data_6Y11
# 
_entry.id   6Y11 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.383 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   6Y11         pdb_00006y11 10.2210/pdb6y11/pdb 
WWPDB D_1292106364 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2020-09-02 
2 'Structure model' 1 1 2024-01-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'        
2 2 'Structure model' 'Database references'    
3 2 'Structure model' 'Refinement description' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' chem_comp_atom                
2 2 'Structure model' chem_comp_bond                
3 2 'Structure model' database_2                    
4 2 'Structure model' pdbx_initial_refinement_model 
5 2 'Structure model' struct_ncs_dom_lim            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_database_2.pdbx_DOI'                  
2  2 'Structure model' '_database_2.pdbx_database_accession'   
3  2 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id'  
4  2 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 
5  2 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 
6  2 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id'  
7  2 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id'  
8  2 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 
9  2 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 
10 2 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id'  
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6Y11 
_pdbx_database_status.recvd_initial_deposition_date   2020-02-10 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Gutierrez-Fernandez, J.' 1 ?                   
'Minhas, G.S.'            2 ?                   
'Sazanov, L.A.'           3 0000-0002-0977-7989 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            11 
_citation.language                  ? 
_citation.page_first                4135 
_citation.page_last                 4135 
_citation.title                     'Key role of quinone in the mechanism of respiratory complex I.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-020-17957-0 
_citation.pdbx_database_id_PubMed   32811817 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Gutierrez-Fernandez, J.' 1 ?                   
primary 'Kaszuba, K.'             2 ?                   
primary 'Minhas, G.S.'            3 ?                   
primary 'Baradaran, R.'           4 ?                   
primary 'Tambalo, M.'             5 ?                   
primary 'Gallagher, D.T.'         6 ?                   
primary 'Sazanov, L.A.'           7 0000-0002-0977-7989 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'NADH-quinone oxidoreductase subunit 1'  48693.715 2  7.1.1.- ? ? ? 
2  polymer     nat 'NADH-quinone oxidoreductase subunit 2'  20309.162 2  7.1.1.- ? ? ? 
3  polymer     nat 'NADH-quinone oxidoreductase subunit 3'  86656.203 2  7.1.1.- ? ? ? 
4  polymer     nat 'NADH-quinone oxidoreductase subunit 4'  46428.027 2  7.1.1.- ? ? ? 
5  polymer     nat 'NADH-quinone oxidoreductase subunit 5'  23893.254 2  7.1.1.- ? ? ? 
6  polymer     nat 'NADH-quinone oxidoreductase subunit 6'  20262.564 2  7.1.1.- ? ? ? 
7  polymer     nat 'NADH-quinone oxidoreductase subunit 9'  20106.309 2  7.1.1.- ? ? ? 
8  polymer     nat 'NADH-quinone oxidoreductase subunit 15' 14812.074 2  7.1.1.- ? ? ? 
9  polymer     nat 'DUF3197 domain-containing protein'      14201.612 2  ?       ? ? ? 
10 polymer     nat 'NADH-quinone oxidoreductase subunit 7'  13154.656 2  7.1.1.- ? ? ? 
11 polymer     nat 'NADH-quinone oxidoreductase subunit 10' 18563.330 2  7.1.1.- ? ? ? 
12 polymer     nat 'NADH-quinone oxidoreductase subunit 11' 10002.788 2  7.1.1.- ? ? ? 
13 polymer     nat 'NADH-quinone oxidoreductase subunit 12' 65189.930 2  7.1.1.- ? ? ? 
14 polymer     nat 'NADH-quinone oxidoreductase subunit 13' 49247.117 2  7.1.1.- ? ? ? 
15 polymer     nat 'NADH-quinone oxidoreductase subunit 14' 44463.895 2  7.1.1.- ? ? ? 
16 polymer     nat 'NADH-quinone oxidoreductase subunit 8'  41034.523 2  7.1.1.- ? ? ? 
17 non-polymer syn 'IRON/SULFUR CLUSTER'                    351.640   14 ?       ? ? ? 
18 non-polymer syn 'FLAVIN MONONUCLEOTIDE'                  456.344   2  ?       ? ? ? 
19 non-polymer syn 'FE2/S2 (INORGANIC) CLUSTER'             175.820   4  ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  'NADH dehydrogenase I chain 1,NDH-1 subunit 1'   
2  'NADH dehydrogenase I chain 2,NDH-1 subunit 2'   
3  'NADH dehydrogenase I chain 3,NDH-1 subunit 3'   
4  'NADH dehydrogenase I chain 4,NDH-1 subunit 4'   
5  'NADH dehydrogenase I chain 5,NDH-1 subunit 5'   
6  'NADH dehydrogenase I subunit 6,NDH-1 subunit 6' 
7  'NADH dehydrogenase I subunit 9,NDH-1 subunit 9' 
8  'NADH dehydrogenase I chain 15,NDH-1 subunit 15' 
10 'NADH dehydrogenase I chain 7,NDH-1 subunit 7'   
11 'NADH dehydrogenase I chain 10,NDH-1 subunit 10' 
12 'NADH dehydrogenase I chain 11,NDH-1 subunit 11' 
13 'NADH dehydrogenase I chain 12,NDH-1 subunit 12' 
14 'NADH dehydrogenase I chain 13,NDH-1 subunit 13' 
15 'NADH dehydrogenase I chain 14,NDH-1 subunit 14' 
16 'NADH dehydrogenase I subunit 8,NDH-1 subunit 8' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)' no no 
;MTGPILSGLDPRFERTLYAHVGKEGSWTLDYYLRHGGYETAKRVLKEKTPDEVIEEVKRSGLRGRGGAGFPTGLKWSFMP
KDDGKQHYLICNADESEPGSFKDRYILEDVPHLLIEGMILAGYAIRATVGYIYVRGEYRRAADRLEQAIKEARARGYLGK
NLFGTDFSFDLHVHRGAGAYICGEETALMNSLEGLRANPRLKPPFPAQSGLWGKPTTINNVETLASVVPIMERGADWFAQ
MGTEQSKGMKLYQISGPVKRPGVYELPMGTTFRELIYEWAGGPLEPIQAIIPGGSSTPPLPFTEEVLDTPMSYEHLQAKG
SMLGTGGVILIPERVSMVDAMWNLTRFYAHESCGKCTPCREGVAGFMVNLFAKIGTGQGEEKDVENLEALLPLIEGRSFC
PLADAAVWPVKGSLRHFKDQYLALAREKRPVPRPSLWR
;
;MTGPILSGLDPRFERTLYAHVGKEGSWTLDYYLRHGGYETAKRVLKEKTPDEVIEEVKRSGLRGRGGAGFPTGLKWSFMP
KDDGKQHYLICNADESEPGSFKDRYILEDVPHLLIEGMILAGYAIRATVGYIYVRGEYRRAADRLEQAIKEARARGYLGK
NLFGTDFSFDLHVHRGAGAYICGEETALMNSLEGLRANPRLKPPFPAQSGLWGKPTTINNVETLASVVPIMERGADWFAQ
MGTEQSKGMKLYQISGPVKRPGVYELPMGTTFRELIYEWAGGPLEPIQAIIPGGSSTPPLPFTEEVLDTPMSYEHLQAKG
SMLGTGGVILIPERVSMVDAMWNLTRFYAHESCGKCTPCREGVAGFMVNLFAKIGTGQGEEKDVENLEALLPLIEGRSFC
PLADAAVWPVKGSLRHFKDQYLALAREKRPVPRPSLWR
;
1,B ? 
2  'polypeptide(L)' no no 
;MGFFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHL
QVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAG
KRLEEIELPGKCGHHVHEVEV
;
;MGFFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHL
QVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAG
KRLEEIELPGKCGHHVHEVEV
;
2,C ? 
3  'polypeptide(L)' no no 
;MVRVKVNDRIVEVPPGTSVMDAVFHAGYDVPLFCSEKHLSPIGACRMCLVRIGLPKKGPDGKPLLNEKGEPEIQWQPKLA
ASCVTAVADGMVVDTLSDVVREAQAGMVEFTLLNHPLDCPTCDKGGACELQDRTVEYGLYEKYYQKGPLELPVYTRFEFT
RRHVDKHHPLSPFVILDRERCIHCKRCVRYFEEVPGDEVLDFIERGVHTFIGTMDFGLPSGFSGNITDICPVGALLDLTA
RFRARNWEMEETPTTCALCPVGCGITADTRSGELLRIRAREVPEVNEIWICDAGRFGHEWADQNRLKTPLVRKEGRLVEA
TWEEAFLALKEGLKEARGEEVGLYLAHDATLEEGLLASELAKALKTPHLDFQGRTAAPASLFPPASLEDLLQADFALVLG
DPTEEAPILHLRLSEFVRDLKPPHRYNHGTPFADLQIKERMPRRTDKMALFAPYRAPLMKWAAIHEVHRPGEEREILLAL
LGDKEGSEMVAKAKEAWEKAKNPVLILGAGVLQDTVAAERARLLAERKGAKVLAMTPAANARGLEAMGVLPGAKGASWDE
PGALYAYYGFVPPEEALKGKRFVVMHLSHLHPLAERYAHVVLPAPTFYEKRGHLVNLEGRVLPLSPAPIENGEAEGALQV
LALLAEALGVRPPFRLHLEAQKALKARKVPEAMGRLSFRLKELRPKERKGAFYLRPTMWKAHQAVGKAQEAARAELWAHP
ETARAEALPEGAQVAVETPFGRVEARVVHREDVPKGHLYLSALGPAAGLRVEGRVLVPAGGEA
;
;MVRVKVNDRIVEVPPGTSVMDAVFHAGYDVPLFCSEKHLSPIGACRMCLVRIGLPKKGPDGKPLLNEKGEPEIQWQPKLA
ASCVTAVADGMVVDTLSDVVREAQAGMVEFTLLNHPLDCPTCDKGGACELQDRTVEYGLYEKYYQKGPLELPVYTRFEFT
RRHVDKHHPLSPFVILDRERCIHCKRCVRYFEEVPGDEVLDFIERGVHTFIGTMDFGLPSGFSGNITDICPVGALLDLTA
RFRARNWEMEETPTTCALCPVGCGITADTRSGELLRIRAREVPEVNEIWICDAGRFGHEWADQNRLKTPLVRKEGRLVEA
TWEEAFLALKEGLKEARGEEVGLYLAHDATLEEGLLASELAKALKTPHLDFQGRTAAPASLFPPASLEDLLQADFALVLG
DPTEEAPILHLRLSEFVRDLKPPHRYNHGTPFADLQIKERMPRRTDKMALFAPYRAPLMKWAAIHEVHRPGEEREILLAL
LGDKEGSEMVAKAKEAWEKAKNPVLILGAGVLQDTVAAERARLLAERKGAKVLAMTPAANARGLEAMGVLPGAKGASWDE
PGALYAYYGFVPPEEALKGKRFVVMHLSHLHPLAERYAHVVLPAPTFYEKRGHLVNLEGRVLPLSPAPIENGEAEGALQV
LALLAEALGVRPPFRLHLEAQKALKARKVPEAMGRLSFRLKELRPKERKGAFYLRPTMWKAHQAVGKAQEAARAELWAHP
ETARAEALPEGAQVAVETPFGRVEARVVHREDVPKGHLYLSALGPAAGLRVEGRVLVPAGGEA
;
3,D ? 
4  'polypeptide(L)' no no 
;MREEFLEEIPLDAPPEEAKELRTEVMTLNVGPQHPSTHGVLRLMVTLSGEEVLEVVPHIGYLHTGFEKTMEHRTYLQNIT
YTPRMDYLHSFAHDLAYALAVEKLLGAVVPPRAETIRVILNELSRLASHLVFLGTGLLDLGALTPFFYAFRERETILDLF
EWVTGQRFHHNYIRIGGVKEDLPEEFVPELKKLLEVLPHRIDEYEALFAESPIFYERARGVGVIPPEVAIDLGLTGGSLR
ASGVNYDVRKAYPYSGYETYTFDVPLGERGDVFDRMLVRIREMRESVKIIKQALERLEPGPVRDPNPQITPPPRHLLETS
MEAVIYHFKHYTEGFHPPKGEVYVPTESARGELGYYIVSDGGSMPYRVKVRAPSFVNLQSLPYACKGEQVPDMVAIIASL
DPVMGDVDR
;
;MREEFLEEIPLDAPPEEAKELRTEVMTLNVGPQHPSTHGVLRLMVTLSGEEVLEVVPHIGYLHTGFEKTMEHRTYLQNIT
YTPRMDYLHSFAHDLAYALAVEKLLGAVVPPRAETIRVILNELSRLASHLVFLGTGLLDLGALTPFFYAFRERETILDLF
EWVTGQRFHHNYIRIGGVKEDLPEEFVPELKKLLEVLPHRIDEYEALFAESPIFYERARGVGVIPPEVAIDLGLTGGSLR
ASGVNYDVRKAYPYSGYETYTFDVPLGERGDVFDRMLVRIREMRESVKIIKQALERLEPGPVRDPNPQITPPPRHLLETS
MEAVIYHFKHYTEGFHPPKGEVYVPTESARGELGYYIVSDGGSMPYRVKVRAPSFVNLQSLPYACKGEQVPDMVAIIASL
DPVMGDVDR
;
4,E ? 
5  'polypeptide(L)' no no 
;MRLERVLEEARAKGYPIEDNGLGNLWVVLPRERFKEEMAHYKAMGFNFLADIVGLDYLTYPDPRPERFAVVYELVSLPGW
KDGDGSRFFVRVYVPEEDPRLPTVTDLWGSANFLEREVYDLFGIVFEGHPDLRKILTPEDLEGHPLRKDYPLGETPTLFR
EGRYIIPAEFRAALTGKDPGLTFYKGGSRKGYRSLWADLKKAREVKG
;
;MRLERVLEEARAKGYPIEDNGLGNLWVVLPRERFKEEMAHYKAMGFNFLADIVGLDYLTYPDPRPERFAVVYELVSLPGW
KDGDGSRFFVRVYVPEEDPRLPTVTDLWGSANFLEREVYDLFGIVFEGHPDLRKILTPEDLEGHPLRKDYPLGETPTLFR
EGRYIIPAEFRAALTGKDPGLTFYKGGSRKGYRSLWADLKKAREVKG
;
5,F ? 
6  'polypeptide(L)' no no 
;MALKDLFERDVQELEREGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDARNDLARFGSEVFRASPRQADVMIV
AGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFNNYAIVQNVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVRG
QAYNERGERLPPVAAWKRTRG
;
;MALKDLFERDVQELEREGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDARNDLARFGSEVFRASPRQADVMIV
AGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFNNYAIVQNVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVRG
QAYNERGERLPPVAAWKRTRG
;
6,G ? 
7  'polypeptide(L)' no no 
;MTLKALAQSLGITLKYLFSKPVTVPYPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENP
VSAGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVDVVGTKPQRREAKRTGKPVKVG
YVVPYVRPELEGFKAPTEGGKR
;
;MTLKALAQSLGITLKYLFSKPVTVPYPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENP
VSAGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVDVVGTKPQRREAKRTGKPVKVG
YVVPYVRPELEGFKAPTEGGKR
;
9,O ? 
8  'polypeptide(L)' no no 
;MSASSERELYEAWVELLSWMREYAQAKGVRFEKEADFPDFIYRMERPYDLPTTIMTASLSDGLGEPFLLADVSPRHAKLK
RIGLRLPRAHIHLHAHYEPGKGLVTGKIPLTKERFFALADRAREALAFA
;
;MSASSERELYEAWVELLSWMREYAQAKGVRFEKEADFPDFIYRMERPYDLPTTIMTASLSDGLGEPFLLADVSPRHAKLK
RIGLRLPRAHIHLHAHYEPGKGLVTGKIPLTKERFFALADRAREALAFA
;
7,I ? 
9  'polypeptide(L)' no no 
;MVRVGMRAAPRVSLEALKAALGGLKLSEAKVYLITDWQDKRDQARYALLLHTGKKDLLVPDAFGPAFPGGEEALSELVGL
LLAQGARRFYEAVVSPGEMTALLDLPPEELLKRVMAIANPTDPGIYLKRAA
;
;MVRVGMRAAPRVSLEALKAALGGLKLSEAKVYLITDWQDKRDQARYALLLHTGKKDLLVPDAFGPAFPGGEEALSELVGL
LLAQGARRFYEAVVSPGEMTALLDLPPEELLKRVMAIANPTDPGIYLKRAA
;
W,X ? 
10 'polypeptide(L)' no no 
;MAPIQEYVGTLIYVGVALFIGVAALLVGALLGPKKPGRAKLMPYESGNDPAGEVKRFPVHFYVVAMLFILFDVEVAFLWP
YAVSAGGLGLYGFLGVLAFTLLLFVGFLYEWWKGVMRWH
;
;MAPIQEYVGTLIYVGVALFIGVAALLVGALLGPKKPGRAKLMPYESGNDPAGEVKRFPVHFYVVAMLFILFDVEVAFLWP
YAVSAGGLGLYGFLGVLAFTLLLFVGFLYEWWKGVMRWH
;
A,P ? 
11 'polypeptide(L)' no no 
;MSLLEGLALFLLLLSGVLVVTLRNAIHAALALILNFLVLAGVYVALDARFLGFIQVIVYAGAIVVLFLFVIMLLFAAQGE
IGFDPLVRSRPLAALLALGVAGILAAGLWGLDLAFTQDLKGGLPQALGPLLYGDWLFVLLAVGFLLMAATVVAVALVEPG
KASRAKEAEKREEVAR
;
;MSLLEGLALFLLLLSGVLVVTLRNAIHAALALILNFLVLAGVYVALDARFLGFIQVIVYAGAIVVLFLFVIMLLFAAQGE
IGFDPLVRSRPLAALLALGVAGILAAGLWGLDLAFTQDLKGGLPQALGPLLYGDWLFVLLAVGFLLMAATVVAVALVEPG
KASRAKEAEKREEVAR
;
J,R ? 
12 'polypeptide(L)' no no 
;MSYLLTSALLFALGVYGVLTRRTAILVFLSIELMLNAANLSLVGFARAYGLDGQVAALMVIAVAAAEVAVGLGLIVAIFR
HRESTAVDDLSELRG
;
;MSYLLTSALLFALGVYGVLTRRTAILVFLSIELMLNAANLSLVGFARAYGLDGQVAALMVIAVAAAEVAVGLGLIVAIFR
HRESTAVDDLSELRG
;
K,S ? 
13 'polypeptide(L)' no no 
;MALLGTILLPLLGFALLGLFGKRMREPLPGVLASGLVLASFLLGAGLLLSGGARFQAEWLPGIPFSLLLDNLSGFMLLIV
TGVGFLIHVYAIGYMGGDPGYSRFFAYFNLFIAMMLTLVLADSYPVMFIGWEGVGLASFLLIGFWYKNPQYADSARKAFI
VNRIGDLGFMLGMAILWALYGTLSISELKEAMEGPLKNPDLLALAGLLLFLGAVGKSAQIPLMVWLPDAMAGPTPVSALI
HAATMVTAGVYLIARSSFLYSVLPDVSYAIAVVGLLTAAYGALSAFGQTDIKKIVAYSTISQLGYMFLAAGVGAYWVALF
HVFTHAFFKALLFLASGSVIHALGGEQDVRKMGGLWKHLPQTRWHALIGALALGGLPLLSGFWSKDAILAATLTYPFGGV
GFYVGALLVAVLTAMYAMRWFVLVFLGEERGHHHPHEAPPVMLWPNHLLALGSVLAGYLALPHPLPNVLEPFLKPALAEV
EAHHLSLGAEWGLIALSAAVALLGLWAGFVFFQRKVFPAWYLAFEAASREAFYVDRAYNALIVNPLKALAEALFYGDRGL
LSGYFGLGGAARSLGQGLARLQTGYLRVYALLFVLGALLLLGVMRW
;
;MALLGTILLPLLGFALLGLFGKRMREPLPGVLASGLVLASFLLGAGLLLSGGARFQAEWLPGIPFSLLLDNLSGFMLLIV
TGVGFLIHVYAIGYMGGDPGYSRFFAYFNLFIAMMLTLVLADSYPVMFIGWEGVGLASFLLIGFWYKNPQYADSARKAFI
VNRIGDLGFMLGMAILWALYGTLSISELKEAMEGPLKNPDLLALAGLLLFLGAVGKSAQIPLMVWLPDAMAGPTPVSALI
HAATMVTAGVYLIARSSFLYSVLPDVSYAIAVVGLLTAAYGALSAFGQTDIKKIVAYSTISQLGYMFLAAGVGAYWVALF
HVFTHAFFKALLFLASGSVIHALGGEQDVRKMGGLWKHLPQTRWHALIGALALGGLPLLSGFWSKDAILAATLTYPFGGV
GFYVGALLVAVLTAMYAMRWFVLVFLGEERGHHHPHEAPPVMLWPNHLLALGSVLAGYLALPHPLPNVLEPFLKPALAEV
EAHHLSLGAEWGLIALSAAVALLGLWAGFVFFQRKVFPAWYLAFEAASREAFYVDRAYNALIVNPLKALAEALFYGDRGL
LSGYFGLGGAARSLGQGLARLQTGYLRVYALLFVLGALLLLGVMRW
;
L,T ? 
14 'polypeptide(L)' no no 
;MVVLAVLLPVVFGALLLLGLPRALGVLGAGLSFLLNLYLFLTHPGGVAHAFQAPLLPGAGVYWAFGLDGLSALFFLTIAL
TVFLGALVARVEGRFLGLALLMEGLLLGLFAARDLLVFYVFFEAALIPALLMLYLYGGEGRTRALYTFVLFTLVGSLPML
AAVLGARLLSGSPTFLLEDLLAHPLQEEAAFWVFLGFALAFAIKTPLFPLHAWLPPFHQENHPSGLADALGTLYKVGVFA
FFRFAIPLAPEGFAQAQGLLLFLAALSALYGAWVAFAAKDFKTLLAYAGLSHMGVAALGVFSGTPEGAMGGLYLLAASGV
YTGGLFLLAGRLYERTGTLEIGRYRGLAQSAPGLAALALILFLAMVGLPGLSGFPGEFLTLLGAYKASPWLAALAFLSVI
ASAAYALTAFQKTFWEEGGSGVKDLAGAEWGFALLSVLALLLMGVFPGYFARGLHPLAEAFAKLLGGGA
;
;MVVLAVLLPVVFGALLLLGLPRALGVLGAGLSFLLNLYLFLTHPGGVAHAFQAPLLPGAGVYWAFGLDGLSALFFLTIAL
TVFLGALVARVEGRFLGLALLMEGLLLGLFAARDLLVFYVFFEAALIPALLMLYLYGGEGRTRALYTFVLFTLVGSLPML
AAVLGARLLSGSPTFLLEDLLAHPLQEEAAFWVFLGFALAFAIKTPLFPLHAWLPPFHQENHPSGLADALGTLYKVGVFA
FFRFAIPLAPEGFAQAQGLLLFLAALSALYGAWVAFAAKDFKTLLAYAGLSHMGVAALGVFSGTPEGAMGGLYLLAASGV
YTGGLFLLAGRLYERTGTLEIGRYRGLAQSAPGLAALALILFLAMVGLPGLSGFPGEFLTLLGAYKASPWLAALAFLSVI
ASAAYALTAFQKTFWEEGGSGVKDLAGAEWGFALLSVLALLLMGVFPGYFARGLHPLAEAFAKLLGGGA
;
M,U ? 
15 'polypeptide(L)' no no 
;MTLAILAVFSVALTLLGFVLPPQGVKRATLLGLALALASLLLTWGKPFAFGPYAVDGVSQVFTLLALLGALWTVGLVRSG
RFEFYLLVLYAALGMHLLASTRHLLLMLVALEALSLPLYALATWRRGQGLEAALKYFLLGALAAAFFLYGAALFYGATGS
LVLGAPGEGPLYALALGLLLVGLGFKAALAPFHFWTPDVYQGSPTPVVLFMATSVKAAAFAALLRVAAPPEALALLVALS
VVVGNLAALAQKEAKRLLAYSSIAHAGYMALALYTGNAQALGFYLLTYVLATGLAFAVLSQISPDRVPLEALRGLYRKDP
LLGLAFLVAMLSLLGLPPLAGFWGKYLAFAEAARAGAWGVLVLALVTSAVSAYYYLGLGLAVFARPEETPFRPGPPWARA
AVVAAGVLLLALGLLPGLVLPALAAGG
;
;MTLAILAVFSVALTLLGFVLPPQGVKRATLLGLALALASLLLTWGKPFAFGPYAVDGVSQVFTLLALLGALWTVGLVRSG
RFEFYLLVLYAALGMHLLASTRHLLLMLVALEALSLPLYALATWRRGQGLEAALKYFLLGALAAAFFLYGAALFYGATGS
LVLGAPGEGPLYALALGLLLVGLGFKAALAPFHFWTPDVYQGSPTPVVLFMATSVKAAAFAALLRVAAPPEALALLVALS
VVVGNLAALAQKEAKRLLAYSSIAHAGYMALALYTGNAQALGFYLLTYVLATGLAFAVLSQISPDRVPLEALRGLYRKDP
LLGLAFLVAMLSLLGLPPLAGFWGKYLAFAEAARAGAWGVLVLALVTSAVSAYYYLGLGLAVFARPEETPFRPGPPWARA
AVVAAGVLLLALGLLPGLVLPALAAGG
;
N,V ? 
16 'polypeptide(L)' no no 
;MTWSYPVDPYWMVALKALLVVVGLLTAFAFMTLIERRLLARFQVRMGPNRVGPFGLLQPLADAIKSIFKEDIVVAQADRF
LFVLAPLISVVFALLAFGLIPFGPPGSFFGYQPWVINLDLGILYLFAVSELAVYGIFLSGWASGSKYSLLGSLRSSASLI
SYELGLGLALLAPVLLVGSLNLNDIVNWQKEHGWLFLYAFPAFLVYLIASMAEAARTPFDLPEAEQELVGGYHTEYSSIK
WALFQMAEYIHFITASALIPTLFLGGWTMPVLEVPYLWMFLKIAFFLFFFIWIRATWFRLRYDQLLRFGWGFLFPLALLW
FLVTALVVALDLPRTYLLYLSALSFLVLLGAVLYTPKPARKGGGA
;
;MTWSYPVDPYWMVALKALLVVVGLLTAFAFMTLIERRLLARFQVRMGPNRVGPFGLLQPLADAIKSIFKEDIVVAQADRF
LFVLAPLISVVFALLAFGLIPFGPPGSFFGYQPWVINLDLGILYLFAVSELAVYGIFLSGWASGSKYSLLGSLRSSASLI
SYELGLGLALLAPVLLVGSLNLNDIVNWQKEHGWLFLYAFPAFLVYLIASMAEAARTPFDLPEAEQELVGGYHTEYSSIK
WALFQMAEYIHFITASALIPTLFLGGWTMPVLEVPYLWMFLKIAFFLFFFIWIRATWFRLRYDQLLRFGWGFLFPLALLW
FLVTALVVALDLPRTYLLYLSALSFLVLLGAVLYTPKPARKGGGA
;
H,Q ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
17 'IRON/SULFUR CLUSTER'        SF4 
18 'FLAVIN MONONUCLEOTIDE'      FMN 
19 'FE2/S2 (INORGANIC) CLUSTER' FES 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1   MET n 
1  2   THR n 
1  3   GLY n 
1  4   PRO n 
1  5   ILE n 
1  6   LEU n 
1  7   SER n 
1  8   GLY n 
1  9   LEU n 
1  10  ASP n 
1  11  PRO n 
1  12  ARG n 
1  13  PHE n 
1  14  GLU n 
1  15  ARG n 
1  16  THR n 
1  17  LEU n 
1  18  TYR n 
1  19  ALA n 
1  20  HIS n 
1  21  VAL n 
1  22  GLY n 
1  23  LYS n 
1  24  GLU n 
1  25  GLY n 
1  26  SER n 
1  27  TRP n 
1  28  THR n 
1  29  LEU n 
1  30  ASP n 
1  31  TYR n 
1  32  TYR n 
1  33  LEU n 
1  34  ARG n 
1  35  HIS n 
1  36  GLY n 
1  37  GLY n 
1  38  TYR n 
1  39  GLU n 
1  40  THR n 
1  41  ALA n 
1  42  LYS n 
1  43  ARG n 
1  44  VAL n 
1  45  LEU n 
1  46  LYS n 
1  47  GLU n 
1  48  LYS n 
1  49  THR n 
1  50  PRO n 
1  51  ASP n 
1  52  GLU n 
1  53  VAL n 
1  54  ILE n 
1  55  GLU n 
1  56  GLU n 
1  57  VAL n 
1  58  LYS n 
1  59  ARG n 
1  60  SER n 
1  61  GLY n 
1  62  LEU n 
1  63  ARG n 
1  64  GLY n 
1  65  ARG n 
1  66  GLY n 
1  67  GLY n 
1  68  ALA n 
1  69  GLY n 
1  70  PHE n 
1  71  PRO n 
1  72  THR n 
1  73  GLY n 
1  74  LEU n 
1  75  LYS n 
1  76  TRP n 
1  77  SER n 
1  78  PHE n 
1  79  MET n 
1  80  PRO n 
1  81  LYS n 
1  82  ASP n 
1  83  ASP n 
1  84  GLY n 
1  85  LYS n 
1  86  GLN n 
1  87  HIS n 
1  88  TYR n 
1  89  LEU n 
1  90  ILE n 
1  91  CYS n 
1  92  ASN n 
1  93  ALA n 
1  94  ASP n 
1  95  GLU n 
1  96  SER n 
1  97  GLU n 
1  98  PRO n 
1  99  GLY n 
1  100 SER n 
1  101 PHE n 
1  102 LYS n 
1  103 ASP n 
1  104 ARG n 
1  105 TYR n 
1  106 ILE n 
1  107 LEU n 
1  108 GLU n 
1  109 ASP n 
1  110 VAL n 
1  111 PRO n 
1  112 HIS n 
1  113 LEU n 
1  114 LEU n 
1  115 ILE n 
1  116 GLU n 
1  117 GLY n 
1  118 MET n 
1  119 ILE n 
1  120 LEU n 
1  121 ALA n 
1  122 GLY n 
1  123 TYR n 
1  124 ALA n 
1  125 ILE n 
1  126 ARG n 
1  127 ALA n 
1  128 THR n 
1  129 VAL n 
1  130 GLY n 
1  131 TYR n 
1  132 ILE n 
1  133 TYR n 
1  134 VAL n 
1  135 ARG n 
1  136 GLY n 
1  137 GLU n 
1  138 TYR n 
1  139 ARG n 
1  140 ARG n 
1  141 ALA n 
1  142 ALA n 
1  143 ASP n 
1  144 ARG n 
1  145 LEU n 
1  146 GLU n 
1  147 GLN n 
1  148 ALA n 
1  149 ILE n 
1  150 LYS n 
1  151 GLU n 
1  152 ALA n 
1  153 ARG n 
1  154 ALA n 
1  155 ARG n 
1  156 GLY n 
1  157 TYR n 
1  158 LEU n 
1  159 GLY n 
1  160 LYS n 
1  161 ASN n 
1  162 LEU n 
1  163 PHE n 
1  164 GLY n 
1  165 THR n 
1  166 ASP n 
1  167 PHE n 
1  168 SER n 
1  169 PHE n 
1  170 ASP n 
1  171 LEU n 
1  172 HIS n 
1  173 VAL n 
1  174 HIS n 
1  175 ARG n 
1  176 GLY n 
1  177 ALA n 
1  178 GLY n 
1  179 ALA n 
1  180 TYR n 
1  181 ILE n 
1  182 CYS n 
1  183 GLY n 
1  184 GLU n 
1  185 GLU n 
1  186 THR n 
1  187 ALA n 
1  188 LEU n 
1  189 MET n 
1  190 ASN n 
1  191 SER n 
1  192 LEU n 
1  193 GLU n 
1  194 GLY n 
1  195 LEU n 
1  196 ARG n 
1  197 ALA n 
1  198 ASN n 
1  199 PRO n 
1  200 ARG n 
1  201 LEU n 
1  202 LYS n 
1  203 PRO n 
1  204 PRO n 
1  205 PHE n 
1  206 PRO n 
1  207 ALA n 
1  208 GLN n 
1  209 SER n 
1  210 GLY n 
1  211 LEU n 
1  212 TRP n 
1  213 GLY n 
1  214 LYS n 
1  215 PRO n 
1  216 THR n 
1  217 THR n 
1  218 ILE n 
1  219 ASN n 
1  220 ASN n 
1  221 VAL n 
1  222 GLU n 
1  223 THR n 
1  224 LEU n 
1  225 ALA n 
1  226 SER n 
1  227 VAL n 
1  228 VAL n 
1  229 PRO n 
1  230 ILE n 
1  231 MET n 
1  232 GLU n 
1  233 ARG n 
1  234 GLY n 
1  235 ALA n 
1  236 ASP n 
1  237 TRP n 
1  238 PHE n 
1  239 ALA n 
1  240 GLN n 
1  241 MET n 
1  242 GLY n 
1  243 THR n 
1  244 GLU n 
1  245 GLN n 
1  246 SER n 
1  247 LYS n 
1  248 GLY n 
1  249 MET n 
1  250 LYS n 
1  251 LEU n 
1  252 TYR n 
1  253 GLN n 
1  254 ILE n 
1  255 SER n 
1  256 GLY n 
1  257 PRO n 
1  258 VAL n 
1  259 LYS n 
1  260 ARG n 
1  261 PRO n 
1  262 GLY n 
1  263 VAL n 
1  264 TYR n 
1  265 GLU n 
1  266 LEU n 
1  267 PRO n 
1  268 MET n 
1  269 GLY n 
1  270 THR n 
1  271 THR n 
1  272 PHE n 
1  273 ARG n 
1  274 GLU n 
1  275 LEU n 
1  276 ILE n 
1  277 TYR n 
1  278 GLU n 
1  279 TRP n 
1  280 ALA n 
1  281 GLY n 
1  282 GLY n 
1  283 PRO n 
1  284 LEU n 
1  285 GLU n 
1  286 PRO n 
1  287 ILE n 
1  288 GLN n 
1  289 ALA n 
1  290 ILE n 
1  291 ILE n 
1  292 PRO n 
1  293 GLY n 
1  294 GLY n 
1  295 SER n 
1  296 SER n 
1  297 THR n 
1  298 PRO n 
1  299 PRO n 
1  300 LEU n 
1  301 PRO n 
1  302 PHE n 
1  303 THR n 
1  304 GLU n 
1  305 GLU n 
1  306 VAL n 
1  307 LEU n 
1  308 ASP n 
1  309 THR n 
1  310 PRO n 
1  311 MET n 
1  312 SER n 
1  313 TYR n 
1  314 GLU n 
1  315 HIS n 
1  316 LEU n 
1  317 GLN n 
1  318 ALA n 
1  319 LYS n 
1  320 GLY n 
1  321 SER n 
1  322 MET n 
1  323 LEU n 
1  324 GLY n 
1  325 THR n 
1  326 GLY n 
1  327 GLY n 
1  328 VAL n 
1  329 ILE n 
1  330 LEU n 
1  331 ILE n 
1  332 PRO n 
1  333 GLU n 
1  334 ARG n 
1  335 VAL n 
1  336 SER n 
1  337 MET n 
1  338 VAL n 
1  339 ASP n 
1  340 ALA n 
1  341 MET n 
1  342 TRP n 
1  343 ASN n 
1  344 LEU n 
1  345 THR n 
1  346 ARG n 
1  347 PHE n 
1  348 TYR n 
1  349 ALA n 
1  350 HIS n 
1  351 GLU n 
1  352 SER n 
1  353 CYS n 
1  354 GLY n 
1  355 LYS n 
1  356 CYS n 
1  357 THR n 
1  358 PRO n 
1  359 CYS n 
1  360 ARG n 
1  361 GLU n 
1  362 GLY n 
1  363 VAL n 
1  364 ALA n 
1  365 GLY n 
1  366 PHE n 
1  367 MET n 
1  368 VAL n 
1  369 ASN n 
1  370 LEU n 
1  371 PHE n 
1  372 ALA n 
1  373 LYS n 
1  374 ILE n 
1  375 GLY n 
1  376 THR n 
1  377 GLY n 
1  378 GLN n 
1  379 GLY n 
1  380 GLU n 
1  381 GLU n 
1  382 LYS n 
1  383 ASP n 
1  384 VAL n 
1  385 GLU n 
1  386 ASN n 
1  387 LEU n 
1  388 GLU n 
1  389 ALA n 
1  390 LEU n 
1  391 LEU n 
1  392 PRO n 
1  393 LEU n 
1  394 ILE n 
1  395 GLU n 
1  396 GLY n 
1  397 ARG n 
1  398 SER n 
1  399 PHE n 
1  400 CYS n 
1  401 PRO n 
1  402 LEU n 
1  403 ALA n 
1  404 ASP n 
1  405 ALA n 
1  406 ALA n 
1  407 VAL n 
1  408 TRP n 
1  409 PRO n 
1  410 VAL n 
1  411 LYS n 
1  412 GLY n 
1  413 SER n 
1  414 LEU n 
1  415 ARG n 
1  416 HIS n 
1  417 PHE n 
1  418 LYS n 
1  419 ASP n 
1  420 GLN n 
1  421 TYR n 
1  422 LEU n 
1  423 ALA n 
1  424 LEU n 
1  425 ALA n 
1  426 ARG n 
1  427 GLU n 
1  428 LYS n 
1  429 ARG n 
1  430 PRO n 
1  431 VAL n 
1  432 PRO n 
1  433 ARG n 
1  434 PRO n 
1  435 SER n 
1  436 LEU n 
1  437 TRP n 
1  438 ARG n 
2  1   MET n 
2  2   GLY n 
2  3   PHE n 
2  4   PHE n 
2  5   ASP n 
2  6   ASP n 
2  7   LYS n 
2  8   GLN n 
2  9   ASP n 
2  10  PHE n 
2  11  LEU n 
2  12  GLU n 
2  13  GLU n 
2  14  THR n 
2  15  PHE n 
2  16  ALA n 
2  17  LYS n 
2  18  TYR n 
2  19  PRO n 
2  20  PRO n 
2  21  GLU n 
2  22  GLY n 
2  23  ARG n 
2  24  ARG n 
2  25  ALA n 
2  26  ALA n 
2  27  ILE n 
2  28  MET n 
2  29  PRO n 
2  30  LEU n 
2  31  LEU n 
2  32  ARG n 
2  33  ARG n 
2  34  VAL n 
2  35  GLN n 
2  36  GLN n 
2  37  GLU n 
2  38  GLU n 
2  39  GLY n 
2  40  TRP n 
2  41  ILE n 
2  42  ARG n 
2  43  PRO n 
2  44  GLU n 
2  45  ARG n 
2  46  ILE n 
2  47  GLU n 
2  48  GLU n 
2  49  ILE n 
2  50  ALA n 
2  51  ARG n 
2  52  LEU n 
2  53  VAL n 
2  54  GLY n 
2  55  THR n 
2  56  THR n 
2  57  PRO n 
2  58  THR n 
2  59  GLU n 
2  60  VAL n 
2  61  MET n 
2  62  GLY n 
2  63  VAL n 
2  64  ALA n 
2  65  SER n 
2  66  PHE n 
2  67  TYR n 
2  68  SER n 
2  69  TYR n 
2  70  TYR n 
2  71  GLN n 
2  72  PHE n 
2  73  VAL n 
2  74  PRO n 
2  75  THR n 
2  76  GLY n 
2  77  LYS n 
2  78  TYR n 
2  79  HIS n 
2  80  LEU n 
2  81  GLN n 
2  82  VAL n 
2  83  CYS n 
2  84  ALA n 
2  85  THR n 
2  86  LEU n 
2  87  SER n 
2  88  CYS n 
2  89  LYS n 
2  90  LEU n 
2  91  ALA n 
2  92  GLY n 
2  93  ALA n 
2  94  GLU n 
2  95  GLU n 
2  96  LEU n 
2  97  TRP n 
2  98  ASP n 
2  99  TYR n 
2  100 LEU n 
2  101 THR n 
2  102 GLU n 
2  103 THR n 
2  104 LEU n 
2  105 GLY n 
2  106 ILE n 
2  107 GLY n 
2  108 PRO n 
2  109 GLY n 
2  110 GLU n 
2  111 VAL n 
2  112 THR n 
2  113 PRO n 
2  114 ASP n 
2  115 GLY n 
2  116 LEU n 
2  117 PHE n 
2  118 SER n 
2  119 VAL n 
2  120 GLN n 
2  121 LYS n 
2  122 VAL n 
2  123 GLU n 
2  124 CYS n 
2  125 LEU n 
2  126 GLY n 
2  127 SER n 
2  128 CYS n 
2  129 HIS n 
2  130 THR n 
2  131 ALA n 
2  132 PRO n 
2  133 VAL n 
2  134 ILE n 
2  135 GLN n 
2  136 VAL n 
2  137 ASN n 
2  138 ASP n 
2  139 GLU n 
2  140 PRO n 
2  141 TYR n 
2  142 VAL n 
2  143 GLU n 
2  144 CYS n 
2  145 VAL n 
2  146 THR n 
2  147 ARG n 
2  148 ALA n 
2  149 ARG n 
2  150 LEU n 
2  151 GLU n 
2  152 ALA n 
2  153 LEU n 
2  154 LEU n 
2  155 ALA n 
2  156 GLY n 
2  157 LEU n 
2  158 ARG n 
2  159 ALA n 
2  160 GLY n 
2  161 LYS n 
2  162 ARG n 
2  163 LEU n 
2  164 GLU n 
2  165 GLU n 
2  166 ILE n 
2  167 GLU n 
2  168 LEU n 
2  169 PRO n 
2  170 GLY n 
2  171 LYS n 
2  172 CYS n 
2  173 GLY n 
2  174 HIS n 
2  175 HIS n 
2  176 VAL n 
2  177 HIS n 
2  178 GLU n 
2  179 VAL n 
2  180 GLU n 
2  181 VAL n 
3  1   MET n 
3  2   VAL n 
3  3   ARG n 
3  4   VAL n 
3  5   LYS n 
3  6   VAL n 
3  7   ASN n 
3  8   ASP n 
3  9   ARG n 
3  10  ILE n 
3  11  VAL n 
3  12  GLU n 
3  13  VAL n 
3  14  PRO n 
3  15  PRO n 
3  16  GLY n 
3  17  THR n 
3  18  SER n 
3  19  VAL n 
3  20  MET n 
3  21  ASP n 
3  22  ALA n 
3  23  VAL n 
3  24  PHE n 
3  25  HIS n 
3  26  ALA n 
3  27  GLY n 
3  28  TYR n 
3  29  ASP n 
3  30  VAL n 
3  31  PRO n 
3  32  LEU n 
3  33  PHE n 
3  34  CYS n 
3  35  SER n 
3  36  GLU n 
3  37  LYS n 
3  38  HIS n 
3  39  LEU n 
3  40  SER n 
3  41  PRO n 
3  42  ILE n 
3  43  GLY n 
3  44  ALA n 
3  45  CYS n 
3  46  ARG n 
3  47  MET n 
3  48  CYS n 
3  49  LEU n 
3  50  VAL n 
3  51  ARG n 
3  52  ILE n 
3  53  GLY n 
3  54  LEU n 
3  55  PRO n 
3  56  LYS n 
3  57  LYS n 
3  58  GLY n 
3  59  PRO n 
3  60  ASP n 
3  61  GLY n 
3  62  LYS n 
3  63  PRO n 
3  64  LEU n 
3  65  LEU n 
3  66  ASN n 
3  67  GLU n 
3  68  LYS n 
3  69  GLY n 
3  70  GLU n 
3  71  PRO n 
3  72  GLU n 
3  73  ILE n 
3  74  GLN n 
3  75  TRP n 
3  76  GLN n 
3  77  PRO n 
3  78  LYS n 
3  79  LEU n 
3  80  ALA n 
3  81  ALA n 
3  82  SER n 
3  83  CYS n 
3  84  VAL n 
3  85  THR n 
3  86  ALA n 
3  87  VAL n 
3  88  ALA n 
3  89  ASP n 
3  90  GLY n 
3  91  MET n 
3  92  VAL n 
3  93  VAL n 
3  94  ASP n 
3  95  THR n 
3  96  LEU n 
3  97  SER n 
3  98  ASP n 
3  99  VAL n 
3  100 VAL n 
3  101 ARG n 
3  102 GLU n 
3  103 ALA n 
3  104 GLN n 
3  105 ALA n 
3  106 GLY n 
3  107 MET n 
3  108 VAL n 
3  109 GLU n 
3  110 PHE n 
3  111 THR n 
3  112 LEU n 
3  113 LEU n 
3  114 ASN n 
3  115 HIS n 
3  116 PRO n 
3  117 LEU n 
3  118 ASP n 
3  119 CYS n 
3  120 PRO n 
3  121 THR n 
3  122 CYS n 
3  123 ASP n 
3  124 LYS n 
3  125 GLY n 
3  126 GLY n 
3  127 ALA n 
3  128 CYS n 
3  129 GLU n 
3  130 LEU n 
3  131 GLN n 
3  132 ASP n 
3  133 ARG n 
3  134 THR n 
3  135 VAL n 
3  136 GLU n 
3  137 TYR n 
3  138 GLY n 
3  139 LEU n 
3  140 TYR n 
3  141 GLU n 
3  142 LYS n 
3  143 TYR n 
3  144 TYR n 
3  145 GLN n 
3  146 LYS n 
3  147 GLY n 
3  148 PRO n 
3  149 LEU n 
3  150 GLU n 
3  151 LEU n 
3  152 PRO n 
3  153 VAL n 
3  154 TYR n 
3  155 THR n 
3  156 ARG n 
3  157 PHE n 
3  158 GLU n 
3  159 PHE n 
3  160 THR n 
3  161 ARG n 
3  162 ARG n 
3  163 HIS n 
3  164 VAL n 
3  165 ASP n 
3  166 LYS n 
3  167 HIS n 
3  168 HIS n 
3  169 PRO n 
3  170 LEU n 
3  171 SER n 
3  172 PRO n 
3  173 PHE n 
3  174 VAL n 
3  175 ILE n 
3  176 LEU n 
3  177 ASP n 
3  178 ARG n 
3  179 GLU n 
3  180 ARG n 
3  181 CYS n 
3  182 ILE n 
3  183 HIS n 
3  184 CYS n 
3  185 LYS n 
3  186 ARG n 
3  187 CYS n 
3  188 VAL n 
3  189 ARG n 
3  190 TYR n 
3  191 PHE n 
3  192 GLU n 
3  193 GLU n 
3  194 VAL n 
3  195 PRO n 
3  196 GLY n 
3  197 ASP n 
3  198 GLU n 
3  199 VAL n 
3  200 LEU n 
3  201 ASP n 
3  202 PHE n 
3  203 ILE n 
3  204 GLU n 
3  205 ARG n 
3  206 GLY n 
3  207 VAL n 
3  208 HIS n 
3  209 THR n 
3  210 PHE n 
3  211 ILE n 
3  212 GLY n 
3  213 THR n 
3  214 MET n 
3  215 ASP n 
3  216 PHE n 
3  217 GLY n 
3  218 LEU n 
3  219 PRO n 
3  220 SER n 
3  221 GLY n 
3  222 PHE n 
3  223 SER n 
3  224 GLY n 
3  225 ASN n 
3  226 ILE n 
3  227 THR n 
3  228 ASP n 
3  229 ILE n 
3  230 CYS n 
3  231 PRO n 
3  232 VAL n 
3  233 GLY n 
3  234 ALA n 
3  235 LEU n 
3  236 LEU n 
3  237 ASP n 
3  238 LEU n 
3  239 THR n 
3  240 ALA n 
3  241 ARG n 
3  242 PHE n 
3  243 ARG n 
3  244 ALA n 
3  245 ARG n 
3  246 ASN n 
3  247 TRP n 
3  248 GLU n 
3  249 MET n 
3  250 GLU n 
3  251 GLU n 
3  252 THR n 
3  253 PRO n 
3  254 THR n 
3  255 THR n 
3  256 CYS n 
3  257 ALA n 
3  258 LEU n 
3  259 CYS n 
3  260 PRO n 
3  261 VAL n 
3  262 GLY n 
3  263 CYS n 
3  264 GLY n 
3  265 ILE n 
3  266 THR n 
3  267 ALA n 
3  268 ASP n 
3  269 THR n 
3  270 ARG n 
3  271 SER n 
3  272 GLY n 
3  273 GLU n 
3  274 LEU n 
3  275 LEU n 
3  276 ARG n 
3  277 ILE n 
3  278 ARG n 
3  279 ALA n 
3  280 ARG n 
3  281 GLU n 
3  282 VAL n 
3  283 PRO n 
3  284 GLU n 
3  285 VAL n 
3  286 ASN n 
3  287 GLU n 
3  288 ILE n 
3  289 TRP n 
3  290 ILE n 
3  291 CYS n 
3  292 ASP n 
3  293 ALA n 
3  294 GLY n 
3  295 ARG n 
3  296 PHE n 
3  297 GLY n 
3  298 HIS n 
3  299 GLU n 
3  300 TRP n 
3  301 ALA n 
3  302 ASP n 
3  303 GLN n 
3  304 ASN n 
3  305 ARG n 
3  306 LEU n 
3  307 LYS n 
3  308 THR n 
3  309 PRO n 
3  310 LEU n 
3  311 VAL n 
3  312 ARG n 
3  313 LYS n 
3  314 GLU n 
3  315 GLY n 
3  316 ARG n 
3  317 LEU n 
3  318 VAL n 
3  319 GLU n 
3  320 ALA n 
3  321 THR n 
3  322 TRP n 
3  323 GLU n 
3  324 GLU n 
3  325 ALA n 
3  326 PHE n 
3  327 LEU n 
3  328 ALA n 
3  329 LEU n 
3  330 LYS n 
3  331 GLU n 
3  332 GLY n 
3  333 LEU n 
3  334 LYS n 
3  335 GLU n 
3  336 ALA n 
3  337 ARG n 
3  338 GLY n 
3  339 GLU n 
3  340 GLU n 
3  341 VAL n 
3  342 GLY n 
3  343 LEU n 
3  344 TYR n 
3  345 LEU n 
3  346 ALA n 
3  347 HIS n 
3  348 ASP n 
3  349 ALA n 
3  350 THR n 
3  351 LEU n 
3  352 GLU n 
3  353 GLU n 
3  354 GLY n 
3  355 LEU n 
3  356 LEU n 
3  357 ALA n 
3  358 SER n 
3  359 GLU n 
3  360 LEU n 
3  361 ALA n 
3  362 LYS n 
3  363 ALA n 
3  364 LEU n 
3  365 LYS n 
3  366 THR n 
3  367 PRO n 
3  368 HIS n 
3  369 LEU n 
3  370 ASP n 
3  371 PHE n 
3  372 GLN n 
3  373 GLY n 
3  374 ARG n 
3  375 THR n 
3  376 ALA n 
3  377 ALA n 
3  378 PRO n 
3  379 ALA n 
3  380 SER n 
3  381 LEU n 
3  382 PHE n 
3  383 PRO n 
3  384 PRO n 
3  385 ALA n 
3  386 SER n 
3  387 LEU n 
3  388 GLU n 
3  389 ASP n 
3  390 LEU n 
3  391 LEU n 
3  392 GLN n 
3  393 ALA n 
3  394 ASP n 
3  395 PHE n 
3  396 ALA n 
3  397 LEU n 
3  398 VAL n 
3  399 LEU n 
3  400 GLY n 
3  401 ASP n 
3  402 PRO n 
3  403 THR n 
3  404 GLU n 
3  405 GLU n 
3  406 ALA n 
3  407 PRO n 
3  408 ILE n 
3  409 LEU n 
3  410 HIS n 
3  411 LEU n 
3  412 ARG n 
3  413 LEU n 
3  414 SER n 
3  415 GLU n 
3  416 PHE n 
3  417 VAL n 
3  418 ARG n 
3  419 ASP n 
3  420 LEU n 
3  421 LYS n 
3  422 PRO n 
3  423 PRO n 
3  424 HIS n 
3  425 ARG n 
3  426 TYR n 
3  427 ASN n 
3  428 HIS n 
3  429 GLY n 
3  430 THR n 
3  431 PRO n 
3  432 PHE n 
3  433 ALA n 
3  434 ASP n 
3  435 LEU n 
3  436 GLN n 
3  437 ILE n 
3  438 LYS n 
3  439 GLU n 
3  440 ARG n 
3  441 MET n 
3  442 PRO n 
3  443 ARG n 
3  444 ARG n 
3  445 THR n 
3  446 ASP n 
3  447 LYS n 
3  448 MET n 
3  449 ALA n 
3  450 LEU n 
3  451 PHE n 
3  452 ALA n 
3  453 PRO n 
3  454 TYR n 
3  455 ARG n 
3  456 ALA n 
3  457 PRO n 
3  458 LEU n 
3  459 MET n 
3  460 LYS n 
3  461 TRP n 
3  462 ALA n 
3  463 ALA n 
3  464 ILE n 
3  465 HIS n 
3  466 GLU n 
3  467 VAL n 
3  468 HIS n 
3  469 ARG n 
3  470 PRO n 
3  471 GLY n 
3  472 GLU n 
3  473 GLU n 
3  474 ARG n 
3  475 GLU n 
3  476 ILE n 
3  477 LEU n 
3  478 LEU n 
3  479 ALA n 
3  480 LEU n 
3  481 LEU n 
3  482 GLY n 
3  483 ASP n 
3  484 LYS n 
3  485 GLU n 
3  486 GLY n 
3  487 SER n 
3  488 GLU n 
3  489 MET n 
3  490 VAL n 
3  491 ALA n 
3  492 LYS n 
3  493 ALA n 
3  494 LYS n 
3  495 GLU n 
3  496 ALA n 
3  497 TRP n 
3  498 GLU n 
3  499 LYS n 
3  500 ALA n 
3  501 LYS n 
3  502 ASN n 
3  503 PRO n 
3  504 VAL n 
3  505 LEU n 
3  506 ILE n 
3  507 LEU n 
3  508 GLY n 
3  509 ALA n 
3  510 GLY n 
3  511 VAL n 
3  512 LEU n 
3  513 GLN n 
3  514 ASP n 
3  515 THR n 
3  516 VAL n 
3  517 ALA n 
3  518 ALA n 
3  519 GLU n 
3  520 ARG n 
3  521 ALA n 
3  522 ARG n 
3  523 LEU n 
3  524 LEU n 
3  525 ALA n 
3  526 GLU n 
3  527 ARG n 
3  528 LYS n 
3  529 GLY n 
3  530 ALA n 
3  531 LYS n 
3  532 VAL n 
3  533 LEU n 
3  534 ALA n 
3  535 MET n 
3  536 THR n 
3  537 PRO n 
3  538 ALA n 
3  539 ALA n 
3  540 ASN n 
3  541 ALA n 
3  542 ARG n 
3  543 GLY n 
3  544 LEU n 
3  545 GLU n 
3  546 ALA n 
3  547 MET n 
3  548 GLY n 
3  549 VAL n 
3  550 LEU n 
3  551 PRO n 
3  552 GLY n 
3  553 ALA n 
3  554 LYS n 
3  555 GLY n 
3  556 ALA n 
3  557 SER n 
3  558 TRP n 
3  559 ASP n 
3  560 GLU n 
3  561 PRO n 
3  562 GLY n 
3  563 ALA n 
3  564 LEU n 
3  565 TYR n 
3  566 ALA n 
3  567 TYR n 
3  568 TYR n 
3  569 GLY n 
3  570 PHE n 
3  571 VAL n 
3  572 PRO n 
3  573 PRO n 
3  574 GLU n 
3  575 GLU n 
3  576 ALA n 
3  577 LEU n 
3  578 LYS n 
3  579 GLY n 
3  580 LYS n 
3  581 ARG n 
3  582 PHE n 
3  583 VAL n 
3  584 VAL n 
3  585 MET n 
3  586 HIS n 
3  587 LEU n 
3  588 SER n 
3  589 HIS n 
3  590 LEU n 
3  591 HIS n 
3  592 PRO n 
3  593 LEU n 
3  594 ALA n 
3  595 GLU n 
3  596 ARG n 
3  597 TYR n 
3  598 ALA n 
3  599 HIS n 
3  600 VAL n 
3  601 VAL n 
3  602 LEU n 
3  603 PRO n 
3  604 ALA n 
3  605 PRO n 
3  606 THR n 
3  607 PHE n 
3  608 TYR n 
3  609 GLU n 
3  610 LYS n 
3  611 ARG n 
3  612 GLY n 
3  613 HIS n 
3  614 LEU n 
3  615 VAL n 
3  616 ASN n 
3  617 LEU n 
3  618 GLU n 
3  619 GLY n 
3  620 ARG n 
3  621 VAL n 
3  622 LEU n 
3  623 PRO n 
3  624 LEU n 
3  625 SER n 
3  626 PRO n 
3  627 ALA n 
3  628 PRO n 
3  629 ILE n 
3  630 GLU n 
3  631 ASN n 
3  632 GLY n 
3  633 GLU n 
3  634 ALA n 
3  635 GLU n 
3  636 GLY n 
3  637 ALA n 
3  638 LEU n 
3  639 GLN n 
3  640 VAL n 
3  641 LEU n 
3  642 ALA n 
3  643 LEU n 
3  644 LEU n 
3  645 ALA n 
3  646 GLU n 
3  647 ALA n 
3  648 LEU n 
3  649 GLY n 
3  650 VAL n 
3  651 ARG n 
3  652 PRO n 
3  653 PRO n 
3  654 PHE n 
3  655 ARG n 
3  656 LEU n 
3  657 HIS n 
3  658 LEU n 
3  659 GLU n 
3  660 ALA n 
3  661 GLN n 
3  662 LYS n 
3  663 ALA n 
3  664 LEU n 
3  665 LYS n 
3  666 ALA n 
3  667 ARG n 
3  668 LYS n 
3  669 VAL n 
3  670 PRO n 
3  671 GLU n 
3  672 ALA n 
3  673 MET n 
3  674 GLY n 
3  675 ARG n 
3  676 LEU n 
3  677 SER n 
3  678 PHE n 
3  679 ARG n 
3  680 LEU n 
3  681 LYS n 
3  682 GLU n 
3  683 LEU n 
3  684 ARG n 
3  685 PRO n 
3  686 LYS n 
3  687 GLU n 
3  688 ARG n 
3  689 LYS n 
3  690 GLY n 
3  691 ALA n 
3  692 PHE n 
3  693 TYR n 
3  694 LEU n 
3  695 ARG n 
3  696 PRO n 
3  697 THR n 
3  698 MET n 
3  699 TRP n 
3  700 LYS n 
3  701 ALA n 
3  702 HIS n 
3  703 GLN n 
3  704 ALA n 
3  705 VAL n 
3  706 GLY n 
3  707 LYS n 
3  708 ALA n 
3  709 GLN n 
3  710 GLU n 
3  711 ALA n 
3  712 ALA n 
3  713 ARG n 
3  714 ALA n 
3  715 GLU n 
3  716 LEU n 
3  717 TRP n 
3  718 ALA n 
3  719 HIS n 
3  720 PRO n 
3  721 GLU n 
3  722 THR n 
3  723 ALA n 
3  724 ARG n 
3  725 ALA n 
3  726 GLU n 
3  727 ALA n 
3  728 LEU n 
3  729 PRO n 
3  730 GLU n 
3  731 GLY n 
3  732 ALA n 
3  733 GLN n 
3  734 VAL n 
3  735 ALA n 
3  736 VAL n 
3  737 GLU n 
3  738 THR n 
3  739 PRO n 
3  740 PHE n 
3  741 GLY n 
3  742 ARG n 
3  743 VAL n 
3  744 GLU n 
3  745 ALA n 
3  746 ARG n 
3  747 VAL n 
3  748 VAL n 
3  749 HIS n 
3  750 ARG n 
3  751 GLU n 
3  752 ASP n 
3  753 VAL n 
3  754 PRO n 
3  755 LYS n 
3  756 GLY n 
3  757 HIS n 
3  758 LEU n 
3  759 TYR n 
3  760 LEU n 
3  761 SER n 
3  762 ALA n 
3  763 LEU n 
3  764 GLY n 
3  765 PRO n 
3  766 ALA n 
3  767 ALA n 
3  768 GLY n 
3  769 LEU n 
3  770 ARG n 
3  771 VAL n 
3  772 GLU n 
3  773 GLY n 
3  774 ARG n 
3  775 VAL n 
3  776 LEU n 
3  777 VAL n 
3  778 PRO n 
3  779 ALA n 
3  780 GLY n 
3  781 GLY n 
3  782 GLU n 
3  783 ALA n 
4  1   MET n 
4  2   ARG n 
4  3   GLU n 
4  4   GLU n 
4  5   PHE n 
4  6   LEU n 
4  7   GLU n 
4  8   GLU n 
4  9   ILE n 
4  10  PRO n 
4  11  LEU n 
4  12  ASP n 
4  13  ALA n 
4  14  PRO n 
4  15  PRO n 
4  16  GLU n 
4  17  GLU n 
4  18  ALA n 
4  19  LYS n 
4  20  GLU n 
4  21  LEU n 
4  22  ARG n 
4  23  THR n 
4  24  GLU n 
4  25  VAL n 
4  26  MET n 
4  27  THR n 
4  28  LEU n 
4  29  ASN n 
4  30  VAL n 
4  31  GLY n 
4  32  PRO n 
4  33  GLN n 
4  34  HIS n 
4  35  PRO n 
4  36  SER n 
4  37  THR n 
4  38  HIS n 
4  39  GLY n 
4  40  VAL n 
4  41  LEU n 
4  42  ARG n 
4  43  LEU n 
4  44  MET n 
4  45  VAL n 
4  46  THR n 
4  47  LEU n 
4  48  SER n 
4  49  GLY n 
4  50  GLU n 
4  51  GLU n 
4  52  VAL n 
4  53  LEU n 
4  54  GLU n 
4  55  VAL n 
4  56  VAL n 
4  57  PRO n 
4  58  HIS n 
4  59  ILE n 
4  60  GLY n 
4  61  TYR n 
4  62  LEU n 
4  63  HIS n 
4  64  THR n 
4  65  GLY n 
4  66  PHE n 
4  67  GLU n 
4  68  LYS n 
4  69  THR n 
4  70  MET n 
4  71  GLU n 
4  72  HIS n 
4  73  ARG n 
4  74  THR n 
4  75  TYR n 
4  76  LEU n 
4  77  GLN n 
4  78  ASN n 
4  79  ILE n 
4  80  THR n 
4  81  TYR n 
4  82  THR n 
4  83  PRO n 
4  84  ARG n 
4  85  MET n 
4  86  ASP n 
4  87  TYR n 
4  88  LEU n 
4  89  HIS n 
4  90  SER n 
4  91  PHE n 
4  92  ALA n 
4  93  HIS n 
4  94  ASP n 
4  95  LEU n 
4  96  ALA n 
4  97  TYR n 
4  98  ALA n 
4  99  LEU n 
4  100 ALA n 
4  101 VAL n 
4  102 GLU n 
4  103 LYS n 
4  104 LEU n 
4  105 LEU n 
4  106 GLY n 
4  107 ALA n 
4  108 VAL n 
4  109 VAL n 
4  110 PRO n 
4  111 PRO n 
4  112 ARG n 
4  113 ALA n 
4  114 GLU n 
4  115 THR n 
4  116 ILE n 
4  117 ARG n 
4  118 VAL n 
4  119 ILE n 
4  120 LEU n 
4  121 ASN n 
4  122 GLU n 
4  123 LEU n 
4  124 SER n 
4  125 ARG n 
4  126 LEU n 
4  127 ALA n 
4  128 SER n 
4  129 HIS n 
4  130 LEU n 
4  131 VAL n 
4  132 PHE n 
4  133 LEU n 
4  134 GLY n 
4  135 THR n 
4  136 GLY n 
4  137 LEU n 
4  138 LEU n 
4  139 ASP n 
4  140 LEU n 
4  141 GLY n 
4  142 ALA n 
4  143 LEU n 
4  144 THR n 
4  145 PRO n 
4  146 PHE n 
4  147 PHE n 
4  148 TYR n 
4  149 ALA n 
4  150 PHE n 
4  151 ARG n 
4  152 GLU n 
4  153 ARG n 
4  154 GLU n 
4  155 THR n 
4  156 ILE n 
4  157 LEU n 
4  158 ASP n 
4  159 LEU n 
4  160 PHE n 
4  161 GLU n 
4  162 TRP n 
4  163 VAL n 
4  164 THR n 
4  165 GLY n 
4  166 GLN n 
4  167 ARG n 
4  168 PHE n 
4  169 HIS n 
4  170 HIS n 
4  171 ASN n 
4  172 TYR n 
4  173 ILE n 
4  174 ARG n 
4  175 ILE n 
4  176 GLY n 
4  177 GLY n 
4  178 VAL n 
4  179 LYS n 
4  180 GLU n 
4  181 ASP n 
4  182 LEU n 
4  183 PRO n 
4  184 GLU n 
4  185 GLU n 
4  186 PHE n 
4  187 VAL n 
4  188 PRO n 
4  189 GLU n 
4  190 LEU n 
4  191 LYS n 
4  192 LYS n 
4  193 LEU n 
4  194 LEU n 
4  195 GLU n 
4  196 VAL n 
4  197 LEU n 
4  198 PRO n 
4  199 HIS n 
4  200 ARG n 
4  201 ILE n 
4  202 ASP n 
4  203 GLU n 
4  204 TYR n 
4  205 GLU n 
4  206 ALA n 
4  207 LEU n 
4  208 PHE n 
4  209 ALA n 
4  210 GLU n 
4  211 SER n 
4  212 PRO n 
4  213 ILE n 
4  214 PHE n 
4  215 TYR n 
4  216 GLU n 
4  217 ARG n 
4  218 ALA n 
4  219 ARG n 
4  220 GLY n 
4  221 VAL n 
4  222 GLY n 
4  223 VAL n 
4  224 ILE n 
4  225 PRO n 
4  226 PRO n 
4  227 GLU n 
4  228 VAL n 
4  229 ALA n 
4  230 ILE n 
4  231 ASP n 
4  232 LEU n 
4  233 GLY n 
4  234 LEU n 
4  235 THR n 
4  236 GLY n 
4  237 GLY n 
4  238 SER n 
4  239 LEU n 
4  240 ARG n 
4  241 ALA n 
4  242 SER n 
4  243 GLY n 
4  244 VAL n 
4  245 ASN n 
4  246 TYR n 
4  247 ASP n 
4  248 VAL n 
4  249 ARG n 
4  250 LYS n 
4  251 ALA n 
4  252 TYR n 
4  253 PRO n 
4  254 TYR n 
4  255 SER n 
4  256 GLY n 
4  257 TYR n 
4  258 GLU n 
4  259 THR n 
4  260 TYR n 
4  261 THR n 
4  262 PHE n 
4  263 ASP n 
4  264 VAL n 
4  265 PRO n 
4  266 LEU n 
4  267 GLY n 
4  268 GLU n 
4  269 ARG n 
4  270 GLY n 
4  271 ASP n 
4  272 VAL n 
4  273 PHE n 
4  274 ASP n 
4  275 ARG n 
4  276 MET n 
4  277 LEU n 
4  278 VAL n 
4  279 ARG n 
4  280 ILE n 
4  281 ARG n 
4  282 GLU n 
4  283 MET n 
4  284 ARG n 
4  285 GLU n 
4  286 SER n 
4  287 VAL n 
4  288 LYS n 
4  289 ILE n 
4  290 ILE n 
4  291 LYS n 
4  292 GLN n 
4  293 ALA n 
4  294 LEU n 
4  295 GLU n 
4  296 ARG n 
4  297 LEU n 
4  298 GLU n 
4  299 PRO n 
4  300 GLY n 
4  301 PRO n 
4  302 VAL n 
4  303 ARG n 
4  304 ASP n 
4  305 PRO n 
4  306 ASN n 
4  307 PRO n 
4  308 GLN n 
4  309 ILE n 
4  310 THR n 
4  311 PRO n 
4  312 PRO n 
4  313 PRO n 
4  314 ARG n 
4  315 HIS n 
4  316 LEU n 
4  317 LEU n 
4  318 GLU n 
4  319 THR n 
4  320 SER n 
4  321 MET n 
4  322 GLU n 
4  323 ALA n 
4  324 VAL n 
4  325 ILE n 
4  326 TYR n 
4  327 HIS n 
4  328 PHE n 
4  329 LYS n 
4  330 HIS n 
4  331 TYR n 
4  332 THR n 
4  333 GLU n 
4  334 GLY n 
4  335 PHE n 
4  336 HIS n 
4  337 PRO n 
4  338 PRO n 
4  339 LYS n 
4  340 GLY n 
4  341 GLU n 
4  342 VAL n 
4  343 TYR n 
4  344 VAL n 
4  345 PRO n 
4  346 THR n 
4  347 GLU n 
4  348 SER n 
4  349 ALA n 
4  350 ARG n 
4  351 GLY n 
4  352 GLU n 
4  353 LEU n 
4  354 GLY n 
4  355 TYR n 
4  356 TYR n 
4  357 ILE n 
4  358 VAL n 
4  359 SER n 
4  360 ASP n 
4  361 GLY n 
4  362 GLY n 
4  363 SER n 
4  364 MET n 
4  365 PRO n 
4  366 TYR n 
4  367 ARG n 
4  368 VAL n 
4  369 LYS n 
4  370 VAL n 
4  371 ARG n 
4  372 ALA n 
4  373 PRO n 
4  374 SER n 
4  375 PHE n 
4  376 VAL n 
4  377 ASN n 
4  378 LEU n 
4  379 GLN n 
4  380 SER n 
4  381 LEU n 
4  382 PRO n 
4  383 TYR n 
4  384 ALA n 
4  385 CYS n 
4  386 LYS n 
4  387 GLY n 
4  388 GLU n 
4  389 GLN n 
4  390 VAL n 
4  391 PRO n 
4  392 ASP n 
4  393 MET n 
4  394 VAL n 
4  395 ALA n 
4  396 ILE n 
4  397 ILE n 
4  398 ALA n 
4  399 SER n 
4  400 LEU n 
4  401 ASP n 
4  402 PRO n 
4  403 VAL n 
4  404 MET n 
4  405 GLY n 
4  406 ASP n 
4  407 VAL n 
4  408 ASP n 
4  409 ARG n 
5  1   MET n 
5  2   ARG n 
5  3   LEU n 
5  4   GLU n 
5  5   ARG n 
5  6   VAL n 
5  7   LEU n 
5  8   GLU n 
5  9   GLU n 
5  10  ALA n 
5  11  ARG n 
5  12  ALA n 
5  13  LYS n 
5  14  GLY n 
5  15  TYR n 
5  16  PRO n 
5  17  ILE n 
5  18  GLU n 
5  19  ASP n 
5  20  ASN n 
5  21  GLY n 
5  22  LEU n 
5  23  GLY n 
5  24  ASN n 
5  25  LEU n 
5  26  TRP n 
5  27  VAL n 
5  28  VAL n 
5  29  LEU n 
5  30  PRO n 
5  31  ARG n 
5  32  GLU n 
5  33  ARG n 
5  34  PHE n 
5  35  LYS n 
5  36  GLU n 
5  37  GLU n 
5  38  MET n 
5  39  ALA n 
5  40  HIS n 
5  41  TYR n 
5  42  LYS n 
5  43  ALA n 
5  44  MET n 
5  45  GLY n 
5  46  PHE n 
5  47  ASN n 
5  48  PHE n 
5  49  LEU n 
5  50  ALA n 
5  51  ASP n 
5  52  ILE n 
5  53  VAL n 
5  54  GLY n 
5  55  LEU n 
5  56  ASP n 
5  57  TYR n 
5  58  LEU n 
5  59  THR n 
5  60  TYR n 
5  61  PRO n 
5  62  ASP n 
5  63  PRO n 
5  64  ARG n 
5  65  PRO n 
5  66  GLU n 
5  67  ARG n 
5  68  PHE n 
5  69  ALA n 
5  70  VAL n 
5  71  VAL n 
5  72  TYR n 
5  73  GLU n 
5  74  LEU n 
5  75  VAL n 
5  76  SER n 
5  77  LEU n 
5  78  PRO n 
5  79  GLY n 
5  80  TRP n 
5  81  LYS n 
5  82  ASP n 
5  83  GLY n 
5  84  ASP n 
5  85  GLY n 
5  86  SER n 
5  87  ARG n 
5  88  PHE n 
5  89  PHE n 
5  90  VAL n 
5  91  ARG n 
5  92  VAL n 
5  93  TYR n 
5  94  VAL n 
5  95  PRO n 
5  96  GLU n 
5  97  GLU n 
5  98  ASP n 
5  99  PRO n 
5  100 ARG n 
5  101 LEU n 
5  102 PRO n 
5  103 THR n 
5  104 VAL n 
5  105 THR n 
5  106 ASP n 
5  107 LEU n 
5  108 TRP n 
5  109 GLY n 
5  110 SER n 
5  111 ALA n 
5  112 ASN n 
5  113 PHE n 
5  114 LEU n 
5  115 GLU n 
5  116 ARG n 
5  117 GLU n 
5  118 VAL n 
5  119 TYR n 
5  120 ASP n 
5  121 LEU n 
5  122 PHE n 
5  123 GLY n 
5  124 ILE n 
5  125 VAL n 
5  126 PHE n 
5  127 GLU n 
5  128 GLY n 
5  129 HIS n 
5  130 PRO n 
5  131 ASP n 
5  132 LEU n 
5  133 ARG n 
5  134 LYS n 
5  135 ILE n 
5  136 LEU n 
5  137 THR n 
5  138 PRO n 
5  139 GLU n 
5  140 ASP n 
5  141 LEU n 
5  142 GLU n 
5  143 GLY n 
5  144 HIS n 
5  145 PRO n 
5  146 LEU n 
5  147 ARG n 
5  148 LYS n 
5  149 ASP n 
5  150 TYR n 
5  151 PRO n 
5  152 LEU n 
5  153 GLY n 
5  154 GLU n 
5  155 THR n 
5  156 PRO n 
5  157 THR n 
5  158 LEU n 
5  159 PHE n 
5  160 ARG n 
5  161 GLU n 
5  162 GLY n 
5  163 ARG n 
5  164 TYR n 
5  165 ILE n 
5  166 ILE n 
5  167 PRO n 
5  168 ALA n 
5  169 GLU n 
5  170 PHE n 
5  171 ARG n 
5  172 ALA n 
5  173 ALA n 
5  174 LEU n 
5  175 THR n 
5  176 GLY n 
5  177 LYS n 
5  178 ASP n 
5  179 PRO n 
5  180 GLY n 
5  181 LEU n 
5  182 THR n 
5  183 PHE n 
5  184 TYR n 
5  185 LYS n 
5  186 GLY n 
5  187 GLY n 
5  188 SER n 
5  189 ARG n 
5  190 LYS n 
5  191 GLY n 
5  192 TYR n 
5  193 ARG n 
5  194 SER n 
5  195 LEU n 
5  196 TRP n 
5  197 ALA n 
5  198 ASP n 
5  199 LEU n 
5  200 LYS n 
5  201 LYS n 
5  202 ALA n 
5  203 ARG n 
5  204 GLU n 
5  205 VAL n 
5  206 LYS n 
5  207 GLY n 
6  1   MET n 
6  2   ALA n 
6  3   LEU n 
6  4   LYS n 
6  5   ASP n 
6  6   LEU n 
6  7   PHE n 
6  8   GLU n 
6  9   ARG n 
6  10  ASP n 
6  11  VAL n 
6  12  GLN n 
6  13  GLU n 
6  14  LEU n 
6  15  GLU n 
6  16  ARG n 
6  17  GLU n 
6  18  GLY n 
6  19  ILE n 
6  20  LEU n 
6  21  PHE n 
6  22  THR n 
6  23  THR n 
6  24  LEU n 
6  25  GLU n 
6  26  LYS n 
6  27  LEU n 
6  28  VAL n 
6  29  ALA n 
6  30  TRP n 
6  31  GLY n 
6  32  ARG n 
6  33  SER n 
6  34  ASN n 
6  35  SER n 
6  36  LEU n 
6  37  TRP n 
6  38  PRO n 
6  39  ALA n 
6  40  THR n 
6  41  PHE n 
6  42  GLY n 
6  43  LEU n 
6  44  ALA n 
6  45  CYS n 
6  46  CYS n 
6  47  ALA n 
6  48  ILE n 
6  49  GLU n 
6  50  MET n 
6  51  MET n 
6  52  ALA n 
6  53  SER n 
6  54  THR n 
6  55  ASP n 
6  56  ALA n 
6  57  ARG n 
6  58  ASN n 
6  59  ASP n 
6  60  LEU n 
6  61  ALA n 
6  62  ARG n 
6  63  PHE n 
6  64  GLY n 
6  65  SER n 
6  66  GLU n 
6  67  VAL n 
6  68  PHE n 
6  69  ARG n 
6  70  ALA n 
6  71  SER n 
6  72  PRO n 
6  73  ARG n 
6  74  GLN n 
6  75  ALA n 
6  76  ASP n 
6  77  VAL n 
6  78  MET n 
6  79  ILE n 
6  80  VAL n 
6  81  ALA n 
6  82  GLY n 
6  83  ARG n 
6  84  LEU n 
6  85  SER n 
6  86  LYS n 
6  87  LYS n 
6  88  MET n 
6  89  ALA n 
6  90  PRO n 
6  91  VAL n 
6  92  MET n 
6  93  ARG n 
6  94  ARG n 
6  95  VAL n 
6  96  TRP n 
6  97  GLU n 
6  98  GLN n 
6  99  MET n 
6  100 PRO n 
6  101 ASP n 
6  102 PRO n 
6  103 LYS n 
6  104 TRP n 
6  105 VAL n 
6  106 ILE n 
6  107 SER n 
6  108 MET n 
6  109 GLY n 
6  110 ALA n 
6  111 CYS n 
6  112 ALA n 
6  113 SER n 
6  114 SER n 
6  115 GLY n 
6  116 GLY n 
6  117 MET n 
6  118 PHE n 
6  119 ASN n 
6  120 ASN n 
6  121 TYR n 
6  122 ALA n 
6  123 ILE n 
6  124 VAL n 
6  125 GLN n 
6  126 ASN n 
6  127 VAL n 
6  128 ASP n 
6  129 SER n 
6  130 VAL n 
6  131 VAL n 
6  132 PRO n 
6  133 VAL n 
6  134 ASP n 
6  135 VAL n 
6  136 TYR n 
6  137 VAL n 
6  138 PRO n 
6  139 GLY n 
6  140 CYS n 
6  141 PRO n 
6  142 PRO n 
6  143 ARG n 
6  144 PRO n 
6  145 GLU n 
6  146 ALA n 
6  147 LEU n 
6  148 ILE n 
6  149 TYR n 
6  150 ALA n 
6  151 VAL n 
6  152 MET n 
6  153 GLN n 
6  154 LEU n 
6  155 GLN n 
6  156 LYS n 
6  157 LYS n 
6  158 VAL n 
6  159 ARG n 
6  160 GLY n 
6  161 GLN n 
6  162 ALA n 
6  163 TYR n 
6  164 ASN n 
6  165 GLU n 
6  166 ARG n 
6  167 GLY n 
6  168 GLU n 
6  169 ARG n 
6  170 LEU n 
6  171 PRO n 
6  172 PRO n 
6  173 VAL n 
6  174 ALA n 
6  175 ALA n 
6  176 TRP n 
6  177 LYS n 
6  178 ARG n 
6  179 THR n 
6  180 ARG n 
6  181 GLY n 
7  1   MET n 
7  2   THR n 
7  3   LEU n 
7  4   LYS n 
7  5   ALA n 
7  6   LEU n 
7  7   ALA n 
7  8   GLN n 
7  9   SER n 
7  10  LEU n 
7  11  GLY n 
7  12  ILE n 
7  13  THR n 
7  14  LEU n 
7  15  LYS n 
7  16  TYR n 
7  17  LEU n 
7  18  PHE n 
7  19  SER n 
7  20  LYS n 
7  21  PRO n 
7  22  VAL n 
7  23  THR n 
7  24  VAL n 
7  25  PRO n 
7  26  TYR n 
7  27  PRO n 
7  28  ASP n 
7  29  ALA n 
7  30  PRO n 
7  31  VAL n 
7  32  ALA n 
7  33  LEU n 
7  34  LYS n 
7  35  PRO n 
7  36  ARG n 
7  37  PHE n 
7  38  HIS n 
7  39  GLY n 
7  40  ARG n 
7  41  HIS n 
7  42  VAL n 
7  43  LEU n 
7  44  THR n 
7  45  ARG n 
7  46  HIS n 
7  47  PRO n 
7  48  ASN n 
