  1 
ATOM   3153 C  C   . PRO A 1 443 ? 19.70817 63.08728 22.45602  1.000 30.53060  ? 443 PRO A C   1 
ATOM   3154 O  O   . PRO A 1 443 ? 18.54865 62.65522 22.39593  1.000 26.57767  ? 443 PRO A O   1 
ATOM   3155 C  CB  . PRO A 1 443 ? 20.33490 65.46940 21.87838  1.000 28.31202  ? 443 PRO A CB  1 
ATOM   3156 C  CG  . PRO A 1 443 ? 21.10459 66.51691 22.58080  1.000 34.79409  ? 443 PRO A CG  1 
ATOM   3157 C  CD  . PRO A 1 443 ? 21.90600 65.75575 23.64050  1.000 39.19677  ? 443 PRO A CD  1 
ATOM   3158 N  N   . THR A 1 444 ? 20.77666 62.36598 22.07426  1.000 28.16415  ? 444 THR A N   1 
ATOM   3159 C  CA  . THR A 1 444 ? 20.64883 60.96723 21.65423  1.000 33.47935  ? 444 THR A CA  1 
ATOM   3160 C  C   . THR A 1 444 ? 20.07896 60.10569 22.76793  1.000 38.55552  ? 444 THR A C   1 
ATOM   3161 O  O   . THR A 1 444 ? 19.13291 59.33798 22.55538  1.000 43.06979  ? 444 THR A O   1 
ATOM   3162 C  CB  . THR A 1 444 ? 22.00191 60.38244 21.25729  1.000 36.46725  ? 444 THR A CB  1 
ATOM   3163 O  OG1 . THR A 1 444 ? 22.57268 61.12101 20.16853  1.000 33.81985  ? 444 THR A OG1 1 
ATOM   3164 C  CG2 . THR A 1 444 ? 21.82173 58.91082 20.88882  1.000 22.31398  ? 444 THR A CG2 1 
ATOM   3165 N  N   . ASN A 1 445 ? 20.69270 60.17468 23.95085  1.000 35.81771  ? 445 ASN A N   1 
ATOM   3166 C  CA  . ASN A 1 445 ? 20.20403 59.39919 25.08390  1.000 43.41038  ? 445 ASN A CA  1 
ATOM   3167 C  C   . ASN A 1 445 ? 18.71242 59.61542 25.29067  1.000 39.37454  ? 445 ASN A C   1 
ATOM   3168 O  O   . ASN A 1 445 ? 17.95485 58.65279 25.45636  1.000 40.41615  ? 445 ASN A O   1 
ATOM   3169 C  CB  . ASN A 1 445 ? 20.97800 59.77252 26.35736  1.000 49.52308  ? 445 ASN A CB  1 
ATOM   3170 C  CG  . ASN A 1 445 ? 21.01936 58.64067 27.37900  1.000 47.73368  ? 445 ASN A CG  1 
ATOM   3171 O  OD1 . ASN A 1 445 ? 20.21611 58.60728 28.32050  1.000 48.44345  ? 445 ASN A OD1 1 
ATOM   3172 N  ND2 . ASN A 1 445 ? 21.96587 57.71540 27.20589  1.000 40.75157  ? 445 ASN A ND2 1 
ATOM   3173 N  N   . GLU A 1 446 ? 18.26467 60.87144 25.25722  1.000 37.34924  ? 446 GLU A N   1 
ATOM   3174 C  CA  . GLU A 1 446 ? 16.86580 61.14212 25.55916  1.000 45.94547  ? 446 GLU A CA  1 
ATOM   3175 C  C   . GLU A 1 446 ? 15.94991 60.50439 24.52640  1.000 42.43538  ? 446 GLU A C   1 
ATOM   3176 O  O   . GLU A 1 446 ? 14.95505 59.86007 24.87933  1.000 29.61151  ? 446 GLU A O   1 
ATOM   3177 C  CB  . GLU A 1 446 ? 16.62589 62.64219 25.64310  1.000 54.41637  ? 446 GLU A CB  1 
ATOM   3178 C  CG  . GLU A 1 446 ? 15.40672 62.99253 26.46622  1.000 71.23132  ? 446 GLU A CG  1 
ATOM   3179 C  CD  . GLU A 1 446 ? 15.07882 64.46268 26.38552  1.000 85.75174  ? 446 GLU A CD  1 
ATOM   3180 O  OE1 . GLU A 1 446 ? 15.29980 65.04390 25.29240  1.000 88.04384  ? 446 GLU A OE1 1 
ATOM   3181 O  OE2 . GLU A 1 446 ? 14.62335 65.03292 27.41102  1.000 89.42135  ? 446 GLU A OE2 1 
ATOM   3182 N  N   . TYR A 1 447 ? 16.28173 60.66014 23.24210  1.000 40.35138  ? 447 TYR A N   1 
ATOM   3183 C  CA  . TYR A 1 447 ? 15.45493 60.06982 22.19034  1.000 45.09900  ? 447 TYR A CA  1 
ATOM   3184 C  C   . TYR A 1 447 ? 15.46539 58.54907 22.27545  1.000 46.65975  ? 447 TYR A C   1 
ATOM   3185 O  O   . TYR A 1 447 ? 14.44397 57.89388 22.02480  1.000 44.67686  ? 447 TYR A O   1 
ATOM   3186 C  CB  . TYR A 1 447 ? 15.93743 60.52191 20.81446  1.000 33.89358  ? 447 TYR A CB  1 
ATOM   3187 C  CG  . TYR A 1 447 ? 14.88849 60.38805 19.75669  1.000 32.38816  ? 447 TYR A CG  1 
ATOM   3188 C  CD1 . TYR A 1 447 ? 13.58773 60.75823 20.00553  1.000 39.37847  ? 447 TYR A CD1 1 
ATOM   3189 C  CD2 . TYR A 1 447 ? 15.19143 59.86844 18.50432  1.000 32.12381  ? 447 TYR A CD2 1 
ATOM   3190 C  CE1 . TYR A 1 447 ? 12.60420 60.63685 19.01708  1.000 48.58715  ? 447 TYR A CE1 1 
ATOM   3191 C  CE2 . TYR A 1 447 ? 14.22186 59.74138 17.51844  1.000 30.68079  ? 447 TYR A CE2 1 
ATOM   3192 C  CZ  . TYR A 1 447 ? 12.93300 60.12786 17.77636  1.000 45.69975  ? 447 TYR A CZ  1 
ATOM   3193 O  OH  . TYR A 1 447 ? 11.96561 60.00695 16.80245  1.000 51.77467  ? 447 TYR A OH  1 
ATOM   3194 N  N   . ALA A 1 448 ? 16.61833 57.97006 22.61999  1.000 36.16151  ? 448 ALA A N   1 
ATOM   3195 C  CA  . ALA A 1 448 ? 16.68870 56.52630 22.77975  1.000 30.31170  ? 448 ALA A CA  1 
ATOM   3196 C  C   . ALA A 1 448 ? 15.71012 56.06435 23.84784  1.000 37.31894  ? 448 ALA A C   1 
ATOM   3197 O  O   . ALA A 1 448 ? 14.95062 55.10729 23.64065  1.000 42.88257  ? 448 ALA A O   1 
ATOM   3198 C  CB  . ALA A 1 448 ? 18.12280 56.10735 23.11554  1.000 26.32752  ? 448 ALA A CB  1 
ATOM   3199 N  N   . GLN A 1 449 ? 15.68352 56.75977 24.98649  1.000 35.70097  ? 449 GLN A N   1 
ATOM   3200 C  CA  . GLN A 1 449 ? 14.69469 56.43528 26.00077  1.000 36.30447  ? 449 GLN A CA  1 
ATOM   3201 C  C   . GLN A 1 449 ? 13.27649 56.63588 25.47038  1.000 37.20631  ? 449 GLN A C   1 
ATOM   3202 O  O   . GLN A 1 449 ? 12.38803 55.81100 25.72348  1.000 42.43127  ? 449 GLN A O   1 
ATOM   3203 C  CB  . GLN A 1 449 ? 14.94948 57.26698 27.25437  1.000 38.88549  ? 449 GLN A CB  1 
ATOM   3204 C  CG  . GLN A 1 449 ? 16.23532 56.88450 27.95774  1.000 41.78202  ? 449 GLN A CG  1 
ATOM   3205 C  CD  . GLN A 1 449 ? 16.59770 57.84195 29.07121  1.000 45.66297  ? 449 GLN A CD  1 
ATOM   3206 O  OE1 . GLN A 1 449 ? 15.80294 58.05973 29.99797  1.000 51.37565  ? 449 GLN A OE1 1 
ATOM   3207 N  NE2 . GLN A 1 449 ? 17.80196 58.43858 28.98572  1.000 34.54288  ? 449 GLN A NE2 1 
ATOM   3208 N  N   . ALA A 1 450 ? 13.04484 57.71142 24.71206  1.000 32.87554  ? 450 ALA A N   1 
ATOM   3209 C  CA  . ALA A 1 450 ? 11.70598 57.94027 24.17351  1.000 38.36283  ? 450 ALA A CA  1 
ATOM   3210 C  C   . ALA A 1 450 ? 11.28695 56.82955 23.20620  1.000 46.38515  ? 450 ALA A C   1 
ATOM   3211 O  O   . ALA A 1 450 ? 10.13658 56.37109 23.24781  1.000 49.97325  ? 450 ALA A O   1 
ATOM   3212 C  CB  . ALA A 1 450 ? 11.63216 59.30977 23.49912  1.000 33.15113  ? 450 ALA A CB  1 
ATOM   3213 N  N   . LEU A 1 451 ? 12.20370 56.36636 22.33891  1.000 41.79421  ? 451 LEU A N   1 
ATOM   3214 C  CA  . LEU A 1 451 ? 11.83244 55.32805 21.37288  1.000 43.21363  ? 451 LEU A CA  1 
ATOM   3215 C  C   . LEU A 1 451 ? 11.49882 54.01878 22.07902  1.000 45.40815  ? 451 LEU A C   1 
ATOM   3216 O  O   . LEU A 1 451 ? 10.44464 53.41677 21.83461  1.000 46.12593  ? 451 LEU A O   1 
ATOM   3217 C  CB  . LEU A 1 451 ? 12.94293 55.11492 20.34041  1.000 35.18066  ? 451 LEU A CB  1 
ATOM   3218 C  CG  . LEU A 1 451 ? 13.16139 56.30944 19.39753  1.000 38.74745  ? 451 LEU A CG  1 
ATOM   3219 C  CD1 . LEU A 1 451 ? 14.55385 56.32732 18.81304  1.000 35.31334  ? 451 LEU A CD1 1 
ATOM   3220 C  CD2 . LEU A 1 451 ? 12.14974 56.30478 18.29130  1.000 44.64946  ? 451 LEU A CD2 1 
ATOM   3221 N  N   . ALA A 1 452 ? 12.37043 53.57521 22.98951  1.000 40.87897  ? 452 ALA A N   1 
ATOM   3222 C  CA  . ALA A 1 452 ? 12.10058 52.32248 23.68825  1.000 44.88802  ? 452 ALA A CA  1 
ATOM   3223 C  C   . ALA A 1 452 ? 10.82021 52.40380 24.51683  1.000 45.71170  ? 452 ALA A C   1 
ATOM   3224 O  O   . ALA A 1 452 ? 10.14687 51.38532 24.72067  1.000 50.07149  ? 452 ALA A O   1 
ATOM   3225 C  CB  . ALA A 1 452 ? 13.29488 51.93836 24.55835  1.000 35.22238  ? 452 ALA A CB  1 
ATOM   3226 N  N   . GLU A 1 453 ? 10.43938 53.60412 24.96618  1.000 40.65627  ? 453 GLU A N   1 
ATOM   3227 C  CA  . GLU A 1 453 ? 9.18741  53.72431 25.70302  1.000 46.79254  ? 453 GLU A CA  1 
ATOM   3228 C  C   . GLU A 1 453 ? 7.98113  53.51875 24.79840  1.000 49.55235  ? 453 GLU A C   1 
ATOM   3229 O  O   . GLU A 1 453 ? 6.92477  53.09212 25.27441  1.000 59.11114  ? 453 GLU A O   1 
ATOM   3230 C  CB  . GLU A 1 453 ? 9.09829  55.07860 26.41293  1.000 58.93410  ? 453 GLU A CB  1 
ATOM   3231 C  CG  . GLU A 1 453 ? 9.98135  55.21215 27.66828  1.000 76.33332  ? 453 GLU A CG  1 
ATOM   3232 C  CD  . GLU A 1 453 ? 9.41582  54.49768 28.89952  1.000 96.45377  ? 453 GLU A CD  1 
ATOM   3233 O  OE1 . GLU A 1 453 ? 8.26419  54.00835 28.84555  1.000 104.30857 ? 453 GLU A OE1 1 
ATOM   3234 O  OE2 . GLU A 1 453 ? 10.12863 54.43205 29.92723  1.000 100.90938 ? 453 GLU A OE2 1 
ATOM   3235 N  N   . ARG A 1 454 ? 8.10144  53.80549 23.50466  1.000 47.07917  ? 454 ARG A N   1 
ATOM   3236 C  CA  . ARG A 1 454 ? 6.97379  53.58011 22.61247  1.000 56.37585  ? 454 ARG A CA  1 
ATOM   3237 C  C   . ARG A 1 454 ? 7.08507  52.28050 21.83707  1.000 52.87918  ? 454 ARG A C   1 
ATOM   3238 O  O   . ARG A 1 454 ? 6.35520  52.09504 20.85810  1.000 50.62997  ? 454 ARG A O   1 
ATOM   3239 C  CB  . ARG A 1 454 ? 6.78297  54.74130 21.63731  1.000 61.99871  ? 454 ARG A CB  1 
ATOM   3240 C  CG  . ARG A 1 454 ? 7.07407  56.13037 22.17193  1.000 62.77375  ? 454 ARG A CG  1 
ATOM   3241 C  CD  . ARG A 1 454 ? 7.64774  56.94639 21.05025  1.000 69.46656  ? 454 ARG A CD  1 
ATOM   3242 N  NE  . ARG A 1 454 ? 6.76016  56.90506 19.87934  1.000 89.14427  ? 454 ARG A NE  1 
ATOM   3243 C  CZ  . ARG A 1 454 ? 7.08878  57.28797 18.64090  1.000 88.81705  ? 454 ARG A CZ  1 
ATOM   3244 N  NH1 . ARG A 1 454 ? 8.31286  57.72861 18.36231  1.000 84.03515  ? 454 ARG A NH1 1 
ATOM   3245 N  NH2 . ARG A 1 454 ? 6.19423  57.20249 17.66583  1.000 84.51722  ? 454 ARG A NH2 1 
ATOM   3246 N  N   . GLY A 1 455 ? 7.97099  51.37911 22.25017  1.000 54.17092  ? 455 GLY A N   1 
ATOM   3247 C  CA  . GLY A 1 455 ? 7.93972  50.01658 21.76488  1.000 56.71272  ? 455 GLY A CA  1 
ATOM   3248 C  C   . GLY A 1 455 ? 9.00449  49.63779 20.76503  1.000 53.12080  ? 455 GLY A C   1 
ATOM   3249 O  O   . GLY A 1 455 ? 9.05294  48.46401 20.36429  1.000 49.19148  ? 455 GLY A O   1 
ATOM   3250 N  N   . ALA A 1 456 ? 9.85094  50.57849 20.34317  1.000 51.74151  ? 456 ALA A N   1 
ATOM   3251 C  CA  . ALA A 1 456 ? 10.90584 50.22880 19.41158  1.000 37.34714  ? 456 ALA A CA  1 
ATOM   3252 C  C   . ALA A 1 456 ? 11.93683 49.35411 20.10275  1.000 42.72615  ? 456 ALA A C   1 
ATOM   3253 O  O   . ALA A 1 456 ? 12.10259 49.38252 21.32004  1.000 46.90535  ? 456 ALA A O   1 
ATOM   3254 C  CB  . ALA A 1 456 ? 11.57172 51.47655 18.84677  1.000 34.99518  ? 456 ALA A CB  1 
ATOM   3255 N  N   . SER A 1 457 ? 12.62207 48.55848 19.30577  1.000 47.91163  ? 457 SER A N   1 
ATOM   3256 C  CA  . SER A 1 457 ? 13.70508 47.70408 19.77625  1.000 46.04909  ? 457 SER A CA  1 
ATOM   3257 C  C   . SER A 1 457 ? 15.01037 48.46482 19.54480  1.000 44.31204  ? 457 SER A C   1 
ATOM   3258 O  O   . SER A 1 457 ? 15.52186 48.51860 18.42414  1.000 48.48641  ? 457 SER A O   1 
ATOM   3259 C  CB  . SER A 1 457 ? 13.66135 46.36531 19.04988  1.000 43.33659  ? 457 SER A CB  1 
ATOM   3260 O  OG  . SER A 1 457 ? 14.77085 45.55649 19.37840  1.000 51.51845  ? 457 SER A OG  1 
ATOM   3261 N  N   . VAL A 1 458 ? 15.53793 49.06490 20.61047  1.000 40.93946  ? 458 VAL A N   1 
ATOM   3262 C  CA  . VAL A 1 458 ? 16.64944 50.00987 20.53916  1.000 32.96946  ? 458 VAL A CA  1 
ATOM   3263 C  C   . VAL A 1 458 ? 17.90570 49.33947 21.06656  1.000 37.52686  ? 458 VAL A C   1 
ATOM   3264 O  O   . VAL A 1 458 ? 17.87835 48.68961 22.11976  1.000 41.81455  ? 458 VAL A O   1 
ATOM   3265 C  CB  . VAL A 1 458 ? 16.35921 51.28711 21.34242  1.000 37.20593  ? 458 VAL A CB  1 
ATOM   3266 C  CG1 . VAL A 1 458 ? 17.57968 52.20138 21.33374  1.000 28.21567  ? 458 VAL A CG1 1 
ATOM   3267 C  CG2 . VAL A 1 458 ? 15.10541 52.00148 20.79583  1.000 43.83941  ? 458 VAL A CG2 1 
ATOM   3268 N  N   . HIS A 1 459 ? 19.00138 49.49759 20.33305  1.000 37.80328  ? 459 HIS A N   1 
ATOM   3269 C  CA  . HIS A 1 459 ? 20.31549 49.05444 20.75972  1.000 35.25370  ? 459 HIS A CA  1 
ATOM   3270 C  C   . HIS A 1 459 ? 21.26399 50.23922 20.68119  1.000 44.63947  ? 459 HIS A C   1 
ATOM   3271 O  O   . HIS A 1 459 ? 21.27134 50.97919 19.68913  1.000 46.65897  ? 459 HIS A O   1 
ATOM   3272 C  CB  . HIS A 1 459 ? 20.81948 47.90496 19.90038  1.000 32.41907  ? 459 HIS A CB  1 
ATOM   3273 C  CG  . HIS A 1 459 ? 20.25019 46.57982 20.27872  1.000 31.33136  ? 459 HIS A CG  1 
ATOM   3274 N  ND1 . HIS A 1 459 ? 19.02625 46.14227 19.82422  1.000 33.77150  ? 459 HIS A ND1 1 
ATOM   3275 C  CD2 . HIS A 1 459 ? 20.73407 45.59423 21.07208  1.000 33.65569  ? 459 HIS A CD2 1 
ATOM   3276 C  CE1 . HIS A 1 459 ? 18.77683 44.94405 20.32339  1.000 37.78158  ? 459 HIS A CE1 1 
ATOM   3277 N  NE2 . HIS A 1 459 ? 19.79565 44.59107 21.08825  1.000 41.65649  ? 459 HIS A NE2 1 
ATOM   3278 N  N   . TYR A 1 460 ? 22.06170 50.40191 21.73146  1.000 41.84914  ? 460 TYR A N   1 
ATOM   3279 C  CA  . TYR A 1 460 ? 22.84884 51.59848 21.98703  1.000 35.17581  ? 460 TYR A CA  1 
ATOM   3280 C  C   . TYR A 1 460 ? 24.32110 51.22269 22.08205  1.000 33.91025  ? 460 TYR A C   1 
ATOM   3281 O  O   . TYR A 1 460 ? 24.67228 50.22196 22.71776  1.000 38.79679  ? 460 TYR A O   1 
ATOM   3282 C  CB  . TYR A 1 460 ? 22.38721 52.26070 23.30122  1.000 33.75102  ? 460 TYR A CB  1 
ATOM   3283 C  CG  . TYR A 1 460 ? 22.69726 53.73584 23.41988  1.000 31.49087  ? 460 TYR A CG  1 
ATOM   3284 C  CD1 . TYR A 1 460 ? 24.00621 54.20264 23.53187  1.000 24.14008  ? 460 TYR A CD1 1 
ATOM   3285 C  CD2 . TYR A 1 460 ? 21.66526 54.67145 23.41523  1.000 30.37267  ? 460 TYR A CD2 1 
ATOM   3286 C  CE1 . TYR A 1 460 ? 24.27126 55.57511 23.62418  1.000 25.95904  ? 460 TYR A CE1 1 
ATOM   3287 C  CE2 . TYR A 1 460 ? 21.91728 56.02920 23.52798  1.000 28.26190  ? 460 TYR A CE2 1 
ATOM   3288 C  CZ  . TYR A 1 460 ? 23.21286 56.47895 23.62763  1.000 27.97267  ? 460 TYR A CZ  1 
ATOM   3289 O  OH  . TYR A 1 460 ? 23.41414 57.83943 23.74906  1.000 32.32953  ? 460 TYR A OH  1 
ATOM   3290 N  N   . TYR A 1 461 ? 25.18407 52.02966 21.47004  1.000 24.36304  ? 461 TYR A N   1 
ATOM   3291 C  CA  . TYR A 1 461 ? 26.61990 51.77649 21.48254  1.000 37.52986  ? 461 TYR A CA  1 
ATOM   3292 C  C   . TYR A 1 461 ? 27.34018 53.04010 21.93286  1.000 35.01505  ? 461 TYR A C   1 
ATOM   3293 O  O   . TYR A 1 461 ? 26.79357 54.14157 21.87270  1.000 32.90092  ? 461 TYR A O   1 
ATOM   3294 C  CB  . TYR A 1 461 ? 27.14891 51.33566 20.08616  1.000 27.03663  ? 461 TYR A CB  1 
ATOM   3295 C  CG  . TYR A 1 461 ? 27.06407 52.45367 19.07078  1.000 32.52876  ? 461 TYR A CG  1 
ATOM   3296 C  CD1 . TYR A 1 461 ? 28.01234 53.47831 19.04077  1.000 30.51210  ? 461 TYR A CD1 1 
ATOM   3297 C  CD2 . TYR A 1 461 ? 26.00967 52.51495 18.16834  1.000 31.77755  ? 461 TYR A CD2 1 
ATOM   3298 C  CE1 . TYR A 1 461 ? 27.90846 54.51434 18.13671  1.000 28.18285  ? 461 TYR A CE1 1 
ATOM   3299 C  CE2 . TYR A 1 461 ? 25.91061 53.54552 17.25407  1.000 26.13705  ? 461 TYR A CE2 1 
ATOM   3300 C  CZ  . TYR A 1 461 ? 26.85571 54.53848 17.24556  1.000 23.40400  ? 461 TYR A CZ  1 
ATOM   3301 O  OH  . TYR A 1 461 ? 26.74597 55.57157 16.34591  1.000 27.92606  ? 461 TYR A OH  1 
ATOM   3302 N  N   . TYR A 1 462 ? 28.60321 52.88462 22.32496  1.000 34.60946  ? 462 TYR A N   1 
ATOM   3303 C  CA  . TYR A 1 462 ? 29.45411 54.02624 22.64830  1.000 27.42841  ? 462 TYR A CA  1 
ATOM   3304 C  C   . TYR A 1 462 ? 30.83224 53.75810 22.06451  1.000 29.48689  ? 462 TYR A C   1 
ATOM   3305 O  O   . TYR A 1 462 ? 31.43204 52.71779 22.36937  1.000 31.80291  ? 462 TYR A O   1 
ATOM   3306 C  CB  . TYR A 1 462 ? 29.52233 54.22073 24.16137  1.000 38.09755  ? 462 TYR A CB  1 
ATOM   3307 C  CG  . TYR A 1 462 ? 30.03999 55.55971 24.63912  1.000 41.51117  ? 462 TYR A CG  1 
ATOM   3308 C  CD1 . TYR A 1 462 ? 29.53579 56.74958 24.12548  1.000 35.93617  ? 462 TYR A CD1 1 
ATOM   3309 C  CD2 . TYR A 1 462 ? 30.98956 55.62793 25.65623  1.000 41.26166  ? 462 TYR A CD2 1 
ATOM   3310 C  CE1 . TYR A 1 462 ? 29.98840 57.96437 24.58904  1.000 43.28515  ? 462 TYR A CE1 1 
ATOM   3311 C  CE2 . TYR A 1 462 ? 31.44739 56.83447 26.12685  1.000 40.37308  ? 462 TYR A CE2 1 
ATOM   3312 C  CZ  . TYR A 1 462 ? 30.94642 57.99722 25.59773  1.000 46.37562  ? 462 TYR A CZ  1 
ATOM   3313 O  OH  . TYR A 1 462 ? 31.40992 59.20038 26.07988  1.000 50.06685  ? 462 TYR A OH  1 
ATOM   3314 N  N   . PHE A 1 463 ? 31.31836 54.66687 21.21049  1.000 23.75054  ? 463 PHE A N   1 
ATOM   3315 C  CA  . PHE A 1 463 ? 32.56946 54.46977 20.47744  1.000 29.52507  ? 463 PHE A CA  1 
ATOM   3316 C  C   . PHE A 1 463 ? 33.70093 55.22631 21.16967  1.000 30.74465  ? 463 PHE A C   1 
ATOM   3317 O  O   . PHE A 1 463 ? 33.67163 56.46030 21.23972  1.000 33.17412  ? 463 PHE A O   1 
ATOM   3318 C  CB  . PHE A 1 463 ? 32.43624 54.95110 19.03268  1.000 23.92519  ? 463 PHE A CB  1 
ATOM   3319 C  CG  . PHE A 1 463 ? 33.70167 54.78695 18.21072  1.000 38.58253  ? 463 PHE A CG  1 
ATOM   3320 C  CD1 . PHE A 1 463 ? 34.12024 53.53372 17.78744  1.000 41.62441  ? 463 PHE A CD1 1 
ATOM   3321 C  CD2 . PHE A 1 463 ? 34.45837 55.87852 17.84242  1.000 34.33432  ? 463 PHE A CD2 1 
ATOM   3322 C  CE1 . PHE A 1 463 ? 35.27549 53.36961 17.02376  1.000 31.83181  ? 463 PHE A CE1 1 
ATOM   3323 C  CE2 . PHE A 1 463 ? 35.61325 55.71920 17.07013  1.000 35.58861  ? 463 PHE A CE2 1 
ATOM   3324 C  CZ  . PHE A 1 463 ? 36.01881 54.46616 16.67496  1.000 34.68475  ? 463 PHE A CZ  1 
ATOM   3325 N  N   . THR A 1 464 ? 34.71587 54.50783 21.64333  1.000 31.83294  ? 464 THR A N   1 
ATOM   3326 C  CA  . THR A 1 464 ? 35.74026 55.15339 22.45754  1.000 42.92549  ? 464 THR A CA  1 
ATOM   3327 C  C   . THR A 1 464 ? 37.14632 55.00381 21.91058  1.000 48.45508  ? 464 THR A C   1 
ATOM   3328 O  O   . THR A 1 464 ? 38.08885 55.41650 22.58825  1.000 51.10859  ? 464 THR A O   1 
ATOM   3329 C  CB  . THR A 1 464 ? 35.73612 54.61877 23.89497  1.000 38.56352  ? 464 THR A CB  1 
ATOM   3330 O  OG1 . THR A 1 464 ? 35.63067 53.19569 23.86933  1.000 54.58162  ? 464 THR A OG1 1 
ATOM   3331 C  CG2 . THR A 1 464 ? 34.56522 55.15448 24.64969  1.000 32.19107  ? 464 THR A CG2 1 
ATOM   3332 N  N   . HIS A 1 465 ? 37.32953 54.41530 20.73195  1.000 54.85554  ? 465 HIS A N   1 
ATOM   3333 C  CA  . HIS A 1 465 ? 38.67522 54.15595 20.22905  1.000 47.43746  ? 465 HIS A CA  1 
ATOM   3334 C  C   . HIS A 1 465 ? 39.24201 55.36720 19.50874  1.000 43.12434  ? 465 HIS A C   1 
ATOM   3335 O  O   . HIS A 1 465 ? 38.60608 55.91356 18.59969  1.000 51.99646  ? 465 HIS A O   1 
ATOM   3336 C  CB  . HIS A 1 465 ? 38.71942 52.97194 19.27341  1.000 46.02817  ? 465 HIS A CB  1 
ATOM   3337 C  CG  . HIS A 1 465 ? 40.10860 52.65024 18.82492  1.000 53.70309  ? 465 HIS A CG  1 
ATOM   3338 N  ND1 . HIS A 1 465 ? 41.18020 52.65719 19.68991  1.000 58.49956  ? 465 HIS A ND1 1 
ATOM   3339 C  CD2 . HIS A 1 465 ? 40.61220 52.35715 17.60618  1.000 55.35634  ? 465 HIS A CD2 1 
ATOM   3340 C  CE1 . HIS A 1 465 ? 42.28231 52.36441 19.02704  1.000 57.78931  ? 465 HIS A CE1 1 
ATOM   3341 N  NE2 . HIS A 1 465 ? 41.96410 52.17597 17.76106  1.000 59.34107  ? 465 HIS A NE2 1 
ATOM   3342 N  N   . ARG A 1 466 ? 40.45294 55.76069 19.89578  1.000 37.60248  ? 466 ARG A N   1 
ATOM   3343 C  CA  . ARG A 1 466 ? 41.18559 56.82883 19.21899  1.000 40.92865  ? 466 ARG A CA  1 
ATOM   3344 C  C   . ARG A 1 466 ? 42.03368 56.19437 18.12276  1.000 42.27844  ? 466 ARG A C   1 
ATOM   3345 O  O   . ARG A 1 466 ? 42.96147 55.43085 18.41903  1.000 45.15104  ? 466 ARG A O   1 
ATOM   3346 C  CB  . ARG A 1 466 ? 42.04202 57.59473 20.22455  1.000 37.26084  ? 466 ARG A CB  1 
ATOM   3347 C  CG  . ARG A 1 466 ? 43.22403 58.33015 19.64889  1.000 42.71909  ? 466 ARG A CG  1 
ATOM   3348 C  CD  . ARG A 1 466 ? 42.81574 59.69167 19.14714  1.000 45.33550  ? 466 ARG A CD  1 
ATOM   3349 N  NE  . ARG A 1 466 ? 43.97154 60.50900 18.80497  1.000 55.52433  ? 466 ARG A NE  1 
ATOM   3350 C  CZ  . ARG A 1 466 ? 43.92686 61.82865 18.64640  1.000 54.77518  ? 466 ARG A CZ  1 
ATOM   3351 N  NH1 . ARG A 1 466 ? 42.77989 62.49940 18.79819  1.000 37.99724  ? 466 ARG A NH1 1 
ATOM   3352 N  NH2 . ARG A 1 466 ? 45.03491 62.47786 18.33285  1.000 53.33736  ? 466 ARG A NH2 1 
ATOM   3353 N  N   . THR A 1 467 ? 41.70594 56.47390 16.86003  1.000 41.73976  ? 467 THR A N   1 
ATOM   3354 C  CA  . THR A 1 467 ? 42.42675 55.81591 15.76696  1.000 45.07814  ? 467 THR A CA  1 
ATOM   3355 C  C   . THR A 1 467 ? 43.91252 56.15815 15.80852  1.000 49.23685  ? 467 THR A C   1 
ATOM   3356 O  O   . THR A 1 467 ? 44.29880 57.31378 16.01358  1.000 50.81146  ? 467 THR A O   1 
ATOM   3357 C  CB  . THR A 1 467 ? 41.85819 56.20226 14.40657  1.000 41.47838  ? 467 THR A CB  1 
ATOM   3358 O  OG1 . THR A 1 467 ? 40.45228 55.93491 14.36628  1.000 43.44600  ? 467 THR A OG1 1 
ATOM   3359 C  CG2 . THR A 1 467 ? 42.52984 55.38327 13.34071  1.000 48.21002  ? 467 THR A CG2 1 
ATOM   3360 N  N   . SER A 1 468 ? 44.74770 55.14232 15.60772  1.000 39.76623  ? 468 SER A N   1 
ATOM   3361 C  CA  . SER A 1 468 ? 46.18170 55.31130 15.79659  1.000 58.32542  ? 468 SER A CA  1 
ATOM   3362 C  C   . SER A 1 468 ? 46.80235 56.27010 14.78918  1.000 64.61339  ? 468 SER A C   1 
ATOM   3363 O  O   . SER A 1 468 ? 47.91260 56.76415 15.02018  1.000 67.97092  ? 468 SER A O   1 
ATOM   3364 C  CB  . SER A 1 468 ? 46.87123 53.95290 15.71575  1.000 60.45253  ? 468 SER A CB  1 
ATOM   3365 O  OG  . SER A 1 468 ? 46.55181 53.31085 14.49320  1.000 62.37296  ? 468 SER A OG  1 
ATOM   3366 N  N   . THR A 1 469 ? 46.12615 56.55198 13.68191  1.000 66.17465  ? 469 THR A N   1 
ATOM   3367 C  CA  . THR A 1 469 ? 46.67426 57.46679 12.69329  1.000 70.72804  ? 469 THR A CA  1 
ATOM   3368 C  C   . THR A 1 469 ? 46.00488 58.83208 12.71587  1.000 68.33830  ? 469 THR A C   1 
ATOM   3369 O  O   . THR A 1 469 ? 46.28526 59.65070 11.83396  1.000 68.63053  ? 469 THR A O   1 
ATOM   3370 C  CB  . THR A 1 469 ? 46.56687 56.87208 11.28853  1.000 67.37510  ? 469 THR A CB  1 
ATOM   3371 O  OG1 . THR A 1 469 ? 45.18651 56.61772 10.98389  1.000 68.04542  ? 469 THR A OG1 1 
ATOM   3372 C  CG2 . THR A 1 469 ? 47.38032 55.57962 11.19288  1.000 59.65159  ? 469 THR A CG2 1 
ATOM   3373 N  N   . SER A 1 470 ? 45.15010 59.10597 13.70540  1.000 60.47970  ? 470 SER A N   1 
ATOM   3374 C  CA  . SER A 1 470 ? 44.36715 60.33253 13.66942  1.000 52.91363  ? 470 SER A CA  1 
ATOM   3375 C  C   . SER A 1 470 ? 45.28649 61.53709 13.63117  1.000 58.21062  ? 470 SER A C   1 
ATOM   3376 O  O   . SER A 1 470 ? 46.21225 61.65643 14.43565  1.000 63.72845  ? 470 SER A O   1 
ATOM   3377 C  CB  . SER A 1 470 ? 43.43677 60.44015 14.86408  1.000 53.14580  ? 470 SER A CB  1 
ATOM   3378 O  OG  . SER A 1 470 ? 43.08789 61.80183 15.06524  1.000 55.32926  ? 470 SER A OG  1 
ATOM   3379 N  N   . LEU A 1 471 ? 45.03225 62.42390 12.67455  1.000 60.13208  ? 471 LEU A N   1 
ATOM   3380 C  CA  . LEU A 1 471 ? 45.88429 63.57911 12.44512  1.000 62.60632  ? 471 LEU A CA  1 
ATOM   3381 C  C   . LEU A 1 471 ? 45.54112 64.76206 13.33593  1.000 55.10458  ? 471 LEU A C   1 
ATOM   3382 O  O   . LEU A 1 471 ? 46.29158 65.74303 13.36518  1.000 55.49404  ? 471 LEU A O   1 
ATOM   3383 C  CB  . LEU A 1 471 ? 45.79701 63.97715 10.98073  1.000 69.98542  ? 471 LEU A CB  1 
ATOM   3384 C  CG  . LEU A 1 471 ? 46.83028 63.18719 10.17629  1.000 76.72868  ? 471 LEU A CG  1 
ATOM   3385 C  CD1 . LEU A 1 471 ? 46.65554 63.48899 8.69666   1.000 79.28996  ? 471 LEU A CD1 1 
ATOM   3386 C  CD2 . LEU A 1 471 ? 48.27973 63.45024 10.68704  1.000 76.47742  ? 471 LEU A CD2 1 
ATOM   3387 N  N   . TRP A 1 472 ? 44.43726 64.68976 14.06041  1.000 56.03537  ? 472 TRP A N   1 
ATOM   3388 C  CA  . TRP A 1 472 ? 44.06413 65.73443 14.99071  1.000 49.85572  ? 472 TRP A CA  1 
ATOM   3389 C  C   . TRP A 1 472 ? 44.85023 65.59027 16.28750  1.000 47.55045  ? 472 TRP A C   1 
ATOM   3390 O  O   . TRP A 1 472 ? 45.42714 64.54061 16.57755  1.000 47.03905  ? 472 TRP A O   1 
ATOM   3391 C  CB  . TRP A 1 472 ? 42.56498 65.67584 15.24651  1.000 44.20879  ? 472 TRP A CB  1 
ATOM   3392 C  CG  . TRP A 1 472 ? 41.78890 65.90112 14.00211  1.000 47.11362  ? 472 TRP A CG  1 
ATOM   3393 C  CD1 . TRP A 1 472 ? 41.26063 64.95111 13.17751  1.000 49.98925  ? 472 TRP A CD1 1 
ATOM   3394 C  CD2 . TRP A 1 472 ? 41.47781 67.16469 13.41455  1.000 48.35929  ? 472 TRP A CD2 1 
ATOM   3395 N  NE1 . TRP A 1 472 ? 40.63454 65.54752 12.11268  1.000 51.00535  ? 472 TRP A NE1 1 
ATOM   3396 C  CE2 . TRP A 1 472 ? 40.75407 66.90753 12.23364  1.000 51.61848  ? 472 TRP A CE2 1 
ATOM   3397 C  CE3 . TRP A 1 472 ? 41.73835 68.49076 13.77534  1.000 46.86867  ? 472 TRP A CE3 1 
ATOM   3398 C  CZ2 . TRP A 1 472 ? 40.27782 67.92748 11.41408  1.000 52.70083  ? 472 TRP A CZ2 1 
ATOM   3399 C  CZ3 . TRP A 1 472 ? 41.27066 69.49788 12.96807  1.000 52.30121  ? 472 TRP A CZ3 1 
ATOM   3400 C  CH2 . TRP A 1 472 ? 40.54150 69.21282 11.79492  1.000 56.35485  ? 472 TRP A CH2 1 
ATOM   3401 N  N   . GLY A 1 473 ? 44.88516 66.67748 17.05642  1.000 50.67525  ? 473 GLY A N   1 
ATOM   3402 C  CA  . GLY A 1 473 ? 45.61646 66.68139 18.30912  1.000 48.66959  ? 473 GLY A CA  1 
ATOM   3403 C  C   . GLY A 1 473 ? 45.07325 65.66904 19.29573  1.000 52.42843  ? 473 GLY A C   1 
ATOM   3404 O  O   . GLY A 1 473 ? 43.92793 65.21467 19.20785  1.000 57.21926  ? 473 GLY A O   1 
ATOM   3405 N  N   . GLU A 1 474 ? 45.92879 65.29881 20.25232  1.000 52.89844  ? 474 GLU A N   1 
ATOM   3406 C  CA  . GLU A 1 474 ? 45.52292 64.27550 21.20662  1.000 55.36381  ? 474 GLU A CA  1 
ATOM   3407 C  C   . GLU A 1 474 ? 44.40562 64.76112 22.11922  1.000 47.46585  ? 474 GLU A C   1 
ATOM   3408 O  O   . GLU A 1 474 ? 43.53387 63.97003 22.49997  1.000 43.28135  ? 474 GLU A O   1 
ATOM   3409 C  CB  . GLU A 1 474 ? 46.72264 63.80231 22.02033  1.000 66.14587  ? 474 GLU A CB  1 
ATOM   3410 C  CG  . GLU A 1 474 ? 47.56822 62.82102 21.24485  1.000 82.84069  ? 474 GLU A CG  1 
ATOM   3411 C  CD  . GLU A 1 474 ? 47.20493 61.38488 21.57323  1.000 95.48397  ? 474 GLU A CD  1 
ATOM   3412 O  OE1 . GLU A 1 474 ? 47.31527 60.51558 20.67645  1.000 99.98659  ? 474 GLU A OE1 1 
ATOM   3413 O  OE2 . GLU A 1 474 ? 46.79399 61.13206 22.72795  1.000 97.95067  ? 474 GLU A OE2 1 
ATOM   3414 N  N   . TRP A 1 475 ? 44.39322 66.05274 22.45361  1.000 44.69398  ? 475 TRP A N   1 
ATOM   3415 C  CA  . TRP A 1 475 ? 43.39161 66.55510 23.38484  1.000 45.15858  ? 475 TRP A CA  1 
ATOM   3416 C  C   . TRP A 1 475 ? 41.98123 66.43121 22.82939  1.000 43.11979  ? 475 TRP A C   1 
ATOM   3417 O  O   . TRP A 1 475 ? 41.02197 66.33046 23.60775  1.000 44.58953  ? 475 TRP A O   1 
ATOM   3418 C  CB  . TRP A 1 475 ? 43.70074 68.00321 23.75175  1.000 49.94797  ? 475 TRP A CB  1 
ATOM   3419 C  CG  . TRP A 1 475 ? 43.54253 68.98473 22.63644  1.000 47.45992  ? 475 TRP A CG  1 
ATOM   3420 C  CD1 . TRP A 1 475 ? 44.50927 69.39236 21.76950  1.000 52.34828  ? 475 TRP A CD1 1 
ATOM   3421 C  CD2 . TRP A 1 475 ? 42.35735 69.72015 22.29284  1.000 44.87962  ? 475 TRP A CD2 1 
ATOM   3422 N  NE1 . TRP A 1 475 ? 43.99724 70.32118 20.89073  1.000 50.81405  ? 475 TRP A NE1 1 
ATOM   3423 C  CE2 . TRP A 1 475 ? 42.67948 70.54207 21.19445  1.000 45.24996  ? 475 TRP A CE2 1 
ATOM   3424 C  CE3 . TRP A 1 475 ? 41.05548 69.76534 22.80973  1.000 47.60839  ? 475 TRP A CE3 1 
ATOM   3425 C  CZ2 . TRP A 1 475 ? 41.74818 71.39856 20.59903  1.000 43.25588  ? 475 TRP A CZ2 1 
ATOM   3426 C  CZ3 . TRP A 1 475 ? 40.12458 70.61909 22.20798  1.000 43.04518  ? 475 TRP A CZ3 1 
ATOM   3427 C  CH2 . TRP A 1 475 ? 40.48122 71.42009 21.11902  1.000 39.13165  ? 475 TRP A CH2 1 
ATOM   3428 N  N   . MET A 1 476 ? 41.83892 66.41402 21.49832  1.000 43.52599  ? 476 MET A N   1 
ATOM   3429 C  CA  . MET A 1 476 ? 40.54149 66.28675 20.84364  1.000 41.77027  ? 476 MET A CA  1 
ATOM   3430 C  C   . MET A 1 476 ? 39.98556 64.86784 20.91244  1.000 44.26902  ? 476 MET A C   1 
ATOM   3431 O  O   . MET A 1 476 ? 38.80047 64.66876 20.60735  1.000 43.92553  ? 476 MET A O   1 
ATOM   3432 C  CB  . MET A 1 476 ? 40.65454 66.74600 19.38588  1.000 48.13136  ? 476 MET A CB  1 
ATOM   3433 C  CG  . MET A 1 476 ? 40.61402 68.26602 19.20768  1.000 56.19889  ? 476 MET A CG  1 
ATOM   3434 S  SD  . MET A 1 476 ? 40.69815 68.84378 17.47959  1.000 55.51181  ? 476 MET A SD  1 
ATOM   3435 C  CE  . MET A 1 476 ? 42.43229 68.69332 17.19692  1.000 62.19633  ? 476 MET A CE  1 
ATOM   3436 N  N   . GLY A 1 477 ? 40.80583 63.88742 21.29967  1.000 43.30658  ? 477 GLY A N   1 
ATOM   3437 C  CA  . GLY A 1 477 ? 40.31098 62.54833 21.59475  1.000 40.28667  ? 477 GLY A CA  1 
ATOM   3438 C  C   . GLY A 1 477 ? 39.60570 61.88678 20.42447  1.000 38.91119  ? 477 GLY A C   1 
ATOM   3439 O  O   . GLY A 1 477 ? 40.03697 61.97862 19.26986  1.000 47.41557  ? 477 GLY A O   1 
ATOM   3440 N  N   . VAL A 1 478 ? 38.49897 61.21059 20.72796  1.000 35.43535  ? 478 VAL A N   1 
ATOM   3441 C  CA  . VAL A 1 478 ? 37.75365 60.42018 19.75146  1.000 34.66003  ? 478 VAL A CA  1 
ATOM   3442 C  C   . VAL A 1 478 ? 36.74111 61.34698 19.07798  1.000 42.04655  ? 478 VAL A C   1 
ATOM   3443 O  O   . VAL A 1 478 ? 35.65597 61.59126 19.61383  1.000 41.26525  ? 478 VAL A O   1 
ATOM   3444 C  CB  . VAL A 1 478 ? 37.07687 59.21798 20.40967  1.000 29.27504  ? 478 VAL A CB  1 
ATOM   3445 C  CG1 . VAL A 1 478 ? 36.35074 58.41665 19.38309  1.000 26.43639  ? 478 VAL A CG1 1 
ATOM   3446 C  CG2 . VAL A 1 478 ? 38.11184 58.33534 21.14251  1.000 28.48535  ? 478 VAL A CG2 1 
ATOM   3447 N  N   . LEU A 1 479 ? 37.08759 61.83430 17.88066  1.000 44.61738  ? 479 LEU A N   1 
ATOM   3448 C  CA  . LEU A 1 479 ? 36.36786 62.92282 17.21508  1.000 50.48763  ? 479 LEU A CA  1 
ATOM   3449 C  C   . LEU A 1 479 ? 35.00027 62.50853 16.67087  1.000 50.19719  ? 479 LEU A C   1 
ATOM   3450 O  O   . LEU A 1 479 ? 34.77569 61.35991 16.28117  1.000 48.63544  ? 479 LEU A O   1 
ATOM   3451 C  CB  . LEU A 1 479 ? 37.18425 63.46996 16.03646  1.000 42.19640  ? 479 LEU A CB  1 
ATOM   3452 C  CG  . LEU A 1 479 ? 38.02380 64.72175 16.26041  1.000 46.29293  ? 479 LEU A CG  1 
ATOM   3453 C  CD1 . LEU A 1 479 ? 39.34087 64.37617 16.91423  1.000 57.30036  ? 479 LEU A CD1 1 
ATOM   3454 C  CD2 . LEU A 1 479 ? 38.25152 65.42261 14.94770  1.000 51.38785  ? 479 LEU A CD2 1 
ATOM   3455 N  N   A HIS A 1 480 ? 34.08379 63.47768 16.63682  0.516 48.03542  ? 480 HIS A N   1 
ATOM   3456 N  N   B HIS A 1 480 ? 34.08709 63.47332 16.63539  0.484 48.08406  ? 480 HIS A N   1 
ATOM   3457 C  CA  A HIS A 1 480 ? 32.83629 63.29360 15.90987  0.516 48.06009  ? 480 HIS A CA  1 
ATOM   3458 C  CA  B HIS A 1 480 ? 32.82215 63.31002 15.93084  0.484 48.03119  ? 480 HIS A CA  1 
ATOM   3459 C  C   A HIS A 1 480 ? 33.14214 62.80797 14.50031  0.516 52.20903  ? 480 HIS A C   1 
ATOM   3460 C  C   B HIS A 1 480 ? 33.06592 62.87306 14.48630  0.484 52.18607  ? 480 HIS A C   1 
ATOM   3461 O  O   A HIS A 1 480 ? 34.01521 63.34523 13.81260  0.516 54.80608  ? 480 HIS A O   1 
ATOM   3462 O  O   B HIS A 1 480 ? 33.79388 63.53191 13.73891  0.484 55.13131  ? 480 HIS A O   1 
ATOM   3463 C  CB  A HIS A 1 480 ? 32.02618 64.60089 15.87841  0.516 44.73805  ? 480 HIS A CB  1 
ATOM   3464 C  CB  B HIS A 1 480 ? 32.06525 64.64033 15.98109  0.484 44.70109  ? 480 HIS A CB  1 
ATOM   3465 C  CG  A HIS A 1 480 ? 32.10483 65.35523 14.57864  0.516 40.59631  ? 480 HIS A CG  1 
ATOM   3466 C  CG  B HIS A 1 480 ? 30.65553 64.57244 15.48795  0.484 38.94999  ? 480 HIS A CG  1 
ATOM   3467 N  ND1 A HIS A 1 480 ? 31.09149 65.33190 13.64013  0.516 36.03830  ? 480 HIS A ND1 1 
ATOM   3468 N  ND1 B HIS A 1 480 ? 29.70245 63.76374 16.06472  0.484 38.31927  ? 480 HIS A ND1 1 
ATOM   3469 C  CD2 A HIS A 1 480 ? 33.05918 66.18111 14.08029  0.516 32.16628  ? 480 HIS A CD2 1 
ATOM   3470 C  CD2 B HIS A 1 480 ? 30.03019 65.24300 14.49245  0.484 38.78762  ? 480 HIS A CD2 1 
ATOM   3471 C  CE1 A HIS A 1 480 ? 31.42730 66.09364 12.61337  0.516 33.04376  ? 480 HIS A CE1 1 
ATOM   3472 C  CE1 B HIS A 1 480 ? 28.55232 63.92984 15.43915  0.484 39.54444  ? 480 HIS A CE1 1 
ATOM   3473 N  NE2 A HIS A 1 480 ? 32.61461 66.62212 12.85663  0.516 36.50698  ? 480 HIS A NE2 1 
ATOM   3474 N  NE2 B HIS A 1 480 ? 28.72523 64.82085 14.47910  0.484 41.93290  ? 480 HIS A NE2 1 
ATOM   3475 N  N   . GLY A 1 481 ? 32.46184 61.74811 14.09545  1.000 50.52971  ? 481 GLY A N   1 
ATOM   3476 C  CA  . GLY A 1 481 ? 32.67336 61.18603 12.78348  1.000 42.77262  ? 481 GLY A CA  1 
ATOM   3477 C  C   . GLY A 1 481 ? 33.81708 60.20073 12.68860  1.000 43.09691  ? 481 GLY A C   1 
ATOM   3478 O  O   . GLY A 1 481 ? 34.01335 59.61493 11.61605  1.000 34.95343  ? 481 GLY A O   1 
ATOM   3479 N  N   . ASP A 1 482 ? 34.57881 60.00195 13.77545  1.000 45.07383  ? 482 ASP A N   1 
ATOM   3480 C  CA  . ASP A 1 482 ? 35.71139 59.07499 13.77814  1.000 35.93785  ? 482 ASP A CA  1 
ATOM   3481 C  C   . ASP A 1 482 ? 35.26232 57.63782 13.62424  1.000 30.63644  ? 482 ASP A C   1 
ATOM   3482 O  O   . ASP A 1 482 ? 36.06810 56.78242 13.24480  1.000 43.36549  ? 482 ASP A O   1 
ATOM   3483 C  CB  . ASP A 1 482 ? 36.50854 59.19386 15.08836  1.000 45.56926  ? 482 ASP A CB  1 
ATOM   3484 C  CG  . ASP A 1 482 ? 37.80246 59.96942 14.93605  1.000 50.57033  ? 482 ASP A CG  1 
ATOM   3485 O  OD1 . ASP A 1 482 ? 37.99465 60.58863 13.86950  1.000 48.04532  ? 482 ASP A OD1 1 
ATOM   3486 O  OD2 . ASP A 1 482 ? 38.61726 59.96245 15.89624  1.000 54.60084  ? 482 ASP A OD2 1 
ATOM   3487 N  N   . GLU A 1 483 ? 34.00335 57.34882 13.91988  1.000 25.32672  ? 483 GLU A N   1 
ATOM   3488 C  CA  . GLU A 1 483 ? 33.53266 55.97852 13.89264  1.000 30.97246  ? 483 GLU A CA  1 
ATOM   3489 C  C   . GLU A 1 483 ? 33.01995 55.55327 12.51920  1.000 36.48833  ? 483 GLU A C   1 
ATOM   3490 O  O   . GLU A 1 483 ? 32.89705 54.34891 12.26851  1.000 44.13622  ? 483 GLU A O   1 
ATOM   3491 C  CB  . GLU A 1 483 ? 32.45222 55.79745 14.95819  1.000 24.09173  ? 483 GLU A CB  1 
ATOM   3492 C  CG  . GLU A 1 483 ? 31.04012 56.15641 14.50038  1.000 26.79053  ? 483 GLU A CG  1 
ATOM   3493 C  CD  . GLU A 1 483 ? 30.75593 57.64787 14.50309  1.000 30.63539  ? 483 GLU A CD  1 
ATOM   3494 O  OE1 . GLU A 1 483 ? 31.68151 58.44388 14.21867  1.000 29.77956  ? 483 GLU A OE1 1 
ATOM   3495 O  OE2 . GLU A 1 483 ? 29.58829 58.02562 14.76656  1.000 32.03250  ? 483 GLU A OE2 1 
ATOM   3496 N  N   . ILE A 1 484 ? 32.75594 56.50647 11.62045  1.000 29.30444  ? 484 ILE A N   1 
ATOM   3497 C  CA  . ILE A 1 484 ? 32.25664 56.18175 10.28556  1.000 32.01675  ? 484 ILE A CA  1 
ATOM   3498 C  C   . ILE A 1 484 ? 33.15382 55.15527 9.58346   1.000 30.26242  ? 484 ILE A C   1 
ATOM   3499 O  O   . ILE A 1 484 ? 32.67016 54.11639 9.12339   1.000 31.77138  ? 484 ILE A O   1 
ATOM   3500 C  CB  . ILE A 1 484 ? 32.09726 57.47030 9.45672   1.000 36.51875  ? 484 ILE A CB  1 
ATOM   3501 C  CG1 . ILE A 1 484 ? 31.03461 58.37992 10.08351  1.000 34.42508  ? 484 ILE A CG1 1 
ATOM   3502 C  CG2 . ILE A 1 484 ? 31.77398 57.15875 7.98567   1.000 27.25911  ? 484 ILE A CG2 1 
ATOM   3503 C  CD1 . ILE A 1 484 ? 30.93931 59.75353 9.42639   1.000 35.88617  ? 484 ILE A CD1 1 
ATOM   3504 N  N   . GLU A 1 485 ? 34.46509 55.43712 9.46150   1.000 37.01649  ? 485 GLU A N   1 
ATOM   3505 C  CA  . GLU A 1 485 ? 35.39762 54.47032 8.84555   1.000 45.96868  ? 485 GLU A CA  1 
ATOM   3506 C  C   . GLU A 1 485 ? 35.15814 53.04942 9.34117   1.000 48.67932  ? 485 GLU A C   1 
ATOM   3507 O  O   . GLU A 1 485 ? 35.13049 52.09670 8.55291   1.000 56.99745  ? 485 GLU A O   1 
ATOM   3508 C  CB  . GLU A 1 485 ? 36.85851 54.79234 9.17356   1.000 52.60095  ? 485 GLU A CB  1 
ATOM   3509 C  CG  . GLU A 1 485 ? 37.22743 56.21973 9.26114   1.000 68.69518  ? 485 GLU A CG  1 
ATOM   3510 C  CD  . GLU A 1 485 ? 38.60884 56.40987 9.83435   1.000 82.38819  ? 485 GLU A CD  1 
ATOM   3511 O  OE1 . GLU A 1 485 ? 39.27773 55.39650 10.14509  1.000 93.18978  ? 485 GLU A OE1 1 
ATOM   3512 O  OE2 . GLU A 1 485 ? 39.00300 57.58361 10.00252  1.000 93.18637  ? 485 GLU A OE2 1 
ATOM   3513 N  N   . TYR A 1 486 ? 35.02975 52.88636 10.65864  1.000 41.51578  ? 486 TYR A N   1 
ATOM   3514 C  CA  . TYR A 1 486 ? 34.95932 51.55529 11.23710  1.000 37.72972  ? 486 TYR A CA  1 
ATOM   3515 C  C   . TYR A 1 486 ? 33.65283 50.85398 10.87366  1.000 34.56319  ? 486 TYR A C   1 
ATOM   3516 O  O   . TYR A 1 486 ? 33.65968 49.68275 10.47260  1.000 33.13449  ? 486 TYR A O   1 
ATOM   3517 C  CB  . TYR A 1 486 ? 35.13789 51.64601 12.75253  1.000 37.39921  ? 486 TYR A CB  1 
ATOM   3518 C  CG  . TYR A 1 486 ? 36.56679 51.94565 13.19097  1.000 39.29240  ? 486 TYR A CG  1 
ATOM   3519 C  CD1 . TYR A 1 486 ? 37.04673 53.25619 13.24194  1.000 35.34348  ? 486 TYR A CD1 1 
ATOM   3520 C  CD2 . TYR A 1 486 ? 37.44078 50.91393 13.53565  1.000 40.56512  ? 486 TYR A CD2 1 
ATOM   3521 C  CE1 . TYR A 1 486 ? 38.34544 53.53056 13.64810  1.000 35.01619  ? 486 TYR A CE1 1 
ATOM   3522 C  CE2 . TYR A 1 486 ? 38.74509 51.17912 13.93906  1.000 40.30209  ? 486 TYR A CE2 1 
ATOM   3523 C  CZ  . TYR A 1 486 ? 39.19147 52.48960 13.99063  1.000 39.35308  ? 486 TYR A CZ  1 
ATOM   3524 O  OH  . TYR A 1 486 ? 40.48995 52.76429 14.37192  1.000 39.99918  ? 486 TYR A OH  1 
ATOM   3525 N  N   . PHE A 1 487 ? 32.51368 51.54788 11.01143  1.000 28.43445  ? 487 PHE A N   1 
ATOM   3526 C  CA  . PHE A 1 487 ? 31.25338 50.93335 10.60398  1.000 27.41334  ? 487 PHE A CA  1 
ATOM   3527 C  C   . PHE A 1 487 ? 31.24527 50.59833 9.11485   1.000 32.93256  ? 487 PHE A C   1 
ATOM   3528 O  O   . PHE A 1 487 ? 30.62910 49.61009 8.70587   1.000 32.82436  ? 487 PHE A O   1 
ATOM   3529 C  CB  . PHE A 1 487 ? 30.08240 51.83965 10.95847  1.000 26.93481  ? 487 PHE A CB  1 
ATOM   3530 C  CG  . PHE A 1 487 ? 29.72214 51.80460 12.41926  1.000 33.03606  ? 487 PHE A CG  1 
ATOM   3531 C  CD1 . PHE A 1 487 ? 29.67143 50.60271 13.10059  1.000 37.33548  ? 487 PHE A CD1 1 
ATOM   3532 C  CD2 . PHE A 1 487 ? 29.46717 52.96487 13.11119  1.000 27.24019  ? 487 PHE A CD2 1 
ATOM   3533 C  CE1 . PHE A 1 487 ? 29.35863 50.57046 14.42907  1.000 36.72926  ? 487 PHE A CE1 1 
ATOM   3534 C  CE2 . PHE A 1 487 ? 29.15482 52.93145 14.43196  1.000 26.32660  ? 487 PHE A CE2 1 
ATOM   3535 C  CZ  . PHE A 1 487 ? 29.09198 51.73781 15.09669  1.000 32.32193  ? 487 PHE A CZ  1 
ATOM   3536 N  N   . PHE A 1 488 ? 31.93005 51.38915 8.29323   1.000 35.43051  ? 488 PHE A N   1 
ATOM   3537 C  CA  . PHE A 1 488 ? 32.03382 51.04786 6.88867   1.000 45.77646  ? 488 PHE A CA  1 
ATOM   3538 C  C   . PHE A 1 488 ? 33.03489 49.93227 6.62965   1.000 49.85316  ? 488 PHE A C   1 
ATOM   3539 O  O   . PHE A 1 488 ? 33.09747 49.42942 5.50010   1.000 53.87301  ? 488 PHE A O   1 
ATOM   3540 C  CB  . PHE A 1 488 ? 32.39231 52.29468 6.06489   1.000 47.65974  ? 488 PHE A CB  1 
ATOM   3541 C  CG  . PHE A 1 488 ? 31.18853 53.07641 5.59656   1.000 46.02694  ? 488 PHE A CG  1 
ATOM   3542 C  CD1 . PHE A 1 488 ? 30.44998 52.64815 4.50417   1.000 39.77620  ? 488 PHE A CD1 1 
ATOM   3543 C  CD2 . PHE A 1 488 ? 30.78745 54.23410 6.25551   1.000 49.99413  ? 488 PHE A CD2 1 
ATOM   3544 C  CE1 . PHE A 1 488 ? 29.32869 53.36855 4.07844   1.000 42.79689  ? 488 PHE A CE1 1 
ATOM   3545 C  CE2 . PHE A 1 488 ? 29.66177 54.96199 5.82813   1.000 42.76624  ? 488 PHE A CE2 1 
ATOM   3546 C  CZ  . PHE A 1 488 ? 28.93129 54.52697 4.74955   1.000 33.61516  ? 488 PHE A CZ  1 
ATOM   3547 N  N   . GLY A 1 489 ? 33.80314 49.52752 7.64054   1.000 51.83397  ? 489 GLY A N   1 
ATOM   3548 C  CA  . GLY A 1 489 ? 34.75018 48.43902 7.48307   1.000 49.61689  ? 489 GLY A CA  1 
ATOM   3549 C  C   . GLY A 1 489 ? 36.04314 48.80740 6.79443   1.000 45.96137  ? 489 GLY A C   1 
ATOM   3550 O  O   . GLY A 1 489 ? 36.73745 47.91944 6.27166   1.000 49.66641  ? 489 GLY A O   1 
ATOM   3551 N  N   . GLN A 1 490 ? 36.40184 50.08928 6.78039   1.000 38.30286  ? 490 GLN A N   1 
ATOM   3552 C  CA  . GLN A 1 490 ? 37.64042 50.47219 6.11792   1.000 43.61230  ? 490 GLN A CA  1 
ATOM   3553 C  C   . GLN A 1 490 ? 38.88733 49.84634 6.74019   1.000 47.77214  ? 490 GLN A C   1 
ATOM   3554 O  O   . GLN A 1 490 ? 39.83664 49.58379 5.98594   1.000 48.60407  ? 490 GLN A O   1 
ATOM   3555 C  CB  . GLN A 1 490 ? 37.74468 52.00385 6.06492   1.000 48.23775  ? 490 GLN A CB  1 
ATOM   3556 C  CG  . GLN A 1 490 ? 36.44069 52.71860 5.64503   1.000 57.88497  ? 490 GLN A CG  1 
ATOM   3557 C  CD  . GLN A 1 490 ? 35.92998 52.39094 4.22115   1.000 62.57603  ? 490 GLN A CD  1 
ATOM   3558 O  OE1 . GLN A 1 490 ? 36.41675 51.47914 3.54952   1.000 62.70824  ? 490 GLN A OE1 1 
ATOM   3559 N  NE2 . GLN A 1 490 ? 34.93339 53.15337 3.76888   1.000 57.37240  ? 490 GLN A NE2 1 
ATOM   3560 N  N   . PRO A 1 491 ? 38.96675 49.58029 8.04861   1.000 47.73736  ? 491 PRO A N   1 
ATOM   3561 C  CA  . PRO A 1 491 ? 40.14943 48.87877 8.57501   1.000 42.68617  ? 491 PRO A CA  1 
ATOM   3562 C  C   . PRO A 1 491 ? 40.36930 47.49368 7.99490   1.000 47.02627  ? 491 PRO A C   1 
ATOM   3563 O  O   . PRO A 1 491 ? 41.45209 46.92480 8.20308   1.000 48.02274  ? 491 PRO A O   1 
ATOM   3564 C  CB  . PRO A 1 491 ? 39.87529 48.80750 10.07721  1.000 40.27551  ? 491 PRO A CB  1 
ATOM   3565 C  CG  . PRO A 1 491 ? 39.04701 50.00542 10.33468  1.000 43.31793  ? 491 PRO A CG  1 
ATOM   3566 C  CD  . PRO A 1 491 ? 38.16969 50.17477 9.13551   1.000 35.26650  ? 491 PRO A CD  1 
ATOM   3567 N  N   . LEU A 1 492 ? 39.39791 46.92462 7.27790   1.000 47.21060  ? 492 LEU A N   1 
ATOM   3568 C  CA  . LEU A 1 492 ? 39.69508 45.69328 6.56010   1.000 43.40500  ? 492 LEU A CA  1 
ATOM   3569 C  C   . LEU A 1 492 ? 40.60928 45.94806 5.37499   1.000 50.87444  ? 492 LEU A C   1 
ATOM   3570 O  O   . LEU A 1 492 ? 41.29145 45.02236 4.93173   1.000 55.68212  ? 492 LEU A O   1 
ATOM   3571 C  CB  . LEU A 1 492 ? 38.40909 45.01097 6.09939   1.000 42.83456  ? 492 LEU A CB  1 
ATOM   3572 C  CG  . LEU A 1 492 ? 37.45107 44.62159 7.23388   1.000 42.38857  ? 492 LEU A CG  1 
ATOM   3573 C  CD1 . LEU A 1 492 ? 36.31820 43.73219 6.74709   1.000 42.78680  ? 492 LEU A CD1 1 
ATOM   3574 C  CD2 . LEU A 1 492 ? 38.20664 43.93440 8.33794   1.000 45.28562  ? 492 LEU A CD2 1 
ATOM   3575 N  N   . ASN A 1 493 ? 40.65942 47.18263 4.87934   1.000 45.02699  ? 493 ASN A N   1 
ATOM   3576 C  CA  . ASN A 1 493 ? 41.45376 47.54510 3.71133   1.000 47.28367  ? 493 ASN A CA  1 
ATOM   3577 C  C   . ASN A 1 493 ? 42.93051 47.49225 4.07832   1.000 49.43917  ? 493 ASN A C   1 
ATOM   3578 O  O   . ASN A 1 493 ? 43.44534 48.37829 4.76189   1.000 53.67760  ? 493 ASN A O   1 
ATOM   3579 C  CB  . ASN A 1 493 ? 41.05316 48.93134 3.22249   1.000 54.90811  ? 493 ASN A CB  1 
ATOM   3580 C  CG  . ASN A 1 493 ? 41.69286 49.30074 1.89530   1.000 69.46536  ? 493 ASN A CG  1 
ATOM   3581 O  OD1 . ASN A 1 493 ? 42.70568 48.73106 1.48700   1.000 62.42520  ? 493 ASN A OD1 1 
ATOM   3582 N  ND2 . ASN A 1 493 ? 41.09877 50.27556 1.21876   1.000 85.60489  ? 493 ASN A ND2 1 
ATOM   3583 N  N   . ASN A 1 494 ? 43.62378 46.45683 3.60201   1.000 52.20194  ? 494 ASN A N   1 
ATOM   3584 C  CA  . ASN A 1 494 ? 45.02001 46.24112 3.95300   1.000 54.67428  ? 494 ASN A CA  1 
ATOM   3585 C  C   . ASN A 1 494 ? 45.94530 47.29899 3.38035   1.000 63.52601  ? 494 ASN A C   1 
ATOM   3586 O  O   . ASN A 1 494 ? 47.10893 47.36056 3.79207   1.000 60.37303  ? 494 ASN A O   1 
ATOM   3587 C  CB  . ASN A 1 494 ? 45.47962 44.86826 3.47077   1.000 57.57908  ? 494 ASN A CB  1 
ATOM   3588 C  CG  . ASN A 1 494 ? 45.03552 43.74902 4.39041   1.000 63.35351  ? 494 ASN A CG  1 
ATOM   3589 O  OD1 . ASN A 1 494 ? 44.35018 42.81421 3.96380   1.000 64.58465  ? 494 ASN A OD1 1 
ATOM   3590 N  ND2 . ASN A 1 494 ? 45.41172 43.84170 5.66461   1.000 65.22130  ? 494 ASN A ND2 1 
ATOM   3591 N  N   . SER A 1 495 ? 45.47224 48.10376 2.42402   1.000 67.78598  ? 495 SER A N   1 
ATOM   3592 C  CA  . SER A 1 495 ? 46.28457 49.19151 1.89073   1.000 67.35920  ? 495 SER A CA  1 
ATOM   3593 C  C   . SER A 1 495 ? 46.26360 50.39726 2.81215   1.000 64.15477  ? 495 SER A C   1 
ATOM   3594 O  O   . SER A 1 495 ? 47.22071 51.18226 2.81991   1.000 63.88923  ? 495 SER A O   1 
ATOM   3595 C  CB  . SER A 1 495 ? 45.81316 49.58923 0.48890   1.000 65.96145  ? 495 SER A CB  1 
ATOM   3596 O  OG  . SER A 1 495 ? 45.43605 48.45801 -0.28221  1.000 69.69389  ? 495 SER A OG  1 
ATOM   3597 N  N   . LEU A 1 496 ? 45.19819 50.54877 3.59573   1.000 52.19484  ? 496 LEU A N   1 
ATOM   3598 C  CA  . LEU A 1 496 ? 45.15914 51.56434 4.63431   1.000 59.30287  ? 496 LEU A CA  1 
ATOM   3599 C  C   . LEU A 1 496 ? 45.95235 51.09895 5.84772   1.000 63.57115  ? 496 LEU A C   1 
ATOM   3600 O  O   . LEU A 1 496 ? 45.97037 49.90955 6.17962   1.000 60.46497  ? 496 LEU A O   1 
ATOM   3601 C  CB  . LEU A 1 496 ? 43.71851 51.86053 5.03694   1.000 54.08559  ? 496 LEU A CB  1 
ATOM   3602 C  CG  . LEU A 1 496 ? 42.83680 52.44544 3.94709   1.000 51.87530  ? 496 LEU A CG  1 
ATOM   3603 C  CD1 . LEU A 1 496 ? 41.45064 52.78452 4.48472   1.000 43.09856  ? 496 LEU A CD1 1 
ATOM   3604 C  CD2 . LEU A 1 496 ? 43.53055 53.66354 3.39884   1.000 48.27731  ? 496 LEU A CD2 1 
ATOM   3605 N  N   . GLN A 1 497 ? 46.60779 52.04604 6.51035   1.000 66.83825  ? 497 GLN A N   1 
ATOM   3606 C  CA  . GLN A 1 497 ? 47.41470 51.74817 7.68893   1.000 69.91101  ? 497 GLN A CA  1 
ATOM   3607 C  C   . GLN A 1 497 ? 46.53695 51.67108 8.93307   1.000 67.35102  ? 497 GLN A C   1 
ATOM   3608 O  O   . GLN A 1 497 ? 45.95662 52.67757 9.35197   1.000 66.85696  ? 497 GLN A O   1 
ATOM   3609 C  CB  . GLN A 1 497 ? 48.48001 52.81947 7.86832   1.000 74.32305  ? 497 GLN A CB  1 
ATOM   3610 C  CG  . GLN A 1 497 ? 49.52789 52.49897 8.89777   1.000 80.54763  ? 497 GLN A CG  1 
ATOM   3611 C  CD  . GLN A 1 497 ? 50.50253 53.64601 9.05357   1.000 91.53622  ? 497 GLN A CD  1 
ATOM   3612 O  OE1 . GLN A 1 497 ? 51.19092 53.76376 10.06797  1.000 95.09114  ? 497 GLN A OE1 1 
ATOM   3613 N  NE2 . GLN A 1 497 ? 50.56683 54.50650 8.03385   1.000 97.01274  ? 497 GLN A NE2 1 
ATOM   3614 N  N   . TYR A 1 498 ? 46.45959 50.48607 9.53467   1.000 66.53607  ? 498 TYR A N   1 
ATOM   3615 C  CA  . TYR A 1 498 ? 45.72463 50.29272 10.77619  1.000 61.32336  ? 498 TYR A CA  1 
ATOM   3616 C  C   . TYR A 1 498 ? 46.43687 49.23761 11.62339  1.000 60.54338  ? 498 TYR A C   1 
ATOM   3617 O  O   . TYR A 1 498 ? 47.06085 48.31254 11.08998  1.000 61.92851  ? 498 TYR A O   1 
ATOM   3618 C  CB  . TYR A 1 498 ? 44.27931 49.85878 10.51050  1.000 61.99046  ? 498 TYR A CB  1 
ATOM   3619 C  CG  . TYR A 1 498 ? 43.32448 50.93595 10.02415  1.000 63.08267  ? 498 TYR A CG  1 
ATOM   3620 C  CD1 . TYR A 1 498 ? 42.82682 51.89771 10.88585  1.000 54.59979  ? 498 TYR A CD1 1 
ATOM   3621 C  CD2 . TYR A 1 498 ? 42.86859 50.94678 8.71275   1.000 66.64784  ? 498 TYR A CD2 1 
ATOM   3622 C  CE1 . TYR A 1 498 ? 41.92664 52.86158 10.44210  1.000 54.33045  ? 498 TYR A CE1 1 
ATOM   3623 C  CE2 . TYR A 1 498 ? 41.96870 51.90525 8.26916   1.000 59.34808  ? 498 TYR A CE2 1 
ATOM   3624 C  CZ  . TYR A 1 498 ? 41.50806 52.85503 9.13549   1.000 54.80069  ? 498 TYR A CZ  1 
ATOM   3625 O  OH  . TYR A 1 498 ? 40.62353 53.80250 8.69447   1.000 59.84237  ? 498 TYR A OH  1 
ATOM   3626 N  N   . ARG A 1 499 ? 46.33870 49.38452 12.95148  1.000 52.56235  ? 499 ARG A N   1 
ATOM   3627 C  CA  . ARG A 1 499 ? 46.85688 48.37093 13.86155  1.000 52.16321  ? 499 ARG A CA  1 
ATOM   3628 C  C   . ARG A 1 499 ? 45.99257 47.11262 13.77210  1.000 52.71963  ? 499 ARG A C   1 
ATOM   3629 O  O   . ARG A 1 499 ? 44.79110 47.19459 13.49018  1.000 55.27117  ? 499 ARG A O   1 
ATOM   3630 C  CB  . ARG A 1 499 ? 46.86964 48.87630 15.31052  1.000 61.69277  ? 499 ARG A CB  1 
ATOM   3631 C  CG  . ARG A 1 499 ? 47.80330 50.05220 15.64353  1.000 66.99463  ? 499 ARG A CG  1 
ATOM   3632 C  CD  . ARG A 1 499 ? 48.77084 49.73129 16.79931  1.000 78.34741  ? 499 ARG A CD  1 
ATOM   3633 N  NE  . ARG A 1 499 ? 48.14812 49.01939 17.92452  1.000 82.17378  ? 499 ARG A NE  1 
ATOM   3634 C  CZ  . ARG A 1 499 ? 48.74467 48.04721 18.62576  1.000 77.54226  ? 499 ARG A CZ  1 
ATOM   3635 N  NH1 . ARG A 1 499 ? 48.09818 47.45277 19.62608  1.000 66.11304  ? 499 ARG A NH1 1 
ATOM   3636 N  NH2 . ARG A 1 499 ? 49.97977 47.64762 18.31430  1.000 74.58321  ? 499 ARG A NH2 1 
ATOM   3637 N  N   . PRO A 1 500 ? 46.57687 45.93293 14.00656  1.000 54.13266  ? 500 PRO A N   1 
ATOM   3638 C  CA  . PRO A 1 500 ? 45.75835 44.70881 13.96110  1.000 57.19766  ? 500 PRO A CA  1 
ATOM   3639 C  C   . PRO A 1 500 ? 44.54944 44.77269 14.87215  1.000 63.30596  ? 500 PRO A C   1 
ATOM   3640 O  O   . PRO A 1 500 ? 43.48043 44.28463 14.48473  1.000 69.71789  ? 500 PRO A O   1 
ATOM   3641 C  CB  . PRO A 1 500 ? 46.73971 43.61001 14.39021  1.000 54.82120  ? 500 PRO A CB  1 
ATOM   3642 C  CG  . PRO A 1 500 ? 48.07656 44.13781 14.03934  1.000 56.99896  ? 500 PRO A CG  1 
ATOM   3643 C  CD  . PRO A 1 500 ? 48.00622 45.63513 14.20206  1.000 56.93074  ? 500 PRO A CD  1 
ATOM   3644 N  N   . VAL A 1 501 ? 44.68246 45.37811 16.06432  1.000 61.39168  ? 501 VAL A N   1 
ATOM   3645 C  CA  . VAL A 1 501 ? 43.51577 45.60856 16.92218  1.000 55.03066  ? 501 VAL A CA  1 
ATOM   3646 C  C   . VAL A 1 501 ? 42.48312 46.44384 16.18360  1.000 45.88612  ? 501 VAL A C   1 
ATOM   3647 O  O   . VAL A 1 501 ? 41.27391 46.19769 16.28678  1.000 44.45740  ? 501 VAL A O   1 
ATOM   3648 C  CB  . VAL A 1 501 ? 43.90699 46.28219 18.25832  1.000 52.62658  ? 501 VAL A CB  1 
ATOM   3649 C  CG1 . VAL A 1 501 ? 44.46296 45.27722 19.20882  1.000 60.64355  ? 501 VAL A CG1 1 
ATOM   3650 C  CG2 . VAL A 1 501 ? 44.87826 47.46503 18.06941  1.000 58.24948  ? 501 VAL A CG2 1 
ATOM   3651 N  N   . GLU A 1 502 ? 42.93506 47.44668 15.42063  1.000 41.92611  ? 502 GLU A N   1 
ATOM   3652 C  CA  . GLU A 1 502 ? 41.98330 48.30502 14.72976  1.000 43.48848  ? 502 GLU A CA  1 
ATOM   3653 C  C   . GLU A 1 502 ? 41.25589 47.54538 13.63822  1.000 43.22390  ? 502 GLU A C   1 
ATOM   3654 O  O   . GLU A 1 502 ? 40.03983 47.70388 13.48131  1.000 41.67824  ? 502 GLU A O   1 
ATOM   3655 C  CB  . GLU A 1 502 ? 42.69031 49.53910 14.18786  1.000 45.47836  ? 502 GLU A CB  1 
ATOM   3656 C  CG  . GLU A 1 502 ? 42.73181 50.61428 15.24669  1.000 47.27891  ? 502 GLU A CG  1 
ATOM   3657 C  CD  . GLU A 1 502 ? 43.87941 51.56860 15.10917  1.000 50.07527  ? 502 GLU A CD  1 
ATOM   3658 O  OE1 . GLU A 1 502 ? 44.85199 51.23470 14.39660  1.000 54.61920  ? 502 GLU A OE1 1 
ATOM   3659 O  OE2 . GLU A 1 502 ? 43.80924 52.64879 15.73897  1.000 45.54638  ? 502 GLU A OE2 1 
ATOM   3660 N  N   . ARG A 1 503 ? 41.97756 46.69971 12.89089  1.000 42.41886  ? 503 ARG A N   1 
ATOM   3661 C  CA  . ARG A 1 503 ? 41.32103 45.85995 11.89496  1.000 44.33557  ? 503 ARG A CA  1 
ATOM   3662 C  C   . ARG A 1 503 ? 40.26940 44.96937 12.53663  1.000 54.84868  ? 503 ARG A C   1 
ATOM   3663 O  O   . ARG A 1 503 ? 39.16197 44.81186 12.00474  1.000 54.05958  ? 503 ARG A O   1 
ATOM   3664 C  CB  . ARG A 1 503 ? 42.35112 45.01655 11.17262  1.000 46.64091  ? 503 ARG A CB  1 
ATOM   3665 C  CG  . ARG A 1 503 ? 43.50765 45.82150 10.65682  1.000 52.10065  ? 503 ARG A CG  1 
ATOM   3666 C  CD  . ARG A 1 503 ? 43.98787 45.28631 9.32143   1.000 52.18832  ? 503 ARG A CD  1 
ATOM   3667 N  NE  . ARG A 1 503 ? 45.23972 45.90533 8.90710   1.000 52.53826  ? 503 ARG A NE  1 
ATOM   3668 C  CZ  . ARG A 1 503 ? 45.31438 46.96610 8.11544   1.000 57.75681  ? 503 ARG A CZ  1 
ATOM   3669 N  NH1 . ARG A 1 503 ? 44.20209 47.54487 7.67477   1.000 55.79281  ? 503 ARG A NH1 1 
ATOM   3670 N  NH2 . ARG A 1 503 ? 46.50035 47.45426 7.77933   1.000 59.48759  ? 503 ARG A NH2 1 
ATOM   3671 N  N   . GLU A 1 504 ? 40.59666 44.38189 13.68720  1.000 57.39293  ? 504 GLU A N   1 
ATOM   3672 C  CA  . GLU A 1 504 ? 39.61925 43.57781 14.40553  1.000 48.29997  ? 504 GLU A CA  1 
ATOM   3673 C  C   . GLU A 1 504 ? 38.39057 44.40702 14.76194  1.000 39.63933  ? 504 GLU A C   1 
ATOM   3674 O  O   . GLU A 1 504 ? 37.25468 43.98971 14.51955  1.000 42.62425  ? 504 GLU A O   1 
ATOM   3675 C  CB  . GLU A 1 504 ? 40.26383 42.97377 15.65220  1.000 55.91534  ? 504 GLU A CB  1 
ATOM   3676 C  CG  . GLU A 1 504 ? 39.30702 42.20189 16.54599  1.000 71.02132  ? 504 GLU A CG  1 
ATOM   3677 C  CD  . GLU A 1 504 ? 38.95337 40.84763 15.96830  1.000 88.17597  ? 504 GLU A CD  1 
ATOM   3678 O  OE1 . GLU A 1 504 ? 37.74529 40.53799 15.87333  1.000 90.01478  ? 504 GLU A OE1 1 
ATOM   3679 O  OE2 . GLU A 1 504 ? 39.88511 40.10224 15.58825  1.000 97.71134  ? 504 GLU A OE2 1 
ATOM   3680 N  N   . LEU A 1 505 ? 38.59052 45.59524 15.32749  1.000 40.46752  ? 505 LEU A N   1 
ATOM   3681 C  CA  . LEU A 1 505 ? 37.43132 46.38199 15.73360  1.000 44.15271  ? 505 LEU A CA  1 
ATOM   3682 C  C   . LEU A 1 505 ? 36.61062 46.80141 14.51917  1.000 48.54596  ? 505 LEU A C   1 
ATOM   3683 O  O   . LEU A 1 505 ? 35.37267 46.79978 14.56826  1.000 39.05484  ? 505 LEU A O   1 
ATOM   3684 C  CB  . LEU A 1 505 ? 37.87055 47.59573 16.55656  1.000 33.96035  ? 505 LEU A CB  1 
ATOM   3685 C  CG  . LEU A 1 505 ? 36.75775 48.54039 17.03221  1.000 33.39257  ? 505 LEU A CG  1 
ATOM   3686 C  CD1 . LEU A 1 505 ? 35.81831 47.85114 18.02543  1.000 31.20612  ? 505 LEU A CD1 1 
ATOM   3687 C  CD2 . LEU A 1 505 ? 37.37341 49.76558 17.67927  1.000 34.57528  ? 505 LEU A CD2 1 
ATOM   3688 N  N   . GLY A 1 506 ? 37.28534 47.13961 13.40987  1.000 49.47950  ? 506 GLY A N   1 
ATOM   3689 C  CA  . GLY A 1 506 ? 36.57446 47.39812 12.16353  1.000 38.00843  ? 506 GLY A CA  1 
ATOM   3690 C  C   . GLY A 1 506 ? 35.73339 46.20913 11.72265  1.000 37.92407  ? 506 GLY A C   1 
ATOM   3691 O  O   . GLY A 1 506 ? 34.55263 46.35204 11.40398  1.000 36.84304  ? 506 GLY A O   1 
ATOM   3692 N  N   . LYS A 1 507 ? 36.32867 45.01340 11.72445  1.000 40.37691  ? 507 LYS A N   1 
ATOM   3693 C  CA  . LYS A 1 507 ? 35.54375 43.82613 11.40756  1.000 48.04611  ? 507 LYS A CA  1 
ATOM   3694 C  C   . LYS A 1 507 ? 34.34391 43.69874 12.33841  1.000 49.10344  ? 507 LYS A C   1 
ATOM   3695 O  O   . LYS A 1 507 ? 33.24490 43.34617 11.89505  1.000 53.13367  ? 507 LYS A O   1 
ATOM   3696 C  CB  . LYS A 1 507 ? 36.40796 42.56521 11.47530  1.000 55.68632  ? 507 LYS A CB  1 
ATOM   3697 C  CG  . LYS A 1 507 ? 35.75925 41.39292 10.73497  1.000 65.68625  ? 507 LYS A CG  1 
ATOM   3698 C  CD  . LYS A 1 507 ? 36.05319 40.00459 11.31295  1.000 76.07232  ? 507 LYS A CD  1 
ATOM   3699 C  CE  . LYS A 1 507 ? 34.77503 39.14067 11.28036  1.000 87.53915  ? 507 LYS A CE  1 
ATOM   3700 N  NZ  . LYS A 1 507 ? 33.94906 39.32692 10.01583  1.000 93.92464  ? 507 LYS A NZ  1 
ATOM   3701 N  N   . ARG A 1 508 ? 34.52040 44.02797 13.62399  1.000 46.34929  ? 508 ARG A N   1 
ATOM   3702 C  CA  . ARG A 1 508 ? 33.43990 43.84270 14.59315  1.000 43.32040  ? 508 ARG A CA  1 
ATOM   3703 C  C   . ARG A 1 508 ? 32.35496 44.90113 14.42631  1.000 39.56106  ? 508 ARG A C   1 
ATOM   3704 O  O   . ARG A 1 508 ? 31.15880 44.59781 14.55574  1.000 36.29901  ? 508 ARG A O   1 
ATOM   3705 C  CB  . ARG A 1 508 ? 33.99746 43.85857 16.01701  1.000 46.56666  ? 508 ARG A CB  1 
ATOM   3706 C  CG  . ARG A 1 508 ? 33.39212 42.78067 16.92342  1.000 69.04274  ? 508 ARG A CG  1 
ATOM   3707 C  CD  . ARG A 1 508 ? 33.62077 43.05769 18.41552  1.000 72.67291  ? 508 ARG A CD  1 
ATOM   3708 N  NE  . ARG A 1 508 ? 34.93211 43.64880 18.66114  1.000 67.52062  ? 508 ARG A NE  1 
ATOM   3709 C  CZ  . ARG A 1 508 ? 35.18145 44.49981 19.64572  1.000 56.48960  ? 508 ARG A CZ  1 
ATOM   3710 N  NH1 . ARG A 1 508 ? 34.20239 44.86245 20.46453  1.000 45.58099  ? 508 ARG A NH1 1 
ATOM   3711 N  NH2 . ARG A 1 508 ? 36.39980 45.00115 19.79624  1.000 58.46002  ? 508 ARG A NH2 1 
ATOM   3712 N  N   . MET A 1 509 ? 32.74502 46.14444 14.11483  1.000 31.78759  ? 509 MET A N   1 
ATOM   3713 C  CA  . MET A 1 509 ? 31.74370 47.19329 13.99906  1.000 33.78281  ? 509 MET A CA  1 
ATOM   3714 C  C   . MET A 1 509 ? 30.95478 47.05641 12.70133  1.000 45.08404  ? 509 MET A C   1 
ATOM   3715 O  O   . MET A 1 509 ? 29.74478 47.33133 12.68019  1.000 45.76571  ? 509 MET A O   1 
ATOM   3716 C  CB  . MET A 1 509 ? 32.40824 48.56965 14.12261  1.000 35.01525  ? 509 MET A CB  1 
ATOM   3717 C  CG  . MET A 1 509 ? 32.76189 48.96847 15.56815  1.000 32.85214  ? 509 MET A CG  1 
ATOM   3718 S  SD  . MET A 1 509 ? 33.75822 50.48061 15.77036  1.000 40.23377  ? 509 MET A SD  1 
ATOM   3719 C  CE  . MET A 1 509 ? 32.52930 51.73784 15.38976  1.000 34.00366  ? 509 MET A CE  1 
ATOM   3720 N  N   . LEU A 1 510 ? 31.61405 46.61648 11.62007  1.000 45.09067  ? 510 LEU A N   1 
ATOM   3721 C  CA  . LEU A 1 510 ? 30.90156 46.34158 10.37814  1.000 36.19501  ? 510 LEU A CA  1 
ATOM   3722 C  C   . LEU A 1 510 ? 29.88692 45.22769 10.57305  1.000 39.27866  ? 510 LEU A C   1 
ATOM   3723 O  O   . LEU A 1 510 ? 28.75689 45.32255 10.08489  1.000 48.09939  ? 510 LEU A O   1 
ATOM   3724 C  CB  . LEU A 1 510 ? 31.88478 45.97497 9.26518   1.000 40.94454  ? 510 LEU A CB  1 
ATOM   3725 C  CG  . LEU A 1 510 ? 31.30594 45.46120 7.93321   1.000 39.06851  ? 510 LEU A CG  1 
ATOM   3726 C  CD1 . LEU A 1 510 ? 30.53811 46.53119 7.15357   1.000 33.93341  ? 510 LEU A CD1 1 
ATOM   3727 C  CD2 . LEU A 1 510 ? 32.40762 44.88059 7.07702   1.000 39.14044  ? 510 LEU A CD2 1 
ATOM   3728 N  N   . SER A 1 511 ? 30.26688 44.16305 11.28805  1.000 34.41100  ? 511 SER A N   1 
ATOM   3729 C  CA  . SER A 1 511 ? 29.32492 43.07130 11.52109  1.000 44.85760  ? 511 SER A CA  1 
ATOM   3730 C  C   . SER A 1 511 ? 28.13784 43.50723 12.36904  1.000 41.40994  ? 511 SER A C   1 
ATOM   3731 O  O   . SER A 1 511 ? 27.04653 42.94884 12.22689  1.000 49.19322  ? 511 SER A O   1 
ATOM   3732 C  CB  . SER A 1 511 ? 30.03354 41.89171 12.17386  1.000 46.53836  ? 511 SER A CB  1 
ATOM   3733 O  OG  . SER A 1 511 ? 31.33623 41.75201 11.63847  1.000 62.65479  ? 511 SER A OG  1 
ATOM   3734 N  N   . ALA A 1 512 ? 28.32457 44.48833 13.25262  1.000 34.31735  ? 512 ALA A N   1 
ATOM   3735 C  CA  . ALA A 1 512 ? 27.18284 45.05511 13.95998  1.000 38.16036  ? 512 ALA A CA  1 
ATOM   3736 C  C   . ALA A 1 512 ? 26.17524 45.63869 12.97934  1.000 40.70581  ? 512 ALA A C   1 
ATOM   3737 O  O   . ALA A 1 512 ? 24.96661 45.40597 13.10293  1.000 43.27356  ? 512 ALA A O   1 
ATOM   3738 C  CB  . ALA A 1 512 ? 27.65690 46.12437 14.94827  1.000 29.15347  ? 512 ALA A CB  1 
ATOM   3739 N  N   . VAL A 1 513 ? 26.66072 46.39903 11.99608  1.000 35.37076  ? 513 VAL A N   1 
ATOM   3740 C  CA  . VAL A 1 513 ? 25.77912 46.98896 10.99781  1.000 37.63126  ? 513 VAL A CA  1 
ATOM   3741 C  C   . VAL A 1 513 ? 25.06418 45.90622 10.19612  1.000 40.31435  ? 513 VAL A C   1 
ATOM   3742 O  O   . VAL A 1 513 ? 23.83226 45.91332 10.08004  1.000 44.84780  ? 513 VAL A O   1 
ATOM   3743 C  CB  . VAL A 1 513 ? 26.57680 47.94230 10.09232  1.000 35.27191  ? 513 VAL A CB  1 
ATOM   3744 C  CG1 . VAL A 1 513 ? 25.74061 48.38051 8.94559   1.000 28.41911  ? 513 VAL A CG1 1 
ATOM   3745 C  CG2 . VAL A 1 513 ? 27.00538 49.18084 10.88630  1.000 26.69056  ? 513 VAL A CG2 1 
ATOM   3746 N  N   . ILE A 1 514 ? 25.82294 44.95575 9.64247   1.000 35.70711  ? 514 ILE A N   1 
ATOM   3747 C  CA  . ILE A 1 514 ? 25.23808 43.92903 8.78092   1.000 34.60361  ? 514 ILE A CA  1 
ATOM   3748 C  C   . ILE A 1 514 ? 24.19349 43.12494 9.54459   1.000 45.75852  ? 514 ILE A C   1 
ATOM   3749 O  O   . ILE A 1 514 ? 23.07545 42.91711 9.06287   1.000 54.93769  ? 514 ILE A O   1 
ATOM   3750 C  CB  . ILE A 1 514 ? 26.33979 43.01715 8.20499   1.000 36.67398  ? 514 ILE A CB  1 
ATOM   3751 C  CG1 . ILE A 1 514 ? 27.44385 43.84343 7.53941   1.000 36.10554  ? 514 ILE A CG1 1 
ATOM   3752 C  CG2 . ILE A 1 514 ? 25.75507 41.98092 7.24117   1.000 39.06388  ? 514 ILE A CG2 1 
ATOM   3753 C  CD1 . ILE A 1 514 ? 26.96966 44.64645 6.36059   1.000 35.62796  ? 514 ILE A CD1 1 
ATOM   3754 N  N   . GLU A 1 515 ? 24.54317 42.65351 10.74735  1.000 42.73505  ? 515 GLU A N   1 
ATOM   3755 C  CA  . GLU A 1 515 ? 23.60059 41.86137 11.53565  1.000 49.33156  ? 515 GLU A CA  1 
ATOM   3756 C  C   . GLU A 1 515 ? 22.35810 42.66516 11.89507  1.000 45.53447  ? 515 GLU A C   1 
ATOM   3757 O  O   . GLU A 1 515 ? 21.24745 42.12261 11.93156  1.000 49.88742  ? 515 GLU A O   1 
ATOM   3758 C  CB  . GLU A 1 515 ? 24.27146 41.34319 12.80608  1.000 56.87177  ? 515 GLU A CB  1 
ATOM   3759 C  CG  . GLU A 1 515 ? 25.08687 40.11036 12.58697  1.000 59.18550  ? 515 GLU A CG  1 
ATOM   3760 C  CD  . GLU A 1 515 ? 24.23629 38.97976 12.08837  1.000 70.62131  ? 515 GLU A CD  1 
ATOM   3761 O  OE1 . GLU A 1 515 ? 23.39839 38.48076 12.87943  1.000 69.81060  ? 515 GLU A OE1 1 
ATOM   3762 O  OE2 . GLU A 1 515 ? 24.39150 38.61533 10.89567  1.000 76.02894  ? 515 GLU A OE2 1 
ATOM   3763 N  N   . PHE A 1 516 ? 22.52581 43.95463 12.18326  1.000 43.09529  ? 516 PHE A N   1 
ATOM   3764 C  CA  . PHE A 1 516 ? 21.36835 44.80478 12.43790  1.000 41.79726  ? 516 PHE A CA  1 
ATOM   3765 C  C   . PHE A 1 516 ? 20.48891 44.89904 11.20102  1.000 45.22934  ? 516 PHE A C   1 
ATOM   3766 O  O   . PHE A 1 516 ? 19.27343 44.66765 11.26080  1.000 45.57412  ? 516 PHE A O   1 
ATOM   3767 C  CB  . PHE A 1 516 ? 21.83327 46.18831 12.86784  1.000 32.16619  ? 516 PHE A CB  1 
ATOM   3768 C  CG  . PHE A 1 516 ? 20.74513 47.20841 12.92247  1.000 31.12915  ? 516 PHE A CG  1 
ATOM   3769 C  CD1 . PHE A 1 516 ? 19.76293 47.13718 13.89216  1.000 35.48788  ? 516 PHE A CD1 1 
ATOM   3770 C  CD2 . PHE A 1 516 ? 20.72281 48.25943 12.02959  1.000 32.28576  ? 516 PHE A CD2 1 
ATOM   3771 C  CE1 . PHE A 1 516 ? 18.78357 48.09104 13.97126  1.000 28.65263  ? 516 PHE A CE1 1 
ATOM   3772 C  CE2 . PHE A 1 516 ? 19.73420 49.21071 12.09274  1.000 35.22394  ? 516 PHE A CE2 1 
ATOM   3773 C  CZ  . PHE A 1 516 ? 18.76402 49.12494 13.06657  1.000 36.09492  ? 516 PHE A CZ  1 
ATOM   3774 N  N   . ALA A 1 517 ? 21.09356 45.23199 10.06178  1.000 38.10918  ? 517 ALA A N   1 
ATOM   3775 C  CA  . ALA A 1 517 ? 20.32147 45.32312 8.83233   1.000 39.43692  ? 517 ALA A CA  1 
ATOM   3776 C  C   . ALA A 1 517 ? 19.66103 43.99601 8.49799   1.000 50.01081  ? 517 ALA A C   1 
ATOM   3777 O  O   . ALA A 1 517 ? 18.58242 43.96695 7.89589   1.000 63.07445  ? 517 ALA A O   1 
ATOM   3778 C  CB  . ALA A 1 517 ? 21.22170 45.77992 7.68836   1.000 32.78620  ? 517 ALA A CB  1 
ATOM   3779 N  N   . LYS A 1 518 ? 20.27399 42.89324 8.90056   1.000 41.41154  ? 518 LYS A N   1 
ATOM   3780 C  CA  . LYS A 1 518 ? 19.78146 41.58900 8.50977   1.000 39.94171  ? 518 LYS A CA  1 
ATOM   3781 C  C   . LYS A 1 518 ? 18.67931 41.10203 9.43131   1.000 49.23885  ? 518 LYS A C   1 
ATOM   3782 O  O   . LYS A 1 518 ? 17.69474 40.51253 8.96899   1.000 58.99684  ? 518 LYS A O   1 
ATOM   3783 C  CB  . LYS A 1 518 ? 20.94355 40.59868 8.48404   1.000 42.48004  ? 518 LYS A CB  1 
ATOM   3784 C  CG  . LYS A 1 518 ? 21.40550 40.24839 7.08311   1.000 45.87588  ? 518 LYS A CG  1 
ATOM   3785 C  CD  . LYS A 1 518 ? 22.87446 39.85537 7.04206   1.000 44.30370  ? 518 LYS A CD  1 
ATOM   3786 C  CE  . LYS A 1 518 ? 23.24287 39.24480 5.70467   1.000 49.95482  ? 518 LYS A CE  1 
ATOM   3787 N  NZ  . LYS A 1 518 ? 24.68873 39.38566 5.41832   1.000 57.45099  ? 518 LYS A NZ  1 
ATOM   3788 N  N   . THR A 1 519 ? 18.81866 41.36863 10.72792  1.000 50.29891  ? 519 THR A N   1 
ATOM   3789 C  CA  . THR A 1 519 ? 17.92593 40.82812 11.74308  1.000 44.79677  ? 519 THR A CA  1 
ATOM   3790 C  C   . THR A 1 519 ? 17.33082 41.87149 12.67225  1.000 44.01667  ? 519 THR A C   1 
ATOM   3791 O  O   . THR A 1 519 ? 16.56959 41.49860 13.56717  1.000 54.67684  ? 519 THR A O   1 
ATOM   3792 C  CB  . THR A 1 519 ? 18.66745 39.81916 12.61459  1.000 46.32826  ? 519 THR A CB  1 
ATOM   3793 O  OG1 . THR A 1 519 ? 19.47432 40.55312 13.54557  1.000 49.64666  ? 519 THR A OG1 1 
ATOM   3794 C  CG2 . THR A 1 519 ? 19.55604 38.91215 11.76286  1.000 43.42644  ? 519 THR A CG2 1 
ATOM   3795 N  N   . GLY A 1 520 ? 17.66383 43.15038 12.51269  1.000 41.82622  ? 520 GLY A N   1 
ATOM   3796 C  CA  . GLY A 1 520 ? 17.22871 44.14883 13.46050  1.000 47.68121  ? 520 GLY A CA  1 
ATOM   3797 C  C   . GLY A 1 520 ? 17.98870 44.13218 14.76695  1.000 55.04208  ? 520 GLY A C   1 
ATOM   3798 O  O   . GLY A 1 520 ? 17.67232 44.92561 15.66744  1.000 55.44885  ? 520 GLY A O   1 
ATOM   3799 N  N   . ASN A 1 521 ? 18.98557 43.26686 14.89654  1.000 54.19762  ? 521 ASN A N   1 
ATOM   3800 C  CA  . ASN A 1 521 ? 19.70158 43.10105 16.14981  1.000 54.99263  ? 521 ASN A CA  1 
ATOM   3801 C  C   . ASN A 1 521 ? 21.19786 43.10044 15.87093  1.000 54.33333  ? 521 ASN A C   1 
ATOM   3802 O  O   . ASN A 1 521 ? 21.69316 42.20704 15.16817  1.000 50.86354  ? 521 ASN A O   1 
ATOM   3803 C  CB  . ASN A 1 521 ? 19.27065 41.80609 16.83463  1.000 61.75726  ? 521 ASN A CB  1 
ATOM   3804 C  CG  . ASN A 1 521 ? 19.69764 41.74315 18.27141  1.000 73.38058  ? 521 ASN A CG  1 
ATOM   3805 O  OD1 . ASN A 1 521 ? 20.87199 41.91634 18.58621  1.000 76.20507  ? 521 ASN A OD1 1 
ATOM   3806 N  ND2 . ASN A 1 521 ? 18.74308 41.50302 19.16350  1.000 82.96510  ? 521 ASN A ND2 1 
ATOM   3807 N  N   . PRO A 1 522 ? 21.94714 44.07297 16.41016  1.000 49.65037  ? 522 PRO A N   1 
ATOM   3808 C  CA  . PRO A 1 522 ? 23.38453 44.15370 16.10465  1.000 42.88554  ? 522 PRO A CA  1 
ATOM   3809 C  C   . PRO A 1 522 ? 24.18227 42.99704 16.66715  1.000 45.99084  ? 522 PRO A C   1 
ATOM   3810 O  O   . PRO A 1 522 ? 25.30388 42.75101 16.20947  1.000 55.80823  ? 522 PRO A O   1 
ATOM   3811 C  CB  . PRO A 1 522 ? 23.80447 45.46956 16.76885  1.000 40.64383  ? 522 PRO A CB  1 
ATOM   3812 C  CG  . PRO A 1 522 ? 22.89472 45.54094 17.96976  1.000 47.02813  ? 522 PRO A CG  1 
ATOM   3813 C  CD  . PRO A 1 522 ? 21.56172 45.01376 17.47959  1.000 47.93059  ? 522 PRO A CD  1 
ATOM   3814 N  N   . ALA A 1 523 ? 23.64074 42.27626 17.63427  1.000 53.18135  ? 523 ALA A N   1 
ATOM   3815 C  CA  . ALA A 1 523 ? 24.44134 41.35736 18.42393  1.000 66.36211  ? 523 ALA A CA  1 
ATOM   3816 C  C   . ALA A 1 523 ? 24.73018 40.08918 17.64128  1.000 78.12680  ? 523 ALA A C   1 
ATOM   3817 O  O   . ALA A 1 523 ? 23.81543 39.46634 17.09167  1.000 59.16345  ? 523 ALA A O   1 
ATOM   3818 C  CB  . ALA A 1 523 ? 23.73287 41.01268 19.73834  1.000 60.16795  ? 523 ALA A CB  1 
ATOM   3819 N  N   . GLN A 1 524 ? 26.01151 39.71171 17.60268  1.000 115.86497 ? 524 GLN A N   1 
ATOM   3820 C  CA  . GLN A 1 524 ? 26.42005 38.36546 17.22726  1.000 129.07955 ? 524 GLN A CA  1 
ATOM   3821 C  C   . GLN A 1 524 ? 25.75196 37.36857 18.16968  1.000 134.37609 ? 524 GLN A C   1 
ATOM   3822 O  O   . GLN A 1 524 ? 25.21931 37.74606 19.22067  1.000 137.56614 ? 524 GLN A O   1 
ATOM   3823 C  CB  . GLN A 1 524 ? 27.94741 38.19461 17.28856  1.000 138.74335 ? 524 GLN A CB  1 
ATOM   3824 C  CG  . GLN A 1 524 ? 28.79896 39.32396 16.68579  1.000 145.47153 ? 524 GLN A CG  1 
ATOM   3825 C  CD  . GLN A 1 524 ? 30.03192 39.66707 17.53564  1.000 153.28470 ? 524 GLN A CD  1 
ATOM   3826 O  OE1 . GLN A 1 524 ? 29.94231 39.87530 18.74997  1.000 157.86250 ? 524 GLN A OE1 1 
ATOM   3827 N  NE2 . GLN A 1 524 ? 31.19546 39.71684 16.88633  1.000 153.01311 ? 524 GLN A NE2 1 
ATOM   3828 N  N   . ASP A 1 525 ? 25.78314 36.09126 17.82307  1.000 135.18050 ? 525 ASP A N   1 
ATOM   3829 C  CA  . ASP A 1 525 ? 25.33772 35.06584 18.74989  1.000 129.45009 ? 525 ASP A CA  1 
ATOM   3830 C  C   . ASP A 1 525 ? 26.52016 34.64808 19.61271  1.000 111.81643 ? 525 ASP A C   1 
ATOM   3831 O  O   . ASP A 1 525 ? 27.65296 34.55170 19.12986  1.000 112.78039 ? 525 ASP A O   1 
ATOM   3832 C  CB  . ASP A 1 525 ? 24.73982 33.87888 17.99707  1.000 137.20601 ? 525 ASP A CB  1 
ATOM   3833 C  CG  . ASP A 1 525 ? 23.44479 34.24461 17.28667  1.000 138.42517 ? 525 ASP A CG  1 
ATOM   3834 O  OD1 . ASP A 1 525 ? 23.32874 33.94582 16.08043  1.000 138.93224 ? 525 ASP A OD1 1 
ATOM   3835 O  OD2 . ASP A 1 525 ? 22.55806 34.85752 17.92270  1.000 136.90793 ? 525 ASP A OD2 1 
ATOM   3836 N  N   . GLY A 1 526 ? 26.25827 34.43970 20.90074  1.000 80.91332  ? 526 GLY A N   1 
ATOM   3837 C  CA  . GLY A 1 526 ? 27.32969 34.31659 21.86185  1.000 70.13845  ? 526 GLY A CA  1 
ATOM   3838 C  C   . GLY A 1 526 ? 27.86534 35.64082 22.34917  1.000 74.31333  ? 526 GLY A C   1 
ATOM   3839 O  O   . GLY A 1 526 ? 28.78675 35.65498 23.17832  1.000 77.43929  ? 526 GLY A O   1 
ATOM   3840 N  N   . GLU A 1 527 ? 27.32655 36.74925 21.84644  1.000 63.82833  ? 527 GLU A N   1 
ATOM   3841 C  CA  . GLU A 1 527 ? 27.64645 38.09290 22.30471  1.000 62.47466  ? 527 GLU A CA  1 
ATOM   3842 C  C   . GLU A 1 527 ? 26.42949 38.66489 23.01335  1.000 60.40138  ? 527 GLU A C   1 
ATOM   3843 O  O   . GLU A 1 527 ? 25.32077 38.64018 22.46891  1.000 67.06330  ? 527 GLU A O   1 
ATOM   3844 C  CB  . GLU A 1 527 ? 28.05123 38.98545 21.12806  1.000 70.05478  ? 527 GLU A CB  1 
ATOM   3845 C  CG  . GLU A 1 527 ? 28.14872 40.48638 21.42567  1.000 81.14748  ? 527 GLU A CG  1 
ATOM   3846 C  CD  . GLU A 1 527 ? 27.88015 41.36141 20.18450  1.000 85.86459  ? 527 GLU A CD  1 
ATOM   3847 O  OE1 . GLU A 1 527 ? 27.45776 40.82126 19.13976  1.000 86.85633  ? 527 GLU A OE1 1 
ATOM   3848 O  OE2 . GLU A 1 527 ? 28.10071 42.59038 20.24667  1.000 84.90467  ? 527 GLU A OE2 1 
ATOM   3849 N  N   . GLU A 1 528 ? 26.62352 39.15663 24.22669  1.000 47.59024  ? 528 GLU A N   1 
ATOM   3850 C  CA  . GLU A 1 528 ? 25.54155 39.81232 24.93626  1.000 44.16173  ? 528 GLU A CA  1 
ATOM   3851 C  C   . GLU A 1 528 ? 25.54112 41.28319 24.55908  1.000 43.88725  ? 528 GLU A C   1 
ATOM   3852 O  O   . GLU A 1 528 ? 26.53921 41.98748 24.76296  1.000 46.44097  ? 528 GLU A O   1 
ATOM   3853 C  CB  . GLU A 1 528 ? 25.67280 39.65150 26.44706  1.000 43.88318  ? 528 GLU A CB  1 
ATOM   3854 C  CG  . GLU A 1 528 ? 24.95864 38.42001 26.99022  1.000 58.91374  ? 528 GLU A CG  1 
ATOM   3855 C  CD  . GLU A 1 528 ? 23.63313 38.12522 26.29175  1.000 60.97222  ? 528 GLU A CD  1 
ATOM   3856 O  OE1 . GLU A 1 528 ? 22.69064 38.94139 26.41410  1.000 60.18792  ? 528 GLU A OE1 1 
ATOM   3857 O  OE2 . GLU A 1 528 ? 23.53402 37.06774 25.62785  1.000 58.33730  ? 528 GLU A OE2 1 
ATOM   3858 N  N   . TRP A 1 529 ? 24.42968 41.74070 24.00065  1.000 37.35390  ? 529 TRP A N   1 
ATOM   3859 C  CA  . TRP A 1 529 ? 24.21313 43.16946 23.78584  1.000 36.72225  ? 529 TRP A CA  1 
ATOM   3860 C  C   . TRP A 1 529 ? 22.73204 43.39947 23.97874  1.000 46.34782  ? 529 TRP A C   1 
ATOM   3861 O  O   . TRP A 1 529 ? 21.94343 43.33790 23.02731  1.000 54.97412  ? 529 TRP A O   1 
ATOM   3862 C  CB  . TRP A 1 529 ? 24.68727 43.61981 22.40510  1.000 33.43266  ? 529 TRP A CB  1 
ATOM   3863 C  CG  . TRP A 1 529 ? 24.60211 45.08995 22.16963  1.000 34.90201  ? 529 TRP A CG  1 
ATOM   3864 C  CD1 . TRP A 1 529 ? 23.93461 46.00821 22.92551  1.000 30.29536  ? 529 TRP A CD1 1 
ATOM   3865 C  CD2 . TRP A 1 529 ? 25.18021 45.81888 21.07339  1.000 36.13874  ? 529 TRP A CD2 1 
ATOM   3866 N  NE1 . TRP A 1 529 ? 24.06103 47.25830 22.37352  1.000 44.03452  ? 529 TRP A NE1 1 