7  49  GLY n 
7  50  LEU n 
7  51  GLU n 
7  52  LYS n 
7  53  CYS n 
7  54  ILE n 
7  55  GLY n 
7  56  CYS n 
7  57  SER n 
7  58  LEU n 
7  59  CYS n 
7  60  ALA n 
7  61  ALA n 
7  62  ALA n 
7  63  CYS n 
7  64  PRO n 
7  65  ALA n 
7  66  TYR n 
7  67  ALA n 
7  68  ILE n 
7  69  TYR n 
7  70  VAL n 
7  71  GLU n 
7  72  PRO n 
7  73  ALA n 
7  74  GLU n 
7  75  ASN n 
7  76  ASP n 
7  77  PRO n 
7  78  GLU n 
7  79  ASN n 
7  80  PRO n 
7  81  VAL n 
7  82  SER n 
7  83  ALA n 
7  84  GLY n 
7  85  GLU n 
7  86  ARG n 
7  87  TYR n 
7  88  ALA n 
7  89  LYS n 
7  90  VAL n 
7  91  TYR n 
7  92  GLU n 
7  93  ILE n 
7  94  ASN n 
7  95  MET n 
7  96  LEU n 
7  97  ARG n 
7  98  CYS n 
7  99  ILE n 
7  100 PHE n 
7  101 CYS n 
7  102 GLY n 
7  103 LEU n 
7  104 CYS n 
7  105 GLU n 
7  106 GLU n 
7  107 ALA n 
7  108 CYS n 
7  109 PRO n 
7  110 THR n 
7  111 GLY n 
7  112 ALA n 
7  113 ILE n 
7  114 VAL n 
7  115 LEU n 
7  116 GLY n 
7  117 TYR n 
7  118 ASP n 
7  119 PHE n 
7  120 GLU n 
7  121 MET n 
7  122 ALA n 
7  123 ASP n 
7  124 TYR n 
7  125 GLU n 
7  126 TYR n 
7  127 SER n 
7  128 ASP n 
7  129 LEU n 
7  130 VAL n 
7  131 TYR n 
7  132 GLY n 
7  133 LYS n 
7  134 GLU n 
7  135 ASP n 
7  136 MET n 
7  137 LEU n 
7  138 VAL n 
7  139 ASP n 
7  140 VAL n 
7  141 VAL n 
7  142 GLY n 
7  143 THR n 
7  144 LYS n 
7  145 PRO n 
7  146 GLN n 
7  147 ARG n 
7  148 ARG n 
7  149 GLU n 
7  150 ALA n 
7  151 LYS n 
7  152 ARG n 
7  153 THR n 
7  154 GLY n 
7  155 LYS n 
7  156 PRO n 
7  157 VAL n 
7  158 LYS n 
7  159 VAL n 
7  160 GLY n 
7  161 TYR n 
7  162 VAL n 
7  163 VAL n 
7  164 PRO n 
7  165 TYR n 
7  166 VAL n 
7  167 ARG n 
7  168 PRO n 
7  169 GLU n 
7  170 LEU n 
7  171 GLU n 
7  172 GLY n 
7  173 PHE n 
7  174 LYS n 
7  175 ALA n 
7  176 PRO n 
7  177 THR n 
7  178 GLU n 
7  179 GLY n 
7  180 GLY n 
7  181 LYS n 
7  182 ARG n 
8  1   MET n 
8  2   SER n 
8  3   ALA n 
8  4   SER n 
8  5   SER n 
8  6   GLU n 
8  7   ARG n 
8  8   GLU n 
8  9   LEU n 
8  10  TYR n 
8  11  GLU n 
8  12  ALA n 
8  13  TRP n 
8  14  VAL n 
8  15  GLU n 
8  16  LEU n 
8  17  LEU n 
8  18  SER n 
8  19  TRP n 
8  20  MET n 
8  21  ARG n 
8  22  GLU n 
8  23  TYR n 
8  24  ALA n 
8  25  GLN n 
8  26  ALA n 
8  27  LYS n 
8  28  GLY n 
8  29  VAL n 
8  30  ARG n 
8  31  PHE n 
8  32  GLU n 
8  33  LYS n 
8  34  GLU n 
8  35  ALA n 
8  36  ASP n 
8  37  PHE n 
8  38  PRO n 
8  39  ASP n 
8  40  PHE n 
8  41  ILE n 
8  42  TYR n 
8  43  ARG n 
8  44  MET n 
8  45  GLU n 
8  46  ARG n 
8  47  PRO n 
8  48  TYR n 
8  49  ASP n 
8  50  LEU n 
8  51  PRO n 
8  52  THR n 
8  53  THR n 
8  54  ILE n 
8  55  MET n 
8  56  THR n 
8  57  ALA n 
8  58  SER n 
8  59  LEU n 
8  60  SER n 
8  61  ASP n 
8  62  GLY n 
8  63  LEU n 
8  64  GLY n 
8  65  GLU n 
8  66  PRO n 
8  67  PHE n 
8  68  LEU n 
8  69  LEU n 
8  70  ALA n 
8  71  ASP n 
8  72  VAL n 
8  73  SER n 
8  74  PRO n 
8  75  ARG n 
8  76  HIS n 
8  77  ALA n 
8  78  LYS n 
8  79  LEU n 
8  80  LYS n 
8  81  ARG n 
8  82  ILE n 
8  83  GLY n 
8  84  LEU n 
8  85  ARG n 
8  86  LEU n 
8  87  PRO n 
8  88  ARG n 
8  89  ALA n 
8  90  HIS n 
8  91  ILE n 
8  92  HIS n 
8  93  LEU n 
8  94  HIS n 
8  95  ALA n 
8  96  HIS n 
8  97  TYR n 
8  98  GLU n 
8  99  PRO n 
8  100 GLY n 
8  101 LYS n 
8  102 GLY n 
8  103 LEU n 
8  104 VAL n 
8  105 THR n 
8  106 GLY n 
8  107 LYS n 
8  108 ILE n 
8  109 PRO n 
8  110 LEU n 
8  111 THR n 
8  112 LYS n 
8  113 GLU n 
8  114 ARG n 
8  115 PHE n 
8  116 PHE n 
8  117 ALA n 
8  118 LEU n 
8  119 ALA n 
8  120 ASP n 
8  121 ARG n 
8  122 ALA n 
8  123 ARG n 
8  124 GLU n 
8  125 ALA n 
8  126 LEU n 
8  127 ALA n 
8  128 PHE n 
8  129 ALA n 
9  1   MET n 
9  2   VAL n 
9  3   ARG n 
9  4   VAL n 
9  5   GLY n 
9  6   MET n 
9  7   ARG n 
9  8   ALA n 
9  9   ALA n 
9  10  PRO n 
9  11  ARG n 
9  12  VAL n 
9  13  SER n 
9  14  LEU n 
9  15  GLU n 
9  16  ALA n 
9  17  LEU n 
9  18  LYS n 
9  19  ALA n 
9  20  ALA n 
9  21  LEU n 
9  22  GLY n 
9  23  GLY n 
9  24  LEU n 
9  25  LYS n 
9  26  LEU n 
9  27  SER n 
9  28  GLU n 
9  29  ALA n 
9  30  LYS n 
9  31  VAL n 
9  32  TYR n 
9  33  LEU n 
9  34  ILE n 
9  35  THR n 
9  36  ASP n 
9  37  TRP n 
9  38  GLN n 
9  39  ASP n 
9  40  LYS n 
9  41  ARG n 
9  42  ASP n 
9  43  GLN n 
9  44  ALA n 
9  45  ARG n 
9  46  TYR n 
9  47  ALA n 
9  48  LEU n 
9  49  LEU n 
9  50  LEU n 
9  51  HIS n 
9  52  THR n 
9  53  GLY n 
9  54  LYS n 
9  55  LYS n 
9  56  ASP n 
9  57  LEU n 
9  58  LEU n 
9  59  VAL n 
9  60  PRO n 
9  61  ASP n 
9  62  ALA n 
9  63  PHE n 
9  64  GLY n 
9  65  PRO n 
9  66  ALA n 
9  67  PHE n 
9  68  PRO n 
9  69  GLY n 
9  70  GLY n 
9  71  GLU n 
9  72  GLU n 
9  73  ALA n 
9  74  LEU n 
9  75  SER n 
9  76  GLU n 
9  77  LEU n 
9  78  VAL n 
9  79  GLY n 
9  80  LEU n 
9  81  LEU n 
9  82  LEU n 
9  83  ALA n 
9  84  GLN n 
9  85  GLY n 
9  86  ALA n 
9  87  ARG n 
9  88  ARG n 
9  89  PHE n 
9  90  TYR n 
9  91  GLU n 
9  92  ALA n 
9  93  VAL n 
9  94  VAL n 
9  95  SER n 
9  96  PRO n 
9  97  GLY n 
9  98  GLU n 
9  99  MET n 
9  100 THR n 
9  101 ALA n 
9  102 LEU n 
9  103 LEU n 
9  104 ASP n 
9  105 LEU n 
9  106 PRO n 
9  107 PRO n 
9  108 GLU n 
9  109 GLU n 
9  110 LEU n 
9  111 LEU n 
9  112 LYS n 
9  113 ARG n 
9  114 VAL n 
9  115 MET n 
9  116 ALA n 
9  117 ILE n 
9  118 ALA n 
9  119 ASN n 
9  120 PRO n 
9  121 THR n 
9  122 ASP n 
9  123 PRO n 
9  124 GLY n 
9  125 ILE n 
9  126 TYR n 
9  127 LEU n 
9  128 LYS n 
9  129 ARG n 
9  130 ALA n 
9  131 ALA n 
10 1   MET n 
10 2   ALA n 
10 3   PRO n 
10 4   ILE n 
10 5   GLN n 
10 6   GLU n 
10 7   TYR n 
10 8   VAL n 
10 9   GLY n 
10 10  THR n 
10 11  LEU n 
10 12  ILE n 
10 13  TYR n 
10 14  VAL n 
10 15  GLY n 
10 16  VAL n 
10 17  ALA n 
10 18  LEU n 
10 19  PHE n 
10 20  ILE n 
10 21  GLY n 
10 22  VAL n 
10 23  ALA n 
10 24  ALA n 
10 25  LEU n 
10 26  LEU n 
10 27  VAL n 
10 28  GLY n 
10 29  ALA n 
10 30  LEU n 
10 31  LEU n 
10 32  GLY n 
10 33  PRO n 
10 34  LYS n 
10 35  LYS n 
10 36  PRO n 
10 37  GLY n 
10 38  ARG n 
10 39  ALA n 
10 40  LYS n 
10 41  LEU n 
10 42  MET n 
10 43  PRO n 
10 44  TYR n 
10 45  GLU n 
10 46  SER n 
10 47  GLY n 
10 48  ASN n 
10 49  ASP n 
10 50  PRO n 
10 51  ALA n 
10 52  GLY n 
10 53  GLU n 
10 54  VAL n 
10 55  LYS n 
10 56  ARG n 
10 57  PHE n 
10 58  PRO n 
10 59  VAL n 
10 60  HIS n 
10 61  PHE n 
10 62  TYR n 
10 63  VAL n 
10 64  VAL n 
10 65  ALA n 
10 66  MET n 
10 67  LEU n 
10 68  PHE n 
10 69  ILE n 
10 70  LEU n 
10 71  PHE n 
10 72  ASP n 
10 73  VAL n 
10 74  GLU n 
10 75  VAL n 
10 76  ALA n 
10 77  PHE n 
10 78  LEU n 
10 79  TRP n 
10 80  PRO n 
10 81  TYR n 
10 82  ALA n 
10 83  VAL n 
10 84  SER n 
10 85  ALA n 
10 86  GLY n 
10 87  GLY n 
10 88  LEU n 
10 89  GLY n 
10 90  LEU n 
10 91  TYR n 
10 92  GLY n 
10 93  PHE n 
10 94  LEU n 
10 95  GLY n 
10 96  VAL n 
10 97  LEU n 
10 98  ALA n 
10 99  PHE n 
10 100 THR n 
10 101 LEU n 
10 102 LEU n 
10 103 LEU n 
10 104 PHE n 
10 105 VAL n 
10 106 GLY n 
10 107 PHE n 
10 108 LEU n 
10 109 TYR n 
10 110 GLU n 
10 111 TRP n 
10 112 TRP n 
10 113 LYS n 
10 114 GLY n 
10 115 VAL n 
10 116 MET n 
10 117 ARG n 
10 118 TRP n 
10 119 HIS n 
11 1   MET n 
11 2   SER n 
11 3   LEU n 
11 4   LEU n 
11 5   GLU n 
11 6   GLY n 
11 7   LEU n 
11 8   ALA n 
11 9   LEU n 
11 10  PHE n 
11 11  LEU n 
11 12  LEU n 
11 13  LEU n 
11 14  LEU n 
11 15  SER n 
11 16  GLY n 
11 17  VAL n 
11 18  LEU n 
11 19  VAL n 
11 20  VAL n 
11 21  THR n 
11 22  LEU n 
11 23  ARG n 
11 24  ASN n 
11 25  ALA n 
11 26  ILE n 
11 27  HIS n 
11 28  ALA n 
11 29  ALA n 
11 30  LEU n 
11 31  ALA n 
11 32  LEU n 
11 33  ILE n 
11 34  LEU n 
11 35  ASN n 
11 36  PHE n 
11 37  LEU n 
11 38  VAL n 
11 39  LEU n 
11 40  ALA n 
11 41  GLY n 
11 42  VAL n 
11 43  TYR n 
11 44  VAL n 
11 45  ALA n 
11 46  LEU n 
11 47  ASP n 
11 48  ALA n 
11 49  ARG n 
11 50  PHE n 
11 51  LEU n 
11 52  GLY n 
11 53  PHE n 
11 54  ILE n 
11 55  GLN n 
11 56  VAL n 
11 57  ILE n 
11 58  VAL n 
11 59  TYR n 
11 60  ALA n 
11 61  GLY n 
11 62  ALA n 
11 63  ILE n 
11 64  VAL n 
11 65  VAL n 
11 66  LEU n 
11 67  PHE n 
11 68  LEU n 
11 69  PHE n 
11 70  VAL n 
11 71  ILE n 
11 72  MET n 
11 73  LEU n 
11 74  LEU n 
11 75  PHE n 
11 76  ALA n 
11 77  ALA n 
11 78  GLN n 
11 79  GLY n 
11 80  GLU n 
11 81  ILE n 
11 82  GLY n 
11 83  PHE n 
11 84  ASP n 
11 85  PRO n 
11 86  LEU n 
11 87  VAL n 
11 88  ARG n 
11 89  SER n 
11 90  ARG n 
11 91  PRO n 
11 92  LEU n 
11 93  ALA n 
11 94  ALA n 
11 95  LEU n 
11 96  LEU n 
11 97  ALA n 
11 98  LEU n 
11 99  GLY n 
11 100 VAL n 
11 101 ALA n 
11 102 GLY n 
11 103 ILE n 
11 104 LEU n 
11 105 ALA n 
11 106 ALA n 
11 107 GLY n 
11 108 LEU n 
11 109 TRP n 
11 110 GLY n 
11 111 LEU n 
11 112 ASP n 
11 113 LEU n 
11 114 ALA n 
11 115 PHE n 
11 116 THR n 
11 117 GLN n 
11 118 ASP n 
11 119 LEU n 
11 120 LYS n 
11 121 GLY n 
11 122 GLY n 
11 123 LEU n 
11 124 PRO n 
11 125 GLN n 
11 126 ALA n 
11 127 LEU n 
11 128 GLY n 
11 129 PRO n 
11 130 LEU n 
11 131 LEU n 
11 132 TYR n 
11 133 GLY n 
11 134 ASP n 
11 135 TRP n 
11 136 LEU n 
11 137 PHE n 
11 138 VAL n 
11 139 LEU n 
11 140 LEU n 
11 141 ALA n 
11 142 VAL n 
11 143 GLY n 
11 144 PHE n 
11 145 LEU n 
11 146 LEU n 
11 147 MET n 
11 148 ALA n 
11 149 ALA n 
11 150 THR n 
11 151 VAL n 
11 152 VAL n 
11 153 ALA n 
11 154 VAL n 
11 155 ALA n 
11 156 LEU n 
11 157 VAL n 
11 158 GLU n 
11 159 PRO n 
11 160 GLY n 
11 161 LYS n 
11 162 ALA n 
11 163 SER n 
11 164 ARG n 
11 165 ALA n 
11 166 LYS n 
11 167 GLU n 
11 168 ALA n 
11 169 GLU n 
11 170 LYS n 
11 171 ARG n 
11 172 GLU n 
11 173 GLU n 
11 174 VAL n 
11 175 ALA n 
11 176 ARG n 
12 1   MET n 
12 2   SER n 
12 3   TYR n 
12 4   LEU n 
12 5   LEU n 
12 6   THR n 
12 7   SER n 
12 8   ALA n 
12 9   LEU n 
12 10  LEU n 
12 11  PHE n 
12 12  ALA n 
12 13  LEU n 
12 14  GLY n 
12 15  VAL n 
12 16  TYR n 
12 17  GLY n 
12 18  VAL n 
12 19  LEU n 
12 20  THR n 
12 21  ARG n 
12 22  ARG n 
12 23  THR n 
12 24  ALA n 
12 25  ILE n 
12 26  LEU n 
12 27  VAL n 
12 28  PHE n 
12 29  LEU n 
12 30  SER n 
12 31  ILE n 
12 32  GLU n 
12 33  LEU n 
12 34  MET n 
12 35  LEU n 
12 36  ASN n 
12 37  ALA n 
12 38  ALA n 
12 39  ASN n 
12 40  LEU n 
12 41  SER n 
12 42  LEU n 
12 43  VAL n 
12 44  GLY n 
12 45  PHE n 
12 46  ALA n 
12 47  ARG n 
12 48  ALA n 
12 49  TYR n 
12 50  GLY n 
12 51  LEU n 
12 52  ASP n 
12 53  GLY n 
12 54  GLN n 
12 55  VAL n 
12 56  ALA n 
12 57  ALA n 
12 58  LEU n 
12 59  MET n 
12 60  VAL n 
12 61  ILE n 
12 62  ALA n 
12 63  VAL n 
12 64  ALA n 
12 65  ALA n 
12 66  ALA n 
12 67  GLU n 
12 68  VAL n 
12 69  ALA n 
12 70  VAL n 
12 71  GLY n 
12 72  LEU n 
12 73  GLY n 
12 74  LEU n 
12 75  ILE n 
12 76  VAL n 
12 77  ALA n 
12 78  ILE n 
12 79  PHE n 
12 80  ARG n 
12 81  HIS n 
12 82  ARG n 
12 83  GLU n 
12 84  SER n 
12 85  THR n 
12 86  ALA n 
12 87  VAL n 
12 88  ASP n 
12 89  ASP n 
12 90  LEU n 
12 91  SER n 
12 92  GLU n 
12 93  LEU n 
12 94  ARG n 
12 95  GLY n 
13 1   MET n 
13 2   ALA n 
13 3   LEU n 
13 4   LEU n 
13 5   GLY n 
13 6   THR n 
13 7   ILE n 
13 8   LEU n 
13 9   LEU n 
13 10  PRO n 
13 11  LEU n 
13 12  LEU n 
13 13  GLY n 
13 14  PHE n 
13 15  ALA n 
13 16  LEU n 
13 17  LEU n 
13 18  GLY n 
13 19  LEU n 
13 20  PHE n 
13 21  GLY n 
13 22  LYS n 
13 23  ARG n 
13 24  MET n 
13 25  ARG n 
13 26  GLU n 
13 27  PRO n 
13 28  LEU n 
13 29  PRO n 
13 30  GLY n 
13 31  VAL n 
13 32  LEU n 
13 33  ALA n 
13 34  SER n 
13 35  GLY n 
13 36  LEU n 
13 37  VAL n 
13 38  LEU n 
13 39  ALA n 
13 40  SER n 
13 41  PHE n 
13 42  LEU n 
13 43  LEU n 
13 44  GLY n 
13 45  ALA n 
13 46  GLY n 
13 47  LEU n 
13 48  LEU n 
13 49  LEU n 
13 50  SER n 
13 51  GLY n 
13 52  GLY n 
13 53  ALA n 
13 54  ARG n 
13 55  PHE n 
13 56  GLN n 
13 57  ALA n 
13 58  GLU n 
13 59  TRP n 
13 60  LEU n 
13 61  PRO n 
13 62  GLY n 
13 63  ILE n 
13 64  PRO n 
13 65  PHE n 
13 66  SER n 
13 67  LEU n 
13 68  LEU n 
13 69  LEU n 
13 70  ASP n 
13 71  ASN n 
13 72  LEU n 
13 73  SER n 
13 74  GLY n 
13 75  PHE n 
13 76  MET n 
13 77  LEU n 
13 78  LEU n 
13 79  ILE n 
13 80  VAL n 
13 81  THR n 
13 82  GLY n 
13 83  VAL n 
13 84  GLY n 
13 85  PHE n 
13 86  LEU n 
13 87  ILE n 
13 88  HIS n 
13 89  VAL n 
13 90  TYR n 
13 91  ALA n 
13 92  ILE n 
13 93  GLY n 
13 94  TYR n 
13 95  MET n 
13 96  GLY n 
13 97  GLY n 
13 98  ASP n 
13 99  PRO n 
13 100 GLY n 
13 101 TYR n 
13 102 SER n 
13 103 ARG n 
13 104 PHE n 
13 105 PHE n 
13 106 ALA n 
13 107 TYR n 
13 108 PHE n 
13 109 ASN n 
13 110 LEU n 
13 111 PHE n 
13 112 ILE n 
13 113 ALA n 
13 114 MET n 
13 115 MET n 
13 116 LEU n 
13 117 THR n 
13 118 LEU n 
13 119 VAL n 
13 120 LEU n 
13 121 ALA n 
13 122 ASP n 
13 123 SER n 
13 124 TYR n 
13 125 PRO n 
13 126 VAL n 
13 127 MET n 
13 128 PHE n 
13 129 ILE n 
13 130 GLY n 
13 131 TRP n 
13 132 GLU n 
13 133 GLY n 
13 134 VAL n 
13 135 GLY n 
13 136 LEU n 
13 137 ALA n 
13 138 SER n 
13 139 PHE n 
13 140 LEU n 
13 141 LEU n 
13 142 ILE n 
13 143 GLY n 
13 144 PHE n 
13 145 TRP n 
13 146 TYR n 
13 147 LYS n 
13 148 ASN n 
13 149 PRO n 
13 150 GLN n 
13 151 TYR n 
13 152 ALA n 
13 153 ASP n 
13 154 SER n 
13 155 ALA n 
13 156 ARG n 
13 157 LYS n 
13 158 ALA n 
13 159 PHE n 
13 160 ILE n 
13 161 VAL n 
13 162 ASN n 
13 163 ARG n 
13 164 ILE n 
13 165 GLY n 
13 166 ASP n 
13 167 LEU n 
13 168 GLY n 
13 169 PHE n 
13 170 MET n 
13 171 LEU n 
13 172 GLY n 
13 173 MET n 
13 174 ALA n 
13 175 ILE n 
13 176 LEU n 
13 177 TRP n 
13 178 ALA n 
13 179 LEU n 
13 180 TYR n 
13 181 GLY n 
13 182 THR n 
13 183 LEU n 
13 184 SER n 
13 185 ILE n 
13 186 SER n 
13 187 GLU n 
13 188 LEU n 
13 189 LYS n 
13 190 GLU n 
13 191 ALA n 
13 192 MET n 
13 193 GLU n 
13 194 GLY n 
13 195 PRO n 
13 196 LEU n 
13 197 LYS n 
13 198 ASN n 
13 199 PRO n 
13 200 ASP n 
13 201 LEU n 
13 202 LEU n 
13 203 ALA n 
13 204 LEU n 
13 205 ALA n 
13 206 GLY n 
13 207 LEU n 
13 208 LEU n 
13 209 LEU n 
13 210 PHE n 
13 211 LEU n 
13 212 GLY n 
13 213 ALA n 
13 214 VAL n 
13 215 GLY n 
13 216 LYS n 
13 217 SER n 
13 218 ALA n 
13 219 GLN n 
13 220 ILE n 
13 221 PRO n 
13 222 LEU n 
13 223 MET n 
13 224 VAL n 
13 225 TRP n 
13 226 LEU n 
13 227 PRO n 
13 228 ASP n 
13 229 ALA n 
13 230 MET n 
13 231 ALA n 
13 232 GLY n 
13 233 PRO n 
13 234 THR n 
13 235 PRO n 
13 236 VAL n 
13 237 SER n 
13 238 ALA n 
13 239 LEU n 
13 240 ILE n 
13 241 HIS n 
13 242 ALA n 
13 243 ALA n 
13 244 THR n 
13 245 MET n 
13 246 VAL n 
13 247 THR n 
13 248 ALA n 
13 249 GLY n 
13 250 VAL n 
13 251 TYR n 
13 252 LEU n 
13 253 ILE n 
13 254 ALA n 
13 255 ARG n 
13 256 SER n 
13 257 SER n 
13 258 PHE n 
13 259 LEU n 
13 260 TYR n 
13 261 SER n 
13 262 VAL n 
13 263 LEU n 
13 264 PRO n 
13 265 ASP n 
13 266 VAL n 
13 267 SER n 
13 268 TYR n 
13 269 ALA n 
13 270 ILE n 
13 271 ALA n 
13 272 VAL n 
13 273 VAL n 
13 274 GLY n 
13 275 LEU n 
13 276 LEU n 
13 277 THR n 
13 278 ALA n 
13 279 ALA n 
13 280 TYR n 
13 281 GLY n 
13 282 ALA n 
13 283 LEU n 
13 284 SER n 
13 285 ALA n 
13 286 PHE n 
13 287 GLY n 
13 288 GLN n 
13 289 THR n 
13 290 ASP n 
13 291 ILE n 
13 292 LYS n 
13 293 LYS n 
13 294 ILE n 
13 295 VAL n 
13 296 ALA n 
13 297 TYR n 
13 298 SER n 
13 299 THR n 
13 300 ILE n 
13 301 SER n 
13 302 GLN n 
13 303 LEU n 
13 304 GLY n 
13 305 TYR n 
13 306 MET n 
13 307 PHE n 
13 308 LEU n 
13 309 ALA n 
13 310 ALA n 
13 311 GLY n 
13 312 VAL n 
13 313 GLY n 
13 314 ALA n 
13 315 TYR n 
13 316 TRP n 
13 317 VAL n 
13 318 ALA n 
13 319 LEU n 
13 320 PHE n 
13 321 HIS n 
13 322 VAL n 
13 323 PHE n 
13 324 THR n 
13 325 HIS n 
13 326 ALA n 
13 327 PHE n 
13 328 PHE n 
13 329 LYS n 
13 330 ALA n 
13 331 LEU n 
13 332 LEU n 
13 333 PHE n 
13 334 LEU n 
13 335 ALA n 
13 336 SER n 
13 337 GLY n 
13 338 SER n 
13 339 VAL n 
13 340 ILE n 
13 341 HIS n 
13 342 ALA n 
13 343 LEU n 
13 344 GLY n 
13 345 GLY n 
13 346 GLU n 
13 347 GLN n 
13 348 ASP n 
13 349 VAL n 
13 350 ARG n 
13 351 LYS n 
13 352 MET n 
13 353 GLY n 
13 354 GLY n 
13 355 LEU n 
13 356 TRP n 
13 357 LYS n 
13 358 HIS n 
13 359 LEU n 
13 360 PRO n 
13 361 GLN n 
13 362 THR n 
13 363 ARG n 
13 364 TRP n 
13 365 HIS n 
13 366 ALA n 
13 367 LEU n 
13 368 ILE n 
13 369 GLY n 
13 370 ALA n 
13 371 LEU n 
13 372 ALA n 
13 373 LEU n 
13 374 GLY n 
13 375 GLY n 
13 376 LEU n 
13 377 PRO n 
13 378 LEU n 
13 379 LEU n 
13 380 SER n 
13 381 GLY n 
13 382 PHE n 
13 383 TRP n 
13 384 SER n 
13 385 LYS n 
13 386 ASP n 
13 387 ALA n 
13 388 ILE n 
13 389 LEU n 
13 390 ALA n 
13 391 ALA n 
13 392 THR n 
13 393 LEU n 
13 394 THR n 
13 395 TYR n 
13 396 PRO n 
13 397 PHE n 
13 398 GLY n 
13 399 GLY n 
13 400 VAL n 
13 401 GLY n 
13 402 PHE n 
13 403 TYR n 
13 404 VAL n 
13 405 GLY n 
13 406 ALA n 
13 407 LEU n 
13 408 LEU n 
13 409 VAL n 
13 410 ALA n 
13 411 VAL n 
13 412 LEU n 
13 413 THR n 
13 414 ALA n 
13 415 MET n 
13 416 TYR n 
13 417 ALA n 
13 418 MET n 
13 419 ARG n 
13 420 TRP n 
13 421 PHE n 
13 422 VAL n 
13 423 LEU n 
13 424 VAL n 
13 425 PHE n 
13 426 LEU n 
13 427 GLY n 
13 428 GLU n 
13 429 GLU n 
13 430 ARG n 
13 431 GLY n 
13 432 HIS n 
13 433 HIS n 
13 434 HIS n 
13 435 PRO n 
13 436 HIS n 
13 437 GLU n 
13 438 ALA n 
13 439 PRO n 
13 440 PRO n 
13 441 VAL n 
13 442 MET n 
13 443 LEU n 
13 444 TRP n 
13 445 PRO n 
13 446 ASN n 
13 447 HIS n 
13 448 LEU n 
13 449 LEU n 
13 450 ALA n 
13 451 LEU n 
13 452 GLY n 
13 453 SER n 
13 454 VAL n 
13 455 LEU n 
13 456 ALA n 
13 457 GLY n 
13 458 TYR n 
13 459 LEU n 
13 460 ALA n 
13 461 LEU n 
13 462 PRO n 
13 463 HIS n 
13 464 PRO n 
13 465 LEU n 
13 466 PRO n 
13 467 ASN n 
13 468 VAL n 
13 469 LEU n 
13 470 GLU n 
13 471 PRO n 
13 472 PHE n 
13 473 LEU n 
13 474 LYS n 
13 475 PRO n 
13 476 ALA n 
13 477 LEU n 
13 478 ALA n 
13 479 GLU n 
13 480 VAL n 
13 481 GLU n 
13 482 ALA n 
13 483 HIS n 
13 484 HIS n 
13 485 LEU n 
13 486 SER n 
13 487 LEU n 
13 488 GLY n 
13 489 ALA n 
13 490 GLU n 
13 491 TRP n 
13 492 GLY n 
13 493 LEU n 
13 494 ILE n 
13 495 ALA n 
13 496 LEU n 
13 497 SER n 
13 498 ALA n 
13 499 ALA n 
13 500 VAL n 
13 501 ALA n 
13 502 LEU n 
13 503 LEU n 
13 504 GLY n 
13 505 LEU n 
13 506 TRP n 
13 507 ALA n 
13 508 GLY n 
13 509 PHE n 
13 510 VAL n 
13 511 PHE n 
13 512 PHE n 
13 513 GLN n 
13 514 ARG n 
13 515 LYS n 
13 516 VAL n 
13 517 PHE n 
13 518 PRO n 
13 519 ALA n 
13 520 TRP n 
13 521 TYR n 
13 522 LEU n 
13 523 ALA n 
13 524 PHE n 
13 525 GLU n 
13 526 ALA n 
13 527 ALA n 
13 528 SER n 
13 529 ARG n 
13 530 GLU n 
13 531 ALA n 
13 532 PHE n 
13 533 TYR n 
13 534 VAL n 
13 535 ASP n 
13 536 ARG n 
13 537 ALA n 
13 538 TYR n 
13 539 ASN n 
13 540 ALA n 
13 541 LEU n 
13 542 ILE n 
13 543 VAL n 
13 544 ASN n 
13 545 PRO n 
13 546 LEU n 
13 547 LYS n 
13 548 ALA n 
13 549 LEU n 
13 550 ALA n 
13 551 GLU n 
13 552 ALA n 
13 553 LEU n 
13 554 PHE n 
13 555 TYR n 
13 556 GLY n 
13 557 ASP n 
13 558 ARG n 
13 559 GLY n 
13 560 LEU n 
13 561 LEU n 
13 562 SER n 
13 563 GLY n 
13 564 TYR n 
13 565 PHE n 
13 566 GLY n 
13 567 LEU n 
13 568 GLY n 
13 569 GLY n 
13 570 ALA n 
13 571 ALA n 
13 572 ARG n 
13 573 SER n 
13 574 LEU n 
13 575 GLY n 
13 576 GLN n 
13 577 GLY n 
13 578 LEU n 
13 579 ALA n 
13 580 ARG n 
13 581 LEU n 
13 582 GLN n 
13 583 THR n 
13 584 GLY n 
13 585 TYR n 
13 586 LEU n 
13 587 ARG n 
13 588 VAL n 
13 589 TYR n 
13 590 ALA n 
13 591 LEU n 
13 592 LEU n 
13 593 PHE n 
13 594 VAL n 
13 595 LEU n 
13 596 GLY n 
13 597 ALA n 
13 598 LEU n 
13 599 LEU n 
13 600 LEU n 
13 601 LEU n 
13 602 GLY n 
13 603 VAL n 
13 604 MET n 
13 605 ARG n 
13 606 TRP n 
14 1   MET n 
14 2   VAL n 
14 3   VAL n 
14 4   LEU n 
14 5   ALA n 
14 6   VAL n 
14 7   LEU n 
14 8   LEU n 
14 9   PRO n 
14 10  VAL n 
14 11  VAL n 
14 12  PHE n 
14 13  GLY n 
14 14  ALA n 
14 15  LEU n 
14 16  LEU n 
14 17  LEU n 
14 18  LEU n 
14 19  GLY n 
14 20  LEU n 
14 21  PRO n 
14 22  ARG n 
14 23  ALA n 
14 24  LEU n 
14 25  GLY n 
14 26  VAL n 
14 27  LEU n 
14 28  GLY n 
14 29  ALA n 
14 30  GLY n 
14 31  LEU n 
14 32  SER n 
14 33  PHE n 
14 34  LEU n 
14 35  LEU n 
14 36  ASN n 
14 37  LEU n 
14 38  TYR n 
14 39  LEU n 
14 40  PHE n 
14 41  LEU n 
14 42  THR n 
14 43  HIS n 
14 44  PRO n 
14 45  GLY n 
14 46  GLY n 
14 47  VAL n 
14 48  ALA n 
14 49  HIS n 
14 50  ALA n 
14 51  PHE n 
14 52  GLN n 
14 53  ALA n 
14 54  PRO n 
14 55  LEU n 
14 56  LEU n 
14 57  PRO n 
14 58  GLY n 
14 59  ALA n 
14 60  GLY n 
14 61  VAL n 
14 62  TYR n 
14 63  TRP n 
14 64  ALA n 
14 65  PHE n 
14 66  GLY n 
14 67  LEU n 
14 68  ASP n 
14 69  GLY n 
14 70  LEU n 
14 71  SER n 
14 72  ALA n 
14 73  LEU n 
14 74  PHE n 
14 75  PHE n 
14 76  LEU n 
14 77  THR n 
14 78  ILE n 
14 79  ALA n 
14 80  LEU n 
14 81  THR n 
14 82  VAL n 
14 83  PHE n 
14 84  LEU n 
14 85  GLY n 
14 86  ALA n 
14 87  LEU n 
14 88  VAL n 
14 89  ALA n 
14 90  ARG n 
14 91  VAL n 
14 92  GLU n 
14 93  GLY n 
14 94  ARG n 
14 95  PHE n 
14 96  LEU n 
14 97  GLY n 
14 98  LEU n 
14 99  ALA n 
14 100 LEU n 
14 101 LEU n 
14 102 MET n 
14 103 GLU n 
14 104 GLY n 
14 105 LEU n 
14 106 LEU n 
14 107 LEU n 
14 108 GLY n 
14 109 LEU n 
14 110 PHE n 
14 111 ALA n 
14 112 ALA n 
14 113 ARG n 
14 114 ASP n 
14 115 LEU n 
14 116 LEU n 
14 117 VAL n 
14 118 PHE n 
14 119 TYR n 
14 120 VAL n 
14 121 PHE n 
14 122 PHE n 
14 123 GLU n 
14 124 ALA n 
14 125 ALA n 
14 126 LEU n 
14 127 ILE n 
14 128 PRO n 
14 129 ALA n 
14 130 LEU n 
14 131 LEU n 
14 132 MET n 
14 133 LEU n 
14 134 TYR n 
14 135 LEU n 
14 136 TYR n 
14 137 GLY n 
14 138 GLY n 
14 139 GLU n 
14 140 GLY n 
14 141 ARG n 
14 142 THR n 
14 143 ARG n 
14 144 ALA n 
14 145 LEU n 
14 146 TYR n 
14 147 THR n 
14 148 PHE n 
14 149 VAL n 
14 150 LEU n 
14 151 PHE n 
14 152 THR n 
14 153 LEU n 
14 154 VAL n 
14 155 GLY n 
14 156 SER n 
14 157 LEU n 
14 158 PRO n 
14 159 MET n 
14 160 LEU n 
14 161 ALA n 
14 162 ALA n 
14 163 VAL n 
14 164 LEU n 
14 165 GLY n 
14 166 ALA n 
14 167 ARG n 
14 168 LEU n 
14 169 LEU n 
14 170 SER n 
14 171 GLY n 
14 172 SER n 
14 173 PRO n 
14 174 THR n 
14 175 PHE n 
14 176 LEU n 
14 177 LEU n 
14 178 GLU n 
14 179 ASP n 
14 180 LEU n 
14 181 LEU n 
14 182 ALA n 
14 183 HIS n 
14 184 PRO n 
14 185 LEU n 
14 186 GLN n 
14 187 GLU n 
14 188 GLU n 
14 189 ALA n 
14 190 ALA n 
14 191 PHE n 
14 192 TRP n 
14 193 VAL n 
14 194 PHE n 
14 195 LEU n 
14 196 GLY n 
14 197 PHE n 
14 198 ALA n 
14 199 LEU n 
14 200 ALA n 
14 201 PHE n 
14 202 ALA n 
14 203 ILE n 
14 204 LYS n 
14 205 THR n 
14 206 PRO n 
14 207 LEU n 
14 208 PHE n 
14 209 PRO n 
14 210 LEU n 
14 211 HIS n 
14 212 ALA n 
14 213 TRP n 
14 214 LEU n 
14 215 PRO n 
14 216 PRO n 
14 217 PHE n 
14 218 HIS n 
14 219 GLN n 
14 220 GLU n 
14 221 ASN n 
14 222 HIS n 
14 223 PRO n 
14 224 SER n 
14 225 GLY n 
14 226 LEU n 
14 227 ALA n 
14 228 ASP n 
14 229 ALA n 
14 230 LEU n 
14 231 GLY n 
14 232 THR n 
14 233 LEU n 
14 234 TYR n 
14 235 LYS n 
14 236 VAL n 
14 237 GLY n 
14 238 VAL n 
14 239 PHE n 
14 240 ALA n 
14 241 PHE n 
14 242 PHE n 
14 243 ARG n 
14 244 PHE n 
14 245 ALA n 
14 246 ILE n 
14 247 PRO n 
14 248 LEU n 
14 249 ALA n 
14 250 PRO n 
14 251 GLU n 
14 252 GLY n 
14 253 PHE n 
14 254 ALA n 
14 255 GLN n 
14 256 ALA n 
14 257 GLN n 
14 258 GLY n 
14 259 LEU n 
14 260 LEU n 
14 261 LEU n 
14 262 PHE n 
14 263 LEU n 
14 264 ALA n 
14 265 ALA n 
14 266 LEU n 
14 267 SER n 
14 268 ALA n 
14 269 LEU n 
14 270 TYR n 
14 271 GLY n 
14 272 ALA n 
14 273 TRP n 
14 274 VAL n 
14 275 ALA n 
14 276 PHE n 
14 277 ALA n 
14 278 ALA n 
14 279 LYS n 
14 280 ASP n 
14 281 PHE n 
14 282 LYS n 
14 283 THR n 
14 284 LEU n 
14 285 LEU n 
14 286 ALA n 
14 287 TYR n 
14 288 ALA n 
14 289 GLY n 
14 290 LEU n 
14 291 SER n 
14 292 HIS n 
14 293 MET n 
14 294 GLY n 
14 295 VAL n 
14 296 ALA n 
14 297 ALA n 
14 298 LEU n 
14 299 GLY n 
14 300 VAL n 
14 301 PHE n 
14 302 SER n 
14 303 GLY n 
14 304 THR n 
14 305 PRO n 
14 306 GLU n 
14 307 GLY n 
14 308 ALA n 
14 309 MET n 
14 310 GLY n 
14 311 GLY n 
14 312 LEU n 
14 313 TYR n 
14 314 LEU n 
14 315 LEU n 
14 316 ALA n 
14 317 ALA n 
14 318 SER n 
14 319 GLY n 
14 320 VAL n 
14 321 TYR n 
14 322 THR n 
14 323 GLY n 
14 324 GLY n 
14 325 LEU n 
14 326 PHE n 
14 327 LEU n 
14 328 LEU n 
14 329 ALA n 
14 330 GLY n 
14 331 ARG n 
14 332 LEU n 
14 333 TYR n 
14 334 GLU n 
14 335 ARG n 
14 336 THR n 
14 337 GLY n 
14 338 THR n 
14 339 LEU n 
14 340 GLU n 
14 341 ILE n 
14 342 GLY n 
14 343 ARG n 
14 344 TYR n 
14 345 ARG n 
14 346 GLY n 
14 347 LEU n 
14 348 ALA n 
14 349 GLN n 
14 350 SER n 
14 351 ALA n 
14 352 PRO n 
14 353 GLY n 
14 354 LEU n 
14 355 ALA n 
14 356 ALA n 
14 357 LEU n 
14 358 ALA n 
14 359 LEU n 
14 360 ILE n 
14 361 LEU n 
14 362 PHE n 
14 363 LEU n 
14 364 ALA n 
14 365 MET n 
14 366 VAL n 
14 367 GLY n 
14 368 LEU n 
14 369 PRO n 
14 370 GLY n 
14 371 LEU n 
14 372 SER n 
14 373 GLY n 
14 374 PHE n 
14 375 PRO n 
14 376 GLY n 
14 377 GLU n 
14 378 PHE n 
14 379 LEU n 
14 380 THR n 
14 381 LEU n 
14 382 LEU n 
14 383 GLY n 
14 384 ALA n 
14 385 TYR n 
14 386 LYS n 
14 387 ALA n 
14 388 SER n 
14 389 PRO n 
14 390 TRP n 
14 391 LEU n 
14 392 ALA n 
14 393 ALA n 
14 394 LEU n 
14 395 ALA n 
14 396 PHE n 
14 397 LEU n 
14 398 SER n 
14 399 VAL n 
14 400 ILE n 
14 401 ALA n 
14 402 SER n 
14 403 ALA n 
14 404 ALA n 
14 405 TYR n 
14 406 ALA n 
14 407 LEU n 
14 408 THR n 
14 409 ALA n 
14 410 PHE n 
14 411 GLN n 
14 412 LYS n 
14 413 THR n 
14 414 PHE n 
14 415 TRP n 
14 416 GLU n 
14 417 GLU n 
14 418 GLY n 
14 419 GLY n 
14 420 SER n 
14 421 GLY n 
14 422 VAL n 
14 423 LYS n 
14 424 ASP n 
14 425 LEU n 
14 426 ALA n 
14 427 GLY n 
14 428 ALA n 
14 429 GLU n 
14 430 TRP n 
14 431 GLY n 
14 432 PHE n 
14 433 ALA n 
14 434 LEU n 
14 435 LEU n 
14 436 SER n 
14 437 VAL n 
14 438 LEU n 
14 439 ALA n 
14 440 LEU n 
14 441 LEU n 
14 442 LEU n 
14 443 MET n 
14 444 GLY n 
14 445 VAL n 
14 446 PHE n 
14 447 PRO n 
14 448 GLY n 
14 449 TYR n 
14 450 PHE n 
14 451 ALA n 
14 452 ARG n 
14 453 GLY n 
14 454 LEU n 
14 455 HIS n 
14 456 PRO n 
14 457 LEU n 
14 458 ALA n 
14 459 GLU n 
14 460 ALA n 
14 461 PHE n 
14 462 ALA n 
14 463 LYS n 
14 464 LEU n 
14 465 LEU n 
14 466 GLY n 
14 467 GLY n 
14 468 GLY n 
14 469 ALA n 
15 1   MET n 
15 2   THR n 
15 3   LEU n 
15 4   ALA n 
15 5   ILE n 
15 6   LEU n 
15 7   ALA n 
15 8   VAL n 
15 9   PHE n 
15 10  SER n 
15 11  VAL n 
15 12  ALA n 
15 13  LEU n 
15 14  THR n 
15 15  LEU n 
15 16  LEU n 
15 17  GLY n 
15 18  PHE n 
15 19  VAL n 
15 20  LEU n 
15 21  PRO n 
15 22  PRO n 
15 23  GLN n 
15 24  GLY n 
15 25  VAL n 
15 26  LYS n 
15 27  ARG n 
15 28  ALA n 
15 29  THR n 
15 30  LEU n 
15 31  LEU n 
15 32  GLY n 
15 33  LEU n 
15 34  ALA n 
15 35  LEU n 
15 36  ALA n 
15 37  LEU n 
15 38  ALA n 
15 39  SER n 
15 40  LEU n 
15 41  LEU n 
15 42  LEU n 
15 43  THR n 
15 44  TRP n 
15 45  GLY n 
15 46  LYS n 
15 47  PRO n 
15 48  PHE n 
15 49  ALA n 
15 50  PHE n 
15 51  GLY n 
15 52  PRO n 
15 53  TYR n 
15 54  ALA n 
15 55  VAL n 
15 56  ASP n 
15 57  GLY n 
15 58  VAL n 
15 59  SER n 
15 60  GLN n 
15 61  VAL n 
15 62  PHE n 
15 63  THR n 
15 64  LEU n 
15 65  LEU n 
15 66  ALA n 
15 67  LEU n 
15 68  LEU n 
15 69  GLY n 
15 70  ALA n 
15 71  LEU n 
15 72  TRP n 
15 73  THR n 
15 74  VAL n 
15 75  GLY n 
15 76  LEU n 
15 77  VAL n 
15 78  ARG n 
15 79  SER n 
15 80  GLY n 
15 81  ARG n 
15 82  PHE n 
15 83  GLU n 
15 84  PHE n 
15 85  TYR n 
15 86  LEU n 
15 87  LEU n 
15 88  VAL n 
15 89  LEU n 
15 90  TYR n 
15 91  ALA n 
15 92  ALA n 
15 93  LEU n 
15 94  GLY n 
15 95  MET n 
15 96  HIS n 
15 97  LEU n 
15 98  LEU n 
15 99  ALA n 
15 100 SER n 
15 101 THR n 
15 102 ARG n 
15 103 HIS n 
15 104 LEU n 
15 105 LEU n 
15 106 LEU n 
15 107 MET n 
15 108 LEU n 
15 109 VAL n 
15 110 ALA n 
15 111 LEU n 
15 112 GLU n 
15 113 ALA n 
15 114 LEU n 
15 115 SER n 
15 116 LEU n 
15 117 PRO n 
15 118 LEU n 
15 119 TYR n 
15 120 ALA n 
15 121 LEU n 
15 122 ALA n 
15 123 THR n 
15 124 TRP n 
15 125 ARG n 
15 126 ARG n 
15 127 GLY n 
15 128 GLN n 
15 129 GLY n 
15 130 LEU n 
15 131 GLU n 
15 132 ALA n 
15 133 ALA n 
15 134 LEU n 
15 135 LYS n 
15 136 TYR n 
15 137 PHE n 
15 138 LEU n 
15 139 LEU n 
15 140 GLY n 
15 141 ALA n 
15 142 LEU n 
15 143 ALA n 
15 144 ALA n 
15 145 ALA n 
15 146 PHE n 
15 147 PHE n 
15 148 LEU n 
15 149 TYR n 
15 150 GLY n 
15 151 ALA n 
15 152 ALA n 
15 153 LEU n 
15 154 PHE n 
15 155 TYR n 
15 156 GLY n 
15 157 ALA n 
15 158 THR n 
15 159 GLY n 
15 160 SER n 
15 161 LEU n 
15 162 VAL n 
15 163 LEU n 
15 164 GLY n 
15 165 ALA n 
15 166 PRO n 
15 167 GLY n 
15 168 GLU n 
15 169 GLY n 
15 170 PRO n 
15 171 LEU n 
15 172 TYR n 
15 173 ALA n 
15 174 LEU n 
15 175 ALA n 
15 176 LEU n 
15 177 GLY n 
15 178 LEU n 
15 179 LEU n 
15 180 LEU n 
15 181 VAL n 
15 182 GLY n 
15 183 LEU n 
15 184 GLY n 
15 185 PHE n 
15 186 LYS n 
15 187 ALA n 
15 188 ALA n 
15 189 LEU n 
15 190 ALA n 
15 191 PRO n 
15 192 PHE n 
15 193 HIS n 
15 194 PHE n 
15 195 TRP n 
15 196 THR n 
15 197 PRO n 
15 198 ASP n 
15 199 VAL n 
15 200 TYR n 
15 201 GLN n 
15 202 GLY n 
15 203 SER n 
15 204 PRO n 
15 205 THR n 
15 206 PRO n 
15 207 VAL n 
15 208 VAL n 
15 209 LEU n 
15 210 PHE n 
15 211 MET n 
15 212 ALA n 
15 213 THR n 
15 214 SER n 
15 215 VAL n 
15 216 LYS n 
15 217 ALA n 
15 218 ALA n 
15 219 ALA n 
15 220 PHE n 
15 221 ALA n 
15 222 ALA n 
15 223 LEU n 
15 224 LEU n 
15 225 ARG n 
15 226 VAL n 
15 227 ALA n 
15 228 ALA n 
15 229 PRO n 
15 230 PRO n 
15 231 GLU n 
15 232 ALA n 
15 233 LEU n 
15 234 ALA n 
15 235 LEU n 
15 236 LEU n 
15 237 VAL n 
15 238 ALA n 
15 239 LEU n 
15 240 SER n 
15 241 VAL n 
15 242 VAL n 
15 243 VAL n 
15 244 GLY n 
15 245 ASN n 
15 246 LEU n 
15 247 ALA n 
15 248 ALA n 
15 249 LEU n 
15 250 ALA n 
15 251 GLN n 
15 252 LYS n 
15 253 GLU n 
15 254 ALA n 
15 255 LYS n 
15 256 ARG n 
15 257 LEU n 
15 258 LEU n 
15 259 ALA n 
15 260 TYR n 
15 261 SER n 
15 262 SER n 
15 263 ILE n 
15 264 ALA n 
15 265 HIS n 
15 266 ALA n 
15 267 GLY n 
15 268 TYR n 
15 269 MET n 
15 270 ALA n 
15 271 LEU n 
15 272 ALA n 
15 273 LEU n 
15 274 TYR n 
15 275 THR n 
15 276 GLY n 
15 277 ASN n 
15 278 ALA n 
15 279 GLN n 
15 280 ALA n 
15 281 LEU n 
15 282 GLY n 
15 283 PHE n 
15 284 TYR n 
15 285 LEU n 
15 286 LEU n 
15 287 THR n 
15 288 TYR n 
15 289 VAL n 
15 290 LEU n 
15 291 ALA n 
15 292 THR n 
15 293 GLY n 
15 294 LEU n 
15 295 ALA n 
15 296 PHE n 
15 297 ALA n 
15 298 VAL n 
15 299 LEU n 
15 300 SER n 
15 301 GLN n 
15 302 ILE n 
15 303 SER n 
15 304 PRO n 
15 305 ASP n 
15 306 ARG n 
15 307 VAL n 
15 308 PRO n 
15 309 LEU n 
15 310 GLU n 
15 311 ALA n 
15 312 LEU n 
15 313 ARG n 
15 314 GLY n 
15 315 LEU n 
15 316 TYR n 
15 317 ARG n 
15 318 LYS n 
15 319 ASP n 
15 320 PRO n 
15 321 LEU n 
15 322 LEU n 
15 323 GLY n 
15 324 LEU n 
15 325 ALA n 
15 326 PHE n 
15 327 LEU n 
15 328 VAL n 
15 329 ALA n 
15 330 MET n 
15 331 LEU n 
15 332 SER n 
15 333 LEU n 
15 334 LEU n 
15 335 GLY n 
15 336 LEU n 
15 337 PRO n 
15 338 PRO n 
15 339 LEU n 
15 340 ALA n 
15 341 GLY n 
15 342 PHE n 
15 343 TRP n 
15 344 GLY n 
15 345 LYS n 
15 346 TYR n 
15 347 LEU n 
15 348 ALA n 
15 349 PHE n 
15 350 ALA n 
15 351 GLU n 
15 352 ALA n 
15 353 ALA n 
15 354 ARG n 
15 355 ALA n 
15 356 GLY n 
15 357 ALA n 
15 358 TRP n 
15 359 GLY n 
15 360 VAL n 
15 361 LEU n 
15 362 VAL n 
15 363 LEU n 
15 364 ALA n 
15 365 LEU n 
15 366 VAL n 
15 367 THR n 
15 368 SER n 
15 369 ALA n 
15 370 VAL n 
15 371 SER n 
15 372 ALA n 
15 373 TYR n 
15 374 TYR n 
15 375 TYR n 
15 376 LEU n 
15 377 GLY n 
15 378 LEU n 
15 379 GLY n 
15 380 LEU n 
15 381 ALA n 
15 382 VAL n 
15 383 PHE n 
15 384 ALA n 
15 385 ARG n 
15 386 PRO n 
15 387 GLU n 
15 388 GLU n 
15 389 THR n 
15 390 PRO n 
15 391 PHE n 
15 392 ARG n 
15 393 PRO n 
15 394 GLY n 
15 395 PRO n 
15 396 PRO n 
15 397 TRP n 
15 398 ALA n 
15 399 ARG n 
15 400 ALA n 
15 401 ALA n 
15 402 VAL n 
15 403 VAL n 
15 404 ALA n 
15 405 ALA n 
15 406 GLY n 
15 407 VAL n 
15 408 LEU n 
15 409 LEU n 
15 410 LEU n 
15 411 ALA n 
15 412 LEU n 
15 413 GLY n 
15 414 LEU n 
15 415 LEU n 
15 416 PRO n 
15 417 GLY n 
15 418 LEU n 
15 419 VAL n 
15 420 LEU n 
15 421 PRO n 
15 422 ALA n 
15 423 LEU n 
15 424 ALA n 
15 425 ALA n 
15 426 GLY n 
15 427 GLY n 
16 1   MET n 
16 2   THR n 
16 3   TRP n 
16 4   SER n 
16 5   TYR n 
16 6   PRO n 
16 7   VAL n 
16 8   ASP n 
16 9   PRO n 
16 10  TYR n 
16 11  TRP n 
16 12  MET n 
16 13  VAL n 
16 14  ALA n 
16 15  LEU n 
16 16  LYS n 
16 17  ALA n 
16 18  LEU n 
16 19  LEU n 
16 20  VAL n 
16 21  VAL n 
16 22  VAL n 
16 23  GLY n 
16 24  LEU n 
16 25  LEU n 
16 26  THR n 
16 27  ALA n 
16 28  PHE n 
16 29  ALA n 
16 30  PHE n 
16 31  MET n 
16 32  THR n 
16 33  LEU n 
16 34  ILE n 
16 35  GLU n 
16 36  ARG n 
16 37  ARG n 
16 38  LEU n 
16 39  LEU n 
16 40  ALA n 
16 41  ARG n 
16 42  PHE n 
16 43  GLN n 
16 44  VAL n 
16 45  ARG n 
16 46  MET n 
16 47  GLY n 
16 48  PRO n 
16 49  ASN n 
16 50  ARG n 
16 51  VAL n 
16 52  GLY n 
16 53  PRO n 
16 54  PHE n 
16 55  GLY n 
16 56  LEU n 
16 57  LEU n 
16 58  GLN n 
16 59  PRO n 
16 60  LEU n 
16 61  ALA n 
16 62  ASP n 
16 63  ALA n 
16 64  ILE n 
16 65  LYS n 
16 66  SER n 
16 67  ILE n 
16 68  PHE n 
16 69  LYS n 
16 70  GLU n 
16 71  ASP n 
16 72  ILE n 
16 73  VAL n 
16 74  VAL n 
16 75  ALA n 
16 76  GLN n 
16 77  ALA n 
16 78  ASP n 
16 79  ARG n 
16 80  PHE n 
16 81  LEU n 
16 82  PHE n 
16 83  VAL n 
16 84  LEU n 
16 85  ALA n 
16 86  PRO n 
16 87  LEU n 
16 88  ILE n 
16 89  SER n 
16 90  VAL n 
16 91  VAL n 
16 92  PHE n 
16 93  ALA n 
16 94  LEU n 
16 95  LEU n 
16 96  ALA n 
16 97  PHE n 
16 98  GLY n 
16 99  LEU n 
16 100 ILE n 
16 101 PRO n 
16 102 PHE n 
16 103 GLY n 
16 104 PRO n 
16 105 PRO n 
16 106 GLY n 
16 107 SER n 
16 108 PHE n 
16 109 PHE n 
16 110 GLY n 
16 111 TYR n 
16 112 GLN n 
16 113 PRO n 
16 114 TRP n 
16 115 VAL n 
16 116 ILE n 
16 117 ASN n 
16 118 LEU n 
16 119 ASP n 
16 120 LEU n 
16 121 GLY n 
16 122 ILE n 
16 123 LEU n 
16 124 TYR n 
16 125 LEU n 
16 126 PHE n 
16 127 ALA n 
16 128 VAL n 
16 129 SER n 
16 130 GLU n 
16 131 LEU n 
16 132 ALA n 
16 133 VAL n 
16 134 TYR n 
16 135 GLY n 
16 136 ILE n 
16 137 PHE n 
16 138 LEU n 
16 139 SER n 
16 140 GLY n 
16 141 TRP n 
16 142 ALA n 
16 143 SER n 
16 144 GLY n 
16 145 SER n 
16 146 LYS n 
16 147 TYR n 
16 148 SER n 
16 149 LEU n 
16 150 LEU n 
16 151 GLY n 
16 152 SER n 
16 153 LEU n 
16 154 ARG n 
16 155 SER n 
16 156 SER n 
16 157 ALA n 
16 158 SER n 
16 159 LEU n 
16 160 ILE n 
16 161 SER n 
16 162 TYR n 
16 163 GLU n 
16 164 LEU n 
16 165 GLY n 
16 166 LEU n 
16 167 GLY n 
16 168 LEU n 
16 169 ALA n 
16 170 LEU n 
16 171 LEU n 
16 172 ALA n 
16 173 PRO n 
16 174 VAL n 
16 175 LEU n 
16 176 LEU n 
16 177 VAL n 
16 178 GLY n 
16 179 SER n 
16 180 LEU n 
16 181 ASN n 
16 182 LEU n 
16 183 ASN n 
16 184 ASP n 
16 185 ILE n 
16 186 VAL n 
16 187 ASN n 
16 188 TRP n 
16 189 GLN n 
16 190 LYS n 
16 191 GLU n 
16 192 HIS n 
16 193 GLY n 
16 194 TRP n 
16 195 LEU n 
16 196 PHE n 
16 197 LEU n 
16 198 TYR n 
16 199 ALA n 
16 200 PHE n 
16 201 PRO n 
16 202 ALA n 
16 203 PHE n 
16 204 LEU n 
16 205 VAL n 
16 206 TYR n 
16 207 LEU n 
16 208 ILE n 
16 209 ALA n 
16 210 SER n 
16 211 MET n 
16 212 ALA n 
16 213 GLU n 
16 214 ALA n 
16 215 ALA n 
16 216 ARG n 
16 217 THR n 
16 218 PRO n 
16 219 PHE n 
16 220 ASP n 
16 221 LEU n 
16 222 PRO n 
16 223 GLU n 
16 224 ALA n 
16 225 GLU n 
16 226 GLN n 
16 227 GLU n 
16 228 LEU n 
16 229 VAL n 
16 230 GLY n 
16 231 GLY n 
16 232 TYR n 
16 233 HIS n 
16 234 THR n 
16 235 GLU n 
16 236 TYR n 
16 237 SER n 
16 238 SER n 
16 239 ILE n 
16 240 LYS n 
16 241 TRP n 
16 242 ALA n 
16 243 LEU n 
16 244 PHE n 
16 245 GLN n 
16 246 MET n 
16 247 ALA n 
16 248 GLU n 
16 249 TYR n 
16 250 ILE n 
16 251 HIS n 
16 252 PHE n 
16 253 ILE n 
16 254 THR n 
16 255 ALA n 
16 256 SER n 
16 257 ALA n 
16 258 LEU n 
16 259 ILE n 
16 260 PRO n 
16 261 THR n 
16 262 LEU n 
16 263 PHE n 
16 264 LEU n 
16 265 GLY n 
16 266 GLY n 
16 267 TRP n 
16 268 THR n 
16 269 MET n 
16 270 PRO n 
16 271 VAL n 
16 272 LEU n 
16 273 GLU n 
16 274 VAL n 
16 275 PRO n 
16 276 TYR n 
16 277 LEU n 
16 278 TRP n 
16 279 MET n 
16 280 PHE n 
16 281 LEU n 
16 282 LYS n 
16 283 ILE n 
16 284 ALA n 
16 285 PHE n 
16 286 PHE n 
16 287 LEU n 
16 288 PHE n 
16 289 PHE n 
16 290 PHE n 
16 291 ILE n 
16 292 TRP n 
16 293 ILE n 
16 294 ARG n 
16 295 ALA n 
16 296 THR n 
16 297 TRP n 
16 298 PHE n 
16 299 ARG n 
16 300 LEU n 
16 301 ARG n 
16 302 TYR n 
16 303 ASP n 
16 304 GLN n 
16 305 LEU n 
16 306 LEU n 
16 307 ARG n 
16 308 PHE n 
16 309 GLY n 
16 310 TRP n 
16 311 GLY n 
16 312 PHE n 
16 313 LEU n 
16 314 PHE n 
16 315 PRO n 
16 316 LEU n 
16 317 ALA n 
16 318 LEU n 
16 319 LEU n 
16 320 TRP n 
16 321 PHE n 
16 322 LEU n 
16 323 VAL n 
16 324 THR n 
16 325 ALA n 
16 326 LEU n 
16 327 VAL n 
16 328 VAL n 
16 329 ALA n 
16 330 LEU n 
16 331 ASP n 
16 332 LEU n 
16 333 PRO n 
16 334 ARG n 
16 335 THR n 
16 336 TYR n 
16 337 LEU n 
16 338 LEU n 
16 339 TYR n 
16 340 LEU n 
16 341 SER n 
16 342 ALA n 
16 343 LEU n 
16 344 SER n 
16 345 PHE n 
16 346 LEU n 
16 347 VAL n 
16 348 LEU n 
16 349 LEU n 
16 350 GLY n 
16 351 ALA n 
16 352 VAL n 
16 353 LEU n 
16 354 TYR n 
16 355 THR n 
16 356 PRO n 
16 357 LYS n 
16 358 PRO n 
16 359 ALA n 
16 360 ARG n 
16 361 LYS n 
16 362 GLY n 
16 363 GLY n 
16 364 GLY n 
16 365 ALA n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample 1 438 ? 'Thermus thermophilus' 274 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample 1 181 ? 'Thermus thermophilus' 274 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample 1 783 ? 'Thermus thermophilus' 274 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample 1 409 ? 'Thermus thermophilus' 274 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample 1 207 ? 'Thermus thermophilus' 274 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample 1 181 ? 'Thermus thermophilus' 274 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample 1 182 ? 'Thermus thermophilus' 274 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample 1 129 ? 'Thermus thermophilus' 274 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample 1 131 ? 'Thermus thermophilus' 274 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample 1 119 ? 'Thermus thermophilus' 274 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample 1 176 ? 'Thermus thermophilus' 274 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample 1 95  ? 'Thermus thermophilus' 274 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample 1 606 ? 'Thermus thermophilus' 274 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
14 1 sample 1 469 ? 'Thermus thermophilus' 274 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
15 1 sample 1 427 ? 'Thermus thermophilus' 274 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
16 1 sample 1 365 ? 'Thermus thermophilus' 274 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                      ?                          'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                     ?                          'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ?                          'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ?                          'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                     ?                          'C3 H7 N O2 S'    121.158 
FES non-polymer         . 'FE2/S2 (INORGANIC) CLUSTER' ?                          'Fe2 S2'          175.820 
FMN non-polymer         . 'FLAVIN MONONUCLEOTIDE'      'RIBOFLAVIN MONOPHOSPHATE' 'C17 H21 N4 O9 P' 456.344 
GLN 'L-peptide linking' y GLUTAMINE                    ?                          'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ?                          'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                      ?                          'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                    ?                          'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                   ?                          'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                      ?                          'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                       ?                          'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                   ?                          'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                ?                          'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                      ?                          'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                       ?                          'C3 H7 N O3'      105.093 
SF4 non-polymer         . 'IRON/SULFUR CLUSTER'        ?                          'Fe4 S4'          351.640 
THR 'L-peptide linking' y THREONINE                    ?                          'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ?                          'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                     ?                          'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                       ?                          'C5 H11 N O2'     117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A  1  1   MET 1   1   ?   ?   ?   1 . n 
A  1  2   THR 2   2   2   THR THR 1 . n 
A  1  3   GLY 3   3   3   GLY GLY 1 . n 
A  1  4   PRO 4   4   4   PRO PRO 1 . n 
A  1  5   ILE 5   5   5   ILE ILE 1 . n 
A  1  6   LEU 6   6   6   LEU LEU 1 . n 
A  1  7   SER 7   7   7   SER SER 1 . n 
A  1  8   GLY 8   8   8   GLY GLY 1 . n 
A  1  9   LEU 9   9   9   LEU LEU 1 . n 
A  1  10  ASP 10  10  10  ASP ASP 1 . n 
A  1  11  PRO 11  11  11  PRO PRO 1 . n 
A  1  12  ARG 12  12  12  ARG ARG 1 . n 
A  1  13  PHE 13  13  13  PHE PHE 1 . n 
A  1  14  GLU 14  14  14  GLU GLU 1 . n 
A  1  15  ARG 15  15  15  ARG ARG 1 . n 
A  1  16  THR 16  16  16  THR THR 1 . n 
A  1  17  LEU 17  17  17  LEU LEU 1 . n 
A  1  18  TYR 18  18  18  TYR TYR 1 . n 
A  1  19  ALA 19  19  19  ALA ALA 1 . n 
A  1  20  HIS 20  20  20  HIS HIS 1 . n 
A  1  21  VAL 21  21  21  VAL VAL 1 . n 
A  1  22  GLY 22  22  22  GLY GLY 1 . n 
A  1  23  LYS 23  23  23  LYS LYS 1 . n 
A  1  24  GLU 24  24  24  GLU GLU 1 . n 
A  1  25  GLY 25  25  25  GLY GLY 1 . n 
A  1  26  SER 26  26  26  SER SER 1 . n 
A  1  27  TRP 27  27  27  TRP TRP 1 . n 
A  1  28  THR 28  28  28  THR THR 1 . n 
A  1  29  LEU 29  29  29  LEU LEU 1 . n 
A  1  30  ASP 30  30  30  ASP ASP 1 . n 
A  1  31  TYR 31  31  31  TYR TYR 1 . n 
A  1  32  TYR 32  32  32  TYR TYR 1 . n 
A  1  33  LEU 33  33  33  LEU LEU 1 . n 
A  1  34  ARG 34  34  34  ARG ARG 1 . n 
A  1  35  HIS 35  35  35  HIS HIS 1 . n 
A  1  36  GLY 36  36  36  GLY GLY 1 . n 
A  1  37  GLY 37  37  37  GLY GLY 1 . n 
A  1  38  TYR 38  38  38  TYR TYR 1 . n 
A  1  39  GLU 39  39  39  GLU GLU 1 . n 
A  1  40  THR 40  40  40  THR THR 1 . n 
A  1  41  ALA 41  41  41  ALA ALA 1 . n 
A  1  42  LYS 42  42  42  LYS LYS 1 . n 
A  1  43  ARG 43  43  43  ARG ARG 1 . n 
A  1  44  VAL 44  44  44  VAL VAL 1 . n 
A  1  45  LEU 45  45  45  LEU LEU 1 . n 
A  1  46  LYS 46  46  46  LYS LYS 1 . n 
A  1  47  GLU 47  47  47  GLU GLU 1 . n 
A  1  48  LYS 48  48  48  LYS LYS 1 . n 
A  1  49  THR 49  49  49  THR THR 1 . n 
A  1  50  PRO 50  50  50  PRO PRO 1 . n 
A  1  51  ASP 51  51  51  ASP ASP 1 . n 
A  1  52  GLU 52  52  52  GLU GLU 1 . n 
A  1  53  VAL 53  53  53  VAL VAL 1 . n 
A  1  54  ILE 54  54  54  ILE ILE 1 . n 
A  1  55  GLU 55  55  55  GLU GLU 1 . n 
A  1  56  GLU 56  56  56  GLU GLU 1 . n 
A  1  57  VAL 57  57  57  VAL VAL 1 . n 
A  1  58  LYS 58  58  58  LYS LYS 1 . n 
A  1  59  ARG 59  59  59  ARG ARG 1 . n 
A  1  60  SER 60  60  60  SER SER 1 . n 
A  1  61  GLY 61  61  61  GLY GLY 1 . n 
A  1  62  LEU 62  62  62  LEU LEU 1 . n 
A  1  63  ARG 63  63  63  ARG ARG 1 . n 
A  1  64  GLY 64  64  64  GLY GLY 1 . n 
A  1  65  ARG 65  65  65  ARG ARG 1 . n 
A  1  66  GLY 66  66  66  GLY GLY 1 . n 
A  1  67  GLY 67  67  67  GLY GLY 1 . n 
A  1  68  ALA 68  68  68  ALA ALA 1 . n 
A  1  69  GLY 69  69  69  GLY GLY 1 . n 
A  1  70  PHE 70  70  70  PHE PHE 1 . n 
A  1  71  PRO 71  71  71  PRO PRO 1 . n 
A  1  72  THR 72  72  72  THR THR 1 . n 
A  1  73  GLY 73  73  73  GLY GLY 1 . n 
A  1  74  LEU 74  74  74  LEU LEU 1 . n 
A  1  75  LYS 75  75  75  LYS LYS 1 . n 
A  1  76  TRP 76  76  76  TRP TRP 1 . n 
A  1  77  SER 77  77  77  SER SER 1 . n 
A  1  78  PHE 78  78  78  PHE PHE 1 . n 
A  1  79  MET 79  79  79  MET MET 1 . n 
A  1  80  PRO 80  80  80  PRO PRO 1 . n 
A  1  81  LYS 81  81  81  LYS LYS 1 . n 
A  1  82  ASP 82  82  82  ASP ASP 1 . n 
A  1  83  ASP 83  83  83  ASP ASP 1 . n 
A  1  84  GLY 84  84  84  GLY GLY 1 . n 
A  1  85  LYS 85  85  85  LYS LYS 1 . n 
A  1  86  GLN 86  86  86  GLN GLN 1 . n 
A  1  87  HIS 87  87  87  HIS HIS 1 . n 
A  1  88  TYR 88  88  88  TYR TYR 1 . n 
A  1  89  LEU 89  89  89  LEU LEU 1 . n 
A  1  90  ILE 90  90  90  ILE ILE 1 . n 
A  1  91  CYS 91  91  91  CYS CYS 1 . n 
A  1  92  ASN 92  92  92  ASN ASN 1 . n 
A  1  93  ALA 93  93  93  ALA ALA 1 . n 
A  1  94  ASP 94  94  94  ASP ASP 1 . n 
A  1  95  GLU 95  95  95  GLU GLU 1 . n 
A  1  96  SER 96  96  96  SER SER 1 . n 
A  1  97  GLU 97  97  97  GLU GLU 1 . n 
A  1  98  PRO 98  98  98  PRO PRO 1 . n 
A  1  99  GLY 99  99  99  GLY GLY 1 . n 
A  1  100 SER 100 100 100 SER SER 1 . n 
A  1  101 PHE 101 101 101 PHE PHE 1 . n 
A  1  102 LYS 102 102 102 LYS LYS 1 . n 
A  1  103 ASP 103 103 103 ASP ASP 1 . n 
A  1  104 ARG 104 104 104 ARG ARG 1 . n 
A  1  105 TYR 105 105 105 TYR TYR 1 . n 
A  1  106 ILE 106 106 106 ILE ILE 1 . n 
A  1  107 LEU 107 107 107 LEU LEU 1 . n 
A  1  108 GLU 108 108 108 GLU GLU 1 . n 
A  1  109 ASP 109 109 109 ASP ASP 1 . n 
A  1  110 VAL 110 110 110 VAL VAL 1 . n 
A  1  111 PRO 111 111 111 PRO PRO 1 . n 
A  1  112 HIS 112 112 112 HIS HIS 1 . n 
A  1  113 LEU 113 113 113 LEU LEU 1 . n 
A  1  114 LEU 114 114 114 LEU LEU 1 . n 
A  1  115 ILE 115 115 115 ILE ILE 1 . n 
A  1  116 GLU 116 116 116 GLU GLU 1 . n 
A  1  117 GLY 117 117 117 GLY GLY 1 . n 
A  1  118 MET 118 118 118 MET MET 1 . n 
A  1  119 ILE 119 119 119 ILE ILE 1 . n 
A  1  120 LEU 120 120 120 LEU LEU 1 . n 
A  1  121 ALA 121 121 121 ALA ALA 1 . n 
A  1  122 GLY 122 122 122 GLY GLY 1 . n 
A  1  123 TYR 123 123 123 TYR TYR 1 . n 
A  1  124 ALA 124 124 124 ALA ALA 1 . n 
A  1  125 ILE 125 125 125 ILE ILE 1 . n 
A  1  126 ARG 126 126 126 ARG ARG 1 . n 
A  1  127 ALA 127 127 127 ALA ALA 1 . n 
A  1  128 THR 128 128 128 THR THR 1 . n 
A  1  129 VAL 129 129 129 VAL VAL 1 . n 
A  1  130 GLY 130 130 130 GLY GLY 1 . n 
A  1  131 TYR 131 131 131 TYR TYR 1 . n 
A  1  132 ILE 132 132 132 ILE ILE 1 . n 
A  1  133 TYR 133 133 133 TYR TYR 1 . n 
A  1  134 VAL 134 134 134 VAL VAL 1 . n 
A  1  135 ARG 135 135 135 ARG ARG 1 . n 
A  1  136 GLY 136 136 136 GLY GLY 1 . n 
A  1  137 GLU 137 137 137 GLU GLU 1 . n 
A  1  138 TYR 138 138 138 TYR TYR 1 . n 
A  1  139 ARG 139 139 139 ARG ARG 1 . n 
A  1  140 ARG 140 140 140 ARG ARG 1 . n 
A  1  141 ALA 141 141 141 ALA ALA 1 . n 
A  1  142 ALA 142 142 142 ALA ALA 1 . n 
A  1  143 ASP 143 143 143 ASP ASP 1 . n 
A  1  144 ARG 144 144 144 ARG ARG 1 . n 
A  1  145 LEU 145 145 145 LEU LEU 1 . n 
A  1  146 GLU 146 146 146 GLU GLU 1 . n 
A  1  147 GLN 147 147 147 GLN GLN 1 . n 
A  1  148 ALA 148 148 148 ALA ALA 1 . n 
A  1  149 ILE 149 149 149 ILE ILE 1 . n 
A  1  150 LYS 150 150 150 LYS LYS 1 . n 
A  1  151 GLU 151 151 151 GLU GLU 1 . n 
A  1  152 ALA 152 152 152 ALA ALA 1 . n 
A  1  153 ARG 153 153 153 ARG ARG 1 . n 
A  1  154 ALA 154 154 154 ALA ALA 1 . n 
A  1  155 ARG 155 155 155 ARG ARG 1 . n 
A  1  156 GLY 156 156 156 GLY GLY 1 . n 
A  1  157 TYR 157 157 157 TYR TYR 1 . n 