ATOM   3867 C  CE2 . TRP A 1 529 ? 24.81109 47.16918 21.23061  1.000 34.45795  ? 529 TRP A CE2 1 
ATOM   3868 C  CE3 . TRP A 1 529 ? 25.95462 45.45564 19.96807  1.000 29.84690  ? 529 TRP A CE3 1 
ATOM   3869 C  CZ2 . TRP A 1 529 ? 25.20441 48.15585 20.33888  1.000 34.94941  ? 529 TRP A CZ2 1 
ATOM   3870 C  CZ3 . TRP A 1 529 ? 26.34517 46.43301 19.08728  1.000 36.17957  ? 529 TRP A CZ3 1 
ATOM   3871 C  CH2 . TRP A 1 529 ? 25.97824 47.77126 19.27707  1.000 35.08392  ? 529 TRP A CH2 1 
ATOM   3872 N  N   . PRO A 1 530 ? 22.31211 43.67125 25.20600  1.000 49.00946  ? 530 PRO A N   1 
ATOM   3873 C  CA  . PRO A 1 530 ? 20.88143 43.71688 25.51967  1.000 47.93538  ? 530 PRO A CA  1 
ATOM   3874 C  C   . PRO A 1 530 ? 20.22512 44.99851 25.01466  1.000 46.57880  ? 530 PRO A C   1 
ATOM   3875 O  O   . PRO A 1 530 ? 20.87793 45.96674 24.61950  1.000 44.25753  ? 530 PRO A O   1 
ATOM   3876 C  CB  . PRO A 1 530 ? 20.84589 43.65207 27.05583  1.000 41.77313  ? 530 PRO A CB  1 
ATOM   3877 C  CG  . PRO A 1 530 ? 22.26732 43.42845 27.49295  1.000 45.55112  ? 530 PRO A CG  1 
ATOM   3878 C  CD  . PRO A 1 530 ? 23.14517 43.92101 26.38826  1.000 50.42764  ? 530 PRO A CD  1 
ATOM   3879 N  N   . ASN A 1 531 ? 18.89550 44.98706 25.05307  1.000 48.49217  ? 531 ASN A N   1 
ATOM   3880 C  CA  . ASN A 1 531 ? 18.12091 46.13867 24.61604  1.000 43.51766  ? 531 ASN A CA  1 
ATOM   3881 C  C   . ASN A 1 531 ? 18.31183 47.32516 25.55604  1.000 44.56835  ? 531 ASN A C   1 
ATOM   3882 O  O   . ASN A 1 531 ? 18.52255 47.16647 26.76006  1.000 54.26381  ? 531 ASN A O   1 
ATOM   3883 C  CB  . ASN A 1 531 ? 16.64317 45.77017 24.53583  1.000 38.71254  ? 531 ASN A CB  1 
ATOM   3884 C  CG  . ASN A 1 531 ? 16.23080 45.38797 23.13482  1.000 48.17563  ? 531 ASN A CG  1 
ATOM   3885 O  OD1 . ASN A 1 531 ? 15.89625 46.25080 22.31169  1.000 51.20879  ? 531 ASN A OD1 1 
ATOM   3886 N  ND2 . ASN A 1 531 ? 16.26828 44.09384 22.84320  1.000 51.48855  ? 531 ASN A ND2 1 
ATOM   3887 N  N   . PHE A 1 532 ? 18.23577 48.52587 24.98483  1.000 38.63386  ? 532 PHE A N   1 
ATOM   3888 C  CA  . PHE A 1 532 ? 18.31399 49.77694 25.73256  1.000 36.55334  ? 532 PHE A CA  1 
ATOM   3889 C  C   . PHE A 1 532 ? 16.91670 50.26511 26.08812  1.000 41.18106  ? 532 PHE A C   1 
ATOM   3890 O  O   . PHE A 1 532 ? 16.03750 50.32334 25.22126  1.000 40.43148  ? 532 PHE A O   1 
ATOM   3891 C  CB  . PHE A 1 532 ? 19.03096 50.84270 24.90778  1.000 33.40695  ? 532 PHE A CB  1 
ATOM   3892 C  CG  . PHE A 1 532 ? 19.17337 52.17749 25.60072  1.000 38.16700  ? 532 PHE A CG  1 
ATOM   3893 C  CD1 . PHE A 1 532 ? 18.15705 53.13080 25.54165  1.000 35.81029  ? 532 PHE A CD1 1 
ATOM   3894 C  CD2 . PHE A 1 532 ? 20.34799 52.49878 26.28061  1.000 37.53222  ? 532 PHE A CD2 1 
ATOM   3895 C  CE1 . PHE A 1 532 ? 18.29978 54.37367 26.16784  1.000 32.50703  ? 532 PHE A CE1 1 
ATOM   3896 C  CE2 . PHE A 1 532 ? 20.49904 53.73892 26.89633  1.000 33.29828  ? 532 PHE A CE2 1 
ATOM   3897 C  CZ  . PHE A 1 532 ? 19.46707 54.67834 26.84078  1.000 29.09945  ? 532 PHE A CZ  1 
ATOM   3898 N  N   . SER A 1 533 ? 16.72506 50.62977 27.35892  1.000 45.01443  ? 533 SER A N   1 
ATOM   3899 C  CA  . SER A 1 533 ? 15.47535 51.20261 27.84820  1.000 44.12066  ? 533 SER A CA  1 
ATOM   3900 C  C   . SER A 1 533 ? 15.80330 52.17739 28.96702  1.000 51.29842  ? 533 SER A C   1 
ATOM   3901 O  O   . SER A 1 533 ? 16.89706 52.14455 29.53814  1.000 50.66594  ? 533 SER A O   1 
ATOM   3902 C  CB  . SER A 1 533 ? 14.51803 50.12772 28.36479  1.000 44.84885  ? 533 SER A CB  1 
ATOM   3903 O  OG  . SER A 1 533 ? 15.07280 49.47130 29.49696  1.000 47.09812  ? 533 SER A OG  1 
ATOM   3904 N  N   . LYS A 1 534 ? 14.84817 53.05561 29.28141  1.000 54.54285  ? 534 LYS A N   1 
ATOM   3905 C  CA  . LYS A 1 534 ? 15.04502 53.90173 30.45169  1.000 57.24048  ? 534 LYS A CA  1 
ATOM   3906 C  C   . LYS A 1 534 ? 15.21481 53.05756 31.70372  1.000 57.25742  ? 534 LYS A C   1 
ATOM   3907 O  O   . LYS A 1 534 ? 16.02802 53.39035 32.57372  1.000 55.09114  ? 534 LYS A O   1 
ATOM   3908 C  CB  . LYS A 1 534 ? 13.88070 54.87163 30.61684  1.000 69.59018  ? 534 LYS A CB  1 
ATOM   3909 C  CG  . LYS A 1 534 ? 14.18817 55.99881 31.58763  1.000 78.97146  ? 534 LYS A CG  1 
ATOM   3910 C  CD  . LYS A 1 534 ? 13.02941 56.98104 31.71132  1.000 88.57844  ? 534 LYS A CD  1 
ATOM   3911 C  CE  . LYS A 1 534 ? 11.96201 56.47683 32.66955  1.000 99.03967  ? 534 LYS A CE  1 
ATOM   3912 N  NZ  . LYS A 1 534 ? 11.21229 57.59617 33.32695  1.000 102.58627 ? 534 LYS A NZ  1 
ATOM   3913 N  N   . GLU A 1 535 ? 14.48578 51.94039 31.78474  1.000 59.38247  ? 535 GLU A N   1 
ATOM   3914 C  CA  . GLU A 1 535 ? 14.58600 51.04223 32.93392  1.000 65.29568  ? 535 GLU A CA  1 
ATOM   3915 C  C   . GLU A 1 535 ? 15.98404 50.45239 33.04657  1.000 64.56517  ? 535 GLU A C   1 
ATOM   3916 O  O   . GLU A 1 535 ? 16.51585 50.30002 34.15210  1.000 65.36054  ? 535 GLU A O   1 
ATOM   3917 C  CB  . GLU A 1 535 ? 13.55311 49.91845 32.80553  1.000 76.80167  ? 535 GLU A CB  1 
ATOM   3918 C  CG  . GLU A 1 535 ? 12.09343 50.37935 32.83872  1.000 89.43713  ? 535 GLU A CG  1 
ATOM   3919 C  CD  . GLU A 1 535 ? 11.66475 51.06293 31.53644  1.000 95.48153  ? 535 GLU A CD  1 
ATOM   3920 O  OE1 . GLU A 1 535 ? 11.60767 50.37906 30.49182  1.000 97.00477  ? 535 GLU A OE1 1 
ATOM   3921 O  OE2 . GLU A 1 535 ? 11.38225 52.28257 31.55690  1.000 97.53140  ? 535 GLU A OE2 1 
ATOM   3922 N  N   . ASP A 1 536 ? 16.59234 50.11257 31.90848  1.000 61.39194  ? 536 ASP A N   1 
ATOM   3923 C  CA  . ASP A 1 536 ? 17.91672 49.49813 31.86590  1.000 50.39170  ? 536 ASP A CA  1 
ATOM   3924 C  C   . ASP A 1 536 ? 18.68983 50.12095 30.71614  1.000 44.98170  ? 536 ASP A C   1 
ATOM   3925 O  O   . ASP A 1 536 ? 18.67160 49.61373 29.59091  1.000 61.67617  ? 536 ASP A O   1 
ATOM   3926 C  CB  . ASP A 1 536 ? 17.81221 47.98231 31.70445  1.000 49.96332  ? 536 ASP A CB  1 
ATOM   3927 C  CG  . ASP A 1 536 ? 19.15135 47.28086 31.80560  1.000 49.18866  ? 536 ASP A CG  1 
ATOM   3928 O  OD1 . ASP A 1 536 ? 20.12261 47.86372 32.33912  1.000 51.61091  ? 536 ASP A OD1 1 
ATOM   3929 O  OD2 . ASP A 1 536 ? 19.22954 46.13271 31.32681  1.000 49.84168  ? 536 ASP A OD2 1 
ATOM   3930 N  N   . PRO A 1 537 ? 19.36434 51.22570 30.95521  1.000 41.02477  ? 537 PRO A N   1 
ATOM   3931 C  CA  . PRO A 1 537 ? 20.03197 51.96935 29.86752  1.000 40.36832  ? 537 PRO A CA  1 
ATOM   3932 C  C   . PRO A 1 537 ? 21.42659 51.43308 29.55892  1.000 39.80523  ? 537 PRO A C   1 
ATOM   3933 O  O   . PRO A 1 537 ? 22.42546 52.15268 29.63260  1.000 42.45946  ? 537 PRO A O   1 
ATOM   3934 C  CB  . PRO A 1 537 ? 20.08146 53.39225 30.43223  1.000 39.01472  ? 537 PRO A CB  1 
ATOM   3935 C  CG  . PRO A 1 537 ? 20.29040 53.14425 31.90418  1.000 41.45364  ? 537 PRO A CG  1 
ATOM   3936 C  CD  . PRO A 1 537 ? 19.48438 51.91593 32.24548  1.000 34.37105  ? 537 PRO A CD  1 
ATOM   3937 N  N   . VAL A 1 538 ? 21.49152 50.15990 29.19514  1.000 41.36473  ? 538 VAL A N   1 
ATOM   3938 C  CA  . VAL A 1 538 ? 22.75906 49.49517 28.91555  1.000 39.47146  ? 538 VAL A CA  1 
ATOM   3939 C  C   . VAL A 1 538 ? 23.21534 49.79054 27.48807  1.000 35.79358  ? 538 VAL A C   1 
ATOM   3940 O  O   . VAL A 1 538 ? 22.41196 49.87069 26.54814  1.000 42.07047  ? 538 VAL A O   1 
ATOM   3941 C  CB  . VAL A 1 538 ? 22.62680 47.98603 29.20248  1.000 43.09745  ? 538 VAL A CB  1 
ATOM   3942 C  CG1 . VAL A 1 538 ? 21.65592 47.32791 28.23355  1.000 44.04545  ? 538 VAL A CG1 1 
ATOM   3943 C  CG2 . VAL A 1 538 ? 23.99153 47.31415 29.13437  1.000 44.34943  ? 538 VAL A CG2 1 
ATOM   3944 N  N   . TYR A 1 539 ? 24.51687 50.01302 27.33373  1.000 38.23003  ? 539 TYR A N   1 
ATOM   3945 C  CA  . TYR A 1 539 ? 25.11941 50.29461 26.03988  1.000 36.50344  ? 539 TYR A CA  1 
ATOM   3946 C  C   . TYR A 1 539 ? 26.40369 49.49007 25.89314  1.000 40.22410  ? 539 TYR A C   1 
ATOM   3947 O  O   . TYR A 1 539 ? 27.05655 49.14065 26.88360  1.000 43.91598  ? 539 TYR A O   1 
ATOM   3948 C  CB  . TYR A 1 539 ? 25.40673 51.78933 25.85996  1.000 38.42164  ? 539 TYR A CB  1 
ATOM   3949 C  CG  . TYR A 1 539 ? 26.24431 52.43836 26.94727  1.000 43.35640  ? 539 TYR A CG  1 
ATOM   3950 C  CD1 . TYR A 1 539 ? 25.65687 52.90701 28.11359  1.000 41.97335  ? 539 TYR A CD1 1 
ATOM   3951 C  CD2 . TYR A 1 539 ? 27.61621 52.61804 26.79163  1.000 44.87734  ? 539 TYR A CD2 1 
ATOM   3952 C  CE1 . TYR A 1 539 ? 26.40232 53.51895 29.10190  1.000 41.78037  ? 539 TYR A CE1 1 
ATOM   3953 C  CE2 . TYR A 1 539 ? 28.37074 53.23092 27.77761  1.000 43.75350  ? 539 TYR A CE2 1 
ATOM   3954 C  CZ  . TYR A 1 539 ? 27.75805 53.68359 28.93557  1.000 42.10388  ? 539 TYR A CZ  1 
ATOM   3955 O  OH  . TYR A 1 539 ? 28.50453 54.29760 29.93500  1.000 41.59164  ? 539 TYR A OH  1 
ATOM   3956 N  N   . TYR A 1 540 ? 26.74880 49.19074 24.64233  1.000 38.51211  ? 540 TYR A N   1 
ATOM   3957 C  CA  . TYR A 1 540 ? 27.92682 48.40386 24.29627  1.000 32.70189  ? 540 TYR A CA  1 
ATOM   3958 C  C   . TYR A 1 540 ? 29.06465 49.36172 23.96172  1.000 31.22735  ? 540 TYR A C   1 
ATOM   3959 O  O   . TYR A 1 540 ? 28.88073 50.27083 23.13867  1.000 31.73224  ? 540 TYR A O   1 
ATOM   3960 C  CB  . TYR A 1 540 ? 27.59233 47.49053 23.11627  1.000 34.88621  ? 540 TYR A CB  1 
ATOM   3961 C  CG  . TYR A 1 540 ? 28.61902 46.43693 22.75719  1.000 37.07466  ? 540 TYR A CG  1 
ATOM   3962 C  CD1 . TYR A 1 540 ? 28.57904 45.17541 23.32403  1.000 34.43379  ? 540 TYR A CD1 1 
ATOM   3963 C  CD2 . TYR A 1 540 ? 29.61066 46.69921 21.81533  1.000 38.05782  ? 540 TYR A CD2 1 
ATOM   3964 C  CE1 . TYR A 1 540 ? 29.51146 44.21591 22.98351  1.000 46.11206  ? 540 TYR A CE1 1 
ATOM   3965 C  CE2 . TYR A 1 540 ? 30.54602 45.74295 21.47116  1.000 36.50208  ? 540 TYR A CE2 1 
ATOM   3966 C  CZ  . TYR A 1 540 ? 30.49610 44.51127 22.05510  1.000 43.77725  ? 540 TYR A CZ  1 
ATOM   3967 O  OH  . TYR A 1 540 ? 31.42554 43.56207 21.70420  1.000 51.15848  ? 540 TYR A OH  1 
ATOM   3968 N  N   . ILE A 1 541 ? 30.20914 49.20067 24.63962  1.000 33.63778  ? 541 ILE A N   1 
ATOM   3969 C  CA  . ILE A 1 541 ? 31.38530 50.05161 24.41927  1.000 35.81600  ? 541 ILE A CA  1 
ATOM   3970 C  C   . ILE A 1 541 ? 32.15907 49.50615 23.23501  1.000 40.48379  ? 541 ILE A C   1 
ATOM   3971 O  O   . ILE A 1 541 ? 32.61945 48.35935 23.27044  1.000 53.52220  ? 541 ILE A O   1 
ATOM   3972 C  CB  . ILE A 1 541 ? 32.31135 50.08753 25.64367  1.000 50.27748  ? 541 ILE A CB  1 
ATOM   3973 C  CG1 . ILE A 1 541 ? 31.56971 50.32642 26.97239  1.000 53.00334  ? 541 ILE A CG1 1 
ATOM   3974 C  CG2 . ILE A 1 541 ? 33.47317 51.04931 25.38225  1.000 27.41220  ? 541 ILE A CG2 1 
ATOM   3975 C  CD1 . ILE A 1 541 ? 31.31808 51.74045 27.28706  1.000 56.35466  ? 541 ILE A CD1 1 
ATOM   3976 N  N   . PHE A 1 542 ? 32.35726 50.33110 22.21152  1.000 35.10602  ? 542 PHE A N   1 
ATOM   3977 C  CA  . PHE A 1 542 ? 33.18242 49.93951 21.06680  1.000 39.68477  ? 542 PHE A CA  1 
ATOM   3978 C  C   . PHE A 1 542 ? 34.58955 50.46430 21.29006  1.000 35.44235  ? 542 PHE A C   1 
ATOM   3979 O  O   . PHE A 1 542 ? 34.82348 51.67755 21.27849  1.000 42.79943  ? 542 PHE A O   1 
ATOM   3980 C  CB  . PHE A 1 542 ? 32.59671 50.44743 19.75331  1.000 38.17717  ? 542 PHE A CB  1 
ATOM   3981 C  CG  . PHE A 1 542 ? 31.66648 49.48047 19.13125  1.000 34.10641  ? 542 PHE A CG  1 
ATOM   3982 C  CD1 . PHE A 1 542 ? 32.04351 48.14282 19.00372  1.000 27.95677  ? 542 PHE A CD1 1 
ATOM   3983 C  CD2 . PHE A 1 542 ? 30.39884 49.88186 18.72376  1.000 26.64361  ? 542 PHE A CD2 1 
ATOM   3984 C  CE1 . PHE A 1 542 ? 31.18506 47.20862 18.43017  1.000 33.60888  ? 542 PHE A CE1 1 
ATOM   3985 C  CE2 . PHE A 1 542 ? 29.51117 48.96590 18.15068  1.000 26.91561  ? 542 PHE A CE2 1 
ATOM   3986 C  CZ  . PHE A 1 542 ? 29.91013 47.61609 17.99652  1.000 37.43473  ? 542 PHE A CZ  1 
ATOM   3987 N  N   . SER A 1 543 ? 35.51991 49.55140 21.51796  1.000 29.79045  ? 543 SER A N   1 
ATOM   3988 C  CA  . SER A 1 543 ? 36.83752 49.96172 21.95418  1.000 33.05207  ? 543 SER A CA  1 
ATOM   3989 C  C   . SER A 1 543 ? 37.83468 48.88575 21.55930  1.000 43.21234  ? 543 SER A C   1 
ATOM   3990 O  O   . SER A 1 543 ? 37.47063 47.74738 21.25114  1.000 32.92037  ? 543 SER A O   1 
ATOM   3991 C  CB  . SER A 1 543 ? 36.85630 50.22349 23.46582  1.000 35.77050  ? 543 SER A CB  1 
ATOM   3992 O  OG  . SER A 1 543 ? 38.11786 49.92004 24.05723  1.000 44.70930  ? 543 SER A OG  1 
ATOM   3993 N  N   . THR A 1 544 ? 39.10170 49.28003 21.55165  1.000 45.47201  ? 544 THR A N   1 
ATOM   3994 C  CA  . THR A 1 544 ? 40.18297 48.38154 21.20826  1.000 45.81504  ? 544 THR A CA  1 
ATOM   3995 C  C   . THR A 1 544 ? 40.85910 47.77735 22.43513  1.000 48.99667  ? 544 THR A C   1 
ATOM   3996 O  O   . THR A 1 544 ? 41.52222 46.74091 22.31786  1.000 42.07276  ? 544 THR A O   1 
ATOM   3997 C  CB  . THR A 1 544 ? 41.20821 49.12761 20.35376  1.000 44.90432  ? 544 THR A CB  1 
ATOM   3998 O  OG1 . THR A 1 544 ? 42.00303 48.17748 19.65999  1.000 63.15046  ? 544 THR A OG1 1 
ATOM   3999 C  CG2 . THR A 1 544 ? 42.11842 49.95186 21.21085  1.000 43.10475  ? 544 THR A CG2 1 
ATOM   4000 N  N   . ASP A 1 545 ? 40.70472 48.39902 23.60047  1.000 51.08535  ? 545 ASP A N   1 
ATOM   4001 C  CA  . ASP A 1 545 ? 41.15737 47.79972 24.84693  1.000 50.14106  ? 545 ASP A CA  1 
ATOM   4002 C  C   . ASP A 1 545 ? 40.27772 46.59846 25.18184  1.000 51.97397  ? 545 ASP A C   1 
ATOM   4003 O  O   . ASP A 1 545 ? 39.04656 46.70305 25.19090  1.000 61.04690  ? 545 ASP A O   1 
ATOM   4004 C  CB  . ASP A 1 545 ? 41.10719 48.84861 25.96271  1.000 44.65459  ? 545 ASP A CB  1 
ATOM   4005 C  CG  . ASP A 1 545 ? 41.75525 48.37979 27.24632  1.000 47.79189  ? 545 ASP A CG  1 
ATOM   4006 O  OD1 . ASP A 1 545 ? 42.36405 47.28816 27.25744  1.000 52.93399  ? 545 ASP A OD1 1 
ATOM   4007 O  OD2 . ASP A 1 545 ? 41.67609 49.11937 28.24582  1.000 51.16484  ? 545 ASP A OD2 1 
ATOM   4008 N  N   . ASP A 1 546 ? 40.89748 45.44858 25.43423  1.000 47.01548  ? 546 ASP A N   1 
ATOM   4009 C  CA  . ASP A 1 546 ? 40.13220 44.25731 25.77334  1.000 50.26501  ? 546 ASP A CA  1 
ATOM   4010 C  C   . ASP A 1 546 ? 40.03505 44.00881 27.28154  1.000 54.96119  ? 546 ASP A C   1 
ATOM   4011 O  O   . ASP A 1 546 ? 39.46819 42.98960 27.69035  1.000 59.21326  ? 546 ASP A O   1 
ATOM   4012 C  CB  . ASP A 1 546 ? 40.71861 43.02635 25.06084  1.000 44.64335  ? 546 ASP A CB  1 
ATOM   4013 C  CG  . ASP A 1 546 ? 42.00768 42.51768 25.69743  1.000 62.61665  ? 546 ASP A CG  1 
ATOM   4014 O  OD1 . ASP A 1 546 ? 42.61952 43.23313 26.52408  1.000 70.45996  ? 546 ASP A OD1 1 
ATOM   4015 O  OD2 . ASP A 1 546 ? 42.40670 41.37436 25.37474  1.000 68.75522  ? 546 ASP A OD2 1 
ATOM   4016 N  N   . LYS A 1 547 ? 40.58434 44.90156 28.11197  1.000 53.59685  ? 547 LYS A N   1 
ATOM   4017 C  CA  . LYS A 1 547 ? 40.48530 44.79854 29.56397  1.000 47.19064  ? 547 LYS A CA  1 
ATOM   4018 C  C   . LYS A 1 547 ? 39.21650 45.44145 30.11903  1.000 47.35008  ? 547 LYS A C   1 
ATOM   4019 O  O   . LYS A 1 547 ? 38.87686 45.19141 31.28035  1.000 45.04883  ? 547 LYS A O   1 
ATOM   4020 C  CB  . LYS A 1 547 ? 41.70569 45.45065 30.23792  1.000 44.28887  ? 547 LYS A CB  1 
ATOM   4021 C  CG  . LYS A 1 547 ? 43.01322 44.65080 30.21335  1.000 51.95131  ? 547 LYS A CG  1 
ATOM   4022 C  CD  . LYS A 1 547 ? 44.22589 45.54024 30.55398  1.000 60.16130  ? 547 LYS A CD  1 
ATOM   4023 C  CE  . LYS A 1 547 ? 44.82919 46.17878 29.28331  1.000 76.82186  ? 547 LYS A CE  1 
ATOM   4024 N  NZ  . LYS A 1 547 ? 45.03004 47.66957 29.33959  1.000 76.50351  ? 547 LYS A NZ  1 
ATOM   4025 N  N   . ILE A 1 548 ? 38.49856 46.26087 29.32810  1.000 42.17471  ? 548 ILE A N   1 
ATOM   4026 C  CA  . ILE A 1 548 ? 37.32493 46.95146 29.86467  1.000 42.41160  ? 548 ILE A CA  1 
ATOM   4027 C  C   . ILE A 1 548 ? 36.11959 46.01547 29.88707  1.000 47.19231  ? 548 ILE A C   1 
ATOM   4028 O  O   . ILE A 1 548 ? 36.07140 44.98761 29.21019  1.000 58.81376  ? 548 ILE A O   1 
ATOM   4029 C  CB  . ILE A 1 548 ? 37.00763 48.22954 29.07044  1.000 42.12230  ? 548 ILE A CB  1 
ATOM   4030 C  CG1 . ILE A 1 548 ? 36.71020 47.89012 27.60972  1.000 42.05046  ? 548 ILE A CG1 1 
ATOM   4031 C  CG2 . ILE A 1 548 ? 38.14357 49.21277 29.16924  1.000 34.95186  ? 548 ILE A CG2 1 
ATOM   4032 C  CD1 . ILE A 1 548 ? 35.69330 48.79811 26.98517  1.000 41.20694  ? 548 ILE A CD1 1 
ATOM   4033 N  N   . GLU A 1 549 ? 35.13426 46.37810 30.69694  1.000 45.88146  ? 549 GLU A N   1 
ATOM   4034 C  CA  . GLU A 1 549 ? 33.80895 45.79261 30.58543  1.000 48.93124  ? 549 GLU A CA  1 
ATOM   4035 C  C   . GLU A 1 549 ? 33.11775 46.47922 29.42477  1.000 52.79935  ? 549 GLU A C   1 
ATOM   4036 O  O   . GLU A 1 549 ? 33.00399 47.71178 29.42122  1.000 56.50436  ? 549 GLU A O   1 
ATOM   4037 C  CB  . GLU A 1 549 ? 33.00692 45.99918 31.86904  1.000 43.51755  ? 549 GLU A CB  1 
ATOM   4038 C  CG  . GLU A 1 549 ? 31.70226 45.22937 31.93385  1.000 39.04878  ? 549 GLU A CG  1 
ATOM   4039 C  CD  . GLU A 1 549 ? 31.93116 43.77425 32.27813  1.000 51.48544  ? 549 GLU A CD  1 
ATOM   4040 O  OE1 . GLU A 1 549 ? 33.00491 43.46214 32.82097  1.000 53.88080  ? 549 GLU A OE1 1 
ATOM   4041 O  OE2 . GLU A 1 549 ? 31.04004 42.94153 32.01996  1.000 64.05656  ? 549 GLU A OE2 1 
ATOM   4042 N  N   . LYS A 1 550 ? 32.65897 45.70764 28.44105  1.000 46.52301  ? 550 LYS A N   1 
ATOM   4043 C  CA  . LYS A 1 550 ? 32.07744 46.37234 27.28357  1.000 47.95394  ? 550 LYS A CA  1 
ATOM   4044 C  C   . LYS A 1 550 ? 30.59719 46.70434 27.45647  1.000 44.15738  ? 550 LYS A C   1 
ATOM   4045 O  O   . LYS A 1 550 ? 30.06613 47.49751 26.67355  1.000 46.47943  ? 550 LYS A O   1 
ATOM   4046 C  CB  . LYS A 1 550 ? 32.31725 45.55123 26.01086  1.000 46.58431  ? 550 LYS A CB  1 
ATOM   4047 C  CG  . LYS A 1 550 ? 32.25933 44.05977 26.19123  1.000 60.89506  ? 550 LYS A CG  1 
ATOM   4048 C  CD  . LYS A 1 550 ? 32.72367 43.34120 24.91905  1.000 64.80983  ? 550 LYS A CD  1 
ATOM   4049 C  CE  . LYS A 1 550 ? 34.20308 43.55639 24.63195  1.000 59.98864  ? 550 LYS A CE  1 
ATOM   4050 N  NZ  . LYS A 1 550 ? 35.07372 42.49146 25.23149  1.000 60.37635  ? 550 LYS A NZ  1 
ATOM   4051 N  N   . LEU A 1 551 ? 29.92675 46.17270 28.47173  1.000 36.10720  ? 551 LEU A N   1 
ATOM   4052 C  CA  . LEU A 1 551 ? 28.56213 46.58287 28.77623  1.000 37.36788  ? 551 LEU A CA  1 
ATOM   4053 C  C   . LEU A 1 551 ? 28.57699 47.51803 29.98017  1.000 41.12077  ? 551 LEU A C   1 
ATOM   4054 O  O   . LEU A 1 551 ? 29.19798 47.21573 31.00703  1.000 53.29977  ? 551 LEU A O   1 
ATOM   4055 C  CB  . LEU A 1 551 ? 27.66043 45.37677 29.04609  1.000 39.55767  ? 551 LEU A CB  1 
ATOM   4056 C  CG  . LEU A 1 551 ? 27.32026 44.46833 27.85515  1.000 41.91761  ? 551 LEU A CG  1 
ATOM   4057 C  CD1 . LEU A 1 551 ? 26.35959 43.35020 28.26966  1.000 37.05866  ? 551 LEU A CD1 1 
ATOM   4058 C  CD2 . LEU A 1 551 ? 26.75535 45.26070 26.68436  1.000 35.26250  ? 551 LEU A CD2 1 
ATOM   4059 N  N   . ALA A 1 552 ? 27.89023 48.64516 29.85119  1.000 32.90693  ? 552 ALA A N   1 
ATOM   4060 C  CA  . ALA A 1 552 ? 27.91904 49.69263 30.85477  1.000 42.93477  ? 552 ALA A CA  1 
ATOM   4061 C  C   . ALA A 1 552 ? 26.56833 50.39613 30.91446  1.000 52.37596  ? 552 ALA A C   1 
ATOM   4062 O  O   . ALA A 1 552 ? 25.83560 50.45224 29.91837  1.000 50.22885  ? 552 ALA A O   1 
ATOM   4063 C  CB  . ALA A 1 552 ? 29.02268 50.70988 30.55437  1.000 29.85322  ? 552 ALA A CB  1 
ATOM   4064 N  N   . ARG A 1 553 ? 26.25008 50.93918 32.09941  1.000 53.08751  ? 553 ARG A N   1 
ATOM   4065 C  CA  . ARG A 1 553 ? 25.01408 51.69216 32.30801  1.000 48.02252  ? 553 ARG A CA  1 
ATOM   4066 C  C   . ARG A 1 553 ? 25.28246 53.05072 32.94816  1.000 49.70272  ? 553 ARG A C   1 
ATOM   4067 O  O   . ARG A 1 553 ? 24.72525 54.07010 32.52118  1.000 47.48358  ? 553 ARG A O   1 
ATOM   4068 C  CB  . ARG A 1 553 ? 24.04242 50.90022 33.18606  1.000 41.17010  ? 553 ARG A CB  1 
ATOM   4069 C  CG  . ARG A 1 553 ? 23.38695 49.72825 32.47983  1.000 56.11844  ? 553 ARG A CG  1 
ATOM   4070 C  CD  . ARG A 1 553 ? 23.82439 48.38788 33.04280  1.000 61.60854  ? 553 ARG A CD  1 
ATOM   4071 N  NE  . ARG A 1 553 ? 22.92002 47.31593 32.63702  1.000 73.96306  ? 553 ARG A NE  1 
ATOM   4072 C  CZ  . ARG A 1 553 ? 23.31191 46.08781 32.29634  1.000 81.46544  ? 553 ARG A CZ  1 
ATOM   4073 N  NH1 . ARG A 1 553 ? 24.60203 45.76033 32.32099  1.000 79.67607  ? 553 ARG A NH1 1 
ATOM   4074 N  NH2 . ARG A 1 553 ? 22.40739 45.18039 31.93789  1.000 81.33332  ? 553 ARG A NH2 1 
ATOM   4075 N  N   . GLY A 1 554 ? 26.14581 53.06753 33.96572  1.000 48.63952  ? 554 GLY A N   1 
ATOM   4076 C  CA  . GLY A 1 554 ? 26.27163 54.18973 34.87205  1.000 49.17045  ? 554 GLY A CA  1 
ATOM   4077 C  C   . GLY A 1 554 ? 26.74090 55.50562 34.27704  1.000 47.93611  ? 554 GLY A C   1 
ATOM   4078 O  O   . GLY A 1 554 ? 26.07816 56.54031 34.40200  1.000 54.49569  ? 554 GLY A O   1 
ATOM   4079 N  N   . PRO A 1 555 ? 27.92007 55.49862 33.65913  1.000 44.21920  ? 555 PRO A N   1 
ATOM   4080 C  CA  . PRO A 1 555 ? 28.54651 56.78068 33.27529  1.000 46.10927  ? 555 PRO A CA  1 
ATOM   4081 C  C   . PRO A 1 555 ? 27.70186 57.67652 32.38019  1.000 50.66061  ? 555 PRO A C   1 
ATOM   4082 O  O   . PRO A 1 555 ? 27.55759 58.86864 32.68655  1.000 55.94311  ? 555 PRO A O   1 
ATOM   4083 C  CB  . PRO A 1 555 ? 29.83941 56.32466 32.59365  1.000 39.72857  ? 555 PRO A CB  1 
ATOM   4084 C  CG  . PRO A 1 555 ? 30.20546 55.09080 33.35345  1.000 41.68312  ? 555 PRO A CG  1 
ATOM   4085 C  CD  . PRO A 1 555 ? 28.90216 54.39829 33.70118  1.000 43.94963  ? 555 PRO A CD  1 
ATOM   4086 N  N   . LEU A 1 556 ? 27.15273 57.15620 31.27812  1.000 46.37578  ? 556 LEU A N   1 
ATOM   4087 C  CA  . LEU A 1 556 ? 26.29332 57.98484 30.43682  1.000 50.61840  ? 556 LEU A CA  1 
ATOM   4088 C  C   . LEU A 1 556 ? 25.07076 58.48419 31.19385  1.000 49.63970  ? 556 LEU A C   1 
ATOM   4089 O  O   . LEU A 1 556 ? 24.59820 59.60596 30.94817  1.000 41.87154  ? 556 LEU A O   1 
ATOM   4090 C  CB  . LEU A 1 556 ? 25.84590 57.21109 29.20220  1.000 53.68711  ? 556 LEU A CB  1 
ATOM   4091 C  CG  . LEU A 1 556 ? 26.87665 57.21118 28.08128  1.000 64.99326  ? 556 LEU A CG  1 
ATOM   4092 C  CD1 . LEU A 1 556 ? 26.22136 56.71382 26.81958  1.000 73.14441  ? 556 LEU A CD1 1 
ATOM   4093 C  CD2 . LEU A 1 556 ? 27.46465 58.60182 27.87017  1.000 63.12433  ? 556 LEU A CD2 1 
ATOM   4094 N  N   . ALA A 1 557 ? 24.54136 57.66719 32.10838  1.000 45.50080  ? 557 ALA A N   1 
ATOM   4095 C  CA  . ALA A 1 557 ? 23.33085 58.05690 32.81431  1.000 42.80166  ? 557 ALA A CA  1 
ATOM   4096 C  C   . ALA A 1 557 ? 23.60014 59.23018 33.73804  1.000 45.37236  ? 557 ALA A C   1 
ATOM   4097 O  O   . ALA A 1 557 ? 22.76470 60.13293 33.86752  1.000 44.58673  ? 557 ALA A O   1 
ATOM   4098 C  CB  . ALA A 1 557 ? 22.77310 56.86566 33.58278  1.000 31.27130  ? 557 ALA A CB  1 
ATOM   4099 N  N   . ALA A 1 558 ? 24.77666 59.24615 34.35968  1.000 44.42304  ? 558 ALA A N   1 
ATOM   4100 C  CA  . ALA A 1 558 ? 25.11907 60.32568 35.26987  1.000 47.44259  ? 558 ALA A CA  1 
ATOM   4101 C  C   . ALA A 1 558 ? 25.35623 61.62755 34.51608  1.000 45.96730  ? 558 ALA A C   1 
ATOM   4102 O  O   . ALA A 1 558 ? 24.86198 62.68648 34.92338  1.000 54.04092  ? 558 ALA A O   1 
ATOM   4103 C  CB  . ALA A 1 558 ? 26.34582 59.93384 36.08817  1.000 56.75112  ? 558 ALA A CB  1 
ATOM   4104 N  N   . ARG A 1 559 ? 26.11480 61.57405 33.41784  1.000 41.45644  ? 559 ARG A N   1 
ATOM   4105 C  CA  . ARG A 1 559 ? 26.35009 62.77922 32.61709  1.000 54.75503  ? 559 ARG A CA  1 
ATOM   4106 C  C   . ARG A 1 559 ? 25.05414 63.36407 32.08252  1.000 42.89326  ? 559 ARG A C   1 
ATOM   4107 O  O   . ARG A 1 559 ? 24.86215 64.58413 32.08186  1.000 44.67901  ? 559 ARG A O   1 
ATOM   4108 C  CB  . ARG A 1 559 ? 27.29037 62.48516 31.44021  1.000 66.53254  ? 559 ARG A CB  1 
ATOM   4109 C  CG  . ARG A 1 559 ? 28.73482 62.37251 31.85685  1.000 84.92907  ? 559 ARG A CG  1 
ATOM   4110 C  CD  . ARG A 1 559 ? 29.64791 61.77237 30.83860  1.000 87.43721  ? 559 ARG A CD  1 
ATOM   4111 N  NE  . ARG A 1 559 ? 30.08953 62.75964 29.86982  1.000 96.68385  ? 559 ARG A NE  1 
ATOM   4112 C  CZ  . ARG A 1 559 ? 30.82455 62.45045 28.81382  1.000 92.85481  ? 559 ARG A CZ  1 
ATOM   4113 N  NH1 . ARG A 1 559 ? 31.19548 61.19289 28.62496  1.000 90.79575  ? 559 ARG A NH1 1 
ATOM   4114 N  NH2 . ARG A 1 559 ? 31.21249 63.39035 27.96778  1.000 99.40581  ? 559 ARG A NH2 1 
ATOM   4115 N  N   . CYS A 1 560 ? 24.15407 62.51043 31.62573  1.000 36.41696  ? 560 CYS A N   1 
ATOM   4116 C  CA  . CYS A 1 560 ? 22.97148 62.98297 30.92713  1.000 32.55468  ? 560 CYS A CA  1 
ATOM   4117 C  C   . CYS A 1 560 ? 21.80532 63.29792 31.84594  1.000 40.08963  ? 560 CYS A C   1 
ATOM   4118 O  O   . CYS A 1 560 ? 20.94540 64.10702 31.46983  1.000 45.02372  ? 560 CYS A O   1 
ATOM   4119 C  CB  . CYS A 1 560 ? 22.54035 61.96742 29.87811  1.000 37.63095  ? 560 CYS A CB  1 
ATOM   4120 S  SG  . CYS A 1 560 ? 23.62723 61.97407 28.46528  1.000 39.71658  ? 560 CYS A SG  1 
ATOM   4121 N  N   . SER A 1 561 ? 21.75033 62.69335 33.03698  1.000 41.69703  ? 561 SER A N   1 
ATOM   4122 C  CA  . SER A 1 561 ? 20.69905 63.06222 33.98209  1.000 44.74707  ? 561 SER A CA  1 
ATOM   4123 C  C   . SER A 1 561 ? 20.77837 64.53358 34.32644  1.000 43.07198  ? 561 SER A C   1 
ATOM   4124 O  O   . SER A 1 561 ? 19.75459 65.16105 34.60592  1.000 36.19543  ? 561 SER A O   1 
ATOM   4125 C  CB  . SER A 1 561 ? 20.78243 62.23739 35.26226  1.000 50.39920  ? 561 SER A CB  1 
ATOM   4126 O  OG  . SER A 1 561 ? 21.62081 62.88094 36.19113  1.000 60.82992  ? 561 SER A OG  1 
ATOM   4127 N  N   . PHE A 1 562 ? 21.98123 65.10328 34.29470  1.000 34.00350  ? 562 PHE A N   1 
ATOM   4128 C  CA  . PHE A 1 562 ? 22.10698 66.54412 34.44195  1.000 41.72327  ? 562 PHE A CA  1 
ATOM   4129 C  C   . PHE A 1 562 ? 21.32429 67.26394 33.35069  1.000 39.83392  ? 562 PHE A C   1 
ATOM   4130 O  O   . PHE A 1 562 ? 20.47196 68.11231 33.63603  1.000 36.56255  ? 562 PHE A O   1 
ATOM   4131 C  CB  . PHE A 1 562 ? 23.58193 66.93684 34.41357  1.000 40.00078  ? 562 PHE A CB  1 
ATOM   4132 C  CG  . PHE A 1 562 ? 23.81632 68.41081 34.37328  1.000 48.86246  ? 562 PHE A CG  1 
ATOM   4133 C  CD1 . PHE A 1 562 ? 23.62155 69.17602 35.50426  1.000 37.84692  ? 562 PHE A CD1 1 
ATOM   4134 C  CD2 . PHE A 1 562 ? 24.23687 69.03552 33.20087  1.000 52.15509  ? 562 PHE A CD2 1 
ATOM   4135 C  CE1 . PHE A 1 562 ? 23.83573 70.53591 35.48082  1.000 39.10873  ? 562 PHE A CE1 1 
ATOM   4136 C  CE2 . PHE A 1 562 ? 24.45643 70.40765 33.17101  1.000 52.29246  ? 562 PHE A CE2 1 
ATOM   4137 C  CZ  . PHE A 1 562 ? 24.25982 71.15962 34.32925  1.000 45.62611  ? 562 PHE A CZ  1 
ATOM   4138 N  N   . TRP A 1 563 ? 21.57464 66.90745 32.08960  1.000 45.12621  ? 563 TRP A N   1 
ATOM   4139 C  CA  . TRP A 1 563 ? 20.96561 67.65073 30.98929  1.000 42.97876  ? 563 TRP A CA  1 
ATOM   4140 C  C   . TRP A 1 563 ? 19.49119 67.31698 30.84574  1.000 43.28914  ? 563 TRP A C   1 
ATOM   4141 O  O   . TRP A 1 563 ? 18.67552 68.20958 30.59451  1.000 49.09759  ? 563 TRP A O   1 
ATOM   4142 C  CB  . TRP A 1 563 ? 21.70924 67.37857 29.68051  1.000 30.13081  ? 563 TRP A CB  1 
ATOM   4143 C  CG  . TRP A 1 563 ? 23.06789 68.02373 29.66038  1.000 29.88422  ? 563 TRP A CG  1 
ATOM   4144 C  CD1 . TRP A 1 563 ? 24.26546 67.40938 29.89441  1.000 33.99543  ? 563 TRP A CD1 1 
ATOM   4145 C  CD2 . TRP A 1 563 ? 23.37016 69.41100 29.41189  1.000 32.99058  ? 563 TRP A CD2 1 
ATOM   4146 N  NE1 . TRP A 1 563 ? 25.29905 68.33145 29.81315  1.000 38.12978  ? 563 TRP A NE1 1 
ATOM   4147 C  CE2 . TRP A 1 563 ? 24.77343 69.56241 29.52259  1.000 33.17891  ? 563 TRP A CE2 1 
ATOM   4148 C  CE3 . TRP A 1 563 ? 22.59196 70.53766 29.10403  1.000 37.69154  ? 563 TRP A CE3 1 
ATOM   4149 C  CZ2 . TRP A 1 563 ? 25.40751 70.78767 29.35021  1.000 31.39090  ? 563 TRP A CZ2 1 
ATOM   4150 C  CZ3 . TRP A 1 563 ? 23.22883 71.76048 28.92025  1.000 34.06531  ? 563 TRP A CZ3 1 
ATOM   4151 C  CH2 . TRP A 1 563 ? 24.62039 71.87301 29.04832  1.000 37.47060  ? 563 TRP A CH2 1 
ATOM   4152 N  N   . ASN A 1 564 ? 19.12498 66.04808 31.02786  1.000 38.19210  ? 564 ASN A N   1 
ATOM   4153 C  CA  . ASN A 1 564 ? 17.78537 65.58517 30.69690  1.000 37.07454  ? 564 ASN A CA  1 
ATOM   4154 C  C   . ASN A 1 564 ? 16.80292 65.57873 31.86305  1.000 42.24206  ? 564 ASN A C   1 
ATOM   4155 O  O   . ASN A 1 564 ? 15.59216 65.59026 31.61679  1.000 43.60584  ? 564 ASN A O   1 
ATOM   4156 C  CB  . ASN A 1 564 ? 17.85928 64.18010 30.09739  1.000 39.37054  ? 564 ASN A CB  1 
ATOM   4157 C  CG  . ASN A 1 564 ? 18.72527 64.12917 28.85001  1.000 37.62618  ? 564 ASN A CG  1 
ATOM   4158 O  OD1 . ASN A 1 564 ? 18.84933 65.11855 28.13211  1.000 36.72884  ? 564 ASN A OD1 1 
ATOM   4159 N  ND2 . ASN A 1 564 ? 19.33137 62.97096 28.58960  1.000 39.48311  ? 564 ASN A ND2 1 
ATOM   4160 N  N   . ASP A 1 565 ? 17.27247 65.56326 33.11251  1.000 45.82267  ? 565 ASP A N   1 
ATOM   4161 C  CA  . ASP A 1 565 ? 16.39460 65.59810 34.28088  1.000 46.67750  ? 565 ASP A CA  1 
ATOM   4162 C  C   . ASP A 1 565 ? 16.55628 66.85651 35.12010  1.000 51.94117  ? 565 ASP A C   1 
ATOM   4163 O  O   . ASP A 1 565 ? 15.56139 67.50905 35.46842  1.000 52.43028  ? 565 ASP A O   1 
ATOM   4164 C  CB  . ASP A 1 565 ? 16.63925 64.37254 35.16970  1.000 52.53558  ? 565 ASP A CB  1 
ATOM   4165 C  CG  . ASP A 1 565 ? 16.60642 63.07674 34.39347  1.000 67.03584  ? 565 ASP A CG  1 
ATOM   4166 O  OD1 . ASP A 1 565 ? 15.94954 63.04058 33.32775  1.000 69.23663  ? 565 ASP A OD1 1 
ATOM   4167 O  OD2 . ASP A 1 565 ? 17.24356 62.09702 34.85038  1.000 71.19467  ? 565 ASP A OD2 1 
ATOM   4168 N  N   . TYR A 1 566 ? 17.79146 67.21103 35.47557  1.000 57.29371  ? 566 TYR A N   1 
ATOM   4169 C  CA  . TYR A 1 566 ? 17.99975 68.28392 36.44342  1.000 56.68770  ? 566 TYR A CA  1 
ATOM   4170 C  C   . TYR A 1 566 ? 17.79487 69.65551 35.80675  1.000 53.33542  ? 566 TYR A C   1 
ATOM   4171 O  O   . TYR A 1 566 ? 16.97937 70.45423 36.28062  1.000 60.18815  ? 566 TYR A O   1 
ATOM   4172 C  CB  . TYR A 1 566 ? 19.39739 68.17386 37.06723  1.000 47.19766  ? 566 TYR A CB  1 
ATOM   4173 C  CG  . TYR A 1 566 ? 19.70048 69.26981 38.06602  1.000 46.04948  ? 566 TYR A CG  1 
ATOM   4174 C  CD1 . TYR A 1 566 ? 18.99987 69.36014 39.26248  1.000 51.92711  ? 566 TYR A CD1 1 
ATOM   4175 C  CD2 . TYR A 1 566 ? 20.67577 70.22497 37.80607  1.000 45.91878  ? 566 TYR A CD2 1 
ATOM   4176 C  CE1 . TYR A 1 566 ? 19.27236 70.37241 40.18747  1.000 55.62982  ? 566 TYR A CE1 1 
ATOM   4177 C  CE2 . TYR A 1 566 ? 20.94858 71.23818 38.71585  1.000 51.93215  ? 566 TYR A CE2 1 
ATOM   4178 C  CZ  . TYR A 1 566 ? 20.24928 71.30960 39.90424  1.000 55.40568  ? 566 TYR A CZ  1 
ATOM   4179 O  OH  . TYR A 1 566 ? 20.52648 72.31804 40.80544  1.000 58.17900  ? 566 TYR A OH  1 
ATOM   4180 N  N   . LEU A 1 567 ? 18.53157 69.94299 34.73623  1.000 45.11488  ? 567 LEU A N   1 
ATOM   4181 C  CA  . LEU A 1 567 ? 18.45576 71.25831 34.10440  1.000 50.58319  ? 567 LEU A CA  1 
ATOM   4182 C  C   . LEU A 1 567 ? 17.03656 71.66310 33.72174  1.000 54.79543  ? 567 LEU A C   1 
ATOM   4183 O  O   . LEU A 1 567 ? 16.69148 72.84475 33.90269  1.000 61.26221  ? 567 LEU A O   1 
ATOM   4184 C  CB  . LEU A 1 567 ? 19.39655 71.30477 32.89033  1.000 42.08504  ? 567 LEU A CB  1 
ATOM   4185 C  CG  . LEU A 1 567 ? 20.18594 72.60949 32.76299  1.000 47.40064  ? 567 LEU A CG  1 
ATOM   4186 C  CD1 . LEU A 1 567 ? 20.75657 73.01982 34.10323  1.000 53.68787  ? 567 LEU A CD1 1 
ATOM   4187 C  CD2 . LEU A 1 567 ? 21.31356 72.44322 31.78600  1.000 48.18159  ? 567 LEU A CD2 1 
ATOM   4188 N  N   . PRO A 1 568 ? 16.17473 70.76989 33.24187  1.000 44.63966  ? 568 PRO A N   1 
ATOM   4189 C  CA  . PRO A 1 568 ? 14.75953 71.13805 33.06758  1.000 44.72822  ? 568 PRO A CA  1 
ATOM   4190 C  C   . PRO A 1 568 ? 14.11584 71.75775 34.29021  1.000 49.36127  ? 568 PRO A C   1 
ATOM   4191 O  O   . PRO A 1 568 ? 13.16544 72.54148 34.15496  1.000 56.04327  ? 568 PRO A O   1 
ATOM   4192 C  CB  . PRO A 1 568 ? 14.10379 69.79899 32.72590  1.000 43.66216  ? 568 PRO A CB  1 
ATOM   4193 C  CG  . PRO A 1 568 ? 15.18533 69.06000 31.98201  1.000 52.57611  ? 568 PRO A CG  1 
ATOM   4194 C  CD  . PRO A 1 568 ? 16.48181 69.45587 32.64975  1.000 42.25452  ? 568 PRO A CD  1 
ATOM   4195 N  N   . LYS A 1 569 ? 14.58829 71.42566 35.48588  1.000 53.18819  ? 569 LYS A N   1 
ATOM   4196 C  CA  . LYS A 1 569 ? 13.95033 71.93086 36.68875  1.000 57.81423  ? 569 LYS A CA  1 
ATOM   4197 C  C   . LYS A 1 569 ? 14.46678 73.30634 37.07424  1.000 66.61789  ? 569 LYS A C   1 
ATOM   4198 O  O   . LYS A 1 569 ? 13.72409 74.09667 37.67604  1.000 72.79916  ? 569 LYS A O   1 
ATOM   4199 C  CB  . LYS A 1 569 ? 14.14757 70.94973 37.85330  1.000 61.23543  ? 569 LYS A CB  1 
ATOM   4200 C  CG  . LYS A 1 569 ? 13.71023 69.52440 37.55382  1.000 63.74356  ? 569 LYS A CG  1 
ATOM   4201 C  CD  . LYS A 1 569 ? 13.76227 68.61995 38.79432  1.000 72.91712  ? 569 LYS A CD  1 
ATOM   4202 C  CE  . LYS A 1 569 ? 13.60236 67.15742 38.36475  1.000 75.30500  ? 569 LYS A CE  1 
ATOM   4203 N  NZ  . LYS A 1 569 ? 13.62819 66.15996 39.46580  1.000 71.01423  ? 569 LYS A NZ  1 
ATOM   4204 N  N   . VAL A 1 570 ? 15.72281 73.62446 36.75519  1.000 67.68835  ? 570 VAL A N   1 
ATOM   4205 C  CA  . VAL A 1 570 ? 16.19791 74.94963 37.13340  1.000 67.26134  ? 570 VAL A CA  1 
ATOM   4206 C  C   . VAL A 1 570 ? 15.58969 75.99096 36.21010  1.000 76.36427  ? 570 VAL A C   1 
ATOM   4207 O  O   . VAL A 1 570 ? 15.41817 77.14608 36.61908  1.000 81.03682  ? 570 VAL A O   1 
ATOM   4208 C  CB  . VAL A 1 570 ? 17.73799 75.04185 37.14979  1.000 52.73813  ? 570 VAL A CB  1 
ATOM   4209 C  CG1 . VAL A 1 570 ? 18.35316 73.81042 37.81022  1.000 51.33798  ? 570 VAL A CG1 1 
ATOM   4210 C  CG2 . VAL A 1 570 ? 18.30715 75.26451 35.77898  1.000 51.85530  ? 570 VAL A CG2 1 
ATOM   4211 N  N   . ARG A 1 571 ? 15.21005 75.58544 34.98935  1.000 76.02665  ? 571 ARG A N   1 
ATOM   4212 C  CA  . ARG A 1 571 ? 14.51138 76.47847 34.07294  1.000 81.30315  ? 571 ARG A CA  1 
ATOM   4213 C  C   . ARG A 1 571 ? 13.19012 76.95826 34.65680  1.000 89.89636  ? 571 ARG A C   1 
ATOM   4214 O  O   . ARG A 1 571 ? 12.81107 78.11891 34.46436  1.000 96.12542  ? 571 ARG A O   1 
ATOM   4215 C  CB  . ARG A 1 571 ? 14.27896 75.77601 32.73560  1.000 82.02115  ? 571 ARG A CB  1 
ATOM   4216 C  CG  . ARG A 1 571 ? 15.54639 75.54792 31.94951  1.000 77.30453  ? 571 ARG A CG  1 
ATOM   4217 C  CD  . ARG A 1 571 ? 15.27639 74.99424 30.56629  1.000 76.22448  ? 571 ARG A CD  1 
ATOM   4218 N  NE  . ARG A 1 571 ? 15.76015 73.62229 30.41294  1.000 81.98758  ? 571 ARG A NE  1 
ATOM   4219 C  CZ  . ARG A 1 571 ? 16.94729 73.28549 29.90564  1.000 90.54077  ? 571 ARG A CZ  1 
ATOM   4220 N  NH1 . ARG A 1 571 ? 17.80421 74.22031 29.50784  1.000 95.41143  ? 571 ARG A NH1 1 
ATOM   4221 N  NH2 . ARG A 1 571 ? 17.28845 72.00643 29.80587  1.000 91.43437  ? 571 ARG A NH2 1 
ATOM   4222 N  N   . SER A 1 572 ? 12.48880 76.09569 35.39069  1.000 97.40544  ? 572 SER A N   1 
ATOM   4223 C  CA  . SER A 1 572 ? 11.27047 76.48530 36.10019  1.000 103.28673 ? 572 SER A CA  1 
ATOM   4224 C  C   . SER A 1 572 ? 11.64242 77.44562 37.22755  1.000 113.88180 ? 572 SER A C   1 
ATOM   4225 O  O   . SER A 1 572 ? 11.78470 77.06404 38.39243  1.000 108.59398 ? 572 SER A O   1 
ATOM   4226 C  CB  . SER A 1 572 ? 10.54366 75.25123 36.61899  1.000 98.63293  ? 572 SER A CB  1 
ATOM   4227 O  OG  . SER A 1 572 ? 10.65470 74.18487 35.68377  1.000 90.60564  ? 572 SER A OG  1 
ATOM   4228 N  N   . TRP A 1 573 ? 11.81391 78.71558 36.84663  1.000 139.80422 ? 573 TRP A N   1 
ATOM   4229 C  CA  . TRP A 1 573 ? 12.13094 79.84134 37.74269  1.000 159.10175 ? 573 TRP A CA  1 
ATOM   4230 C  C   . TRP A 1 573 ? 13.20014 79.54440 38.79771  1.000 160.73181 ? 573 TRP A C   1 
ATOM   4231 O  O   . TRP A 1 573 ? 13.29606 80.27322 39.78503  1.000 163.52418 ? 573 TRP A O   1 
ATOM   4232 C  CB  . TRP A 1 573 ? 10.85640 80.34509 38.43982  1.000 171.99071 ? 573 TRP A CB  1 
ATOM   4233 C  CG  . TRP A 1 573 ? 9.82448  80.91992 37.49506  1.000 178.68948 ? 573 TRP A CG  1 
ATOM   4234 C  CD1 . TRP A 1 573 ? 8.93929  80.21931 36.72528  1.000 177.69535 ? 573 TRP A CD1 1 
ATOM   4235 C  CD2 . TRP A 1 573 ? 9.57042  82.31029 37.22997  1.000 185.08964 ? 573 TRP A CD2 1 
ATOM   4236 N  NE1 . TRP A 1 573 ? 8.15596  81.08214 35.99715  1.000 180.97531 ? 573 TRP A NE1 1 
ATOM   4237 C  CE2 . TRP A 1 573 ? 8.52172  82.37043 36.28698  1.000 185.34947 ? 573 TRP A CE2 1 
ATOM   4238 C  CE3 . TRP A 1 573 ? 10.12829 83.50750 37.69504  1.000 187.92290 ? 573 TRP A CE3 1 
ATOM   4239 C  CZ2 . TRP A 1 573 ? 8.01876  83.57974 35.80062  1.000 187.78536 ? 573 TRP A CZ2 1 
ATOM   4240 C  CZ3 . TRP A 1 573 ? 9.62611  84.70895 37.20921  1.000 190.45704 ? 573 TRP A CZ3 1 
ATOM   4241 C  CH2 . TRP A 1 573 ? 8.58227  84.73353 36.27219  1.000 190.60757 ? 573 TRP A CH2 1 
HETATM 4242 C  C1  . NAG B 2 .   ? 41.58922 50.73974 -0.05276  1.000 43.32917  ? 1   NAG B C1  1 
HETATM 4243 C  C2  . NAG B 2 .   ? 40.47400 51.27805 -0.90546  1.000 41.42765  ? 1   NAG B C2  1 
HETATM 4244 C  C3  . NAG B 2 .   ? 41.02315 51.63896 -2.27316  1.000 42.58935  ? 1   NAG B C3  1 
HETATM 4245 C  C4  . NAG B 2 .   ? 42.08474 52.71466 -2.09903  1.000 47.34867  ? 1   NAG B C4  1 
HETATM 4246 C  C5  . NAG B 2 .   ? 43.15210 52.28216 -1.08829  1.000 52.48595  ? 1   NAG B C5  1 
HETATM 4247 C  C6  . NAG B 2 .   ? 44.00607 53.44291 -0.64789  1.000 61.81809  ? 1   NAG B C6  1 
HETATM 4248 C  C7  . NAG B 2 .   ? 39.40170 49.10598 -1.39910  1.000 55.18363  ? 1   NAG B C7  1 
HETATM 4249 C  C8  . NAG B 2 .   ? 38.09149 48.37175 -1.45369  1.000 48.16897  ? 1   NAG B C8  1 
HETATM 4250 N  N2  . NAG B 2 .   ? 39.33282 50.37911 -1.00117  1.000 44.84655  ? 1   NAG B N2  1 
HETATM 4251 O  O3  . NAG B 2 .   ? 39.99224 52.06833 -3.16200  1.000 42.06314  ? 1   NAG B O3  1 
HETATM 4252 O  O4  . NAG B 2 .   ? 42.71419 52.99145 -3.34485  1.000 68.32672  ? 1   NAG B O4  1 
HETATM 4253 O  O5  . NAG B 2 .   ? 42.57710 51.74683 0.11865   1.000 52.29511  ? 1   NAG B O5  1 
HETATM 4254 O  O6  . NAG B 2 .   ? 43.17913 54.47382 -0.12344  1.000 71.15584  ? 1   NAG B O6  1 
HETATM 4255 O  O7  . NAG B 2 .   ? 40.47043 48.56737 -1.70326  1.000 64.75111  ? 1   NAG B O7  1 
HETATM 4256 C  C1  . NAG B 2 .   ? 42.36672 54.13566 -4.02078  1.000 74.64644  ? 2   NAG B C1  1 
HETATM 4257 C  C2  . NAG B 2 .   ? 43.40587 54.96817 -4.75065  1.000 79.75191  ? 2   NAG B C2  1 
HETATM 4258 C  C3  . NAG B 2 .   ? 42.72905 56.11791 -5.48238  1.000 92.34894  ? 2   NAG B C3  1 
HETATM 4259 C  C4  . NAG B 2 .   ? 41.65513 55.57646 -6.41870  1.000 101.02297 ? 2   NAG B C4  1 
HETATM 4260 C  C5  . NAG B 2 .   ? 40.67700 54.69326 -5.64105  1.000 90.13760  ? 2   NAG B C5  1 
HETATM 4261 C  C6  . NAG B 2 .   ? 39.64784 54.01961 -6.52121  1.000 87.60917  ? 2   NAG B C6  1 
HETATM 4262 C  C7  . NAG B 2 .   ? 45.53637 54.76584 -3.54981  1.000 72.87072  ? 2   NAG B C7  1 
HETATM 4263 C  C8  . NAG B 2 .   ? 46.50446 55.43349 -2.61271  1.000 61.86960  ? 2   NAG B C8  1 
HETATM 4264 N  N2  . NAG B 2 .   ? 44.43278 55.46391 -3.84857  1.000 76.41311  ? 2   NAG B N2  1 
HETATM 4265 O  O3  . NAG B 2 .   ? 43.70901 56.84815 -6.21113  1.000 92.65758  ? 2   NAG B O3  1 
HETATM 4266 O  O4  . NAG B 2 .   ? 40.95796 56.64696 -7.04940  1.000 110.67117 ? 2   NAG B O4  1 
HETATM 4267 O  O5  . NAG B 2 .   ? 41.39199 53.64897 -4.96079  1.000 76.01599  ? 2   NAG B O5  1 
HETATM 4268 O  O6  . NAG B 2 .   ? 40.14401 52.80310 -7.06241  1.000 84.25054  ? 2   NAG B O6  1 
HETATM 4269 O  O7  . NAG B 2 .   ? 45.74212 53.63771 -4.00985  1.000 73.79504  ? 2   NAG B O7  1 
HETATM 4270 C  C1  . MAN B 2 .   ? 40.96898 57.57476 -8.06333  1.000 116.52531 ? 3   MAN B C1  1 
HETATM 4271 C  C2  . MAN B 2 .   ? 39.85029 57.63129 -9.11712  1.000 121.17906 ? 3   MAN B C2  1 
HETATM 4272 C  C3  . MAN B 2 .   ? 40.18805 56.64849 -10.28007 1.000 123.50692 ? 3   MAN B C3  1 
HETATM 4273 C  C4  . MAN B 2 .   ? 41.63912 56.84880 -10.80232 1.000 122.68745 ? 3   MAN B C4  1 
HETATM 4274 C  C5  . MAN B 2 .   ? 42.64698 56.82187 -9.62997  1.000 119.80777 ? 3   MAN B C5  1 
HETATM 4275 C  C6  . MAN B 2 .   ? 44.08507 57.12183 -10.06175 1.000 117.12338 ? 3   MAN B C6  1 
HETATM 4276 O  O2  . MAN B 2 .   ? 39.72083 58.96088 -9.65339  1.000 119.23140 ? 3   MAN B O2  1 
HETATM 4277 O  O3  . MAN B 2 .   ? 39.22000 56.66892 -11.37673 1.000 119.54111 ? 3   MAN B O3  1 
HETATM 4278 O  O4  . MAN B 2 .   ? 41.97039 55.82421 -11.72716 1.000 121.79114 ? 3   MAN B O4  1 
HETATM 4279 O  O5  . MAN B 2 .   ? 42.24604 57.80170 -8.63783  1.000 119.71625 ? 3   MAN B O5  1 
HETATM 4280 O  O6  . MAN B 2 .   ? 44.28792 58.53900 -10.06472 1.000 115.86572 ? 3   MAN B O6  1 
HETATM 4281 C  C1  . MAN B 2 .   ? 38.59854 56.15246 -12.49145 1.000 117.04202 ? 4   MAN B C1  1 
HETATM 4282 C  C2  . MAN B 2 .   ? 38.49395 56.38279 -14.07926 1.000 115.87922 ? 4   MAN B C2  1 
HETATM 4283 C  C3  . MAN B 2 .   ? 37.03388 56.58627 -14.64846 1.000 111.91893 ? 4   MAN B C3  1 
HETATM 4284 C  C4  . MAN B 2 .   ? 35.93730 56.97002 -13.57180 1.000 120.13288 ? 4   MAN B C4  1 
HETATM 4285 C  C5  . MAN B 2 .   ? 36.54921 57.31449 -12.17331 1.000 114.24763 ? 4   MAN B C5  1 
HETATM 4286 C  C6  . MAN B 2 .   ? 35.49948 57.54073 -11.06670 1.000 105.98776 ? 4   MAN B C6  1 
HETATM 4287 O  O2  . MAN B 2 .   ? 39.08212 55.30491 -14.82162 1.000 115.19792 ? 4   MAN B O2  1 
HETATM 4288 O  O3  . MAN B 2 .   ? 36.58934 55.48874 -15.51794 1.000 95.57859  ? 4   MAN B O3  1 
HETATM 4289 O  O4  . MAN B 2 .   ? 35.14192 58.06777 -14.05298 1.000 123.85420 ? 4   MAN B O4  1 
HETATM 4290 O  O5  . MAN B 2 .   ? 37.37019 56.21087 -11.78388 1.000 114.53894 ? 4   MAN B O5  1 
HETATM 4291 O  O6  . MAN B 2 .   ? 35.38490 58.94586 -10.77838 1.000 97.67743  ? 4   MAN B O6  1 
HETATM 4292 C  C1  . PPI C 3 .   ? 27.13259 66.94377 11.65900  1.000 24.37486  ? 601 PPI A C1  1 
HETATM 4293 C  C2  . PPI C 3 .   ? 27.17433 68.26767 12.71079  1.000 28.77676  ? 601 PPI A C2  1 
HETATM 4294 C  C3  . PPI C 3 .   ? 25.75207 68.64925 13.02542  1.000 29.19800  ? 601 PPI A C3  1 
HETATM 4295 O  O1  . PPI C 3 .   ? 26.21757 67.10673 10.78156  1.000 27.44245  ? 601 PPI A O1  1 
HETATM 4296 O  O2  . PPI C 3 .   ? 28.32394 66.54548 11.41367  1.000 40.09837  ? 601 PPI A O2  1 
HETATM 4297 C  C1  . 760 D 4 .   ? 31.89475 63.93635 9.84083   1.000 66.57036  ? 602 760 A C1  1 
HETATM 4298 C  C2  . 760 D 4 .   ? 30.77190 63.90660 8.80683   1.000 63.09562  ? 602 760 A C2  1 
HETATM 4299 C  C3  . 760 D 4 .   ? 30.17915 65.28650 8.60803   1.000 56.74123  ? 602 760 A C3  1 
HETATM 4300 C  C4  . 760 D 4 .   ? 31.21910 66.30083 8.13713   1.000 58.57183  ? 602 760 A C4  1 
HETATM 4301 C  C5  . 760 D 4 .   ? 33.36520 67.36855 8.84594   1.000 59.97108  ? 602 760 A C5  1 
HETATM 4302 C  C6  . 760 D 4 .   ? 35.57965 68.31102 9.65828   1.000 54.47238  ? 602 760 A C6  1 
HETATM 4303 C  C7  . 760 D 4 .   ? 36.71153 68.15200 10.41411  1.000 57.49514  ? 602 760 A C7  1 
HETATM 4304 C  C8  . 760 D 4 .   ? 36.91901 66.98555 11.19207  1.000 60.66821  ? 602 760 A C8  1 
HETATM 4305 C  C9  . 760 D 4 .   ? 35.98697 65.97934 11.18683  1.000 60.55424  ? 602 760 A C9  1 
HETATM 4306 N  N10 . 760 D 4 .   ? 33.92568 65.05787 10.44262  1.000 59.24011  ? 602 760 A N10 1 
HETATM 4307 C  C11 . 760 D 4 .   ? 32.80778 65.14879 9.72044   1.000 66.67463  ? 602 760 A C11 1 
HETATM 4308 C  C12 . 760 D 4 .   ? 32.48956 66.28874 8.90082   1.000 64.27482  ? 602 760 A C12 1 
HETATM 4309 C  C13 . 760 D 4 .   ? 34.57901 67.29500 9.61712   1.000 58.25280  ? 602 760 A C13 1 
HETATM 4310 C  C14 . 760 D 4 .   ? 34.80246 66.12369 10.39612  1.000 60.06701  ? 602 760 A C14 1 
HETATM 4311 N  N15 . 760 D 4 .   ? 33.11959 68.54169 8.07586   1.000 58.50016  ? 602 760 A N15 1 
HETATM 4312 C  C17 . 760 D 4 .   ? 32.86801 69.90738 8.65776   1.000 57.20973  ? 602 760 A C17 1 
HETATM 4313 C  C18 . 760 D 4 .   ? 31.47609 70.14986 9.24622   1.000 66.35517  ? 602 760 A C18 1 
HETATM 4314 C  C19 . 760 D 4 .   ? 30.74567 71.31976 8.96568   1.000 65.44544  ? 602 760 A C19 1 
HETATM 4315 C  C20 . 760 D 4 .   ? 29.47783 71.52011 9.50611   1.000 66.35096  ? 602 760 A C20 1 
HETATM 4316 C  C21 . 760 D 4 .   ? 28.90186 70.56012 10.34555  1.000 69.26830  ? 602 760 A C21 1 
HETATM 4317 C  C22 . 760 D 4 .   ? 29.61150 69.39517 10.63330  1.000 66.37985  ? 602 760 A C22 1 
HETATM 4318 C  C23 . 760 D 4 .   ? 30.88109 69.19896 10.09646  1.000 67.47381  ? 602 760 A C23 1 
HETATM 4319 C  C1  . NAG E 5 .   ? 35.52610 69.88575 -13.01042 0.958 85.22837  ? 603 NAG A C1  1 
HETATM 4320 C  C2  . NAG E 5 .   ? 34.95904 69.49905 -14.39811 0.958 93.39228  ? 603 NAG A C2  1 
HETATM 4321 C  C3  . NAG E 5 .   ? 35.73361 70.18240 -15.51704 0.958 99.82150  ? 603 NAG A C3  1 
HETATM 4322 C  C4  . NAG E 5 .   ? 35.66463 71.68553 -15.30698 0.958 104.87251 ? 603 NAG A C4  1 
HETATM 4323 C  C5  . NAG E 5 .   ? 36.52077 72.05031 -14.09794 0.958 99.68609  ? 603 NAG A C5  1 
HETATM 4324 C  C6  . NAG E 5 .   ? 36.02788 73.26280 -13.33652 0.958 90.82454  ? 603 NAG A C6  1 
HETATM 4325 C  C7  . NAG E 5 .   ? 33.82920 67.31478 -14.54147 0.958 89.89999  ? 603 NAG A C7  1 
HETATM 4326 C  C8  . NAG E 5 .   ? 34.01114 65.83446 -14.72341 0.958 79.81429  ? 603 NAG A C8  1 
HETATM 4327 N  N2  . NAG E 5 .   ? 34.94841 68.05303 -14.57022 0.958 95.03156  ? 603 NAG A N2  1 
HETATM 4328 O  O3  . NAG E 5 .   ? 35.20052 69.83645 -16.79388 0.958 94.31282  ? 603 NAG A O3  1 
HETATM 4329 O  O4  . NAG E 5 .   ? 36.12625 72.37379 -16.46547 0.958 107.52214 ? 603 NAG A O4  1 
HETATM 4330 O  O5  . NAG E 5 .   ? 36.62040 70.96070 -13.15456 0.958 96.58882  ? 603 NAG A O5  1 
HETATM 4331 O  O6  . NAG E 5 .   ? 37.09853 74.13914 -13.00737 0.958 77.82900  ? 603 NAG A O6  1 
HETATM 4332 O  O7  . NAG E 5 .   ? 32.71756 67.81950 -14.38456 0.958 90.68313  ? 603 NAG A O7  1 
HETATM 4333 S  S   . SO4 F 6 .   ? 42.29258 42.29258 0.00000   0.5   173.66550 ? 604 SO4 A S   1 
HETATM 4334 O  O1  . SO4 F 6 .   ? 43.24504 42.33395 -1.10772  1.000 175.12347 ? 604 SO4 A O1  1 
HETATM 4335 O  O2  . SO4 F 6 .   ? 40.92865 42.46376 -0.49610  1.000 171.76681 ? 604 SO4 A O2  1 
HETATM 4336 O  O3  . SO4 F 6 .   ? 42.47460 40.93269 0.50342   1.000 171.76409 ? 604 SO4 A O3  1 
HETATM 4337 O  O4  . SO4 F 6 .   ? 42.32706 43.24887 1.10467   1.000 175.12562 ? 604 SO4 A O4  1 
HETATM 4338 CL CL  . CL  G 7 .   ? 32.97463 32.97463 0.00000   0.50  132.83246 ? 605 CL  A CL  1 
HETATM 4339 O  O   . HOH H 8 .   ? 18.56243 71.13412 28.17576  1.000 54.42966  ? 701 HOH A O   1 
HETATM 4340 O  O   . HOH H 8 .   ? 30.30947 75.28473 14.66728  1.000 84.47116  ? 702 HOH A O   1 
HETATM 4341 O  O   . HOH H 8 .   ? 22.55112 40.37458 23.60343  1.000 42.80696  ? 703 HOH A O   1 
HETATM 4342 O  O   . HOH H 8 .   ? 35.34388 62.81508 11.93369  1.000 52.97423  ? 704 HOH A O   1 
HETATM 4343 O  O   . HOH H 8 .   ? 4.13188  88.40760 -7.58021  1.000 54.84707  ? 705 HOH A O   1 
HETATM 4344 O  O   . HOH H 8 .   ? 35.28455 58.01785 10.40553  1.000 34.77458  ? 706 HOH A O   1 
HETATM 4345 O  O   . HOH H 8 .   ? 36.90860 45.65575 25.18177  1.000 86.17742  ? 707 HOH A O   1 
HETATM 4346 O  O   . HOH H 8 .   ? 20.46067 84.12641 5.75628   1.000 53.59047  ? 708 HOH A O   1 
HETATM 4347 O  O   . HOH H 8 .   ? 28.13127 57.76015 16.67971  1.000 41.35419  ? 709 HOH A O   1 
HETATM 4348 O  O   . HOH H 8 .   ? 15.08887 48.77544 23.62052  1.000 41.52106  ? 710 HOH A O   1 
HETATM 4349 O  O   . HOH H 8 .   ? 19.54841 64.70068 -11.56771 1.000 40.22491  ? 711 HOH A O   1 
HETATM 4350 O  O   . HOH H 8 .   ? 6.51394  54.75484 -2.38061  1.000 59.03773  ? 712 HOH A O   1 
HETATM 4351 O  O   . HOH H 8 .   ? 28.90517 33.89529 0.98939   1.000 56.27999  ? 713 HOH A O   1 
HETATM 4352 O  O   . HOH H 8 .   ? 29.67858 64.19732 4.83687   1.000 33.86444  ? 714 HOH A O   1 
HETATM 4353 O  O   . HOH H 8 .   ? 29.80829 60.49882 14.99439  1.000 21.45615  ? 715 HOH A O   1 
HETATM 4354 O  O   . HOH H 8 .   ? 22.96734 78.17571 20.42493  1.000 65.73864  ? 716 HOH A O   1 
HETATM 4355 O  O   . HOH H 8 .   ? 28.66751 56.98574 -0.74414  1.000 35.13270  ? 717 HOH A O   1 
HETATM 4356 O  O   . HOH H 8 .   ? 24.15045 41.58399 -17.93369 1.000 70.12268  ? 718 HOH A O   1 
HETATM 4357 O  O   . HOH H 8 .   ? 12.43293 75.35673 -0.00429  1.000 38.71503  ? 719 HOH A O   1 
HETATM 4358 O  O   . HOH H 8 .   ? 43.70496 70.51006 40.36130  1.000 61.25057  ? 720 HOH A O   1 
HETATM 4359 O  O   . HOH H 8 .   ? 8.48141  73.24940 -4.32158  1.000 30.98235  ? 721 HOH A O   1 
HETATM 4360 O  O   . HOH H 8 .   ? 25.39056 35.31120 25.44903  1.000 38.56517  ? 722 HOH A O   1 
HETATM 4361 O  O   . HOH H 8 .   ? 1.44791  46.59155 12.32286  1.000 71.57155  ? 723 HOH A O   1 
HETATM 4362 O  O   . HOH H 8 .   ? 46.75314 71.76828 32.82585  1.000 71.78140  ? 724 HOH A O   1 
HETATM 4363 O  O   . HOH H 8 .   ? 28.35967 61.98247 7.46361   1.000 33.97670  ? 725 HOH A O   1 
HETATM 4364 O  O   . HOH H 8 .   ? 42.90663 69.69853 27.18078  1.000 42.53181  ? 726 HOH A O   1 
HETATM 4365 O  O   . HOH H 8 .   ? 7.69887  76.97899 13.66751  1.000 48.86728  ? 727 HOH A O   1 
HETATM 4366 O  O   . HOH H 8 .   ? 21.60476 39.32758 15.65929  1.000 61.12186  ? 728 HOH A O   1 
HETATM 4367 O  O   . HOH H 8 .   ? 19.18476 74.36672 -6.39524  1.000 49.69024  ? 729 HOH A O   1 
HETATM 4368 O  O   . HOH H 8 .   ? 18.20507 77.51646 4.65350   1.000 35.03377  ? 730 HOH A O   1 
HETATM 4369 O  O   . HOH H 8 .   ? 32.55622 49.88127 2.49107   1.000 36.14997  ? 731 HOH A O   1 
HETATM 4370 O  O   . HOH H 8 .   ? 24.32788 59.84720 1.22911   1.000 39.47653  ? 732 HOH A O   1 
HETATM 4371 O  O   . HOH H 8 .   ? 44.29704 73.62322 22.19636  1.000 54.46009  ? 733 HOH A O   1 
HETATM 4372 O  O   . HOH H 8 .   ? 30.25401 64.21721 24.94211  1.000 43.89234  ? 734 HOH A O   1 
HETATM 4373 O  O   . HOH H 8 .   ? 34.46351 66.19316 17.99827  1.000 45.28733  ? 735 HOH A O   1 
HETATM 4374 O  O   . HOH H 8 .   ? 31.88285 57.29804 -1.52370  1.000 47.86163  ? 736 HOH A O   1 
HETATM 4375 O  O   . HOH H 8 .   ? 20.66095 66.86744 -10.48778 1.000 45.07633  ? 737 HOH A O   1 
HETATM 4376 O  O   . HOH H 8 .   ? 17.84141 47.24581 17.64759  1.000 38.76434  ? 738 HOH A O   1 
HETATM 4377 O  O   . HOH H 8 .   ? 26.46514 70.22497 39.48765  1.000 28.31196  ? 739 HOH A O   1 
HETATM 4378 O  O   . HOH H 8 .   ? 13.90082 71.10781 -7.95885  1.000 41.81542  ? 740 HOH A O   1 
HETATM 4379 O  O   . HOH H 8 .   ? 23.24670 72.56330 40.50750  0.50  78.96083  ? 741 HOH A O   1 
HETATM 4380 O  O   . HOH H 8 .   ? 26.89027 66.27909 32.85576  1.000 46.86715  ? 742 HOH A O   1 
HETATM 4381 O  O   . HOH H 8 .   ? 23.18095 54.73917 30.33070  1.000 36.68367  ? 743 HOH A O   1 
HETATM 4382 O  O   . HOH H 8 .   ? 38.65470 51.38026 1.90052   1.000 45.68850  ? 744 HOH A O   1 
HETATM 4383 O  O   . HOH H 8 .   ? 17.96416 45.76650 5.86798   1.000 44.71097  ? 745 HOH A O   1 
HETATM 4384 O  O   . HOH H 8 .   ? 16.76374 78.03231 6.98024   1.000 30.65455  ? 746 HOH A O   1 
HETATM 4385 O  O   . HOH H 8 .   ? 17.32399 52.74067 -23.55191 1.000 43.74952  ? 747 HOH A O   1 
HETATM 4386 O  O   . HOH H 8 .   ? 13.61224 74.47973 5.24416   1.000 38.26430  ? 748 HOH A O   1 
HETATM 4387 O  O   . HOH H 8 .   ? 31.71103 69.02164 5.43048   1.000 38.72967  ? 749 HOH A O   1 
HETATM 4388 O  O   . HOH H 8 .   ? 25.64990 74.81224 0.80407   1.000 35.48450  ? 750 HOH A O   1 
HETATM 4389 O  O   . HOH H 8 .   ? 14.09447 68.28620 -9.37370  1.000 21.79085  ? 751 HOH A O   1 
HETATM 4390 O  O   . HOH H 8 .   ? 5.34354  49.92615 15.18488  1.000 61.64216  ? 752 HOH A O   1 
HETATM 4391 O  O   . HOH H 8 .   ? 26.24636 64.38296 37.03338  1.000 55.60572  ? 753 HOH A O   1 
HETATM 4392 O  O   . HOH H 8 .   ? 27.95895 45.32620 32.64242  1.000 54.67817  ? 754 HOH A O   1 
HETATM 4393 O  O   . HOH H 8 .   ? 24.78156 67.79679 5.85226   1.000 27.85671  ? 755 HOH A O   1 
HETATM 4394 O  O   . HOH H 8 .   ? 23.41383 72.64741 -4.86012  1.000 51.37083  ? 756 HOH A O   1 
HETATM 4395 O  O   . HOH H 8 .   ? 21.92946 48.70755 23.97001  1.000 45.09098  ? 757 HOH A O   1 
HETATM 4396 O  O   . HOH H 8 .   ? 31.21330 41.08082 23.01921  1.000 50.80076  ? 758 HOH A O   1 
HETATM 4397 O  O   . HOH H 8 .   ? 21.09309 74.86260 13.35993  1.000 41.23973  ? 759 HOH A O   1 
HETATM 4398 O  O   . HOH H 8 .   ? 26.57007 67.01869 -1.91849  1.000 36.89191  ? 760 HOH A O   1 
HETATM 4399 O  O   . HOH H 8 .   ? 37.23278 60.82340 11.16144  1.000 47.82991  ? 761 HOH A O   1 
HETATM 4400 O  O   . HOH H 8 .   ? 21.74399 78.60327 5.15243   1.000 44.39712  ? 762 HOH A O   1 
HETATM 4401 O  O   . HOH H 8 .   ? 39.28019 63.86048 9.73972   1.000 40.19644  ? 763 HOH A O   1 
HETATM 4402 O  O   . HOH H 8 .   ? 32.61597 73.46883 11.24614  1.000 42.71177  ? 764 HOH A O   1 
HETATM 4403 O  O   . HOH H 8 .   ? 11.24268 55.99737 -8.29055  1.000 59.47781  ? 765 HOH A O   1 
HETATM 4404 O  O   . HOH H 8 .   ? 30.08186 61.33003 24.68015  1.000 46.98188  ? 766 HOH A O   1 
HETATM 4405 O  O   . HOH H 8 .   ? 15.17292 79.69543 5.08646   1.000 50.55375  ? 767 HOH A O   1 
HETATM 4406 O  O   . HOH H 8 .   ? 32.61281 71.41002 2.23929   1.000 46.46053  ? 768 HOH A O   1 
HETATM 4407 O  O   . HOH H 8 .   ? 32.51751 66.01163 23.94321  1.000 39.37710  ? 769 HOH A O   1 
HETATM 4408 O  O   . HOH H 8 .   ? 47.27208 74.56822 34.24873  1.000 53.01716  ? 770 HOH A O   1 
HETATM 4409 O  O   . HOH H 8 .   ? 10.04363 63.71963 -2.47762  1.000 21.40607  ? 771 HOH A O   1 
HETATM 4410 O  O   . HOH H 8 .   ? 21.09455 72.06772 -6.15932  1.000 32.76186  ? 772 HOH A O   1 
HETATM 4411 O  O   . HOH H 8 .   ? 19.90691 66.67015 25.89840  1.000 62.78921  ? 773 HOH A O   1 
HETATM 4412 O  O   . HOH H 8 .   ? 12.50882 92.57062 -5.97182  1.000 65.76932  ? 774 HOH A O   1 
HETATM 4413 O  O   . HOH H 8 .   ? 12.96385 69.42140 19.05877  1.000 105.56127 ? 775 HOH A O   1 
HETATM 4414 O  O   . HOH H 8 .   ? 15.69389 43.45421 17.55635  1.000 66.18130  ? 776 HOH A O   1 
HETATM 4415 O  O   . HOH H 8 .   ? -2.98409 83.26037 -3.12922  1.000 40.18638  ? 777 HOH A O   1 
HETATM 4416 O  O   . HOH H 8 .   ? 26.15708 60.97654 -5.70975  1.000 40.18694  ? 778 HOH A O   1 
HETATM 4417 O  O   . HOH H 8 .   ? 21.46184 56.82854 30.29672  1.000 35.08449  ? 779 HOH A O   1 
HETATM 4418 O  O   . HOH H 8 .   ? 22.49061 87.48030 31.09890  1.000 69.12642  ? 780 HOH A O   1 
HETATM 4419 O  O   . HOH H 8 .   ? 18.58228 75.53583 14.48496  1.000 45.11311  ? 781 HOH A O   1 
HETATM 4420 O  O   . HOH H 8 .   ? 33.65271 52.28807 -5.52559  1.000 57.72825  ? 782 HOH A O   1 
HETATM 4421 O  O   . HOH H 8 .   ? 5.21576  67.42607 -2.49765  1.000 61.51014  ? 783 HOH A O   1 
HETATM 4422 O  O   . HOH H 8 .   ? 15.20690 73.30602 -14.85099 1.000 39.11766  ? 784 HOH A O   1 
HETATM 4423 O  O   . HOH H 8 .   ? 12.45052 59.60345 -9.27025  1.000 49.05633  ? 785 HOH A O   1 
HETATM 4424 O  O   . HOH H 8 .   ? 35.00268 65.61799 25.32619  1.000 35.79352  ? 786 HOH A O   1 
HETATM 4425 O  O   . HOH H 8 .   ? 14.40703 63.12947 18.03170  1.000 52.78319  ? 787 HOH A O   1 
HETATM 4426 O  O   . HOH H 8 .   ? 21.47097 77.80831 39.66783  1.000 51.80276  ? 788 HOH A O   1 
HETATM 4427 O  O   . HOH H 8 .   ? 43.70684 45.38212 23.93809  1.000 67.71577  ? 789 HOH A O   1 
HETATM 4428 O  O   . HOH H 8 .   ? 47.86938 45.29699 17.46038  1.000 36.93232  ? 790 HOH A O   1 
HETATM 4429 O  O   . HOH H 8 .   ? 41.85724 54.55600 22.40170  1.000 41.52080  ? 791 HOH A O   1 
HETATM 4430 O  O   . HOH H 8 .   ? 18.12546 60.84784 30.94948  1.000 64.18275  ? 792 HOH A O   1 
HETATM 4431 O  O   . HOH H 8 .   ? 29.35695 41.50517 26.05546  1.000 48.89622  ? 793 HOH A O   1 
HETATM 4432 O  O   . HOH H 8 .   ? 31.49907 66.25264 4.66369   1.000 29.28186  ? 794 HOH A O   1 
HETATM 4433 O  O   . HOH H 8 .   ? 22.13789 87.54196 8.60639   1.000 54.52187  ? 795 HOH A O   1 
HETATM 4434 O  O   . HOH H 8 .   ? 25.18323 85.61585 28.09711  1.000 53.84632  ? 796 HOH A O   1 
HETATM 4435 O  O   . HOH H 8 .   ? 8.52010  61.20656 -2.66394  1.000 56.99331  ? 797 HOH A O   1 
HETATM 4436 O  O   . HOH H 8 .   ? 31.32837 36.96151 24.60710  1.000 52.53791  ? 798 HOH A O   1 
HETATM 4437 O  O   . HOH H 8 .   ? 7.60495  50.88343 28.98884  1.000 59.52211  ? 799 HOH A O   1 
HETATM 4438 O  O   . HOH H 8 .   ? 31.59779 75.68256 11.89736  1.000 51.43646  ? 800 HOH A O   1 
HETATM 4439 O  O   . HOH H 8 .   ? 33.41003 58.56471 28.53597  1.000 39.75415  ? 801 HOH A O   1 
HETATM 4440 O  O   . HOH H 8 .   ? 33.98275 66.19932 -10.95054 1.000 53.10975  ? 802 HOH A O   1 
HETATM 4441 O  O   . HOH H 8 .   ? 37.74099 69.75015 -5.50770  1.000 52.19531  ? 803 HOH A O   1 
HETATM 4442 O  O   . HOH H 8 .   ? 31.95489 78.52528 9.62422   1.000 75.64796  ? 804 HOH A O   1 
HETATM 4443 O  O   . HOH H 8 .   ? 5.26482  71.40827 1.78168   1.000 58.02347  ? 805 HOH A O   1 
HETATM 4444 O  O   . HOH H 8 .   ? 8.68610  83.47822 -10.16321 1.000 46.96582  ? 806 HOH A O   1 
HETATM 4445 O  O   . HOH H 8 .   ? 7.03686  67.77838 -6.70316  1.000 51.54229  ? 807 HOH A O   1 
HETATM 4446 O  O   . HOH H 8 .   ? 49.704   48.440   1.920     1.000 57.41558  ? 808 HOH A O   1 
HETATM 4447 O  O   . HOH H 8 .   ? 13.71610 68.21680 28.09755  1.000 64.11347  ? 809 HOH A O   1 
HETATM 4448 O  O   . HOH H 8 .   ? 32.87390 59.23588 -15.41613 1.000 48.35234  ? 810 HOH A O   1 
HETATM 4449 O  O   . HOH H 8 .   ? 18.95690 47.34791 35.50725  1.000 50.76962  ? 811 HOH A O   1 
HETATM 4450 O  O   . HOH H 8 .   ? 22.88232 40.55632 29.44628  1.000 56.84467  ? 812 HOH A O   1 
HETATM 4451 O  O   . HOH H 8 .   ? 4.42016  75.37393 1.65721   1.000 55.69397  ? 813 HOH A O   1 
HETATM 4452 O  O   . HOH H 8 .   ? 14.24796 70.38729 21.84068  1.000 44.64784  ? 814 HOH A O   1 
HETATM 4453 O  O   . HOH H 8 .   ? 7.72226  60.22176 -5.28199  1.000 63.47240  ? 815 HOH A O   1 
HETATM 4454 O  O   . HOH H 8 .   ? 6.893    76.777   -11.883   1.000 43.32213  ? 816 HOH A O   1 
HETATM 4455 O  O   . HOH H 8 .   ? 40.06053 45.93663 0.33758   1.000 50.40118  ? 817 HOH A O   1 
HETATM 4456 O  O   . HOH H 8 .   ? 33.49639 37.63325 1.31358   1.000 64.97012  ? 818 HOH A O   1 
HETATM 4457 O  O   . HOH H 8 .   ? 45.17110 54.25261 20.99279  1.000 62.18668  ? 819 HOH A O   1 
HETATM 4458 O  O   . HOH H 8 .   ? 38.00780 44.12184 22.91006  1.000 46.77221  ? 820 HOH A O   1 
HETATM 4459 O  O   . HOH H 8 .   ? 44.55324 67.52744 27.27579  1.000 57.04990  ? 821 HOH A O   1 
HETATM 4460 O  O   . HOH H 8 .   ? 7.07887  49.82519 26.89323  1.000 50.15411  ? 822 HOH A O   1 
HETATM 4461 O  O   . HOH H 8 .   ? 40.890   46.909   33.795    1.000 59.50857  ? 823 HOH A O   1 
HETATM 4462 O  O   . HOH H 8 .   ? 35.59254 60.84151 28.78162  1.000 48.42109  ? 824 HOH A O   1 
HETATM 4463 O  O   . HOH H 8 .   ? 16.72265 87.20631 14.86543  1.000 73.09031  ? 825 HOH A O   1 
HETATM 4464 O  O   . HOH H 8 .   ? 14.872   76.316   40.355    1.000 63.10139  ? 826 HOH A O   1 
HETATM 4465 O  O   . HOH H 8 .   ? 38.42023 56.22686 3.75087   1.000 41.43575  ? 827 HOH A O   1 
HETATM 4466 O  O   . HOH H 8 .   ? 12.31966 45.31176 22.86282  1.000 55.82240  ? 828 HOH A O   1 
HETATM 4467 O  O   . HOH H 8 .   ? 37.99555 81.72013 9.99101   1.000 58.22380  ? 829 HOH A O   1 
HETATM 4468 O  O   . HOH H 8 .   ? 20.96207 84.32226 13.65833  1.000 74.58370  ? 830 HOH A O   1 
HETATM 4469 O  O   . HOH H 8 .   ? 42.90672 51.44493 23.73454  1.000 43.55053  ? 831 HOH A O   1 
HETATM 4470 O  O   . HOH H 8 .   ? 20.678   44.273   35.169    1.000 57.04093  ? 832 HOH A O   1 
HETATM 4471 O  O   . HOH H 8 .   ? 33.94610 38.85015 25.31973  1.000 59.89436  ? 833 HOH A O   1 
HETATM 4472 O  O   . HOH H 8 .   ? 0.68852  57.48604 25.37977  1.000 55.87034  ? 834 HOH A O   1 
HETATM 4473 O  O   . HOH H 8 .   ? 3.16217  55.99021 23.33174  1.000 60.86865  ? 835 HOH A O   1 
HETATM 4474 O  O   . HOH H 8 .   ? 44.46827 49.52277 23.31450  1.000 45.19237  ? 836 HOH A O   1 
HETATM 4475 O  O   . HOH H 8 .   ? 11.49890 63.69012 13.17261  1.000 63.06943  ? 837 HOH A O   1 
HETATM 4476 O  O   . HOH H 8 .   ? 16.11256 69.65828 26.81347  1.000 50.14971  ? 838 HOH A O   1 
HETATM 4477 O  O   . HOH H 8 .   ? 5.33908  49.30525 25.43155  1.000 60.29450  ? 839 HOH A O   1 
HETATM 4478 O  O   . HOH H 8 .   ? 32.50265 78.49016 6.73271   1.000 55.88422  ? 840 HOH A O   1 
HETATM 4479 O  O   . HOH H 8 .   ? 17.85835 72.53372 25.45057  1.000 48.15789  ? 841 HOH A O   1 
HETATM 4480 O  O   . HOH H 8 .   ? 19.74352 83.86143 17.71863  1.000 80.53253  ? 842 HOH A O   1 
HETATM 4481 O  O   . HOH H 8 .   ? 39.70305 60.44036 31.99354  1.000 46.04582  ? 843 HOH A O   1 
HETATM 4482 O  O   . HOH H 8 .   ? 7.18346  62.70319 -6.23172  1.000 46.88839  ? 844 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ASP A 3   ? 1.30877 1.14881 0.63637 0.53477  -0.12193 -0.30918 3   ASP A N   
2    C CA  . ASP A 3   ? 1.42707 1.30242 0.77810 0.53855  -0.09638 -0.29416 3   ASP A CA  
3    C C   . ASP A 3   ? 1.53915 1.38529 0.92689 0.51919  -0.10791 -0.29913 3   ASP A C   
4    O O   . ASP A 3   ? 1.53767 1.35296 0.94418 0.49473  -0.12786 -0.30553 3   ASP A O   
5    C CB  . ASP A 3   ? 1.44488 1.38112 0.81760 0.52554  -0.06628 -0.26583 3   ASP A CB  
6    C CG  . ASP A 3   ? 1.52421 1.50395 0.92146 0.53040  -0.03936 -0.24857 3   ASP A CG  
7    O OD1 . ASP A 3   ? 1.56550 1.59093 0.95148 0.54626  -0.01615 -0.23406 3   ASP A OD1 
8    O OD2 . ASP A 3   ? 1.53739 1.50722 0.96635 0.51803  -0.04142 -0.24854 3   ASP A OD2 
9    N N   . ARG A 4   ? 1.56565 1.42221 0.96372 0.53077  -0.09545 -0.29561 4   ARG A N   
10   C CA  . ARG A 4   ? 1.61928 1.45136 1.05084 0.51504  -0.10284 -0.29775 4   ARG A CA  
11   C C   . ARG A 4   ? 1.59576 1.45472 1.07414 0.48266  -0.09044 -0.27856 4   ARG A C   
12   O O   . ARG A 4   ? 1.63875 1.47699 1.14744 0.46595  -0.09694 -0.27897 4   ARG A O   
13   C CB  . ARG A 4   ? 1.69307 1.53475 1.11967 0.53968  -0.09068 -0.29739 4   ARG A CB  
14   C CG  . ARG A 4   ? 1.75251 1.55790 1.20248 0.53118  -0.10193 -0.30361 4   ARG A CG  
15   C CD  . ARG A 4   ? 1.88759 1.63046 1.30641 0.54806  -0.12963 -0.32911 4   ARG A CD  
16   N NE  . ARG A 4   ? 1.93992 1.64684 1.38180 0.53890  -0.13964 -0.33286 4   ARG A NE  
17   C CZ  . ARG A 4   ? 1.94665 1.61247 1.41268 0.51092  -0.15977 -0.33751 4   ARG A CZ  
18   N NH1 . ARG A 4   ? 1.90393 1.56063 1.37523 0.48961  -0.17307 -0.34005 4   ARG A NH1 
19   N NH2 . ARG A 4   ? 1.96907 1.60385 1.45510 0.50430  -0.16651 -0.33854 4   ARG A NH2 
20   N N   . LEU A 5   ? 1.45424 1.35686 0.93800 0.47367  -0.07321 -0.26161 5   LEU A N   
21   C CA  . LEU A 5   ? 1.09708 1.03031 0.62186 0.44636  -0.05870 -0.24218 5   LEU A CA  
22   C C   . LEU A 5   ? 1.10070 1.03426 0.62830 0.42575  -0.06523 -0.23876 5   LEU A C   
23   O O   . LEU A 5   ? 1.12192 1.08665 0.67699 0.40603  -0.05066 -0.22106 5   LEU A O   
24   C CB  . LEU A 5   ? 1.01257 1.00681 0.54915 0.45313  -0.02732 -0.21956 5   LEU A CB  
25   C CG  . LEU A 5   ? 1.03759 1.03913 0.57142 0.47607  -0.01929 -0.22120 5   LEU A CG  
26   C CD1 . LEU A 5   ? 1.03711 1.10402 0.58602 0.48092  0.01047  -0.19744 5   LEU A CD1 
27   C CD2 . LEU A 5   ? 0.98703 0.95623 0.54684 0.46565  -0.03018 -0.22774 5   LEU A CD2 
28   N N   . VAL A 6   ? 1.02083 0.92057 0.52085 0.42998  -0.08759 -0.25508 6   VAL A N   
29   C CA  . VAL A 6   ? 1.10388 0.99776 0.60864 0.40972  -0.09873 -0.25403 6   VAL A CA  
30   C C   . VAL A 6   ? 1.15375 1.00593 0.68606 0.38753  -0.12295 -0.26566 6   VAL A C   
31   O O   . VAL A 6   ? 1.23861 1.04871 0.76529 0.39297  -0.14342 -0.28304 6   VAL A O   
32   C CB  . VAL A 6   ? 1.05631 0.93870 0.51862 0.42514  -0.11108 -0.26409 6   VAL A CB  
33   C CG1 . VAL A 6   ? 1.07054 0.99809 0.50867 0.44418  -0.08495 -0.24898 6   VAL A CG1 
34   C CG2 . VAL A 6   ? 1.23986 1.07385 0.67744 0.44192  -0.13638 -0.28882 6   VAL A CG2 
35   N N   . VAL A 7   ? 1.03137 0.89480 0.59396 0.36224  -0.12101 -0.25548 7   VAL A N   
36   C CA  . VAL A 7   ? 1.05080 0.87881 0.64079 0.33941  -0.14489 -0.26495 7   VAL A CA  
37   C C   . VAL A 7   ? 1.05572 0.88445 0.64246 0.32673  -0.15796 -0.26512 7   VAL A C   
38   O O   . VAL A 7   ? 1.00112 0.86368 0.57752 0.32755  -0.14227 -0.25152 7   VAL A O   
39   C CB  . VAL A 7   ? 1.08201 0.91939 0.71537 0.32062  -0.13336 -0.25388 7   VAL A CB  
40   C CG1 . VAL A 7   ? 1.12176 1.00341 0.76724 0.31072  -0.11135 -0.23462 7   VAL A CG1 
41   C CG2 . VAL A 7   ? 1.09803 0.89769 0.76219 0.29772  -0.15789 -0.26294 7   VAL A CG2 
42   N N   . GLN A 8   ? 1.08130 0.87274 0.67839 0.31422  -0.18766 -0.27933 8   GLN A N   
43   C CA  . GLN A 8   ? 1.15325 0.94115 0.74762 0.30378  -0.20586 -0.28210 8   GLN A CA  
44   C C   . GLN A 8   ? 1.16751 0.96254 0.80744 0.27495  -0.20905 -0.27364 8   GLN A C   
45   O O   . GLN A 8   ? 1.28500 1.05391 0.95742 0.25727  -0.22844 -0.28070 8   GLN A O   
46   C CB  . GLN A 8   ? 1.16330 0.90935 0.74305 0.30830  -0.23775 -0.30241 8   GLN A CB  
47   C CG  . GLN A 8   ? 1.21279 0.95361 0.79205 0.29806  -0.26019 -0.30646 8   GLN A CG  
48   C CD  . GLN A 8   ? 1.25974 1.02996 0.80397 0.31206  -0.24673 -0.29741 8   GLN A CD  
49   O OE1 . GLN A 8   ? 1.23232 1.02251 0.78922 0.29855  -0.24564 -0.28638 8   GLN A OE1 
50   N NE2 . GLN A 8   ? 1.19944 0.97241 0.69937 0.33954  -0.23646 -0.30100 8   GLN A NE2 
51   N N   . THR A 9   ? 1.05014 0.88087 0.69347 0.26975  -0.19004 -0.25742 9   THR A N   
52   C CA  . THR A 9   ? 0.99476 0.83403 0.67928 0.24498  -0.19167 -0.24955 9   THR A CA  
53   C C   . THR A 9   ? 0.95900 0.79343 0.65129 0.23225  -0.21560 -0.25231 9   THR A C   
54   O O   . THR A 9   ? 1.05475 0.88177 0.71778 0.24312  -0.22842 -0.25868 9   THR A O   
55   C CB  . THR A 9   ? 0.97116 0.84920 0.65808 0.24355  -0.16242 -0.23066 9   THR A CB  
56   O OG1 . THR A 9   ? 0.98469 0.88490 0.63929 0.25236  -0.15522 -0.22099 9   THR A OG1 
57   C CG2 . THR A 9   ? 0.91312 0.80360 0.59840 0.25556  -0.13742 -0.22501 9   THR A CG2 
58   N N   . SER A 10  ? 0.83939 0.68084 0.57327 0.20964  -0.22095 -0.24640 10  SER A N   
59   C CA  . SER A 10  ? 0.91623 0.75897 0.66776 0.19590  -0.24380 -0.24643 10  SER A CA  
60   C C   . SER A 10  ? 0.90680 0.77092 0.62380 0.20685  -0.23811 -0.23694 10  SER A C   
61   O O   . SER A 10  ? 0.83977 0.70140 0.55745 0.20365  -0.25813 -0.23886 10  SER A O   
62   C CB  . SER A 10  ? 0.89439 0.75344 0.70985 0.16836  -0.23939 -0.22969 10  SER A CB  
63   O OG  . SER A 10  ? 0.87006 0.76250 0.69429 0.16451  -0.21063 -0.20568 10  SER A OG  
64   N N   . SER A 11  ? 0.91516 0.80119 0.60401 0.21902  -0.21051 -0.22466 11  SER A N   
65   C CA  . SER A 11  ? 0.91388 0.82037 0.57007 0.22804  -0.20119 -0.21080 11  SER A CA  
66   C C   . SER A 11  ? 1.04608 0.95008 0.65412 0.25154  -0.19297 -0.21378 11  SER A C   
67   O O   . SER A 11  ? 1.14242 1.05746 0.72138 0.25943  -0.18973 -0.20408 11  SER A O   
68   C CB  . SER A 11  ? 0.89398 0.83222 0.56732 0.21862  -0.17006 -0.18365 11  SER A CB  
69   O OG  . SER A 11  ? 0.95318 0.89686 0.68501 0.19484  -0.16706 -0.17360 11  SER A OG  
70   N N   . GLY A 12  ? 1.06573 0.95574 0.66502 0.26353  -0.18941 -0.22579 12  GLY A N   
71   C CA  . GLY A 12  ? 1.06402 0.95229 0.61967 0.28762  -0.18293 -0.22992 12  GLY A CA  
72   C C   . GLY A 12  ? 1.12397 1.01368 0.67452 0.30127  -0.16562 -0.23306 12  GLY A C   
73   O O   . GLY A 12  ? 1.01453 0.90424 0.59546 0.29183  -0.15869 -0.23240 12  GLY A O   
74   N N   . PRO A 13  ? 1.18663 1.07860 0.69841 0.32507  -0.15833 -0.23599 13  PRO A N   
75   C CA  . PRO A 13  ? 1.10157 0.99731 0.60710 0.34138  -0.14278 -0.23856 13  PRO A CA  
76   C C   . PRO A 13  ? 0.97387 0.91409 0.48694 0.34157  -0.10824 -0.21550 13  PRO A C   
77   O O   . PRO A 13  ? 0.90674 0.87546 0.40984 0.33888  -0.09344 -0.19743 13  PRO A O   
78   C CB  . PRO A 13  ? 1.00776 0.89143 0.46763 0.36742  -0.14976 -0.24998 13  PRO A CB  
79   C CG  . PRO A 13  ? 1.01707 0.91515 0.45583 0.36649  -0.14934 -0.23992 13  PRO A CG  
80   C CD  . PRO A 13  ? 1.19313 1.08634 0.66443 0.33946  -0.16325 -0.23608 13  PRO A CD  
81   N N   . VAL A 14  ? 0.89285 0.83838 0.42504 0.34392  -0.09632 -0.21510 14  VAL A N   
82   C CA  . VAL A 14  ? 0.89984 0.88834 0.44786 0.34193  -0.06540 -0.19365 14  VAL A CA  
83   C C   . VAL A 14  ? 0.90858 0.89946 0.45704 0.35934  -0.05631 -0.19834 14  VAL A C   
84   O O   . VAL A 14  ? 0.95811 0.91527 0.51547 0.36056  -0.07231 -0.21482 14  VAL A O   
85   C CB  . VAL A 14  ? 1.03960 1.03674 0.62699 0.31628  -0.06120 -0.18362 14  VAL A CB  
86   C CG1 . VAL A 14  ? 1.07655 1.03494 0.68807 0.30614  -0.08321 -0.20160 14  VAL A CG1 
87   C CG2 . VAL A 14  ? 1.08080 1.11649 0.68897 0.31469  -0.03339 -0.16523 14  VAL A CG2 
88   N N   . ARG A 15  ? 0.87598 0.90651 0.41550 0.37253  -0.03152 -0.18291 15  ARG A N   
89   C CA  . ARG A 15  ? 0.93527 0.97521 0.47578 0.39065  -0.02123 -0.18473 15  ARG A CA  
90   C C   . ARG A 15  ? 0.94891 1.03359 0.52446 0.37975  0.00406  -0.16233 15  ARG A C   
91   O O   . ARG A 15  ? 0.92126 1.04380 0.50483 0.36883  0.02169  -0.14100 15  ARG A O   
92   C CB  . ARG A 15  ? 1.08838 1.13819 0.58920 0.41908  -0.01558 -0.18744 15  ARG A CB  
93   C CG  . ARG A 15  ? 1.22571 1.32286 0.71796 0.41989  0.00787  -0.16426 15  ARG A CG  
94   C CD  . ARG A 15  ? 1.30470 1.43173 0.77865 0.44680  0.02545  -0.15899 15  ARG A CD  
95   N NE  . ARG A 15  ? 1.30840 1.48713 0.78692 0.44129  0.05100  -0.13165 15  ARG A NE  
96   C CZ  . ARG A 15  ? 1.29131 1.51728 0.79539 0.43988  0.07447  -0.11167 15  ARG A CZ  
97   N NH1 . ARG A 15  ? 1.26645 1.49510 0.79166 0.44579  0.07592  -0.11652 15  ARG A NH1 
98   N NH2 . ARG A 15  ? 1.26399 1.53421 0.77353 0.43156  0.09551  -0.08598 15  ARG A NH2 
99   N N   . GLY A 16  ? 0.88443 0.96315 0.48142 0.38161  0.00442  -0.16657 16  GLY A N   
100  C CA  . GLY A 16  ? 0.93846 1.05702 0.56959 0.37271  0.02499  -0.14745 16  GLY A CA  
101  C C   . GLY A 16  ? 0.99767 1.13953 0.62328 0.39564  0.03739  -0.14456 16  GLY A C   
102  O O   . GLY A 16  ? 1.07162 1.21268 0.66381 0.41922  0.03722  -0.15142 16  GLY A O   
103  N N   . ARG A 17  ? 0.85732 1.02121 0.51580 0.38963  0.04793  -0.13419 17  ARG A N   
104  C CA  . ARG A 17  ? 0.84048 1.02655 0.49818 0.41100  0.05817  -0.13167 17  ARG A CA  
105  C C   . ARG A 17  ? 0.84514 1.00360 0.51967 0.41244  0.04842  -0.14189 17  ARG A C   
106  O O   . ARG A 17  ? 0.85480 0.98712 0.54917 0.39333  0.03823  -0.14567 17  ARG A O   
107  C CB  . ARG A 17  ? 0.80661 1.05702 0.48827 0.40447  0.08275  -0.10477 17  ARG A CB  
108  C CG  . ARG A 17  ? 0.82542 1.09613 0.54992 0.37561  0.08896  -0.08858 17  ARG A CG  
109  C CD  . ARG A 17  ? 0.85713 1.18969 0.60748 0.36981  0.11010  -0.06316 17  ARG A CD  
110  N NE  . ARG A 17  ? 0.97907 1.33066 0.75753 0.33873  0.11559  -0.04554 17  ARG A NE  
111  C CZ  . ARG A 17  ? 0.97808 1.32314 0.78704 0.31920  0.11109  -0.04315 17  ARG A CZ  
112  N NH1 . ARG A 17  ? 0.90166 1.22286 0.71768 0.32730  0.10198  -0.05584 17  ARG A NH1 
113  N NH2 . ARG A 17  ? 0.98210 1.34296 0.81307 0.29209  0.11542  -0.02769 17  ARG A NH2 
114  N N   . SER A 18  ? 0.89391 1.05788 0.55930 0.43650  0.05177  -0.14598 18  SER A N   
115  C CA  . SER A 18  ? 0.90216 1.03482 0.57557 0.44326  0.04144  -0.15702 18  SER A CA  
116  C C   . SER A 18  ? 0.88439 1.06231 0.58716 0.44535  0.05814  -0.13998 18  SER A C   
117  O O   . SER A 18  ? 0.82626 1.04982 0.52602 0.45922  0.07400  -0.12872 18  SER A O   
118  C CB  . SER A 18  ? 0.99653 1.08817 0.63005 0.47204  0.02697  -0.17948 18  SER A CB  
119  O OG  . SER A 18  ? 1.07854 1.15935 0.71660 0.48749  0.02519  -0.18429 18  SER A OG  
120  N N   . VAL A 19  ? 0.85631 1.02334 0.58875 0.43099  0.05432  -0.13709 19  VAL A N   
121  C CA  . VAL A 19  ? 0.86600 1.07169 0.62754 0.43197  0.06655  -0.12210 19  VAL A CA  
122  C C   . VAL A 19  ? 0.92144 1.08828 0.68278 0.44417  0.05480  -0.13410 19  VAL A C   
123  O O   . VAL A 19  ? 0.94739 1.05730 0.69579 0.44294  0.03725  -0.15067 19  VAL A O   
124  C CB  . VAL A 19  ? 0.74257 0.98022 0.54407 0.40170  0.07486  -0.10258 19  VAL A CB  
125  C CG1 . VAL A 19  ? 0.67179 0.94887 0.47525 0.38879  0.08712  -0.08822 19  VAL A CG1 
126  C CG2 . VAL A 19  ? 0.72801 0.92063 0.54029 0.38255  0.06071  -0.11030 19  VAL A CG2 
127  N N   . THR A 20  ? 0.88926 1.08805 0.66696 0.45501  0.06416  -0.12437 20  THR A N   
128  C CA  . THR A 20  ? 0.86094 1.02939 0.63923 0.46943  0.05530  -0.13268 20  THR A CA  
129  C C   . THR A 20  ? 0.82105 1.02180 0.63990 0.45439  0.06249  -0.11474 20  THR A C   
130  O O   . THR A 20  ? 0.75315 1.00466 0.58715 0.46231  0.07514  -0.10159 20  THR A O   
131  C CB  . THR A 20  ? 0.94299 1.11554 0.69385 0.50512  0.05764  -0.14147 20  THR A CB  
132  O OG1 . THR A 20  ? 1.02796 1.16857 0.73945 0.51785  0.04911  -0.15856 20  THR A OG1 
133  C CG2 . THR A 20  ? 0.89988 1.03689 0.64938 0.52067  0.04750  -0.15034 20  THR A CG2 
134  N N   . VAL A 21  ? 0.85041 1.02243 0.68712 0.43246  0.05372  -0.11394 21  VAL A N   
135  C CA  . VAL A 21  ? 0.86854 1.06392 0.74136 0.41634  0.05753  -0.09809 21  VAL A CA  
136  C C   . VAL A 21  ? 0.84555 0.99675 0.71892 0.42560  0.04558  -0.10506 21  VAL A C   
137  O O   . VAL A 21  ? 0.85947 0.95275 0.71765 0.42494  0.03170  -0.11892 21  VAL A O   
138  C CB  . VAL A 21  ? 0.91165 1.11039 0.80417 0.38464  0.05765  -0.08980 21  VAL A CB  
139  C CG1 . VAL A 21  ? 0.87745 1.11262 0.80568 0.36845  0.06333  -0.07151 21  VAL A CG1 
140  C CG2 . VAL A 21  ? 0.96413 1.18843 0.84710 0.37736  0.06567  -0.08711 21  VAL A CG2 
141  N N   . GLN A 22  ? 0.69635 0.87422 0.58789 0.43362  0.05004  -0.09470 22  GLN A N   
142  C CA  . GLN A 22  ? 0.71512 0.85515 0.61032 0.44152  0.03958  -0.09727 22  GLN A CA  
143  C C   . GLN A 22  ? 0.91608 0.99568 0.77883 0.46239  0.02694  -0.11716 22  GLN A C   
144  O O   . GLN A 22  ? 0.94276 0.96794 0.80368 0.45832  0.01368  -0.12274 22  GLN A O   
145  C CB  . GLN A 22  ? 0.70527 0.82475 0.62194 0.41549  0.03335  -0.08968 22  GLN A CB  
146  C CG  . GLN A 22  ? 0.65126 0.82385 0.59745 0.39252  0.04310  -0.07180 22  GLN A CG  
147  C CD  . GLN A 22  ? 0.78457 0.99077 0.75360 0.39624  0.04575  -0.05777 22  GLN A CD  
148  O OE1 . GLN A 22  ? 0.89871 1.07518 0.86869 0.40471  0.03745  -0.05785 22  GLN A OE1 
149  N NE2 . GLN A 22  ? 0.57723 0.84511 0.56488 0.38970  0.05638  -0.04500 22  GLN A NE2 
150  N N   . GLY A 23  ? 0.81957 0.90791 0.65609 0.48452  0.03046  -0.12728 23  GLY A N   
151  C CA  . GLY A 23  ? 0.88672 0.91986 0.68913 0.50668  0.01755  -0.14735 23  GLY A CA  
152  C C   . GLY A 23  ? 1.07184 1.05216 0.85465 0.49475  0.00373  -0.16238 23  GLY A C   
153  O O   . GLY A 23  ? 1.11084 1.03468 0.86902 0.50768  -0.01156 -0.17904 23  GLY A O   
154  N N   . ARG A 24  ? 1.06166 1.05811 0.85474 0.47042  0.00745  -0.15721 24  ARG A N   
155  C CA  . ARG A 24  ? 1.07302 1.02325 0.85299 0.45581  -0.00640 -0.16980 24  ARG A CA  
156  C C   . ARG A 24  ? 1.04101 1.02300 0.80888 0.45166  0.00125  -0.17042 24  ARG A C   
157  O O   . ARG A 24  ? 0.90350 0.94057 0.69054 0.44116  0.01714  -0.15440 24  ARG A O   
158  C CB  . ARG A 24  ? 1.10985 1.04083 0.91862 0.42663  -0.01168 -0.16138 24  ARG A CB  
159  C CG  . ARG A 24  ? 1.26590 1.13022 1.07395 0.42380  -0.02980 -0.16905 24  ARG A CG  
160  C CD  . ARG A 24  ? 1.31716 1.15715 1.14329 0.39403  -0.03759 -0.16620 24  ARG A CD  
161  N NE  . ARG A 24  ? 1.42173 1.20854 1.25856 0.38612  -0.05101 -0.16484 24  ARG A NE  
162  C CZ  . ARG A 24  ? 1.51504 1.24077 1.33902 0.38229  -0.07048 -0.17827 24  ARG A CZ  
163  N NH1 . ARG A 24  ? 1.49885 1.20873 1.29720 0.38665  -0.08023 -0.19592 24  ARG A NH1 
164  N NH2 . ARG A 24  ? 1.57772 1.25821 1.41481 0.37307  -0.08104 -0.17278 24  ARG A NH2 
165  N N   . GLU A 25  ? 1.13011 1.07590 0.86628 0.45896  -0.01130 -0.18825 25  GLU A N   
166  C CA  . GLU A 25  ? 1.10843 1.07702 0.83049 0.45446  -0.00663 -0.18925 25  GLU A CA  
167  C C   . GLU A 25  ? 0.99400 0.95155 0.73465 0.42345  -0.01193 -0.18589 25  GLU A C   
168  O O   . GLU A 25  ? 1.05108 0.95711 0.79389 0.41197  -0.02946 -0.19570 25  GLU A O   
169  C CB  . GLU A 25  ? 1.24135 1.17626 0.92000 0.47619  -0.01952 -0.20993 25  GLU A CB  
170  C CG  . GLU A 25  ? 1.29369 1.26729 0.95175 0.48403  -0.00884 -0.20764 25  GLU A CG  
171  C CD  . GLU A 25  ? 1.35114 1.28401 0.96739 0.49754  -0.02614 -0.22878 25  GLU A CD  
172  O OE1 . GLU A 25  ? 1.34279 1.21559 0.94810 0.49675  -0.04845 -0.24586 25  GLU A OE1 
173  O OE2 . GLU A 25  ? 1.34252 1.30362 0.93736 0.50817  -0.01800 -0.22741 25  GLU A OE2 
174  N N   . VAL A 26  ? 0.79775 0.80399 0.55339 0.40954  0.00304  -0.17106 26  VAL A N   
175  C CA  . VAL A 26  ? 0.73737 0.73958 0.50654 0.38330  -0.00016 -0.16797 26  VAL A CA  
176  C C   . VAL A 26  ? 0.74392 0.76792 0.49117 0.38565  0.00448  -0.16891 26  VAL A C   
177  O O   . VAL A 26  ? 0.87439 0.94003 0.61212 0.39966  0.01907  -0.16088 26  VAL A O   
178  C CB  . VAL A 26  ? 0.78052 0.81847 0.58883 0.36226  0.01259  -0.14788 26  VAL A CB  
179  C CG1 . VAL A 26  ? 0.74904 0.77312 0.57090 0.33714  0.00656  -0.14726 26  VAL A CG1 
180  C CG2 . VAL A 26  ? 0.67037 0.69662 0.49826 0.36453  0.01101  -0.14353 26  VAL A CG2 
181  N N   . HIS A 27  ? 0.73966 0.73707 0.48016 0.37185  -0.00788 -0.17734 27  HIS A N   
182  C CA  . HIS A 27  ? 0.82145 0.83604 0.54055 0.37262  -0.00510 -0.17751 27  HIS A CA  
183  C C   . HIS A 27  ? 0.68706 0.73189 0.43064 0.34822  0.00509  -0.16179 27  HIS A C   
184  O O   . HIS A 27  ? 0.66017 0.68159 0.42165 0.32946  -0.00454 -0.16442 27  HIS A O   
185  C CB  . HIS A 27  ? 0.79183 0.75558 0.48273 0.37613  -0.02859 -0.19891 27  HIS A CB  
186  C CG  . HIS A 27  ? 0.90461 0.83926 0.56493 0.40199  -0.03924 -0.21509 27  HIS A CG  
187  N ND1 . HIS A 27  ? 0.99865 0.88150 0.63498 0.40604  -0.06395 -0.23583 27  HIS A ND1 
188  C CD2 . HIS A 27  ? 0.90638 0.85647 0.55619 0.42558  -0.02951 -0.21381 27  HIS A CD2 
189  C CE1 . HIS A 27  ? 1.05120 0.91646 0.66148 0.43153  -0.06892 -0.24718 27  HIS A CE1 
190  N NE2 . HIS A 27  ? 0.99653 0.90208 0.61404 0.44469  -0.04781 -0.23434 27  HIS A NE2 
191  N N   . VAL A 28  ? 0.67095 0.76659 0.41557 0.34829  0.02393  -0.14512 28  VAL A N   
192  C CA  . VAL A 28  ? 0.63996 0.76914 0.41036 0.32523  0.03584  -0.12693 28  VAL A CA  
193  C C   . VAL A 28  ? 0.69973 0.83501 0.44900 0.32099  0.03612  -0.12549 28  VAL A C   
194  O O   . VAL A 28  ? 0.79976 0.96108 0.52943 0.33296  0.04609  -0.11892 28  VAL A O   
195  C CB  . VAL A 28  ? 0.68156 0.86478 0.47589 0.32305  0.05600  -0.10541 28  VAL A CB  
196  C CG1 . VAL A 28  ? 0.54215 0.75444 0.36445 0.29638  0.06528  -0.08713 28  VAL A CG1 
197  C CG2 . VAL A 28  ? 0.73661 0.91351 0.54742 0.33097  0.05448  -0.10735 28  VAL A CG2 
198  N N   . TYR A 29  ? 0.73760 0.85081 0.49187 0.30405  0.02576  -0.13010 29  TYR A N   
199  C CA  . TYR A 29  ? 0.75550 0.87076 0.49011 0.29822  0.02365  -0.12852 29  TYR A CA  
200  C C   . TYR A 29  ? 0.72346 0.86842 0.48374 0.27528  0.03592  -0.10933 29  TYR A C   
201  O O   . TYR A 29  ? 0.52387 0.65388 0.30653 0.26060  0.02965  -0.11204 29  TYR A O   
202  C CB  . TYR A 29  ? 0.65253 0.71692 0.37010 0.29783  -0.00165 -0.15049 29  TYR A CB  
203  C CG  . TYR A 29  ? 0.73266 0.75859 0.43123 0.31590  -0.01824 -0.17086 29  TYR A CG  
204  C CD1 . TYR A 29  ? 0.75102 0.75120 0.46855 0.31531  -0.02589 -0.17866 29  TYR A CD1 
205  C CD2 . TYR A 29  ? 0.88333 0.89652 0.54399 0.33335  -0.02708 -0.18162 29  TYR A CD2 
206  C CE1 . TYR A 29  ? 0.87023 0.83223 0.56953 0.33070  -0.04188 -0.19625 29  TYR A CE1 
207  C CE2 . TYR A 29  ? 1.01407 0.98990 0.65585 0.35004  -0.04358 -0.20073 29  TYR A CE2 
208  C CZ  . TYR A 29  ? 1.01508 0.96456 0.67643 0.34799  -0.05120 -0.20795 29  TYR A CZ  
209  O OH  . TYR A 29  ? 1.01315 0.92249 0.65518 0.36349  -0.06841 -0.22610 29  TYR A OH  
210  N N   . THR A 30  ? 0.75943 0.94535 0.51701 0.27196  0.05291  -0.08937 30  THR A N   
211  C CA  . THR A 30  ? 0.69214 0.90657 0.47100 0.24924  0.06436  -0.06863 30  THR A CA  
212  C C   . THR A 30  ? 0.71666 0.93379 0.46968 0.24438  0.06481  -0.06067 30  THR A C   
213  O O   . THR A 30  ? 0.77577 0.99788 0.50133 0.25860  0.06714  -0.06021 30  THR A O   
214  C CB  . THR A 30  ? 0.65077 0.91202 0.45550 0.24417  0.08286  -0.04736 30  THR A CB  
215  O OG1 . THR A 30  ? 0.85214 1.12959 0.63871 0.26437  0.08962  -0.04663 30  THR A OG1 
216  C CG2 . THR A 30  ? 0.49171 0.75179 0.32772 0.24094  0.08140  -0.05017 30  THR A CG2 
217  N N   . GLY A 31  ? 0.67326 0.88213 0.44168 0.22003  0.05942  -0.05106 31  GLY A N   
218  C CA  . GLY A 31  ? 0.56245 0.77296 0.31105 0.21190  0.05925  -0.03863 31  GLY A CA  
219  C C   . GLY A 31  ? 0.62196 0.79340 0.34374 0.21768  0.03806  -0.05535 31  GLY A C   
220  O O   . GLY A 31  ? 0.73092 0.90517 0.41763 0.22606  0.03866  -0.05099 31  GLY A O   
221  N N   . ILE A 32  ? 0.65190 0.78856 0.38963 0.21309  0.01884  -0.07314 32  ILE A N   
222  C CA  . ILE A 32  ? 0.62430 0.72581 0.34326 0.21663  -0.00439 -0.08970 32  ILE A CA  
223  C C   . ILE A 32  ? 0.68082 0.77458 0.42096 0.19285  -0.01238 -0.07728 32  ILE A C   
224  O O   . ILE A 32  ? 0.67819 0.77249 0.45705 0.17389  -0.01047 -0.06983 32  ILE A O   
225  C CB  . ILE A 32  ? 0.56339 0.63256 0.29190 0.22273  -0.02181 -0.11401 32  ILE A CB  
226  C CG1 . ILE A 32  ? 0.61483 0.68660 0.31857 0.24977  -0.01503 -0.12776 32  ILE A CG1 
227  C CG2 . ILE A 32  ? 0.61384 0.64996 0.33061 0.22216  -0.04799 -0.12973 32  ILE A CG2 
228  C CD1 . ILE A 32  ? 0.64708 0.68434 0.36314 0.25416  -0.03088 -0.14880 32  ILE A CD1 
229  N N   . PRO A 33  ? 0.63461 0.72069 0.34912 0.19482  -0.02150 -0.07466 33  PRO A N   
230  C CA  . PRO A 33  ? 0.62895 0.70739 0.36318 0.17503  -0.02889 -0.06236 33  PRO A CA  
231  C C   . PRO A 33  ? 0.59880 0.65079 0.35869 0.16786  -0.05082 -0.07834 33  PRO A C   
232  O O   . PRO A 33  ? 0.68359 0.71661 0.42860 0.17939  -0.06867 -0.09812 33  PRO A O   
233  C CB  . PRO A 33  ? 0.65181 0.73060 0.34487 0.18413  -0.03208 -0.05479 33  PRO A CB  
234  C CG  . PRO A 33  ? 0.60881 0.68180 0.26223 0.20915  -0.03810 -0.07394 33  PRO A CG  
235  C CD  . PRO A 33  ? 0.62669 0.71177 0.28994 0.21718  -0.02459 -0.08148 33  PRO A CD  
236  N N   . TYR A 34  ? 0.51701 0.56845 0.31569 0.14877  -0.04979 -0.06957 34  TYR A N   
237  C CA  . TYR A 34  ? 0.45966 0.49302 0.28750 0.14038  -0.06763 -0.08008 34  TYR A CA  
238  C C   . TYR A 34  ? 0.45360 0.48311 0.29004 0.13154  -0.07613 -0.07057 34  TYR A C   
239  O O   . TYR A 34  ? 0.58403 0.60419 0.44695 0.12539  -0.09044 -0.07746 34  TYR A O   
240  C CB  . TYR A 34  ? 0.51197 0.54694 0.37821 0.12922  -0.06043 -0.08034 34  TYR A CB  
241  C CG  . TYR A 34  ? 0.53942 0.58721 0.42837 0.11421  -0.04580 -0.06246 34  TYR A CG  
242  C CD1 . TYR A 34  ? 0.36836 0.41025 0.28509 0.10218  -0.05142 -0.05855 34  TYR A CD1 
243  C CD2 . TYR A 34  ? 0.48207 0.54858 0.36517 0.11282  -0.02726 -0.05022 34  TYR A CD2 
244  C CE1 . TYR A 34  ? 0.44078 0.48962 0.37346 0.09055  -0.03998 -0.04495 34  TYR A CE1 
245  C CE2 . TYR A 34  ? 0.40827 0.48294 0.31113 0.09800  -0.01733 -0.03557 34  TYR A CE2 
246  C CZ  . TYR A 34  ? 0.41049 0.47344 0.33554 0.08764  -0.02429 -0.03416 34  TYR A CZ  
247  O OH  . TYR A 34  ? 0.42284 0.48910 0.36276 0.07512  -0.01637 -0.02238 34  TYR A OH  
248  N N   . ALA A 35  ? 0.46464 0.50119 0.27927 0.13173  -0.06834 -0.05440 35  ALA A N   
249  C CA  . ALA A 35  ? 0.49438 0.52360 0.31253 0.12622  -0.07690 -0.04458 35  ALA A CA  
250  C C   . ALA A 35  ? 0.66187 0.69349 0.43931 0.13331  -0.07281 -0.03067 35  ALA A C   
251  O O   . ALA A 35  ? 0.58284 0.62799 0.33717 0.13801  -0.05747 -0.02363 35  ALA A O   
252  C CB  . ALA A 35  ? 0.49443 0.52518 0.34512 0.11041  -0.06762 -0.03239 35  ALA A CB  
253  N N   . LYS A 36  ? 0.67853 0.69880 0.44820 0.13462  -0.08592 -0.02496 36  LYS A N   
254  C CA  . LYS A 36  ? 0.59856 0.61828 0.33101 0.13897  -0.08119 -0.00690 36  LYS A CA  
255  C C   . LYS A 36  ? 0.63231 0.65944 0.37345 0.12412  -0.06056 0.01474  36  LYS A C   
256  O O   . LYS A 36  ? 0.57560 0.59979 0.35120 0.11092  -0.05714 0.01625  36  LYS A O   
257  C CB  . LYS A 36  ? 0.63697 0.64064 0.36130 0.14336  -0.10000 -0.00308 36  LYS A CB  
258  C CG  . LYS A 36  ? 0.80502 0.80267 0.52550 0.15593  -0.12465 -0.02402 36  LYS A CG  
259  C CD  . LYS A 36  ? 0.88898 0.87497 0.58741 0.16536  -0.14328 -0.01776 36  LYS A CD  
260  C CE  . LYS A 36  ? 0.94512 0.92761 0.60241 0.16798  -0.13129 0.00670  36  LYS A CE  
261  N NZ  . LYS A 36  ? 0.94375 0.91143 0.58137 0.17644  -0.14854 0.01654  36  LYS A NZ  
262  N N   . PRO A 37  ? 0.75569 0.79359 0.46673 0.12563  -0.04683 0.03168  37  PRO A N   
263  C CA  . PRO A 37  ? 0.78502 0.82978 0.50635 0.10867  -0.02996 0.05407  37  PRO A CA  
264  C C   . PRO A 37  ? 0.83717 0.85741 0.57191 0.09747  -0.03887 0.06459  37  PRO A C   
265  O O   . PRO A 37  ? 0.91183 0.91562 0.62301 0.10302  -0.04873 0.07391  37  PRO A O   
266  C CB  . PRO A 37  ? 0.73706 0.79701 0.41865 0.11489  -0.01735 0.07220  37  PRO A CB  
267  C CG  . PRO A 37  ? 0.60476 0.67497 0.26270 0.13602  -0.02033 0.05282  37  PRO A CG  
268  C CD  . PRO A 37  ? 0.59808 0.64610 0.26553 0.14312  -0.04453 0.03011  37  PRO A CD  
269  N N   . PRO A 38  ? 0.70582 0.72135 0.47584 0.08362  -0.03634 0.06285  38  PRO A N   
270  C CA  . PRO A 38  ? 0.71926 0.70827 0.50287 0.07659  -0.04612 0.06796  38  PRO A CA  
271  C C   . PRO A 38  ? 0.75064 0.72496 0.51928 0.06443  -0.04122 0.09344  38  PRO A C   
272  O O   . PRO A 38  ? 0.80106 0.76778 0.58666 0.04848  -0.03587 0.10152  38  PRO A O   
273  C CB  . PRO A 38  ? 0.55633 0.54875 0.37734 0.06782  -0.04249 0.05638  38  PRO A CB  
274  C CG  . PRO A 38  ? 0.52910 0.54779 0.35373 0.06154  -0.02616 0.05836  38  PRO A CG  
275  C CD  . PRO A 38  ? 0.53595 0.57058 0.33156 0.07549  -0.02374 0.05676  38  PRO A CD  
276  N N   . VAL A 39  ? 0.69828 0.66574 0.43284 0.07184  -0.04476 0.10683  39  VAL A N   
277  C CA  . VAL A 39  ? 0.72079 0.67419 0.43619 0.06037  -0.03978 0.13469  39  VAL A CA  
278  C C   . VAL A 39  ? 0.78888 0.71150 0.48152 0.07134  -0.05661 0.14090  39  VAL A C   
279  O O   . VAL A 39  ? 0.79234 0.71222 0.48294 0.08845  -0.07097 0.12400  39  VAL A O   
280  C CB  . VAL A 39  ? 0.72515 0.70681 0.41661 0.05866  -0.02266 0.15152  39  VAL A CB  
281  C CG1 . VAL A 39  ? 0.60101 0.61695 0.31601 0.05242  -0.00713 0.14328  39  VAL A CG1 
282  C CG2 . VAL A 39  ? 0.66373 0.65206 0.31924 0.08094  -0.02822 0.14576  39  VAL A CG2 
283  N N   . GLU A 40  ? 0.68763 0.58697 0.36416 0.06091  -0.05586 0.16632  40  GLU A N   
284  C CA  . GLU A 40  ? 0.95012 0.81673 0.60184 0.07210  -0.07204 0.17576  40  GLU A CA  
285  C C   . GLU A 40  ? 0.81914 0.66522 0.49672 0.08047  -0.08828 0.15583  40  GLU A C   
286  O O   . GLU A 40  ? 0.69882 0.53903 0.40584 0.06933  -0.08510 0.14845  40  GLU A O   
287  C CB  . GLU A 40  ? 1.00043 0.88114 0.61532 0.09079  -0.07540 0.17690  40  GLU A CB  
288  C CG  . GLU A 40  ? 1.10142 1.00015 0.68646 0.08404  -0.05751 0.20156  40  GLU A CG  
289  C CD  . GLU A 40  ? 1.35168 1.22597 0.89555 0.08954  -0.06388 0.22737  40  GLU A CD  
290  O OE1 . GLU A 40  ? 1.48728 1.35855 1.01873 0.07333  -0.05063 0.25741  40  GLU A OE1 
291  O OE2 . GLU A 40  ? 1.36342 1.22224 0.88857 0.10945  -0.08275 0.21891  40  GLU A OE2 
292  N N   . ASP A 41  ? 0.80362 0.64143 0.47185 0.10063  -0.10558 0.14685  41  ASP A N   
293  C CA  . ASP A 41  ? 0.90337 0.72912 0.60000 0.10991  -0.11910 0.12927  41  ASP A CA  
294  C C   . ASP A 41  ? 0.82239 0.67596 0.55664 0.10772  -0.11356 0.10493  41  ASP A C   
295  O O   . ASP A 41  ? 0.86227 0.71097 0.62484 0.11275  -0.12010 0.09158  41  ASP A O   
296  C CB  . ASP A 41  ? 1.00205 0.82183 0.68512 0.13221  -0.13932 0.12492  41  ASP A CB  
297  C CG  . ASP A 41  ? 1.42407 1.27524 1.09927 0.14261  -0.14322 0.11085  41  ASP A CG  
298  O OD1 . ASP A 41  ? 1.56417 1.43384 1.22462 0.13506  -0.12886 0.11413  41  ASP A OD1 
299  O OD2 . ASP A 41  ? 1.56534 1.42298 1.24953 0.15851  -0.16110 0.09635  41  ASP A OD2 
300  N N   . LEU A 42  ? 0.72610 0.60843 0.46112 0.10128  -0.10088 0.09986  42  LEU A N   
301  C CA  . LEU A 42  ? 0.72526 0.63004 0.49437 0.09915  -0.09625 0.07865  42  LEU A CA  
302  C C   . LEU A 42  ? 0.68705 0.59162 0.47698 0.08149  -0.08198 0.08114  42  LEU A C   
303  O O   . LEU A 42  ? 0.71930 0.64151 0.53576 0.07895  -0.07665 0.06590  42  LEU A O   
304  C CB  . LEU A 42  ? 0.57029 0.50309 0.33065 0.10503  -0.09319 0.06770  42  LEU A CB  
305  C CG  . LEU A 42  ? 0.63532 0.57441 0.39729 0.12179  -0.11165 0.05036  42  LEU A CG  
306  C CD1 . LEU A 42  ? 0.71927 0.67994 0.47259 0.12695  -0.10993 0.03626  42  LEU A CD1 
307  C CD2 . LEU A 42  ? 0.59885 0.53806 0.40146 0.12351  -0.12049 0.03616  42  LEU A CD2 
308  N N   . ARG A 43  ? 0.65399 0.53765 0.43258 0.06871  -0.07723 0.10022  43  ARG A N   
309  C CA  . ARG A 43  ? 0.64825 0.52738 0.44719 0.05213  -0.06854 0.10083  43  ARG A CA  
310  C C   . ARG A 43  ? 0.72533 0.58799 0.54698 0.05854  -0.07663 0.08598  43  ARG A C   
311  O O   . ARG A 43  ? 0.75935 0.60330 0.57725 0.07254  -0.08926 0.08366  43  ARG A O   
312  C CB  . ARG A 43  ? 0.70002 0.55689 0.48268 0.03510  -0.06508 0.12503  43  ARG A CB  
313  C CG  . ARG A 43  ? 0.72709 0.57331 0.52958 0.01716  -0.06099 0.12474  43  ARG A CG  
314  C CD  . ARG A 43  ? 0.86903 0.68784 0.65745 -0.00220 -0.06158 0.14937  43  ARG A CD  
315  N NE  . ARG A 43  ? 0.90966 0.75798 0.69332 -0.01750 -0.04754 0.16793  43  ARG A NE  
316  C CZ  . ARG A 43  ? 0.97017 0.80506 0.73886 -0.03383 -0.04559 0.19511  43  ARG A CZ  
317  N NH1 . ARG A 43  ? 0.97302 0.75926 0.72707 -0.03729 -0.05849 0.20677  43  ARG A NH1 
318  N NH2 . ARG A 43  ? 0.98285 0.85350 0.75145 -0.04610 -0.03035 0.21181  43  ARG A NH2 
319  N N   . PHE A 44  ? 0.67887 0.55193 0.52396 0.05022  -0.06873 0.07586  44  PHE A N   
320  C CA  . PHE A 44  ? 0.55317 0.41484 0.41849 0.05610  -0.07253 0.06225  44  PHE A CA  
321  C C   . PHE A 44  ? 0.50944 0.38992 0.39365 0.07317  -0.07747 0.04599  44  PHE A C   
322  O O   . PHE A 44  ? 0.47212 0.35476 0.37769 0.07862  -0.07673 0.03439  44  PHE A O   
323  C CB  . PHE A 44  ? 0.57153 0.39053 0.42347 0.05847  -0.08242 0.06985  44  PHE A CB  
324  C CG  . PHE A 44  ? 0.63698 0.43194 0.47442 0.03849  -0.08033 0.08593  44  PHE A CG  
325  C CD1 . PHE A 44  ? 0.62882 0.43798 0.47761 0.02085  -0.07068 0.08560  44  PHE A CD1 
326  C CD2 . PHE A 44  ? 0.61386 0.37114 0.42780 0.03673  -0.08956 0.10228  44  PHE A CD2 
327  C CE1 . PHE A 44  ? 0.58375 0.37280 0.42372 0.00003  -0.07096 0.10112  44  PHE A CE1 
328  C CE2 . PHE A 44  ? 0.65849 0.39201 0.46218 0.01537  -0.08919 0.11860  44  PHE A CE2 
329  C CZ  . PHE A 44  ? 0.61565 0.36652 0.43395 -0.00388 -0.08023 0.11787  44  PHE A CZ  
330  N N   . ARG A 45  ? 0.48296 0.37790 0.35977 0.08161  -0.08304 0.04532  45  ARG A N   
331  C CA  . ARG A 45  ? 0.47589 0.38716 0.37346 0.09571  -0.09132 0.03116  45  ARG A CA  
332  C C   . ARG A 45  ? 0.54435 0.48494 0.46295 0.09134  -0.08389 0.01878  45  ARG A C   
333  O O   . ARG A 45  ? 0.59456 0.54425 0.50769 0.08069  -0.07303 0.02083  45  ARG A O   
334  C CB  . ARG A 45  ? 0.48802 0.39792 0.36785 0.10792  -0.10543 0.03438  45  ARG A CB  
335  C CG  . ARG A 45  ? 0.53248 0.41047 0.38929 0.11375  -0.11391 0.04842  45  ARG A CG  
336  C CD  . ARG A 45  ? 0.56129 0.44085 0.41487 0.13178  -0.13150 0.04610  45  ARG A CD  
337  N NE  . ARG A 45  ? 0.74445 0.59393 0.56469 0.13709  -0.13977 0.06322  45  ARG A NE  
338  C CZ  . ARG A 45  ? 0.81067 0.63891 0.63022 0.15162  -0.15229 0.06638  45  ARG A CZ  
339  N NH1 . ARG A 45  ? 0.75257 0.59122 0.60486 0.16330  -0.15686 0.05317  45  ARG A NH1 
340  N NH2 . ARG A 45  ? 0.84615 0.64366 0.63208 0.15547  -0.15971 0.08402  45  ARG A NH2 
341  N N   . LYS A 46  ? 0.52824 0.48420 0.47295 0.09981  -0.09030 0.00676  46  LYS A N   
342  C CA  . LYS A 46  ? 0.56156 0.54089 0.52605 0.09579  -0.08617 -0.00427 46  LYS A CA  
343  C C   . LYS A 46  ? 0.61095 0.59632 0.55264 0.09560  -0.08904 -0.00513 46  LYS A C   
344  O O   . LYS A 46  ? 0.64396 0.62107 0.56009 0.10226  -0.09814 0.00044  46  LYS A O   
345  C CB  . LYS A 46  ? 0.40394 0.39894 0.40191 0.10345  -0.09502 -0.01426 46  LYS A CB  
346  C CG  . LYS A 46  ? 0.41668 0.41260 0.43849 0.10598  -0.08859 -0.01459 46  LYS A CG  
347  C CD  . LYS A 46  ? 0.53476 0.55235 0.59204 0.11418  -0.09724 -0.02126 46  LYS A CD  
348  C CE  . LYS A 46  ? 0.60527 0.62695 0.68418 0.12103  -0.08914 -0.02063 46  LYS A CE  
349  N NZ  . LYS A 46  ? 0.63675 0.68547 0.75383 0.13026  -0.09683 -0.02421 46  LYS A NZ  
350  N N   . PRO A 47  ? 0.59141 0.58988 0.53859 0.09000  -0.08128 -0.01181 47  PRO A N   
351  C CA  . PRO A 47  ? 0.55799 0.56160 0.48088 0.09361  -0.08369 -0.01489 47  PRO A CA  
352  C C   . PRO A 47  ? 0.55447 0.56053 0.47933 0.10354  -0.10262 -0.02617 47  PRO A C   
353  O O   . PRO A 47  ? 0.57990 0.59145 0.53598 0.10421  -0.11135 -0.03344 47  PRO A O   
354  C CB  . PRO A 47  ? 0.54143 0.55664 0.47588 0.08733  -0.07183 -0.02119 47  PRO A CB  
355  C CG  . PRO A 47  ? 0.59118 0.60989 0.56243 0.08291  -0.07085 -0.02640 47  PRO A CG  
356  C CD  . PRO A 47  ? 0.58229 0.59072 0.55660 0.08278  -0.07097 -0.01759 47  PRO A CD  
357  N N   . VAL A 48  ? 0.50074 0.50450 0.39205 0.11144  -0.10935 -0.02720 48  VAL A N   
358  C CA  . VAL A 48  ? 0.58099 0.58596 0.47013 0.12075  -0.13002 -0.04084 48  VAL A CA  
359  C C   . VAL A 48  ? 0.56765 0.57469 0.43626 0.12486  -0.12958 -0.05243 48  VAL A C   
360  O O   . VAL A 48  ? 0.59332 0.60184 0.43269 0.12674  -0.11537 -0.04566 48  VAL A O   
361  C CB  . VAL A 48  ? 0.71656 0.71308 0.57955 0.13159  -0.14500 -0.03453 48  VAL A CB  
362  C CG1 . VAL A 48  ? 0.79442 0.78760 0.68131 0.13132  -0.14921 -0.02661 48  VAL A CG1 
363  C CG2 . VAL A 48  ? 0.77950 0.76914 0.59748 0.13482  -0.13465 -0.02048 48  VAL A CG2 
364  N N   . PRO A 49  ? 0.56987 0.57709 0.45349 0.12676  -0.14534 -0.06972 49  PRO A N   
365  C CA  . PRO A 49  ? 0.57026 0.57351 0.43307 0.13277  -0.14724 -0.08371 49  PRO A CA  
366  C C   . PRO A 49  ? 0.62158 0.62099 0.42999 0.14712  -0.14717 -0.08174 49  PRO A C   
367  O O   . PRO A 49  ? 0.57032 0.56643 0.35699 0.15397  -0.15712 -0.07530 49  PRO A O   
368  C CB  . PRO A 49  ? 0.56639 0.56493 0.45210 0.13221  -0.17210 -0.10136 49  PRO A CB  
369  C CG  . PRO A 49  ? 0.55705 0.56568 0.49081 0.12129  -0.17359 -0.09445 49  PRO A CG  
370  C CD  . PRO A 49  ? 0.56348 0.57460 0.48515 0.12362  -0.16338 -0.07686 49  PRO A CD  
371  N N   . ALA A 50  ? 0.76215 0.76295 0.54789 0.15331  -0.13559 -0.08690 50  ALA A N   
372  C CA  . ALA A 50  ? 0.82420 0.82758 0.55816 0.16764  -0.12837 -0.08186 50  ALA A CA  
373  C C   . ALA A 50  ? 0.89173 0.88261 0.59015 0.18399  -0.15232 -0.09786 50  ALA A C   
374  O O   . ALA A 50  ? 0.85501 0.83422 0.56840 0.18433  -0.17411 -0.11747 50  ALA A O   
375  C CB  . ALA A 50  ? 0.84789 0.86114 0.57160 0.17184  -0.10788 -0.08311 50  ALA A CB  
376  N N   . GLU A 51  ? 1.00255 0.99571 0.65311 0.19683  -0.14893 -0.08830 51  GLU A N   
377  C CA  . GLU A 51  ? 1.11889 1.10064 0.72359 0.21588  -0.17001 -0.10240 51  GLU A CA  
378  C C   . GLU A 51  ? 1.07256 1.04712 0.65590 0.22936  -0.17226 -0.12539 51  GLU A C   
379  O O   . GLU A 51  ? 1.05703 1.04353 0.62464 0.23551  -0.14828 -0.12027 51  GLU A O   
380  C CB  . GLU A 51  ? 1.25411 1.24226 0.80833 0.22731  -0.15991 -0.08290 51  GLU A CB  
381  C CG  . GLU A 51  ? 1.40123 1.39589 0.97327 0.21291  -0.14679 -0.05433 51  GLU A CG  
382  C CD  . GLU A 51  ? 1.42589 1.43733 1.01508 0.20027  -0.11507 -0.03647 51  GLU A CD  
383  O OE1 . GLU A 51  ? 1.42328 1.44234 0.99288 0.19765  -0.09902 -0.01166 51  GLU A OE1 
384  O OE2 . GLU A 51  ? 1.34774 1.36446 0.97085 0.19217  -0.10752 -0.04629 51  GLU A OE2 
385  N N   . PRO A 52  ? 1.10198 1.05750 0.69414 0.23149  -0.19772 -0.14855 52  PRO A N   
386  C CA  . PRO A 52  ? 1.08935 1.03124 0.66271 0.24443  -0.19862 -0.16777 52  PRO A CA  
387  C C   . PRO A 52  ? 1.04707 0.99667 0.57099 0.26325  -0.18098 -0.15982 52  PRO A C   
388  O O   . PRO A 52  ? 0.99220 0.94883 0.49300 0.26659  -0.17867 -0.14499 52  PRO A O   
389  C CB  . PRO A 52  ? 1.08282 1.00215 0.66944 0.24214  -0.23192 -0.18746 52  PRO A CB  
390  C CG  . PRO A 52  ? 1.14097 1.06657 0.77508 0.22271  -0.24488 -0.18216 52  PRO A CG  
391  C CD  . PRO A 52  ? 1.14507 1.09200 0.77452 0.21968  -0.22578 -0.15677 52  PRO A CD  
392  N N   . TRP A 53  ? 1.12567 1.07476 0.63521 0.27593  -0.16806 -0.16858 53  TRP A N   
393  C CA  . TRP A 53  ? 1.28390 1.24634 0.75216 0.29456  -0.14787 -0.16019 53  TRP A CA  
394  C C   . TRP A 53  ? 1.33698 1.27865 0.78132 0.31407  -0.15966 -0.18319 53  TRP A C   
395  O O   . TRP A 53  ? 1.29453 1.21384 0.75754 0.31235  -0.17595 -0.20336 53  TRP A O   
396  C CB  . TRP A 53  ? 1.29776 1.28931 0.77235 0.29379  -0.11448 -0.14290 53  TRP A CB  
397  C CG  . TRP A 53  ? 1.21973 1.20638 0.72062 0.29256  -0.11186 -0.15640 53  TRP A CG  
398  C CD1 . TRP A 53  ? 1.18505 1.16071 0.67566 0.30913  -0.11248 -0.17317 53  TRP A CD1 
399  C CD2 . TRP A 53  ? 1.06794 1.05878 0.60834 0.27478  -0.10876 -0.15365 53  TRP A CD2 
400  N NE1 . TRP A 53  ? 1.09176 1.06338 0.61416 0.30190  -0.11012 -0.18003 53  TRP A NE1 
401  C CE2 . TRP A 53  ? 1.09049 1.07216 0.64362 0.28081  -0.10713 -0.16866 53  TRP A CE2 
402  C CE3 . TRP A 53  ? 1.04030 1.04056 0.60528 0.25544  -0.10781 -0.13972 53  TRP A CE3 
403  C CZ2 . TRP A 53  ? 1.09014 1.07260 0.68002 0.26747  -0.10327 -0.17000 53  TRP A CZ2 
404  C CZ3 . TRP A 53  ? 0.98960 0.99197 0.60172 0.23887  -0.10226 -0.13859 53  TRP A CZ3 
405  C CH2 . TRP A 53  ? 1.01376 1.00783 0.63509 0.24557  -0.10004 -0.15412 53  TRP A CH2 
406  N N   . HIS A 54  ? 1.47687 1.42542 0.87895 0.33275  -0.15098 -0.17882 54  HIS A N   
407  C CA  . HIS A 54  ? 1.55688 1.48921 0.92879 0.35570  -0.15770 -0.19814 54  HIS A CA  
408  C C   . HIS A 54  ? 1.39885 1.35913 0.75125 0.37190  -0.12576 -0.18579 54  HIS A C   
409  O O   . HIS A 54  ? 1.43651 1.42795 0.78478 0.36782  -0.10156 -0.16055 54  HIS A O   
410  C CB  . HIS A 54  ? 1.81520 1.72988 1.15124 0.36719  -0.17911 -0.20717 54  HIS A CB  
411  C CG  . HIS A 54  ? 1.98196 1.87818 1.34012 0.35019  -0.20873 -0.21387 54  HIS A CG  
412  N ND1 . HIS A 54  ? 1.99000 1.90061 1.36463 0.33353  -0.20671 -0.19469 54  HIS A ND1 
413  C CD2 . HIS A 54  ? 2.03851 1.90463 1.40788 0.34696  -0.24151 -0.23648 54  HIS A CD2 
414  C CE1 . HIS A 54  ? 1.98326 1.87630 1.37957 0.32218  -0.23628 -0.20544 54  HIS A CE1 
415  N NE2 . HIS A 54  ? 2.01575 1.88293 1.41082 0.32876  -0.25759 -0.23033 54  HIS A NE2 
416  N N   . GLY A 55  ? 1.22508 1.17445 0.56796 0.38958  -0.12647 -0.20258 55  GLY A N   
417  C CA  . GLY A 55  ? 1.10530 1.08388 0.43750 0.40532  -0.09711 -0.19186 55  GLY A CA  
418  C C   . GLY A 55  ? 1.18871 1.18384 0.56271 0.39211  -0.08122 -0.18414 55  GLY A C   
419  O O   . GLY A 55  ? 1.17313 1.18149 0.57666 0.36936  -0.07485 -0.16910 55  GLY A O   
420  N N   . VAL A 56  ? 1.19383 1.18756 0.56947 0.40706  -0.07553 -0.19419 56  VAL A N   
421  C CA  . VAL A 56  ? 1.13190 1.13444 0.54772 0.39520  -0.06573 -0.19081 56  VAL A CA  
422  C C   . VAL A 56  ? 1.06975 1.11834 0.50682 0.38129  -0.03616 -0.16138 56  VAL A C   
423  O O   . VAL A 56  ? 0.97504 1.05677 0.39584 0.39066  -0.01452 -0.14401 56  VAL A O   
424  C CB  . VAL A 56  ? 1.23428 1.22884 0.64368 0.41668  -0.06404 -0.20455 56  VAL A CB  
425  C CG1 . VAL A 56  ? 1.34709 1.29299 0.73051 0.43049  -0.09507 -0.23292 56  VAL A CG1 
426  C CG2 . VAL A 56  ? 1.23650 1.27044 0.62627 0.43750  -0.03679 -0.19022 56  VAL A CG2 
427  N N   . LEU A 57  ? 1.00873 1.05894 0.48288 0.35760  -0.03623 -0.15511 57  LEU A N   
428  C CA  . LEU A 57  ? 0.94268 1.03148 0.44087 0.34034  -0.01214 -0.12798 57  LEU A CA  
429  C C   . LEU A 57  ? 0.88415 1.00093 0.40591 0.34436  0.00863  -0.12063 57  LEU A C   
430  O O   . LEU A 57  ? 0.84132 0.94048 0.37952 0.34704  0.00052  -0.13574 57  LEU A O   
431  C CB  . LEU A 57  ? 0.94675 1.02321 0.47173 0.31517  -0.02319 -0.12597 57  LEU A CB  
432  C CG  . LEU A 57  ? 0.86858 0.97359 0.40988 0.29446  -0.00663 -0.09843 57  LEU A CG  
433  C CD1 . LEU A 57  ? 0.83401 0.91594 0.39208 0.27622  -0.02589 -0.10398 57  LEU A CD1 
434  C CD2 . LEU A 57  ? 0.80813 0.94846 0.37989 0.28745  0.01824  -0.08220 57  LEU A CD2 
435  N N   . ASP A 58  ? 0.82457 0.98487 0.34993 0.34341  0.03432  -0.09614 58  ASP A N   
436  C CA  . ASP A 58  ? 0.82748 1.02224 0.37870 0.34583  0.05460  -0.08530 58  ASP A CA  
437  C C   . ASP A 58  ? 0.88138 1.08032 0.47529 0.32277  0.05635  -0.07955 58  ASP A C   
438  O O   . ASP A 58  ? 0.97986 1.19270 0.58975 0.30065  0.06280  -0.06163 58  ASP A O   
439  C CB  . ASP A 58  ? 0.81808 1.05950 0.36603 0.34633  0.07946  -0.05854 58  ASP A CB  
440  C CG  . ASP A 58  ? 1.03459 1.31593 0.61059 0.34961  0.09892  -0.04668 58  ASP A CG  
441  O OD1 . ASP A 58  ? 1.04578 1.31511 0.63389 0.35860  0.09250  -0.06206 58  ASP A OD1 
442  O OD2 . ASP A 58  ? 1.03961 1.36367 0.62625 0.34260  0.11949  -0.02140 58  ASP A OD2 
443  N N   . ALA A 59  ? 0.82155 1.00693 0.43254 0.32822  0.05030  -0.09408 59  ALA A N   
444  C CA  . ALA A 59  ? 0.80432 0.99341 0.45490 0.30924  0.05228  -0.08982 59  ALA A CA  
445  C C   . ALA A 59  ? 0.85084 1.07269 0.52702 0.31373  0.06853  -0.08007 59  ALA A C   
446  O O   . ALA A 59  ? 0.86372 1.07631 0.56459 0.30961  0.06464  -0.08637 59  ALA A O   
447  C CB  . ALA A 59  ? 0.84540 0.98705 0.49955 0.30749  0.02899  -0.11393 59  ALA A CB  
448  N N   . THR A 60  ? 0.76677 1.02779 0.43814 0.32219  0.08625  -0.06395 60  THR A N   
449  C CA  . THR A 60  ? 0.73113 1.02757 0.42698 0.32738  0.10058  -0.05378 60  THR A CA  
450  C C   . THR A 60  ? 0.77726 1.11941 0.50817 0.30365  0.11779  -0.02556 60  THR A C   
451  O O   . THR A 60  ? 0.86962 1.24294 0.62736 0.30362  0.12758  -0.01600 60  THR A O   
452  C CB  . THR A 60  ? 0.80631 1.11707 0.47528 0.35623  0.10751  -0.05680 60  THR A CB  
453  O OG1 . THR A 60  ? 0.84556 1.19156 0.50565 0.35349  0.12323  -0.03624 60  THR A OG1 
454  C CG2 . THR A 60  ? 0.77895 1.04062 0.40786 0.37817  0.08797  -0.08446 60  THR A CG2 
455  N N   . GLY A 61  ? 0.74591 1.09080 0.47747 0.28289  0.11982  -0.01206 61  GLY A N   
456  C CA  . GLY A 61  ? 0.67830 1.06039 0.44252 0.25750  0.13319  0.01469  61  GLY A CA  
457  C C   . GLY A 61  ? 0.67219 1.04057 0.46354 0.23377  0.12593  0.01535  61  GLY A C   
458  O O   . GLY A 61  ? 0.70763 1.03751 0.48910 0.23487  0.11143  -0.00279 61  GLY A O   
459  N N   . LEU A 62  ? 0.69570 1.09652 0.52252 0.21194  0.13535  0.03645  62  LEU A N   
460  C CA  . LEU A 62  ? 0.55516 0.94508 0.40514 0.18772  0.12945  0.04023  62  LEU A CA  
461  C C   . LEU A 62  ? 0.57764 0.95255 0.41023 0.17225  0.12711  0.05003  62  LEU A C   
462  O O   . LEU A 62  ? 0.51824 0.90497 0.33412 0.17119  0.13431  0.06439  62  LEU A O   
463  C CB  . LEU A 62  ? 0.50309 0.92931 0.39561 0.16842  0.13695  0.05878  62  LEU A CB  
464  C CG  . LEU A 62  ? 0.54370 0.97718 0.45788 0.17893  0.13459  0.04862  62  LEU A CG  
465  C CD1 . LEU A 62  ? 0.44799 0.91905 0.40262 0.15836  0.13977  0.06817  62  LEU A CD1 
466  C CD2 . LEU A 62  ? 0.63746 1.03125 0.54998 0.18271  0.12143  0.02760  62  LEU A CD2 
467  N N   . SER A 63  ? 0.60571 0.95369 0.44113 0.16111  0.11675  0.04287  63  SER A N   
468  C CA  . SER A 63  ? 0.49945 0.82066 0.32251 0.14466  0.10758  0.05073  63  SER A CA  
469  C C   . SER A 63  ? 0.55253 0.88837 0.40430 0.11410  0.11193  0.07588  63  SER A C   
470  O O   . SER A 63  ? 0.63776 1.00099 0.52171 0.10367  0.11864  0.08428  63  SER A O   
471  C CB  . SER A 63  ? 0.52624 0.79688 0.34935 0.14225  0.08561  0.02995  63  SER A CB  
472  O OG  . SER A 63  ? 0.65068 0.91001 0.50709 0.11758  0.07916  0.03618  63  SER A OG  
473  N N   . ALA A 64  ? 0.55880 0.87303 0.39802 0.09994  0.10575  0.08722  64  ALA A N   
474  C CA  . ALA A 64  ? 0.55490 0.87197 0.41660 0.07036  0.10627  0.11001  64  ALA A CA  
475  C C   . ALA A 64  ? 0.55072 0.84264 0.44277 0.05459  0.09255  0.10018  64  ALA A C   
476  O O   . ALA A 64  ? 0.62587 0.89080 0.51753 0.06446  0.08118  0.07813  64  ALA A O   
477  C CB  . ALA A 64  ? 0.46942 0.76168 0.30555 0.06277  0.10099  0.12281  64  ALA A CB  
478  N N   . THR A 65  ? 0.44704 0.74743 0.36481 0.02949  0.09313  0.11719  65  THR A N   
479  C CA  . THR A 65  ? 0.59360 0.86633 0.53355 0.01503  0.07938  0.10846  65  THR A CA  
480  C C   . THR A 65  ? 0.54298 0.77659 0.47493 -0.00123 0.06770  0.11577  65  THR A C   
481  O O   . THR A 65  ? 0.55111 0.78594 0.47055 -0.01045 0.07136  0.13527  65  THR A O   
482  C CB  . THR A 65  ? 0.69112 0.99246 0.66460 -0.00047 0.08279  0.11700  65  THR A CB  
483  O OG1 . THR A 65  ? 0.88029 1.18456 0.86315 -0.02636 0.08221  0.13979  65  THR A OG1 
484  C CG2 . THR A 65  ? 0.62442 0.97602 0.60655 0.01425  0.09800  0.11900  65  THR A CG2 
485  N N   . CYS A 66  ? 0.43951 0.63822 0.37794 -0.00326 0.05411  0.10072  66  CYS A N   
486  C CA  . CYS A 66  ? 0.37239 0.53096 0.30165 -0.01314 0.04208  0.10398  66  CYS A CA  
487  C C   . CYS A 66  ? 0.55030 0.70673 0.49133 -0.03868 0.04061  0.12368  66  CYS A C   
488  O O   . CYS A 66  ? 0.52576 0.70680 0.48940 -0.05061 0.04438  0.12903  66  CYS A O   
489  C CB  . CYS A 66  ? 0.47326 0.60121 0.40848 -0.00672 0.03014  0.08338  66  CYS A CB  
490  S SG  . CYS A 66  ? 0.62288 0.74554 0.54432 0.01936  0.02716  0.06228  66  CYS A SG  
491  N N   . VAL A 67  ? 0.59228 0.71785 0.51754 -0.04701 0.03352  0.13494  67  VAL A N   
492  C CA  . VAL A 67  ? 0.54628 0.66263 0.47890 -0.07262 0.03018  0.15573  67  VAL A CA  
493  C C   . VAL A 67  ? 0.52303 0.62869 0.47833 -0.08559 0.02084  0.14675  67  VAL A C   
494  O O   . VAL A 67  ? 0.52527 0.60409 0.47954 -0.07628 0.01166  0.12712  67  VAL A O   
495  C CB  . VAL A 67  ? 0.54401 0.61621 0.45342 -0.07596 0.02025  0.16503  67  VAL A CB  
496  C CG1 . VAL A 67  ? 0.59613 0.64868 0.51323 -0.10396 0.01335  0.18501  67  VAL A CG1 
497  C CG2 . VAL A 67  ? 0.49239 0.57592 0.37616 -0.06434 0.02876  0.17678  67  VAL A CG2 
498  N N   . GLN A 68  ? 0.49655 0.62628 0.47277 -0.10658 0.02319  0.16142  68  GLN A N   
499  C CA  . GLN A 68  ? 0.55985 0.68427 0.55676 -0.11973 0.01314  0.15367  68  GLN A CA  
500  C C   . GLN A 68  ? 0.65060 0.80487 0.67041 -0.14617 0.01490  0.17607  68  GLN A C   
501  O O   . GLN A 68  ? 0.67611 0.86782 0.70012 -0.14975 0.02872  0.19573  68  GLN A O   
502  C CB  . GLN A 68  ? 0.46814 0.61415 0.47606 -0.10240 0.01687  0.13296  68  GLN A CB  
503  C CG  . GLN A 68  ? 0.46097 0.66467 0.48400 -0.09526 0.03256  0.13857  68  GLN A CG  
504  C CD  . GLN A 68  ? 0.53706 0.75288 0.56560 -0.07469 0.03523  0.11774  68  GLN A CD  
505  O OE1 . GLN A 68  ? 0.62498 0.86063 0.67336 -0.07874 0.03336  0.11457  68  GLN A OE1 
506  N NE2 . GLN A 68  ? 0.50598 0.70848 0.51701 -0.05318 0.03813  0.10419  68  GLN A NE2 
507  N N   . GLU A 69  ? 0.66406 0.80378 0.69904 -0.16432 0.00058  0.17300  69  GLU A N   
508  C CA  . GLU A 69  ? 0.57690 0.74257 0.63841 -0.19341 -0.00240 0.19359  69  GLU A CA  
509  C C   . GLU A 69  ? 0.50965 0.72789 0.60073 -0.19273 0.00186  0.18928  69  GLU A C   
510  O O   . GLU A 69  ? 0.42745 0.64412 0.51726 -0.17557 -0.00060 0.16745  69  GLU A O   
511  C CB  . GLU A 69  ? 0.57310 0.68672 0.63237 -0.21761 -0.02484 0.19508  69  GLU A CB  
512  C CG  . GLU A 69  ? 0.72959 0.79022 0.76114 -0.21971 -0.03027 0.20298  69  GLU A CG  
513  C CD  . GLU A 69  ? 0.90800 0.99091 0.94388 -0.23630 -0.01938 0.23554  69  GLU A CD  
514  O OE1 . GLU A 69  ? 0.98095 1.09992 1.04594 -0.26175 -0.01793 0.25575  69  GLU A OE1 
515  O OE2 . GLU A 69  ? 0.97678 1.04444 0.98754 -0.22341 -0.01188 0.24190  69  GLU A OE2 
516  N N   . ARG A 70  ? 0.54036 0.80721 0.65916 -0.21170 0.00870  0.21263  70  ARG A N   
517  C CA  . ARG A 70  ? 0.57796 0.90400 0.73000 -0.21285 0.01339  0.21426  70  ARG A CA  
518  C C   . ARG A 70  ? 0.63318 0.94341 0.80262 -0.23376 -0.00950 0.20751  70  ARG A C   
519  O O   . ARG A 70  ? 0.73036 1.01186 0.90403 -0.26223 -0.02504 0.21867  70  ARG A O   
520  C CB  . ARG A 70  ? 0.67777 1.05897 0.85213 -0.22317 0.02844  0.24140  70  ARG A CB  
521  C CG  . ARG A 70  ? 0.76107 1.20425 0.95624 -0.20338 0.04192  0.23808  70  ARG A CG  
522  C CD  . ARG A 70  ? 0.74621 1.22554 0.93896 -0.19111 0.06237  0.25299  70  ARG A CD  
523  N NE  . ARG A 70  ? 0.78251 1.24827 0.94121 -0.16767 0.07610  0.24730  70  ARG A NE  
524  C CZ  . ARG A 70  ? 0.89962 1.39004 1.04839 -0.13606 0.08990  0.23427  70  ARG A CZ  
525  N NH1 . ARG A 70  ? 0.79762 1.32604 0.96825 -0.12406 0.09215  0.22675  70  ARG A NH1 
526  N NH2 . ARG A 70  ? 1.02856 1.50181 1.14362 -0.11580 0.09947  0.22808  70  ARG A NH2 
527  N N   . TYR A 71  ? 0.56936 0.89660 0.74748 -0.22001 -0.01292 0.18982  71  TYR A N   
528  C CA  . TYR A 71  ? 0.69046 1.01383 0.88674 -0.23936 -0.03455 0.18517  71  TYR A CA  
529  C C   . TYR A 71  ? 0.69147 1.07607 0.92884 -0.25811 -0.03274 0.20619  71  TYR A C   
530  O O   . TYR A 71  ? 0.65689 1.09463 0.90906 -0.23908 -0.01684 0.20794  71  TYR A O   
531  C CB  . TYR A 71  ? 0.77828 1.09532 0.96539 -0.21650 -0.03955 0.15968  71  TYR A CB  
532  C CG  . TYR A 71  ? 0.79476 1.04173 0.94585 -0.20767 -0.05194 0.13802  71  TYR A CG  
533  C CD1 . TYR A 71  ? 0.72247 0.94812 0.84768 -0.17935 -0.04033 0.12317  71  TYR A CD1 
534  C CD2 . TYR A 71  ? 0.90627 1.10908 1.04970 -0.22730 -0.07568 0.13249  71  TYR A CD2 
535  C CE1 . TYR A 71  ? 0.75615 0.92498 0.85234 -0.17034 -0.04971 0.10523  71  TYR A CE1 
536  C CE2 . TYR A 71  ? 0.88649 1.02792 0.99565 -0.21572 -0.08523 0.11251  71  TYR A CE2 
537  C CZ  . TYR A 71  ? 0.82354 0.95163 0.91098 -0.18702 -0.07095 0.09993  71  TYR A CZ  
538  O OH  . TYR A 71  ? 0.85775 0.93219 0.91503 -0.17441 -0.07848 0.08174  71  TYR A OH  
539  N N   . GLU A 72  ? 0.72699 1.09021 0.97298 -0.28545 -0.04948 0.21587  72  GLU A N   
540  C CA  . GLU A 72  ? 0.71660 1.12279 0.99400 -0.29794 -0.04913 0.23184  72  GLU A CA  
541  C C   . GLU A 72  ? 0.70927 1.09916 1.00065 -0.31931 -0.07678 0.22526  72  GLU A C   
542  O O   . GLU A 72  ? 0.74825 1.14016 1.05773 -0.34254 -0.08640 0.23918  72  GLU A O   
543  C CB  . GLU A 72  ? 0.82135 1.22458 1.09872 -0.31148 -0.04009 0.25489  72  GLU A CB  
544  C CG  . GLU A 72  ? 0.89817 1.31680 1.15779 -0.28942 -0.01369 0.26152  72  GLU A CG  
545  C CD  . GLU A 72  ? 0.95809 1.44602 1.23635 -0.26914 0.00796  0.26806  72  GLU A CD  
546  O OE1 . GLU A 72  ? 1.01180 1.53769 1.31875 -0.27186 0.00302  0.26810  72  GLU A OE1 
547  O OE2 . GLU A 72  ? 0.90482 1.40703 1.16691 -0.24923 0.02897  0.27246  72  GLU A OE2 
548  N N   . TYR A 73  ? 0.67893 1.05178 0.96086 -0.31141 -0.09071 0.20361  73  TYR A N   
549  C CA  . TYR A 73  ? 0.74463 1.09921 1.03404 -0.32846 -0.11859 0.19427  73  TYR A CA  
550  C C   . TYR A 73  ? 0.68209 1.09875 1.00919 -0.33092 -0.11785 0.20322  73  TYR A C   
551  O O   . TYR A 73  ? 0.65726 1.06743 0.99888 -0.35157 -0.13913 0.20387  73  TYR A O   
552  C CB  . TYR A 73  ? 0.78158 1.10309 1.04666 -0.31623 -0.13313 0.16834  73  TYR A CB  
553  C CG  . TYR A 73  ? 0.92346 1.16780 1.15106 -0.32201 -0.14673 0.15611  73  TYR A CG  
554  C CD1 . TYR A 73  ? 0.95362 1.17515 1.15783 -0.30777 -0.12987 0.15570  73  TYR A CD1 
555  C CD2 . TYR A 73  ? 1.05306 1.24276 1.26364 -0.33598 -0.17561 0.14244  73  TYR A CD2 
556  C CE1 . TYR A 73  ? 1.05427 1.20017 1.21862 -0.30322 -0.13948 0.14156  73  TYR A CE1 
557  C CE2 . TYR A 73  ? 1.14758 1.26244 1.31972 -0.33632 -0.18772 0.12916  73  TYR A CE2 
558  C CZ  . TYR A 73  ? 1.15125 1.24510 1.30095 -0.31872 -0.16858 0.12906  73  TYR A CZ  
559  O OH  . TYR A 73  ? 1.19187 1.21103 1.30089 -0.31062 -0.17736 0.11438  73  TYR A OH  
560  N N   . PHE A 74  ? 0.65124 1.12606 0.99330 -0.30899 -0.09436 0.20933  74  PHE A N   
561  C CA  . PHE A 74  ? 0.61880 1.15563 0.99613 -0.30661 -0.09083 0.21806  74  PHE A CA  
562  C C   . PHE A 74  ? 0.66637 1.24762 1.05592 -0.29732 -0.06309 0.23776  74  PHE A C   
563  O O   . PHE A 74  ? 0.55990 1.17487 0.94705 -0.26852 -0.04291 0.23479  74  PHE A O   
564  C CB  . PHE A 74  ? 0.56916 1.13000 0.94759 -0.28215 -0.09196 0.20151  74  PHE A CB  
565  C CG  . PHE A 74  ? 0.57263 1.09381 0.93711 -0.28939 -0.11978 0.18218  74  PHE A CG  
566  C CD1 . PHE A 74  ? 0.60292 1.07918 0.93314 -0.27838 -0.12379 0.16448  74  PHE A CD1 
567  C CD2 . PHE A 74  ? 0.51493 1.04326 0.89896 -0.30678 -0.14266 0.18122  74  PHE A CD2 
568  C CE1 . PHE A 74  ? 0.61993 1.05807 0.93199 -0.28278 -0.14960 0.14583  74  PHE A CE1 
569  C CE2 . PHE A 74  ? 0.59489 1.08401 0.96043 -0.31109 -0.16922 0.16176  74  PHE A CE2 
570  C CZ  . PHE A 74  ? 0.66894 1.11205 0.99642 -0.29820 -0.17241 0.14386  74  PHE A CZ  
571  N N   . PRO A 75  ? 0.84770 1.42768 1.24808 -0.31998 -0.06204 0.25760  75  PRO A N   
572  C CA  . PRO A 75  ? 0.88110 1.49517 1.28483 -0.31068 -0.03539 0.27625  75  PRO A CA  
573  C C   . PRO A 75  ? 0.90315 1.58696 1.33178 -0.29022 -0.01910 0.28133  75  PRO A C   
574  O O   . PRO A 75  ? 0.96279 1.68020 1.42298 -0.29966 -0.02931 0.28514  75  PRO A O   
575  C CB  . PRO A 75  ? 0.90585 1.50752 1.32301 -0.34369 -0.04327 0.29729  75  PRO A CB  
576  C CG  . PRO A 75  ? 0.92971 1.46777 1.33442 -0.36606 -0.07269 0.28520  75  PRO A CG  
577  C CD  . PRO A 75  ? 0.94031 1.48333 1.34729 -0.35448 -0.08615 0.26333  75  PRO A CD  
578  N N   . GLY A 76  ? 0.85928 1.56231 1.27202 -0.26095 0.00509  0.28017  76  GLY A N   
579  C CA  . GLY A 76  ? 0.85051 1.61316 1.27966 -0.23579 0.02161  0.28234  76  GLY A CA  
580  C C   . GLY A 76  ? 0.82376 1.59088 1.24653 -0.20925 0.01912  0.26093  76  GLY A C   
581  O O   . GLY A 76  ? 0.84211 1.62619 1.25124 -0.17742 0.03689  0.25423  76  GLY A O   
582  N N   . PHE A 77  ? 0.77354 1.52249 1.20392 -0.22162 -0.00392 0.24973  77  PHE A N   
583  C CA  . PHE A 77  ? 0.57843 1.32781 1.00311 -0.19968 -0.00997 0.23027  77  PHE A CA  
584  C C   . PHE A 77  ? 0.51530 1.24413 0.90643 -0.16889 0.00537  0.21600  77  PHE A C   
585  O O   . PHE A 77  ? 0.55496 1.23929 0.92040 -0.17303 0.00434  0.20959  77  PHE A O   
586  C CB  . PHE A 77  ? 0.51688 1.22865 0.93991 -0.22020 -0.03814 0.21872  77  PHE A CB  
587  C CG  . PHE A 77  ? 0.49736 1.20144 0.90825 -0.19837 -0.04518 0.19880  77  PHE A CG  
588  C CD1 . PHE A 77  ? 0.44059 1.18789 0.86799 -0.17696 -0.04113 0.19687  77  PHE A CD1 
589  C CD2 . PHE A 77  ? 0.41782 1.07152 0.80019 -0.19825 -0.05581 0.18273  77  PHE A CD2 
590  C CE1 . PHE A 77  ? 0.35191 1.09041 0.76683 -0.15612 -0.04793 0.18012  77  PHE A CE1 
591  C CE2 . PHE A 77  ? 0.35310 1.00157 0.72406 -0.17787 -0.06200 0.16617  77  PHE A CE2 
592  C CZ  . PHE A 77  ? 0.32471 1.01465 0.71145 -0.15673 -0.05814 0.16529  77  PHE A CZ  
593  N N   . SER A 78  ? 0.44655 1.20578 0.83783 -0.13769 0.01837  0.21042  78  SER A N   
594  C CA  . SER A 78  ? 0.50863 1.25189 0.86914 -0.10776 0.03555  0.19956  78  SER A CA  
595  C C   . SER A 78  ? 0.51968 1.22013 0.85717 -0.09905 0.02642  0.17986  78  SER A C   
596  O O   . SER A 78  ? 0.56412 1.23626 0.87443 -0.08558 0.03614  0.17152  78  SER A O   
597  C CB  . SER A 78  ? 0.53165 1.31462 0.89683 -0.07666 0.05050  0.19886  78  SER A CB  
598  O OG  . SER A 78  ? 0.59412 1.37195 0.95543 -0.05691 0.04350  0.18334  78  SER A OG  
599  N N   . GLY A 79  ? 0.40705 1.10324 0.75462 -0.10605 0.00753  0.17240  79  GLY A N   
600  C CA  . GLY A 79  ? 0.33872 0.99814 0.66493 -0.09686 -0.00094 0.15494  79  GLY A CA  
601  C C   . GLY A 79  ? 0.34055 0.95554 0.64637 -0.11224 -0.00401 0.15164  79  GLY A C   
602  O O   . GLY A 79  ? 0.34601 0.93275 0.63054 -0.09912 -0.00302 0.13833  79  GLY A O   
603  N N   . GLU A 80  ? 0.43766 1.04503 0.74997 -0.13992 -0.00795 0.16432  80  GLU A N   
604  C CA  . GLU A 80  ? 0.41655 0.97992 0.70870 -0.15473 -0.01033 0.16331  80  GLU A CA  
605  C C   . GLU A 80  ? 0.49101 1.05386 0.76694 -0.14106 0.01220  0.16870  80  GLU A C   
606  O O   . GLU A 80  ? 0.50755 1.03762 0.76036 -0.13601 0.01602  0.16106  80  GLU A O   
607  C CB  . GLU A 80  ? 0.35847 0.90413 0.66123 -0.19093 -0.02799 0.17403  80  GLU A CB  
608  C CG  . GLU A 80  ? 0.32482 0.82910 0.60881 -0.20685 -0.02684 0.17977  80  GLU A CG  
609  C CD  . GLU A 80  ? 0.57726 1.05081 0.86702 -0.24117 -0.04886 0.18660  80  GLU A CD  
610  O OE1 . GLU A 80  ? 0.59737 1.09833 0.91221 -0.25565 -0.05275 0.19988  80  GLU A OE1 
611  O OE2 . GLU A 80  ? 0.59736 1.01686 0.86569 -0.25298 -0.06306 0.17798  80  GLU A OE2 
612  N N   . GLU A 81  ? 0.59339 1.19301 0.87991 -0.13371 0.02680  0.18129  81  GLU A N   
613  C CA  . GLU A 81  ? 0.71490 1.31234 0.98297 -0.12314 0.04559  0.18750  81  GLU A CA  
614  C C   . GLU A 81  ? 0.59282 1.18606 0.83778 -0.08787 0.05944  0.17197  81  GLU A C   
615  O O   . GLU A 81  ? 0.62214 1.19698 0.84329 -0.07949 0.07012  0.17101  81  GLU A O   
616  C CB  . GLU A 81  ? 0.82587 1.46389 1.11122 -0.12764 0.05600  0.20685  81  GLU A CB  
617  C CG  . GLU A 81  ? 0.97029 1.59747 1.26667 -0.16278 0.04731  0.22515  81  GLU A CG  
618  C CD  . GLU A 81  ? 1.07875 1.68779 1.35260 -0.16425 0.05984  0.23546  81  GLU A CD  
619  O OE1 . GLU A 81  ? 1.12304 1.70852 1.39838 -0.19193 0.05137  0.24855  81  GLU A OE1 
620  O OE2 . GLU A 81  ? 1.08333 1.69800 1.33578 -0.13723 0.07671  0.22989  81  GLU A OE2 
621  N N   . ILE A 82  ? 0.44525 1.05076 0.69467 -0.06718 0.05794  0.15952  82  ILE A N   
622  C CA  . ILE A 82  ? 0.25152 0.84409 0.47777 -0.03474 0.06799  0.14345  82  ILE A CA  
623  C C   . ILE A 82  ? 0.45087 1.00022 0.65584 -0.03505 0.06465  0.13145  82  ILE A C   
624  O O   . ILE A 82  ? 0.49506 1.02729 0.67938 -0.01059 0.07187  0.11787  82  ILE A O   
625  C CB  . ILE A 82  ? 0.34271 0.94984 0.57705 -0.01394 0.06467  0.13338  82  ILE A CB  
626  C CG1 . ILE A 82  ? 0.43343 1.02398 0.67543 -0.02559 0.04715  0.12613  82  ILE A CG1 
627  C CG2 . ILE A 82  ? 0.31126 0.96445 0.56845 -0.01224 0.06806  0.14521  82  ILE A CG2 
628  C CD1 . ILE A 82  ? 0.38335 0.95620 0.61224 0.00037  0.04608  0.10949  82  ILE A CD1 
629  N N   . TRP A 83  ? 0.39086 0.91427 0.59731 -0.06144 0.05157  0.13426  83  TRP A N   
630  C CA  . TRP A 83  ? 0.43982 0.89877 0.61425 -0.05983 0.04501  0.11960  83  TRP A CA  
631  C C   . TRP A 83  ? 0.43031 0.86725 0.59080 -0.07456 0.04750  0.12919  83  TRP A C   
632  O O   . TRP A 83  ? 0.56462 0.95010 0.70071 -0.07450 0.04128  0.11891  83  TRP A O   
633  C CB  . TRP A 83  ? 0.53611 0.96162 0.70890 -0.07112 0.02584  0.10950  83  TRP A CB  
634  C CG  . TRP A 83  ? 0.48682 0.92754 0.66749 -0.05461 0.02269  0.10013  83  TRP A CG  
635  C CD1 . TRP A 83  ? 0.49721 0.97406 0.70337 -0.06157 0.01406  0.10590  83  TRP A CD1 
636  C CD2 . TRP A 83  ? 0.46965 0.88966 0.63309 -0.02874 0.02713  0.08485  83  TRP A CD2 
637  N NE1 . TRP A 83  ? 0.43132 0.90971 0.63433 -0.03981 0.01316  0.09524  83  TRP A NE1 
638  C CE2 . TRP A 83  ? 0.41841 0.86100 0.59558 -0.02025 0.02152  0.08288  83  TRP A CE2 
639  C CE3 . TRP A 83  ? 0.54560 0.92992 0.68466 -0.01300 0.03387  0.07345  83  TRP A CE3 
640  C CZ2 . TRP A 83  ? 0.45902 0.88670 0.62464 0.00326  0.02361  0.07132  83  TRP A CZ2 
641  C CZ3 . TRP A 83  ? 0.54067 0.91170 0.67138 0.00834  0.03527  0.06153  83  TRP A CZ3 
642  C CH2 . TRP A 83  ? 0.52566 0.91661 0.66871 0.01617  0.03066  0.06115  83  TRP A CH2 
643  N N   . ASN A 84  ? 0.44996 0.92552 0.62580 -0.08653 0.05656  0.14977  84  ASN A N   
644  C CA  . ASN A 84  ? 0.49962 0.95856 0.66068 -0.09837 0.06130  0.16253  84  ASN A CA  
645  C C   . ASN A 84  ? 0.45627 0.92353 0.59450 -0.07236 0.07923  0.16008  84  ASN A C   
646  O O   . ASN A 84  ? 0.40955 0.91101 0.55150 -0.04878 0.09071  0.15463  84  ASN A O   
647  C CB  . ASN A 84  ? 0.52496 1.02055 0.71371 -0.12586 0.06199  0.18856  84  ASN A CB  
648  C CG  . ASN A 84  ? 0.44223 0.91673 0.64762 -0.15729 0.04019  0.19186  84  ASN A CG  
649  O OD1 . ASN A 84  ? 0.34378 0.75960 0.52790 -0.15994 0.02506  0.17639  84  ASN A OD1 
650  N ND2 . ASN A 84  ? 0.33648 0.83960 0.56885 -0.17362 0.03491  0.20485  84  ASN A ND2 
651  N N   . PRO A 85  ? 0.42144 0.85578 0.53346 -0.07443 0.08060  0.16316  85  PRO A N   
652  C CA  . PRO A 85  ? 0.50741 0.94798 0.59373 -0.04985 0.09532  0.16030  85  PRO A CA  
653  C C   . PRO A 85  ? 0.44557 0.94269 0.54374 -0.03804 0.11162  0.17123  85  PRO A C   
654  O O   . PRO A 85  ? 0.33596 0.85873 0.45727 -0.05503 0.11150  0.18789  85  PRO A O   
655  C CB  . PRO A 85  ? 0.50360 0.91103 0.56766 -0.06277 0.09295  0.17161  85  PRO A CB  
656  C CG  . PRO A 85  ? 0.49499 0.85759 0.56406 -0.08441 0.07371  0.16784  85  PRO A CG  
657  C CD  . PRO A 85  ? 0.43667 0.82484 0.53920 -0.09782 0.06737  0.16906  85  PRO A CD  
658  N N   . ASN A 86  ? 0.48405 0.98611 0.56349 -0.00648 0.12016  0.15646  86  ASN A N   
659  C CA  . ASN A 86  ? 0.47137 1.00877 0.55261 0.01053  0.13140  0.16072  86  ASN A CA  
660  C C   . ASN A 86  ? 0.45745 0.98774 0.50358 0.02873  0.14163  0.16018  86  ASN A C   
661  O O   . ASN A 86  ? 0.47693 1.03527 0.51964 0.04475  0.15203  0.16381  86  ASN A O   
662  C CB  . ASN A 86  ? 0.43261 0.98378 0.52313 0.03335  0.13073  0.14446  86  ASN A CB  
663  C CG  . ASN A 86  ? 0.52463 1.04441 0.58771 0.05940  0.12931  0.12083  86  ASN A CG  
664  O OD1 . ASN A 86  ? 0.57513 1.06161 0.62006 0.05627  0.12506  0.11378  86  ASN A OD1 
665  N ND2 . ASN A 86  ? 0.55769 1.08641 0.61748 0.08519  0.13185  0.10862  86  ASN A ND2 
666  N N   . THR A 87  ? 0.46854 0.96277 0.48721 0.02743  0.13837  0.15608  87  THR A N   
667  C CA  . THR A 87  ? 0.50414 0.98980 0.48931 0.03674  0.14546  0.16155  87  THR A CA  
668  C C   . THR A 87  ? 0.53191 0.99598 0.51282 0.00898  0.14085  0.18046  87  THR A C   
669  O O   . THR A 87  ? 0.69807 1.14825 0.69820 -0.01456 0.13098  0.18509  87  THR A O   
670  C CB  . THR A 87  ? 0.47224 0.92969 0.42102 0.06539  0.14311  0.13759  87  THR A CB  
671  O OG1 . THR A 87  ? 0.46509 0.88421 0.40800 0.05759  0.13075  0.12715  87  THR A OG1 
672  C CG2 . THR A 87  ? 0.41723 0.88727 0.37101 0.09110  0.14453  0.11855  87  THR A CG2 
673  N N   . ASN A 88  ? 0.48723 0.94591 0.44163 0.01176  0.14689  0.19195  88  ASN A N   
674  C CA  . ASN A 88  ? 0.61210 1.04765 0.56193 -0.01456 0.14189  0.21280  88  ASN A CA  
675  C C   . ASN A 88  ? 0.59271 0.97991 0.52675 -0.01895 0.12696  0.20205  88  ASN A C   
676  O O   . ASN A 88  ? 0.64255 1.00570 0.55877 0.00334  0.11996  0.17609  88  ASN A O   
677  C CB  . ASN A 88  ? 0.89861 1.33333 0.81815 -0.00769 0.15060  0.22643  88  ASN A CB  
678  C CG  . ASN A 88  ? 1.12783 1.60932 1.05924 -0.00025 0.16607  0.23678  88  ASN A CG  
679  O OD1 . ASN A 88  ? 1.06880 1.58471 1.03329 -0.00162 0.16948  0.23589  88  ASN A OD1 
680  N ND2 . ASN A 88  ? 1.41644 1.89963 1.31905 0.00880  0.17516  0.24738  88  ASN A ND2 
681  N N   . VAL A 89  ? 0.61719 0.97487 0.56164 -0.04663 0.11522  0.21466  89  VAL A N   
682  C CA  . VAL A 89  ? 0.62799 0.92484 0.56183 -0.04959 0.09489  0.19855  89  VAL A CA  
683  C C   . VAL A 89  ? 0.62046 0.88690 0.51638 -0.04174 0.09227  0.20425  89  VAL A C   
684  O O   . VAL A 89  ? 0.73664 1.01696 0.61966 -0.04905 0.10212  0.22980  89  VAL A O   
685  C CB  . VAL A 89  ? 0.44557 0.72026 0.40509 -0.07971 0.08160  0.20633  89  VAL A CB  
686  C CG1 . VAL A 89  ? 0.41235 0.70916 0.40412 -0.08263 0.07955  0.19411  89  VAL A CG1 
687  C CG2 . VAL A 89  ? 0.47696 0.76651 0.44438 -0.10572 0.08732  0.23970  89  VAL A CG2 
688  N N   . SER A 90  ? 0.59004 0.81669 0.46897 -0.02672 0.07872  0.18148  90  SER A N   
689  C CA  . SER A 90  ? 0.52465 0.72057 0.36820 -0.01572 0.07225  0.18220  90  SER A CA  
690  C C   . SER A 90  ? 0.57941 0.73044 0.42189 -0.00885 0.05320  0.15879  90  SER A C   
691  O O   . SER A 90  ? 0.52431 0.67562 0.38438 -0.00229 0.04912  0.13732  90  SER A O   
692  C CB  . SER A 90  ? 0.54306 0.76281 0.35676 0.01067  0.08284  0.17706  90  SER A CB  
693  O OG  . SER A 90  ? 0.69866 0.89059 0.47680 0.01901  0.07557  0.18169  90  SER A OG  
694  N N   . GLU A 91  ? 0.56574 0.68028 0.38713 -0.00873 0.04216  0.16411  91  GLU A N   
695  C CA  . GLU A 91  ? 0.57900 0.65963 0.39705 0.00393  0.02578  0.14173  91  GLU A CA  
696  C C   . GLU A 91  ? 0.63482 0.72861 0.43957 0.02840  0.02582  0.12149  91  GLU A C   
697  O O   . GLU A 91  ? 0.60510 0.68851 0.42299 0.03666  0.01681  0.09922  91  GLU A O   
698  C CB  . GLU A 91  ? 0.53346 0.57505 0.33115 0.00221  0.01346  0.15215  91  GLU A CB  
699  C CG  . GLU A 91  ? 0.59253 0.61069 0.40183 -0.02138 0.00962  0.16916  91  GLU A CG  
700  C CD  . GLU A 91  ? 0.71075 0.68092 0.50929 -0.01847 -0.00748 0.16729  91  GLU A CD  
701  O OE1 . GLU A 91  ? 0.72673 0.67706 0.54209 -0.01672 -0.01717 0.14985  91  GLU A OE1 
702  O OE2 . GLU A 91  ? 0.82730 0.78053 0.59922 -0.01600 -0.01075 0.18378  91  GLU A OE2 
703  N N   . ASP A 92  ? 0.72915 0.84496 0.50687 0.04024  0.03558  0.12916  92  ASP A N   
704  C CA  . ASP A 92  ? 0.64725 0.77362 0.40862 0.06423  0.03461  0.10849  92  ASP A CA  
705  C C   . ASP A 92  ? 0.51886 0.67189 0.30461 0.06651  0.04400  0.09611  92  ASP A C   
706  O O   . ASP A 92  ? 0.58118 0.76892 0.36193 0.07121  0.06027  0.10433  92  ASP A O   
707  C CB  . ASP A 92  ? 0.56148 0.70314 0.28185 0.07832  0.04303  0.12025  92  ASP A CB  
708  C CG  . ASP A 92  ? 0.61370 0.75621 0.30864 0.10518  0.03684  0.09635  92  ASP A CG  
709  O OD1 . ASP A 92  ? 0.59880 0.73282 0.31200 0.11083  0.02745  0.07221  92  ASP A OD1 
710  O OD2 . ASP A 92  ? 0.67983 0.83118 0.33458 0.12085  0.04137  0.10215  92  ASP A OD2 
711  N N   . CYS A 93  ? 0.45460 0.59283 0.26625 0.06477  0.03427  0.07727  93  CYS A N   
712  C CA  . CYS A 93  ? 0.59058 0.74801 0.42831 0.06459  0.04094  0.06717  93  CYS A CA  
713  C C   . CYS A 93  ? 0.58611 0.72787 0.43299 0.07638  0.02992  0.04143  93  CYS A C   
714  O O   . CYS A 93  ? 0.53427 0.68887 0.39993 0.07811  0.03479  0.03332  93  CYS A O   
715  C CB  . CYS A 93  ? 0.40188 0.56173 0.27056 0.04176  0.04351  0.07837  93  CYS A CB  
716  S SG  . CYS A 93  ? 0.53457 0.65165 0.41692 0.02923  0.02667  0.07340  93  CYS A SG  
717  N N   . LEU A 94  ? 0.56782 0.68426 0.40289 0.08470  0.01498  0.02938  94  LEU A N   
718  C CA  . LEU A 94  ? 0.49040 0.59220 0.34134 0.09082  0.00362  0.00797  94  LEU A CA  
719  C C   . LEU A 94  ? 0.54459 0.65371 0.37897 0.10981  0.00383  -0.00737 94  LEU A C   
720  O O   . LEU A 94  ? 0.65605 0.75373 0.46619 0.12287  -0.00684 -0.01739 94  LEU A O   
721  C CB  . LEU A 94  ? 0.47969 0.55569 0.33119 0.09023  -0.01329 0.00270  94  LEU A CB  
722  C CG  . LEU A 94  ? 0.49791 0.56193 0.36470 0.07477  -0.01433 0.01530  94  LEU A CG  
723  C CD1 . LEU A 94  ? 0.41232 0.45469 0.28139 0.07784  -0.03035 0.00989  94  LEU A CD1 
724  C CD2 . LEU A 94  ? 0.50152 0.56924 0.39840 0.06390  -0.00844 0.01381  94  LEU A CD2 
725  N N   . TYR A 95  ? 0.59214 0.71870 0.43843 0.11263  0.01456  -0.01018 95  TYR A N   
726  C CA  . TYR A 95  ? 0.53101 0.66285 0.36092 0.13281  0.01592  -0.02499 95  TYR A CA  
727  C C   . TYR A 95  ? 0.46701 0.59511 0.32325 0.13295  0.01516  -0.03628 95  TYR A C   
728  O O   . TYR A 95  ? 0.49916 0.63404 0.38342 0.11871  0.02046  -0.02804 95  TYR A O   
729  C CB  . TYR A 95  ? 0.48564 0.64993 0.29446 0.14295  0.03397  -0.01336 95  TYR A CB  
730  C CG  . TYR A 95  ? 0.55900 0.72699 0.33776 0.14417  0.03604  -0.00018 95  TYR A CG  
731  C CD1 . TYR A 95  ? 0.67792 0.83631 0.41736 0.16440  0.02902  -0.01137 95  TYR A CD1 
732  C CD2 . TYR A 95  ? 0.54477 0.72183 0.33211 0.12507  0.04304  0.02342  95  TYR A CD2 
733  C CE1 . TYR A 95  ? 0.64384 0.80484 0.35178 0.16690  0.03068  0.00208  95  TYR A CE1 
734  C CE2 . TYR A 95  ? 0.66793 0.84514 0.42595 0.12589  0.04463  0.03807  95  TYR A CE2 
735  C CZ  . TYR A 95  ? 0.70573 0.87632 0.42349 0.14746  0.03916  0.02794  95  TYR A CZ  
736  O OH  . TYR A 95  ? 0.74501 0.91525 0.43007 0.14983  0.04055  0.04346  95  TYR A OH  
737  N N   . ILE A 96  ? 0.47633 0.59095 0.32075 0.14972  0.00741  -0.05520 96  ILE A N   
738  C CA  . ILE A 96  ? 0.56157 0.66571 0.42689 0.15174  0.00428  -0.06642 96  ILE A CA  
739  C C   . ILE A 96  ? 0.62767 0.74755 0.47770 0.17218  0.01483  -0.07157 96  ILE A C   
740  O O   . ILE A 96  ? 0.67386 0.80353 0.49144 0.18925  0.01923  -0.07423 96  ILE A O   
741  C CB  . ILE A 96  ? 0.53827 0.60767 0.40649 0.15282  -0.01658 -0.08448 96  ILE A CB  
742  C CG1 . ILE A 96  ? 0.59254 0.65239 0.49304 0.13227  -0.02316 -0.07869 96  ILE A CG1 
743  C CG2 . ILE A 96  ? 0.51462 0.56826 0.38416 0.16518  -0.02125 -0.09995 96  ILE A CG2 
744  C CD1 . ILE A 96  ? 0.62719 0.66042 0.53447 0.13059  -0.04387 -0.09264 96  ILE A CD1 
745  N N   . ASN A 97  ? 0.52820 0.65154 0.40025 0.17231  0.01935  -0.07242 97  ASN A N   
746  C CA  . ASN A 97  ? 0.56955 0.70180 0.43058 0.19467  0.02623  -0.08047 97  ASN A CA  
747  C C   . ASN A 97  ? 0.63946 0.73750 0.51071 0.19936  0.01321  -0.09625 97  ASN A C   
748  O O   . ASN A 97  ? 0.70171 0.78496 0.60018 0.18161  0.00675  -0.09313 97  ASN A O   
749  C CB  . ASN A 97  ? 0.50627 0.68004 0.38464 0.19256  0.04486  -0.06354 97  ASN A CB  
750  C CG  . ASN A 97  ? 0.51580 0.71915 0.39603 0.17754  0.05548  -0.04341 97  ASN A CG  
751  O OD1 . ASN A 97  ? 0.56400 0.78555 0.41928 0.18765  0.06356  -0.03890 97  ASN A OD1 
752  N ND2 . ASN A 97  ? 0.40706 0.61341 0.31475 0.15353  0.05523  -0.03067 97  ASN A ND2 
753  N N   . VAL A 98  ? 0.56799 0.65215 0.41572 0.22415  0.00952  -0.11276 98  VAL A N   
754  C CA  . VAL A 98  ? 0.54650 0.59254 0.39990 0.23038  -0.00428 -0.12805 98  VAL A CA  
755  C C   . VAL A 98  ? 0.55985 0.61201 0.39873 0.25837  0.00359  -0.13542 98  VAL A C   
756  O O   . VAL A 98  ? 0.60370 0.66630 0.41408 0.27539  0.00745  -0.13883 98  VAL A O   
757  C CB  . VAL A 98  ? 0.55225 0.55559 0.38794 0.23215  -0.02701 -0.14745 98  VAL A CB  
758  C CG1 . VAL A 98  ? 0.59225 0.55424 0.44119 0.23193  -0.04221 -0.15933 98  VAL A CG1 
759  C CG2 . VAL A 98  ? 0.49488 0.49750 0.34360 0.20854  -0.03472 -0.14030 98  VAL A CG2 
760  N N   . TRP A 99  ? 0.53697 0.58131 0.39826 0.25771  0.00398  -0.13285 99  TRP A N   
761  C CA  . TRP A 99  ? 0.54619 0.58929 0.40133 0.27587  0.00674  -0.13481 99  TRP A CA  
762  C C   . TRP A 99  ? 0.63729 0.62352 0.48712 0.28035  -0.01339 -0.15172 99  TRP A C   
763  O O   . TRP A 99  ? 0.74994 0.71231 0.62308 0.26734  -0.02109 -0.15104 99  TRP A O   
764  C CB  . TRP A 99  ? 0.51190 0.58763 0.39606 0.27072  0.02044  -0.11722 99  TRP A CB  
765  C CG  . TRP A 99  ? 0.57607 0.70956 0.46813 0.26564  0.03903  -0.09873 99  TRP A CG  
766  C CD1 . TRP A 99  ? 0.59826 0.76596 0.48545 0.27782  0.05017  -0.09069 99  TRP A CD1 
767  C CD2 . TRP A 99  ? 0.51998 0.68229 0.42869 0.24569  0.04732  -0.08508 99  TRP A CD2 
768  N NE1 . TRP A 99  ? 0.51678 0.73196 0.41822 0.26459  0.06399  -0.07221 99  TRP A NE1 
769  C CE2 . TRP A 99  ? 0.51220 0.72332 0.42569 0.24450  0.06226  -0.06854 99  TRP A CE2 
770  C CE3 . TRP A 99  ? 0.47065 0.61669 0.39272 0.22052  0.03995  -0.08120 99  TRP A CE3 
771  C CZ2 . TRP A 99  ? 0.47771 0.72270 0.40635 0.22499  0.07172  -0.05177 99  TRP A CZ2 
772  C CZ3 . TRP A 99  ? 0.46267 0.63877 0.39796 0.19974  0.04820  -0.06394 99  TRP A CZ3 
773  C CH2 . TRP A 99  ? 0.44858 0.67296 0.38616 0.20314  0.06401  -0.05033 99  TRP A CH2 
774  N N   . ALA A 100 ? 0.67434 0.63830 0.49447 0.29795  -0.02244 -0.16563 100 ALA A N   
775  C CA  . ALA A 100 ? 0.68474 0.59089 0.49686 0.29951  -0.04495 -0.18268 100 ALA A CA  
776  C C   . ALA A 100 ? 0.71906 0.61127 0.51441 0.32129  -0.04633 -0.18859 100 ALA A C   
777  O O   . ALA A 100 ? 0.72675 0.63784 0.49538 0.34096  -0.04007 -0.19181 100 ALA A O   
778  C CB  . ALA A 100 ? 0.68063 0.56294 0.46980 0.29750  -0.06198 -0.19794 100 ALA A CB  
779  N N   . PRO A 101 ? 0.86717 0.72674 0.67640 0.31977  -0.05413 -0.18936 101 PRO A N   
780  C CA  . PRO A 101 ? 0.86612 0.70898 0.65796 0.34202  -0.05658 -0.19572 101 PRO A CA  
781  C C   . PRO A 101 ? 0.91688 0.72454 0.67236 0.35653  -0.07374 -0.21619 101 PRO A C   
782  O O   . PRO A 101 ? 0.88542 0.66415 0.63484 0.34486  -0.09082 -0.22699 101 PRO A O   
783  C CB  . PRO A 101 ? 0.75802 0.56454 0.57328 0.33240  -0.06472 -0.19159 101 PRO A CB  
784  C CG  . PRO A 101 ? 0.75738 0.58399 0.60631 0.30896  -0.05712 -0.17651 101 PRO A CG  
785  C CD  . PRO A 101 ? 0.75785 0.60147 0.60122 0.29883  -0.05746 -0.18048 101 PRO A CD  
786  N N   . ALA A 102 ? 1.06296 0.87606 0.79459 0.38302  -0.06941 -0.22109 102 ALA A N   
787  C CA  . ALA A 102 ? 0.93577 0.71417 0.62926 0.40393  -0.08494 -0.24077 102 ALA A CA  
788  C C   . ALA A 102 ? 1.02480 0.74707 0.70966 0.39130  -0.11236 -0.25725 102 ALA A C   
789  O O   . ALA A 102 ? 1.17912 0.85578 0.84293 0.40323  -0.13033 -0.27262 102 ALA A O   
790  C CB  . ALA A 102 ? 0.97708 0.73849 0.66325 0.42506  -0.08514 -0.24362 102 ALA A CB  
791  N N   . THR A 137 ? 1.55216 1.01104 1.66698 0.06386  -0.19402 -0.09690 137 THR A N   
792  C CA  . THR A 137 ? 1.63780 1.08832 1.79007 0.02937  -0.20883 -0.08817 137 THR A CA  
793  C C   . THR A 137 ? 1.84060 1.25895 1.97522 0.02944  -0.23582 -0.11223 137 THR A C   
794  O O   . THR A 137 ? 1.82482 1.22686 1.98681 0.00300  -0.25177 -0.10572 137 THR A O   
795  C CB  . THR A 137 ? 1.46452 0.96290 1.65383 0.00963  -0.20175 -0.07951 137 THR A CB  
796  O OG1 . THR A 137 ? 1.33456 0.87202 1.52570 0.01911  -0.17486 -0.06470 137 THR A OG1 
797  C CG2 . THR A 137 ? 1.41063 0.91290 1.64956 -0.02749 -0.20725 -0.05757 137 THR A CG2 
798  N N   . THR A 138 ? 2.07498 1.48870 2.16478 0.05954  -0.23959 -0.13822 138 THR A N   
799  C CA  . THR A 138 ? 2.20168 1.58382 2.25959 0.07143  -0.26241 -0.16420 138 THR A CA  
800  C C   . THR A 138 ? 2.15393 1.56331 2.19360 0.08129  -0.26853 -0.18528 138 THR A C   
801  O O   . THR A 138 ? 2.22243 1.61581 2.22177 0.10376  -0.27912 -0.20772 138 THR A O   
802  C CB  . THR A 138 ? 2.31072 1.65396 2.39042 0.04528  -0.28717 -0.16157 138 THR A CB  
803  O OG1 . THR A 138 ? 2.35040 1.67232 2.45244 0.03094  -0.28019 -0.13724 138 THR A OG1 
804  C CG2 . THR A 138 ? 2.37710 1.67790 2.41689 0.06357  -0.30965 -0.18767 138 THR A CG2 
805  N N   . ASN A 139 ? 1.98828 1.43870 2.05531 0.06623  -0.26176 -0.17789 139 ASN A N   
806  C CA  . ASN A 139 ? 1.70910 1.18207 1.76461 0.06976  -0.27155 -0.19521 139 ASN A CA  
807  C C   . ASN A 139 ? 1.38545 0.89556 1.41253 0.09518  -0.25131 -0.20221 139 ASN A C   
808  O O   . ASN A 139 ? 1.33638 0.87795 1.36878 0.09118  -0.25110 -0.20606 139 ASN A O   
809  C CB  . ASN A 139 ? 1.74679 1.24267 1.85178 0.03679  -0.27980 -0.18360 139 ASN A CB  
810  C CG  . ASN A 139 ? 1.85524 1.32483 1.99714 0.00793  -0.29511 -0.17019 139 ASN A CG  
811  O OD1 . ASN A 139 ? 1.93831 1.38535 2.08787 0.00372  -0.28773 -0.15554 139 ASN A OD1 
812  N ND2 . ASN A 139 ? 1.85332 1.32813 2.01924 -0.01220 -0.31603 -0.17345 139 ASN A ND2 
813  N N   . GLY A 140 ? 1.21813 0.72775 1.21602 0.12128  -0.23431 -0.20304 140 GLY A N   
814  C CA  . GLY A 140 ? 1.06258 0.61252 1.03685 0.14397  -0.21356 -0.20667 140 GLY A CA  
815  C C   . GLY A 140 ? 1.03038 0.60423 1.01757 0.14933  -0.18777 -0.18830 140 GLY A C   
816  O O   . GLY A 140 ? 0.95284 0.51757 0.97405 0.13084  -0.18496 -0.16984 140 GLY A O   
817  N N   . LEU A 141 ? 0.94836 0.55634 0.90948 0.17413  -0.16856 -0.19130 141 LEU A N   
818  C CA  . LEU A 141 ? 0.79383 0.42882 0.76191 0.18400  -0.14491 -0.17542 141 LEU A CA  
819  C C   . LEU A 141 ? 0.78908 0.47175 0.79047 0.16014  -0.12860 -0.15371 141 LEU A C   
820  O O   . LEU A 141 ? 0.75233 0.45275 0.76367 0.14503  -0.13296 -0.15543 141 LEU A O   
821  C CB  . LEU A 141 ? 0.74583 0.41331 0.67888 0.21343  -0.12894 -0.18223 141 LEU A CB  
822  C CG  . LEU A 141 ? 0.80892 0.45539 0.70909 0.23674  -0.13298 -0.19348 141 LEU A CG  
823  C CD1 . LEU A 141 ? 0.84911 0.54061 0.72214 0.26197  -0.11469 -0.19648 141 LEU A CD1 
824  C CD2 . LEU A 141 ? 0.78344 0.40214 0.69361 0.23876  -0.13252 -0.18307 141 LEU A CD2 
825  N N   . PRO A 142 ? 0.68450 0.39013 0.70138 0.15718  -0.10979 -0.13270 142 PRO A N   
826  C CA  . PRO A 142 ? 0.64443 0.39782 0.68597 0.13806  -0.09261 -0.11327 142 PRO A CA  
827  C C   . PRO A 142 ? 0.65213 0.44984 0.67615 0.14871  -0.07979 -0.11752 142 PRO A C   
828  O O   . PRO A 142 ? 0.60258 0.40502 0.59795 0.17310  -0.07661 -0.12896 142 PRO A O   
829  C CB  . PRO A 142 ? 0.64400 0.40383 0.69700 0.13800  -0.07847 -0.09319 142 PRO A CB  
830  C CG  . PRO A 142 ? 0.66872 0.37730 0.71069 0.15126  -0.09122 -0.09938 142 PRO A CG  
831  C CD  . PRO A 142 ? 0.67408 0.36033 0.68508 0.17214  -0.10516 -0.12612 142 PRO A CD  
832  N N   . ILE A 143 ? 0.55760 0.38838 0.59938 0.13073  -0.07185 -0.10709 143 ILE A N   
833  C CA  . ILE A 143 ? 0.67453 0.54356 0.70212 0.13626  -0.06157 -0.10891 143 ILE A CA  
834  C C   . ILE A 143 ? 0.60644 0.51248 0.65120 0.12486  -0.04344 -0.08940 143 ILE A C   
835  O O   . ILE A 143 ? 0.65860 0.56923 0.72776 0.10562  -0.04250 -0.07873 143 ILE A O   
836  C CB  . ILE A 143 ? 0.60766 0.47571 0.63289 0.12831  -0.07388 -0.11916 143 ILE A CB  
837  C CG1 . ILE A 143 ? 0.75176 0.57942 0.75755 0.13911  -0.09530 -0.14051 143 ILE A CG1 
838  C CG2 . ILE A 143 ? 0.46391 0.36662 0.46986 0.13609  -0.06327 -0.11961 143 ILE A CG2 
839  C CD1 . ILE A 143 ? 0.86504 0.67301 0.89103 0.12002  -0.11505 -0.14500 143 ILE A CD1 
840  N N   . LEU A 144 ? 0.49616 0.42959 0.52831 0.13722  -0.02972 -0.08513 144 LEU A N   
841  C CA  . LEU A 144 ? 0.38711 0.35455 0.43066 0.12780  -0.01496 -0.06922 144 LEU A CA  
842  C C   . LEU A 144 ? 0.42068 0.41700 0.45425 0.12643  -0.00940 -0.07011 144 LEU A C   
843  O O   . LEU A 144 ? 0.49123 0.49572 0.50399 0.14123  -0.00854 -0.07851 144 LEU A O   
844  C CB  . LEU A 144 ? 0.39337 0.37308 0.43374 0.13998  -0.00568 -0.06193 144 LEU A CB  
845  C CG  . LEU A 144 ? 0.43327 0.39114 0.48618 0.13730  -0.00725 -0.05306 144 LEU A CG  
846  C CD1 . LEU A 144 ? 0.66102 0.57696 0.70656 0.14792  -0.02046 -0.06447 144 LEU A CD1 
847  C CD2 . LEU A 144 ? 0.35265 0.33347 0.40341 0.14710  0.00263  -0.04348 144 LEU A CD2 
848  N N   . ILE A 145 ? 0.35682 0.36817 0.40368 0.11002  -0.00491 -0.06054 145 ILE A N   
849  C CA  . ILE A 145 ? 0.37403 0.40671 0.41293 0.10585  -0.00127 -0.05930 145 ILE A CA  
850  C C   . ILE A 145 ? 0.38847 0.44717 0.43322 0.09866  0.01049  -0.04601 145 ILE A C   
851  O O   . ILE A 145 ? 0.42877 0.48634 0.48813 0.08783  0.01286  -0.03808 145 ILE A O   
852  C CB  . ILE A 145 ? 0.44701 0.46959 0.49490 0.09398  -0.00996 -0.06179 145 ILE A CB  
853  C CG1 . ILE A 145 ? 0.48678 0.48195 0.53211 0.09842  -0.02523 -0.07532 145 ILE A CG1 
854  C CG2 . ILE A 145 ? 0.42358 0.46367 0.46035 0.09116  -0.00737 -0.05965 145 ILE A CG2 
855  C CD1 . ILE A 145 ? 0.55921 0.54807 0.62024 0.08578  -0.03556 -0.07668 145 ILE A CD1 
856  N N   . TRP A 146 ? 0.39851 0.48116 0.43151 0.10410  0.01731  -0.04342 146 TRP A N   
857  C CA  . TRP A 146 ? 0.36902 0.47644 0.40755 0.09608  0.02565  -0.03156 146 TRP A CA  
858  C C   . TRP A 146 ? 0.34159 0.45479 0.37837 0.08299  0.02585  -0.02684 146 TRP A C   
859  O O   . TRP A 146 ? 0.41284 0.52714 0.43746 0.08503  0.02412  -0.02985 146 TRP A O   
860  C CB  . TRP A 146 ? 0.24937 0.38359 0.28142 0.10746  0.03263  -0.02896 146 TRP A CB  
861  C CG  . TRP A 146 ? 0.36932 0.53167 0.40878 0.09709  0.03862  -0.01683 146 TRP A CG  
862  C CD1 . TRP A 146 ? 0.36227 0.54726 0.39793 0.09079  0.04296  -0.01009 146 TRP A CD1 
863  C CD2 . TRP A 146 ? 0.40318 0.57271 0.45456 0.09098  0.03928  -0.00954 146 TRP A CD2 
864  N NE1 . TRP A 146 ? 0.36167 0.56665 0.40874 0.07945  0.04494  0.00036  146 TRP A NE1 
865  C CE2 . TRP A 146 ? 0.40600 0.60204 0.46134 0.08031  0.04215  -0.00021 146 TRP A CE2 
866  C CE3 . TRP A 146 ? 0.30720 0.46254 0.36497 0.09321  0.03708  -0.00915 146 TRP A CE3 
867  C CZ2 . TRP A 146 ? 0.41280 0.62084 0.47751 0.07234  0.04079  0.00699  146 TRP A CZ2 
868  C CZ3 . TRP A 146 ? 0.38331 0.55187 0.44766 0.08712  0.03756  -0.00099 146 TRP A CZ3 
869  C CH2 . TRP A 146 ? 0.42536 0.61965 0.49276 0.07701  0.03838  0.00575  146 TRP A CH2 
870  N N   . ILE A 147 ? 0.31611 0.43124 0.36187 0.07118  0.02751  -0.01946 147 ILE A N   
871  C CA  . ILE A 147 ? 0.32992 0.44789 0.37258 0.05973  0.02721  -0.01438 147 ILE A CA  
872  C C   . ILE A 147 ? 0.32384 0.46073 0.36850 0.05249  0.03112  -0.00536 147 ILE A C   
873  O O   . ILE A 147 ? 0.41135 0.54677 0.46228 0.04916  0.03121  -0.00296 147 ILE A O   