A  1  158 LEU 158 158 158 LEU LEU 1 . n 
A  1  159 GLY 159 159 159 GLY GLY 1 . n 
A  1  160 LYS 160 160 160 LYS LYS 1 . n 
A  1  161 ASN 161 161 161 ASN ASN 1 . n 
A  1  162 LEU 162 162 162 LEU LEU 1 . n 
A  1  163 PHE 163 163 163 PHE PHE 1 . n 
A  1  164 GLY 164 164 164 GLY GLY 1 . n 
A  1  165 THR 165 165 165 THR THR 1 . n 
A  1  166 ASP 166 166 166 ASP ASP 1 . n 
A  1  167 PHE 167 167 167 PHE PHE 1 . n 
A  1  168 SER 168 168 168 SER SER 1 . n 
A  1  169 PHE 169 169 169 PHE PHE 1 . n 
A  1  170 ASP 170 170 170 ASP ASP 1 . n 
A  1  171 LEU 171 171 171 LEU LEU 1 . n 
A  1  172 HIS 172 172 172 HIS HIS 1 . n 
A  1  173 VAL 173 173 173 VAL VAL 1 . n 
A  1  174 HIS 174 174 174 HIS HIS 1 . n 
A  1  175 ARG 175 175 175 ARG ARG 1 . n 
A  1  176 GLY 176 176 176 GLY GLY 1 . n 
A  1  177 ALA 177 177 177 ALA ALA 1 . n 
A  1  178 GLY 178 178 178 GLY GLY 1 . n 
A  1  179 ALA 179 179 179 ALA ALA 1 . n 
A  1  180 TYR 180 180 180 TYR TYR 1 . n 
A  1  181 ILE 181 181 181 ILE ILE 1 . n 
A  1  182 CYS 182 182 182 CYS CYS 1 . n 
A  1  183 GLY 183 183 183 GLY GLY 1 . n 
A  1  184 GLU 184 184 184 GLU GLU 1 . n 
A  1  185 GLU 185 185 185 GLU GLU 1 . n 
A  1  186 THR 186 186 186 THR THR 1 . n 
A  1  187 ALA 187 187 187 ALA ALA 1 . n 
A  1  188 LEU 188 188 188 LEU LEU 1 . n 
A  1  189 MET 189 189 189 MET MET 1 . n 
A  1  190 ASN 190 190 190 ASN ASN 1 . n 
A  1  191 SER 191 191 191 SER SER 1 . n 
A  1  192 LEU 192 192 192 LEU LEU 1 . n 
A  1  193 GLU 193 193 193 GLU GLU 1 . n 
A  1  194 GLY 194 194 194 GLY GLY 1 . n 
A  1  195 LEU 195 195 195 LEU LEU 1 . n 
A  1  196 ARG 196 196 196 ARG ARG 1 . n 
A  1  197 ALA 197 197 197 ALA ALA 1 . n 
A  1  198 ASN 198 198 198 ASN ASN 1 . n 
A  1  199 PRO 199 199 199 PRO PRO 1 . n 
A  1  200 ARG 200 200 200 ARG ARG 1 . n 
A  1  201 LEU 201 201 201 LEU LEU 1 . n 
A  1  202 LYS 202 202 202 LYS LYS 1 . n 
A  1  203 PRO 203 203 203 PRO PRO 1 . n 
A  1  204 PRO 204 204 204 PRO PRO 1 . n 
A  1  205 PHE 205 205 205 PHE PHE 1 . n 
A  1  206 PRO 206 206 206 PRO PRO 1 . n 
A  1  207 ALA 207 207 207 ALA ALA 1 . n 
A  1  208 GLN 208 208 208 GLN GLN 1 . n 
A  1  209 SER 209 209 209 SER SER 1 . n 
A  1  210 GLY 210 210 210 GLY GLY 1 . n 
A  1  211 LEU 211 211 211 LEU LEU 1 . n 
A  1  212 TRP 212 212 212 TRP TRP 1 . n 
A  1  213 GLY 213 213 213 GLY GLY 1 . n 
A  1  214 LYS 214 214 214 LYS LYS 1 . n 
A  1  215 PRO 215 215 215 PRO PRO 1 . n 
A  1  216 THR 216 216 216 THR THR 1 . n 
A  1  217 THR 217 217 217 THR THR 1 . n 
A  1  218 ILE 218 218 218 ILE ILE 1 . n 
A  1  219 ASN 219 219 219 ASN ASN 1 . n 
A  1  220 ASN 220 220 220 ASN ASN 1 . n 
A  1  221 VAL 221 221 221 VAL VAL 1 . n 
A  1  222 GLU 222 222 222 GLU GLU 1 . n 
A  1  223 THR 223 223 223 THR THR 1 . n 
A  1  224 LEU 224 224 224 LEU LEU 1 . n 
A  1  225 ALA 225 225 225 ALA ALA 1 . n 
A  1  226 SER 226 226 226 SER SER 1 . n 
A  1  227 VAL 227 227 227 VAL VAL 1 . n 
A  1  228 VAL 228 228 228 VAL VAL 1 . n 
A  1  229 PRO 229 229 229 PRO PRO 1 . n 
A  1  230 ILE 230 230 230 ILE ILE 1 . n 
A  1  231 MET 231 231 231 MET MET 1 . n 
A  1  232 GLU 232 232 232 GLU GLU 1 . n 
A  1  233 ARG 233 233 233 ARG ARG 1 . n 
A  1  234 GLY 234 234 234 GLY GLY 1 . n 
A  1  235 ALA 235 235 235 ALA ALA 1 . n 
A  1  236 ASP 236 236 236 ASP ASP 1 . n 
A  1  237 TRP 237 237 237 TRP TRP 1 . n 
A  1  238 PHE 238 238 238 PHE PHE 1 . n 
A  1  239 ALA 239 239 239 ALA ALA 1 . n 
A  1  240 GLN 240 240 240 GLN GLN 1 . n 
A  1  241 MET 241 241 241 MET MET 1 . n 
A  1  242 GLY 242 242 242 GLY GLY 1 . n 
A  1  243 THR 243 243 243 THR THR 1 . n 
A  1  244 GLU 244 244 244 GLU GLU 1 . n 
A  1  245 GLN 245 245 245 GLN GLN 1 . n 
A  1  246 SER 246 246 246 SER SER 1 . n 
A  1  247 LYS 247 247 247 LYS LYS 1 . n 
A  1  248 GLY 248 248 248 GLY GLY 1 . n 
A  1  249 MET 249 249 249 MET MET 1 . n 
A  1  250 LYS 250 250 250 LYS LYS 1 . n 
A  1  251 LEU 251 251 251 LEU LEU 1 . n 
A  1  252 TYR 252 252 252 TYR TYR 1 . n 
A  1  253 GLN 253 253 253 GLN GLN 1 . n 
A  1  254 ILE 254 254 254 ILE ILE 1 . n 
A  1  255 SER 255 255 255 SER SER 1 . n 
A  1  256 GLY 256 256 256 GLY GLY 1 . n 
A  1  257 PRO 257 257 257 PRO PRO 1 . n 
A  1  258 VAL 258 258 258 VAL VAL 1 . n 
A  1  259 LYS 259 259 259 LYS LYS 1 . n 
A  1  260 ARG 260 260 260 ARG ARG 1 . n 
A  1  261 PRO 261 261 261 PRO PRO 1 . n 
A  1  262 GLY 262 262 262 GLY GLY 1 . n 
A  1  263 VAL 263 263 263 VAL VAL 1 . n 
A  1  264 TYR 264 264 264 TYR TYR 1 . n 
A  1  265 GLU 265 265 265 GLU GLU 1 . n 
A  1  266 LEU 266 266 266 LEU LEU 1 . n 
A  1  267 PRO 267 267 267 PRO PRO 1 . n 
A  1  268 MET 268 268 268 MET MET 1 . n 
A  1  269 GLY 269 269 269 GLY GLY 1 . n 
A  1  270 THR 270 270 270 THR THR 1 . n 
A  1  271 THR 271 271 271 THR THR 1 . n 
A  1  272 PHE 272 272 272 PHE PHE 1 . n 
A  1  273 ARG 273 273 273 ARG ARG 1 . n 
A  1  274 GLU 274 274 274 GLU GLU 1 . n 
A  1  275 LEU 275 275 275 LEU LEU 1 . n 
A  1  276 ILE 276 276 276 ILE ILE 1 . n 
A  1  277 TYR 277 277 277 TYR TYR 1 . n 
A  1  278 GLU 278 278 278 GLU GLU 1 . n 
A  1  279 TRP 279 279 279 TRP TRP 1 . n 
A  1  280 ALA 280 280 280 ALA ALA 1 . n 
A  1  281 GLY 281 281 281 GLY GLY 1 . n 
A  1  282 GLY 282 282 282 GLY GLY 1 . n 
A  1  283 PRO 283 283 283 PRO PRO 1 . n 
A  1  284 LEU 284 284 284 LEU LEU 1 . n 
A  1  285 GLU 285 285 285 GLU GLU 1 . n 
A  1  286 PRO 286 286 286 PRO PRO 1 . n 
A  1  287 ILE 287 287 287 ILE ILE 1 . n 
A  1  288 GLN 288 288 288 GLN GLN 1 . n 
A  1  289 ALA 289 289 289 ALA ALA 1 . n 
A  1  290 ILE 290 290 290 ILE ILE 1 . n 
A  1  291 ILE 291 291 291 ILE ILE 1 . n 
A  1  292 PRO 292 292 292 PRO PRO 1 . n 
A  1  293 GLY 293 293 293 GLY GLY 1 . n 
A  1  294 GLY 294 294 294 GLY GLY 1 . n 
A  1  295 SER 295 295 295 SER SER 1 . n 
A  1  296 SER 296 296 296 SER SER 1 . n 
A  1  297 THR 297 297 297 THR THR 1 . n 
A  1  298 PRO 298 298 298 PRO PRO 1 . n 
A  1  299 PRO 299 299 299 PRO PRO 1 . n 
A  1  300 LEU 300 300 300 LEU LEU 1 . n 
A  1  301 PRO 301 301 301 PRO PRO 1 . n 
A  1  302 PHE 302 302 302 PHE PHE 1 . n 
A  1  303 THR 303 303 303 THR THR 1 . n 
A  1  304 GLU 304 304 304 GLU GLU 1 . n 
A  1  305 GLU 305 305 305 GLU GLU 1 . n 
A  1  306 VAL 306 306 306 VAL VAL 1 . n 
A  1  307 LEU 307 307 307 LEU LEU 1 . n 
A  1  308 ASP 308 308 308 ASP ASP 1 . n 
A  1  309 THR 309 309 309 THR THR 1 . n 
A  1  310 PRO 310 310 310 PRO PRO 1 . n 
A  1  311 MET 311 311 311 MET MET 1 . n 
A  1  312 SER 312 312 312 SER SER 1 . n 
A  1  313 TYR 313 313 313 TYR TYR 1 . n 
A  1  314 GLU 314 314 314 GLU GLU 1 . n 
A  1  315 HIS 315 315 315 HIS HIS 1 . n 
A  1  316 LEU 316 316 316 LEU LEU 1 . n 
A  1  317 GLN 317 317 317 GLN GLN 1 . n 
A  1  318 ALA 318 318 318 ALA ALA 1 . n 
A  1  319 LYS 319 319 319 LYS LYS 1 . n 
A  1  320 GLY 320 320 320 GLY GLY 1 . n 
A  1  321 SER 321 321 321 SER SER 1 . n 
A  1  322 MET 322 322 322 MET MET 1 . n 
A  1  323 LEU 323 323 323 LEU LEU 1 . n 
A  1  324 GLY 324 324 324 GLY GLY 1 . n 
A  1  325 THR 325 325 325 THR THR 1 . n 
A  1  326 GLY 326 326 326 GLY GLY 1 . n 
A  1  327 GLY 327 327 327 GLY GLY 1 . n 
A  1  328 VAL 328 328 328 VAL VAL 1 . n 
A  1  329 ILE 329 329 329 ILE ILE 1 . n 
A  1  330 LEU 330 330 330 LEU LEU 1 . n 
A  1  331 ILE 331 331 331 ILE ILE 1 . n 
A  1  332 PRO 332 332 332 PRO PRO 1 . n 
A  1  333 GLU 333 333 333 GLU GLU 1 . n 
A  1  334 ARG 334 334 334 ARG ARG 1 . n 
A  1  335 VAL 335 335 335 VAL VAL 1 . n 
A  1  336 SER 336 336 336 SER SER 1 . n 
A  1  337 MET 337 337 337 MET MET 1 . n 
A  1  338 VAL 338 338 338 VAL VAL 1 . n 
A  1  339 ASP 339 339 339 ASP ASP 1 . n 
A  1  340 ALA 340 340 340 ALA ALA 1 . n 
A  1  341 MET 341 341 341 MET MET 1 . n 
A  1  342 TRP 342 342 342 TRP TRP 1 . n 
A  1  343 ASN 343 343 343 ASN ASN 1 . n 
A  1  344 LEU 344 344 344 LEU LEU 1 . n 
A  1  345 THR 345 345 345 THR THR 1 . n 
A  1  346 ARG 346 346 346 ARG ARG 1 . n 
A  1  347 PHE 347 347 347 PHE PHE 1 . n 
A  1  348 TYR 348 348 348 TYR TYR 1 . n 
A  1  349 ALA 349 349 349 ALA ALA 1 . n 
A  1  350 HIS 350 350 350 HIS HIS 1 . n 
A  1  351 GLU 351 351 351 GLU GLU 1 . n 
A  1  352 SER 352 352 352 SER SER 1 . n 
A  1  353 CYS 353 353 353 CYS CYS 1 . n 
A  1  354 GLY 354 354 354 GLY GLY 1 . n 
A  1  355 LYS 355 355 355 LYS LYS 1 . n 
A  1  356 CYS 356 356 356 CYS CYS 1 . n 
A  1  357 THR 357 357 357 THR THR 1 . n 
A  1  358 PRO 358 358 358 PRO PRO 1 . n 
A  1  359 CYS 359 359 359 CYS CYS 1 . n 
A  1  360 ARG 360 360 360 ARG ARG 1 . n 
A  1  361 GLU 361 361 361 GLU GLU 1 . n 
A  1  362 GLY 362 362 362 GLY GLY 1 . n 
A  1  363 VAL 363 363 363 VAL VAL 1 . n 
A  1  364 ALA 364 364 364 ALA ALA 1 . n 
A  1  365 GLY 365 365 365 GLY GLY 1 . n 
A  1  366 PHE 366 366 366 PHE PHE 1 . n 
A  1  367 MET 367 367 367 MET MET 1 . n 
A  1  368 VAL 368 368 368 VAL VAL 1 . n 
A  1  369 ASN 369 369 369 ASN ASN 1 . n 
A  1  370 LEU 370 370 370 LEU LEU 1 . n 
A  1  371 PHE 371 371 371 PHE PHE 1 . n 
A  1  372 ALA 372 372 372 ALA ALA 1 . n 
A  1  373 LYS 373 373 373 LYS LYS 1 . n 
A  1  374 ILE 374 374 374 ILE ILE 1 . n 
A  1  375 GLY 375 375 375 GLY GLY 1 . n 
A  1  376 THR 376 376 376 THR THR 1 . n 
A  1  377 GLY 377 377 377 GLY GLY 1 . n 
A  1  378 GLN 378 378 378 GLN GLN 1 . n 
A  1  379 GLY 379 379 379 GLY GLY 1 . n 
A  1  380 GLU 380 380 380 GLU GLU 1 . n 
A  1  381 GLU 381 381 381 GLU GLU 1 . n 
A  1  382 LYS 382 382 382 LYS LYS 1 . n 
A  1  383 ASP 383 383 383 ASP ASP 1 . n 
A  1  384 VAL 384 384 384 VAL VAL 1 . n 
A  1  385 GLU 385 385 385 GLU GLU 1 . n 
A  1  386 ASN 386 386 386 ASN ASN 1 . n 
A  1  387 LEU 387 387 387 LEU LEU 1 . n 
A  1  388 GLU 388 388 388 GLU GLU 1 . n 
A  1  389 ALA 389 389 389 ALA ALA 1 . n 
A  1  390 LEU 390 390 390 LEU LEU 1 . n 
A  1  391 LEU 391 391 391 LEU LEU 1 . n 
A  1  392 PRO 392 392 392 PRO PRO 1 . n 
A  1  393 LEU 393 393 393 LEU LEU 1 . n 
A  1  394 ILE 394 394 394 ILE ILE 1 . n 
A  1  395 GLU 395 395 395 GLU GLU 1 . n 
A  1  396 GLY 396 396 396 GLY GLY 1 . n 
A  1  397 ARG 397 397 397 ARG ARG 1 . n 
A  1  398 SER 398 398 398 SER SER 1 . n 
A  1  399 PHE 399 399 399 PHE PHE 1 . n 
A  1  400 CYS 400 400 400 CYS CYS 1 . n 
A  1  401 PRO 401 401 401 PRO PRO 1 . n 
A  1  402 LEU 402 402 402 LEU LEU 1 . n 
A  1  403 ALA 403 403 403 ALA ALA 1 . n 
A  1  404 ASP 404 404 404 ASP ASP 1 . n 
A  1  405 ALA 405 405 405 ALA ALA 1 . n 
A  1  406 ALA 406 406 406 ALA ALA 1 . n 
A  1  407 VAL 407 407 407 VAL VAL 1 . n 
A  1  408 TRP 408 408 408 TRP TRP 1 . n 
A  1  409 PRO 409 409 409 PRO PRO 1 . n 
A  1  410 VAL 410 410 410 VAL VAL 1 . n 
A  1  411 LYS 411 411 411 LYS LYS 1 . n 
A  1  412 GLY 412 412 412 GLY GLY 1 . n 
A  1  413 SER 413 413 413 SER SER 1 . n 
A  1  414 LEU 414 414 414 LEU LEU 1 . n 
A  1  415 ARG 415 415 415 ARG ARG 1 . n 
A  1  416 HIS 416 416 416 HIS HIS 1 . n 
A  1  417 PHE 417 417 417 PHE PHE 1 . n 
A  1  418 LYS 418 418 418 LYS LYS 1 . n 
A  1  419 ASP 419 419 419 ASP ASP 1 . n 
A  1  420 GLN 420 420 420 GLN GLN 1 . n 
A  1  421 TYR 421 421 421 TYR TYR 1 . n 
A  1  422 LEU 422 422 422 LEU LEU 1 . n 
A  1  423 ALA 423 423 423 ALA ALA 1 . n 
A  1  424 LEU 424 424 424 LEU LEU 1 . n 
A  1  425 ALA 425 425 425 ALA ALA 1 . n 
A  1  426 ARG 426 426 426 ARG ARG 1 . n 
A  1  427 GLU 427 427 427 GLU GLU 1 . n 
A  1  428 LYS 428 428 428 LYS LYS 1 . n 
A  1  429 ARG 429 429 429 ARG ARG 1 . n 
A  1  430 PRO 430 430 430 PRO PRO 1 . n 
A  1  431 VAL 431 431 431 VAL VAL 1 . n 
A  1  432 PRO 432 432 432 PRO PRO 1 . n 
A  1  433 ARG 433 433 433 ARG ARG 1 . n 
A  1  434 PRO 434 434 434 PRO PRO 1 . n 
A  1  435 SER 435 435 435 SER SER 1 . n 
A  1  436 LEU 436 436 436 LEU LEU 1 . n 
A  1  437 TRP 437 437 437 TRP TRP 1 . n 
A  1  438 ARG 438 438 438 ARG ARG 1 . n 
B  2  1   MET 1   1   ?   ?   ?   2 . n 
B  2  2   GLY 2   2   ?   ?   ?   2 . n 
B  2  3   PHE 3   3   3   PHE PHE 2 . n 
B  2  4   PHE 4   4   4   PHE PHE 2 . n 
B  2  5   ASP 5   5   5   ASP ASP 2 . n 
B  2  6   ASP 6   6   6   ASP ASP 2 . n 
B  2  7   LYS 7   7   7   LYS LYS 2 . n 
B  2  8   GLN 8   8   8   GLN GLN 2 . n 
B  2  9   ASP 9   9   9   ASP ASP 2 . n 
B  2  10  PHE 10  10  10  PHE PHE 2 . n 
B  2  11  LEU 11  11  11  LEU LEU 2 . n 
B  2  12  GLU 12  12  12  GLU GLU 2 . n 
B  2  13  GLU 13  13  13  GLU GLU 2 . n 
B  2  14  THR 14  14  14  THR THR 2 . n 
B  2  15  PHE 15  15  15  PHE PHE 2 . n 
B  2  16  ALA 16  16  16  ALA ALA 2 . n 
B  2  17  LYS 17  17  17  LYS LYS 2 . n 
B  2  18  TYR 18  18  18  TYR TYR 2 . n 
B  2  19  PRO 19  19  19  PRO PRO 2 . n 
B  2  20  PRO 20  20  20  PRO PRO 2 . n 
B  2  21  GLU 21  21  21  GLU GLU 2 . n 
B  2  22  GLY 22  22  22  GLY GLY 2 . n 
B  2  23  ARG 23  23  23  ARG ARG 2 . n 
B  2  24  ARG 24  24  24  ARG ARG 2 . n 
B  2  25  ALA 25  25  25  ALA ALA 2 . n 
B  2  26  ALA 26  26  26  ALA ALA 2 . n 
B  2  27  ILE 27  27  27  ILE ILE 2 . n 
B  2  28  MET 28  28  28  MET MET 2 . n 
B  2  29  PRO 29  29  29  PRO PRO 2 . n 
B  2  30  LEU 30  30  30  LEU LEU 2 . n 
B  2  31  LEU 31  31  31  LEU LEU 2 . n 
B  2  32  ARG 32  32  32  ARG ARG 2 . n 
B  2  33  ARG 33  33  33  ARG ARG 2 . n 
B  2  34  VAL 34  34  34  VAL VAL 2 . n 
B  2  35  GLN 35  35  35  GLN GLN 2 . n 
B  2  36  GLN 36  36  36  GLN GLN 2 . n 
B  2  37  GLU 37  37  37  GLU GLU 2 . n 
B  2  38  GLU 38  38  38  GLU GLU 2 . n 
B  2  39  GLY 39  39  39  GLY GLY 2 . n 
B  2  40  TRP 40  40  40  TRP TRP 2 . n 
B  2  41  ILE 41  41  41  ILE ILE 2 . n 
B  2  42  ARG 42  42  42  ARG ARG 2 . n 
B  2  43  PRO 43  43  43  PRO PRO 2 . n 
B  2  44  GLU 44  44  44  GLU GLU 2 . n 
B  2  45  ARG 45  45  45  ARG ARG 2 . n 
B  2  46  ILE 46  46  46  ILE ILE 2 . n 
B  2  47  GLU 47  47  47  GLU GLU 2 . n 
B  2  48  GLU 48  48  48  GLU GLU 2 . n 
B  2  49  ILE 49  49  49  ILE ILE 2 . n 
B  2  50  ALA 50  50  50  ALA ALA 2 . n 
B  2  51  ARG 51  51  51  ARG ARG 2 . n 
B  2  52  LEU 52  52  52  LEU LEU 2 . n 
B  2  53  VAL 53  53  53  VAL VAL 2 . n 
B  2  54  GLY 54  54  54  GLY GLY 2 . n 
B  2  55  THR 55  55  55  THR THR 2 . n 
B  2  56  THR 56  56  56  THR THR 2 . n 
B  2  57  PRO 57  57  57  PRO PRO 2 . n 
B  2  58  THR 58  58  58  THR THR 2 . n 
B  2  59  GLU 59  59  59  GLU GLU 2 . n 
B  2  60  VAL 60  60  60  VAL VAL 2 . n 
B  2  61  MET 61  61  61  MET MET 2 . n 
B  2  62  GLY 62  62  62  GLY GLY 2 . n 
B  2  63  VAL 63  63  63  VAL VAL 2 . n 
B  2  64  ALA 64  64  64  ALA ALA 2 . n 
B  2  65  SER 65  65  65  SER SER 2 . n 
B  2  66  PHE 66  66  66  PHE PHE 2 . n 
B  2  67  TYR 67  67  67  TYR TYR 2 . n 
B  2  68  SER 68  68  68  SER SER 2 . n 
B  2  69  TYR 69  69  69  TYR TYR 2 . n 
B  2  70  TYR 70  70  70  TYR TYR 2 . n 
B  2  71  GLN 71  71  71  GLN GLN 2 . n 
B  2  72  PHE 72  72  72  PHE PHE 2 . n 
B  2  73  VAL 73  73  73  VAL VAL 2 . n 
B  2  74  PRO 74  74  74  PRO PRO 2 . n 
B  2  75  THR 75  75  75  THR THR 2 . n 
B  2  76  GLY 76  76  76  GLY GLY 2 . n 
B  2  77  LYS 77  77  77  LYS LYS 2 . n 
B  2  78  TYR 78  78  78  TYR TYR 2 . n 
B  2  79  HIS 79  79  79  HIS HIS 2 . n 
B  2  80  LEU 80  80  80  LEU LEU 2 . n 
B  2  81  GLN 81  81  81  GLN GLN 2 . n 
B  2  82  VAL 82  82  82  VAL VAL 2 . n 
B  2  83  CYS 83  83  83  CYS CYS 2 . n 
B  2  84  ALA 84  84  84  ALA ALA 2 . n 
B  2  85  THR 85  85  85  THR THR 2 . n 
B  2  86  LEU 86  86  86  LEU LEU 2 . n 
B  2  87  SER 87  87  87  SER SER 2 . n 
B  2  88  CYS 88  88  88  CYS CYS 2 . n 
B  2  89  LYS 89  89  89  LYS LYS 2 . n 
B  2  90  LEU 90  90  90  LEU LEU 2 . n 
B  2  91  ALA 91  91  91  ALA ALA 2 . n 
B  2  92  GLY 92  92  92  GLY GLY 2 . n 
B  2  93  ALA 93  93  93  ALA ALA 2 . n 
B  2  94  GLU 94  94  94  GLU GLU 2 . n 
B  2  95  GLU 95  95  95  GLU GLU 2 . n 
B  2  96  LEU 96  96  96  LEU LEU 2 . n 
B  2  97  TRP 97  97  97  TRP TRP 2 . n 
B  2  98  ASP 98  98  98  ASP ASP 2 . n 
B  2  99  TYR 99  99  99  TYR TYR 2 . n 
B  2  100 LEU 100 100 100 LEU LEU 2 . n 
B  2  101 THR 101 101 101 THR THR 2 . n 
B  2  102 GLU 102 102 102 GLU GLU 2 . n 
B  2  103 THR 103 103 103 THR THR 2 . n 
B  2  104 LEU 104 104 104 LEU LEU 2 . n 
B  2  105 GLY 105 105 105 GLY GLY 2 . n 
B  2  106 ILE 106 106 106 ILE ILE 2 . n 
B  2  107 GLY 107 107 107 GLY GLY 2 . n 
B  2  108 PRO 108 108 108 PRO PRO 2 . n 
B  2  109 GLY 109 109 109 GLY GLY 2 . n 
B  2  110 GLU 110 110 110 GLU GLU 2 . n 
B  2  111 VAL 111 111 111 VAL VAL 2 . n 
B  2  112 THR 112 112 112 THR THR 2 . n 
B  2  113 PRO 113 113 113 PRO PRO 2 . n 
B  2  114 ASP 114 114 114 ASP ASP 2 . n 
B  2  115 GLY 115 115 115 GLY GLY 2 . n 
B  2  116 LEU 116 116 116 LEU LEU 2 . n 
B  2  117 PHE 117 117 117 PHE PHE 2 . n 
B  2  118 SER 118 118 118 SER SER 2 . n 
B  2  119 VAL 119 119 119 VAL VAL 2 . n 
B  2  120 GLN 120 120 120 GLN GLN 2 . n 
B  2  121 LYS 121 121 121 LYS LYS 2 . n 
B  2  122 VAL 122 122 122 VAL VAL 2 . n 
B  2  123 GLU 123 123 123 GLU GLU 2 . n 
B  2  124 CYS 124 124 124 CYS CYS 2 . n 
B  2  125 LEU 125 125 125 LEU LEU 2 . n 
B  2  126 GLY 126 126 126 GLY GLY 2 . n 
B  2  127 SER 127 127 127 SER SER 2 . n 
B  2  128 CYS 128 128 128 CYS CYS 2 . n 
B  2  129 HIS 129 129 129 HIS HIS 2 . n 
B  2  130 THR 130 130 130 THR THR 2 . n 
B  2  131 ALA 131 131 131 ALA ALA 2 . n 
B  2  132 PRO 132 132 132 PRO PRO 2 . n 
B  2  133 VAL 133 133 133 VAL VAL 2 . n 
B  2  134 ILE 134 134 134 ILE ILE 2 . n 
B  2  135 GLN 135 135 135 GLN GLN 2 . n 
B  2  136 VAL 136 136 136 VAL VAL 2 . n 
B  2  137 ASN 137 137 137 ASN ASN 2 . n 
B  2  138 ASP 138 138 138 ASP ASP 2 . n 
B  2  139 GLU 139 139 139 GLU GLU 2 . n 
B  2  140 PRO 140 140 140 PRO PRO 2 . n 
B  2  141 TYR 141 141 141 TYR TYR 2 . n 
B  2  142 VAL 142 142 142 VAL VAL 2 . n 
B  2  143 GLU 143 143 143 GLU GLU 2 . n 
B  2  144 CYS 144 144 144 CYS CYS 2 . n 
B  2  145 VAL 145 145 145 VAL VAL 2 . n 
B  2  146 THR 146 146 146 THR THR 2 . n 
B  2  147 ARG 147 147 147 ARG ARG 2 . n 
B  2  148 ALA 148 148 148 ALA ALA 2 . n 
B  2  149 ARG 149 149 149 ARG ARG 2 . n 
B  2  150 LEU 150 150 150 LEU LEU 2 . n 
B  2  151 GLU 151 151 151 GLU GLU 2 . n 
B  2  152 ALA 152 152 152 ALA ALA 2 . n 
B  2  153 LEU 153 153 153 LEU LEU 2 . n 
B  2  154 LEU 154 154 154 LEU LEU 2 . n 
B  2  155 ALA 155 155 155 ALA ALA 2 . n 
B  2  156 GLY 156 156 156 GLY GLY 2 . n 
B  2  157 LEU 157 157 157 LEU LEU 2 . n 
B  2  158 ARG 158 158 158 ARG ARG 2 . n 
B  2  159 ALA 159 159 159 ALA ALA 2 . n 
B  2  160 GLY 160 160 160 GLY GLY 2 . n 
B  2  161 LYS 161 161 161 LYS LYS 2 . n 
B  2  162 ARG 162 162 162 ARG ARG 2 . n 
B  2  163 LEU 163 163 163 LEU LEU 2 . n 
B  2  164 GLU 164 164 164 GLU GLU 2 . n 
B  2  165 GLU 165 165 165 GLU GLU 2 . n 
B  2  166 ILE 166 166 166 ILE ILE 2 . n 
B  2  167 GLU 167 167 167 GLU GLU 2 . n 
B  2  168 LEU 168 168 168 LEU LEU 2 . n 
B  2  169 PRO 169 169 169 PRO PRO 2 . n 
B  2  170 GLY 170 170 170 GLY GLY 2 . n 
B  2  171 LYS 171 171 171 LYS LYS 2 . n 
B  2  172 CYS 172 172 172 CYS CYS 2 . n 
B  2  173 GLY 173 173 173 GLY GLY 2 . n 
B  2  174 HIS 174 174 174 HIS HIS 2 . n 
B  2  175 HIS 175 175 175 HIS HIS 2 . n 
B  2  176 VAL 176 176 176 VAL VAL 2 . n 
B  2  177 HIS 177 177 177 HIS HIS 2 . n 
B  2  178 GLU 178 178 178 GLU GLU 2 . n 
B  2  179 VAL 179 179 179 VAL VAL 2 . n 
B  2  180 GLU 180 180 180 GLU GLU 2 . n 
B  2  181 VAL 181 181 ?   ?   ?   2 . n 
C  3  1   MET 1   1   1   MET MET 3 . n 
C  3  2   VAL 2   2   2   VAL VAL 3 . n 
C  3  3   ARG 3   3   3   ARG ARG 3 . n 
C  3  4   VAL 4   4   4   VAL VAL 3 . n 
C  3  5   LYS 5   5   5   LYS LYS 3 . n 
C  3  6   VAL 6   6   6   VAL VAL 3 . n 
C  3  7   ASN 7   7   7   ASN ASN 3 . n 
C  3  8   ASP 8   8   8   ASP ASP 3 . n 
C  3  9   ARG 9   9   9   ARG ARG 3 . n 
C  3  10  ILE 10  10  10  ILE ILE 3 . n 
C  3  11  VAL 11  11  11  VAL VAL 3 . n 
C  3  12  GLU 12  12  12  GLU GLU 3 . n 
C  3  13  VAL 13  13  13  VAL VAL 3 . n 
C  3  14  PRO 14  14  14  PRO PRO 3 . n 
C  3  15  PRO 15  15  15  PRO PRO 3 . n 
C  3  16  GLY 16  16  16  GLY GLY 3 . n 
C  3  17  THR 17  17  17  THR THR 3 . n 
C  3  18  SER 18  18  18  SER SER 3 . n 
C  3  19  VAL 19  19  19  VAL VAL 3 . n 
C  3  20  MET 20  20  20  MET MET 3 . n 
C  3  21  ASP 21  21  21  ASP ASP 3 . n 
C  3  22  ALA 22  22  22  ALA ALA 3 . n 
C  3  23  VAL 23  23  23  VAL VAL 3 . n 
C  3  24  PHE 24  24  24  PHE PHE 3 . n 
C  3  25  HIS 25  25  25  HIS HIS 3 . n 
C  3  26  ALA 26  26  26  ALA ALA 3 . n 
C  3  27  GLY 27  27  27  GLY GLY 3 . n 
C  3  28  TYR 28  28  28  TYR TYR 3 . n 
C  3  29  ASP 29  29  29  ASP ASP 3 . n 
C  3  30  VAL 30  30  30  VAL VAL 3 . n 
C  3  31  PRO 31  31  31  PRO PRO 3 . n 
C  3  32  LEU 32  32  32  LEU LEU 3 . n 
C  3  33  PHE 33  33  33  PHE PHE 3 . n 
C  3  34  CYS 34  34  34  CYS CYS 3 . n 
C  3  35  SER 35  35  35  SER SER 3 . n 
C  3  36  GLU 36  36  36  GLU GLU 3 . n 
C  3  37  LYS 37  37  37  LYS LYS 3 . n 
C  3  38  HIS 38  38  38  HIS HIS 3 . n 
C  3  39  LEU 39  39  39  LEU LEU 3 . n 
C  3  40  SER 40  40  40  SER SER 3 . n 
C  3  41  PRO 41  41  41  PRO PRO 3 . n 
C  3  42  ILE 42  42  42  ILE ILE 3 . n 
C  3  43  GLY 43  43  43  GLY GLY 3 . n 
C  3  44  ALA 44  44  44  ALA ALA 3 . n 
C  3  45  CYS 45  45  45  CYS CYS 3 . n 
C  3  46  ARG 46  46  46  ARG ARG 3 . n 
C  3  47  MET 47  47  47  MET MET 3 . n 
C  3  48  CYS 48  48  48  CYS CYS 3 . n 
C  3  49  LEU 49  49  49  LEU LEU 3 . n 
C  3  50  VAL 50  50  50  VAL VAL 3 . n 
C  3  51  ARG 51  51  51  ARG ARG 3 . n 
C  3  52  ILE 52  52  52  ILE ILE 3 . n 
C  3  53  GLY 53  53  53  GLY GLY 3 . n 
C  3  54  LEU 54  54  54  LEU LEU 3 . n 
C  3  55  PRO 55  55  55  PRO PRO 3 . n 
C  3  56  LYS 56  56  ?   ?   ?   3 . n 
C  3  57  LYS 57  57  ?   ?   ?   3 . n 
C  3  58  GLY 58  58  ?   ?   ?   3 . n 
C  3  59  PRO 59  59  ?   ?   ?   3 . n 
C  3  60  ASP 60  60  ?   ?   ?   3 . n 
C  3  61  GLY 61  61  ?   ?   ?   3 . n 
C  3  62  LYS 62  62  ?   ?   ?   3 . n 
C  3  63  PRO 63  63  ?   ?   ?   3 . n 
C  3  64  LEU 64  64  ?   ?   ?   3 . n 
C  3  65  LEU 65  65  ?   ?   ?   3 . n 
C  3  66  ASN 66  66  ?   ?   ?   3 . n 
C  3  67  GLU 67  67  ?   ?   ?   3 . n 
C  3  68  LYS 68  68  ?   ?   ?   3 . n 
C  3  69  GLY 69  69  ?   ?   ?   3 . n 
C  3  70  GLU 70  70  ?   ?   ?   3 . n 
C  3  71  PRO 71  71  ?   ?   ?   3 . n 
C  3  72  GLU 72  72  ?   ?   ?   3 . n 
C  3  73  ILE 73  73  73  ILE ILE 3 . n 
C  3  74  GLN 74  74  74  GLN GLN 3 . n 
C  3  75  TRP 75  75  75  TRP TRP 3 . n 
C  3  76  GLN 76  76  76  GLN GLN 3 . n 
C  3  77  PRO 77  77  77  PRO PRO 3 . n 
C  3  78  LYS 78  78  78  LYS LYS 3 . n 
C  3  79  LEU 79  79  79  LEU LEU 3 . n 
C  3  80  ALA 80  80  80  ALA ALA 3 . n 
C  3  81  ALA 81  81  81  ALA ALA 3 . n 
C  3  82  SER 82  82  82  SER SER 3 . n 
C  3  83  CYS 83  83  83  CYS CYS 3 . n 
C  3  84  VAL 84  84  84  VAL VAL 3 . n 
C  3  85  THR 85  85  85  THR THR 3 . n 
C  3  86  ALA 86  86  86  ALA ALA 3 . n 
C  3  87  VAL 87  87  87  VAL VAL 3 . n 
C  3  88  ALA 88  88  88  ALA ALA 3 . n 
C  3  89  ASP 89  89  89  ASP ASP 3 . n 
C  3  90  GLY 90  90  90  GLY GLY 3 . n 
C  3  91  MET 91  91  91  MET MET 3 . n 
C  3  92  VAL 92  92  92  VAL VAL 3 . n 
C  3  93  VAL 93  93  93  VAL VAL 3 . n 
C  3  94  ASP 94  94  94  ASP ASP 3 . n 
C  3  95  THR 95  95  95  THR THR 3 . n 
C  3  96  LEU 96  96  96  LEU LEU 3 . n 
C  3  97  SER 97  97  97  SER SER 3 . n 
C  3  98  ASP 98  98  98  ASP ASP 3 . n 
C  3  99  VAL 99  99  99  VAL VAL 3 . n 
C  3  100 VAL 100 100 100 VAL VAL 3 . n 
C  3  101 ARG 101 101 101 ARG ARG 3 . n 
C  3  102 GLU 102 102 102 GLU GLU 3 . n 
C  3  103 ALA 103 103 103 ALA ALA 3 . n 
C  3  104 GLN 104 104 104 GLN GLN 3 . n 
C  3  105 ALA 105 105 105 ALA ALA 3 . n 
C  3  106 GLY 106 106 106 GLY GLY 3 . n 
C  3  107 MET 107 107 107 MET MET 3 . n 
C  3  108 VAL 108 108 108 VAL VAL 3 . n 
C  3  109 GLU 109 109 109 GLU GLU 3 . n 
C  3  110 PHE 110 110 110 PHE PHE 3 . n 
C  3  111 THR 111 111 111 THR THR 3 . n 
C  3  112 LEU 112 112 112 LEU LEU 3 . n 
C  3  113 LEU 113 113 113 LEU LEU 3 . n 
C  3  114 ASN 114 114 114 ASN ASN 3 . n 
C  3  115 HIS 115 115 115 HIS HIS 3 . n 
C  3  116 PRO 116 116 116 PRO PRO 3 . n 
C  3  117 LEU 117 117 117 LEU LEU 3 . n 
C  3  118 ASP 118 118 118 ASP ASP 3 . n 
C  3  119 CYS 119 119 119 CYS CYS 3 . n 
C  3  120 PRO 120 120 120 PRO PRO 3 . n 
C  3  121 THR 121 121 121 THR THR 3 . n 
C  3  122 CYS 122 122 122 CYS CYS 3 . n 
C  3  123 ASP 123 123 123 ASP ASP 3 . n 
C  3  124 LYS 124 124 124 LYS LYS 3 . n 
C  3  125 GLY 125 125 125 GLY GLY 3 . n 
C  3  126 GLY 126 126 126 GLY GLY 3 . n 
C  3  127 ALA 127 127 127 ALA ALA 3 . n 
C  3  128 CYS 128 128 128 CYS CYS 3 . n 
C  3  129 GLU 129 129 129 GLU GLU 3 . n 
C  3  130 LEU 130 130 130 LEU LEU 3 . n 
C  3  131 GLN 131 131 131 GLN GLN 3 . n 
C  3  132 ASP 132 132 132 ASP ASP 3 . n 
C  3  133 ARG 133 133 133 ARG ARG 3 . n 
C  3  134 THR 134 134 134 THR THR 3 . n 
C  3  135 VAL 135 135 135 VAL VAL 3 . n 
C  3  136 GLU 136 136 136 GLU GLU 3 . n 
C  3  137 TYR 137 137 137 TYR TYR 3 . n 
C  3  138 GLY 138 138 138 GLY GLY 3 . n 
C  3  139 LEU 139 139 139 LEU LEU 3 . n 
C  3  140 TYR 140 140 140 TYR TYR 3 . n 
C  3  141 GLU 141 141 141 GLU GLU 3 . n 
C  3  142 LYS 142 142 142 LYS LYS 3 . n 
C  3  143 TYR 143 143 143 TYR TYR 3 . n 
C  3  144 TYR 144 144 ?   ?   ?   3 . n 
C  3  145 GLN 145 145 ?   ?   ?   3 . n 
C  3  146 LYS 146 146 ?   ?   ?   3 . n 
C  3  147 GLY 147 147 ?   ?   ?   3 . n 
C  3  148 PRO 148 148 148 PRO PRO 3 . n 
C  3  149 LEU 149 149 149 LEU LEU 3 . n 
C  3  150 GLU 150 150 150 GLU GLU 3 . n 
C  3  151 LEU 151 151 151 LEU LEU 3 . n 
C  3  152 PRO 152 152 152 PRO PRO 3 . n 
C  3  153 VAL 153 153 153 VAL VAL 3 . n 
C  3  154 TYR 154 154 154 TYR TYR 3 . n 
C  3  155 THR 155 155 155 THR THR 3 . n 
C  3  156 ARG 156 156 156 ARG ARG 3 . n 
C  3  157 PHE 157 157 157 PHE PHE 3 . n 
C  3  158 GLU 158 158 158 GLU GLU 3 . n 
C  3  159 PHE 159 159 159 PHE PHE 3 . n 
C  3  160 THR 160 160 160 THR THR 3 . n 
C  3  161 ARG 161 161 161 ARG ARG 3 . n 
C  3  162 ARG 162 162 162 ARG ARG 3 . n 
C  3  163 HIS 163 163 163 HIS HIS 3 . n 
C  3  164 VAL 164 164 164 VAL VAL 3 . n 
C  3  165 ASP 165 165 165 ASP ASP 3 . n 
C  3  166 LYS 166 166 166 LYS LYS 3 . n 
C  3  167 HIS 167 167 167 HIS HIS 3 . n 
C  3  168 HIS 168 168 168 HIS HIS 3 . n 
C  3  169 PRO 169 169 169 PRO PRO 3 . n 
C  3  170 LEU 170 170 170 LEU LEU 3 . n 
C  3  171 SER 171 171 171 SER SER 3 . n 
C  3  172 PRO 172 172 172 PRO PRO 3 . n 
C  3  173 PHE 173 173 173 PHE PHE 3 . n 
C  3  174 VAL 174 174 174 VAL VAL 3 . n 
C  3  175 ILE 175 175 175 ILE ILE 3 . n 
C  3  176 LEU 176 176 176 LEU LEU 3 . n 
C  3  177 ASP 177 177 177 ASP ASP 3 . n 
C  3  178 ARG 178 178 178 ARG ARG 3 . n 
C  3  179 GLU 179 179 179 GLU GLU 3 . n 
C  3  180 ARG 180 180 180 ARG ARG 3 . n 
C  3  181 CYS 181 181 181 CYS CYS 3 . n 
C  3  182 ILE 182 182 182 ILE ILE 3 . n 
C  3  183 HIS 183 183 183 HIS HIS 3 . n 
C  3  184 CYS 184 184 184 CYS CYS 3 . n 
C  3  185 LYS 185 185 185 LYS LYS 3 . n 
C  3  186 ARG 186 186 186 ARG ARG 3 . n 
C  3  187 CYS 187 187 187 CYS CYS 3 . n 
C  3  188 VAL 188 188 188 VAL VAL 3 . n 
C  3  189 ARG 189 189 189 ARG ARG 3 . n 
C  3  190 TYR 190 190 190 TYR TYR 3 . n 
C  3  191 PHE 191 191 191 PHE PHE 3 . n 
C  3  192 GLU 192 192 192 GLU GLU 3 . n 
C  3  193 GLU 193 193 193 GLU GLU 3 . n 
C  3  194 VAL 194 194 194 VAL VAL 3 . n 
C  3  195 PRO 195 195 195 PRO PRO 3 . n 
C  3  196 GLY 196 196 196 GLY GLY 3 . n 
C  3  197 ASP 197 197 197 ASP ASP 3 . n 
C  3  198 GLU 198 198 198 GLU GLU 3 . n 
C  3  199 VAL 199 199 199 VAL VAL 3 . n 
C  3  200 LEU 200 200 200 LEU LEU 3 . n 
C  3  201 ASP 201 201 201 ASP ASP 3 . n 
C  3  202 PHE 202 202 202 PHE PHE 3 . n 
C  3  203 ILE 203 203 203 ILE ILE 3 . n 
C  3  204 GLU 204 204 204 GLU GLU 3 . n 
C  3  205 ARG 205 205 205 ARG ARG 3 . n 
C  3  206 GLY 206 206 206 GLY GLY 3 . n 
C  3  207 VAL 207 207 207 VAL VAL 3 . n 
C  3  208 HIS 208 208 208 HIS HIS 3 . n 
C  3  209 THR 209 209 209 THR THR 3 . n 
C  3  210 PHE 210 210 210 PHE PHE 3 . n 
C  3  211 ILE 211 211 211 ILE ILE 3 . n 
C  3  212 GLY 212 212 212 GLY GLY 3 . n 
C  3  213 THR 213 213 213 THR THR 3 . n 
C  3  214 MET 214 214 214 MET MET 3 . n 
C  3  215 ASP 215 215 215 ASP ASP 3 . n 
C  3  216 PHE 216 216 216 PHE PHE 3 . n 
C  3  217 GLY 217 217 217 GLY GLY 3 . n 
C  3  218 LEU 218 218 218 LEU LEU 3 . n 
C  3  219 PRO 219 219 219 PRO PRO 3 . n 
C  3  220 SER 220 220 220 SER SER 3 . n 
C  3  221 GLY 221 221 221 GLY GLY 3 . n 
C  3  222 PHE 222 222 222 PHE PHE 3 . n 
C  3  223 SER 223 223 223 SER SER 3 . n 
C  3  224 GLY 224 224 224 GLY GLY 3 . n 
C  3  225 ASN 225 225 225 ASN ASN 3 . n 
C  3  226 ILE 226 226 226 ILE ILE 3 . n 
C  3  227 THR 227 227 227 THR THR 3 . n 
C  3  228 ASP 228 228 228 ASP ASP 3 . n 
C  3  229 ILE 229 229 229 ILE ILE 3 . n 
C  3  230 CYS 230 230 230 CYS CYS 3 . n 
C  3  231 PRO 231 231 231 PRO PRO 3 . n 
C  3  232 VAL 232 232 232 VAL VAL 3 . n 
C  3  233 GLY 233 233 233 GLY GLY 3 . n 
C  3  234 ALA 234 234 234 ALA ALA 3 . n 
C  3  235 LEU 235 235 235 LEU LEU 3 . n 
C  3  236 LEU 236 236 236 LEU LEU 3 . n 
C  3  237 ASP 237 237 237 ASP ASP 3 . n 
C  3  238 LEU 238 238 238 LEU LEU 3 . n 
C  3  239 THR 239 239 239 THR THR 3 . n 
C  3  240 ALA 240 240 240 ALA ALA 3 . n 
C  3  241 ARG 241 241 241 ARG ARG 3 . n 
C  3  242 PHE 242 242 242 PHE PHE 3 . n 
C  3  243 ARG 243 243 243 ARG ARG 3 . n 
C  3  244 ALA 244 244 244 ALA ALA 3 . n 
C  3  245 ARG 245 245 245 ARG ARG 3 . n 
C  3  246 ASN 246 246 246 ASN ASN 3 . n 
C  3  247 TRP 247 247 247 TRP TRP 3 . n 
C  3  248 GLU 248 248 248 GLU GLU 3 . n 
C  3  249 MET 249 249 249 MET MET 3 . n 
C  3  250 GLU 250 250 250 GLU GLU 3 . n 
C  3  251 GLU 251 251 251 GLU GLU 3 . n 
C  3  252 THR 252 252 252 THR THR 3 . n 
C  3  253 PRO 253 253 253 PRO PRO 3 . n 
C  3  254 THR 254 254 254 THR THR 3 . n 
C  3  255 THR 255 255 255 THR THR 3 . n 
C  3  256 CYS 256 256 256 CYS CYS 3 . n 
C  3  257 ALA 257 257 257 ALA ALA 3 . n 
C  3  258 LEU 258 258 258 LEU LEU 3 . n 
C  3  259 CYS 259 259 259 CYS CYS 3 . n 
C  3  260 PRO 260 260 260 PRO PRO 3 . n 
C  3  261 VAL 261 261 261 VAL VAL 3 . n 
C  3  262 GLY 262 262 262 GLY GLY 3 . n 
C  3  263 CYS 263 263 263 CYS CYS 3 . n 
C  3  264 GLY 264 264 264 GLY GLY 3 . n 
C  3  265 ILE 265 265 265 ILE ILE 3 . n 
C  3  266 THR 266 266 266 THR THR 3 . n 
C  3  267 ALA 267 267 267 ALA ALA 3 . n 
C  3  268 ASP 268 268 268 ASP ASP 3 . n 
C  3  269 THR 269 269 269 THR THR 3 . n 
C  3  270 ARG 270 270 270 ARG ARG 3 . n 
C  3  271 SER 271 271 271 SER SER 3 . n 
C  3  272 GLY 272 272 272 GLY GLY 3 . n 
C  3  273 GLU 273 273 273 GLU GLU 3 . n 
C  3  274 LEU 274 274 274 LEU LEU 3 . n 
C  3  275 LEU 275 275 275 LEU LEU 3 . n 
C  3  276 ARG 276 276 276 ARG ARG 3 . n 
C  3  277 ILE 277 277 277 ILE ILE 3 . n 
C  3  278 ARG 278 278 278 ARG ARG 3 . n 
C  3  279 ALA 279 279 279 ALA ALA 3 . n 
C  3  280 ARG 280 280 280 ARG ARG 3 . n 
C  3  281 GLU 281 281 281 GLU GLU 3 . n 
C  3  282 VAL 282 282 282 VAL VAL 3 . n 
C  3  283 PRO 283 283 283 PRO PRO 3 . n 
C  3  284 GLU 284 284 284 GLU GLU 3 . n 
C  3  285 VAL 285 285 285 VAL VAL 3 . n 
C  3  286 ASN 286 286 286 ASN ASN 3 . n 
C  3  287 GLU 287 287 287 GLU GLU 3 . n 
C  3  288 ILE 288 288 288 ILE ILE 3 . n 
C  3  289 TRP 289 289 289 TRP TRP 3 . n 
C  3  290 ILE 290 290 290 ILE ILE 3 . n 
C  3  291 CYS 291 291 291 CYS CYS 3 . n 
C  3  292 ASP 292 292 292 ASP ASP 3 . n 
C  3  293 ALA 293 293 293 ALA ALA 3 . n 
C  3  294 GLY 294 294 294 GLY GLY 3 . n 
C  3  295 ARG 295 295 295 ARG ARG 3 . n 
C  3  296 PHE 296 296 296 PHE PHE 3 . n 
C  3  297 GLY 297 297 297 GLY GLY 3 . n 
C  3  298 HIS 298 298 298 HIS HIS 3 . n 
C  3  299 GLU 299 299 299 GLU GLU 3 . n 
C  3  300 TRP 300 300 300 TRP TRP 3 . n 
C  3  301 ALA 301 301 301 ALA ALA 3 . n 
C  3  302 ASP 302 302 302 ASP ASP 3 . n 
C  3  303 GLN 303 303 303 GLN GLN 3 . n 
C  3  304 ASN 304 304 304 ASN ASN 3 . n 
C  3  305 ARG 305 305 305 ARG ARG 3 . n 
C  3  306 LEU 306 306 306 LEU LEU 3 . n 
C  3  307 LYS 307 307 307 LYS LYS 3 . n 
C  3  308 THR 308 308 308 THR THR 3 . n 
C  3  309 PRO 309 309 309 PRO PRO 3 . n 
C  3  310 LEU 310 310 310 LEU LEU 3 . n 
C  3  311 VAL 311 311 311 VAL VAL 3 . n 
C  3  312 ARG 312 312 312 ARG ARG 3 . n 
C  3  313 LYS 313 313 313 LYS LYS 3 . n 
C  3  314 GLU 314 314 314 GLU GLU 3 . n 
C  3  315 GLY 315 315 315 GLY GLY 3 . n 
C  3  316 ARG 316 316 316 ARG ARG 3 . n 
C  3  317 LEU 317 317 317 LEU LEU 3 . n 
C  3  318 VAL 318 318 318 VAL VAL 3 . n 
C  3  319 GLU 319 319 319 GLU GLU 3 . n 
C  3  320 ALA 320 320 320 ALA ALA 3 . n 
C  3  321 THR 321 321 321 THR THR 3 . n 
C  3  322 TRP 322 322 322 TRP TRP 3 . n 
C  3  323 GLU 323 323 323 GLU GLU 3 . n 
C  3  324 GLU 324 324 324 GLU GLU 3 . n 
C  3  325 ALA 325 325 325 ALA ALA 3 . n 
C  3  326 PHE 326 326 326 PHE PHE 3 . n 
C  3  327 LEU 327 327 327 LEU LEU 3 . n 
C  3  328 ALA 328 328 328 ALA ALA 3 . n 
C  3  329 LEU 329 329 329 LEU LEU 3 . n 
C  3  330 LYS 330 330 330 LYS LYS 3 . n 
C  3  331 GLU 331 331 331 GLU GLU 3 . n 
C  3  332 GLY 332 332 332 GLY GLY 3 . n 
C  3  333 LEU 333 333 333 LEU LEU 3 . n 
C  3  334 LYS 334 334 334 LYS LYS 3 . n 
C  3  335 GLU 335 335 335 GLU GLU 3 . n 
C  3  336 ALA 336 336 336 ALA ALA 3 . n 
C  3  337 ARG 337 337 337 ARG ARG 3 . n 
C  3  338 GLY 338 338 338 GLY GLY 3 . n 
C  3  339 GLU 339 339 339 GLU GLU 3 . n 
C  3  340 GLU 340 340 340 GLU GLU 3 . n 
C  3  341 VAL 341 341 341 VAL VAL 3 . n 
C  3  342 GLY 342 342 342 GLY GLY 3 . n 
C  3  343 LEU 343 343 343 LEU LEU 3 . n 
C  3  344 TYR 344 344 344 TYR TYR 3 . n 
C  3  345 LEU 345 345 345 LEU LEU 3 . n 
C  3  346 ALA 346 346 346 ALA ALA 3 . n 
C  3  347 HIS 347 347 347 HIS HIS 3 . n 
C  3  348 ASP 348 348 348 ASP ASP 3 . n 
C  3  349 ALA 349 349 349 ALA ALA 3 . n 
C  3  350 THR 350 350 350 THR THR 3 . n 
C  3  351 LEU 351 351 351 LEU LEU 3 . n 
C  3  352 GLU 352 352 352 GLU GLU 3 . n 
C  3  353 GLU 353 353 353 GLU GLU 3 . n 
C  3  354 GLY 354 354 354 GLY GLY 3 . n 
C  3  355 LEU 355 355 355 LEU LEU 3 . n 
C  3  356 LEU 356 356 356 LEU LEU 3 . n 
C  3  357 ALA 357 357 357 ALA ALA 3 . n 
C  3  358 SER 358 358 358 SER SER 3 . n 
C  3  359 GLU 359 359 359 GLU GLU 3 . n 
C  3  360 LEU 360 360 360 LEU LEU 3 . n 
C  3  361 ALA 361 361 361 ALA ALA 3 . n 
C  3  362 LYS 362 362 362 LYS LYS 3 . n 
C  3  363 ALA 363 363 363 ALA ALA 3 . n 
C  3  364 LEU 364 364 364 LEU LEU 3 . n 
C  3  365 LYS 365 365 365 LYS LYS 3 . n 
C  3  366 THR 366 366 366 THR THR 3 . n 
C  3  367 PRO 367 367 367 PRO PRO 3 . n 
C  3  368 HIS 368 368 368 HIS HIS 3 . n 
C  3  369 LEU 369 369 369 LEU LEU 3 . n 
C  3  370 ASP 370 370 370 ASP ASP 3 . n 
C  3  371 PHE 371 371 371 PHE PHE 3 . n 
C  3  372 GLN 372 372 372 GLN GLN 3 . n 
C  3  373 GLY 373 373 373 GLY GLY 3 . n 
C  3  374 ARG 374 374 374 ARG ARG 3 . n 
C  3  375 THR 375 375 375 THR THR 3 . n 
C  3  376 ALA 376 376 376 ALA ALA 3 . n 
C  3  377 ALA 377 377 377 ALA ALA 3 . n 
C  3  378 PRO 378 378 378 PRO PRO 3 . n 
C  3  379 ALA 379 379 379 ALA ALA 3 . n 
C  3  380 SER 380 380 380 SER SER 3 . n 
C  3  381 LEU 381 381 381 LEU LEU 3 . n 
C  3  382 PHE 382 382 382 PHE PHE 3 . n 
C  3  383 PRO 383 383 383 PRO PRO 3 . n 
C  3  384 PRO 384 384 384 PRO PRO 3 . n 
C  3  385 ALA 385 385 385 ALA ALA 3 . n 
C  3  386 SER 386 386 386 SER SER 3 . n 
C  3  387 LEU 387 387 387 LEU LEU 3 . n 
C  3  388 GLU 388 388 388 GLU GLU 3 . n 
C  3  389 ASP 389 389 389 ASP ASP 3 . n 
C  3  390 LEU 390 390 390 LEU LEU 3 . n 
C  3  391 LEU 391 391 391 LEU LEU 3 . n 
C  3  392 GLN 392 392 392 GLN GLN 3 . n 
C  3  393 ALA 393 393 393 ALA ALA 3 . n 
C  3  394 ASP 394 394 394 ASP ASP 3 . n 
C  3  395 PHE 395 395 395 PHE PHE 3 . n 
C  3  396 ALA 396 396 396 ALA ALA 3 . n 
C  3  397 LEU 397 397 397 LEU LEU 3 . n 
C  3  398 VAL 398 398 398 VAL VAL 3 . n 
C  3  399 LEU 399 399 399 LEU LEU 3 . n 
C  3  400 GLY 400 400 400 GLY GLY 3 . n 
C  3  401 ASP 401 401 401 ASP ASP 3 . n 
C  3  402 PRO 402 402 402 PRO PRO 3 . n 
C  3  403 THR 403 403 403 THR THR 3 . n 
C  3  404 GLU 404 404 404 GLU GLU 3 . n 
C  3  405 GLU 405 405 405 GLU GLU 3 . n 
C  3  406 ALA 406 406 406 ALA ALA 3 . n 
C  3  407 PRO 407 407 407 PRO PRO 3 . n 
C  3  408 ILE 408 408 408 ILE ILE 3 . n 
C  3  409 LEU 409 409 409 LEU LEU 3 . n 
C  3  410 HIS 410 410 410 HIS HIS 3 . n 
C  3  411 LEU 411 411 411 LEU LEU 3 . n 
C  3  412 ARG 412 412 412 ARG ARG 3 . n 
C  3  413 LEU 413 413 413 LEU LEU 3 . n 
C  3  414 SER 414 414 414 SER SER 3 . n 
C  3  415 GLU 415 415 415 GLU GLU 3 . n 
C  3  416 PHE 416 416 416 PHE PHE 3 . n 
C  3  417 VAL 417 417 417 VAL VAL 3 . n 
C  3  418 ARG 418 418 418 ARG ARG 3 . n 
C  3  419 ASP 419 419 419 ASP ASP 3 . n 
C  3  420 LEU 420 420 420 LEU LEU 3 . n 
C  3  421 LYS 421 421 421 LYS LYS 3 . n 
C  3  422 PRO 422 422 422 PRO PRO 3 . n 
C  3  423 PRO 423 423 423 PRO PRO 3 . n 
C  3  424 HIS 424 424 424 HIS HIS 3 . n 
C  3  425 ARG 425 425 425 ARG ARG 3 . n 
C  3  426 TYR 426 426 426 TYR TYR 3 . n 
C  3  427 ASN 427 427 427 ASN ASN 3 . n 
C  3  428 HIS 428 428 428 HIS HIS 3 . n 
C  3  429 GLY 429 429 429 GLY GLY 3 . n 
C  3  430 THR 430 430 430 THR THR 3 . n 
C  3  431 PRO 431 431 431 PRO PRO 3 . n 
C  3  432 PHE 432 432 432 PHE PHE 3 . n 
C  3  433 ALA 433 433 433 ALA ALA 3 . n 
C  3  434 ASP 434 434 434 ASP ASP 3 . n 
C  3  435 LEU 435 435 435 LEU LEU 3 . n 
C  3  436 GLN 436 436 436 GLN GLN 3 . n 
C  3  437 ILE 437 437 437 ILE ILE 3 . n 
C  3  438 LYS 438 438 438 LYS LYS 3 . n 
C  3  439 GLU 439 439 439 GLU GLU 3 . n 
C  3  440 ARG 440 440 440 ARG ARG 3 . n 
C  3  441 MET 441 441 441 MET MET 3 . n 
C  3  442 PRO 442 442 442 PRO PRO 3 . n 
C  3  443 ARG 443 443 443 ARG ARG 3 . n 
C  3  444 ARG 444 444 444 ARG ARG 3 . n 
C  3  445 THR 445 445 445 THR THR 3 . n 
C  3  446 ASP 446 446 446 ASP ASP 3 . n 
C  3  447 LYS 447 447 447 LYS LYS 3 . n 
C  3  448 MET 448 448 448 MET MET 3 . n 
C  3  449 ALA 449 449 449 ALA ALA 3 . n 
C  3  450 LEU 450 450 450 LEU LEU 3 . n 
C  3  451 PHE 451 451 451 PHE PHE 3 . n 
C  3  452 ALA 452 452 452 ALA ALA 3 . n 
C  3  453 PRO 453 453 453 PRO PRO 3 . n 
C  3  454 TYR 454 454 454 TYR TYR 3 . n 
C  3  455 ARG 455 455 455 ARG ARG 3 . n 
C  3  456 ALA 456 456 456 ALA ALA 3 . n 
C  3  457 PRO 457 457 457 PRO PRO 3 . n 
C  3  458 LEU 458 458 458 LEU LEU 3 . n 
C  3  459 MET 459 459 459 MET MET 3 . n 
C  3  460 LYS 460 460 460 LYS LYS 3 . n 
C  3  461 TRP 461 461 461 TRP TRP 3 . n 
C  3  462 ALA 462 462 462 ALA ALA 3 . n 
C  3  463 ALA 463 463 463 ALA ALA 3 . n 
C  3  464 ILE 464 464 464 ILE ILE 3 . n 
C  3  465 HIS 465 465 465 HIS HIS 3 . n 
C  3  466 GLU 466 466 466 GLU GLU 3 . n 
C  3  467 VAL 467 467 467 VAL VAL 3 . n 
C  3  468 HIS 468 468 468 HIS HIS 3 . n 
C  3  469 ARG 469 469 469 ARG ARG 3 . n 
C  3  470 PRO 470 470 470 PRO PRO 3 . n 
C  3  471 GLY 471 471 471 GLY GLY 3 . n 
C  3  472 GLU 472 472 472 GLU GLU 3 . n 
C  3  473 GLU 473 473 473 GLU GLU 3 . n 
C  3  474 ARG 474 474 474 ARG ARG 3 . n 
C  3  475 GLU 475 475 475 GLU GLU 3 . n 
C  3  476 ILE 476 476 476 ILE ILE 3 . n 
C  3  477 LEU 477 477 477 LEU LEU 3 . n 
C  3  478 LEU 478 478 478 LEU LEU 3 . n 
C  3  479 ALA 479 479 479 ALA ALA 3 . n 
C  3  480 LEU 480 480 480 LEU LEU 3 . n 
C  3  481 LEU 481 481 481 LEU LEU 3 . n 
C  3  482 GLY 482 482 482 GLY GLY 3 . n 
C  3  483 ASP 483 483 483 ASP ASP 3 . n 
C  3  484 LYS 484 484 484 LYS LYS 3 . n 
C  3  485 GLU 485 485 485 GLU GLU 3 . n 
C  3  486 GLY 486 486 486 GLY GLY 3 . n 
C  3  487 SER 487 487 487 SER SER 3 . n 
C  3  488 GLU 488 488 488 GLU GLU 3 . n 
C  3  489 MET 489 489 489 MET MET 3 . n 
C  3  490 VAL 490 490 490 VAL VAL 3 . n 
C  3  491 ALA 491 491 491 ALA ALA 3 . n 
C  3  492 LYS 492 492 492 LYS LYS 3 . n 
C  3  493 ALA 493 493 493 ALA ALA 3 . n 
C  3  494 LYS 494 494 494 LYS LYS 3 . n 
C  3  495 GLU 495 495 495 GLU GLU 3 . n 
C  3  496 ALA 496 496 496 ALA ALA 3 . n 
C  3  497 TRP 497 497 497 TRP TRP 3 . n 
C  3  498 GLU 498 498 498 GLU GLU 3 . n 
C  3  499 LYS 499 499 499 LYS LYS 3 . n 
C  3  500 ALA 500 500 500 ALA ALA 3 . n 
C  3  501 LYS 501 501 501 LYS LYS 3 . n 
C  3  502 ASN 502 502 502 ASN ASN 3 . n 
C  3  503 PRO 503 503 503 PRO PRO 3 . n 
C  3  504 VAL 504 504 504 VAL VAL 3 . n 
C  3  505 LEU 505 505 505 LEU LEU 3 . n 
C  3  506 ILE 506 506 506 ILE ILE 3 . n 
C  3  507 LEU 507 507 507 LEU LEU 3 . n 
C  3  508 GLY 508 508 508 GLY GLY 3 . n 
C  3  509 ALA 509 509 509 ALA ALA 3 . n 
C  3  510 GLY 510 510 510 GLY GLY 3 . n 
C  3  511 VAL 511 511 511 VAL VAL 3 . n 
C  3  512 LEU 512 512 512 LEU LEU 3 . n 
C  3  513 GLN 513 513 513 GLN GLN 3 . n 
C  3  514 ASP 514 514 514 ASP ASP 3 . n 
C  3  515 THR 515 515 515 THR THR 3 . n 
C  3  516 VAL 516 516 516 VAL VAL 3 . n 
C  3  517 ALA 517 517 517 ALA ALA 3 . n 
C  3  518 ALA 518 518 518 ALA ALA 3 . n 
C  3  519 GLU 519 519 519 GLU GLU 3 . n 
C  3  520 ARG 520 520 520 ARG ARG 3 . n 
C  3  521 ALA 521 521 521 ALA ALA 3 . n 
C  3  522 ARG 522 522 522 ARG ARG 3 . n 
C  3  523 LEU 523 523 523 LEU LEU 3 . n 
C  3  524 LEU 524 524 524 LEU LEU 3 . n 
C  3  525 ALA 525 525 525 ALA ALA 3 . n 
C  3  526 GLU 526 526 526 GLU GLU 3 . n 
C  3  527 ARG 527 527 527 ARG ARG 3 . n 
C  3  528 LYS 528 528 528 LYS LYS 3 . n 
C  3  529 GLY 529 529 529 GLY GLY 3 . n 
C  3  530 ALA 530 530 530 ALA ALA 3 . n 
C  3  531 LYS 531 531 531 LYS LYS 3 . n 
C  3  532 VAL 532 532 532 VAL VAL 3 . n 
C  3  533 LEU 533 533 533 LEU LEU 3 . n 
C  3  534 ALA 534 534 534 ALA ALA 3 . n 
C  3  535 MET 535 535 535 MET MET 3 . n 
C  3  536 THR 536 536 536 THR THR 3 . n 
C  3  537 PRO 537 537 537 PRO PRO 3 . n 
C  3  538 ALA 538 538 538 ALA ALA 3 . n 
C  3  539 ALA 539 539 539 ALA ALA 3 . n 
C  3  540 ASN 540 540 540 ASN ASN 3 . n 
C  3  541 ALA 541 541 541 ALA ALA 3 . n 
C  3  542 ARG 542 542 542 ARG ARG 3 . n 
C  3  543 GLY 543 543 543 GLY GLY 3 . n 
C  3  544 LEU 544 544 544 LEU LEU 3 . n 
C  3  545 GLU 545 545 545 GLU GLU 3 . n 
C  3  546 ALA 546 546 546 ALA ALA 3 . n 
C  3  547 MET 547 547 547 MET MET 3 . n 
C  3  548 GLY 548 548 548 GLY GLY 3 . n 
C  3  549 VAL 549 549 549 VAL VAL 3 . n 
C  3  550 LEU 550 550 550 LEU LEU 3 . n 
C  3  551 PRO 551 551 551 PRO PRO 3 . n 
C  3  552 GLY 552 552 552 GLY GLY 3 . n 
C  3  553 ALA 553 553 553 ALA ALA 3 . n 
C  3  554 LYS 554 554 554 LYS LYS 3 . n 
C  3  555 GLY 555 555 555 GLY GLY 3 . n 
C  3  556 ALA 556 556 556 ALA ALA 3 . n 
C  3  557 SER 557 557 557 SER SER 3 . n 
C  3  558 TRP 558 558 558 TRP TRP 3 . n 
C  3  559 ASP 559 559 559 ASP ASP 3 . n 
C  3  560 GLU 560 560 560 GLU GLU 3 . n 
C  3  561 PRO 561 561 561 PRO PRO 3 . n 
C  3  562 GLY 562 562 562 GLY GLY 3 . n 
C  3  563 ALA 563 563 563 ALA ALA 3 . n 
C  3  564 LEU 564 564 564 LEU LEU 3 . n 
C  3  565 TYR 565 565 565 TYR TYR 3 . n 
C  3  566 ALA 566 566 566 ALA ALA 3 . n 
C  3  567 TYR 567 567 567 TYR TYR 3 . n 
C  3  568 TYR 568 568 568 TYR TYR 3 . n 
C  3  569 GLY 569 569 569 GLY GLY 3 . n 
C  3  570 PHE 570 570 570 PHE PHE 3 . n 
C  3  571 VAL 571 571 571 VAL VAL 3 . n 
C  3  572 PRO 572 572 572 PRO PRO 3 . n 
C  3  573 PRO 573 573 573 PRO PRO 3 . n 
C  3  574 GLU 574 574 574 GLU GLU 3 . n 
C  3  575 GLU 575 575 575 GLU GLU 3 . n 
C  3  576 ALA 576 576 576 ALA ALA 3 . n 
C  3  577 LEU 577 577 577 LEU LEU 3 . n 
C  3  578 LYS 578 578 578 LYS LYS 3 . n 
C  3  579 GLY 579 579 579 GLY GLY 3 . n 
C  3  580 LYS 580 580 580 LYS LYS 3 . n 
C  3  581 ARG 581 581 581 ARG ARG 3 . n 
C  3  582 PHE 582 582 582 PHE PHE 3 . n 
C  3  583 VAL 583 583 583 VAL VAL 3 . n 
C  3  584 VAL 584 584 584 VAL VAL 3 . n 
C  3  585 MET 585 585 585 MET MET 3 . n 
C  3  586 HIS 586 586 586 HIS HIS 3 . n 
C  3  587 LEU 587 587 587 LEU LEU 3 . n 
C  3  588 SER 588 588 588 SER SER 3 . n 
C  3  589 HIS 589 589 589 HIS HIS 3 . n 
C  3  590 LEU 590 590 590 LEU LEU 3 . n 
C  3  591 HIS 591 591 591 HIS HIS 3 . n 
C  3  592 PRO 592 592 592 PRO PRO 3 . n 
C  3  593 LEU 593 593 593 LEU LEU 3 . n 
C  3  594 ALA 594 594 594 ALA ALA 3 . n 
C  3  595 GLU 595 595 595 GLU GLU 3 . n 
C  3  596 ARG 596 596 596 ARG ARG 3 . n 
C  3  597 TYR 597 597 597 TYR TYR 3 . n 
C  3  598 ALA 598 598 598 ALA ALA 3 . n 
C  3  599 HIS 599 599 599 HIS HIS 3 . n 
C  3  600 VAL 600 600 600 VAL VAL 3 . n 
C  3  601 VAL 601 601 601 VAL VAL 3 . n 
C  3  602 LEU 602 602 602 LEU LEU 3 . n 
C  3  603 PRO 603 603 603 PRO PRO 3 . n 
C  3  604 ALA 604 604 604 ALA ALA 3 . n 
C  3  605 PRO 605 605 605 PRO PRO 3 . n 
C  3  606 THR 606 606 606 THR THR 3 . n 
C  3  607 PHE 607 607 607 PHE PHE 3 . n 
C  3  608 TYR 608 608 608 TYR TYR 3 . n 
C  3  609 GLU 609 609 609 GLU GLU 3 . n 
C  3  610 LYS 610 610 610 LYS LYS 3 . n 
C  3  611 ARG 611 611 611 ARG ARG 3 . n 
C  3  612 GLY 612 612 612 GLY GLY 3 . n 
C  3  613 HIS 613 613 613 HIS HIS 3 . n 
C  3  614 LEU 614 614 614 LEU LEU 3 . n 
C  3  615 VAL 615 615 615 VAL VAL 3 . n 
C  3  616 ASN 616 616 616 ASN ASN 3 . n 
C  3  617 LEU 617 617 617 LEU LEU 3 . n 
C  3  618 GLU 618 618 618 GLU GLU 3 . n 
C  3  619 GLY 619 619 619 GLY GLY 3 . n 
C  3  620 ARG 620 620 620 ARG ARG 3 . n 
C  3  621 VAL 621 621 621 VAL VAL 3 . n 
C  3  622 LEU 622 622 622 LEU LEU 3 . n 
C  3  623 PRO 623 623 623 PRO PRO 3 . n 
C  3  624 LEU 624 624 624 LEU LEU 3 . n 
C  3  625 SER 625 625 625 SER SER 3 . n 
C  3  626 PRO 626 626 626 PRO PRO 3 . n 
C  3  627 ALA 627 627 627 ALA ALA 3 . n 
C  3  628 PRO 628 628 628 PRO PRO 3 . n 
C  3  629 ILE 629 629 629 ILE ILE 3 . n 
C  3  630 GLU 630 630 630 GLU GLU 3 . n 
C  3  631 ASN 631 631 631 ASN ASN 3 . n 
C  3  632 GLY 632 632 632 GLY GLY 3 . n 
C  3  633 GLU 633 633 633 GLU GLU 3 . n 
C  3  634 ALA 634 634 634 ALA ALA 3 . n 
C  3  635 GLU 635 635 635 GLU GLU 3 . n 
C  3  636 GLY 636 636 636 GLY GLY 3 . n 
C  3  637 ALA 637 637 637 ALA ALA 3 . n 
C  3  638 LEU 638 638 638 LEU LEU 3 . n 
C  3  639 GLN 639 639 639 GLN GLN 3 . n 
C  3  640 VAL 640 640 640 VAL VAL 3 . n 
C  3  641 LEU 641 641 641 LEU LEU 3 . n 
C  3  642 ALA 642 642 642 ALA ALA 3 . n 
C  3  643 LEU 643 643 643 LEU LEU 3 . n 
C  3  644 LEU 644 644 644 LEU LEU 3 . n 
C  3  645 ALA 645 645 645 ALA ALA 3 . n 
C  3  646 GLU 646 646 646 GLU GLU 3 . n 
C  3  647 ALA 647 647 647 ALA ALA 3 . n 
C  3  648 LEU 648 648 648 LEU LEU 3 . n 
C  3  649 GLY 649 649 649 GLY GLY 3 . n 
C  3  650 VAL 650 650 650 VAL VAL 3 . n 
C  3  651 ARG 651 651 651 ARG ARG 3 . n 
C  3  652 PRO 652 652 652 PRO PRO 3 . n 
C  3  653 PRO 653 653 653 PRO PRO 3 . n 
C  3  654 PHE 654 654 654 PHE PHE 3 . n 
C  3  655 ARG 655 655 655 ARG ARG 3 . n 
C  3  656 LEU 656 656 656 LEU LEU 3 . n 
C  3  657 HIS 657 657 657 HIS HIS 3 . n 
C  3  658 LEU 658 658 658 LEU LEU 3 . n 
C  3  659 GLU 659 659 659 GLU GLU 3 . n 
C  3  660 ALA 660 660 660 ALA ALA 3 . n 
C  3  661 GLN 661 661 661 GLN GLN 3 . n 
C  3  662 LYS 662 662 662 LYS LYS 3 . n 
C  3  663 ALA 663 663 663 ALA ALA 3 . n 
C  3  664 LEU 664 664 664 LEU LEU 3 . n 
C  3  665 LYS 665 665 665 LYS LYS 3 . n 
C  3  666 ALA 666 666 666 ALA ALA 3 . n 
C  3  667 ARG 667 667 667 ARG ARG 3 . n 
C  3  668 LYS 668 668 668 LYS LYS 3 . n 
C  3  669 VAL 669 669 669 VAL VAL 3 . n 
C  3  670 PRO 670 670 670 PRO PRO 3 . n 
C  3  671 GLU 671 671 671 GLU GLU 3 . n 
C  3  672 ALA 672 672 672 ALA ALA 3 . n 
C  3  673 MET 673 673 673 MET MET 3 . n 
C  3  674 GLY 674 674 674 GLY GLY 3 . n 
C  3  675 ARG 675 675 675 ARG ARG 3 . n 
C  3  676 LEU 676 676 676 LEU LEU 3 . n 
C  3  677 SER 677 677 677 SER SER 3 . n 
C  3  678 PHE 678 678 678 PHE PHE 3 . n 
C  3  679 ARG 679 679 679 ARG ARG 3 . n 
C  3  680 LEU 680 680 680 LEU LEU 3 . n 
C  3  681 LYS 681 681 681 LYS LYS 3 . n 
C  3  682 GLU 682 682 682 GLU GLU 3 . n 
C  3  683 LEU 683 683 683 LEU LEU 3 . n 
C  3  684 ARG 684 684 684 ARG ARG 3 . n 
C  3  685 PRO 685 685 685 PRO PRO 3 . n 
C  3  686 LYS 686 686 686 LYS LYS 3 . n 
C  3  687 GLU 687 687 687 GLU GLU 3 . n 
C  3  688 ARG 688 688 688 ARG ARG 3 . n 
C  3  689 LYS 689 689 689 LYS LYS 3 . n 
C  3  690 GLY 690 690 690 GLY GLY 3 . n 
C  3  691 ALA 691 691 691 ALA ALA 3 . n 
C  3  692 PHE 692 692 692 PHE PHE 3 . n 
C  3  693 TYR 693 693 693 TYR TYR 3 . n 
C  3  694 LEU 694 694 694 LEU LEU 3 . n 
C  3  695 ARG 695 695 695 ARG ARG 3 . n 