874  C CB  . ILE A 147 ? 0.29744 0.39712 0.34697 0.05313  0.02353  -0.01561 147 ILE A CB  
875  C CG1 . ILE A 147 ? 0.21401 0.29815 0.26889 0.05810  0.01790  -0.02355 147 ILE A CG1 
876  C CG2 . ILE A 147 ? 0.27689 0.37428 0.31977 0.04462  0.02166  -0.01181 147 ILE A CG2 
877  C CD1 . ILE A 147 ? 0.20851 0.28223 0.27544 0.05221  0.01566  -0.02296 147 ILE A CD1 
878  N N   . TYR A 148 ? 0.31132 0.46618 0.35053 0.04915  0.03361  0.00044  148 TYR A N   
879  C CA  . TYR A 148 ? 0.25859 0.43357 0.30357 0.03924  0.03512  0.00993  148 TYR A CA  
880  C C   . TYR A 148 ? 0.30843 0.46669 0.35254 0.02535  0.02955  0.01227  148 TYR A C   
881  O O   . TYR A 148 ? 0.29855 0.43425 0.33650 0.02354  0.02628  0.00872  148 TYR A O   
882  C CB  . TYR A 148 ? 0.37834 0.57836 0.42056 0.03643  0.03981  0.01845  148 TYR A CB  
883  C CG  . TYR A 148 ? 0.41931 0.60597 0.44877 0.03082  0.03825  0.02079  148 TYR A CG  
884  C CD1 . TYR A 148 ? 0.44351 0.61857 0.47155 0.01466  0.03343  0.02786  148 TYR A CD1 
885  C CD2 . TYR A 148 ? 0.45161 0.63439 0.46789 0.04294  0.04003  0.01547  148 TYR A CD2 
886  C CE1 . TYR A 148 ? 0.54447 0.70488 0.55945 0.01100  0.03126  0.03132  148 TYR A CE1 
887  C CE2 . TYR A 148 ? 0.51892 0.68970 0.52131 0.03938  0.03755  0.01838  148 TYR A CE2 
888  C CZ  . TYR A 148 ? 0.58870 0.74867 0.59106 0.02357  0.03362  0.02720  148 TYR A CZ  
889  O OH  . TYR A 148 ? 0.55834 0.70415 0.54559 0.02150  0.03048  0.03127  148 TYR A OH  
890  N N   . GLY A 149 ? 0.30033 0.47044 0.35012 0.01654  0.02734  0.01785  149 GLY A N   
891  C CA  . GLY A 149 ? 0.33434 0.48814 0.37986 0.00379  0.02034  0.01922  149 GLY A CA  
892  C C   . GLY A 149 ? 0.37337 0.53796 0.42042 -0.01189 0.01695  0.02919  149 GLY A C   
893  O O   . GLY A 149 ? 0.34055 0.52320 0.38978 -0.01299 0.02203  0.03633  149 GLY A O   
894  N N   . GLY A 150 ? 0.35858 0.51104 0.40339 -0.02435 0.00788  0.03015  150 GLY A N   
895  C CA  . GLY A 150 ? 0.33234 0.48468 0.37814 -0.04280 0.00160  0.03982  150 GLY A CA  
896  C C   . GLY A 150 ? 0.39769 0.50880 0.42772 -0.04956 -0.00755 0.03590  150 GLY A C   
897  O O   . GLY A 150 ? 0.28881 0.38846 0.31470 -0.06128 -0.01121 0.04388  150 GLY A O   
898  N N   . GLY A 151 ? 0.31856 0.40683 0.33856 -0.04060 -0.01060 0.02435  151 GLY A N   
899  C CA  . GLY A 151 ? 0.35176 0.40170 0.35527 -0.04404 -0.02018 0.01866  151 GLY A CA  
900  C C   . GLY A 151 ? 0.43025 0.45575 0.42421 -0.03969 -0.01927 0.01833  151 GLY A C   
901  O O   . GLY A 151 ? 0.44339 0.43623 0.42374 -0.04448 -0.02866 0.01643  151 GLY A O   
902  N N   . PHE A 152 ? 0.41525 0.45331 0.41445 -0.02955 -0.00994 0.01926  152 PHE A N   
903  C CA  . PHE A 152 ? 0.43229 0.45203 0.42353 -0.02454 -0.01022 0.01987  152 PHE A CA  
904  C C   . PHE A 152 ? 0.54244 0.55181 0.52704 -0.03917 -0.01599 0.03196  152 PHE A C   
905  O O   . PHE A 152 ? 0.57330 0.56055 0.54720 -0.03609 -0.01918 0.03381  152 PHE A O   
906  C CB  . PHE A 152 ? 0.33396 0.32506 0.31594 -0.01330 -0.01358 0.00948  152 PHE A CB  
907  C CG  . PHE A 152 ? 0.44743 0.45003 0.43738 0.00005  -0.00628 0.00091  152 PHE A CG  
908  C CD1 . PHE A 152 ? 0.40759 0.42368 0.40819 0.00995  0.00029  -0.00082 152 PHE A CD1 
909  C CD2 . PHE A 152 ? 0.47686 0.47592 0.46272 0.00202  -0.00686 -0.00466 152 PHE A CD2 
910  C CE1 . PHE A 152 ? 0.37025 0.39582 0.38069 0.01943  0.00665  -0.00612 152 PHE A CE1 
911  C CE2 . PHE A 152 ? 0.37767 0.38771 0.37029 0.01350  0.00115  -0.00932 152 PHE A CE2 
912  C CZ  . PHE A 152 ? 0.41868 0.44199 0.42535 0.02109  0.00818  -0.00910 152 PHE A CZ  
913  N N   . MET A 153 ? 0.40888 0.43489 0.40102 -0.05544 -0.01777 0.04177  153 MET A N   
914  C CA  . MET A 153 ? 0.46300 0.48304 0.45252 -0.07260 -0.02219 0.05697  153 MET A CA  
915  C C   . MET A 153 ? 0.43904 0.50072 0.44060 -0.07753 -0.01156 0.07088  153 MET A C   
916  O O   . MET A 153 ? 0.51858 0.57981 0.51590 -0.08721 -0.01053 0.08573  153 MET A O   
917  C CB  . MET A 153 ? 0.48720 0.48968 0.47717 -0.09151 -0.03566 0.05916  153 MET A CB  
918  C CG  . MET A 153 ? 0.49922 0.45780 0.47194 -0.08442 -0.04658 0.04423  153 MET A CG  
919  S SD  . MET A 153 ? 0.57086 0.47728 0.52137 -0.08111 -0.05491 0.04521  153 MET A SD  
920  C CE  . MET A 153 ? 0.46579 0.36054 0.41858 -0.11183 -0.06574 0.06568  153 MET A CE  
921  N N   . THR A 154 ? 0.47379 0.57064 0.48856 -0.06937 -0.00314 0.06692  154 THR A N   
922  C CA  . THR A 154 ? 0.44927 0.59096 0.47798 -0.07244 0.00694  0.07877  154 THR A CA  
923  C C   . THR A 154 ? 0.42388 0.58765 0.45625 -0.05141 0.01654  0.06805  154 THR A C   
924  O O   . THR A 154 ? 0.39847 0.54300 0.42507 -0.03837 0.01480  0.05372  154 THR A O   
925  C CB  . THR A 154 ? 0.46806 0.63193 0.51610 -0.09176 0.00169  0.08811  154 THR A CB  
926  O OG1 . THR A 154 ? 0.38598 0.55376 0.44083 -0.08537 -0.00257 0.07540  154 THR A OG1 
927  C CG2 . THR A 154 ? 0.52003 0.65508 0.56500 -0.11545 -0.01160 0.09773  154 THR A CG2 
928  N N   . GLY A 155 ? 0.44720 0.65176 0.49007 -0.04804 0.02668  0.07575  155 GLY A N   
929  C CA  . GLY A 155 ? 0.46780 0.69140 0.51352 -0.02772 0.03454  0.06590  155 GLY A CA  
930  C C   . GLY A 155 ? 0.44609 0.67703 0.47803 -0.01296 0.04369  0.06576  155 GLY A C   
931  O O   . GLY A 155 ? 0.42706 0.64275 0.44415 -0.01617 0.04311  0.07113  155 GLY A O   
932  N N   . SER A 156 ? 0.40262 0.65497 0.43699 0.00495  0.05107  0.05897  156 SER A N   
933  C CA  . SER A 156 ? 0.33680 0.59894 0.35539 0.02173  0.05936  0.05704  156 SER A CA  
934  C C   . SER A 156 ? 0.30543 0.57675 0.32582 0.04284  0.06284  0.04408  156 SER A C   
935  O O   . SER A 156 ? 0.39532 0.68529 0.43290 0.04390  0.06398  0.04446  156 SER A O   
936  C CB  . SER A 156 ? 0.36409 0.66327 0.38327 0.01671  0.07035  0.07532  156 SER A CB  
937  O OG  . SER A 156 ? 0.28732 0.60799 0.29417 0.03903  0.08093  0.07122  156 SER A OG  
938  N N   . ALA A 157 ? 0.29480 0.55192 0.29607 0.06005  0.06316  0.03290  157 ALA A N   
939  C CA  . ALA A 157 ? 0.33010 0.58715 0.32869 0.08128  0.06434  0.01909  157 ALA A CA  
940  C C   . ALA A 157 ? 0.43887 0.73550 0.43549 0.09689  0.07684  0.02355  157 ALA A C   
941  O O   . ALA A 157 ? 0.50368 0.80232 0.49986 0.11581  0.07800  0.01304  157 ALA A O   
942  C CB  . ALA A 157 ? 0.31850 0.54171 0.29716 0.09273  0.05662  0.00387  157 ALA A CB  
943  N N   . THR A 158 ? 0.28839 0.61668 0.28452 0.08999  0.08651  0.03981  158 THR A N   
944  C CA  . THR A 158 ? 0.38142 0.75221 0.37346 0.10736  0.10114  0.04537  158 THR A CA  
945  C C   . THR A 158 ? 0.37654 0.79153 0.39889 0.10413  0.10795  0.05639  158 THR A C   
946  O O   . THR A 158 ? 0.52099 0.96444 0.54370 0.11615  0.11597  0.06136  158 THR A O   
947  C CB  . THR A 158 ? 0.42302 0.81187 0.39916 0.10253  0.11068  0.06069  158 THR A CB  
948  O OG1 . THR A 158 ? 0.47330 0.88170 0.47209 0.07471  0.11227  0.08217  158 THR A OG1 
949  C CG2 . THR A 158 ? 0.38542 0.73153 0.33246 0.10356  0.10157  0.05194  158 THR A CG2 
950  N N   . LEU A 159 ? 0.42274 0.83116 0.46823 0.08525  0.09882  0.05957  159 LEU A N   
951  C CA  . LEU A 159 ? 0.41462 0.86616 0.49000 0.08115  0.10223  0.07003  159 LEU A CA  
952  C C   . LEU A 159 ? 0.40498 0.85558 0.47715 0.10721  0.10189  0.05754  159 LEU A C   
953  O O   . LEU A 159 ? 0.46306 0.88192 0.52278 0.12195  0.09704  0.04107  159 LEU A O   
954  C CB  . LEU A 159 ? 0.40011 0.83405 0.49335 0.05831  0.08849  0.07164  159 LEU A CB  
955  C CG  . LEU A 159 ? 0.39537 0.79962 0.48429 0.03178  0.07978  0.07752  159 LEU A CG  
956  C CD1 . LEU A 159 ? 0.26995 0.66092 0.37447 0.01456  0.06637  0.07681  159 LEU A CD1 
957  C CD2 . LEU A 159 ? 0.25379 0.68663 0.34700 0.01665  0.08778  0.09760  159 LEU A CD2 
958  N N   . ASP A 160 ? 0.35043 0.83511 0.43406 0.11282  0.10673  0.06614  160 ASP A N   
959  C CA  . ASP A 160 ? 0.40049 0.88536 0.48158 0.13747  0.10604  0.05604  160 ASP A CA  
960  C C   . ASP A 160 ? 0.43686 0.89670 0.52457 0.14001  0.09577  0.04563  160 ASP A C   
961  O O   . ASP A 160 ? 0.39821 0.83320 0.47188 0.16144  0.09316  0.03169  160 ASP A O   
962  C CB  . ASP A 160 ? 0.41436 0.94488 0.51549 0.13850  0.11097  0.06925  160 ASP A CB  
963  C CG  . ASP A 160 ? 0.61515 1.17487 0.71358 0.13468  0.12199  0.08283  160 ASP A CG  
964  O OD1 . ASP A 160 ? 0.65239 1.19420 0.72509 0.14097  0.12666  0.07836  160 ASP A OD1 
965  O OD2 . ASP A 160 ? 0.68843 1.28959 0.81046 0.12577  0.12563  0.09841  160 ASP A OD2 
966  N N   . ILE A 161 ? 0.37365 0.83743 0.48114 0.11837  0.08915  0.05247  161 ILE A N   
967  C CA  . ILE A 161 ? 0.35937 0.80442 0.47370 0.12065  0.07982  0.04544  161 ILE A CA  
968  C C   . ILE A 161 ? 0.44512 0.84465 0.53938 0.13285  0.07717  0.02958  161 ILE A C   
969  O O   . ILE A 161 ? 0.37473 0.75339 0.46857 0.14360  0.07131  0.02221  161 ILE A O   
970  C CB  . ILE A 161 ? 0.35426 0.81181 0.48959 0.09417  0.07254  0.05540  161 ILE A CB  
971  C CG1 . ILE A 161 ? 0.42745 0.88151 0.57306 0.09805  0.06304  0.05271  161 ILE A CG1 
972  C CG2 . ILE A 161 ? 0.30144 0.71995 0.42251 0.07630  0.06791  0.05222  161 ILE A CG2 
973  C CD1 . ILE A 161 ? 0.47163 0.95395 0.62820 0.10942  0.06302  0.05730  161 ILE A CD1 
974  N N   . TYR A 162 ? 0.41115 0.79228 0.48760 0.13128  0.08021  0.02480  162 TYR A N   
975  C CA  . TYR A 162 ? 0.37690 0.70652 0.43289 0.13726  0.07347  0.00974  162 TYR A CA  
976  C C   . TYR A 162 ? 0.39212 0.71403 0.42788 0.16487  0.07750  -0.00283 162 TYR A C   
977  O O   . TYR A 162 ? 0.31377 0.59356 0.33246 0.16989  0.07024  -0.01614 162 TYR A O   
978  C CB  . TYR A 162 ? 0.28756 0.59400 0.33456 0.11724  0.06960  0.01089  162 TYR A CB  
979  C CG  . TYR A 162 ? 0.28405 0.58890 0.34508 0.09189  0.06398  0.02030  162 TYR A CG  
980  C CD1 . TYR A 162 ? 0.36525 0.67149 0.44052 0.08763  0.05874  0.02222  162 TYR A CD1 
981  C CD2 . TYR A 162 ? 0.25462 0.55297 0.31116 0.07372  0.06272  0.02661  162 TYR A CD2 
982  C CE1 . TYR A 162 ? 0.39197 0.69313 0.47497 0.06623  0.05207  0.02847  162 TYR A CE1 
983  C CE2 . TYR A 162 ? 0.29136 0.58219 0.35694 0.05254  0.05598  0.03299  162 TYR A CE2 
984  C CZ  . TYR A 162 ? 0.37400 0.66633 0.45197 0.04905  0.05056  0.03304  162 TYR A CZ  
985  O OH  . TYR A 162 ? 0.36372 0.64561 0.44583 0.02969  0.04258  0.03730  162 TYR A OH  
986  N N   . ASN A 163 ? 0.32778 0.67728 0.36204 0.17726  0.08401  0.00129  163 ASN A N   
987  C CA  . ASN A 163 ? 0.38158 0.71364 0.39219 0.20195  0.08397  -0.01152 163 ASN A CA  
988  C C   . ASN A 163 ? 0.45736 0.74860 0.46367 0.21471  0.07409  -0.02539 163 ASN A C   
989  O O   . ASN A 163 ? 0.42348 0.71795 0.44553 0.21528  0.07129  -0.02125 163 ASN A O   
990  C CB  . ASN A 163 ? 0.40079 0.77024 0.41467 0.21262  0.09173  -0.00308 163 ASN A CB  
991  C CG  . ASN A 163 ? 0.42310 0.77619 0.41130 0.23984  0.09161  -0.01622 163 ASN A CG  
992  O OD1 . ASN A 163 ? 0.52066 0.83483 0.48577 0.24897  0.08531  -0.03160 163 ASN A OD1 
993  N ND2 . ASN A 163 ? 0.48515 0.86857 0.47671 0.25332  0.09781  -0.01054 163 ASN A ND2 
994  N N   . ALA A 164 ? 0.48283 0.73413 0.46766 0.22423  0.06754  -0.04127 164 ALA A N   
995  C CA  . ALA A 164 ? 0.50134 0.70801 0.48208 0.23428  0.05656  -0.05402 164 ALA A CA  
996  C C   . ALA A 164 ? 0.56604 0.75562 0.52668 0.25842  0.05337  -0.06499 164 ALA A C   
997  O O   . ALA A 164 ? 0.61303 0.75714 0.56392 0.26720  0.04219  -0.07801 164 ALA A O   
998  C CB  . ALA A 164 ? 0.47975 0.64658 0.45284 0.22560  0.04681  -0.06468 164 ALA A CB  
999  N N   . ASP A 165 ? 0.45573 0.67980 0.41040 0.26908  0.06235  -0.05957 165 ASP A N   
1000 C CA  . ASP A 165 ? 0.52666 0.73768 0.46172 0.29438  0.06003  -0.06964 165 ASP A CA  
1001 C C   . ASP A 165 ? 0.56230 0.74756 0.50575 0.30227  0.05236  -0.07257 165 ASP A C   
1002 O O   . ASP A 165 ? 0.59459 0.73258 0.52140 0.31422  0.04135  -0.08713 165 ASP A O   
1003 C CB  . ASP A 165 ? 0.60295 0.86388 0.53836 0.30390  0.07263  -0.05917 165 ASP A CB  
1004 C CG  . ASP A 165 ? 0.66039 0.93714 0.57698 0.30493  0.07922  -0.05888 165 ASP A CG  
1005 O OD1 . ASP A 165 ? 0.69747 0.94698 0.59997 0.29798  0.07332  -0.06736 165 ASP A OD1 
1006 O OD2 . ASP A 165 ? 0.67388 0.99125 0.59008 0.31320  0.09016  -0.04939 165 ASP A OD2 
1007 N N   . ILE A 166 ? 0.55847 0.77293 0.52735 0.29504  0.05674  -0.05821 166 ILE A N   
1008 C CA  . ILE A 166 ? 0.56509 0.75947 0.54068 0.30475  0.05027  -0.05843 166 ILE A CA  
1009 C C   . ILE A 166 ? 0.58871 0.73076 0.56422 0.29733  0.03881  -0.06512 166 ILE A C   
1010 O O   . ILE A 166 ? 0.50208 0.60131 0.46678 0.31028  0.02947  -0.07411 166 ILE A O   
1011 C CB  . ILE A 166 ? 0.47918 0.71764 0.48137 0.29732  0.05565  -0.04130 166 ILE A CB  
1012 C CG1 . ILE A 166 ? 0.46213 0.74274 0.46457 0.31252  0.06384  -0.03648 166 ILE A CG1 
1013 C CG2 . ILE A 166 ? 0.46050 0.67362 0.47140 0.30082  0.04736  -0.03898 166 ILE A CG2 
1014 C CD1 . ILE A 166 ? 0.43211 0.76766 0.46190 0.29837  0.07025  -0.01892 166 ILE A CD1 
1015 N N   . MET A 167 ? 0.43203 0.57590 0.41995 0.27628  0.03905  -0.06018 167 MET A N   
1016 C CA  . MET A 167 ? 0.42949 0.52854 0.42129 0.26846  0.02921  -0.06375 167 MET A CA  
1017 C C   . MET A 167 ? 0.60427 0.65087 0.57459 0.27814  0.01778  -0.08152 167 MET A C   
1018 O O   . MET A 167 ? 0.58414 0.58661 0.55357 0.28218  0.00743  -0.08507 167 MET A O   
1019 C CB  . MET A 167 ? 0.42177 0.53320 0.42717 0.24676  0.03188  -0.05769 167 MET A CB  
1020 C CG  . MET A 167 ? 0.48030 0.54514 0.49061 0.22953  0.02132  -0.05765 167 MET A CG  
1021 S SD  . MET A 167 ? 0.49825 0.57079 0.52256 0.19470  0.02265  -0.04827 167 MET A SD  
1022 C CE  . MET A 167 ? 0.32340 0.42219 0.36552 0.18468  0.02809  -0.02986 167 MET A CE  
1023 N N   . ALA A 168 ? 0.61175 0.66078 0.56366 0.28115  0.01815  -0.09213 168 ALA A N   
1024 C CA  . ALA A 168 ? 0.57266 0.57158 0.50240 0.28879  0.00432  -0.11042 168 ALA A CA  
1025 C C   . ALA A 168 ? 0.62259 0.59704 0.53711 0.30983  -0.00134 -0.11772 168 ALA A C   
1026 O O   . ALA A 168 ? 0.72377 0.64557 0.63234 0.31170  -0.01578 -0.12682 168 ALA A O   
1027 C CB  . ALA A 168 ? 0.53064 0.54154 0.44002 0.29007  0.00580  -0.11931 168 ALA A CB  
1028 N N   . ALA A 169 ? 0.57955 0.59154 0.48922 0.32517  0.00932  -0.11291 169 ALA A N   
1029 C CA  . ALA A 169 ? 0.63013 0.62222 0.52253 0.34874  0.00464  -0.12105 169 ALA A CA  
1030 C C   . ALA A 169 ? 0.77667 0.73718 0.68201 0.34957  -0.00266 -0.11614 169 ALA A C   
1031 O O   . ALA A 169 ? 0.86465 0.77245 0.75662 0.35754  -0.01615 -0.12695 169 ALA A O   
1032 C CB  . ALA A 169 ? 0.63235 0.67840 0.52201 0.36432  0.01888  -0.11416 169 ALA A CB  
1033 N N   . VAL A 170 ? 0.73556 0.72702 0.66619 0.34086  0.00521  -0.09893 170 VAL A N   
1034 C CA  . VAL A 170 ? 0.68118 0.64813 0.62341 0.34265  -0.00051 -0.09080 170 VAL A CA  
1035 C C   . VAL A 170 ? 0.66912 0.58722 0.61858 0.32558  -0.01143 -0.09040 170 VAL A C   
1036 O O   . VAL A 170 ? 0.68626 0.55995 0.63532 0.32885  -0.02120 -0.08890 170 VAL A O   
1037 C CB  . VAL A 170 ? 0.64593 0.66505 0.61059 0.33882  0.01004  -0.07254 170 VAL A CB  
1038 C CG1 . VAL A 170 ? 0.57610 0.57071 0.55223 0.33775  0.00379  -0.06158 170 VAL A CG1 
1039 C CG2 . VAL A 170 ? 0.79608 0.85711 0.75597 0.35739  0.01829  -0.07208 170 VAL A CG2 
1040 N N   . GLY A 171 ? 0.57386 0.49876 0.53072 0.30701  -0.01015 -0.09051 171 GLY A N   
1041 C CA  . GLY A 171 ? 0.75455 0.63550 0.72022 0.29062  -0.02066 -0.08976 171 GLY A CA  
1042 C C   . GLY A 171 ? 0.84005 0.66698 0.78964 0.29023  -0.03650 -0.10707 171 GLY A C   
1043 O O   . GLY A 171 ? 0.92506 0.70614 0.88336 0.27751  -0.04850 -0.10526 171 GLY A O   
1044 N N   . ASN A 172 ? 0.81396 0.64532 0.74022 0.30304  -0.03772 -0.12262 172 ASN A N   
1045 C CA  . ASN A 172 ? 0.78651 0.57203 0.69472 0.30137  -0.05437 -0.14087 172 ASN A CA  
1046 C C   . ASN A 172 ? 0.75192 0.52473 0.67562 0.27691  -0.06172 -0.14098 172 ASN A C   
1047 O O   . ASN A 172 ? 0.77793 0.50288 0.70885 0.26326  -0.07796 -0.14423 172 ASN A O   
1048 C CB  . ASN A 172 ? 0.81750 0.54637 0.71722 0.30857  -0.06918 -0.14627 172 ASN A CB  
1049 C CG  . ASN A 172 ? 0.96053 0.64661 0.83712 0.31023  -0.08752 -0.16693 172 ASN A CG  
1050 O OD1 . ASN A 172 ? 1.01276 0.71745 0.86913 0.31802  -0.08666 -0.17923 172 ASN A OD1 
1051 N ND2 . ASN A 172 ? 1.09086 0.71923 0.96972 0.30237  -0.10500 -0.16972 172 ASN A ND2 
1052 N N   . VAL A 173 ? 0.69402 0.51226 0.62577 0.27002  -0.04965 -0.13570 173 VAL A N   
1053 C CA  . VAL A 173 ? 0.74456 0.56125 0.69243 0.24678  -0.05433 -0.13435 173 VAL A CA  
1054 C C   . VAL A 173 ? 0.65928 0.51150 0.59272 0.24927  -0.04774 -0.14139 173 VAL A C   
1055 O O   . VAL A 173 ? 0.71580 0.59898 0.63123 0.26694  -0.03676 -0.14318 173 VAL A O   
1056 C CB  . VAL A 173 ? 0.66870 0.51175 0.64792 0.22229  -0.04322 -0.11019 173 VAL A CB  
1057 C CG1 . VAL A 173 ? 0.70115 0.50605 0.69470 0.21542  -0.05038 -0.10041 173 VAL A CG1 
1058 C CG2 . VAL A 173 ? 0.58132 0.47823 0.56164 0.23143  -0.02461 -0.09941 173 VAL A CG2 
1059 N N   . ILE A 174 ? 0.62735 0.48039 0.57168 0.22553  -0.05323 -0.14003 174 ILE A N   
1060 C CA  . ILE A 174 ? 0.64551 0.53044 0.57846 0.22361  -0.04761 -0.14276 174 ILE A CA  
1061 C C   . ILE A 174 ? 0.65070 0.57983 0.60706 0.20421  -0.03163 -0.12186 174 ILE A C   
1062 O O   . ILE A 174 ? 0.58366 0.50837 0.56617 0.18340  -0.03209 -0.10966 174 ILE A O   
1063 C CB  . ILE A 174 ? 0.63093 0.48689 0.55913 0.21217  -0.06657 -0.15574 174 ILE A CB  
1064 C CG1 . ILE A 174 ? 0.60963 0.41923 0.50852 0.23385  -0.08453 -0.17945 174 ILE A CG1 
1065 C CG2 . ILE A 174 ? 0.52277 0.41219 0.44384 0.20563  -0.06066 -0.15344 174 ILE A CG2 
1066 C CD1 . ILE A 174 ? 0.81460 0.60563 0.69473 0.23249  -0.10224 -0.19667 174 ILE A CD1 
1067 N N   . VAL A 175 ? 0.65374 0.62481 0.59998 0.21141  -0.01748 -0.11726 175 VAL A N   
1068 C CA  . VAL A 175 ? 0.60557 0.61568 0.57005 0.19341  -0.00448 -0.09928 175 VAL A CA  
1069 C C   . VAL A 175 ? 0.57332 0.60254 0.52465 0.18910  -0.00209 -0.10023 175 VAL A C   
1070 O O   . VAL A 175 ? 0.73344 0.77090 0.65894 0.20739  0.00023  -0.10886 175 VAL A O   
1071 C CB  . VAL A 175 ? 0.49614 0.54253 0.46680 0.20256  0.01045  -0.08767 175 VAL A CB  
1072 C CG1 . VAL A 175 ? 0.35276 0.42887 0.34424 0.18032  0.01905  -0.07017 175 VAL A CG1 
1073 C CG2 . VAL A 175 ? 0.46136 0.48665 0.43703 0.21467  0.00700  -0.08875 175 VAL A CG2 
1074 N N   . ALA A 176 ? 0.45377 0.49039 0.42086 0.16674  -0.00189 -0.09056 176 ALA A N   
1075 C CA  . ALA A 176 ? 0.44152 0.49401 0.39713 0.16136  -0.00012 -0.08861 176 ALA A CA  
1076 C C   . ALA A 176 ? 0.47503 0.55624 0.44697 0.14390  0.01077  -0.07087 176 ALA A C   
1077 O O   . ALA A 176 ? 0.52770 0.60959 0.52115 0.13194  0.01297  -0.06239 176 ALA A O   
1078 C CB  . ALA A 176 ? 0.39912 0.42363 0.35305 0.15333  -0.01633 -0.09824 176 ALA A CB  
1079 N N   . SER A 177 ? 0.44769 0.55037 0.40664 0.14288  0.01688  -0.06519 177 SER A N   
1080 C CA  . SER A 177 ? 0.46872 0.59228 0.43982 0.12539  0.02422  -0.04939 177 SER A CA  
1081 C C   . SER A 177 ? 0.48532 0.61116 0.43938 0.12208  0.02267  -0.04704 177 SER A C   
1082 O O   . SER A 177 ? 0.55397 0.67286 0.48458 0.13558  0.01846  -0.05652 177 SER A O   
1083 C CB  . SER A 177 ? 0.39380 0.55205 0.37223 0.12658  0.03744  -0.03754 177 SER A CB  
1084 O OG  . SER A 177 ? 0.48031 0.66131 0.44047 0.14236  0.04563  -0.03763 177 SER A OG  
1085 N N   . PHE A 178 ? 0.41028 0.54345 0.37342 0.10516  0.02514  -0.03450 178 PHE A N   
1086 C CA  . PHE A 178 ? 0.39169 0.52127 0.33978 0.10073  0.02186  -0.03053 178 PHE A CA  
1087 C C   . PHE A 178 ? 0.41142 0.55077 0.36933 0.08302  0.02669  -0.01450 178 PHE A C   
1088 O O   . PHE A 178 ? 0.40111 0.53919 0.37874 0.07250  0.02727  -0.01104 178 PHE A O   
1089 C CB  . PHE A 178 ? 0.32138 0.42242 0.27038 0.09986  0.00707  -0.04148 178 PHE A CB  
1090 C CG  . PHE A 178 ? 0.32945 0.41940 0.30479 0.08718  0.00358  -0.04009 178 PHE A CG  
1091 C CD1 . PHE A 178 ? 0.41201 0.50039 0.39439 0.07464  0.00344  -0.03091 178 PHE A CD1 
1092 C CD2 . PHE A 178 ? 0.31206 0.39227 0.30319 0.08892  0.00103  -0.04715 178 PHE A CD2 
1093 C CE1 . PHE A 178 ? 0.39244 0.47260 0.39558 0.06623  0.00185  -0.03012 178 PHE A CE1 
1094 C CE2 . PHE A 178 ? 0.35767 0.43105 0.37114 0.07832  0.00014  -0.04388 178 PHE A CE2 
1095 C CZ  . PHE A 178 ? 0.38763 0.46248 0.40645 0.06796  0.00112  -0.03596 178 PHE A CZ  
1096 N N   . GLN A 179 ? 0.35825 0.50345 0.29985 0.08005  0.02876  -0.00497 179 GLN A N   
1097 C CA  . GLN A 179 ? 0.43274 0.57704 0.38084 0.06244  0.02952  0.00938  179 GLN A CA  
1098 C C   . GLN A 179 ? 0.39660 0.51195 0.34773 0.05723  0.01770  0.00479  179 GLN A C   
1099 O O   . GLN A 179 ? 0.43877 0.53998 0.37997 0.06598  0.00901  -0.00432 179 GLN A O   
1100 C CB  . GLN A 179 ? 0.51739 0.67743 0.44752 0.06003  0.03651  0.02448  179 GLN A CB  
1101 C CG  . GLN A 179 ? 0.51129 0.70562 0.43621 0.06974  0.04977  0.02907  179 GLN A CG  
1102 C CD  . GLN A 179 ? 0.48643 0.70615 0.43588 0.05832  0.05759  0.03922  179 GLN A CD  
1103 O OE1 . GLN A 179 ? 0.48641 0.69760 0.45504 0.05299  0.05286  0.03312  179 GLN A OE1 
1104 N NE2 . GLN A 179 ? 0.42039 0.67328 0.36992 0.05375  0.06927  0.05619  179 GLN A NE2 
1105 N N   . TYR A 180 ? 0.40703 0.51462 0.37197 0.04407  0.01662  0.01053  180 TYR A N   
1106 C CA  . TYR A 180 ? 0.33517 0.41858 0.30236 0.04019  0.00748  0.00883  180 TYR A CA  
1107 C C   . TYR A 180 ? 0.35617 0.43307 0.31850 0.02686  0.00785  0.02275  180 TYR A C   
1108 O O   . TYR A 180 ? 0.36617 0.45692 0.33342 0.01684  0.01398  0.03167  180 TYR A O   
1109 C CB  . TYR A 180 ? 0.26417 0.33914 0.25165 0.04042  0.00496  -0.00059 180 TYR A CB  
1110 C CG  . TYR A 180 ? 0.31704 0.39840 0.31592 0.03182  0.01054  0.00340  180 TYR A CG  
1111 C CD1 . TYR A 180 ? 0.35582 0.45429 0.36260 0.03439  0.01667  0.00163  180 TYR A CD1 
1112 C CD2 . TYR A 180 ? 0.26275 0.33097 0.26234 0.02263  0.00802  0.00811  180 TYR A CD2 
1113 C CE1 . TYR A 180 ? 0.35408 0.45928 0.37006 0.02725  0.01972  0.00530  180 TYR A CE1 
1114 C CE2 . TYR A 180 ? 0.37752 0.44982 0.38415 0.01528  0.01052  0.01023  180 TYR A CE2 
1115 C CZ  . TYR A 180 ? 0.36572 0.45792 0.38100 0.01718  0.01614  0.00923  180 TYR A CZ  
1116 O OH  . TYR A 180 ? 0.32439 0.42115 0.34546 0.01031  0.01657  0.01143  180 TYR A OH  
1117 N N   . ARG A 181 ? 0.34981 0.40501 0.30303 0.02667  -0.00015 0.02502  181 ARG A N   
1118 C CA  . ARG A 181 ? 0.37386 0.41578 0.31846 0.01449  -0.00187 0.03897  181 ARG A CA  
1119 C C   . ARG A 181 ? 0.44162 0.47445 0.39928 0.00390  -0.00278 0.03842  181 ARG A C   
1120 O O   . ARG A 181 ? 0.47391 0.49943 0.44251 0.00927  -0.00499 0.02710  181 ARG A O   
1121 C CB  . ARG A 181 ? 0.34823 0.36480 0.27924 0.01981  -0.01181 0.04047  181 ARG A CB  
1122 C CG  . ARG A 181 ? 0.37310 0.39255 0.28111 0.02429  -0.01223 0.04993  181 ARG A CG  
1123 C CD  . ARG A 181 ? 0.44429 0.43894 0.34087 0.03310  -0.02457 0.04878  181 ARG A CD  
1124 N NE  . ARG A 181 ? 0.54811 0.54579 0.45494 0.04697  -0.03153 0.03178  181 ARG A NE  
1125 C CZ  . ARG A 181 ? 0.58818 0.57149 0.49356 0.05672  -0.04355 0.02741  181 ARG A CZ  
1126 N NH1 . ARG A 181 ? 0.41485 0.37599 0.30565 0.05671  -0.05005 0.03807  181 ARG A NH1 
1127 N NH2 . ARG A 181 ? 0.55862 0.54974 0.47882 0.06622  -0.05005 0.01309  181 ARG A NH2 
1128 N N   . VAL A 182 ? 0.44117 0.47575 0.39747 -0.01146 -0.00132 0.05121  182 VAL A N   
1129 C CA  . VAL A 182 ? 0.38813 0.41282 0.35328 -0.02285 -0.00483 0.05047  182 VAL A CA  
1130 C C   . VAL A 182 ? 0.45006 0.44443 0.40374 -0.03542 -0.01355 0.06098  182 VAL A C   
1131 O O   . VAL A 182 ? 0.57599 0.56324 0.51696 -0.03812 -0.01447 0.07303  182 VAL A O   
1132 C CB  . VAL A 182 ? 0.35338 0.40910 0.33255 -0.03215 0.00168  0.05489  182 VAL A CB  
1133 C CG1 . VAL A 182 ? 0.37741 0.45297 0.36781 -0.01917 0.00762  0.04247  182 VAL A CG1 
1134 C CG2 . VAL A 182 ? 0.32714 0.40771 0.30484 -0.04033 0.00853  0.07129  182 VAL A CG2 
1135 N N   . GLY A 183 ? 0.41747 0.39158 0.37339 -0.04275 -0.02075 0.05645  183 GLY A N   
1136 C CA  . GLY A 183 ? 0.43815 0.37461 0.38181 -0.05372 -0.03198 0.06315  183 GLY A CA  
1137 C C   . GLY A 183 ? 0.50456 0.40915 0.43324 -0.03942 -0.03798 0.05910  183 GLY A C   
1138 O O   . GLY A 183 ? 0.52349 0.43447 0.45475 -0.02130 -0.03502 0.04813  183 GLY A O   
1139 N N   . ALA A 184 ? 0.50475 0.37398 0.41907 -0.04846 -0.04781 0.06908  184 ALA A N   
1140 C CA  . ALA A 184 ? 0.52675 0.36356 0.42553 -0.03436 -0.05509 0.06758  184 ALA A CA  
1141 C C   . ALA A 184 ? 0.55225 0.41037 0.44911 -0.02106 -0.04927 0.07029  184 ALA A C   
1142 O O   . ALA A 184 ? 0.55034 0.39255 0.44058 -0.00427 -0.05474 0.06440  184 ALA A O   
1143 C CB  . ALA A 184 ? 0.56677 0.36238 0.44901 -0.04840 -0.06638 0.08235  184 ALA A CB  
1144 N N   . PHE A 185 ? 0.60316 0.49698 0.50466 -0.02689 -0.03933 0.07866  185 PHE A N   
1145 C CA  . PHE A 185 ? 0.62864 0.54038 0.52405 -0.01281 -0.03563 0.07852  185 PHE A CA  
1146 C C   . PHE A 185 ? 0.68836 0.61446 0.59737 0.00440  -0.03444 0.05896  185 PHE A C   
1147 O O   . PHE A 185 ? 0.82691 0.75666 0.73143 0.01828  -0.03750 0.05478  185 PHE A O   
1148 C CB  . PHE A 185 ? 0.44315 0.38939 0.33672 -0.02045 -0.02442 0.09102  185 PHE A CB  
1149 C CG  . PHE A 185 ? 0.47293 0.41298 0.35940 -0.04069 -0.02335 0.11344  185 PHE A CG  
1150 C CD1 . PHE A 185 ? 0.53877 0.46235 0.40346 -0.04171 -0.02613 0.13059  185 PHE A CD1 
1151 C CD2 . PHE A 185 ? 0.55828 0.50914 0.46063 -0.05967 -0.02060 0.11887  185 PHE A CD2 
1152 C CE1 . PHE A 185 ? 0.60859 0.52587 0.46849 -0.06299 -0.02479 0.15467  185 PHE A CE1 
1153 C CE2 . PHE A 185 ? 0.69808 0.64496 0.59857 -0.08167 -0.02072 0.14158  185 PHE A CE2 
1154 C CZ  . PHE A 185 ? 0.62421 0.55407 0.50396 -0.08409 -0.02208 0.16044  185 PHE A CZ  
1155 N N   . GLY A 186 ? 0.60527 0.53883 0.53069 0.00314  -0.03118 0.04789  186 GLY A N   
1156 C CA  . GLY A 186 ? 0.58015 0.52800 0.52084 0.01678  -0.02892 0.03242  186 GLY A CA  
1157 C C   . GLY A 186 ? 0.56272 0.49111 0.50921 0.02532  -0.03349 0.02244  186 GLY A C   
1158 O O   . GLY A 186 ? 0.46532 0.40499 0.42605 0.03735  -0.03216 0.01221  186 GLY A O   
1159 N N   . PHE A 187 ? 0.47764 0.37648 0.41310 0.01960  -0.03914 0.02553  187 PHE A N   
1160 C CA  . PHE A 187 ? 0.45620 0.33789 0.39387 0.02980  -0.04162 0.01446  187 PHE A CA  
1161 C C   . PHE A 187 ? 0.58734 0.42764 0.50709 0.03462  -0.05253 0.01644  187 PHE A C   
1162 O O   . PHE A 187 ? 0.64449 0.46683 0.56130 0.04474  -0.05472 0.00666  187 PHE A O   
1163 C CB  . PHE A 187 ? 0.38831 0.27597 0.33043 0.02161  -0.03699 0.00930  187 PHE A CB  
1164 C CG  . PHE A 187 ? 0.39758 0.32226 0.35732 0.02118  -0.02680 0.00632  187 PHE A CG  
1165 C CD1 . PHE A 187 ? 0.32934 0.26873 0.30360 0.03418  -0.02118 -0.00285 187 PHE A CD1 
1166 C CD2 . PHE A 187 ? 0.40115 0.34681 0.36392 0.00886  -0.02269 0.01403  187 PHE A CD2 
1167 C CE1 . PHE A 187 ? 0.38885 0.35666 0.37826 0.03333  -0.01340 -0.00454 187 PHE A CE1 
1168 C CE2 . PHE A 187 ? 0.30956 0.28524 0.28646 0.01112  -0.01439 0.01069  187 PHE A CE2 
1169 C CZ  . PHE A 187 ? 0.32004 0.30373 0.30921 0.02266  -0.01067 0.00144  187 PHE A CZ  
1170 N N   . LEU A 188 ? 0.56861 0.39199 0.47428 0.02972  -0.05923 0.02890  188 LEU A N   
1171 C CA  . LEU A 188 ? 0.53032 0.31104 0.41852 0.03783  -0.07083 0.03092  188 LEU A CA  
1172 C C   . LEU A 188 ? 0.55137 0.33578 0.44824 0.06271  -0.07183 0.01929  188 LEU A C   
1173 O O   . LEU A 188 ? 0.57339 0.38494 0.48263 0.07117  -0.06967 0.01887  188 LEU A O   
1174 C CB  . LEU A 188 ? 0.53177 0.29759 0.40386 0.03064  -0.07692 0.04847  188 LEU A CB  
1175 C CG  . LEU A 188 ? 0.62719 0.34266 0.47892 0.03921  -0.09055 0.05230  188 LEU A CG  
1176 C CD1 . LEU A 188 ? 0.63143 0.30879 0.47376 0.03256  -0.09709 0.04630  188 LEU A CD1 
1177 C CD2 . LEU A 188 ? 0.61447 0.31302 0.44758 0.03038  -0.09626 0.07341  188 LEU A CD2 
1178 N N   . HIS A 189 ? 0.65704 0.41549 0.54778 0.07490  -0.07559 0.00951  189 HIS A N   
1179 C CA  . HIS A 189 ? 0.63257 0.40176 0.53601 0.09966  -0.07330 -0.00212 189 HIS A CA  
1180 C C   . HIS A 189 ? 0.72071 0.44461 0.60418 0.11587  -0.08503 -0.00353 189 HIS A C   
1181 O O   . HIS A 189 ? 0.80706 0.49637 0.67298 0.11737  -0.08898 -0.00997 189 HIS A O   
1182 C CB  . HIS A 189 ? 0.58468 0.37415 0.50027 0.10235  -0.06217 -0.01395 189 HIS A CB  
1183 C CG  . HIS A 189 ? 0.68002 0.47928 0.60686 0.12758  -0.05764 -0.02451 189 HIS A CG  
1184 N ND1 . HIS A 189 ? 0.56188 0.40151 0.51762 0.13803  -0.05146 -0.02539 189 HIS A ND1 
1185 C CD2 . HIS A 189 ? 0.67441 0.45087 0.58823 0.14464  -0.05776 -0.03455 189 HIS A CD2 
1186 C CE1 . HIS A 189 ? 0.59233 0.43791 0.55577 0.15972  -0.04653 -0.03341 189 HIS A CE1 
1187 N NE2 . HIS A 189 ? 0.52574 0.33317 0.46200 0.16596  -0.04949 -0.03968 189 HIS A NE2 
1188 N N   . LEU A 190 ? 0.62794 0.34929 0.51180 0.12901  -0.09231 0.00198  190 LEU A N   
1189 C CA  . LEU A 190 ? 0.62463 0.30203 0.48936 0.14729  -0.10442 0.00159  190 LEU A CA  
1190 C C   . LEU A 190 ? 0.64189 0.33893 0.52385 0.17670  -0.10521 -0.00494 190 LEU A C   
1191 O O   . LEU A 190 ? 0.75502 0.41756 0.62237 0.19689  -0.11478 -0.00680 190 LEU A O   
1192 C CB  . LEU A 190 ? 0.73889 0.38194 0.58068 0.13584  -0.11657 0.01866  190 LEU A CB  
1193 C CG  . LEU A 190 ? 0.80904 0.43373 0.63630 0.10517  -0.11685 0.02953  190 LEU A CG  
1194 C CD1 . LEU A 190 ? 0.74506 0.34443 0.55276 0.09460  -0.12619 0.05036  190 LEU A CD1 
1195 C CD2 . LEU A 190 ? 0.84666 0.43028 0.65857 0.10125  -0.12163 0.02086  190 LEU A CD2 
1196 N N   . ALA A 191 ? 0.67150 0.42218 0.58527 0.17985  -0.09638 -0.00824 191 ALA A N   
1197 C CA  . ALA A 191 ? 0.57233 0.34908 0.50897 0.20459  -0.09888 -0.01163 191 ALA A CA  
1198 C C   . ALA A 191 ? 0.64154 0.40309 0.57623 0.23292  -0.09840 -0.02139 191 ALA A C   
1199 O O   . ALA A 191 ? 0.81721 0.57257 0.75361 0.25513  -0.10814 -0.01990 191 ALA A O   
1200 C CB  . ALA A 191 ? 0.51986 0.35591 0.49449 0.19981  -0.08866 -0.01488 191 ALA A CB  
1201 N N   . PRO A 192 ? 0.67487 0.43125 0.60480 0.23632  -0.08789 -0.03166 192 PRO A N   
1202 C CA  . PRO A 192 ? 0.64006 0.37919 0.56236 0.26747  -0.08741 -0.04191 192 PRO A CA  
1203 C C   . PRO A 192 ? 0.84217 0.52747 0.73336 0.27388  -0.10227 -0.03915 192 PRO A C   
1204 O O   . PRO A 192 ? 0.85198 0.54017 0.74594 0.29414  -0.10173 -0.04342 192 PRO A O   
1205 C CB  . PRO A 192 ? 0.63966 0.37171 0.54929 0.26264  -0.07578 -0.05229 192 PRO A CB  
1206 C CG  . PRO A 192 ? 0.61183 0.38464 0.54267 0.23576  -0.06533 -0.04752 192 PRO A CG  
1207 C CD  . PRO A 192 ? 0.66755 0.44020 0.60077 0.21582  -0.07515 -0.03509 192 PRO A CD  
1208 N N   . GLU A 193 ? 0.87504 0.51297 0.73804 0.25570  -0.11500 -0.03051 193 GLU A N   
1209 C CA  . GLU A 193 ? 0.91649 0.49990 0.74890 0.25683  -0.12871 -0.02631 193 GLU A CA  
1210 C C   . GLU A 193 ? 0.89712 0.48344 0.73383 0.26531  -0.13892 -0.01458 193 GLU A C   
1211 O O   . GLU A 193 ? 0.94869 0.49185 0.76179 0.26887  -0.14992 -0.01028 193 GLU A O   
1212 C CB  . GLU A 193 ? 1.01397 0.54672 0.81674 0.22951  -0.13758 -0.01903 193 GLU A CB  
1213 C CG  . GLU A 193 ? 1.19604 0.67026 0.96724 0.22875  -0.14879 -0.02121 193 GLU A CG  
1214 C CD  . GLU A 193 ? 1.28888 0.75207 1.04939 0.23591  -0.14373 -0.03976 193 GLU A CD  
1215 O OE1 . GLU A 193 ? 1.24941 0.75227 1.02695 0.24152  -0.12962 -0.04971 193 GLU A OE1 
1216 O OE2 . GLU A 193 ? 1.32708 0.74216 1.06107 0.23698  -0.15430 -0.04404 193 GLU A OE2 
1217 N N   . MET A 194 ? 0.80326 0.43837 0.66861 0.26847  -0.13687 -0.00956 194 MET A N   
1218 C CA  . MET A 194 ? 0.82297 0.46335 0.69090 0.27570  -0.14831 0.00151  194 MET A CA  
1219 C C   . MET A 194 ? 0.77633 0.47125 0.68164 0.29738  -0.14371 -0.00470 194 MET A C   
1220 O O   . MET A 194 ? 0.75604 0.49057 0.68848 0.30257  -0.12994 -0.01476 194 MET A O   
1221 C CB  . MET A 194 ? 0.83123 0.47822 0.69544 0.25714  -0.15435 0.01504  194 MET A CB  
1222 C CG  . MET A 194 ? 0.91075 0.51798 0.74599 0.22927  -0.15442 0.02358  194 MET A CG  
1223 S SD  . MET A 194 ? 0.84973 0.48919 0.68751 0.19786  -0.14959 0.03713  194 MET A SD  
1224 C CE  . MET A 194 ? 0.88880 0.59602 0.76771 0.19331  -0.13269 0.02231  194 MET A CE  
1225 N N   . PRO A 195 ? 0.84932 0.54975 0.75849 0.30930  -0.15456 0.00226  195 PRO A N   
1226 C CA  . PRO A 195 ? 0.74940 0.50822 0.69995 0.32547  -0.15179 -0.00145 195 PRO A CA  
1227 C C   . PRO A 195 ? 0.68267 0.49159 0.66349 0.31267  -0.14881 -0.00099 195 PRO A C   
1228 O O   . PRO A 195 ? 0.85277 0.64995 0.81884 0.29441  -0.15197 0.00392  195 PRO A O   
1229 C CB  . PRO A 195 ? 0.77797 0.52365 0.71913 0.33727  -0.16767 0.00781  195 PRO A CB  
1230 C CG  . PRO A 195 ? 0.83126 0.50795 0.72661 0.33305  -0.17484 0.01347  195 PRO A CG  
1231 C CD  . PRO A 195 ? 0.91332 0.56678 0.79017 0.30911  -0.16969 0.01439  195 PRO A CD  
1232 N N   . SER A 196 ? 0.70022 0.56612 0.72499 0.32204  -0.14294 -0.00554 196 SER A N   
1233 C CA  . SER A 196 ? 0.65630 0.57136 0.71470 0.30892  -0.13926 -0.00697 196 SER A CA  
1234 C C   . SER A 196 ? 0.66102 0.58094 0.71494 0.29930  -0.15656 0.00025  196 SER A C   
1235 O O   . SER A 196 ? 0.57873 0.51847 0.64262 0.28379  -0.15673 -0.00098 196 SER A O   
1236 C CB  . SER A 196 ? 0.71786 0.69183 0.82659 0.31892  -0.12942 -0.01091 196 SER A CB  
1237 O OG  . SER A 196 ? 0.83256 0.83522 0.96436 0.32582  -0.14323 -0.00593 196 SER A OG  
1238 N N   . GLU A 197 ? 0.73828 0.63944 0.77497 0.30897  -0.17135 0.00741  197 GLU A N   
1239 C CA  . GLU A 197 ? 0.64145 0.53929 0.66233 0.30099  -0.18803 0.01512  197 GLU A CA  
1240 C C   . GLU A 197 ? 0.74907 0.61814 0.73773 0.28204  -0.18717 0.01928  197 GLU A C   
1241 O O   . GLU A 197 ? 0.77460 0.65988 0.76179 0.27156  -0.19504 0.02107  197 GLU A O   
1242 C CB  . GLU A 197 ? 0.69398 0.56160 0.68926 0.31458  -0.20148 0.02416  197 GLU A CB  
1243 C CG  . GLU A 197 ? 0.90845 0.75505 0.86934 0.30621  -0.21635 0.03530  197 GLU A CG  
1244 C CD  . GLU A 197 ? 0.98988 0.80473 0.92439 0.31976  -0.22858 0.04586  197 GLU A CD  
1245 O OE1 . GLU A 197 ? 0.89759 0.71356 0.81542 0.31851  -0.24236 0.05401  197 GLU A OE1 
1246 O OE2 . GLU A 197 ? 1.10225 0.89045 1.03117 0.33214  -0.22453 0.04552  197 GLU A OE2 
1247 N N   . PHE A 198 ? 0.77275 0.60072 0.73614 0.27710  -0.17780 0.02031  198 PHE A N   
1248 C CA  . PHE A 198 ? 0.64419 0.44572 0.57694 0.25231  -0.17249 0.02699  198 PHE A CA  
1249 C C   . PHE A 198 ? 0.59822 0.42452 0.54985 0.23287  -0.15396 0.01800  198 PHE A C   
1250 O O   . PHE A 198 ? 0.62872 0.43294 0.55850 0.21258  -0.14568 0.02195  198 PHE A O   
1251 C CB  . PHE A 198 ? 0.69277 0.43153 0.58508 0.25188  -0.17490 0.03615  198 PHE A CB  
1252 C CG  . PHE A 198 ? 0.74335 0.45340 0.61276 0.26545  -0.19041 0.04745  198 PHE A CG  
1253 C CD1 . PHE A 198 ? 0.76722 0.47637 0.64786 0.28539  -0.19241 0.04215  198 PHE A CD1 
1254 C CD2 . PHE A 198 ? 0.81268 0.50126 0.64963 0.25508  -0.19920 0.06383  198 PHE A CD2 
1255 C CE1 . PHE A 198 ? 0.81433 0.50015 0.67583 0.29531  -0.20456 0.05221  198 PHE A CE1 
1256 C CE2 . PHE A 198 ? 0.81596 0.48196 0.63299 0.26414  -0.21016 0.07471  198 PHE A CE2 
1257 C CZ  . PHE A 198 ? 0.83865 0.50199 0.66843 0.28435  -0.21356 0.06854  198 PHE A CZ  
1258 N N   . ALA A 199 ? 0.59004 0.46388 0.58317 0.23763  -0.14797 0.00772  199 ALA A N   
1259 C CA  . ALA A 199 ? 0.58712 0.48186 0.59803 0.22248  -0.13003 0.00012  199 ALA A CA  
1260 C C   . ALA A 199 ? 0.61279 0.50859 0.61017 0.19605  -0.12512 0.00323  199 ALA A C   
1261 O O   . ALA A 199 ? 0.76622 0.65534 0.75779 0.18150  -0.11197 0.00130  199 ALA A O   
1262 C CB  . ALA A 199 ? 0.48987 0.43766 0.54949 0.23048  -0.12569 -0.00767 199 ALA A CB  
1263 N N   . GLU A 200 ? 0.62114 0.52649 0.61242 0.19130  -0.13574 0.00744  200 GLU A N   
1264 C CA  . GLU A 200 ? 0.66322 0.57489 0.64318 0.17015  -0.13003 0.00882  200 GLU A CA  
1265 C C   . GLU A 200 ? 0.71146 0.58641 0.65012 0.15850  -0.12808 0.02082  200 GLU A C   
1266 O O   . GLU A 200 ? 0.58417 0.46631 0.51028 0.14416  -0.12405 0.02400  200 GLU A O   
1267 C CB  . GLU A 200 ? 0.47927 0.41730 0.46740 0.17085  -0.14227 0.00620  200 GLU A CB  
1268 C CG  . GLU A 200 ? 0.44675 0.42595 0.47960 0.17170  -0.14264 -0.00492 200 GLU A CG  
1269 C CD  . GLU A 200 ? 0.64691 0.63857 0.69720 0.15767  -0.12434 -0.01027 200 GLU A CD  
1270 O OE1 . GLU A 200 ? 0.69704 0.67283 0.72404 0.14418  -0.11435 -0.00748 200 GLU A OE1 
1271 O OE2 . GLU A 200 ? 0.65333 0.67304 0.74178 0.16017  -0.11988 -0.01599 200 GLU A OE2 
1272 N N   . GLU A 201 ? 0.71710 0.55340 0.63527 0.16452  -0.13106 0.02799  201 GLU A N   
1273 C CA  . GLU A 201 ? 0.66923 0.47020 0.55148 0.15068  -0.13031 0.04231  201 GLU A CA  
1274 C C   . GLU A 201 ? 0.68773 0.48915 0.57057 0.12961  -0.11545 0.04122  201 GLU A C   
1275 O O   . GLU A 201 ? 0.72008 0.51950 0.58586 0.11259  -0.11069 0.05147  201 GLU A O   
1276 C CB  . GLU A 201 ? 0.65231 0.40638 0.51343 0.16217  -0.14007 0.05016  201 GLU A CB  
1277 C CG  . GLU A 201 ? 0.76915 0.51391 0.61714 0.18010  -0.15660 0.05817  201 GLU A CG  
1278 C CD  . GLU A 201 ? 0.79596 0.53538 0.61388 0.16914  -0.16014 0.07443  201 GLU A CD  
1279 O OE1 . GLU A 201 ? 0.77627 0.52632 0.58806 0.18239  -0.17245 0.07727  201 GLU A OE1 
1280 O OE2 . GLU A 201 ? 0.76779 0.49414 0.56804 0.14814  -0.15086 0.08494  201 GLU A OE2 
1281 N N   . ALA A 202 ? 0.69931 0.50521 0.60105 0.13163  -0.10795 0.02975  202 ALA A N   
1282 C CA  . ALA A 202 ? 0.66529 0.47364 0.56949 0.11405  -0.09556 0.02697  202 ALA A CA  
1283 C C   . ALA A 202 ? 0.63982 0.46979 0.57112 0.12312  -0.08776 0.01223  202 ALA A C   
1284 O O   . ALA A 202 ? 0.64323 0.45212 0.57045 0.12915  -0.08617 0.00693  202 ALA A O   
1285 C CB  . ALA A 202 ? 0.62333 0.38705 0.50263 0.10385  -0.09810 0.03500  202 ALA A CB  
1286 N N   . PRO A 203 ? 0.62796 0.49801 0.58549 0.12492  -0.08333 0.00577  203 PRO A N   
1287 C CA  . PRO A 203 ? 0.54013 0.43407 0.52594 0.13374  -0.07507 -0.00499 203 PRO A CA  
1288 C C   . PRO A 203 ? 0.54811 0.44197 0.53278 0.12168  -0.06249 -0.00862 203 PRO A C   
1289 O O   . PRO A 203 ? 0.53385 0.43199 0.52821 0.13021  -0.05511 -0.01568 203 PRO A O   
1290 C CB  . PRO A 203 ? 0.52731 0.46034 0.53999 0.13344  -0.07635 -0.00791 203 PRO A CB  
1291 C CG  . PRO A 203 ? 0.47320 0.40383 0.46736 0.11859  -0.07877 -0.00205 203 PRO A CG  
1292 C CD  . PRO A 203 ? 0.55520 0.44911 0.51558 0.11673  -0.08477 0.00838  203 PRO A CD  
1293 N N   . GLY A 204 ? 0.48810 0.37888 0.45985 0.10308  -0.05997 -0.00319 204 GLY A N   
1294 C CA  . GLY A 204 ? 0.40326 0.29803 0.37488 0.09038  -0.04995 -0.00553 204 GLY A CA  
1295 C C   . GLY A 204 ? 0.35549 0.28664 0.34944 0.08497  -0.04150 -0.00902 204 GLY A C   
1296 O O   . GLY A 204 ? 0.52512 0.47840 0.53884 0.09172  -0.04313 -0.01188 204 GLY A O   
1297 N N   . ASN A 205 ? 0.34309 0.27868 0.33403 0.07225  -0.03402 -0.00859 205 ASN A N   
1298 C CA  . ASN A 205 ? 0.31274 0.27660 0.32102 0.06685  -0.02583 -0.01135 205 ASN A CA  
1299 C C   . ASN A 205 ? 0.50381 0.48180 0.51377 0.06316  -0.02920 -0.00899 205 ASN A C   
1300 O O   . ASN A 205 ? 0.58719 0.58548 0.61240 0.06165  -0.02525 -0.01280 205 ASN A O   
1301 C CB  . ASN A 205 ? 0.39686 0.37867 0.42953 0.07701  -0.01992 -0.01767 205 ASN A CB  
1302 C CG  . ASN A 205 ? 0.44956 0.42110 0.47653 0.08268  -0.01349 -0.02110 205 ASN A CG  
1303 O OD1 . ASN A 205 ? 0.49793 0.45960 0.51055 0.07458  -0.01070 -0.02093 205 ASN A OD1 
1304 N ND2 . ASN A 205 ? 0.49463 0.47052 0.53270 0.09786  -0.01163 -0.02451 205 ASN A ND2 
1305 N N   . VAL A 206 ? 0.34940 0.31494 0.34127 0.06245  -0.03678 -0.00269 206 VAL A N   
1306 C CA  . VAL A 206 ? 0.48460 0.46308 0.47395 0.06330  -0.04086 -0.00231 206 VAL A CA  
1307 C C   . VAL A 206 ? 0.56585 0.56005 0.55390 0.05452  -0.03266 -0.00211 206 VAL A C   
1308 O O   . VAL A 206 ? 0.50697 0.51460 0.49744 0.05755  -0.03439 -0.00668 206 VAL A O   
1309 C CB  . VAL A 206 ? 0.52308 0.48553 0.48841 0.06562  -0.04974 0.00642  206 VAL A CB  
1310 C CG1 . VAL A 206 ? 0.36884 0.31764 0.33695 0.07836  -0.06003 0.00529  206 VAL A CG1 
1311 C CG2 . VAL A 206 ? 0.37662 0.32401 0.32051 0.05352  -0.04586 0.01870  206 VAL A CG2 
1312 N N   . GLY A 207 ? 0.47394 0.46644 0.45849 0.04486  -0.02503 0.00206  207 GLY A N   
1313 C CA  . GLY A 207 ? 0.41934 0.43047 0.40760 0.03907  -0.01689 0.00164  207 GLY A CA  
1314 C C   . GLY A 207 ? 0.39386 0.41810 0.40278 0.04363  -0.01365 -0.00779 207 GLY A C   
1315 O O   . GLY A 207 ? 0.44603 0.48359 0.45739 0.04430  -0.01067 -0.01064 207 GLY A O   
1316 N N   . LEU A 208 ? 0.27809 0.29838 0.30153 0.04753  -0.01366 -0.01190 208 LEU A N   
1317 C CA  . LEU A 208 ? 0.32498 0.35792 0.37049 0.05092  -0.01110 -0.01800 208 LEU A CA  
1318 C C   . LEU A 208 ? 0.42194 0.45976 0.47558 0.05599  -0.02010 -0.02292 208 LEU A C   
1319 O O   . LEU A 208 ? 0.46183 0.50779 0.52743 0.05565  -0.02051 -0.02762 208 LEU A O   
1320 C CB  . LEU A 208 ? 0.29468 0.32658 0.35365 0.05476  -0.00706 -0.01898 208 LEU A CB  
1321 C CG  . LEU A 208 ? 0.41885 0.44123 0.46528 0.05167  -0.00125 -0.01658 208 LEU A CG  
1322 C CD1 . LEU A 208 ? 0.35120 0.37510 0.40797 0.05907  0.00460  -0.01878 208 LEU A CD1 
1323 C CD2 . LEU A 208 ? 0.35972 0.38968 0.40137 0.04359  0.00401  -0.01449 208 LEU A CD2 
1324 N N   . TRP A 209 ? 0.29789 0.32843 0.34418 0.06094  -0.02924 -0.02217 209 TRP A N   
1325 C CA  . TRP A 209 ? 0.39141 0.42640 0.44290 0.06591  -0.04084 -0.02766 209 TRP A CA  
1326 C C   . TRP A 209 ? 0.46222 0.49811 0.49507 0.06534  -0.04252 -0.03029 209 TRP A C   
1327 O O   . TRP A 209 ? 0.36075 0.40029 0.40043 0.06785  -0.05017 -0.03849 209 TRP A O   
1328 C CB  . TRP A 209 ? 0.41721 0.44415 0.46140 0.07305  -0.05120 -0.02529 209 TRP A CB  
1329 C CG  . TRP A 209 ? 0.50933 0.53911 0.57523 0.07863  -0.05140 -0.02509 209 TRP A CG  
1330 C CD1 . TRP A 209 ? 0.51392 0.53163 0.57290 0.08175  -0.04636 -0.02070 209 TRP A CD1 
1331 C CD2 . TRP A 209 ? 0.46345 0.51020 0.56153 0.08292  -0.05714 -0.02939 209 TRP A CD2 
1332 N NE1 . TRP A 209 ? 0.37266 0.39995 0.45533 0.09070  -0.04692 -0.02265 209 TRP A NE1 
1333 C CE2 . TRP A 209 ? 0.40038 0.44877 0.51002 0.09058  -0.05273 -0.02668 209 TRP A CE2 
1334 C CE3 . TRP A 209 ? 0.40849 0.46914 0.52758 0.08074  -0.06639 -0.03526 209 TRP A CE3 
1335 C CZ2 . TRP A 209 ? 0.32337 0.39329 0.46770 0.09664  -0.05488 -0.02784 209 TRP A CZ2 
1336 C CZ3 . TRP A 209 ? 0.37204 0.45183 0.52740 0.08338  -0.07065 -0.03601 209 TRP A CZ3 
1337 C CH2 . TRP A 209 ? 0.36068 0.44817 0.52988 0.09155  -0.06373 -0.03142 209 TRP A CH2 
1338 N N   . ASP A 210 ? 0.46181 0.49473 0.47141 0.06236  -0.03572 -0.02340 210 ASP A N   
1339 C CA  . ASP A 210 ? 0.47788 0.51678 0.46967 0.06418  -0.03350 -0.02489 210 ASP A CA  
1340 C C   . ASP A 210 ? 0.50076 0.54671 0.50701 0.06436  -0.02993 -0.03285 210 ASP A C   
1341 O O   . ASP A 210 ? 0.49840 0.54374 0.49961 0.07059  -0.03642 -0.04181 210 ASP A O   
1342 C CB  . ASP A 210 ? 0.41634 0.45816 0.38988 0.05845  -0.02354 -0.01325 210 ASP A CB  
1343 C CG  . ASP A 210 ? 0.43753 0.46797 0.39245 0.05755  -0.02783 -0.00315 210 ASP A CG  
1344 O OD1 . ASP A 210 ? 0.38596 0.40842 0.33429 0.06500  -0.03888 -0.00583 210 ASP A OD1 
1345 O OD2 . ASP A 210 ? 0.46830 0.49717 0.41531 0.04880  -0.02122 0.00833  210 ASP A OD2 
1346 N N   . GLN A 211 ? 0.49681 0.54647 0.51854 0.05843  -0.02080 -0.02992 211 GLN A N   
1347 C CA  . GLN A 211 ? 0.46305 0.51677 0.49809 0.05873  -0.01729 -0.03511 211 GLN A CA  
1348 C C   . GLN A 211 ? 0.42293 0.47151 0.47605 0.06064  -0.02764 -0.04362 211 GLN A C   
1349 O O   . GLN A 211 ? 0.45658 0.50103 0.50905 0.06419  -0.03238 -0.05140 211 GLN A O   
1350 C CB  . GLN A 211 ? 0.36120 0.41880 0.40855 0.05270  -0.00722 -0.02932 211 GLN A CB  
1351 C CG  . GLN A 211 ? 0.36102 0.42171 0.39475 0.04772  -0.00084 -0.02090 211 GLN A CG  
1352 C CD  . GLN A 211 ? 0.47519 0.53618 0.51768 0.04267  0.00552  -0.01718 211 GLN A CD  
1353 O OE1 . GLN A 211 ? 0.49352 0.55219 0.55094 0.04392  0.00645  -0.01926 211 GLN A OE1 
1354 N NE2 . GLN A 211 ? 0.41641 0.48154 0.44941 0.03673  0.00955  -0.01102 211 GLN A NE2 
1355 N N   . ALA A 212 ? 0.33778 0.38653 0.40817 0.05855  -0.03211 -0.04223 212 ALA A N   
1356 C CA  . ALA A 212 ? 0.34400 0.39282 0.43769 0.05793  -0.04306 -0.04836 212 ALA A CA  
1357 C C   . ALA A 212 ? 0.37449 0.41570 0.45325 0.06331  -0.05781 -0.05830 212 ALA A C   
1358 O O   . ALA A 212 ? 0.42180 0.45665 0.50929 0.06258  -0.06604 -0.06642 212 ALA A O   
1359 C CB  . ALA A 212 ? 0.35161 0.40761 0.46506 0.05764  -0.04564 -0.04442 212 ALA A CB  
1360 N N   . LEU A 213 ? 0.37980 0.41890 0.43256 0.06919  -0.06169 -0.05762 213 LEU A N   
1361 C CA  . LEU A 213 ? 0.42237 0.45416 0.45444 0.07682  -0.07603 -0.06734 213 LEU A CA  
1362 C C   . LEU A 213 ? 0.46662 0.49282 0.47969 0.08205  -0.07265 -0.07443 213 LEU A C   
1363 O O   . LEU A 213 ? 0.46801 0.48351 0.47596 0.08694  -0.08611 -0.08716 213 LEU A O   
1364 C CB  . LEU A 213 ? 0.42135 0.45242 0.42574 0.08280  -0.07852 -0.06190 213 LEU A CB  
1365 C CG  . LEU A 213 ? 0.48775 0.51177 0.46661 0.09273  -0.09481 -0.07135 213 LEU A CG  
1366 C CD1 . LEU A 213 ? 0.55695 0.57985 0.55900 0.09204  -0.11529 -0.07930 213 LEU A CD1 
1367 C CD2 . LEU A 213 ? 0.48778 0.51118 0.43115 0.09913  -0.09181 -0.06205 213 LEU A CD2 
1368 N N   . ALA A 214 ? 0.45580 0.48884 0.45848 0.08197  -0.05603 -0.06702 214 ALA A N   
1369 C CA  . ALA A 214 ? 0.46803 0.49951 0.45489 0.08973  -0.05139 -0.07313 214 ALA A CA  
1370 C C   . ALA A 214 ? 0.42535 0.44641 0.43441 0.08716  -0.05545 -0.08054 214 ALA A C   
1371 O O   . ALA A 214 ? 0.42875 0.43746 0.42570 0.09590  -0.06215 -0.09210 214 ALA A O   
1372 C CB  . ALA A 214 ? 0.36206 0.40894 0.33944 0.08908  -0.03321 -0.06168 214 ALA A CB  
1373 N N   . ILE A 215 ? 0.44371 0.46771 0.48342 0.07611  -0.05158 -0.07367 215 ILE A N   
1374 C CA  . ILE A 215 ? 0.43535 0.44877 0.49736 0.07183  -0.05527 -0.07738 215 ILE A CA  
1375 C C   . ILE A 215 ? 0.42495 0.42410 0.49599 0.07052  -0.07581 -0.08882 215 ILE A C   
1376 O O   . ILE A 215 ? 0.49996 0.48053 0.56990 0.07297  -0.08524 -0.09866 215 ILE A O   
1377 C CB  . ILE A 215 ? 0.35948 0.38243 0.44981 0.06117  -0.04446 -0.06524 215 ILE A CB  
1378 C CG1 . ILE A 215 ? 0.30974 0.34221 0.38934 0.06287  -0.02783 -0.05684 215 ILE A CG1 
1379 C CG2 . ILE A 215 ? 0.27892 0.29163 0.39615 0.05422  -0.04954 -0.06588 215 ILE A CG2 
1380 C CD1 . ILE A 215 ? 0.26407 0.30570 0.36328 0.05470  -0.01683 -0.04539 215 ILE A CD1 
1381 N N   . ARG A 216 ? 0.39766 0.40367 0.47692 0.06728  -0.08499 -0.08833 216 ARG A N   
1382 C CA  . ARG A 216 ? 0.50086 0.49604 0.59034 0.06528  -0.10745 -0.09953 216 ARG A CA  
1383 C C   . ARG A 216 ? 0.57005 0.54658 0.62259 0.07819  -0.11965 -0.11524 216 ARG A C   
1384 O O   . ARG A 216 ? 0.50741 0.46387 0.56352 0.07751  -0.13734 -0.12803 216 ARG A O   
1385 C CB  . ARG A 216 ? 0.50987 0.51919 0.61251 0.06259  -0.11570 -0.09596 216 ARG A CB  
1386 C CG  . ARG A 216 ? 0.72732 0.73270 0.85481 0.05627  -0.13944 -0.10454 216 ARG A CG  
1387 C CD  . ARG A 216 ? 0.98749 1.01429 1.13839 0.05363  -0.14418 -0.09739 216 ARG A CD  
1388 N NE  . ARG A 216 ? 1.06729 1.11238 1.23772 0.05001  -0.12304 -0.08209 216 ARG A NE  
1389 C CZ  . ARG A 216 ? 0.98256 1.04474 1.19618 0.04045  -0.11885 -0.07360 216 ARG A CZ  
1390 N NH1 . ARG A 216 ? 0.87805 0.94370 1.12603 0.03034  -0.13466 -0.07684 216 ARG A NH1 
1391 N NH2 . ARG A 216 ? 0.86970 0.94601 1.09183 0.04104  -0.09909 -0.06153 216 ARG A NH2 
1392 N N   . TRP A 217 ? 0.55655 0.53877 0.57257 0.09025  -0.10998 -0.11408 217 TRP A N   
1393 C CA  . TRP A 217 ? 0.48040 0.44865 0.45658 0.10607  -0.11823 -0.12821 217 TRP A CA  
1394 C C   . TRP A 217 ? 0.61109 0.56050 0.58415 0.11132  -0.11857 -0.13789 217 TRP A C   
1395 O O   . TRP A 217 ? 0.66964 0.59509 0.62626 0.11948  -0.13664 -0.15527 217 TRP A O   
1396 C CB  . TRP A 217 ? 0.59095 0.57478 0.53295 0.11673  -0.10253 -0.12038 217 TRP A CB  
1397 C CG  . TRP A 217 ? 0.65320 0.62772 0.54978 0.13561  -0.11014 -0.13347 217 TRP A CG  
1398 C CD1 . TRP A 217 ? 0.62763 0.59946 0.49786 0.14318  -0.12337 -0.13840 217 TRP A CD1 
1399 C CD2 . TRP A 217 ? 0.60356 0.57062 0.47348 0.15178  -0.10476 -0.14338 217 TRP A CD2 
1400 N NE1 . TRP A 217 ? 0.65079 0.61394 0.47727 0.16295  -0.12594 -0.15093 217 TRP A NE1 
1401 C CE2 . TRP A 217 ? 0.65372 0.61429 0.47980 0.16927  -0.11416 -0.15461 217 TRP A CE2 
1402 C CE3 . TRP A 217 ? 0.61437 0.58010 0.49177 0.15521  -0.09296 -0.14367 217 TRP A CE3 
1403 C CZ2 . TRP A 217 ? 0.64454 0.59788 0.43378 0.19109  -0.11102 -0.16705 217 TRP A CZ2 
1404 C CZ3 . TRP A 217 ? 0.58584 0.54435 0.42909 0.17689  -0.09068 -0.15575 217 TRP A CZ3 
1405 C CH2 . TRP A 217 ? 0.59315 0.54600 0.39286 0.19497  -0.09898 -0.16761 217 TRP A CH2 
1406 N N   . LEU A 218 ? 0.58178 0.53916 0.56848 0.10783  -0.10030 -0.12746 218 LEU A N   
1407 C CA  . LEU A 218 ? 0.54235 0.48092 0.52550 0.11475  -0.10009 -0.13500 218 LEU A CA  
1408 C C   . LEU A 218 ? 0.59038 0.50276 0.60015 0.10369  -0.11887 -0.14236 218 LEU A C   
1409 O O   . LEU A 218 ? 0.59024 0.47307 0.58623 0.11219  -0.13206 -0.15729 218 LEU A O   
1410 C CB  . LEU A 218 ? 0.48318 0.43830 0.47701 0.11290  -0.07799 -0.12056 218 LEU A CB  
1411 C CG  . LEU A 218 ? 0.58823 0.56790 0.55622 0.12402  -0.06109 -0.11425 218 LEU A CG  
1412 C CD1 . LEU A 218 ? 0.49320 0.49519 0.48012 0.11492  -0.04237 -0.09681 218 LEU A CD1 
1413 C CD2 . LEU A 218 ? 0.42754 0.39911 0.36393 0.14577  -0.06059 -0.12643 218 LEU A CD2 
1414 N N   . LYS A 219 ? 0.54502 0.46735 0.59333 0.08497  -0.12073 -0.13180 219 LYS A N   
1415 C CA  . LYS A 219 ? 0.67874 0.57994 0.75672 0.07187  -0.13854 -0.13615 219 LYS A CA  
1416 C C   . LYS A 219 ? 0.66931 0.54877 0.73202 0.07605  -0.16637 -0.15583 219 LYS A C   
1417 O O   . LYS A 219 ? 0.56757 0.41479 0.63340 0.07371  -0.18462 -0.16769 219 LYS A O   
1418 C CB  . LYS A 219 ? 0.67020 0.59342 0.79429 0.05230  -0.13302 -0.11936 219 LYS A CB  
1419 C CG  . LYS A 219 ? 0.87461 0.78251 1.03652 0.03527  -0.15098 -0.12016 219 LYS A CG  
1420 C CD  . LYS A 219 ? 0.98333 0.91677 1.19295 0.01738  -0.14017 -0.10031 219 LYS A CD  
1421 C CE  . LYS A 219 ? 1.01977 0.94631 1.24247 0.01167  -0.12441 -0.08689 219 LYS A CE  
1422 N NZ  . LYS A 219 ? 1.04529 0.97151 1.23447 0.02679  -0.10563 -0.08529 219 LYS A NZ  
1423 N N   . ASP A 220 ? 0.58705 0.48035 0.62938 0.08326  -0.17116 -0.15996 220 ASP A N   
1424 C CA  . ASP A 220 ? 0.62196 0.49503 0.64264 0.09004  -0.19846 -0.17960 220 ASP A CA  
1425 C C   . ASP A 220 ? 0.68890 0.53254 0.66284 0.11101  -0.20347 -0.19807 220 ASP A C   
1426 O O   . ASP A 220 ? 0.77106 0.58345 0.73130 0.11480  -0.22978 -0.21779 220 ASP A O   
1427 C CB  . ASP A 220 ? 0.71250 0.60775 0.71716 0.09549  -0.20051 -0.17745 220 ASP A CB  
1428 C CG  . ASP A 220 ? 0.78888 0.70549 0.83850 0.07797  -0.20723 -0.16662 220 ASP A CG  
1429 O OD1 . ASP A 220 ? 0.86910 0.77879 0.95828 0.06201  -0.22149 -0.16770 220 ASP A OD1 
1430 O OD2 . ASP A 220 ? 0.77367 0.71416 0.81967 0.08058  -0.19828 -0.15632 220 ASP A OD2 
1431 N N   . ASN A 221 ? 0.63315 0.48666 0.58234 0.12563  -0.17969 -0.19273 221 ASN A N   
1432 C CA  . ASN A 221 ? 0.60365 0.43700 0.50581 0.15037  -0.18058 -0.20920 221 ASN A CA  
1433 C C   . ASN A 221 ? 0.73452 0.54973 0.64196 0.15505  -0.17221 -0.20967 221 ASN A C   
1434 O O   . ASN A 221 ? 0.75313 0.55578 0.62329 0.17866  -0.16861 -0.22154 221 ASN A O   
1435 C CB  . ASN A 221 ? 0.59644 0.45863 0.46189 0.16759  -0.16096 -0.20339 221 ASN A CB  
1436 C CG  . ASN A 221 ? 0.77392 0.64002 0.61397 0.17262  -0.17506 -0.21002 221 ASN A CG  
1437 O OD1 . ASN A 221 ? 0.90226 0.74215 0.71048 0.18587  -0.19660 -0.23108 221 ASN A OD1 
1438 N ND2 . ASN A 221 ? 0.66345 0.55922 0.51518 0.16303  -0.16481 -0.19273 221 ASN A ND2 
1439 N N   . ALA A 222 ? 0.75340 0.56733 0.70496 0.13493  -0.16888 -0.19655 222 ALA A N   
1440 C CA  . ALA A 222 ? 0.74539 0.54006 0.70224 0.13910  -0.16192 -0.19483 222 ALA A CA  
1441 C C   . ALA A 222 ? 0.72748 0.47297 0.65806 0.15349  -0.18446 -0.21861 222 ALA A C   
1442 O O   . ALA A 222 ? 0.74658 0.47990 0.64709 0.17670  -0.17734 -0.22676 222 ALA A O   
1443 C CB  . ALA A 222 ? 0.76770 0.56526 0.77479 0.11373  -0.15833 -0.17674 222 ALA A CB  
1444 N N   . HIS A 223 ? 0.86701 0.58372 0.80816 0.14097  -0.21310 -0.23082 223 HIS A N   
1445 C CA  . HIS A 223 ? 0.97540 0.64680 0.89512 0.14988  -0.23479 -0.24842 223 HIS A CA  
1446 C C   . HIS A 223 ? 0.95257 0.62675 0.81668 0.17988  -0.23122 -0.26103 223 HIS A C   
1447 O O   . HIS A 223 ? 0.99660 0.64580 0.83756 0.19505  -0.23451 -0.26863 223 HIS A O   
1448 C CB  . HIS A 223 ? 1.17119 0.82447 1.11549 0.12777  -0.26435 -0.25319 223 HIS A CB  
1449 C CG  . HIS A 223 ? 1.35012 0.97779 1.33690 0.10438  -0.27375 -0.24388 223 HIS A CG  
1450 N ND1 . HIS A 223 ? 1.41902 1.01374 1.39597 0.11150  -0.27300 -0.24437 223 HIS A ND1 
1451 C CD2 . HIS A 223 ? 1.36871 1.00176 1.40889 0.07383  -0.28269 -0.23134 223 HIS A CD2 
1452 C CE1 . HIS A 223 ? 1.42410 1.00205 1.44434 0.08570  -0.28133 -0.23218 223 HIS A CE1 
1453 N NE2 . HIS A 223 ? 1.39479 0.99777 1.45527 0.06218  -0.28635 -0.22327 223 HIS A NE2 
1454 N N   . ALA A 224 ? 0.94021 0.64519 0.78231 0.18920  -0.22368 -0.26197 224 ALA A N   
1455 C CA  . ALA A 224 ? 0.89485 0.60624 0.68566 0.21693  -0.21879 -0.27067 224 ALA A CA  
1456 C C   . ALA A 224 ? 0.89358 0.62070 0.66638 0.23783  -0.19247 -0.26448 224 ALA A C   
1457 O O   . ALA A 224 ? 0.93901 0.66733 0.67323 0.26167  -0.18872 -0.27120 224 ALA A O   
1458 C CB  . ALA A 224 ? 0.85072 0.59273 0.62367 0.22015  -0.21557 -0.26893 224 ALA A CB  
1459 N N   . PHE A 225 ? 0.89750 0.63879 0.69884 0.23011  -0.17441 -0.25102 225 PHE A N   
1460 C CA  . PHE A 225 ? 0.83660 0.59952 0.62709 0.24831  -0.14944 -0.24254 225 PHE A CA  
1461 C C   . PHE A 225 ? 0.91038 0.64358 0.71393 0.24922  -0.15229 -0.24225 225 PHE A C   
1462 O O   . PHE A 225 ? 0.75296 0.50395 0.55326 0.26302  -0.13309 -0.23402 225 PHE A O   
1463 C CB  . PHE A 225 ? 0.78663 0.59303 0.59656 0.24219  -0.12500 -0.22551 225 PHE A CB  
1464 C CG  . PHE A 225 ? 0.75849 0.60234 0.54389 0.25049  -0.11282 -0.22169 225 PHE A CG  
1465 C CD1 . PHE A 225 ? 0.71409 0.57299 0.51301 0.23151  -0.11633 -0.21426 225 PHE A CD1 
1466 C CD2 . PHE A 225 ? 0.69816 0.56701 0.45253 0.27261  -0.09701 -0.21853 225 PHE A CD2 
1467 C CE1 . PHE A 225 ? 0.67239 0.56295 0.44766 0.23781  -0.10560 -0.20780 225 PHE A CE1 
1468 C CE2 . PHE A 225 ? 0.76474 0.66823 0.49789 0.27835  -0.08485 -0.21128 225 PHE A CE2 
1469 C CZ  . PHE A 225 ? 0.73430 0.64500 0.47312 0.26316  -0.08971 -0.20862 225 PHE A CZ  
1470 N N   . GLY A 226 ? 0.93539 0.62504 0.75430 0.23432  -0.17636 -0.24969 226 GLY A N   
1471 C CA  . GLY A 226 ? 0.99651 0.65420 0.83198 0.23043  -0.18025 -0.24639 226 GLY A CA  
1472 C C   . GLY A 226 ? 0.95002 0.60980 0.83136 0.20747  -0.17402 -0.22973 226 GLY A C   
1473 O O   . GLY A 226 ? 0.95118 0.58726 0.84674 0.20438  -0.17409 -0.22287 226 GLY A O   
1474 N N   . GLY A 227 ? 0.84519 0.53176 0.74913 0.19232  -0.16875 -0.22236 227 GLY A N   
1475 C CA  . GLY A 227 ? 0.78700 0.48921 0.73548 0.16905  -0.15791 -0.20038 227 GLY A CA  
1476 C C   . GLY A 227 ? 0.83636 0.51811 0.82180 0.13922  -0.17736 -0.19667 227 GLY A C   
1477 O O   . GLY A 227 ? 0.86348 0.53114 0.84476 0.13354  -0.19884 -0.21093 227 GLY A O   
1478 N N   . ASN A 228 ? 0.85077 0.53341 0.87321 0.12032  -0.16963 -0.17626 228 ASN A N   
1479 C CA  . ASN A 228 ? 0.81890 0.49248 0.88406 0.08990  -0.18300 -0.16679 228 ASN A CA  
1480 C C   . ASN A 228 ? 0.70385 0.43031 0.79571 0.07392  -0.16748 -0.14983 228 ASN A C   
1481 O O   . ASN A 228 ? 0.68527 0.44109 0.78940 0.07120  -0.14407 -0.13058 228 ASN A O   
1482 C CB  . ASN A 228 ? 0.76307 0.41040 0.85266 0.07847  -0.18145 -0.15137 228 ASN A CB  
1483 C CG  . ASN A 228 ? 0.74140 0.37868 0.87721 0.04627  -0.19575 -0.14026 228 ASN A CG  
1484 O OD1 . ASN A 228 ? 0.81067 0.48337 0.97331 0.02948  -0.19384 -0.13261 228 ASN A OD1 
1485 N ND2 . ASN A 228 ? 0.70869 0.29825 0.85571 0.03754  -0.21008 -0.13800 228 ASN A ND2 
1486 N N   . PRO A 229 ? 0.75373 0.49186 0.85434 0.06420  -0.18092 -0.15656 229 PRO A N   
1487 C CA  . PRO A 229 ? 0.68605 0.47279 0.80820 0.05325  -0.16632 -0.14173 229 PRO A CA  
1488 C C   . PRO A 229 ? 0.67545 0.48205 0.84139 0.03281  -0.15173 -0.11692 229 PRO A C   
1489 O O   . PRO A 229 ? 0.70600 0.55163 0.88286 0.02937  -0.13404 -0.10381 229 PRO A O   
1490 C CB  . PRO A 229 ? 0.71731 0.50301 0.84598 0.04542  -0.19033 -0.15435 229 PRO A CB  
1491 C CG  . PRO A 229 ? 0.82139 0.56232 0.91484 0.05984  -0.21407 -0.17975 229 PRO A CG  
1492 C CD  . PRO A 229 ? 0.84990 0.55516 0.94058 0.06352  -0.21226 -0.17863 229 PRO A CD  
1493 N N   . GLU A 230 ? 0.75217 0.53195 0.94160 0.01984  -0.15844 -0.10956 230 GLU A N   
1494 C CA  . GLU A 230 ? 0.84366 0.64277 1.07259 0.00130  -0.14322 -0.08409 230 GLU A CA  
1495 C C   . GLU A 230 ? 0.78590 0.58437 1.00151 0.01111  -0.12158 -0.07108 230 GLU A C   
1496 O O   . GLU A 230 ? 0.70656 0.51881 0.94783 -0.00118 -0.10736 -0.04936 230 GLU A O   
1497 C CB  . GLU A 230 ? 0.96573 0.73982 1.23289 -0.02209 -0.16249 -0.07892 230 GLU A CB  
1498 C CG  . GLU A 230 ? 1.04008 0.82813 1.33310 -0.03633 -0.18213 -0.08609 230 GLU A CG  
1499 C CD  . GLU A 230 ? 1.12947 0.97108 1.45842 -0.04808 -0.16482 -0.06673 230 GLU A CD  
1500 O OE1 . GLU A 230 ? 1.20029 1.05308 1.57056 -0.06728 -0.15765 -0.04549 230 GLU A OE1 
1501 O OE2 . GLU A 230 ? 1.10443 0.97616 1.41905 -0.03705 -0.15760 -0.07187 230 GLU A OE2 
1502 N N   . TRP A 231 ? 0.76936 0.55570 0.94522 0.03412  -0.11840 -0.08325 231 TRP A N   
1503 C CA  . TRP A 231 ? 0.70355 0.48965 0.86648 0.04541  -0.10107 -0.07246 231 TRP A CA  
1504 C C   . TRP A 231 ? 0.65965 0.48357 0.80020 0.06040  -0.08217 -0.07213 231 TRP A C   
1505 O O   . TRP A 231 ? 0.70266 0.52230 0.81503 0.08053  -0.07747 -0.07891 231 TRP A O   
1506 C CB  . TRP A 231 ? 0.75578 0.49450 0.89504 0.06072  -0.11421 -0.08540 231 TRP A CB  
1507 C CG  . TRP A 231 ? 0.83789 0.56099 0.97972 0.06329  -0.10499 -0.06983 231 TRP A CG  
1508 C CD1 . TRP A 231 ? 0.89107 0.64082 1.04814 0.05598  -0.08501 -0.04661 231 TRP A CD1 
1509 C CD2 . TRP A 231 ? 0.82542 0.50001 0.95065 0.07617  -0.11633 -0.07651 231 TRP A CD2 
1510 N NE1 . TRP A 231 ? 0.88361 0.60570 1.03479 0.06297  -0.08326 -0.03711 231 TRP A NE1 
1511 C CE2 . TRP A 231 ? 0.85789 0.53296 0.99058 0.07551  -0.10231 -0.05489 231 TRP A CE2 
1512 C CE3 . TRP A 231 ? 0.85935 0.48774 0.96106 0.09018  -0.13782 -0.09952 231 TRP A CE3 
1513 C CZ2 . TRP A 231 ? 0.95176 0.58282 1.07133 0.08790  -0.10915 -0.05417 231 TRP A CZ2 
1514 C CZ3 . TRP A 231 ? 1.01068 0.59344 1.09875 0.10321  -0.14465 -0.10045 231 TRP A CZ3 
1515 C CH2 . TRP A 231 ? 1.05059 0.63489 1.14858 0.10188  -0.13037 -0.07723 231 TRP A CH2 
1516 N N   . MET A 232 ? 0.49146 0.35239 0.64526 0.05111  -0.07193 -0.06410 232 MET A N   
1517 C CA  . MET A 232 ? 0.44897 0.34230 0.58293 0.06200  -0.05738 -0.06425 232 MET A CA  
1518 C C   . MET A 232 ? 0.48813 0.40512 0.63058 0.05832  -0.03777 -0.04557 232 MET A C   
1519 O O   . MET A 232 ? 0.54739 0.46870 0.71488 0.04443  -0.03292 -0.03137 232 MET A O   
1520 C CB  . MET A 232 ? 0.40518 0.31866 0.54061 0.05744  -0.06148 -0.07030 232 MET A CB  
1521 C CG  . MET A 232 ? 0.63745 0.52913 0.76159 0.06140  -0.08288 -0.08944 232 MET A CG  
1522 S SD  . MET A 232 ? 0.58975 0.50486 0.69677 0.06627  -0.08578 -0.09806 232 MET A SD  
1523 C CE  . MET A 232 ? 0.36436 0.31658 0.49266 0.05537  -0.06552 -0.07792 232 MET A CE  
1524 N N   . THR A 233 ? 0.41558 0.34936 0.53676 0.07111  -0.02683 -0.04542 233 THR A N   
1525 C CA  . THR A 233 ? 0.49436 0.45147 0.61803 0.06908  -0.01082 -0.03074 233 THR A CA  
1526 C C   . THR A 233 ? 0.50990 0.49482 0.61949 0.07286  -0.00416 -0.03379 233 THR A C   
1527 O O   . THR A 233 ? 0.62193 0.60967 0.71270 0.08410  -0.00678 -0.04386 233 THR A O   
1528 C CB  . THR A 233 ? 0.49296 0.44126 0.60701 0.08002  -0.00625 -0.02510 233 THR A CB  
1529 O OG1 . THR A 233 ? 0.41433 0.33253 0.54139 0.07493  -0.01265 -0.01962 233 THR A OG1 
1530 C CG2 . THR A 233 ? 0.45923 0.43263 0.57172 0.07917  0.00779  -0.01176 233 THR A CG2 
1531 N N   . LEU A 234 ? 0.37739 0.38162 0.49514 0.06398  0.00433  -0.02483 234 LEU A N   
1532 C CA  . LEU A 234 ? 0.41195 0.43857 0.51626 0.06601  0.01076  -0.02479 234 LEU A CA  
1533 C C   . LEU A 234 ? 0.46110 0.49959 0.55803 0.07017  0.01981  -0.01646 234 LEU A C   
1534 O O   . LEU A 234 ? 0.48983 0.52419 0.59396 0.06796  0.02423  -0.00719 234 LEU A O   
1535 C CB  . LEU A 234 ? 0.43832 0.47530 0.55184 0.05641  0.01302  -0.02141 234 LEU A CB  
1536 C CG  . LEU A 234 ? 0.50680 0.53854 0.62950 0.05221  0.00322  -0.02849 234 LEU A CG  
1537 C CD1 . LEU A 234 ? 0.46538 0.51059 0.59305 0.04712  0.00739  -0.02430 234 LEU A CD1 
1538 C CD2 . LEU A 234 ? 0.52464 0.55212 0.62901 0.05989  -0.00503 -0.04006 234 LEU A CD2 
1539 N N   . PHE A 235 ? 0.39462 0.44952 0.47767 0.07599  0.02217  -0.01864 235 PHE A N   
1540 C CA  . PHE A 235 ? 0.41826 0.48974 0.49711 0.07683  0.02862  -0.01060 235 PHE A CA  
1541 C C   . PHE A 235 ? 0.44089 0.53351 0.51144 0.07390  0.03040  -0.01087 235 PHE A C   
1542 O O   . PHE A 235 ? 0.46286 0.55976 0.52722 0.07629  0.02846  -0.01649 235 PHE A O   
1543 C CB  . PHE A 235 ? 0.30616 0.37653 0.38215 0.08882  0.02889  -0.00876 235 PHE A CB  
1544 C CG  . PHE A 235 ? 0.30051 0.37984 0.36765 0.10151  0.02741  -0.01611 235 PHE A CG  
1545 C CD1 . PHE A 235 ? 0.31938 0.38783 0.38059 0.10579  0.02251  -0.02693 235 PHE A CD1 
1546 C CD2 . PHE A 235 ? 0.32268 0.42221 0.38693 0.11156  0.03061  -0.01221 235 PHE A CD2 
1547 C CE1 . PHE A 235 ? 0.41084 0.48859 0.45988 0.12123  0.02286  -0.03391 235 PHE A CE1 
1548 C CE2 . PHE A 235 ? 0.40903 0.52191 0.46621 0.12639  0.03148  -0.01805 235 PHE A CE2 
1549 C CZ  . PHE A 235 ? 0.41985 0.52158 0.46776 0.13196  0.02861  -0.02897 235 PHE A CZ  
1550 N N   . GLY A 236 ? 0.24656 0.35075 0.31581 0.06821  0.03340  -0.00414 236 GLY A N   
1551 C CA  . GLY A 236 ? 0.29837 0.41931 0.36211 0.06149  0.03343  -0.00237 236 GLY A CA  
1552 C C   . GLY A 236 ? 0.37083 0.50105 0.43261 0.05696  0.03359  0.00377  236 GLY A C   
1553 O O   . GLY A 236 ? 0.39197 0.51550 0.45380 0.05989  0.03479  0.00694  236 GLY A O   
1554 N N   . GLU A 237 ? 0.35969 0.50439 0.41865 0.04902  0.03144  0.00605  237 GLU A N   
1555 C CA  . GLU A 237 ? 0.29568 0.44968 0.35205 0.04343  0.02796  0.01038  237 GLU A CA  
1556 C C   . GLU A 237 ? 0.35705 0.50369 0.40664 0.03039  0.02335  0.00993  237 GLU A C   
1557 O O   . GLU A 237 ? 0.39312 0.53896 0.44268 0.02481  0.02310  0.00975  237 GLU A O   
1558 C CB  . GLU A 237 ? 0.19792 0.38081 0.26176 0.04663  0.02708  0.01490  237 GLU A CB  
1559 C CG  . GLU A 237 ? 0.30398 0.49866 0.36731 0.04246  0.02093  0.01904  237 GLU A CG  
1560 C CD  . GLU A 237 ? 0.36250 0.57112 0.42885 0.02687  0.01459  0.02211  237 GLU A CD  
1561 O OE1 . GLU A 237 ? 0.43165 0.64404 0.50123 0.02065  0.01712  0.02327  237 GLU A OE1 
1562 O OE2 . GLU A 237 ? 0.37145 0.58622 0.43623 0.02037  0.00608  0.02395  237 GLU A OE2 
1563 N N   . SER A 238 ? 0.35696 0.49542 0.39788 0.02680  0.01898  0.00965  238 SER A N   
1564 C CA  . SER A 238 ? 0.31157 0.43572 0.34217 0.01629  0.01244  0.00738  238 SER A CA  
1565 C C   . SER A 238 ? 0.25070 0.35547 0.27881 0.01734  0.01575  0.00360  238 SER A C   
1566 O O   . SER A 238 ? 0.34328 0.43899 0.37273 0.02597  0.02160  0.00115  238 SER A O   
1567 C CB  . SER A 238 ? 0.34861 0.48857 0.38426 0.00280  0.00501  0.01207  238 SER A CB  
1568 O OG  . SER A 238 ? 0.42818 0.54975 0.45162 -0.00785 -0.00514 0.00949  238 SER A OG  
1569 N N   . ALA A 239 ? 0.31523 0.41503 0.34148 0.00836  0.01170  0.00456  239 ALA A N   
1570 C CA  . ALA A 239 ? 0.34612 0.42832 0.36953 0.01078  0.01316  0.00148  239 ALA A CA  
1571 C C   . ALA A 239 ? 0.31420 0.40287 0.34768 0.02007  0.01974  0.00013  239 ALA A C   
1572 O O   . ALA A 239 ? 0.30468 0.38165 0.34038 0.02600  0.02173  -0.00365 239 ALA A O   
1573 C CB  . ALA A 239 ? 0.34172 0.41847 0.36063 -0.00024 0.00752  0.00551  239 ALA A CB  
1574 N N   . GLY A 240 ? 0.27297 0.38059 0.31327 0.02223  0.02240  0.00272  240 GLY A N   
1575 C CA  . GLY A 240 ? 0.37898 0.48730 0.42593 0.03201  0.02614  -0.00076 240 GLY A CA  
1576 C C   . GLY A 240 ? 0.41330 0.51328 0.46612 0.03813  0.02898  -0.00264 240 GLY A C   
1577 O O   . GLY A 240 ? 0.43252 0.52321 0.49221 0.04202  0.02964  -0.00581 240 GLY A O   
1578 N N   . SER A 241 ? 0.32282 0.42713 0.37356 0.03841  0.03011  0.00047  241 SER A N   
1579 C CA  . SER A 241 ? 0.30905 0.40586 0.36270 0.04373  0.03427  0.00175  241 SER A CA  
1580 C C   . SER A 241 ? 0.32547 0.40961 0.37829 0.04297  0.03612  -0.00009 241 SER A C   
1581 O O   . SER A 241 ? 0.30483 0.38460 0.36850 0.04619  0.04018  0.00074  241 SER A O   
1582 C CB  . SER A 241 ? 0.32682 0.43095 0.37321 0.04508  0.03399  0.00595  241 SER A CB  
1583 O OG  . SER A 241 ? 0.36778 0.46373 0.41088 0.04951  0.03882  0.00889  241 SER A OG  
1584 N N   . SER A 242 ? 0.28217 0.36046 0.32355 0.03893  0.03267  -0.00226 242 SER A N   
1585 C CA  . SER A 242 ? 0.31520 0.38201 0.35506 0.04175  0.03454  -0.00493 242 SER A CA  
1586 C C   . SER A 242 ? 0.35709 0.42254 0.41052 0.04246  0.03377  -0.00689 242 SER A C   
1587 O O   . SER A 242 ? 0.29136 0.35581 0.35511 0.04687  0.03757  -0.00692 242 SER A O   
1588 C CB  . SER A 242 ? 0.36126 0.41581 0.38366 0.03844  0.02849  -0.00842 242 SER A CB  
1589 O OG  . SER A 242 ? 0.52514 0.57537 0.53368 0.04276  0.03019  -0.00923 242 SER A OG  
1590 N N   . SER A 243 ? 0.30601 0.37388 0.35984 0.03876  0.02873  -0.00804 243 SER A N   
1591 C CA  . SER A 243 ? 0.29794 0.36382 0.36145 0.04057  0.02581  -0.01087 243 SER A CA  
1592 C C   . SER A 243 ? 0.35444 0.42377 0.43525 0.04370  0.02822  -0.01092 243 SER A C   
1593 O O   . SER A 243 ? 0.35266 0.42076 0.44747 0.04498  0.02683  -0.01222 243 SER A O   
1594 C CB  . SER A 243 ? 0.36625 0.43448 0.42188 0.03792  0.02083  -0.01157 243 SER A CB  
1595 O OG  . SER A 243 ? 0.44205 0.50825 0.48421 0.03168  0.01880  -0.00832 243 SER A OG  
1596 N N   . VAL A 244 ? 0.23829 0.31162 0.31996 0.04469  0.03082  -0.00880 244 VAL A N   
1597 C CA  . VAL A 244 ? 0.19643 0.26729 0.29382 0.04635  0.03232  -0.00725 244 VAL A CA  
1598 C C   . VAL A 244 ? 0.29736 0.36943 0.40737 0.04568  0.03814  -0.00234 244 VAL A C   
1599 O O   . VAL A 244 ? 0.37112 0.44324 0.50050 0.04390  0.03648  -0.00198 244 VAL A O   
1600 C CB  . VAL A 244 ? 0.30304 0.37502 0.39667 0.04939  0.03502  -0.00371 244 VAL A CB  
1601 C CG1 . VAL A 244 ? 0.28213 0.34595 0.39184 0.04962  0.03646  0.00047  244 VAL A CG1 
1602 C CG2 . VAL A 244 ? 0.25287 0.32835 0.33754 0.05292  0.03080  -0.00835 244 VAL A CG2 
1603 N N   . ASN A 245 ? 0.29247 0.36725 0.39164 0.04752  0.04471  0.00153  245 ASN A N   
1604 C CA  . ASN A 245 ? 0.37859 0.45769 0.48493 0.05022  0.05267  0.00618  245 ASN A CA  
1605 C C   . ASN A 245 ? 0.28562 0.36744 0.40589 0.05073  0.04971  0.00265  245 ASN A C   
1606 O O   . ASN A 245 ? 0.29623 0.38689 0.43963 0.05030  0.05339  0.00725  245 ASN A O   
1607 C CB  . ASN A 245 ? 0.44867 0.52598 0.53175 0.05451  0.05654  0.00606  245 ASN A CB  
1608 C CG  . ASN A 245 ? 0.43387 0.51691 0.51756 0.06121  0.06749  0.01141  245 ASN A CG  
1609 O OD1 . ASN A 245 ? 0.51976 0.59915 0.58104 0.06677  0.07027  0.01027  245 ASN A OD1 
1610 N ND2 . ASN A 245 ? 0.34250 0.43568 0.45131 0.06101  0.07344  0.01734  245 ASN A ND2 
1611 N N   . ALA A 246 ? 0.30716 0.38264 0.41515 0.05123  0.04248  -0.00413 246 ALA A N   
1612 C CA  . ALA A 246 ? 0.34663 0.42342 0.46484 0.05381  0.03797  -0.00737 246 ALA A CA  
1613 C C   . ALA A 246 ? 0.36194 0.44340 0.50268 0.04993  0.03088  -0.00855 246 ALA A C   
1614 O O   . ALA A 246 ? 0.42718 0.51847 0.59013 0.05125  0.02999  -0.00729 246 ALA A O   
1615 C CB  . ALA A 246 ? 0.31549 0.38004 0.41260 0.05436  0.03052  -0.01251 246 ALA A CB  
1616 N N   . GLN A 247 ? 0.27272 0.34805 0.40844 0.04600  0.02487  -0.01154 247 GLN A N   
1617 C CA  . GLN A 247 ? 0.28533 0.36002 0.43795 0.04320  0.01523  -0.01529 247 GLN A CA  
1618 C C   . GLN A 247 ? 0.31973 0.40052 0.50036 0.03858  0.01840  -0.00920 247 GLN A C   
1619 O O   . GLN A 247 ? 0.35210 0.43595 0.55511 0.03472  0.00966  -0.01097 247 GLN A O   
1620 C CB  . GLN A 247 ? 0.29241 0.35743 0.42930 0.04333  0.00873  -0.02116 247 GLN A CB  
1621 C CG  . GLN A 247 ? 0.39575 0.45816 0.50854 0.04618  0.00524  -0.02489 247 GLN A CG  
1622 C CD  . GLN A 247 ? 0.49427 0.55602 0.60895 0.04793  -0.00365 -0.02819 247 GLN A CD  
1623 O OE1 . GLN A 247 ? 0.60890 0.67230 0.74195 0.04742  -0.01171 -0.03135 247 GLN A OE1 
1624 N NE2 . GLN A 247 ? 0.41262 0.47124 0.50895 0.04948  -0.00372 -0.02678 247 GLN A NE2 
1625 N N   . LEU A 248 ? 0.33747 0.42035 0.51781 0.03811  0.02989  -0.00092 248 LEU A N   
1626 C CA  . LEU A 248 ? 0.31057 0.39858 0.51742 0.03223  0.03415  0.00838  248 LEU A CA  
1627 C C   . LEU A 248 ? 0.39096 0.49959 0.62136 0.03255  0.04182  0.01582  248 LEU A C   
1628 O O   . LEU A 248 ? 0.44806 0.56621 0.71071 0.02491  0.04073  0.02268  248 LEU A O   
1629 C CB  . LEU A 248 ? 0.37852 0.46132 0.57481 0.03278  0.04397  0.01680  248 LEU A CB  
1630 C CG  . LEU A 248 ? 0.52950 0.59574 0.70903 0.03404  0.03955  0.01384  248 LEU A CG  
1631 C CD1 . LEU A 248 ? 0.59498 0.66168 0.76341 0.03705  0.05081  0.02443  248 LEU A CD1 
1632 C CD2 . LEU A 248 ? 0.51713 0.56866 0.71205 0.02868  0.02878  0.01133  248 LEU A CD2 
1633 N N   . MET A 249 ? 0.41133 0.52728 0.62730 0.04152  0.04912  0.01480  249 MET A N   
1634 C CA  . MET A 249 ? 0.48308 0.62069 0.71698 0.04667  0.06010  0.02226  249 MET A CA  
1635 C C   . MET A 249 ? 0.45490 0.60161 0.69832 0.05271  0.05322  0.01589  249 MET A C   
1636 O O   . MET A 249 ? 0.40299 0.57235 0.66815 0.05814  0.06120  0.02198  249 MET A O   
1637 C CB  . MET A 249 ? 0.44391 0.58194 0.65195 0.05660  0.07457  0.02570  249 MET A CB  
1638 C CG  . MET A 249 ? 0.48621 0.61649 0.68049 0.05359  0.08146  0.03281  249 MET A CG  
1639 S SD  . MET A 249 ? 0.59376 0.73884 0.82268 0.04455  0.09098  0.05081  249 MET A SD  
1640 C CE  . MET A 249 ? 0.51119 0.63550 0.71599 0.04199  0.09152  0.05518  249 MET A CE  
1641 N N   . SER A 250 ? 0.40663 0.53804 0.63362 0.05350  0.03966  0.00511  250 SER A N   
1642 C CA  . SER A 250 ? 0.42347 0.56101 0.65745 0.06026  0.03160  0.00015  250 SER A CA  
1643 C C   . SER A 250 ? 0.34638 0.50631 0.62315 0.05520  0.02561  0.00406  250 SER A C   
1644 O O   . SER A 250 ? 0.35535 0.51278 0.64792 0.04339  0.01755  0.00449  250 SER A O   
1645 C CB  . SER A 250 ? 0.40655 0.52351 0.61588 0.05997  0.01735  -0.00949 250 SER A CB  
1646 O OG  . SER A 250 ? 0.41226 0.53005 0.61871 0.06955  0.01178  -0.01271 250 SER A OG  
1647 N N   . PRO A 251 ? 0.28551 0.46701 0.58240 0.06417  0.02765  0.00641  251 PRO A N   
1648 C CA  . PRO A 251 ? 0.26311 0.46887 0.60388 0.05835  0.01775  0.00941  251 PRO A CA  
1649 C C   . PRO A 251 ? 0.35129 0.54160 0.68809 0.05213  -0.00503 -0.00082 251 PRO A C   
1650 O O   . PRO A 251 ? 0.51035 0.70797 0.87614 0.04003  -0.01659 -0.00020 251 PRO A O   
1651 C CB  . PRO A 251 ? 0.22699 0.45683 0.58136 0.07450  0.02339  0.01162  251 PRO A CB  
1652 C CG  . PRO A 251 ? 0.25798 0.47882 0.58142 0.08677  0.04085  0.01253  251 PRO A CG  
1653 C CD  . PRO A 251 ? 0.31192 0.49642 0.59325 0.08103  0.03728  0.00567  251 PRO A CD  
1654 N N   . VAL A 252 ? 0.35048 0.51816 0.65041 0.05980  -0.01235 -0.00986 252 VAL A N   
1655 C CA  . VAL A 252 ? 0.43945 0.59258 0.72887 0.05648  -0.03266 -0.01913 252 VAL A CA  
1656 C C   . VAL A 252 ? 0.53480 0.67607 0.82636 0.04333  -0.03902 -0.02211 252 VAL A C   
1657 O O   . VAL A 252 ? 0.61674 0.75547 0.91875 0.03801  -0.05725 -0.02858 252 VAL A O   
1658 C CB  . VAL A 252 ? 0.35878 0.48773 0.60349 0.06487  -0.03486 -0.02469 252 VAL A CB  
1659 C CG1 . VAL A 252 ? 0.43944 0.55487 0.66880 0.06291  -0.05352 -0.03296 252 VAL A CG1 
1660 C CG2 . VAL A 252 ? 0.27207 0.40592 0.51353 0.07869  -0.03208 -0.02268 252 VAL A CG2 
1661 N N   . THR A 253 ? 0.49499 0.62717 0.77553 0.03918  -0.02555 -0.01808 253 THR A N   
1662 C CA  . THR A 253 ? 0.53011 0.64392 0.80233 0.03092  -0.03081 -0.02205 253 THR A CA  
1663 C C   . THR A 253 ? 0.67469 0.79341 0.97151 0.02105  -0.02174 -0.01234 253 THR A C   
1664 O O   . THR A 253 ? 0.66185 0.76279 0.95612 0.01430  -0.02843 -0.01546 253 THR A O   
1665 C CB  . THR A 253 ? 0.46133 0.55550 0.69095 0.03642  -0.02512 -0.02624 253 THR A CB  
1666 O OG1 . THR A 253 ? 0.46267 0.56188 0.68442 0.03972  -0.00737 -0.01839 253 THR A OG1 
1667 C CG2 . THR A 253 ? 0.44843 0.53527 0.65233 0.04401  -0.03440 -0.03351 253 THR A CG2 
1668 N N   . ARG A 254 ? 0.73844 0.87911 1.05619 0.02147  -0.00636 -0.00024 254 ARG A N   
1669 C CA  . ARG A 254 ? 0.77669 0.92290 1.11479 0.01249  0.00498  0.01252  254 ARG A CA  
1670 C C   . ARG A 254 ? 0.78568 0.92726 1.15503 -0.00263 -0.01023 0.01311  254 ARG A C   
1671 O O   . ARG A 254 ? 0.73241 0.88775 1.13039 -0.00755 -0.02409 0.01056  254 ARG A O   
1672 C CB  . ARG A 254 ? 0.75259 0.92992 1.11246 0.01675  0.02292  0.02586  254 ARG A CB  
1673 C CG  . ARG A 254 ? 0.78811 0.98236 1.18500 0.00468  0.03195  0.04268  254 ARG A CG  
1674 C CD  . ARG A 254 ? 0.90134 1.13391 1.32245 0.01164  0.04943  0.05528  254 ARG A CD  
1675 N NE  . ARG A 254 ? 1.03175 1.26250 1.41668 0.02793  0.06731  0.05551  254 ARG A NE  
1676 C CZ  . ARG A 254 ? 1.10439 1.32839 1.47069 0.02878  0.08262  0.06453  254 ARG A CZ  
1677 N NH1 . ARG A 254 ? 1.12077 1.33805 1.50121 0.01461  0.08356  0.07564  254 ARG A NH1 
1678 N NH2 . ARG A 254 ? 1.10948 1.33064 1.44109 0.04418  0.09536  0.06221  254 ARG A NH2 
1679 N N   . GLY A 255 ? 0.74785 0.86718 1.11009 -0.00956 -0.00993 0.01557  255 GLY A N   
1680 C CA  . GLY A 255 ? 0.76788 0.87403 1.15632 -0.02475 -0.02492 0.01646  255 GLY A CA  
1681 C C   . GLY A 255 ? 0.80734 0.87588 1.16685 -0.02283 -0.04182 0.00037  255 GLY A C   
1682 O O   . GLY A 255 ? 0.95417 0.99981 1.32173 -0.03217 -0.04953 0.00196  255 GLY A O   
1683 N N   . LEU A 256 ? 0.69648 0.75738 1.02162 -0.01007 -0.04759 -0.01453 256 LEU A N   
1684 C CA  . LEU A 256 ? 0.66549 0.69460 0.96282 -0.00571 -0.06305 -0.03027 256 LEU A CA  
1685 C C   . LEU A 256 ? 0.68522 0.69366 0.96015 -0.00122 -0.05314 -0.02759 256 LEU A C   
1686 O O   . LEU A 256 ? 0.82946 0.80935 1.09911 -0.00269 -0.06493 -0.03432 256 LEU A O   
1687 C CB  . LEU A 256 ? 0.63298 0.66234 0.89811 0.00725  -0.06933 -0.04393 256 LEU A CB  
1688 C CG  . LEU A 256 ? 0.67731 0.72214 0.95777 0.00613  -0.08358 -0.04900 256 LEU A CG  
1689 C CD1 . LEU A 256 ? 0.63148 0.68717 0.88499 0.01877  -0.07702 -0.05105 256 LEU A CD1 
1690 C CD2 . LEU A 256 ? 0.73911 0.76408 1.01901 0.00317  -0.11057 -0.06428 256 LEU A CD2 
1691 N N   . VAL A 257 ? 0.54006 0.56086 0.80092 0.00527  -0.03326 -0.01853 257 VAL A N   
1692 C CA  . VAL A 257 ? 0.42351 0.42978 0.66501 0.01052  -0.02384 -0.01435 257 VAL A CA  
1693 C C   . VAL A 257 ? 0.41909 0.44071 0.67563 0.00571  -0.00582 0.00450  257 VAL A C   
1694 O O   . VAL A 257 ? 0.44620 0.49188 0.70582 0.00753  0.00550  0.01019  257 VAL A O   
1695 C CB  . VAL A 257 ? 0.45815 0.46505 0.66210 0.02468  -0.01876 -0.02247 257 VAL A CB  
1696 C CG1 . VAL A 257 ? 0.59686 0.58575 0.78304 0.03178  -0.01625 -0.02255 257 VAL A CG1 
1697 C CG2 . VAL A 257 ? 0.41447 0.41818 0.60305 0.03032  -0.03199 -0.03784 257 VAL A CG2 
1698 N N   . LYS A 258 ? 0.41996 0.42572 0.68355 0.00088  -0.00349 0.01430  258 LYS A N   
1699 C CA  . LYS A 258 ? 0.39650 0.41524 0.67011 -0.00259 0.01418  0.03397  258 LYS A CA  
1700 C C   . LYS A 258 ? 0.53042 0.53383 0.77777 0.00623  0.02119  0.03844  258 LYS A C   
1701 O O   . LYS A 258 ? 0.62367 0.62663 0.87746 0.00275  0.03164  0.05550  258 LYS A O   
1702 C CB  . LYS A 258 ? 0.38397 0.40317 0.69724 -0.01929 0.01252  0.04857  258 LYS A CB  
1703 C CG  . LYS A 258 ? 0.51145 0.55787 0.85779 -0.02787 0.00974  0.04951  258 LYS A CG  
1704 C CD  . LYS A 258 ? 0.63037 0.66395 1.01169 -0.04505 -0.00823 0.05030  258 LYS A CD  
1705 C CE  . LYS A 258 ? 0.71587 0.78245 1.13591 -0.05397 -0.01184 0.05297  258 LYS A CE  
1706 N NZ  . LYS A 258 ? 0.75305 0.85000 1.21074 -0.06490 0.00539  0.07802  258 LYS A NZ  
1707 N N   . ARG A 259 ? 0.50347 0.49658 0.72206 0.01815  0.01581  0.02474  259 ARG A N   
1708 C CA  . ARG A 259 ? 0.50971 0.49037 0.70615 0.02807  0.01985  0.02786  259 ARG A CA  
1709 C C   . ARG A 259 ? 0.49421 0.48794 0.66372 0.04014  0.02197  0.01714  259 ARG A C   
1710 O O   . ARG A 259 ? 0.46655 0.45781 0.62784 0.04420  0.01285  0.00265  259 ARG A O   
1711 C CB  . ARG A 259 ? 0.32492 0.27124 0.52148 0.02931  0.00647  0.02304  259 ARG A CB  
1712 C CG  . ARG A 259 ? 0.41820 0.35125 0.59120 0.04356  0.00838  0.02384  259 ARG A CG  
1713 C CD  . ARG A 259 ? 0.37560 0.26886 0.54911 0.04594  -0.00516 0.02016  259 ARG A CD  
1714 N NE  . ARG A 259 ? 0.39682 0.27286 0.59502 0.03045  -0.00604 0.03648  259 ARG A NE  
1715 C CZ  . ARG A 259 ? 0.49950 0.33608 0.70470 0.02659  -0.01999 0.03562  259 ARG A CZ  
1716 N NH1 . ARG A 259 ? 0.56180 0.37086 0.74759 0.04032  -0.03414 0.01696  259 ARG A NH1 
1717 N NH2 . ARG A 259 ? 0.55037 0.37409 0.78122 0.00944  -0.01972 0.05396  259 ARG A NH2 
1718 N N   . GLY A 260 ? 0.37431 0.38235 0.53006 0.04516  0.03330  0.02487  260 GLY A N   
1719 C CA  . GLY A 260 ? 0.35901 0.38330 0.49489 0.05204  0.03519  0.01724  260 GLY A CA  
1720 C C   . GLY A 260 ? 0.39650 0.42881 0.51552 0.05908  0.04197  0.02414  260 GLY A C   
1721 O O   . GLY A 260 ? 0.41837 0.45042 0.53791 0.05835  0.04929  0.03669  260 GLY A O   
1722 N N   . MET A 261 ? 0.34841 0.39030 0.45258 0.06584  0.03930  0.01675  261 MET A N   
1723 C CA  . MET A 261 ? 0.37010 0.42406 0.46019 0.07194  0.04251  0.02159  261 MET A CA  
1724 C C   . MET A 261 ? 0.41439 0.48637 0.49565 0.06811  0.04333  0.01751  261 MET A C   
1725 O O   . MET A 261 ? 0.44711 0.52564 0.52689 0.06725  0.03952  0.00945  261 MET A O   
1726 C CB  . MET A 261 ? 0.25086 0.30357 0.33526 0.08341  0.03784  0.01838  261 MET A CB  
1727 C CG  . MET A 261 ? 0.24870 0.32021 0.32247 0.08970  0.03887  0.02261  261 MET A CG  
1728 S SD  . MET A 261 ? 0.40148 0.48182 0.47238 0.10556  0.03435  0.01713  261 MET A SD  
1729 C CE  . MET A 261 ? 0.39676 0.49815 0.46111 0.11125  0.03441  0.02695  261 MET A CE  
1730 N N   . MET A 262 ? 0.44029 0.51806 0.51355 0.06621  0.04776  0.02336  262 MET A N   
1731 C CA  . MET A 262 ? 0.44590 0.53409 0.50863 0.06196  0.04658  0.01938  262 MET A CA  
1732 C C   . MET A 262 ? 0.41596 0.51577 0.46600 0.06517  0.04355  0.02220  262 MET A C   
1733 O O   . MET A 262 ? 0.38067 0.47905 0.42076 0.06846  0.04597  0.02840  262 MET A O   
1734 C CB  . MET A 262 ? 0.37880 0.46234 0.43960 0.05908  0.05217  0.02117  262 MET A CB  
1735 C CG  . MET A 262 ? 0.39175 0.46961 0.46909 0.05544  0.05383  0.01880  262 MET A CG  
1736 S SD  . MET A 262 ? 0.42729 0.50659 0.50567 0.05621  0.06335  0.02353  262 MET A SD  
1737 C CE  . MET A 262 ? 0.42530 0.50225 0.52238 0.05557  0.07071  0.03635  262 MET A CE  
1738 N N   . GLN A 263 ? 0.39899 0.51276 0.44959 0.06425  0.03806  0.01847  263 GLN A N   
1739 C CA  . GLN A 263 ? 0.30825 0.43867 0.35205 0.06520  0.03286  0.02111  263 GLN A CA  
1740 C C   . GLN A 263 ? 0.40596 0.53800 0.44000 0.05518  0.02802  0.01777  263 GLN A C   
1741 O O   . GLN A 263 ? 0.45702 0.59176 0.49462 0.04713  0.02560  0.01382  263 GLN A O   
1742 C CB  . GLN A 263 ? 0.23674 0.38681 0.29008 0.06929  0.03016  0.02053  263 GLN A CB  
1743 C CG  . GLN A 263 ? 0.24083 0.38166 0.30170 0.07920  0.03371  0.01876  263 GLN A CG  
1744 C CD  . GLN A 263 ? 0.25192 0.41361 0.31895 0.08740  0.03273  0.01696  263 GLN A CD  
1745 O OE1 . GLN A 263 ? 0.21235 0.40078 0.28267 0.08426  0.03035  0.01928  263 GLN A OE1 
1746 N NE2 . GLN A 263 ? 0.26946 0.41955 0.33844 0.09829  0.03424  0.01282  263 GLN A NE2 
1747 N N   . SER A 264 ? 0.41231 0.53979 0.43134 0.05633  0.02586  0.01941  264 SER A N   
1748 C CA  . SER A 264 ? 0.26604 0.39145 0.27165 0.04828  0.01757  0.01478  264 SER A CA  
1749 C C   . SER A 264 ? 0.38531 0.49552 0.38921 0.04143  0.01859  0.00860  264 SER A C   
1750 O O   . SER A 264 ? 0.53716 0.64695 0.53930 0.03133  0.01055  0.00521  264 SER A O   
1751 C CB  . SER A 264 ? 0.25472 0.40202 0.26731 0.04128  0.00702  0.01573  264 SER A CB  
1752 O OG  . SER A 264 ? 0.40444 0.56691 0.41755 0.04965  0.00429  0.02126  264 SER A OG  
1753 N N   . GLY A 265 ? 0.33113 0.42906 0.33704 0.04659  0.02781  0.00828  265 GLY A N   
1754 C CA  . GLY A 265 ? 0.26604 0.35114 0.27151 0.04265  0.02814  0.00279  265 GLY A CA  
1755 C C   . GLY A 265 ? 0.39570 0.47257 0.40573 0.04962  0.03816  0.00351  265 GLY A C   
1756 O O   . GLY A 265 ? 0.43183 0.51288 0.45858 0.05157  0.04370  0.00727  265 GLY A O   
1757 N N   . THR A 266 ? 0.31645 0.38196 0.31233 0.05379  0.03992  -0.00019 266 THR A N   
1758 C CA  . THR A 266 ? 0.34443 0.40821 0.34723 0.06119  0.05058  0.00167  266 THR A CA  
1759 C C   . THR A 266 ? 0.39169 0.44235 0.38473 0.06381  0.04808  -0.00622 266 THR A C   
1760 O O   . THR A 266 ? 0.32512 0.36261 0.29686 0.06270  0.03947  -0.01277 266 THR A O   
1761 C CB  . THR A 266 ? 0.36453 0.43249 0.35773 0.07027  0.06040  0.00860  266 THR A CB  
1762 O OG1 . THR A 266 ? 0.48722 0.54740 0.45078 0.07454  0.05518  0.00379  266 THR A OG1 
1763 C CG2 . THR A 266 ? 0.27043 0.34722 0.27428 0.06894  0.06274  0.01800  266 THR A CG2 
1764 N N   . MET A 267 ? 0.45948 0.51279 0.46884 0.06761  0.05426  -0.00558 267 MET A N   
1765 C CA  . MET A 267 ? 0.48014 0.52147 0.48394 0.07224  0.05137  -0.01258 267 MET A CA  
1766 C C   . MET A 267 ? 0.55968 0.58949 0.53736 0.08451  0.05411  -0.01801 267 MET A C   
1767 O O   . MET A 267 ? 0.66168 0.67465 0.62779 0.08966  0.04881  -0.02576 267 MET A O   
1768 C CB  . MET A 267 ? 0.48542 0.53805 0.51577 0.07553  0.05750  -0.00954 267 MET A CB  
1769 C CG  . MET A 267 ? 0.61573 0.67224 0.66543 0.06602  0.05089  -0.00867 267 MET A CG  
1770 S SD  . MET A 267 ? 0.64756 0.68681 0.68708 0.06339  0.03853  -0.01556 267 MET A SD  
1771 C CE  . MET A 267 ? 0.64257 0.67447 0.67572 0.07867  0.04264  -0.01983 267 MET A CE  
1772 N N   . ASN A 268 ? 0.43451 0.47095 0.39997 0.09129  0.06207  -0.01430 268 ASN A N   
1773 C CA  . ASN A 268 ? 0.45612 0.48026 0.39028 0.10552  0.06421  -0.02112 268 ASN A CA  
1774 C C   . ASN A 268 ? 0.40643 0.40790 0.31028 0.10076  0.04803  -0.03075 268 ASN A C   
1775 O O   . ASN A 268 ? 0.48231 0.46445 0.35604 0.11213  0.04464  -0.04064 268 ASN A O   
1776 C CB  . ASN A 268 ? 0.35475 0.39548 0.28339 0.11647  0.08004  -0.01222 268 ASN A CB  
1777 C CG  . ASN A 268 ? 0.52616 0.57371 0.45232 0.10860  0.07802  -0.00450 268 ASN A CG  
1778 O OD1 . ASN A 268 ? 0.63357 0.68571 0.57962 0.09523  0.07152  -0.00095 268 ASN A OD1 
1779 N ND2 . ASN A 268 ? 0.42722 0.47581 0.32716 0.11903  0.08368  -0.00175 268 ASN A ND2 
1780 N N   . ALA A 269 ? 0.35211 0.35624 0.26383 0.08489  0.03755  -0.02828 269 ALA A N   
1781 C CA  . ALA A 269 ? 0.48616 0.47317 0.37706 0.07623  0.02021  -0.03564 269 ALA A CA  
1782 C C   . ALA A 269 ? 0.55984 0.51831 0.43890 0.07480  0.00931  -0.04564 269 ALA A C   
1783 O O   . ALA A 269 ? 0.55100 0.50816 0.44643 0.07474  0.01263  -0.04430 269 ALA A O   
1784 C CB  . ALA A 269 ? 0.34675 0.34953 0.25754 0.05953  0.01333  -0.02880 269 ALA A CB  
1785 N N   . PRO A 270 ? 0.58508 0.51784 0.43493 0.07333  -0.00583 -0.05575 270 PRO A N   
1786 C CA  . PRO A 270 ? 0.53760 0.43528 0.37228 0.07347  -0.01747 -0.06561 270 PRO A CA  
1787 C C   . PRO A 270 ? 0.56849 0.46315 0.42511 0.05574  -0.02480 -0.05976 270 PRO A C   
1788 O O   . PRO A 270 ? 0.72653 0.60064 0.58123 0.05984  -0.02678 -0.06273 270 PRO A O   
1789 C CB  . PRO A 270 ? 0.51793 0.38906 0.31894 0.07081  -0.03576 -0.07678 270 PRO A CB  
1790 C CG  . PRO A 270 ? 0.53664 0.42912 0.32722 0.07982  -0.02832 -0.07485 270 PRO A CG  
1791 C CD  . PRO A 270 ? 0.58251 0.51391 0.40961 0.07297  -0.01451 -0.05929 270 PRO A CD  
1792 N N   . TRP A 271 ? 0.55327 0.46849 0.42920 0.03767  -0.02871 -0.05086 271 TRP A N   
1793 C CA  . TRP A 271 ? 0.54148 0.45655 0.43518 0.02091  -0.03465 -0.04369 271 TRP A CA  
1794 C C   . TRP A 271 ? 0.58555 0.51823 0.50217 0.02569  -0.02134 -0.03672 271 TRP A C   
1795 O O   . TRP A 271 ? 0.56403 0.49557 0.49143 0.01515  -0.02483 -0.03067 271 TRP A O   
1796 C CB  . TRP A 271 ? 0.58117 0.51870 0.48903 0.00230  -0.04142 -0.03583 271 TRP A CB  
1797 C CG  . TRP A 271 ? 0.64020 0.61280 0.56176 0.00787  -0.03020 -0.03063 271 TRP A CG  
1798 C CD1 . TRP A 271 ? 0.60836 0.58860 0.51859 0.01312  -0.03194 -0.03327 271 TRP A CD1 
1799 C CD2 . TRP A 271 ? 0.60673 0.60733 0.55304 0.00956  -0.01727 -0.02204 271 TRP A CD2 
1800 N NE1 . TRP A 271 ? 0.54926 0.55975 0.47700 0.01782  -0.02029 -0.02541 271 TRP A NE1 
1801 C CE2 . TRP A 271 ? 0.52897 0.55100 0.47895 0.01557  -0.01165 -0.01932 271 TRP A CE2 
1802 C CE3 . TRP A 271 ? 0.55342 0.56049 0.51637 0.00759  -0.01122 -0.01696 271 TRP A CE3 
1803 C CZ2 . TRP A 271 ? 0.50268 0.54874 0.47300 0.01931  -0.00072 -0.01231 271 TRP A CZ2 
1804 C CZ3 . TRP A 271 ? 0.53394 0.56630 0.51570 0.01153  -0.00085 -0.01145 271 TRP A CZ3 
1805 C CH2 . TRP A 271 ? 0.50774 0.55776 0.49345 0.01711  0.00407  -0.00943 271 TRP A CH2 
1806 N N   . SER A 272 ? 0.53432 0.48307 0.45808 0.04060  -0.00710 -0.03675 272 SER A N   
1807 C CA  . SER A 272 ? 0.39137 0.36137 0.34023 0.04308  0.00365  -0.03020 272 SER A CA  
1808 C C   . SER A 272 ? 0.48709 0.44820 0.43845 0.05627  0.00846  -0.03335 272 SER A C   
1809 O O   . SER A 272 ? 0.51701 0.49571 0.49001 0.05909  0.01580  -0.02899 272 SER A O   
1810 C CB  . SER A 272 ? 0.40478 0.40100 0.36587 0.04747  0.01485  -0.02557 272 SER A CB  
1811 O OG  . SER A 272 ? 0.50204 0.51643 0.48713 0.04467  0.02036  -0.01957 272 SER A OG  
1812 N N   . HIS A 273 ? 0.58424 0.51869 0.51434 0.06562  0.00353  -0.04142 273 HIS A N   
1813 C CA  . HIS A 273 ? 0.57106 0.49947 0.50505 0.08055  0.00762  -0.04417 273 HIS A CA  
1814 C C   . HIS A 273 ? 0.57637 0.46499 0.48301 0.08608  -0.00435 -0.05297 273 HIS A C   
1815 O O   . HIS A 273 ? 0.52608 0.39238 0.40913 0.08064  -0.01427 -0.05868 273 HIS A O   
1816 C CB  . HIS A 273 ? 0.49348 0.44347 0.43593 0.09748  0.02334  -0.04423 273 HIS A CB  
1817 C CG  . HIS A 273 ? 0.57842 0.51819 0.49357 0.10895  0.02616  -0.05120 273 HIS A CG  
1818 N ND1 . HIS A 273 ? 0.62108 0.56650 0.52561 0.10213  0.02591  -0.04998 273 HIS A ND1 
1819 C CD2 . HIS A 273 ? 0.68674 0.61070 0.58003 0.12900  0.02877  -0.06014 273 HIS A CD2 
1820 C CE1 . HIS A 273 ? 0.62825 0.56085 0.50359 0.11661  0.02753  -0.05796 273 HIS A CE1 
1821 N NE2 . HIS A 273 ? 0.63474 0.55383 0.50189 0.13365  0.02992  -0.06471 273 HIS A NE2 
1822 N N   . MET A 274 ? 0.58866 0.46684 0.49885 0.09669  -0.00541 -0.05410 274 MET A N   
1823 C CA  . MET A 274 ? 0.61874 0.45382 0.50343 0.10280  -0.01832 -0.06158 274 MET A CA  
1824 C C   . MET A 274 ? 0.77038 0.60519 0.66109 0.12540  -0.01327 -0.06433 274 MET A C   
1825 O O   . MET A 274 ? 0.80126 0.66403 0.71997 0.12655  -0.00682 -0.05706 274 MET A O   
1826 C CB  . MET A 274 ? 0.57841 0.39332 0.46118 0.08158  -0.03265 -0.05474 274 MET A CB  
1827 C CG  . MET A 274 ? 0.68162 0.44729 0.54012 0.08551  -0.04764 -0.05958 274 MET A CG  
1828 S SD  . MET A 274 ? 0.77461 0.52257 0.63477 0.05742  -0.06170 -0.04596 274 MET A SD  
1829 C CE  . MET A 274 ? 0.75134 0.50673 0.60912 0.03332  -0.06711 -0.04473 274 MET A CE  
1830 N N   . THR A 275 ? 0.80078 0.60443 0.66503 0.14447  -0.01725 -0.07560 275 THR A N   
1831 C CA  . THR A 275 ? 0.77951 0.58304 0.64868 0.16947  -0.01297 -0.07880 275 THR A CA  
1832 C C   . THR A 275 ? 0.65680 0.44640 0.53531 0.16422  -0.02401 -0.07209 275 THR A C   
1833 O O   . THR A 275 ? 0.61185 0.37403 0.47931 0.14496  -0.03766 -0.06785 275 THR A O   
1834 C CB  . THR A 275 ? 0.82561 0.59044 0.65820 0.19243  -0.01760 -0.09372 275 THR A CB  
1835 O OG1 . THR A 275 ? 0.93591 0.64801 0.73926 0.17833  -0.03826 -0.09835 275 THR A OG1 
1836 C CG2 . THR A 275 ? 0.59155 0.37361 0.41168 0.20394  -0.00445 -0.10039 275 THR A CG2 
1837 N N   . SER A 276 ? 0.61367 0.42442 0.51325 0.18187  -0.01807 -0.06992 276 SER A N   
1838 C CA  . SER A 276 ? 0.65285 0.44308 0.55301 0.18580  -0.03021 -0.06600 276 SER A CA  
1839 C C   . SER A 276 ? 0.72915 0.45716 0.59097 0.18770  -0.04689 -0.07219 276 SER A C   
1840 O O   . SER A 276 ? 0.74678 0.44834 0.60074 0.17069  -0.06013 -0.06436 276 SER A O   
1841 C CB  . SER A 276 ? 0.61253 0.42907 0.53471 0.21250  -0.02300 -0.06689 276 SER A CB  
1842 O OG  . SER A 276 ? 0.63932 0.44595 0.56796 0.21476  -0.03473 -0.06073 276 SER A OG  
1843 N N   . GLU A 277 ? 0.79094 0.49347 0.62692 0.20831  -0.04665 -0.08594 277 GLU A N   
1844 C CA  . GLU A 277 ? 0.80547 0.44228 0.60353 0.21423  -0.06472 -0.09406 277 GLU A CA  
1845 C C   . GLU A 277 ? 0.71980 0.32367 0.50064 0.18214  -0.07916 -0.09047 277 GLU A C   
1846 O O   . GLU A 277 ? 0.76801 0.32430 0.53164 0.17348  -0.09643 -0.08688 277 GLU A O   
1847 C CB  . GLU A 277 ? 1.00791 0.62744 0.77953 0.24291  -0.06093 -0.11123 277 GLU A CB  
1848 C CG  . GLU A 277 ? 1.14422 0.79926 0.93546 0.26931  -0.04842 -0.11053 277 GLU A CG  
1849 C CD  . GLU A 277 ? 1.19298 0.91500 1.01799 0.27697  -0.02523 -0.10657 277 GLU A CD  
1850 O OE1 . GLU A 277 ? 1.24057 0.99319 1.07895 0.29732  -0.01335 -0.10710 277 GLU A OE1 
1851 O OE2 . GLU A 277 ? 1.14805 0.89303 0.98769 0.26155  -0.01894 -0.10167 277 GLU A OE2 
1852 N N   . LYS A 278 ? 0.77037 0.39935 0.55700 0.16392  -0.07292 -0.08987 278 LYS A N   
1853 C CA  . LYS A 278 ? 0.86028 0.46546 0.63651 0.13280  -0.08677 -0.08500 278 LYS A CA  
1854 C C   . LYS A 278 ? 0.78495 0.40185 0.58211 0.11017  -0.08973 -0.06649 278 LYS A C   
1855 O O   . LYS A 278 ? 0.87531 0.45393 0.65974 0.09285  -0.10524 -0.05957 278 LYS A O   
1856 C CB  . LYS A 278 ? 0.85358 0.48749 0.63316 0.12063  -0.07974 -0.08790 278 LYS A CB  
1857 C CG  . LYS A 278 ? 0.91798 0.51359 0.67383 0.09970  -0.09824 -0.09227 278 LYS A CG  
1858 C CD  . LYS A 278 ? 1.10499 0.66808 0.82455 0.12000  -0.10389 -0.11272 278 LYS A CD  
1859 C CE  . LYS A 278 ? 1.16930 0.77958 0.89551 0.13842  -0.08275 -0.11780 278 LYS A CE  
1860 N NZ  . LYS A 278 ? 1.19272 0.77833 0.88025 0.16050  -0.08522 -0.13717 278 LYS A NZ  
1861 N N   . ALA A 279 ? 0.61737 0.28591 0.44543 0.11043  -0.07528 -0.05795 279 ALA A N   
1862 C CA  . ALA A 279 ? 0.75537 0.43717 0.59943 0.09327  -0.07706 -0.04174 279 ALA A CA  
1863 C C   . ALA A 279 ? 0.84071 0.48131 0.67021 0.09988  -0.09003 -0.03652 279 ALA A C   
1864 O O   . ALA A 279 ? 0.74692 0.36971 0.57122 0.07985  -0.09899 -0.02317 279 ALA A O   
1865 C CB  . ALA A 279 ? 0.54271 0.27996 0.41820 0.09831  -0.06201 -0.03742 279 ALA A CB  
1866 N N   . VAL A 280 ? 0.65488 0.28006 0.47720 0.12862  -0.09096 -0.04561 280 VAL A N   
1867 C CA  . VAL A 280 ? 0.80055 0.38374 0.60750 0.13760  -0.10447 -0.04042 280 VAL A CA  
1868 C C   . VAL A 280 ? 0.84009 0.36157 0.61679 0.12154  -0.12203 -0.03908 280 VAL A C   
1869 O O   . VAL A 280 ? 0.87019 0.36570 0.63982 0.10639  -0.13262 -0.02415 280 VAL A O   
1870 C CB  . VAL A 280 ? 0.83243 0.41160 0.63778 0.17462  -0.10243 -0.05164 280 VAL A CB  
1871 C CG1 . VAL A 280 ? 0.77483 0.29886 0.55764 0.18643  -0.11950 -0.04768 280 VAL A CG1 
1872 C CG2 . VAL A 280 ? 0.74517 0.38636 0.58640 0.18551  -0.08828 -0.04849 280 VAL A CG2 
1873 N N   . GLU A 281 ? 0.87866 0.37641 0.63698 0.12281  -0.12595 -0.05367 281 GLU A N   
1874 C CA  . GLU A 281 ? 1.00324 0.43937 0.73380 0.10539  -0.14588 -0.05383 281 GLU A CA  
1875 C C   . GLU A 281 ? 0.90665 0.35565 0.65018 0.06595  -0.14889 -0.03565 281 GLU A C   
1876 O O   . GLU A 281 ? 0.98450 0.39454 0.71792 0.04786  -0.16293 -0.02214 281 GLU A O   
1877 C CB  . GLU A 281 ? 1.20414 0.61411 0.91042 0.11555  -0.15104 -0.07535 281 GLU A CB  
1878 C CG  . GLU A 281 ? 1.52317 0.93511 1.21900 0.15646  -0.14281 -0.09272 281 GLU A CG  
1879 C CD  . GLU A 281 ? 1.67691 1.09643 1.35706 0.16765  -0.13766 -0.11152 281 GLU A CD  
1880 O OE1 . GLU A 281 ? 1.65607 1.07386 1.33111 0.14747  -0.14185 -0.11452 281 GLU A OE1 
1881 O OE2 . GLU A 281 ? 1.67316 1.10336 1.34619 0.19725  -0.12903 -0.12235 281 GLU A OE2 
1882 N N   . ILE A 282 ? 0.76092 0.26554 0.52768 0.05297  -0.13521 -0.03353 282 ILE A N   
1883 C CA  . ILE A 282 ? 0.84753 0.37404 0.63023 0.01904  -0.13519 -0.01570 282 ILE A CA  
1884 C C   . ILE A 282 ? 0.89140 0.42638 0.68296 0.01342  -0.13272 0.00424  282 ILE A C   
1885 O O   . ILE A 282 ? 0.86160 0.38181 0.65170 -0.01161 -0.14028 0.02196  282 ILE A O   
1886 C CB  . ILE A 282 ? 0.79201 0.37925 0.59820 0.01295  -0.11951 -0.01798 282 ILE A CB  
1887 C CG1 . ILE A 282 ? 0.76111 0.33657 0.55635 0.00552  -0.12690 -0.03086 282 ILE A CG1 
1888 C CG2 . ILE A 282 ? 0.72808 0.35501 0.55703 -0.01040 -0.11214 0.00226  282 ILE A CG2 
1889 C CD1 . ILE A 282 ? 0.70344 0.32665 0.51181 0.01575  -0.11133 -0.04000 282 ILE A CD1 
1890 N N   . GLY A 283 ? 0.86024 0.42096 0.66131 0.03628  -0.12236 0.00252  283 GLY A N   
1891 C CA  . GLY A 283 ? 0.85067 0.41918 0.65603 0.03588  -0.12130 0.01900  283 GLY A CA  
1892 C C   . GLY A 283 ? 0.83835 0.34739 0.61977 0.03273  -0.13790 0.02988  283 GLY A C   
1893 O O   . GLY A 283 ? 0.83882 0.34511 0.61890 0.01279  -0.14027 0.05062  283 GLY A O   
1894 N N   . LYS A 284 ? 0.86592 0.32603 0.62684 0.05314  -0.14914 0.01700  284 LYS A N   
1895 C CA  . LYS A 284 ? 0.98543 0.38439 0.72229 0.05376  -0.16594 0.02765  284 LYS A CA  
1896 C C   . LYS A 284 ? 1.07307 0.42923 0.79720 0.02110  -0.17985 0.03808  284 LYS A C   
1897 O O   . LYS A 284 ? 1.08628 0.40140 0.79643 0.00920  -0.19151 0.05654  284 LYS A O   
1898 C CB  . LYS A 284 ? 0.91313 0.27175 0.63126 0.08954  -0.17409 0.01032  284 LYS A CB  
1899 C CG  . LYS A 284 ? 1.29255 0.62074 0.99471 0.09415  -0.18073 -0.00992 284 LYS A CG  
1900 C CD  . LYS A 284 ? 1.43653 0.74251 1.12423 0.12431  -0.18511 -0.02251 284 LYS A CD  
1901 C CE  . LYS A 284 ? 1.36192 0.70388 1.06484 0.15577  -0.17424 -0.02431 284 LYS A CE  
1902 N NZ  . LYS A 284 ? 1.41849 0.75352 1.11176 0.18727  -0.17333 -0.04285 284 LYS A NZ  
1903 N N   . ALA A 285 ? 1.02200 0.38944 0.75244 0.00496  -0.17927 0.02849  285 ALA A N   
1904 C CA  . ALA A 285 ? 1.07628 0.41479 0.80287 -0.03066 -0.19261 0.04005  285 ALA A CA  
1905 C C   . ALA A 285 ? 0.96324 0.34103 0.71002 -0.05893 -0.18358 0.06816  285 ALA A C   
1906 O O   . ALA A 285 ? 0.95350 0.29813 0.69368 -0.08279 -0.19444 0.08910  285 ALA A O   
1907 C CB  . ALA A 285 ? 0.92626 0.27436 0.65632 -0.03918 -0.19483 0.02222  285 ALA A CB  
1908 N N   . LEU A 286 ? 0.87388 0.32158 0.64429 -0.05577 -0.16343 0.06954  286 LEU A N   
1909 C CA  . LEU A 286 ? 0.90084 0.38907 0.68642 -0.07496 -0.15239 0.09445  286 LEU A CA  
1910 C C   . LEU A 286 ? 0.97417 0.43353 0.74302 -0.06964 -0.15684 0.11315  286 LEU A C   
1911 O O   . LEU A 286 ? 0.93877 0.39458 0.70690 -0.09351 -0.15773 0.13899  286 LEU A O   
1912 C CB  . LEU A 286 ? 0.77105 0.33018 0.57861 -0.06371 -0.13188 0.08804  286 LEU A CB  
1913 C CG  . LEU A 286 ? 0.76885 0.37266 0.58694 -0.07284 -0.11848 0.10893  286 LEU A CG  
1914 C CD1 . LEU A 286 ? 0.82151 0.43926 0.65032 -0.10685 -0.11734 0.12979  286 LEU A CD1 
1915 C CD2 . LEU A 286 ? 0.66803 0.33014 0.50391 -0.05715 -0.10203 0.09677  286 LEU A CD2 
1916 N N   . ILE A 287 ? 0.99803 0.43824 0.75372 -0.03790 -0.15961 0.10167  287 ILE A N   
1917 C CA  . ILE A 287 ? 1.04269 0.44753 0.77867 -0.02892 -0.16748 0.11766  287 ILE A CA  
1918 C C   . ILE A 287 ? 1.09256 0.43034 0.80932 -0.05102 -0.18559 0.13347  287 ILE A C   
1919 O O   . ILE A 287 ? 1.14710 0.48273 0.86063 -0.06962 -0.18501 0.15988  287 ILE A O   
1920 C CB  . ILE A 287 ? 1.04989 0.44002 0.77672 0.01027  -0.17113 0.09943  287 ILE A CB  
1921 C CG1 . ILE A 287 ? 0.93651 0.39339 0.68703 0.02790  -0.15435 0.08433  287 ILE A CG1 
1922 C CG2 . ILE A 287 ? 0.95422 0.31335 0.66164 0.02184  -0.17963 0.11645  287 ILE A CG2 
1923 C CD1 . ILE A 287 ? 0.84139 0.33650 0.59750 0.03378  -0.14645 0.09698  287 ILE A CD1 
1924 N N   . ASN A 288 ? 1.09714 0.39657 0.80662 -0.04810 -0.19775 0.11413  288 ASN A N   
1925 C CA  . ASN A 288 ? 1.11484 0.37350 0.81620 -0.06804 -0.21105 0.12248  288 ASN A CA  
1926 C C   . ASN A 288 ? 1.11619 0.39711 0.83543 -0.10964 -0.20836 0.14470  288 ASN A C   
1927 O O   . ASN A 288 ? 1.12553 0.39177 0.84373 -0.12924 -0.21219 0.16643  288 ASN A O   
1928 C CB  . ASN A 288 ? 1.16800 0.38846 0.85753 -0.05720 -0.22450 0.09541  288 ASN A CB  
1929 C CG  . ASN A 288 ? 1.19891 0.38947 0.86899 -0.01935 -0.22928 0.07962  288 ASN A CG  
1930 O OD1 . ASN A 288 ? 1.21061 0.38366 0.87154 -0.01142 -0.23175 0.09303  288 ASN A OD1 
1931 N ND2 . ASN A 288 ? 1.24439 0.43215 0.90832 0.00511  -0.22982 0.05152  288 ASN A ND2 
1932 N N   . ASP A 289 ? 1.13749 0.45807 0.87539 -0.12294 -0.20064 0.14065  289 ASP A N   
1933 C CA  . ASP A 289 ? 1.23112 0.58416 0.99193 -0.16120 -0.19668 0.16060  289 ASP A CA  
1934 C C   . ASP A 289 ? 1.31241 0.70111 1.08056 -0.17322 -0.18191 0.19245  289 ASP A C   
1935 O O   . ASP A 289 ? 1.30165 0.71503 1.08808 -0.20354 -0.17793 0.21333  289 ASP A O   
1936 C CB  . ASP A 289 ? 1.20290 0.59507 0.98248 -0.16889 -0.19089 0.14829  289 ASP A CB  
1937 C CG  . ASP A 289 ? 1.32053 0.68251 1.09422 -0.16605 -0.20639 0.12079  289 ASP A CG  
1938 O OD1 . ASP A 289 ? 1.32162 0.63521 1.07942 -0.16435 -0.22212 0.11449  289 ASP A OD1 
1939 O OD2 . ASP A 289 ? 1.37927 0.77255 1.16377 -0.16225 -0.20118 0.10409  289 ASP A OD2 
1940 N N   . CYS A 290 ? 1.30193 0.69748 1.05626 -0.14862 -0.17353 0.19632  290 CYS A N   
1941 C CA  . CYS A 290 ? 1.21785 0.64273 0.97068 -0.15440 -0.16054 0.22497  290 CYS A CA  
1942 C C   . CYS A 290 ? 1.25553 0.63874 0.98635 -0.14341 -0.16779 0.23583  290 CYS A C   
1943 O O   . CYS A 290 ? 1.22049 0.62277 0.94210 -0.13826 -0.15799 0.25575  290 CYS A O   
1944 C CB  . CYS A 290 ? 1.10690 0.59037 0.86509 -0.13161 -0.14258 0.21722  290 CYS A CB  
1945 S SG  . CYS A 290 ? 1.00325 0.55621 0.79439 -0.13477 -0.12761 0.19651  290 CYS A SG  
1946 N N   . ASN A 291 ? 1.27972 0.60707 0.99996 -0.13831 -0.18486 0.22279  291 ASN A N   
1947 C CA  . ASN A 291 ? 1.38737 0.67056 1.08767 -0.12992 -0.19345 0.23347  291 ASN A CA  
1948 C C   . ASN A 291 ? 1.37167 0.65882 1.05446 -0.09658 -0.18928 0.23351  291 ASN A C   
1949 O O   . ASN A 291 ? 1.36198 0.64777 1.03304 -0.09558 -0.18569 0.25597  291 ASN A O   
1950 C CB  . ASN A 291 ? 1.50367 0.79101 1.21014 -0.16127 -0.18940 0.26560  291 ASN A CB  
1951 C CG  . ASN A 291 ? 1.63329 0.92896 1.36329 -0.19575 -0.19306 0.26741  291 ASN A CG  
1952 O OD1 . ASN A 291 ? 1.71570 0.98515 1.44777 -0.19636 -0.20707 0.24429  291 ASN A OD1 
1953 N ND2 . ASN A 291 ? 1.65730 0.99274 1.40518 -0.22322 -0.18035 0.29468  291 ASN A ND2 
1954 N N   . CYS A 292 ? 1.32187 0.61730 1.00405 -0.06885 -0.18965 0.20845  292 CYS A N   
1955 C CA  . CYS A 292 ? 1.26532 0.55407 0.93367 -0.03202 -0.19230 0.19923  292 CYS A CA  
1956 C C   . CYS A 292 ? 1.33777 0.58961 1.00185 -0.01004 -0.20421 0.17038  292 CYS A C   
1957 O O   . CYS A 292 ? 1.42724 0.68570 1.10109 -0.00945 -0.20380 0.14957  292 CYS A O   
1958 C CB  . CYS A 292 ? 1.13856 0.47778 0.81347 -0.01665 -0.18109 0.19509  292 CYS A CB  
1959 S SG  . CYS A 292 ? 1.13452 0.52735 0.81567 -0.04516 -0.16416 0.22374  292 CYS A SG  
1960 N N   . ASN A 293 ? 1.36101 0.57454 1.00923 0.00784  -0.21432 0.16972  293 ASN A N   
1961 C CA  . ASN A 293 ? 1.36852 0.54547 1.00962 0.02778  -0.22527 0.14404  293 ASN A CA  
1962 C C   . ASN A 293 ? 1.26954 0.47728 0.92088 0.05731  -0.21897 0.11740  293 ASN A C   
1963 O O   . ASN A 293 ? 1.23242 0.45681 0.88473 0.08663  -0.21681 0.11262  293 ASN A O   
1964 C CB  . ASN A 293 ? 1.50081 0.63627 1.12323 0.04550  -0.23602 0.14949  293 ASN A CB  
1965 C CG  . ASN A 293 ? 1.61094 0.70667 1.22268 0.01664  -0.24393 0.17384  293 ASN A CG  
1966 O OD1 . ASN A 293 ? 1.68846 0.78428 1.30850 -0.01669 -0.24337 0.18267  293 ASN A OD1 
1967 N ND2 . ASN A 293 ? 1.58522 0.64809 1.18034 0.02974  -0.25166 0.18502  293 ASN A ND2 
1968 N N   . ALA A 294 ? 1.19277 0.41159 0.85368 0.04977  -0.21582 0.10059  294 ALA A N   
1969 C CA  . ALA A 294 ? 1.10638 0.35689 0.77846 0.07688  -0.20779 0.07670  294 ALA A CA  
1970 C C   . ALA A 294 ? 1.21280 0.44413 0.87609 0.11142  -0.21285 0.05677  294 ALA A C   
1971 O O   . ALA A 294 ? 1.13348 0.39866 0.80904 0.13908  -0.20452 0.04194  294 ALA A O   
1972 C CB  . ALA A 294 ? 1.07112 0.33345 0.75201 0.06144  -0.20385 0.06362  294 ALA A CB  
1973 N N   . SER A 295 ? 1.31789 0.49803 0.96162 0.11042  -0.22598 0.05689  295 SER A N   
1974 C CA  . SER A 295 ? 1.38810 0.55017 1.02164 0.14473  -0.23078 0.04157  295 SER A CA  
1975 C C   . SER A 295 ? 1.36259 0.55080 1.00430 0.16829  -0.22681 0.04983  295 SER A C   
1976 O O   . SER A 295 ? 1.39723 0.59665 1.04239 0.20084  -0.22509 0.03529  295 SER A O   
1977 C CB  . SER A 295 ? 1.48320 0.58098 1.09216 0.13750  -0.24748 0.04374  295 SER A CB  
1978 O OG  . SER A 295 ? 1.50372 0.58032 1.10654 0.11961  -0.25357 0.07059  295 SER A OG  
1979 N N   . MET A 296 ? 1.25349 0.45508 0.89869 0.15279  -0.22528 0.07335  296 MET A N   
1980 C CA  . MET A 296 ? 1.21697 0.44237 0.86744 0.17440  -0.22425 0.08152  296 MET A CA  
1981 C C   . MET A 296 ? 1.19090 0.47903 0.86672 0.18851  -0.21235 0.07299  296 MET A C   
1982 O O   . MET A 296 ? 1.22653 0.54166 0.91083 0.20768  -0.21249 0.07681  296 MET A O   
1983 C CB  . MET A 296 ? 1.26019 0.47150 0.89858 0.15432  -0.22848 0.11108  296 MET A CB  
1984 C CG  . MET A 296 ? 1.46133 0.61956 1.07819 0.15951  -0.24146 0.12043  296 MET A CG  
1985 S SD  . MET A 296 ? 1.60560 0.74441 1.20665 0.13283  -0.24454 0.15803  296 MET A SD  
1986 C CE  . MET A 296 ? 1.51707 0.71986 1.12942 0.14336  -0.23472 0.16788  296 MET A CE  
1987 N N   . LEU A 297 ? 1.20067 0.51231 0.88947 0.17994  -0.20322 0.06102  297 LEU A N   
1988 C CA  . LEU A 297 ? 1.15842 0.52884 0.87278 0.19000  -0.19199 0.05428  297 LEU A CA  
1989 C C   . LEU A 297 ? 1.22855 0.63016 0.96048 0.22469  -0.18956 0.04077  297 LEU A C   
1990 O O   . LEU A 297 ? 1.08811 0.53549 0.84019 0.23436  -0.18601 0.04315  297 LEU A O   
1991 C CB  . LEU A 297 ? 1.06927 0.45332 0.79305 0.17859  -0.18296 0.04111  297 LEU A CB  
1992 C CG  . LEU A 297 ? 1.10000 0.51247 0.83316 0.15676  -0.17635 0.05201  297 LEU A CG  
1993 C CD1 . LEU A 297 ? 1.03441 0.47654 0.78455 0.15119  -0.16421 0.03512  297 LEU A CD1 
1994 C CD2 . LEU A 297 ? 1.20024 0.66014 0.94953 0.16829  -0.17273 0.05877  297 LEU A CD2 
1995 N N   . LYS A 298 ? 1.42619 0.80612 1.15177 0.24326  -0.19177 0.02657  298 LYS A N   
1996 C CA  . LYS A 298 ? 1.44767 0.86527 1.19471 0.27510  -0.18607 0.01302  298 LYS A CA  
1997 C C   . LYS A 298 ? 1.37445 0.79737 1.12399 0.29141  -0.19460 0.02361  298 LYS A C   
1998 O O   . LYS A 298 ? 1.29109 0.76435 1.06835 0.30923  -0.19026 0.02009  298 LYS A O   
1999 C CB  . LYS A 298 ? 1.46896 0.86369 1.20556 0.29102  -0.18446 -0.00534 298 LYS A CB  
2000 C CG  . LYS A 298 ? 1.40771 0.84929 1.16725 0.30311  -0.16836 -0.02274 298 LYS A CG  
2001 C CD  . LYS A 298 ? 1.47686 0.98380 1.27410 0.32016  -0.15986 -0.02182 298 LYS A CD  
2002 C CE  . LYS A 298 ? 1.54952 1.10959 1.37465 0.32408  -0.14215 -0.03354 298 LYS A CE  
2003 N NZ  . LYS A 298 ? 1.48032 1.10600 1.34703 0.33696  -0.13510 -0.03120 298 LYS A NZ  
2004 N N   . THR A 299 ? 1.40515 0.77841 1.12757 0.28432  -0.20719 0.03759  299 THR A N   
2005 C CA  . THR A 299 ? 1.36218 0.73281 1.08206 0.30208  -0.21667 0.04724  299 THR A CA  
2006 C C   . THR A 299 ? 1.31950 0.70487 1.03760 0.28921  -0.22105 0.06779  299 THR A C   
2007 O O   . THR A 299 ? 1.27886 0.69139 1.00792 0.30633  -0.22568 0.07187  299 THR A O   
2008 C CB  . THR A 299 ? 1.35395 0.65972 1.04374 0.30634  -0.22842 0.05042  299 THR A CB  
2009 O OG1 . THR A 299 ? 1.37132 0.63297 1.03673 0.27571  -0.23436 0.06749  299 THR A OG1 
2010 C CG2 . THR A 299 ? 1.32334 0.61185 1.00920 0.31961  -0.22520 0.02891  299 THR A CG2 
2011 N N   . ASN A 300 ? 1.30036 0.66978 1.00401 0.25978  -0.22005 0.08145  300 ASN A N   
2012 C CA  . ASN A 300 ? 1.31081 0.69827 1.00960 0.24754  -0.22198 0.10110  300 ASN A CA  
2013 C C   . ASN A 300 ? 1.10080 0.51451 0.80788 0.22527  -0.21199 0.10148  300 ASN A C   
2014 O O   . ASN A 300 ? 1.05606 0.44738 0.74585 0.19823  -0.21053 0.11670  300 ASN A O   
2015 C CB  . ASN A 300 ? 1.54056 0.87954 1.20824 0.23473  -0.23092 0.12433  300 ASN A CB  
2016 C CG  . ASN A 300 ? 1.70140 1.06296 1.36100 0.23148  -0.23356 0.14439  300 ASN A CG  
2017 O OD1 . ASN A 300 ? 1.78078 1.11129 1.41650 0.22436  -0.23958 0.16529  300 ASN A OD1 
2018 N ND2 . ASN A 300 ? 1.66424 1.08013 1.34271 0.23660  -0.22918 0.13804  300 ASN A ND2 
2019 N N   . PRO A 301 ? 0.97627 0.44040 0.71183 0.23561  -0.20462 0.08614  301 PRO A N   
2020 C CA  . PRO A 301 ? 0.91505 0.40615 0.65879 0.21695  -0.19596 0.08667  301 PRO A CA  
2021 C C   . PRO A 301 ? 1.03927 0.53683 0.76615 0.20054  -0.19809 0.10776  301 PRO A C   
2022 O O   . PRO A 301 ? 1.11472 0.60240 0.82960 0.17558  -0.19279 0.11842  301 PRO A O   
2023 C CB  . PRO A 301 ? 0.87688 0.42492 0.65683 0.23575  -0.19022 0.06854  301 PRO A CB  
2024 C CG  . PRO A 301 ? 0.93095 0.47871 0.72250 0.26111  -0.19242 0.05677  301 PRO A CG  
2025 C CD  . PRO A 301 ? 0.99604 0.49819 0.75966 0.26408  -0.20389 0.06996  301 PRO A CD  
2026 N N   . ALA A 302 ? 1.07675 0.59442 0.80235 0.21420  -0.20528 0.11401  302 ALA A N   
2027 C CA  . ALA A 302 ? 1.04221 0.57408 0.74985 0.20214  -0.20612 0.13163  302 ALA A CA  
2028 C C   . ALA A 302 ? 1.13758 0.62966 0.81491 0.17599  -0.20299 0.15456  302 ALA A C   
2029 O O   . ALA A 302 ? 1.21895 0.72486 0.88545 0.15675  -0.19575 0.16665  302 ALA A O   
2030 C CB  . ALA A 302 ? 0.97978 0.52831 0.68447 0.22134  -0.21691 0.13557  302 ALA A CB  
2031 N N   . HIS A 303 ? 1.13342 0.57813 0.79881 0.17410  -0.20767 0.16061  303 HIS A N   
2032 C CA  . HIS A 303 ? 1.15303 0.56174 0.79479 0.14747  -0.20546 0.18418  303 HIS A CA  
2033 C C   . HIS A 303 ? 1.13518 0.54075 0.78290 0.12012  -0.19603 0.18366  303 HIS A C   
2034 O O   . HIS A 303 ? 1.14314 0.55447 0.78037 0.09483  -0.18848 0.20364  303 HIS A O   
2035 C CB  . HIS A 303 ? 1.33444 0.69181 0.96459 0.15292  -0.21478 0.18828  303 HIS A CB  
2036 C CG  . HIS A 303 ? 1.62049 0.94492 1.22794 0.12850  -0.21426 0.21641  303 HIS A CG  
2037 N ND1 . HIS A 303 ? 1.69553 0.99139 1.30199 0.10010  -0.21084 0.22280  303 HIS A ND1 
2038 C CD2 . HIS A 303 ? 1.71078 1.02960 1.29765 0.12764  -0.21628 0.24068  303 HIS A CD2 
2039 C CE1 . HIS A 303 ? 1.76725 1.04292 1.35652 0.08197  -0.21000 0.25052  303 HIS A CE1 
2040 N NE2 . HIS A 303 ? 1.75401 1.04233 1.32963 0.09895  -0.21245 0.26237  303 HIS A NE2 
2041 N N   . VAL A 304 ? 1.03533 0.43482 0.70036 0.12503  -0.19562 0.16138  304 VAL A N   
2042 C CA  . VAL A 304 ? 1.00710 0.40091 0.67831 0.09969  -0.18885 0.15899  304 VAL A CA  
2043 C C   . VAL A 304 ? 1.02118 0.47502 0.70833 0.08642  -0.17380 0.15901  304 VAL A C   
2044 O O   . VAL A 304 ? 1.00303 0.46772 0.69244 0.05754  -0.16430 0.17005  304 VAL A O   
2045 C CB  . VAL A 304 ? 0.98172 0.36212 0.66678 0.11253  -0.19069 0.13199  304 VAL A CB  
2046 C CG1 . VAL A 304 ? 0.94878 0.33995 0.64564 0.09085  -0.18247 0.12443  304 VAL A CG1 
2047 C CG2 . VAL A 304 ? 1.08222 0.41085 0.75381 0.11622  -0.20074 0.13014  304 VAL A CG2 
2048 N N   . MET A 305 ? 0.99958 0.50109 0.70349 0.10625  -0.16983 0.14482  305 MET A N   
2049 C CA  . MET A 305 ? 0.90311 0.46470 0.62438 0.09494  -0.15477 0.14098  305 MET A CA  
2050 C C   . MET A 305 ? 0.92348 0.49378 0.62330 0.08048  -0.15069 0.16561  305 MET A C   
2051 O O   . MET A 305 ? 0.92559 0.52412 0.63112 0.05897  -0.13703 0.17160  305 MET A O   
2052 C CB  . MET A 305 ? 0.88088 0.48541 0.62419 0.11856  -0.15478 0.12128  305 MET A CB  
2053 C CG  . MET A 305 ? 0.91598 0.52340 0.68425 0.13093  -0.15350 0.09828  305 MET A CG  
2054 S SD  . MET A 305 ? 0.88265 0.50528 0.66775 0.10630  -0.13797 0.08877  305 MET A SD  
2055 C CE  . MET A 305 ? 0.79728 0.48379 0.59927 0.09629  -0.12459 0.08723  305 MET A CE  
2056 N N   . SER A 306 ? 1.02597 0.57368 0.69995 0.09371  -0.16198 0.18085  306 SER A N   
2057 C CA  . SER A 306 ? 1.10858 0.66120 0.75607 0.08178  -0.15761 0.20721  306 SER A CA  
2058 C C   . SER A 306 ? 1.09996 0.63369 0.74194 0.04950  -0.14908 0.22789  306 SER A C   
2059 O O   . SER A 306 ? 1.13403 0.70008 0.77256 0.03231  -0.13496 0.24215  306 SER A O   
2060 C CB  . SER A 306 ? 1.17219 0.69076 0.78865 0.10068  -0.17350 0.22302  306 SER A CB  
2061 O OG  . SER A 306 ? 1.28430 0.80043 0.87228 0.08615  -0.16761 0.25250  306 SER A OG  
2062 N N   . CYS A 307 ? 1.03345 0.51603 0.67560 0.04128  -0.15804 0.22918  307 CYS A N   
2063 C CA  . CYS A 307 ? 1.08261 0.54688 0.72561 0.00773  -0.15295 0.24680  307 CYS A CA  
2064 C C   . CYS A 307 ? 1.11141 0.62814 0.78365 -0.00984 -0.13627 0.23510  307 CYS A C   
2065 O O   . CYS A 307 ? 1.13230 0.67177 0.80685 -0.03464 -0.12433 0.25436  307 CYS A O   
2066 C CB  . CYS A 307 ? 1.07159 0.47732 0.71573 0.00523  -0.16634 0.24002  307 CYS A CB  
2067 S SG  . CYS A 307 ? 1.16296 0.55067 0.81823 -0.03729 -0.16276 0.25467  307 CYS A SG  
2068 N N   . MET A 308 ? 1.01331 0.55221 0.70870 0.00381  -0.13468 0.20492  308 MET A N   
2069 C CA  . MET A 308 ? 1.00349 0.58815 0.72581 -0.01027 -0.12052 0.19275  308 MET A CA  
2070 C C   . MET A 308 ? 1.02174 0.66517 0.74719 -0.01082 -0.10490 0.19777  308 MET A C   
2071 O O   . MET A 308 ? 1.05748 0.73562 0.79821 -0.02907 -0.09174 0.20070  308 MET A O   
2072 C CB  . MET A 308 ? 0.96501 0.55688 0.70772 0.00700  -0.12256 0.16147  308 MET A CB  
2073 C CG  . MET A 308 ? 0.97127 0.51009 0.71079 0.00599  -0.13509 0.15345  308 MET A CG  
2074 S SD  . MET A 308 ? 0.90053 0.42374 0.64469 -0.03272 -0.13433 0.16672  308 MET A SD  
2075 C CE  . MET A 308 ? 0.76805 0.35704 0.54402 -0.03736 -0.11771 0.14744  308 MET A CE  
2076 N N   . ARG A 309 ? 1.00513 0.66018 0.71550 0.01027  -0.10721 0.19791  309 ARG A N   
2077 C CA  . ARG A 309 ? 0.96909 0.67265 0.67411 0.01229  -0.09463 0.20261  309 ARG A CA  
2078 C C   . ARG A 309 ? 0.99381 0.69628 0.67463 -0.00351 -0.08731 0.23526  309 ARG A C   
2079 O O   . ARG A 309 ? 0.97207 0.71538 0.64445 -0.00156 -0.07482 0.24094  309 ARG A O   
2080 C CB  . ARG A 309 ? 0.94809 0.66379 0.64492 0.04075  -0.10264 0.18874  309 ARG A CB  
2081 C CG  . ARG A 309 ? 0.92205 0.64531 0.64666 0.05546  -0.10815 0.15942  309 ARG A CG  
2082 C CD  . ARG A 309 ? 0.88781 0.64926 0.61811 0.07350  -0.10890 0.14313  309 ARG A CD  
2083 N NE  . ARG A 309 ? 0.81490 0.59048 0.57760 0.08275  -0.11081 0.11782  309 ARG A NE  
2084 C CZ  . ARG A 309 ? 0.82131 0.58155 0.59353 0.10029  -0.12330 0.10757  309 ARG A CZ  
2085 N NH1 . ARG A 309 ? 0.81229 0.53993 0.56300 0.11159  -0.13649 0.11925  309 ARG A NH1 
2086 N NH2 . ARG A 309 ? 0.83078 0.60954 0.63419 0.10743  -0.12206 0.08706  309 ARG A NH2 
2087 N N   . SER A 310 ? 1.04048 0.69673 0.70906 -0.01855 -0.09460 0.25721  310 SER A N   
2088 C CA  . SER A 310 ? 1.08002 0.73519 0.72930 -0.03795 -0.08636 0.29250  310 SER A CA  
2089 C C   . SER A 310 ? 1.06271 0.73156 0.73515 -0.07091 -0.07556 0.30497  310 SER A C   
2090 O O   . SER A 310 ? 1.00251 0.69085 0.66743 -0.08845 -0.06300 0.33392  310 SER A O   
2091 C CB  . SER A 310 ? 1.18765 0.78130 0.80834 -0.03670 -0.10194 0.31413  310 SER A CB  
2092 O OG  . SER A 310 ? 1.33290 0.90887 0.93962 -0.00515 -0.11636 0.29803  310 SER A OG  
2093 N N   . VAL A 311 ? 1.00236 0.66335 0.70260 -0.07918 -0.08044 0.28471  311 VAL A N   
2094 C CA  . VAL A 311 ? 0.97439 0.64864 0.69939 -0.11042 -0.07383 0.29399  311 VAL A CA  
2095 C C   . VAL A 311 ? 0.99301 0.73893 0.73423 -0.11381 -0.05229 0.29450  311 VAL A C   
2096 O O   . VAL A 311 ? 0.93429 0.71385 0.68011 -0.09218 -0.04633 0.27114  311 VAL A O   
2097 C CB  . VAL A 311 ? 0.96231 0.61108 0.70810 -0.11308 -0.08592 0.26813  311 VAL A CB  
2098 C CG1 . VAL A 311 ? 1.00210 0.66079 0.77233 -0.14618 -0.08337 0.27790  311 VAL A CG1 
2099 C CG2 . VAL A 311 ? 0.97348 0.55169 0.70076 -0.10288 -0.10689 0.26312  311 VAL A CG2 
2100 N N   . ASP A 312 ? 0.99292 0.76270 0.74441 -0.14097 -0.04086 0.32157  312 ASP A N   
2101 C CA  . ASP A 312 ? 0.93642 0.77510 0.70886 -0.14519 -0.02059 0.32134  312 ASP A CA  
2102 C C   . ASP A 312 ? 0.77210 0.62700 0.57347 -0.14105 -0.02297 0.28935  312 ASP A C   
2103 O O   . ASP A 312 ? 0.78487 0.60636 0.60035 -0.15314 -0.03692 0.27960  312 ASP A O   
2104 C CB  . ASP A 312 ? 1.05271 0.91344 0.84122 -0.17831 -0.01020 0.35487  312 ASP A CB  
2105 C CG  . ASP A 312 ? 1.21983 1.08931 0.98603 -0.17374 0.00241  0.37781  312 ASP A CG  
2106 O OD1 . ASP A 312 ? 1.36410 1.18194 1.10768 -0.17213 -0.00898 0.38720  312 ASP A OD1 
2107 O OD2 . ASP A 312 ? 1.27860 1.20503 1.04838 -0.17006 0.02378  0.38574  312 ASP A OD2 
2108 N N   . ALA A 313 ? 0.70341 0.60745 0.51070 -0.12288 -0.00987 0.27303  313 ALA A N   
2109 C CA  . ALA A 313 ? 0.65342 0.57382 0.48585 -0.11686 -0.01109 0.24414  313 ALA A CA  
2110 C C   . ALA A 313 ? 0.81707 0.74884 0.68020 -0.14451 -0.01148 0.25022  313 ALA A C   
2111 O O   . ALA A 313 ? 0.75176 0.66761 0.62979 -0.14568 -0.02169 0.22968  313 ALA A O   
2112 C CB  . ALA A 313 ? 0.61513 0.58650 0.44865 -0.09577 0.00366  0.23031  313 ALA A CB  
2113 N N   . LYS A 314 ? 0.80476 0.76629 0.67794 -0.16671 -0.00068 0.27885  314 LYS A N   
2114 C CA  . LYS A 314 ? 0.81732 0.79244 0.72314 -0.19577 -0.00338 0.28697  314 LYS A CA  
2115 C C   . LYS A 314 ? 0.87015 0.78121 0.77599 -0.21085 -0.02707 0.28051  314 LYS A C   
2116 O O   . LYS A 314 ? 0.83682 0.74779 0.76498 -0.22270 -0.03589 0.26790  314 LYS A O   
2117 C CB  . LYS A 314 ? 0.77719 0.78972 0.69378 -0.21953 0.01054  0.32415  314 LYS A CB  
2118 C CG  . LYS A 314 ? 0.92887 0.96857 0.88680 -0.24663 0.00851  0.32913  314 LYS A CG  
2119 C CD  . LYS A 314 ? 1.00208 1.10823 0.98587 -0.23810 0.02247  0.31808  314 LYS A CD  
2120 C CE  . LYS A 314 ? 1.03862 1.16746 1.06381 -0.26241 0.01534  0.31891  314 LYS A CE  
2121 N NZ  . LYS A 314 ? 0.94708 1.14245 0.99954 -0.25286 0.02827  0.30974  314 LYS A NZ  
2122 N N   . THR A 315 ? 0.87666 0.73100 0.75483 -0.20759 -0.03864 0.28710  315 THR A N   
2123 C CA  . THR A 315 ? 0.91753 0.70512 0.79089 -0.21867 -0.06190 0.28021  315 THR A CA  
2124 C C   . THR A 315 ? 0.87134 0.64027 0.74343 -0.19602 -0.07120 0.24297  315 THR A C   
2125 O O   . THR A 315 ? 0.84715 0.59352 0.73000 -0.20705 -0.08462 0.23013  315 THR A O   
2126 C CB  . THR A 315 ? 0.90612 0.63760 0.74867 -0.21773 -0.07141 0.29785  315 THR A CB  
2127 O OG1 . THR A 315 ? 0.96209 0.71181 0.81167 -0.23981 -0.06250 0.32897  315 THR A OG1 
2128 C CG2 . THR A 315 ? 0.86298 0.51915 0.69514 -0.22115 -0.09651 0.28518  315 THR A CG2 
2129 N N   . ILE A 316 ? 0.83433 0.61271 0.69299 -0.16456 -0.06480 0.22578  316 ILE A N   
2130 C CA  . ILE A 316 ? 0.79156 0.56304 0.65369 -0.14376 -0.06990 0.19320  316 ILE A CA  
2131 C C   . ILE A 316 ? 0.79697 0.61054 0.68662 -0.15248 -0.06366 0.18258  316 ILE A C   
2132 O O   . ILE A 316 ? 0.73289 0.52856 0.62857 -0.15222 -0.07355 0.16377  316 ILE A O   
2133 C CB  . ILE A 316 ? 0.70789 0.49418 0.55819 -0.11221 -0.06265 0.17971  316 ILE A CB  
2134 C CG1 . ILE A 316 ? 0.70450 0.44802 0.52725 -0.10046 -0.07167 0.18829  316 ILE A CG1 
2135 C CG2 . ILE A 316 ? 0.61015 0.40033 0.47034 -0.09349 -0.06443 0.14935  316 ILE A CG2 
2136 C CD1 . ILE A 316 ? 0.71406 0.48088 0.52661 -0.07314 -0.06502 0.17985  316 ILE A CD1 
2137 N N   . SER A 317 ? 0.78447 0.65490 0.68925 -0.15852 -0.04720 0.19477  317 SER A N   
2138 C CA  . SER A 317 ? 0.72950 0.64427 0.66033 -0.16231 -0.04048 0.18475  317 SER A CA  
2139 C C   . SER A 317 ? 0.77024 0.67016 0.71752 -0.18928 -0.05402 0.18802  317 SER A C   
2140 O O   . SER A 317 ? 0.80910 0.72187 0.77066 -0.18811 -0.05728 0.17097  317 SER A O   
2141 C CB  . SER A 317 ? 0.75480 0.73157 0.69668 -0.16204 -0.02038 0.19943  317 SER A CB  
2142 O OG  . SER A 317 ? 0.90586 0.92521 0.87706 -0.17654 -0.01568 0.20227  317 SER A OG  
2143 N N   . VAL A 318 ? 0.73746 0.60602 0.68114 -0.21357 -0.06410 0.20926  318 VAL A N   
2144 C CA  . VAL A 318 ? 0.75331 0.60049 0.71148 -0.24162 -0.08135 0.21199  318 VAL A CA  
2145 C C   . VAL A 318 ? 0.83406 0.61188 0.77055 -0.23355 -0.10259 0.18992  318 VAL A C   
2146 O O   . VAL A 318 ? 0.84028 0.61159 0.78278 -0.23410 -0.11292 0.17036  318 VAL A O   
2147 C CB  . VAL A 318 ? 0.75745 0.60175 0.72495 -0.27501 -0.08393 0.24642  318 VAL A CB  
2148 C CG1 . VAL A 318 ? 0.74963 0.55259 0.72620 -0.30366 -0.10849 0.24611  318 VAL A CG1 
2149 C CG2 . VAL A 318 ? 0.68291 0.60525 0.67917 -0.28587 -0.06310 0.26752  318 VAL A CG2 
2150 N N   . GLN A 319 ? 0.82039 0.54625 0.72953 -0.22376 -0.10932 0.19270  319 GLN A N   
2151 C CA  . GLN A 319 ? 0.86655 0.52199 0.75384 -0.21741 -0.13065 0.17503  319 GLN A CA  
2152 C C   . GLN A 319 ? 0.85856 0.51287 0.73806 -0.18686 -0.12977 0.14217  319 GLN A C   
2153 O O   . GLN A 319 ? 0.93222 0.53681 0.79605 -0.18133 -0.14644 0.12430  319 GLN A O   
2154 C CB  . GLN A 319 ? 0.87581 0.47704 0.73582 -0.21116 -0.13781 0.18692  319 GLN A CB  
2155 C CG  . GLN A 319 ? 0.92498 0.52798 0.79000 -0.23987 -0.13610 0.22303  319 GLN A CG  
2156 C CD  . GLN A 319 ? 0.96530 0.54323 0.84267 -0.27027 -0.15323 0.22870  319 GLN A CD  
2157 O OE1 . GLN A 319 ? 0.98380 0.59144 0.88092 -0.29318 -0.14735 0.25159  319 GLN A OE1 
2158 N NE2 . GLN A 319 ? 0.91817 0.44857 0.78472 -0.26519 -0.17291 0.20377  319 GLN A NE2 
2159 N N   . GLN A 320 ? 0.76097 0.46676 0.64971 -0.16666 -0.11113 0.13403  320 GLN A N   
2160 C CA  . GLN A 320 ? 0.73584 0.44339 0.62080 -0.14103 -0.10956 0.10596  320 GLN A CA  
2161 C C   . GLN A 320 ? 0.81846 0.52672 0.71206 -0.15210 -0.11874 0.09309  320 GLN A C   
2162 O O   . GLN A 320 ? 0.83374 0.52020 0.71509 -0.13486 -0.12449 0.07069  320 GLN A O   
2163 C CB  . GLN A 320 ? 0.60548 0.36780 0.50201 -0.12188 -0.08956 0.10131  320 GLN A CB  
2164 C CG  . GLN A 320 ? 0.57998 0.40130 0.50156 -0.13556 -0.07741 0.11011  320 GLN A CG  
2165 C CD  . GLN A 320 ? 0.57291 0.43932 0.50206 -0.11466 -0.06012 0.10290  320 GLN A CD  
2166 O OE1 . GLN A 320 ? 0.62786 0.48486 0.54884 -0.09174 -0.05852 0.08722  320 GLN A OE1 
2167 N NE2 . GLN A 320 ? 0.51059 0.42620 0.45605 -0.12221 -0.04754 0.11470  320 GLN A NE2 
2168 N N   . TRP A 321 ? 0.83926 0.57343 0.75345 -0.18028 -0.12071 0.10767  321 TRP A N   
2169 C CA  . TRP A 321 ? 0.78403 0.52525 0.70869 -0.19201 -0.13097 0.09666  321 TRP A CA  
2170 C C   . TRP A 321 ? 0.83286 0.50796 0.73816 -0.20288 -0.15677 0.08759  321 TRP A C   
2171 O O   . TRP A 321 ? 0.80762 0.48039 0.71431 -0.20831 -0.16843 0.07376  321 TRP A O   
2172 C CB  . TRP A 321 ? 0.80612 0.60200 0.76337 -0.21836 -0.12548 0.11639  321 TRP A CB  
2173 C CG  . TRP A 321 ? 0.81305 0.67535 0.78819 -0.20351 -0.10263 0.11682  321 TRP A CG  
2174 C CD1 . TRP A 321 ? 0.79394 0.69478 0.77795 -0.20080 -0.08420 0.13385  321 TRP A CD1 
2175 C CD2 . TRP A 321 ? 0.76561 0.65944 0.74849 -0.18792 -0.09673 0.09908  321 TRP A CD2 
2176 N NE1 . TRP A 321 ? 0.76170 0.71327 0.75846 -0.18419 -0.06839 0.12610  321 TRP A NE1 
2177 C CE2 . TRP A 321 ? 0.80236 0.75034 0.79989 -0.17682 -0.07561 0.10596  321 TRP A CE2 
2178 C CE3 . TRP A 321 ? 0.69512 0.57476 0.67116 -0.18130 -0.10754 0.07847  321 TRP A CE3 
2179 C CZ2 . TRP A 321 ? 0.81037 0.79546 0.81777 -0.16054 -0.06588 0.09358  321 TRP A CZ2 
2180 C CZ3 . TRP A 321 ? 0.71177 0.63152 0.69737 -0.16537 -0.09653 0.06796  321 TRP A CZ3 
2181 C CH2 . TRP A 321 ? 0.77188 0.74233 0.77400 -0.15575 -0.07629 0.07589  321 TRP A CH2 
2182 N N   . ASN A 322 ? 0.89925 0.51813 0.78413 -0.20496 -0.16739 0.09424  322 ASN A N   
2183 C CA  . ASN A 322 ? 0.93225 0.48009 0.79347 -0.21050 -0.19337 0.08168  322 ASN A CA  
2184 C C   . ASN A 322 ? 0.99722 0.52691 0.83654 -0.18041 -0.19625 0.04982  322 ASN A C   
2185 O O   . ASN A 322 ? 1.19455 0.69040 1.02052 -0.18590 -0.21566 0.03423  322 ASN A O   
2186 C CB  . ASN A 322 ? 1.01799 0.50513 0.85734 -0.21076 -0.20288 0.09279  322 ASN A CB  
2187 C CG  . ASN A 322 ? 1.03319 0.52871 0.89035 -0.24446 -0.20334 0.12638  322 ASN A CG  
2188 O OD1 . ASN A 322 ? 1.01538 0.55824 0.90257 -0.27032 -0.19995 0.13991  322 ASN A OD1 
2189 N ND2 . ASN A 322 ? 1.04773 0.50879 0.88902 -0.23967 -0.20450 0.13923  322 ASN A ND2 
2190 N N   . SER A 323 ? 0.96489 0.51786 0.80010 -0.14871 -0.17745 0.04023  323 SER A N   
2191 C CA  . SER A 323 ? 1.04146 0.58391 0.85791 -0.11841 -0.17597 0.01327  323 SER A CA  
2192 C C   . SER A 323 ? 1.02897 0.61932 0.85946 -0.11781 -0.16862 0.00357  323 SER A C   
2193 O O   . SER A 323 ? 1.07471 0.67518 0.89589 -0.09106 -0.15918 -0.01369 323 SER A O   
2194 C CB  . SER A 323 ? 1.12322 0.67390 0.93437 -0.08679 -0.15959 0.00928  323 SER A CB  
2195 O OG  . SER A 323 ? 1.29055 0.81084 1.09443 -0.08909 -0.16360 0.02406  323 SER A OG  
2196 N N   . TYR A 324 ? 1.05392 0.67568 0.90749 -0.14589 -0.17238 0.01551  324 TYR A N   
2197 C CA  . TYR A 324 ? 1.13479 0.79658 0.99965 -0.14615 -0.16980 0.00644  324 TYR A CA  
2198 C C   . TYR A 324 ? 1.23539 0.85193 1.07706 -0.15146 -0.19470 -0.01104 324 TYR A C   
2199 O O   . TYR A 324 ? 1.19771 0.79102 1.04350 -0.18029 -0.21547 -0.00371 324 TYR A O   
2200 C CB  . TYR A 324 ? 1.10448 0.82410 1.00605 -0.17106 -0.16290 0.02709  324 TYR A CB  
2201 C CG  . TYR A 324 ? 1.08678 0.85310 1.00290 -0.16925 -0.15894 0.02021  324 TYR A CG  
2202 C CD1 . TYR A 324 ? 0.98364 0.79741 0.91100 -0.14930 -0.13667 0.01875  324 TYR A CD1 
2203 C CD2 . TYR A 324 ? 1.16662 0.92723 1.08454 -0.18748 -0.17948 0.01519  324 TYR A CD2 
2204 C CE1 . TYR A 324 ? 0.93909 0.79222 0.87814 -0.14642 -0.13368 0.01373  324 TYR A CE1 
2205 C CE2 . TYR A 324 ? 1.11216 0.91567 1.04212 -0.18423 -0.17712 0.00962  324 TYR A CE2 
2206 C CZ  . TYR A 324 ? 0.97765 0.82671 0.91765 -0.16308 -0.15354 0.00956  324 TYR A CZ  
2207 O OH  . TYR A 324 ? 0.90572 0.79418 0.85631 -0.15883 -0.15173 0.00545  324 TYR A OH  
2208 N N   . SER A 325 ? 1.29789 0.90264 1.11487 -0.12400 -0.19304 -0.03372 325 SER A N   
2209 C CA  . SER A 325 ? 1.42108 0.97108 1.20359 -0.12017 -0.21665 -0.05487 325 SER A CA  
2210 C C   . SER A 325 ? 1.38317 0.95866 1.17065 -0.13163 -0.22711 -0.06154 325 SER A C   
2211 O O   . SER A 325 ? 1.31889 0.87655 1.11011 -0.15944 -0.25128 -0.05938 325 SER A O   
2212 C CB  . SER A 325 ? 1.46737 0.98931 1.21628 -0.08101 -0.20834 -0.07519 325 SER A CB  
2213 O OG  . SER A 325 ? 1.45736 1.03200 1.21586 -0.05978 -0.18444 -0.07812 325 SER A OG  
2214 N N   . GLY A 326 ? 1.30687 0.92358 1.09497 -0.11078 -0.21028 -0.06885 326 GLY A N   
2215 C CA  . GLY A 326 ? 1.19808 0.84569 0.99254 -0.11914 -0.21808 -0.07267 326 GLY A CA  
2216 C C   . GLY A 326 ? 1.03853 0.75794 0.86612 -0.11610 -0.19457 -0.05958 326 GLY A C   
2217 O O   . GLY A 326 ? 1.03678 0.78242 0.88448 -0.11098 -0.17328 -0.04685 326 GLY A O   
2218 N N   . ILE A 327 ? 0.87637 0.62489 0.70704 -0.11760 -0.19989 -0.06369 327 ILE A N   
2219 C CA  . ILE A 327 ? 0.82329 0.63694 0.68497 -0.11564 -0.18132 -0.05140 327 ILE A CA  
2220 C C   . ILE A 327 ? 0.91208 0.74110 0.77031 -0.08705 -0.15345 -0.05242 327 ILE A C   
2221 O O   . ILE A 327 ? 0.94476 0.74728 0.77236 -0.06320 -0.14909 -0.06690 327 ILE A O   
2222 C CB  . ILE A 327 ? 0.78619 0.62009 0.64410 -0.11735 -0.19449 -0.05812 327 ILE A CB  
2223 C CG1 . ILE A 327 ? 0.70560 0.60516 0.59656 -0.11517 -0.17735 -0.04449 327 ILE A CG1 
2224 C CG2 . ILE A 327 ? 0.84397 0.64563 0.65636 -0.09076 -0.19750 -0.07947 327 ILE A CG2 
2225 C CD1 . ILE A 327 ? 0.67993 0.60563 0.57523 -0.12171 -0.19359 -0.04665 327 ILE A CD1 
2226 N N   . LEU A 328 ? 0.80191 0.67453 0.69232 -0.08949 -0.13474 -0.03665 328 LEU A N   
2227 C CA  . LEU A 328 ? 0.73979 0.63498 0.63460 -0.06657 -0.11007 -0.03561 328 LEU A CA  
2228 C C   . LEU A 328 ? 0.74025 0.60068 0.61576 -0.04902 -0.10258 -0.04320 328 LEU A C   
2229 O O   . LEU A 328 ? 0.64384 0.50943 0.51106 -0.02651 -0.08802 -0.04908 328 LEU A O   
2230 C CB  . LEU A 328 ? 0.62643 0.54267 0.51321 -0.05063 -0.10451 -0.04189 328 LEU A CB  
2231 C CG  . LEU A 328 ? 0.66209 0.62874 0.57734 -0.05812 -0.10036 -0.03039 328 LEU A CG  
2232 C CD1 . LEU A 328 ? 0.63514 0.61453 0.53712 -0.04346 -0.09954 -0.03624 328 LEU A CD1 
2233 C CD2 . LEU A 328 ? 0.71151 0.70772 0.65232 -0.05380 -0.07984 -0.01887 328 LEU A CD2 
2234 N N   . SER A 329 ? 0.75214 0.57829 0.62205 -0.05900 -0.11240 -0.04169 329 SER A N   
2235 C CA  . SER A 329 ? 0.76942 0.56294 0.62237 -0.04113 -0.10695 -0.04827 329 SER A CA  
2236 C C   . SER A 329 ? 0.77088 0.56223 0.64052 -0.05441 -0.10552 -0.03366 329 SER A C   
2237 O O   . SER A 329 ? 0.75851 0.51188 0.61845 -0.06677 -0.12016 -0.03146 329 SER A O   
2238 C CB  . SER A 329 ? 0.72432 0.46434 0.54033 -0.03308 -0.12393 -0.06548 329 SER A CB  
2239 O OG  . SER A 329 ? 0.77830 0.48985 0.57913 -0.01264 -0.11806 -0.07184 329 SER A OG  
2240 N N   . PHE A 330 ? 0.68309 0.51380 0.57608 -0.05180 -0.08849 -0.02312 330 PHE A N   
2241 C CA  . PHE A 330 ? 0.67512 0.50912 0.58166 -0.06471 -0.08694 -0.00803 330 PHE A CA  
2242 C C   . PHE A 330 ? 0.60697 0.40860 0.49967 -0.04990 -0.08545 -0.01091 330 PHE A C   
2243 O O   . PHE A 330 ? 0.63355 0.42648 0.51536 -0.02717 -0.07960 -0.02303 330 PHE A O   
2244 C CB  . PHE A 330 ? 0.71204 0.59848 0.64493 -0.06588 -0.07080 0.00300  330 PHE A CB  
2245 C CG  . PHE A 330 ? 0.75081 0.67166 0.69938 -0.07838 -0.07235 0.00707  330 PHE A CG  
2246 C CD1 . PHE A 330 ? 0.71133 0.65449 0.66206 -0.06557 -0.06558 -0.00070 330 PHE A CD1 
2247 C CD2 . PHE A 330 ? 0.77692 0.70867 0.73918 -0.10299 -0.08105 0.02008  330 PHE A CD2 
2248 C CE1 . PHE A 330 ? 0.70835 0.68288 0.67302 -0.07492 -0.06841 0.00321  330 PHE A CE1 
2249 C CE2 . PHE A 330 ? 0.73720 0.70504 0.71723 -0.11335 -0.08336 0.02415  330 PHE A CE2 
2250 C CZ  . PHE A 330 ? 0.71130 0.69978 0.69164 -0.09824 -0.07758 0.01504  330 PHE A CZ  
2251 N N   . PRO A 331 ? 0.59588 0.38021 0.48892 -0.06188 -0.09079 0.00132  331 PRO A N   
2252 C CA  . PRO A 331 ? 0.66683 0.41811 0.54542 -0.04656 -0.09176 -0.00088 331 PRO A CA  
2253 C C   . PRO A 331 ? 0.68540 0.46674 0.57641 -0.02915 -0.07558 0.00091  331 PRO A C   
2254 O O   . PRO A 331 ? 0.68925 0.44930 0.57131 -0.01399 -0.07636 -0.00139 331 PRO A O   
2255 C CB  . PRO A 331 ? 0.66836 0.39315 0.54353 -0.06797 -0.10335 0.01501  331 PRO A CB  
2256 C CG  . PRO A 331 ? 0.58408 0.35085 0.48220 -0.09114 -0.09887 0.02993  331 PRO A CG  
2257 C CD  . PRO A 331 ? 0.53090 0.32293 0.43637 -0.09011 -0.09744 0.01878  331 PRO A CD  
2258 N N   . SER A 332 ? 0.64384 0.47231 0.55507 -0.03033 -0.06270 0.00444  332 SER A N   
2259 C CA  . SER A 332 ? 0.57895 0.43483 0.50259 -0.01519 -0.04970 0.00430  332 SER A CA  
2260 C C   . SER A 332 ? 0.48929 0.37297 0.42353 -0.00450 -0.03952 -0.00502 332 SER A C   
2261 O O   . SER A 332 ? 0.54038 0.44352 0.48109 -0.01371 -0.03800 -0.00406 332 SER A O   
2262 C CB  . SER A 332 ? 0.56260 0.44558 0.49805 -0.02583 -0.04416 0.01880  332 SER A CB  
2263 O OG  . SER A 332 ? 0.59830 0.45697 0.52265 -0.03153 -0.05103 0.02953  332 SER A OG  
2264 N N   . ALA A 333 ? 0.41492 0.30178 0.35235 0.01460  -0.03285 -0.01252 333 ALA A N   
2265 C CA  . ALA A 333 ? 0.46348 0.37758 0.41314 0.02373  -0.02185 -0.01790 333 ALA A CA  
2266 C C   . ALA A 333 ? 0.41865 0.34193 0.37985 0.04033  -0.01493 -0.02081 333 ALA A C   
2267 O O   . ALA A 333 ? 0.45140 0.35652 0.40733 0.04785  -0.01995 -0.02134 333 ALA A O   
2268 C CB  . ALA A 333 ? 0.52500 0.42713 0.46040 0.02821  -0.02345 -0.02678 333 ALA A CB  
2269 N N   . PRO A 334 ? 0.35558 0.30642 0.33387 0.04594  -0.00461 -0.02185 334 PRO A N   
2270 C CA  . PRO A 334 ? 0.40323 0.36564 0.39741 0.05965  0.00092  -0.02383 334 PRO A CA  
2271 C C   . PRO A 334 ? 0.46947 0.41412 0.45339 0.07508  0.00065  -0.03023 334 PRO A C   
2272 O O   . PRO A 334 ? 0.56957 0.50427 0.53850 0.07974  0.00276  -0.03538 334 PRO A O   
2273 C CB  . PRO A 334 ? 0.43596 0.42576 0.44763 0.06001  0.01144  -0.02282 334 PRO A CB  
2274 C CG  . PRO A 334 ? 0.28991 0.28602 0.29783 0.04653  0.01010  -0.01910 334 PRO A CG  
2275 C CD  . PRO A 334 ? 0.30102 0.27405 0.28709 0.03940  0.00146  -0.01988 334 PRO A CD  
2276 N N   . THR A 335 ? 0.43188 0.37250 0.42200 0.08485  -0.00272 -0.03040 335 THR A N   
2277 C CA  . THR A 335 ? 0.44039 0.35987 0.41841 0.10172  -0.00544 -0.03626 335 THR A CA  
2278 C C   . THR A 335 ? 0.42027 0.36642 0.42200 0.11867  0.00399  -0.03745 335 THR A C   
2279 O O   . THR A 335 ? 0.33299 0.30386 0.36054 0.11631  0.00483  -0.03289 335 THR A O   
2280 C CB  . THR A 335 ? 0.48551 0.37738 0.45128 0.10089  -0.01855 -0.03375 335 THR A CB  
2281 O OG1 . THR A 335 ? 0.55773 0.43775 0.51189 0.08047  -0.02513 -0.02771 335 THR A OG1 
2282 C CG2 . THR A 335 ? 0.53631 0.39308 0.47995 0.11713  -0.02450 -0.04099 335 THR A CG2 
2283 N N   . ILE A 336 ? 0.47968 0.42144 0.47242 0.13607  0.01055  -0.04361 336 ILE A N   
2284 C CA  . ILE A 336 ? 0.54538 0.51619 0.56234 0.15405  0.02109  -0.04317 336 ILE A CA  
2285 C C   . ILE A 336 ? 0.47589 0.44235 0.50232 0.16459  0.01175  -0.04288 336 ILE A C   
2286 O O   . ILE A 336 ? 0.56203 0.49859 0.56681 0.17902  0.00490  -0.04856 336 ILE A O   
2287 C CB  . ILE A 336 ? 0.64977 0.61739 0.64973 0.17310  0.03182  -0.04974 336 ILE A CB  
2288 C CG1 . ILE A 336 ? 0.60682 0.58697 0.60209 0.16339  0.04187  -0.04752 336 ILE A CG1 
2289 C CG2 . ILE A 336 ? 0.64397 0.64372 0.66964 0.19476  0.04344  -0.04806 336 ILE A CG2 
2290 C CD1 . ILE A 336 ? 0.70445 0.65581 0.66030 0.17158  0.04095  -0.05692 336 ILE A CD1 
2291 N N   . ASP A 337 ? 0.42476 0.41797 0.48159 0.15790  0.00939  -0.03671 337 ASP A N   
2292 C CA  . ASP A 337 ? 0.48615 0.47552 0.55052 0.16572  -0.00262 -0.03555 337 ASP A CA  
2293 C C   . ASP A 337 ? 0.50514 0.53573 0.60963 0.17761  0.00161  -0.03285 337 ASP A C   
2294 O O   . ASP A 337 ? 0.54156 0.57575 0.65742 0.18375  -0.00976 -0.03139 337 ASP A O   
2295 C CB  . ASP A 337 ? 0.37004 0.34997 0.42946 0.14726  -0.01451 -0.03106 337 ASP A CB  
2296 C CG  . ASP A 337 ? 0.45882 0.47019 0.54380 0.13254  -0.01052 -0.02758 337 ASP A CG  
2297 O OD1 . ASP A 337 ? 0.45605 0.49386 0.56271 0.13327  0.00138  -0.02696 337 ASP A OD1 
2298 O OD2 . ASP A 337 ? 0.56437 0.57210 0.64556 0.12070  -0.01924 -0.02508 337 ASP A OD2 
2299 N N   . GLY A 338 ? 0.59542 0.65876 0.72270 0.18041  0.01712  -0.03077 338 GLY A N   
2300 C CA  . GLY A 338 ? 0.60041 0.70822 0.77235 0.18764  0.02121  -0.02567 338 GLY A CA  
2301 C C   . GLY A 338 ? 0.59064 0.71512 0.78940 0.17131  0.00915  -0.02162 338 GLY A C   
2302 O O   . GLY A 338 ? 0.58362 0.74142 0.82011 0.17645  0.00597  -0.01811 338 GLY A O   
2303 N N   . ALA A 339 ? 0.60360 0.70647 0.78347 0.15274  0.00145  -0.02250 339 ALA A N   
2304 C CA  . ALA A 339 ? 0.49422 0.60843 0.69248 0.13845  -0.01046 -0.02089 339 ALA A CA  
2305 C C   . ALA A 339 ? 0.51308 0.62783 0.71043 0.11972  -0.00442 -0.01947 339 ALA A C   
2306 O O   . ALA A 339 ? 0.61168 0.75253 0.83889 0.11380  0.00343  -0.01521 339 ALA A O   
2307 C CB  . ALA A 339 ? 0.39978 0.48673 0.57246 0.13852  -0.02753 -0.02330 339 ALA A CB  
2308 N N   . PHE A 340 ? 0.56153 0.64853 0.72610 0.11056  -0.00773 -0.02170 340 PHE A N   
2309 C CA  . PHE A 340 ? 0.48788 0.57522 0.64986 0.09612  -0.00152 -0.02057 340 PHE A CA  
2310 C C   . PHE A 340 ? 0.44550 0.53717 0.60516 0.09837  0.01482  -0.01810 340 PHE A C   
2311 O O   . PHE A 340 ? 0.37928 0.48534 0.55461 0.09067  0.02264  -0.01412 340 PHE A O   
2312 C CB  . PHE A 340 ? 0.38542 0.44817 0.51543 0.08756  -0.00785 -0.02241 340 PHE A CB  
2313 C CG  . PHE A 340 ? 0.45797 0.52572 0.59180 0.07530  -0.00792 -0.02258 340 PHE A CG  
2314 C CD1 . PHE A 340 ? 0.48675 0.55874 0.62882 0.07180  -0.01958 -0.02537 340 PHE A CD1 
2315 C CD2 . PHE A 340 ? 0.34346 0.41028 0.47090 0.06916  0.00243  -0.02079 340 PHE A CD2 
2316 C CE1 . PHE A 340 ? 0.47893 0.55167 0.62195 0.06333  -0.02035 -0.02734 340 PHE A CE1 
2317 C CE2 . PHE A 340 ? 0.31117 0.38075 0.44156 0.06073  0.00199  -0.02119 340 PHE A CE2 
2318 C CZ  . PHE A 340 ? 0.37836 0.44969 0.51614 0.05829  -0.00913 -0.02495 340 PHE A CZ  
2319 N N   . LEU A 341 ? 0.51314 0.58990 0.65093 0.10971  0.01914  -0.02048 341 LEU A N   
2320 C CA  . LEU A 341 ? 0.60354 0.68293 0.73321 0.11596  0.03364  -0.01971 341 LEU A CA  
2321 C C   . LEU A 341 ? 0.67612 0.76997 0.81735 0.13563  0.04084  -0.01993 341 LEU A C   
2322 O O   . LEU A 341 ? 0.71388 0.78610 0.83139 0.14947  0.03795  -0.02587 341 LEU A O   
2323 C CB  . LEU A 341 ? 0.70060 0.74800 0.79073 0.11386  0.03144  -0.02438 341 LEU A CB  
2324 C CG  . LEU A 341 ? 0.75465 0.79772 0.83599 0.09725  0.03080  -0.02242 341 LEU A CG  
2325 C CD1 . LEU A 341 ? 0.73166 0.77190 0.81733 0.08654  0.01943  -0.02169 341 LEU A CD1 
2326 C CD2 . LEU A 341 ? 0.90200 0.91990 0.94956 0.09637  0.02951  -0.02637 341 LEU A CD2 
2327 N N   . PRO A 342 ? 0.72547 0.85566 0.90309 0.13812  0.05050  -0.01306 342 PRO A N   
2328 C CA  . PRO A 342 ? 0.74110 0.89269 0.93470 0.15887  0.05817  -0.01213 342 PRO A CA  
2329 C C   . PRO A 342 ? 0.69694 0.83987 0.86252 0.17634  0.07210  -0.01549 342 PRO A C   
2330 O O   . PRO A 342 ? 0.84845 0.99130 1.00891 0.19836  0.07402  -0.01995 342 PRO A O   
2331 C CB  . PRO A 342 ? 0.71448 0.91111 0.95811 0.15188  0.06570  -0.00107 342 PRO A CB  
2332 C CG  . PRO A 342 ? 0.70055 0.89017 0.95287 0.12930  0.05359  -0.00009 342 PRO A CG  
2333 C CD  . PRO A 342 ? 0.70255 0.85641 0.91270 0.12194  0.05198  -0.00538 342 PRO A CD  
2334 N N   . ALA A 343 ? 0.63895 0.77368 0.78415 0.16952  0.08091  -0.01426 343 ALA A N   
2335 C CA  . ALA A 343 ? 0.79758 0.92180 0.91069 0.18747  0.09234  -0.01911 343 ALA A CA  
2336 C C   . ALA A 343 ? 1.10910 1.20392 1.18614 0.17548  0.08898  -0.02293 343 ALA A C   
2337 O O   . ALA A 343 ? 1.11948 1.19919 1.19433 0.15623  0.07689  -0.02314 343 ALA A O   
2338 C CB  . ALA A 343 ? 0.57766 0.74469 0.71487 0.19972  0.11422  -0.00901 343 ALA A CB  
2339 N N   . ASP A 344 ? 1.37299 1.65374 2.09018 0.17104  -0.06400 -0.14728 344 ASP A N   
2340 C CA  . ASP A 344 ? 1.49420 1.76051 2.17495 0.16600  -0.04860 -0.14683 344 ASP A CA  
2341 C C   . ASP A 344 ? 1.61707 1.90648 2.28490 0.14502  -0.02664 -0.13433 344 ASP A C   
2342 O O   . ASP A 344 ? 1.62850 1.95522 2.31479 0.13660  -0.01109 -0.13218 344 ASP A O   
2343 C CB  . ASP A 344 ? 1.49880 1.77517 2.17488 0.17921  -0.02754 -0.16605 344 ASP A CB  
2344 C CG  . ASP A 344 ? 1.52531 1.76335 2.19874 0.19921  -0.05148 -0.17822 344 ASP A CG  
2345 O OD1 . ASP A 344 ? 1.51632 1.71573 2.15890 0.20024  -0.06031 -0.17742 344 ASP A OD1 
2346 O OD2 . ASP A 344 ? 1.53905 1.78436 2.24094 0.21354  -0.06273 -0.18830 344 ASP A OD2 
2347 N N   . PRO A 345 ? 1.72124 1.97866 2.33493 0.13086  -0.02518 -0.12149 345 PRO A N   
2348 C CA  . PRO A 345 ? 1.78812 2.05709 2.37666 0.10986  -0.00804 -0.10784 345 PRO A CA  
2349 C C   . PRO A 345 ? 1.85555 2.16524 2.45301 0.10495  0.02547  -0.11524 345 PRO A C   
2350 O O   . PRO A 345 ? 1.91620 2.23014 2.48874 0.08742  0.03778  -0.10383 345 PRO A O   
2351 C CB  . PRO A 345 ? 1.79841 2.02426 2.32648 0.10020  -0.01323 -0.09646 345 PRO A CB  
2352 C CG  . PRO A 345 ? 1.80576 1.99521 2.33085 0.10930  -0.04306 -0.09524 345 PRO A CG  
2353 C CD  . PRO A 345 ? 1.79185 1.99646 2.36385 0.13084  -0.04688 -0.11452 345 PRO A CD  
2354 N N   . MET A 346 ? 1.83122 2.16869 2.45900 0.11960  0.03990  -0.13379 346 MET A N   
2355 C CA  . MET A 346 ? 1.72484 2.09835 2.34950 0.11115  0.07029  -0.13656 346 MET A CA  
2356 C C   . MET A 346 ? 1.70155 2.11325 2.36556 0.11431  0.07347  -0.13950 346 MET A C   
2357 O O   . MET A 346 ? 1.61396 2.05989 2.27899 0.10488  0.09716  -0.13852 346 MET A O   
2358 C CB  . MET A 346 ? 1.70582 2.07428 2.30504 0.11966  0.08923  -0.15088 346 MET A CB  
2359 C CG  . MET A 346 ? 1.72910 2.05722 2.28984 0.11907  0.08333  -0.14976 346 MET A CG  
2360 S SD  . MET A 346 ? 1.73861 2.06119 2.24729 0.09366  0.10203  -0.13376 346 MET A SD  
2361 C CE  . MET A 346 ? 1.69805 1.98040 2.15768 0.09905  0.10221  -0.14039 346 MET A CE  
2362 N N   . THR A 347 ? 1.70984 2.11696 2.40593 0.12631  0.04940  -0.14196 347 THR A N   
2363 C CA  . THR A 347 ? 1.70850 2.15296 2.44645 0.12763  0.04874  -0.14241 347 THR A CA  
2364 C C   . THR A 347 ? 1.74438 2.19012 2.49739 0.11241  0.03119  -0.12560 347 THR A C   
2365 O O   . THR A 347 ? 1.72509 2.20221 2.51443 0.11083  0.02848  -0.12394 347 THR A O   
2366 C CB  . THR A 347 ? 1.64936 2.08911 2.41536 0.15164  0.03222  -0.15735 347 THR A CB  
2367 O OG1 . THR A 347 ? 1.64022 2.04674 2.41416 0.15418  -0.00235 -0.15030 347 THR A OG1 
2368 C CG2 . THR A 347 ? 1.62065 2.03737 2.36316 0.16810  0.03780  -0.17327 347 THR A CG2 
2369 N N   . LEU A 348 ? 1.70028 2.11271 2.42674 0.10204  0.01814  -0.11355 348 LEU A N   
2370 C CA  . LEU A 348 ? 1.70216 2.11248 2.43500 0.08609  0.00276  -0.09736 348 LEU A CA  
2371 C C   . LEU A 348 ? 1.73101 2.17914 2.47089 0.06725  0.02356  -0.08995 348 LEU A C   
2372 O O   . LEU A 348 ? 1.61361 2.07987 2.38053 0.05821  0.01358  -0.08203 348 LEU A O   
2373 C CB  . LEU A 348 ? 1.67870 2.05052 2.37574 0.07864  -0.00883 -0.08695 348 LEU A CB  
2374 C CG  . LEU A 348 ? 1.64492 1.97572 2.31460 0.09103  -0.02188 -0.09072 348 LEU A CG  
2375 C CD1 . LEU A 348 ? 1.61614 1.90706 2.22716 0.07630  -0.02998 -0.07409 348 LEU A CD1 
2376 C CD2 . LEU A 348 ? 1.64101 1.95573 2.33738 0.10738  -0.05124 -0.09574 348 LEU A CD2 
2377 N N   . MET A 349 ? 1.82441 2.28134 2.53729 0.05945  0.05034  -0.09110 349 MET A N   
2378 C CA  . MET A 349 ? 1.86326 2.34280 2.56887 0.03701  0.06677  -0.08010 349 MET A CA  
2379 C C   . MET A 349 ? 1.76993 2.29688 2.49308 0.03404  0.09180  -0.08471 349 MET A C   
2380 O O   . MET A 349 ? 1.78823 2.33604 2.50524 0.01342  0.10572  -0.07440 349 MET A O   
2381 C CB  . MET A 349 ? 1.99997 2.45468 2.65958 0.02700  0.07754  -0.07533 349 MET A CB  
2382 C CG  . MET A 349 ? 2.12263 2.57248 2.75275 0.03520  0.09916  -0.08655 349 MET A CG  
2383 S SD  . MET A 349 ? 2.16943 2.57681 2.78151 0.05483  0.08437  -0.09585 349 MET A SD  
2384 C CE  . MET A 349 ? 2.16141 2.56357 2.73005 0.05341  0.11205  -0.10347 349 MET A CE  
2385 N N   . LYS A 350 ? 1.69920 2.24339 2.44392 0.05378  0.09683  -0.09934 350 LYS A N   
2386 C CA  . LYS A 350 ? 1.58720 2.18300 2.36033 0.05340  0.11624  -0.10304 350 LYS A CA  
2387 C C   . LYS A 350 ? 1.65089 2.27623 2.45444 0.03384  0.10888  -0.08815 350 LYS A C   
2388 O O   . LYS A 350 ? 1.67563 2.33875 2.48417 0.01691  0.12815  -0.08037 350 LYS A O   
2389 C CB  . LYS A 350 ? 1.43090 2.03783 2.23522 0.08035  0.11168  -0.12057 350 LYS A CB  
2390 C CG  . LYS A 350 ? 1.30090 1.91877 2.09184 0.09534  0.13595  -0.13660 350 LYS A CG  
2391 C CD  . LYS A 350 ? 1.23141 1.80013 1.99369 0.11277  0.12530  -0.14864 350 LYS A CD  
2392 C CE  . LYS A 350 ? 1.20068 1.77543 1.94722 0.12816  0.14689  -0.16590 350 LYS A CE  
2393 N NZ  . LYS A 350 ? 1.15508 1.67994 1.86301 0.13739  0.13944  -0.17383 350 LYS A NZ  
2394 N N   . THR A 351 ? 1.73174 2.33678 2.55287 0.03460  0.07931  -0.08294 351 THR A N   
2395 C CA  . THR A 351 ? 1.73919 2.37049 2.59748 0.02138  0.06587  -0.07230 351 THR A CA  
2396 C C   . THR A 351 ? 1.66053 2.27418 2.50024 -0.00493 0.05599  -0.05435 351 THR A C   
2397 O O   . THR A 351 ? 1.69323 2.33629 2.53469 -0.02721 0.06971  -0.04414 351 THR A O   
2398 C CB  . THR A 351 ? 1.76231 2.37846 2.65086 0.03882  0.03612  -0.07773 351 THR A CB  
2399 O OG1 . THR A 351 ? 1.77006 2.37988 2.66181 0.06535  0.03932  -0.09539 351 THR A OG1 
2400 C CG2 . THR A 351 ? 1.74573 2.40557 2.68395 0.03202  0.02891  -0.07298 351 THR A CG2 
2401 N N   . ALA A 352 ? 1.42828 1.99284 2.24884 -0.00283 0.03127  -0.04999 352 ALA A N   
2402 C CA  . ALA A 352 ? 1.16132 1.70556 1.97359 -0.02342 0.01224  -0.03379 352 ALA A CA  
2403 C C   . ALA A 352 ? 0.87896 1.42281 1.65996 -0.04564 0.02998  -0.02417 352 ALA A C   
2404 O O   . ALA A 352 ? 0.75483 1.30031 1.50971 -0.04328 0.05398  -0.02982 352 ALA A O   
2405 C CB  . ALA A 352 ? 1.07004 1.56110 1.86323 -0.01368 -0.01697 -0.03181 352 ALA A CB  
2406 N N   . ASP A 353 ? 0.71491 1.25294 1.49713 -0.06803 0.01557  -0.00904 353 ASP A N   
2407 C CA  . ASP A 353 ? 0.62367 1.15576 1.37803 -0.09219 0.02580  0.00277  353 ASP A CA  
2408 C C   . ASP A 353 ? 0.49023 0.96944 1.21641 -0.09727 -0.00032 0.01298  353 ASP A C   
2409 O O   . ASP A 353 ? 0.37601 0.83448 1.11198 -0.09603 -0.03031 0.01811  353 ASP A O   
2410 C CB  . ASP A 353 ? 0.61572 1.18600 1.39276 -0.11775 0.03049  0.01334  353 ASP A CB  