C  3  696 PRO 696 696 696 PRO PRO 3 . n 
C  3  697 THR 697 697 697 THR THR 3 . n 
C  3  698 MET 698 698 698 MET MET 3 . n 
C  3  699 TRP 699 699 699 TRP TRP 3 . n 
C  3  700 LYS 700 700 700 LYS LYS 3 . n 
C  3  701 ALA 701 701 701 ALA ALA 3 . n 
C  3  702 HIS 702 702 702 HIS HIS 3 . n 
C  3  703 GLN 703 703 703 GLN GLN 3 . n 
C  3  704 ALA 704 704 704 ALA ALA 3 . n 
C  3  705 VAL 705 705 705 VAL VAL 3 . n 
C  3  706 GLY 706 706 706 GLY GLY 3 . n 
C  3  707 LYS 707 707 707 LYS LYS 3 . n 
C  3  708 ALA 708 708 708 ALA ALA 3 . n 
C  3  709 GLN 709 709 709 GLN GLN 3 . n 
C  3  710 GLU 710 710 710 GLU GLU 3 . n 
C  3  711 ALA 711 711 711 ALA ALA 3 . n 
C  3  712 ALA 712 712 712 ALA ALA 3 . n 
C  3  713 ARG 713 713 713 ARG ARG 3 . n 
C  3  714 ALA 714 714 714 ALA ALA 3 . n 
C  3  715 GLU 715 715 715 GLU GLU 3 . n 
C  3  716 LEU 716 716 716 LEU LEU 3 . n 
C  3  717 TRP 717 717 717 TRP TRP 3 . n 
C  3  718 ALA 718 718 718 ALA ALA 3 . n 
C  3  719 HIS 719 719 719 HIS HIS 3 . n 
C  3  720 PRO 720 720 720 PRO PRO 3 . n 
C  3  721 GLU 721 721 721 GLU GLU 3 . n 
C  3  722 THR 722 722 722 THR THR 3 . n 
C  3  723 ALA 723 723 723 ALA ALA 3 . n 
C  3  724 ARG 724 724 724 ARG ARG 3 . n 
C  3  725 ALA 725 725 725 ALA ALA 3 . n 
C  3  726 GLU 726 726 726 GLU GLU 3 . n 
C  3  727 ALA 727 727 727 ALA ALA 3 . n 
C  3  728 LEU 728 728 728 LEU LEU 3 . n 
C  3  729 PRO 729 729 729 PRO PRO 3 . n 
C  3  730 GLU 730 730 730 GLU GLU 3 . n 
C  3  731 GLY 731 731 731 GLY GLY 3 . n 
C  3  732 ALA 732 732 732 ALA ALA 3 . n 
C  3  733 GLN 733 733 733 GLN GLN 3 . n 
C  3  734 VAL 734 734 734 VAL VAL 3 . n 
C  3  735 ALA 735 735 735 ALA ALA 3 . n 
C  3  736 VAL 736 736 736 VAL VAL 3 . n 
C  3  737 GLU 737 737 737 GLU GLU 3 . n 
C  3  738 THR 738 738 738 THR THR 3 . n 
C  3  739 PRO 739 739 739 PRO PRO 3 . n 
C  3  740 PHE 740 740 740 PHE PHE 3 . n 
C  3  741 GLY 741 741 741 GLY GLY 3 . n 
C  3  742 ARG 742 742 742 ARG ARG 3 . n 
C  3  743 VAL 743 743 743 VAL VAL 3 . n 
C  3  744 GLU 744 744 744 GLU GLU 3 . n 
C  3  745 ALA 745 745 745 ALA ALA 3 . n 
C  3  746 ARG 746 746 746 ARG ARG 3 . n 
C  3  747 VAL 747 747 747 VAL VAL 3 . n 
C  3  748 VAL 748 748 748 VAL VAL 3 . n 
C  3  749 HIS 749 749 749 HIS HIS 3 . n 
C  3  750 ARG 750 750 750 ARG ARG 3 . n 
C  3  751 GLU 751 751 751 GLU GLU 3 . n 
C  3  752 ASP 752 752 752 ASP ASP 3 . n 
C  3  753 VAL 753 753 753 VAL VAL 3 . n 
C  3  754 PRO 754 754 754 PRO PRO 3 . n 
C  3  755 LYS 755 755 755 LYS LYS 3 . n 
C  3  756 GLY 756 756 756 GLY GLY 3 . n 
C  3  757 HIS 757 757 757 HIS HIS 3 . n 
C  3  758 LEU 758 758 758 LEU LEU 3 . n 
C  3  759 TYR 759 759 759 TYR TYR 3 . n 
C  3  760 LEU 760 760 760 LEU LEU 3 . n 
C  3  761 SER 761 761 761 SER SER 3 . n 
C  3  762 ALA 762 762 762 ALA ALA 3 . n 
C  3  763 LEU 763 763 763 LEU LEU 3 . n 
C  3  764 GLY 764 764 764 GLY GLY 3 . n 
C  3  765 PRO 765 765 765 PRO PRO 3 . n 
C  3  766 ALA 766 766 766 ALA ALA 3 . n 
C  3  767 ALA 767 767 767 ALA ALA 3 . n 
C  3  768 GLY 768 768 768 GLY GLY 3 . n 
C  3  769 LEU 769 769 769 LEU LEU 3 . n 
C  3  770 ARG 770 770 770 ARG ARG 3 . n 
C  3  771 VAL 771 771 771 VAL VAL 3 . n 
C  3  772 GLU 772 772 772 GLU GLU 3 . n 
C  3  773 GLY 773 773 773 GLY GLY 3 . n 
C  3  774 ARG 774 774 774 ARG ARG 3 . n 
C  3  775 VAL 775 775 775 VAL VAL 3 . n 
C  3  776 LEU 776 776 776 LEU LEU 3 . n 
C  3  777 VAL 777 777 777 VAL VAL 3 . n 
C  3  778 PRO 778 778 ?   ?   ?   3 . n 
C  3  779 ALA 779 779 ?   ?   ?   3 . n 
C  3  780 GLY 780 780 ?   ?   ?   3 . n 
C  3  781 GLY 781 781 ?   ?   ?   3 . n 
C  3  782 GLU 782 782 ?   ?   ?   3 . n 
C  3  783 ALA 783 783 ?   ?   ?   3 . n 
D  4  1   MET 1   1   ?   ?   ?   4 . n 
D  4  2   ARG 2   2   ?   ?   ?   4 . n 
D  4  3   GLU 3   3   ?   ?   ?   4 . n 
D  4  4   GLU 4   4   ?   ?   ?   4 . n 
D  4  5   PHE 5   5   ?   ?   ?   4 . n 
D  4  6   LEU 6   6   ?   ?   ?   4 . n 
D  4  7   GLU 7   7   ?   ?   ?   4 . n 
D  4  8   GLU 8   8   ?   ?   ?   4 . n 
D  4  9   ILE 9   9   ?   ?   ?   4 . n 
D  4  10  PRO 10  10  ?   ?   ?   4 . n 
D  4  11  LEU 11  11  ?   ?   ?   4 . n 
D  4  12  ASP 12  12  ?   ?   ?   4 . n 
D  4  13  ALA 13  13  ?   ?   ?   4 . n 
D  4  14  PRO 14  14  ?   ?   ?   4 . n 
D  4  15  PRO 15  15  ?   ?   ?   4 . n 
D  4  16  GLU 16  16  ?   ?   ?   4 . n 
D  4  17  GLU 17  17  ?   ?   ?   4 . n 
D  4  18  ALA 18  18  ?   ?   ?   4 . n 
D  4  19  LYS 19  19  ?   ?   ?   4 . n 
D  4  20  GLU 20  20  ?   ?   ?   4 . n 
D  4  21  LEU 21  21  ?   ?   ?   4 . n 
D  4  22  ARG 22  22  ?   ?   ?   4 . n 
D  4  23  THR 23  23  ?   ?   ?   4 . n 
D  4  24  GLU 24  24  ?   ?   ?   4 . n 
D  4  25  VAL 25  25  ?   ?   ?   4 . n 
D  4  26  MET 26  26  26  MET MET 4 . n 
D  4  27  THR 27  27  27  THR THR 4 . n 
D  4  28  LEU 28  28  28  LEU LEU 4 . n 
D  4  29  ASN 29  29  29  ASN ASN 4 . n 
D  4  30  VAL 30  30  30  VAL VAL 4 . n 
D  4  31  GLY 31  31  31  GLY GLY 4 . n 
D  4  32  PRO 32  32  32  PRO PRO 4 . n 
D  4  33  GLN 33  33  33  GLN GLN 4 . n 
D  4  34  HIS 34  34  34  HIS HIS 4 . n 
D  4  35  PRO 35  35  35  PRO PRO 4 . n 
D  4  36  SER 36  36  36  SER SER 4 . n 
D  4  37  THR 37  37  37  THR THR 4 . n 
D  4  38  HIS 38  38  38  HIS HIS 4 . n 
D  4  39  GLY 39  39  39  GLY GLY 4 . n 
D  4  40  VAL 40  40  40  VAL VAL 4 . n 
D  4  41  LEU 41  41  41  LEU LEU 4 . n 
D  4  42  ARG 42  42  42  ARG ARG 4 . n 
D  4  43  LEU 43  43  43  LEU LEU 4 . n 
D  4  44  MET 44  44  44  MET MET 4 . n 
D  4  45  VAL 45  45  45  VAL VAL 4 . n 
D  4  46  THR 46  46  46  THR THR 4 . n 
D  4  47  LEU 47  47  47  LEU LEU 4 . n 
D  4  48  SER 48  48  48  SER SER 4 . n 
D  4  49  GLY 49  49  49  GLY GLY 4 . n 
D  4  50  GLU 50  50  50  GLU GLU 4 . n 
D  4  51  GLU 51  51  51  GLU GLU 4 . n 
D  4  52  VAL 52  52  52  VAL VAL 4 . n 
D  4  53  LEU 53  53  53  LEU LEU 4 . n 
D  4  54  GLU 54  54  54  GLU GLU 4 . n 
D  4  55  VAL 55  55  55  VAL VAL 4 . n 
D  4  56  VAL 56  56  56  VAL VAL 4 . n 
D  4  57  PRO 57  57  57  PRO PRO 4 . n 
D  4  58  HIS 58  58  58  HIS HIS 4 . n 
D  4  59  ILE 59  59  59  ILE ILE 4 . n 
D  4  60  GLY 60  60  60  GLY GLY 4 . n 
D  4  61  TYR 61  61  61  TYR TYR 4 . n 
D  4  62  LEU 62  62  62  LEU LEU 4 . n 
D  4  63  HIS 63  63  63  HIS HIS 4 . n 
D  4  64  THR 64  64  64  THR THR 4 . n 
D  4  65  GLY 65  65  65  GLY GLY 4 . n 
D  4  66  PHE 66  66  66  PHE PHE 4 . n 
D  4  67  GLU 67  67  67  GLU GLU 4 . n 
D  4  68  LYS 68  68  68  LYS LYS 4 . n 
D  4  69  THR 69  69  69  THR THR 4 . n 
D  4  70  MET 70  70  70  MET MET 4 . n 
D  4  71  GLU 71  71  71  GLU GLU 4 . n 
D  4  72  HIS 72  72  72  HIS HIS 4 . n 
D  4  73  ARG 73  73  73  ARG ARG 4 . n 
D  4  74  THR 74  74  74  THR THR 4 . n 
D  4  75  TYR 75  75  75  TYR TYR 4 . n 
D  4  76  LEU 76  76  76  LEU LEU 4 . n 
D  4  77  GLN 77  77  77  GLN GLN 4 . n 
D  4  78  ASN 78  78  78  ASN ASN 4 . n 
D  4  79  ILE 79  79  79  ILE ILE 4 . n 
D  4  80  THR 80  80  80  THR THR 4 . n 
D  4  81  TYR 81  81  81  TYR TYR 4 . n 
D  4  82  THR 82  82  82  THR THR 4 . n 
D  4  83  PRO 83  83  83  PRO PRO 4 . n 
D  4  84  ARG 84  84  84  ARG ARG 4 . n 
D  4  85  MET 85  85  85  MET MET 4 . n 
D  4  86  ASP 86  86  86  ASP ASP 4 . n 
D  4  87  TYR 87  87  87  TYR TYR 4 . n 
D  4  88  LEU 88  88  88  LEU LEU 4 . n 
D  4  89  HIS 89  89  89  HIS HIS 4 . n 
D  4  90  SER 90  90  90  SER SER 4 . n 
D  4  91  PHE 91  91  91  PHE PHE 4 . n 
D  4  92  ALA 92  92  92  ALA ALA 4 . n 
D  4  93  HIS 93  93  93  HIS HIS 4 . n 
D  4  94  ASP 94  94  94  ASP ASP 4 . n 
D  4  95  LEU 95  95  95  LEU LEU 4 . n 
D  4  96  ALA 96  96  96  ALA ALA 4 . n 
D  4  97  TYR 97  97  97  TYR TYR 4 . n 
D  4  98  ALA 98  98  98  ALA ALA 4 . n 
D  4  99  LEU 99  99  99  LEU LEU 4 . n 
D  4  100 ALA 100 100 100 ALA ALA 4 . n 
D  4  101 VAL 101 101 101 VAL VAL 4 . n 
D  4  102 GLU 102 102 102 GLU GLU 4 . n 
D  4  103 LYS 103 103 103 LYS LYS 4 . n 
D  4  104 LEU 104 104 104 LEU LEU 4 . n 
D  4  105 LEU 105 105 105 LEU LEU 4 . n 
D  4  106 GLY 106 106 106 GLY GLY 4 . n 
D  4  107 ALA 107 107 107 ALA ALA 4 . n 
D  4  108 VAL 108 108 108 VAL VAL 4 . n 
D  4  109 VAL 109 109 109 VAL VAL 4 . n 
D  4  110 PRO 110 110 110 PRO PRO 4 . n 
D  4  111 PRO 111 111 111 PRO PRO 4 . n 
D  4  112 ARG 112 112 112 ARG ARG 4 . n 
D  4  113 ALA 113 113 113 ALA ALA 4 . n 
D  4  114 GLU 114 114 114 GLU GLU 4 . n 
D  4  115 THR 115 115 115 THR THR 4 . n 
D  4  116 ILE 116 116 116 ILE ILE 4 . n 
D  4  117 ARG 117 117 117 ARG ARG 4 . n 
D  4  118 VAL 118 118 118 VAL VAL 4 . n 
D  4  119 ILE 119 119 119 ILE ILE 4 . n 
D  4  120 LEU 120 120 120 LEU LEU 4 . n 
D  4  121 ASN 121 121 121 ASN ASN 4 . n 
D  4  122 GLU 122 122 122 GLU GLU 4 . n 
D  4  123 LEU 123 123 123 LEU LEU 4 . n 
D  4  124 SER 124 124 124 SER SER 4 . n 
D  4  125 ARG 125 125 125 ARG ARG 4 . n 
D  4  126 LEU 126 126 126 LEU LEU 4 . n 
D  4  127 ALA 127 127 127 ALA ALA 4 . n 
D  4  128 SER 128 128 128 SER SER 4 . n 
D  4  129 HIS 129 129 129 HIS HIS 4 . n 
D  4  130 LEU 130 130 130 LEU LEU 4 . n 
D  4  131 VAL 131 131 131 VAL VAL 4 . n 
D  4  132 PHE 132 132 132 PHE PHE 4 . n 
D  4  133 LEU 133 133 133 LEU LEU 4 . n 
D  4  134 GLY 134 134 134 GLY GLY 4 . n 
D  4  135 THR 135 135 135 THR THR 4 . n 
D  4  136 GLY 136 136 136 GLY GLY 4 . n 
D  4  137 LEU 137 137 137 LEU LEU 4 . n 
D  4  138 LEU 138 138 138 LEU LEU 4 . n 
D  4  139 ASP 139 139 139 ASP ASP 4 . n 
D  4  140 LEU 140 140 140 LEU LEU 4 . n 
D  4  141 GLY 141 141 141 GLY GLY 4 . n 
D  4  142 ALA 142 142 142 ALA ALA 4 . n 
D  4  143 LEU 143 143 143 LEU LEU 4 . n 
D  4  144 THR 144 144 144 THR THR 4 . n 
D  4  145 PRO 145 145 145 PRO PRO 4 . n 
D  4  146 PHE 146 146 146 PHE PHE 4 . n 
D  4  147 PHE 147 147 147 PHE PHE 4 . n 
D  4  148 TYR 148 148 148 TYR TYR 4 . n 
D  4  149 ALA 149 149 149 ALA ALA 4 . n 
D  4  150 PHE 150 150 150 PHE PHE 4 . n 
D  4  151 ARG 151 151 151 ARG ARG 4 . n 
D  4  152 GLU 152 152 152 GLU GLU 4 . n 
D  4  153 ARG 153 153 153 ARG ARG 4 . n 
D  4  154 GLU 154 154 154 GLU GLU 4 . n 
D  4  155 THR 155 155 155 THR THR 4 . n 
D  4  156 ILE 156 156 156 ILE ILE 4 . n 
D  4  157 LEU 157 157 157 LEU LEU 4 . n 
D  4  158 ASP 158 158 158 ASP ASP 4 . n 
D  4  159 LEU 159 159 159 LEU LEU 4 . n 
D  4  160 PHE 160 160 160 PHE PHE 4 . n 
D  4  161 GLU 161 161 161 GLU GLU 4 . n 
D  4  162 TRP 162 162 162 TRP TRP 4 . n 
D  4  163 VAL 163 163 163 VAL VAL 4 . n 
D  4  164 THR 164 164 164 THR THR 4 . n 
D  4  165 GLY 165 165 165 GLY GLY 4 . n 
D  4  166 GLN 166 166 166 GLN GLN 4 . n 
D  4  167 ARG 167 167 167 ARG ARG 4 . n 
D  4  168 PHE 168 168 168 PHE PHE 4 . n 
D  4  169 HIS 169 169 169 HIS HIS 4 . n 
D  4  170 HIS 170 170 170 HIS HIS 4 . n 
D  4  171 ASN 171 171 171 ASN ASN 4 . n 
D  4  172 TYR 172 172 172 TYR TYR 4 . n 
D  4  173 ILE 173 173 173 ILE ILE 4 . n 
D  4  174 ARG 174 174 174 ARG ARG 4 . n 
D  4  175 ILE 175 175 175 ILE ILE 4 . n 
D  4  176 GLY 176 176 176 GLY GLY 4 . n 
D  4  177 GLY 177 177 177 GLY GLY 4 . n 
D  4  178 VAL 178 178 178 VAL VAL 4 . n 
D  4  179 LYS 179 179 179 LYS LYS 4 . n 
D  4  180 GLU 180 180 180 GLU GLU 4 . n 
D  4  181 ASP 181 181 181 ASP ASP 4 . n 
D  4  182 LEU 182 182 182 LEU LEU 4 . n 
D  4  183 PRO 183 183 183 PRO PRO 4 . n 
D  4  184 GLU 184 184 184 GLU GLU 4 . n 
D  4  185 GLU 185 185 185 GLU GLU 4 . n 
D  4  186 PHE 186 186 186 PHE PHE 4 . n 
D  4  187 VAL 187 187 187 VAL VAL 4 . n 
D  4  188 PRO 188 188 188 PRO PRO 4 . n 
D  4  189 GLU 189 189 189 GLU GLU 4 . n 
D  4  190 LEU 190 190 190 LEU LEU 4 . n 
D  4  191 LYS 191 191 191 LYS LYS 4 . n 
D  4  192 LYS 192 192 192 LYS LYS 4 . n 
D  4  193 LEU 193 193 193 LEU LEU 4 . n 
D  4  194 LEU 194 194 194 LEU LEU 4 . n 
D  4  195 GLU 195 195 195 GLU GLU 4 . n 
D  4  196 VAL 196 196 196 VAL VAL 4 . n 
D  4  197 LEU 197 197 197 LEU LEU 4 . n 
D  4  198 PRO 198 198 198 PRO PRO 4 . n 
D  4  199 HIS 199 199 199 HIS HIS 4 . n 
D  4  200 ARG 200 200 200 ARG ARG 4 . n 
D  4  201 ILE 201 201 201 ILE ILE 4 . n 
D  4  202 ASP 202 202 202 ASP ASP 4 . n 
D  4  203 GLU 203 203 203 GLU GLU 4 . n 
D  4  204 TYR 204 204 204 TYR TYR 4 . n 
D  4  205 GLU 205 205 205 GLU GLU 4 . n 
D  4  206 ALA 206 206 206 ALA ALA 4 . n 
D  4  207 LEU 207 207 207 LEU LEU 4 . n 
D  4  208 PHE 208 208 208 PHE PHE 4 . n 
D  4  209 ALA 209 209 209 ALA ALA 4 . n 
D  4  210 GLU 210 210 210 GLU GLU 4 . n 
D  4  211 SER 211 211 211 SER SER 4 . n 
D  4  212 PRO 212 212 212 PRO PRO 4 . n 
D  4  213 ILE 213 213 213 ILE ILE 4 . n 
D  4  214 PHE 214 214 214 PHE PHE 4 . n 
D  4  215 TYR 215 215 215 TYR TYR 4 . n 
D  4  216 GLU 216 216 216 GLU GLU 4 . n 
D  4  217 ARG 217 217 217 ARG ARG 4 . n 
D  4  218 ALA 218 218 218 ALA ALA 4 . n 
D  4  219 ARG 219 219 219 ARG ARG 4 . n 
D  4  220 GLY 220 220 220 GLY GLY 4 . n 
D  4  221 VAL 221 221 221 VAL VAL 4 . n 
D  4  222 GLY 222 222 222 GLY GLY 4 . n 
D  4  223 VAL 223 223 223 VAL VAL 4 . n 
D  4  224 ILE 224 224 224 ILE ILE 4 . n 
D  4  225 PRO 225 225 225 PRO PRO 4 . n 
D  4  226 PRO 226 226 226 PRO PRO 4 . n 
D  4  227 GLU 227 227 227 GLU GLU 4 . n 
D  4  228 VAL 228 228 228 VAL VAL 4 . n 
D  4  229 ALA 229 229 229 ALA ALA 4 . n 
D  4  230 ILE 230 230 230 ILE ILE 4 . n 
D  4  231 ASP 231 231 231 ASP ASP 4 . n 
D  4  232 LEU 232 232 232 LEU LEU 4 . n 
D  4  233 GLY 233 233 233 GLY GLY 4 . n 
D  4  234 LEU 234 234 234 LEU LEU 4 . n 
D  4  235 THR 235 235 235 THR THR 4 . n 
D  4  236 GLY 236 236 236 GLY GLY 4 . n 
D  4  237 GLY 237 237 237 GLY GLY 4 . n 
D  4  238 SER 238 238 238 SER SER 4 . n 
D  4  239 LEU 239 239 239 LEU LEU 4 . n 
D  4  240 ARG 240 240 240 ARG ARG 4 . n 
D  4  241 ALA 241 241 241 ALA ALA 4 . n 
D  4  242 SER 242 242 242 SER SER 4 . n 
D  4  243 GLY 243 243 243 GLY GLY 4 . n 
D  4  244 VAL 244 244 244 VAL VAL 4 . n 
D  4  245 ASN 245 245 245 ASN ASN 4 . n 
D  4  246 TYR 246 246 246 TYR TYR 4 . n 
D  4  247 ASP 247 247 247 ASP ASP 4 . n 
D  4  248 VAL 248 248 248 VAL VAL 4 . n 
D  4  249 ARG 249 249 249 ARG ARG 4 . n 
D  4  250 LYS 250 250 250 LYS LYS 4 . n 
D  4  251 ALA 251 251 251 ALA ALA 4 . n 
D  4  252 TYR 252 252 252 TYR TYR 4 . n 
D  4  253 PRO 253 253 253 PRO PRO 4 . n 
D  4  254 TYR 254 254 254 TYR TYR 4 . n 
D  4  255 SER 255 255 255 SER SER 4 . n 
D  4  256 GLY 256 256 256 GLY GLY 4 . n 
D  4  257 TYR 257 257 257 TYR TYR 4 . n 
D  4  258 GLU 258 258 258 GLU GLU 4 . n 
D  4  259 THR 259 259 259 THR THR 4 . n 
D  4  260 TYR 260 260 260 TYR TYR 4 . n 
D  4  261 THR 261 261 261 THR THR 4 . n 
D  4  262 PHE 262 262 262 PHE PHE 4 . n 
D  4  263 ASP 263 263 263 ASP ASP 4 . n 
D  4  264 VAL 264 264 264 VAL VAL 4 . n 
D  4  265 PRO 265 265 265 PRO PRO 4 . n 
D  4  266 LEU 266 266 266 LEU LEU 4 . n 
D  4  267 GLY 267 267 267 GLY GLY 4 . n 
D  4  268 GLU 268 268 268 GLU GLU 4 . n 
D  4  269 ARG 269 269 269 ARG ARG 4 . n 
D  4  270 GLY 270 270 270 GLY GLY 4 . n 
D  4  271 ASP 271 271 271 ASP ASP 4 . n 
D  4  272 VAL 272 272 272 VAL VAL 4 . n 
D  4  273 PHE 273 273 273 PHE PHE 4 . n 
D  4  274 ASP 274 274 274 ASP ASP 4 . n 
D  4  275 ARG 275 275 275 ARG ARG 4 . n 
D  4  276 MET 276 276 276 MET MET 4 . n 
D  4  277 LEU 277 277 277 LEU LEU 4 . n 
D  4  278 VAL 278 278 278 VAL VAL 4 . n 
D  4  279 ARG 279 279 279 ARG ARG 4 . n 
D  4  280 ILE 280 280 280 ILE ILE 4 . n 
D  4  281 ARG 281 281 281 ARG ARG 4 . n 
D  4  282 GLU 282 282 282 GLU GLU 4 . n 
D  4  283 MET 283 283 283 MET MET 4 . n 
D  4  284 ARG 284 284 284 ARG ARG 4 . n 
D  4  285 GLU 285 285 285 GLU GLU 4 . n 
D  4  286 SER 286 286 286 SER SER 4 . n 
D  4  287 VAL 287 287 287 VAL VAL 4 . n 
D  4  288 LYS 288 288 288 LYS LYS 4 . n 
D  4  289 ILE 289 289 289 ILE ILE 4 . n 
D  4  290 ILE 290 290 290 ILE ILE 4 . n 
D  4  291 LYS 291 291 291 LYS LYS 4 . n 
D  4  292 GLN 292 292 292 GLN GLN 4 . n 
D  4  293 ALA 293 293 293 ALA ALA 4 . n 
D  4  294 LEU 294 294 294 LEU LEU 4 . n 
D  4  295 GLU 295 295 295 GLU GLU 4 . n 
D  4  296 ARG 296 296 296 ARG ARG 4 . n 
D  4  297 LEU 297 297 297 LEU LEU 4 . n 
D  4  298 GLU 298 298 298 GLU GLU 4 . n 
D  4  299 PRO 299 299 299 PRO PRO 4 . n 
D  4  300 GLY 300 300 300 GLY GLY 4 . n 
D  4  301 PRO 301 301 301 PRO PRO 4 . n 
D  4  302 VAL 302 302 302 VAL VAL 4 . n 
D  4  303 ARG 303 303 303 ARG ARG 4 . n 
D  4  304 ASP 304 304 304 ASP ASP 4 . n 
D  4  305 PRO 305 305 305 PRO PRO 4 . n 
D  4  306 ASN 306 306 306 ASN ASN 4 . n 
D  4  307 PRO 307 307 307 PRO PRO 4 . n 
D  4  308 GLN 308 308 308 GLN GLN 4 . n 
D  4  309 ILE 309 309 309 ILE ILE 4 . n 
D  4  310 THR 310 310 310 THR THR 4 . n 
D  4  311 PRO 311 311 311 PRO PRO 4 . n 
D  4  312 PRO 312 312 312 PRO PRO 4 . n 
D  4  313 PRO 313 313 313 PRO PRO 4 . n 
D  4  314 ARG 314 314 314 ARG ARG 4 . n 
D  4  315 HIS 315 315 315 HIS HIS 4 . n 
D  4  316 LEU 316 316 316 LEU LEU 4 . n 
D  4  317 LEU 317 317 317 LEU LEU 4 . n 
D  4  318 GLU 318 318 318 GLU GLU 4 . n 
D  4  319 THR 319 319 319 THR THR 4 . n 
D  4  320 SER 320 320 320 SER SER 4 . n 
D  4  321 MET 321 321 321 MET MET 4 . n 
D  4  322 GLU 322 322 322 GLU GLU 4 . n 
D  4  323 ALA 323 323 323 ALA ALA 4 . n 
D  4  324 VAL 324 324 324 VAL VAL 4 . n 
D  4  325 ILE 325 325 325 ILE ILE 4 . n 
D  4  326 TYR 326 326 326 TYR TYR 4 . n 
D  4  327 HIS 327 327 327 HIS HIS 4 . n 
D  4  328 PHE 328 328 328 PHE PHE 4 . n 
D  4  329 LYS 329 329 329 LYS LYS 4 . n 
D  4  330 HIS 330 330 330 HIS HIS 4 . n 
D  4  331 TYR 331 331 331 TYR TYR 4 . n 
D  4  332 THR 332 332 332 THR THR 4 . n 
D  4  333 GLU 333 333 333 GLU GLU 4 . n 
D  4  334 GLY 334 334 334 GLY GLY 4 . n 
D  4  335 PHE 335 335 335 PHE PHE 4 . n 
D  4  336 HIS 336 336 336 HIS HIS 4 . n 
D  4  337 PRO 337 337 337 PRO PRO 4 . n 
D  4  338 PRO 338 338 338 PRO PRO 4 . n 
D  4  339 LYS 339 339 339 LYS LYS 4 . n 
D  4  340 GLY 340 340 340 GLY GLY 4 . n 
D  4  341 GLU 341 341 341 GLU GLU 4 . n 
D  4  342 VAL 342 342 342 VAL VAL 4 . n 
D  4  343 TYR 343 343 343 TYR TYR 4 . n 
D  4  344 VAL 344 344 344 VAL VAL 4 . n 
D  4  345 PRO 345 345 345 PRO PRO 4 . n 
D  4  346 THR 346 346 346 THR THR 4 . n 
D  4  347 GLU 347 347 347 GLU GLU 4 . n 
D  4  348 SER 348 348 348 SER SER 4 . n 
D  4  349 ALA 349 349 349 ALA ALA 4 . n 
D  4  350 ARG 350 350 350 ARG ARG 4 . n 
D  4  351 GLY 351 351 351 GLY GLY 4 . n 
D  4  352 GLU 352 352 352 GLU GLU 4 . n 
D  4  353 LEU 353 353 353 LEU LEU 4 . n 
D  4  354 GLY 354 354 354 GLY GLY 4 . n 
D  4  355 TYR 355 355 355 TYR TYR 4 . n 
D  4  356 TYR 356 356 356 TYR TYR 4 . n 
D  4  357 ILE 357 357 357 ILE ILE 4 . n 
D  4  358 VAL 358 358 358 VAL VAL 4 . n 
D  4  359 SER 359 359 359 SER SER 4 . n 
D  4  360 ASP 360 360 360 ASP ASP 4 . n 
D  4  361 GLY 361 361 361 GLY GLY 4 . n 
D  4  362 GLY 362 362 362 GLY GLY 4 . n 
D  4  363 SER 363 363 363 SER SER 4 . n 
D  4  364 MET 364 364 364 MET MET 4 . n 
D  4  365 PRO 365 365 365 PRO PRO 4 . n 
D  4  366 TYR 366 366 366 TYR TYR 4 . n 
D  4  367 ARG 367 367 367 ARG ARG 4 . n 
D  4  368 VAL 368 368 368 VAL VAL 4 . n 
D  4  369 LYS 369 369 369 LYS LYS 4 . n 
D  4  370 VAL 370 370 370 VAL VAL 4 . n 
D  4  371 ARG 371 371 371 ARG ARG 4 . n 
D  4  372 ALA 372 372 372 ALA ALA 4 . n 
D  4  373 PRO 373 373 373 PRO PRO 4 . n 
D  4  374 SER 374 374 374 SER SER 4 . n 
D  4  375 PHE 375 375 375 PHE PHE 4 . n 
D  4  376 VAL 376 376 376 VAL VAL 4 . n 
D  4  377 ASN 377 377 377 ASN ASN 4 . n 
D  4  378 LEU 378 378 378 LEU LEU 4 . n 
D  4  379 GLN 379 379 379 GLN GLN 4 . n 
D  4  380 SER 380 380 380 SER SER 4 . n 
D  4  381 LEU 381 381 381 LEU LEU 4 . n 
D  4  382 PRO 382 382 382 PRO PRO 4 . n 
D  4  383 TYR 383 383 383 TYR TYR 4 . n 
D  4  384 ALA 384 384 384 ALA ALA 4 . n 
D  4  385 CYS 385 385 385 CYS CYS 4 . n 
D  4  386 LYS 386 386 386 LYS LYS 4 . n 
D  4  387 GLY 387 387 387 GLY GLY 4 . n 
D  4  388 GLU 388 388 388 GLU GLU 4 . n 
D  4  389 GLN 389 389 389 GLN GLN 4 . n 
D  4  390 VAL 390 390 390 VAL VAL 4 . n 
D  4  391 PRO 391 391 391 PRO PRO 4 . n 
D  4  392 ASP 392 392 392 ASP ASP 4 . n 
D  4  393 MET 393 393 393 MET MET 4 . n 
D  4  394 VAL 394 394 394 VAL VAL 4 . n 
D  4  395 ALA 395 395 395 ALA ALA 4 . n 
D  4  396 ILE 396 396 396 ILE ILE 4 . n 
D  4  397 ILE 397 397 397 ILE ILE 4 . n 
D  4  398 ALA 398 398 398 ALA ALA 4 . n 
D  4  399 SER 399 399 399 SER SER 4 . n 
D  4  400 LEU 400 400 400 LEU LEU 4 . n 
D  4  401 ASP 401 401 401 ASP ASP 4 . n 
D  4  402 PRO 402 402 402 PRO PRO 4 . n 
D  4  403 VAL 403 403 403 VAL VAL 4 . n 
D  4  404 MET 404 404 404 MET MET 4 . n 
D  4  405 GLY 405 405 405 GLY GLY 4 . n 
D  4  406 ASP 406 406 406 ASP ASP 4 . n 
D  4  407 VAL 407 407 407 VAL VAL 4 . n 
D  4  408 ASP 408 408 408 ASP ASP 4 . n 
D  4  409 ARG 409 409 409 ARG ARG 4 . n 
E  5  1   MET 1   1   1   MET MET 5 . n 
E  5  2   ARG 2   2   2   ARG ARG 5 . n 
E  5  3   LEU 3   3   3   LEU LEU 5 . n 
E  5  4   GLU 4   4   4   GLU GLU 5 . n 
E  5  5   ARG 5   5   5   ARG ARG 5 . n 
E  5  6   VAL 6   6   6   VAL VAL 5 . n 
E  5  7   LEU 7   7   7   LEU LEU 5 . n 
E  5  8   GLU 8   8   8   GLU GLU 5 . n 
E  5  9   GLU 9   9   9   GLU GLU 5 . n 
E  5  10  ALA 10  10  10  ALA ALA 5 . n 
E  5  11  ARG 11  11  11  ARG ARG 5 . n 
E  5  12  ALA 12  12  12  ALA ALA 5 . n 
E  5  13  LYS 13  13  13  LYS LYS 5 . n 
E  5  14  GLY 14  14  14  GLY GLY 5 . n 
E  5  15  TYR 15  15  15  TYR TYR 5 . n 
E  5  16  PRO 16  16  16  PRO PRO 5 . n 
E  5  17  ILE 17  17  17  ILE ILE 5 . n 
E  5  18  GLU 18  18  18  GLU GLU 5 . n 
E  5  19  ASP 19  19  19  ASP ASP 5 . n 
E  5  20  ASN 20  20  20  ASN ASN 5 . n 
E  5  21  GLY 21  21  21  GLY GLY 5 . n 
E  5  22  LEU 22  22  22  LEU LEU 5 . n 
E  5  23  GLY 23  23  23  GLY GLY 5 . n 
E  5  24  ASN 24  24  24  ASN ASN 5 . n 
E  5  25  LEU 25  25  25  LEU LEU 5 . n 
E  5  26  TRP 26  26  26  TRP TRP 5 . n 
E  5  27  VAL 27  27  27  VAL VAL 5 . n 
E  5  28  VAL 28  28  28  VAL VAL 5 . n 
E  5  29  LEU 29  29  29  LEU LEU 5 . n 
E  5  30  PRO 30  30  30  PRO PRO 5 . n 
E  5  31  ARG 31  31  31  ARG ARG 5 . n 
E  5  32  GLU 32  32  32  GLU GLU 5 . n 
E  5  33  ARG 33  33  33  ARG ARG 5 . n 
E  5  34  PHE 34  34  34  PHE PHE 5 . n 
E  5  35  LYS 35  35  35  LYS LYS 5 . n 
E  5  36  GLU 36  36  36  GLU GLU 5 . n 
E  5  37  GLU 37  37  37  GLU GLU 5 . n 
E  5  38  MET 38  38  38  MET MET 5 . n 
E  5  39  ALA 39  39  39  ALA ALA 5 . n 
E  5  40  HIS 40  40  40  HIS HIS 5 . n 
E  5  41  TYR 41  41  41  TYR TYR 5 . n 
E  5  42  LYS 42  42  42  LYS LYS 5 . n 
E  5  43  ALA 43  43  43  ALA ALA 5 . n 
E  5  44  MET 44  44  44  MET MET 5 . n 
E  5  45  GLY 45  45  45  GLY GLY 5 . n 
E  5  46  PHE 46  46  46  PHE PHE 5 . n 
E  5  47  ASN 47  47  47  ASN ASN 5 . n 
E  5  48  PHE 48  48  48  PHE PHE 5 . n 
E  5  49  LEU 49  49  49  LEU LEU 5 . n 
E  5  50  ALA 50  50  50  ALA ALA 5 . n 
E  5  51  ASP 51  51  51  ASP ASP 5 . n 
E  5  52  ILE 52  52  52  ILE ILE 5 . n 
E  5  53  VAL 53  53  53  VAL VAL 5 . n 
E  5  54  GLY 54  54  54  GLY GLY 5 . n 
E  5  55  LEU 55  55  55  LEU LEU 5 . n 
E  5  56  ASP 56  56  56  ASP ASP 5 . n 
E  5  57  TYR 57  57  57  TYR TYR 5 . n 
E  5  58  LEU 58  58  58  LEU LEU 5 . n 
E  5  59  THR 59  59  59  THR THR 5 . n 
E  5  60  TYR 60  60  60  TYR TYR 5 . n 
E  5  61  PRO 61  61  61  PRO PRO 5 . n 
E  5  62  ASP 62  62  62  ASP ASP 5 . n 
E  5  63  PRO 63  63  63  PRO PRO 5 . n 
E  5  64  ARG 64  64  64  ARG ARG 5 . n 
E  5  65  PRO 65  65  65  PRO PRO 5 . n 
E  5  66  GLU 66  66  66  GLU GLU 5 . n 
E  5  67  ARG 67  67  67  ARG ARG 5 . n 
E  5  68  PHE 68  68  68  PHE PHE 5 . n 
E  5  69  ALA 69  69  69  ALA ALA 5 . n 
E  5  70  VAL 70  70  70  VAL VAL 5 . n 
E  5  71  VAL 71  71  71  VAL VAL 5 . n 
E  5  72  TYR 72  72  72  TYR TYR 5 . n 
E  5  73  GLU 73  73  73  GLU GLU 5 . n 
E  5  74  LEU 74  74  74  LEU LEU 5 . n 
E  5  75  VAL 75  75  75  VAL VAL 5 . n 
E  5  76  SER 76  76  76  SER SER 5 . n 
E  5  77  LEU 77  77  77  LEU LEU 5 . n 
E  5  78  PRO 78  78  78  PRO PRO 5 . n 
E  5  79  GLY 79  79  79  GLY GLY 5 . n 
E  5  80  TRP 80  80  80  TRP TRP 5 . n 
E  5  81  LYS 81  81  81  LYS LYS 5 . n 
E  5  82  ASP 82  82  82  ASP ASP 5 . n 
E  5  83  GLY 83  83  83  GLY GLY 5 . n 
E  5  84  ASP 84  84  84  ASP ASP 5 . n 
E  5  85  GLY 85  85  85  GLY GLY 5 . n 
E  5  86  SER 86  86  86  SER SER 5 . n 
E  5  87  ARG 87  87  87  ARG ARG 5 . n 
E  5  88  PHE 88  88  88  PHE PHE 5 . n 
E  5  89  PHE 89  89  89  PHE PHE 5 . n 
E  5  90  VAL 90  90  90  VAL VAL 5 . n 
E  5  91  ARG 91  91  91  ARG ARG 5 . n 
E  5  92  VAL 92  92  92  VAL VAL 5 . n 
E  5  93  TYR 93  93  93  TYR TYR 5 . n 
E  5  94  VAL 94  94  94  VAL VAL 5 . n 
E  5  95  PRO 95  95  95  PRO PRO 5 . n 
E  5  96  GLU 96  96  96  GLU GLU 5 . n 
E  5  97  GLU 97  97  97  GLU GLU 5 . n 
E  5  98  ASP 98  98  98  ASP ASP 5 . n 
E  5  99  PRO 99  99  99  PRO PRO 5 . n 
E  5  100 ARG 100 100 100 ARG ARG 5 . n 
E  5  101 LEU 101 101 101 LEU LEU 5 . n 
E  5  102 PRO 102 102 102 PRO PRO 5 . n 
E  5  103 THR 103 103 103 THR THR 5 . n 
E  5  104 VAL 104 104 104 VAL VAL 5 . n 
E  5  105 THR 105 105 105 THR THR 5 . n 
E  5  106 ASP 106 106 106 ASP ASP 5 . n 
E  5  107 LEU 107 107 107 LEU LEU 5 . n 
E  5  108 TRP 108 108 108 TRP TRP 5 . n 
E  5  109 GLY 109 109 109 GLY GLY 5 . n 
E  5  110 SER 110 110 110 SER SER 5 . n 
E  5  111 ALA 111 111 111 ALA ALA 5 . n 
E  5  112 ASN 112 112 112 ASN ASN 5 . n 
E  5  113 PHE 113 113 113 PHE PHE 5 . n 
E  5  114 LEU 114 114 114 LEU LEU 5 . n 
E  5  115 GLU 115 115 115 GLU GLU 5 . n 
E  5  116 ARG 116 116 116 ARG ARG 5 . n 
E  5  117 GLU 117 117 117 GLU GLU 5 . n 
E  5  118 VAL 118 118 118 VAL VAL 5 . n 
E  5  119 TYR 119 119 119 TYR TYR 5 . n 
E  5  120 ASP 120 120 120 ASP ASP 5 . n 
E  5  121 LEU 121 121 121 LEU LEU 5 . n 
E  5  122 PHE 122 122 122 PHE PHE 5 . n 
E  5  123 GLY 123 123 123 GLY GLY 5 . n 
E  5  124 ILE 124 124 124 ILE ILE 5 . n 
E  5  125 VAL 125 125 125 VAL VAL 5 . n 
E  5  126 PHE 126 126 126 PHE PHE 5 . n 
E  5  127 GLU 127 127 127 GLU GLU 5 . n 
E  5  128 GLY 128 128 128 GLY GLY 5 . n 
E  5  129 HIS 129 129 129 HIS HIS 5 . n 
E  5  130 PRO 130 130 130 PRO PRO 5 . n 
E  5  131 ASP 131 131 131 ASP ASP 5 . n 
E  5  132 LEU 132 132 132 LEU LEU 5 . n 
E  5  133 ARG 133 133 133 ARG ARG 5 . n 
E  5  134 LYS 134 134 134 LYS LYS 5 . n 
E  5  135 ILE 135 135 135 ILE ILE 5 . n 
E  5  136 LEU 136 136 136 LEU LEU 5 . n 
E  5  137 THR 137 137 137 THR THR 5 . n 
E  5  138 PRO 138 138 138 PRO PRO 5 . n 
E  5  139 GLU 139 139 139 GLU GLU 5 . n 
E  5  140 ASP 140 140 140 ASP ASP 5 . n 
E  5  141 LEU 141 141 141 LEU LEU 5 . n 
E  5  142 GLU 142 142 142 GLU GLU 5 . n 
E  5  143 GLY 143 143 143 GLY GLY 5 . n 
E  5  144 HIS 144 144 144 HIS HIS 5 . n 
E  5  145 PRO 145 145 145 PRO PRO 5 . n 
E  5  146 LEU 146 146 146 LEU LEU 5 . n 
E  5  147 ARG 147 147 147 ARG ARG 5 . n 
E  5  148 LYS 148 148 148 LYS LYS 5 . n 
E  5  149 ASP 149 149 149 ASP ASP 5 . n 
E  5  150 TYR 150 150 150 TYR TYR 5 . n 
E  5  151 PRO 151 151 151 PRO PRO 5 . n 
E  5  152 LEU 152 152 152 LEU LEU 5 . n 
E  5  153 GLY 153 153 153 GLY GLY 5 . n 
E  5  154 GLU 154 154 154 GLU GLU 5 . n 
E  5  155 THR 155 155 155 THR THR 5 . n 
E  5  156 PRO 156 156 156 PRO PRO 5 . n 
E  5  157 THR 157 157 157 THR THR 5 . n 
E  5  158 LEU 158 158 158 LEU LEU 5 . n 
E  5  159 PHE 159 159 159 PHE PHE 5 . n 
E  5  160 ARG 160 160 160 ARG ARG 5 . n 
E  5  161 GLU 161 161 161 GLU GLU 5 . n 
E  5  162 GLY 162 162 162 GLY GLY 5 . n 
E  5  163 ARG 163 163 163 ARG ARG 5 . n 
E  5  164 TYR 164 164 164 TYR TYR 5 . n 
E  5  165 ILE 165 165 165 ILE ILE 5 . n 
E  5  166 ILE 166 166 166 ILE ILE 5 . n 
E  5  167 PRO 167 167 167 PRO PRO 5 . n 
E  5  168 ALA 168 168 168 ALA ALA 5 . n 
E  5  169 GLU 169 169 169 GLU GLU 5 . n 
E  5  170 PHE 170 170 170 PHE PHE 5 . n 
E  5  171 ARG 171 171 171 ARG ARG 5 . n 
E  5  172 ALA 172 172 172 ALA ALA 5 . n 
E  5  173 ALA 173 173 173 ALA ALA 5 . n 
E  5  174 LEU 174 174 174 LEU LEU 5 . n 
E  5  175 THR 175 175 175 THR THR 5 . n 
E  5  176 GLY 176 176 176 GLY GLY 5 . n 
E  5  177 LYS 177 177 177 LYS LYS 5 . n 
E  5  178 ASP 178 178 178 ASP ASP 5 . n 
E  5  179 PRO 179 179 179 PRO PRO 5 . n 
E  5  180 GLY 180 180 180 GLY GLY 5 . n 
E  5  181 LEU 181 181 181 LEU LEU 5 . n 
E  5  182 THR 182 182 182 THR THR 5 . n 
E  5  183 PHE 183 183 183 PHE PHE 5 . n 
E  5  184 TYR 184 184 184 TYR TYR 5 . n 
E  5  185 LYS 185 185 185 LYS LYS 5 . n 
E  5  186 GLY 186 186 186 GLY GLY 5 . n 
E  5  187 GLY 187 187 187 GLY GLY 5 . n 
E  5  188 SER 188 188 188 SER SER 5 . n 
E  5  189 ARG 189 189 189 ARG ARG 5 . n 
E  5  190 LYS 190 190 190 LYS LYS 5 . n 
E  5  191 GLY 191 191 191 GLY GLY 5 . n 
E  5  192 TYR 192 192 192 TYR TYR 5 . n 
E  5  193 ARG 193 193 193 ARG ARG 5 . n 
E  5  194 SER 194 194 194 SER SER 5 . n 
E  5  195 LEU 195 195 195 LEU LEU 5 . n 
E  5  196 TRP 196 196 196 TRP TRP 5 . n 
E  5  197 ALA 197 197 ?   ?   ?   5 . n 
E  5  198 ASP 198 198 ?   ?   ?   5 . n 
E  5  199 LEU 199 199 ?   ?   ?   5 . n 
E  5  200 LYS 200 200 ?   ?   ?   5 . n 
E  5  201 LYS 201 201 ?   ?   ?   5 . n 
E  5  202 ALA 202 202 ?   ?   ?   5 . n 
E  5  203 ARG 203 203 ?   ?   ?   5 . n 
E  5  204 GLU 204 204 ?   ?   ?   5 . n 
E  5  205 VAL 205 205 ?   ?   ?   5 . n 
E  5  206 LYS 206 206 ?   ?   ?   5 . n 
E  5  207 GLY 207 207 ?   ?   ?   5 . n 
F  6  1   MET 1   1   ?   ?   ?   6 . n 
F  6  2   ALA 2   2   ?   ?   ?   6 . n 
F  6  3   LEU 3   3   ?   ?   ?   6 . n 
F  6  4   LYS 4   4   ?   ?   ?   6 . n 
F  6  5   ASP 5   5   ?   ?   ?   6 . n 
F  6  6   LEU 6   6   ?   ?   ?   6 . n 
F  6  7   PHE 7   7   ?   ?   ?   6 . n 
F  6  8   GLU 8   8   ?   ?   ?   6 . n 
F  6  9   ARG 9   9   ?   ?   ?   6 . n 
F  6  10  ASP 10  10  ?   ?   ?   6 . n 
F  6  11  VAL 11  11  ?   ?   ?   6 . n 
F  6  12  GLN 12  12  ?   ?   ?   6 . n 
F  6  13  GLU 13  13  ?   ?   ?   6 . n 
F  6  14  LEU 14  14  ?   ?   ?   6 . n 
F  6  15  GLU 15  15  ?   ?   ?   6 . n 
F  6  16  ARG 16  16  16  ARG ARG 6 . n 
F  6  17  GLU 17  17  17  GLU GLU 6 . n 
F  6  18  GLY 18  18  18  GLY GLY 6 . n 
F  6  19  ILE 19  19  19  ILE ILE 6 . n 
F  6  20  LEU 20  20  20  LEU LEU 6 . n 
F  6  21  PHE 21  21  21  PHE PHE 6 . n 
F  6  22  THR 22  22  22  THR THR 6 . n 
F  6  23  THR 23  23  23  THR THR 6 . n 
F  6  24  LEU 24  24  24  LEU LEU 6 . n 
F  6  25  GLU 25  25  25  GLU GLU 6 . n 
F  6  26  LYS 26  26  26  LYS LYS 6 . n 
F  6  27  LEU 27  27  27  LEU LEU 6 . n 
F  6  28  VAL 28  28  28  VAL VAL 6 . n 
F  6  29  ALA 29  29  29  ALA ALA 6 . n 
F  6  30  TRP 30  30  30  TRP TRP 6 . n 
F  6  31  GLY 31  31  31  GLY GLY 6 . n 
F  6  32  ARG 32  32  32  ARG ARG 6 . n 
F  6  33  SER 33  33  33  SER SER 6 . n 
F  6  34  ASN 34  34  34  ASN ASN 6 . n 
F  6  35  SER 35  35  35  SER SER 6 . n 
F  6  36  LEU 36  36  36  LEU LEU 6 . n 
F  6  37  TRP 37  37  37  TRP TRP 6 . n 
F  6  38  PRO 38  38  38  PRO PRO 6 . n 
F  6  39  ALA 39  39  39  ALA ALA 6 . n 
F  6  40  THR 40  40  40  THR THR 6 . n 
F  6  41  PHE 41  41  41  PHE PHE 6 . n 
F  6  42  GLY 42  42  42  GLY GLY 6 . n 
F  6  43  LEU 43  43  43  LEU LEU 6 . n 
F  6  44  ALA 44  44  44  ALA ALA 6 . n 
F  6  45  CYS 45  45  45  CYS CYS 6 . n 
F  6  46  CYS 46  46  46  CYS CYS 6 . n 
F  6  47  ALA 47  47  47  ALA ALA 6 . n 
F  6  48  ILE 48  48  48  ILE ILE 6 . n 
F  6  49  GLU 49  49  49  GLU GLU 6 . n 
F  6  50  MET 50  50  50  MET MET 6 . n 
F  6  51  MET 51  51  51  MET MET 6 . n 
F  6  52  ALA 52  52  52  ALA ALA 6 . n 
F  6  53  SER 53  53  53  SER SER 6 . n 
F  6  54  THR 54  54  54  THR THR 6 . n 
F  6  55  ASP 55  55  55  ASP ASP 6 . n 
F  6  56  ALA 56  56  56  ALA ALA 6 . n 
F  6  57  ARG 57  57  57  ARG ARG 6 . n 
F  6  58  ASN 58  58  58  ASN ASN 6 . n 
F  6  59  ASP 59  59  59  ASP ASP 6 . n 
F  6  60  LEU 60  60  60  LEU LEU 6 . n 
F  6  61  ALA 61  61  61  ALA ALA 6 . n 
F  6  62  ARG 62  62  62  ARG ARG 6 . n 
F  6  63  PHE 63  63  63  PHE PHE 6 . n 
F  6  64  GLY 64  64  64  GLY GLY 6 . n 
F  6  65  SER 65  65  65  SER SER 6 . n 
F  6  66  GLU 66  66  66  GLU GLU 6 . n 
F  6  67  VAL 67  67  67  VAL VAL 6 . n 
F  6  68  PHE 68  68  68  PHE PHE 6 . n 
F  6  69  ARG 69  69  69  ARG ARG 6 . n 
F  6  70  ALA 70  70  70  ALA ALA 6 . n 
F  6  71  SER 71  71  71  SER SER 6 . n 
F  6  72  PRO 72  72  72  PRO PRO 6 . n 
F  6  73  ARG 73  73  73  ARG ARG 6 . n 
F  6  74  GLN 74  74  74  GLN GLN 6 . n 
F  6  75  ALA 75  75  75  ALA ALA 6 . n 
F  6  76  ASP 76  76  76  ASP ASP 6 . n 
F  6  77  VAL 77  77  77  VAL VAL 6 . n 
F  6  78  MET 78  78  78  MET MET 6 . n 
F  6  79  ILE 79  79  79  ILE ILE 6 . n 
F  6  80  VAL 80  80  80  VAL VAL 6 . n 
F  6  81  ALA 81  81  81  ALA ALA 6 . n 
F  6  82  GLY 82  82  82  GLY GLY 6 . n 
F  6  83  ARG 83  83  83  ARG ARG 6 . n 
F  6  84  LEU 84  84  84  LEU LEU 6 . n 
F  6  85  SER 85  85  85  SER SER 6 . n 
F  6  86  LYS 86  86  86  LYS LYS 6 . n 
F  6  87  LYS 87  87  87  LYS LYS 6 . n 
F  6  88  MET 88  88  88  MET MET 6 . n 
F  6  89  ALA 89  89  89  ALA ALA 6 . n 
F  6  90  PRO 90  90  90  PRO PRO 6 . n 
F  6  91  VAL 91  91  91  VAL VAL 6 . n 
F  6  92  MET 92  92  92  MET MET 6 . n 
F  6  93  ARG 93  93  93  ARG ARG 6 . n 
F  6  94  ARG 94  94  94  ARG ARG 6 . n 
F  6  95  VAL 95  95  95  VAL VAL 6 . n 
F  6  96  TRP 96  96  96  TRP TRP 6 . n 
F  6  97  GLU 97  97  97  GLU GLU 6 . n 
F  6  98  GLN 98  98  98  GLN GLN 6 . n 
F  6  99  MET 99  99  99  MET MET 6 . n 
F  6  100 PRO 100 100 100 PRO PRO 6 . n 
F  6  101 ASP 101 101 101 ASP ASP 6 . n 
F  6  102 PRO 102 102 102 PRO PRO 6 . n 
F  6  103 LYS 103 103 103 LYS LYS 6 . n 
F  6  104 TRP 104 104 104 TRP TRP 6 . n 
F  6  105 VAL 105 105 105 VAL VAL 6 . n 
F  6  106 ILE 106 106 106 ILE ILE 6 . n 
F  6  107 SER 107 107 107 SER SER 6 . n 
F  6  108 MET 108 108 108 MET MET 6 . n 
F  6  109 GLY 109 109 109 GLY GLY 6 . n 
F  6  110 ALA 110 110 110 ALA ALA 6 . n 
F  6  111 CYS 111 111 111 CYS CYS 6 . n 
F  6  112 ALA 112 112 112 ALA ALA 6 . n 
F  6  113 SER 113 113 113 SER SER 6 . n 
F  6  114 SER 114 114 114 SER SER 6 . n 
F  6  115 GLY 115 115 115 GLY GLY 6 . n 
F  6  116 GLY 116 116 116 GLY GLY 6 . n 
F  6  117 MET 117 117 117 MET MET 6 . n 
F  6  118 PHE 118 118 118 PHE PHE 6 . n 
F  6  119 ASN 119 119 119 ASN ASN 6 . n 
F  6  120 ASN 120 120 120 ASN ASN 6 . n 
F  6  121 TYR 121 121 121 TYR TYR 6 . n 
F  6  122 ALA 122 122 122 ALA ALA 6 . n 
F  6  123 ILE 123 123 123 ILE ILE 6 . n 
F  6  124 VAL 124 124 124 VAL VAL 6 . n 
F  6  125 GLN 125 125 125 GLN GLN 6 . n 
F  6  126 ASN 126 126 126 ASN ASN 6 . n 
F  6  127 VAL 127 127 127 VAL VAL 6 . n 
F  6  128 ASP 128 128 128 ASP ASP 6 . n 
F  6  129 SER 129 129 129 SER SER 6 . n 
F  6  130 VAL 130 130 130 VAL VAL 6 . n 
F  6  131 VAL 131 131 131 VAL VAL 6 . n 
F  6  132 PRO 132 132 132 PRO PRO 6 . n 
F  6  133 VAL 133 133 133 VAL VAL 6 . n 
F  6  134 ASP 134 134 134 ASP ASP 6 . n 
F  6  135 VAL 135 135 135 VAL VAL 6 . n 
F  6  136 TYR 136 136 136 TYR TYR 6 . n 
F  6  137 VAL 137 137 137 VAL VAL 6 . n 
F  6  138 PRO 138 138 138 PRO PRO 6 . n 
F  6  139 GLY 139 139 139 GLY GLY 6 . n 
F  6  140 CYS 140 140 140 CYS CYS 6 . n 
F  6  141 PRO 141 141 141 PRO PRO 6 . n 
F  6  142 PRO 142 142 142 PRO PRO 6 . n 
F  6  143 ARG 143 143 143 ARG ARG 6 . n 
F  6  144 PRO 144 144 144 PRO PRO 6 . n 
F  6  145 GLU 145 145 145 GLU GLU 6 . n 
F  6  146 ALA 146 146 146 ALA ALA 6 . n 
F  6  147 LEU 147 147 147 LEU LEU 6 . n 
F  6  148 ILE 148 148 148 ILE ILE 6 . n 
F  6  149 TYR 149 149 149 TYR TYR 6 . n 
F  6  150 ALA 150 150 150 ALA ALA 6 . n 
F  6  151 VAL 151 151 151 VAL VAL 6 . n 
F  6  152 MET 152 152 152 MET MET 6 . n 
F  6  153 GLN 153 153 153 GLN GLN 6 . n 
F  6  154 LEU 154 154 154 LEU LEU 6 . n 
F  6  155 GLN 155 155 155 GLN GLN 6 . n 
F  6  156 LYS 156 156 156 LYS LYS 6 . n 
F  6  157 LYS 157 157 157 LYS LYS 6 . n 
F  6  158 VAL 158 158 158 VAL VAL 6 . n 
F  6  159 ARG 159 159 159 ARG ARG 6 . n 
F  6  160 GLY 160 160 160 GLY GLY 6 . n 
F  6  161 GLN 161 161 161 GLN GLN 6 . n 
F  6  162 ALA 162 162 162 ALA ALA 6 . n 
F  6  163 TYR 163 163 163 TYR TYR 6 . n 
F  6  164 ASN 164 164 164 ASN ASN 6 . n 
F  6  165 GLU 165 165 165 GLU GLU 6 . n 
F  6  166 ARG 166 166 166 ARG ARG 6 . n 
F  6  167 GLY 167 167 167 GLY GLY 6 . n 
F  6  168 GLU 168 168 168 GLU GLU 6 . n 
F  6  169 ARG 169 169 169 ARG ARG 6 . n 
F  6  170 LEU 170 170 170 LEU LEU 6 . n 
F  6  171 PRO 171 171 171 PRO PRO 6 . n 
F  6  172 PRO 172 172 172 PRO PRO 6 . n 
F  6  173 VAL 173 173 173 VAL VAL 6 . n 
F  6  174 ALA 174 174 174 ALA ALA 6 . n 
F  6  175 ALA 175 175 175 ALA ALA 6 . n 
F  6  176 TRP 176 176 176 TRP TRP 6 . n 
F  6  177 LYS 177 177 177 LYS LYS 6 . n 
F  6  178 ARG 178 178 178 ARG ARG 6 . n 
F  6  179 THR 179 179 179 THR THR 6 . n 
F  6  180 ARG 180 180 180 ARG ARG 6 . n 
F  6  181 GLY 181 181 181 GLY GLY 6 . n 
G  7  1   MET 1   1   ?   ?   ?   9 . n 
G  7  2   THR 2   2   2   THR THR 9 . n 
G  7  3   LEU 3   3   3   LEU LEU 9 . n 
G  7  4   LYS 4   4   4   LYS LYS 9 . n 
G  7  5   ALA 5   5   5   ALA ALA 9 . n 
G  7  6   LEU 6   6   6   LEU LEU 9 . n 
G  7  7   ALA 7   7   7   ALA ALA 9 . n 
G  7  8   GLN 8   8   8   GLN GLN 9 . n 
G  7  9   SER 9   9   9   SER SER 9 . n 
G  7  10  LEU 10  10  10  LEU LEU 9 . n 
G  7  11  GLY 11  11  11  GLY GLY 9 . n 
G  7  12  ILE 12  12  12  ILE ILE 9 . n 
G  7  13  THR 13  13  13  THR THR 9 . n 
G  7  14  LEU 14  14  14  LEU LEU 9 . n 
G  7  15  LYS 15  15  15  LYS LYS 9 . n 
G  7  16  TYR 16  16  16  TYR TYR 9 . n 
G  7  17  LEU 17  17  17  LEU LEU 9 . n 
G  7  18  PHE 18  18  18  PHE PHE 9 . n 
G  7  19  SER 19  19  19  SER SER 9 . n 
G  7  20  LYS 20  20  20  LYS LYS 9 . n 
G  7  21  PRO 21  21  21  PRO PRO 9 . n 
G  7  22  VAL 22  22  22  VAL VAL 9 . n 
G  7  23  THR 23  23  23  THR THR 9 . n 
G  7  24  VAL 24  24  24  VAL VAL 9 . n 
G  7  25  PRO 25  25  25  PRO PRO 9 . n 
G  7  26  TYR 26  26  26  TYR TYR 9 . n 
G  7  27  PRO 27  27  27  PRO PRO 9 . n 
G  7  28  ASP 28  28  28  ASP ASP 9 . n 
G  7  29  ALA 29  29  29  ALA ALA 9 . n 
G  7  30  PRO 30  30  30  PRO PRO 9 . n 
G  7  31  VAL 31  31  31  VAL VAL 9 . n 
G  7  32  ALA 32  32  32  ALA ALA 9 . n 
G  7  33  LEU 33  33  33  LEU LEU 9 . n 
G  7  34  LYS 34  34  34  LYS LYS 9 . n 
G  7  35  PRO 35  35  35  PRO PRO 9 . n 
G  7  36  ARG 36  36  36  ARG ARG 9 . n 
G  7  37  PHE 37  37  37  PHE PHE 9 . n 
G  7  38  HIS 38  38  38  HIS HIS 9 . n 
G  7  39  GLY 39  39  39  GLY GLY 9 . n 
G  7  40  ARG 40  40  40  ARG ARG 9 . n 
G  7  41  HIS 41  41  41  HIS HIS 9 . n 
G  7  42  VAL 42  42  42  VAL VAL 9 . n 
G  7  43  LEU 43  43  43  LEU LEU 9 . n 
G  7  44  THR 44  44  44  THR THR 9 . n 
G  7  45  ARG 45  45  45  ARG ARG 9 . n 
G  7  46  HIS 46  46  46  HIS HIS 9 . n 
G  7  47  PRO 47  47  47  PRO PRO 9 . n 
G  7  48  ASN 48  48  48  ASN ASN 9 . n 
G  7  49  GLY 49  49  49  GLY GLY 9 . n 
G  7  50  LEU 50  50  50  LEU LEU 9 . n 
G  7  51  GLU 51  51  51  GLU GLU 9 . n 
G  7  52  LYS 52  52  52  LYS LYS 9 . n 
G  7  53  CYS 53  53  53  CYS CYS 9 . n 
G  7  54  ILE 54  54  54  ILE ILE 9 . n 
G  7  55  GLY 55  55  55  GLY GLY 9 . n 
G  7  56  CYS 56  56  56  CYS CYS 9 . n 
G  7  57  SER 57  57  57  SER SER 9 . n 
G  7  58  LEU 58  58  58  LEU LEU 9 . n 
G  7  59  CYS 59  59  59  CYS CYS 9 . n 
G  7  60  ALA 60  60  60  ALA ALA 9 . n 
G  7  61  ALA 61  61  61  ALA ALA 9 . n 
G  7  62  ALA 62  62  62  ALA ALA 9 . n 
G  7  63  CYS 63  63  63  CYS CYS 9 . n 
G  7  64  PRO 64  64  64  PRO PRO 9 . n 
G  7  65  ALA 65  65  65  ALA ALA 9 . n 
G  7  66  TYR 66  66  66  TYR TYR 9 . n 
G  7  67  ALA 67  67  67  ALA ALA 9 . n 
G  7  68  ILE 68  68  68  ILE ILE 9 . n 
G  7  69  TYR 69  69  69  TYR TYR 9 . n 
G  7  70  VAL 70  70  70  VAL VAL 9 . n 
G  7  71  GLU 71  71  71  GLU GLU 9 . n 
G  7  72  PRO 72  72  72  PRO PRO 9 . n 
G  7  73  ALA 73  73  73  ALA ALA 9 . n 
G  7  74  GLU 74  74  74  GLU GLU 9 . n 
G  7  75  ASN 75  75  75  ASN ASN 9 . n 
G  7  76  ASP 76  76  76  ASP ASP 9 . n 
G  7  77  PRO 77  77  77  PRO PRO 9 . n 
G  7  78  GLU 78  78  78  GLU GLU 9 . n 
G  7  79  ASN 79  79  79  ASN ASN 9 . n 
G  7  80  PRO 80  80  80  PRO PRO 9 . n 
G  7  81  VAL 81  81  81  VAL VAL 9 . n 
G  7  82  SER 82  82  82  SER SER 9 . n 
G  7  83  ALA 83  83  83  ALA ALA 9 . n 
G  7  84  GLY 84  84  84  GLY GLY 9 . n 
G  7  85  GLU 85  85  85  GLU GLU 9 . n 
G  7  86  ARG 86  86  86  ARG ARG 9 . n 
G  7  87  TYR 87  87  87  TYR TYR 9 . n 
G  7  88  ALA 88  88  88  ALA ALA 9 . n 
G  7  89  LYS 89  89  89  LYS LYS 9 . n 
G  7  90  VAL 90  90  90  VAL VAL 9 . n 
G  7  91  TYR 91  91  91  TYR TYR 9 . n 
G  7  92  GLU 92  92  92  GLU GLU 9 . n 
G  7  93  ILE 93  93  93  ILE ILE 9 . n 
G  7  94  ASN 94  94  94  ASN ASN 9 . n 
G  7  95  MET 95  95  95  MET MET 9 . n 
G  7  96  LEU 96  96  96  LEU LEU 9 . n 
G  7  97  ARG 97  97  97  ARG ARG 9 . n 
G  7  98  CYS 98  98  98  CYS CYS 9 . n 
G  7  99  ILE 99  99  99  ILE ILE 9 . n 
G  7  100 PHE 100 100 100 PHE PHE 9 . n 
G  7  101 CYS 101 101 101 CYS CYS 9 . n 
G  7  102 GLY 102 102 102 GLY GLY 9 . n 
G  7  103 LEU 103 103 103 LEU LEU 9 . n 
G  7  104 CYS 104 104 104 CYS CYS 9 . n 
G  7  105 GLU 105 105 105 GLU GLU 9 . n 
G  7  106 GLU 106 106 106 GLU GLU 9 . n 
G  7  107 ALA 107 107 107 ALA ALA 9 . n 
G  7  108 CYS 108 108 108 CYS CYS 9 . n 
G  7  109 PRO 109 109 109 PRO PRO 9 . n 
G  7  110 THR 110 110 110 THR THR 9 . n 
G  7  111 GLY 111 111 111 GLY GLY 9 . n 
G  7  112 ALA 112 112 112 ALA ALA 9 . n 
G  7  113 ILE 113 113 113 ILE ILE 9 . n 
G  7  114 VAL 114 114 114 VAL VAL 9 . n 
G  7  115 LEU 115 115 115 LEU LEU 9 . n 
G  7  116 GLY 116 116 116 GLY GLY 9 . n 
G  7  117 TYR 117 117 117 TYR TYR 9 . n 
G  7  118 ASP 118 118 118 ASP ASP 9 . n 
G  7  119 PHE 119 119 119 PHE PHE 9 . n 
G  7  120 GLU 120 120 120 GLU GLU 9 . n 
G  7  121 MET 121 121 121 MET MET 9 . n 
G  7  122 ALA 122 122 122 ALA ALA 9 . n 
G  7  123 ASP 123 123 123 ASP ASP 9 . n 
G  7  124 TYR 124 124 124 TYR TYR 9 . n 
G  7  125 GLU 125 125 125 GLU GLU 9 . n 
G  7  126 TYR 126 126 126 TYR TYR 9 . n 
G  7  127 SER 127 127 127 SER SER 9 . n 
G  7  128 ASP 128 128 128 ASP ASP 9 . n 
G  7  129 LEU 129 129 129 LEU LEU 9 . n 
G  7  130 VAL 130 130 130 VAL VAL 9 . n 
G  7  131 TYR 131 131 131 TYR TYR 9 . n 
G  7  132 GLY 132 132 132 GLY GLY 9 . n 
G  7  133 LYS 133 133 133 LYS LYS 9 . n 
G  7  134 GLU 134 134 134 GLU GLU 9 . n 
G  7  135 ASP 135 135 135 ASP ASP 9 . n 
G  7  136 MET 136 136 136 MET MET 9 . n 
G  7  137 LEU 137 137 137 LEU LEU 9 . n 
G  7  138 VAL 138 138 138 VAL VAL 9 . n 
G  7  139 ASP 139 139 139 ASP ASP 9 . n 
G  7  140 VAL 140 140 140 VAL VAL 9 . n 
G  7  141 VAL 141 141 141 VAL VAL 9 . n 
G  7  142 GLY 142 142 142 GLY GLY 9 . n 
G  7  143 THR 143 143 143 THR THR 9 . n 
G  7  144 LYS 144 144 144 LYS LYS 9 . n 
G  7  145 PRO 145 145 145 PRO PRO 9 . n 
G  7  146 GLN 146 146 146 GLN GLN 9 . n 
G  7  147 ARG 147 147 147 ARG ARG 9 . n 
G  7  148 ARG 148 148 148 ARG ARG 9 . n 
G  7  149 GLU 149 149 149 GLU GLU 9 . n 
G  7  150 ALA 150 150 150 ALA ALA 9 . n 
G  7  151 LYS 151 151 151 LYS LYS 9 . n 
G  7  152 ARG 152 152 152 ARG ARG 9 . n 
G  7  153 THR 153 153 153 THR THR 9 . n 
G  7  154 GLY 154 154 154 GLY GLY 9 . n 
G  7  155 LYS 155 155 155 LYS LYS 9 . n 
G  7  156 PRO 156 156 156 PRO PRO 9 . n 
G  7  157 VAL 157 157 157 VAL VAL 9 . n 
G  7  158 LYS 158 158 158 LYS LYS 9 . n 
G  7  159 VAL 159 159 159 VAL VAL 9 . n 
G  7  160 GLY 160 160 160 GLY GLY 9 . n 
G  7  161 TYR 161 161 161 TYR TYR 9 . n 
G  7  162 VAL 162 162 162 VAL VAL 9 . n 
G  7  163 VAL 163 163 163 VAL VAL 9 . n 
G  7  164 PRO 164 164 164 PRO PRO 9 . n 
G  7  165 TYR 165 165 165 TYR TYR 9 . n 
G  7  166 VAL 166 166 166 VAL VAL 9 . n 
G  7  167 ARG 167 167 167 ARG ARG 9 . n 
G  7  168 PRO 168 168 168 PRO PRO 9 . n 
G  7  169 GLU 169 169 169 GLU GLU 9 . n 
G  7  170 LEU 170 170 170 LEU LEU 9 . n 
G  7  171 GLU 171 171 171 GLU GLU 9 . n 
G  7  172 GLY 172 172 172 GLY GLY 9 . n 
G  7  173 PHE 173 173 173 PHE PHE 9 . n 
G  7  174 LYS 174 174 174 LYS LYS 9 . n 
G  7  175 ALA 175 175 175 ALA ALA 9 . n 
G  7  176 PRO 176 176 176 PRO PRO 9 . n 
G  7  177 THR 177 177 177 THR THR 9 . n 
G  7  178 GLU 178 178 178 GLU GLU 9 . n 
G  7  179 GLY 179 179 179 GLY GLY 9 . n 
G  7  180 GLY 180 180 180 GLY GLY 9 . n 
G  7  181 LYS 181 181 181 LYS LYS 9 . n 
G  7  182 ARG 182 182 ?   ?   ?   9 . n 
H  8  1   MET 1   1   ?   ?   ?   7 . n 
H  8  2   SER 2   2   ?   ?   ?   7 . n 
H  8  3   ALA 3   3   3   ALA ALA 7 . n 
H  8  4   SER 4   4   4   SER SER 7 . n 
H  8  5   SER 5   5   5   SER SER 7 . n 
H  8  6   GLU 6   6   6   GLU GLU 7 . n 
H  8  7   ARG 7   7   7   ARG ARG 7 . n 
H  8  8   GLU 8   8   8   GLU GLU 7 . n 
H  8  9   LEU 9   9   9   LEU LEU 7 . n 
H  8  10  TYR 10  10  10  TYR TYR 7 . n 
H  8  11  GLU 11  11  11  GLU GLU 7 . n 
H  8  12  ALA 12  12  12  ALA ALA 7 . n 
H  8  13  TRP 13  13  13  TRP TRP 7 . n 
H  8  14  VAL 14  14  14  VAL VAL 7 . n 
H  8  15  GLU 15  15  15  GLU GLU 7 . n 
H  8  16  LEU 16  16  16  LEU LEU 7 . n 
H  8  17  LEU 17  17  17  LEU LEU 7 . n 
H  8  18  SER 18  18  18  SER SER 7 . n 
H  8  19  TRP 19  19  19  TRP TRP 7 . n 
H  8  20  MET 20  20  20  MET MET 7 . n 
H  8  21  ARG 21  21  21  ARG ARG 7 . n 
H  8  22  GLU 22  22  22  GLU GLU 7 . n 
H  8  23  TYR 23  23  23  TYR TYR 7 . n 
H  8  24  ALA 24  24  24  ALA ALA 7 . n 
H  8  25  GLN 25  25  25  GLN GLN 7 . n 
H  8  26  ALA 26  26  26  ALA ALA 7 . n 
H  8  27  LYS 27  27  27  LYS LYS 7 . n 
H  8  28  GLY 28  28  28  GLY GLY 7 . n 
H  8  29  VAL 29  29  29  VAL VAL 7 . n 
H  8  30  ARG 30  30  30  ARG ARG 7 . n 
H  8  31  PHE 31  31  31  PHE PHE 7 . n 
H  8  32  GLU 32  32  32  GLU GLU 7 . n 
H  8  33  LYS 33  33  33  LYS LYS 7 . n 
H  8  34  GLU 34  34  34  GLU GLU 7 . n 
H  8  35  ALA 35  35  35  ALA ALA 7 . n 
H  8  36  ASP 36  36  36  ASP ASP 7 . n 
H  8  37  PHE 37  37  37  PHE PHE 7 . n 
H  8  38  PRO 38  38  38  PRO PRO 7 . n 
H  8  39  ASP 39  39  39  ASP ASP 7 . n 
H  8  40  PHE 40  40  40  PHE PHE 7 . n 
H  8  41  ILE 41  41  41  ILE ILE 7 . n 
H  8  42  TYR 42  42  42  TYR TYR 7 . n 
H  8  43  ARG 43  43  43  ARG ARG 7 . n 
H  8  44  MET 44  44  44  MET MET 7 . n 
H  8  45  GLU 45  45  45  GLU GLU 7 . n 
H  8  46  ARG 46  46  46  ARG ARG 7 . n 
H  8  47  PRO 47  47  47  PRO PRO 7 . n 
H  8  48  TYR 48  48  48  TYR TYR 7 . n 
H  8  49  ASP 49  49  49  ASP ASP 7 . n 
H  8  50  LEU 50  50  50  LEU LEU 7 . n 
H  8  51  PRO 51  51  51  PRO PRO 7 . n 
H  8  52  THR 52  52  52  THR THR 7 . n 
H  8  53  THR 53  53  53  THR THR 7 . n 
H  8  54  ILE 54  54  54  ILE ILE 7 . n 
H  8  55  MET 55  55  55  MET MET 7 . n 
H  8  56  THR 56  56  56  THR THR 7 . n 
H  8  57  ALA 57  57  57  ALA ALA 7 . n 
H  8  58  SER 58  58  58  SER SER 7 . n 
H  8  59  LEU 59  59  59  LEU LEU 7 . n 
H  8  60  SER 60  60  60  SER SER 7 . n 
H  8  61  ASP 61  61  61  ASP ASP 7 . n 
H  8  62  GLY 62  62  62  GLY GLY 7 . n 
H  8  63  LEU 63  63  63  LEU LEU 7 . n 
H  8  64  GLY 64  64  64  GLY GLY 7 . n 
H  8  65  GLU 65  65  65  GLU GLU 7 . n 
H  8  66  PRO 66  66  66  PRO PRO 7 . n 
H  8  67  PHE 67  67  67  PHE PHE 7 . n 
H  8  68  LEU 68  68  68  LEU LEU 7 . n 
H  8  69  LEU 69  69  69  LEU LEU 7 . n 
H  8  70  ALA 70  70  70  ALA ALA 7 . n 
H  8  71  ASP 71  71  71  ASP ASP 7 . n 
H  8  72  VAL 72  72  72  VAL VAL 7 . n 
H  8  73  SER 73  73  73  SER SER 7 . n 
H  8  74  PRO 74  74  74  PRO PRO 7 . n 
H  8  75  ARG 75  75  75  ARG ARG 7 . n 
H  8  76  HIS 76  76  76  HIS HIS 7 . n 
H  8  77  ALA 77  77  77  ALA ALA 7 . n 
H  8  78  LYS 78  78  78  LYS LYS 7 . n 
H  8  79  LEU 79  79  79  LEU LEU 7 . n 
H  8  80  LYS 80  80  80  LYS LYS 7 . n 
H  8  81  ARG 81  81  81  ARG ARG 7 . n 
H  8  82  ILE 82  82  82  ILE ILE 7 . n 
H  8  83  GLY 83  83  83  GLY GLY 7 . n 
H  8  84  LEU 84  84  84  LEU LEU 7 . n 
H  8  85  ARG 85  85  85  ARG ARG 7 . n 
H  8  86  LEU 86  86  86  LEU LEU 7 . n 
H  8  87  PRO 87  87  87  PRO PRO 7 . n 
H  8  88  ARG 88  88  88  ARG ARG 7 . n 
H  8  89  ALA 89  89  89  ALA ALA 7 . n 
H  8  90  HIS 90  90  90  HIS HIS 7 . n 