2411 C CG  . ASP A 353 ? 0.64929 1.23097 1.39946 -0.13976 0.05505  0.02032  353 ASP A CG  
2412 O OD1 . ASP A 353 ? 0.66591 1.28245 1.41516 -0.13541 0.08419  0.01227  353 ASP A OD1 
2413 O OD2 . ASP A 353 ? 0.64486 1.19626 1.37108 -0.16074 0.04281  0.03507  353 ASP A OD2 
2414 N N   . LEU A 354 ? 0.45524 0.90441 1.12740 -0.10081 0.00998  0.01524  354 LEU A N   
2415 C CA  . LEU A 354 ? 0.37798 0.76612 0.99194 -0.09721 -0.01097 0.02034  354 LEU A CA  
2416 C C   . LEU A 354 ? 0.31414 0.67830 0.89303 -0.11984 -0.01828 0.03454  354 LEU A C   
2417 O O   . LEU A 354 ? 0.36225 0.68450 0.88606 -0.11673 -0.02190 0.03567  354 LEU A O   
2418 C CB  . LEU A 354 ? 0.40684 0.77217 0.97964 -0.07895 0.00221  0.01016  354 LEU A CB  
2419 C CG  . LEU A 354 ? 0.38199 0.76975 0.98569 -0.05820 0.01193  -0.00423 354 LEU A CG  
2420 C CD1 . LEU A 354 ? 0.31674 0.68778 0.87962 -0.04753 0.02944  -0.01197 354 LEU A CD1 
2421 C CD2 . LEU A 354 ? 0.42470 0.79064 1.03881 -0.04472 -0.01634 -0.00540 354 LEU A CD2 
2422 N N   . LYS A 355 ? 0.38353 0.77299 0.99432 -0.14290 -0.02260 0.04572  355 LYS A N   
2423 C CA  . LYS A 355 ? 0.47620 0.83720 1.05198 -0.16605 -0.03388 0.06045  355 LYS A CA  
2424 C C   . LYS A 355 ? 0.52425 0.82097 1.05064 -0.15778 -0.06481 0.06263  355 LYS A C   
2425 O O   . LYS A 355 ? 0.64880 0.90878 1.12701 -0.16556 -0.07063 0.06848  355 LYS A O   
2426 C CB  . LYS A 355 ? 0.50001 0.89647 1.12205 -0.19395 -0.03993 0.07401  355 LYS A CB  
2427 C CG  . LYS A 355 ? 0.64540 1.04609 1.30971 -0.19262 -0.06853 0.07653  355 LYS A CG  
2428 C CD  . LYS A 355 ? 0.74734 1.15093 1.42364 -0.22259 -0.08571 0.09319  355 LYS A CD  
2429 C CE  . LYS A 355 ? 0.79152 1.16815 1.47784 -0.21927 -0.12361 0.09634  355 LYS A CE  
2430 N NZ  . LYS A 355 ? 0.75633 1.13683 1.46685 -0.19141 -0.13131 0.08304  355 LYS A NZ  
2431 N N   . ASP A 356 ? 0.47443 0.75596 1.00901 -0.14074 -0.08446 0.05692  356 ASP A N   
2432 C CA  . ASP A 356 ? 0.49207 0.71659 0.98203 -0.13319 -0.11421 0.05818  356 ASP A CA  
2433 C C   . ASP A 356 ? 0.44454 0.63887 0.88793 -0.10950 -0.10887 0.04728  356 ASP A C   
2434 O O   . ASP A 356 ? 0.45452 0.60444 0.85757 -0.10112 -0.13025 0.04637  356 ASP A O   
2435 C CB  . ASP A 356 ? 0.54669 0.76815 1.06707 -0.13129 -0.14220 0.06001  356 ASP A CB  
2436 C CG  . ASP A 356 ? 0.64839 0.89531 1.21282 -0.15677 -0.15334 0.07260  356 ASP A CG  
2437 O OD1 . ASP A 356 ? 0.71671 0.96365 1.26927 -0.17802 -0.14821 0.08250  356 ASP A OD1 
2438 O OD2 . ASP A 356 ? 0.68785 0.95469 1.29876 -0.15677 -0.16823 0.07343  356 ASP A OD2 
2439 N N   . TYR A 357 ? 0.40436 0.62174 0.85109 -0.09906 -0.08138 0.03887  357 TYR A N   
2440 C CA  . TYR A 357 ? 0.38998 0.58392 0.79885 -0.07851 -0.07681 0.02970  357 TYR A CA  
2441 C C   . TYR A 357 ? 0.46637 0.63879 0.82743 -0.07967 -0.06708 0.02987  357 TYR A C   
2442 O O   . TYR A 357 ? 0.44053 0.62871 0.80373 -0.09302 -0.05114 0.03374  357 TYR A O   
2443 C CB  . TYR A 357 ? 0.29595 0.52070 0.73284 -0.06566 -0.05716 0.02028  357 TYR A CB  
2444 C CG  . TYR A 357 ? 0.30810 0.54223 0.78263 -0.05758 -0.07256 0.01785  357 TYR A CG  
2445 C CD1 . TYR A 357 ? 0.32829 0.58955 0.85277 -0.06875 -0.08134 0.02267  357 TYR A CD1 
2446 C CD2 . TYR A 357 ? 0.32411 0.54119 0.78559 -0.03993 -0.07910 0.01147  357 TYR A CD2 
2447 C CE1 . TYR A 357 ? 0.39984 0.66968 0.96142 -0.06050 -0.09787 0.02016  357 TYR A CE1 
2448 C CE2 . TYR A 357 ? 0.37085 0.59281 0.86522 -0.03284 -0.09600 0.00985  357 TYR A CE2 
2449 C CZ  . TYR A 357 ? 0.39350 0.64141 0.93861 -0.04218 -0.10603 0.01368  357 TYR A CZ  
2450 O OH  . TYR A 357 ? 0.44376 0.69646 1.02425 -0.03458 -0.12553 0.01196  357 TYR A OH  
2451 N N   . ASP A 358 ? 0.52739 0.66433 0.84498 -0.06573 -0.07754 0.02564  358 ASP A N   
2452 C CA  . ASP A 358 ? 0.48642 0.60334 0.75991 -0.06121 -0.07013 0.02319  358 ASP A CA  
2453 C C   . ASP A 358 ? 0.42195 0.54277 0.68249 -0.04360 -0.05654 0.01424  358 ASP A C   
2454 O O   . ASP A 358 ? 0.48784 0.59755 0.74129 -0.03170 -0.06689 0.01070  358 ASP A O   
2455 C CB  . ASP A 358 ? 0.36610 0.44040 0.60009 -0.05890 -0.09470 0.02465  358 ASP A CB  
2456 C CG  . ASP A 358 ? 0.61277 0.67686 0.85706 -0.07764 -0.11315 0.03464  358 ASP A CG  
2457 O OD1 . ASP A 358 ? 0.47013 0.54766 0.72426 -0.09513 -0.10341 0.04191  358 ASP A OD1 
2458 O OD2 . ASP A 358 ? 0.74881 0.79107 0.99033 -0.07637 -0.13800 0.03592  358 ASP A OD2 
2459 N N   . ILE A 359 ? 0.30552 0.44026 0.56049 -0.04363 -0.03480 0.01154  359 ILE A N   
2460 C CA  . ILE A 359 ? 0.32595 0.46853 0.57454 -0.03059 -0.02078 0.00433  359 ILE A CA  
2461 C C   . ILE A 359 ? 0.39138 0.52154 0.60331 -0.02729 -0.01319 0.00238  359 ILE A C   
2462 O O   . ILE A 359 ? 0.36728 0.49879 0.57312 -0.03753 -0.00602 0.00549  359 ILE A O   
2463 C CB  . ILE A 359 ? 0.32061 0.49603 0.60498 -0.03253 -0.00153 0.00107  359 ILE A CB  
2464 C CG1 . ILE A 359 ? 0.26933 0.46206 0.59714 -0.03507 -0.00959 0.00219  359 ILE A CG1 
2465 C CG2 . ILE A 359 ? 0.34626 0.52286 0.62115 -0.01983 0.00810  -0.00567 359 ILE A CG2 
2466 C CD1 . ILE A 359 ? 0.26919 0.44987 0.59916 -0.02299 -0.02496 -0.00015 359 ILE A CD1 
2467 N N   . LEU A 360 ? 0.34021 0.45972 0.52833 -0.01397 -0.01511 -0.00222 360 LEU A N   
2468 C CA  . LEU A 360 ? 0.34551 0.46003 0.50532 -0.00851 -0.00693 -0.00533 360 LEU A CA  
2469 C C   . LEU A 360 ? 0.40123 0.53042 0.56527 -0.00183 0.00629  -0.00921 360 LEU A C   
2470 O O   . LEU A 360 ? 0.41637 0.54440 0.58167 0.00488  0.00059  -0.01017 360 LEU A O   
2471 C CB  . LEU A 360 ? 0.30890 0.40001 0.43631 0.00127  -0.02228 -0.00765 360 LEU A CB  
2472 C CG  . LEU A 360 ? 0.36515 0.45647 0.46830 0.00974  -0.01473 -0.01212 360 LEU A CG  
2473 C CD1 . LEU A 360 ? 0.36997 0.45989 0.46854 0.00120  -0.00821 -0.00991 360 LEU A CD1 
2474 C CD2 . LEU A 360 ? 0.32200 0.39712 0.39709 0.02324  -0.02772 -0.01732 360 LEU A CD2 
2475 N N   . MET A 361 ? 0.26051 0.40041 0.42404 -0.00483 0.02204  -0.01078 361 MET A N   
2476 C CA  . MET A 361 ? 0.24810 0.39869 0.41596 -0.00016 0.03235  -0.01408 361 MET A CA  
2477 C C   . MET A 361 ? 0.30929 0.46123 0.45886 -0.00076 0.04295  -0.01579 361 MET A C   
2478 O O   . MET A 361 ? 0.36963 0.51629 0.50764 -0.00601 0.04440  -0.01450 361 MET A O   
2479 C CB  . MET A 361 ? 0.24102 0.40652 0.44106 -0.00287 0.03963  -0.01606 361 MET A CB  
2480 C CG  . MET A 361 ? 0.30496 0.48337 0.51890 -0.01222 0.05205  -0.01667 361 MET A CG  
2481 S SD  . MET A 361 ? 0.31854 0.52021 0.57906 -0.01356 0.05657  -0.01996 361 MET A SD  
2482 C CE  . MET A 361 ? 0.23193 0.43543 0.49848 -0.00194 0.06146  -0.02781 361 MET A CE  
2483 N N   . GLY A 362 ? 0.24470 0.40153 0.39063 0.00339  0.04814  -0.01778 362 GLY A N   
2484 C CA  . GLY A 362 ? 0.23849 0.39657 0.36813 0.00258  0.05584  -0.01907 362 GLY A CA  
2485 C C   . GLY A 362 ? 0.28121 0.44419 0.40985 0.00497  0.05885  -0.01979 362 GLY A C   
2486 O O   . GLY A 362 ? 0.24587 0.40972 0.38768 0.00625  0.05654  -0.01968 362 GLY A O   
2487 N N   . ASN A 363 ? 0.24455 0.40925 0.35733 0.00482  0.06164  -0.01979 363 ASN A N   
2488 C CA  . ASN A 363 ? 0.23163 0.40017 0.34237 0.00325  0.06455  -0.01939 363 ASN A CA  
2489 C C   . ASN A 363 ? 0.23196 0.40704 0.32691 0.00445  0.06294  -0.01773 363 ASN A C   
2490 O O   . ASN A 363 ? 0.48465 0.65905 0.57037 0.00788  0.06027  -0.01877 363 ASN A O   
2491 C CB  . ASN A 363 ? 0.27027 0.43530 0.38538 -0.00120 0.07312  -0.02342 363 ASN A CB  
2492 C CG  . ASN A 363 ? 0.35196 0.51643 0.48776 -0.00014 0.07571  -0.02710 363 ASN A CG  
2493 O OD1 . ASN A 363 ? 0.31232 0.47976 0.45659 -0.00188 0.08180  -0.02988 363 ASN A OD1 
2494 N ND2 . ASN A 363 ? 0.42595 0.58750 0.57087 0.00221  0.07022  -0.02678 363 ASN A ND2 
2495 N N   . VAL A 364 ? 0.23161 0.41305 0.32467 0.00135  0.06309  -0.01508 364 VAL A N   
2496 C CA  . VAL A 364 ? 0.30071 0.49372 0.38444 0.00090  0.06243  -0.01350 364 VAL A CA  
2497 C C   . VAL A 364 ? 0.31314 0.50022 0.39353 -0.00585 0.06523  -0.01433 364 VAL A C   
2498 O O   . VAL A 364 ? 0.38860 0.56359 0.47244 -0.00947 0.06825  -0.01657 364 VAL A O   
2499 C CB  . VAL A 364 ? 0.38988 0.59922 0.47296 -0.00026 0.06001  -0.00820 364 VAL A CB  
2500 C CG1 . VAL A 364 ? 0.23225 0.44551 0.31294 0.00701  0.05710  -0.00845 364 VAL A CG1 
2501 C CG2 . VAL A 364 ? 0.38290 0.58631 0.46990 -0.00946 0.05879  -0.00343 364 VAL A CG2 
2502 N N   . ARG A 365 ? 0.34090 0.53671 0.41447 -0.00645 0.06315  -0.01351 365 ARG A N   
2503 C CA  . ARG A 365 ? 0.37777 0.56477 0.44411 -0.01288 0.06340  -0.01449 365 ARG A CA  
2504 C C   . ARG A 365 ? 0.40736 0.58945 0.47606 -0.02092 0.06246  -0.01199 365 ARG A C   
2505 O O   . ARG A 365 ? 0.45766 0.62258 0.52023 -0.02449 0.06417  -0.01586 365 ARG A O   
2506 C CB  . ARG A 365 ? 0.40566 0.60445 0.46722 -0.01144 0.05807  -0.01353 365 ARG A CB  
2507 C CG  . ARG A 365 ? 0.42286 0.60690 0.47184 -0.01688 0.05586  -0.01525 365 ARG A CG  
2508 C CD  . ARG A 365 ? 0.57609 0.77378 0.62471 -0.01519 0.04746  -0.01375 365 ARG A CD  
2509 N NE  . ARG A 365 ? 0.77136 0.99123 0.83205 -0.02041 0.04507  -0.00852 365 ARG A NE  
2510 C CZ  . ARG A 365 ? 0.73280 0.97780 0.80281 -0.01838 0.03926  -0.00656 365 ARG A CZ  
2511 N NH1 . ARG A 365 ? 0.76497 1.01254 0.83307 -0.00862 0.03337  -0.01079 365 ARG A NH1 
2512 N NH2 . ARG A 365 ? 0.61034 0.87833 0.69241 -0.02651 0.03829  -0.00015 365 ARG A NH2 
2513 N N   . ASP A 366 ? 0.41785 0.61285 0.49287 -0.02422 0.05904  -0.00570 366 ASP A N   
2514 C CA  . ASP A 366 ? 0.39626 0.58418 0.47115 -0.03424 0.05407  -0.00105 366 ASP A CA  
2515 C C   . ASP A 366 ? 0.37045 0.55419 0.45100 -0.03521 0.05164  0.00275  366 ASP A C   
2516 O O   . ASP A 366 ? 0.36806 0.56248 0.44880 -0.04303 0.04707  0.01162  366 ASP A O   
2517 C CB  . ASP A 366 ? 0.39920 0.60664 0.47429 -0.04245 0.04937  0.00607  366 ASP A CB  
2518 C CG  . ASP A 366 ? 0.54008 0.75257 0.61120 -0.03941 0.04910  0.00228  366 ASP A CG  
2519 O OD1 . ASP A 366 ? 0.65886 0.85054 0.72007 -0.04226 0.04719  -0.00168 366 ASP A OD1 
2520 O OD2 . ASP A 366 ? 0.57427 0.80954 0.65044 -0.03309 0.04991  0.00233  366 ASP A OD2 
2521 N N   . GLU A 367 ? 0.38605 0.55446 0.47126 -0.02844 0.05396  -0.00343 367 GLU A N   
2522 C CA  . GLU A 367 ? 0.38597 0.54664 0.47744 -0.02811 0.04877  -0.00056 367 GLU A CA  
2523 C C   . GLU A 367 ? 0.43780 0.58496 0.52537 -0.03834 0.03851  0.00571  367 GLU A C   
2524 O O   . GLU A 367 ? 0.48598 0.63234 0.57243 -0.04365 0.03124  0.01399  367 GLU A O   
2525 C CB  . GLU A 367 ? 0.39072 0.53866 0.49265 -0.01914 0.05198  -0.00958 367 GLU A CB  
2526 C CG  . GLU A 367 ? 0.46881 0.62634 0.57390 -0.01217 0.06001  -0.01412 367 GLU A CG  
2527 C CD  . GLU A 367 ? 0.45513 0.61857 0.56596 -0.00776 0.05659  -0.01112 367 GLU A CD  
2528 O OE1 . GLU A 367 ? 0.36004 0.52356 0.46858 -0.01070 0.04942  -0.00463 367 GLU A OE1 
2529 O OE2 . GLU A 367 ? 0.36045 0.52622 0.47584 -0.00267 0.05985  -0.01466 367 GLU A OE2 
2530 N N   . GLY A 368 ? 0.44981 0.58322 0.53203 -0.04236 0.03601  0.00255  368 GLY A N   
2531 C CA  . GLY A 368 ? 0.38058 0.49196 0.45840 -0.05063 0.02303  0.00670  368 GLY A CA  
2532 C C   . GLY A 368 ? 0.38610 0.50452 0.45572 -0.06734 0.01465  0.01986  368 GLY A C   
2533 O O   . GLY A 368 ? 0.48234 0.58052 0.54662 -0.07702 0.00093  0.02648  368 GLY A O   
2534 N N   . THR A 369 ? 0.35253 0.49910 0.42202 -0.07168 0.02092  0.02423  369 THR A N   
2535 C CA  . THR A 369 ? 0.43028 0.58790 0.49615 -0.08904 0.01321  0.03653  369 THR A CA  
2536 C C   . THR A 369 ? 0.49310 0.65364 0.55639 -0.10173 0.00577  0.05031  369 THR A C   
2537 O O   . THR A 369 ? 0.59087 0.73595 0.64740 -0.11782 -0.00773 0.06004  369 THR A O   
2538 C CB  . THR A 369 ? 0.50965 0.70380 0.58132 -0.08895 0.02149  0.03797  369 THR A CB  
2539 O OG1 . THR A 369 ? 0.50431 0.72444 0.58147 -0.07999 0.03149  0.03756  369 THR A OG1 
2540 C CG2 . THR A 369 ? 0.56526 0.74966 0.63428 -0.07968 0.02496  0.02641  369 THR A CG2 
2541 N N   . TYR A 370 ? 0.59900 0.77546 0.66447 -0.09567 0.01275  0.05171  370 TYR A N   
2542 C CA  . TYR A 370 ? 0.61718 0.79792 0.67533 -0.10884 0.00668  0.06569  370 TYR A CA  
2543 C C   . TYR A 370 ? 0.55698 0.69532 0.60719 -0.11629 -0.01116 0.06993  370 TYR A C   
2544 O O   . TYR A 370 ? 0.52530 0.65714 0.56572 -0.13618 -0.02312 0.08475  370 TYR A O   
2545 C CB  . TYR A 370 ? 0.63808 0.83395 0.69587 -0.09782 0.01552  0.06326  370 TYR A CB  
2546 C CG  . TYR A 370 ? 0.69138 0.87610 0.73677 -0.10860 0.00624  0.07513  370 TYR A CG  
2547 C CD1 . TYR A 370 ? 0.85607 1.06254 0.89114 -0.12830 0.00555  0.09102  370 TYR A CD1 
2548 C CD2 . TYR A 370 ? 0.73414 0.88667 0.77812 -0.10058 -0.00298 0.07127  370 TYR A CD2 
2549 C CE1 . TYR A 370 ? 0.94354 1.13687 0.96207 -0.14103 -0.00408 0.10372  370 TYR A CE1 
2550 C CE2 . TYR A 370 ? 0.86678 1.00438 0.89659 -0.11128 -0.01477 0.08308  370 TYR A CE2 
2551 C CZ  . TYR A 370 ? 0.99546 1.15172 1.00977 -0.13242 -0.01544 0.09996  370 TYR A CZ  
2552 O OH  . TYR A 370 ? 1.02962 1.16943 1.02434 -0.14621 -0.02780 0.11382  370 TYR A OH  
2553 N N   . PHE A 371 ? 0.51666 0.62613 0.57160 -0.10063 -0.01405 0.05696  371 PHE A N   
2554 C CA  . PHE A 371 ? 0.51692 0.58470 0.56690 -0.10287 -0.03259 0.05771  371 PHE A CA  
2555 C C   . PHE A 371 ? 0.56955 0.61380 0.61210 -0.11346 -0.04528 0.05925  371 PHE A C   
2556 O O   . PHE A 371 ? 0.56244 0.57656 0.59428 -0.12607 -0.06517 0.06846  371 PHE A O   
2557 C CB  . PHE A 371 ? 0.42187 0.47277 0.48419 -0.08105 -0.03038 0.04124  371 PHE A CB  
2558 C CG  . PHE A 371 ? 0.46575 0.53392 0.53480 -0.07203 -0.02235 0.04056  371 PHE A CG  
2559 C CD1 . PHE A 371 ? 0.50929 0.56486 0.57222 -0.07685 -0.03473 0.04977  371 PHE A CD1 
2560 C CD2 . PHE A 371 ? 0.46713 0.56038 0.54562 -0.05986 -0.00493 0.03143  371 PHE A CD2 
2561 C CE1 . PHE A 371 ? 0.46176 0.52991 0.52815 -0.06885 -0.02945 0.04884  371 PHE A CE1 
2562 C CE2 . PHE A 371 ? 0.43794 0.54294 0.52069 -0.05213 -0.00030 0.03070  371 PHE A CE2 
2563 C CZ  . PHE A 371 ? 0.39920 0.49203 0.47594 -0.05628 -0.01237 0.03900  371 PHE A CZ  
2564 N N   . LEU A 372 ? 0.57164 0.62538 0.61712 -0.10929 -0.03649 0.05079  372 LEU A N   
2565 C CA  . LEU A 372 ? 0.56718 0.59716 0.60292 -0.12005 -0.05003 0.05218  372 LEU A CA  
2566 C C   . LEU A 372 ? 0.58734 0.62930 0.61586 -0.14683 -0.06022 0.07327  372 LEU A C   
2567 O O   . LEU A 372 ? 0.68368 0.69319 0.70048 -0.16151 -0.08109 0.08138  372 LEU A O   
2568 C CB  . LEU A 372 ? 0.42530 0.46381 0.46266 -0.11118 -0.03884 0.03973  372 LEU A CB  
2569 C CG  . LEU A 372 ? 0.48456 0.50170 0.50978 -0.12287 -0.05240 0.04099  372 LEU A CG  
2570 C CD1 . LEU A 372 ? 0.48458 0.45202 0.49904 -0.11317 -0.06569 0.02764  372 LEU A CD1 
2571 C CD2 . LEU A 372 ? 0.44741 0.48705 0.47395 -0.12015 -0.04071 0.03553  372 LEU A CD2 
2572 N N   . LEU A 373 ? 0.50491 0.59383 0.54044 -0.15376 -0.04638 0.08233  373 LEU A N   
2573 C CA  . LEU A 373 ? 0.58856 0.69826 0.62035 -0.18035 -0.05291 0.10298  373 LEU A CA  
2574 C C   . LEU A 373 ? 0.61325 0.69690 0.63101 -0.19540 -0.06936 0.11722  373 LEU A C   
2575 O O   . LEU A 373 ? 0.64106 0.71027 0.64873 -0.21962 -0.08673 0.13286  373 LEU A O   
2576 C CB  . LEU A 373 ? 0.55775 0.72651 0.60116 -0.18067 -0.03289 0.10722  373 LEU A CB  
2577 C CG  . LEU A 373 ? 0.53015 0.73217 0.57152 -0.20719 -0.03407 0.12876  373 LEU A CG  
2578 C CD1 . LEU A 373 ? 0.47070 0.67828 0.51533 -0.23045 -0.04589 0.14054  373 LEU A CD1 
2579 C CD2 . LEU A 373 ? 0.47768 0.73674 0.52905 -0.20052 -0.01220 0.12834  373 LEU A CD2 
2580 N N   . TYR A 374 ? 0.60400 0.67776 0.61975 -0.18252 -0.06683 0.11279  374 TYR A N   
2581 C CA  . TYR A 374 ? 0.66008 0.70959 0.66000 -0.19766 -0.08365 0.12785  374 TYR A CA  
2582 C C   . TYR A 374 ? 0.74366 0.73213 0.73357 -0.19907 -0.11074 0.12599  374 TYR A C   
2583 O O   . TYR A 374 ? 0.84694 0.81090 0.82022 -0.22243 -0.13178 0.14364  374 TYR A O   
2584 C CB  . TYR A 374 ? 0.65280 0.70940 0.65260 -0.18382 -0.07514 0.12414  374 TYR A CB  
2585 C CG  . TYR A 374 ? 0.71752 0.82096 0.71178 -0.19571 -0.06022 0.13686  374 TYR A CG  
2586 C CD1 . TYR A 374 ? 0.72617 0.88038 0.73297 -0.19219 -0.03884 0.13307  374 TYR A CD1 
2587 C CD2 . TYR A 374 ? 0.76395 0.86044 0.73890 -0.20982 -0.06817 0.15192  374 TYR A CD2 
2588 C CE1 . TYR A 374 ? 0.72742 0.92755 0.73011 -0.20018 -0.02413 0.14189  374 TYR A CE1 
2589 C CE2 . TYR A 374 ? 0.78913 0.93104 0.75596 -0.22005 -0.05234 0.16206  374 TYR A CE2 
2590 C CZ  . TYR A 374 ? 0.75750 0.95288 0.73956 -0.21398 -0.02946 0.15590  374 TYR A CZ  
2591 O OH  . TYR A 374 ? 0.71665 0.96064 0.69220 -0.22095 -0.01250 0.16296  374 TYR A OH  
2592 N N   . ASP A 375 ? 0.74929 0.71206 0.74784 -0.17477 -0.11143 0.10481  375 ASP A N   
2593 C CA  . ASP A 375 ? 0.89723 0.80172 0.88697 -0.17129 -0.13749 0.09970  375 ASP A CA  
2594 C C   . ASP A 375 ? 0.84804 0.72741 0.82773 -0.18363 -0.15282 0.10124  375 ASP A C   
2595 O O   . ASP A 375 ? 0.80809 0.63468 0.77677 -0.18226 -0.17798 0.09752  375 ASP A O   
2596 C CB  . ASP A 375 ? 1.04264 0.93205 1.04690 -0.13910 -0.13185 0.07515  375 ASP A CB  
2597 C CG  . ASP A 375 ? 1.12011 1.00274 1.12900 -0.13020 -0.13623 0.07596  375 ASP A CG  
2598 O OD1 . ASP A 375 ? 1.06977 0.98932 1.08831 -0.12371 -0.11651 0.07536  375 ASP A OD1 
2599 O OD2 . ASP A 375 ? 1.18517 1.02310 1.18701 -0.12968 -0.16166 0.07723  375 ASP A OD2 
2600 N N   . PHE A 376 ? 1.02844 0.68246 0.76118 -0.20286 -0.09587 0.06083  376 PHE A N   
2601 C CA  . PHE A 376 ? 1.07312 0.71654 0.80954 -0.22337 -0.11205 0.05289  376 PHE A CA  
2602 C C   . PHE A 376 ? 1.05549 0.74483 0.82607 -0.26029 -0.10145 0.06104  376 PHE A C   
2603 O O   . PHE A 376 ? 0.93136 0.65852 0.73193 -0.27048 -0.10733 0.05269  376 PHE A O   
2604 C CB  . PHE A 376 ? 0.98663 0.65095 0.73459 -0.19711 -0.12246 0.03550  376 PHE A CB  
2605 C CG  . PHE A 376 ? 0.96020 0.57718 0.67336 -0.16440 -0.13397 0.02594  376 PHE A CG  
2606 C CD1 . PHE A 376 ? 0.88697 0.51635 0.59931 -0.13414 -0.12272 0.02735  376 PHE A CD1 
2607 C CD2 . PHE A 376 ? 1.03320 0.59191 0.71419 -0.16449 -0.15627 0.01508  376 PHE A CD2 
2608 C CE1 . PHE A 376 ? 0.86343 0.45517 0.54771 -0.10418 -0.13240 0.01813  376 PHE A CE1 
2609 C CE2 . PHE A 376 ? 1.06466 0.58243 0.71432 -0.13181 -0.16607 0.00499  376 PHE A CE2 
2610 C CZ  . PHE A 376 ? 0.90657 0.44400 0.55971 -0.10162 -0.15352 0.00668  376 PHE A CZ  
2611 N N   . ILE A 377 ? 1.07075 0.75877 0.83636 -0.28024 -0.08569 0.07731  377 ILE A N   
2612 C CA  . ILE A 377 ? 1.04949 0.79158 0.85067 -0.31278 -0.06987 0.08597  377 ILE A CA  
2613 C C   . ILE A 377 ? 1.13084 0.85800 0.93709 -0.35116 -0.08355 0.08481  377 ILE A C   
2614 O O   . ILE A 377 ? 1.17658 0.95981 1.02278 -0.37811 -0.07438 0.08724  377 ILE A O   
2615 C CB  . ILE A 377 ? 0.99168 0.72993 0.77782 -0.32337 -0.04900 0.10377  377 ILE A CB  
2616 C CG1 . ILE A 377 ? 0.91602 0.72504 0.74416 -0.35055 -0.02753 0.11109  377 ILE A CG1 
2617 C CG2 . ILE A 377 ? 1.06236 0.71723 0.79635 -0.34271 -0.05858 0.11539  377 ILE A CG2 
2618 C CD1 . ILE A 377 ? 0.88014 0.71700 0.70778 -0.34153 -0.00305 0.12100  377 ILE A CD1 
2619 N N   . ASP A 378 ? 1.26538 0.91900 1.03349 -0.35375 -0.10642 0.07967  378 ASP A N   
2620 C CA  . ASP A 378 ? 1.35445 0.99051 1.12754 -0.38954 -0.12314 0.07551  378 ASP A CA  
2621 C C   . ASP A 378 ? 1.21514 0.91035 1.03090 -0.38405 -0.13234 0.05840  378 ASP A C   
2622 O O   . ASP A 378 ? 1.22336 0.94258 1.06631 -0.41835 -0.13854 0.05631  378 ASP A O   
2623 C CB  . ASP A 378 ? 1.48743 1.02554 1.20626 -0.38831 -0.14781 0.07126  378 ASP A CB  
2624 C CG  . ASP A 378 ? 1.58869 1.06486 1.26162 -0.38877 -0.14156 0.08816  378 ASP A CG  
2625 O OD1 . ASP A 378 ? 1.57168 1.05420 1.24692 -0.41436 -0.12850 0.10274  378 ASP A OD1 
2626 O OD2 . ASP A 378 ? 1.64246 1.07978 1.28296 -0.35246 -0.14705 0.08453  378 ASP A OD2 
2627 N N   . TYR A 379 ? 1.09016 0.81062 0.91250 -0.34245 -0.13360 0.04666  379 TYR A N   
2628 C CA  . TYR A 379 ? 1.08460 0.85800 0.94166 -0.33409 -0.14327 0.03156  379 TYR A CA  
2629 C C   . TYR A 379 ? 1.02498 0.88807 0.93435 -0.33225 -0.12337 0.03550  379 TYR A C   
2630 O O   . TYR A 379 ? 0.98322 0.89763 0.92941 -0.33943 -0.13078 0.02666  379 TYR A O   
2631 C CB  . TYR A 379 ? 1.08567 0.84070 0.92099 -0.29054 -0.15511 0.01711  379 TYR A CB  
2632 C CG  . TYR A 379 ? 1.20281 0.87237 0.98544 -0.28139 -0.17374 0.01030  379 TYR A CG  
2633 C CD1 . TYR A 379 ? 1.21164 0.84639 0.97818 -0.28830 -0.19977 -0.00532 379 TYR A CD1 
2634 C CD2 . TYR A 379 ? 1.28103 0.90438 1.02930 -0.26383 -0.16681 0.01803  379 TYR A CD2 
2635 C CE1 . TYR A 379 ? 1.28521 0.83938 1.00188 -0.27681 -0.21743 -0.01343 379 TYR A CE1 
2636 C CE2 . TYR A 379 ? 1.34910 0.89501 1.04990 -0.25189 -0.18478 0.01072  379 TYR A CE2 
2637 C CZ  . TYR A 379 ? 1.30952 0.82011 0.99420 -0.25778 -0.20959 -0.00520 379 TYR A CZ  
2638 O OH  . TYR A 379 ? 1.30730 0.73883 0.94327 -0.24280 -0.22770 -0.01401 379 TYR A OH  
2639 N N   . PHE A 380 ? 0.98126 0.86394 0.89403 -0.32081 -0.09995 0.04722  380 PHE A N   
2640 C CA  . PHE A 380 ? 0.88369 0.84242 0.83803 -0.30325 -0.08371 0.04678  380 PHE A CA  
2641 C C   . PHE A 380 ? 0.82712 0.83122 0.80923 -0.32742 -0.06025 0.05950  380 PHE A C   
2642 O O   . PHE A 380 ? 0.82180 0.79693 0.78715 -0.35733 -0.05373 0.07118  380 PHE A O   
2643 C CB  . PHE A 380 ? 0.82200 0.77181 0.75922 -0.26059 -0.07728 0.04530  380 PHE A CB  
2644 C CG  . PHE A 380 ? 0.82832 0.74720 0.74352 -0.23521 -0.09688 0.03221  380 PHE A CG  
2645 C CD1 . PHE A 380 ? 0.77794 0.71420 0.70750 -0.23941 -0.11494 0.02011  380 PHE A CD1 
2646 C CD2 . PHE A 380 ? 0.80349 0.67800 0.68339 -0.20733 -0.09769 0.03113  380 PHE A CD2 
2647 C CE1 . PHE A 380 ? 0.76517 0.67340 0.67036 -0.21555 -0.13192 0.00764  380 PHE A CE1 
2648 C CE2 . PHE A 380 ? 0.77790 0.62858 0.63774 -0.18364 -0.11345 0.01851  380 PHE A CE2 
2649 C CZ  . PHE A 380 ? 0.75047 0.61665 0.62073 -0.18763 -0.12996 0.00697  380 PHE A CZ  
2650 N N   . ASP A 381 ? 0.76774 0.84378 0.79160 -0.31345 -0.04768 0.05693  381 ASP A N   
2651 C CA  . ASP A 381 ? 0.80720 0.94201 0.86626 -0.33307 -0.02553 0.06493  381 ASP A CA  
2652 C C   . ASP A 381 ? 0.79354 0.97037 0.86889 -0.29903 -0.00851 0.06422  381 ASP A C   
2653 O O   . ASP A 381 ? 0.84769 1.04630 0.93732 -0.26997 -0.01663 0.05460  381 ASP A O   
2654 C CB  . ASP A 381 ? 0.78588 0.97896 0.89321 -0.35902 -0.03259 0.05842  381 ASP A CB  
2655 C CG  . ASP A 381 ? 0.79972 1.05946 0.94667 -0.38090 -0.00823 0.06586  381 ASP A CG  
2656 O OD1 . ASP A 381 ? 0.69085 0.93201 0.82414 -0.41426 0.00443  0.07865  381 ASP A OD1 
2657 O OD2 . ASP A 381 ? 0.82597 1.15612 1.01579 -0.36269 -0.00116 0.05906  381 ASP A OD2 
2658 N N   . LYS A 382 ? 0.75722 0.94144 0.82685 -0.30271 0.01442  0.07454  382 LYS A N   
2659 C CA  . LYS A 382 ? 0.66969 0.88523 0.74963 -0.27085 0.02996  0.07312  382 LYS A CA  
2660 C C   . LYS A 382 ? 0.63133 0.92633 0.76521 -0.26136 0.03457  0.06473  382 LYS A C   
2661 O O   . LYS A 382 ? 0.50852 0.82531 0.65215 -0.22981 0.04104  0.06051  382 LYS A O   
2662 C CB  . LYS A 382 ? 0.62642 0.83422 0.68690 -0.27902 0.05279  0.08467  382 LYS A CB  
2663 C CG  . LYS A 382 ? 0.60410 0.87264 0.69827 -0.30573 0.07262  0.08918  382 LYS A CG  
2664 C CD  . LYS A 382 ? 0.66889 0.93088 0.73893 -0.30951 0.09645  0.09992  382 LYS A CD  
2665 C CE  . LYS A 382 ? 0.76824 1.10837 0.87910 -0.32158 0.12036  0.10005  382 LYS A CE  
2666 N NZ  . LYS A 382 ? 0.84905 1.24575 0.99913 -0.28685 0.12247  0.08632  382 LYS A NZ  
2667 N N   . ASP A 383 ? 0.66014 0.99847 0.82995 -0.28747 0.03021  0.06178  383 ASP A N   
2668 C CA  . ASP A 383 ? 0.63510 1.05404 0.85927 -0.27748 0.03383  0.05320  383 ASP A CA  
2669 C C   . ASP A 383 ? 0.65108 1.08185 0.89256 -0.26350 0.00823  0.04150  383 ASP A C   
2670 O O   . ASP A 383 ? 0.64971 1.11642 0.91318 -0.23260 0.00619  0.03451  383 ASP A O   
2671 C CB  . ASP A 383 ? 0.71115 1.18778 0.97330 -0.31370 0.04811  0.05640  383 ASP A CB  
2672 C CG  . ASP A 383 ? 0.76459 1.25760 1.02155 -0.31726 0.07836  0.06532  383 ASP A CG  
2673 O OD1 . ASP A 383 ? 0.78566 1.27743 1.03938 -0.34834 0.09090  0.07361  383 ASP A OD1 
2674 O OD2 . ASP A 383 ? 0.71212 1.20803 0.96194 -0.28327 0.08796  0.06287  383 ASP A OD2 
2675 N N   . ASP A 384 ? 0.64430 1.04271 0.87336 -0.28484 -0.01232 0.03906  384 ASP A N   
2676 C CA  . ASP A 384 ? 0.54984 0.96418 0.79548 -0.27574 -0.03764 0.02700  384 ASP A CA  
2677 C C   . ASP A 384 ? 0.52590 0.86997 0.72341 -0.25670 -0.05579 0.02401  384 ASP A C   
2678 O O   . ASP A 384 ? 0.49343 0.77357 0.64804 -0.26220 -0.05368 0.03023  384 ASP A O   
2679 C CB  . ASP A 384 ? 0.57822 1.01943 0.85293 -0.31534 -0.05008 0.02270  384 ASP A CB  
2680 C CG  . ASP A 384 ? 0.71159 1.23099 1.03901 -0.33612 -0.03092 0.02499  384 ASP A CG  
2681 O OD1 . ASP A 384 ? 0.72592 1.30447 1.08682 -0.30987 -0.02192 0.02065  384 ASP A OD1 
2682 O OD2 . ASP A 384 ? 0.79377 1.31476 1.12818 -0.37811 -0.02416 0.03128  384 ASP A OD2 
2683 N N   . ALA A 385 ? 0.53688 0.89490 0.74117 -0.23281 -0.07363 0.01429  385 ALA A N   
2684 C CA  . ALA A 385 ? 0.55648 0.85586 0.71765 -0.21619 -0.09168 0.00954  385 ALA A CA  
2685 C C   . ALA A 385 ? 0.60853 0.87282 0.75448 -0.24622 -0.11198 0.00370  385 ALA A C   
2686 O O   . ALA A 385 ? 0.63494 0.93130 0.81191 -0.27814 -0.11710 0.00129  385 ALA A O   
2687 C CB  . ALA A 385 ? 0.45140 0.77633 0.62077 -0.18291 -0.10404 0.00212  385 ALA A CB  
2688 N N   . THR A 386 ? 0.54172 0.73963 0.64013 -0.23624 -0.12354 0.00075  386 THR A N   
2689 C CA  . THR A 386 ? 0.63979 0.79133 0.71507 -0.26036 -0.14443 -0.00631 386 THR A CA  
2690 C C   . THR A 386 ? 0.68000 0.81809 0.73654 -0.23852 -0.16888 -0.02056 386 THR A C   
2691 O O   . THR A 386 ? 0.64225 0.75591 0.66929 -0.20526 -0.16735 -0.02145 386 THR A O   
2692 C CB  . THR A 386 ? 0.67329 0.75240 0.70395 -0.26745 -0.13802 0.00125  386 THR A CB  
2693 O OG1 . THR A 386 ? 0.74046 0.82856 0.78631 -0.30015 -0.12192 0.01323  386 THR A OG1 
2694 C CG2 . THR A 386 ? 0.68543 0.69985 0.67746 -0.27567 -0.16283 -0.00909 386 THR A CG2 
2695 N N   . ALA A 387 ? 0.62839 0.78547 0.70255 -0.25756 -0.19108 -0.03184 387 ALA A N   
2696 C CA  . ALA A 387 ? 0.74595 0.88201 0.79449 -0.24042 -0.21711 -0.04688 387 ALA A CA  
2697 C C   . ALA A 387 ? 0.83550 0.88929 0.83260 -0.24793 -0.22889 -0.05246 387 ALA A C   
2698 O O   . ALA A 387 ? 0.85420 0.88284 0.84956 -0.28146 -0.24336 -0.05769 387 ALA A O   
2699 C CB  . ALA A 387 ? 0.66342 0.84979 0.74882 -0.25699 -0.23909 -0.05854 387 ALA A CB  
2700 N N   . LEU A 388 ? 0.80046 0.81201 0.75607 -0.21626 -0.22300 -0.05178 388 LEU A N   
2701 C CA  . LEU A 388 ? 0.84956 0.78368 0.75650 -0.21679 -0.22968 -0.05574 388 LEU A CA  
2702 C C   . LEU A 388 ? 0.90705 0.80976 0.77888 -0.20042 -0.25513 -0.07454 388 LEU A C   
2703 O O   . LEU A 388 ? 0.95521 0.87748 0.81815 -0.16780 -0.25495 -0.07858 388 LEU A O   
2704 C CB  . LEU A 388 ? 0.91363 0.82585 0.79992 -0.19162 -0.20721 -0.04471 388 LEU A CB  
2705 C CG  . LEU A 388 ? 0.97396 0.81160 0.81223 -0.18372 -0.20955 -0.04668 388 LEU A CG  
2706 C CD1 . LEU A 388 ? 0.93367 0.74939 0.77536 -0.21156 -0.19839 -0.03320 388 LEU A CD1 
2707 C CD2 . LEU A 388 ? 0.94927 0.78591 0.77057 -0.14421 -0.19449 -0.04371 388 LEU A CD2 
2708 N N   . PRO A 389 ? 0.91842 0.77170 0.76761 -0.22186 -0.27737 -0.08639 389 PRO A N   
2709 C CA  . PRO A 389 ? 0.90193 0.72595 0.71588 -0.20592 -0.30324 -0.10697 389 PRO A CA  
2710 C C   . PRO A 389 ? 0.96314 0.73642 0.72599 -0.16940 -0.29897 -0.11191 389 PRO A C   
2711 O O   . PRO A 389 ? 1.08653 0.83452 0.83811 -0.16141 -0.28073 -0.10105 389 PRO A O   
2712 C CB  . PRO A 389 ? 0.94317 0.72530 0.75070 -0.24447 -0.32730 -0.11733 389 PRO A CB  
2713 C CG  . PRO A 389 ? 0.93015 0.73362 0.77716 -0.28279 -0.31274 -0.10044 389 PRO A CG  
2714 C CD  . PRO A 389 ? 0.94740 0.76960 0.80200 -0.26380 -0.28086 -0.08168 389 PRO A CD  
2715 N N   . ARG A 390 ? 1.00149 0.76145 0.73271 -0.14686 -0.31703 -0.12971 390 ARG A N   
2716 C CA  . ARG A 390 ? 0.99438 0.71924 0.68016 -0.10841 -0.31129 -0.13597 390 ARG A CA  
2717 C C   . ARG A 390 ? 1.08598 0.73985 0.74008 -0.11136 -0.31184 -0.13806 390 ARG A C   
2718 O O   . ARG A 390 ? 1.11439 0.75571 0.75603 -0.08896 -0.29304 -0.13042 390 ARG A O   
2719 C CB  . ARG A 390 ? 0.96483 0.68252 0.61703 -0.08772 -0.33294 -0.15689 390 ARG A CB  
2720 C CG  . ARG A 390 ? 0.96978 0.69685 0.59395 -0.04388 -0.31848 -0.15750 390 ARG A CG  
2721 C CD  . ARG A 390 ? 1.13396 0.80433 0.71749 -0.02311 -0.31236 -0.16403 390 ARG A CD  
2722 N NE  . ARG A 390 ? 1.19175 0.86634 0.74252 0.01749  -0.30218 -0.16996 390 ARG A NE  
2723 C CZ  . ARG A 390 ? 1.08548 0.79582 0.64824 0.03818  -0.27508 -0.15473 390 ARG A CZ  
2724 N NH1 . ARG A 390 ? 0.93712 0.68262 0.54315 0.02473  -0.25638 -0.13358 390 ARG A NH1 
2725 N NH2 . ARG A 390 ? 1.01086 0.72262 0.54168 0.07199  -0.26638 -0.16113 390 ARG A NH2 
2726 N N   . ASP A 391 ? 1.11344 0.71911 0.75444 -0.13914 -0.33456 -0.14839 391 ASP A N   
2727 C CA  . ASP A 391 ? 1.19003 0.71940 0.79565 -0.14099 -0.33895 -0.15098 391 ASP A CA  
2728 C C   . ASP A 391 ? 1.10560 0.63725 0.72835 -0.14712 -0.31373 -0.12819 391 ASP A C   
2729 O O   . ASP A 391 ? 1.05995 0.54910 0.65397 -0.12629 -0.30711 -0.12713 391 ASP A O   
2730 C CB  . ASP A 391 ? 1.38161 0.86497 0.98007 -0.17641 -0.36399 -0.16041 391 ASP A CB  
2731 C CG  . ASP A 391 ? 1.46327 0.97626 1.10717 -0.22448 -0.36114 -0.14498 391 ASP A CG  
2732 O OD1 . ASP A 391 ? 1.41741 1.00136 1.10420 -0.22670 -0.34159 -0.13043 391 ASP A OD1 
2733 O OD2 . ASP A 391 ? 1.55218 1.03138 1.19823 -0.25328 -0.36806 -0.14305 391 ASP A OD2 
2734 N N   . LYS A 392 ? 1.09948 0.68267 0.76879 -0.17391 -0.29988 -0.11081 392 LYS A N   
2735 C CA  . LYS A 392 ? 1.21296 0.79920 0.89666 -0.18169 -0.27654 -0.08969 392 LYS A CA  
2736 C C   . LYS A 392 ? 1.14423 0.77407 0.83963 -0.14819 -0.25167 -0.08047 392 LYS A C   
2737 O O   . LYS A 392 ? 1.29807 0.91936 0.99357 -0.14453 -0.23432 -0.06680 392 LYS A O   
2738 C CB  . LYS A 392 ? 1.24515 0.86596 0.97106 -0.22537 -0.27102 -0.07590 392 LYS A CB  
2739 C CG  . LYS A 392 ? 1.43922 0.99357 1.14491 -0.26079 -0.28305 -0.07288 392 LYS A CG  
2740 C CD  . LYS A 392 ? 1.51893 1.10296 1.26316 -0.31020 -0.28491 -0.06510 392 LYS A CD  
2741 C CE  . LYS A 392 ? 1.66415 1.17582 1.38374 -0.34663 -0.29262 -0.05725 392 LYS A CE  
2742 N NZ  . LYS A 392 ? 1.71990 1.14621 1.38269 -0.32176 -0.29901 -0.06007 392 LYS A NZ  
2743 N N   . TYR A 393 ? 0.94543 0.61802 0.64769 -0.12402 -0.25070 -0.08761 393 TYR A N   
2744 C CA  . TYR A 393 ? 0.84292 0.54182 0.54535 -0.08931 -0.23011 -0.08165 393 TYR A CA  
2745 C C   . TYR A 393 ? 0.91508 0.56082 0.57465 -0.06165 -0.23187 -0.09056 393 TYR A C   
2746 O O   . TYR A 393 ? 0.87906 0.52261 0.53833 -0.04683 -0.21480 -0.08128 393 TYR A O   
2747 C CB  . TYR A 393 ? 0.83147 0.58187 0.54563 -0.07174 -0.23038 -0.08631 393 TYR A CB  
2748 C CG  . TYR A 393 ? 0.85326 0.62224 0.55839 -0.03515 -0.21280 -0.08319 393 TYR A CG  
2749 C CD1 . TYR A 393 ? 0.84291 0.65269 0.57747 -0.02947 -0.18923 -0.06644 393 TYR A CD1 
2750 C CD2 . TYR A 393 ? 0.91396 0.65990 0.58087 -0.00714 -0.21939 -0.09748 393 TYR A CD2 
2751 C CE1 . TYR A 393 ? 0.76980 0.59537 0.49760 0.00026  -0.17342 -0.06300 393 TYR A CE1 
2752 C CE2 . TYR A 393 ? 0.91616 0.68257 0.57671 0.02329  -0.20152 -0.09365 393 TYR A CE2 
2753 C CZ  . TYR A 393 ? 0.85928 0.66446 0.55110 0.02539  -0.17895 -0.07590 393 TYR A CZ  
2754 O OH  . TYR A 393 ? 0.87755 0.70128 0.56400 0.05221  -0.16160 -0.07172 393 TYR A OH  
2755 N N   . LEU A 394 ? 0.95829 0.56097 0.58167 -0.05392 -0.25367 -0.11003 394 LEU A N   
2756 C CA  . LEU A 394 ? 0.95449 0.50583 0.53693 -0.02595 -0.25699 -0.12114 394 LEU A CA  
2757 C C   . LEU A 394 ? 1.10074 0.60402 0.67503 -0.03802 -0.25559 -0.11202 394 LEU A C   
2758 O O   . LEU A 394 ? 1.03054 0.52260 0.59506 -0.01477 -0.24397 -0.10854 394 LEU A O   
2759 C CB  . LEU A 394 ? 1.01057 0.51943 0.55406 -0.01850 -0.28318 -0.14544 394 LEU A CB  
2760 C CG  . LEU A 394 ? 1.10330 0.65004 0.64414 -0.00623 -0.28986 -0.15713 394 LEU A CG  
2761 C CD1 . LEU A 394 ? 1.15025 0.65985 0.67140 -0.02596 -0.32096 -0.17536 394 LEU A CD1 
2762 C CD2 . LEU A 394 ? 1.09784 0.65037 0.60987 0.03698  -0.28135 -0.16791 394 LEU A CD2 
2763 N N   . GLU A 395 ? 1.19221 0.66717 0.77013 -0.07526 -0.26792 -0.10763 395 GLU A N   
2764 C CA  . GLU A 395 ? 1.21722 0.64036 0.78189 -0.09049 -0.26834 -0.09709 395 GLU A CA  
2765 C C   . GLU A 395 ? 1.17187 0.62873 0.75959 -0.08476 -0.24231 -0.07707 395 GLU A C   
2766 O O   . GLU A 395 ? 1.20338 0.62071 0.77038 -0.07363 -0.23994 -0.07229 395 GLU A O   
2767 C CB  . GLU A 395 ? 1.29888 0.70176 0.87194 -0.13742 -0.28160 -0.09227 395 GLU A CB  
2768 C CG  . GLU A 395 ? 1.36581 0.69506 0.91163 -0.15786 -0.29011 -0.08455 395 GLU A CG  
2769 C CD  . GLU A 395 ? 1.36905 0.71112 0.94223 -0.20808 -0.28687 -0.06814 395 GLU A CD  
2770 O OE1 . GLU A 395 ? 1.32158 0.69960 0.91941 -0.21755 -0.26439 -0.04829 395 GLU A OE1 
2771 O OE2 . GLU A 395 ? 1.41949 0.74202 0.99234 -0.23735 -0.30515 -0.07527 395 GLU A OE2 
2772 N N   . ILE A 396 ? 1.06559 0.59392 0.69466 -0.09024 -0.22415 -0.06628 396 ILE A N   
2773 C CA  . ILE A 396 ? 1.04175 0.60139 0.69270 -0.08674 -0.20054 -0.04855 396 ILE A CA  
2774 C C   . ILE A 396 ? 1.01026 0.58649 0.65640 -0.04662 -0.18886 -0.05231 396 ILE A C   
2775 O O   . ILE A 396 ? 0.97518 0.53874 0.61566 -0.03491 -0.17959 -0.04506 396 ILE A O   
2776 C CB  . ILE A 396 ? 0.96165 0.58792 0.65832 -0.10805 -0.18621 -0.03639 396 ILE A CB  
2777 C CG1 . ILE A 396 ? 1.03750 0.65111 0.74352 -0.15083 -0.19134 -0.02792 396 ILE A CG1 
2778 C CG2 . ILE A 396 ? 0.82904 0.49367 0.54656 -0.09404 -0.16203 -0.02306 396 ILE A CG2 
2779 C CD1 . ILE A 396 ? 1.02693 0.71019 0.78033 -0.17147 -0.17997 -0.01987 396 ILE A CD1 
2780 N N   . MET A 397 ? 1.02708 0.63441 0.67610 -0.02618 -0.18886 -0.06300 397 MET A N   
2781 C CA  . MET A 397 ? 0.92746 0.55216 0.57164 0.01001  -0.17705 -0.06703 397 MET A CA  
2782 C C   . MET A 397 ? 0.89500 0.46499 0.50351 0.03141  -0.18620 -0.07766 397 MET A C   
2783 O O   . MET A 397 ? 0.80870 0.38388 0.41935 0.05123  -0.17465 -0.07393 397 MET A O   
2784 C CB  . MET A 397 ? 0.83408 0.49139 0.47760 0.02621  -0.17811 -0.07730 397 MET A CB  
2785 C CG  . MET A 397 ? 0.78342 0.49857 0.46215 0.01372  -0.16835 -0.06673 397 MET A CG  
2786 S SD  . MET A 397 ? 0.72820 0.49064 0.44036 0.02246  -0.14028 -0.04860 397 MET A SD  
2787 C CE  . MET A 397 ? 0.70914 0.48269 0.40469 0.06071  -0.13068 -0.05629 397 MET A CE  
2788 N N   . ASN A 398 ? 0.89030 0.40765 0.46606 0.02908  -0.20840 -0.09244 398 ASN A N   
2789 C CA  . ASN A 398 ? 0.98455 0.44472 0.52389 0.05181  -0.21979 -0.10442 398 ASN A CA  
2790 C C   . ASN A 398 ? 1.06657 0.49613 0.60389 0.04386  -0.21737 -0.09076 398 ASN A C   
2791 O O   . ASN A 398 ? 1.14912 0.54993 0.66691 0.06995  -0.22007 -0.09640 398 ASN A O   
2792 C CB  . ASN A 398 ? 1.14350 0.54480 0.64682 0.04591  -0.24642 -0.12216 398 ASN A CB  
2793 C CG  . ASN A 398 ? 1.16903 0.58616 0.65768 0.06940  -0.25156 -0.14199 398 ASN A CG  
2794 O OD1 . ASN A 398 ? 1.09007 0.53965 0.57970 0.10148  -0.23786 -0.14705 398 ASN A OD1 
2795 N ND2 . ASN A 398 ? 1.27311 0.66732 0.74679 0.05277  -0.27160 -0.15363 398 ASN A ND2 
2796 N N   . ASN A 399 ? 1.04938 0.48615 0.60580 0.00917  -0.21246 -0.07312 399 ASN A N   
2797 C CA  . ASN A 399 ? 1.03590 0.44604 0.58755 0.00046  -0.20857 -0.05812 399 ASN A CA  
2798 C C   . ASN A 399 ? 0.94033 0.39747 0.51544 0.02075  -0.18775 -0.04971 399 ASN A C   
2799 O O   . ASN A 399 ? 0.93159 0.36396 0.49166 0.04057  -0.18916 -0.04957 399 ASN A O   
2800 C CB  . ASN A 399 ? 1.12310 0.53158 0.68746 -0.04352 -0.20708 -0.04194 399 ASN A CB  
2801 C CG  . ASN A 399 ? 1.16937 0.53906 0.71820 -0.05500 -0.20525 -0.02596 399 ASN A CG  
2802 O OD1 . ASN A 399 ? 1.06439 0.46143 0.62627 -0.04376 -0.18971 -0.01597 399 ASN A OD1 
2803 N ND2 . ASN A 399 ? 1.24452 0.54731 0.76268 -0.07770 -0.22213 -0.02345 399 ASN A ND2 
2804 N N   . ILE A 400 ? 0.84289 0.36661 0.45498 0.01596  -0.16988 -0.04300 400 ILE A N   
2805 C CA  . ILE A 400 ? 0.88358 0.45198 0.52062 0.03004  -0.15026 -0.03426 400 ILE A CA  
2806 C C   . ILE A 400 ? 0.96052 0.53116 0.58906 0.06793  -0.14934 -0.04634 400 ILE A C   
2807 O O   . ILE A 400 ? 0.92855 0.50216 0.56088 0.08213  -0.14331 -0.04238 400 ILE A O   
2808 C CB  . ILE A 400 ? 0.84996 0.48349 0.52480 0.01970  -0.13405 -0.02714 400 ILE A CB  
2809 C CG1 . ILE A 400 ? 0.70437 0.34512 0.39423 -0.01598 -0.13150 -0.01423 400 ILE A CG1 
2810 C CG2 . ILE A 400 ? 0.74528 0.42282 0.44394 0.03786  -0.11546 -0.02174 400 ILE A CG2 
2811 C CD1 . ILE A 400 ? 0.68346 0.38300 0.40751 -0.02451 -0.12124 -0.01105 400 ILE A CD1 
2812 N N   . PHE A 401 ? 0.93691 0.50828 0.55384 0.08511  -0.15546 -0.06198 401 PHE A N   
2813 C CA  . PHE A 401 ? 0.94192 0.52482 0.55358 0.12116  -0.15170 -0.07455 401 PHE A CA  
2814 C C   . PHE A 401 ? 1.13580 0.65905 0.70802 0.14041  -0.17185 -0.09159 401 PHE A C   
2815 O O   . PHE A 401 ? 1.15630 0.68629 0.71796 0.16999  -0.17210 -0.10759 401 PHE A O   
2816 C CB  . PHE A 401 ? 0.78109 0.41418 0.40686 0.13071  -0.14012 -0.07940 401 PHE A CB  
2817 C CG  . PHE A 401 ? 0.70611 0.39198 0.36796 0.11386  -0.12252 -0.06325 401 PHE A CG  
2818 C CD1 . PHE A 401 ? 0.73606 0.43198 0.40667 0.08890  -0.12527 -0.05734 401 PHE A CD1 
2819 C CD2 . PHE A 401 ? 0.72932 0.45359 0.41722 0.12294  -0.10469 -0.05478 401 PHE A CD2 
2820 C CE1 . PHE A 401 ? 0.70290 0.44549 0.40620 0.07638  -0.11027 -0.04356 401 PHE A CE1 
2821 C CE2 . PHE A 401 ? 0.74558 0.51209 0.46423 0.10844  -0.08997 -0.04078 401 PHE A CE2 
2822 C CZ  . PHE A 401 ? 0.71368 0.48877 0.43922 0.08663  -0.09268 -0.03532 401 PHE A CZ  
2823 N N   . GLY A 402 ? 1.22387 0.68742 0.77283 0.12450  -0.18824 -0.08799 402 GLY A N   
2824 C CA  . GLY A 402 ? 1.31228 0.70799 0.81980 0.14070  -0.21054 -0.10357 402 GLY A CA  
2825 C C   . GLY A 402 ? 1.33558 0.72543 0.83454 0.18028  -0.21162 -0.11407 402 GLY A C   
2826 O O   . GLY A 402 ? 1.36234 0.71818 0.83524 0.20133  -0.22631 -0.12882 402 GLY A O   
2827 N N   . LYS A 403 ? 1.34409 0.77832 0.87183 0.18873  -0.19549 -0.10420 403 LYS A N   
2828 C CA  . LYS A 403 ? 1.48397 0.92390 1.01173 0.22576  -0.19587 -0.11410 403 LYS A CA  
2829 C C   . LYS A 403 ? 1.40369 0.90644 0.95380 0.25188  -0.17936 -0.12620 403 LYS A C   
2830 O O   . LYS A 403 ? 1.38884 0.91337 0.94696 0.27973  -0.17789 -0.13411 403 LYS A O   
2831 C CB  . LYS A 403 ? 1.51636 0.96758 1.06169 0.22104  -0.19022 -0.09820 403 LYS A CB  
2832 C CG  . LYS A 403 ? 1.60408 0.99028 1.11900 0.20915  -0.20864 -0.08908 403 LYS A CG  
2833 C CD  . LYS A 403 ? 1.62211 1.01163 1.14804 0.18416  -0.20090 -0.06778 403 LYS A CD  
2834 C CE  . LYS A 403 ? 1.52576 0.95990 1.07933 0.15128  -0.18320 -0.05639 403 LYS A CE  
2835 N NZ  . LYS A 403 ? 1.51611 0.95978 1.08087 0.12572  -0.17406 -0.03606 403 LYS A NZ  
2836 N N   . ALA A 404 ? 1.31528 0.85970 0.88133 0.23817  -0.16558 -0.12323 404 ALA A N   
2837 C CA  . ALA A 404 ? 1.11106 0.70804 0.69006 0.26077  -0.15013 -0.13378 404 ALA A CA  
2838 C C   . ALA A 404 ? 1.00690 0.57196 0.54933 0.28090  -0.16329 -0.15590 404 ALA A C   
2839 O O   . ALA A 404 ? 1.03207 0.54413 0.54716 0.26709  -0.18264 -0.15856 404 ALA A O   
2840 C CB  . ALA A 404 ? 1.03322 0.68344 0.63963 0.23926  -0.13112 -0.12017 404 ALA A CB  
2841 N N   . THR A 405 ? 0.94371 0.55586 0.49710 0.30601  -0.15066 -0.16450 405 THR A N   
2842 C CA  . THR A 405 ? 1.05348 0.65916 0.58443 0.32009  -0.15737 -0.17866 405 THR A CA  
2843 C C   . THR A 405 ? 1.18199 0.76456 0.69115 0.29938  -0.16485 -0.18041 405 THR A C   
2844 O O   . THR A 405 ? 1.21189 0.81049 0.72972 0.27919  -0.15648 -0.17159 405 THR A O   
2845 C CB  . THR A 405 ? 1.07181 0.74387 0.62193 0.34292  -0.13554 -0.18368 405 THR A CB  
2846 O OG1 . THR A 405 ? 1.02841 0.72315 0.59976 0.36086  -0.13200 -0.18449 405 THR A OG1 
2847 C CG2 . THR A 405 ? 1.24733 0.91798 0.77337 0.35727  -0.13917 -0.19767 405 THR A CG2 
2848 N N   . GLN A 406 ? 1.31066 0.85684 0.79200 0.30343  -0.18216 -0.19195 406 GLN A N   
2849 C CA  . GLN A 406 ? 1.37673 0.90820 0.84098 0.28347  -0.19026 -0.19460 406 GLN A CA  
2850 C C   . GLN A 406 ? 1.22469 0.81337 0.69523 0.29104  -0.17113 -0.19588 406 GLN A C   
2851 O O   . GLN A 406 ? 1.15965 0.75674 0.62777 0.27074  -0.17143 -0.19130 406 GLN A O   
2852 C CB  . GLN A 406 ? 1.52522 1.00390 0.95937 0.28506  -0.21383 -0.20685 406 GLN A CB  
2853 C CG  . GLN A 406 ? 1.67540 1.13247 1.09722 0.25570  -0.22674 -0.20718 406 GLN A CG  
2854 C CD  . GLN A 406 ? 1.80522 1.20475 1.19956 0.25100  -0.25166 -0.21779 406 GLN A CD  
2855 O OE1 . GLN A 406 ? 1.83584 1.23438 1.21266 0.27261  -0.25567 -0.23219 406 GLN A OE1 
2856 N NE2 . GLN A 406 ? 1.80645 1.15763 1.19635 0.22147  -0.26808 -0.21024 406 GLN A NE2 
2857 N N   . ALA A 407 ? 1.10930 0.74055 0.58879 0.31833  -0.15434 -0.20025 407 ALA A N   
2858 C CA  . ALA A 407 ? 1.00944 0.69768 0.49701 0.32290  -0.13232 -0.19628 407 ALA A CA  
2859 C C   . ALA A 407 ? 1.03272 0.75636 0.54585 0.30755  -0.11485 -0.17965 407 ALA A C   
2860 O O   . ALA A 407 ? 1.09889 0.85833 0.61340 0.30218  -0.10141 -0.17240 407 ALA A O   
2861 C CB  . ALA A 407 ? 0.94962 0.67814 0.44417 0.35167  -0.11635 -0.20265 407 ALA A CB  
2862 N N   . GLU A 408 ? 0.85603 0.57052 0.38839 0.30071  -0.11480 -0.17232 408 GLU A N   
2863 C CA  . GLU A 408 ? 0.89648 0.64671 0.46691 0.27394  -0.10086 -0.14757 408 GLU A CA  
2864 C C   . GLU A 408 ? 1.01416 0.73700 0.58222 0.24185  -0.11600 -0.13849 408 GLU A C   
2865 O O   . GLU A 408 ? 1.02758 0.78117 0.61258 0.22390  -0.10743 -0.12440 408 GLU A O   
2866 C CB  . GLU A 408 ? 0.92258 0.68375 0.52447 0.27355  -0.09353 -0.13791 408 GLU A CB  
2867 C CG  . GLU A 408 ? 1.01605 0.80503 0.62620 0.30436  -0.08149 -0.14821 408 GLU A CG  
2868 C CD  . GLU A 408 ? 0.95200 0.73896 0.58702 0.30481  -0.08288 -0.14232 408 GLU A CD  
2869 O OE1 . GLU A 408 ? 0.86414 0.63293 0.49067 0.32734  -0.09275 -0.15546 408 GLU A OE1 
2870 O OE2 . GLU A 408 ? 0.93379 0.73796 0.59733 0.28140  -0.07557 -0.12339 408 GLU A OE2 
2871 N N   . ARG A 409 ? 1.07878 0.74423 0.62708 0.23428  -0.13851 -0.14604 409 ARG A N   
2872 C CA  . ARG A 409 ? 1.06073 0.69888 0.60484 0.20295  -0.15436 -0.14038 409 ARG A CA  
2873 C C   . ARG A 409 ? 1.08864 0.74391 0.62045 0.19934  -0.15718 -0.14540 409 ARG A C   
2874 O O   . ARG A 409 ? 1.12845 0.80675 0.67995 0.17549  -0.15525 -0.13213 409 ARG A O   
2875 C CB  . ARG A 409 ? 1.12729 0.69434 0.64138 0.19977  -0.17951 -0.15221 409 ARG A CB  
2876 C CG  . ARG A 409 ? 1.12952 0.66973 0.65690 0.17014  -0.18595 -0.13648 409 ARG A CG  
2877 C CD  . ARG A 409 ? 1.22473 0.68775 0.71578 0.16761  -0.21163 -0.14810 409 ARG A CD  
2878 N NE  . ARG A 409 ? 1.29438 0.73086 0.76543 0.20221  -0.21554 -0.16126 409 ARG A NE  
2879 C CZ  . ARG A 409 ? 1.43818 0.83622 0.88529 0.21566  -0.23159 -0.17260 409 ARG A CZ  
2880 N NH1 . ARG A 409 ? 1.44985 0.81622 0.87850 0.19918  -0.24819 -0.17879 409 ARG A NH1 
2881 N NH2 . ARG A 409 ? 1.51895 0.91561 0.96407 0.24488  -0.23125 -0.17687 409 ARG A NH2 
2882 N N   . GLU A 410 ? 1.07998 0.72554 0.57804 0.22492  -0.16219 -0.16536 410 GLU A N   
2883 C CA  . GLU A 410 ? 1.08543 0.74642 0.56560 0.22491  -0.16594 -0.17133 410 GLU A CA  
2884 C C   . GLU A 410 ? 0.96721 0.69051 0.47437 0.22139  -0.14284 -0.15261 410 GLU A C   
2885 O O   . GLU A 410 ? 1.00323 0.74207 0.51243 0.20658  -0.14746 -0.14651 410 GLU A O   
2886 C CB  . GLU A 410 ? 1.04464 0.69477 0.49329 0.25423  -0.16899 -0.19126 410 GLU A CB  
2887 C CG  . GLU A 410 ? 1.11097 0.70245 0.53792 0.25269  -0.19430 -0.20610 410 GLU A CG  
2888 C CD  . GLU A 410 ? 1.34462 0.93533 0.75120 0.28279  -0.19338 -0.22145 410 GLU A CD  
2889 O OE1 . GLU A 410 ? 1.36571 0.99836 0.77925 0.30644  -0.17187 -0.22053 410 GLU A OE1 
2890 O OE2 . GLU A 410 ? 1.43817 0.98717 0.82209 0.28179  -0.21422 -0.23443 410 GLU A OE2 
2891 N N   . ALA A 411 ? 0.87284 0.63134 0.40127 0.23472  -0.11916 -0.14345 411 ALA A N   
2892 C CA  . ALA A 411 ? 0.85189 0.66383 0.40117 0.23292  -0.09701 -0.12618 411 ALA A CA  
2893 C C   . ALA A 411 ? 0.81852 0.64616 0.40540 0.20459  -0.09402 -0.10487 411 ALA A C   
2894 O O   . ALA A 411 ? 0.96922 0.82506 0.56517 0.19603  -0.08806 -0.09274 411 ALA A O   
2895 C CB  . ALA A 411 ? 0.75751 0.60245 0.31895 0.25399  -0.07284 -0.12410 411 ALA A CB  
2896 N N   . ILE A 412 ? 0.71097 0.52057 0.31805 0.19180  -0.09780 -0.10020 412 ILE A N   
2897 C CA  . ILE A 412 ? 0.76739 0.58868 0.40654 0.16516  -0.09630 -0.08268 412 ILE A CA  
2898 C C   . ILE A 412 ? 0.83646 0.64737 0.46834 0.14638  -0.11402 -0.08436 412 ILE A C   
2899 O O   . ILE A 412 ? 0.92800 0.76897 0.57904 0.13451  -0.10969 -0.07226 412 ILE A O   
2900 C CB  . ILE A 412 ? 0.80128 0.59904 0.45462 0.15589  -0.09896 -0.07927 412 ILE A CB  
2901 C CG1 . ILE A 412 ? 0.75976 0.57406 0.42428 0.17549  -0.08295 -0.07851 412 ILE A CG1 
2902 C CG2 . ILE A 412 ? 0.71066 0.52119 0.39444 0.12830  -0.09661 -0.06240 412 ILE A CG2 
2903 C CD1 . ILE A 412 ? 0.79282 0.57080 0.45176 0.17959  -0.09236 -0.08444 412 ILE A CD1 
2904 N N   . ILE A 413 ? 0.84216 0.61007 0.44654 0.14415  -0.13552 -0.10036 413 ILE A N   
2905 C CA  . ILE A 413 ? 0.91871 0.67572 0.51847 0.12340  -0.15518 -0.10401 413 ILE A CA  
2906 C C   . ILE A 413 ? 0.89420 0.68408 0.48704 0.13056  -0.15452 -0.10393 413 ILE A C   
2907 O O   . ILE A 413 ? 0.97535 0.78519 0.58602 0.11261  -0.16104 -0.09675 413 ILE A O   
2908 C CB  . ILE A 413 ? 0.97219 0.67213 0.53826 0.12222  -0.17919 -0.12354 413 ILE A CB  
2909 C CG1 . ILE A 413 ? 0.89809 0.56228 0.47246 0.10738  -0.18286 -0.11878 413 ILE A CG1 
2910 C CG2 . ILE A 413 ? 0.84822 0.54093 0.40500 0.10473  -0.20100 -0.13166 413 ILE A CG2 
2911 C CD1 . ILE A 413 ? 1.03731 0.63815 0.57874 0.10171  -0.20809 -0.13543 413 ILE A CD1 
2912 N N   . PHE A 414 ? 0.80337 0.60131 0.36996 0.15755  -0.14636 -0.11149 414 PHE A N   
2913 C CA  . PHE A 414 ? 0.83632 0.66363 0.39131 0.16523  -0.14473 -0.10890 414 PHE A CA  
2914 C C   . PHE A 414 ? 0.81095 0.68224 0.39964 0.16014  -0.12470 -0.08576 414 PHE A C   
2915 O O   . PHE A 414 ? 0.81407 0.70696 0.40880 0.15349  -0.12955 -0.07816 414 PHE A O   
2916 C CB  . PHE A 414 ? 0.86943 0.69381 0.38325 0.19509  -0.13931 -0.12246 414 PHE A CB  
2917 C CG  . PHE A 414 ? 0.82613 0.67527 0.31875 0.20414  -0.13876 -0.11975 414 PHE A CG  
2918 C CD1 . PHE A 414 ? 0.86707 0.70102 0.33360 0.20051  -0.16392 -0.13293 414 PHE A CD1 
2919 C CD2 . PHE A 414 ? 0.80266 0.68815 0.29959 0.21560  -0.11428 -0.10376 414 PHE A CD2 
2920 C CE1 . PHE A 414 ? 0.88289 0.73910 0.33010 0.20934  -0.16426 -0.12924 414 PHE A CE1 
2921 C CE2 . PHE A 414 ? 0.82254 0.72633 0.29443 0.22439  -0.11427 -0.09925 414 PHE A CE2 
2922 C CZ  . PHE A 414 ? 0.86085 0.75055 0.31034 0.22132  -0.13902 -0.11147 414 PHE A CZ  
2923 N N   . GLN A 415 ? 0.68718 0.57080 0.29786 0.16386  -0.10386 -0.07514 415 GLN A N   
2924 C CA  . GLN A 415 ? 0.64139 0.56110 0.28277 0.15883  -0.08564 -0.05425 415 GLN A CA  
2925 C C   . GLN A 415 ? 0.81590 0.74407 0.48887 0.13507  -0.09378 -0.04443 415 GLN A C   
2926 O O   . GLN A 415 ? 0.85241 0.80873 0.54634 0.13204  -0.08397 -0.02919 415 GLN A O   
2927 C CB  . GLN A 415 ? 0.63225 0.56071 0.29244 0.16532  -0.06467 -0.04754 415 GLN A CB  
2928 C CG  . GLN A 415 ? 0.63383 0.59253 0.32850 0.15735  -0.04703 -0.02710 415 GLN A CG  
2929 C CD  . GLN A 415 ? 0.66898 0.65315 0.35409 0.16947  -0.03152 -0.01697 415 GLN A CD  
2930 O OE1 . GLN A 415 ? 0.66668 0.64953 0.31793 0.18407  -0.03290 -0.02446 415 GLN A OE1 
2931 N NE2 . GLN A 415 ? 0.59961 0.60464 0.31181 0.16329  -0.01659 0.00037  415 GLN A NE2 
2932 N N   . TYR A 416 ? 0.76314 0.66770 0.43960 0.11814  -0.11130 -0.05283 416 TYR A N   
2933 C CA  . TYR A 416 ? 0.75142 0.66932 0.46031 0.09454  -0.11704 -0.04423 416 TYR A CA  
2934 C C   . TYR A 416 ? 0.88347 0.79394 0.58494 0.08093  -0.14146 -0.05474 416 TYR A C   
2935 O O   . TYR A 416 ? 1.05685 0.97329 0.78463 0.05795  -0.14837 -0.05146 416 TYR A O   
2936 C CB  . TYR A 416 ? 0.62221 0.52654 0.35253 0.07970  -0.11144 -0.03957 416 TYR A CB  
2937 C CG  . TYR A 416 ? 0.63437 0.55630 0.38273 0.08851  -0.08893 -0.02719 416 TYR A CG  
2938 C CD1 . TYR A 416 ? 0.65428 0.56385 0.38857 0.10561  -0.07963 -0.03141 416 TYR A CD1 
2939 C CD2 . TYR A 416 ? 0.59773 0.55028 0.37785 0.08100  -0.07771 -0.01263 416 TYR A CD2 
2940 C CE1 . TYR A 416 ? 0.64138 0.56970 0.39481 0.11208  -0.06029 -0.02105 416 TYR A CE1 
2941 C CE2 . TYR A 416 ? 0.51510 0.48090 0.31093 0.08810  -0.05859 -0.00249 416 TYR A CE2 
2942 C CZ  . TYR A 416 ? 0.52959 0.48386 0.31264 0.10239  -0.05032 -0.00663 416 TYR A CZ  
2943 O OH  . TYR A 416 ? 0.50136 0.47098 0.30206 0.10785  -0.03286 0.00226  416 TYR A OH  
2944 N N   . THR A 417 ? 0.77127 0.67136 0.43829 0.09378  -0.15462 -0.06772 417 THR A N   
2945 C CA  . THR A 417 ? 0.86886 0.76810 0.53182 0.08072  -0.17942 -0.07770 417 THR A CA  
2946 C C   . THR A 417 ? 0.88960 0.83278 0.57551 0.07932  -0.17956 -0.06628 417 THR A C   
2947 O O   . THR A 417 ? 0.80190 0.76493 0.48068 0.09801  -0.16668 -0.05654 417 THR A O   
2948 C CB  . THR A 417 ? 0.91207 0.78405 0.52735 0.09606  -0.19578 -0.09728 417 THR A CB  
2949 O OG1 . THR A 417 ? 1.12470 1.00414 0.71457 0.12409  -0.17898 -0.09485 417 THR A OG1 
2950 C CG2 . THR A 417 ? 0.88090 0.70316 0.47740 0.08960  -0.20752 -0.11291 417 THR A CG2 
2951 N N   . SER A 418 ? 0.94864 0.90718 0.66326 0.05682  -0.19380 -0.06690 418 SER A N   
2952 C CA  . SER A 418 ? 0.89368 0.89480 0.63205 0.05649  -0.19859 -0.05910 418 SER A CA  
2953 C C   . SER A 418 ? 0.87563 0.87756 0.58426 0.06653  -0.22159 -0.07149 418 SER A C   
2954 O O   . SER A 418 ? 0.90616 0.87776 0.58659 0.06304  -0.23941 -0.08903 418 SER A O   
2955 C CB  . SER A 418 ? 1.02014 1.04465 0.80503 0.02875  -0.20422 -0.05633 418 SER A CB  
2956 O OG  . SER A 418 ? 1.13607 1.18227 0.95357 0.02722  -0.18192 -0.04014 418 SER A OG  
2957 N N   . TRP A 419 ? 0.96816 1.00211 0.68039 0.08025  -0.22232 -0.06255 419 TRP A N   
2958 C CA  . TRP A 419 ? 1.17731 1.21927 0.86613 0.08867  -0.24732 -0.07288 419 TRP A CA  
2959 C C   . TRP A 419 ? 1.31716 1.40425 1.03929 0.08798  -0.25669 -0.06450 419 TRP A C   
2960 O O   . TRP A 419 ? 1.34663 1.44563 1.05810 0.09092  -0.28221 -0.07445 419 TRP A O   
2961 C CB  . TRP A 419 ? 1.11118 1.13631 0.74532 0.11743  -0.24188 -0.07307 419 TRP A CB  
2962 C CG  . TRP A 419 ? 1.08113 1.06441 0.67440 0.12224  -0.24348 -0.08972 419 TRP A CG  
2963 C CD1 . TRP A 419 ? 1.13242 1.09096 0.69819 0.11780  -0.26949 -0.11228 419 TRP A CD1 
2964 C CD2 . TRP A 419 ? 0.93685 0.89835 0.51233 0.13414  -0.21928 -0.08669 419 TRP A CD2 
2965 N NE1 . TRP A 419 ? 1.11228 1.03240 0.64229 0.12824  -0.26248 -0.12363 419 TRP A NE1 
2966 C CE2 . TRP A 419 ? 0.99862 0.92271 0.53567 0.13872  -0.23164 -0.10827 419 TRP A CE2 
2967 C CE3 . TRP A 419 ? 0.87038 0.84122 0.45963 0.14170  -0.18952 -0.06899 419 TRP A CE3 
2968 C CZ2 . TRP A 419 ? 0.91233 0.81166 0.42642 0.15273  -0.21459 -0.11268 419 TRP A CZ2 
2969 C CZ3 . TRP A 419 ? 0.91129 0.85989 0.47996 0.15300  -0.17288 -0.07307 419 TRP A CZ3 
2970 C CH2 . TRP A 419 ? 0.94967 0.86461 0.48176 0.15958  -0.18523 -0.09478 419 TRP A CH2 
2971 N N   . GLU A 420 ? 1.45477 1.56719 1.21625 0.08563  -0.23860 -0.04809 420 GLU A N   
2972 C CA  . GLU A 420 ? 1.62565 1.78116 1.42002 0.08936  -0.24578 -0.04005 420 GLU A CA  
2973 C C   . GLU A 420 ? 1.76876 1.95262 1.62083 0.06464  -0.24294 -0.03954 420 GLU A C   
2974 O O   . GLU A 420 ? 1.54932 1.71773 1.41409 0.04904  -0.22660 -0.03767 420 GLU A O   
2975 C CB  . GLU A 420 ? 1.66646 1.82666 1.45250 0.11304  -0.22637 -0.02046 420 GLU A CB  
2976 C CG  . GLU A 420 ? 1.69789 1.84121 1.49142 0.11077  -0.19589 -0.00920 420 GLU A CG  
2977 C CD  . GLU A 420 ? 1.67590 1.83264 1.48277 0.12520  -0.17877 0.00995  420 GLU A CD  
2978 O OE1 . GLU A 420 ? 1.60263 1.74779 1.41766 0.12327  -0.15522 0.01888  420 GLU A OE1 
2979 O OE2 . GLU A 420 ? 1.67411 1.85066 1.48203 0.13897  -0.19035 0.01556  420 GLU A OE2 
2980 N N   . GLY A 421 ? 1.98308 2.21052 1.86925 0.06225  -0.25898 -0.04122 421 GLY A N   
2981 C CA  . GLY A 421 ? 2.01009 2.27341 1.95290 0.03861  -0.25738 -0.04237 421 GLY A CA  
2982 C C   . GLY A 421 ? 2.04754 2.30691 1.99968 0.00843  -0.27553 -0.05882 421 GLY A C   
2983 O O   . GLY A 421 ? 2.14601 2.37564 2.06126 0.00759  -0.29376 -0.07163 421 GLY A O   
2984 N N   . ASN A 422 ? 1.92166 2.21095 1.92308 -0.01733 -0.27027 -0.05862 422 ASN A N   
2985 C CA  . ASN A 422 ? 1.75109 2.03131 1.76316 -0.05177 -0.28293 -0.07104 422 ASN A CA  
2986 C C   . ASN A 422 ? 1.54562 1.76647 1.52504 -0.06084 -0.26765 -0.06904 422 ASN A C   
2987 O O   . ASN A 422 ? 1.41055 1.62537 1.39780 -0.05968 -0.24163 -0.05627 422 ASN A O   
2988 C CB  . ASN A 422 ? 1.69966 2.03423 1.77493 -0.07797 -0.27983 -0.06994 422 ASN A CB  
2989 C CG  . ASN A 422 ? 1.62730 2.01537 1.73553 -0.08285 -0.30815 -0.08183 422 ASN A CG  
2990 O OD1 . ASN A 422 ? 1.59723 1.97073 1.68038 -0.08214 -0.33542 -0.09541 422 ASN A OD1 
2991 N ND2 . ASN A 422 ? 1.54902 2.00102 1.71410 -0.08690 -0.30241 -0.07805 422 ASN A ND2 
2992 N N   . PRO A 423 ? 1.42003 1.59506 1.36134 -0.06794 -0.28416 -0.08227 423 PRO A N   
2993 C CA  . PRO A 423 ? 1.31004 1.42523 1.21069 -0.06390 -0.27096 -0.08097 423 PRO A CA  
2994 C C   . PRO A 423 ? 1.20897 1.30849 1.12842 -0.09055 -0.25507 -0.07407 423 PRO A C   
2995 O O   . PRO A 423 ? 1.18933 1.25123 1.08478 -0.08191 -0.23800 -0.06790 423 PRO A O   
2996 C CB  . PRO A 423 ? 1.34885 1.42294 1.20673 -0.06452 -0.29718 -0.10015 423 PRO A CB  
2997 C CG  . PRO A 423 ? 1.34424 1.45860 1.21462 -0.06211 -0.32320 -0.10982 423 PRO A CG  
2998 C CD  . PRO A 423 ? 1.34754 1.52283 1.28037 -0.07801 -0.31722 -0.10061 423 PRO A CD  
2999 N N   . GLY A 424 ? 1.16389 1.29280 1.12511 -0.12238 -0.25975 -0.07446 424 GLY A N   
3000 C CA  . GLY A 424 ? 1.07798 1.18925 1.05204 -0.15053 -0.24546 -0.06704 424 GLY A CA  
3001 C C   . GLY A 424 ? 1.00145 1.12523 0.98875 -0.13998 -0.21486 -0.05008 424 GLY A C   
3002 O O   . GLY A 424 ? 0.93224 1.01224 0.89452 -0.13847 -0.20134 -0.04421 424 GLY A O   
3003 N N   . TYR A 425 ? 0.88884 1.07166 0.91489 -0.13113 -0.20530 -0.04320 425 TYR A N   
3004 C CA  . TYR A 425 ? 0.76892 0.96412 0.80742 -0.11987 -0.17761 -0.02886 425 TYR A CA  
3005 C C   . TYR A 425 ? 0.73576 0.89546 0.73584 -0.08835 -0.16779 -0.02447 425 TYR A C   
3006 O O   . TYR A 425 ? 0.71004 0.85579 0.70606 -0.08321 -0.14713 -0.01477 425 TYR A O   
3007 C CB  . TYR A 425 ? 0.68465 0.94774 0.76994 -0.11263 -0.17194 -0.02484 425 TYR A CB  
3008 C CG  . TYR A 425 ? 0.70906 1.02013 0.84169 -0.14376 -0.17634 -0.02817 425 TYR A CG  
3009 C CD1 . TYR A 425 ? 0.72083 1.01075 0.85395 -0.18041 -0.17739 -0.02933 425 TYR A CD1 
3010 C CD2 . TYR A 425 ? 0.66935 1.04779 0.84711 -0.13664 -0.17892 -0.02966 425 TYR A CD2 
3011 C CE1 . TYR A 425 ? 0.62887 0.96668 0.80781 -0.21206 -0.17931 -0.03133 425 TYR A CE1 
3012 C CE2 . TYR A 425 ? 0.60381 1.03425 0.82987 -0.16509 -0.18152 -0.03345 425 TYR A CE2 
3013 C CZ  . TYR A 425 ? 0.59660 1.00815 0.82397 -0.20417 -0.18071 -0.03391 425 TYR A CZ  
3014 O OH  . TYR A 425 ? 0.58141 1.04854 0.85912 -0.23522 -0.18155 -0.03681 425 TYR A OH  
3015 N N   . GLN A 426 ? 0.77035 0.91643 0.74158 -0.06779 -0.18218 -0.03174 426 GLN A N   
3016 C CA  . GLN A 426 ? 0.75583 0.87499 0.69346 -0.03902 -0.17096 -0.02696 426 GLN A CA  
3017 C C   . GLN A 426 ? 0.67906 0.74308 0.58261 -0.04198 -0.16640 -0.02954 426 GLN A C   
3018 O O   . GLN A 426 ? 0.63646 0.68484 0.52801 -0.02705 -0.14877 -0.02201 426 GLN A O   
3019 C CB  . GLN A 426 ? 0.83527 0.95871 0.74972 -0.01637 -0.18604 -0.03292 426 GLN A CB  
3020 C CG  . GLN A 426 ? 0.97191 1.14517 0.91491 -0.00381 -0.18682 -0.02652 426 GLN A CG  
3021 C CD  . GLN A 426 ? 1.00598 1.19612 0.97261 0.00388  -0.16191 -0.01190 426 GLN A CD  
3022 O OE1 . GLN A 426 ? 0.98837 1.21848 0.99584 -0.00371 -0.15809 -0.00849 426 GLN A OE1 
3023 N NE2 . GLN A 426 ? 0.95354 1.11456 0.89531 0.01905  -0.14507 -0.00449 426 GLN A NE2 
3024 N N   . ASN A 427 ? 0.62915 0.66242 0.51732 -0.06070 -0.18331 -0.04068 427 ASN A N   
3025 C CA  . ASN A 427 ? 0.66268 0.64028 0.51808 -0.06208 -0.18100 -0.04364 427 ASN A CA  
3026 C C   . ASN A 427 ? 0.69416 0.66820 0.56390 -0.06984 -0.15956 -0.03050 427 ASN A C   
3027 O O   . ASN A 427 ? 0.70305 0.65333 0.55357 -0.05289 -0.14718 -0.02674 427 ASN A O   
3028 C CB  . ASN A 427 ? 0.74891 0.69186 0.58974 -0.08579 -0.20340 -0.05648 427 ASN A CB  
3029 C CG  . ASN A 427 ? 0.79402 0.71694 0.60043 -0.07082 -0.22481 -0.07310 427 ASN A CG  
3030 O OD1 . ASN A 427 ? 0.77117 0.68683 0.55053 -0.04082 -0.21965 -0.07510 427 ASN A OD1 
3031 N ND2 . ASN A 427 ? 0.73785 0.65234 0.54436 -0.09251 -0.24876 -0.08551 427 ASN A ND2 
3032 N N   . GLN A 428 ? 0.73165 0.73240 0.63571 -0.09518 -0.15485 -0.02388 428 GLN A N   
3033 C CA  . GLN A 428 ? 0.59958 0.60090 0.51602 -0.10257 -0.13408 -0.01129 428 GLN A CA  
3034 C C   . GLN A 428 ? 0.56764 0.58978 0.49037 -0.07573 -0.11563 -0.00318 428 GLN A C   
3035 O O   . GLN A 428 ? 0.50122 0.50082 0.41109 -0.06756 -0.10258 0.00253  428 GLN A O   
3036 C CB  . GLN A 428 ? 0.58791 0.62710 0.54318 -0.13189 -0.13015 -0.00605 428 GLN A CB  
3037 C CG  . GLN A 428 ? 0.59982 0.65096 0.57045 -0.13800 -0.10697 0.00689  428 GLN A CG  
3038 C CD  . GLN A 428 ? 0.61045 0.70736 0.62103 -0.16574 -0.10161 0.01081  428 GLN A CD  
3039 O OE1 . GLN A 428 ? 0.59955 0.74547 0.64193 -0.16651 -0.10822 0.00611  428 GLN A OE1 
3040 N NE2 . GLN A 428 ? 0.55732 0.63983 0.56592 -0.18853 -0.08993 0.01938  428 GLN A NE2 
3041 N N   . GLN A 429 ? 0.60484 0.66844 0.54676 -0.06180 -0.11581 -0.00268 429 GLN A N   
3042 C CA  . GLN A 429 ? 0.57410 0.65268 0.52020 -0.03747 -0.09979 0.00533  429 GLN A CA  
3043 C C   . GLN A 429 ? 0.61664 0.65824 0.52749 -0.01729 -0.09654 0.00394  429 GLN A C   
3044 O O   . GLN A 429 ? 0.76464 0.80039 0.67470 -0.00717 -0.08068 0.01087  429 GLN A O   
3045 C CB  . GLN A 429 ? 0.48785 0.60781 0.45263 -0.02413 -0.10469 0.00580  429 GLN A CB  
3046 C CG  . GLN A 429 ? 0.49655 0.66380 0.50453 -0.03598 -0.10031 0.00932  429 GLN A CG  
3047 C CD  . GLN A 429 ? 0.58435 0.75262 0.60615 -0.04465 -0.07994 0.01722  429 GLN A CD  
3048 O OE1 . GLN A 429 ? 0.60299 0.78433 0.64362 -0.06833 -0.07720 0.01747  429 GLN A OE1 
3049 N NE2 . GLN A 429 ? 0.57837 0.73318 0.58989 -0.02651 -0.06551 0.02371  429 GLN A NE2 
3050 N N   . GLN A 430 ? 0.56810 0.58559 0.45011 -0.01157 -0.11162 -0.00624 430 GLN A N   
3051 C CA  . GLN A 430 ? 0.61258 0.60340 0.46339 0.01033  -0.10713 -0.00871 430 GLN A CA  
3052 C C   . GLN A 430 ? 0.67692 0.63069 0.51360 0.00667  -0.10178 -0.00943 430 GLN A C   
3053 O O   . GLN A 430 ? 0.74982 0.69520 0.57703 0.02363  -0.08995 -0.00684 430 GLN A O   
3054 C CB  . GLN A 430 ? 0.64294 0.62039 0.46407 0.02029  -0.12433 -0.02094 430 GLN A CB  
3055 C CG  . GLN A 430 ? 0.65014 0.66162 0.47680 0.03352  -0.12653 -0.01765 430 GLN A CG  
3056 C CD  . GLN A 430 ? 0.79856 0.81024 0.60769 0.05862  -0.11199 -0.01153 430 GLN A CD  
3057 O OE1 . GLN A 430 ? 0.95469 0.94325 0.73149 0.07181  -0.11300 -0.01897 430 GLN A OE1 
3058 N NE2 . GLN A 430 ? 0.81911 0.85610 0.65024 0.06460  -0.09715 0.00195  430 GLN A NE2 
3059 N N   . ILE A 431 ? 0.60544 0.53648 0.44039 -0.01560 -0.11090 -0.01250 431 ILE A N   
3060 C CA  . ILE A 431 ? 0.63971 0.53290 0.45929 -0.01826 -0.10684 -0.01124 431 ILE A CA  
3061 C C   . ILE A 431 ? 0.66794 0.58034 0.50846 -0.01677 -0.08723 0.00115  431 ILE A C   
3062 O O   . ILE A 431 ? 0.69353 0.58713 0.52255 -0.00476 -0.07990 0.00262  431 ILE A O   
3063 C CB  . ILE A 431 ? 0.69591 0.55665 0.50695 -0.04514 -0.12026 -0.01426 431 ILE A CB  
3064 C CG1 . ILE A 431 ? 0.68758 0.53127 0.48078 -0.04917 -0.14209 -0.02815 431 ILE A CG1 
3065 C CG2 . ILE A 431 ? 0.60041 0.41383 0.38709 -0.04283 -0.11890 -0.01311 431 ILE A CG2 
3066 C CD1 . ILE A 431 ? 0.70681 0.50657 0.48506 -0.07510 -0.15745 -0.03243 431 ILE A CD1 
3067 N N   . GLY A 432 ? 0.68412 0.63554 0.55605 -0.02757 -0.07945 0.00880  432 GLY A N   
3068 C CA  . GLY A 432 ? 0.60982 0.57988 0.50032 -0.02450 -0.06149 0.01870  432 GLY A CA  
3069 C C   . GLY A 432 ? 0.57425 0.55069 0.46216 0.00067  -0.05163 0.02036  432 GLY A C   
3070 O O   . GLY A 432 ? 0.64468 0.61088 0.53006 0.00705  -0.04205 0.02375  432 GLY A O   
3071 N N   . ARG A 433 ? 0.51114 0.50485 0.39908 0.01429  -0.05427 0.01838  433 ARG A N   
3072 C CA  . ARG A 433 ? 0.51301 0.51209 0.39680 0.03559  -0.04407 0.02126  433 ARG A CA  
3073 C C   . ARG A 433 ? 0.51936 0.48857 0.37940 0.04606  -0.04400 0.01553  433 ARG A C   
3074 O O   . ARG A 433 ? 0.58822 0.55894 0.45276 0.05552  -0.03243 0.01911  433 ARG A O   
3075 C CB  . ARG A 433 ? 0.63691 0.65300 0.51584 0.04763  -0.04845 0.02074  433 ARG A CB  
3076 C CG  . ARG A 433 ? 0.73626 0.78270 0.63680 0.04138  -0.05319 0.02420  433 ARG A CG  
3077 C CD  . ARG A 433 ? 0.84417 0.90722 0.74108 0.05931  -0.05109 0.02947  433 ARG A CD  
3078 N NE  . ARG A 433 ? 0.97384 1.05792 0.87724 0.05793  -0.06502 0.02754  433 ARG A NE  
3079 C CZ  . ARG A 433 ? 1.13240 1.24401 1.06598 0.04899  -0.06738 0.02963  433 ARG A CZ  
3080 N NH1 . ARG A 433 ? 1.15936 1.27906 1.11652 0.04023  -0.05542 0.03383  433 ARG A NH1 
3081 N NH2 . ARG A 433 ? 1.18765 1.32112 1.12784 0.04980  -0.08220 0.02650  433 ARG A NH2 
3082 N N   . ALA A 434 ? 0.54351 0.48599 0.37893 0.04544  -0.05793 0.00536  434 ALA A N   
3083 C CA  . ALA A 434 ? 0.51538 0.42897 0.32761 0.05857  -0.05957 -0.00226 434 ALA A CA  
3084 C C   . ALA A 434 ? 0.60971 0.50938 0.42763 0.05462  -0.05377 0.00184  434 ALA A C   
3085 O O   . ALA A 434 ? 0.65259 0.55147 0.46919 0.06968  -0.04637 0.00091  434 ALA A O   
3086 C CB  . ALA A 434 ? 0.51562 0.39593 0.29964 0.05617  -0.07807 -0.01487 434 ALA A CB  
3087 N N   . VAL A 435 ? 0.63381 0.52451 0.45808 0.03406  -0.05704 0.00645  435 VAL A N   
3088 C CA  . VAL A 435 ? 0.63387 0.50925 0.45847 0.02973  -0.05244 0.01129  435 VAL A CA  
3089 C C   . VAL A 435 ? 0.56995 0.47463 0.41680 0.03862  -0.03654 0.01804  435 VAL A C   
3090 O O   . VAL A 435 ? 0.50095 0.39899 0.34477 0.05141  -0.03292 0.01657  435 VAL A O   
3091 C CB  . VAL A 435 ? 0.62868 0.49419 0.45553 0.00385  -0.05579 0.01708  435 VAL A CB  
3092 C CG1 . VAL A 435 ? 0.47163 0.32736 0.29815 0.00049  -0.04837 0.02413  435 VAL A CG1 
3093 C CG2 . VAL A 435 ? 0.74661 0.57158 0.54749 -0.00654 -0.07301 0.01044  435 VAL A CG2 
3094 N N   . GLY A 436 ? 0.52255 0.45990 0.39282 0.03245  -0.02822 0.02455  436 GLY A N   
3095 C CA  . GLY A 436 ? 0.49604 0.45643 0.38653 0.03909  -0.01449 0.03051  436 GLY A CA  
3096 C C   . GLY A 436 ? 0.48808 0.45611 0.37865 0.05780  -0.00891 0.02864  436 GLY A C   
3097 O O   . GLY A 436 ? 0.45611 0.42772 0.35496 0.06419  -0.00147 0.03000  436 GLY A O   
3098 N N   . ASP A 437 ? 0.51459 0.48650 0.39553 0.06600  -0.01237 0.02527  437 ASP A N   
3099 C CA  . ASP A 437 ? 0.55199 0.53389 0.43093 0.08258  -0.00483 0.02434  437 ASP A CA  
3100 C C   . ASP A 437 ? 0.61348 0.58048 0.48341 0.09281  -0.00562 0.01715  437 ASP A C   
3101 O O   . ASP A 437 ? 0.69107 0.67192 0.57406 0.10048  0.00424  0.01880  437 ASP A O   
3102 C CB  . ASP A 437 ? 0.50684 0.49184 0.36922 0.08976  -0.00966 0.02102  437 ASP A CB  
3103 C CG  . ASP A 437 ? 0.59604 0.60161 0.46941 0.08545  -0.00794 0.02909  437 ASP A CG  
3104 O OD1 . ASP A 437 ? 0.58826 0.60579 0.48359 0.07779  -0.00214 0.03645  437 ASP A OD1 
3105 O OD2 . ASP A 437 ? 0.69299 0.70219 0.55146 0.09148  -0.01318 0.02734  437 ASP A OD2 
3106 N N   . HIS A 438 ? 0.57018 0.50857 0.41850 0.09332  -0.01842 0.00860  438 HIS A N   
3107 C CA  . HIS A 438 ? 0.57010 0.49384 0.40768 0.10797  -0.02139 -0.00000 438 HIS A CA  
3108 C C   . HIS A 438 ? 0.58661 0.50521 0.43520 0.10492  -0.02018 0.00305  438 HIS A C   
3109 O O   . HIS A 438 ? 0.61541 0.54061 0.46987 0.11850  -0.01738 -0.00130 438 HIS A O   
3110 C CB  . HIS A 438 ? 0.46242 0.35035 0.26964 0.11138  -0.03761 -0.01084 438 HIS A CB  
3111 C CG  . HIS A 438 ? 0.55120 0.41332 0.34511 0.12428  -0.04539 -0.01919 438 HIS A CG  
3112 N ND1 . HIS A 438 ? 0.63235 0.50825 0.42892 0.14637  -0.04038 -0.02704 438 HIS A ND1 
3113 C CD2 . HIS A 438 ? 0.60234 0.42631 0.38030 0.11882  -0.05803 -0.02035 438 HIS A CD2 
3114 C CE1 . HIS A 438 ? 0.54512 0.39325 0.32900 0.15644  -0.05127 -0.03416 438 HIS A CE1 
3115 N NE2 . HIS A 438 ? 0.59891 0.41183 0.36879 0.14003  -0.06256 -0.02953 438 HIS A NE2 
3116 N N   . PHE A 439 ? 0.52632 0.43646 0.37829 0.08774  -0.02201 0.01001  439 PHE A N   
3117 C CA  . PHE A 439 ? 0.55728 0.45537 0.41029 0.08487  -0.02354 0.01219  439 PHE A CA  
3118 C C   . PHE A 439 ? 0.59371 0.51917 0.47248 0.08156  -0.01142 0.01867  439 PHE A C   
3119 O O   . PHE A 439 ? 0.56595 0.48595 0.44639 0.08370  -0.01270 0.01834  439 PHE A O   
3120 C CB  . PHE A 439 ? 0.51144 0.38077 0.34780 0.06719  -0.03185 0.01624  439 PHE A CB  
3121 C CG  . PHE A 439 ? 0.60093 0.42979 0.40750 0.06944  -0.04706 0.00979  439 PHE A CG  
3122 C CD1 . PHE A 439 ? 0.49457 0.29545 0.28384 0.08206  -0.05618 0.00503  439 PHE A CD1 
3123 C CD2 . PHE A 439 ? 0.65818 0.47529 0.45351 0.05981  -0.05411 0.00755  439 PHE A CD2 
3124 C CE1 . PHE A 439 ? 0.57482 0.33210 0.33381 0.08593  -0.07177 -0.00143 439 PHE A CE1 
3125 C CE2 . PHE A 439 ? 0.73178 0.50581 0.49762 0.06131  -0.06971 0.00053  439 PHE A CE2 
3126 C CZ  . PHE A 439 ? 0.65869 0.40033 0.40510 0.07496  -0.07845 -0.00380 439 PHE A CZ  
3127 N N   . PHE A 440 ? 0.55709 0.50843 0.45356 0.07690  -0.00154 0.02409  440 PHE A N   
3128 C CA  . PHE A 440 ? 0.32549 0.29648 0.24399 0.07325  0.00845  0.02948  440 PHE A CA  
3129 C C   . PHE A 440 ? 0.31011 0.30642 0.24648 0.07959  0.01882  0.03236  440 PHE A C   
3130 O O   . PHE A 440 ? 0.39690 0.40401 0.34601 0.08598  0.02394  0.03105  440 PHE A O   
3131 C CB  . PHE A 440 ? 0.32047 0.29309 0.24236 0.05842  0.01033  0.03517  440 PHE A CB  
3132 C CG  . PHE A 440 ? 0.38970 0.33878 0.29449 0.04895  0.00366  0.03519  440 PHE A CG  
3133 C CD1 . PHE A 440 ? 0.39921 0.34343 0.30368 0.04822  0.00522  0.03574  440 PHE A CD1 
3134 C CD2 . PHE A 440 ? 0.36301 0.29288 0.24989 0.03975  -0.00464 0.03505  440 PHE A CD2 
3135 C CE1 . PHE A 440 ? 0.41859 0.33886 0.30222 0.03931  -0.00020 0.03772  440 PHE A CE1 
3136 C CE2 . PHE A 440 ? 0.50262 0.40710 0.37083 0.02865  -0.00995 0.03740  440 PHE A CE2 
3137 C CZ  . PHE A 440 ? 0.54686 0.44623 0.41186 0.02877  -0.00712 0.03957  440 PHE A CZ  
3138 N N   . THR A 441 ? 0.32435 0.32990 0.26117 0.07735  0.02124  0.03666  441 THR A N   
3139 C CA  . THR A 441 ? 0.40235 0.42731 0.35307 0.08109  0.03131  0.04285  441 THR A CA  
3140 C C   . THR A 441 ? 0.42622 0.45954 0.37653 0.09179  0.03680  0.04073  441 THR A C   
3141 O O   . THR A 441 ? 0.42760 0.47436 0.39459 0.09242  0.04636  0.04478  441 THR A O   
3142 C CB  . THR A 441 ? 0.46864 0.49921 0.41464 0.07921  0.02953  0.04735  441 THR A CB  
3143 O OG1 . THR A 441 ? 0.34372 0.37380 0.29540 0.06903  0.02582  0.04845  441 THR A OG1 
3144 C CG2 . THR A 441 ? 0.29179 0.33652 0.24732 0.08372  0.03894  0.05599  441 THR A CG2 
3145 N N   . CYS A 442 ? 0.38474 0.41077 0.31652 0.09995  0.03119  0.03371  442 CYS A N   
3146 C CA  . CYS A 442 ? 0.43057 0.47094 0.36272 0.11142  0.03899  0.03128  442 CYS A CA  
3147 C C   . CYS A 442 ? 0.54470 0.59022 0.48947 0.11708  0.03956  0.02445  442 CYS A C   
3148 O O   . CYS A 442 ? 0.53180 0.59984 0.49187 0.12137  0.05032  0.02537  442 CYS A O   
3149 C CB  . CYS A 442 ? 0.35597 0.38914 0.26233 0.12097  0.03367  0.02485  442 CYS A CB  
3150 S SG  . CYS A 442 ? 0.55054 0.58578 0.44527 0.11608  0.03305  0.03342  442 CYS A SG  
3151 N N   . PRO A 443 ? 0.57853 0.60530 0.51827 0.11678  0.02820  0.01814  443 PRO A N   
3152 C CA  . PRO A 443 ? 0.44094 0.47536 0.39703 0.12102  0.02747  0.01331  443 PRO A CA  
3153 C C   . PRO A 443 ? 0.37476 0.42750 0.35776 0.11149  0.03683  0.02008  443 PRO A C   
3154 O O   . PRO A 443 ? 0.31071 0.38484 0.31427 0.11515  0.04216  0.01730  443 PRO A O   
3155 C CB  . PRO A 443 ? 0.37740 0.38158 0.31675 0.11915  0.01281  0.00936  443 PRO A CB  
3156 C CG  . PRO A 443 ? 0.47582 0.45776 0.38844 0.12066  0.00518  0.00691  443 PRO A CG  
3157 C CD  . PRO A 443 ? 0.52546 0.52242 0.44143 0.11457  0.01444  0.01402  443 PRO A CD  
3158 N N   . THR A 444 ? 0.34665 0.39233 0.33112 0.09956  0.03853  0.02790  444 THR A N   
3159 C CA  . THR A 444 ? 0.40257 0.46007 0.40942 0.09133  0.04664  0.03372  444 THR A CA  
3160 C C   . THR A 444 ? 0.45597 0.53361 0.47536 0.09175  0.05942  0.03983  444 THR A C   
3161 O O   . THR A 444 ? 0.50075 0.59359 0.54212 0.08839  0.06560  0.04025  444 THR A O   
3162 C CB  . THR A 444 ? 0.44496 0.49193 0.44870 0.08234  0.04660  0.04000  444 THR A CB  
3163 O OG1 . THR A 444 ? 0.42096 0.45138 0.41267 0.07924  0.03748  0.03595  444 THR A OG1 
3164 C CG2 . THR A 444 ? 0.25643 0.31057 0.28083 0.07615  0.05390  0.04463  444 THR A CG2 
3165 N N   . ASN A 445 ? 0.42632 0.50359 0.43100 0.09429  0.06329  0.04538  445 ASN A N   
3166 C CA  . ASN A 445 ? 0.51538 0.60897 0.52504 0.09459  0.07639  0.05335  445 ASN A CA  
3167 C C   . ASN A 445 ? 0.45209 0.56844 0.47552 0.09976  0.08316  0.04767  445 ASN A C   
3168 O O   . ASN A 445 ? 0.45287 0.58636 0.49640 0.09298  0.09453  0.05352  445 ASN A O   
3169 C CB  . ASN A 445 ? 0.60264 0.69184 0.58718 0.10040  0.07658  0.05729  445 ASN A CB  
3170 C CG  . ASN A 445 ? 0.57791 0.67442 0.56134 0.09755  0.08878  0.07091  445 ASN A CG  
3171 O OD1 . ASN A 445 ? 0.58320 0.69502 0.56241 0.10169  0.09955  0.07344  445 ASN A OD1 
3172 N ND2 . ASN A 445 ? 0.49265 0.57772 0.47801 0.09141  0.08736  0.07996  445 ASN A ND2 
3173 N N   . GLU A 446 ? 0.42928 0.54633 0.44349 0.11159  0.07590  0.03586  446 GLU A N   
3174 C CA  . GLU A 446 ? 0.52431 0.66855 0.55285 0.12016  0.08247  0.02871  446 GLU A CA  
3175 C C   . GLU A 446 ? 0.46364 0.62365 0.52506 0.11299  0.08282  0.02631  446 GLU A C   
3176 O O   . GLU A 446 ? 0.28331 0.47309 0.36870 0.10914  0.09514  0.02833  446 GLU A O   
3177 C CB  . GLU A 446 ? 0.64019 0.77689 0.65050 0.13734  0.07170  0.01490  446 GLU A CB  
3178 C CG  . GLU A 446 ? 0.84035 1.00822 0.85790 0.15113  0.08132  0.00736  446 GLU A CG  
3179 C CD  . GLU A 446 ? 1.03353 1.19028 1.03436 0.17105  0.06814  -0.00856 446 GLU A CD  
3180 O OE1 . GLU A 446 ? 1.07221 1.20428 1.06878 0.17192  0.05179  -0.01366 446 GLU A OE1 
3181 O OE2 . GLU A 446 ? 1.07958 1.24950 1.06852 0.18631  0.07395  -0.01579 446 GLU A OE2 
3182 N N   . TYR A 447 ? 0.44320 0.58432 0.50565 0.10994  0.06943  0.02205  447 TYR A N   
3183 C CA  . TYR A 447 ? 0.48971 0.64339 0.58046 0.10368  0.06662  0.01804  447 TYR A CA  
3184 C C   . TYR A 447 ? 0.50049 0.66126 0.61110 0.08688  0.07785  0.02863  447 TYR A C   
3185 O O   . TYR A 447 ? 0.45782 0.64158 0.59812 0.07985  0.08212  0.02678  447 TYR A O   
3186 C CB  . TYR A 447 ? 0.35998 0.48784 0.43997 0.10408  0.05022  0.01243  447 TYR A CB  
3187 C CG  . TYR A 447 ? 0.32892 0.47018 0.43150 0.10475  0.04211  0.00340  447 TYR A CG  
3188 C CD1 . TYR A 447 ? 0.40046 0.57235 0.52340 0.11462  0.04227  -0.00534 447 TYR A CD1 
3189 C CD2 . TYR A 447 ? 0.33016 0.45612 0.43428 0.09646  0.03385  0.00247  447 TYR A CD2 
3190 C CE1 . TYR A 447 ? 0.50395 0.69174 0.65040 0.11593  0.03228  -0.01487 447 TYR A CE1 
3191 C CE2 . TYR A 447 ? 0.30158 0.43954 0.42461 0.09756  0.02395  -0.00696 447 TYR A CE2 
3192 C CZ  . TYR A 447 ? 0.47400 0.64319 0.61919 0.10702  0.02226  -0.01552 447 TYR A CZ  
3193 O OH  . TYR A 447 ? 0.53882 0.72326 0.70512 0.10880  0.01018  -0.02591 447 TYR A OH  
3194 N N   . ALA A 448 ? 0.37950 0.51981 0.47466 0.08028  0.08150  0.03940  448 ALA A N   
3195 C CA  . ALA A 448 ? 0.30097 0.44060 0.41014 0.06622  0.09100  0.05028  448 ALA A CA  
3196 C C   . ALA A 448 ? 0.37579 0.54246 0.49969 0.06186  0.10691  0.05681  448 ALA A C   
3197 O O   . ALA A 448 ? 0.43348 0.61226 0.58359 0.04879  0.11314  0.05980  448 ALA A O   
3198 C CB  . ALA A 448 ? 0.26606 0.38052 0.35375 0.06471  0.09104  0.06016  448 ALA A CB  
3199 N N   . GLN A 449 ? 0.35747 0.53462 0.46438 0.07195  0.11385  0.05844  449 GLN A N   
3200 C CA  . GLN A 449 ? 0.35100 0.55858 0.46983 0.06890  0.13120  0.06397  449 GLN A CA  
3201 C C   . GLN A 449 ? 0.33917 0.58183 0.49267 0.06851  0.13211  0.05256  449 GLN A C   
3202 O O   . GLN A 449 ? 0.38793 0.65602 0.56824 0.05519  0.14522  0.05814  449 GLN A O   
3203 C CB  . GLN A 449 ? 0.39201 0.60387 0.48160 0.08306  0.13698  0.06473  449 GLN A CB  
3204 C CG  . GLN A 449 ? 0.44817 0.63215 0.50720 0.08192  0.13718  0.07750  449 GLN A CG  
3205 C CD  . GLN A 449 ? 0.50814 0.69221 0.53463 0.09716  0.13783  0.07487  449 GLN A CD  
3206 O OE1 . GLN A 449 ? 0.57335 0.78235 0.59635 0.10289  0.15119  0.07472  449 GLN A OE1 
3207 N NE2 . GLN A 449 ? 0.38406 0.54178 0.38663 0.10357  0.12340  0.07176  449 GLN A NE2 
3208 N N   . ALA A 450 ? 0.28354 0.52789 0.43768 0.08234  0.11745  0.03687  450 ALA A N   
3209 C CA  . ALA A 450 ? 0.32998 0.60960 0.51803 0.08509  0.11524  0.02458  450 ALA A CA  
3210 C C   . ALA A 450 ? 0.41975 0.70301 0.63967 0.06624  0.11211  0.02562  450 ALA A C   
3211 O O   . ALA A 450 ? 0.44058 0.76145 0.69672 0.05759  0.11979  0.02326  450 ALA A O   
3212 C CB  . ALA A 450 ? 0.27028 0.54243 0.44688 0.10550  0.09701  0.00858  450 ALA A CB  
3213 N N   . LEU A 451 ? 0.37794 0.62419 0.58586 0.05919  0.10111  0.02828  451 LEU A N   
3214 C CA  . LEU A 451 ? 0.38751 0.63260 0.62181 0.04278  0.09596  0.02675  451 LEU A CA  
3215 C C   . LEU A 451 ? 0.40596 0.66022 0.65913 0.02209  0.11287  0.04029  451 LEU A C   
3216 O O   . LEU A 451 ? 0.39402 0.67506 0.68350 0.00843  0.11572  0.03731  451 LEU A O   
3217 C CB  . LEU A 451 ? 0.30667 0.51002 0.52002 0.04192  0.08223  0.02588  451 LEU A CB  
3218 C CG  . LEU A 451 ? 0.36133 0.55347 0.55742 0.05791  0.06468  0.01336  451 LEU A CG  
3219 C CD1 . LEU A 451 ? 0.34104 0.49399 0.50672 0.05885  0.05767  0.01649  451 LEU A CD1 
3220 C CD2 . LEU A 451 ? 0.42250 0.63081 0.64317 0.05743  0.05164  0.00006  451 LEU A CD2 
3221 N N   . ALA A 452 ? 0.36410 0.59636 0.59276 0.01897  0.12371  0.05576  452 ALA A N   
3222 C CA  . ALA A 452 ? 0.41062 0.64399 0.65093 -0.00088 0.13947  0.07130  452 ALA A CA  
3223 C C   . ALA A 452 ? 0.39648 0.67804 0.66231 -0.00673 0.15662  0.07312  452 ALA A C   
3224 O O   . ALA A 452 ? 0.43945 0.73285 0.73019 -0.02840 0.16781  0.08182  452 ALA A O   
3225 C CB  . ALA A 452 ? 0.31119 0.51131 0.51580 0.00094  0.14594  0.08765  452 ALA A CB  
3226 N N   . GLU A 453 ? 0.32431 0.63480 0.58564 0.01189  0.15892  0.06419  453 GLU A N   
3227 C CA  . GLU A 453 ? 0.37553 0.73861 0.66377 0.00885  0.17619  0.06344  453 GLU A CA  
3228 C C   . GLU A 453 ? 0.38174 0.78125 0.71977 -0.00088 0.17015  0.05064  453 GLU A C   
3229 O O   . GLU A 453 ? 0.47696 0.92034 0.84866 -0.01474 0.18633  0.05365  453 GLU A O   
3230 C CB  . GLU A 453 ? 0.52905 0.91224 0.79793 0.03474  0.17910  0.05462  453 GLU A CB  
3231 C CG  . GLU A 453 ? 0.77123 1.13330 0.99579 0.04172  0.19048  0.06793  453 GLU A CG  
3232 C CD  . GLU A 453 ? 1.01608 1.40450 1.24423 0.02820  0.21748  0.08402  453 GLU A CD  
3233 O OE1 . GLU A 453 ? 1.08840 1.51791 1.35694 0.01326  0.22958  0.08403  453 GLU A OE1 
3234 O OE2 . GLU A 453 ? 1.09181 1.46064 1.28165 0.03194  0.22649  0.09697  453 GLU A OE2 
3235 N N   . ARG A 454 ? 0.35351 0.73805 0.69723 0.00533  0.14726  0.03646  454 ARG A N   
3236 C CA  . ARG A 454 ? 0.44449 0.86298 0.83456 -0.00340 0.13835  0.02331  454 ARG A CA  
3237 C C   . ARG A 454 ? 0.40359 0.79694 0.80864 -0.02856 0.13169  0.02753  454 ARG A C   
3238 O O   . ARG A 454 ? 0.35847 0.76918 0.79606 -0.03498 0.11777  0.01424  454 ARG A O   
3239 C CB  . ARG A 454 ? 0.51433 0.93779 0.90355 0.02037  0.11575  0.00309  454 ARG A CB  
3240 C CG  . ARG A 454 ? 0.53423 0.95756 0.89332 0.04899  0.11496  -0.00226 454 ARG A CG  
3241 C CD  . ARG A 454 ? 0.63868 1.02733 0.97341 0.06579  0.08998  -0.01336 454 ARG A CD  
3242 N NE  . ARG A 454 ? 0.87019 1.27949 1.23740 0.06535  0.07249  -0.02805 454 ARG A NE  
3243 C CZ  . ARG A 454 ? 0.88089 1.26126 1.23249 0.07377  0.04945  -0.03706 454 ARG A CZ  
3244 N NH1 . ARG A 454 ? 0.85214 1.18247 1.15834 0.08122  0.04247  -0.03240 454 ARG A NH1 
3245 N NH2 . ARG A 454 ? 0.80891 1.21189 1.19046 0.07365  0.03335  -0.05055 454 ARG A NH2 
3246 N N   . GLY A 455 ? 0.44177 0.79355 0.82293 -0.04155 0.13969  0.04463  455 GLY A N   
3247 C CA  . GLY A 455 ? 0.47634 0.80518 0.87331 -0.06736 0.13726  0.05028  455 GLY A CA  
3248 C C   . GLY A 455 ? 0.45746 0.73170 0.82918 -0.06417 0.11905  0.04677  455 GLY A C   
3249 O O   . GLY A 455 ? 0.41330 0.66180 0.79396 -0.08379 0.11591  0.05041  455 GLY A O   
3250 N N   . ALA A 456 ? 0.45669 0.71213 0.79712 -0.04077 0.10734  0.03951  456 ALA A N   
3251 C CA  . ALA A 456 ? 0.29821 0.50649 0.61433 -0.03736 0.09282  0.03634  456 ALA A CA  
3252 C C   . ALA A 456 ? 0.38756 0.55696 0.67888 -0.04352 0.10273  0.05394  456 ALA A C   
3253 O O   . ALA A 456 ? 0.44272 0.61681 0.72266 -0.04337 0.11852  0.06859  456 ALA A O   
3254 C CB  . ALA A 456 ? 0.28045 0.48017 0.56904 -0.01340 0.08025  0.02639  456 ALA A CB  
3255 N N   . SER A 457 ? 0.46950 0.59995 0.75097 -0.04735 0.09248  0.05168  457 SER A N   
3256 C CA  . SER A 457 ? 0.46791 0.55703 0.72471 -0.04894 0.09758  0.06577  457 SER A CA  
3257 C C   . SER A 457 ? 0.46287 0.53461 0.68618 -0.02707 0.09101  0.06284  457 SER A C   
3258 O O   . SER A 457 ? 0.52395 0.57908 0.73923 -0.02016 0.07788  0.05084  457 SER A O   
3259 C CB  . SER A 457 ? 0.44090 0.49784 0.70785 -0.06457 0.08996  0.06321  457 SER A CB  
3260 O OG  . SER A 457 ? 0.56753 0.58097 0.80896 -0.06164 0.09185  0.07454  457 SER A OG  
3261 N N   . VAL A 458 ? 0.42487 0.50218 0.62846 -0.01706 0.10041  0.07349  458 VAL A N   
3262 C CA  . VAL A 458 ? 0.33548 0.40555 0.51166 0.00162  0.09494  0.07048  458 VAL A CA  
3263 C C   . VAL A 458 ? 0.41083 0.45052 0.56450 0.00566  0.09749  0.08248  458 VAL A C   
3264 O O   . VAL A 458 ? 0.46875 0.50178 0.61823 -0.00025 0.10783  0.09779  458 VAL A O   
3265 C CB  . VAL A 458 ? 0.38200 0.48026 0.55139 0.01174  0.10040  0.07076  458 VAL A CB  
3266 C CG1 . VAL A 458 ? 0.28163 0.36802 0.42242 0.02746  0.09412  0.06879  458 VAL A CG1 
3267 C CG2 . VAL A 458 ? 0.44775 0.57762 0.64033 0.01184  0.09604  0.05737  458 VAL A CG2 
3268 N N   . HIS A 459 ? 0.42497 0.44761 0.56377 0.01622  0.08816  0.07579  459 HIS A N   
3269 C CA  . HIS A 459 ? 0.40660 0.40714 0.52574 0.02457  0.08834  0.08417  459 HIS A CA  
3270 C C   . HIS A 459 ? 0.52789 0.53795 0.63025 0.03815  0.08379  0.07916  459 HIS A C   
3271 O O   . HIS A 459 ? 0.55111 0.56788 0.65383 0.04110  0.07681  0.06678  459 HIS A O   
3272 C CB  . HIS A 459 ? 0.37990 0.35112 0.50076 0.02361  0.08198  0.07996  459 HIS A CB  
3273 C CG  . HIS A 459 ? 0.37013 0.32007 0.50025 0.01056  0.08615  0.08944  459 HIS A CG  
3274 N ND1 . HIS A 459 ? 0.39244 0.34575 0.54497 -0.00582 0.08587  0.08463  459 HIS A ND1 
3275 C CD2 . HIS A 459 ? 0.41211 0.33517 0.53149 0.01054  0.08980  0.10404  459 HIS A CD2 
3276 C CE1 . HIS A 459 ? 0.45048 0.37885 0.60619 -0.01783 0.09022  0.09635  459 HIS A CE1 
3277 N NE2 . HIS A 459 ? 0.51392 0.42123 0.64760 -0.00745 0.09266  0.10894  459 HIS A NE2 
3278 N N   . TYR A 460 ? 0.49822 0.50729 0.58457 0.04538  0.08705  0.08931  460 TYR A N   
3279 C CA  . TYR A 460 ? 0.41481 0.43550 0.48621 0.05513  0.08351  0.08647  460 TYR A CA  
3280 C C   . TYR A 460 ? 0.40602 0.41551 0.46690 0.06385  0.07942  0.08962  460 TYR A C   
3281 O O   . TYR A 460 ? 0.47393 0.46900 0.53117 0.06599  0.08151  0.09998  460 TYR A O   
3282 C CB  . TYR A 460 ? 0.39499 0.43032 0.45707 0.05666  0.08989  0.09380  460 TYR A CB  
3283 C CG  . TYR A 460 ? 0.36632 0.41415 0.41604 0.06386  0.08484  0.08652  460 TYR A CG  
3284 C CD1 . TYR A 460 ? 0.27898 0.32330 0.31493 0.07049  0.07824  0.08583  460 TYR A CD1 
3285 C CD2 . TYR A 460 ? 0.34603 0.40902 0.39897 0.06397  0.08579  0.07962  460 TYR A CD2 
3286 C CE1 . TYR A 460 ? 0.30359 0.35498 0.32775 0.07425  0.07254  0.07906  460 TYR A CE1 
3287 C CE2 . TYR A 460 ? 0.32248 0.39003 0.36131 0.07100  0.07971  0.07262  460 TYR A CE2 
3288 C CZ  . TYR A 460 ? 0.32654 0.38608 0.35021 0.07474  0.07303  0.07268  460 TYR A CZ  
3289 O OH  . TYR A 460 ? 0.38641 0.44638 0.39558 0.07919  0.06616  0.06573  460 TYR A OH  
3290 N N   . TYR A 461 ? 0.28431 0.30099 0.34038 0.06892  0.07346  0.08120  461 TYR A N   
3291 C CA  . TYR A 461 ? 0.45322 0.46818 0.50456 0.07735  0.06962  0.08200  461 TYR A CA  
3292 C C   . TYR A 461 ? 0.41942 0.45038 0.46061 0.08014  0.06581  0.08054  461 TYR A C   
3293 O O   . TYR A 461 ? 0.39189 0.42988 0.42831 0.07606  0.06497  0.07616  461 TYR A O   
3294 C CB  . TYR A 461 ? 0.31955 0.32943 0.37829 0.07901  0.06701  0.07169  461 TYR A CB  
3295 C CG  . TYR A 461 ? 0.38637 0.40672 0.44285 0.07470  0.06483  0.06130  461 TYR A CG  
3296 C CD1 . TYR A 461 ? 0.35854 0.39274 0.40805 0.07582  0.06250  0.05922  461 TYR A CD1 
3297 C CD2 . TYR A 461 ? 0.37730 0.39256 0.43754 0.06859  0.06408  0.05420  461 TYR A CD2 
3298 C CE1 . TYR A 461 ? 0.32987 0.36790 0.37305 0.07045  0.06056  0.05212  461 TYR A CE1 
3299 C CE2 . TYR A 461 ? 0.30642 0.32697 0.35970 0.06591  0.06079  0.04625  461 TYR A CE2 
3300 C CZ  . TYR A 461 ? 0.27214 0.30180 0.31531 0.06658  0.05958  0.04615  461 TYR A CZ  
3301 O OH  . TYR A 461 ? 0.33312 0.36253 0.36541 0.06262  0.05633  0.04041  461 TYR A OH  
3302 N N   . TYR A 462 ? 0.41339 0.44949 0.45212 0.08749  0.06200  0.08301  462 TYR A N   
3303 C CA  . TYR A 462 ? 0.31929 0.37128 0.35158 0.08795  0.05660  0.08017  462 TYR A CA  
3304 C C   . TYR A 462 ? 0.33836 0.40170 0.38031 0.09259  0.05346  0.07579  462 TYR A C   
3305 O O   . TYR A 462 ? 0.36685 0.42782 0.41370 0.10238  0.05225  0.07983  462 TYR A O   
3306 C CB  . TYR A 462 ? 0.45820 0.51215 0.47719 0.09256  0.05416  0.08849  462 TYR A CB  
3307 C CG  . TYR A 462 ? 0.50068 0.56670 0.50985 0.09068  0.04730  0.08421  462 TYR A CG  
3308 C CD1 . TYR A 462 ? 0.43158 0.49733 0.43650 0.08301  0.04649  0.07661  462 TYR A CD1 
3309 C CD2 . TYR A 462 ? 0.49701 0.57156 0.49918 0.09705  0.03988  0.08766  462 TYR A CD2 
3310 C CE1 . TYR A 462 ? 0.52682 0.59720 0.52063 0.08043  0.03894  0.07245  462 TYR A CE1 
3311 C CE2 . TYR A 462 ? 0.48595 0.56918 0.47886 0.09392  0.03189  0.08257  462 TYR A CE2 
3312 C CZ  . TYR A 462 ? 0.56472 0.64414 0.55320 0.08499  0.03169  0.07500  462 TYR A CZ  
3313 O OH  . TYR A 462 ? 0.61422 0.69649 0.59160 0.08105  0.02235  0.06951  462 TYR A OH  
3314 N N   . PHE A 463 ? 0.26089 0.33627 0.30525 0.08603  0.05254  0.06784  463 PHE A N   
3315 C CA  . PHE A 463 ? 0.32438 0.41680 0.38064 0.08858  0.05266  0.06242  463 PHE A CA  
3316 C C   . PHE A 463 ? 0.33151 0.44621 0.39044 0.08735  0.04631  0.06279  463 PHE A C   
3317 O O   . PHE A 463 ? 0.36388 0.48155 0.41504 0.07652  0.04343  0.06107  463 PHE A O   
3318 C CB  . PHE A 463 ? 0.25338 0.34643 0.30924 0.08006  0.05728  0.05451  463 PHE A CB  
3319 C CG  . PHE A 463 ? 0.42779 0.54285 0.49532 0.08184  0.06060  0.04855  463 PHE A CG  
3320 C CD1 . PHE A 463 ? 0.46223 0.57902 0.54028 0.09437  0.06369  0.04486  463 PHE A CD1 
3321 C CD2 . PHE A 463 ? 0.36764 0.50140 0.43551 0.07081  0.06119  0.04624  463 PHE A CD2 
3322 C CE1 . PHE A 463 ? 0.32587 0.46772 0.41588 0.09828  0.06830  0.03779  463 PHE A CE1 
3323 C CE2 . PHE A 463 ? 0.37041 0.53045 0.45135 0.07128  0.06687  0.04086  463 PHE A CE2 
3324 C CZ  . PHE A 463 ? 0.35290 0.51942 0.44554 0.08620  0.07087  0.03609  463 PHE A CZ  
3325 N N   . THR A 464 ? 0.33657 0.46616 0.40677 0.09852  0.04262  0.06413  464 THR A N   
3326 C CA  . THR A 464 ? 0.46791 0.62061 0.54245 0.09788  0.03392  0.06416  464 THR A CA  
3327 C C   . THR A 464 ? 0.51904 0.70545 0.61659 0.10065  0.03363  0.05778  464 THR A C   
3328 O O   . THR A 464 ? 0.54160 0.75224 0.64805 0.10061  0.02497  0.05692  464 THR A O   
3329 C CB  . THR A 464 ? 0.41798 0.56378 0.48348 0.11009  0.02586  0.07229  464 THR A CB  
3330 O OG1 . THR A 464 ? 0.62438 0.75669 0.69278 0.12449  0.02826  0.07674  464 THR A OG1 
3331 C CG2 . THR A 464 ? 0.35203 0.47602 0.39506 0.10489  0.02605  0.07747  464 THR A CG2 
3332 N N   . HIS A 465 ? 0.59491 0.78630 0.70305 0.10372  0.04248  0.05229  465 HIS A N   
3333 C CA  . HIS A 465 ? 0.48052 0.70918 0.61271 0.10936  0.04421  0.04530  465 HIS A CA  
3334 C C   . HIS A 465 ? 0.41515 0.66907 0.55431 0.08958  0.04916  0.04071  465 HIS A C   
3335 O O   . HIS A 465 ? 0.53700 0.77564 0.66299 0.07675  0.05701  0.03987  465 HIS A O   
3336 C CB  . HIS A 465 ? 0.46173 0.68640 0.60073 0.12342  0.05218  0.03962  465 HIS A CB  
3337 C CG  . HIS A 465 ? 0.53602 0.80329 0.70117 0.13301  0.05473  0.03113  465 HIS A CG  
3338 N ND1 . HIS A 465 ? 0.57957 0.87928 0.76386 0.14103  0.04510  0.03107  465 HIS A ND1 
3339 C CD2 . HIS A 465 ? 0.54676 0.83368 0.72284 0.13621  0.06596  0.02150  465 HIS A CD2 
3340 C CE1 . HIS A 465 ? 0.54852 0.88895 0.75826 0.14903  0.05055  0.02160  465 HIS A CE1 
3341 N NE2 . HIS A 465 ? 0.57239 0.90571 0.77659 0.14643  0.06428  0.01571  465 HIS A NE2 
3342 N N   . ARG A 466 ? 0.32543 0.61799 0.48530 0.08679  0.04400  0.03805  466 ARG A N   
3343 C CA  . ARG A 466 ? 0.35416 0.67573 0.52520 0.06584  0.04955  0.03441  466 ARG A CA  
3344 C C   . ARG A 466 ? 0.35241 0.70854 0.54544 0.07256  0.06223  0.02686  466 ARG A C   
3345 O O   . ARG A 466 ? 0.36942 0.75848 0.58763 0.08951  0.05916  0.02206  466 ARG A O   
3346 C CB  . ARG A 466 ? 0.29430 0.64236 0.47907 0.05695  0.03672  0.03441  466 ARG A CB  
3347 C CG  . ARG A 466 ? 0.33974 0.73348 0.54992 0.03855  0.04173  0.02963  466 ARG A CG  
3348 C CD  . ARG A 466 ? 0.38599 0.75939 0.57716 0.01004  0.04560  0.03307  466 ARG A CD  
3349 N NE  . ARG A 466 ? 0.49322 0.90835 0.70811 -0.01247 0.04866  0.03054  466 ARG A NE  
3350 C CZ  . ARG A 466 ? 0.49251 0.89374 0.69496 -0.04057 0.04734  0.03397  466 ARG A CZ  
3351 N NH1 . ARG A 466 ? 0.31025 0.65718 0.47629 -0.04638 0.04215  0.03884  466 ARG A NH1 
3352 N NH2 . ARG A 466 ? 0.45246 0.89440 0.67972 -0.06295 0.05106  0.03234  466 ARG A NH2 
3353 N N   . THR A 467 ? 0.35185 0.70040 0.53367 0.06180  0.07604  0.02521  467 THR A N   
3354 C CA  . THR A 467 ? 0.37843 0.75809 0.57624 0.07036  0.08998  0.01688  467 THR A CA  
3355 C C   . THR A 467 ? 0.39905 0.83995 0.63177 0.06408  0.09282  0.01237  467 THR A C   
3356 O O   . THR A 467 ? 0.41245 0.86823 0.64992 0.03989  0.09089  0.01620  467 THR A O   
3357 C CB  . THR A 467 ? 0.34634 0.70828 0.52136 0.05773  0.10400  0.01645  467 THR A CB  
3358 O OG1 . THR A 467 ? 0.39833 0.70773 0.54470 0.06249  0.09973  0.01960  467 THR A OG1 
3359 C CG2 . THR A 467 ? 0.41767 0.80913 0.60496 0.07084  0.11846  0.00637  467 THR A CG2 
3360 N N   . SER A 468 ? 0.25859 0.73537 0.51698 0.08609  0.09684  0.00341  468 SER A N   
3361 C CA  . SER A 468 ? 0.45833 1.00076 0.75701 0.08471  0.09745  -0.00236 468 SER A CA  
3362 C C   . SER A 468 ? 0.52268 1.10173 0.83060 0.05738  0.11485  -0.00313 468 SER A C   
3363 O O   . SER A 468 ? 0.53711 1.16785 0.87762 0.04533  0.11448  -0.00558 468 SER A O   
3364 C CB  . SER A 468 ? 0.46870 1.03768 0.79054 0.11810  0.09794  -0.01317 468 SER A CB  
3365 O OG  . SER A 468 ? 0.50505 1.05479 0.81005 0.12658  0.11275  -0.01960 468 SER A OG  
3366 N N   . THR A 469 ? 0.56157 1.11273 0.84003 0.04607  0.12921  -0.00062 469 THR A N   
3367 C CA  . THR A 469 ? 0.60874 1.18925 0.88936 0.01887  0.14694  0.00119  469 THR A CA  
3368 C C   . THR A 469 ? 0.60167 1.14223 0.85265 -0.01318 0.14329  0.01354  469 THR A C   
3369 O O   . THR A 469 ? 0.60450 1.15572 0.84743 -0.03814 0.15779  0.01805  469 THR A O   
3370 C CB  . THR A 469 ? 0.57530 1.14719 0.83746 0.02822  0.16495  -0.00515 469 THR A CB  
3371 O OG1 . THR A 469 ? 0.61505 1.13156 0.83881 0.03566  0.16316  -0.00211 469 THR A OG1 
3372 C CG2 . THR A 469 ? 0.46213 1.05660 0.74776 0.05815  0.16522  -0.01881 469 THR A CG2 
3373 N N   . SER A 470 ? 0.52330 1.01803 0.75662 -0.01260 0.12463  0.01919  470 SER A N   
3374 C CA  . SER A 470 ? 0.45355 0.90284 0.65409 -0.03758 0.12026  0.02916  470 SER A CA  
3375 C C   . SER A 470 ? 0.50608 0.98467 0.72099 -0.07024 0.12316  0.03350  470 SER A C   
3376 O O   . SER A 470 ? 0.55115 1.07009 0.80016 -0.07443 0.11500  0.03019  470 SER A O   
3377 C CB  . SER A 470 ? 0.47662 0.88161 0.66106 -0.02998 0.10013  0.03250  470 SER A CB  
3378 O OG  . SER A 470 ? 0.52104 0.89655 0.68466 -0.05554 0.09324  0.03984  470 SER A OG  
3379 N N   . LEU A 471 ? 0.54653 1.00370 0.73452 -0.09404 0.13406  0.04118  471 LEU A N   
3380 C CA  . LEU A 471 ? 0.56695 1.04719 0.76461 -0.12936 0.13982  0.04725  471 LEU A CA  
3381 C C   . LEU A 471 ? 0.48991 0.93091 0.67291 -0.14978 0.12059  0.05353  471 LEU A C   
3382 O O   . LEU A 471 ? 0.48565 0.94303 0.67984 -0.18086 0.12098  0.05792  471 LEU A O   
3383 C CB  . LEU A 471 ? 0.67251 1.14379 0.84282 -0.14582 0.16086  0.05428  471 LEU A CB  
3384 C CG  . LEU A 471 ? 0.72774 1.26080 0.92680 -0.13742 0.18182  0.04664  471 LEU A CG  
3385 C CD1 . LEU A 471 ? 0.78035 1.28963 0.94268 -0.14688 0.20002  0.05256  471 LEU A CD1 
3386 C CD2 . LEU A 471 ? 0.69082 1.27764 0.93734 -0.14963 0.17972  0.04232  471 LEU A CD2 
3387 N N   . TRP A 472 ? 0.52663 0.91714 0.68531 -0.13351 0.10416  0.05340  472 TRP A N   
3388 C CA  . TRP A 472 ? 0.46623 0.81870 0.60936 -0.14730 0.08492  0.05658  472 TRP A CA  
3389 C C   . TRP A 472 ? 0.41339 0.80172 0.59159 -0.14380 0.06965  0.04945  472 TRP A C   
3390 O O   . TRP A 472 ? 0.38123 0.81470 0.59134 -0.12361 0.07126  0.04252  472 TRP A O   
3391 C CB  . TRP A 472 ? 0.42794 0.71885 0.53294 -0.12908 0.07514  0.05800  472 TRP A CB  
3392 C CG  . TRP A 472 ? 0.48821 0.74362 0.55828 -0.13262 0.08640  0.06432  472 TRP A CG  
3393 C CD1 . TRP A 472 ? 0.52792 0.78195 0.58949 -0.11327 0.09769  0.06242  472 TRP A CD1 
3394 C CD2 . TRP A 472 ? 0.52897 0.74294 0.56553 -0.15688 0.08588  0.07340  472 TRP A CD2 
3395 N NE1 . TRP A 472 ? 0.56534 0.78247 0.59016 -0.12338 0.10383  0.06939  472 TRP A NE1 
3396 C CE2 . TRP A 472 ? 0.58746 0.77838 0.59543 -0.14961 0.09691  0.07708  472 TRP A CE2 
3397 C CE3 . TRP A 472 ? 0.52151 0.71195 0.54733 -0.18381 0.07564  0.07856  472 TRP A CE3 
3398 C CZ2 . TRP A 472 ? 0.62970 0.77524 0.59745 -0.16676 0.09779  0.08688  472 TRP A CZ2 
3399 C CZ3 . TRP A 472 ? 0.61952 0.76191 0.60578 -0.20157 0.07696  0.08846  472 TRP A CZ3 
3400 C CH2 . TRP A 472 ? 0.68804 0.80838 0.64481 -0.19227 0.08795  0.09317  472 TRP A CH2 
3401 N N   . GLY A 473 ? 0.46319 0.82898 0.63326 -0.16302 0.05329  0.05060  473 GLY A N   
3402 C CA  . GLY A 473 ? 0.41812 0.81424 0.61686 -0.16189 0.03579  0.04321  473 GLY A CA  
3403 C C   . GLY A 473 ? 0.46816 0.85846 0.66543 -0.12640 0.02459  0.03794  473 GLY A C   
3404 O O   . GLY A 473 ? 0.55160 0.90202 0.72045 -0.10672 0.02681  0.04041  473 GLY A O   
3405 N N   . GLU A 474 ? 0.44953 0.88184 0.67853 -0.11879 0.01204  0.03096  474 GLU A N   
3406 C CA  . GLU A 474 ? 0.48303 0.91114 0.70941 -0.08522 0.00175  0.02775  474 GLU A CA  
3407 C C   . GLU A 474 ? 0.41568 0.78570 0.60210 -0.07942 -0.01281 0.02923  474 GLU A C   
3408 O O   . GLU A 474 ? 0.37660 0.72282 0.54508 -0.05401 -0.01313 0.03101  474 GLU A O   
3409 C CB  . GLU A 474 ? 0.58701 1.07251 0.85372 -0.07705 -0.01046 0.02026  474 GLU A CB  
3410 C CG  . GLU A 474 ? 0.76698 1.30904 1.07155 -0.06574 0.00470  0.01721  474 GLU A CG  
3411 C CD  . GLU A 474 ? 0.92913 1.46746 1.23137 -0.02707 0.00385  0.01634  474 GLU A CD  
3412 O OE1 . GLU A 474 ? 0.97656 1.53233 1.29014 -0.01339 0.02024  0.01523  474 GLU A OE1 
3413 O OE2 . GLU A 474 ? 0.97354 1.48845 1.25968 -0.01066 -0.01321 0.01691  474 GLU A OE2 
3414 N N   . TRP A 475 ? 0.39367 0.73943 0.56507 -0.10289 -0.02416 0.02829  475 TRP A N   
3415 C CA  . TRP A 475 ? 0.42927 0.72340 0.56315 -0.09518 -0.03852 0.02721  475 TRP A CA  
3416 C C   . TRP A 475 ? 0.43082 0.67692 0.53062 -0.08368 -0.02774 0.03295  475 TRP A C   
3417 O O   . TRP A 475 ? 0.46861 0.68281 0.54278 -0.06629 -0.03486 0.03217  475 TRP A O   
3418 C CB  . TRP A 475 ? 0.49994 0.77425 0.62360 -0.12294 -0.05339 0.02338  475 TRP A CB  
3419 C CG  . TRP A 475 ? 0.48223 0.72900 0.59203 -0.15006 -0.04375 0.02917  475 TRP A CG  
3420 C CD1 . TRP A 475 ? 0.52627 0.80255 0.66018 -0.17850 -0.03443 0.03232  475 TRP A CD1 
3421 C CD2 . TRP A 475 ? 0.48495 0.66846 0.55181 -0.15143 -0.04317 0.03305  475 TRP A CD2 
3422 N NE1 . TRP A 475 ? 0.53173 0.76259 0.63638 -0.19828 -0.02779 0.03964  475 TRP A NE1 
3423 C CE2 . TRP A 475 ? 0.49430 0.66717 0.55782 -0.18083 -0.03435 0.03966  475 TRP A CE2 
3424 C CE3 . TRP A 475 ? 0.54689 0.68372 0.57829 -0.13010 -0.04907 0.03157  475 TRP A CE3 
3425 C CZ2 . TRP A 475 ? 0.50241 0.61524 0.52587 -0.18768 -0.03356 0.04509  475 TRP A CZ2 
3426 C CZ3 . TRP A 475 ? 0.51883 0.60155 0.51515 -0.13617 -0.04780 0.03523  475 TRP A CZ3 
3427 C CH2 . TRP A 475 ? 0.47538 0.54456 0.46688 -0.16382 -0.04129 0.04201  475 TRP A CH2 
3428 N N   . MET A 476 ? 0.43698 0.68042 0.53639 -0.09259 -0.01056 0.03834  476 MET A N   
3429 C CA  . MET A 476 ? 0.43830 0.64045 0.50833 -0.08238 -0.00142 0.04296  476 MET A CA  
3430 C C   . MET A 476 ? 0.46560 0.67583 0.54059 -0.05378 0.00589  0.04347  476 MET A C   
3431 O O   . MET A 476 ? 0.47959 0.65709 0.53230 -0.04291 0.01049  0.04592  476 MET A O   
3432 C CB  . MET A 476 ? 0.52227 0.71918 0.58732 -0.10177 0.01296  0.04852  476 MET A CB  
3433 C CG  . MET A 476 ? 0.64442 0.80475 0.68613 -0.12839 0.00554  0.05122  476 MET A CG  
3434 S SD  . MET A 476 ? 0.64507 0.79213 0.67200 -0.15192 0.02267  0.06100  476 MET A SD  
3435 C CE  . MET A 476 ? 0.69217 0.90703 0.76397 -0.17417 0.03259  0.06081  476 MET A CE  
3436 N N   . GLY A 477 ? 0.42987 0.68178 0.53380 -0.04158 0.00597  0.04106  477 GLY A N   
3437 C CA  . GLY A 477 ? 0.39075 0.64347 0.49649 -0.01439 0.00925  0.04203  477 GLY A CA  
3438 C C   . GLY A 477 ? 0.37984 0.61951 0.47910 -0.00744 0.02496  0.04455  477 GLY A C   
3439 O O   . GLY A 477 ? 0.48002 0.73410 0.58745 -0.01809 0.03664  0.04432  477 GLY A O   
3440 N N   . VAL A 478 ? 0.35001 0.56277 0.43360 0.00986  0.02534  0.04678  478 VAL A N   
3441 C CA  . VAL A 478 ? 0.34632 0.54577 0.42484 0.01866  0.03730  0.04776  478 VAL A CA  
3442 C C   . VAL A 478 ? 0.46003 0.62486 0.51268 0.00730  0.03930  0.04924  478 VAL A C   
3443 O O   . VAL A 478 ? 0.46584 0.60205 0.50000 0.01248  0.03396  0.05049  478 VAL A O   
3444 C CB  . VAL A 478 ? 0.28241 0.47059 0.35932 0.04006  0.03614  0.04987  478 VAL A CB  
3445 C CG1 . VAL A 478 ? 0.25226 0.42641 0.32579 0.04677  0.04657  0.04928  478 VAL A CG1 
3446 C CG2 . VAL A 478 ? 0.25533 0.47309 0.35389 0.05365  0.03126  0.04929  478 VAL A CG2 
3447 N N   . LEU A 479 ? 0.49203 0.66057 0.54265 -0.00691 0.04739  0.04921  479 LEU A N   
3448 C CA  . LEU A 479 ? 0.58635 0.72179 0.61016 -0.01995 0.04681  0.05159  479 LEU A CA  
3449 C C   . LEU A 479 ? 0.59792 0.70489 0.60446 -0.00823 0.04930  0.05144  479 LEU A C   
3450 O O   . LEU A 479 ? 0.57250 0.68736 0.58807 0.00455  0.05600  0.04939  479 LEU A O   
3451 C CB  . LEU A 479 ? 0.47723 0.62505 0.50099 -0.03897 0.05625  0.05356  479 LEU A CB  
3452 C CG  . LEU A 479 ? 0.52802 0.67938 0.55152 -0.06292 0.05113  0.05614  479 LEU A CG  
3453 C CD1 . LEU A 479 ? 0.64010 0.83889 0.69816 -0.06558 0.05026  0.05294  479 LEU A CD1 
3454 C CD2 . LEU A 479 ? 0.60063 0.74354 0.60834 -0.08257 0.06102  0.06141  479 LEU A CD2 
3455 N N   A HIS A 480 ? 0.59004 0.66310 0.57199 -0.01251 0.04247  0.05270  480 HIS A N   
3456 N N   B HIS A 480 ? 0.59059 0.66377 0.57262 -0.01250 0.04251  0.05270  480 HIS A N   
3457 C CA  A HIS A 480 ? 0.60363 0.65264 0.56979 -0.00433 0.04364  0.05189  480 HIS A CA  
3458 C CA  B HIS A 480 ? 0.60349 0.65206 0.56942 -0.00429 0.04340  0.05189  480 HIS A CA  
3459 C C   A HIS A 480 ? 0.65370 0.71099 0.61901 -0.00727 0.05441  0.05165  480 HIS A C   
3460 C C   B HIS A 480 ? 0.65486 0.70964 0.61833 -0.00741 0.05385  0.05174  480 HIS A C   
3461 O O   A HIS A 480 ? 0.68541 0.75056 0.64641 -0.02203 0.05991  0.05440  480 HIS A O   
3462 O O   B HIS A 480 ? 0.69427 0.75131 0.64916 -0.02256 0.05836  0.05485  480 HIS A O   
3463 C CB  A HIS A 480 ? 0.58269 0.59566 0.52149 -0.00933 0.03391  0.05290  480 HIS A CB  
3464 C CB  B HIS A 480 ? 0.58193 0.59529 0.52121 -0.00958 0.03334  0.05289  480 HIS A CB  
3465 C CG  A HIS A 480 ? 0.54384 0.53807 0.46056 -0.02192 0.03588  0.05643  480 HIS A CG  
3466 C CG  B HIS A 480 ? 0.52137 0.51194 0.44661 0.00163  0.03056  0.05077  480 HIS A CG  
3467 N ND1 A HIS A 480 ? 0.49920 0.47217 0.39791 -0.01510 0.03495  0.05576  480 HIS A ND1 
3468 N ND1 B HIS A 480 ? 0.50828 0.50324 0.44444 0.01711  0.03014  0.04745  480 HIS A ND1 
3469 C CD2 A HIS A 480 ? 0.44064 0.43309 0.34844 -0.04174 0.03824  0.06148  480 HIS A CD2 
3470 C CD2 B HIS A 480 ? 0.53605 0.50018 0.43752 -0.00074 0.02705  0.05163  480 HIS A CD2 
3471 C CE1 A HIS A 480 ? 0.47434 0.43087 0.35031 -0.02861 0.03657  0.06091  480 HIS A CE1 
3472 C CE1 B HIS A 480 ? 0.53389 0.51064 0.45798 0.02343  0.02645  0.04506  480 HIS A CE1 
3473 N NE2 A HIS A 480 ? 0.51283 0.48039 0.39388 -0.04607 0.03966  0.06512  480 HIS A NE2 
3474 N NE2 B HIS A 480 ? 0.57816 0.53509 0.48002 0.01430  0.02353  0.04729  480 HIS A NE2 
3475 N N   . GLY A 481 ? 0.63108 0.68807 0.60074 0.00614  0.05798  0.04800  481 GLY A N   
3476 C CA  . GLY A 481 ? 0.53200 0.59510 0.49806 0.00650  0.06726  0.04540  481 GLY A CA  
3477 C C   . GLY A 481 ? 0.51708 0.61416 0.50625 0.01060  0.07720  0.04230  481 GLY A C   
3478 O O   . GLY A 481 ? 0.41271 0.51657 0.39880 0.01383  0.08579  0.03806  481 GLY A O   
3479 N N   . ASP A 482 ? 0.52761 0.64642 0.53857 0.01243  0.07535  0.04327  482 ASP A N   
3480 C CA  . ASP A 482 ? 0.39204 0.54577 0.42766 0.01954  0.08273  0.03956  482 ASP A CA  
3481 C C   . ASP A 482 ? 0.32396 0.47339 0.36669 0.03851  0.08465  0.03412  482 ASP A C   
3482 O O   . ASP A 482 ? 0.47260 0.64490 0.53019 0.04763  0.09173  0.02872  482 ASP A O   
3483 C CB  . ASP A 482 ? 0.50020 0.67530 0.55593 0.01954  0.07621  0.04170  482 ASP A CB  
3484 C CG  . ASP A 482 ? 0.54925 0.75540 0.61679 0.00326  0.07996  0.04253  482 ASP A CG  
3485 O OD1 . ASP A 482 ? 0.52128 0.72728 0.57695 -0.01097 0.08838  0.04382  482 ASP A OD1 
3486 O OD2 . ASP A 482 ? 0.58517 0.81609 0.67333 0.00393  0.07404  0.04227  482 ASP A OD2 
3487 N N   . GLU A 483 ? 0.26922 0.39032 0.30275 0.04458  0.07833  0.03485  483 GLU A N   
3488 C CA  . GLU A 483 ? 0.34107 0.45377 0.38197 0.05959  0.07868  0.03063  483 GLU A CA  
3489 C C   . GLU A 483 ? 0.41936 0.51930 0.44773 0.06175  0.08296  0.02326  483 GLU A C   
3490 O O   . GLU A 483 ? 0.51581 0.61052 0.55064 0.07370  0.08409  0.01722  483 GLU A O   
3491 C CB  . GLU A 483 ? 0.26074 0.35347 0.30116 0.06308  0.07092  0.03548  483 GLU A CB  
3492 C CG  . GLU A 483 ? 0.30799 0.37641 0.33352 0.05892  0.06748  0.03446  483 GLU A CG  
3493 C CD  . GLU A 483 ? 0.36422 0.42597 0.37382 0.04796  0.06330  0.03754  483 GLU A CD  
3494 O OE1 . GLU A 483 ? 0.35152 0.42376 0.35621 0.03916  0.06551  0.03893  483 GLU A OE1 
3495 O OE2 . GLU A 483 ? 0.38974 0.43534 0.39201 0.04805  0.05767  0.03826  483 GLU A OE2 
3496 N N   . ILE A 484 ? 0.33768 0.42996 0.34579 0.05091  0.08425  0.02343  484 ILE A N   
3497 C CA  . ILE A 484 ? 0.38201 0.46134 0.37314 0.05330  0.08669  0.01618  484 ILE A CA  
3498 C C   . ILE A 484 ? 0.35147 0.44845 0.34992 0.06356  0.09621  0.00727  484 ILE A C   
3499 O O   . ILE A 484 ? 0.37537 0.45908 0.37272 0.07442  0.09461  -0.00134 484 ILE A O   
3500 C CB  . ILE A 484 ? 0.45116 0.52089 0.41550 0.04005  0.08695  0.01995  484 ILE A CB  
3501 C CG1 . ILE A 484 ? 0.43501 0.48232 0.39066 0.03495  0.07539  0.02586  484 ILE A CG1 
3502 C CG2 . ILE A 484 ? 0.34485 0.40405 0.28682 0.04317  0.08996  0.01240  484 ILE A CG2 
3503 C CD1 . ILE A 484 ? 0.46812 0.50001 0.39538 0.02266  0.07321  0.03131  484 ILE A CD1 
3504 N N   . GLU A 485 ? 0.42400 0.55191 0.43055 0.06031  0.10603  0.00802  485 GLU A N   
3505 C CA  . GLU A 485 ? 0.52650 0.67727 0.54282 0.07312  0.11613  -0.00200 485 GLU A CA  
3506 C C   . GLU A 485 ? 0.55943 0.69922 0.59094 0.09212  0.11045  -0.00861 485 GLU A C   
3507 O O   . GLU A 485 ? 0.66880 0.80169 0.69516 0.10489  0.11322  -0.02007 485 GLU A O   
3508 C CB  . GLU A 485 ? 0.58907 0.78296 0.62657 0.06977  0.12498  0.00015  485 GLU A CB  
3509 C CG  . GLU A 485 ? 0.79107 0.99596 0.82307 0.04774  0.12742  0.01017  485 GLU A CG  
3510 C CD  . GLU A 485 ? 0.93982 1.18963 1.00093 0.04412  0.13275  0.01154  485 GLU A CD  
3511 O OE1 . GLU A 485 ? 1.06050 1.33431 1.14597 0.06189  0.13428  0.00424  485 GLU A OE1 
3512 O OE2 . GLU A 485 ? 1.07377 1.33325 1.13364 0.02358  0.13372  0.01966  485 GLU A OE2 
3513 N N   . TYR A 486 ? 0.46447 0.60057 0.51237 0.09433  0.10231  -0.00143 486 TYR A N   
3514 C CA  . TYR A 486 ? 0.41600 0.54042 0.47714 0.11135  0.09725  -0.00477 486 TYR A CA  
3515 C C   . TYR A 486 ? 0.39269 0.47890 0.44166 0.11346  0.09099  -0.00895 486 TYR A C   
3516 O O   . TYR A 486 ? 0.37870 0.45148 0.42878 0.12702  0.09029  -0.01844 486 TYR A O   
3517 C CB  . TYR A 486 ? 0.40525 0.53424 0.48151 0.11184  0.09029  0.00591  486 TYR A CB  
3518 C CG  . TYR A 486 ? 0.40959 0.57872 0.50462 0.11473  0.09350  0.00690  486 TYR A CG  
3519 C CD1 . TYR A 486 ? 0.35167 0.54402 0.44720 0.09789  0.09630  0.01178  486 TYR A CD1 
3520 C CD2 . TYR A 486 ? 0.41493 0.59840 0.52795 0.13437  0.09250  0.00234  486 TYR A CD2 
3521 C CE1 . TYR A 486 ? 0.32702 0.55968 0.44375 0.09815  0.09820  0.01186  486 TYR A CE1 
3522 C CE2 . TYR A 486 ? 0.39036 0.61618 0.52475 0.13791  0.09393  0.00199  486 TYR A CE2 
3523 C CZ  . TYR A 486 ? 0.36834 0.62079 0.50611 0.11855  0.09700  0.00654  486 TYR A CZ  
3524 O OH  . TYR A 486 ? 0.35287 0.65125 0.51567 0.11954  0.09773  0.00529  486 TYR A OH  
3525 N N   . PHE A 487 ? 0.32446 0.39298 0.36294 0.10050  0.08544  -0.00303 487 PHE A N   
3526 C CA  . PHE A 487 ? 0.32407 0.36244 0.35507 0.10048  0.07896  -0.00808 487 PHE A CA  
3527 C C   . PHE A 487 ? 0.40134 0.43379 0.41616 0.10474  0.08151  -0.02187 487 PHE A C   
3528 O O   . PHE A 487 ? 0.40825 0.41782 0.42111 0.11056  0.07624  -0.03084 487 PHE A O   
3529 C CB  . PHE A 487 ? 0.32332 0.35159 0.34849 0.08753  0.07282  -0.00077 487 PHE A CB  
3530 C CG  . PHE A 487 ? 0.39690 0.42281 0.43551 0.08576  0.06940  0.01019  487 PHE A CG  
3531 C CD1 . PHE A 487 ? 0.45126 0.46537 0.50195 0.09330  0.06787  0.01205  487 PHE A CD1 
3532 C CD2 . PHE A 487 ? 0.32208 0.35503 0.35790 0.07728  0.06771  0.01865  487 PHE A CD2 
3533 C CE1 . PHE A 487 ? 0.44188 0.45351 0.50016 0.09148  0.06604  0.02336  487 PHE A CE1 
3534 C CE2 . PHE A 487 ? 0.30801 0.33992 0.35235 0.07696  0.06558  0.02766  487 PHE A CE2 
3535 C CZ  . PHE A 487 ? 0.38359 0.40597 0.43853 0.08361  0.06540  0.03072  487 PHE A CZ  
3536 N N   . PHE A 488 ? 0.43106 0.48263 0.43250 0.10121  0.08952  -0.02381 488 PHE A N   
3537 C CA  . PHE A 488 ? 0.56976 0.61781 0.55173 0.10695  0.09359  -0.03701 488 PHE A CA  
3538 C C   . PHE A 488 ? 0.61483 0.67377 0.60559 0.12468  0.10041  -0.04831 488 PHE A C   
3539 O O   . PHE A 488 ? 0.67327 0.72648 0.64718 0.13311  0.10337  -0.06217 488 PHE A O   
3540 C CB  . PHE A 488 ? 0.59600 0.65885 0.55601 0.09589  0.10129  -0.03344 488 PHE A CB  
3541 C CG  . PHE A 488 ? 0.59050 0.63028 0.52803 0.08548  0.09196  -0.03054 488 PHE A CG  
3542 C CD1 . PHE A 488 ? 0.52514 0.54486 0.44131 0.09004  0.08614  -0.04202 488 PHE A CD1 
3543 C CD2 . PHE A 488 ? 0.64160 0.67913 0.57882 0.07293  0.08726  -0.01766 488 PHE A CD2 
3544 C CE1 . PHE A 488 ? 0.57624 0.57683 0.47302 0.08260  0.07517  -0.03993 488 PHE A CE1 
3545 C CE2 . PHE A 488 ? 0.56382 0.58020 0.48090 0.06669  0.07705  -0.01587 488 PHE A CE2 
3546 C CZ  . PHE A 488 ? 0.45993 0.45930 0.35800 0.07175  0.07068  -0.02663 488 PHE A CZ  
3547 N N   . GLY A 489 ? 0.62699 0.70060 0.64187 0.13246  0.10184  -0.04374 489 GLY A N   
3548 C CA  . GLY A 489 ? 0.59222 0.67557 0.61743 0.15298  0.10634  -0.05495 489 GLY A CA  
3549 C C   . GLY A 489 ? 0.53164 0.65701 0.55768 0.15781  0.12134  -0.06081 489 GLY A C   
3550 O O   . GLY A 489 ? 0.57471 0.70909 0.60330 0.17724  0.12672  -0.07490 489 GLY A O   
3551 N N   . GLN A 490 ? 0.42643 0.57816 0.45075 0.14060  0.12866  -0.05076 490 GLN A N   
3552 C CA  . GLN A 490 ? 0.47804 0.67380 0.50522 0.14138  0.14502  -0.05501 490 GLN A CA  
3553 C C   . GLN A 490 ? 0.50776 0.73983 0.56753 0.15829  0.14907  -0.05931 490 GLN A C   
3554 O O   . GLN A 490 ? 0.50578 0.77157 0.56938 0.16915  0.16265  -0.07046 490 GLN A O   
3555 C CB  . GLN A 490 ? 0.53415 0.74564 0.55302 0.11595  0.15066  -0.04129 490 GLN A CB  
3556 C CG  . GLN A 490 ? 0.67962 0.85233 0.66741 0.10102  0.14272  -0.03516 490 GLN A CG  
3557 C CD  . GLN A 490 ? 0.75642 0.91016 0.71103 0.10631  0.14567  -0.04662 490 GLN A CD  
3558 O OE1 . GLN A 490 ? 0.75564 0.91872 0.70827 0.12304  0.15286  -0.06112 490 GLN A OE1 
3559 N NE2 . GLN A 490 ? 0.70895 0.83512 0.63583 0.09356  0.13872  -0.04096 490 GLN A NE2 
3560 N N   . PRO A 491 ? 0.50056 0.73004 0.58320 0.16283  0.13823  -0.05179 491 PRO A N   
3561 C CA  . PRO A 491 ? 0.41574 0.67830 0.52784 0.18331  0.13949  -0.05752 491 PRO A CA  
3562 C C   . PRO A 491 ? 0.47493 0.72650 0.58536 0.21181  0.14011  -0.07509 491 PRO A C   
3563 O O   . PRO A 491 ? 0.47068 0.75033 0.60363 0.22884  0.14127  -0.08196 491 PRO A O   
3564 C CB  . PRO A 491 ? 0.38585 0.63255 0.51189 0.18264  0.12433  -0.04478 491 PRO A CB  
3565 C CG  . PRO A 491 ? 0.43381 0.66614 0.54593 0.15581  0.12161  -0.03134 491 PRO A CG  
3566 C CD  . PRO A 491 ? 0.34993 0.55687 0.43317 0.14764  0.12618  -0.03637 491 PRO A CD  
3567 N N   . LEU A 492 ? 0.50075 0.70798 0.58506 0.21485  0.13634  -0.08290 492 LEU A N   
3568 C CA  . LEU A 492 ? 0.45765 0.65484 0.53671 0.24171  0.13784  -0.10254 492 LEU A CA  
3569 C C   . LEU A 492 ? 0.54121 0.77625 0.61553 0.24085  0.15410  -0.11331 492 LEU A C   
3570 O O   . LEU A 492 ? 0.59990 0.83728 0.67849 0.25832  0.15506  -0.12682 492 LEU A O   
3571 C CB  . LEU A 492 ? 0.47926 0.61646 0.53180 0.24165  0.12707  -0.10883 492 LEU A CB  
3572 C CG  . LEU A 492 ? 0.48678 0.57966 0.54413 0.23533  0.11003  -0.09613 492 LEU A CG  
3573 C CD1 . LEU A 492 ? 0.51707 0.55434 0.55429 0.23712  0.09928  -0.10534 492 LEU A CD1 
3574 C CD2 . LEU A 492 ? 0.51368 0.61199 0.59497 0.25362  0.10394  -0.09213 492 LEU A CD2 
3575 N N   . ASN A 493 ? 0.46124 0.72371 0.52587 0.21974  0.16679  -0.10610 493 ASN A N   
3576 C CA  . ASN A 493 ? 0.48208 0.77694 0.53755 0.21391  0.18383  -0.11285 493 ASN A CA  
3577 C C   . ASN A 493 ? 0.48144 0.82456 0.57246 0.21762  0.19004  -0.11287 493 ASN A C   
3578 O O   . ASN A 493 ? 0.51708 0.89260 0.62982 0.20169  0.19235  -0.10011 493 ASN A O   
3579 C CB  . ASN A 493 ? 0.58294 0.88709 0.61623 0.18760  0.19389  -0.10119 493 ASN A CB  
3580 C CG  . ASN A 493 ? 0.76583 1.09332 0.78021 0.18001  0.21195  -0.10653 493 ASN A CG  
3581 O OD1 . ASN A 493 ? 0.66388 1.01633 0.69166 0.19158  0.22015  -0.11679 493 ASN A OD1 
3582 N ND2 . ASN A 493 ? 0.98442 1.30264 0.96554 0.16084  0.21828  -0.09859 493 ASN A ND2 
3583 N N   . ASN A 494 ? 0.51291 0.86093 0.60960 0.23894  0.19205  -0.12811 494 ASN A N   
3584 C CA  . ASN A 494 ? 0.51760 0.91051 0.64926 0.24745  0.19612  -0.13040 494 ASN A CA  
3585 C C   . ASN A 494 ? 0.60940 1.05492 0.74938 0.22767  0.21555  -0.12557 494 ASN A C   
3586 O O   . ASN A 494 ? 0.54360 1.03296 0.71734 0.22973  0.21877  -0.12502 494 ASN A O   
3587 C CB  . ASN A 494 ? 0.55776 0.94059 0.68939 0.27653  0.19411  -0.14879 494 ASN A CB  
3588 C CG  . ASN A 494 ? 0.64330 0.98319 0.78065 0.29693  0.17325  -0.15085 494 ASN A CG  
3589 O OD1 . ASN A 494 ? 0.68190 0.97532 0.79671 0.31096  0.16580  -0.16167 494 ASN A OD1 
3590 N ND2 . ASN A 494 ? 0.65335 1.00582 0.81894 0.29759  0.16294  -0.13999 494 ASN A ND2 
3591 N N   . SER A 495 ? 0.67525 1.11604 0.78428 0.20878  0.22806  -0.12200 495 SER A N   
3592 C CA  . SER A 495 ? 0.65397 1.13821 0.76716 0.18600  0.24688  -0.11418 495 SER A CA  
3593 C C   . SER A 495 ? 0.60339 1.10164 0.73256 0.15979  0.24331  -0.09542 495 SER A C   
3594 O O   . SER A 495 ? 0.57916 1.11976 0.72858 0.14247  0.25417  -0.08836 495 SER A O   
3595 C CB  . SER A 495 ? 0.65616 1.12530 0.72477 0.17581  0.26122  -0.11609 495 SER A CB  
3596 O OG  . SER A 495 ? 0.72059 1.16151 0.76595 0.19995  0.25896  -0.13407 495 SER A OG  
3597 N N   . LEU A 496 ? 0.46626 0.92967 0.58723 0.15661  0.22808  -0.08766 496 LEU A N   
3598 C CA  . LEU A 496 ? 0.54716 1.02124 0.68483 0.13559  0.22157  -0.07147 496 LEU A CA  
3599 C C   . LEU A 496 ? 0.57879 1.07754 0.75908 0.14808  0.20989  -0.07256 496 LEU A C   
3600 O O   . LEU A 496 ? 0.54105 1.02626 0.73008 0.17492  0.19990  -0.08256 496 LEU A O   
3601 C CB  . LEU A 496 ? 0.50426 0.93363 0.61711 0.13014  0.21010  -0.06322 496 LEU A CB  
3602 C CG  . LEU A 496 ? 0.50009 0.90278 0.56816 0.11695  0.21817  -0.06031 496 LEU A CG  
3603 C CD1 . LEU A 496 ? 0.41015 0.76880 0.45859 0.11117  0.20393  -0.05102 496 LEU A CD1 
3604 C CD2 . LEU A 496 ? 0.44696 0.87706 0.51030 0.08894  0.23334  -0.04983 496 LEU A CD2 
3605 N N   . GLN A 497 ? 0.60091 1.13306 0.80558 0.12817  0.20982  -0.06210 497 GLN A N   
3606 C CA  . GLN A 497 ? 0.61763 1.17692 0.86176 0.13796  0.19741  -0.06257 497 GLN A CA  
3607 C C   . GLN A 497 ? 0.59611 1.12404 0.83889 0.14253  0.17801  -0.05484 497 GLN A C   
3608 O O   . GLN A 497 ? 0.59572 1.11491 0.82963 0.12099  0.17515  -0.04251 497 GLN A O   
3609 C CB  . GLN A 497 ? 0.64820 1.25677 0.91896 0.11351  0.20422  -0.05571 497 GLN A CB  
3610 C CG  . GLN A 497 ? 0.70039 1.34632 1.01374 0.12448  0.19275  -0.05897 497 GLN A CG  
3611 C CD  . GLN A 497 ? 0.81503 1.50840 1.15453 0.09671  0.19863  -0.05238 497 GLN A CD  
3612 O OE1 . GLN A 497 ? 0.83959 1.56172 1.21172 0.09706  0.18616  -0.05173 497 GLN A OE1 
3613 N NE2 . GLN A 497 ? 0.88754 1.58737 1.21113 0.07178  0.21706  -0.04714 497 GLN A NE2 
3614 N N   . TYR A 498 ? 0.58938 1.09906 0.83963 0.17041  0.16475  -0.06128 498 TYR A N   
3615 C CA  . TYR A 498 ? 0.53348 1.01368 0.78284 0.17730  0.14662  -0.05314 498 TYR A CA  
3616 C C   . TYR A 498 ? 0.51407 0.99977 0.78653 0.20330  0.13262  -0.05841 498 TYR A C   
3617 O O   . TYR A 498 ? 0.52729 1.01940 0.80630 0.22262  0.13575  -0.07056 498 TYR A O   
3618 C CB  . TYR A 498 ? 0.57156 0.99617 0.78763 0.18369  0.14395  -0.05209 498 TYR A CB  
3619 C CG  . TYR A 498 ? 0.59863 1.00924 0.78898 0.15996  0.15190  -0.04339 498 TYR A CG  
3620 C CD1 . TYR A 498 ? 0.49740 0.89343 0.68372 0.13874  0.14247  -0.02873 498 TYR A CD1 
3621 C CD2 . TYR A 498 ? 0.65777 1.05384 0.82070 0.15637  0.16414  -0.04960 498 TYR A CD2 
3622 C CE1 . TYR A 498 ? 0.51345 0.88004 0.67083 0.11474  0.14459  -0.02045 498 TYR A CE1 
3623 C CE2 . TYR A 498 ? 0.58449 0.95272 0.71775 0.13228  0.16595  -0.04042 498 TYR A CE2 
3624 C CZ  . TYR A 498 ? 0.53256 0.88553 0.66408 0.11196  0.15583  -0.02588 498 TYR A CZ  
3625 O OH  . TYR A 498 ? 0.61646 0.93920 0.71808 0.09070  0.15580  -0.01755 498 TYR A OH  
3626 N N   . ARG A 499 ? 0.41105 0.89281 0.69327 0.20446  0.11661  -0.04892 499 ARG A N   
3627 C CA  . ARG A 499 ? 0.40271 0.87985 0.69940 0.22973  0.10060  -0.05128 499 ARG A CA  
3628 C C   . ARG A 499 ? 0.43685 0.85639 0.70986 0.25153  0.09440  -0.05402 499 ARG A C   
3629 O O   . ARG A 499 ? 0.49059 0.87150 0.73796 0.24489  0.09714  -0.04975 499 ARG A O   
3630 C CB  . ARG A 499 ? 0.51844 1.00099 0.82462 0.22504  0.08433  -0.03938 499 ARG A CB  
3631 C CG  . ARG A 499 ? 0.55808 1.09620 0.89121 0.20424  0.08506  -0.03721 499 ARG A CG  
3632 C CD  . ARG A 499 ? 0.68545 1.24777 1.04363 0.21851  0.06707  -0.03764 499 ARG A CD  
3633 N NE  . ARG A 499 ? 0.75391 1.27307 1.09525 0.23718  0.04865  -0.02973 499 ARG A NE  
3634 C CZ  . ARG A 499 ? 0.69422 1.20879 1.04325 0.26207  0.03381  -0.03188 499 ARG A CZ  
3635 N NH1 . ARG A 499 ? 0.57157 1.04118 0.89924 0.27588  0.01840  -0.02208 499 ARG A NH1 
3636 N NH2 . ARG A 499 ? 0.63467 1.18814 1.01101 0.27342  0.03486  -0.04303 499 ARG A NH2 
3637 N N   . PRO A 500 ? 0.48229 0.91157 0.66293 0.30265  0.12465  0.03047  500 PRO A N   
3638 C CA  . PRO A 500 ? 0.55288 0.90763 0.71274 0.32587  0.12292  0.02086  500 PRO A CA  
3639 C C   . PRO A 500 ? 0.65383 0.95141 0.80010 0.31230  0.11203  0.03389  500 PRO A C   
3640 O O   . PRO A 500 ? 0.76538 0.99748 0.88610 0.30737  0.11138  0.02584  500 PRO A O   
3641 C CB  . PRO A 500 ? 0.51838 0.87376 0.69082 0.35710  0.11675  0.01787  500 PRO A CB  
3642 C CG  . PRO A 500 ? 0.51191 0.94566 0.70813 0.35470  0.12274  0.01669  500 PRO A CG  
3643 C CD  . PRO A 500 ? 0.49346 0.97194 0.69770 0.31836  0.12296  0.03039  500 PRO A CD  
3644 N N   . VAL A 501 ? 0.61922 0.93520 0.77818 0.29862  0.10103  0.05300  501 VAL A N   
3645 C CA  . VAL A 501 ? 0.56210 0.82494 0.70388 0.27544  0.09020  0.06485  501 VAL A CA  
3646 C C   . VAL A 501 ? 0.45889 0.70223 0.58235 0.24218  0.09435  0.05933  501 VAL A C   
3647 O O   . VAL A 501 ? 0.46703 0.65146 0.57069 0.23066  0.09054  0.05925  501 VAL A O   
3648 C CB  . VAL A 501 ? 0.51671 0.81032 0.67253 0.26499  0.07855  0.08418  501 VAL A CB  
3649 C CG1 . VAL A 501 ? 0.61798 0.90385 0.78235 0.29572  0.06973  0.09293  501 VAL A CG1 
3650 C CG2 . VAL A 501 ? 0.55471 0.92619 0.73231 0.24990  0.08088  0.08715  501 VAL A CG2 
3651 N N   . GLU A 502 ? 0.38975 0.68329 0.51996 0.22558  0.10156  0.05572  502 GLU A N   
3652 C CA  . GLU A 502 ? 0.42177 0.69673 0.53386 0.19446  0.10332  0.05217  502 GLU A CA  
3653 C C   . GLU A 502 ? 0.44081 0.67019 0.53131 0.20155  0.11001  0.03542  502 GLU A C   
3654 O O   . GLU A 502 ? 0.44273 0.62592 0.51494 0.18291  0.10590  0.03411  502 GLU A O   
3655 C CB  . GLU A 502 ? 0.42308 0.75959 0.54530 0.17409  0.10798  0.05470  502 GLU A CB  
3656 C CG  . GLU A 502 ? 0.43720 0.79114 0.56805 0.15119  0.09628  0.07082  502 GLU A CG  
3657 C CD  . GLU A 502 ? 0.44256 0.86710 0.59297 0.13853  0.09768  0.07724  502 GLU A CD  
3658 O OE1 . GLU A 502 ? 0.47976 0.95127 0.64425 0.15368  0.10879  0.07125  502 GLU A OE1 
3659 O OE2 . GLU A 502 ? 0.38182 0.81523 0.53350 0.11333  0.08734  0.08808  502 GLU A OE2 
3660 N N   . ARG A 503 ? 0.42572 0.66792 0.51808 0.22944  0.11961  0.02161  503 ARG A N   
3661 C CA  . ARG A 503 ? 0.47419 0.66760 0.54275 0.23889  0.12427  0.00350  503 ARG A CA  
3662 C C   . ARG A 503 ? 0.63651 0.75547 0.69202 0.24202  0.11368  0.00570  503 ARG A C   
3663 O O   . ARG A 503 ? 0.64960 0.72034 0.68408 0.22797  0.11133  -0.00163 503 ARG A O   
3664 C CB  . ARG A 503 ? 0.49368 0.71196 0.56651 0.27389  0.13554  -0.01255 503 ARG A CB  
3665 C CG  . ARG A 503 ? 0.52906 0.83076 0.61977 0.27198  0.14731  -0.01223 503 ARG A CG  
3666 C CD  . ARG A 503 ? 0.52849 0.84667 0.60776 0.29312  0.16280  -0.03431 503 ARG A CD  
3667 N NE  . ARG A 503 ? 0.49998 0.89739 0.59885 0.28863  0.17206  -0.03223 503 ARG A NE  
3668 C CZ  . ARG A 503 ? 0.55516 0.99129 0.64805 0.26058  0.17985  -0.02977 503 ARG A CZ  
3669 N NH1 . ARG A 503 ? 0.54912 0.95358 0.61717 0.23619  0.17903  -0.02942 503 ARG A NH1 
3670 N NH2 . ARG A 503 ? 0.55000 1.04998 0.66028 0.25319  0.18545  -0.02611 503 ARG A NH2 
3671 N N   . GLU A 504 ? 0.66761 0.77775 0.73531 0.25893  0.10644  0.01706  504 GLU A N   
3672 C CA  . GLU A 504 ? 0.57922 0.62134 0.63461 0.25833  0.09630  0.02335  504 GLU A CA  
3673 C C   . GLU A 504 ? 0.47847 0.50153 0.52610 0.22224  0.09085  0.03326  504 GLU A C   
3674 O O   . GLU A 504 ? 0.53930 0.50967 0.57056 0.21101  0.08738  0.02931  504 GLU A O   
3675 C CB  . GLU A 504 ? 0.67073 0.71406 0.73974 0.28017  0.08882  0.03765  504 GLU A CB  
3676 C CG  . GLU A 504 ? 0.88847 0.86556 0.94446 0.27647  0.07823  0.04912  504 GLU A CG  
3677 C CD  . GLU A 504 ? 1.13308 1.04588 1.17133 0.29526  0.07654  0.03601  504 GLU A CD  
3678 O OE1 . GLU A 504 ? 1.18032 1.03843 1.20140 0.27639  0.07229  0.03587  504 GLU A OE1 
3679 O OE2 . GLU A 504 ? 1.25097 1.16877 1.29284 0.32905  0.07901  0.02500  504 GLU A OE2 
3680 N N   . LEU A 505 ? 0.47067 0.53662 0.53030 0.20384  0.08934  0.04541  505 LEU A N   
3681 C CA  . LEU A 505 ? 0.52568 0.57360 0.57832 0.17373  0.08393  0.05364  505 LEU A CA  
3682 C C   . LEU A 505 ? 0.59075 0.62446 0.62931 0.15538  0.08712  0.04114  505 LEU A C   
3683 O O   . LEU A 505 ? 0.48646 0.48228 0.51517 0.13882  0.08249  0.04209  505 LEU A O   
3684 C CB  . LEU A 505 ? 0.37716 0.47060 0.44258 0.15960  0.08038  0.06678  505 LEU A CB  
3685 C CG  . LEU A 505 ? 0.37679 0.45655 0.43543 0.13158  0.07484  0.07385  505 LEU A CG  
3686 C CD1 . LEU A 505 ? 0.36588 0.40192 0.41789 0.13143  0.06983  0.08296  505 LEU A CD1 
3687 C CD2 . LEU A 505 ? 0.37359 0.49801 0.44211 0.11972  0.07068  0.08302  505 LEU A CD2 
3688 N N   . GLY A 506 ? 0.59214 0.65830 0.62956 0.15820  0.09495  0.02984  506 GLY A N   
3689 C CA  . GLY A 506 ? 0.45797 0.50835 0.47783 0.14381  0.09735  0.01731  506 GLY A CA  
3690 C C   . GLY A 506 ? 0.48219 0.47325 0.48550 0.15157  0.09500  0.00573  506 GLY A C   
3691 O O   . GLY A 506 ? 0.48296 0.44199 0.47492 0.13250  0.08958  0.00351  506 GLY A O   
3692 N N   . LYS A 507 ? 0.51901 0.49376 0.52137 0.17988  0.09756  -0.00169 507 LYS A N   
3693 C CA  . LYS A 507 ? 0.64314 0.55398 0.62840 0.18640  0.09278  -0.01202 507 LYS A CA  
3694 C C   . LYS A 507 ? 0.66952 0.54036 0.65583 0.16757  0.08268  0.00193  507 LYS A C   
3695 O O   . LYS A 507 ? 0.73912 0.56741 0.71231 0.15358  0.07727  -0.00409 507 LYS A O   
3696 C CB  . LYS A 507 ? 0.74558 0.64001 0.73024 0.22216  0.09478  -0.02003 507 LYS A CB  
3697 C CG  . LYS A 507 ? 0.90209 0.73072 0.86296 0.22990  0.09051  -0.03736 507 LYS A CG  
3698 C CD  . LYS A 507 ? 1.05029 0.83151 1.00860 0.25780  0.08460  -0.03754 507 LYS A CD  
3699 C CE  . LYS A 507 ? 1.22768 0.93116 1.16725 0.24361  0.07294  -0.03960 507 LYS A CE  
3700 N NZ  . LYS A 507 ? 1.32099 1.00721 1.24051 0.22480  0.07250  -0.05761 507 LYS A NZ  
3701 N N   . ARG A 508 ? 0.62381 0.51170 0.62555 0.16544  0.08008  0.02071  508 ARG A N   
3702 C CA  . ARG A 508 ? 0.59641 0.45093 0.59864 0.14950  0.07262  0.03491  508 ARG A CA  
3703 C C   . ARG A 508 ? 0.54595 0.40877 0.54842 0.11951  0.07066  0.03716  508 ARG A C   
3704 O O   . ARG A 508 ? 0.51741 0.34589 0.51590 0.10387  0.06559  0.03985  508 ARG A O   
3705 C CB  . ARG A 508 ? 0.62782 0.49914 0.64236 0.15798  0.07063  0.05360  508 ARG A CB  
3706 C CG  . ARG A 508 ? 0.93101 0.75230 0.94000 0.15992  0.06417  0.06573  508 ARG A CG  
3707 C CD  . ARG A 508 ? 0.96814 0.80786 0.98524 0.15951  0.06146  0.08693  508 ARG A CD  
3708 N NE  . ARG A 508 ? 0.88142 0.77335 0.91070 0.17464  0.06357  0.08847  508 ARG A NE  
3709 C CZ  . ARG A 508 ? 0.72735 0.65466 0.76433 0.16727  0.06178  0.10150  508 ARG A CZ  
3710 N NH1 . ARG A 508 ? 0.59434 0.51085 0.62668 0.14736  0.05956  0.11293  508 ARG A NH1 
3711 N NH2 . ARG A 508 ? 0.73216 0.70761 0.78144 0.17934  0.06218  0.10227  508 ARG A NH2 
3712 N N   . MET A 509 ? 0.43066 0.33879 0.43833 0.11097  0.07385  0.03632  509 MET A N   
3713 C CA  . MET A 509 ? 0.45396 0.36792 0.46171 0.08553  0.07029  0.03875  509 MET A CA  
3714 C C   . MET A 509 ? 0.60936 0.49998 0.60364 0.07550  0.06822  0.02438  509 MET A C   
3715 O O   . MET A 509 ? 0.62331 0.49802 0.61755 0.05704  0.06241  0.02605  509 MET A O   
3716 C CB  . MET A 509 ? 0.45096 0.41347 0.46599 0.07862  0.07177  0.04364  509 MET A CB  
3717 C CG  . MET A 509 ? 0.41315 0.39520 0.43988 0.07989  0.06980  0.05903  509 MET A CG  
3718 S SD  . MET A 509 ? 0.48594 0.52224 0.52051 0.07234  0.06917  0.06429  509 MET A SD  
3719 C CE  . MET A 509 ? 0.41191 0.44028 0.43979 0.04641  0.06319  0.06266  509 MET A CE  
3720 N N   . LEU A 510 ? 0.61345 0.50373 0.59606 0.08824  0.07269  0.00974  510 LEU A N   
3721 C CA  . LEU A 510 ? 0.51537 0.37933 0.48055 0.08039  0.06962  -0.00536 510 LEU A CA  
3722 C C   . LEU A 510 ? 0.57361 0.38428 0.53453 0.07698  0.06229  -0.00708 510 LEU A C   
3723 O O   . LEU A 510 ? 0.69354 0.48474 0.64928 0.05850  0.05498  -0.01090 510 LEU A O   
3724 C CB  . LEU A 510 ? 0.57705 0.45110 0.52756 0.09804  0.07730  -0.02184 510 LEU A CB  
3725 C CG  . LEU A 510 ? 0.57204 0.41420 0.49818 0.09488  0.07422  -0.04085 510 LEU A CG  
3726 C CD1 . LEU A 510 ? 0.50588 0.35976 0.42368 0.07029  0.06905  -0.04146 510 LEU A CD1 
3727 C CD2 . LEU A 510 ? 0.57477 0.42604 0.48634 0.11922  0.08402  -0.05772 510 LEU A CD2 
3728 N N   . SER A 511 ? 0.51923 0.30561 0.48262 0.09365  0.06282  -0.00321 511 SER A N   
3729 C CA  . SER A 511 ? 0.67126 0.40340 0.62973 0.08760  0.05487  -0.00240 511 SER A CA  
3730 C C   . SER A 511 ? 0.62292 0.35528 0.59519 0.06316  0.04996  0.01364  511 SER A C   
3731 O O   . SER A 511 ? 0.73388 0.43161 0.70363 0.04766  0.04257  0.01286  511 SER A O   
3732 C CB  . SER A 511 ? 0.70248 0.40646 0.65930 0.11099  0.05526  0.00107  511 SER A CB  
3733 O OG  . SER A 511 ? 0.90190 0.62520 0.85349 0.13783  0.06246  -0.01096 511 SER A OG  
3734 N N   . ALA A 512 ? 0.51501 0.28702 0.50188 0.05934  0.05377  0.02753  512 ALA A N   
3735 C CA  . ALA A 512 ? 0.55717 0.33640 0.55635 0.03797  0.05068  0.03976  512 ALA A CA  
3736 C C   . ALA A 512 ? 0.58933 0.37017 0.58713 0.01925  0.04508  0.03027  512 ALA A C   
3737 O O   . ALA A 512 ? 0.62495 0.38997 0.62928 0.00220  0.03952  0.03375  512 ALA A O   
3738 C CB  . ALA A 512 ? 0.42519 0.24681 0.43569 0.03947  0.05515  0.05211  512 ALA A CB  
3739 N N   . VAL A 513 ? 0.51738 0.31946 0.50708 0.02155  0.04599  0.01936  513 VAL A N   
3740 C CA  . VAL A 513 ? 0.54703 0.35038 0.53241 0.00530  0.03896  0.01091  513 VAL A CA  
3741 C C   . VAL A 513 ? 0.59871 0.36017 0.57287 -0.00058 0.03160  -0.00060 513 VAL A C   
3742 O O   . VAL A 513 ? 0.65698 0.40877 0.63826 -0.01878 0.02314  0.00045  513 VAL A O   
3743 C CB  . VAL A 513 ? 0.51137 0.34314 0.48567 0.00907  0.04161  0.00342  513 VAL A CB  
3744 C CG1 . VAL A 513 ? 0.42960 0.25630 0.39390 -0.00555 0.03286  -0.00566 513 VAL A CG1 
3745 C CG2 . VAL A 513 ? 0.38595 0.25581 0.37236 0.00771  0.04474  0.01562  513 VAL A CG2 
3746 N N   . ILE A 514 ? 0.55439 0.29100 0.51132 0.01519  0.03395  -0.01245 514 ILE A N   
3747 C CA  . ILE A 514 ? 0.56072 0.25246 0.50160 0.01056  0.02544  -0.02669 514 ILE A CA  
3748 C C   . ILE A 514 ? 0.70864 0.36840 0.66157 -0.00398 0.01827  -0.01657 514 ILE A C   
3749 O O   . ILE A 514 ? 0.83076 0.47267 0.78395 -0.02349 0.00766  -0.02072 514 ILE A O   
3750 C CB  . ILE A 514 ? 0.60158 0.27073 0.52113 0.03499  0.03026  -0.04199 514 ILE A CB  
3751 C CG1 . ILE A 514 ? 0.58340 0.29421 0.49424 0.04836  0.04008  -0.04933 514 ILE A CG1 
3752 C CG2 . ILE A 514 ? 0.65626 0.27401 0.55397 0.03073  0.01993  -0.05997 514 ILE A CG2 
3753 C CD1 . ILE A 514 ? 0.57715 0.30204 0.47451 0.03362  0.03551  -0.05866 514 ILE A CD1 
3754 N N   . GLU A 515 ? 0.66902 0.32276 0.63196 0.00402  0.02339  -0.00204 515 GLU A N   
3755 C CA  . GLU A 515 ? 0.75900 0.38343 0.73194 -0.01151 0.01782  0.01067  515 GLU A CA  
3756 C C   . GLU A 515 ? 0.69397 0.34770 0.68843 -0.03604 0.01514  0.02124  515 GLU A C   
3757 O O   . GLU A 515 ? 0.75330 0.38697 0.75523 -0.05657 0.00726  0.02496  515 GLU A O   
3758 C CB  . GLU A 515 ? 0.85535 0.47289 0.83264 0.00213  0.02418  0.02685  515 GLU A CB  
3759 C CG  . GLU A 515 ? 0.90651 0.47723 0.86504 0.02277  0.02217  0.01878  515 GLU A CG  
3760 C CD  . GLU A 515 ? 1.07461 0.58693 1.02175 0.00853  0.01005  0.01201  515 GLU A CD  
3761 O OE1 . GLU A 515 ? 1.06779 0.56035 1.02434 -0.01051 0.00561  0.02870  515 GLU A OE1 
3762 O OE2 . GLU A 515 ? 1.15782 0.64534 1.08560 0.01487  0.00484  -0.00999 515 GLU A OE2 
3763 N N   . PHE A 516 ? 0.64346 0.34506 0.64891 -0.03410 0.02109  0.02616  516 PHE A N   
3764 C CA  . PHE A 516 ? 0.61049 0.34167 0.63594 -0.05294 0.01824  0.03321  516 PHE A CA  
3765 C C   . PHE A 516 ? 0.65729 0.38127 0.67995 -0.06764 0.00643  0.01997  516 PHE A C   
3766 O O   . PHE A 516 ? 0.65743 0.37910 0.69507 -0.08731 -0.00079 0.02392  516 PHE A O   
3767 C CB  . PHE A 516 ? 0.47116 0.24739 0.50363 -0.04510 0.02485  0.03789  516 PHE A CB  
3768 C CG  . PHE A 516 ? 0.44219 0.24843 0.49215 -0.05905 0.02077  0.04074  516 PHE A CG  
3769 C CD1 . PHE A 516 ? 0.48663 0.30475 0.55700 -0.07061 0.02261  0.05324  516 PHE A CD1 
3770 C CD2 . PHE A 516 ? 0.45229 0.27647 0.49795 -0.05948 0.01534  0.03165  516 PHE A CD2 
3771 C CE1 . PHE A 516 ? 0.38357 0.23312 0.47198 -0.07951 0.01951  0.05461  516 PHE A CE1 
3772 C CE2 . PHE A 516 ? 0.47553 0.32532 0.53750 -0.06897 0.01010  0.03403  516 PHE A CE2 
3773 C CZ  . PHE A 516 ? 0.47442 0.33805 0.55897 -0.07759 0.01238  0.04454  516 PHE A CZ  
3774 N N   . ALA A 517 ? 0.57385 0.29692 0.57720 -0.05900 0.00408  0.00471  517 ALA A N   
3775 C CA  . ALA A 517 ? 0.59582 0.31097 0.59164 -0.07211 -0.00852 -0.00822 517 ALA A CA  
3776 C C   . ALA A 517 ? 0.74659 0.41680 0.73680 -0.08421 -0.01833 -0.01433 517 ALA A C   
3777 O O   . ALA A 517 ? 0.91143 0.57821 0.90691 -0.10297 -0.03115 -0.01892 517 ALA A O   
3778 C CB  . ALA A 517 ? 0.51881 0.23799 0.48892 -0.05984 -0.00763 -0.02280 517 ALA A CB  
3779 N N   . LYS A 518 ? 0.65303 0.28739 0.63304 -0.07426 -0.01419 -0.01391 518 LYS A N   
3780 C CA  . LYS A 518 ? 0.65551 0.23761 0.62449 -0.08466 -0.02515 -0.02145 518 LYS A CA  
3781 C C   . LYS A 518 ? 0.76703 0.34337 0.76045 -0.10764 -0.02924 -0.00410 518 LYS A C   
3782 O O   . LYS A 518 ? 0.89765 0.45071 0.89324 -0.12946 -0.04278 -0.00812 518 LYS A O   
3783 C CB  . LYS A 518 ? 0.70935 0.25033 0.65437 -0.06157 -0.02044 -0.02956 518 LYS A CB  
3784 C CG  . LYS A 518 ? 0.77196 0.28628 0.68484 -0.05084 -0.02596 -0.05519 518 LYS A CG  
3785 C CD  . LYS A 518 ? 0.76211 0.26540 0.65583 -0.01848 -0.01503 -0.06390 518 LYS A CD  
3786 C CE  . LYS A 518 ? 0.85684 0.32545 0.71577 -0.00714 -0.02043 -0.09113 518 LYS A CE  
3787 N NZ  . LYS A 518 ? 0.95075 0.43715 0.79498 0.02481  -0.00639 -0.10126 518 LYS A NZ  
3788 N N   . THR A 519 ? 0.76636 0.36678 0.77799 -0.10447 -0.01786 0.01551  519 THR A N   
3789 C CA  . THR A 519 ? 0.69110 0.28774 0.72323 -0.12461 -0.01821 0.03465  519 THR A CA  
3790 C C   . THR A 519 ? 0.65229 0.30681 0.71333 -0.13168 -0.00950 0.05060  519 THR A C   
3791 O O   . THR A 519 ? 0.77940 0.43959 0.85847 -0.14863 -0.00726 0.06761  519 THR A O   
3792 C CB  . THR A 519 ? 0.72686 0.28576 0.74764 -0.11365 -0.01276 0.04565  519 THR A CB  
3793 O OG1 . THR A 519 ? 0.75518 0.35003 0.78113 -0.09498 0.00139  0.05654  519 THR A OG1 
3794 C CG2 . THR A 519 ? 0.71874 0.22289 0.70837 -0.09604 -0.01880 0.02739  519 THR A CG2 
3795 N N   . GLY A 520 ? 0.60949 0.30576 0.67395 -0.11922 -0.00441 0.04587  520 GLY A N   
3796 C CA  . GLY A 520 ? 0.65923 0.40547 0.74697 -0.12105 0.00407  0.05886  520 GLY A CA  
3797 C C   . GLY A 520 ? 0.75067 0.50402 0.83666 -0.10789 0.01748  0.07358  520 GLY A C   
3798 O O   . GLY A 520 ? 0.73735 0.53032 0.83913 -0.10803 0.02538  0.08387  520 GLY A O   
3799 N N   . ASN A 521 ? 0.75887 0.47532 0.82507 -0.09496 0.01950  0.07409  521 ASN A N   
3800 C CA  . ASN A 521 ? 0.76904 0.48829 0.83214 -0.08298 0.02974  0.08951  521 ASN A CA  
3801 C C   . ASN A 521 ? 0.77102 0.47902 0.81438 -0.05676 0.03225  0.08088  521 ASN A C   
3802 O O   . ASN A 521 ? 0.74614 0.41344 0.77300 -0.04900 0.02696  0.07085  521 ASN A O   
3803 C CB  . ASN A 521 ? 0.86692 0.55024 0.92933 -0.09616 0.02847  0.10499  521 ASN A CB  
3804 C CG  . ASN A 521 ? 1.01087 0.70485 1.07241 -0.08902 0.03859  0.12509  521 ASN A CG  
3805 O OD1 . ASN A 521 ? 1.05031 0.74555 1.09959 -0.06643 0.04274  0.12484  521 ASN A OD1 
3806 N ND2 . ASN A 521 ? 1.12415 0.82936 1.19879 -0.10891 0.04262  0.14322  521 ASN A ND2 
3807 N N   . PRO A 522 ? 0.69922 0.44323 0.74404 -0.04251 0.03988  0.08388  522 PRO A N   
3808 C CA  . PRO A 522 ? 0.61871 0.36160 0.64914 -0.01902 0.04238  0.07594  522 PRO A CA  
3809 C C   . PRO A 522 ? 0.67273 0.38253 0.69219 -0.00450 0.04346  0.08346  522 PRO A C   
3810 O O   . PRO A 522 ? 0.80349 0.50531 0.81165 0.01605  0.04406  0.07418  522 PRO A O   
3811 C CB  . PRO A 522 ? 0.57218 0.36219 0.60991 -0.01309 0.04858  0.08110  522 PRO A CB  
3812 C CG  . PRO A 522 ? 0.64480 0.44722 0.69483 -0.02582 0.05212  0.09744  522 PRO A CG  
3813 C CD  . PRO A 522 ? 0.65891 0.44440 0.71783 -0.04674 0.04672  0.09604  522 PRO A CD  
3814 N N   . ALA A 523 ? 0.76898 0.46032 0.79134 -0.01407 0.04357  0.10053  523 ALA A N   
3815 C CA  . ALA A 523 ? 0.94836 0.61294 0.96016 0.00103  0.04413  0.11242  523 ALA A CA  
3816 C C   . ALA A 523 ? 1.12143 0.72910 1.11794 0.00929  0.03621  0.10240  523 ALA A C   
3817 O O   . ALA A 523 ? 0.89293 0.46739 0.88763 -0.00866 0.02915  0.09823  523 ALA A O   
3818 C CB  . ALA A 523 ? 0.86909 0.53150 0.88552 -0.01397 0.04677  0.13634  523 ALA A CB  
3819 N N   . GLN A 524 ? 1.60640 1.20368 1.59227 0.03716  0.03665  0.09785  524 GLN A N   
3820 C CA  . GLN A 524 ? 1.79912 1.33694 1.76837 0.05124  0.02916  0.09207  524 GLN A CA  
3821 C C   . GLN A 524 ? 1.88198 1.37650 1.84721 0.03668  0.02357  0.11375  524 GLN A C   
3822 O O   . GLN A 524 ? 1.91100 1.42997 1.88592 0.02097  0.02811  0.13414  524 GLN A O   
3823 C CB  . GLN A 524 ? 1.92150 1.46546 1.88465 0.08685  0.03165  0.08723  524 GLN A CB  
3824 C CG  . GLN A 524 ? 1.98536 1.58621 1.95569 0.10043  0.03963  0.07289  524 GLN A CG  
3825 C CD  . GLN A 524 ? 2.06982 1.70719 2.04711 0.12310  0.04424  0.08291  524 GLN A CD  
3826 O OE1 . GLN A 524 ? 2.12137 1.77237 2.10431 0.11759  0.04474  0.10322  524 GLN A OE1 
3827 N NE2 . GLN A 524 ? 2.06042 1.71637 2.03701 0.14861  0.04752  0.06835  524 GLN A NE2 
3828 N N   . ASP A 525 ? 1.91942 1.34841 1.86841 0.04162  0.01366  0.10993  525 ASP A N   
3829 C CA  . ASP A 525 ? 1.85887 1.25345 1.80619 0.02866  0.00487  0.13117  525 ASP A CA  
3830 C C   . ASP A 525 ? 1.63852 1.03038 1.57962 0.05684  0.00317  0.14221  525 ASP A C   
3831 O O   . ASP A 525 ? 1.65372 1.04273 1.58869 0.08889  0.00371  0.12733  525 ASP A O   
3832 C CB  . ASP A 525 ? 1.97379 1.31951 1.91990 0.01711  -0.00513 0.12059  525 ASP A CB  
3833 C CG  . ASP A 525 ? 1.98374 1.33807 1.93772 -0.01445 -0.00438 0.11243  525 ASP A CG  
3834 O OD1 . ASP A 525 ? 2.00071 1.33183 1.94625 -0.01372 -0.01093 0.08897  525 ASP A OD1 
3835 O OD2 . ASP A 525 ? 1.94920 1.33672 1.91596 -0.03873 0.00306  0.12812  525 ASP A OD2 
3836 N N   . GLY A 526 ? 1.24504 0.64248 1.18682 0.04481  0.00081  0.16805  526 GLY A N   
3837 C CA  . GLY A 526 ? 1.10729 0.51440 1.04325 0.06881  -0.00016 0.18071  526 GLY A CA  
3838 C C   . GLY A 526 ? 1.13726 0.60587 1.08043 0.07925  0.01433  0.18439  526 GLY A C   
3839 O O   . GLY A 526 ? 1.17235 0.65720 1.11279 0.09872  0.01319  0.19481  526 GLY A O   
3840 N N   . GLU A 527 ? 0.98810 0.49292 0.94417 0.06661  0.02626  0.17635  527 GLU A N   
3841 C CA  . GLU A 527 ? 0.94456 0.51612 0.91307 0.06924  0.03634  0.17803  527 GLU A CA  
3842 C C   . GLU A 527 ? 0.90734 0.50419 0.88345 0.03886  0.04260  0.19220  527 GLU A C   
3843 O O   . GLU A 527 ? 0.99231 0.58081 0.97498 0.01543  0.04271  0.18721  527 GLU A O   
3844 C CB  . GLU A 527 ? 1.02592 0.63194 1.00391 0.07755  0.04009  0.15206  527 GLU A CB  
3845 C CG  . GLU A 527 ? 1.14015 0.81216 1.13092 0.07286  0.04801  0.15082  527 GLU A CG  
3846 C CD  . GLU A 527 ? 1.18920 0.88519 1.18808 0.06558  0.05060  0.12895  527 GLU A CD  
3847 O OE1 . GLU A 527 ? 1.21376 0.87805 1.20834 0.06086  0.04681  0.11544  527 GLU A OE1 
3848 O OE2 . GLU A 527 ? 1.15825 0.90220 1.16555 0.06425  0.05514  0.12543  527 GLU A OE2 
3849 N N   . GLU A 528 ? 0.73469 0.36376 0.70976 0.03979  0.04743  0.20932  528 GLU A N   
3850 C CA  . GLU A 528 ? 0.67816 0.33979 0.65999 0.01500  0.05538  0.22020  528 GLU A CA  
3851 C C   . GLU A 528 ? 0.65173 0.36831 0.64747 0.01547  0.06158  0.20365  528 GLU A C   
3852 O O   . GLU A 528 ? 0.67452 0.42059 0.66944 0.03341  0.06209  0.19889  528 GLU A O   
3853 C CB  . GLU A 528 ? 0.67518 0.34933 0.64285 0.01382  0.05547  0.24026  528 GLU A CB  
3854 C CG  . GLU A 528 ? 0.88383 0.51868 0.83595 -0.00460 0.04924  0.25438  528 GLU A CG  
3855 C CD  . GLU A 528 ? 0.91186 0.53223 0.87258 -0.03196 0.05007  0.24888  528 GLU A CD  
3856 O OE1 . GLU A 528 ? 0.88335 0.54481 0.85870 -0.04945 0.05984  0.24789  528 GLU A OE1 
3857 O OE2 . GLU A 528 ? 0.89882 0.46675 0.85098 -0.03525 0.04001  0.24473  528 GLU A OE2 
3858 N N   . TRP A 529 ? 0.56035 0.28989 0.56904 -0.00468 0.06466  0.19522  529 TRP A N   
3859 C CA  . TRP A 529 ? 0.53190 0.31078 0.55260 -0.00695 0.06955  0.18256  529 TRP A CA  
3860 C C   . TRP A 529 ? 0.64448 0.43881 0.67771 -0.03161 0.07461  0.18740  529 TRP A C   
3861 O O   . TRP A 529 ? 0.75238 0.53944 0.79695 -0.04470 0.07153  0.17688  529 TRP A O   
3862 C CB  . TRP A 529 ? 0.48803 0.26886 0.51339 0.00193  0.06524  0.15940  529 TRP A CB  
3863 C CG  . TRP A 529 ? 0.48885 0.31399 0.52328 0.00075  0.06793  0.14797  529 TRP A CG  
3864 C CD1 . TRP A 529 ? 0.41705 0.27621 0.45783 -0.00809 0.07315  0.15278  529 TRP A CD1 
3865 C CD2 . TRP A 529 ? 0.49973 0.33736 0.53603 0.00859  0.06496  0.12966  529 TRP A CD2 
3866 N NE1 . TRP A 529 ? 0.58000 0.46687 0.62624 -0.00560 0.07185  0.13846  529 TRP A NE1 
3867 C CE2 . TRP A 529 ? 0.46371 0.33833 0.50720 0.00283  0.06685  0.12548  529 TRP A CE2 
3868 C CE3 . TRP A 529 ? 0.42732 0.24830 0.45842 0.01993  0.06120  0.11643  529 TRP A CE3 
3869 C CZ2 . TRP A 529 ? 0.46362 0.35571 0.50858 0.00588  0.06383  0.11107  529 TRP A CZ2 
3870 C CZ3 . TRP A 529 ? 0.49917 0.34342 0.53207 0.02259  0.06030  0.10213  529 TRP A CZ3 
3871 C CH2 . TRP A 529 ? 0.47185 0.34982 0.51136 0.01451  0.06099  0.10067  529 TRP A CH2 
3872 N N   . PRO A 530 ? 0.67044 0.48959 0.70211 -0.03815 0.08242  0.20302  530 PRO A N   
3873 C CA  . PRO A 530 ? 0.64635 0.48360 0.69138 -0.06143 0.08909  0.21062  530 PRO A CA  
3874 C C   . PRO A 530 ? 0.60936 0.48804 0.67238 -0.06434 0.09156  0.19371  530 PRO A C   
3875 O O   . PRO A 530 ? 0.57506 0.46963 0.63690 -0.04973 0.08887  0.17873  530 PRO A O   
3876 C CB  . PRO A 530 ? 0.56693 0.42202 0.59823 -0.06248 0.09665  0.22911  530 PRO A CB  
3877 C CG  . PRO A 530 ? 0.62714 0.46503 0.63856 -0.04079 0.09203  0.23448  530 PRO A CG  
3878 C CD  . PRO A 530 ? 0.68839 0.52258 0.70505 -0.02422 0.08546  0.21464  530 PRO A CD  
3879 N N   . ASN A 531 ? 0.62173 0.51849 0.70226 -0.08422 0.09612  0.19753  531 ASN A N   
3880 C CA  . ASN A 531 ? 0.53918 0.47525 0.63904 -0.08642 0.09748  0.18290  531 ASN A CA  
3881 C C   . ASN A 531 ? 0.54087 0.51691 0.63561 -0.07330 0.10534  0.18115  531 ASN A C   
3882 O O   . ASN A 531 ? 0.66536 0.64989 0.74653 -0.07085 0.11339  0.19548  531 ASN A O   
3883 C CB  . ASN A 531 ? 0.46548 0.41701 0.58840 -0.11026 0.10066  0.18909  531 ASN A CB  
3884 C CG  . ASN A 531 ? 0.58880 0.51747 0.72419 -0.12085 0.08864  0.17705  531 ASN A CG  
3885 O OD1 . ASN A 531 ? 0.61653 0.56434 0.76483 -0.11766 0.08334  0.16047  531 ASN A OD1 
3886 N ND2 . ASN A 531 ? 0.64776 0.53191 0.77666 -0.13310 0.08275  0.18503  531 ASN A ND2 
3887 N N   . PHE A 532 ? 0.45575 0.45335 0.55881 -0.06496 0.10166  0.16323  532 PHE A N   
3888 C CA  . PHE A 532 ? 0.41967 0.45117 0.51802 -0.05252 0.10650  0.15740  532 PHE A CA  
3889 C C   . PHE A 532 ? 0.45838 0.52941 0.57691 -0.06014 0.11463  0.15656  532 PHE A C   
3890 O O   . PHE A 532 ? 0.43900 0.51719 0.58002 -0.06917 0.11036  0.14944  532 PHE A O   
3891 C CB  . PHE A 532 ? 0.38196 0.41075 0.47660 -0.03947 0.09637  0.13913  532 PHE A CB  
3892 C CG  . PHE A 532 ? 0.43595 0.49117 0.52305 -0.02694 0.09802  0.13124  532 PHE A CG  
3893 C CD1 . PHE A 532 ? 0.39215 0.47462 0.49385 -0.02586 0.09899  0.12108  532 PHE A CD1 
3894 C CD2 . PHE A 532 ? 0.43649 0.48790 0.50166 -0.01528 0.09676  0.13281  532 PHE A CD2 
3895 C CE1 . PHE A 532 ? 0.34773 0.44799 0.43941 -0.01258 0.09891  0.11171  532 PHE A CE1 
3896 C CE2 . PHE A 532 ? 0.37978 0.45025 0.43516 -0.00491 0.09599  0.12395  532 PHE A CE2 
3897 C CZ  . PHE A 532 ? 0.31537 0.40764 0.38264 -0.00315 0.09711  0.11282  532 PHE A CZ  
3898 N N   . SER A 533 ? 0.50033 0.59950 0.61051 -0.05532 0.12606  0.16311  533 SER A N   
3899 C CA  . SER A 533 ? 0.46805 0.61238 0.59595 -0.05771 0.13628  0.16081  533 SER A CA  
3900 C C   . SER A 533 ? 0.55802 0.72498 0.66611 -0.04059 0.14305  0.15593  533 SER A C   
3901 O O   . SER A 533 ? 0.56495 0.71407 0.64606 -0.03231 0.14122  0.16008  533 SER A O   
3902 C CB  . SER A 533 ? 0.46809 0.62723 0.60874 -0.07843 0.14805  0.18028  533 SER A CB  
3903 O OG  . SER A 533 ? 0.50810 0.65811 0.62331 -0.07995 0.15636  0.19875  533 SER A OG  
3904 N N   . LYS A 534 ? 0.58132 0.78832 0.70274 -0.03419 0.14997  0.14603  534 LYS A N   
3905 C CA  . LYS A 534 ? 0.61564 0.84398 0.71525 -0.01815 0.15768  0.14074  534 LYS A CA  
3906 C C   . LYS A 534 ? 0.62066 0.85540 0.69946 -0.02516 0.17123  0.16143  534 LYS A C   
3907 O O   . LYS A 534 ? 0.60518 0.83481 0.65322 -0.01394 0.17171  0.16155  534 LYS A O   
3908 C CB  . LYS A 534 ? 0.75121 1.02325 0.86964 -0.00835 0.16450  0.12648  534 LYS A CB  
3909 C CG  . LYS A 534 ? 0.87441 1.15911 0.96703 0.01299  0.16757  0.11322  534 LYS A CG  
3910 C CD  . LYS A 534 ? 0.97602 1.30208 1.08748 0.02706  0.17365  0.09654  534 LYS A CD  
3911 C CE  . LYS A 534 ? 1.08773 1.46544 1.20989 0.02109  0.19654  0.10774  534 LYS A CE  
3912 N NZ  . LYS A 534 ? 1.11864 1.53759 1.24158 0.04382  0.20571  0.08903  534 LYS A NZ  
3913 N N   . GLU A 535 ? 0.63974 0.88307 0.73346 -0.04532 0.18057  0.18017  535 GLU A N   
3914 C CA  . GLU A 535 ? 0.72474 0.96190 0.79430 -0.05431 0.18703  0.19613  535 GLU A CA  
3915 C C   . GLU A 535 ? 0.73975 0.93187 0.78156 -0.05145 0.17720  0.20638  535 GLU A C   
3916 O O   . GLU A 535 ? 0.76081 0.94981 0.77278 -0.04686 0.17962  0.21380  535 GLU A O   
3917 C CB  . GLU A 535 ? 0.86329 1.10286 0.95196 -0.07849 0.19071  0.20753  535 GLU A CB  
3918 C CG  . GLU A 535 ? 0.99660 1.28704 1.11457 -0.08252 0.20121  0.19917  535 GLU A CG  
3919 C CD  . GLU A 535 ? 1.05766 1.35988 1.21032 -0.07821 0.19372  0.18464  535 GLU A CD  
3920 O OE1 . GLU A 535 ? 1.07968 1.35670 1.24936 -0.09280 0.18353  0.18859  535 GLU A OE1 
3921 O OE2 . GLU A 535 ? 1.06987 1.40459 1.23129 -0.05953 0.19697  0.16860  535 GLU A OE2 
3922 N N   . ASP A 536 ? 0.70772 0.86569 0.75920 -0.05320 0.16555  0.20626  536 ASP A N   
3923 C CA  . ASP A 536 ? 0.58946 0.70559 0.61960 -0.04845 0.15530  0.21447  536 ASP A CA  
3924 C C   . ASP A 536 ? 0.52510 0.62210 0.56189 -0.03713 0.14152  0.19666  536 ASP A C   
3925 O O   . ASP A 536 ? 0.73938 0.81233 0.79171 -0.04394 0.13376  0.19363  536 ASP A O   
3926 C CB  . ASP A 536 ? 0.59540 0.67732 0.62566 -0.06508 0.15106  0.22910  536 ASP A CB  
3927 C CG  . ASP A 536 ? 0.60668 0.64779 0.61447 -0.05686 0.14082  0.23782  536 ASP A CG  
3928 O OD1 . ASP A 536 ? 0.64236 0.68753 0.63109 -0.04060 0.13833  0.23615  536 ASP A OD1 
3929 O OD2 . ASP A 536 ? 0.62655 0.63116 0.63604 -0.06619 0.13421  0.24565  536 ASP A OD2 
3930 N N   . PRO A 537 ? 0.47656 0.58228 0.49992 -0.02093 0.13671  0.18282  537 PRO A N   
3931 C CA  . PRO A 537 ? 0.47104 0.56247 0.50031 -0.01228 0.12305  0.16446  537 PRO A CA  
3932 C C   . PRO A 537 ? 0.47825 0.53899 0.49518 -0.00683 0.11298  0.16893  537 PRO A C   
3933 O O   . PRO A 537 ? 0.51607 0.57651 0.52069 0.00431  0.10507  0.16092  537 PRO A O   
3934 C CB  . PRO A 537 ? 0.44989 0.56436 0.46813 0.00063  0.12243  0.14956  537 PRO A CB  
3935 C CG  . PRO A 537 ? 0.48508 0.61164 0.47833 0.00362  0.13114  0.16246  537 PRO A CG  
3936 C CD  . PRO A 537 ? 0.39176 0.52193 0.39226 -0.01110 0.14335  0.18262  537 PRO A CD  
3937 N N   . VAL A 538 ? 0.50511 0.54027 0.52629 -0.01466 0.11262  0.18138  538 VAL A N   
3938 C CA  . VAL A 538 ? 0.49390 0.50061 0.50522 -0.00684 0.10405  0.18604  538 VAL A CA  
3939 C C   . VAL A 538 ? 0.44754 0.44155 0.47091 -0.00341 0.09471  0.16964  538 VAL A C   
3940 O O   . VAL A 538 ? 0.52219 0.51410 0.56219 -0.01208 0.09412  0.16076  538 VAL A O   
3941 C CB  . VAL A 538 ? 0.55033 0.52979 0.55739 -0.01475 0.10674  0.20629  538 VAL A CB  
3942 C CG1 . VAL A 538 ? 0.56125 0.52430 0.58798 -0.03020 0.10725  0.20471  538 VAL A CG1 
3943 C CG2 . VAL A 538 ? 0.57928 0.53175 0.57405 -0.00147 0.09785  0.21177  538 VAL A CG2 
3944 N N   . TYR A 539 ? 0.48271 0.47241 0.49745 0.00896  0.08720  0.16568  539 TYR A N   
3945 C CA  . TYR A 539 ? 0.46081 0.44256 0.48360 0.01270  0.07967  0.15170  539 TYR A CA  
3946 C C   . TYR A 539 ? 0.51545 0.48091 0.53197 0.02441  0.07504  0.15679  539 TYR A C   
3947 O O   . TYR A 539 ? 0.56555 0.53272 0.57034 0.03242  0.07458  0.16887  539 TYR A O   