H  8  91  ILE 91  91  91  ILE ILE 7 . n 
H  8  92  HIS 92  92  92  HIS HIS 7 . n 
H  8  93  LEU 93  93  93  LEU LEU 7 . n 
H  8  94  HIS 94  94  94  HIS HIS 7 . n 
H  8  95  ALA 95  95  95  ALA ALA 7 . n 
H  8  96  HIS 96  96  96  HIS HIS 7 . n 
H  8  97  TYR 97  97  97  TYR TYR 7 . n 
H  8  98  GLU 98  98  98  GLU GLU 7 . n 
H  8  99  PRO 99  99  99  PRO PRO 7 . n 
H  8  100 GLY 100 100 100 GLY GLY 7 . n 
H  8  101 LYS 101 101 101 LYS LYS 7 . n 
H  8  102 GLY 102 102 102 GLY GLY 7 . n 
H  8  103 LEU 103 103 103 LEU LEU 7 . n 
H  8  104 VAL 104 104 104 VAL VAL 7 . n 
H  8  105 THR 105 105 105 THR THR 7 . n 
H  8  106 GLY 106 106 106 GLY GLY 7 . n 
H  8  107 LYS 107 107 107 LYS LYS 7 . n 
H  8  108 ILE 108 108 108 ILE ILE 7 . n 
H  8  109 PRO 109 109 109 PRO PRO 7 . n 
H  8  110 LEU 110 110 110 LEU LEU 7 . n 
H  8  111 THR 111 111 111 THR THR 7 . n 
H  8  112 LYS 112 112 112 LYS LYS 7 . n 
H  8  113 GLU 113 113 113 GLU GLU 7 . n 
H  8  114 ARG 114 114 114 ARG ARG 7 . n 
H  8  115 PHE 115 115 115 PHE PHE 7 . n 
H  8  116 PHE 116 116 116 PHE PHE 7 . n 
H  8  117 ALA 117 117 117 ALA ALA 7 . n 
H  8  118 LEU 118 118 118 LEU LEU 7 . n 
H  8  119 ALA 119 119 119 ALA ALA 7 . n 
H  8  120 ASP 120 120 120 ASP ASP 7 . n 
H  8  121 ARG 121 121 121 ARG ARG 7 . n 
H  8  122 ALA 122 122 122 ALA ALA 7 . n 
H  8  123 ARG 123 123 123 ARG ARG 7 . n 
H  8  124 GLU 124 124 124 GLU GLU 7 . n 
H  8  125 ALA 125 125 125 ALA ALA 7 . n 
H  8  126 LEU 126 126 126 LEU LEU 7 . n 
H  8  127 ALA 127 127 127 ALA ALA 7 . n 
H  8  128 PHE 128 128 128 PHE PHE 7 . n 
H  8  129 ALA 129 129 129 ALA ALA 7 . n 
I  9  1   MET 1   1   1   MET MET W . n 
I  9  2   VAL 2   2   2   VAL VAL W . n 
I  9  3   ARG 3   3   3   ARG ARG W . n 
I  9  4   VAL 4   4   4   VAL VAL W . n 
I  9  5   GLY 5   5   5   GLY GLY W . n 
I  9  6   MET 6   6   6   MET MET W . n 
I  9  7   ARG 7   7   7   ARG ARG W . n 
I  9  8   ALA 8   8   8   ALA ALA W . n 
I  9  9   ALA 9   9   9   ALA ALA W . n 
I  9  10  PRO 10  10  10  PRO PRO W . n 
I  9  11  ARG 11  11  11  ARG ARG W . n 
I  9  12  VAL 12  12  12  VAL VAL W . n 
I  9  13  SER 13  13  13  SER SER W . n 
I  9  14  LEU 14  14  14  LEU LEU W . n 
I  9  15  GLU 15  15  15  GLU GLU W . n 
I  9  16  ALA 16  16  16  ALA ALA W . n 
I  9  17  LEU 17  17  17  LEU LEU W . n 
I  9  18  LYS 18  18  18  LYS LYS W . n 
I  9  19  ALA 19  19  19  ALA ALA W . n 
I  9  20  ALA 20  20  20  ALA ALA W . n 
I  9  21  LEU 21  21  21  LEU LEU W . n 
I  9  22  GLY 22  22  22  GLY GLY W . n 
I  9  23  GLY 23  23  23  GLY GLY W . n 
I  9  24  LEU 24  24  24  LEU LEU W . n 
I  9  25  LYS 25  25  25  LYS LYS W . n 
I  9  26  LEU 26  26  26  LEU LEU W . n 
I  9  27  SER 27  27  27  SER SER W . n 
I  9  28  GLU 28  28  28  GLU GLU W . n 
I  9  29  ALA 29  29  29  ALA ALA W . n 
I  9  30  LYS 30  30  30  LYS LYS W . n 
I  9  31  VAL 31  31  31  VAL VAL W . n 
I  9  32  TYR 32  32  32  TYR TYR W . n 
I  9  33  LEU 33  33  33  LEU LEU W . n 
I  9  34  ILE 34  34  34  ILE ILE W . n 
I  9  35  THR 35  35  35  THR THR W . n 
I  9  36  ASP 36  36  36  ASP ASP W . n 
I  9  37  TRP 37  37  37  TRP TRP W . n 
I  9  38  GLN 38  38  38  GLN GLN W . n 
I  9  39  ASP 39  39  39  ASP ASP W . n 
I  9  40  LYS 40  40  40  LYS LYS W . n 
I  9  41  ARG 41  41  41  ARG ARG W . n 
I  9  42  ASP 42  42  42  ASP ASP W . n 
I  9  43  GLN 43  43  43  GLN GLN W . n 
I  9  44  ALA 44  44  44  ALA ALA W . n 
I  9  45  ARG 45  45  45  ARG ARG W . n 
I  9  46  TYR 46  46  46  TYR TYR W . n 
I  9  47  ALA 47  47  47  ALA ALA W . n 
I  9  48  LEU 48  48  48  LEU LEU W . n 
I  9  49  LEU 49  49  49  LEU LEU W . n 
I  9  50  LEU 50  50  50  LEU LEU W . n 
I  9  51  HIS 51  51  51  HIS HIS W . n 
I  9  52  THR 52  52  52  THR THR W . n 
I  9  53  GLY 53  53  53  GLY GLY W . n 
I  9  54  LYS 54  54  54  LYS LYS W . n 
I  9  55  LYS 55  55  55  LYS LYS W . n 
I  9  56  ASP 56  56  56  ASP ASP W . n 
I  9  57  LEU 57  57  57  LEU LEU W . n 
I  9  58  LEU 58  58  58  LEU LEU W . n 
I  9  59  VAL 59  59  59  VAL VAL W . n 
I  9  60  PRO 60  60  60  PRO PRO W . n 
I  9  61  ASP 61  61  61  ASP ASP W . n 
I  9  62  ALA 62  62  62  ALA ALA W . n 
I  9  63  PHE 63  63  63  PHE PHE W . n 
I  9  64  GLY 64  64  64  GLY GLY W . n 
I  9  65  PRO 65  65  65  PRO PRO W . n 
I  9  66  ALA 66  66  66  ALA ALA W . n 
I  9  67  PHE 67  67  67  PHE PHE W . n 
I  9  68  PRO 68  68  68  PRO PRO W . n 
I  9  69  GLY 69  69  69  GLY GLY W . n 
I  9  70  GLY 70  70  70  GLY GLY W . n 
I  9  71  GLU 71  71  71  GLU GLU W . n 
I  9  72  GLU 72  72  72  GLU GLU W . n 
I  9  73  ALA 73  73  73  ALA ALA W . n 
I  9  74  LEU 74  74  74  LEU LEU W . n 
I  9  75  SER 75  75  75  SER SER W . n 
I  9  76  GLU 76  76  76  GLU GLU W . n 
I  9  77  LEU 77  77  77  LEU LEU W . n 
I  9  78  VAL 78  78  78  VAL VAL W . n 
I  9  79  GLY 79  79  79  GLY GLY W . n 
I  9  80  LEU 80  80  80  LEU LEU W . n 
I  9  81  LEU 81  81  81  LEU LEU W . n 
I  9  82  LEU 82  82  82  LEU LEU W . n 
I  9  83  ALA 83  83  83  ALA ALA W . n 
I  9  84  GLN 84  84  84  GLN GLN W . n 
I  9  85  GLY 85  85  85  GLY GLY W . n 
I  9  86  ALA 86  86  86  ALA ALA W . n 
I  9  87  ARG 87  87  87  ARG ARG W . n 
I  9  88  ARG 88  88  88  ARG ARG W . n 
I  9  89  PHE 89  89  89  PHE PHE W . n 
I  9  90  TYR 90  90  90  TYR TYR W . n 
I  9  91  GLU 91  91  91  GLU GLU W . n 
I  9  92  ALA 92  92  92  ALA ALA W . n 
I  9  93  VAL 93  93  93  VAL VAL W . n 
I  9  94  VAL 94  94  94  VAL VAL W . n 
I  9  95  SER 95  95  95  SER SER W . n 
I  9  96  PRO 96  96  96  PRO PRO W . n 
I  9  97  GLY 97  97  97  GLY GLY W . n 
I  9  98  GLU 98  98  98  GLU GLU W . n 
I  9  99  MET 99  99  99  MET MET W . n 
I  9  100 THR 100 100 100 THR THR W . n 
I  9  101 ALA 101 101 101 ALA ALA W . n 
I  9  102 LEU 102 102 102 LEU LEU W . n 
I  9  103 LEU 103 103 103 LEU LEU W . n 
I  9  104 ASP 104 104 104 ASP ASP W . n 
I  9  105 LEU 105 105 105 LEU LEU W . n 
I  9  106 PRO 106 106 106 PRO PRO W . n 
I  9  107 PRO 107 107 107 PRO PRO W . n 
I  9  108 GLU 108 108 108 GLU GLU W . n 
I  9  109 GLU 109 109 109 GLU GLU W . n 
I  9  110 LEU 110 110 110 LEU LEU W . n 
I  9  111 LEU 111 111 111 LEU LEU W . n 
I  9  112 LYS 112 112 112 LYS LYS W . n 
I  9  113 ARG 113 113 113 ARG ARG W . n 
I  9  114 VAL 114 114 114 VAL VAL W . n 
I  9  115 MET 115 115 115 MET MET W . n 
I  9  116 ALA 116 116 116 ALA ALA W . n 
I  9  117 ILE 117 117 117 ILE ILE W . n 
I  9  118 ALA 118 118 118 ALA ALA W . n 
I  9  119 ASN 119 119 119 ASN ASN W . n 
I  9  120 PRO 120 120 120 PRO PRO W . n 
I  9  121 THR 121 121 121 THR THR W . n 
I  9  122 ASP 122 122 122 ASP ASP W . n 
I  9  123 PRO 123 123 123 PRO PRO W . n 
I  9  124 GLY 124 124 124 GLY GLY W . n 
I  9  125 ILE 125 125 125 ILE ILE W . n 
I  9  126 TYR 126 126 126 TYR TYR W . n 
I  9  127 LEU 127 127 127 LEU LEU W . n 
I  9  128 LYS 128 128 ?   ?   ?   W . n 
I  9  129 ARG 129 129 ?   ?   ?   W . n 
I  9  130 ALA 130 130 ?   ?   ?   W . n 
I  9  131 ALA 131 131 ?   ?   ?   W . n 
J  10 1   MET 1   1   1   MET MET A . n 
J  10 2   ALA 2   2   2   ALA ALA A . n 
J  10 3   PRO 3   3   3   PRO PRO A . n 
J  10 4   ILE 4   4   4   ILE ILE A . n 
J  10 5   GLN 5   5   5   GLN GLN A . n 
J  10 6   GLU 6   6   6   GLU GLU A . n 
J  10 7   TYR 7   7   7   TYR TYR A . n 
J  10 8   VAL 8   8   8   VAL VAL A . n 
J  10 9   GLY 9   9   9   GLY GLY A . n 
J  10 10  THR 10  10  10  THR THR A . n 
J  10 11  LEU 11  11  11  LEU LEU A . n 
J  10 12  ILE 12  12  12  ILE ILE A . n 
J  10 13  TYR 13  13  13  TYR TYR A . n 
J  10 14  VAL 14  14  14  VAL VAL A . n 
J  10 15  GLY 15  15  15  GLY GLY A . n 
J  10 16  VAL 16  16  16  VAL VAL A . n 
J  10 17  ALA 17  17  17  ALA ALA A . n 
J  10 18  LEU 18  18  18  LEU LEU A . n 
J  10 19  PHE 19  19  19  PHE PHE A . n 
J  10 20  ILE 20  20  20  ILE ILE A . n 
J  10 21  GLY 21  21  21  GLY GLY A . n 
J  10 22  VAL 22  22  22  VAL VAL A . n 
J  10 23  ALA 23  23  23  ALA ALA A . n 
J  10 24  ALA 24  24  24  ALA ALA A . n 
J  10 25  LEU 25  25  25  LEU LEU A . n 
J  10 26  LEU 26  26  26  LEU LEU A . n 
J  10 27  VAL 27  27  27  VAL VAL A . n 
J  10 28  GLY 28  28  28  GLY GLY A . n 
J  10 29  ALA 29  29  29  ALA ALA A . n 
J  10 30  LEU 30  30  30  LEU LEU A . n 
J  10 31  LEU 31  31  31  LEU LEU A . n 
J  10 32  GLY 32  32  32  GLY GLY A . n 
J  10 33  PRO 33  33  33  PRO PRO A . n 
J  10 34  LYS 34  34  34  LYS LYS A . n 
J  10 35  LYS 35  35  35  LYS LYS A . n 
J  10 36  PRO 36  36  36  PRO PRO A . n 
J  10 37  GLY 37  37  37  GLY GLY A . n 
J  10 38  ARG 38  38  38  ARG ARG A . n 
J  10 39  ALA 39  39  39  ALA ALA A . n 
J  10 40  LYS 40  40  40  LYS LYS A . n 
J  10 41  LEU 41  41  41  LEU LEU A . n 
J  10 42  MET 42  42  42  MET MET A . n 
J  10 43  PRO 43  43  43  PRO PRO A . n 
J  10 44  TYR 44  44  44  TYR TYR A . n 
J  10 45  GLU 45  45  45  GLU GLU A . n 
J  10 46  SER 46  46  46  SER SER A . n 
J  10 47  GLY 47  47  47  GLY GLY A . n 
J  10 48  ASN 48  48  48  ASN ASN A . n 
J  10 49  ASP 49  49  49  ASP ASP A . n 
J  10 50  PRO 50  50  50  PRO PRO A . n 
J  10 51  ALA 51  51  51  ALA ALA A . n 
J  10 52  GLY 52  52  52  GLY GLY A . n 
J  10 53  GLU 53  53  53  GLU GLU A . n 
J  10 54  VAL 54  54  54  VAL VAL A . n 
J  10 55  LYS 55  55  55  LYS LYS A . n 
J  10 56  ARG 56  56  56  ARG ARG A . n 
J  10 57  PHE 57  57  57  PHE PHE A . n 
J  10 58  PRO 58  58  58  PRO PRO A . n 
J  10 59  VAL 59  59  59  VAL VAL A . n 
J  10 60  HIS 60  60  60  HIS HIS A . n 
J  10 61  PHE 61  61  61  PHE PHE A . n 
J  10 62  TYR 62  62  62  TYR TYR A . n 
J  10 63  VAL 63  63  63  VAL VAL A . n 
J  10 64  VAL 64  64  64  VAL VAL A . n 
J  10 65  ALA 65  65  65  ALA ALA A . n 
J  10 66  MET 66  66  66  MET MET A . n 
J  10 67  LEU 67  67  67  LEU LEU A . n 
J  10 68  PHE 68  68  68  PHE PHE A . n 
J  10 69  ILE 69  69  69  ILE ILE A . n 
J  10 70  LEU 70  70  70  LEU LEU A . n 
J  10 71  PHE 71  71  71  PHE PHE A . n 
J  10 72  ASP 72  72  72  ASP ASP A . n 
J  10 73  VAL 73  73  73  VAL VAL A . n 
J  10 74  GLU 74  74  74  GLU GLU A . n 
J  10 75  VAL 75  75  75  VAL VAL A . n 
J  10 76  ALA 76  76  76  ALA ALA A . n 
J  10 77  PHE 77  77  77  PHE PHE A . n 
J  10 78  LEU 78  78  78  LEU LEU A . n 
J  10 79  TRP 79  79  79  TRP TRP A . n 
J  10 80  PRO 80  80  80  PRO PRO A . n 
J  10 81  TYR 81  81  81  TYR TYR A . n 
J  10 82  ALA 82  82  82  ALA ALA A . n 
J  10 83  VAL 83  83  83  VAL VAL A . n 
J  10 84  SER 84  84  84  SER SER A . n 
J  10 85  ALA 85  85  85  ALA ALA A . n 
J  10 86  GLY 86  86  86  GLY GLY A . n 
J  10 87  GLY 87  87  87  GLY GLY A . n 
J  10 88  LEU 88  88  88  LEU LEU A . n 
J  10 89  GLY 89  89  89  GLY GLY A . n 
J  10 90  LEU 90  90  90  LEU LEU A . n 
J  10 91  TYR 91  91  91  TYR TYR A . n 
J  10 92  GLY 92  92  92  GLY GLY A . n 
J  10 93  PHE 93  93  93  PHE PHE A . n 
J  10 94  LEU 94  94  94  LEU LEU A . n 
J  10 95  GLY 95  95  95  GLY GLY A . n 
J  10 96  VAL 96  96  96  VAL VAL A . n 
J  10 97  LEU 97  97  97  LEU LEU A . n 
J  10 98  ALA 98  98  98  ALA ALA A . n 
J  10 99  PHE 99  99  99  PHE PHE A . n 
J  10 100 THR 100 100 100 THR THR A . n 
J  10 101 LEU 101 101 101 LEU LEU A . n 
J  10 102 LEU 102 102 102 LEU LEU A . n 
J  10 103 LEU 103 103 103 LEU LEU A . n 
J  10 104 PHE 104 104 104 PHE PHE A . n 
J  10 105 VAL 105 105 105 VAL VAL A . n 
J  10 106 GLY 106 106 106 GLY GLY A . n 
J  10 107 PHE 107 107 107 PHE PHE A . n 
J  10 108 LEU 108 108 108 LEU LEU A . n 
J  10 109 TYR 109 109 109 TYR TYR A . n 
J  10 110 GLU 110 110 110 GLU GLU A . n 
J  10 111 TRP 111 111 111 TRP TRP A . n 
J  10 112 TRP 112 112 112 TRP TRP A . n 
J  10 113 LYS 113 113 113 LYS LYS A . n 
J  10 114 GLY 114 114 114 GLY GLY A . n 
J  10 115 VAL 115 115 115 VAL VAL A . n 
J  10 116 MET 116 116 116 MET MET A . n 
J  10 117 ARG 117 117 117 ARG ARG A . n 
J  10 118 TRP 118 118 ?   ?   ?   A . n 
J  10 119 HIS 119 119 ?   ?   ?   A . n 
K  11 1   MET 1   1   1   MET MET J . n 
K  11 2   SER 2   2   2   SER SER J . n 
K  11 3   LEU 3   3   3   LEU LEU J . n 
K  11 4   LEU 4   4   4   LEU LEU J . n 
K  11 5   GLU 5   5   5   GLU GLU J . n 
K  11 6   GLY 6   6   6   GLY GLY J . n 
K  11 7   LEU 7   7   7   LEU LEU J . n 
K  11 8   ALA 8   8   8   ALA ALA J . n 
K  11 9   LEU 9   9   9   LEU LEU J . n 
K  11 10  PHE 10  10  10  PHE PHE J . n 
K  11 11  LEU 11  11  11  LEU LEU J . n 
K  11 12  LEU 12  12  12  LEU LEU J . n 
K  11 13  LEU 13  13  13  LEU LEU J . n 
K  11 14  LEU 14  14  14  LEU LEU J . n 
K  11 15  SER 15  15  15  SER SER J . n 
K  11 16  GLY 16  16  16  GLY GLY J . n 
K  11 17  VAL 17  17  17  VAL VAL J . n 
K  11 18  LEU 18  18  18  LEU LEU J . n 
K  11 19  VAL 19  19  19  VAL VAL J . n 
K  11 20  VAL 20  20  20  VAL VAL J . n 
K  11 21  THR 21  21  21  THR THR J . n 
K  11 22  LEU 22  22  22  LEU LEU J . n 
K  11 23  ARG 23  23  23  ARG ARG J . n 
K  11 24  ASN 24  24  24  ASN ASN J . n 
K  11 25  ALA 25  25  25  ALA ALA J . n 
K  11 26  ILE 26  26  26  ILE ILE J . n 
K  11 27  HIS 27  27  27  HIS HIS J . n 
K  11 28  ALA 28  28  28  ALA ALA J . n 
K  11 29  ALA 29  29  29  ALA ALA J . n 
K  11 30  LEU 30  30  30  LEU LEU J . n 
K  11 31  ALA 31  31  31  ALA ALA J . n 
K  11 32  LEU 32  32  32  LEU LEU J . n 
K  11 33  ILE 33  33  33  ILE ILE J . n 
K  11 34  LEU 34  34  34  LEU LEU J . n 
K  11 35  ASN 35  35  35  ASN ASN J . n 
K  11 36  PHE 36  36  36  PHE PHE J . n 
K  11 37  LEU 37  37  37  LEU LEU J . n 
K  11 38  VAL 38  38  38  VAL VAL J . n 
K  11 39  LEU 39  39  39  LEU LEU J . n 
K  11 40  ALA 40  40  40  ALA ALA J . n 
K  11 41  GLY 41  41  41  GLY GLY J . n 
K  11 42  VAL 42  42  42  VAL VAL J . n 
K  11 43  TYR 43  43  43  TYR TYR J . n 
K  11 44  VAL 44  44  44  VAL VAL J . n 
K  11 45  ALA 45  45  45  ALA ALA J . n 
K  11 46  LEU 46  46  46  LEU LEU J . n 
K  11 47  ASP 47  47  47  ASP ASP J . n 
K  11 48  ALA 48  48  48  ALA ALA J . n 
K  11 49  ARG 49  49  49  ARG ARG J . n 
K  11 50  PHE 50  50  50  PHE PHE J . n 
K  11 51  LEU 51  51  51  LEU LEU J . n 
K  11 52  GLY 52  52  52  GLY GLY J . n 
K  11 53  PHE 53  53  53  PHE PHE J . n 
K  11 54  ILE 54  54  54  ILE ILE J . n 
K  11 55  GLN 55  55  55  GLN GLN J . n 
K  11 56  VAL 56  56  56  VAL VAL J . n 
K  11 57  ILE 57  57  57  ILE ILE J . n 
K  11 58  VAL 58  58  58  VAL VAL J . n 
K  11 59  TYR 59  59  59  TYR TYR J . n 
K  11 60  ALA 60  60  60  ALA ALA J . n 
K  11 61  GLY 61  61  61  GLY GLY J . n 
K  11 62  ALA 62  62  62  ALA ALA J . n 
K  11 63  ILE 63  63  63  ILE ILE J . n 
K  11 64  VAL 64  64  64  VAL VAL J . n 
K  11 65  VAL 65  65  65  VAL VAL J . n 
K  11 66  LEU 66  66  66  LEU LEU J . n 
K  11 67  PHE 67  67  67  PHE PHE J . n 
K  11 68  LEU 68  68  68  LEU LEU J . n 
K  11 69  PHE 69  69  69  PHE PHE J . n 
K  11 70  VAL 70  70  70  VAL VAL J . n 
K  11 71  ILE 71  71  71  ILE ILE J . n 
K  11 72  MET 72  72  72  MET MET J . n 
K  11 73  LEU 73  73  73  LEU LEU J . n 
K  11 74  LEU 74  74  74  LEU LEU J . n 
K  11 75  PHE 75  75  75  PHE PHE J . n 
K  11 76  ALA 76  76  76  ALA ALA J . n 
K  11 77  ALA 77  77  77  ALA ALA J . n 
K  11 78  GLN 78  78  78  GLN GLN J . n 
K  11 79  GLY 79  79  79  GLY GLY J . n 
K  11 80  GLU 80  80  80  GLU GLU J . n 
K  11 81  ILE 81  81  81  ILE ILE J . n 
K  11 82  GLY 82  82  82  GLY GLY J . n 
K  11 83  PHE 83  83  83  PHE PHE J . n 
K  11 84  ASP 84  84  84  ASP ASP J . n 
K  11 85  PRO 85  85  85  PRO PRO J . n 
K  11 86  LEU 86  86  86  LEU LEU J . n 
K  11 87  VAL 87  87  87  VAL VAL J . n 
K  11 88  ARG 88  88  88  ARG ARG J . n 
K  11 89  SER 89  89  89  SER SER J . n 
K  11 90  ARG 90  90  90  ARG ARG J . n 
K  11 91  PRO 91  91  91  PRO PRO J . n 
K  11 92  LEU 92  92  92  LEU LEU J . n 
K  11 93  ALA 93  93  93  ALA ALA J . n 
K  11 94  ALA 94  94  94  ALA ALA J . n 
K  11 95  LEU 95  95  95  LEU LEU J . n 
K  11 96  LEU 96  96  96  LEU LEU J . n 
K  11 97  ALA 97  97  97  ALA ALA J . n 
K  11 98  LEU 98  98  98  LEU LEU J . n 
K  11 99  GLY 99  99  99  GLY GLY J . n 
K  11 100 VAL 100 100 100 VAL VAL J . n 
K  11 101 ALA 101 101 101 ALA ALA J . n 
K  11 102 GLY 102 102 102 GLY GLY J . n 
K  11 103 ILE 103 103 103 ILE ILE J . n 
K  11 104 LEU 104 104 104 LEU LEU J . n 
K  11 105 ALA 105 105 105 ALA ALA J . n 
K  11 106 ALA 106 106 106 ALA ALA J . n 
K  11 107 GLY 107 107 107 GLY GLY J . n 
K  11 108 LEU 108 108 108 LEU LEU J . n 
K  11 109 TRP 109 109 109 TRP TRP J . n 
K  11 110 GLY 110 110 110 GLY GLY J . n 
K  11 111 LEU 111 111 111 LEU LEU J . n 
K  11 112 ASP 112 112 112 ASP ASP J . n 
K  11 113 LEU 113 113 113 LEU LEU J . n 
K  11 114 ALA 114 114 114 ALA ALA J . n 
K  11 115 PHE 115 115 115 PHE PHE J . n 
K  11 116 THR 116 116 116 THR THR J . n 
K  11 117 GLN 117 117 117 GLN GLN J . n 
K  11 118 ASP 118 118 118 ASP ASP J . n 
K  11 119 LEU 119 119 119 LEU LEU J . n 
K  11 120 LYS 120 120 120 LYS LYS J . n 
K  11 121 GLY 121 121 121 GLY GLY J . n 
K  11 122 GLY 122 122 122 GLY GLY J . n 
K  11 123 LEU 123 123 123 LEU LEU J . n 
K  11 124 PRO 124 124 124 PRO PRO J . n 
K  11 125 GLN 125 125 125 GLN GLN J . n 
K  11 126 ALA 126 126 126 ALA ALA J . n 
K  11 127 LEU 127 127 127 LEU LEU J . n 
K  11 128 GLY 128 128 128 GLY GLY J . n 
K  11 129 PRO 129 129 129 PRO PRO J . n 
K  11 130 LEU 130 130 130 LEU LEU J . n 
K  11 131 LEU 131 131 131 LEU LEU J . n 
K  11 132 TYR 132 132 132 TYR TYR J . n 
K  11 133 GLY 133 133 133 GLY GLY J . n 
K  11 134 ASP 134 134 134 ASP ASP J . n 
K  11 135 TRP 135 135 135 TRP TRP J . n 
K  11 136 LEU 136 136 136 LEU LEU J . n 
K  11 137 PHE 137 137 137 PHE PHE J . n 
K  11 138 VAL 138 138 138 VAL VAL J . n 
K  11 139 LEU 139 139 139 LEU LEU J . n 
K  11 140 LEU 140 140 140 LEU LEU J . n 
K  11 141 ALA 141 141 141 ALA ALA J . n 
K  11 142 VAL 142 142 142 VAL VAL J . n 
K  11 143 GLY 143 143 143 GLY GLY J . n 
K  11 144 PHE 144 144 144 PHE PHE J . n 
K  11 145 LEU 145 145 145 LEU LEU J . n 
K  11 146 LEU 146 146 146 LEU LEU J . n 
K  11 147 MET 147 147 147 MET MET J . n 
K  11 148 ALA 148 148 148 ALA ALA J . n 
K  11 149 ALA 149 149 149 ALA ALA J . n 
K  11 150 THR 150 150 150 THR THR J . n 
K  11 151 VAL 151 151 151 VAL VAL J . n 
K  11 152 VAL 152 152 152 VAL VAL J . n 
K  11 153 ALA 153 153 153 ALA ALA J . n 
K  11 154 VAL 154 154 154 VAL VAL J . n 
K  11 155 ALA 155 155 155 ALA ALA J . n 
K  11 156 LEU 156 156 156 LEU LEU J . n 
K  11 157 VAL 157 157 157 VAL VAL J . n 
K  11 158 GLU 158 158 158 GLU GLU J . n 
K  11 159 PRO 159 159 159 PRO PRO J . n 
K  11 160 GLY 160 160 160 GLY GLY J . n 
K  11 161 LYS 161 161 ?   ?   ?   J . n 
K  11 162 ALA 162 162 ?   ?   ?   J . n 
K  11 163 SER 163 163 ?   ?   ?   J . n 
K  11 164 ARG 164 164 ?   ?   ?   J . n 
K  11 165 ALA 165 165 ?   ?   ?   J . n 
K  11 166 LYS 166 166 ?   ?   ?   J . n 
K  11 167 GLU 167 167 ?   ?   ?   J . n 
K  11 168 ALA 168 168 ?   ?   ?   J . n 
K  11 169 GLU 169 169 ?   ?   ?   J . n 
K  11 170 LYS 170 170 ?   ?   ?   J . n 
K  11 171 ARG 171 171 ?   ?   ?   J . n 
K  11 172 GLU 172 172 ?   ?   ?   J . n 
K  11 173 GLU 173 173 ?   ?   ?   J . n 
K  11 174 VAL 174 174 ?   ?   ?   J . n 
K  11 175 ALA 175 175 ?   ?   ?   J . n 
K  11 176 ARG 176 176 ?   ?   ?   J . n 
L  12 1   MET 1   1   1   MET MET K . n 
L  12 2   SER 2   2   2   SER SER K . n 
L  12 3   TYR 3   3   3   TYR TYR K . n 
L  12 4   LEU 4   4   4   LEU LEU K . n 
L  12 5   LEU 5   5   5   LEU LEU K . n 
L  12 6   THR 6   6   6   THR THR K . n 
L  12 7   SER 7   7   7   SER SER K . n 
L  12 8   ALA 8   8   8   ALA ALA K . n 
L  12 9   LEU 9   9   9   LEU LEU K . n 
L  12 10  LEU 10  10  10  LEU LEU K . n 
L  12 11  PHE 11  11  11  PHE PHE K . n 
L  12 12  ALA 12  12  12  ALA ALA K . n 
L  12 13  LEU 13  13  13  LEU LEU K . n 
L  12 14  GLY 14  14  14  GLY GLY K . n 
L  12 15  VAL 15  15  15  VAL VAL K . n 
L  12 16  TYR 16  16  16  TYR TYR K . n 
L  12 17  GLY 17  17  17  GLY GLY K . n 
L  12 18  VAL 18  18  18  VAL VAL K . n 
L  12 19  LEU 19  19  19  LEU LEU K . n 
L  12 20  THR 20  20  20  THR THR K . n 
L  12 21  ARG 21  21  21  ARG ARG K . n 
L  12 22  ARG 22  22  22  ARG ARG K . n 
L  12 23  THR 23  23  23  THR THR K . n 
L  12 24  ALA 24  24  24  ALA ALA K . n 
L  12 25  ILE 25  25  25  ILE ILE K . n 
L  12 26  LEU 26  26  26  LEU LEU K . n 
L  12 27  VAL 27  27  27  VAL VAL K . n 
L  12 28  PHE 28  28  28  PHE PHE K . n 
L  12 29  LEU 29  29  29  LEU LEU K . n 
L  12 30  SER 30  30  30  SER SER K . n 
L  12 31  ILE 31  31  31  ILE ILE K . n 
L  12 32  GLU 32  32  32  GLU GLU K . n 
L  12 33  LEU 33  33  33  LEU LEU K . n 
L  12 34  MET 34  34  34  MET MET K . n 
L  12 35  LEU 35  35  35  LEU LEU K . n 
L  12 36  ASN 36  36  36  ASN ASN K . n 
L  12 37  ALA 37  37  37  ALA ALA K . n 
L  12 38  ALA 38  38  38  ALA ALA K . n 
L  12 39  ASN 39  39  39  ASN ASN K . n 
L  12 40  LEU 40  40  40  LEU LEU K . n 
L  12 41  SER 41  41  41  SER SER K . n 
L  12 42  LEU 42  42  42  LEU LEU K . n 
L  12 43  VAL 43  43  43  VAL VAL K . n 
L  12 44  GLY 44  44  44  GLY GLY K . n 
L  12 45  PHE 45  45  45  PHE PHE K . n 
L  12 46  ALA 46  46  46  ALA ALA K . n 
L  12 47  ARG 47  47  47  ARG ARG K . n 
L  12 48  ALA 48  48  48  ALA ALA K . n 
L  12 49  TYR 49  49  49  TYR TYR K . n 
L  12 50  GLY 50  50  50  GLY GLY K . n 
L  12 51  LEU 51  51  51  LEU LEU K . n 
L  12 52  ASP 52  52  52  ASP ASP K . n 
L  12 53  GLY 53  53  53  GLY GLY K . n 
L  12 54  GLN 54  54  54  GLN GLN K . n 
L  12 55  VAL 55  55  55  VAL VAL K . n 
L  12 56  ALA 56  56  56  ALA ALA K . n 
L  12 57  ALA 57  57  57  ALA ALA K . n 
L  12 58  LEU 58  58  58  LEU LEU K . n 
L  12 59  MET 59  59  59  MET MET K . n 
L  12 60  VAL 60  60  60  VAL VAL K . n 
L  12 61  ILE 61  61  61  ILE ILE K . n 
L  12 62  ALA 62  62  62  ALA ALA K . n 
L  12 63  VAL 63  63  63  VAL VAL K . n 
L  12 64  ALA 64  64  64  ALA ALA K . n 
L  12 65  ALA 65  65  65  ALA ALA K . n 
L  12 66  ALA 66  66  66  ALA ALA K . n 
L  12 67  GLU 67  67  67  GLU GLU K . n 
L  12 68  VAL 68  68  68  VAL VAL K . n 
L  12 69  ALA 69  69  69  ALA ALA K . n 
L  12 70  VAL 70  70  70  VAL VAL K . n 
L  12 71  GLY 71  71  71  GLY GLY K . n 
L  12 72  LEU 72  72  72  LEU LEU K . n 
L  12 73  GLY 73  73  73  GLY GLY K . n 
L  12 74  LEU 74  74  74  LEU LEU K . n 
L  12 75  ILE 75  75  75  ILE ILE K . n 
L  12 76  VAL 76  76  76  VAL VAL K . n 
L  12 77  ALA 77  77  77  ALA ALA K . n 
L  12 78  ILE 78  78  78  ILE ILE K . n 
L  12 79  PHE 79  79  79  PHE PHE K . n 
L  12 80  ARG 80  80  80  ARG ARG K . n 
L  12 81  HIS 81  81  81  HIS HIS K . n 
L  12 82  ARG 82  82  82  ARG ARG K . n 
L  12 83  GLU 83  83  83  GLU GLU K . n 
L  12 84  SER 84  84  84  SER SER K . n 
L  12 85  THR 85  85  85  THR THR K . n 
L  12 86  ALA 86  86  86  ALA ALA K . n 
L  12 87  VAL 87  87  87  VAL VAL K . n 
L  12 88  ASP 88  88  88  ASP ASP K . n 
L  12 89  ASP 89  89  89  ASP ASP K . n 
L  12 90  LEU 90  90  90  LEU LEU K . n 
L  12 91  SER 91  91  91  SER SER K . n 
L  12 92  GLU 92  92  92  GLU GLU K . n 
L  12 93  LEU 93  93  93  LEU LEU K . n 
L  12 94  ARG 94  94  94  ARG ARG K . n 
L  12 95  GLY 95  95  95  GLY GLY K . n 
M  13 1   MET 1   1   1   MET MET L . n 
M  13 2   ALA 2   2   2   ALA ALA L . n 
M  13 3   LEU 3   3   3   LEU LEU L . n 
M  13 4   LEU 4   4   4   LEU LEU L . n 
M  13 5   GLY 5   5   5   GLY GLY L . n 
M  13 6   THR 6   6   6   THR THR L . n 
M  13 7   ILE 7   7   7   ILE ILE L . n 
M  13 8   LEU 8   8   8   LEU LEU L . n 
M  13 9   LEU 9   9   9   LEU LEU L . n 
M  13 10  PRO 10  10  10  PRO PRO L . n 
M  13 11  LEU 11  11  11  LEU LEU L . n 
M  13 12  LEU 12  12  12  LEU LEU L . n 
M  13 13  GLY 13  13  13  GLY GLY L . n 
M  13 14  PHE 14  14  14  PHE PHE L . n 
M  13 15  ALA 15  15  15  ALA ALA L . n 
M  13 16  LEU 16  16  16  LEU LEU L . n 
M  13 17  LEU 17  17  17  LEU LEU L . n 
M  13 18  GLY 18  18  18  GLY GLY L . n 
M  13 19  LEU 19  19  19  LEU LEU L . n 
M  13 20  PHE 20  20  20  PHE PHE L . n 
M  13 21  GLY 21  21  21  GLY GLY L . n 
M  13 22  LYS 22  22  22  LYS LYS L . n 
M  13 23  ARG 23  23  23  ARG ARG L . n 
M  13 24  MET 24  24  24  MET MET L . n 
M  13 25  ARG 25  25  25  ARG ARG L . n 
M  13 26  GLU 26  26  26  GLU GLU L . n 
M  13 27  PRO 27  27  27  PRO PRO L . n 
M  13 28  LEU 28  28  28  LEU LEU L . n 
M  13 29  PRO 29  29  29  PRO PRO L . n 
M  13 30  GLY 30  30  30  GLY GLY L . n 
M  13 31  VAL 31  31  31  VAL VAL L . n 
M  13 32  LEU 32  32  32  LEU LEU L . n 
M  13 33  ALA 33  33  33  ALA ALA L . n 
M  13 34  SER 34  34  34  SER SER L . n 
M  13 35  GLY 35  35  35  GLY GLY L . n 
M  13 36  LEU 36  36  36  LEU LEU L . n 
M  13 37  VAL 37  37  37  VAL VAL L . n 
M  13 38  LEU 38  38  38  LEU LEU L . n 
M  13 39  ALA 39  39  39  ALA ALA L . n 
M  13 40  SER 40  40  40  SER SER L . n 
M  13 41  PHE 41  41  41  PHE PHE L . n 
M  13 42  LEU 42  42  42  LEU LEU L . n 
M  13 43  LEU 43  43  43  LEU LEU L . n 
M  13 44  GLY 44  44  44  GLY GLY L . n 
M  13 45  ALA 45  45  45  ALA ALA L . n 
M  13 46  GLY 46  46  46  GLY GLY L . n 
M  13 47  LEU 47  47  47  LEU LEU L . n 
M  13 48  LEU 48  48  48  LEU LEU L . n 
M  13 49  LEU 49  49  49  LEU LEU L . n 
M  13 50  SER 50  50  50  SER SER L . n 
M  13 51  GLY 51  51  51  GLY GLY L . n 
M  13 52  GLY 52  52  52  GLY GLY L . n 
M  13 53  ALA 53  53  53  ALA ALA L . n 
M  13 54  ARG 54  54  54  ARG ARG L . n 
M  13 55  PHE 55  55  55  PHE PHE L . n 
M  13 56  GLN 56  56  56  GLN GLN L . n 
M  13 57  ALA 57  57  57  ALA ALA L . n 
M  13 58  GLU 58  58  58  GLU GLU L . n 
M  13 59  TRP 59  59  59  TRP TRP L . n 
M  13 60  LEU 60  60  60  LEU LEU L . n 
M  13 61  PRO 61  61  61  PRO PRO L . n 
M  13 62  GLY 62  62  62  GLY GLY L . n 
M  13 63  ILE 63  63  63  ILE ILE L . n 
M  13 64  PRO 64  64  64  PRO PRO L . n 
M  13 65  PHE 65  65  65  PHE PHE L . n 
M  13 66  SER 66  66  66  SER SER L . n 
M  13 67  LEU 67  67  67  LEU LEU L . n 
M  13 68  LEU 68  68  68  LEU LEU L . n 
M  13 69  LEU 69  69  69  LEU LEU L . n 
M  13 70  ASP 70  70  70  ASP ASP L . n 
M  13 71  ASN 71  71  71  ASN ASN L . n 
M  13 72  LEU 72  72  72  LEU LEU L . n 
M  13 73  SER 73  73  73  SER SER L . n 
M  13 74  GLY 74  74  74  GLY GLY L . n 
M  13 75  PHE 75  75  75  PHE PHE L . n 
M  13 76  MET 76  76  76  MET MET L . n 
M  13 77  LEU 77  77  77  LEU LEU L . n 
M  13 78  LEU 78  78  78  LEU LEU L . n 
M  13 79  ILE 79  79  79  ILE ILE L . n 
M  13 80  VAL 80  80  80  VAL VAL L . n 
M  13 81  THR 81  81  81  THR THR L . n 
M  13 82  GLY 82  82  82  GLY GLY L . n 
M  13 83  VAL 83  83  83  VAL VAL L . n 
M  13 84  GLY 84  84  84  GLY GLY L . n 
M  13 85  PHE 85  85  85  PHE PHE L . n 
M  13 86  LEU 86  86  86  LEU LEU L . n 
M  13 87  ILE 87  87  87  ILE ILE L . n 
M  13 88  HIS 88  88  88  HIS HIS L . n 
M  13 89  VAL 89  89  89  VAL VAL L . n 
M  13 90  TYR 90  90  90  TYR TYR L . n 
M  13 91  ALA 91  91  91  ALA ALA L . n 
M  13 92  ILE 92  92  92  ILE ILE L . n 
M  13 93  GLY 93  93  93  GLY GLY L . n 
M  13 94  TYR 94  94  94  TYR TYR L . n 
M  13 95  MET 95  95  95  MET MET L . n 
M  13 96  GLY 96  96  96  GLY GLY L . n 
M  13 97  GLY 97  97  97  GLY GLY L . n 
M  13 98  ASP 98  98  98  ASP ASP L . n 
M  13 99  PRO 99  99  99  PRO PRO L . n 
M  13 100 GLY 100 100 100 GLY GLY L . n 
M  13 101 TYR 101 101 101 TYR TYR L . n 
M  13 102 SER 102 102 102 SER SER L . n 
M  13 103 ARG 103 103 103 ARG ARG L . n 
M  13 104 PHE 104 104 104 PHE PHE L . n 
M  13 105 PHE 105 105 105 PHE PHE L . n 
M  13 106 ALA 106 106 106 ALA ALA L . n 
M  13 107 TYR 107 107 107 TYR TYR L . n 
M  13 108 PHE 108 108 108 PHE PHE L . n 
M  13 109 ASN 109 109 109 ASN ASN L . n 
M  13 110 LEU 110 110 110 LEU LEU L . n 
M  13 111 PHE 111 111 111 PHE PHE L . n 
M  13 112 ILE 112 112 112 ILE ILE L . n 
M  13 113 ALA 113 113 113 ALA ALA L . n 
M  13 114 MET 114 114 114 MET MET L . n 
M  13 115 MET 115 115 115 MET MET L . n 
M  13 116 LEU 116 116 116 LEU LEU L . n 
M  13 117 THR 117 117 117 THR THR L . n 
M  13 118 LEU 118 118 118 LEU LEU L . n 
M  13 119 VAL 119 119 119 VAL VAL L . n 
M  13 120 LEU 120 120 120 LEU LEU L . n 
M  13 121 ALA 121 121 121 ALA ALA L . n 
M  13 122 ASP 122 122 122 ASP ASP L . n 
M  13 123 SER 123 123 123 SER SER L . n 
M  13 124 TYR 124 124 124 TYR TYR L . n 
M  13 125 PRO 125 125 125 PRO PRO L . n 
M  13 126 VAL 126 126 126 VAL VAL L . n 
M  13 127 MET 127 127 127 MET MET L . n 
M  13 128 PHE 128 128 128 PHE PHE L . n 
M  13 129 ILE 129 129 129 ILE ILE L . n 
M  13 130 GLY 130 130 130 GLY GLY L . n 
M  13 131 TRP 131 131 131 TRP TRP L . n 
M  13 132 GLU 132 132 132 GLU GLU L . n 
M  13 133 GLY 133 133 133 GLY GLY L . n 
M  13 134 VAL 134 134 134 VAL VAL L . n 
M  13 135 GLY 135 135 135 GLY GLY L . n 
M  13 136 LEU 136 136 136 LEU LEU L . n 
M  13 137 ALA 137 137 137 ALA ALA L . n 
M  13 138 SER 138 138 138 SER SER L . n 
M  13 139 PHE 139 139 139 PHE PHE L . n 
M  13 140 LEU 140 140 140 LEU LEU L . n 
M  13 141 LEU 141 141 141 LEU LEU L . n 
M  13 142 ILE 142 142 142 ILE ILE L . n 
M  13 143 GLY 143 143 143 GLY GLY L . n 
M  13 144 PHE 144 144 144 PHE PHE L . n 
M  13 145 TRP 145 145 145 TRP TRP L . n 
M  13 146 TYR 146 146 146 TYR TYR L . n 
M  13 147 LYS 147 147 147 LYS LYS L . n 
M  13 148 ASN 148 148 148 ASN ASN L . n 
M  13 149 PRO 149 149 149 PRO PRO L . n 
M  13 150 GLN 150 150 150 GLN GLN L . n 
M  13 151 TYR 151 151 151 TYR TYR L . n 
M  13 152 ALA 152 152 152 ALA ALA L . n 
M  13 153 ASP 153 153 153 ASP ASP L . n 
M  13 154 SER 154 154 154 SER SER L . n 
M  13 155 ALA 155 155 155 ALA ALA L . n 
M  13 156 ARG 156 156 156 ARG ARG L . n 
M  13 157 LYS 157 157 157 LYS LYS L . n 
M  13 158 ALA 158 158 158 ALA ALA L . n 
M  13 159 PHE 159 159 159 PHE PHE L . n 
M  13 160 ILE 160 160 160 ILE ILE L . n 
M  13 161 VAL 161 161 161 VAL VAL L . n 
M  13 162 ASN 162 162 162 ASN ASN L . n 
M  13 163 ARG 163 163 163 ARG ARG L . n 
M  13 164 ILE 164 164 164 ILE ILE L . n 
M  13 165 GLY 165 165 165 GLY GLY L . n 
M  13 166 ASP 166 166 166 ASP ASP L . n 
M  13 167 LEU 167 167 167 LEU LEU L . n 
M  13 168 GLY 168 168 168 GLY GLY L . n 
M  13 169 PHE 169 169 169 PHE PHE L . n 
M  13 170 MET 170 170 170 MET MET L . n 
M  13 171 LEU 171 171 171 LEU LEU L . n 
M  13 172 GLY 172 172 172 GLY GLY L . n 
M  13 173 MET 173 173 173 MET MET L . n 
M  13 174 ALA 174 174 174 ALA ALA L . n 
M  13 175 ILE 175 175 175 ILE ILE L . n 
M  13 176 LEU 176 176 176 LEU LEU L . n 
M  13 177 TRP 177 177 177 TRP TRP L . n 
M  13 178 ALA 178 178 178 ALA ALA L . n 
M  13 179 LEU 179 179 179 LEU LEU L . n 
M  13 180 TYR 180 180 180 TYR TYR L . n 
M  13 181 GLY 181 181 181 GLY GLY L . n 
M  13 182 THR 182 182 182 THR THR L . n 
M  13 183 LEU 183 183 183 LEU LEU L . n 
M  13 184 SER 184 184 184 SER SER L . n 
M  13 185 ILE 185 185 185 ILE ILE L . n 
M  13 186 SER 186 186 186 SER SER L . n 
M  13 187 GLU 187 187 187 GLU GLU L . n 
M  13 188 LEU 188 188 188 LEU LEU L . n 
M  13 189 LYS 189 189 189 LYS LYS L . n 
M  13 190 GLU 190 190 190 GLU GLU L . n 
M  13 191 ALA 191 191 191 ALA ALA L . n 
M  13 192 MET 192 192 192 MET MET L . n 
M  13 193 GLU 193 193 193 GLU GLU L . n 
M  13 194 GLY 194 194 194 GLY GLY L . n 
M  13 195 PRO 195 195 195 PRO PRO L . n 
M  13 196 LEU 196 196 196 LEU LEU L . n 
M  13 197 LYS 197 197 197 LYS LYS L . n 
M  13 198 ASN 198 198 198 ASN ASN L . n 
M  13 199 PRO 199 199 199 PRO PRO L . n 
M  13 200 ASP 200 200 200 ASP ASP L . n 
M  13 201 LEU 201 201 201 LEU LEU L . n 
M  13 202 LEU 202 202 202 LEU LEU L . n 
M  13 203 ALA 203 203 203 ALA ALA L . n 
M  13 204 LEU 204 204 204 LEU LEU L . n 
M  13 205 ALA 205 205 205 ALA ALA L . n 
M  13 206 GLY 206 206 206 GLY GLY L . n 
M  13 207 LEU 207 207 207 LEU LEU L . n 
M  13 208 LEU 208 208 208 LEU LEU L . n 
M  13 209 LEU 209 209 209 LEU LEU L . n 
M  13 210 PHE 210 210 210 PHE PHE L . n 
M  13 211 LEU 211 211 211 LEU LEU L . n 
M  13 212 GLY 212 212 212 GLY GLY L . n 
M  13 213 ALA 213 213 213 ALA ALA L . n 
M  13 214 VAL 214 214 214 VAL VAL L . n 
M  13 215 GLY 215 215 215 GLY GLY L . n 
M  13 216 LYS 216 216 216 LYS LYS L . n 
M  13 217 SER 217 217 217 SER SER L . n 
M  13 218 ALA 218 218 218 ALA ALA L . n 
M  13 219 GLN 219 219 219 GLN GLN L . n 
M  13 220 ILE 220 220 220 ILE ILE L . n 
M  13 221 PRO 221 221 221 PRO PRO L . n 
M  13 222 LEU 222 222 222 LEU LEU L . n 
M  13 223 MET 223 223 223 MET MET L . n 
M  13 224 VAL 224 224 224 VAL VAL L . n 
M  13 225 TRP 225 225 225 TRP TRP L . n 
M  13 226 LEU 226 226 226 LEU LEU L . n 
M  13 227 PRO 227 227 227 PRO PRO L . n 
M  13 228 ASP 228 228 228 ASP ASP L . n 
M  13 229 ALA 229 229 229 ALA ALA L . n 
M  13 230 MET 230 230 230 MET MET L . n 
M  13 231 ALA 231 231 231 ALA ALA L . n 
M  13 232 GLY 232 232 232 GLY GLY L . n 
M  13 233 PRO 233 233 233 PRO PRO L . n 
M  13 234 THR 234 234 234 THR THR L . n 
M  13 235 PRO 235 235 235 PRO PRO L . n 
M  13 236 VAL 236 236 236 VAL VAL L . n 
M  13 237 SER 237 237 237 SER SER L . n 
M  13 238 ALA 238 238 238 ALA ALA L . n 
M  13 239 LEU 239 239 239 LEU LEU L . n 
M  13 240 ILE 240 240 240 ILE ILE L . n 
M  13 241 HIS 241 241 241 HIS HIS L . n 
M  13 242 ALA 242 242 242 ALA ALA L . n 
M  13 243 ALA 243 243 243 ALA ALA L . n 
M  13 244 THR 244 244 244 THR THR L . n 
M  13 245 MET 245 245 245 MET MET L . n 
M  13 246 VAL 246 246 246 VAL VAL L . n 
M  13 247 THR 247 247 247 THR THR L . n 
M  13 248 ALA 248 248 248 ALA ALA L . n 
M  13 249 GLY 249 249 249 GLY GLY L . n 
M  13 250 VAL 250 250 250 VAL VAL L . n 
M  13 251 TYR 251 251 251 TYR TYR L . n 
M  13 252 LEU 252 252 252 LEU LEU L . n 
M  13 253 ILE 253 253 253 ILE ILE L . n 
M  13 254 ALA 254 254 254 ALA ALA L . n 
M  13 255 ARG 255 255 255 ARG ARG L . n 
M  13 256 SER 256 256 256 SER SER L . n 
M  13 257 SER 257 257 257 SER SER L . n 
M  13 258 PHE 258 258 258 PHE PHE L . n 
M  13 259 LEU 259 259 259 LEU LEU L . n 
M  13 260 TYR 260 260 260 TYR TYR L . n 
M  13 261 SER 261 261 261 SER SER L . n 
M  13 262 VAL 262 262 262 VAL VAL L . n 
M  13 263 LEU 263 263 263 LEU LEU L . n 
M  13 264 PRO 264 264 264 PRO PRO L . n 
M  13 265 ASP 265 265 265 ASP ASP L . n 
M  13 266 VAL 266 266 266 VAL VAL L . n 
M  13 267 SER 267 267 267 SER SER L . n 
M  13 268 TYR 268 268 268 TYR TYR L . n 
M  13 269 ALA 269 269 269 ALA ALA L . n 
M  13 270 ILE 270 270 270 ILE ILE L . n 
M  13 271 ALA 271 271 271 ALA ALA L . n 
M  13 272 VAL 272 272 272 VAL VAL L . n 
M  13 273 VAL 273 273 273 VAL VAL L . n 
M  13 274 GLY 274 274 274 GLY GLY L . n 
M  13 275 LEU 275 275 275 LEU LEU L . n 
M  13 276 LEU 276 276 276 LEU LEU L . n 
M  13 277 THR 277 277 277 THR THR L . n 
M  13 278 ALA 278 278 278 ALA ALA L . n 
M  13 279 ALA 279 279 279 ALA ALA L . n 
M  13 280 TYR 280 280 280 TYR TYR L . n 
M  13 281 GLY 281 281 281 GLY GLY L . n 
M  13 282 ALA 282 282 282 ALA ALA L . n 
M  13 283 LEU 283 283 283 LEU LEU L . n 
M  13 284 SER 284 284 284 SER SER L . n 
M  13 285 ALA 285 285 285 ALA ALA L . n 
M  13 286 PHE 286 286 286 PHE PHE L . n 
M  13 287 GLY 287 287 287 GLY GLY L . n 
M  13 288 GLN 288 288 288 GLN GLN L . n 
M  13 289 THR 289 289 289 THR THR L . n 
M  13 290 ASP 290 290 290 ASP ASP L . n 
M  13 291 ILE 291 291 291 ILE ILE L . n 
M  13 292 LYS 292 292 292 LYS LYS L . n 
M  13 293 LYS 293 293 293 LYS LYS L . n 
M  13 294 ILE 294 294 294 ILE ILE L . n 
M  13 295 VAL 295 295 295 VAL VAL L . n 
M  13 296 ALA 296 296 296 ALA ALA L . n 
M  13 297 TYR 297 297 297 TYR TYR L . n 
M  13 298 SER 298 298 298 SER SER L . n 
M  13 299 THR 299 299 299 THR THR L . n 
M  13 300 ILE 300 300 300 ILE ILE L . n 
M  13 301 SER 301 301 301 SER SER L . n 
M  13 302 GLN 302 302 302 GLN GLN L . n 
M  13 303 LEU 303 303 303 LEU LEU L . n 
M  13 304 GLY 304 304 304 GLY GLY L . n 
M  13 305 TYR 305 305 305 TYR TYR L . n 
M  13 306 MET 306 306 306 MET MET L . n 
M  13 307 PHE 307 307 307 PHE PHE L . n 
M  13 308 LEU 308 308 308 LEU LEU L . n 
M  13 309 ALA 309 309 309 ALA ALA L . n 
M  13 310 ALA 310 310 310 ALA ALA L . n 
M  13 311 GLY 311 311 311 GLY GLY L . n 
M  13 312 VAL 312 312 312 VAL VAL L . n 
M  13 313 GLY 313 313 313 GLY GLY L . n 
M  13 314 ALA 314 314 314 ALA ALA L . n 
M  13 315 TYR 315 315 315 TYR TYR L . n 
M  13 316 TRP 316 316 316 TRP TRP L . n 
M  13 317 VAL 317 317 317 VAL VAL L . n 
M  13 318 ALA 318 318 318 ALA ALA L . n 
M  13 319 LEU 319 319 319 LEU LEU L . n 
M  13 320 PHE 320 320 320 PHE PHE L . n 
M  13 321 HIS 321 321 321 HIS HIS L . n 
M  13 322 VAL 322 322 322 VAL VAL L . n 
M  13 323 PHE 323 323 323 PHE PHE L . n 
M  13 324 THR 324 324 324 THR THR L . n 
M  13 325 HIS 325 325 325 HIS HIS L . n 
M  13 326 ALA 326 326 326 ALA ALA L . n 
M  13 327 PHE 327 327 327 PHE PHE L . n 
M  13 328 PHE 328 328 328 PHE PHE L . n 
M  13 329 LYS 329 329 329 LYS LYS L . n 
M  13 330 ALA 330 330 330 ALA ALA L . n 
M  13 331 LEU 331 331 331 LEU LEU L . n 
M  13 332 LEU 332 332 332 LEU LEU L . n 
M  13 333 PHE 333 333 333 PHE PHE L . n 
M  13 334 LEU 334 334 334 LEU LEU L . n 
M  13 335 ALA 335 335 335 ALA ALA L . n 
M  13 336 SER 336 336 336 SER SER L . n 
M  13 337 GLY 337 337 337 GLY GLY L . n 
M  13 338 SER 338 338 338 SER SER L . n 
M  13 339 VAL 339 339 339 VAL VAL L . n 
M  13 340 ILE 340 340 340 ILE ILE L . n 
M  13 341 HIS 341 341 341 HIS HIS L . n 
M  13 342 ALA 342 342 342 ALA ALA L . n 
M  13 343 LEU 343 343 343 LEU LEU L . n 
M  13 344 GLY 344 344 344 GLY GLY L . n 
M  13 345 GLY 345 345 345 GLY GLY L . n 
M  13 346 GLU 346 346 346 GLU GLU L . n 
M  13 347 GLN 347 347 347 GLN GLN L . n 
M  13 348 ASP 348 348 348 ASP ASP L . n 
M  13 349 VAL 349 349 349 VAL VAL L . n 
M  13 350 ARG 350 350 350 ARG ARG L . n 
M  13 351 LYS 351 351 351 LYS LYS L . n 
M  13 352 MET 352 352 352 MET MET L . n 
M  13 353 GLY 353 353 353 GLY GLY L . n 
M  13 354 GLY 354 354 354 GLY GLY L . n 
M  13 355 LEU 355 355 355 LEU LEU L . n 
M  13 356 TRP 356 356 356 TRP TRP L . n 
M  13 357 LYS 357 357 357 LYS LYS L . n 
M  13 358 HIS 358 358 358 HIS HIS L . n 
M  13 359 LEU 359 359 359 LEU LEU L . n 
M  13 360 PRO 360 360 360 PRO PRO L . n 
M  13 361 GLN 361 361 361 GLN GLN L . n 
M  13 362 THR 362 362 362 THR THR L . n 
M  13 363 ARG 363 363 363 ARG ARG L . n 
M  13 364 TRP 364 364 364 TRP TRP L . n 
M  13 365 HIS 365 365 365 HIS HIS L . n 
M  13 366 ALA 366 366 366 ALA ALA L . n 
M  13 367 LEU 367 367 367 LEU LEU L . n 
M  13 368 ILE 368 368 368 ILE ILE L . n 
M  13 369 GLY 369 369 369 GLY GLY L . n 
M  13 370 ALA 370 370 370 ALA ALA L . n 
M  13 371 LEU 371 371 371 LEU LEU L . n 
M  13 372 ALA 372 372 372 ALA ALA L . n 
M  13 373 LEU 373 373 373 LEU LEU L . n 
M  13 374 GLY 374 374 374 GLY GLY L . n 
M  13 375 GLY 375 375 375 GLY GLY L . n 
M  13 376 LEU 376 376 376 LEU LEU L . n 
M  13 377 PRO 377 377 377 PRO PRO L . n 
M  13 378 LEU 378 378 378 LEU LEU L . n 
M  13 379 LEU 379 379 379 LEU LEU L . n 
M  13 380 SER 380 380 380 SER SER L . n 
M  13 381 GLY 381 381 381 GLY GLY L . n 
M  13 382 PHE 382 382 382 PHE PHE L . n 
M  13 383 TRP 383 383 383 TRP TRP L . n 
M  13 384 SER 384 384 384 SER SER L . n 
M  13 385 LYS 385 385 385 LYS LYS L . n 
M  13 386 ASP 386 386 386 ASP ASP L . n 
M  13 387 ALA 387 387 387 ALA ALA L . n 
M  13 388 ILE 388 388 388 ILE ILE L . n 
M  13 389 LEU 389 389 389 LEU LEU L . n 
M  13 390 ALA 390 390 390 ALA ALA L . n 
M  13 391 ALA 391 391 391 ALA ALA L . n 
M  13 392 THR 392 392 392 THR THR L . n 
M  13 393 LEU 393 393 393 LEU LEU L . n 
M  13 394 THR 394 394 394 THR THR L . n 
M  13 395 TYR 395 395 395 TYR TYR L . n 
M  13 396 PRO 396 396 396 PRO PRO L . n 
M  13 397 PHE 397 397 397 PHE PHE L . n 
M  13 398 GLY 398 398 398 GLY GLY L . n 
M  13 399 GLY 399 399 399 GLY GLY L . n 
M  13 400 VAL 400 400 400 VAL VAL L . n 
M  13 401 GLY 401 401 401 GLY GLY L . n 
M  13 402 PHE 402 402 402 PHE PHE L . n 
M  13 403 TYR 403 403 403 TYR TYR L . n 
M  13 404 VAL 404 404 404 VAL VAL L . n 
M  13 405 GLY 405 405 405 GLY GLY L . n 
M  13 406 ALA 406 406 406 ALA ALA L . n 
M  13 407 LEU 407 407 407 LEU LEU L . n 
M  13 408 LEU 408 408 408 LEU LEU L . n 
M  13 409 VAL 409 409 409 VAL VAL L . n 
M  13 410 ALA 410 410 410 ALA ALA L . n 
M  13 411 VAL 411 411 411 VAL VAL L . n 
M  13 412 LEU 412 412 412 LEU LEU L . n 
M  13 413 THR 413 413 413 THR THR L . n 
M  13 414 ALA 414 414 414 ALA ALA L . n 
M  13 415 MET 415 415 415 MET MET L . n 
M  13 416 TYR 416 416 416 TYR TYR L . n 
M  13 417 ALA 417 417 417 ALA ALA L . n 
M  13 418 MET 418 418 418 MET MET L . n 
M  13 419 ARG 419 419 419 ARG ARG L . n 
M  13 420 TRP 420 420 420 TRP TRP L . n 
M  13 421 PHE 421 421 421 PHE PHE L . n 
M  13 422 VAL 422 422 422 VAL VAL L . n 
M  13 423 LEU 423 423 423 LEU LEU L . n 
M  13 424 VAL 424 424 424 VAL VAL L . n 
M  13 425 PHE 425 425 425 PHE PHE L . n 
M  13 426 LEU 426 426 426 LEU LEU L . n 
M  13 427 GLY 427 427 427 GLY GLY L . n 
M  13 428 GLU 428 428 428 GLU GLU L . n 
M  13 429 GLU 429 429 429 GLU GLU L . n 
M  13 430 ARG 430 430 430 ARG ARG L . n 
M  13 431 GLY 431 431 431 GLY GLY L . n 
M  13 432 HIS 432 432 432 HIS HIS L . n 
M  13 433 HIS 433 433 433 HIS HIS L . n 
M  13 434 HIS 434 434 434 HIS HIS L . n 
M  13 435 PRO 435 435 435 PRO PRO L . n 
M  13 436 HIS 436 436 436 HIS HIS L . n 
M  13 437 GLU 437 437 437 GLU GLU L . n 
M  13 438 ALA 438 438 438 ALA ALA L . n 
M  13 439 PRO 439 439 439 PRO PRO L . n 
M  13 440 PRO 440 440 440 PRO PRO L . n 
M  13 441 VAL 441 441 441 VAL VAL L . n 
M  13 442 MET 442 442 442 MET MET L . n 
M  13 443 LEU 443 443 443 LEU LEU L . n 
M  13 444 TRP 444 444 444 TRP TRP L . n 
M  13 445 PRO 445 445 445 PRO PRO L . n 
M  13 446 ASN 446 446 446 ASN ASN L . n 
M  13 447 HIS 447 447 447 HIS HIS L . n 
M  13 448 LEU 448 448 448 LEU LEU L . n 
M  13 449 LEU 449 449 449 LEU LEU L . n 
M  13 450 ALA 450 450 450 ALA ALA L . n 
M  13 451 LEU 451 451 451 LEU LEU L . n 
M  13 452 GLY 452 452 452 GLY GLY L . n 
M  13 453 SER 453 453 453 SER SER L . n 
M  13 454 VAL 454 454 454 VAL VAL L . n 
M  13 455 LEU 455 455 455 LEU LEU L . n 
M  13 456 ALA 456 456 456 ALA ALA L . n 
M  13 457 GLY 457 457 457 GLY GLY L . n 
M  13 458 TYR 458 458 458 TYR TYR L . n 
M  13 459 LEU 459 459 459 LEU LEU L . n 
M  13 460 ALA 460 460 460 ALA ALA L . n 
M  13 461 LEU 461 461 461 LEU LEU L . n 
M  13 462 PRO 462 462 462 PRO PRO L . n 
M  13 463 HIS 463 463 463 HIS HIS L . n 
M  13 464 PRO 464 464 464 PRO PRO L . n 
M  13 465 LEU 465 465 465 LEU LEU L . n 
M  13 466 PRO 466 466 466 PRO PRO L . n 
M  13 467 ASN 467 467 467 ASN ASN L . n 
M  13 468 VAL 468 468 468 VAL VAL L . n 
M  13 469 LEU 469 469 469 LEU LEU L . n 
M  13 470 GLU 470 470 470 GLU GLU L . n 
M  13 471 PRO 471 471 471 PRO PRO L . n 
M  13 472 PHE 472 472 472 PHE PHE L . n 
M  13 473 LEU 473 473 473 LEU LEU L . n 
M  13 474 LYS 474 474 474 LYS LYS L . n 
M  13 475 PRO 475 475 475 PRO PRO L . n 
M  13 476 ALA 476 476 476 ALA ALA L . n 
M  13 477 LEU 477 477 477 LEU LEU L . n 
M  13 478 ALA 478 478 478 ALA ALA L . n 
M  13 479 GLU 479 479 479 GLU GLU L . n 
M  13 480 VAL 480 480 480 VAL VAL L . n 
M  13 481 GLU 481 481 481 GLU GLU L . n 
M  13 482 ALA 482 482 482 ALA ALA L . n 
M  13 483 HIS 483 483 483 HIS HIS L . n 
M  13 484 HIS 484 484 484 HIS HIS L . n 
M  13 485 LEU 485 485 485 LEU LEU L . n 
M  13 486 SER 486 486 486 SER SER L . n 
M  13 487 LEU 487 487 487 LEU LEU L . n 
M  13 488 GLY 488 488 488 GLY GLY L . n 
M  13 489 ALA 489 489 489 ALA ALA L . n 
M  13 490 GLU 490 490 490 GLU GLU L . n 
M  13 491 TRP 491 491 491 TRP TRP L . n 
M  13 492 GLY 492 492 492 GLY GLY L . n 
M  13 493 LEU 493 493 493 LEU LEU L . n 
M  13 494 ILE 494 494 494 ILE ILE L . n 
M  13 495 ALA 495 495 495 ALA ALA L . n 
M  13 496 LEU 496 496 496 LEU LEU L . n 
M  13 497 SER 497 497 497 SER SER L . n 
M  13 498 ALA 498 498 498 ALA ALA L . n 
M  13 499 ALA 499 499 499 ALA ALA L . n 
M  13 500 VAL 500 500 500 VAL VAL L . n 
M  13 501 ALA 501 501 501 ALA ALA L . n 
M  13 502 LEU 502 502 502 LEU LEU L . n 
M  13 503 LEU 503 503 503 LEU LEU L . n 
M  13 504 GLY 504 504 504 GLY GLY L . n 
M  13 505 LEU 505 505 505 LEU LEU L . n 
M  13 506 TRP 506 506 506 TRP TRP L . n 
M  13 507 ALA 507 507 507 ALA ALA L . n 
M  13 508 GLY 508 508 508 GLY GLY L . n 
M  13 509 PHE 509 509 509 PHE PHE L . n 
M  13 510 VAL 510 510 510 VAL VAL L . n 
M  13 511 PHE 511 511 511 PHE PHE L . n 
M  13 512 PHE 512 512 512 PHE PHE L . n 
M  13 513 GLN 513 513 513 GLN GLN L . n 
M  13 514 ARG 514 514 514 ARG ARG L . n 
M  13 515 LYS 515 515 515 LYS LYS L . n 
M  13 516 VAL 516 516 516 VAL VAL L . n 
M  13 517 PHE 517 517 517 PHE PHE L . n 
M  13 518 PRO 518 518 518 PRO PRO L . n 
M  13 519 ALA 519 519 519 ALA ALA L . n 
M  13 520 TRP 520 520 520 TRP TRP L . n 
M  13 521 TYR 521 521 521 TYR TYR L . n 
M  13 522 LEU 522 522 522 LEU LEU L . n 
M  13 523 ALA 523 523 523 ALA ALA L . n 
M  13 524 PHE 524 524 524 PHE PHE L . n 
M  13 525 GLU 525 525 525 GLU GLU L . n 
M  13 526 ALA 526 526 526 ALA ALA L . n 
M  13 527 ALA 527 527 527 ALA ALA L . n 
M  13 528 SER 528 528 528 SER SER L . n 
M  13 529 ARG 529 529 529 ARG ARG L . n 
M  13 530 GLU 530 530 530 GLU GLU L . n 
M  13 531 ALA 531 531 531 ALA ALA L . n 
M  13 532 PHE 532 532 532 PHE PHE L . n 
M  13 533 TYR 533 533 533 TYR TYR L . n 
M  13 534 VAL 534 534 534 VAL VAL L . n 
M  13 535 ASP 535 535 535 ASP ASP L . n 
M  13 536 ARG 536 536 536 ARG ARG L . n 
M  13 537 ALA 537 537 537 ALA ALA L . n 
M  13 538 TYR 538 538 538 TYR TYR L . n 
M  13 539 ASN 539 539 539 ASN ASN L . n 
M  13 540 ALA 540 540 540 ALA ALA L . n 
M  13 541 LEU 541 541 541 LEU LEU L . n 
M  13 542 ILE 542 542 542 ILE ILE L . n 
M  13 543 VAL 543 543 543 VAL VAL L . n 
M  13 544 ASN 544 544 544 ASN ASN L . n 
M  13 545 PRO 545 545 545 PRO PRO L . n 
M  13 546 LEU 546 546 546 LEU LEU L . n 
M  13 547 LYS 547 547 547 LYS LYS L . n 
M  13 548 ALA 548 548 548 ALA ALA L . n 
M  13 549 LEU 549 549 549 LEU LEU L . n 
M  13 550 ALA 550 550 550 ALA ALA L . n 
M  13 551 GLU 551 551 551 GLU GLU L . n 
M  13 552 ALA 552 552 552 ALA ALA L . n 
M  13 553 LEU 553 553 553 LEU LEU L . n 
M  13 554 PHE 554 554 554 PHE PHE L . n 
M  13 555 TYR 555 555 555 TYR TYR L . n 
M  13 556 GLY 556 556 556 GLY GLY L . n 
M  13 557 ASP 557 557 557 ASP ASP L . n 
M  13 558 ARG 558 558 558 ARG ARG L . n 
M  13 559 GLY 559 559 559 GLY GLY L . n 
M  13 560 LEU 560 560 560 LEU LEU L . n 
M  13 561 LEU 561 561 561 LEU LEU L . n 
M  13 562 SER 562 562 562 SER SER L . n 
M  13 563 GLY 563 563 563 GLY GLY L . n 
M  13 564 TYR 564 564 564 TYR TYR L . n 
M  13 565 PHE 565 565 565 PHE PHE L . n 
M  13 566 GLY 566 566 566 GLY GLY L . n 
M  13 567 LEU 567 567 567 LEU LEU L . n 
M  13 568 GLY 568 568 568 GLY GLY L . n 
M  13 569 GLY 569 569 569 GLY GLY L . n 
M  13 570 ALA 570 570 570 ALA ALA L . n 
M  13 571 ALA 571 571 571 ALA ALA L . n 
M  13 572 ARG 572 572 572 ARG ARG L . n 
M  13 573 SER 573 573 573 SER SER L . n 
M  13 574 LEU 574 574 574 LEU LEU L . n 
M  13 575 GLY 575 575 575 GLY GLY L . n 
M  13 576 GLN 576 576 576 GLN GLN L . n 
M  13 577 GLY 577 577 577 GLY GLY L . n 
M  13 578 LEU 578 578 578 LEU LEU L . n 
M  13 579 ALA 579 579 579 ALA ALA L . n 
M  13 580 ARG 580 580 580 ARG ARG L . n 
M  13 581 LEU 581 581 581 LEU LEU L . n 
M  13 582 GLN 582 582 582 GLN GLN L . n 
M  13 583 THR 583 583 583 THR THR L . n 
M  13 584 GLY 584 584 584 GLY GLY L . n 
M  13 585 TYR 585 585 585 TYR TYR L . n 
M  13 586 LEU 586 586 586 LEU LEU L . n 
M  13 587 ARG 587 587 587 ARG ARG L . n 
M  13 588 VAL 588 588 588 VAL VAL L . n 
M  13 589 TYR 589 589 589 TYR TYR L . n 
M  13 590 ALA 590 590 590 ALA ALA L . n 
M  13 591 LEU 591 591 591 LEU LEU L . n 
M  13 592 LEU 592 592 592 LEU LEU L . n 
M  13 593 PHE 593 593 593 PHE PHE L . n 
M  13 594 VAL 594 594 594 VAL VAL L . n 
M  13 595 LEU 595 595 595 LEU LEU L . n 
M  13 596 GLY 596 596 596 GLY GLY L . n 
M  13 597 ALA 597 597 597 ALA ALA L . n 
M  13 598 LEU 598 598 598 LEU LEU L . n 
M  13 599 LEU 599 599 599 LEU LEU L . n 
M  13 600 LEU 600 600 600 LEU LEU L . n 
M  13 601 LEU 601 601 601 LEU LEU L . n 
M  13 602 GLY 602 602 602 GLY GLY L . n 
M  13 603 VAL 603 603 603 VAL VAL L . n 
M  13 604 MET 604 604 604 MET MET L . n 
M  13 605 ARG 605 605 605 ARG ARG L . n 
M  13 606 TRP 606 606 ?   ?   ?   L . n 
N  14 1   MET 1   1   1   MET MET M . n 
N  14 2   VAL 2   2   2   VAL VAL M . n 
N  14 3   VAL 3   3   3   VAL VAL M . n 
N  14 4   LEU 4   4   4   LEU LEU M . n 
N  14 5   ALA 5   5   5   ALA ALA M . n 
N  14 6   VAL 6   6   6   VAL VAL M . n 
N  14 7   LEU 7   7   7   LEU LEU M . n 
N  14 8   LEU 8   8   8   LEU LEU M . n 
N  14 9   PRO 9   9   9   PRO PRO M . n 
N  14 10  VAL 10  10  10  VAL VAL M . n 
N  14 11  VAL 11  11  11  VAL VAL M . n 
N  14 12  PHE 12  12  12  PHE PHE M . n 
N  14 13  GLY 13  13  13  GLY GLY M . n 
N  14 14  ALA 14  14  14  ALA ALA M . n 
N  14 15  LEU 15  15  15  LEU LEU M . n 
N  14 16  LEU 16  16  16  LEU LEU M . n 
N  14 17  LEU 17  17  17  LEU LEU M . n 
N  14 18  LEU 18  18  18  LEU LEU M . n 
N  14 19  GLY 19  19  19  GLY GLY M . n 
N  14 20  LEU 20  20  20  LEU LEU M . n 
N  14 21  PRO 21  21  21  PRO PRO M . n 
N  14 22  ARG 22  22  22  ARG ARG M . n 
N  14 23  ALA 23  23  23  ALA ALA M . n 
N  14 24  LEU 24  24  24  LEU LEU M . n 
N  14 25  GLY 25  25  25  GLY GLY M . n 
N  14 26  VAL 26  26  26  VAL VAL M . n 
N  14 27  LEU 27  27  27  LEU LEU M . n 
N  14 28  GLY 28  28  28  GLY GLY M . n 
N  14 29  ALA 29  29  29  ALA ALA M . n 
N  14 30  GLY 30  30  30  GLY GLY M . n 
N  14 31  LEU 31  31  31  LEU LEU M . n 
N  14 32  SER 32  32  32  SER SER M . n 
N  14 33  PHE 33  33  33  PHE PHE M . n 
N  14 34  LEU 34  34  34  LEU LEU M . n 
N  14 35  LEU 35  35  35  LEU LEU M . n 
N  14 36  ASN 36  36  36  ASN ASN M . n 
N  14 37  LEU 37  37  37  LEU LEU M . n 
N  14 38  TYR 38  38  38  TYR TYR M . n 
N  14 39  LEU 39  39  39  LEU LEU M . n 
N  14 40  PHE 40  40  40  PHE PHE M . n 
N  14 41  LEU 41  41  41  LEU LEU M . n 
N  14 42  THR 42  42  42  THR THR M . n 
N  14 43  HIS 43  43  43  HIS HIS M . n 
N  14 44  PRO 44  44  44  PRO PRO M . n 
N  14 45  GLY 45  45  45  GLY GLY M . n 
N  14 46  GLY 46  46  46  GLY GLY M . n 
N  14 47  VAL 47  47  47  VAL VAL M . n 
N  14 48  ALA 48  48  48  ALA ALA M . n 
N  14 49  HIS 49  49  49  HIS HIS M . n 
N  14 50  ALA 50  50  50  ALA ALA M . n 
N  14 51  PHE 51  51  51  PHE PHE M . n 
N  14 52  GLN 52  52  52  GLN GLN M . n 
N  14 53  ALA 53  53  53  ALA ALA M . n 
N  14 54  PRO 54  54  54  PRO PRO M . n 
N  14 55  LEU 55  55  55  LEU LEU M . n 
N  14 56  LEU 56  56  56  LEU LEU M . n 
N  14 57  PRO 57  57  57  PRO PRO M . n 
N  14 58  GLY 58  58  58  GLY GLY M . n 
N  14 59  ALA 59  59  59  ALA ALA M . n 
N  14 60  GLY 60  60  60  GLY GLY M . n 
N  14 61  VAL 61  61  61  VAL VAL M . n 
N  14 62  TYR 62  62  62  TYR TYR M . n 
N  14 63  TRP 63  63  63  TRP TRP M . n 
N  14 64  ALA 64  64  64  ALA ALA M . n 
N  14 65  PHE 65  65  65  PHE PHE M . n 
N  14 66  GLY 66  66  66  GLY GLY M . n 
N  14 67  LEU 67  67  67  LEU LEU M . n 
N  14 68  ASP 68  68  68  ASP ASP M . n 
N  14 69  GLY 69  69  69  GLY GLY M . n 
N  14 70  LEU 70  70  70  LEU LEU M . n 
N  14 71  SER 71  71  71  SER SER M . n 
N  14 72  ALA 72  72  72  ALA ALA M . n 
N  14 73  LEU 73  73  73  LEU LEU M . n 
N  14 74  PHE 74  74  74  PHE PHE M . n 
N  14 75  PHE 75  75  75  PHE PHE M . n 
N  14 76  LEU 76  76  76  LEU LEU M . n 
N  14 77  THR 77  77  77  THR THR M . n 
N  14 78  ILE 78  78  78  ILE ILE M . n 
N  14 79  ALA 79  79  79  ALA ALA M . n 
N  14 80  LEU 80  80  80  LEU LEU M . n 
N  14 81  THR 81  81  81  THR THR M . n 
N  14 82  VAL 82  82  82  VAL VAL M . n 
N  14 83  PHE 83  83  83  PHE PHE M . n 
N  14 84  LEU 84  84  84  LEU LEU M . n 
N  14 85  GLY 85  85  85  GLY GLY M . n 
N  14 86  ALA 86  86  86  ALA ALA M . n 
N  14 87  LEU 87  87  87  LEU LEU M . n 
N  14 88  VAL 88  88  88  VAL VAL M . n 
N  14 89  ALA 89  89  89  ALA ALA M . n 
N  14 90  ARG 90  90  90  ARG ARG M . n 
N  14 91  VAL 91  91  91  VAL VAL M . n 
N  14 92  GLU 92  92  92  GLU GLU M . n 
N  14 93  GLY 93  93  93  GLY GLY M . n 
N  14 94  ARG 94  94  94  ARG ARG M . n 
N  14 95  PHE 95  95  95  PHE PHE M . n 
N  14 96  LEU 96  96  96  LEU LEU M . n 
N  14 97  GLY 97  97  97  GLY GLY M . n 
N  14 98  LEU 98  98  98  LEU LEU M . n 
N  14 99  ALA 99  99  99  ALA ALA M . n 
N  14 100 LEU 100 100 100 LEU LEU M . n 
N  14 101 LEU 101 101 101 LEU LEU M . n 
N  14 102 MET 102 102 102 MET MET M . n 
N  14 103 GLU 103 103 103 GLU GLU M . n 
N  14 104 GLY 104 104 104 GLY GLY M . n 
N  14 105 LEU 105 105 105 LEU LEU M . n 
N  14 106 LEU 106 106 106 LEU LEU M . n 
N  14 107 LEU 107 107 107 LEU LEU M . n 
N  14 108 GLY 108 108 108 GLY GLY M . n 
N  14 109 LEU 109 109 109 LEU LEU M . n 
N  14 110 PHE 110 110 110 PHE PHE M . n 
N  14 111 ALA 111 111 111 ALA ALA M . n 
N  14 112 ALA 112 112 112 ALA ALA M . n 
N  14 113 ARG 113 113 113 ARG ARG M . n 
N  14 114 ASP 114 114 114 ASP ASP M . n 
N  14 115 LEU 115 115 115 LEU LEU M . n 
N  14 116 LEU 116 116 116 LEU LEU M . n 
N  14 117 VAL 117 117 117 VAL VAL M . n 
N  14 118 PHE 118 118 118 PHE PHE M . n 
N  14 119 TYR 119 119 119 TYR TYR M . n 
N  14 120 VAL 120 120 120 VAL VAL M . n 
N  14 121 PHE 121 121 121 PHE PHE M . n 
N  14 122 PHE 122 122 122 PHE PHE M . n 
N  14 123 GLU 123 123 123 GLU GLU M . n 
N  14 124 ALA 124 124 124 ALA ALA M . n 
N  14 125 ALA 125 125 125 ALA ALA M . n 
N  14 126 LEU 126 126 126 LEU LEU M . n 
N  14 127 ILE 127 127 127 ILE ILE M . n 
N  14 128 PRO 128 128 128 PRO PRO M . n 
N  14 129 ALA 129 129 129 ALA ALA M . n 
N  14 130 LEU 130 130 130 LEU LEU M . n 
N  14 131 LEU 131 131 131 LEU LEU M . n 
N  14 132 MET 132 132 132 MET MET M . n 
N  14 133 LEU 133 133 133 LEU LEU M . n 
N  14 134 TYR 134 134 134 TYR TYR M . n 
N  14 135 LEU 135 135 135 LEU LEU M . n 
N  14 136 TYR 136 136 136 TYR TYR M . n 
N  14 137 GLY 137 137 137 GLY GLY M . n 
N  14 138 GLY 138 138 138 GLY GLY M . n 
N  14 139 GLU 139 139 139 GLU GLU M . n 
N  14 140 GLY 140 140 140 GLY GLY M . n 
N  14 141 ARG 141 141 141 ARG ARG M . n 
N  14 142 THR 142 142 142 THR THR M . n 
N  14 143 ARG 143 143 143 ARG ARG M . n 
N  14 144 ALA 144 144 144 ALA ALA M . n 
N  14 145 LEU 145 145 145 LEU LEU M . n 
N  14 146 TYR 146 146 146 TYR TYR M . n 
N  14 147 THR 147 147 147 THR THR M . n 
N  14 148 PHE 148 148 148 PHE PHE M . n 
N  14 149 VAL 149 149 149 VAL VAL M . n 
N  14 150 LEU 150 150 150 LEU LEU M . n 
N  14 151 PHE 151 151 151 PHE PHE M . n 
N  14 152 THR 152 152 152 THR THR M . n 
N  14 153 LEU 153 153 153 LEU LEU M . n 
N  14 154 VAL 154 154 154 VAL VAL M . n 
N  14 155 GLY 155 155 155 GLY GLY M . n 
N  14 156 SER 156 156 156 SER SER M . n 
N  14 157 LEU 157 157 157 LEU LEU M . n 
N  14 158 PRO 158 158 158 PRO PRO M . n 
N  14 159 MET 159 159 159 MET MET M . n 
N  14 160 LEU 160 160 160 LEU LEU M . n 
N  14 161 ALA 161 161 161 ALA ALA M . n 
N  14 162 ALA 162 162 162 ALA ALA M . n 
N  14 163 VAL 163 163 163 VAL VAL M . n 
N  14 164 LEU 164 164 164 LEU LEU M . n 
N  14 165 GLY 165 165 165 GLY GLY M . n 
N  14 166 ALA 166 166 166 ALA ALA M . n 
N  14 167 ARG 167 167 167 ARG ARG M . n 
N  14 168 LEU 168 168 168 LEU LEU M . n 
N  14 169 LEU 169 169 169 LEU LEU M . n 
N  14 170 SER 170 170 170 SER SER M . n 
N  14 171 GLY 171 171 171 GLY GLY M . n 
N  14 172 SER 172 172 172 SER SER M . n 
N  14 173 PRO 173 173 173 PRO PRO M . n 
N  14 174 THR 174 174 174 THR THR M . n 
N  14 175 PHE 175 175 175 PHE PHE M . n 
N  14 176 LEU 176 176 176 LEU LEU M . n 
N  14 177 LEU 177 177 177 LEU LEU M . n 
N  14 178 GLU 178 178 178 GLU GLU M . n 
N  14 179 ASP 179 179 179 ASP ASP M . n 
N  14 180 LEU 180 180 180 LEU LEU M . n 
N  14 181 LEU 181 181 181 LEU LEU M . n 
N  14 182 ALA 182 182 182 ALA ALA M . n 
N  14 183 HIS 183 183 183 HIS HIS M . n 
N  14 184 PRO 184 184 184 PRO PRO M . n 
N  14 185 LEU 185 185 185 LEU LEU M . n 
N  14 186 GLN 186 186 186 GLN GLN M . n 
N  14 187 GLU 187 187 187 GLU GLU M . n 
N  14 188 GLU 188 188 188 GLU GLU M . n 
N  14 189 ALA 189 189 189 ALA ALA M . n 
N  14 190 ALA 190 190 190 ALA ALA M . n 
N  14 191 PHE 191 191 191 PHE PHE M . n 
N  14 192 TRP 192 192 192 TRP TRP M . n 
N  14 193 VAL 193 193 193 VAL VAL M . n 
N  14 194 PHE 194 194 194 PHE PHE M . n 
N  14 195 LEU 195 195 195 LEU LEU M . n 
N  14 196 GLY 196 196 196 GLY GLY M . n 
N  14 197 PHE 197 197 197 PHE PHE M . n 
N  14 198 ALA 198 198 198 ALA ALA M . n 
N  14 199 LEU 199 199 199 LEU LEU M . n 
N  14 200 ALA 200 200 200 ALA ALA M . n 
N  14 201 PHE 201 201 201 PHE PHE M . n 
N  14 202 ALA 202 202 202 ALA ALA M . n 
N  14 203 ILE 203 203 203 ILE ILE M . n 
N  14 204 LYS 204 204 204 LYS LYS M . n 
N  14 205 THR 205 205 205 THR THR M . n 
N  14 206 PRO 206 206 206 PRO PRO M . n 
N  14 207 LEU 207 207 207 LEU LEU M . n 
N  14 208 PHE 208 208 208 PHE PHE M . n 
N  14 209 PRO 209 209 209 PRO PRO M . n 
N  14 210 LEU 210 210 210 LEU LEU M . n 
N  14 211 HIS 211 211 211 HIS HIS M . n 
N  14 212 ALA 212 212 212 ALA ALA M . n 
N  14 213 TRP 213 213 213 TRP TRP M . n 
N  14 214 LEU 214 214 214 LEU LEU M . n 
N  14 215 PRO 215 215 215 PRO PRO M . n 
N  14 216 PRO 216 216 216 PRO PRO M . n 
N  14 217 PHE 217 217 217 PHE PHE M . n 
N  14 218 HIS 218 218 218 HIS HIS M . n 
N  14 219 GLN 219 219 219 GLN GLN M . n 
N  14 220 GLU 220 220 220 GLU GLU M . n 
N  14 221 ASN 221 221 221 ASN ASN M . n 
N  14 222 HIS 222 222 222 HIS HIS M . n 
N  14 223 PRO 223 223 223 PRO PRO M . n 
N  14 224 SER 224 224 224 SER SER M . n 
N  14 225 GLY 225 225 225 GLY GLY M . n 
N  14 226 LEU 226 226 226 LEU LEU M . n 
N  14 227 ALA 227 227 227 ALA ALA M . n 
N  14 228 ASP 228 228 228 ASP ASP M . n 
N  14 229 ALA 229 229 229 ALA ALA M . n 
N  14 230 LEU 230 230 230 LEU LEU M . n 
N  14 231 GLY 231 231 231 GLY GLY M . n 
N  14 232 THR 232 232 232 THR THR M . n 
N  14 233 LEU 233 233 233 LEU LEU M . n 
N  14 234 TYR 234 234 234 TYR TYR M . n 
N  14 235 LYS 235 235 235 LYS LYS M . n 
N  14 236 VAL 236 236 236 VAL VAL M . n 
N  14 237 GLY 237 237 237 GLY GLY M . n 
N  14 238 VAL 238 238 238 VAL VAL M . n 
N  14 239 PHE 239 239 239 PHE PHE M . n 
N  14 240 ALA 240 240 240 ALA ALA M . n 
N  14 241 PHE 241 241 241 PHE PHE M . n 
N  14 242 PHE 242 242 242 PHE PHE M . n 
N  14 243 ARG 243 243 243 ARG ARG M . n 
N  14 244 PHE 244 244 244 PHE PHE M . n 
N  14 245 ALA 245 245 245 ALA ALA M . n 
N  14 246 ILE 246 246 246 ILE ILE M . n 
N  14 247 PRO 247 247 247 PRO PRO M . n 
N  14 248 LEU 248 248 248 LEU LEU M . n 
N  14 249 ALA 249 249 249 ALA ALA M . n 
N  14 250 PRO 250 250 250 PRO PRO M . n 
N  14 251 GLU 251 251 251 GLU GLU M . n 
N  14 252 GLY 252 252 252 GLY GLY M . n 
N  14 253 PHE 253 253 253 PHE PHE M . n 
N  14 254 ALA 254 254 254 ALA ALA M . n 
N  14 255 GLN 255 255 255 GLN GLN M . n 
N  14 256 ALA 256 256 256 ALA ALA M . n 
N  14 257 GLN 257 257 257 GLN GLN M . n 
N  14 258 GLY 258 258 258 GLY GLY M . n 
N  14 259 LEU 259 259 259 LEU LEU M . n 
N  14 260 LEU 260 260 260 LEU LEU M . n 
N  14 261 LEU 261 261 261 LEU LEU M . n 
N  14 262 PHE 262 262 262 PHE PHE M . n 
N  14 263 LEU 263 263 263 LEU LEU M . n 
N  14 264 ALA 264 264 264 ALA ALA M . n 
N  14 265 ALA 265 265 265 ALA ALA M . n 
N  14 266 LEU 266 266 266 LEU LEU M . n 
N  14 267 SER 267 267 267 SER SER M . n 
N  14 268 ALA 268 268 268 ALA ALA M . n 
N  14 269 LEU 269 269 269 LEU LEU M . n 
N  14 270 TYR 270 270 270 TYR TYR M . n 
N  14 271 GLY 271 271 271 GLY GLY M . n 
N  14 272 ALA 272 272 272 ALA ALA M . n 
N  14 273 TRP 273 273 273 TRP TRP M . n 
N  14 274 VAL 274 274 274 VAL VAL M . n 
N  14 275 ALA 275 275 275 ALA ALA M . n 
N  14 276 PHE 276 276 276 PHE PHE M . n 
N  14 277 ALA 277 277 277 ALA ALA M . n 
N  14 278 ALA 278 278 278 ALA ALA M . n 
N  14 279 LYS 279 279 279 LYS LYS M . n 
N  14 280 ASP 280 280 280 ASP ASP M . n 
N  14 281 PHE 281 281 281 PHE PHE M . n 
N  14 282 LYS 282 282 282 LYS LYS M . n 
N  14 283 THR 283 283 283 THR THR M . n 
N  14 284 LEU 284 284 284 LEU LEU M . n 
N  14 285 LEU 285 285 285 LEU LEU M . n 
N  14 286 ALA 286 286 286 ALA ALA M . n 
N  14 287 TYR 287 287 287 TYR TYR M . n 
N  14 288 ALA 288 288 288 ALA ALA M . n 
N  14 289 GLY 289 289 289 GLY GLY M . n 
N  14 290 LEU 290 290 290 LEU LEU M . n 
N  14 291 SER 291 291 291 SER SER M . n 
N  14 292 HIS 292 292 292 HIS HIS M . n 
N  14 293 MET 293 293 293 MET MET M . n 
N  14 294 GLY 294 294 294 GLY GLY M . n 
N  14 295 VAL 295 295 295 VAL VAL M . n 
N  14 296 ALA 296 296 296 ALA ALA M . n 
N  14 297 ALA 297 297 297 ALA ALA M . n 
N  14 298 LEU 298 298 298 LEU LEU M . n 
N  14 299 GLY 299 299 299 GLY GLY M . n 
N  14 300 VAL 300 300 300 VAL VAL M . n 
N  14 301 PHE 301 301 301 PHE PHE M . n 
N  14 302 SER 302 302 302 SER SER M . n 
N  14 303 GLY 303 303 303 GLY GLY M . n 
N  14 304 THR 304 304 304 THR THR M . n 
N  14 305 PRO 305 305 305 PRO PRO M . n 
N  14 306 GLU 306 306 306 GLU GLU M . n 
N  14 307 GLY 307 307 307 GLY GLY M . n 
N  14 308 ALA 308 308 308 ALA ALA M . n 
N  14 309 MET 309 309 309 MET MET M . n 
N  14 310 GLY 310 310 310 GLY GLY M . n 
N  14 311 GLY 311 311 311 GLY GLY M . n 
N  14 312 LEU 312 312 312 LEU LEU M . n 
N  14 313 TYR 313 313 313 TYR TYR M . n 
N  14 314 LEU 314 314 314 LEU LEU M . n 
N  14 315 LEU 315 315 315 LEU LEU M . n 
N  14 316 ALA 316 316 316 ALA ALA M . n 
N  14 317 ALA 317 317 317 ALA ALA M . n 
N  14 318 SER 318 318 318 SER SER M . n 
N  14 319 GLY 319 319 319 GLY GLY M . n 
N  14 320 VAL 320 320 320 VAL VAL M . n 
N  14 321 TYR 321 321 321 TYR TYR M . n 
N  14 322 THR 322 322 322 THR THR M . n 
N  14 323 GLY 323 323 323 GLY GLY M . n 
N  14 324 GLY 324 324 324 GLY GLY M . n 
N  14 325 LEU 325 325 325 LEU LEU M . n 
N  14 326 PHE 326 326 326 PHE PHE M . n 
N  14 327 LEU 327 327 327 LEU LEU M . n 
N  14 328 LEU 328 328 328 LEU LEU M . n 
N  14 329 ALA 329 329 329 ALA ALA M . n 
N  14 330 GLY 330 330 330 GLY GLY M . n 
N  14 331 ARG 331 331 331 ARG ARG M . n 
N  14 332 LEU 332 332 332 LEU LEU M . n 
N  14 333 TYR 333 333 333 TYR TYR M . n 
N  14 334 GLU 334 334 334 GLU GLU M . n 
N  14 335 ARG 335 335 335 ARG ARG M . n 
N  14 336 THR 336 336 336 THR THR M . n 
N  14 337 GLY 337 337 337 GLY GLY M . n 
N  14 338 THR 338 338 338 THR THR M . n 
N  14 339 LEU 339 339 339 LEU LEU M . n 
N  14 340 GLU 340 340 340 GLU GLU M . n 
N  14 341 ILE 341 341 341 ILE ILE M . n 
N  14 342 GLY 342 342 342 GLY GLY M . n 
N  14 343 ARG 343 343 343 ARG ARG M . n 
N  14 344 TYR 344 344 344 TYR TYR M . n 
N  14 345 ARG 345 345 345 ARG ARG M . n 
N  14 346 GLY 346 346 346 GLY GLY M . n 
N  14 347 LEU 347 347 347 LEU LEU M . n 
N  14 348 ALA 348 348 348 ALA ALA M . n 
N  14 349 GLN 349 349 349 GLN GLN M . n 
N  14 350 SER 350 350 350 SER SER M . n 
N  14 351 ALA 351 351 351 ALA ALA M . n 
N  14 352 PRO 352 352 352 PRO PRO M . n 
N  14 353 GLY 353 353 353 GLY GLY M . n 
N  14 354 LEU 354 354 354 LEU LEU M . n 
N  14 355 ALA 355 355 355 ALA ALA M . n 
N  14 356 ALA 356 356 356 ALA ALA M . n 
N  14 357 LEU 357 357 357 LEU LEU M . n 
N  14 358 ALA 358 358 358 ALA ALA M . n 
N  14 359 LEU 359 359 359 LEU LEU M . n 
N  14 360 ILE 360 360 360 ILE ILE M . n 
N  14 361 LEU 361 361 361 LEU LEU M . n 
N  14 362 PHE 362 362 362 PHE PHE M . n 
N  14 363 LEU 363 363 363 LEU LEU M . n 
N  14 364 ALA 364 364 364 ALA ALA M . n 
N  14 365 MET 365 365 365 MET MET M . n 
N  14 366 VAL 366 366 366 VAL VAL M . n 
N  14 367 GLY 367 367 367 GLY GLY M . n 
N  14 368 LEU 368 368 368 LEU LEU M . n 
N  14 369 PRO 369 369 369 PRO PRO M . n 
N  14 370 GLY 370 370 370 GLY GLY M . n 
N  14 371 LEU 371 371 371 LEU LEU M . n 
N  14 372 SER 372 372 372 SER SER M . n 
N  14 373 GLY 373 373 373 GLY GLY M . n 
N  14 374 PHE 374 374 374 PHE PHE M . n 
N  14 375 PRO 375 375 375 PRO PRO M . n 
N  14 376 GLY 376 376 376 GLY GLY M . n 
N  14 377 GLU 377 377 377 GLU GLU M . n 
N  14 378 PHE 378 378 378 PHE PHE M . n 
N  14 379 LEU 379 379 379 LEU LEU M . n 
N  14 380 THR 380 380 380 THR THR M . n 
N  14 381 LEU 381 381 381 LEU LEU M . n 
N  14 382 LEU 382 382 382 LEU LEU M . n 
N  14 383 GLY 383 383 383 GLY GLY M . n 
N  14 384 ALA 384 384 384 ALA ALA M . n 
N  14 385 TYR 385 385 385 TYR TYR M . n 
N  14 386 LYS 386 386 386 LYS LYS M . n 
N  14 387 ALA 387 387 387 ALA ALA M . n 
N  14 388 SER 388 388 388 SER SER M . n 
N  14 389 PRO 389 389 389 PRO PRO M . n 
N  14 390 TRP 390 390 390 TRP TRP M . n 
N  14 391 LEU 391 391 391 LEU LEU M . n 
N  14 392 ALA 392 392 392 ALA ALA M . n 
N  14 393 ALA 393 393 393 ALA ALA M . n 
N  14 394 LEU 394 394 394 LEU LEU M . n 
N  14 395 ALA 395 395 395 ALA ALA M . n 
N  14 396 PHE 396 396 396 PHE PHE M . n 
N  14 397 LEU 397 397 397 LEU LEU M . n 
N  14 398 SER 398 398 398 SER SER M . n 
N  14 399 VAL 399 399 399 VAL VAL M . n 
N  14 400 ILE 400 400 400 ILE ILE M . n 
N  14 401 ALA 401 401 401 ALA ALA M . n 
N  14 402 SER 402 402 402 SER SER M . n 
N  14 403 ALA 403 403 403 ALA ALA M . n 
N  14 404 ALA 404 404 404 ALA ALA M . n 
N  14 405 TYR 405 405 405 TYR TYR M . n 
N  14 406 ALA 406 406 406 ALA ALA M . n 
N  14 407 LEU 407 407 407 LEU LEU M . n 
N  14 408 THR 408 408 408 THR THR M . n 
N  14 409 ALA 409 409 409 ALA ALA M . n 
N  14 410 PHE 410 410 410 PHE PHE M . n 
N  14 411 GLN 411 411 411 GLN GLN M . n 
N  14 412 LYS 412 412 412 LYS LYS M . n 
N  14 413 THR 413 413 413 THR THR M . n 
N  14 414 PHE 414 414 414 PHE PHE M . n 
N  14 415 TRP 415 415 415 TRP TRP M . n 
N  14 416 GLU 416 416 416 GLU GLU M . n 
N  14 417 GLU 417 417 417 GLU GLU M . n 
N  14 418 GLY 418 418 418 GLY GLY M . n 
N  14 419 GLY 419 419 419 GLY GLY M . n 
N  14 420 SER 420 420 420 SER SER M . n 
N  14 421 GLY 421 421 421 GLY GLY M . n 
N  14 422 VAL 422 422 422 VAL VAL M . n 
N  14 423 LYS 423 423 423 LYS LYS M . n 
N  14 424 ASP 424 424 424 ASP ASP M . n 
N  14 425 LEU 425 425 425 LEU LEU M . n 
N  14 426 ALA 426 426 426 ALA ALA M . n 
N  14 427 GLY 427 427 427 GLY GLY M . n 
N  14 428 ALA 428 428 428 ALA ALA M . n 
N  14 429 GLU 429 429 429 GLU GLU M . n 
N  14 430 TRP 430 430 430 TRP TRP M . n 
N  14 431 GLY 431 431 431 GLY GLY M . n 
N  14 432 PHE 432 432 432 PHE PHE M . n 
N  14 433 ALA 433 433 433 ALA ALA M . n 
N  14 434 LEU 434 434 434 LEU LEU M . n 
N  14 435 LEU 435 435 435 LEU LEU M . n 
N  14 436 SER 436 436 436 SER SER M . n 
N  14 437 VAL 437 437 437 VAL VAL M . n 
N  14 438 LEU 438 438 438 LEU LEU M . n 
N  14 439 ALA 439 439 439 ALA ALA M . n 
N  14 440 LEU 440 440 440 LEU LEU M . n 
N  14 441 LEU 441 441 441 LEU LEU M . n 
N  14 442 LEU 442 442 442 LEU LEU M . n 
N  14 443 MET 443 443 443 MET MET M . n 
N  14 444 GLY 444 444 444 GLY GLY M . n 
N  14 445 VAL 445 445 445 VAL VAL M . n 
N  14 446 PHE 446 446 446 PHE PHE M . n 
N  14 447 PRO 447 447 447 PRO PRO M . n 
N  14 448 GLY 448 448 448 GLY GLY M . n 
N  14 449 TYR 449 449 449 TYR TYR M . n 
N  14 450 PHE 450 450 450 PHE PHE M . n 
N  14 451 ALA 451 451 451 ALA ALA M . n 
N  14 452 ARG 452 452 452 ARG ARG M . n 
N  14 453 GLY 453 453 453 GLY GLY M . n 
N  14 454 LEU 454 454 454 LEU LEU M . n 
N  14 455 HIS 455 455 455 HIS HIS M . n 
N  14 456 PRO 456 456 456 PRO PRO M . n 
N  14 457 LEU 457 457 457 LEU LEU M . n 
N  14 458 ALA 458 458 458 ALA ALA M . n 
N  14 459 GLU 459 459 459 GLU GLU M . n 
N  14 460 ALA 460 460 460 ALA ALA M . n 
N  14 461 PHE 461 461 461 PHE PHE M . n 
N  14 462 ALA 462 462 462 ALA ALA M . n 
N  14 463 LYS 463 463 463 LYS LYS M . n 
N  14 464 LEU 464 464 464 LEU LEU M . n 
N  14 465 LEU 465 465 465 LEU LEU M . n 
N  14 466 GLY 466 466 466 GLY GLY M . n 
N  14 467 GLY 467 467 467 GLY GLY M . n 
N  14 468 GLY 468 468 ?   ?   ?   M . n 
N  14 469 ALA 469 469 ?   ?   ?   M . n 
O  15 1   MET 1   1   1   MET MET N . n 
O  15 2   THR 2   2   2   THR THR N . n 
O  15 3   LEU 3   3   3   LEU LEU N . n 
O  15 4   ALA 4   4   4   ALA ALA N . n 
O  15 5   ILE 5   5   5   ILE ILE N . n 
O  15 6   LEU 6   6   6   LEU LEU N . n 
O  15 7   ALA 7   7   7   ALA ALA N . n 
O  15 8   VAL 8   8   8   VAL VAL N . n 
O  15 9   PHE 9   9   9   PHE PHE N . n 
O  15 10  SER 10  10  10  SER SER N . n 
O  15 11  VAL 11  11  11  VAL VAL N . n 
O  15 12  ALA 12  12  12  ALA ALA N . n 
O  15 13  LEU 13  13  13  LEU LEU N . n 
O  15 14  THR 14  14  14  THR THR N . n 
O  15 15  LEU 15  15  15  LEU LEU N . n 
O  15 16  LEU 16  16  16  LEU LEU N . n 
O  15 17  GLY 17  17  17  GLY GLY N . n 
O  15 18  PHE 18  18  18  PHE PHE N . n 
O  15 19  VAL 19  19  19  VAL VAL N . n 
O  15 20  LEU 20  20  20  LEU LEU N . n 
O  15 21  PRO 21  21  21  PRO PRO N . n 
O  15 22  PRO 22  22  22  PRO PRO N . n 
O  15 23  GLN 23  23  23  GLN GLN N . n 
O  15 24  GLY 24  24  24  GLY GLY N . n 
O  15 25  VAL 25  25  25  VAL VAL N . n 
O  15 26  LYS 26  26  26  LYS LYS N . n 
O  15 27  ARG 27  27  27  ARG ARG N . n 
O  15 28  ALA 28  28  28  ALA ALA N . n 
O  15 29  THR 29  29  29  THR THR N . n 
O  15 30  LEU 30  30  30  LEU LEU N . n 
O  15 31  LEU 31  31  31  LEU LEU N . n 
O  15 32  GLY 32  32  32  GLY GLY N . n 
O  15 33  LEU 33  33  33  LEU LEU N . n 
O  15 34  ALA 34  34  34  ALA ALA N . n 
O  15 35  LEU 35  35  35  LEU LEU N . n 
O  15 36  ALA 36  36  36  ALA ALA N . n 
O  15 37  LEU 37  37  37  LEU LEU N . n 
O  15 38  ALA 38  38  38  ALA ALA N . n 
O  15 39  SER 39  39  39  SER SER N . n 
O  15 40  LEU 40  40  40  LEU LEU N . n 
O  15 41  LEU 41  41  41  LEU LEU N . n 
O  15 42  LEU 42  42  42  LEU LEU N . n 
O  15 43  THR 43  43  43  THR THR N . n 
O  15 44  TRP 44  44  44  TRP TRP N . n 
O  15 45  GLY 45  45  45  GLY GLY N . n 
O  15 46  LYS 46  46  46  LYS LYS N . n 
O  15 47  PRO 47  47  47  PRO PRO N . n 
O  15 48  PHE 48  48  48  PHE PHE N . n 
O  15 49  ALA 49  49  49  ALA ALA N . n 
O  15 50  PHE 50  50  50  PHE PHE N . n 
O  15 51  GLY 51  51  51  GLY GLY N . n 
O  15 52  PRO 52  52  52  PRO PRO N . n 
O  15 53  TYR 53  53  53  TYR TYR N . n 
O  15 54  ALA 54  54  54  ALA ALA N . n 
O  15 55  VAL 55  55  55  VAL VAL N . n 
O  15 56  ASP 56  56  56  ASP ASP N . n 
O  15 57  GLY 57  57  57  GLY GLY N . n 
O  15 58  VAL 58  58  58  VAL VAL N . n 
O  15 59  SER 59  59  59  SER SER N . n 
O  15 60  GLN 60  60  60  GLN GLN N . n 
O  15 61  VAL 61  61  61  VAL VAL N . n 
O  15 62  PHE 62  62  62  PHE PHE N . n 
O  15 63  THR 63  63  63  THR THR N . n 
O  15 64  LEU 64  64  64  LEU LEU N . n 
O  15 65  LEU 65  65  65  LEU LEU N . n 
O  15 66  ALA 66  66  66  ALA ALA N . n 
O  15 67  LEU 67  67  67  LEU LEU N . n 
O  15 68  LEU 68  68  68  LEU LEU N . n 
O  15 69  GLY 69  69  69  GLY GLY N . n 
O  15 70  ALA 70  70  70  ALA ALA N . n 
O  15 71  LEU 71  71  71  LEU LEU N . n 
O  15 72  TRP 72  72  72  TRP TRP N . n 
O  15 73  THR 73  73  73  THR THR N . n 
O  15 74  VAL 74  74  74  VAL VAL N . n 
O  15 75  GLY 75  75  75  GLY GLY N . n 
O  15 76  LEU 76  76  76  LEU LEU N . n 
O  15 77  VAL 77  77  77  VAL VAL N . n 
O  15 78  ARG 78  78  78  ARG ARG N . n 
O  15 79  SER 79  79  79  SER SER N . n 
O  15 80  GLY 80  80  80  GLY GLY N . n 
O  15 81  ARG 81  81  81  ARG ARG N . n 
O  15 82  PHE 82  82  82  PHE PHE N . n 
O  15 83  GLU 83  83  83  GLU GLU N . n 
O  15 84  PHE 84  84  84  PHE PHE N . n 
O  15 85  TYR 85  85  85  TYR TYR N . n 
O  15 86  LEU 86  86  86  LEU LEU N . n 
O  15 87  LEU 87  87  87  LEU LEU N . n 
O  15 88  VAL 88  88  88  VAL VAL N . n 
O  15 89  LEU 89  89  89  LEU LEU N . n 
O  15 90  TYR 90  90  90  TYR TYR N . n 
O  15 91  ALA 91  91  91  ALA ALA N . n 
O  15 92  ALA 92  92  92  ALA ALA N . n 
O  15 93  LEU 93  93  93  LEU LEU N . n 
O  15 94  GLY 94  94  94  GLY GLY N . n 
O  15 95  MET 95  95  95  MET MET N . n 
O  15 96  HIS 96  96  96  HIS HIS N . n 
O  15 97  LEU 97  97  97  LEU LEU N . n 
O  15 98  LEU 98  98  98  LEU LEU N . n 
O  15 99  ALA 99  99  99  ALA ALA N . n 
O  15 100 SER 100 100 100 SER SER N . n 
O  15 101 THR 101 101 101 THR THR N . n 
O  15 102 ARG 102 102 102 ARG ARG N . n 
O  15 103 HIS 103 103 103 HIS HIS N . n 
O  15 104 LEU 104 104 104 LEU LEU N . n 
O  15 105 LEU 105 105 105 LEU LEU N . n 
O  15 106 LEU 106 106 106 LEU LEU N . n 
O  15 107 MET 107 107 107 MET MET N . n 
O  15 108 LEU 108 108 108 LEU LEU N . n 
O  15 109 VAL 109 109 109 VAL VAL N . n 
O  15 110 ALA 110 110 110 ALA ALA N . n 
O  15 111 LEU 111 111 111 LEU LEU N . n 
O  15 112 GLU 112 112 112 GLU GLU N . n 
O  15 113 ALA 113 113 113 ALA ALA N . n 
O  15 114 LEU 114 114 114 LEU LEU N . n 
O  15 115 SER 115 115 115 SER SER N . n 
O  15 116 LEU 116 116 116 LEU LEU N . n 
O  15 117 PRO 117 117 117 PRO PRO N . n 
O  15 118 LEU 118 118 118 LEU LEU N . n 
O  15 119 TYR 119 119 119 TYR TYR N . n 
O  15 120 ALA 120 120 120 ALA ALA N . n 
O  15 121 LEU 121 121 121 LEU LEU N . n 
O  15 122 ALA 122 122 122 ALA ALA N . n 
O  15 123 THR 123 123 123 THR THR N . n 
O  15 124 TRP 124 124 124 TRP TRP N . n 
O  15 125 ARG 125 125 125 ARG ARG N . n 
O  15 126 ARG 126 126 126 ARG ARG N . n 
O  15 127 GLY 127 127 127 GLY GLY N . n 
O  15 128 GLN 128 128 128 GLN GLN N . n 
O  15 129 GLY 129 129 129 GLY GLY N . n 
O  15 130 LEU 130 130 130 LEU LEU N . n 
O  15 131 GLU 131 131 131 GLU GLU N . n 
O  15 132 ALA 132 132 132 ALA ALA N . n 
O  15 133 ALA 133 133 133 ALA ALA N . n 
O  15 134 LEU 134 134 134 LEU LEU N . n 
O  15 135 LYS 135 135 135 LYS LYS N . n 
O  15 136 TYR 136 136 136 TYR TYR N . n 
O  15 137 PHE 137 137 137 PHE PHE N . n 
O  15 138 LEU 138 138 138 LEU LEU N . n 
O  15 139 LEU 139 139 139 LEU LEU N . n 
O  15 140 GLY 140 140 140 GLY GLY N . n 
O  15 141 ALA 141 141 141 ALA ALA N . n 
O  15 142 LEU 142 142 142 LEU LEU N . n 
O  15 143 ALA 143 143 143 ALA ALA N . n 
O  15 144 ALA 144 144 144 ALA ALA N . n 
O  15 145 ALA 145 145 145 ALA ALA N . n 
O  15 146 PHE 146 146 146 PHE PHE N . n 
O  15 147 PHE 147 147 147 PHE PHE N . n 
O  15 148 LEU 148 148 148 LEU LEU N . n 
O  15 149 TYR 149 149 149 TYR TYR N . n 
O  15 150 GLY 150 150 150 GLY GLY N . n 
O  15 151 ALA 151 151 151 ALA ALA N . n 
O  15 152 ALA 152 152 152 ALA ALA N . n 
O  15 153 LEU 153 153 153 LEU LEU N . n 
O  15 154 PHE 154 154 154 PHE PHE N . n 
O  15 155 TYR 155 155 155 TYR TYR N . n 
O  15 156 GLY 156 156 156 GLY GLY N . n 
O  15 157 ALA 157 157 157 ALA ALA N . n 
O  15 158 THR 158 158 158 THR THR N . n 
O  15 159 GLY 159 159 159 GLY GLY N . n 
O  15 160 SER 160 160 160 SER SER N . n 
O  15 161 LEU 161 161 161 LEU LEU N . n 
O  15 162 VAL 162 162 162 VAL VAL N . n 
O  15 163 LEU 163 163 163 LEU LEU N . n 
O  15 164 GLY 164 164 164 GLY GLY N . n 
O  15 165 ALA 165 165 165 ALA ALA N . n 
O  15 166 PRO 166 166 166 PRO PRO N . n 
O  15 167 GLY 167 167 167 GLY GLY N . n 
O  15 168 GLU 168 168 168 GLU GLU N . n 
O  15 169 GLY 169 169 169 GLY GLY N . n 
O  15 170 PRO 170 170 170 PRO PRO N . n 
O  15 171 LEU 171 171 171 LEU LEU N . n 
O  15 172 TYR 172 172 172 TYR TYR N . n 
O  15 173 ALA 173 173 173 ALA ALA N . n 
O  15 174 LEU 174 174 174 LEU LEU N . n 
O  15 175 ALA 175 175 175 ALA ALA N . n 
O  15 176 LEU 176 176 176 LEU LEU N . n 
O  15 177 GLY 177 177 177 GLY GLY N . n 
O  15 178 LEU 178 178 178 LEU LEU N . n 
O  15 179 LEU 179 179 179 LEU LEU N . n 
O  15 180 LEU 180 180 180 LEU LEU N . n 
O  15 181 VAL 181 181 181 VAL VAL N . n 
O  15 182 GLY 182 182 182 GLY GLY N . n 
O  15 183 LEU 183 183 183 LEU LEU N . n 
O  15 184 GLY 184 184 184 GLY GLY N . n 
O  15 185 PHE 185 185 185 PHE PHE N . n 
O  15 186 LYS 186 186 186 LYS LYS N . n 
O  15 187 ALA 187 187 187 ALA ALA N . n 
O  15 188 ALA 188 188 188 ALA ALA N . n 
O  15 189 LEU 189 189 189 LEU LEU N . n 
O  15 190 ALA 190 190 190 ALA ALA N . n 
O  15 191 PRO 191 191 191 PRO PRO N . n 
O  15 192 PHE 192 192 192 PHE PHE N . n 
O  15 193 HIS 193 193 193 HIS HIS N . n 
O  15 194 PHE 194 194 194 PHE PHE N . n 
O  15 195 TRP 195 195 195 TRP TRP N . n 
O  15 196 THR 196 196 196 THR THR N . n 
O  15 197 PRO 197 197 197 PRO PRO N . n 
O  15 198 ASP 198 198 198 ASP ASP N . n 
O  15 199 VAL 199 199 199 VAL VAL N . n 
O  15 200 TYR 200 200 200 TYR TYR N . n 
O  15 201 GLN 201 201 201 GLN GLN N . n 
O  15 202 GLY 202 202 202 GLY GLY N . n 
O  15 203 SER 203 203 203 SER SER N . n 
O  15 204 PRO 204 204 204 PRO PRO N . n 
O  15 205 THR 205 205 205 THR THR N . n 
O  15 206 PRO 206 206 206 PRO PRO N . n 
O  15 207 VAL 207 207 207 VAL VAL N . n 
O  15 208 VAL 208 208 208 VAL VAL N . n 
O  15 209 LEU 209 209 209 LEU LEU N . n 
O  15 210 PHE 210 210 210 PHE PHE N . n 
O  15 211 MET 211 211 211 MET MET N . n 
O  15 212 ALA 212 212 212 ALA ALA N . n 
O  15 213 THR 213 213 213 THR THR N . n 
O  15 214 SER 214 214 214 SER SER N . n 
O  15 215 VAL 215 215 215 VAL VAL N . n 
O  15 216 LYS 216 216 216 LYS LYS N . n 
O  15 217 ALA 217 217 217 ALA ALA N . n 
O  15 218 ALA 218 218 218 ALA ALA N . n 
O  15 219 ALA 219 219 219 ALA ALA N . n 
O  15 220 PHE 220 220 220 PHE PHE N . n 
O  15 221 ALA 221 221 221 ALA ALA N . n 
O  15 222 ALA 222 222 222 ALA ALA N . n 
O  15 223 LEU 223 223 223 LEU LEU N . n 
O  15 224 LEU 224 224 224 LEU LEU N . n 
O  15 225 ARG 225 225 225 ARG ARG N . n 
O  15 226 VAL 226 226 226 VAL VAL N . n 
O  15 227 ALA 227 227 227 ALA ALA N . n 
O  15 228 ALA 228 228 228 ALA ALA N . n 
O  15 229 PRO 229 229 229 PRO PRO N . n 
O  15 230 PRO 230 230 230 PRO PRO N . n 
O  15 231 GLU 231 231 231 GLU GLU N . n 
O  15 232 ALA 232 232 232 ALA ALA N . n 
O  15 233 LEU 233 233 233 LEU LEU N . n 
O  15 234 ALA 234 234 234 ALA ALA N . n 
O  15 235 LEU 235 235 235 LEU LEU N . n 
O  15 236 LEU 236 236 236 LEU LEU N . n 
O  15 237 VAL 237 237 237 VAL VAL N . n 
O  15 238 ALA 238 238 238 ALA ALA N . n 
O  15 239 LEU 239 239 239 LEU LEU N . n 
O  15 240 SER 240 240 240 SER SER N . n 
O  15 241 VAL 241 241 241 VAL VAL N . n 
O  15 242 VAL 242 242 242 VAL VAL N . n 
O  15 243 VAL 243 243 243 VAL VAL N . n 
O  15 244 GLY 244 244 244 GLY GLY N . n 
O  15 245 ASN 245 245 245 ASN ASN N . n 
O  15 246 LEU 246 246 246 LEU LEU N . n 
O  15 247 ALA 247 247 247 ALA ALA N . n 
O  15 248 ALA 248 248 248 ALA ALA N . n 
O  15 249 LEU 249 249 249 LEU LEU N . n 
O  15 250 ALA 250 250 250 ALA ALA N . n 
O  15 251 GLN 251 251 251 GLN GLN N . n 
O  15 252 LYS 252 252 252 LYS LYS N . n 
O  15 253 GLU 253 253 253 GLU GLU N . n 
O  15 254 ALA 254 254 254 ALA ALA N . n 
O  15 255 LYS 255 255 255 LYS LYS N . n 
O  15 256 ARG 256 256 256 ARG ARG N . n 
O  15 257 LEU 257 257 257 LEU LEU N . n 
O  15 258 LEU 258 258 258 LEU LEU N . n 
O  15 259 ALA 259 259 259 ALA ALA N . n 
O  15 260 TYR 260 260 260 TYR TYR N . n 
O  15 261 SER 261 261 261 SER SER N . n 
O  15 262 SER 262 262 262 SER SER N . n 
O  15 263 ILE 263 263 263 ILE ILE N . n 
O  15 264 ALA 264 264 264 ALA ALA N . n 
O  15 265 HIS 265 265 265 HIS HIS N . n 
O  15 266 ALA 266 266 266 ALA ALA N . n 
O  15 267 GLY 267 267 267 GLY GLY N . n 
O  15 268 TYR 268 268 268 TYR TYR N . n 
O  15 269 MET 269 269 269 MET MET N . n 
O  15 270 ALA 270 270 270 ALA ALA N . n 
O  15 271 LEU 271 271 271 LEU LEU N . n 
O  15 272 ALA 272 272 272 ALA ALA N . n 
O  15 273 LEU 273 273 273 LEU LEU N . n 
O  15 274 TYR 274 274 274 TYR TYR N . n 
O  15 275 THR 275 275 275 THR THR N . n 
O  15 276 GLY 276 276 276 GLY GLY N . n 
O  15 277 ASN 277 277 277 ASN ASN N . n 
O  15 278 ALA 278 278 278 ALA ALA N . n 
O  15 279 GLN 279 279 279 GLN GLN N . n 
O  15 280 ALA 280 280 280 ALA ALA N . n 
O  15 281 LEU 281 281 281 LEU LEU N . n 
O  15 282 GLY 282 282 282 GLY GLY N . n 
O  15 283 PHE 283 283 283 PHE PHE N . n 
O  15 284 TYR 284 284 284 TYR TYR N . n 
O  15 285 LEU 285 285 285 LEU LEU N . n 
O  15 286 LEU 286 286 286 LEU LEU N . n 
O  15 287 THR 287 287 287 THR THR N . n 
O  15 288 TYR 288 288 288 TYR TYR N . n 
O  15 289 VAL 289 289 289 VAL VAL N . n 
O  15 290 LEU 290 290 290 LEU LEU N . n 
O  15 291 ALA 291 291 291 ALA ALA N . n 
O  15 292 THR 292 292 292 THR THR N . n 
O  15 293 GLY 293 293 293 GLY GLY N . n 
O  15 294 LEU 294 294 294 LEU LEU N . n 
O  15 295 ALA 295 295 295 ALA ALA N . n 
O  15 296 PHE 296 296 296 PHE PHE N . n 
O  15 297 ALA 297 297 297 ALA ALA N . n 
O  15 298 VAL 298 298 298 VAL VAL N . n 
O  15 299 LEU 299 299 299 LEU LEU N . n 
O  15 300 SER 300 300 300 SER SER N . n 
O  15 301 GLN 301 301 301 GLN GLN N . n 
O  15 302 ILE 302 302 302 ILE ILE N . n 
O  15 303 SER 303 303 303 SER SER N . n 
O  15 304 PRO 304 304 304 PRO PRO N . n 
O  15 305 ASP 305 305 305 ASP ASP N . n 
O  15 306 ARG 306 306 306 ARG ARG N . n 
O  15 307 VAL 307 307 307 VAL VAL N . n 
O  15 308 PRO 308 308 308 PRO PRO N . n 
O  15 309 LEU 309 309 309 LEU LEU N . n 
O  15 310 GLU 310 310 310 GLU GLU N . n 
O  15 311 ALA 311 311 311 ALA ALA N . n 
O  15 312 LEU 312 312 312 LEU LEU N . n 
O  15 313 ARG 313 313 313 ARG ARG N . n 
O  15 314 GLY 314 314 314 GLY GLY N . n 
O  15 315 LEU 315 315 315 LEU LEU N . n 
O  15 316 TYR 316 316 316 TYR TYR N . n 
O  15 317 ARG 317 317 317 ARG ARG N . n 
O  15 318 LYS 318 318 318 LYS LYS N . n 
O  15 319 ASP 319 319 319 ASP ASP N . n 
O  15 320 PRO 320 320 320 PRO PRO N . n 
O  15 321 LEU 321 321 321 LEU LEU N . n 
O  15 322 LEU 322 322 322 LEU LEU N . n 
O  15 323 GLY 323 323 323 GLY GLY N . n 
O  15 324 LEU 324 324 324 LEU LEU N . n 
O  15 325 ALA 325 325 325 ALA ALA N . n 
O  15 326 PHE 326 326 326 PHE PHE N . n 
O  15 327 LEU 327 327 327 LEU LEU N . n 
O  15 328 VAL 328 328 328 VAL VAL N . n 
O  15 329 ALA 329 329 329 ALA ALA N . n 
O  15 330 MET 330 330 330 MET MET N . n 
O  15 331 LEU 331 331 331 LEU LEU N . n 
O  15 332 SER 332 332 332 SER SER N . n 
O  15 333 LEU 333 333 333 LEU LEU N . n 
O  15 334 LEU 334 334 334 LEU LEU N . n 
O  15 335 GLY 335 335 335 GLY GLY N . n 
O  15 336 LEU 336 336 336 LEU LEU N . n 
O  15 337 PRO 337 337 337 PRO PRO N . n 
O  15 338 PRO 338 338 338 PRO PRO N . n 
O  15 339 LEU 339 339 339 LEU LEU N . n 
O  15 340 ALA 340 340 340 ALA ALA N . n 
O  15 341 GLY 341 341 341 GLY GLY N . n 
O  15 342 PHE 342 342 342 PHE PHE N . n 
O  15 343 TRP 343 343 343 TRP TRP N . n 
O  15 344 GLY 344 344 344 GLY GLY N . n 
O  15 345 LYS 345 345 345 LYS LYS N . n 
O  15 346 TYR 346 346 346 TYR TYR N . n 
O  15 347 LEU 347 347 347 LEU LEU N . n 
O  15 348 ALA 348 348 348 ALA ALA N . n 
O  15 349 PHE 349 349 349 PHE PHE N . n 
O  15 350 ALA 350 350 350 ALA ALA N . n 
O  15 351 GLU 351 351 351 GLU GLU N . n 
O  15 352 ALA 352 352 352 ALA ALA N . n 
O  15 353 ALA 353 353 353 ALA ALA N . n 
O  15 354 ARG 354 354 354 ARG ARG N . n 
O  15 355 ALA 355 355 355 ALA ALA N . n 
O  15 356 GLY 356 356 356 GLY GLY N . n 
O  15 357 ALA 357 357 357 ALA ALA N . n 
O  15 358 TRP 358 358 358 TRP TRP N . n 
O  15 359 GLY 359 359 359 GLY GLY N . n 
O  15 360 VAL 360 360 360 VAL VAL N . n 
O  15 361 LEU 361 361 361 LEU LEU N . n 
O  15 362 VAL 362 362 362 VAL VAL N . n 
O  15 363 LEU 363 363 363 LEU LEU N . n 
O  15 364 ALA 364 364 364 ALA ALA N . n 
O  15 365 LEU 365 365 365 LEU LEU N . n 
O  15 366 VAL 366 366 366 VAL VAL N . n 
O  15 367 THR 367 367 367 THR THR N . n 
O  15 368 SER 368 368 368 SER SER N . n 
O  15 369 ALA 369 369 369 ALA ALA N . n 
O  15 370 VAL 370 370 370 VAL VAL N . n 
O  15 371 SER 371 371 371 SER SER N . n 
O  15 372 ALA 372 372 372 ALA ALA N . n 
O  15 373 TYR 373 373 373 TYR TYR N . n 
O  15 374 TYR 374 374 374 TYR TYR N . n 
O  15 375 TYR 375 375 375 TYR TYR N . n 
O  15 376 LEU 376 376 376 LEU LEU N . n 
O  15 377 GLY 377 377 377 GLY GLY N . n 
O  15 378 LEU 378 378 378 LEU LEU N . n 
O  15 379 GLY 379 379 379 GLY GLY N . n 
O  15 380 LEU 380 380 380 LEU LEU N . n 
O  15 381 ALA 381 381 381 ALA ALA N . n 
O  15 382 VAL 382 382 382 VAL VAL N . n 
O  15 383 PHE 383 383 383 PHE PHE N . n 
O  15 384 ALA 384 384 384 ALA ALA N . n 
O  15 385 ARG 385 385 385 ARG ARG N . n 
O  15 386 PRO 386 386 386 PRO PRO N . n 
O  15 387 GLU 387 387 387 GLU GLU N . n 
O  15 388 GLU 388 388 388 GLU GLU N . n 
O  15 389 THR 389 389 389 THR THR N . n 
O  15 390 PRO 390 390 390 PRO PRO N . n 
O  15 391 PHE 391 391 391 PHE PHE N . n 
O  15 392 ARG 392 392 392 ARG ARG N . n 
O  15 393 PRO 393 393 393 PRO PRO N . n 
O  15 394 GLY 394 394 394 GLY GLY N . n 
O  15 395 PRO 395 395 395 PRO PRO N . n 
O  15 396 PRO 396 396 396 PRO PRO N . n 
O  15 397 TRP 397 397 397 TRP TRP N . n 
O  15 398 ALA 398 398 398 ALA ALA N . n 
O  15 399 ARG 399 399 399 ARG ARG N . n 
O  15 400 ALA 400 400 400 ALA ALA N . n 
O  15 401 ALA 401 401 401 ALA ALA N . n 
O  15 402 VAL 402 402 402 VAL VAL N . n 
O  15 403 VAL 403 403 403 VAL VAL N . n 
O  15 404 ALA 404 404 404 ALA ALA N . n 
O  15 405 ALA 405 405 405 ALA ALA N . n 
O  15 406 GLY 406 406 406 GLY GLY N . n 
O  15 407 VAL 407 407 407 VAL VAL N . n 
O  15 408 LEU 408 408 408 LEU LEU N . n 
O  15 409 LEU 409 409 409 LEU LEU N . n 
O  15 410 LEU 410 410 410 LEU LEU N . n 
O  15 411 ALA 411 411 411 ALA ALA N . n 
O  15 412 LEU 412 412 412 LEU LEU N . n 
O  15 413 GLY 413 413 413 GLY GLY N . n 
O  15 414 LEU 414 414 414 LEU LEU N . n 
O  15 415 LEU 415 415 415 LEU LEU N . n 
O  15 416 PRO 416 416 416 PRO PRO N . n 
O  15 417 GLY 417 417 417 GLY GLY N . n 
O  15 418 LEU 418 418 418 LEU LEU N . n 
O  15 419 VAL 419 419 419 VAL VAL N . n 
O  15 420 LEU 420 420 420 LEU LEU N . n 
O  15 421 PRO 421 421 421 PRO PRO N . n 
O  15 422 ALA 422 422 422 ALA ALA N . n 
O  15 423 LEU 423 423 423 LEU LEU N . n 
O  15 424 ALA 424 424 424 ALA ALA N . n 
O  15 425 ALA 425 425 425 ALA ALA N . n 
O  15 426 GLY 426 426 426 GLY GLY N . n 
O  15 427 GLY 427 427 427 GLY GLY N . n 
P  16 1   MET 1   1   ?   ?   ?   H . n 
P  16 2   THR 2   2   2   THR THR H . n 
P  16 3   TRP 3   3   3   TRP TRP H . n 
P  16 4   SER 4   4   4   SER SER H . n 
P  16 5   TYR 5   5   5   TYR TYR H . n 
P  16 6   PRO 6   6   6   PRO PRO H . n 
P  16 7   VAL 7   7   7   VAL VAL H . n 
P  16 8   ASP 8   8   8   ASP ASP H . n 
P  16 9   PRO 9   9   9   PRO PRO H . n 
P  16 10  TYR 10  10  10  TYR TYR H . n 
P  16 11  TRP 11  11  11  TRP TRP H . n 
P  16 12  MET 12  12  12  MET MET H . n 
P  16 13  VAL 13  13  13  VAL VAL H . n 
P  16 14  ALA 14  14  14  ALA ALA H . n 
P  16 15  LEU 15  15  15  LEU LEU H . n 
P  16 16  LYS 16  16  16  LYS LYS H . n 
P  16 17  ALA 17  17  17  ALA ALA H . n 
P  16 18  LEU 18  18  18  LEU LEU H . n 
P  16 19  LEU 19  19  19  LEU LEU H . n 
P  16 20  VAL 20  20  20  VAL VAL H . n 
P  16 21  VAL 21  21  21  VAL VAL H . n 
P  16 22  VAL 22  22  22  VAL VAL H . n 
P  16 23  GLY 23  23  23  GLY GLY H . n 
P  16 24  LEU 24  24  24  LEU LEU H . n 
P  16 25  LEU 25  25  25  LEU LEU H . n 
P  16 26  THR 26  26  26  THR THR H . n 
P  16 27  ALA 27  27  27  ALA ALA H . n 
P  16 28  PHE 28  28  28  PHE PHE H . n 
P  16 29  ALA 29  29  29  ALA ALA H . n 
P  16 30  PHE 30  30  30  PHE PHE H . n 
P  16 31  MET 31  31  31  MET MET H . n 
P  16 32  THR 32  32  32  THR THR H . n 
P  16 33  LEU 33  33  33  LEU LEU H . n 
P  16 34  ILE 34  34  34  ILE ILE H . n 
P  16 35  GLU 35  35  35  GLU GLU H . n 
P  16 36  ARG 36  36  36  ARG ARG H . n 
P  16 37  ARG 37  37  37  ARG ARG H . n 
P  16 38  LEU 38  38  38  LEU LEU H . n 
P  16 39  LEU 39  39  39  LEU LEU H . n 
P  16 40  ALA 40  40  40  ALA ALA H . n 
P  16 41  ARG 41  41  41  ARG ARG H . n 
P  16 42  PHE 42  42  42  PHE PHE H . n 
P  16 43  GLN 43  43  43  GLN GLN H . n 
P  16 44  VAL 44  44  44  VAL VAL H . n 
P  16 45  ARG 45  45  45  ARG ARG H . n 
P  16 46  MET 46  46  46  MET MET H . n 
P  16 47  GLY 47  47  47  GLY GLY H . n 
P  16 48  PRO 48  48  48  PRO PRO H . n 
P  16 49  ASN 49  49  49  ASN ASN H . n 
P  16 50  ARG 50  50  50  ARG ARG H . n 
P  16 51  VAL 51  51  51  VAL VAL H . n 
P  16 52  GLY 52  52  52  GLY GLY H . n 
P  16 53  PRO 53  53  53  PRO PRO H . n 
P  16 54  PHE 54  54  54  PHE PHE H . n 
P  16 55  GLY 55  55  55  GLY GLY H . n 
P  16 56  LEU 56  56  56  LEU LEU H . n 
P  16 57  LEU 57  57  57  LEU LEU H . n 
P  16 58  GLN 58  58  58  GLN GLN H . n 
P  16 59  PRO 59  59  59  PRO PRO H . n 
P  16 60  LEU 60  60  60  LEU LEU H . n 
P  16 61  ALA 61  61  61  ALA ALA H . n 
P  16 62  ASP 62  62  62  ASP ASP H . n 
P  16 63  ALA 63  63  63  ALA ALA H . n 
P  16 64  ILE 64  64  64  ILE ILE H . n 
P  16 65  LYS 65  65  65  LYS LYS H . n 
P  16 66  SER 66  66  66  SER SER H . n 
P  16 67  ILE 67  67  67  ILE ILE H . n 
P  16 68  PHE 68  68  68  PHE PHE H . n 
P  16 69  LYS 69  69  69  LYS LYS H . n 
P  16 70  GLU 70  70  70  GLU GLU H . n 
P  16 71  ASP 71  71  71  ASP ASP H . n 
P  16 72  ILE 72  72  72  ILE ILE H . n 
P  16 73  VAL 73  73  73  VAL VAL H . n 
P  16 74  VAL 74  74  74  VAL VAL H . n 
P  16 75  ALA 75  75  75  ALA ALA H . n 
P  16 76  GLN 76  76  76  GLN GLN H . n 
P  16 77  ALA 77  77  77  ALA ALA H . n 
P  16 78  ASP 78  78  78  ASP ASP H . n 
P  16 79  ARG 79  79  79  ARG ARG H . n 
P  16 80  PHE 80  80  80  PHE PHE H . n 
P  16 81  LEU 81  81  81  LEU LEU H . n 
P  16 82  PHE 82  82  82  PHE PHE H . n 
P  16 83  VAL 83  83  83  VAL VAL H . n 
P  16 84  LEU 84  84  84  LEU LEU H . n 
P  16 85  ALA 85  85  85  ALA ALA H . n 
P  16 86  PRO 86  86  86  PRO PRO H . n 
P  16 87  LEU 87  87  87  LEU LEU H . n 
P  16 88  ILE 88  88  88  ILE ILE H . n 
P  16 89  SER 89  89  89  SER SER H . n 
P  16 90  VAL 90  90  90  VAL VAL H . n 
P  16 91  VAL 91  91  91  VAL VAL H . n 
P  16 92  PHE 92  92  92  PHE PHE H . n 
P  16 93  ALA 93  93  93  ALA ALA H . n 
P  16 94  LEU 94  94  94  LEU LEU H . n 
P  16 95  LEU 95  95  95  LEU LEU H . n 
P  16 96  ALA 96  96  96  ALA ALA H . n 
P  16 97  PHE 97  97  97  PHE PHE H . n 
P  16 98  GLY 98  98  98  GLY GLY H . n 
P  16 99  LEU 99  99  99  LEU LEU H . n 
P  16 100 ILE 100 100 100 ILE ILE H . n 
P  16 101 PRO 101 101 101 PRO PRO H . n 
P  16 102 PHE 102 102 102 PHE PHE H . n 
P  16 103 GLY 103 103 103 GLY GLY H . n 
P  16 104 PRO 104 104 104 PRO PRO H . n 
P  16 105 PRO 105 105 105 PRO PRO H . n 
P  16 106 GLY 106 106 106 GLY GLY H . n 
P  16 107 SER 107 107 107 SER SER H . n 
P  16 108 PHE 108 108 108 PHE PHE H . n 
P  16 109 PHE 109 109 109 PHE PHE H . n 
P  16 110 GLY 110 110 110 GLY GLY H . n 
P  16 111 TYR 111 111 111 TYR TYR H . n 
P  16 112 GLN 112 112 112 GLN GLN H . n 
P  16 113 PRO 113 113 113 PRO PRO H . n 
P  16 114 TRP 114 114 114 TRP TRP H . n 
P  16 115 VAL 115 115 115 VAL VAL H . n 
P  16 116 ILE 116 116 116 ILE ILE H . n 
P  16 117 ASN 117 117 117 ASN ASN H . n 
P  16 118 LEU 118 118 118 LEU LEU H . n 
P  16 119 ASP 119 119 119 ASP ASP H . n 
P  16 120 LEU 120 120 120 LEU LEU H . n 
P  16 121 GLY 121 121 121 GLY GLY H . n 
P  16 122 ILE 122 122 122 ILE ILE H . n 
P  16 123 LEU 123 123 123 LEU LEU H . n 
P  16 124 TYR 124 124 124 TYR TYR H . n 
P  16 125 LEU 125 125 125 LEU LEU H . n 
P  16 126 PHE 126 126 126 PHE PHE H . n 
P  16 127 ALA 127 127 127 ALA ALA H . n 
P  16 128 VAL 128 128 128 VAL VAL H . n 
P  16 129 SER 129 129 129 SER SER H . n 
P  16 130 GLU 130 130 130 GLU GLU H . n 
P  16 131 LEU 131 131 131 LEU LEU H . n 
P  16 132 ALA 132 132 132 ALA ALA H . n 
P  16 133 VAL 133 133 133 VAL VAL H . n 
P  16 134 TYR 134 134 134 TYR TYR H . n 
P  16 135 GLY 135 135 135 GLY GLY H . n 
P  16 136 ILE 136 136 136 ILE ILE H . n 
P  16 137 PHE 137 137 137 PHE PHE H . n 
P  16 138 LEU 138 138 138 LEU LEU H . n 
P  16 139 SER 139 139 139 SER SER H . n 
P  16 140 GLY 140 140 140 GLY GLY H . n 
P  16 141 TRP 141 141 141 TRP TRP H . n 
P  16 142 ALA 142 142 142 ALA ALA H . n 
P  16 143 SER 143 143 143 SER SER H . n 
P  16 144 GLY 144 144 144 GLY GLY H . n 
P  16 145 SER 145 145 145 SER SER H . n 
P  16 146 LYS 146 146 146 LYS LYS H . n 
P  16 147 TYR 147 147 147 TYR TYR H . n 
P  16 148 SER 148 148 148 SER SER H . n 
P  16 149 LEU 149 149 149 LEU LEU H . n 
P  16 150 LEU 150 150 150 LEU LEU H . n 
P  16 151 GLY 151 151 151 GLY GLY H . n 
P  16 152 SER 152 152 152 SER SER H . n 
P  16 153 LEU 153 153 153 LEU LEU H . n 
P  16 154 ARG 154 154 154 ARG ARG H . n 
P  16 155 SER 155 155 155 SER SER H . n 
P  16 156 SER 156 156 156 SER SER H . n 
P  16 157 ALA 157 157 157 ALA ALA H . n 
P  16 158 SER 158 158 158 SER SER H . n 
P  16 159 LEU 159 159 159 LEU LEU H . n 
P  16 160 ILE 160 160 160 ILE ILE H . n 
P  16 161 SER 161 161 161 SER SER H . n 
P  16 162 TYR 162 162 162 TYR TYR H . n 
P  16 163 GLU 163 163 163 GLU GLU H . n 
P  16 164 LEU 164 164 164 LEU LEU H . n 
P  16 165 GLY 165 165 165 GLY GLY H . n 
P  16 166 LEU 166 166 166 LEU LEU H . n 
P  16 167 GLY 167 167 167 GLY GLY H . n 
P  16 168 LEU 168 168 168 LEU LEU H . n 
P  16 169 ALA 169 169 169 ALA ALA H . n 
P  16 170 LEU 170 170 170 LEU LEU H . n 
P  16 171 LEU 171 171 171 LEU LEU H . n 
P  16 172 ALA 172 172 172 ALA ALA H . n 
P  16 173 PRO 173 173 173 PRO PRO H . n 
P  16 174 VAL 174 174 174 VAL VAL H . n 
P  16 175 LEU 175 175 175 LEU LEU H . n 
P  16 176 LEU 176 176 176 LEU LEU H . n 
P  16 177 VAL 177 177 177 VAL VAL H . n 
P  16 178 GLY 178 178 178 GLY GLY H . n 
P  16 179 SER 179 179 179 SER SER H . n 
P  16 180 LEU 180 180 180 LEU LEU H . n 
P  16 181 ASN 181 181 181 ASN ASN H . n 
P  16 182 LEU 182 182 182 LEU LEU H . n 
P  16 183 ASN 183 183 183 ASN ASN H . n 
P  16 184 ASP 184 184 184 ASP ASP H . n 
P  16 185 ILE 185 185 185 ILE ILE H . n 
P  16 186 VAL 186 186 186 VAL VAL H . n 
P  16 187 ASN 187 187 187 ASN ASN H . n 
P  16 188 TRP 188 188 188 TRP TRP H . n 
P  16 189 GLN 189 189 189 GLN GLN H . n 
P  16 190 LYS 190 190 190 LYS LYS H . n 
P  16 191 GLU 191 191 191 GLU GLU H . n 
P  16 192 HIS 192 192 192 HIS HIS H . n 
P  16 193 GLY 193 193 193 GLY GLY H . n 
P  16 194 TRP 194 194 194 TRP TRP H . n 
P  16 195 LEU 195 195 195 LEU LEU H . n 
P  16 196 PHE 196 196 196 PHE PHE H . n 
P  16 197 LEU 197 197 197 LEU LEU H . n 
P  16 198 TYR 198 198 198 TYR TYR H . n 
P  16 199 ALA 199 199 199 ALA ALA H . n 
P  16 200 PHE 200 200 200 PHE PHE H . n 
P  16 201 PRO 201 201 201 PRO PRO H . n 
P  16 202 ALA 202 202 202 ALA ALA H . n 
P  16 203 PHE 203 203 203 PHE PHE H . n 
P  16 204 LEU 204 204 204 LEU LEU H . n 
P  16 205 VAL 205 205 205 VAL VAL H . n 
P  16 206 TYR 206 206 206 TYR TYR H . n 
P  16 207 LEU 207 207 207 LEU LEU H . n 
P  16 208 ILE 208 208 208 ILE ILE H . n 
P  16 209 ALA 209 209 209 ALA ALA H . n 
P  16 210 SER 210 210 210 SER SER H . n 
P  16 211 MET 211 211 211 MET MET H . n 
P  16 212 ALA 212 212 212 ALA ALA H . n 
P  16 213 GLU 213 213 213 GLU GLU H . n 
P  16 214 ALA 214 214 214 ALA ALA H . n 
P  16 215 ALA 215 215 215 ALA ALA H . n 
P  16 216 ARG 216 216 216 ARG ARG H . n 
P  16 217 THR 217 217 217 THR THR H . n 
P  16 218 PRO 218 218 218 PRO PRO H . n 
P  16 219 PHE 219 219 219 PHE PHE H . n 
P  16 220 ASP 220 220 220 ASP ASP H . n 
P  16 221 LEU 221 221 221 LEU LEU H . n 
P  16 222 PRO 222 222 222 PRO PRO H . n 
P  16 223 GLU 223 223 223 GLU GLU H . n 
P  16 224 ALA 224 224 224 ALA ALA H . n 
P  16 225 GLU 225 225 225 GLU GLU H . n 
P  16 226 GLN 226 226 226 GLN GLN H . n 
P  16 227 GLU 227 227 227 GLU GLU H . n 
P  16 228 LEU 228 228 228 LEU LEU H . n 
P  16 229 VAL 229 229 229 VAL VAL H . n 
P  16 230 GLY 230 230 230 GLY GLY H . n 
P  16 231 GLY 231 231 231 GLY GLY H . n 
P  16 232 TYR 232 232 232 TYR TYR H . n 
P  16 233 HIS 233 233 233 HIS HIS H . n 
P  16 234 THR 234 234 234 THR THR H . n 
P  16 235 GLU 235 235 235 GLU GLU H . n 
P  16 236 TYR 236 236 236 TYR TYR H . n 
P  16 237 SER 237 237 237 SER SER H . n 
P  16 238 SER 238 238 238 SER SER H . n 
P  16 239 ILE 239 239 239 ILE ILE H . n 
P  16 240 LYS 240 240 240 LYS LYS H . n 
P  16 241 TRP 241 241 241 TRP TRP H . n 
P  16 242 ALA 242 242 242 ALA ALA H . n 
P  16 243 LEU 243 243 243 LEU LEU H . n 
P  16 244 PHE 244 244 244 PHE PHE H . n 
P  16 245 GLN 245 245 245 GLN GLN H . n 
P  16 246 MET 246 246 246 MET MET H . n 
P  16 247 ALA 247 247 247 ALA ALA H . n 
P  16 248 GLU 248 248 248 GLU GLU H . n 
P  16 249 TYR 249 249 249 TYR TYR H . n 
P  16 250 ILE 250 250 250 ILE ILE H . n 
P  16 251 HIS 251 251 251 HIS HIS H . n 
P  16 252 PHE 252 252 252 PHE PHE H . n 