3948 C CB  . TYR A 539 ? 0.47793 0.48181 0.50011 0.01558  0.07480  0.13785  539 TYR A CB  
3949 C CG  . TYR A 539 ? 0.53977 0.56080 0.54677 0.02371  0.07213  0.14086  539 TYR A CG  
3950 C CD1 . TYR A 539 ? 0.52050 0.55687 0.51742 0.02300  0.07688  0.14410  539 TYR A CD1 
3951 C CD2 . TYR A 539 ? 0.55919 0.58402 0.56192 0.03182  0.06457  0.13946  539 TYR A CD2 
3952 C CE1 . TYR A 539 ? 0.51927 0.56924 0.49895 0.02983  0.07280  0.14519  539 TYR A CE1 
3953 C CE2 . TYR A 539 ? 0.54388 0.58531 0.53324 0.03722  0.05985  0.14186  539 TYR A CE2 
3954 C CZ  . TYR A 539 ? 0.52403 0.57558 0.50015 0.03607  0.06324  0.14428  539 TYR A CZ  
3955 O OH  . TYR A 539 ? 0.51841 0.58435 0.47753 0.04106  0.05700  0.14532  539 TYR A OH  
3956 N N   . TYR A 540 ? 0.49619 0.44708 0.52001 0.02657  0.07139  0.14712  540 TYR A N   
3957 C CA  . TYR A 540 ? 0.42822 0.36524 0.44907 0.04046  0.06777  0.14844  540 TYR A CA  
3958 C C   . TYR A 540 ? 0.40028 0.36378 0.42244 0.04862  0.06337  0.13926  540 TYR A C   
3959 O O   . TYR A 540 ? 0.40125 0.37590 0.42853 0.04174  0.06196  0.12690  540 TYR A O   
3960 C CB  . TYR A 540 ? 0.46460 0.37064 0.49027 0.03829  0.06723  0.14158  540 TYR A CB  
3961 C CG  . TYR A 540 ? 0.50096 0.38517 0.52254 0.05501  0.06440  0.14202  540 TYR A CG  
3962 C CD1 . TYR A 540 ? 0.48070 0.33252 0.49511 0.05971  0.06348  0.15531  540 TYR A CD1 
3963 C CD2 . TYR A 540 ? 0.50860 0.40432 0.53310 0.06652  0.06264  0.12906  540 TYR A CD2 
3964 C CE1 . TYR A 540 ? 0.63758 0.46649 0.64798 0.07851  0.05971  0.15423  540 TYR A CE1 
3965 C CE2 . TYR A 540 ? 0.49508 0.37463 0.51720 0.08522  0.06099  0.12744  540 TYR A CE2 
3966 C CZ  . TYR A 540 ? 0.60108 0.44596 0.61630 0.09266  0.05896  0.13916  540 TYR A CZ  
3967 O OH  . TYR A 540 ? 0.70176 0.52772 0.71431 0.11467  0.05618  0.13618  540 TYR A OH  
3968 N N   . ILE A 541 ? 0.42850 0.40350 0.44609 0.06173  0.06022  0.14670  541 ILE A N   
3969 C CA  . ILE A 541 ? 0.44496 0.44984 0.46604 0.06767  0.05536  0.14037  541 ILE A CA  
3970 C C   . ILE A 541 ? 0.50252 0.50405 0.53163 0.07768  0.05565  0.13228  541 ILE A C   
3971 O O   . ILE A 541 ? 0.67317 0.65831 0.70212 0.09213  0.05584  0.13726  541 ILE A O   
3972 C CB  . ILE A 541 ? 0.62399 0.64747 0.63885 0.07743  0.05044  0.15173  541 ILE A CB  
3973 C CG1 . ILE A 541 ? 0.66323 0.68621 0.66445 0.07081  0.05143  0.16156  541 ILE A CG1 
3974 C CG2 . ILE A 541 ? 0.32071 0.37880 0.34203 0.07921  0.04434  0.14518  541 ILE A CG2 
3975 C CD1 . ILE A 541 ? 0.70023 0.74409 0.69690 0.06082  0.04899  0.15381  541 ILE A CD1 
3976 N N   . PHE A 542 ? 0.42746 0.44460 0.46181 0.07134  0.05539  0.12005  542 PHE A N   
3977 C CA  . PHE A 542 ? 0.48182 0.50397 0.52205 0.08105  0.05729  0.11130  542 PHE A CA  
3978 C C   . PHE A 542 ? 0.41225 0.47463 0.45976 0.08871  0.05420  0.11333  542 PHE A C   
3979 O O   . PHE A 542 ? 0.49654 0.58432 0.54532 0.07655  0.05068  0.11140  542 PHE A O   
3980 C CB  . PHE A 542 ? 0.46471 0.48163 0.50421 0.06871  0.05914  0.09835  542 PHE A CB  
3981 C CG  . PHE A 542 ? 0.42698 0.40635 0.46255 0.06787  0.06174  0.09345  542 PHE A CG  
3982 C CD1 . PHE A 542 ? 0.35722 0.31390 0.39111 0.08403  0.06360  0.09355  542 PHE A CD1 
3983 C CD2 . PHE A 542 ? 0.33785 0.30294 0.37155 0.05139  0.06072  0.08894  542 PHE A CD2 
3984 C CE1 . PHE A 542 ? 0.44401 0.36067 0.47230 0.08147  0.06397  0.08848  542 PHE A CE1 
3985 C CE2 . PHE A 542 ? 0.35343 0.28468 0.38456 0.04803  0.06131  0.08460  542 PHE A CE2 
3986 C CZ  . PHE A 542 ? 0.49668 0.40168 0.52399 0.06194  0.06270  0.08418  542 PHE A CZ  
3987 N N   . SER A 543 ? 0.33714 0.40480 0.38996 0.10868  0.05423  0.11771  543 SER A N   
3988 C CA  . SER A 543 ? 0.36083 0.47122 0.42377 0.11654  0.04987  0.12226  543 SER A CA  
3989 C C   . SER A 543 ? 0.48381 0.60137 0.55670 0.14173  0.05239  0.12062  543 SER A C   
3990 O O   . SER A 543 ? 0.36735 0.44838 0.43510 0.15439  0.05557  0.11817  543 SER A O   
3991 C CB  . SER A 543 ? 0.39531 0.51133 0.45247 0.11483  0.04230  0.13551  543 SER A CB  
3992 O OG  . SER A 543 ? 0.49555 0.64104 0.56216 0.13130  0.03659  0.14316  543 SER A OG  
3993 N N   . THR A 544 ? 0.49139 0.65715 0.57919 0.14877  0.05031  0.12138  544 THR A N   
3994 C CA  . THR A 544 ? 0.48509 0.66919 0.58648 0.17560  0.05275  0.11903  544 THR A CA  
3995 C C   . THR A 544 ? 0.52107 0.71281 0.62777 0.19465  0.04381  0.13280  544 THR A C   
3996 O O   . THR A 544 ? 0.43103 0.62181 0.54573 0.22217  0.04417  0.13227  544 THR A O   
3997 C CB  . THR A 544 ? 0.44914 0.68964 0.56738 0.17247  0.05708  0.11179  544 THR A CB  
3998 O OG1 . THR A 544 ? 0.67224 0.92555 0.80164 0.19972  0.06383  0.10404  544 THR A OG1 
3999 C CG2 . THR A 544 ? 0.40535 0.69524 0.53719 0.16603  0.04804  0.12206  544 THR A CG2 
4000 N N   . ASP A 545 ? 0.54747 0.74548 0.64807 0.18200  0.03504  0.14451  545 ASP A N   
4001 C CA  . ASP A 545 ? 0.53608 0.73381 0.63524 0.19795  0.02518  0.15935  545 ASP A CA  
4002 C C   . ASP A 545 ? 0.58531 0.72249 0.66698 0.20759  0.02619  0.16569  545 ASP A C   
4003 O O   . ASP A 545 ? 0.71767 0.81840 0.78343 0.18989  0.03038  0.16514  545 ASP A O   
4004 C CB  . ASP A 545 ? 0.46273 0.67979 0.55416 0.17922  0.01581  0.16825  545 ASP A CB  
4005 C CG  . ASP A 545 ? 0.49981 0.72679 0.58927 0.19458  0.00367  0.18387  545 ASP A CG  
4006 O OD1 . ASP A 545 ? 0.56330 0.78684 0.66111 0.22120  0.00153  0.18868  545 ASP A OD1 
4007 O OD2 . ASP A 545 ? 0.54272 0.78045 0.62086 0.18105  -0.00481 0.19086  545 ASP A OD2 
4008 N N   . ASP A 546 ? 0.52492 0.65115 0.61030 0.23539  0.02177  0.17208  546 ASP A N   
4009 C CA  . ASP A 546 ? 0.59267 0.65709 0.66007 0.24350  0.02071  0.18030  546 ASP A CA  
4010 C C   . ASP A 546 ? 0.66117 0.71362 0.71349 0.24409  0.01031  0.20186  546 ASP A C   
4011 O O   . ASP A 546 ? 0.73743 0.73896 0.77345 0.24971  0.00811  0.21280  546 ASP A O   
4012 C CB  . ASP A 546 ? 0.52571 0.57007 0.60046 0.27463  0.02134  0.17355  546 ASP A CB  
4013 C CG  . ASP A 546 ? 0.74034 0.81132 0.82748 0.30296  0.01070  0.18191  546 ASP A CG  
4014 O OD1 . ASP A 546 ? 0.82237 0.93820 0.91658 0.29734  0.00321  0.19061  546 ASP A OD1 
4015 O OD2 . ASP A 546 ? 0.82710 0.87073 0.91456 0.32439  0.00810  0.17513  546 ASP A OD2 
4016 N N   . LYS A 547 ? 0.62816 0.72486 0.68342 0.23743  0.00308  0.20866  547 LYS A N   
4017 C CA  . LYS A 547 ? 0.55557 0.64514 0.59232 0.23595  -0.00689 0.22826  547 LYS A CA  
4018 C C   . LYS A 547 ? 0.57110 0.64226 0.58573 0.20761  -0.00171 0.23142  547 LYS A C   
4019 O O   . LYS A 547 ? 0.55421 0.60984 0.54760 0.20500  -0.00676 0.24806  547 LYS A O   
4020 C CB  . LYS A 547 ? 0.49619 0.64226 0.54433 0.24106  -0.01898 0.23173  547 LYS A CB  
4021 C CG  . LYS A 547 ? 0.58158 0.74497 0.64736 0.26613  -0.02735 0.22975  547 LYS A CG  
4022 C CD  . LYS A 547 ? 0.65716 0.88686 0.74183 0.26460  -0.03696 0.22791  547 LYS A CD  
4023 C CE  . LYS A 547 ? 0.84246 1.11927 0.95715 0.26498  -0.02892 0.21286  547 LYS A CE  
4024 N NZ  . LYS A 547 ? 0.81954 1.14532 0.94193 0.24152  -0.03187 0.21071  547 LYS A NZ  
4025 N N   . ILE A 548 ? 0.50344 0.57724 0.52176 0.18731  0.00824  0.21620  548 ILE A N   
4026 C CA  . ILE A 548 ? 0.51610 0.57889 0.51645 0.16341  0.01298  0.21755  548 ILE A CA  
4027 C C   . ILE A 548 ? 0.59811 0.61008 0.58490 0.15811  0.02039  0.22478  548 ILE A C   
4028 O O   . ILE A 548 ? 0.75419 0.73463 0.74584 0.16864  0.02243  0.22396  548 ILE A O   
4029 C CB  . ILE A 548 ? 0.50233 0.58659 0.51153 0.14481  0.01840  0.19972  548 ILE A CB  
4030 C CG1 . ILE A 548 ? 0.50254 0.57025 0.52493 0.14520  0.02711  0.18617  548 ILE A CG1 
4031 C CG2 . ILE A 548 ? 0.39167 0.52444 0.41191 0.14469  0.00978  0.19516  548 ILE A CG2 
4032 C CD1 . ILE A 548 ? 0.49364 0.55735 0.51468 0.12354  0.03399  0.17396  548 ILE A CD1 
4033 N N   . GLU A 549 ? 0.58985 0.59456 0.55888 0.14116  0.02417  0.23172  549 GLU A N   
4034 C CA  . GLU A 549 ? 0.64387 0.61068 0.60461 0.12833  0.03336  0.23596  549 GLU A CA  
4035 C C   . GLU A 549 ? 0.68710 0.65740 0.66164 0.11451  0.04134  0.21643  549 GLU A C   
4036 O O   . GLU A 549 ? 0.72377 0.72274 0.70040 0.10442  0.04229  0.20613  549 GLU A O   
4037 C CB  . GLU A 549 ? 0.58268 0.54968 0.52110 0.11541  0.03638  0.24999  549 GLU A CB  
4038 C CG  . GLU A 549 ? 0.54041 0.47227 0.47099 0.10152  0.04551  0.25972  549 GLU A CG  
4039 C CD  . GLU A 549 ? 0.71360 0.60752 0.63509 0.10906  0.03915  0.27367  549 GLU A CD  
4040 O OE1 . GLU A 549 ? 0.74402 0.64307 0.66013 0.12530  0.02823  0.27959  549 GLU A OE1 
4041 O OE2 . GLU A 549 ? 0.88509 0.74396 0.80481 0.09747  0.04326  0.27747  549 GLU A OE2 
4042 N N   . LYS A 550 ? 0.61558 0.55450 0.59758 0.11406  0.04544  0.21107  550 LYS A N   
4043 C CA  . LYS A 550 ? 0.62803 0.57195 0.62205 0.10194  0.05106  0.19260  550 LYS A CA  
4044 C C   . LYS A 550 ? 0.58377 0.52008 0.57392 0.08073  0.05831  0.19306  550 LYS A C   
4045 O O   . LYS A 550 ? 0.60677 0.55339 0.60585 0.07018  0.06132  0.17864  550 LYS A O   
4046 C CB  . LYS A 550 ? 0.61585 0.53505 0.61910 0.11122  0.05133  0.18244  550 LYS A CB  
4047 C CG  . LYS A 550 ? 0.81472 0.68896 0.81006 0.12110  0.04877  0.19396  550 LYS A CG  
4048 C CD  . LYS A 550 ? 0.86918 0.72172 0.87158 0.13536  0.04782  0.17981  550 LYS A CD  
4049 C CE  . LYS A 550 ? 0.79369 0.67916 0.80644 0.15835  0.04463  0.17262  550 LYS A CE  
4050 N NZ  . LYS A 550 ? 0.80552 0.67413 0.81438 0.18352  0.03710  0.18470  550 LYS A NZ  
4051 N N   . LEU A 551 ? 0.49068 0.41308 0.46815 0.07427  0.06111  0.20976  551 LEU A N   
4052 C CA  . LEU A 551 ? 0.50558 0.43257 0.48166 0.05511  0.06934  0.21079  551 LEU A CA  
4053 C C   . LEU A 551 ? 0.54685 0.50551 0.51004 0.05370  0.07063  0.21509  551 LEU A C   
4054 O O   . LEU A 551 ? 0.70549 0.66665 0.65301 0.06197  0.06682  0.22920  551 LEU A O   
4055 C CB  . LEU A 551 ? 0.54624 0.43955 0.51722 0.04481  0.07351  0.22657  551 LEU A CB  
4056 C CG  . LEU A 551 ? 0.58500 0.44130 0.56638 0.04121  0.07192  0.22050  551 LEU A CG  
4057 C CD1 . LEU A 551 ? 0.53659 0.35976 0.51171 0.02613  0.07479  0.23844  551 LEU A CD1 
4058 C CD2 . LEU A 551 ? 0.49082 0.36034 0.48866 0.03238  0.07407  0.19954  551 LEU A CD2 
4059 N N   . ALA A 552 ? 0.43381 0.41469 0.40181 0.04435  0.07484  0.20239  552 ALA A N   
4060 C CA  . ALA A 552 ? 0.55588 0.56504 0.51040 0.04459  0.07500  0.20077  552 ALA A CA  
4061 C C   . ALA A 552 ? 0.66988 0.69201 0.62816 0.03267  0.08410  0.19305  552 ALA A C   
4062 O O   . ALA A 552 ? 0.63878 0.65492 0.61478 0.02511  0.08679  0.18368  552 ALA A O   
4063 C CB  . ALA A 552 ? 0.38325 0.41120 0.33984 0.05237  0.06507  0.18753  552 ALA A CB  
4064 N N   . ARG A 553 ? 0.67816 0.71992 0.61900 0.03241  0.08837  0.19638  553 ARG A N   
4065 C CA  . ARG A 553 ? 0.60693 0.66726 0.55045 0.02535  0.09766  0.18775  553 ARG A CA  
4066 C C   . ARG A 553 ? 0.62633 0.70778 0.55437 0.03229  0.09357  0.17441  553 ARG A C   
4067 O O   . ARG A 553 ? 0.59236 0.68313 0.52867 0.03178  0.09342  0.15736  553 ARG A O   
4068 C CB  . ARG A 553 ? 0.52123 0.58574 0.45731 0.01676  0.11087  0.20516  553 ARG A CB  
4069 C CG  . ARG A 553 ? 0.71162 0.75490 0.66572 0.00479  0.11528  0.21546  553 ARG A CG  
4070 C CD  . ARG A 553 ? 0.79405 0.81261 0.73418 0.00329  0.11414  0.23847  553 ARG A CD  
4071 N NE  . ARG A 553 ? 0.95278 0.95143 0.90605 -0.01251 0.11768  0.24556  553 ARG A NE  
4072 C CZ  . ARG A 553 ? 1.06083 1.02141 1.01308 -0.01414 0.11043  0.25497  553 ARG A CZ  
4073 N NH1 . ARG A 553 ? 1.04803 0.98986 0.98944 0.00147  0.10022  0.25867  553 ARG A NH1 
4074 N NH2 . ARG A 553 ? 1.06228 1.00381 1.02421 -0.03101 0.11257  0.26025  553 ARG A NH2 
4075 N N   . GLY A 554 ? 0.61914 0.70551 0.52343 0.03915  0.08839  0.18187  554 GLY A N   
4076 C CA  . GLY A 554 ? 0.62733 0.73149 0.50943 0.04443  0.08533  0.17161  554 GLY A CA  
4077 C C   . GLY A 554 ? 0.60971 0.71546 0.49618 0.04707  0.07333  0.15041  554 GLY A C   
4078 O O   . GLY A 554 ? 0.69167 0.80524 0.57368 0.04833  0.07484  0.13484  554 GLY A O   
4079 N N   . PRO A 555 ? 0.56238 0.66111 0.45663 0.04830  0.06077  0.14996  555 PRO A N   
4080 C CA  . PRO A 555 ? 0.58580 0.68692 0.47922 0.04795  0.04742  0.13316  555 PRO A CA  
4081 C C   . PRO A 555 ? 0.64089 0.73643 0.54755 0.04399  0.04837  0.11646  555 PRO A C   
4082 O O   . PRO A 555 ? 0.71175 0.80828 0.60555 0.04537  0.04203  0.10204  555 PRO A O   
4083 C CB  . PRO A 555 ? 0.50110 0.60059 0.40782 0.04832  0.03787  0.13930  555 PRO A CB  
4084 C CG  . PRO A 555 ? 0.52837 0.62822 0.42718 0.05436  0.04106  0.15860  555 PRO A CG  
4085 C CD  . PRO A 555 ? 0.56038 0.65317 0.45634 0.05197  0.05659  0.16651  555 PRO A CD  
4086 N N   . LEU A 556 ? 0.58153 0.66879 0.51175 0.03969  0.05428  0.11745  556 LEU A N   
4087 C CA  . LEU A 556 ? 0.63276 0.71538 0.57513 0.03671  0.05380  0.10288  556 LEU A CA  
4088 C C   . LEU A 556 ? 0.61960 0.71221 0.55428 0.04107  0.06220  0.09575  556 LEU A C   
4089 O O   . LEU A 556 ? 0.52216 0.61238 0.45638 0.04374  0.05701  0.08006  556 LEU A O   
4090 C CB  . LEU A 556 ? 0.66658 0.73997 0.63332 0.03105  0.05857  0.10619  556 LEU A CB  
4091 C CG  . LEU A 556 ? 0.80970 0.87433 0.78542 0.02780  0.04928  0.10469  556 LEU A CG  
4092 C CD1 . LEU A 556 ? 0.90997 0.96403 0.90515 0.02248  0.05290  0.10292  556 LEU A CD1 
4093 C CD2 . LEU A 556 ? 0.78864 0.85334 0.75646 0.02583  0.03612  0.09284  556 LEU A CD2 
4094 N N   . ALA A 557 ? 0.56545 0.66966 0.49372 0.04236  0.07522  0.10739  557 ALA A N   
4095 C CA  . ALA A 557 ? 0.52724 0.64845 0.45058 0.04682  0.08637  0.10123  557 ALA A CA  
4096 C C   . ALA A 557 ? 0.56768 0.69302 0.46324 0.05633  0.07991  0.08732  557 ALA A C   
4097 O O   . ALA A 557 ? 0.55605 0.68807 0.44997 0.06373  0.08197  0.07160  557 ALA A O   
4098 C CB  . ALA A 557 ? 0.37755 0.51188 0.29873 0.04296  0.10236  0.11973  557 ALA A CB  
4099 N N   . ALA A 558 ? 0.56454 0.68513 0.43821 0.05708  0.07052  0.09184  558 ALA A N   
4100 C CA  . ALA A 558 ? 0.61262 0.73373 0.45625 0.06446  0.06185  0.07818  558 ALA A CA  
4101 C C   . ALA A 558 ? 0.59891 0.70213 0.44551 0.06468  0.04584  0.05898  558 ALA A C   
4102 O O   . ALA A 558 ? 0.70747 0.80725 0.53858 0.07315  0.04272  0.04112  558 ALA A O   
4103 C CB  . ALA A 558 ? 0.73754 0.85981 0.55893 0.06337  0.05375  0.08961  558 ALA A CB  
4104 N N   . ARG A 559 ? 0.53999 0.63057 0.40460 0.05579  0.03538  0.06242  559 ARG A N   
4105 C CA  . ARG A 559 ? 0.71394 0.78563 0.58088 0.05270  0.01976  0.04752  559 ARG A CA  
4106 C C   . ARG A 559 ? 0.56157 0.62796 0.44021 0.05871  0.02408  0.03472  559 ARG A C   
4107 O O   . ARG A 559 ? 0.59337 0.64401 0.46021 0.06367  0.01303  0.01799  559 ARG A O   
4108 C CB  . ARG A 559 ? 0.85889 0.92388 0.74516 0.04108  0.01158  0.05578  559 ARG A CB  
4109 C CG  . ARG A 559 ? 1.09353 1.16404 0.96935 0.03589  0.00092  0.06331  559 ARG A CG  
4110 C CD  . ARG A 559 ? 1.11688 1.19130 1.01404 0.02764  -0.00178 0.07396  559 ARG A CD  
4111 N NE  . ARG A 559 ? 1.23608 1.29898 1.13849 0.01740  -0.01498 0.06611  559 ARG A NE  
4112 C CZ  . ARG A 559 ? 1.17993 1.24775 1.10037 0.00928  -0.01701 0.07275  559 ARG A CZ  
4113 N NH1 . ARG A 559 ? 1.14450 1.22613 1.07920 0.01298  -0.00749 0.08503  559 ARG A NH1 
4114 N NH2 . ARG A 559 ? 1.26542 1.32374 1.18781 -0.00220 -0.02870 0.06736  559 ARG A NH2 
4115 N N   . CYS A 560 ? 0.46782 0.54610 0.36976 0.05851  0.03855  0.04234  560 CYS A N   
4116 C CA  . CYS A 560 ? 0.41347 0.49040 0.33306 0.06313  0.04075  0.03197  560 CYS A CA  
4117 C C   . CYS A 560 ? 0.50489 0.60024 0.41810 0.07715  0.05233  0.02221  560 CYS A C   
4118 O O   . CYS A 560 ? 0.56552 0.65812 0.48705 0.08613  0.04935  0.00800  560 CYS A O   
4119 C CB  . CYS A 560 ? 0.46615 0.54783 0.41582 0.05450  0.04838  0.04346  560 CYS A CB  
4120 S SG  . CYS A 560 ? 0.49683 0.55664 0.45558 0.04192  0.03408  0.04745  560 CYS A SG  
4121 N N   . SER A 561 ? 0.52356 0.63907 0.42167 0.08023  0.06540  0.02962  561 SER A N   
4122 C CA  . SER A 561 ? 0.55797 0.69570 0.44651 0.09446  0.07791  0.01918  561 SER A CA  
4123 C C   . SER A 561 ? 0.55056 0.67072 0.41526 0.10837  0.06446  -0.00445 561 SER A C   
4124 O O   . SER A 561 ? 0.45936 0.59123 0.32467 0.12405  0.07041  -0.01985 561 SER A O   
4125 C CB  . SER A 561 ? 0.62872 0.78888 0.49734 0.09403  0.09282  0.03212  561 SER A CB  
4126 O OG  . SER A 561 ? 0.77686 0.92635 0.60804 0.09988  0.08302  0.02388  561 SER A OG  
4127 N N   . PHE A 562 ? 0.45182 0.54388 0.29628 0.10297  0.04555  -0.00795 562 PHE A N   
4128 C CA  . PHE A 562 ? 0.56588 0.63136 0.38806 0.11291  0.02851  -0.03034 562 PHE A CA  
4129 C C   . PHE A 562 ? 0.53949 0.59024 0.38377 0.11863  0.02147  -0.04142 562 PHE A C   
4130 O O   . PHE A 562 ? 0.50097 0.54946 0.33878 0.13705  0.02112  -0.06033 562 PHE A O   
4131 C CB  . PHE A 562 ? 0.55932 0.59843 0.36210 0.10013  0.00791  -0.02845 562 PHE A CB  
4132 C CG  . PHE A 562 ? 0.69073 0.69396 0.47186 0.10482  -0.01361 -0.04924 562 PHE A CG  
4133 C CD1 . PHE A 562 ? 0.56509 0.56131 0.31161 0.11971  -0.01669 -0.06813 562 PHE A CD1 
4134 C CD2 . PHE A 562 ? 0.73838 0.71231 0.53097 0.09378  -0.03145 -0.04983 562 PHE A CD2 
4135 C CE1 . PHE A 562 ? 0.60194 0.55821 0.32580 0.12405  -0.03858 -0.08829 562 PHE A CE1 
4136 C CE2 . PHE A 562 ? 0.76052 0.69547 0.53089 0.09613  -0.05325 -0.06748 562 PHE A CE2 
4137 C CZ  . PHE A 562 ? 0.69135 0.61518 0.42706 0.11155  -0.05761 -0.08733 562 PHE A CZ  
4138 N N   . TRP A 563 ? 0.60094 0.64271 0.47094 0.10454  0.01595  -0.02995 563 TRP A N   
4139 C CA  . TRP A 563 ? 0.57424 0.59757 0.46118 0.10827  0.00531  -0.03894 563 TRP A CA  
4140 C C   . TRP A 563 ? 0.55954 0.61196 0.47329 0.12052  0.02085  -0.04144 563 TRP A C   
4141 O O   . TRP A 563 ? 0.63416 0.67882 0.55251 0.13589  0.01435  -0.05695 563 TRP A O   
4142 C CB  . TRP A 563 ? 0.41191 0.41862 0.31430 0.08886  -0.00510 -0.02592 563 TRP A CB  
4143 C CG  . TRP A 563 ? 0.42581 0.40432 0.30534 0.07704  -0.02375 -0.02616 563 TRP A CG  
4144 C CD1 . TRP A 563 ? 0.47772 0.46288 0.35107 0.06329  -0.02387 -0.01325 563 TRP A CD1 
4145 C CD2 . TRP A 563 ? 0.48414 0.42442 0.34493 0.07716  -0.04604 -0.03931 563 TRP A CD2 
4146 N NE1 . TRP A 563 ? 0.54521 0.50406 0.39949 0.05337  -0.04417 -0.01741 563 TRP A NE1 
4147 C CE2 . TRP A 563 ? 0.49579 0.42423 0.34063 0.06025  -0.05823 -0.03288 563 TRP A CE2 
4148 C CE3 . TRP A 563 ? 0.55400 0.46785 0.41025 0.09003  -0.05805 -0.05535 563 TRP A CE3 
4149 C CZ2 . TRP A 563 ? 0.49254 0.38354 0.31663 0.05252  -0.08156 -0.04111 563 TRP A CZ2 
4150 C CZ3 . TRP A 563 ? 0.53025 0.40082 0.36326 0.08423  -0.08218 -0.06375 563 TRP A CZ3 
4151 C CH2 . TRP A 563 ? 0.58250 0.44181 0.39940 0.06397  -0.09354 -0.05622 563 TRP A CH2 
4152 N N   . ASN A 564 ? 0.47763 0.56388 0.40961 0.11406  0.04044  -0.02610 564 ASN A N   
4153 C CA  . ASN A 564 ? 0.44248 0.55960 0.40658 0.11915  0.05410  -0.02448 564 ASN A CA  
4154 C C   . ASN A 564 ? 0.49633 0.65092 0.45776 0.13562  0.07265  -0.03196 564 ASN A C   
4155 O O   . ASN A 564 ? 0.49549 0.67742 0.48391 0.14463  0.08086  -0.03646 564 ASN A O   
4156 C CB  . ASN A 564 ? 0.45932 0.58951 0.44707 0.09986  0.06360  -0.00296 564 ASN A CB  
4157 C CG  . ASN A 564 ? 0.44600 0.54515 0.43847 0.08530  0.04790  0.00332  564 ASN A CG  
4158 O OD1 . ASN A 564 ? 0.44402 0.51796 0.43354 0.08831  0.03104  -0.00686 564 ASN A OD1 
4159 N ND2 . ASN A 564 ? 0.46721 0.56748 0.46548 0.06997  0.05341  0.02035  564 ASN A ND2 
4160 N N   . ASP A 565 ? 0.55029 0.71038 0.48038 0.13985  0.07952  -0.03333 565 ASP A N   
4161 C CA  . ASP A 565 ? 0.55135 0.74897 0.47322 0.15595  0.09849  -0.04106 565 ASP A CA  
4162 C C   . ASP A 565 ? 0.63586 0.81665 0.52101 0.17714  0.09011  -0.06553 565 ASP A C   
4163 O O   . ASP A 565 ? 0.63488 0.83466 0.52257 0.19953  0.09676  -0.08366 565 ASP A O   
4164 C CB  . ASP A 565 ? 0.62004 0.84370 0.53238 0.14336  0.11704  -0.02050 565 ASP A CB  
4165 C CG  . ASP A 565 ? 0.79090 1.02206 0.73409 0.12162  0.12303  0.00358  565 ASP A CG  
4166 O OD1 . ASP A 565 ? 0.80650 1.04047 0.78371 0.11871  0.12007  0.00308  565 ASP A OD1 
4167 O OD2 . ASP A 565 ? 0.84716 1.07905 0.77886 0.10811  0.12923  0.02257  565 ASP A OD2 
4168 N N   . TYR A 566 ? 0.72658 0.87297 0.57735 0.17120  0.07512  -0.06735 566 TYR A N   
4169 C CA  . TYR A 566 ? 0.73818 0.86765 0.54803 0.18905  0.06735  -0.09017 566 TYR A CA  
4170 C C   . TYR A 566 ? 0.70904 0.80025 0.51722 0.20360  0.04623  -0.11303 566 TYR A C   
4171 O O   . TYR A 566 ? 0.79738 0.89339 0.59611 0.22912  0.04889  -0.13551 566 TYR A O   
4172 C CB  . TYR A 566 ? 0.63715 0.74471 0.41143 0.17565  0.05651  -0.08357 566 TYR A CB  
4173 C CG  . TYR A 566 ? 0.64538 0.73085 0.37344 0.19126  0.04544  -0.10770 566 TYR A CG  
4174 C CD1 . TYR A 566 ? 0.71816 0.83211 0.42273 0.21076  0.06260  -0.12036 566 TYR A CD1 
4175 C CD2 . TYR A 566 ? 0.66736 0.70344 0.37390 0.18566  0.01760  -0.11829 566 TYR A CD2 
4176 C CE1 . TYR A 566 ? 0.78835 0.87907 0.44626 0.22638  0.05166  -0.14517 566 TYR A CE1 
4177 C CE2 . TYR A 566 ? 0.76681 0.77760 0.42878 0.19875  0.00509  -0.14179 566 TYR A CE2 
4178 C CZ  . TYR A 566 ? 0.81071 0.84725 0.44721 0.22010  0.02177  -0.15628 566 TYR A CZ  
4179 O OH  . TYR A 566 ? 0.87128 0.87962 0.45964 0.23407  0.00845  -0.18195 566 TYR A OH  
4180 N N   . LEU A 567 ? 0.61515 0.66785 0.43116 0.18831  0.02509  -0.10734 567 LEU A N   
4181 C CA  . LEU A 567 ? 0.70111 0.70963 0.51119 0.19870  0.00185  -0.12583 567 LEU A CA  
4182 C C   . LEU A 567 ? 0.74057 0.76512 0.57628 0.22210  0.00750  -0.13879 567 LEU A C   
4183 O O   . LEU A 567 ? 0.83753 0.83449 0.65567 0.24436  -0.00548 -0.16250 567 LEU A O   
4184 C CB  . LEU A 567 ? 0.60186 0.57563 0.42155 0.17444  -0.01789 -0.11194 567 LEU A CB  
4185 C CG  . LEU A 567 ? 0.69854 0.61495 0.48752 0.17253  -0.04674 -0.12561 567 LEU A CG  
4186 C CD1 . LEU A 567 ? 0.79559 0.70226 0.54204 0.17837  -0.05015 -0.13895 567 LEU A CD1 
4187 C CD2 . LEU A 567 ? 0.71349 0.60805 0.50914 0.14381  -0.06125 -0.10754 567 LEU A CD2 
4188 N N   . PRO A 568 ? 0.58420 0.65177 0.46013 0.21952  0.02508  -0.12564 568 PRO A N   
4189 C CA  . PRO A 568 ? 0.56784 0.66184 0.46979 0.24422  0.03216  -0.13900 568 PRO A CA  
4190 C C   . PRO A 568 ? 0.62760 0.74003 0.50787 0.27451  0.04278  -0.16275 568 PRO A C   
4191 O O   . PRO A 568 ? 0.70726 0.82345 0.59868 0.30165  0.03959  -0.18186 568 PRO A O   
4192 C CB  . PRO A 568 ? 0.52283 0.67001 0.46612 0.23040  0.05393  -0.11755 568 PRO A CB  
4193 C CG  . PRO A 568 ? 0.64280 0.76680 0.58806 0.19924  0.04590  -0.09523 568 PRO A CG  
4194 C CD  . PRO A 568 ? 0.53849 0.62672 0.44026 0.19322  0.03492  -0.09849 568 PRO A CD  
4195 N N   . LYS A 569 ? 0.68221 0.80771 0.53098 0.27240  0.05530  -0.16264 569 LYS A N   
4196 C CA  . LYS A 569 ? 0.74097 0.88944 0.56627 0.30138  0.06846  -0.18540 569 LYS A CA  
4197 C C   . LYS A 569 ? 0.88680 0.97722 0.66715 0.31911  0.04486  -0.21295 569 LYS A C   
4198 O O   . LYS A 569 ? 0.96716 1.06232 0.73656 0.34752  0.04726  -0.23645 569 LYS A O   
4199 C CB  . LYS A 569 ? 0.77627 0.96663 0.58377 0.29172  0.09312  -0.17269 569 LYS A CB  
4200 C CG  . LYS A 569 ? 0.77770 1.01925 0.62501 0.27085  0.11528  -0.14351 569 LYS A CG  
4201 C CD  . LYS A 569 ? 0.88690 1.17000 0.71362 0.26397  0.14022  -0.13095 569 LYS A CD  
4202 C CE  . LYS A 569 ? 0.89431 1.21034 0.75659 0.23651  0.15557  -0.09816 569 LYS A CE  
4203 N NZ  . LYS A 569 ? 0.83320 1.18703 0.67799 0.22601  0.17893  -0.08044 569 LYS A NZ  
4204 N N   . VAL A 570 ? 0.92673 0.96168 0.68344 0.29865  0.02057  -0.20795 570 VAL A N   
4205 C CA  . VAL A 570 ? 0.95550 0.93175 0.66837 0.31286  -0.00388 -0.23409 570 VAL A CA  
4206 C C   . VAL A 570 ? 1.07811 1.01770 0.80568 0.33127  -0.02349 -0.24936 570 VAL A C   
4207 O O   . VAL A 570 ? 1.15796 1.06118 0.85989 0.35120  -0.03846 -0.27267 570 VAL A O   
4208 C CB  . VAL A 570 ? 0.79685 0.72756 0.47941 0.28403  -0.02514 -0.22452 570 VAL A CB  
4209 C CG1 . VAL A 570 ? 0.76727 0.73759 0.44575 0.26309  -0.00686 -0.20244 570 VAL A CG1 
4210 C CG2 . VAL A 570 ? 0.79213 0.68330 0.49484 0.26214  -0.04764 -0.21057 570 VAL A CG2 
4211 N N   . ARG A 571 ? 1.05518 1.00591 0.82757 0.32060  -0.02423 -0.23173 571 ARG A N   
4212 C CA  . ARG A 571 ? 1.12565 1.04794 0.91556 0.33918  -0.04198 -0.24336 571 ARG A CA  
4213 C C   . ARG A 571 ? 1.21956 1.17500 1.02110 0.37164  -0.03011 -0.26122 571 ARG A C   
4214 O O   . ARG A 571 ? 1.31282 1.23119 1.10833 0.38707  -0.04973 -0.27499 571 ARG A O   
4215 C CB  . ARG A 571 ? 1.11326 1.05306 0.95011 0.31930  -0.04149 -0.21835 571 ARG A CB  
4216 C CG  . ARG A 571 ? 1.06848 0.97029 0.89845 0.28242  -0.05806 -0.19702 571 ARG A CG  
4217 C CD  . ARG A 571 ? 1.03753 0.95029 0.90837 0.26619  -0.06003 -0.17632 571 ARG A CD  
4218 N NE  . ARG A 571 ? 1.09258 1.04144 0.98113 0.23773  -0.04257 -0.15103 571 ARG A NE  
4219 C CZ  . ARG A 571 ? 1.21141 1.13712 1.09161 0.20801  -0.05160 -0.13372 571 ARG A CZ  
4220 N NH1 . ARG A 571 ? 1.30037 1.16965 1.15518 0.19894  -0.07737 -0.13703 571 ARG A NH1 
4221 N NH2 . ARG A 571 ? 1.20582 1.16522 1.10305 0.18722  -0.03496 -0.11285 571 ARG A NH2 
4222 N N   . SER A 572 ? 1.28515 1.31117 1.10464 0.37604  0.00125  -0.25620 572 SER A N   
4223 C CA  . SER A 572 ? 1.34311 1.40755 1.17376 0.39969  0.01501  -0.26886 572 SER A CA  
4224 C C   . SER A 572 ? 1.50545 1.53491 1.28663 0.41295  0.00628  -0.29031 572 SER A C   
4225 O O   . SER A 572 ? 1.43687 1.49372 1.19549 0.41220  0.02423  -0.29231 572 SER A O   
4226 C CB  . SER A 572 ? 1.24719 1.39345 1.10696 0.39393  0.05016  -0.25429 572 SER A CB  
4227 O OG  . SER A 572 ? 1.12637 1.29551 1.02073 0.37316  0.05665  -0.23141 572 SER A OG  
4228 N N   . TRP A 573 ? 1.86093 1.82660 1.62439 0.42352  -0.02317 -0.30510 573 TRP A N   
4229 C CA  . TRP A 573 ? 2.13543 2.05630 1.85341 0.43705  -0.03789 -0.32709 573 TRP A CA  
4230 C C   . TRP A 573 ? 2.17381 2.08537 1.84789 0.42279  -0.03393 -0.32836 573 TRP A C   
4231 O O   . TRP A 573 ? 2.22747 2.11956 1.86614 0.43515  -0.03850 -0.34660 573 TRP A O   
4232 C CB  . TRP A 573 ? 2.28397 2.24015 2.01075 0.46821  -0.02451 -0.34441 573 TRP A CB  
4233 C CG  . TRP A 573 ? 2.35691 2.31286 2.11962 0.48595  -0.03429 -0.34739 573 TRP A CG  
4234 C CD1 . TRP A 573 ? 2.30994 2.31767 2.12401 0.48519  -0.02057 -0.33332 573 TRP A CD1 
4235 C CD2 . TRP A 573 ? 2.46070 2.36199 2.20987 0.50625  -0.06096 -0.36469 573 TRP A CD2 
4236 N NE1 . TRP A 573 ? 2.35100 2.34113 2.18410 0.50414  -0.03721 -0.34098 573 TRP A NE1 
4237 C CE2 . TRP A 573 ? 2.44149 2.36599 2.23495 0.51788  -0.06191 -0.35990 573 TRP A CE2 
4238 C CE3 . TRP A 573 ? 2.53411 2.36833 2.23778 0.51478  -0.08500 -0.38296 573 TRP A CE3 
4239 C CZ2 . TRP A 573 ? 2.48657 2.36959 2.27882 0.53893  -0.08581 -0.37249 573 TRP A CZ2 
4240 C CZ3 . TRP A 573 ? 2.58070 2.37225 2.28355 0.53509  -0.10854 -0.39523 573 TRP A CZ3 
4241 C CH2 . TRP A 573 ? 2.55993 2.37611 2.30618 0.54755  -0.10867 -0.38983 573 TRP A CH2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   VAL 1   1   ?   ?   ?   A . n 
A 1 2   ILE 2   2   ?   ?   ?   A . n 
A 1 3   ASP 3   3   3   ASP ASP A . n 
A 1 4   ARG 4   4   4   ARG ARG A . n 
A 1 5   LEU 5   5   5   LEU LEU A . n 
A 1 6   VAL 6   6   6   VAL VAL A . n 
A 1 7   VAL 7   7   7   VAL VAL A . n 
A 1 8   GLN 8   8   8   GLN GLN A . n 
A 1 9   THR 9   9   9   THR THR A . n 
A 1 10  SER 10  10  10  SER SER A . n 
A 1 11  SER 11  11  11  SER SER A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  PRO 13  13  13  PRO PRO A . n 
A 1 14  VAL 14  14  14  VAL VAL A . n 
A 1 15  ARG 15  15  15  ARG ARG A . n 
A 1 16  GLY 16  16  16  GLY GLY A . n 
A 1 17  ARG 17  17  17  ARG ARG A . n 
A 1 18  SER 18  18  18  SER SER A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  THR 20  20  20  THR THR A . n 
A 1 21  VAL 21  21  21  VAL VAL A . n 
A 1 22  GLN 22  22  22  GLN GLN A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  ARG 24  24  24  ARG ARG A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  VAL 26  26  26  VAL VAL A . n 
A 1 27  HIS 27  27  27  HIS HIS A . n 
A 1 28  VAL 28  28  28  VAL VAL A . n 
A 1 29  TYR 29  29  29  TYR TYR A . n 
A 1 30  THR 30  30  30  THR THR A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  ILE 32  32  32  ILE ILE A . n 
A 1 33  PRO 33  33  33  PRO PRO A . n 
A 1 34  TYR 34  34  34  TYR TYR A . n 
A 1 35  ALA 35  35  35  ALA ALA A . n 
A 1 36  LYS 36  36  36  LYS LYS A . n 
A 1 37  PRO 37  37  37  PRO PRO A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  VAL 39  39  39  VAL VAL A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  ASP 41  41  41  ASP ASP A . n 
A 1 42  LEU 42  42  42  LEU LEU A . n 
A 1 43  ARG 43  43  43  ARG ARG A . n 
A 1 44  PHE 44  44  44  PHE PHE A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  PRO 47  47  47  PRO PRO A . n 
A 1 48  VAL 48  48  48  VAL VAL A . n 
A 1 49  PRO 49  49  49  PRO PRO A . n 
A 1 50  ALA 50  50  50  ALA ALA A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  TRP 53  53  53  TRP TRP A . n 
A 1 54  HIS 54  54  54  HIS HIS A . n 
A 1 55  GLY 55  55  55  GLY GLY A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  LEU 57  57  57  LEU LEU A . n 
A 1 58  ASP 58  58  58  ASP ASP A . n 
A 1 59  ALA 59  59  59  ALA ALA A . n 
A 1 60  THR 60  60  60  THR THR A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  SER 63  63  63  SER SER A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  THR 65  65  65  THR THR A . n 
A 1 66  CYS 66  66  66  CYS CYS A . n 
A 1 67  VAL 67  67  67  VAL VAL A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLU 69  69  69  GLU GLU A . n 
A 1 70  ARG 70  70  70  ARG ARG A . n 
A 1 71  TYR 71  71  71  TYR TYR A . n 
A 1 72  GLU 72  72  72  GLU GLU A . n 
A 1 73  TYR 73  73  73  TYR TYR A . n 
A 1 74  PHE 74  74  74  PHE PHE A . n 
A 1 75  PRO 75  75  75  PRO PRO A . n 
A 1 76  GLY 76  76  76  GLY GLY A . n 
A 1 77  PHE 77  77  77  PHE PHE A . n 
A 1 78  SER 78  78  78  SER SER A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  GLU 80  80  80  GLU GLU A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  ILE 82  82  82  ILE ILE A . n 
A 1 83  TRP 83  83  83  TRP TRP A . n 
A 1 84  ASN 84  84  84  ASN ASN A . n 
A 1 85  PRO 85  85  85  PRO PRO A . n 
A 1 86  ASN 86  86  86  ASN ASN A . n 
A 1 87  THR 87  87  87  THR THR A . n 
A 1 88  ASN 88  88  88  ASN ASN A . n 
A 1 89  VAL 89  89  89  VAL VAL A . n 
A 1 90  SER 90  90  90  SER SER A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  ASP 92  92  92  ASP ASP A . n 
A 1 93  CYS 93  93  93  CYS CYS A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  TYR 95  95  95  TYR TYR A . n 
A 1 96  ILE 96  96  96  ILE ILE A . n 
A 1 97  ASN 97  97  97  ASN ASN A . n 
A 1 98  VAL 98  98  98  VAL VAL A . n 
A 1 99  TRP 99  99  99  TRP TRP A . n 
A 1 100 ALA 100 100 100 ALA ALA A . n 
A 1 101 PRO 101 101 101 PRO PRO A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 LYS 103 103 ?   ?   ?   A . n 
A 1 104 ALA 104 104 ?   ?   ?   A . n 
A 1 105 ARG 105 105 ?   ?   ?   A . n 
A 1 106 LEU 106 106 ?   ?   ?   A . n 
A 1 107 ARG 107 107 ?   ?   ?   A . n 
A 1 108 HIS 108 108 ?   ?   ?   A . n 
A 1 109 GLY 109 109 ?   ?   ?   A . n 
A 1 110 ARG 110 110 ?   ?   ?   A . n 
A 1 111 GLY 111 111 ?   ?   ?   A . n 
A 1 112 ALA 112 112 ?   ?   ?   A . n 
A 1 113 ASN 113 113 ?   ?   ?   A . n 
A 1 114 GLY 114 114 ?   ?   ?   A . n 
A 1 115 GLY 115 115 ?   ?   ?   A . n 
A 1 116 GLU 116 116 ?   ?   ?   A . n 
A 1 117 HIS 117 117 ?   ?   ?   A . n 
A 1 118 PRO 118 118 ?   ?   ?   A . n 
A 1 119 ASN 119 119 ?   ?   ?   A . n 
A 1 120 GLY 120 120 ?   ?   ?   A . n 
A 1 121 LYS 121 121 ?   ?   ?   A . n 
A 1 122 GLN 122 122 ?   ?   ?   A . n 
A 1 123 ALA 123 123 ?   ?   ?   A . n 
A 1 124 ASP 124 124 ?   ?   ?   A . n 
A 1 125 THR 125 125 ?   ?   ?   A . n 
A 1 126 ASP 126 126 ?   ?   ?   A . n 
A 1 127 HIS 127 127 ?   ?   ?   A . n 
A 1 128 LEU 128 128 ?   ?   ?   A . n 
A 1 129 ILE 129 129 ?   ?   ?   A . n 
A 1 130 HIS 130 130 ?   ?   ?   A . n 
A 1 131 ASN 131 131 ?   ?   ?   A . n 
A 1 132 GLY 132 132 ?   ?   ?   A . n 
A 1 133 ASN 133 133 ?   ?   ?   A . n 
A 1 134 PRO 134 134 ?   ?   ?   A . n 
A 1 135 GLN 135 135 ?   ?   ?   A . n 
A 1 136 ASN 136 136 ?   ?   ?   A . n 
A 1 137 THR 137 137 137 THR THR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 ASN 139 139 139 ASN ASN A . n 
A 1 140 GLY 140 140 140 GLY GLY A . n 
A 1 141 LEU 141 141 141 LEU LEU A . n 
A 1 142 PRO 142 142 142 PRO PRO A . n 
A 1 143 ILE 143 143 143 ILE ILE A . n 
A 1 144 LEU 144 144 144 LEU LEU A . n 
A 1 145 ILE 145 145 145 ILE ILE A . n 
A 1 146 TRP 146 146 146 TRP TRP A . n 
A 1 147 ILE 147 147 147 ILE ILE A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 GLY 149 149 149 GLY GLY A . n 
A 1 150 GLY 150 150 150 GLY GLY A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 PHE 152 152 152 PHE PHE A . n 
A 1 153 MET 153 153 153 MET MET A . n 
A 1 154 THR 154 154 154 THR THR A . n 
A 1 155 GLY 155 155 155 GLY GLY A . n 
A 1 156 SER 156 156 156 SER SER A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 THR 158 158 158 THR THR A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 ASP 160 160 160 ASP ASP A . n 
A 1 161 ILE 161 161 161 ILE ILE A . n 
A 1 162 TYR 162 162 162 TYR TYR A . n 
A 1 163 ASN 163 163 163 ASN ASN A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 ASP 165 165 165 ASP ASP A . n 
A 1 166 ILE 166 166 166 ILE ILE A . n 
A 1 167 MET 167 167 167 MET MET A . n 
A 1 168 ALA 168 168 168 ALA ALA A . n 
A 1 169 ALA 169 169 169 ALA ALA A . n 
A 1 170 VAL 170 170 170 VAL VAL A . n 
A 1 171 GLY 171 171 171 GLY GLY A . n 
A 1 172 ASN 172 172 172 ASN ASN A . n 
A 1 173 VAL 173 173 173 VAL VAL A . n 
A 1 174 ILE 174 174 174 ILE ILE A . n 
A 1 175 VAL 175 175 175 VAL VAL A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 SER 177 177 177 SER SER A . n 
A 1 178 PHE 178 178 178 PHE PHE A . n 
A 1 179 GLN 179 179 179 GLN GLN A . n 
A 1 180 TYR 180 180 180 TYR TYR A . n 
A 1 181 ARG 181 181 181 ARG ARG A . n 
A 1 182 VAL 182 182 182 VAL VAL A . n 
A 1 183 GLY 183 183 183 GLY GLY A . n 
A 1 184 ALA 184 184 184 ALA ALA A . n 
A 1 185 PHE 185 185 185 PHE PHE A . n 
A 1 186 GLY 186 186 186 GLY GLY A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 LEU 188 188 188 LEU LEU A . n 
A 1 189 HIS 189 189 189 HIS HIS A . n 
A 1 190 LEU 190 190 190 LEU LEU A . n 
A 1 191 ALA 191 191 191 ALA ALA A . n 
A 1 192 PRO 192 192 192 PRO PRO A . n 
A 1 193 GLU 193 193 193 GLU GLU A . n 
A 1 194 MET 194 194 194 MET MET A . n 
A 1 195 PRO 195 195 195 PRO PRO A . n 
A 1 196 SER 196 196 196 SER SER A . n 
A 1 197 GLU 197 197 197 GLU GLU A . n 
A 1 198 PHE 198 198 198 PHE PHE A . n 
A 1 199 ALA 199 199 199 ALA ALA A . n 
A 1 200 GLU 200 200 200 GLU GLU A . n 
A 1 201 GLU 201 201 201 GLU GLU A . n 
A 1 202 ALA 202 202 202 ALA ALA A . n 
A 1 203 PRO 203 203 203 PRO PRO A . n 
A 1 204 GLY 204 204 204 GLY GLY A . n 
A 1 205 ASN 205 205 205 ASN ASN A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 LEU 208 208 208 LEU LEU A . n 
A 1 209 TRP 209 209 209 TRP TRP A . n 
A 1 210 ASP 210 210 210 ASP ASP A . n 
A 1 211 GLN 211 211 211 GLN GLN A . n 
A 1 212 ALA 212 212 212 ALA ALA A . n 
A 1 213 LEU 213 213 213 LEU LEU A . n 
A 1 214 ALA 214 214 214 ALA ALA A . n 
A 1 215 ILE 215 215 215 ILE ILE A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 TRP 217 217 217 TRP TRP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 LYS 219 219 219 LYS LYS A . n 
A 1 220 ASP 220 220 220 ASP ASP A . n 
A 1 221 ASN 221 221 221 ASN ASN A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 HIS 223 223 223 HIS HIS A . n 
A 1 224 ALA 224 224 224 ALA ALA A . n 
A 1 225 PHE 225 225 225 PHE PHE A . n 
A 1 226 GLY 226 226 226 GLY GLY A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 ASN 228 228 228 ASN ASN A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 GLU 230 230 230 GLU GLU A . n 
A 1 231 TRP 231 231 231 TRP TRP A . n 
A 1 232 MET 232 232 232 MET MET A . n 
A 1 233 THR 233 233 233 THR THR A . n 
A 1 234 LEU 234 234 234 LEU LEU A . n 
A 1 235 PHE 235 235 235 PHE PHE A . n 
A 1 236 GLY 236 236 236 GLY GLY A . n 
A 1 237 GLU 237 237 237 GLU GLU A . n 
A 1 238 SER 238 238 238 SER SER A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLY 240 240 240 GLY GLY A . n 
A 1 241 SER 241 241 241 SER SER A . n 
A 1 242 SER 242 242 242 SER SER A . n 
A 1 243 SER 243 243 243 SER SER A . n 
A 1 244 VAL 244 244 244 VAL VAL A . n 
A 1 245 ASN 245 245 245 ASN ASN A . n 
A 1 246 ALA 246 246 246 ALA ALA A . n 
A 1 247 GLN 247 247 247 GLN GLN A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 MET 249 249 249 MET MET A . n 
A 1 250 SER 250 250 250 SER SER A . n 
A 1 251 PRO 251 251 251 PRO PRO A . n 
A 1 252 VAL 252 252 252 VAL VAL A . n 
A 1 253 THR 253 253 253 THR THR A . n 
A 1 254 ARG 254 254 254 ARG ARG A . n 
A 1 255 GLY 255 255 255 GLY GLY A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 VAL 257 257 257 VAL VAL A . n 
A 1 258 LYS 258 258 258 LYS LYS A . n 
A 1 259 ARG 259 259 259 ARG ARG A . n 
A 1 260 GLY 260 260 260 GLY GLY A . n 
A 1 261 MET 261 261 261 MET MET A . n 
A 1 262 MET 262 262 262 MET MET A . n 
A 1 263 GLN 263 263 263 GLN GLN A . n 
A 1 264 SER 264 264 264 SER SER A . n 
A 1 265 GLY 265 265 265 GLY GLY A . n 
A 1 266 THR 266 266 266 THR THR A . n 
A 1 267 MET 267 267 267 MET MET A . n 
A 1 268 ASN 268 268 268 ASN ASN A . n 
A 1 269 ALA 269 269 269 ALA ALA A . n 
A 1 270 PRO 270 270 270 PRO PRO A . n 
A 1 271 TRP 271 271 271 TRP TRP A . n 
A 1 272 SER 272 272 272 SER SER A . n 
A 1 273 HIS 273 273 273 HIS HIS A . n 
A 1 274 MET 274 274 274 MET MET A . n 
A 1 275 THR 275 275 275 THR THR A . n 
A 1 276 SER 276 276 276 SER SER A . n 
A 1 277 GLU 277 277 277 GLU GLU A . n 
A 1 278 LYS 278 278 278 LYS LYS A . n 
A 1 279 ALA 279 279 279 ALA ALA A . n 
A 1 280 VAL 280 280 280 VAL VAL A . n 
A 1 281 GLU 281 281 281 GLU GLU A . n 
A 1 282 ILE 282 282 282 ILE ILE A . n 
A 1 283 GLY 283 283 283 GLY GLY A . n 
A 1 284 LYS 284 284 284 LYS LYS A . n 
A 1 285 ALA 285 285 285 ALA ALA A . n 
A 1 286 LEU 286 286 286 LEU LEU A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 ASN 288 288 288 ASN ASN A . n 
A 1 289 ASP 289 289 289 ASP ASP A . n 
A 1 290 CYS 290 290 290 CYS CYS A . n 
A 1 291 ASN 291 291 291 ASN ASN A . n 
A 1 292 CYS 292 292 292 CYS CYS A . n 
A 1 293 ASN 293 293 293 ASN ASN A . n 
A 1 294 ALA 294 294 294 ALA ALA A . n 
A 1 295 SER 295 295 295 SER SER A . n 
A 1 296 MET 296 296 296 MET MET A . n 
A 1 297 LEU 297 297 297 LEU LEU A . n 
A 1 298 LYS 298 298 298 LYS LYS A . n 
A 1 299 THR 299 299 299 THR THR A . n 
A 1 300 ASN 300 300 300 ASN ASN A . n 
A 1 301 PRO 301 301 301 PRO PRO A . n 
A 1 302 ALA 302 302 302 ALA ALA A . n 
A 1 303 HIS 303 303 303 HIS HIS A . n 
A 1 304 VAL 304 304 304 VAL VAL A . n 
A 1 305 MET 305 305 305 MET MET A . n 
A 1 306 SER 306 306 306 SER SER A . n 
A 1 307 CYS 307 307 307 CYS CYS A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 ARG 309 309 309 ARG ARG A . n 
A 1 310 SER 310 310 310 SER SER A . n 
A 1 311 VAL 311 311 311 VAL VAL A . n 
A 1 312 ASP 312 312 312 ASP ASP A . n 
A 1 313 ALA 313 313 313 ALA ALA A . n 
A 1 314 LYS 314 314 314 LYS LYS A . n 
A 1 315 THR 315 315 315 THR THR A . n 
A 1 316 ILE 316 316 316 ILE ILE A . n 
A 1 317 SER 317 317 317 SER SER A . n 
A 1 318 VAL 318 318 318 VAL VAL A . n 
A 1 319 GLN 319 319 319 GLN GLN A . n 
A 1 320 GLN 320 320 320 GLN GLN A . n 
A 1 321 TRP 321 321 321 TRP TRP A . n 
A 1 322 ASN 322 322 322 ASN ASN A . n 
A 1 323 SER 323 323 323 SER SER A . n 
A 1 324 TYR 324 324 324 TYR TYR A . n 
A 1 325 SER 325 325 325 SER SER A . n 
A 1 326 GLY 326 326 326 GLY GLY A . n 
A 1 327 ILE 327 327 327 ILE ILE A . n 
A 1 328 LEU 328 328 328 LEU LEU A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PRO 331 331 331 PRO PRO A . n 
A 1 332 SER 332 332 332 SER SER A . n 
A 1 333 ALA 333 333 333 ALA ALA A . n 
A 1 334 PRO 334 334 334 PRO PRO A . n 
A 1 335 THR 335 335 335 THR THR A . n 
A 1 336 ILE 336 336 336 ILE ILE A . n 
A 1 337 ASP 337 337 337 ASP ASP A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 ALA 339 339 339 ALA ALA A . n 
A 1 340 PHE 340 340 340 PHE PHE A . n 
A 1 341 LEU 341 341 341 LEU LEU A . n 
A 1 342 PRO 342 342 342 PRO PRO A . n 
A 1 343 ALA 343 343 343 ALA ALA A . n 
A 1 344 ASP 344 344 344 ASP ASP A . n 
A 1 345 PRO 345 345 345 PRO PRO A . n 
A 1 346 MET 346 346 346 MET MET A . n 
A 1 347 THR 347 347 347 THR THR A . n 
A 1 348 LEU 348 348 348 LEU LEU A . n 
A 1 349 MET 349 349 349 MET MET A . n 
A 1 350 LYS 350 350 350 LYS LYS A . n 
A 1 351 THR 351 351 351 THR THR A . n 
A 1 352 ALA 352 352 352 ALA ALA A . n 
A 1 353 ASP 353 353 353 ASP ASP A . n 
A 1 354 LEU 354 354 354 LEU LEU A . n 
A 1 355 LYS 355 355 355 LYS LYS A . n 
A 1 356 ASP 356 356 356 ASP ASP A . n 
A 1 357 TYR 357 357 357 TYR TYR A . n 
A 1 358 ASP 358 358 358 ASP ASP A . n 
A 1 359 ILE 359 359 359 ILE ILE A . n 
A 1 360 LEU 360 360 360 LEU LEU A . n 
A 1 361 MET 361 361 361 MET MET A . n 
A 1 362 GLY 362 362 362 GLY GLY A . n 
A 1 363 ASN 363 363 363 ASN ASN A . n 
A 1 364 VAL 364 364 364 VAL VAL A . n 
A 1 365 ARG 365 365 365 ARG ARG A . n 
A 1 366 ASP 366 366 366 ASP ASP A . n 
A 1 367 GLU 367 367 367 GLU GLU A . n 
A 1 368 GLY 368 368 368 GLY GLY A . n 
A 1 369 THR 369 369 369 THR THR A . n 
A 1 370 TYR 370 370 370 TYR TYR A . n 
A 1 371 PHE 371 371 371 PHE PHE A . n 
A 1 372 LEU 372 372 372 LEU LEU A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 TYR 374 374 374 TYR TYR A . n 
A 1 375 ASP 375 375 375 ASP ASP A . n 
A 1 376 PHE 376 376 376 PHE PHE A . n 
A 1 377 ILE 377 377 377 ILE ILE A . n 
A 1 378 ASP 378 378 378 ASP ASP A . n 
A 1 379 TYR 379 379 379 TYR TYR A . n 
A 1 380 PHE 380 380 380 PHE PHE A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 LYS 382 382 382 LYS LYS A . n 
A 1 383 ASP 383 383 383 ASP ASP A . n 
A 1 384 ASP 384 384 384 ASP ASP A . n 
A 1 385 ALA 385 385 385 ALA ALA A . n 
A 1 386 THR 386 386 386 THR THR A . n 
A 1 387 ALA 387 387 387 ALA ALA A . n 
A 1 388 LEU 388 388 388 LEU LEU A . n 
A 1 389 PRO 389 389 389 PRO PRO A . n 
A 1 390 ARG 390 390 390 ARG ARG A . n 
A 1 391 ASP 391 391 391 ASP ASP A . n 
A 1 392 LYS 392 392 392 LYS LYS A . n 
A 1 393 TYR 393 393 393 TYR TYR A . n 
A 1 394 LEU 394 394 394 LEU LEU A . n 
A 1 395 GLU 395 395 395 GLU GLU A . n 
A 1 396 ILE 396 396 396 ILE ILE A . n 
A 1 397 MET 397 397 397 MET MET A . n 
A 1 398 ASN 398 398 398 ASN ASN A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 ILE 400 400 400 ILE ILE A . n 
A 1 401 PHE 401 401 401 PHE PHE A . n 
A 1 402 GLY 402 402 402 GLY GLY A . n 
A 1 403 LYS 403 403 403 LYS LYS A . n 
A 1 404 ALA 404 404 404 ALA ALA A . n 
A 1 405 THR 405 405 405 THR THR A . n 
A 1 406 GLN 406 406 406 GLN GLN A . n 
A 1 407 ALA 407 407 407 ALA ALA A . n 
A 1 408 GLU 408 408 408 GLU GLU A . n 
A 1 409 ARG 409 409 409 ARG ARG A . n 
A 1 410 GLU 410 410 410 GLU GLU A . n 
A 1 411 ALA 411 411 411 ALA ALA A . n 
A 1 412 ILE 412 412 412 ILE ILE A . n 
A 1 413 ILE 413 413 413 ILE ILE A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLN 415 415 415 GLN GLN A . n 
A 1 416 TYR 416 416 416 TYR TYR A . n 
A 1 417 THR 417 417 417 THR THR A . n 
A 1 418 SER 418 418 418 SER SER A . n 
A 1 419 TRP 419 419 419 TRP TRP A . n 
A 1 420 GLU 420 420 420 GLU GLU A . n 
A 1 421 GLY 421 421 421 GLY GLY A . n 
A 1 422 ASN 422 422 422 ASN ASN A . n 
A 1 423 PRO 423 423 423 PRO PRO A . n 
A 1 424 GLY 424 424 424 GLY GLY A . n 
A 1 425 TYR 425 425 425 TYR TYR A . n 
A 1 426 GLN 426 426 426 GLN GLN A . n 
A 1 427 ASN 427 427 427 ASN ASN A . n 
A 1 428 GLN 428 428 428 GLN GLN A . n 
A 1 429 GLN 429 429 429 GLN GLN A . n 
A 1 430 GLN 430 430 430 GLN GLN A . n 
A 1 431 ILE 431 431 431 ILE ILE A . n 
A 1 432 GLY 432 432 432 GLY GLY A . n 
A 1 433 ARG 433 433 433 ARG ARG A . n 
A 1 434 ALA 434 434 434 ALA ALA A . n 
A 1 435 VAL 435 435 435 VAL VAL A . n 
A 1 436 GLY 436 436 436 GLY GLY A . n 
A 1 437 ASP 437 437 437 ASP ASP A . n 
A 1 438 HIS 438 438 438 HIS HIS A . n 
A 1 439 PHE 439 439 439 PHE PHE A . n 
A 1 440 PHE 440 440 440 PHE PHE A . n 
A 1 441 THR 441 441 441 THR THR A . n 
A 1 442 CYS 442 442 442 CYS CYS A . n 
A 1 443 PRO 443 443 443 PRO PRO A . n 
A 1 444 THR 444 444 444 THR THR A . n 
A 1 445 ASN 445 445 445 ASN ASN A . n 
A 1 446 GLU 446 446 446 GLU GLU A . n 
A 1 447 TYR 447 447 447 TYR TYR A . n 
A 1 448 ALA 448 448 448 ALA ALA A . n 
A 1 449 GLN 449 449 449 GLN GLN A . n 
A 1 450 ALA 450 450 450 ALA ALA A . n 
A 1 451 LEU 451 451 451 LEU LEU A . n 
A 1 452 ALA 452 452 452 ALA ALA A . n 
A 1 453 GLU 453 453 453 GLU GLU A . n 
A 1 454 ARG 454 454 454 ARG ARG A . n 
A 1 455 GLY 455 455 455 GLY GLY A . n 
A 1 456 ALA 456 456 456 ALA ALA A . n 
A 1 457 SER 457 457 457 SER SER A . n 
A 1 458 VAL 458 458 458 VAL VAL A . n 
A 1 459 HIS 459 459 459 HIS HIS A . n 
A 1 460 TYR 460 460 460 TYR TYR A . n 
A 1 461 TYR 461 461 461 TYR TYR A . n 
A 1 462 TYR 462 462 462 TYR TYR A . n 
A 1 463 PHE 463 463 463 PHE PHE A . n 
A 1 464 THR 464 464 464 THR THR A . n 
A 1 465 HIS 465 465 465 HIS HIS A . n 
A 1 466 ARG 466 466 466 ARG ARG A . n 
A 1 467 THR 467 467 467 THR THR A . n 
A 1 468 SER 468 468 468 SER SER A . n 
A 1 469 THR 469 469 469 THR THR A . n 
A 1 470 SER 470 470 470 SER SER A . n 
A 1 471 LEU 471 471 471 LEU LEU A . n 
A 1 472 TRP 472 472 472 TRP TRP A . n 
A 1 473 GLY 473 473 473 GLY GLY A . n 
A 1 474 GLU 474 474 474 GLU GLU A . n 
A 1 475 TRP 475 475 475 TRP TRP A . n 
A 1 476 MET 476 476 476 MET MET A . n 
A 1 477 GLY 477 477 477 GLY GLY A . n 
A 1 478 VAL 478 478 478 VAL VAL A . n 
A 1 479 LEU 479 479 479 LEU LEU A . n 
A 1 480 HIS 480 480 480 HIS HIS A . n 
A 1 481 GLY 481 481 481 GLY GLY A . n 
A 1 482 ASP 482 482 482 ASP ASP A . n 
A 1 483 GLU 483 483 483 GLU GLU A . n 
A 1 484 ILE 484 484 484 ILE ILE A . n 
A 1 485 GLU 485 485 485 GLU GLU A . n 
A 1 486 TYR 486 486 486 TYR TYR A . n 
A 1 487 PHE 487 487 487 PHE PHE A . n 
A 1 488 PHE 488 488 488 PHE PHE A . n 
A 1 489 GLY 489 489 489 GLY GLY A . n 
A 1 490 GLN 490 490 490 GLN GLN A . n 
A 1 491 PRO 491 491 491 PRO PRO A . n 
A 1 492 LEU 492 492 492 LEU LEU A . n 
A 1 493 ASN 493 493 493 ASN ASN A . n 
A 1 494 ASN 494 494 494 ASN ASN A . n 
A 1 495 SER 495 495 495 SER SER A . n 
A 1 496 LEU 496 496 496 LEU LEU A . n 
A 1 497 GLN 497 497 497 GLN GLN A . n 
A 1 498 TYR 498 498 498 TYR TYR A . n 
A 1 499 ARG 499 499 499 ARG ARG A . n 
A 1 500 PRO 500 500 500 PRO PRO A . n 
A 1 501 VAL 501 501 501 VAL VAL A . n 
A 1 502 GLU 502 502 502 GLU GLU A . n 
A 1 503 ARG 503 503 503 ARG ARG A . n 
A 1 504 GLU 504 504 504 GLU GLU A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 GLY 506 506 506 GLY GLY A . n 
A 1 507 LYS 507 507 507 LYS LYS A . n 
A 1 508 ARG 508 508 508 ARG ARG A . n 
A 1 509 MET 509 509 509 MET MET A . n 
A 1 510 LEU 510 510 510 LEU LEU A . n 
A 1 511 SER 511 511 511 SER SER A . n 
A 1 512 ALA 512 512 512 ALA ALA A . n 
A 1 513 VAL 513 513 513 VAL VAL A . n 
A 1 514 ILE 514 514 514 ILE ILE A . n 
A 1 515 GLU 515 515 515 GLU GLU A . n 
A 1 516 PHE 516 516 516 PHE PHE A . n 
A 1 517 ALA 517 517 517 ALA ALA A . n 
A 1 518 LYS 518 518 518 LYS LYS A . n 
A 1 519 THR 519 519 519 THR THR A . n 
A 1 520 GLY 520 520 520 GLY GLY A . n 
A 1 521 ASN 521 521 521 ASN ASN A . n 
A 1 522 PRO 522 522 522 PRO PRO A . n 
A 1 523 ALA 523 523 523 ALA ALA A . n 
A 1 524 GLN 524 524 524 GLN GLN A . n 
A 1 525 ASP 525 525 525 ASP ASP A . n 
A 1 526 GLY 526 526 526 GLY GLY A . n 
A 1 527 GLU 527 527 527 GLU GLU A . n 
A 1 528 GLU 528 528 528 GLU GLU A . n 
A 1 529 TRP 529 529 529 TRP TRP A . n 
A 1 530 PRO 530 530 530 PRO PRO A . n 
A 1 531 ASN 531 531 531 ASN ASN A . n 
A 1 532 PHE 532 532 532 PHE PHE A . n 
A 1 533 SER 533 533 533 SER SER A . n 
A 1 534 LYS 534 534 534 LYS LYS A . n 
A 1 535 GLU 535 535 535 GLU GLU A . n 
A 1 536 ASP 536 536 536 ASP ASP A . n 
A 1 537 PRO 537 537 537 PRO PRO A . n 
A 1 538 VAL 538 538 538 VAL VAL A . n 
A 1 539 TYR 539 539 539 TYR TYR A . n 
A 1 540 TYR 540 540 540 TYR TYR A . n 
A 1 541 ILE 541 541 541 ILE ILE A . n 
A 1 542 PHE 542 542 542 PHE PHE A . n 
A 1 543 SER 543 543 543 SER SER A . n 
A 1 544 THR 544 544 544 THR THR A . n 
A 1 545 ASP 545 545 545 ASP ASP A . n 
A 1 546 ASP 546 546 546 ASP ASP A . n 
A 1 547 LYS 547 547 547 LYS LYS A . n 
A 1 548 ILE 548 548 548 ILE ILE A . n 
A 1 549 GLU 549 549 549 GLU GLU A . n 
A 1 550 LYS 550 550 550 LYS LYS A . n 
A 1 551 LEU 551 551 551 LEU LEU A . n 
A 1 552 ALA 552 552 552 ALA ALA A . n 
A 1 553 ARG 553 553 553 ARG ARG A . n 
A 1 554 GLY 554 554 554 GLY GLY A . n 
A 1 555 PRO 555 555 555 PRO PRO A . n 
A 1 556 LEU 556 556 556 LEU LEU A . n 
A 1 557 ALA 557 557 557 ALA ALA A . n 
A 1 558 ALA 558 558 558 ALA ALA A . n 
A 1 559 ARG 559 559 559 ARG ARG A . n 
A 1 560 CYS 560 560 560 CYS CYS A . n 
A 1 561 SER 561 561 561 SER SER A . n 
A 1 562 PHE 562 562 562 PHE PHE A . n 
A 1 563 TRP 563 563 563 TRP TRP A . n 
A 1 564 ASN 564 564 564 ASN ASN A . n 
A 1 565 ASP 565 565 565 ASP ASP A . n 
A 1 566 TYR 566 566 566 TYR TYR A . n 
A 1 567 LEU 567 567 567 LEU LEU A . n 
A 1 568 PRO 568 568 568 PRO PRO A . n 
A 1 569 LYS 569 569 569 LYS LYS A . n 
A 1 570 VAL 570 570 570 VAL VAL A . n 
A 1 571 ARG 571 571 571 ARG ARG A . n 
A 1 572 SER 572 572 572 SER SER A . n 
A 1 573 TRP 573 573 573 TRP TRP A . n 
A 1 574 ALA 574 574 ?   ?   ?   A . n 
A 1 575 GLY 575 575 ?   ?   ?   A . n 
A 1 576 THR 576 576 ?   ?   ?   A . n 
A 1 577 CYS 577 577 ?   ?   ?   A . n 
A 1 578 ASP 578 578 ?   ?   ?   A . n 
A 1 579 GLY 579 579 ?   ?   ?   A . n 
A 1 580 ASP 580 580 ?   ?   ?   A . n 
A 1 581 SER 581 581 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 PPI 1   601 700 PPI PPI A . 
D 4 760 1   602 701 760 760 A . 
E 5 NAG 1   603 602 NAG NAG A . 
F 6 SO4 1   604 702 SO4 SO4 A . 
G 7 CL  1   605 703 CL  CL  A . 
H 8 HOH 1   701 88  HOH HOH A . 
H 8 HOH 2   702 109 HOH HOH A . 
H 8 HOH 3   703 71  HOH HOH A . 
H 8 HOH 4   704 62  HOH HOH A . 
H 8 HOH 5   705 96  HOH HOH A . 
H 8 HOH 6   706 83  HOH HOH A . 
H 8 HOH 7   707 102 HOH HOH A . 
H 8 HOH 8   708 38  HOH HOH A . 
H 8 HOH 9   709 37  HOH HOH A . 
H 8 HOH 10  710 59  HOH HOH A . 
H 8 HOH 11  711 4   HOH HOH A . 
H 8 HOH 12  712 32  HOH HOH A . 
H 8 HOH 13  713 85  HOH HOH A . 
H 8 HOH 14  714 23  HOH HOH A . 
H 8 HOH 15  715 35  HOH HOH A . 
H 8 HOH 16  716 40  HOH HOH A . 
H 8 HOH 17  717 25  HOH HOH A . 
H 8 HOH 18  718 118 HOH HOH A . 
H 8 HOH 19  719 7   HOH HOH A . 
H 8 HOH 20  720 110 HOH HOH A . 
H 8 HOH 21  721 8   HOH HOH A . 
H 8 HOH 22  722 70  HOH HOH A . 
H 8 HOH 23  723 136 HOH HOH A . 
H 8 HOH 24  724 50  HOH HOH A . 
H 8 HOH 25  725 22  HOH HOH A . 
H 8 HOH 26  726 51  HOH HOH A . 
H 8 HOH 27  727 122 HOH HOH A . 
H 8 HOH 28  728 100 HOH HOH A . 
H 8 HOH 29  729 6   HOH HOH A . 
H 8 HOH 30  730 29  HOH HOH A . 
H 8 HOH 31  731 87  HOH HOH A . 
H 8 HOH 32  732 21  HOH HOH A . 
H 8 HOH 33  733 46  HOH HOH A . 
H 8 HOH 34  734 54  HOH HOH A . 
H 8 HOH 35  735 82  HOH HOH A . 
H 8 HOH 36  736 26  HOH HOH A . 
H 8 HOH 37  737 20  HOH HOH A . 
H 8 HOH 38  738 44  HOH HOH A . 
H 8 HOH 39  739 49  HOH HOH A . 
H 8 HOH 40  740 92  HOH HOH A . 
H 8 HOH 41  741 143 HOH HOH A . 
H 8 HOH 42  742 123 HOH HOH A . 
H 8 HOH 43  743 74  HOH HOH A . 
H 8 HOH 44  744 64  HOH HOH A . 
H 8 HOH 45  745 34  HOH HOH A . 
H 8 HOH 46  746 41  HOH HOH A . 
H 8 HOH 47  747 117 HOH HOH A . 
H 8 HOH 48  748 28  HOH HOH A . 
H 8 HOH 49  749 98  HOH HOH A . 
H 8 HOH 50  750 140 HOH HOH A . 
H 8 HOH 51  751 5   HOH HOH A . 
H 8 HOH 52  752 137 HOH HOH A . 
H 8 HOH 53  753 124 HOH HOH A . 
H 8 HOH 54  754 79  HOH HOH A . 
H 8 HOH 55  755 24  HOH HOH A . 
H 8 HOH 56  756 141 HOH HOH A . 
H 8 HOH 57  757 60  HOH HOH A . 
H 8 HOH 58  758 75  HOH HOH A . 
H 8 HOH 59  759 144 HOH HOH A . 
H 8 HOH 60  760 12  HOH HOH A . 
H 8 HOH 61  761 63  HOH HOH A . 
H 8 HOH 62  762 94  HOH HOH A . 
H 8 HOH 63  763 107 HOH HOH A . 
H 8 HOH 64  764 16  HOH HOH A . 
H 8 HOH 65  765 116 HOH HOH A . 
H 8 HOH 66  766 138 HOH HOH A . 
H 8 HOH 67  767 139 HOH HOH A . 
H 8 HOH 68  768 13  HOH HOH A . 
H 8 HOH 69  769 112 HOH HOH A . 
H 8 HOH 70  770 91  HOH HOH A . 
H 8 HOH 71  771 31  HOH HOH A . 
H 8 HOH 72  772 19  HOH HOH A . 
H 8 HOH 73  773 55  HOH HOH A . 
H 8 HOH 74  774 95  HOH HOH A . 
H 8 HOH 75  775 133 HOH HOH A . 
H 8 HOH 76  776 135 HOH HOH A . 
H 8 HOH 77  777 30  HOH HOH A . 
H 8 HOH 78  778 11  HOH HOH A . 
H 8 HOH 79  779 90  HOH HOH A . 
H 8 HOH 80  780 126 HOH HOH A . 
H 8 HOH 81  781 106 HOH HOH A . 
H 8 HOH 82  782 127 HOH HOH A . 
H 8 HOH 83  783 9   HOH HOH A . 
H 8 HOH 84  784 119 HOH HOH A . 
H 8 HOH 85  785 115 HOH HOH A . 
H 8 HOH 86  786 45  HOH HOH A . 
H 8 HOH 87  787 142 HOH HOH A . 
H 8 HOH 88  788 47  HOH HOH A . 
H 8 HOH 89  789 77  HOH HOH A . 
H 8 HOH 90  790 66  HOH HOH A . 
H 8 HOH 91  791 61  HOH HOH A . 
H 8 HOH 92  792 89  HOH HOH A . 
H 8 HOH 93  793 68  HOH HOH A . 
H 8 HOH 94  794 84  HOH HOH A . 
H 8 HOH 95  795 121 HOH HOH A . 
H 8 HOH 96  796 125 HOH HOH A . 
H 8 HOH 97  797 132 HOH HOH A . 
H 8 HOH 98  798 67  HOH HOH A . 
H 8 HOH 99  799 131 HOH HOH A . 
H 8 HOH 100 800 97  HOH HOH A . 
H 8 HOH 101 801 80  HOH HOH A . 
H 8 HOH 102 802 18  HOH HOH A . 
H 8 HOH 103 803 14  HOH HOH A . 
H 8 HOH 104 804 108 HOH HOH A . 
H 8 HOH 105 805 128 HOH HOH A . 
H 8 HOH 106 806 39  HOH HOH A . 
H 8 HOH 107 807 10  HOH HOH A . 
H 8 HOH 108 808 65  HOH HOH A . 
H 8 HOH 109 809 57  HOH HOH A . 
H 8 HOH 110 810 101 HOH HOH A . 
H 8 HOH 111 811 73  HOH HOH A . 
H 8 HOH 112 812 69  HOH HOH A . 
H 8 HOH 113 813 129 HOH HOH A . 
H 8 HOH 114 814 134 HOH HOH A . 
H 8 HOH 115 815 113 HOH HOH A . 
H 8 HOH 116 816 86  HOH HOH A . 
H 8 HOH 117 817 3   HOH HOH A . 
H 8 HOH 118 818 2   HOH HOH A . 
H 8 HOH 119 819 103 HOH HOH A . 
H 8 HOH 120 820 78  HOH HOH A . 
H 8 HOH 121 821 111 HOH HOH A . 
H 8 HOH 122 822 58  HOH HOH A . 
H 8 HOH 123 823 120 HOH HOH A . 
H 8 HOH 124 824 52  HOH HOH A . 
H 8 HOH 125 825 93  HOH HOH A . 
H 8 HOH 126 826 48  HOH HOH A . 
H 8 HOH 127 827 27  HOH HOH A . 
H 8 HOH 128 828 72  HOH HOH A . 
H 8 HOH 129 829 17  HOH HOH A . 
H 8 HOH 130 830 104 HOH HOH A . 
H 8 HOH 131 831 99  HOH HOH A . 
H 8 HOH 132 832 1   HOH HOH A . 
H 8 HOH 133 833 33  HOH HOH A . 
H 8 HOH 134 834 42  HOH HOH A . 
H 8 HOH 135 835 43  HOH HOH A . 
H 8 HOH 136 836 76  HOH HOH A . 
H 8 HOH 137 837 36  HOH HOH A . 
H 8 HOH 138 838 81  HOH HOH A . 
H 8 HOH 139 839 130 HOH HOH A . 
H 8 HOH 140 840 15  HOH HOH A . 
H 8 HOH 141 841 56  HOH HOH A . 
H 8 HOH 142 842 105 HOH HOH A . 
H 8 HOH 143 843 53  HOH HOH A . 
H 8 HOH 144 844 114 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D,E,F,G,H 
1 2 A,C,D,E,F,G,H   
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z            1.0000000000 0.0000000000  0.0000000000 0.0000000000  0.0000000000  
1.0000000000 0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 8_665 -y+1,-x+1,-z+1/2 0.0000000000 -1.0000000000 0.0000000000 95.8100000000 -1.0000000000 
0.0000000000 0.0000000000 95.8100000000 0.0000000000 0.0000000000 -1.0000000000 81.0150000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A SO4 604 ? F SO4 . 
2 1 A CL  605 ? G CL  . 
3 1 A HOH 741 ? H HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2020-03-18 
2 'Structure model' 2 0 2020-07-29 
3 'Structure model' 3 0 2021-05-05 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 2 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' Advisory               
2  2 'Structure model' 'Atomic model'         
3  2 'Structure model' 'Data collection'      
4  2 'Structure model' 'Derived calculations' 
5  2 'Structure model' 'Structure summary'    
6  3 'Structure model' Advisory               
7  3 'Structure model' 'Atomic model'         
8  3 'Structure model' 'Data collection'      
9  3 'Structure model' 'Derived calculations' 
10 3 'Structure model' 'Structure summary'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  2 'Structure model' atom_site                     
2  2 'Structure model' chem_comp                     
3  2 'Structure model' entity                        
4  2 'Structure model' pdbx_branch_scheme            
5  2 'Structure model' pdbx_chem_comp_identifier     
6  2 'Structure model' pdbx_entity_branch            
7  2 'Structure model' pdbx_entity_branch_descriptor 
8  2 'Structure model' pdbx_entity_branch_link       
9  2 'Structure model' pdbx_entity_branch_list       
10 2 'Structure model' pdbx_entity_nonpoly           
11 2 'Structure model' pdbx_nonpoly_scheme           
12 2 'Structure model' pdbx_struct_assembly_gen      
13 2 'Structure model' pdbx_struct_special_symmetry  
14 2 'Structure model' pdbx_validate_close_contact   
15 2 'Structure model' struct_asym                   
16 2 'Structure model' struct_conn                   
17 2 'Structure model' struct_site                   
18 2 'Structure model' struct_site_gen               
19 3 'Structure model' atom_site                     
20 3 'Structure model' chem_comp                     
21 3 'Structure model' pdbx_nonpoly_scheme           
22 3 'Structure model' pdbx_struct_assembly          
23 3 'Structure model' pdbx_struct_assembly_gen      
24 3 'Structure model' pdbx_struct_assembly_prop     
25 3 'Structure model' pdbx_struct_oper_list         
26 3 'Structure model' pdbx_struct_special_symmetry  
27 3 'Structure model' pdbx_validate_symm_contact    
28 3 'Structure model' struct_conn                   
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_atom_site.B_iso_or_equiv'                   
2  2 'Structure model' '_atom_site.Cartn_x'                          
3  2 'Structure model' '_atom_site.Cartn_y'                          
4  2 'Structure model' '_atom_site.Cartn_z'                          
5  2 'Structure model' '_atom_site.auth_asym_id'                     
6  2 'Structure model' '_atom_site.auth_atom_id'                     
7  2 'Structure model' '_atom_site.auth_comp_id'                     
8  2 'Structure model' '_atom_site.auth_seq_id'                      
9  2 'Structure model' '_atom_site.label_asym_id'                    
10 2 'Structure model' '_atom_site.label_atom_id'                    
11 2 'Structure model' '_atom_site.label_comp_id'                    
12 2 'Structure model' '_atom_site.label_entity_id'                  
13 2 'Structure model' '_atom_site.type_symbol'                      
14 2 'Structure model' '_chem_comp.name'                             
15 2 'Structure model' '_entity.formula_weight'                      
16 2 'Structure model' '_entity.pdbx_description'                    
17 2 'Structure model' '_entity.pdbx_number_of_molecules'            
18 2 'Structure model' '_entity.src_method'                          
19 2 'Structure model' '_entity.type'                                
20 2 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'      
21 2 'Structure model' '_pdbx_struct_special_symmetry.label_asym_id' 
22 2 'Structure model' '_pdbx_validate_close_contact.auth_asym_id_1' 
23 2 'Structure model' '_pdbx_validate_close_contact.auth_asym_id_2' 
24 2 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_1'  
25 2 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_2'  
26 2 'Structure model' '_struct_conn.pdbx_role'                      
27 2 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
28 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
29 2 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
30 2 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
31 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
32 2 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
33 3 'Structure model' '_atom_site.B_iso_or_equiv'                   
34 3 'Structure model' '_atom_site.Cartn_x'                          
35 3 'Structure model' '_atom_site.Cartn_y'                          
36 3 'Structure model' '_atom_site.Cartn_z'                          
37 3 'Structure model' '_atom_site.auth_seq_id'                      
38 3 'Structure model' '_chem_comp.pdbx_synonyms'                    
39 3 'Structure model' '_pdbx_nonpoly_scheme.auth_seq_num'           
40 3 'Structure model' '_pdbx_nonpoly_scheme.pdb_seq_num'            
41 3 'Structure model' '_pdbx_struct_assembly.oligomeric_count'      
42 3 'Structure model' '_pdbx_struct_assembly.oligomeric_details'    
43 3 'Structure model' '_pdbx_struct_special_symmetry.auth_seq_id'   
44 3 'Structure model' '_pdbx_validate_symm_contact.auth_seq_id_1'   
45 3 'Structure model' '_pdbx_validate_symm_contact.auth_seq_id_2'   
46 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[1][1]_esd 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][2]_esd 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[1][3]_esd 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[2][2]_esd 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.T[2][3]_esd 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[3][3]_esd 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[1][1]_esd 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][2]_esd 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[1][3]_esd 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[2][2]_esd 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.L[2][3]_esd 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[3][3]_esd 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][1]_esd 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][2]_esd 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[1][3]_esd 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][1]_esd 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][2]_esd 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][3]_esd 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][1]_esd 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][2]_esd 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[3][3]_esd 
1 'X-RAY DIFFRACTION' ? refined 20.4339477596 65.3097148661 -0.391849821428 0.270399198105 ? 0.0398396889431  ? 0.00743641784125 ? 
0.352083420788 ? 0.00360201178414 ? 0.250465509273 ? 2.49131191739 ? -0.99859256303  ? 0.922590998928 ? 2.58401894613 ? 
-0.656213744906 ? 3.25131164256 ? 0.0640454202708  ? 0.414396331609  ? 0.0541531782255 ? -0.360018985225  ? -0.19778994797   ? 
0.0632215930557 ? -0.185902306866 ? 0.38832526328   ? 0.120049611634   ? 
2 'X-RAY DIFFRACTION' ? refined 20.1176664408 61.7308264247 18.256111257    0.240382319678 ? 0.0210464298773  ? 0.0456196575197  ? 
0.413948600043 ? -0.0368163207845 ? 0.501679868574 ? 1.78000888751 ? 0.416304113904  ? 1.85609530223  ? 2.72268357377 ? 
0.0933924840806 ? 2.97433651921 ? -0.0394713278562 ? -0.185883924815 ? 0.28415670898   ? -0.0477707480742 ? -0.0805930068052 ? 
0.699122467     ? -0.163477840683 ? -0.242675209151 ? 0.0677340746521  ? 
3 'X-RAY DIFFRACTION' ? refined 33.2259551623 66.0915935707 23.1429812165   0.345422197863 ? 0.00716516544117 ? -0.012506823223  ? 
0.373969469036 ? 0.0397446513776  ? 0.28632915897  ? 2.18561488848 ? -0.4521782327   ? 0.777516838916 ? 2.61045287248 ? 
0.538014033815  ? 3.5755962385  ? -0.268427902918  ? -0.176336336723 ? 0.137703024203  ? 0.112638352219   ? 0.118145793021   ? 
-0.329823008934 ? -0.538700379333 ? 0.458152913367  ? 0.182959808957   ? 
4 'X-RAY DIFFRACTION' ? refined 26.1374442325 51.9406034581 24.2868438795   0.299612598056 ? 0.0173352505415  ? 0.067387246182   ? 
0.293915127454 ? 0.125239642868   ? 0.329145608877 ? 2.44748704191 ? 0.0772937913889 ? 1.08427968727  ? 2.17010734244 ? 
-0.176501878863 ? 3.70803477707 ? -0.0950473575897 ? -0.389362849603 ? -0.42866780774  ? 0.179775357861   ? 0.0317511053841  ? 
0.144206587599  ? 0.406269079828  ? 0.0531957645953 ? -0.0230884676899 ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid    3  through  343 )
;
2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid  344  through  375 )
;
3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid  376  through  499 )
;
4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid  500  through  573 )
;
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data processing' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .         1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? .         2 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? .         3 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.16_3549 4 
? 'model building'  ? ? ? ? ? ? ? ? ? ? ? Coot   ? ? ? .         5 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .         6 
# 
_pdbx_entry_details.entry_id                 6XYY 
_pdbx_entry_details.has_ligand_of_interest   Y 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OG A SER 238 ? ? C1 A PPI 601 ? ? 1.63 
2 1 O3 B MAN 3   ? ? O5 B MAN 4   ? ? 1.95 
3 1 O4 B NAG 1   ? ? O5 B NAG 2   ? ? 2.19 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O1 A SO4 604 ? ? 1_555 O4 A SO4 604 ? ? 7_555 0.01 
2 1 O2 A SO4 604 ? ? 1_555 O3 A SO4 604 ? ? 7_555 0.01 
3 1 S  A SO4 604 ? ? 1_555 O2 A SO4 604 ? ? 7_555 1.46 
4 1 S  A SO4 604 ? ? 1_555 O3 A SO4 604 ? ? 7_555 1.46 
5 1 S  A SO4 604 ? ? 1_555 O1 A SO4 604 ? ? 7_555 1.46 
6 1 S  A SO4 604 ? ? 1_555 O4 A SO4 604 ? ? 7_555 1.46 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 40  ? ? 61.23   -137.20 
2  1 PHE A 44  ? ? 70.43   -13.42  
3  1 THR A 138 ? ? 118.36  -26.96  
4  1 ASN A 139 ? ? -99.73  33.72   
5  1 PHE A 152 ? ? 59.75   12.20   
6  1 ALA A 202 ? ? -157.80 74.33   
7  1 TRP A 231 ? ? -115.95 53.44   
8  1 SER A 238 ? ? 53.42   -125.15 
9  1 ASN A 293 ? ? -59.60  96.82   
10 1 SER A 325 ? ? -93.54  -70.32  
11 1 ALA A 339 ? ? -126.44 -87.11  
12 1 PRO A 345 ? ? -60.80  4.67    
13 1 THR A 351 ? ? -97.38  -73.04  
14 1 PHE A 440 ? ? -132.75 -68.40  
15 1 SER A 572 ? ? -67.93  81.50   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A VAL 1   ? A VAL 1   
2  1 Y 1 A ILE 2   ? A ILE 2   
3  1 Y 1 A LYS 103 ? A LYS 103 
4  1 Y 1 A ALA 104 ? A ALA 104 
5  1 Y 1 A ARG 105 ? A ARG 105 
6  1 Y 1 A LEU 106 ? A LEU 106 
7  1 Y 1 A ARG 107 ? A ARG 107 
8  1 Y 1 A HIS 108 ? A HIS 108 
9  1 Y 1 A GLY 109 ? A GLY 109 
10 1 Y 1 A ARG 110 ? A ARG 110 
11 1 Y 1 A GLY 111 ? A GLY 111 
12 1 Y 1 A ALA 112 ? A ALA 112 
13 1 Y 1 A ASN 113 ? A ASN 113 
14 1 Y 1 A GLY 114 ? A GLY 114 
15 1 Y 1 A GLY 115 ? A GLY 115 
16 1 Y 1 A GLU 116 ? A GLU 116 
17 1 Y 1 A HIS 117 ? A HIS 117 
18 1 Y 1 A PRO 118 ? A PRO 118 
19 1 Y 1 A ASN 119 ? A ASN 119 
20 1 Y 1 A GLY 120 ? A GLY 120 
21 1 Y 1 A LYS 121 ? A LYS 121 
22 1 Y 1 A GLN 122 ? A GLN 122 
23 1 Y 1 A ALA 123 ? A ALA 123 
24 1 Y 1 A ASP 124 ? A ASP 124 
25 1 Y 1 A THR 125 ? A THR 125 
26 1 Y 1 A ASP 126 ? A ASP 126 
27 1 Y 1 A HIS 127 ? A HIS 127 
28 1 Y 1 A LEU 128 ? A LEU 128 
29 1 Y 1 A ILE 129 ? A ILE 129 
30 1 Y 1 A HIS 130 ? A HIS 130 
31 1 Y 1 A ASN 131 ? A ASN 131 
32 1 Y 1 A GLY 132 ? A GLY 132 
33 1 Y 1 A ASN 133 ? A ASN 133 
34 1 Y 1 A PRO 134 ? A PRO 134 
35 1 Y 1 A GLN 135 ? A GLN 135 
36 1 Y 1 A ASN 136 ? A ASN 136 
37 1 Y 1 A ALA 574 ? A ALA 574 
38 1 Y 1 A GLY 575 ? A GLY 575 
39 1 Y 1 A THR 576 ? A THR 576 
40 1 Y 1 A CYS 577 ? A CYS 577 
41 1 Y 1 A ASP 578 ? A ASP 578 
42 1 Y 1 A GLY 579 ? A GLY 579 
43 1 Y 1 A ASP 580 ? A ASP 580 
44 1 Y 1 A SER 581 ? A SER 581 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
B 2 NAG 1 B NAG 1 A NAG 601 n 
B 2 NAG 2 B NAG 2 A NAG 603 n 
B 2 MAN 3 B MAN 3 A BMA 604 n 
B 2 MAN 4 B MAN 4 A BMA 606 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
MAN 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DManpa                         
MAN 'COMMON NAME'                         GMML     1.0 a-D-mannopyranose              
MAN 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-D-Manp                       
MAN 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Man                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 DManpa1-3DManpa1-4DGlcpNAcb1-4DGlcpNAcb1-                                                'Glycam Condensed Sequence' GMML 1.0 
2 2 'WURCS=2.0/2,4,3/[a2122h-1b_1-5_2*NCC/3=O][a1122h-1a_1-5]/1-1-2-2/a4-b1_b4-c1_c3-d1'     WURCS                       
PDB2Glycan 1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{[(4+1)][a-D-Manp]{[(3+1)][a-D-Manp]{}}}}}' LINUCS                      PDB-CARE 
?     
# 
loop_
_pdbx_entity_branch_link.link_id 
_pdbx_entity_branch_link.entity_id 
_pdbx_entity_branch_link.entity_branch_list_num_1 
_pdbx_entity_branch_link.comp_id_1 
_pdbx_entity_branch_link.atom_id_1 
_pdbx_entity_branch_link.leaving_atom_id_1 
_pdbx_entity_branch_link.entity_branch_list_num_2 
_pdbx_entity_branch_link.comp_id_2 
_pdbx_entity_branch_link.atom_id_2 
_pdbx_entity_branch_link.leaving_atom_id_2 
_pdbx_entity_branch_link.value_order 
_pdbx_entity_branch_link.details 
1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
2 2 3 MAN C1 O1 2 NAG O4 HO4 sing ? 
3 2 4 MAN C1 O1 3 MAN O3 HO3 sing ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NAG 2 n 
2 MAN 3 n 
2 MAN 4 n 
# 
loop_
_pdbx_entity_instance_feature.ordinal 
_pdbx_entity_instance_feature.comp_id 
_pdbx_entity_instance_feature.asym_id 
_pdbx_entity_instance_feature.seq_num 
_pdbx_entity_instance_feature.auth_comp_id 
_pdbx_entity_instance_feature.auth_asym_id 
_pdbx_entity_instance_feature.auth_seq_num 
_pdbx_entity_instance_feature.feature_type 
_pdbx_entity_instance_feature.details 
1 760 ? ? 760 ? ? 'SUBJECT OF INVESTIGATION' ? 
2 PPI ? ? PPI ? ? 'SUBJECT OF INVESTIGATION' ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'PROPANOIC ACID'                                     PPI 
4 '9-(3-PHENYLMETHYLAMINO)-1,2,3,4-TETRAHYDROACRIDINE' 760 
5 2-acetamido-2-deoxy-beta-D-glucopyranose             NAG 
6 'SULFATE ION'                                        SO4 
7 'CHLORIDE ION'                                       CL  
8 water                                                HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
_space_group.name_H-M_alt     'P 43 21 2' 
_space_group.name_Hall        'P 4nw 2abw' 
_space_group.IT_number        96 
_space_group.crystal_system   tetragonal 
_space_group.id               1 
# 
loop_
_space_group_symop.id 
_space_group_symop.operation_xyz 
1 x,y,z               
2 -y+1/2,x+1/2,z+3/4  
3 y+1/2,-x+1/2,z+1/4  
4 x+1/2,-y+1/2,-z+1/4 
5 -x+1/2,y+1/2,-z+3/4 
6 -x,-y,z+1/2         
7 y,x,-z              
8 -y,-x,-z+1/2        
#