P  16 253 ILE 253 253 253 ILE ILE H . n 
P  16 254 THR 254 254 254 THR THR H . n 
P  16 255 ALA 255 255 255 ALA ALA H . n 
P  16 256 SER 256 256 256 SER SER H . n 
P  16 257 ALA 257 257 257 ALA ALA H . n 
P  16 258 LEU 258 258 258 LEU LEU H . n 
P  16 259 ILE 259 259 259 ILE ILE H . n 
P  16 260 PRO 260 260 260 PRO PRO H . n 
P  16 261 THR 261 261 261 THR THR H . n 
P  16 262 LEU 262 262 262 LEU LEU H . n 
P  16 263 PHE 263 263 263 PHE PHE H . n 
P  16 264 LEU 264 264 264 LEU LEU H . n 
P  16 265 GLY 265 265 265 GLY GLY H . n 
P  16 266 GLY 266 266 266 GLY GLY H . n 
P  16 267 TRP 267 267 267 TRP TRP H . n 
P  16 268 THR 268 268 268 THR THR H . n 
P  16 269 MET 269 269 269 MET MET H . n 
P  16 270 PRO 270 270 270 PRO PRO H . n 
P  16 271 VAL 271 271 271 VAL VAL H . n 
P  16 272 LEU 272 272 272 LEU LEU H . n 
P  16 273 GLU 273 273 273 GLU GLU H . n 
P  16 274 VAL 274 274 274 VAL VAL H . n 
P  16 275 PRO 275 275 275 PRO PRO H . n 
P  16 276 TYR 276 276 276 TYR TYR H . n 
P  16 277 LEU 277 277 277 LEU LEU H . n 
P  16 278 TRP 278 278 278 TRP TRP H . n 
P  16 279 MET 279 279 279 MET MET H . n 
P  16 280 PHE 280 280 280 PHE PHE H . n 
P  16 281 LEU 281 281 281 LEU LEU H . n 
P  16 282 LYS 282 282 282 LYS LYS H . n 
P  16 283 ILE 283 283 283 ILE ILE H . n 
P  16 284 ALA 284 284 284 ALA ALA H . n 
P  16 285 PHE 285 285 285 PHE PHE H . n 
P  16 286 PHE 286 286 286 PHE PHE H . n 
P  16 287 LEU 287 287 287 LEU LEU H . n 
P  16 288 PHE 288 288 288 PHE PHE H . n 
P  16 289 PHE 289 289 289 PHE PHE H . n 
P  16 290 PHE 290 290 290 PHE PHE H . n 
P  16 291 ILE 291 291 291 ILE ILE H . n 
P  16 292 TRP 292 292 292 TRP TRP H . n 
P  16 293 ILE 293 293 293 ILE ILE H . n 
P  16 294 ARG 294 294 294 ARG ARG H . n 
P  16 295 ALA 295 295 295 ALA ALA H . n 
P  16 296 THR 296 296 296 THR THR H . n 
P  16 297 TRP 297 297 297 TRP TRP H . n 
P  16 298 PHE 298 298 298 PHE PHE H . n 
P  16 299 ARG 299 299 299 ARG ARG H . n 
P  16 300 LEU 300 300 300 LEU LEU H . n 
P  16 301 ARG 301 301 301 ARG ARG H . n 
P  16 302 TYR 302 302 302 TYR TYR H . n 
P  16 303 ASP 303 303 303 ASP ASP H . n 
P  16 304 GLN 304 304 304 GLN GLN H . n 
P  16 305 LEU 305 305 305 LEU LEU H . n 
P  16 306 LEU 306 306 306 LEU LEU H . n 
P  16 307 ARG 307 307 307 ARG ARG H . n 
P  16 308 PHE 308 308 308 PHE PHE H . n 
P  16 309 GLY 309 309 309 GLY GLY H . n 
P  16 310 TRP 310 310 310 TRP TRP H . n 
P  16 311 GLY 311 311 311 GLY GLY H . n 
P  16 312 PHE 312 312 312 PHE PHE H . n 
P  16 313 LEU 313 313 313 LEU LEU H . n 
P  16 314 PHE 314 314 314 PHE PHE H . n 
P  16 315 PRO 315 315 315 PRO PRO H . n 
P  16 316 LEU 316 316 316 LEU LEU H . n 
P  16 317 ALA 317 317 317 ALA ALA H . n 
P  16 318 LEU 318 318 318 LEU LEU H . n 
P  16 319 LEU 319 319 319 LEU LEU H . n 
P  16 320 TRP 320 320 320 TRP TRP H . n 
P  16 321 PHE 321 321 321 PHE PHE H . n 
P  16 322 LEU 322 322 322 LEU LEU H . n 
P  16 323 VAL 323 323 323 VAL VAL H . n 
P  16 324 THR 324 324 324 THR THR H . n 
P  16 325 ALA 325 325 325 ALA ALA H . n 
P  16 326 LEU 326 326 326 LEU LEU H . n 
P  16 327 VAL 327 327 327 VAL VAL H . n 
P  16 328 VAL 328 328 328 VAL VAL H . n 
P  16 329 ALA 329 329 329 ALA ALA H . n 
P  16 330 LEU 330 330 330 LEU LEU H . n 
P  16 331 ASP 331 331 331 ASP ASP H . n 
P  16 332 LEU 332 332 332 LEU LEU H . n 
P  16 333 PRO 333 333 333 PRO PRO H . n 
P  16 334 ARG 334 334 334 ARG ARG H . n 
P  16 335 THR 335 335 335 THR THR H . n 
P  16 336 TYR 336 336 336 TYR TYR H . n 
P  16 337 LEU 337 337 337 LEU LEU H . n 
P  16 338 LEU 338 338 338 LEU LEU H . n 
P  16 339 TYR 339 339 339 TYR TYR H . n 
P  16 340 LEU 340 340 340 LEU LEU H . n 
P  16 341 SER 341 341 341 SER SER H . n 
P  16 342 ALA 342 342 342 ALA ALA H . n 
P  16 343 LEU 343 343 343 LEU LEU H . n 
P  16 344 SER 344 344 344 SER SER H . n 
P  16 345 PHE 345 345 345 PHE PHE H . n 
P  16 346 LEU 346 346 346 LEU LEU H . n 
P  16 347 VAL 347 347 347 VAL VAL H . n 
P  16 348 LEU 348 348 348 LEU LEU H . n 
P  16 349 LEU 349 349 349 LEU LEU H . n 
P  16 350 GLY 350 350 350 GLY GLY H . n 
P  16 351 ALA 351 351 351 ALA ALA H . n 
P  16 352 VAL 352 352 352 VAL VAL H . n 
P  16 353 LEU 353 353 353 LEU LEU H . n 
P  16 354 TYR 354 354 354 TYR TYR H . n 
P  16 355 THR 355 355 ?   ?   ?   H . n 
P  16 356 PRO 356 356 ?   ?   ?   H . n 
P  16 357 LYS 357 357 ?   ?   ?   H . n 
P  16 358 PRO 358 358 ?   ?   ?   H . n 
P  16 359 ALA 359 359 ?   ?   ?   H . n 
P  16 360 ARG 360 360 ?   ?   ?   H . n 
P  16 361 LYS 361 361 ?   ?   ?   H . n 
P  16 362 GLY 362 362 ?   ?   ?   H . n 
P  16 363 GLY 363 363 ?   ?   ?   H . n 
P  16 364 GLY 364 364 ?   ?   ?   H . n 
P  16 365 ALA 365 365 ?   ?   ?   H . n 
Q  1  1   MET 1   1   ?   ?   ?   B . n 
Q  1  2   THR 2   2   2   THR THR B . n 
Q  1  3   GLY 3   3   3   GLY GLY B . n 
Q  1  4   PRO 4   4   4   PRO PRO B . n 
Q  1  5   ILE 5   5   5   ILE ILE B . n 
Q  1  6   LEU 6   6   6   LEU LEU B . n 
Q  1  7   SER 7   7   7   SER SER B . n 
Q  1  8   GLY 8   8   8   GLY GLY B . n 
Q  1  9   LEU 9   9   9   LEU LEU B . n 
Q  1  10  ASP 10  10  10  ASP ASP B . n 
Q  1  11  PRO 11  11  11  PRO PRO B . n 
Q  1  12  ARG 12  12  12  ARG ARG B . n 
Q  1  13  PHE 13  13  13  PHE PHE B . n 
Q  1  14  GLU 14  14  14  GLU GLU B . n 
Q  1  15  ARG 15  15  15  ARG ARG B . n 
Q  1  16  THR 16  16  16  THR THR B . n 
Q  1  17  LEU 17  17  17  LEU LEU B . n 
Q  1  18  TYR 18  18  18  TYR TYR B . n 
Q  1  19  ALA 19  19  19  ALA ALA B . n 
Q  1  20  HIS 20  20  20  HIS HIS B . n 
Q  1  21  VAL 21  21  21  VAL VAL B . n 
Q  1  22  GLY 22  22  22  GLY GLY B . n 
Q  1  23  LYS 23  23  23  LYS LYS B . n 
Q  1  24  GLU 24  24  24  GLU GLU B . n 
Q  1  25  GLY 25  25  25  GLY GLY B . n 
Q  1  26  SER 26  26  26  SER SER B . n 
Q  1  27  TRP 27  27  27  TRP TRP B . n 
Q  1  28  THR 28  28  28  THR THR B . n 
Q  1  29  LEU 29  29  29  LEU LEU B . n 
Q  1  30  ASP 30  30  30  ASP ASP B . n 
Q  1  31  TYR 31  31  31  TYR TYR B . n 
Q  1  32  TYR 32  32  32  TYR TYR B . n 
Q  1  33  LEU 33  33  33  LEU LEU B . n 
Q  1  34  ARG 34  34  34  ARG ARG B . n 
Q  1  35  HIS 35  35  35  HIS HIS B . n 
Q  1  36  GLY 36  36  36  GLY GLY B . n 
Q  1  37  GLY 37  37  37  GLY GLY B . n 
Q  1  38  TYR 38  38  38  TYR TYR B . n 
Q  1  39  GLU 39  39  39  GLU GLU B . n 
Q  1  40  THR 40  40  40  THR THR B . n 
Q  1  41  ALA 41  41  41  ALA ALA B . n 
Q  1  42  LYS 42  42  42  LYS LYS B . n 
Q  1  43  ARG 43  43  43  ARG ARG B . n 
Q  1  44  VAL 44  44  44  VAL VAL B . n 
Q  1  45  LEU 45  45  45  LEU LEU B . n 
Q  1  46  LYS 46  46  46  LYS LYS B . n 
Q  1  47  GLU 47  47  47  GLU GLU B . n 
Q  1  48  LYS 48  48  48  LYS LYS B . n 
Q  1  49  THR 49  49  49  THR THR B . n 
Q  1  50  PRO 50  50  50  PRO PRO B . n 
Q  1  51  ASP 51  51  51  ASP ASP B . n 
Q  1  52  GLU 52  52  52  GLU GLU B . n 
Q  1  53  VAL 53  53  53  VAL VAL B . n 
Q  1  54  ILE 54  54  54  ILE ILE B . n 
Q  1  55  GLU 55  55  55  GLU GLU B . n 
Q  1  56  GLU 56  56  56  GLU GLU B . n 
Q  1  57  VAL 57  57  57  VAL VAL B . n 
Q  1  58  LYS 58  58  58  LYS LYS B . n 
Q  1  59  ARG 59  59  59  ARG ARG B . n 
Q  1  60  SER 60  60  60  SER SER B . n 
Q  1  61  GLY 61  61  61  GLY GLY B . n 
Q  1  62  LEU 62  62  62  LEU LEU B . n 
Q  1  63  ARG 63  63  63  ARG ARG B . n 
Q  1  64  GLY 64  64  64  GLY GLY B . n 
Q  1  65  ARG 65  65  65  ARG ARG B . n 
Q  1  66  GLY 66  66  66  GLY GLY B . n 
Q  1  67  GLY 67  67  67  GLY GLY B . n 
Q  1  68  ALA 68  68  68  ALA ALA B . n 
Q  1  69  GLY 69  69  69  GLY GLY B . n 
Q  1  70  PHE 70  70  70  PHE PHE B . n 
Q  1  71  PRO 71  71  71  PRO PRO B . n 
Q  1  72  THR 72  72  72  THR THR B . n 
Q  1  73  GLY 73  73  73  GLY GLY B . n 
Q  1  74  LEU 74  74  74  LEU LEU B . n 
Q  1  75  LYS 75  75  75  LYS LYS B . n 
Q  1  76  TRP 76  76  76  TRP TRP B . n 
Q  1  77  SER 77  77  77  SER SER B . n 
Q  1  78  PHE 78  78  78  PHE PHE B . n 
Q  1  79  MET 79  79  79  MET MET B . n 
Q  1  80  PRO 80  80  80  PRO PRO B . n 
Q  1  81  LYS 81  81  81  LYS LYS B . n 
Q  1  82  ASP 82  82  82  ASP ASP B . n 
Q  1  83  ASP 83  83  83  ASP ASP B . n 
Q  1  84  GLY 84  84  84  GLY GLY B . n 
Q  1  85  LYS 85  85  85  LYS LYS B . n 
Q  1  86  GLN 86  86  86  GLN GLN B . n 
Q  1  87  HIS 87  87  87  HIS HIS B . n 
Q  1  88  TYR 88  88  88  TYR TYR B . n 
Q  1  89  LEU 89  89  89  LEU LEU B . n 
Q  1  90  ILE 90  90  90  ILE ILE B . n 
Q  1  91  CYS 91  91  91  CYS CYS B . n 
Q  1  92  ASN 92  92  92  ASN ASN B . n 
Q  1  93  ALA 93  93  93  ALA ALA B . n 
Q  1  94  ASP 94  94  94  ASP ASP B . n 
Q  1  95  GLU 95  95  95  GLU GLU B . n 
Q  1  96  SER 96  96  96  SER SER B . n 
Q  1  97  GLU 97  97  97  GLU GLU B . n 
Q  1  98  PRO 98  98  98  PRO PRO B . n 
Q  1  99  GLY 99  99  99  GLY GLY B . n 
Q  1  100 SER 100 100 100 SER SER B . n 
Q  1  101 PHE 101 101 101 PHE PHE B . n 
Q  1  102 LYS 102 102 102 LYS LYS B . n 
Q  1  103 ASP 103 103 103 ASP ASP B . n 
Q  1  104 ARG 104 104 104 ARG ARG B . n 
Q  1  105 TYR 105 105 105 TYR TYR B . n 
Q  1  106 ILE 106 106 106 ILE ILE B . n 
Q  1  107 LEU 107 107 107 LEU LEU B . n 
Q  1  108 GLU 108 108 108 GLU GLU B . n 
Q  1  109 ASP 109 109 109 ASP ASP B . n 
Q  1  110 VAL 110 110 110 VAL VAL B . n 
Q  1  111 PRO 111 111 111 PRO PRO B . n 
Q  1  112 HIS 112 112 112 HIS HIS B . n 
Q  1  113 LEU 113 113 113 LEU LEU B . n 
Q  1  114 LEU 114 114 114 LEU LEU B . n 
Q  1  115 ILE 115 115 115 ILE ILE B . n 
Q  1  116 GLU 116 116 116 GLU GLU B . n 
Q  1  117 GLY 117 117 117 GLY GLY B . n 
Q  1  118 MET 118 118 118 MET MET B . n 
Q  1  119 ILE 119 119 119 ILE ILE B . n 
Q  1  120 LEU 120 120 120 LEU LEU B . n 
Q  1  121 ALA 121 121 121 ALA ALA B . n 
Q  1  122 GLY 122 122 122 GLY GLY B . n 
Q  1  123 TYR 123 123 123 TYR TYR B . n 
Q  1  124 ALA 124 124 124 ALA ALA B . n 
Q  1  125 ILE 125 125 125 ILE ILE B . n 
Q  1  126 ARG 126 126 126 ARG ARG B . n 
Q  1  127 ALA 127 127 127 ALA ALA B . n 
Q  1  128 THR 128 128 128 THR THR B . n 
Q  1  129 VAL 129 129 129 VAL VAL B . n 
Q  1  130 GLY 130 130 130 GLY GLY B . n 
Q  1  131 TYR 131 131 131 TYR TYR B . n 
Q  1  132 ILE 132 132 132 ILE ILE B . n 
Q  1  133 TYR 133 133 133 TYR TYR B . n 
Q  1  134 VAL 134 134 134 VAL VAL B . n 
Q  1  135 ARG 135 135 135 ARG ARG B . n 
Q  1  136 GLY 136 136 136 GLY GLY B . n 
Q  1  137 GLU 137 137 137 GLU GLU B . n 
Q  1  138 TYR 138 138 138 TYR TYR B . n 
Q  1  139 ARG 139 139 139 ARG ARG B . n 
Q  1  140 ARG 140 140 140 ARG ARG B . n 
Q  1  141 ALA 141 141 141 ALA ALA B . n 
Q  1  142 ALA 142 142 142 ALA ALA B . n 
Q  1  143 ASP 143 143 143 ASP ASP B . n 
Q  1  144 ARG 144 144 144 ARG ARG B . n 
Q  1  145 LEU 145 145 145 LEU LEU B . n 
Q  1  146 GLU 146 146 146 GLU GLU B . n 
Q  1  147 GLN 147 147 147 GLN GLN B . n 
Q  1  148 ALA 148 148 148 ALA ALA B . n 
Q  1  149 ILE 149 149 149 ILE ILE B . n 
Q  1  150 LYS 150 150 150 LYS LYS B . n 
Q  1  151 GLU 151 151 151 GLU GLU B . n 
Q  1  152 ALA 152 152 152 ALA ALA B . n 
Q  1  153 ARG 153 153 153 ARG ARG B . n 
Q  1  154 ALA 154 154 154 ALA ALA B . n 
Q  1  155 ARG 155 155 155 ARG ARG B . n 
Q  1  156 GLY 156 156 156 GLY GLY B . n 
Q  1  157 TYR 157 157 157 TYR TYR B . n 
Q  1  158 LEU 158 158 158 LEU LEU B . n 
Q  1  159 GLY 159 159 159 GLY GLY B . n 
Q  1  160 LYS 160 160 160 LYS LYS B . n 
Q  1  161 ASN 161 161 161 ASN ASN B . n 
Q  1  162 LEU 162 162 162 LEU LEU B . n 
Q  1  163 PHE 163 163 163 PHE PHE B . n 
Q  1  164 GLY 164 164 164 GLY GLY B . n 
Q  1  165 THR 165 165 165 THR THR B . n 
Q  1  166 ASP 166 166 166 ASP ASP B . n 
Q  1  167 PHE 167 167 167 PHE PHE B . n 
Q  1  168 SER 168 168 168 SER SER B . n 
Q  1  169 PHE 169 169 169 PHE PHE B . n 
Q  1  170 ASP 170 170 170 ASP ASP B . n 
Q  1  171 LEU 171 171 171 LEU LEU B . n 
Q  1  172 HIS 172 172 172 HIS HIS B . n 
Q  1  173 VAL 173 173 173 VAL VAL B . n 
Q  1  174 HIS 174 174 174 HIS HIS B . n 
Q  1  175 ARG 175 175 175 ARG ARG B . n 
Q  1  176 GLY 176 176 176 GLY GLY B . n 
Q  1  177 ALA 177 177 177 ALA ALA B . n 
Q  1  178 GLY 178 178 178 GLY GLY B . n 
Q  1  179 ALA 179 179 179 ALA ALA B . n 
Q  1  180 TYR 180 180 180 TYR TYR B . n 
Q  1  181 ILE 181 181 181 ILE ILE B . n 
Q  1  182 CYS 182 182 182 CYS CYS B . n 
Q  1  183 GLY 183 183 183 GLY GLY B . n 
Q  1  184 GLU 184 184 184 GLU GLU B . n 
Q  1  185 GLU 185 185 185 GLU GLU B . n 
Q  1  186 THR 186 186 186 THR THR B . n 
Q  1  187 ALA 187 187 187 ALA ALA B . n 
Q  1  188 LEU 188 188 188 LEU LEU B . n 
Q  1  189 MET 189 189 189 MET MET B . n 
Q  1  190 ASN 190 190 190 ASN ASN B . n 
Q  1  191 SER 191 191 191 SER SER B . n 
Q  1  192 LEU 192 192 192 LEU LEU B . n 
Q  1  193 GLU 193 193 193 GLU GLU B . n 
Q  1  194 GLY 194 194 194 GLY GLY B . n 
Q  1  195 LEU 195 195 195 LEU LEU B . n 
Q  1  196 ARG 196 196 196 ARG ARG B . n 
Q  1  197 ALA 197 197 197 ALA ALA B . n 
Q  1  198 ASN 198 198 198 ASN ASN B . n 
Q  1  199 PRO 199 199 199 PRO PRO B . n 
Q  1  200 ARG 200 200 200 ARG ARG B . n 
Q  1  201 LEU 201 201 201 LEU LEU B . n 
Q  1  202 LYS 202 202 202 LYS LYS B . n 
Q  1  203 PRO 203 203 203 PRO PRO B . n 
Q  1  204 PRO 204 204 204 PRO PRO B . n 
Q  1  205 PHE 205 205 205 PHE PHE B . n 
Q  1  206 PRO 206 206 206 PRO PRO B . n 
Q  1  207 ALA 207 207 207 ALA ALA B . n 
Q  1  208 GLN 208 208 208 GLN GLN B . n 
Q  1  209 SER 209 209 209 SER SER B . n 
Q  1  210 GLY 210 210 210 GLY GLY B . n 
Q  1  211 LEU 211 211 211 LEU LEU B . n 
Q  1  212 TRP 212 212 212 TRP TRP B . n 
Q  1  213 GLY 213 213 213 GLY GLY B . n 
Q  1  214 LYS 214 214 214 LYS LYS B . n 
Q  1  215 PRO 215 215 215 PRO PRO B . n 
Q  1  216 THR 216 216 216 THR THR B . n 
Q  1  217 THR 217 217 217 THR THR B . n 
Q  1  218 ILE 218 218 218 ILE ILE B . n 
Q  1  219 ASN 219 219 219 ASN ASN B . n 
Q  1  220 ASN 220 220 220 ASN ASN B . n 
Q  1  221 VAL 221 221 221 VAL VAL B . n 
Q  1  222 GLU 222 222 222 GLU GLU B . n 
Q  1  223 THR 223 223 223 THR THR B . n 
Q  1  224 LEU 224 224 224 LEU LEU B . n 
Q  1  225 ALA 225 225 225 ALA ALA B . n 
Q  1  226 SER 226 226 226 SER SER B . n 
Q  1  227 VAL 227 227 227 VAL VAL B . n 
Q  1  228 VAL 228 228 228 VAL VAL B . n 
Q  1  229 PRO 229 229 229 PRO PRO B . n 
Q  1  230 ILE 230 230 230 ILE ILE B . n 
Q  1  231 MET 231 231 231 MET MET B . n 
Q  1  232 GLU 232 232 232 GLU GLU B . n 
Q  1  233 ARG 233 233 233 ARG ARG B . n 
Q  1  234 GLY 234 234 234 GLY GLY B . n 
Q  1  235 ALA 235 235 235 ALA ALA B . n 
Q  1  236 ASP 236 236 236 ASP ASP B . n 
Q  1  237 TRP 237 237 237 TRP TRP B . n 
Q  1  238 PHE 238 238 238 PHE PHE B . n 
Q  1  239 ALA 239 239 239 ALA ALA B . n 
Q  1  240 GLN 240 240 240 GLN GLN B . n 
Q  1  241 MET 241 241 241 MET MET B . n 
Q  1  242 GLY 242 242 242 GLY GLY B . n 
Q  1  243 THR 243 243 243 THR THR B . n 
Q  1  244 GLU 244 244 244 GLU GLU B . n 
Q  1  245 GLN 245 245 245 GLN GLN B . n 
Q  1  246 SER 246 246 246 SER SER B . n 
Q  1  247 LYS 247 247 247 LYS LYS B . n 
Q  1  248 GLY 248 248 248 GLY GLY B . n 
Q  1  249 MET 249 249 249 MET MET B . n 
Q  1  250 LYS 250 250 250 LYS LYS B . n 
Q  1  251 LEU 251 251 251 LEU LEU B . n 
Q  1  252 TYR 252 252 252 TYR TYR B . n 
Q  1  253 GLN 253 253 253 GLN GLN B . n 
Q  1  254 ILE 254 254 254 ILE ILE B . n 
Q  1  255 SER 255 255 255 SER SER B . n 
Q  1  256 GLY 256 256 256 GLY GLY B . n 
Q  1  257 PRO 257 257 257 PRO PRO B . n 
Q  1  258 VAL 258 258 258 VAL VAL B . n 
Q  1  259 LYS 259 259 259 LYS LYS B . n 
Q  1  260 ARG 260 260 260 ARG ARG B . n 
Q  1  261 PRO 261 261 261 PRO PRO B . n 
Q  1  262 GLY 262 262 262 GLY GLY B . n 
Q  1  263 VAL 263 263 263 VAL VAL B . n 
Q  1  264 TYR 264 264 264 TYR TYR B . n 
Q  1  265 GLU 265 265 265 GLU GLU B . n 
Q  1  266 LEU 266 266 266 LEU LEU B . n 
Q  1  267 PRO 267 267 267 PRO PRO B . n 
Q  1  268 MET 268 268 268 MET MET B . n 
Q  1  269 GLY 269 269 269 GLY GLY B . n 
Q  1  270 THR 270 270 270 THR THR B . n 
Q  1  271 THR 271 271 271 THR THR B . n 
Q  1  272 PHE 272 272 272 PHE PHE B . n 
Q  1  273 ARG 273 273 273 ARG ARG B . n 
Q  1  274 GLU 274 274 274 GLU GLU B . n 
Q  1  275 LEU 275 275 275 LEU LEU B . n 
Q  1  276 ILE 276 276 276 ILE ILE B . n 
Q  1  277 TYR 277 277 277 TYR TYR B . n 
Q  1  278 GLU 278 278 278 GLU GLU B . n 
Q  1  279 TRP 279 279 279 TRP TRP B . n 
Q  1  280 ALA 280 280 280 ALA ALA B . n 
Q  1  281 GLY 281 281 281 GLY GLY B . n 
Q  1  282 GLY 282 282 282 GLY GLY B . n 
Q  1  283 PRO 283 283 283 PRO PRO B . n 
Q  1  284 LEU 284 284 284 LEU LEU B . n 
Q  1  285 GLU 285 285 285 GLU GLU B . n 
Q  1  286 PRO 286 286 286 PRO PRO B . n 
Q  1  287 ILE 287 287 287 ILE ILE B . n 
Q  1  288 GLN 288 288 288 GLN GLN B . n 
Q  1  289 ALA 289 289 289 ALA ALA B . n 
Q  1  290 ILE 290 290 290 ILE ILE B . n 
Q  1  291 ILE 291 291 291 ILE ILE B . n 
Q  1  292 PRO 292 292 292 PRO PRO B . n 
Q  1  293 GLY 293 293 293 GLY GLY B . n 
Q  1  294 GLY 294 294 294 GLY GLY B . n 
Q  1  295 SER 295 295 295 SER SER B . n 
Q  1  296 SER 296 296 296 SER SER B . n 
Q  1  297 THR 297 297 297 THR THR B . n 
Q  1  298 PRO 298 298 298 PRO PRO B . n 
Q  1  299 PRO 299 299 299 PRO PRO B . n 
Q  1  300 LEU 300 300 300 LEU LEU B . n 
Q  1  301 PRO 301 301 301 PRO PRO B . n 
Q  1  302 PHE 302 302 302 PHE PHE B . n 
Q  1  303 THR 303 303 303 THR THR B . n 
Q  1  304 GLU 304 304 304 GLU GLU B . n 
Q  1  305 GLU 305 305 305 GLU GLU B . n 
Q  1  306 VAL 306 306 306 VAL VAL B . n 
Q  1  307 LEU 307 307 307 LEU LEU B . n 
Q  1  308 ASP 308 308 308 ASP ASP B . n 
Q  1  309 THR 309 309 309 THR THR B . n 
Q  1  310 PRO 310 310 310 PRO PRO B . n 
Q  1  311 MET 311 311 311 MET MET B . n 
Q  1  312 SER 312 312 312 SER SER B . n 
Q  1  313 TYR 313 313 313 TYR TYR B . n 
Q  1  314 GLU 314 314 314 GLU GLU B . n 
Q  1  315 HIS 315 315 315 HIS HIS B . n 
Q  1  316 LEU 316 316 316 LEU LEU B . n 
Q  1  317 GLN 317 317 317 GLN GLN B . n 
Q  1  318 ALA 318 318 318 ALA ALA B . n 
Q  1  319 LYS 319 319 319 LYS LYS B . n 
Q  1  320 GLY 320 320 320 GLY GLY B . n 
Q  1  321 SER 321 321 321 SER SER B . n 
Q  1  322 MET 322 322 322 MET MET B . n 
Q  1  323 LEU 323 323 323 LEU LEU B . n 
Q  1  324 GLY 324 324 324 GLY GLY B . n 
Q  1  325 THR 325 325 325 THR THR B . n 
Q  1  326 GLY 326 326 326 GLY GLY B . n 
Q  1  327 GLY 327 327 327 GLY GLY B . n 
Q  1  328 VAL 328 328 328 VAL VAL B . n 
Q  1  329 ILE 329 329 329 ILE ILE B . n 
Q  1  330 LEU 330 330 330 LEU LEU B . n 
Q  1  331 ILE 331 331 331 ILE ILE B . n 
Q  1  332 PRO 332 332 332 PRO PRO B . n 
Q  1  333 GLU 333 333 333 GLU GLU B . n 
Q  1  334 ARG 334 334 334 ARG ARG B . n 
Q  1  335 VAL 335 335 335 VAL VAL B . n 
Q  1  336 SER 336 336 336 SER SER B . n 
Q  1  337 MET 337 337 337 MET MET B . n 
Q  1  338 VAL 338 338 338 VAL VAL B . n 
Q  1  339 ASP 339 339 339 ASP ASP B . n 
Q  1  340 ALA 340 340 340 ALA ALA B . n 
Q  1  341 MET 341 341 341 MET MET B . n 
Q  1  342 TRP 342 342 342 TRP TRP B . n 
Q  1  343 ASN 343 343 343 ASN ASN B . n 
Q  1  344 LEU 344 344 344 LEU LEU B . n 
Q  1  345 THR 345 345 345 THR THR B . n 
Q  1  346 ARG 346 346 346 ARG ARG B . n 
Q  1  347 PHE 347 347 347 PHE PHE B . n 
Q  1  348 TYR 348 348 348 TYR TYR B . n 
Q  1  349 ALA 349 349 349 ALA ALA B . n 
Q  1  350 HIS 350 350 350 HIS HIS B . n 
Q  1  351 GLU 351 351 351 GLU GLU B . n 
Q  1  352 SER 352 352 352 SER SER B . n 
Q  1  353 CYS 353 353 353 CYS CYS B . n 
Q  1  354 GLY 354 354 354 GLY GLY B . n 
Q  1  355 LYS 355 355 355 LYS LYS B . n 
Q  1  356 CYS 356 356 356 CYS CYS B . n 
Q  1  357 THR 357 357 357 THR THR B . n 
Q  1  358 PRO 358 358 358 PRO PRO B . n 
Q  1  359 CYS 359 359 359 CYS CYS B . n 
Q  1  360 ARG 360 360 360 ARG ARG B . n 
Q  1  361 GLU 361 361 361 GLU GLU B . n 
Q  1  362 GLY 362 362 362 GLY GLY B . n 
Q  1  363 VAL 363 363 363 VAL VAL B . n 
Q  1  364 ALA 364 364 364 ALA ALA B . n 
Q  1  365 GLY 365 365 365 GLY GLY B . n 
Q  1  366 PHE 366 366 366 PHE PHE B . n 
Q  1  367 MET 367 367 367 MET MET B . n 
Q  1  368 VAL 368 368 368 VAL VAL B . n 
Q  1  369 ASN 369 369 369 ASN ASN B . n 
Q  1  370 LEU 370 370 370 LEU LEU B . n 
Q  1  371 PHE 371 371 371 PHE PHE B . n 
Q  1  372 ALA 372 372 372 ALA ALA B . n 
Q  1  373 LYS 373 373 373 LYS LYS B . n 
Q  1  374 ILE 374 374 374 ILE ILE B . n 
Q  1  375 GLY 375 375 375 GLY GLY B . n 
Q  1  376 THR 376 376 376 THR THR B . n 
Q  1  377 GLY 377 377 377 GLY GLY B . n 
Q  1  378 GLN 378 378 378 GLN GLN B . n 
Q  1  379 GLY 379 379 379 GLY GLY B . n 
Q  1  380 GLU 380 380 380 GLU GLU B . n 
Q  1  381 GLU 381 381 381 GLU GLU B . n 
Q  1  382 LYS 382 382 382 LYS LYS B . n 
Q  1  383 ASP 383 383 383 ASP ASP B . n 
Q  1  384 VAL 384 384 384 VAL VAL B . n 
Q  1  385 GLU 385 385 385 GLU GLU B . n 
Q  1  386 ASN 386 386 386 ASN ASN B . n 
Q  1  387 LEU 387 387 387 LEU LEU B . n 
Q  1  388 GLU 388 388 388 GLU GLU B . n 
Q  1  389 ALA 389 389 389 ALA ALA B . n 
Q  1  390 LEU 390 390 390 LEU LEU B . n 
Q  1  391 LEU 391 391 391 LEU LEU B . n 
Q  1  392 PRO 392 392 392 PRO PRO B . n 
Q  1  393 LEU 393 393 393 LEU LEU B . n 
Q  1  394 ILE 394 394 394 ILE ILE B . n 
Q  1  395 GLU 395 395 395 GLU GLU B . n 
Q  1  396 GLY 396 396 396 GLY GLY B . n 
Q  1  397 ARG 397 397 397 ARG ARG B . n 
Q  1  398 SER 398 398 398 SER SER B . n 
Q  1  399 PHE 399 399 399 PHE PHE B . n 
Q  1  400 CYS 400 400 400 CYS CYS B . n 
Q  1  401 PRO 401 401 401 PRO PRO B . n 
Q  1  402 LEU 402 402 402 LEU LEU B . n 
Q  1  403 ALA 403 403 403 ALA ALA B . n 
Q  1  404 ASP 404 404 404 ASP ASP B . n 
Q  1  405 ALA 405 405 405 ALA ALA B . n 
Q  1  406 ALA 406 406 406 ALA ALA B . n 
Q  1  407 VAL 407 407 407 VAL VAL B . n 
Q  1  408 TRP 408 408 408 TRP TRP B . n 
Q  1  409 PRO 409 409 409 PRO PRO B . n 
Q  1  410 VAL 410 410 410 VAL VAL B . n 
Q  1  411 LYS 411 411 411 LYS LYS B . n 
Q  1  412 GLY 412 412 412 GLY GLY B . n 
Q  1  413 SER 413 413 413 SER SER B . n 
Q  1  414 LEU 414 414 414 LEU LEU B . n 
Q  1  415 ARG 415 415 415 ARG ARG B . n 
Q  1  416 HIS 416 416 416 HIS HIS B . n 
Q  1  417 PHE 417 417 417 PHE PHE B . n 
Q  1  418 LYS 418 418 418 LYS LYS B . n 
Q  1  419 ASP 419 419 419 ASP ASP B . n 
Q  1  420 GLN 420 420 420 GLN GLN B . n 
Q  1  421 TYR 421 421 421 TYR TYR B . n 
Q  1  422 LEU 422 422 422 LEU LEU B . n 
Q  1  423 ALA 423 423 423 ALA ALA B . n 
Q  1  424 LEU 424 424 424 LEU LEU B . n 
Q  1  425 ALA 425 425 425 ALA ALA B . n 
Q  1  426 ARG 426 426 426 ARG ARG B . n 
Q  1  427 GLU 427 427 427 GLU GLU B . n 
Q  1  428 LYS 428 428 428 LYS LYS B . n 
Q  1  429 ARG 429 429 429 ARG ARG B . n 
Q  1  430 PRO 430 430 430 PRO PRO B . n 
Q  1  431 VAL 431 431 431 VAL VAL B . n 
Q  1  432 PRO 432 432 432 PRO PRO B . n 
Q  1  433 ARG 433 433 433 ARG ARG B . n 
Q  1  434 PRO 434 434 434 PRO PRO B . n 
Q  1  435 SER 435 435 435 SER SER B . n 
Q  1  436 LEU 436 436 436 LEU LEU B . n 
Q  1  437 TRP 437 437 437 TRP TRP B . n 
Q  1  438 ARG 438 438 438 ARG ARG B . n 
R  2  1   MET 1   1   ?   ?   ?   C . n 
R  2  2   GLY 2   2   ?   ?   ?   C . n 
R  2  3   PHE 3   3   3   PHE PHE C . n 
R  2  4   PHE 4   4   4   PHE PHE C . n 
R  2  5   ASP 5   5   5   ASP ASP C . n 
R  2  6   ASP 6   6   6   ASP ASP C . n 
R  2  7   LYS 7   7   7   LYS LYS C . n 
R  2  8   GLN 8   8   8   GLN GLN C . n 
R  2  9   ASP 9   9   9   ASP ASP C . n 
R  2  10  PHE 10  10  10  PHE PHE C . n 
R  2  11  LEU 11  11  11  LEU LEU C . n 
R  2  12  GLU 12  12  12  GLU GLU C . n 
R  2  13  GLU 13  13  13  GLU GLU C . n 
R  2  14  THR 14  14  14  THR THR C . n 
R  2  15  PHE 15  15  15  PHE PHE C . n 
R  2  16  ALA 16  16  16  ALA ALA C . n 
R  2  17  LYS 17  17  17  LYS LYS C . n 
R  2  18  TYR 18  18  18  TYR TYR C . n 
R  2  19  PRO 19  19  19  PRO PRO C . n 
R  2  20  PRO 20  20  20  PRO PRO C . n 
R  2  21  GLU 21  21  21  GLU GLU C . n 
R  2  22  GLY 22  22  22  GLY GLY C . n 
R  2  23  ARG 23  23  23  ARG ARG C . n 
R  2  24  ARG 24  24  24  ARG ARG C . n 
R  2  25  ALA 25  25  25  ALA ALA C . n 
R  2  26  ALA 26  26  26  ALA ALA C . n 
R  2  27  ILE 27  27  27  ILE ILE C . n 
R  2  28  MET 28  28  28  MET MET C . n 
R  2  29  PRO 29  29  29  PRO PRO C . n 
R  2  30  LEU 30  30  30  LEU LEU C . n 
R  2  31  LEU 31  31  31  LEU LEU C . n 
R  2  32  ARG 32  32  32  ARG ARG C . n 
R  2  33  ARG 33  33  33  ARG ARG C . n 
R  2  34  VAL 34  34  34  VAL VAL C . n 
R  2  35  GLN 35  35  35  GLN GLN C . n 
R  2  36  GLN 36  36  36  GLN GLN C . n 
R  2  37  GLU 37  37  37  GLU GLU C . n 
R  2  38  GLU 38  38  38  GLU GLU C . n 
R  2  39  GLY 39  39  39  GLY GLY C . n 
R  2  40  TRP 40  40  40  TRP TRP C . n 
R  2  41  ILE 41  41  41  ILE ILE C . n 
R  2  42  ARG 42  42  42  ARG ARG C . n 
R  2  43  PRO 43  43  43  PRO PRO C . n 
R  2  44  GLU 44  44  44  GLU GLU C . n 
R  2  45  ARG 45  45  45  ARG ARG C . n 
R  2  46  ILE 46  46  46  ILE ILE C . n 
R  2  47  GLU 47  47  47  GLU GLU C . n 
R  2  48  GLU 48  48  48  GLU GLU C . n 
R  2  49  ILE 49  49  49  ILE ILE C . n 
R  2  50  ALA 50  50  50  ALA ALA C . n 
R  2  51  ARG 51  51  51  ARG ARG C . n 
R  2  52  LEU 52  52  52  LEU LEU C . n 
R  2  53  VAL 53  53  53  VAL VAL C . n 
R  2  54  GLY 54  54  54  GLY GLY C . n 
R  2  55  THR 55  55  55  THR THR C . n 
R  2  56  THR 56  56  56  THR THR C . n 
R  2  57  PRO 57  57  57  PRO PRO C . n 
R  2  58  THR 58  58  58  THR THR C . n 
R  2  59  GLU 59  59  59  GLU GLU C . n 
R  2  60  VAL 60  60  60  VAL VAL C . n 
R  2  61  MET 61  61  61  MET MET C . n 
R  2  62  GLY 62  62  62  GLY GLY C . n 
R  2  63  VAL 63  63  63  VAL VAL C . n 
R  2  64  ALA 64  64  64  ALA ALA C . n 
R  2  65  SER 65  65  65  SER SER C . n 
R  2  66  PHE 66  66  66  PHE PHE C . n 
R  2  67  TYR 67  67  67  TYR TYR C . n 
R  2  68  SER 68  68  68  SER SER C . n 
R  2  69  TYR 69  69  69  TYR TYR C . n 
R  2  70  TYR 70  70  70  TYR TYR C . n 
R  2  71  GLN 71  71  71  GLN GLN C . n 
R  2  72  PHE 72  72  72  PHE PHE C . n 
R  2  73  VAL 73  73  73  VAL VAL C . n 
R  2  74  PRO 74  74  74  PRO PRO C . n 
R  2  75  THR 75  75  75  THR THR C . n 
R  2  76  GLY 76  76  76  GLY GLY C . n 
R  2  77  LYS 77  77  77  LYS LYS C . n 
R  2  78  TYR 78  78  78  TYR TYR C . n 
R  2  79  HIS 79  79  79  HIS HIS C . n 
R  2  80  LEU 80  80  80  LEU LEU C . n 
R  2  81  GLN 81  81  81  GLN GLN C . n 
R  2  82  VAL 82  82  82  VAL VAL C . n 
R  2  83  CYS 83  83  83  CYS CYS C . n 
R  2  84  ALA 84  84  84  ALA ALA C . n 
R  2  85  THR 85  85  85  THR THR C . n 
R  2  86  LEU 86  86  86  LEU LEU C . n 
R  2  87  SER 87  87  87  SER SER C . n 
R  2  88  CYS 88  88  88  CYS CYS C . n 
R  2  89  LYS 89  89  89  LYS LYS C . n 
R  2  90  LEU 90  90  90  LEU LEU C . n 
R  2  91  ALA 91  91  91  ALA ALA C . n 
R  2  92  GLY 92  92  92  GLY GLY C . n 
R  2  93  ALA 93  93  93  ALA ALA C . n 
R  2  94  GLU 94  94  94  GLU GLU C . n 
R  2  95  GLU 95  95  95  GLU GLU C . n 
R  2  96  LEU 96  96  96  LEU LEU C . n 
R  2  97  TRP 97  97  97  TRP TRP C . n 
R  2  98  ASP 98  98  98  ASP ASP C . n 
R  2  99  TYR 99  99  99  TYR TYR C . n 
R  2  100 LEU 100 100 100 LEU LEU C . n 
R  2  101 THR 101 101 101 THR THR C . n 
R  2  102 GLU 102 102 102 GLU GLU C . n 
R  2  103 THR 103 103 103 THR THR C . n 
R  2  104 LEU 104 104 104 LEU LEU C . n 
R  2  105 GLY 105 105 105 GLY GLY C . n 
R  2  106 ILE 106 106 106 ILE ILE C . n 
R  2  107 GLY 107 107 107 GLY GLY C . n 
R  2  108 PRO 108 108 108 PRO PRO C . n 
R  2  109 GLY 109 109 109 GLY GLY C . n 
R  2  110 GLU 110 110 110 GLU GLU C . n 
R  2  111 VAL 111 111 111 VAL VAL C . n 
R  2  112 THR 112 112 112 THR THR C . n 
R  2  113 PRO 113 113 113 PRO PRO C . n 
R  2  114 ASP 114 114 114 ASP ASP C . n 
R  2  115 GLY 115 115 115 GLY GLY C . n 
R  2  116 LEU 116 116 116 LEU LEU C . n 
R  2  117 PHE 117 117 117 PHE PHE C . n 
R  2  118 SER 118 118 118 SER SER C . n 
R  2  119 VAL 119 119 119 VAL VAL C . n 
R  2  120 GLN 120 120 120 GLN GLN C . n 
R  2  121 LYS 121 121 121 LYS LYS C . n 
R  2  122 VAL 122 122 122 VAL VAL C . n 
R  2  123 GLU 123 123 123 GLU GLU C . n 
R  2  124 CYS 124 124 124 CYS CYS C . n 
R  2  125 LEU 125 125 125 LEU LEU C . n 
R  2  126 GLY 126 126 126 GLY GLY C . n 
R  2  127 SER 127 127 127 SER SER C . n 
R  2  128 CYS 128 128 128 CYS CYS C . n 
R  2  129 HIS 129 129 129 HIS HIS C . n 
R  2  130 THR 130 130 130 THR THR C . n 
R  2  131 ALA 131 131 131 ALA ALA C . n 
R  2  132 PRO 132 132 132 PRO PRO C . n 
R  2  133 VAL 133 133 133 VAL VAL C . n 
R  2  134 ILE 134 134 134 ILE ILE C . n 
R  2  135 GLN 135 135 135 GLN GLN C . n 
R  2  136 VAL 136 136 136 VAL VAL C . n 
R  2  137 ASN 137 137 137 ASN ASN C . n 
R  2  138 ASP 138 138 138 ASP ASP C . n 
R  2  139 GLU 139 139 139 GLU GLU C . n 
R  2  140 PRO 140 140 140 PRO PRO C . n 
R  2  141 TYR 141 141 141 TYR TYR C . n 
R  2  142 VAL 142 142 142 VAL VAL C . n 
R  2  143 GLU 143 143 143 GLU GLU C . n 
R  2  144 CYS 144 144 144 CYS CYS C . n 
R  2  145 VAL 145 145 145 VAL VAL C . n 
R  2  146 THR 146 146 146 THR THR C . n 
R  2  147 ARG 147 147 147 ARG ARG C . n 
R  2  148 ALA 148 148 148 ALA ALA C . n 
R  2  149 ARG 149 149 149 ARG ARG C . n 
R  2  150 LEU 150 150 150 LEU LEU C . n 
R  2  151 GLU 151 151 151 GLU GLU C . n 
R  2  152 ALA 152 152 152 ALA ALA C . n 
R  2  153 LEU 153 153 153 LEU LEU C . n 
R  2  154 LEU 154 154 154 LEU LEU C . n 
R  2  155 ALA 155 155 155 ALA ALA C . n 
R  2  156 GLY 156 156 156 GLY GLY C . n 
R  2  157 LEU 157 157 157 LEU LEU C . n 
R  2  158 ARG 158 158 158 ARG ARG C . n 
R  2  159 ALA 159 159 159 ALA ALA C . n 
R  2  160 GLY 160 160 160 GLY GLY C . n 
R  2  161 LYS 161 161 161 LYS LYS C . n 
R  2  162 ARG 162 162 162 ARG ARG C . n 
R  2  163 LEU 163 163 163 LEU LEU C . n 
R  2  164 GLU 164 164 164 GLU GLU C . n 
R  2  165 GLU 165 165 165 GLU GLU C . n 
R  2  166 ILE 166 166 166 ILE ILE C . n 
R  2  167 GLU 167 167 167 GLU GLU C . n 
R  2  168 LEU 168 168 168 LEU LEU C . n 
R  2  169 PRO 169 169 169 PRO PRO C . n 
R  2  170 GLY 170 170 170 GLY GLY C . n 
R  2  171 LYS 171 171 171 LYS LYS C . n 
R  2  172 CYS 172 172 172 CYS CYS C . n 
R  2  173 GLY 173 173 173 GLY GLY C . n 
R  2  174 HIS 174 174 174 HIS HIS C . n 
R  2  175 HIS 175 175 175 HIS HIS C . n 
R  2  176 VAL 176 176 176 VAL VAL C . n 
R  2  177 HIS 177 177 177 HIS HIS C . n 
R  2  178 GLU 178 178 178 GLU GLU C . n 
R  2  179 VAL 179 179 179 VAL VAL C . n 
R  2  180 GLU 180 180 180 GLU GLU C . n 
R  2  181 VAL 181 181 ?   ?   ?   C . n 
S  3  1   MET 1   1   1   MET MET D . n 
S  3  2   VAL 2   2   2   VAL VAL D . n 
S  3  3   ARG 3   3   3   ARG ARG D . n 
S  3  4   VAL 4   4   4   VAL VAL D . n 
S  3  5   LYS 5   5   5   LYS LYS D . n 
S  3  6   VAL 6   6   6   VAL VAL D . n 
S  3  7   ASN 7   7   7   ASN ASN D . n 
S  3  8   ASP 8   8   8   ASP ASP D . n 
S  3  9   ARG 9   9   9   ARG ARG D . n 
S  3  10  ILE 10  10  10  ILE ILE D . n 
S  3  11  VAL 11  11  11  VAL VAL D . n 
S  3  12  GLU 12  12  12  GLU GLU D . n 
S  3  13  VAL 13  13  13  VAL VAL D . n 
S  3  14  PRO 14  14  14  PRO PRO D . n 
S  3  15  PRO 15  15  15  PRO PRO D . n 
S  3  16  GLY 16  16  16  GLY GLY D . n 
S  3  17  THR 17  17  17  THR THR D . n 
S  3  18  SER 18  18  18  SER SER D . n 
S  3  19  VAL 19  19  19  VAL VAL D . n 
S  3  20  MET 20  20  20  MET MET D . n 
S  3  21  ASP 21  21  21  ASP ASP D . n 
S  3  22  ALA 22  22  22  ALA ALA D . n 
S  3  23  VAL 23  23  23  VAL VAL D . n 
S  3  24  PHE 24  24  24  PHE PHE D . n 
S  3  25  HIS 25  25  25  HIS HIS D . n 
S  3  26  ALA 26  26  26  ALA ALA D . n 
S  3  27  GLY 27  27  27  GLY GLY D . n 
S  3  28  TYR 28  28  28  TYR TYR D . n 
S  3  29  ASP 29  29  29  ASP ASP D . n 
S  3  30  VAL 30  30  30  VAL VAL D . n 
S  3  31  PRO 31  31  31  PRO PRO D . n 
S  3  32  LEU 32  32  32  LEU LEU D . n 
S  3  33  PHE 33  33  33  PHE PHE D . n 
S  3  34  CYS 34  34  34  CYS CYS D . n 
S  3  35  SER 35  35  35  SER SER D . n 
S  3  36  GLU 36  36  36  GLU GLU D . n 
S  3  37  LYS 37  37  37  LYS LYS D . n 
S  3  38  HIS 38  38  38  HIS HIS D . n 
S  3  39  LEU 39  39  39  LEU LEU D . n 
S  3  40  SER 40  40  40  SER SER D . n 
S  3  41  PRO 41  41  41  PRO PRO D . n 
S  3  42  ILE 42  42  42  ILE ILE D . n 
S  3  43  GLY 43  43  43  GLY GLY D . n 
S  3  44  ALA 44  44  44  ALA ALA D . n 
S  3  45  CYS 45  45  45  CYS CYS D . n 
S  3  46  ARG 46  46  46  ARG ARG D . n 
S  3  47  MET 47  47  47  MET MET D . n 
S  3  48  CYS 48  48  48  CYS CYS D . n 
S  3  49  LEU 49  49  49  LEU LEU D . n 
S  3  50  VAL 50  50  50  VAL VAL D . n 
S  3  51  ARG 51  51  51  ARG ARG D . n 
S  3  52  ILE 52  52  52  ILE ILE D . n 
S  3  53  GLY 53  53  53  GLY GLY D . n 
S  3  54  LEU 54  54  54  LEU LEU D . n 
S  3  55  PRO 55  55  55  PRO PRO D . n 
S  3  56  LYS 56  56  ?   ?   ?   D . n 
S  3  57  LYS 57  57  ?   ?   ?   D . n 
S  3  58  GLY 58  58  ?   ?   ?   D . n 
S  3  59  PRO 59  59  ?   ?   ?   D . n 
S  3  60  ASP 60  60  ?   ?   ?   D . n 
S  3  61  GLY 61  61  ?   ?   ?   D . n 
S  3  62  LYS 62  62  ?   ?   ?   D . n 
S  3  63  PRO 63  63  ?   ?   ?   D . n 
S  3  64  LEU 64  64  ?   ?   ?   D . n 
S  3  65  LEU 65  65  ?   ?   ?   D . n 
S  3  66  ASN 66  66  ?   ?   ?   D . n 
S  3  67  GLU 67  67  ?   ?   ?   D . n 
S  3  68  LYS 68  68  ?   ?   ?   D . n 
S  3  69  GLY 69  69  ?   ?   ?   D . n 
S  3  70  GLU 70  70  ?   ?   ?   D . n 
S  3  71  PRO 71  71  ?   ?   ?   D . n 
S  3  72  GLU 72  72  ?   ?   ?   D . n 
S  3  73  ILE 73  73  73  ILE ILE D . n 
S  3  74  GLN 74  74  74  GLN GLN D . n 
S  3  75  TRP 75  75  75  TRP TRP D . n 
S  3  76  GLN 76  76  76  GLN GLN D . n 
S  3  77  PRO 77  77  77  PRO PRO D . n 
S  3  78  LYS 78  78  78  LYS LYS D . n 
S  3  79  LEU 79  79  79  LEU LEU D . n 
S  3  80  ALA 80  80  80  ALA ALA D . n 
S  3  81  ALA 81  81  81  ALA ALA D . n 
S  3  82  SER 82  82  82  SER SER D . n 
S  3  83  CYS 83  83  83  CYS CYS D . n 
S  3  84  VAL 84  84  84  VAL VAL D . n 
S  3  85  THR 85  85  85  THR THR D . n 
S  3  86  ALA 86  86  86  ALA ALA D . n 
S  3  87  VAL 87  87  87  VAL VAL D . n 
S  3  88  ALA 88  88  88  ALA ALA D . n 
S  3  89  ASP 89  89  89  ASP ASP D . n 
S  3  90  GLY 90  90  90  GLY GLY D . n 
S  3  91  MET 91  91  91  MET MET D . n 
S  3  92  VAL 92  92  92  VAL VAL D . n 
S  3  93  VAL 93  93  93  VAL VAL D . n 
S  3  94  ASP 94  94  94  ASP ASP D . n 
S  3  95  THR 95  95  95  THR THR D . n 
S  3  96  LEU 96  96  96  LEU LEU D . n 
S  3  97  SER 97  97  97  SER SER D . n 
S  3  98  ASP 98  98  98  ASP ASP D . n 
S  3  99  VAL 99  99  99  VAL VAL D . n 
S  3  100 VAL 100 100 100 VAL VAL D . n 
S  3  101 ARG 101 101 101 ARG ARG D . n 
S  3  102 GLU 102 102 102 GLU GLU D . n 
S  3  103 ALA 103 103 103 ALA ALA D . n 
S  3  104 GLN 104 104 104 GLN GLN D . n 
S  3  105 ALA 105 105 105 ALA ALA D . n 
S  3  106 GLY 106 106 106 GLY GLY D . n 
S  3  107 MET 107 107 107 MET MET D . n 
S  3  108 VAL 108 108 108 VAL VAL D . n 
S  3  109 GLU 109 109 109 GLU GLU D . n 
S  3  110 PHE 110 110 110 PHE PHE D . n 
S  3  111 THR 111 111 111 THR THR D . n 
S  3  112 LEU 112 112 112 LEU LEU D . n 
S  3  113 LEU 113 113 113 LEU LEU D . n 
S  3  114 ASN 114 114 114 ASN ASN D . n 
S  3  115 HIS 115 115 115 HIS HIS D . n 
S  3  116 PRO 116 116 116 PRO PRO D . n 
S  3  117 LEU 117 117 117 LEU LEU D . n 
S  3  118 ASP 118 118 118 ASP ASP D . n 
S  3  119 CYS 119 119 119 CYS CYS D . n 
S  3  120 PRO 120 120 120 PRO PRO D . n 
S  3  121 THR 121 121 121 THR THR D . n 
S  3  122 CYS 122 122 122 CYS CYS D . n 
S  3  123 ASP 123 123 123 ASP ASP D . n 
S  3  124 LYS 124 124 124 LYS LYS D . n 
S  3  125 GLY 125 125 125 GLY GLY D . n 
S  3  126 GLY 126 126 126 GLY GLY D . n 
S  3  127 ALA 127 127 127 ALA ALA D . n 
S  3  128 CYS 128 128 128 CYS CYS D . n 
S  3  129 GLU 129 129 129 GLU GLU D . n 
S  3  130 LEU 130 130 130 LEU LEU D . n 
S  3  131 GLN 131 131 131 GLN GLN D . n 
S  3  132 ASP 132 132 132 ASP ASP D . n 
S  3  133 ARG 133 133 133 ARG ARG D . n 
S  3  134 THR 134 134 134 THR THR D . n 
S  3  135 VAL 135 135 135 VAL VAL D . n 
S  3  136 GLU 136 136 136 GLU GLU D . n 
S  3  137 TYR 137 137 137 TYR TYR D . n 
S  3  138 GLY 138 138 138 GLY GLY D . n 
S  3  139 LEU 139 139 139 LEU LEU D . n 
S  3  140 TYR 140 140 140 TYR TYR D . n 
S  3  141 GLU 141 141 141 GLU GLU D . n 
S  3  142 LYS 142 142 142 LYS LYS D . n 
S  3  143 TYR 143 143 143 TYR TYR D . n 
S  3  144 TYR 144 144 ?   ?   ?   D . n 
S  3  145 GLN 145 145 ?   ?   ?   D . n 
S  3  146 LYS 146 146 ?   ?   ?   D . n 
S  3  147 GLY 147 147 ?   ?   ?   D . n 
S  3  148 PRO 148 148 148 PRO PRO D . n 
S  3  149 LEU 149 149 149 LEU LEU D . n 
S  3  150 GLU 150 150 150 GLU GLU D . n 
S  3  151 LEU 151 151 151 LEU LEU D . n 
S  3  152 PRO 152 152 152 PRO PRO D . n 
S  3  153 VAL 153 153 153 VAL VAL D . n 
S  3  154 TYR 154 154 154 TYR TYR D . n 
S  3  155 THR 155 155 155 THR THR D . n 
S  3  156 ARG 156 156 156 ARG ARG D . n 
S  3  157 PHE 157 157 157 PHE PHE D . n 
S  3  158 GLU 158 158 158 GLU GLU D . n 
S  3  159 PHE 159 159 159 PHE PHE D . n 
S  3  160 THR 160 160 160 THR THR D . n 
S  3  161 ARG 161 161 161 ARG ARG D . n 
S  3  162 ARG 162 162 162 ARG ARG D . n 
S  3  163 HIS 163 163 163 HIS HIS D . n 
S  3  164 VAL 164 164 164 VAL VAL D . n 
S  3  165 ASP 165 165 165 ASP ASP D . n 
S  3  166 LYS 166 166 166 LYS LYS D . n 
S  3  167 HIS 167 167 167 HIS HIS D . n 
S  3  168 HIS 168 168 168 HIS HIS D . n 
S  3  169 PRO 169 169 169 PRO PRO D . n 
S  3  170 LEU 170 170 170 LEU LEU D . n 
S  3  171 SER 171 171 171 SER SER D . n 
S  3  172 PRO 172 172 172 PRO PRO D . n 
S  3  173 PHE 173 173 173 PHE PHE D . n 
S  3  174 VAL 174 174 174 VAL VAL D . n 
S  3  175 ILE 175 175 175 ILE ILE D . n 
S  3  176 LEU 176 176 176 LEU LEU D . n 
S  3  177 ASP 177 177 177 ASP ASP D . n 
S  3  178 ARG 178 178 178 ARG ARG D . n 
S  3  179 GLU 179 179 179 GLU GLU D . n 
S  3  180 ARG 180 180 180 ARG ARG D . n 
S  3  181 CYS 181 181 181 CYS CYS D . n 
S  3  182 ILE 182 182 182 ILE ILE D . n 
S  3  183 HIS 183 183 183 HIS HIS D . n 
S  3  184 CYS 184 184 184 CYS CYS D . n 
S  3  185 LYS 185 185 185 LYS LYS D . n 
S  3  186 ARG 186 186 186 ARG ARG D . n 
S  3  187 CYS 187 187 187 CYS CYS D . n 
S  3  188 VAL 188 188 188 VAL VAL D . n 
S  3  189 ARG 189 189 189 ARG ARG D . n 
S  3  190 TYR 190 190 190 TYR TYR D . n 
S  3  191 PHE 191 191 191 PHE PHE D . n 
S  3  192 GLU 192 192 192 GLU GLU D . n 
S  3  193 GLU 193 193 193 GLU GLU D . n 
S  3  194 VAL 194 194 194 VAL VAL D . n 
S  3  195 PRO 195 195 195 PRO PRO D . n 
S  3  196 GLY 196 196 196 GLY GLY D . n 
S  3  197 ASP 197 197 197 ASP ASP D . n 
S  3  198 GLU 198 198 198 GLU GLU D . n 
S  3  199 VAL 199 199 199 VAL VAL D . n 
S  3  200 LEU 200 200 200 LEU LEU D . n 
S  3  201 ASP 201 201 201 ASP ASP D . n 
S  3  202 PHE 202 202 202 PHE PHE D . n 
S  3  203 ILE 203 203 203 ILE ILE D . n 
S  3  204 GLU 204 204 204 GLU GLU D . n 
S  3  205 ARG 205 205 205 ARG ARG D . n 
S  3  206 GLY 206 206 206 GLY GLY D . n 
S  3  207 VAL 207 207 207 VAL VAL D . n 
S  3  208 HIS 208 208 208 HIS HIS D . n 
S  3  209 THR 209 209 209 THR THR D . n 
S  3  210 PHE 210 210 210 PHE PHE D . n 
S  3  211 ILE 211 211 211 ILE ILE D . n 
S  3  212 GLY 212 212 212 GLY GLY D . n 
S  3  213 THR 213 213 213 THR THR D . n 
S  3  214 MET 214 214 214 MET MET D . n 
S  3  215 ASP 215 215 215 ASP ASP D . n 
S  3  216 PHE 216 216 216 PHE PHE D . n 
S  3  217 GLY 217 217 217 GLY GLY D . n 
S  3  218 LEU 218 218 218 LEU LEU D . n 
S  3  219 PRO 219 219 219 PRO PRO D . n 
S  3  220 SER 220 220 220 SER SER D . n 
S  3  221 GLY 221 221 221 GLY GLY D . n 
S  3  222 PHE 222 222 222 PHE PHE D . n 
S  3  223 SER 223 223 223 SER SER D . n 
S  3  224 GLY 224 224 224 GLY GLY D . n 
S  3  225 ASN 225 225 225 ASN ASN D . n 
S  3  226 ILE 226 226 226 ILE ILE D . n 
S  3  227 THR 227 227 227 THR THR D . n 
S  3  228 ASP 228 228 228 ASP ASP D . n 
S  3  229 ILE 229 229 229 ILE ILE D . n 
S  3  230 CYS 230 230 230 CYS CYS D . n 
S  3  231 PRO 231 231 231 PRO PRO D . n 
S  3  232 VAL 232 232 232 VAL VAL D . n 
S  3  233 GLY 233 233 233 GLY GLY D . n 
S  3  234 ALA 234 234 234 ALA ALA D . n 
S  3  235 LEU 235 235 235 LEU LEU D . n 
S  3  236 LEU 236 236 236 LEU LEU D . n 
S  3  237 ASP 237 237 237 ASP ASP D . n 
S  3  238 LEU 238 238 238 LEU LEU D . n 
S  3  239 THR 239 239 239 THR THR D . n 
S  3  240 ALA 240 240 240 ALA ALA D . n 
S  3  241 ARG 241 241 241 ARG ARG D . n 
S  3  242 PHE 242 242 242 PHE PHE D . n 
S  3  243 ARG 243 243 243 ARG ARG D . n 
S  3  244 ALA 244 244 244 ALA ALA D . n 
S  3  245 ARG 245 245 245 ARG ARG D . n 
S  3  246 ASN 246 246 246 ASN ASN D . n 
S  3  247 TRP 247 247 247 TRP TRP D . n 
S  3  248 GLU 248 248 248 GLU GLU D . n 
S  3  249 MET 249 249 249 MET MET D . n 
S  3  250 GLU 250 250 250 GLU GLU D . n 
S  3  251 GLU 251 251 251 GLU GLU D . n 
S  3  252 THR 252 252 252 THR THR D . n 
S  3  253 PRO 253 253 253 PRO PRO D . n 
S  3  254 THR 254 254 254 THR THR D . n 
S  3  255 THR 255 255 255 THR THR D . n 
S  3  256 CYS 256 256 256 CYS CYS D . n 
S  3  257 ALA 257 257 257 ALA ALA D . n 
S  3  258 LEU 258 258 258 LEU LEU D . n 
S  3  259 CYS 259 259 259 CYS CYS D . n 
S  3  260 PRO 260 260 260 PRO PRO D . n 
S  3  261 VAL 261 261 261 VAL VAL D . n 
S  3  262 GLY 262 262 262 GLY GLY D . n 
S  3  263 CYS 263 263 263 CYS CYS D . n 
S  3  264 GLY 264 264 264 GLY GLY D . n 
S  3  265 ILE 265 265 265 ILE ILE D . n 
S  3  266 THR 266 266 266 THR THR D . n 
S  3  267 ALA 267 267 267 ALA ALA D . n 
S  3  268 ASP 268 268 268 ASP ASP D . n 
S  3  269 THR 269 269 269 THR THR D . n 
S  3  270 ARG 270 270 270 ARG ARG D . n 
S  3  271 SER 271 271 271 SER SER D . n 
S  3  272 GLY 272 272 272 GLY GLY D . n 
S  3  273 GLU 273 273 273 GLU GLU D . n 
S  3  274 LEU 274 274 274 LEU LEU D . n 
S  3  275 LEU 275 275 275 LEU LEU D . n 
S  3  276 ARG 276 276 276 ARG ARG D . n 
S  3  277 ILE 277 277 277 ILE ILE D . n 
S  3  278 ARG 278 278 278 ARG ARG D . n 
S  3  279 ALA 279 279 279 ALA ALA D . n 
S  3  280 ARG 280 280 280 ARG ARG D . n 
S  3  281 GLU 281 281 281 GLU GLU D . n 
S  3  282 VAL 282 282 282 VAL VAL D . n 
S  3  283 PRO 283 283 283 PRO PRO D . n 
S  3  284 GLU 284 284 284 GLU GLU D . n 
S  3  285 VAL 285 285 285 VAL VAL D . n 
S  3  286 ASN 286 286 286 ASN ASN D . n 
S  3  287 GLU 287 287 287 GLU GLU D . n 
S  3  288 ILE 288 288 288 ILE ILE D . n 
S  3  289 TRP 289 289 289 TRP TRP D . n 
S  3  290 ILE 290 290 290 ILE ILE D . n 
S  3  291 CYS 291 291 291 CYS CYS D . n 
S  3  292 ASP 292 292 292 ASP ASP D . n 
S  3  293 ALA 293 293 293 ALA ALA D . n 
S  3  294 GLY 294 294 294 GLY GLY D . n 
S  3  295 ARG 295 295 295 ARG ARG D . n 
S  3  296 PHE 296 296 296 PHE PHE D . n 
S  3  297 GLY 297 297 297 GLY GLY D . n 
S  3  298 HIS 298 298 298 HIS HIS D . n 
S  3  299 GLU 299 299 299 GLU GLU D . n 
S  3  300 TRP 300 300 300 TRP TRP D . n 
S  3  301 ALA 301 301 301 ALA ALA D . n 
S  3  302 ASP 302 302 302 ASP ASP D . n 
S  3  303 GLN 303 303 303 GLN GLN D . n 
S  3  304 ASN 304 304 304 ASN ASN D . n 
S  3  305 ARG 305 305 305 ARG ARG D . n 
S  3  306 LEU 306 306 306 LEU LEU D . n 
S  3  307 LYS 307 307 307 LYS LYS D . n 
S  3  308 THR 308 308 308 THR THR D . n 
S  3  309 PRO 309 309 309 PRO PRO D . n 
S  3  310 LEU 310 310 310 LEU LEU D . n 
S  3  311 VAL 311 311 311 VAL VAL D . n 
S  3  312 ARG 312 312 312 ARG ARG D . n 
S  3  313 LYS 313 313 313 LYS LYS D . n 
S  3  314 GLU 314 314 314 GLU GLU D . n 
S  3  315 GLY 315 315 315 GLY GLY D . n 
S  3  316 ARG 316 316 316 ARG ARG D . n 
S  3  317 LEU 317 317 317 LEU LEU D . n 
S  3  318 VAL 318 318 318 VAL VAL D . n 
S  3  319 GLU 319 319 319 GLU GLU D . n 
S  3  320 ALA 320 320 320 ALA ALA D . n 
S  3  321 THR 321 321 321 THR THR D . n 
S  3  322 TRP 322 322 322 TRP TRP D . n 
S  3  323 GLU 323 323 323 GLU GLU D . n 
S  3  324 GLU 324 324 324 GLU GLU D . n 
S  3  325 ALA 325 325 325 ALA ALA D . n 
S  3  326 PHE 326 326 326 PHE PHE D . n 
S  3  327 LEU 327 327 327 LEU LEU D . n 
S  3  328 ALA 328 328 328 ALA ALA D . n 
S  3  329 LEU 329 329 329 LEU LEU D . n 
S  3  330 LYS 330 330 330 LYS LYS D . n 
S  3  331 GLU 331 331 331 GLU GLU D . n 
S  3  332 GLY 332 332 332 GLY GLY D . n 
S  3  333 LEU 333 333 333 LEU LEU D . n 
S  3  334 LYS 334 334 334 LYS LYS D . n 
S  3  335 GLU 335 335 335 GLU GLU D . n 
S  3  336 ALA 336 336 336 ALA ALA D . n 
S  3  337 ARG 337 337 337 ARG ARG D . n 
S  3  338 GLY 338 338 338 GLY GLY D . n 
S  3  339 GLU 339 339 339 GLU GLU D . n 
S  3  340 GLU 340 340 340 GLU GLU D . n 
S  3  341 VAL 341 341 341 VAL VAL D . n 
S  3  342 GLY 342 342 342 GLY GLY D . n 
S  3  343 LEU 343 343 343 LEU LEU D . n 
S  3  344 TYR 344 344 344 TYR TYR D . n 
S  3  345 LEU 345 345 345 LEU LEU D . n 
S  3  346 ALA 346 346 346 ALA ALA D . n 
S  3  347 HIS 347 347 347 HIS HIS D . n 
S  3  348 ASP 348 348 348 ASP ASP D . n 
S  3  349 ALA 349 349 349 ALA ALA D . n 
S  3  350 THR 350 350 350 THR THR D . n 
S  3  351 LEU 351 351 351 LEU LEU D . n 
S  3  352 GLU 352 352 352 GLU GLU D . n 
S  3  353 GLU 353 353 353 GLU GLU D . n 
S  3  354 GLY 354 354 354 GLY GLY D . n 
S  3  355 LEU 355 355 355 LEU LEU D . n 
S  3  356 LEU 356 356 356 LEU LEU D . n 
S  3  357 ALA 357 357 357 ALA ALA D . n 
S  3  358 SER 358 358 358 SER SER D . n 
S  3  359 GLU 359 359 359 GLU GLU D . n 
S  3  360 LEU 360 360 360 LEU LEU D . n 
S  3  361 ALA 361 361 361 ALA ALA D . n 
S  3  362 LYS 362 362 362 LYS LYS D . n 
S  3  363 ALA 363 363 363 ALA ALA D . n 
S  3  364 LEU 364 364 364 LEU LEU D . n 
S  3  365 LYS 365 365 365 LYS LYS D . n 
S  3  366 THR 366 366 366 THR THR D . n 
S  3  367 PRO 367 367 367 PRO PRO D . n 
S  3  368 HIS 368 368 368 HIS HIS D . n 
S  3  369 LEU 369 369 369 LEU LEU D . n 
S  3  370 ASP 370 370 370 ASP ASP D . n 
S  3  371 PHE 371 371 371 PHE PHE D . n 
S  3  372 GLN 372 372 372 GLN GLN D . n 
S  3  373 GLY 373 373 373 GLY GLY D . n 
S  3  374 ARG 374 374 374 ARG ARG D . n 
S  3  375 THR 375 375 375 THR THR D . n 
S  3  376 ALA 376 376 376 ALA ALA D . n 
S  3  377 ALA 377 377 377 ALA ALA D . n 
S  3  378 PRO 378 378 378 PRO PRO D . n 
S  3  379 ALA 379 379 379 ALA ALA D . n 
S  3  380 SER 380 380 380 SER SER D . n 
S  3  381 LEU 381 381 381 LEU LEU D . n 
S  3  382 PHE 382 382 382 PHE PHE D . n 
S  3  383 PRO 383 383 383 PRO PRO D . n 
S  3  384 PRO 384 384 384 PRO PRO D . n 
S  3  385 ALA 385 385 385 ALA ALA D . n 
S  3  386 SER 386 386 386 SER SER D . n 
S  3  387 LEU 387 387 387 LEU LEU D . n 
S  3  388 GLU 388 388 388 GLU GLU D . n 
S  3  389 ASP 389 389 389 ASP ASP D . n 
S  3  390 LEU 390 390 390 LEU LEU D . n 
S  3  391 LEU 391 391 391 LEU LEU D . n 
S  3  392 GLN 392 392 392 GLN GLN D . n 
S  3  393 ALA 393 393 393 ALA ALA D . n 
S  3  394 ASP 394 394 394 ASP ASP D . n 
S  3  395 PHE 395 395 395 PHE PHE D . n 
S  3  396 ALA 396 396 396 ALA ALA D . n 
S  3  397 LEU 397 397 397 LEU LEU D . n 
S  3  398 VAL 398 398 398 VAL VAL D . n 
S  3  399 LEU 399 399 399 LEU LEU D . n 
S  3  400 GLY 400 400 400 GLY GLY D . n 
S  3  401 ASP 401 401 401 ASP ASP D . n 
S  3  402 PRO 402 402 402 PRO PRO D . n 
S  3  403 THR 403 403 403 THR THR D . n 
S  3  404 GLU 404 404 404 GLU GLU D . n 
S  3  405 GLU 405 405 405 GLU GLU D . n 
S  3  406 ALA 406 406 406 ALA ALA D . n 
S  3  407 PRO 407 407 407 PRO PRO D . n 
S  3  408 ILE 408 408 408 ILE ILE D . n 
S  3  409 LEU 409 409 409 LEU LEU D . n 
S  3  410 HIS 410 410 410 HIS HIS D . n 
S  3  411 LEU 411 411 411 LEU LEU D . n 
S  3  412 ARG 412 412 412 ARG ARG D . n 
S  3  413 LEU 413 413 413 LEU LEU D . n 
S  3  414 SER 414 414 414 SER SER D . n 
S  3  415 GLU 415 415 415 GLU GLU D . n 
S  3  416 PHE 416 416 416 PHE PHE D . n 
S  3  417 VAL 417 417 417 VAL VAL D . n 
S  3  418 ARG 418 418 418 ARG ARG D . n 
S  3  419 ASP 419 419 419 ASP ASP D . n 
S  3  420 LEU 420 420 420 LEU LEU D . n 
S  3  421 LYS 421 421 421 LYS LYS D . n 
S  3  422 PRO 422 422 422 PRO PRO D . n 
S  3  423 PRO 423 423 423 PRO PRO D . n 
S  3  424 HIS 424 424 424 HIS HIS D . n 
S  3  425 ARG 425 425 425 ARG ARG D . n 
S  3  426 TYR 426 426 426 TYR TYR D . n 
S  3  427 ASN 427 427 427 ASN ASN D . n 
S  3  428 HIS 428 428 428 HIS HIS D . n 
S  3  429 GLY 429 429 429 GLY GLY D . n 
S  3  430 THR 430 430 430 THR THR D . n 
S  3  431 PRO 431 431 431 PRO PRO D . n 
S  3  432 PHE 432 432 432 PHE PHE D . n 
S  3  433 ALA 433 433 433 ALA ALA D . n 
S  3  434 ASP 434 434 434 ASP ASP D . n 
S  3  435 LEU 435 435 435 LEU LEU D . n 
S  3  436 GLN 436 436 436 GLN GLN D . n 
S  3  437 ILE 437 437 437 ILE ILE D . n 
S  3  438 LYS 438 438 438 LYS LYS D . n 
S  3  439 GLU 439 439 439 GLU GLU D . n 
S  3  440 ARG 440 440 440 ARG ARG D . n 
S  3  441 MET 441 441 441 MET MET D . n 
S  3  442 PRO 442 442 442 PRO PRO D . n 
S  3  443 ARG 443 443 443 ARG ARG D . n 
S  3  444 ARG 444 444 444 ARG ARG D . n 
S  3  445 THR 445 445 445 THR THR D . n 
S  3  446 ASP 446 446 446 ASP ASP D . n 
S  3  447 LYS 447 447 447 LYS LYS D . n 
S  3  448 MET 448 448 448 MET MET D . n 
S  3  449 ALA 449 449 449 ALA ALA D . n 
S  3  450 LEU 450 450 450 LEU LEU D . n 
S  3  451 PHE 451 451 451 PHE PHE D . n 
S  3  452 ALA 452 452 452 ALA ALA D . n 
S  3  453 PRO 453 453 453 PRO PRO D . n 
S  3  454 TYR 454 454 454 TYR TYR D . n 
S  3  455 ARG 455 455 455 ARG ARG D . n 
S  3  456 ALA 456 456 456 ALA ALA D . n 
S  3  457 PRO 457 457 457 PRO PRO D . n 
S  3  458 LEU 458 458 458 LEU LEU D . n 
S  3  459 MET 459 459 459 MET MET D . n 
S  3  460 LYS 460 460 460 LYS LYS D . n 
S  3  461 TRP 461 461 461 TRP TRP D . n 
S  3  462 ALA 462 462 462 ALA ALA D . n 
S  3  463 ALA 463 463 463 ALA ALA D . n 
S  3  464 ILE 464 464 464 ILE ILE D . n 
S  3  465 HIS 465 465 465 HIS HIS D . n 
S  3  466 GLU 466 466 466 GLU GLU D . n 
S  3  467 VAL 467 467 467 VAL VAL D . n 
S  3  468 HIS 468 468 468 HIS HIS D . n 
S  3  469 ARG 469 469 469 ARG ARG D . n 
S  3  470 PRO 470 470 470 PRO PRO D . n 
S  3  471 GLY 471 471 471 GLY GLY D . n 
S  3  472 GLU 472 472 472 GLU GLU D . n 
S  3  473 GLU 473 473 473 GLU GLU D . n 
S  3  474 ARG 474 474 474 ARG ARG D . n 
S  3  475 GLU 475 475 475 GLU GLU D . n 
S  3  476 ILE 476 476 476 ILE ILE D . n 
S  3  477 LEU 477 477 477 LEU LEU D . n 
S  3  478 LEU 478 478 478 LEU LEU D . n 
S  3  479 ALA 479 479 479 ALA ALA D . n 
S  3  480 LEU 480 480 480 LEU LEU D . n 
S  3  481 LEU 481 481 481 LEU LEU D . n 
S  3  482 GLY 482 482 482 GLY GLY D . n 
S  3  483 ASP 483 483 483 ASP ASP D . n 
S  3  484 LYS 484 484 484 LYS LYS D . n 
S  3  485 GLU 485 485 485 GLU GLU D . n 
S  3  486 GLY 486 486 486 GLY GLY D . n 
S  3  487 SER 487 487 487 SER SER D . n 
S  3  488 GLU 488 488 488 GLU GLU D . n 
S  3  489 MET 489 489 489 MET MET D . n 
S  3  490 VAL 490 490 490 VAL VAL D . n 
S  3  491 ALA 491 491 491 ALA ALA D . n 
S  3  492 LYS 492 492 492 LYS LYS D . n 
S  3  493 ALA 493 493 493 ALA ALA D . n 
S  3  494 LYS 494 494 494 LYS LYS D . n 
S  3  495 GLU 495 495 495 GLU GLU D . n 
S  3  496 ALA 496 496 496 ALA ALA D . n 
S  3  497 TRP 497 497 497 TRP TRP D . n 
S  3  498 GLU 498 498 498 GLU GLU D . n 
S  3  499 LYS 499 499 499 LYS LYS D . n 
S  3  500 ALA 500 500 500 ALA ALA D . n 
S  3  501 LYS 501 501 501 LYS LYS D . n 
S  3  502 ASN 502 502 502 ASN ASN D . n 
S  3  503 PRO 503 503 503 PRO PRO D . n 
S  3  504 VAL 504 504 504 VAL VAL D . n 
S  3  505 LEU 505 505 505 LEU LEU D . n 
S  3  506 ILE 506 506 506 ILE ILE D . n 
S  3  507 LEU 507 507 507 LEU LEU D . n 
S  3  508 GLY 508 508 508 GLY GLY D . n 
S  3  509 ALA 509 509 509 ALA ALA D . n 
S  3  510 GLY 510 510 510 GLY GLY D . n 
S  3  511 VAL 511 511 511 VAL VAL D . n 
S  3  512 LEU 512 512 512 LEU LEU D . n 
S  3  513 GLN 513 513 513 GLN GLN D . n 
S  3  514 ASP 514 514 514 ASP ASP D . n 
S  3  515 THR 515 515 515 THR THR D . n 
S  3  516 VAL 516 516 516 VAL VAL D . n 
S  3  517 ALA 517 517 517 ALA ALA D . n 
S  3  518 ALA 518 518 518 ALA ALA D . n 
S  3  519 GLU 519 519 519 GLU GLU D . n 
S  3  520 ARG 520 520 520 ARG ARG D . n 
S  3  521 ALA 521 521 521 ALA ALA D . n 
S  3  522 ARG 522 522 522 ARG ARG D . n 
S  3  523 LEU 523 523 523 LEU LEU D . n 
S  3  524 LEU 524 524 524 LEU LEU D . n 
S  3  525 ALA 525 525 525 ALA ALA D . n 
S  3  526 GLU 526 526 526 GLU GLU D . n 
S  3  527 ARG 527 527 527 ARG ARG D . n 
S  3  528 LYS 528 528 528 LYS LYS D . n 
S  3  529 GLY 529 529 529 GLY GLY D . n 
S  3  530 ALA 530 530 530 ALA ALA D . n 
S  3  531 LYS 531 531 531 LYS LYS D . n 
S  3  532 VAL 532 532 532 VAL VAL D . n 
S  3  533 LEU 533 533 533 LEU LEU D . n 
S  3  534 ALA 534 534 534 ALA ALA D . n 
S  3  535 MET 535 535 535 MET MET D . n 
S  3  536 THR 536 536 536 THR THR D . n 
S  3  537 PRO 537 537 537 PRO PRO D . n 
S  3  538 ALA 538 538 538 ALA ALA D . n 
S  3  539 ALA 539 539 539 ALA ALA D . n 
S  3  540 ASN 540 540 540 ASN ASN D . n 
S  3  541 ALA 541 541 541 ALA ALA D . n 
S  3  542 ARG 542 542 542 ARG ARG D . n 
S  3  543 GLY 543 543 543 GLY GLY D . n 
S  3  544 LEU 544 544 544 LEU LEU D . n 
S  3  545 GLU 545 545 545 GLU GLU D . n 
S  3  546 ALA 546 546 546 ALA ALA D . n 
S  3  547 MET 547 547 547 MET MET D . n 
S  3  548 GLY 548 548 548 GLY GLY D . n 
S  3  549 VAL 549 549 549 VAL VAL D . n 
S  3  550 LEU 550 550 550 LEU LEU D . n 
S  3  551 PRO 551 551 551 PRO PRO D . n 
S  3  552 GLY 552 552 552 GLY GLY D . n 
S  3  553 ALA 553 553 553 ALA ALA D . n 
S  3  554 LYS 554 554 554 LYS LYS D . n 
S  3  555 GLY 555 555 555 GLY GLY D . n 
S  3  556 ALA 556 556 556 ALA ALA D . n 
S  3  557 SER 557 557 557 SER SER D . n 
S  3  558 TRP 558 558 558 TRP TRP D . n 
S  3  559 ASP 559 559 559 ASP ASP D . n 
S  3  560 GLU 560 560 560 GLU GLU D . n 
S  3  561 PRO 561 561 561 PRO PRO D . n 
S  3  562 GLY 562 562 562 GLY GLY D . n 
S  3  563 ALA 563 563 563 ALA ALA D . n 
S  3  564 LEU 564 564 564 LEU LEU D . n 
S  3  565 TYR 565 565 565 TYR TYR D . n 
S  3  566 ALA 566 566 566 ALA ALA D . n 
S  3  567 TYR 567 567 567 TYR TYR D . n 
S  3  568 TYR 568 568 568 TYR TYR D . n 
S  3  569 GLY 569 569 569 GLY GLY D . n 
S  3  570 PHE 570 570 570 PHE PHE D . n 
S  3  571 VAL 571 571 571 VAL VAL D . n 
S  3  572 PRO 572 572 572 PRO PRO D . n 
S  3  573 PRO 573 573 573 PRO PRO D . n 
S  3  574 GLU 574 574 574 GLU GLU D . n 
S  3  575 GLU 575 575 575 GLU GLU D . n 
S  3  576 ALA 576 576 576 ALA ALA D . n 
S  3  577 LEU 577 577 577 LEU LEU D . n 
S  3  578 LYS 578 578 578 LYS LYS D . n 
S  3  579 GLY 579 579 579 GLY GLY D . n 
S  3  580 LYS 580 580 580 LYS LYS D . n 
S  3  581 ARG 581 581 581 ARG ARG D . n 
S  3  582 PHE 582 582 582 PHE PHE D . n 
S  3  583 VAL 583 583 583 VAL VAL D . n 
S  3  584 VAL 584 584 584 VAL VAL D . n 
S  3  585 MET 585 585 585 MET MET D . n 
S  3  586 HIS 586 586 586 HIS HIS D . n 
S  3  587 LEU 587 587 587 LEU LEU D . n 
S  3  588 SER 588 588 588 SER SER D . n 
S  3  589 HIS 589 589 589 HIS HIS D . n 
S  3  590 LEU 590 590 590 LEU LEU D . n 
S  3  591 HIS 591 591 591 HIS HIS D . n 
S  3  592 PRO 592 592 592 PRO PRO D . n 
S  3  593 LEU 593 593 593 LEU LEU D . n 
S  3  594 ALA 594 594 594 ALA ALA D . n 
S  3  595 GLU 595 595 595 GLU GLU D . n 
S  3  596 ARG 596 596 596 ARG ARG D . n 
S  3  597 TYR 597 597 597 TYR TYR D . n 
S  3  598 ALA 598 598 598 ALA ALA D . n 
S  3  599 HIS 599 599 599 HIS HIS D . n 
S  3  600 VAL 600 600 600 VAL VAL D . n 
S  3  601 VAL 601 601 601 VAL VAL D . n 
S  3  602 LEU 602 602 602 LEU LEU D . n 
S  3  603 PRO 603 603 603 PRO PRO D . n 
S  3  604 ALA 604 604 604 ALA ALA D . n 
S  3  605 PRO 605 605 605 PRO PRO D . n 
S  3  606 THR 606 606 606 THR THR D . n 
S  3  607 PHE 607 607 607 PHE PHE D . n 
S  3  608 TYR 608 608 608 TYR TYR D . n 
S  3  609 GLU 609 609 609 GLU GLU D . n 
S  3  610 LYS 610 610 610 LYS LYS D . n 
S  3  611 ARG 611 611 611 ARG ARG D . n 
S  3  612 GLY 612 612 612 GLY GLY D . n 
S  3  613 HIS 613 613 613 HIS HIS D . n 
S  3  614 LEU 614 614 614 LEU LEU D . n 
S  3  615 VAL 615 615 615 VAL VAL D . n 
S  3  616 ASN 616 616 616 ASN ASN D . n 
S  3  617 LEU 617 617 617 LEU LEU D . n 
S  3  618 GLU 618 618 618 GLU GLU D . n 
S  3  619 GLY 619 619 619 GLY GLY D . n 
S  3  620 ARG 620 620 620 ARG ARG D . n 
S  3  621 VAL 621 621 621 VAL VAL D . n 
S  3  622 LEU 622 622 622 LEU LEU D . n 
S  3  623 PRO 623 623 623 PRO PRO D . n 
S  3  624 LEU 624 624 624 LEU LEU D . n 
S  3  625 SER 625 625 625 SER SER D . n 
S  3  626 PRO 626 626 626 PRO PRO D . n 
S  3  627 ALA 627 627 627 ALA ALA D . n 
S  3  628 PRO 628 628 628 PRO PRO D . n 
S  3  629 ILE 629 629 629 ILE ILE D . n 
S  3  630 GLU 630 630 630 GLU GLU D . n 
S  3  631 ASN 631 631 631 ASN ASN D . n 
S  3  632 GLY 632 632 632 GLY GLY D . n 
S  3  633 GLU 633 633 633 GLU GLU D . n 
S  3  634 ALA 634 634 634 ALA ALA D . n 
S  3  635 GLU 635 635 635 GLU GLU D . n 
S  3  636 GLY 636 636 636 GLY GLY D . n 
S  3  637 ALA 637 637 637 ALA ALA D . n 
S  3  638 LEU 638 638 638 LEU LEU D . n 
S  3  639 GLN 639 639 639 GLN GLN D . n 
S  3  640 VAL 640 640 640 VAL VAL D . n 
S  3  641 LEU 641 641 641 LEU LEU D . n 
S  3  642 ALA 642 642 642 ALA ALA D . n 
S  3  643 LEU 643 643 643 LEU LEU D . n 
S  3  644 LEU 644 644 644 LEU LEU D . n 
S  3  645 ALA 645 645 645 ALA ALA D . n 
S  3  646 GLU 646 646 646 GLU GLU D . n 
S  3  647 ALA 647 647 647 ALA ALA D . n 
S  3  648 LEU 648 648 648 LEU LEU D . n 
S  3  649 GLY 649 649 649 GLY GLY D . n 
S  3  650 VAL 650 650 650 VAL VAL D . n 
S  3  651 ARG 651 651 651 ARG ARG D . n 
S  3  652 PRO 652 652 652 PRO PRO D . n 
S  3  653 PRO 653 653 653 PRO PRO D . n 
S  3  654 PHE 654 654 654 PHE PHE D . n 
S  3  655 ARG 655 655 655 ARG ARG D . n 
S  3  656 LEU 656 656 656 LEU LEU D . n 
S  3  657 HIS 657 657 657 HIS HIS D . n 
S  3  658 LEU 658 658 658 LEU LEU D . n 
S  3  659 GLU 659 659 659 GLU GLU D . n 
S  3  660 ALA 660 660 660 ALA ALA D . n 
S  3  661 GLN 661 661 661 GLN GLN D . n 
S  3  662 LYS 662 662 662 LYS LYS D . n 
S  3  663 ALA 663 663 663 ALA ALA D . n 
S  3  664 LEU 664 664 664 LEU LEU D . n 
S  3  665 LYS 665 665 665 LYS LYS D . n 
S  3  666 ALA 666 666 666 ALA ALA D . n 
S  3  667 ARG 667 667 667 ARG ARG D . n 
S  3  668 LYS 668 668 668 LYS LYS D . n 
S  3  669 VAL 669 669 669 VAL VAL D . n 
S  3  670 PRO 670 670 670 PRO PRO D . n 
S  3  671 GLU 671 671 671 GLU GLU D . n 
S  3  672 ALA 672 672 672 ALA ALA D . n 
S  3  673 MET 673 673 673 MET MET D . n 
S  3  674 GLY 674 674 674 GLY GLY D . n 
S  3  675 ARG 675 675 675 ARG ARG D . n 
S  3  676 LEU 676 676 676 LEU LEU D . n 
S  3  677 SER 677 677 677 SER SER D . n 
S  3  678 PHE 678 678 678 PHE PHE D . n 
S  3  679 ARG 679 679 679 ARG ARG D . n 
S  3  680 LEU 680 680 680 LEU LEU D . n 
S  3  681 LYS 681 681 681 LYS LYS D . n 
S  3  682 GLU 682 682 682 GLU GLU D . n 
S  3  683 LEU 683 683 683 LEU LEU D . n 
S  3  684 ARG 684 684 684 ARG ARG D . n 
S  3  685 PRO 685 685 685 PRO PRO D . n 
S  3  686 LYS 686 686 686 LYS LYS D . n 
S  3  687 GLU 687 687 687 GLU GLU D . n 
S  3  688 ARG 688 688 688 ARG ARG D . n 
S  3  689 LYS 689 689 689 LYS LYS D . n 
S  3  690 GLY 690 690 690 GLY GLY D . n 
S  3  691 ALA 691 691 691 ALA ALA D . n 
S  3  692 PHE 692 692 692 PHE PHE D . n 
S  3  693 TYR 693 693 693 TYR TYR D . n 
S  3  694 LEU 694 694 694 LEU LEU D . n 
S  3  695 ARG 695 695 695 ARG ARG D . n 
S  3  696 PRO 696 696 696 PRO PRO D . n 
S  3  697 THR 697 697 697 THR THR D . n 
S  3  698 MET 698 698 698 MET MET D . n 
S  3  699 TRP 699 699 699 TRP TRP D . n 
S  3  700 LYS 700 700 700 LYS LYS D . n 
S  3  701 ALA 701 701 701 ALA ALA D . n 
S  3  702 HIS 702 702 702 HIS HIS D . n 
S  3  703 GLN 703 703 703 GLN GLN D . n 
S  3  704 ALA 704 704 704 ALA ALA D . n 
S  3  705 VAL 705 705 705 VAL VAL D . n 
S  3  706 GLY 706 706 706 GLY GLY D . n 
S  3  707 LYS 707 707 707 LYS LYS D . n 
S  3  708 ALA 708 708 708 ALA ALA D . n 
S  3  709 GLN 709 709 709 GLN GLN D . n 
S  3  710 GLU 710 710 710 GLU GLU D . n 
S  3  711 ALA 711 711 711 ALA ALA D . n 
S  3  712 ALA 712 712 712 ALA ALA D . n 
S  3  713 ARG 713 713 713 ARG ARG D . n 
S  3  714 ALA 714 714 714 ALA ALA D . n 
S  3  715 GLU 715 715 715 GLU GLU D . n 
S  3  716 LEU 716 716 716 LEU LEU D . n 
S  3  717 TRP 717 717 717 TRP TRP D . n 
S  3  718 ALA 718 718 718 ALA ALA D . n 
S  3  719 HIS 719 719 719 HIS HIS D . n 
S  3  720 PRO 720 720 720 PRO PRO D . n 
S  3  721 GLU 721 721 721 GLU GLU D . n 
S  3  722 THR 722 722 722 THR THR D . n 
S  3  723 ALA 723 723 723 ALA ALA D . n 
S  3  724 ARG 724 724 724 ARG ARG D . n 
S  3  725 ALA 725 725 725 ALA ALA D . n 
S  3  726 GLU 726 726 726 GLU GLU D . n 
S  3  727 ALA 727 727 727 ALA ALA D . n 
S  3  728 LEU 728 728 728 LEU LEU D . n 
S  3  729 PRO 729 729 729 PRO PRO D . n 
S  3  730 GLU 730 730 730 GLU GLU D . n 
S  3  731 GLY 731 731 731 GLY GLY D . n 
S  3  732 ALA 732 732 732 ALA ALA D . n 
S  3  733 GLN 733 733 733 GLN GLN D . n 
S  3  734 VAL 734 734 734 VAL VAL D . n 
S  3  735 ALA 735 735 735 ALA ALA D . n 
S  3  736 VAL 736 736 736 VAL VAL D . n 
S  3  737 GLU 737 737 737 GLU GLU D . n 
S  3  738 THR 738 738 738 THR THR D . n 
S  3  739 PRO 739 739 739 PRO PRO D . n 
S  3  740 PHE 740 740 740 PHE PHE D . n 
S  3  741 GLY 741 741 741 GLY GLY D . n 
S  3  742 ARG 742 742 742 ARG ARG D . n 
S  3  743 VAL 743 743 743 VAL VAL D . n 
S  3  744 GLU 744 744 744 GLU GLU D . n 
S  3  745 ALA 745 745 745 ALA ALA D . n 
S  3  746 ARG 746 746 746 ARG ARG D . n 
S  3  747 VAL 747 747 747 VAL VAL D . n 
S  3  748 VAL 748 748 748 VAL VAL D . n 
S  3  749 HIS 749 749 749 HIS HIS D . n 
S  3  750 ARG 750 750 750 ARG ARG D . n 
S  3  751 GLU 751 751 751 GLU GLU D . n 
S  3  752 ASP 752 752 752 ASP ASP D . n 
S  3  753 VAL 753 753 753 VAL VAL D . n 
S  3  754 PRO 754 754 754 PRO PRO D . n 
S  3  755 LYS 755 755 755 LYS LYS D . n 
S  3  756 GLY 756 756 756 GLY GLY D . n 
S  3  757 HIS 757 757 757 HIS HIS D . n 
S  3  758 LEU 758 758 758 LEU LEU D . n 
S  3  759 TYR 759 759 759 TYR TYR D . n 
S  3  760 LEU 760 760 760 LEU LEU D . n 
S  3  761 SER 761 761 761 SER SER D . n 
S  3  762 ALA 762 762 762 ALA ALA D . n 
S  3  763 LEU 763 763 763 LEU LEU D . n 
S  3  764 GLY 764 764 764 GLY GLY D . n 
S  3  765 PRO 765 765 765 PRO PRO D . n 
S  3  766 ALA 766 766 766 ALA ALA D . n 
S  3  767 ALA 767 767 767 ALA ALA D . n 
S  3  768 GLY 768 768 768 GLY GLY D . n 
S  3  769 LEU 769 769 769 LEU LEU D . n 
S  3  770 ARG 770 770 770 ARG ARG D . n 
S  3  771 VAL 771 771 771 VAL VAL D . n 
S  3  772 GLU 772 772 772 GLU GLU D . n 
S  3  773 GLY 773 773 773 GLY GLY D . n 
S  3  774 ARG 774 774 774 ARG ARG D . n 
S  3  775 VAL 775 775 775 VAL VAL D . n 
S  3  776 LEU 776 776 776 LEU LEU D . n 
S  3  777 VAL 777 777 777 VAL VAL D . n 
S  3  778 PRO 778 778 ?   ?   ?   D . n 
S  3  779 ALA 779 779 ?   ?   ?   D . n 
S  3  780 GLY 780 780 ?   ?   ?   D . n 
S  3  781 GLY 781 781 ?   ?   ?   D . n 
S  3  782 GLU 782 782 ?   ?   ?   D . n 
S  3  783 ALA 783 783 ?   ?   ?   D . n 
T  4  1   MET 1   1   ?   ?   ?   E . n 
T  4  2   ARG 2   2   ?   ?   ?   E . n 
T  4  3   GLU 3   3   ?   ?   ?   E . n 
T  4  4   GLU 4   4   ?   ?   ?   E . n 
T  4  5   PHE 5   5   ?   ?   ?   E . n 
T  4  6   LEU 6   6   ?   ?   ?   E . n 
T  4  7   GLU 7   7   ?   ?   ?   E . n 
T  4  8   GLU 8   8   ?   ?   ?   E . n 
T  4  9   ILE 9   9   ?   ?   ?   E . n 
T  4  10  PRO 10  10  ?   ?   ?   E . n 
T  4  11  LEU 11  11  ?   ?   ?   E . n 
T  4  12  ASP 12  12  ?   ?   ?   E . n 
T  4  13  ALA 13  13  ?   ?   ?   E . n 
T  4  14  PRO 14  14  ?   ?   ?   E . n 
T  4  15  PRO 15  15  ?   ?   ?   E . n 
T  4  16  GLU 16  16  ?   ?   ?   E . n 
T  4  17  GLU 17  17  ?   ?   ?   E . n 
T  4  18  ALA 18  18  ?   ?   ?   E . n 
T  4  19  LYS 19  19  ?   ?   ?   E . n 
T  4  20  GLU 20  20  ?   ?   ?   E . n 
T  4  21  LEU 21  21  ?   ?   ?   E . n 
T  4  22  ARG 22  22  ?   ?   ?   E . n 
T  4  23  THR 23  23  ?   ?   ?   E . n 
T  4  24  GLU 24  24  ?   ?   ?   E . n 
T  4  25  VAL 25  25  ?   ?   ?   E . n 
T  4  26  MET 26  26  26  MET MET E . n 
T  4  27  THR 27  27  27  THR THR E . n 
T  4  28  LEU 28  28  28  LEU LEU E . n 
T  4  29  ASN 29  29  29  ASN ASN E . n 
T  4  30  VAL 30  30  30  VAL VAL E . n 
T  4  31  GLY 31  31  31  GLY GLY E . n 
T  4  32  PRO 32  32  32  PRO PRO E . n 
T  4  33  GLN 33  33  33  GLN GLN E . n 
T  4  34  HIS 34  34  34  HIS HIS E . n 
T  4  35  PRO 35  35  35  PRO PRO E . n 
T  4  36  SER 36  36  36  SER SER E . n 
T  4  37  THR 37  37  37  THR THR E . n 
T  4  38  HIS 38  38  38  HIS HIS E . n 
T  4  39  GLY 39  39  39  GLY GLY E . n 
T  4  40  VAL 40  40  40  VAL VAL E . n 
T  4  41  LEU 41  41  41  LEU LEU E . n 
T  4  42  ARG 42  42  42  ARG ARG E . n 
T  4  43  LEU 43  43  43  LEU LEU E . n 
T  4  44  MET 44  44  44  MET MET E . n 
T  4  45  VAL 45  45  45  VAL VAL E . n 
T  4  46  THR 46  46  46  THR THR E . n 
T  4  47  LEU 47  47  47  LEU LEU E . n 
T  4  48  SER 48  48  48  SER SER E . n 
T  4  49  GLY 49  49  49  GLY GLY E . n 
T  4  50  GLU 50  50  50  GLU GLU E . n 
T  4  51  GLU 51  51  51  GLU GLU E . n 
T  4  52  VAL 52  52  52  VAL VAL E . n 
T  4  53  LEU 53  53  53  LEU LEU E . n 
T  4  54  GLU 54  54  54  GLU GLU E . n 
T  4  55  VAL 55  55  55  VAL VAL E . n 
T  4  56  VAL 56  56  56  VAL VAL E . n 
T  4  57  PRO 57  57  57  PRO PRO E . n 
T  4  58  HIS 58  58  58  HIS HIS E . n 
T  4  59  ILE 59  59  59  ILE ILE E . n 
T  4  60  GLY 60  60  60  GLY GLY E . n 
T  4  61  TYR 61  61  61  TYR TYR E . n 
T  4  62  LEU 62  62  62  LEU LEU E . n 
T  4  63  HIS 63  63  63  HIS HIS E . n 
T  4  64  THR 64  64  64  THR THR E . n 
T  4  65  GLY 65  65  65  GLY GLY E . n 
T  4  66  PHE 66  66  66  PHE PHE E . n 
T  4  67  GLU 67  67  67  GLU GLU E . n 
T  4  68  LYS 68  68  68  LYS LYS E . n 
T  4  69  THR 69  69  69  THR THR E . n 
T  4  70  MET 70  70  70  MET MET E . n 
T  4  71  GLU 71  71  71  GLU GLU E . n 
T  4  72  HIS 72  72  72  HIS HIS E . n 
T  4  73  ARG 73  73  73  ARG ARG E . n 
T  4  74  THR 74  74  74  THR THR E . n 
T  4  75  TYR 75  75  75  TYR TYR E . n 
T  4  76  LEU 76  76  76  LEU LEU E . n 
T  4  77  GLN 77  77  77  GLN GLN E . n 
T  4  78  ASN 78  78  78  ASN ASN E . n 
T  4  79  ILE 79  79  79  ILE ILE E . n 
T  4  80  THR 80  80  80  THR THR E . n 
T  4  81  TYR 81  81  81  TYR TYR E . n 
T  4  82  THR 82  82  82  THR THR E . n 
T  4  83  PRO 83  83  83  PRO PRO E . n 
T  4  84  ARG 84  84  84  ARG ARG E . n 
T  4  85  MET 85  85  85  MET MET E . n 
T  4  86  ASP 86  86  86  ASP ASP E . n 
T  4  87  TYR 87  87  87  TYR TYR E . n 
T  4  88  LEU 88  88  88  LEU LEU E . n 
T  4  89  HIS 89  89  89  HIS HIS E . n 
T  4  90  SER 90  90  90  SER SER E . n 
T  4  91  PHE 91  91  91  PHE PHE E . n 
T  4  92  ALA 92  92  92  ALA ALA E . n 
T  4  93  HIS 93  93  93  HIS HIS E . n 
T  4  94  ASP 94  94  94  ASP ASP E . n 
T  4  95  LEU 95  95  95  LEU LEU E . n 
T  4  96  ALA 96  96  96  ALA ALA E . n 
T  4  97  TYR 97  97  97  TYR TYR E . n 
T  4  98  ALA 98  98  98  ALA ALA E . n 
T  4  99  LEU 99  99  99  LEU LEU E . n 
T  4  100 ALA 100 100 100 ALA ALA E . n 
T  4  101 VAL 101 101 101 VAL VAL E . n 
T  4  102 GLU 102 102 102 GLU GLU E . n 
T  4  103 LYS 103 103 103 LYS LYS E . n 
T  4  104 LEU 104 104 104 LEU LEU E . n 
T  4  105 LEU 105 105 105 LEU LEU E . n 
T  4  106 GLY 106 106 106 GLY GLY E . n 
T  4  107 ALA 107 107 107 ALA ALA E . n 
T  4  108 VAL 108 108 108 VAL VAL E . n 
T  4  109 VAL 109 109 109 VAL VAL E . n 
T  4  110 PRO 110 110 110 PRO PRO E . n 
T  4  111 PRO 111 111 111 PRO PRO E . n 
T  4  112 ARG 112 112 112 ARG ARG E . n 
T  4  113 ALA 113 113 113 ALA ALA E . n 
T  4  114 GLU 114 114 114 GLU GLU E . n 
T  4  115 THR 115 115 115 THR THR E . n 
T  4  116 ILE 116 116 116 ILE ILE E . n 
T  4  117 ARG 117 117 117 ARG ARG E . n 
T  4  118 VAL 118 118 118 VAL VAL E . n 
T  4  119 ILE 119 119 119 ILE ILE E . n 
T  4  120 LEU 120 120 120 LEU LEU E . n 
T  4  121 ASN 121 121 121 ASN ASN E . n 
T  4  122 GLU 122 122 122 GLU GLU E . n 
T  4  123 LEU 123 123 123 LEU LEU E . n 
T  4  124 SER 124 124 124 SER SER E . n 
T  4  125 ARG 125 125 125 ARG ARG E . n 
T  4  126 LEU 126 126 126 LEU LEU E . n 
T  4  127 ALA 127 127 127 ALA ALA E . n 
T  4  128 SER 128 128 128 SER SER E . n 
T  4  129 HIS 129 129 129 HIS HIS E . n 
T  4  130 LEU 130 130 130 LEU LEU E . n 
T  4  131 VAL 131 131 131 VAL VAL E . n 
T  4  132 PHE 132 132 132 PHE PHE E . n 
T  4  133 LEU 133 133 133 LEU LEU E . n 
T  4  134 GLY 134 134 134 GLY GLY E . n 
T  4  135 THR 135 135 135 THR THR E . n 
T  4  136 GLY 136 136 136 GLY GLY E . n 
T  4  137 LEU 137 137 137 LEU LEU E . n 
T  4  138 LEU 138 138 138 LEU LEU E . n 
T  4  139 ASP 139 139 139 ASP ASP E . n 
T  4  140 LEU 140 140 140 LEU LEU E . n 
T  4  141 GLY 141 141 141 GLY GLY E . n 
T  4  142 ALA 142 142 142 ALA ALA E . n 
T  4  143 LEU 143 143 143 LEU LEU E . n 
T  4  144 THR 144 144 144 THR THR E . n 
T  4  145 PRO 145 145 145 PRO PRO E . n 
T  4  146 PHE 146 146 146 PHE PHE E . n 
T  4  147 PHE 147 147 147 PHE PHE E . n 
T  4  148 TYR 148 148 148 TYR TYR E . n 
T  4  149 ALA 149 149 149 ALA ALA E . n 
T  4  150 PHE 150 150 150 PHE PHE E . n 
T  4  151 ARG 151 151 151 ARG ARG E . n 
T  4  152 GLU 152 152 152 GLU GLU E . n 
T  4  153 ARG 153 153 153 ARG ARG E . n 
T  4  154 GLU 154 154 154 GLU GLU E . n 
T  4  155 THR 155 155 155 THR THR E . n 
T  4  156 ILE 156 156 156 ILE ILE E . n 
T  4  157 LEU 157 157 157 LEU LEU E . n 
T  4  158 ASP 158 158 158 ASP ASP E . n 
T  4  159 LEU 159 159 159 LEU LEU E . n 
T  4  160 PHE 160 160 160 PHE PHE E . n 
T  4  161 GLU 161 161 161 GLU GLU E . n 
T  4  162 TRP 162 162 162 TRP TRP E . n 
T  4  163 VAL 163 163 163 VAL VAL E . n 
T  4  164 THR 164 164 164 THR THR E . n 
T  4  165 GLY 165 165 165 GLY GLY E . n 
T  4  166 GLN 166 166 166 GLN GLN E . n 
T  4  167 ARG 167 167 167 ARG ARG E . n 
T  4  168 PHE 168 168 168 PHE PHE E . n 
T  4  169 HIS 169 169 169 HIS HIS E . n 
T  4  170 HIS 170 170 170 HIS HIS E . n 
T  4  171 ASN 171 171 171 ASN ASN E . n 
T  4  172 TYR 172 172 172 TYR TYR E . n 
T  4  173 ILE 173 173 173 ILE ILE E . n 
T  4  174 ARG 174 174 174 ARG ARG E . n 
T  4  175 ILE 175 175 175 ILE ILE E . n 
T  4  176 GLY 176 176 176 GLY GLY E . n 
T  4  177 GLY 177 177 177 GLY GLY E . n 
T  4  178 VAL 178 178 178 VAL VAL E . n 
T  4  179 LYS 179 179 179 LYS LYS E . n 
T  4  180 GLU 180 180 180 GLU GLU E . n 
T  4  181 ASP 181 181 181 ASP ASP E . n 
T  4  182 LEU 182 182 182 LEU LEU E . n 
T  4  183 PRO 183 183 183 PRO PRO E . n 
T  4  184 GLU 184 184 184 GLU GLU E . n 
T  4  185 GLU 185 185 185 GLU GLU E . n 
T  4  186 PHE 186 186 186 PHE PHE E . n 
T  4  187 VAL 187 187 187 VAL VAL E . n 
T  4  188 PRO 188 188 188 PRO PRO E . n 
T  4  189 GLU 189 189 189 GLU GLU E . n 
T  4  190 LEU 190 190 190 LEU LEU E . n 
T  4  191 LYS 191 191 191 LYS LYS E . n 
T  4  192 LYS 192 192 192 LYS LYS E . n 
T  4  193 LEU 193 193 193 LEU LEU E . n 
T  4  194 LEU 194 194 194 LEU LEU E . n 
T  4  195 GLU 195 195 195 GLU GLU E . n 
T  4  196 VAL 196 196 196 VAL VAL E . n 
T  4  197 LEU 197 197 197 LEU LEU E . n 
T  4  198 PRO 198 198 198 PRO PRO E . n 
T  4  199 HIS 199 199 199 HIS HIS E . n 
T  4  200 ARG 200 200 200 ARG ARG E . n 
T  4  201 ILE 201 201 201 ILE ILE E . n 
T  4  202 ASP 202 202 202 ASP ASP E . n 
T  4  203 GLU 203 203 203 GLU GLU E . n 
T  4  204 TYR 204 204 204 TYR TYR E . n 
T  4  205 GLU 205 205 205 GLU GLU E . n 
T  4  206 ALA 206 206 206 ALA ALA E . n 
T  4  207 LEU 207 207 207 LEU LEU E . n 
T  4  208 PHE 208 208 208 PHE PHE E . n 
T  4  209 ALA 209 209 209 ALA ALA E . n 
T  4  210 GLU 210 210 210 GLU GLU E . n 
T  4  211 SER 211 211 211 SER SER E . n 
T  4  212 PRO 212 212 212 PRO PRO E . n 
T  4  213 ILE 213 213 213 ILE ILE E . n 
T  4  214 PHE 214 214 214 PHE PHE E . n 
T  4  215 TYR 215 215 215 TYR TYR E . n 
T  4  216 GLU 216 216 216 GLU GLU E . n 
T  4  217 ARG 217 217 217 ARG ARG E . n 
T  4  218 ALA 218 218 218 ALA ALA E . n 
T  4  219 ARG 219 219 219 ARG ARG E . n 
T  4  220 GLY 220 220 220 GLY GLY E . n 
T  4  221 VAL 221 221 221 VAL VAL E . n 
T  4  222 GLY 222 222 222 GLY GLY E . n 
T  4  223 VAL 223 223 223 VAL VAL E . n 
T  4  224 ILE 224 224 224 ILE ILE E . n 
T  4  225 PRO 225 225 225 PRO PRO E . n 
T  4  226 PRO 226 226 226 PRO PRO E . n 
T  4  227 GLU 227 227 227 GLU GLU E . n 
T  4  228 VAL 228 228 228 VAL VAL E . n 
T  4  229 ALA 229 229 229 ALA ALA E . n 
T  4  230 ILE 230 230 230 ILE ILE E . n 
T  4  231 ASP 231 231 231 ASP ASP E . n 
T  4  232 LEU 232 232 232 LEU LEU E . n 
T  4  233 GLY 233 233 233 GLY GLY E . n 
T  4  234 LEU 234 234 234 LEU LEU E . n 
T  4  235 THR 235 235 235 THR THR E . n 
T  4  236 GLY 236 236 236 GLY GLY E . n 
T  4  237 GLY 237 237 237 GLY GLY E . n 
T  4  238 SER 238 238 238 SER SER E . n 
T  4  239 LEU 239 239 239 LEU LEU E . n 
T  4  240 ARG 240 240 240 ARG ARG E . n 
T  4  241 ALA 241 241 241 ALA ALA E . n 
T  4  242 SER 242 242 242 SER SER E . n 
T  4  243 GLY 243 243 243 GLY GLY E . n 
T  4  244 VAL 244 244 244 VAL VAL E . n 
T  4  245 ASN 245 245 245 ASN ASN E . n 
T  4  246 TYR 246 246 246 TYR TYR E . n 
T  4  247 ASP 247 247 247 ASP ASP E . n 
T  4  248 VAL 248 248 248 VAL VAL E . n 
T  4  249 ARG 249 249 249 ARG ARG E . n 
T  4  250 LYS 250 250 250 LYS LYS E . n 
T  4  251 ALA 251 251 251 ALA ALA E . n 
T  4  252 TYR 252 252 252 TYR TYR E . n 
T  4  253 PRO 253 253 253 PRO PRO E . n 
T  4  254 TYR 254 254 254 TYR TYR E . n 
T  4  255 SER 255 255 255 SER SER E . n 
T  4  256 GLY 256 256 256 GLY GLY E . n 
T  4  257 TYR 257 257 257 TYR TYR E . n 
T  4  258 GLU 258 258 258 GLU GLU E . n 
T  4  259 THR 259 259 259 THR THR E . n 
T  4  260 TYR 260 260 260 TYR TYR E . n 
T  4  261 THR 261 261 261 THR THR E . n 
T  4  262 PHE 262 262 262 PHE PHE E . n 
T  4  263 ASP 263 263 263 ASP ASP E . n 
T  4  264 VAL 264 264 264 VAL VAL E . n 
T  4  265 PRO 265 265 265 PRO PRO E . n 
T  4  266 LEU 266 266 266 LEU LEU E . n 
T  4  267 GLY 267 267 267 GLY GLY E . n 
T  4  268 GLU 268 268 268 GLU GLU E . n 
T  4  269 ARG 269 269 269 ARG ARG E . n 
T  4  270 GLY 270 270 270 GLY GLY E . n 
T  4  271 ASP 271 271 271 ASP ASP E . n 
T  4  272 VAL 272 272 272 VAL VAL E . n 
T  4  273 PHE 273 273 273 PHE PHE E . n 
T  4  274 ASP 274 274 274 ASP ASP E . n 
T  4  275 ARG 275 275 275 ARG ARG E . n 
T  4  276 MET 276 276 276 MET MET E . n 
T  4  277 LEU 277 277 277 LEU LEU E . n 
T  4  278 VAL 278 278 278 VAL VAL E . n 
T  4  279 ARG 279 279 279 ARG ARG E . n 
T  4  280 ILE 280 280 280 ILE ILE E . n 
T  4  281 ARG 281 281 281 ARG ARG E . n 
T  4  282 GLU 282 282 282 GLU GLU E . n 
T  4  283 MET 283 283 283 MET MET E . n 
T  4  284 ARG 284 284 284 ARG ARG E . n 
T  4  285 GLU 285 285 285 GLU GLU E . n 
T  4  286 SER 286 286 286 SER SER E . n 
T  4  287 VAL 287 287 287 VAL VAL E . n 
T  4  288 LYS 288 288 288 LYS LYS E . n 
T  4  289 ILE 289 289 289 ILE ILE E . n 
T  4  290 ILE 290 290 290 ILE ILE E . n 
T  4  291 LYS 291 291 291 LYS LYS E . n 
T  4  292 GLN 292 292 292 GLN GLN E . n 
T  4  293 ALA 293 293 293 ALA ALA E . n 
T  4  294 LEU 294 294 294 LEU LEU E . n 
T  4  295 GLU 295 295 295 GLU GLU E . n 
T  4  296 ARG 296 296 296 ARG ARG E . n 
T  4  297 LEU 297 297 297 LEU LEU E . n 
T  4  298 GLU 298 298 298 GLU GLU E . n 
T  4  299 PRO 299 299 299 PRO PRO E . n 
T  4  300 GLY 300 300 300 GLY GLY E . n 
T  4  301 PRO 301 301 301 PRO PRO E . n 
T  4  302 VAL 302 302 302 VAL VAL E . n 
T  4  303 ARG 303 303 303 ARG ARG E . n 
T  4  304 ASP 304 304 304 ASP ASP E . n 
T  4  305 PRO 305 305 305 PRO PRO E . n 
T  4  306 ASN 306 306 306 ASN ASN E . n 
T  4  307 PRO 307 307 307 PRO PRO E . n 
T  4  308 GLN 308 308 308 GLN GLN E . n 
T  4  309 ILE 309 309 309 ILE ILE E . n 
T  4  310 THR 310 310 310 THR THR E . n 
T  4  311 PRO 311 311 311 PRO PRO E . n 
T  4  312 PRO 312 312 312 PRO PRO E . n 
T  4  313 PRO 313 313 313 PRO PRO E . n 
T  4  314 ARG 314 314 314 ARG ARG E . n 
T  4  315 HIS 315 315 315 HIS HIS E . n 
T  4  316 LEU 316 316 316 LEU LEU E . n 
T  4  317 LEU 317 317 317 LEU LEU E . n 
T  4  318 GLU 318 318 318 GLU GLU E . n 
T  4  319 THR 319 319 319 THR THR E . n 
T  4  320 SER 320 320 320 SER SER E . n 
T  4  321 MET 321 321 321 MET MET E . n 
T  4  322 GLU 322 322 322 GLU GLU E . n 
T  4  323 ALA 323 323 323 ALA ALA E . n 
T  4  324 VAL 324 324 324 VAL VAL E . n 
T  4  325 ILE 325 325 325 ILE ILE E . n 
T  4  326 TYR 326 326 326 TYR TYR E . n 
T  4  327 HIS 327 327 327 HIS HIS E . n 
T  4  328 PHE 328 328 328 PHE PHE E . n 
T  4  329 LYS 329 329 329 LYS LYS E . n 
T  4  330 HIS 330 330 330 HIS HIS E . n 
T  4  331 TYR 331 331 331 TYR TYR E . n 
T  4  332 THR 332 332 332 THR THR E . n 
T  4  333 GLU 333 333 333 GLU GLU E . n 
T  4  334 GLY 334 334 334 GLY GLY E . n 
T  4  335 PHE 335 335 335 PHE PHE E . n 
T  4  336 HIS 336 336 336 HIS HIS E . n 
T  4  337 PRO 337 337 337 PRO PRO E . n 
T  4  338 PRO 338 338 338 PRO PRO E . n 
T  4  339 LYS 339 339 339 LYS LYS E . n 
T  4  340 GLY 340 340 340 GLY GLY E . n 
T  4  341 GLU 341 341 341 GLU GLU E . n 
T  4  342 VAL 342 342 342 VAL VAL E . n 
T  4  343 TYR 343 343 343 TYR TYR E . n 
T  4  344 VAL 344 344 344 VAL VAL E . n 
T  4  345 PRO 345 345 345 PRO PRO E . n 
T  4  346 THR 346 346 346 THR THR E . n 
T  4  347 GLU 347 347 347 GLU GLU E . n 
T  4  348 SER 348 348 348 SER SER E . n 
T  4  349 ALA 349 349 349 ALA ALA E . n 
T  4  350 ARG 350 350 350 ARG ARG E . n 
T  4  351 GLY 351 351 351 GLY GLY E . n 
T  4  352 GLU 352 352 352 GLU GLU E . n 
T  4  353 LEU 353 353 353 LEU LEU E . n 
T  4  354 GLY 354 354 354 GLY GLY E . n 
T  4  355 TYR 355 355 355 TYR TYR E . n 
T  4  356 TYR 356 356 356 TYR TYR E . n 
T  4  357 ILE 357 357 357 ILE ILE E . n 
T  4  358 VAL 358 358 358 VAL VAL E . n 
T  4  359 SER 359 359 359 SER SER E . n 
T  4  360 ASP 360 360 360 ASP ASP E . n 
T  4  361 GLY 361 361 361 GLY GLY E . n 
T  4  362 GLY 362 362 362 GLY GLY E . n 
T  4  363 SER 363 363 363 SER SER E . n 
T  4  364 MET 364 364 364 MET MET E . n 
T  4  365 PRO 365 365 365 PRO PRO E . n 
T  4  366 TYR 366 366 366 TYR TYR E . n 
T  4  367 ARG 367 367 367 ARG ARG E . n 
T  4  368 VAL 368 368 368 VAL VAL E . n 
T  4  369 LYS 369 369 369 LYS LYS E . n 
T  4  370 VAL 370 370 370 VAL VAL E . n 
T  4  371 ARG 371 371 371 ARG ARG E . n 
T  4  372 ALA 372 372 372 ALA ALA E . n 
T  4  373 PRO 373 373 373 PRO PRO E . n 
T  4  374 SER 374 374 374 SER SER E . n 
T  4  375 PHE 375 375 375 PHE PHE E . n 
T  4  376 VAL 376 376 376 VAL VAL E . n 
T  4  377 ASN 377 377 377 ASN ASN E . n 
T  4  378 LEU 378 378 378 LEU LEU E . n 
T  4  379 GLN 379 379 379 GLN GLN E . n 
T  4  380 SER 380 380 380 SER SER E . n 
T  4  381 LEU 381 381 381 LEU LEU E . n 
T  4  382 PRO 382 382 382 PRO PRO E . n 
T  4  383 TYR 383 383 383 TYR TYR E . n 
T  4  384 ALA 384 384 384 ALA ALA E . n 
T  4  385 CYS 385 385 385 CYS CYS E . n 
T  4  386 LYS 386 386 386 LYS LYS E . n 
T  4  387 GLY 387 387 387 GLY GLY E . n 
T  4  388 GLU 388 388 388 GLU GLU E . n 
T  4  389 GLN 389 389 389 GLN GLN E . n 
T  4  390 VAL 390 390 390 VAL VAL E . n 
T  4  391 PRO 391 391 391 PRO PRO E . n 
T  4  392 ASP 392 392 392 ASP ASP E . n 
T  4  393 MET 393 393 393 MET MET E . n 
T  4  394 VAL 394 394 394 VAL VAL E . n 
T  4  395 ALA 395 395 395 ALA ALA E . n 
T  4  396 ILE 396 396 396 ILE ILE E . n 
T  4  397 ILE 397 397 397 ILE ILE E . n 
T  4  398 ALA 398 398 398 ALA ALA E . n 
T  4  399 SER 399 399 399 SER SER E . n 
T  4  400 LEU 400 400 400 LEU LEU E . n 
T  4  401 ASP 401 401 401 ASP ASP E . n 
T  4  402 PRO 402 402 402 PRO PRO E . n 
T  4  403 VAL 403 403 403 VAL VAL E . n 
T  4  404 MET 404 404 404 MET MET E . n 
T  4  405 GLY 405 405 405 GLY GLY E . n 
T  4  406 ASP 406 406 406 ASP ASP E . n 
T  4  407 VAL 407 407 407 VAL VAL E . n 
T  4  408 ASP 408 408 408 ASP ASP E . n 
T  4  409 ARG 409 409 409 ARG ARG E . n 
U  5  1   MET 1   1   1   MET MET F . n 
U  5  2   ARG 2   2   2   ARG ARG F . n 
U  5  3   LEU 3   3   3   LEU LEU F . n 
U  5  4   GLU 4   4   4   GLU GLU F . n 
U  5  5   ARG 5   5   5   ARG ARG F . n 
U  5  6   VAL 6   6   6   VAL VAL F . n 
U  5  7   LEU 7   7   7   LEU LEU F . n 
U  5  8   GLU 8   8   8   GLU GLU F . n 
U  5  9   GLU 9   9   9   GLU GLU F . n 
U  5  10  ALA 10  10  10  ALA ALA F . n 
U  5  11  ARG 11  11  11  ARG ARG F . n 
U  5  12  ALA 12  12  12  ALA ALA F . n 
U  5  13  LYS 13  13  13  LYS LYS F . n 
U  5  14  GLY 14  14  14  GLY GLY F . n 
U  5  15  TYR 15  15  15  TYR TYR F . n 
U  5  16  PRO 16  16  16  PRO PRO F . n 
U  5  17  ILE 17  17  17  ILE ILE F . n 
U  5  18  GLU 18  18  18  GLU GLU F . n 
U  5  19  ASP 19  19  19  ASP ASP F . n 
U  5  20  ASN 20  20  20  ASN ASN F . n 
U  5  21  GLY 21  21  21  GLY GLY F . n 
U  5  22  LEU 22  22  22  LEU LEU F . n 
U  5  23  GLY 23  23  23  GLY GLY F . n 
U  5  24  ASN 24  24  24  ASN ASN F . n 
U  5  25  LEU 25  25  25  LEU LEU F . n 
U  5  26  TRP 26  26  26  TRP TRP F . n 
U  5  27  VAL 27  27  27  VAL VAL F . n 
U  5  28  VAL 28  28  28  VAL VAL F . n 
U  5  29  LEU 29  29  29  LEU LEU F . n 
U  5  30  PRO 30  30  30  PRO PRO F . n 
U  5  31  ARG 31  31  31  ARG ARG F . n 
U  5  32  GLU 32  32  32  GLU GLU F . n 
U  5  33  ARG 33  33  33  ARG ARG F . n 
U  5  34  PHE 34  34  34  PHE PHE F . n 
U  5  35  LYS 35  35  35  LYS LYS F . n 
U  5  36  GLU 36  36  36  GLU GLU F . n 
U  5  37  GLU 37  37  37  GLU GLU F . n 
U  5  38  MET 38  38  38  MET MET F . n 
U  5  39  ALA 39  39  39  ALA ALA F . n 
U  5  40  HIS 40  40  40  HIS HIS F . n 
U  5  41  TYR 41  41  41  TYR TYR F . n 
U  5  42  LYS 42  42  42  LYS LYS F . n 
U  5  43  ALA 43  43  43  ALA ALA F . n 
U  5  44  MET 44  44  44  MET MET F . n 
U  5  45  GLY 45  45  45  GLY GLY F . n 
U  5  46  PHE 46  46  46  PHE PHE F . n 
U  5  47  ASN 47  47  47  ASN ASN F . n 
U  5  48  PHE 48  48  48  PHE PHE F . n 
U  5  49  LEU 49  49  49  LEU LEU F . n 
U  5  50  ALA 50  50  50  ALA ALA F . n 
U  5  51  ASP 51  51  51  ASP ASP F . n 
U  5  52  ILE 52  52  52  ILE ILE F . n 
U  5  53  VAL 53  53  53  VAL VAL F . n 
U  5  54  GLY 54  54  54  GLY GLY F . n 
U  5  55  LEU 55  55  55  LEU LEU F . n 
U  5  56  ASP 56  56  56  ASP ASP F . n 
U  5  57  TYR 57  57  57  TYR TYR F . n 
U  5  58  LEU 58  58  58  LEU LEU F . n 
U  5  59  THR 59  59  59  THR THR F . n 
U  5  60  TYR 60  60  60  TYR TYR F . n 
U  5  61  PRO 61  61  61  PRO PRO F . n 
U  5  62  ASP 62  62  62  ASP ASP F . n 
U  5  63  PRO 63  63  63  PRO PRO F . n 
U  5  64  ARG 64  64  64  ARG ARG F . n 
U  5  65  PRO 65  65  65  PRO PRO F . n 
U  5  66  GLU 66  66  66  GLU GLU F . n 
U  5  67  ARG 67  67  67  ARG ARG F . n 
U  5  68  PHE 68  68  68  PHE PHE F . n 
U  5  69  ALA 69  69  69  ALA ALA F . n 
U  5  70  VAL 70  70  70  VAL VAL F . n 
U  5  71  VAL 71  71  71  VAL VAL F . n 
U  5  72  TYR 72  72  72  TYR TYR F . n 
U  5  73  GLU 73  73  73  GLU GLU F . n 
U  5  74  LEU 74  74  74  LEU LEU F . n 
U  5  75  VAL 75  75  75  VAL VAL F . n 
U  5  76  SER 76  76  76  SER SER F . n 
U  5  77  LEU 77  77  77  LEU LEU F . n 
U  5  78  PRO 78  78  78  PRO PRO F . n 
U  5  79  GLY 79  79  79  GLY GLY F . n 
U  5  80  TRP 80  80  80  TRP TRP F . n 
U  5  81  LYS 81  81  81  LYS LYS F . n 
U  5  82  ASP 82  82  82  ASP ASP F . n 
U  5  83  GLY 83  83  83  GLY GLY F . n 
U  5  84  ASP 84  84  84  ASP ASP F . n 
U  5  85  GLY 85  85  85  GLY GLY F . n 
U  5  86  SER 86  86  86  SER SER F . n 
U  5  87  ARG 87  87  87  ARG ARG F . n 
U  5  88  PHE 88  88  88  PHE PHE F . n 
U  5  89  PHE 89  89  89  PHE PHE F . n 
U  5  90  VAL 90  90  90  VAL VAL F . n 
U  5  91  ARG 91  91  91  ARG ARG F . n 
U  5  92  VAL 92  92  92  VAL VAL F . n 
U  5  93  TYR 93  93  93  TYR TYR F . n 
U  5  94  VAL 94  94  94  VAL VAL F . n 
U  5  95  PRO 95  95  95  PRO PRO F . n 
U  5  96  GLU 96  96  96  GLU GLU F . n 
U  5  97  GLU 97  97  97  GLU GLU F . n 
U  5  98  ASP 98  98  98  ASP ASP F . n 
U  5  99  PRO 99  99  99  PRO PRO F . n 
U  5  100 ARG 100 100 100 ARG ARG F . n 
U  5  101 LEU 101 101 101 LEU LEU F . n 
U  5  102 PRO 102 102 102 PRO PRO F . n 
U  5  103 THR 103 103 103 THR THR F . n 
U  5  104 VAL 104 104 104 VAL VAL F . n 
U  5  105 THR 105 105 105 THR THR F . n 
U  5  106 ASP 106 106 106 ASP ASP F . n 
U  5  107 LEU 107 107 107 LEU LEU F . n 
U  5  108 TRP 108 108 108 TRP TRP F . n 
U  5  109 GLY 109 109 109 GLY GLY F . n 
U  5  110 SER 110 110 110 SER SER F . n 
U  5  111 ALA 111 111 111 ALA ALA F . n 
U  5  112 ASN 112 112 112 ASN ASN F . n 
U  5  113 PHE 113 113 113 PHE PHE F . n 
U  5  114 LEU 114 114 114 LEU LEU F . n 
U  5  115 GLU 115 115 115 GLU GLU F . n 
U  5  116 ARG 116 116 116 ARG ARG F . n 
U  5  117 GLU 117 117 117 GLU GLU F . n 
U  5  118 VAL 118 118 118 VAL VAL F . n 
U  5  119 TYR 119 119 119 TYR TYR F . n 
U  5  120 ASP 120 120 120 ASP ASP F . n 
U  5  121 LEU 121 121 121 LEU LEU F . n 
U  5  122 PHE 122 122 122 PHE PHE F . n 
U  5  123 GLY 123 123 123 GLY GLY F . n 
U  5  124 ILE 124 124 124 ILE ILE F . n 
U  5  125 VAL 125 125 125 VAL VAL F . n 
U  5  126 PHE 126 126 126 PHE PHE F . n 
U  5  127 GLU 127 127 127 GLU GLU F . n 
U  5  128 GLY 128 128 128 GLY GLY F . n 
U  5  129 HIS 129 129 129 HIS HIS F . n 
U  5  130 PRO 130 130 130 PRO PRO F . n 
U  5  131 ASP 131 131 131 ASP ASP F . n 
U  5  132 LEU 132 132 132 LEU LEU F . n 
U  5  133 ARG 133 133 133 ARG ARG F . n 
U  5  134 LYS 134 134 134 LYS LYS F . n 
U  5  135 ILE 135 135 135 ILE ILE F . n 
U  5  136 LEU 136 136 136 LEU LEU F . n 
U  5  137 THR 137 137 137 THR THR F . n 
U  5  138 PRO 138 138 138 PRO PRO F . n 
U  5  139 GLU 139 139 139 GLU GLU F . n 
U  5  140 ASP 140 140 140 ASP ASP F . n 
U  5  141 LEU 141 141 141 LEU LEU F . n 
U  5  142 GLU 142 142 142 GLU GLU F . n 
U  5  143 GLY 143 143 143 GLY GLY F . n 
U  5  144 HIS 144 144 144 HIS HIS F . n 
U  5  145 PRO 145 145 145 PRO PRO F . n 
U  5  146 LEU 146 146 146 LEU LEU F . n 
U  5  147 ARG 147 147 147 ARG ARG F . n 
U  5  148 LYS 148 148 148 LYS LYS F . n 
U  5  149 ASP 149 149 149 ASP ASP F . n 
U  5  150 TYR 150 150 150 TYR TYR F . n 
U  5  151 PRO 151 151 151 PRO PRO F . n 
U  5  152 LEU 152 152 152 LEU LEU F . n 
U  5  153 GLY 153 153 153 GLY GLY F . n 
U  5  154 GLU 154 154 154 GLU GLU F . n 
U  5  155 THR 155 155 155 THR THR F . n 
U  5  156 PRO 156 156 156 PRO PRO F . n 
U  5  157 THR 157 157 157 THR THR F . n 
U  5  158 LEU 158 158 158 LEU LEU F . n 
U  5  159 PHE 159 159 159 PHE PHE F . n 
U  5  160 ARG 160 160 160 ARG ARG F . n 
U  5  161 GLU 161 161 161 GLU GLU F . n 
U  5  162 GLY 162 162 162 GLY GLY F . n 
U  5  163 ARG 163 163 163 ARG ARG F . n 
U  5  164 TYR 164 164 164 TYR TYR F . n 
U  5  165 ILE 165 165 165 ILE ILE F . n 
U  5  166 ILE 166 166 166 ILE ILE F . n 
U  5  167 PRO 167 167 167 PRO PRO F . n 
U  5  168 ALA 168 168 168 ALA ALA F . n 
U  5  169 GLU 169 169 169 GLU GLU F . n 
U  5  170 PHE 170 170 170 PHE PHE F . n 
U  5  171 ARG 171 171 171 ARG ARG F . n 
U  5  172 ALA 172 172 172 ALA ALA F . n 
U  5  173 ALA 173 173 173 ALA ALA F . n 
U  5  174 LEU 174 174 174 LEU LEU F . n 
U  5  175 THR 175 175 175 THR THR F . n 
U  5  176 GLY 176 176 176 GLY GLY F . n 
U  5  177 LYS 177 177 177 LYS LYS F . n 
U  5  178 ASP 178 178 178 ASP ASP F . n 
U  5  179 PRO 179 179 179 PRO PRO F . n 
U  5  180 GLY 180 180 180 GLY GLY F . n 
U  5  181 LEU 181 181 181 LEU LEU F . n 
U  5  182 THR 182 182 182 THR THR F . n 
U  5  183 PHE 183 183 183 PHE PHE F . n 
U  5  184 TYR 184 184 184 TYR TYR F . n 
U  5  185 LYS 185 185 185 LYS LYS F . n 
U  5  186 GLY 186 186 186 GLY GLY F . n 
U  5  187 GLY 187 187 187 GLY GLY F . n 
U  5  188 SER 188 188 188 SER SER F . n 
U  5  189 ARG 189 189 189 ARG ARG F . n 
U  5  190 LYS 190 190 190 LYS LYS F . n 
U  5  191 GLY 191 191 191 GLY GLY F . n 
U  5  192 TYR 192 192 192 TYR TYR F . n 
U  5  193 ARG 193 193 193 ARG ARG F . n 
U  5  194 SER 194 194 194 SER SER F . n 
U  5  195 LEU 195 195 195 LEU LEU F . n 
U  5  196 TRP 196 196 196 TRP TRP F . n 
U  5  197 ALA 197 197 ?   ?   ?   F . n 
U  5  198 ASP 198 198 ?   ?   ?   F . n 
U  5  199 LEU 199 199 ?   ?   ?   F . n 
U  5  200 LYS 200 200 ?   ?   ?   F . n 
U  5  201 LYS 201 201 ?   ?   ?   F . n 
U  5  202 ALA 202 202 ?   ?   ?   F . n 
U  5  203 ARG 203 203 ?   ?   ?   F . n 
U  5  204 GLU 204 204 ?   ?   ?   F . n 
U  5  205 VAL 205 205 ?   ?   ?   F . n 
U  5  206 LYS 206 206 ?   ?   ?   F . n 
U  5  207 GLY 207 207 ?   ?   ?   F . n 
V  6  1   MET 1   1   ?   ?   ?   G . n 
V  6  2   ALA 2   2   ?   ?   ?   G . n 
V  6  3   LEU 3   3   ?   ?   ?   G . n 
V  6  4   LYS 4   4   ?   ?   ?   G . n 
V  6  5   ASP 5   5   ?   ?   ?   G . n 
V  6  6   LEU 6   6   ?   ?   ?   G . n 
V  6  7   PHE 7   7   ?   ?   ?   G . n 
V  6  8   GLU 8   8   ?   ?   ?   G . n 
V  6  9   ARG 9   9   ?   ?   ?   G . n 
V  6  10  ASP 10  10  ?   ?   ?   G . n 
V  6  11  VAL 11  11  ?   ?   ?   G . n 
V  6  12  GLN 12  12  ?   ?   ?   G . n 
V  6  13  GLU 13  13  ?   ?   ?   G . n 
V  6  14  LEU 14  14  ?   ?   ?   G . n 
V  6  15  GLU 15  15  ?   ?   ?   G . n 
V  6  16  ARG 16  16  16  ARG ARG G . n 
V  6  17  GLU 17  17  17  GLU GLU G . n 
V  6  18  GLY 18  18  18  GLY GLY G . n 
V  6  19  ILE 19  19  19  ILE ILE G . n 
V  6  20  LEU 20  20  20  LEU LEU G . n 
V  6  21  PHE 21  21  21  PHE PHE G . n 
V  6  22  THR 22  22  22  THR THR G . n 
V  6  23  THR 23  23  23  THR THR G . n 
V  6  24  LEU 24  24  24  LEU LEU G . n 
V  6  25  GLU 25  25  25  GLU GLU G . n 
V  6  26  LYS 26  26  26  LYS LYS G . n 
V  6  27  LEU 27  27  27  LEU LEU G . n 
V  6  28  VAL 28  28  28  VAL VAL G . n 
V  6  29  ALA 29  29  29  ALA ALA G . n 
V  6  30  TRP 30  30  30  TRP TRP G . n 
V  6  31  GLY 31  31  31  GLY GLY G . n 
V  6  32  ARG 32  32  32  ARG ARG G . n 
V  6  33  SER 33  33  33  SER SER G . n 
V  6  34  ASN 34  34  34  ASN ASN G . n 
V  6  35  SER 35  35  35  SER SER G . n 
V  6  36  LEU 36  36  36  LEU LEU G . n 
V  6  37  TRP 37  37  37  TRP TRP G . n 
V  6  38  PRO 38  38  38  PRO PRO G . n 
V  6  39  ALA 39  39  39  ALA ALA G . n 
V  6  40  THR 40  40  40  THR THR G . n 
V  6  41  PHE 41  41  41  PHE PHE G . n 
V  6  42  GLY 42  42  42  GLY GLY G . n 
V  6  43  LEU 43  43  43  LEU LEU G . n 
V  6  44  ALA 44  44  44  ALA ALA G . n 
V  6  45  CYS 45  45  45  CYS CYS G . n 
V  6  46  CYS 46  46  46  CYS CYS G . n 
V  6  47  ALA 47  47  47  ALA ALA G . n 
V  6  48  ILE 48  48  48  ILE ILE G . n 
V  6  49  GLU 49  49  49  GLU GLU G . n 
V  6  50  MET 50  50  50  MET MET G . n 
V  6  51  MET 51  51  51  MET MET G . n 
V  6  52  ALA 52  52  52  ALA ALA G . n 
V  6  53  SER 53  53  53  SER SER G . n 
V  6  54  THR 54  54  54  THR THR G . n 
V  6  55  ASP 55  55  55  ASP ASP G . n 
V  6  56  ALA 56  56  56  ALA ALA G . n 
V  6  57  ARG 57  57  57  ARG ARG G . n 
V  6  58  ASN 58  58  58  ASN ASN G . n 
V  6  59  ASP 59  59  59  ASP ASP G . n 
V  6  60  LEU 60  60  60  LEU LEU G . n 
V  6  61  ALA 61  61  61  ALA ALA G . n 
V  6  62  ARG 62  62  62  ARG ARG G . n 
V  6  63  PHE 63  63  63  PHE PHE G . n 
V  6  64  GLY 64  64  64  GLY GLY G . n 
V  6  65  SER 65  65  65  SER SER G . n 
V  6  66  GLU 66  66  66  GLU GLU G . n 
V  6  67  VAL 67  67  67  VAL VAL G . n 
V  6  68  PHE 68  68  68  PHE PHE G . n 
V  6  69  ARG 69  69  69  ARG ARG G . n 
V  6  70  ALA 70  70  70  ALA ALA G . n 
V  6  71  SER 71  71  71  SER SER G . n 
V  6  72  PRO 72  72  72  PRO PRO G . n 
V  6  73  ARG 73  73  73  ARG ARG G . n 
V  6  74  GLN 74  74  74  GLN GLN G . n 
V  6  75  ALA 75  75  75  ALA ALA G . n 
V  6  76  ASP 76  76  76  ASP ASP G . n 
V  6  77  VAL 77  77  77  VAL VAL G . n 
V  6  78  MET 78  78  78  MET MET G . n 
V  6  79  ILE 79  79  79  ILE ILE G . n 
V  6  80  VAL 80  80  80  VAL VAL G . n 
V  6  81  ALA 81  81  81  ALA ALA G . n 
V  6  82  GLY 82  82  82  GLY GLY G . n 
V  6  83  ARG 83  83  83  ARG ARG G . n 
V  6  84  LEU 84  84  84  LEU LEU G . n 
V  6  85  SER 85  85  85  SER SER G . n 
V  6  86  LYS 86  86  86  LYS LYS G . n 
V  6  87  LYS 87  87  87  LYS LYS G . n 
V  6  88  MET 88  88  88  MET MET G . n 
V  6  89  ALA 89  89  89  ALA ALA G . n 
V  6  90  PRO 90  90  90  PRO PRO G . n 
V  6  91  VAL 91  91  91  VAL VAL G . n 
V  6  92  MET 92  92  92  MET MET G . n 
V  6  93  ARG 93  93  93  ARG ARG G . n 
V  6  94  ARG 94  94  94  ARG ARG G . n 
V  6  95  VAL 95  95  95  VAL VAL G . n 
V  6  96  TRP 96  96  96  TRP TRP G . n 
V  6  97  GLU 97  97  97  GLU GLU G . n 
V  6  98  GLN 98  98  98  GLN GLN G . n 
V  6  99  MET 99  99  99  MET MET G . n 
V  6  100 PRO 100 100 100 PRO PRO G . n 
V  6  101 ASP 101 101 101 ASP ASP G . n 
V  6  102 PRO 102 102 102 PRO PRO G . n 
V  6  103 LYS 103 103 103 LYS LYS G . n 
V  6  104 TRP 104 104 104 TRP TRP G . n 
V  6  105 VAL 105 105 105 VAL VAL G . n 
V  6  106 ILE 106 106 106 ILE ILE G . n 
V  6  107 SER 107 107 107 SER SER G . n 
V  6  108 MET 108 108 108 MET MET G . n 
V  6  109 GLY 109 109 109 GLY GLY G . n 
V  6  110 ALA 110 110 110 ALA ALA G . n 
V  6  111 CYS 111 111 111 CYS CYS G . n 
V  6  112 ALA 112 112 112 ALA ALA G . n 
V  6  113 SER 113 113 113 SER SER G . n 
V  6  114 SER 114 114 114 SER SER G . n 
V  6  115 GLY 115 115 115 GLY GLY G . n 
V  6  116 GLY 116 116 116 GLY GLY G . n 
V  6  117 MET 117 117 117 MET MET G . n 
V  6  118 PHE 118 118 118 PHE PHE G . n 
V  6  119 ASN 119 119 119 ASN ASN G . n 
V  6  120 ASN 120 120 120 ASN ASN G . n 
V  6  121 TYR 121 121 121 TYR TYR G . n 
V  6  122 ALA 122 122 122 ALA ALA G . n 
V  6  123 ILE 123 123 123 ILE ILE G . n 
V  6  124 VAL 124 124 124 VAL VAL G . n 
V  6  125 GLN 125 125 125 GLN GLN G . n 
V  6  126 ASN 126 126 126 ASN ASN G . n 
V  6  127 VAL 127 127 127 VAL VAL G . n 
V  6  128 ASP 128 128 128 ASP ASP G . n 
V  6  129 SER 129 129 129 SER SER G . n 
V  6  130 VAL 130 130 130 VAL VAL G . n 
V  6  131 VAL 131 131 131 VAL VAL G . n 
V  6  132 PRO 132 132 132 PRO PRO G . n 
V  6  133 VAL 133 133 133 VAL VAL G . n 
V  6  134 ASP 134 134 134 ASP ASP G . n 
V  6  135 VAL 135 135 135 VAL VAL G . n 
V  6  136 TYR 136 136 136 TYR TYR G . n 
V  6  137 VAL 137 137 137 VAL VAL G . n 
V  6  138 PRO 138 138 138 PRO PRO G . n 
V  6  139 GLY 139 139 139 GLY GLY G . n 
V  6  140 CYS 140 140 140 CYS CYS G . n 
V  6  141 PRO 141 141 141 PRO PRO G . n 
V  6  142 PRO 142 142 142 PRO PRO G . n 
V  6  143 ARG 143 143 143 ARG ARG G . n 
V  6  144 PRO 144 144 144 PRO PRO G . n 
V  6  145 GLU 145 145 145 GLU GLU G . n 
V  6  146 ALA 146 146 146 ALA ALA G . n 
V  6  147 LEU 147 147 147 LEU LEU G . n 
V  6  148 ILE 148 148 148 ILE ILE G . n 
V  6  149 TYR 149 149 149 TYR TYR G . n 
V  6  150 ALA 150 150 150 ALA ALA G . n 
V  6  151 VAL 151 151 151 VAL VAL G . n 
V  6  152 MET 152 152 152 MET MET G . n 
V  6  153 GLN 153 153 153 GLN GLN G . n 
V  6  154 LEU 154 154 154 LEU LEU G . n 
V  6  155 GLN 155 155 155 GLN GLN G . n 
V  6  156 LYS 156 156 156 LYS LYS G . n 
V  6  157 LYS 157 157 157 LYS LYS G . n 
V  6  158 VAL 158 158 158 VAL VAL G . n 
V  6  159 ARG 159 159 159 ARG ARG G . n 
V  6  160 GLY 160 160 160 GLY GLY G . n 
V  6  161 GLN 161 161 161 GLN GLN G . n 
V  6  162 ALA 162 162 162 ALA ALA G . n 
V  6  163 TYR 163 163 163 TYR TYR G . n 
V  6  164 ASN 164 164 164 ASN ASN G . n 
V  6  165 GLU 165 165 165 GLU GLU G . n 
V  6  166 ARG 166 166 166 ARG ARG G . n 
V  6  167 GLY 167 167 167 GLY GLY G . n 
V  6  168 GLU 168 168 168 GLU GLU G . n 
V  6  169 ARG 169 169 169 ARG ARG G . n 
V  6  170 LEU 170 170 170 LEU LEU G . n 
V  6  171 PRO 171 171 171 PRO PRO G . n 
V  6  172 PRO 172 172 172 PRO PRO G . n 
V  6  173 VAL 173 173 173 VAL VAL G . n 
V  6  174 ALA 174 174 174 ALA ALA G . n 
V  6  175 ALA 175 175 175 ALA ALA G . n 
V  6  176 TRP 176 176 176 TRP TRP G . n 
V  6  177 LYS 177 177 177 LYS LYS G . n 
V  6  178 ARG 178 178 178 ARG ARG G . n 
V  6  179 THR 179 179 179 THR THR G . n 
V  6  180 ARG 180 180 180 ARG ARG G . n 
V  6  181 GLY 181 181 181 GLY GLY G . n 
W  7  1   MET 1   1   ?   ?   ?   O . n 
W  7  2   THR 2   2   2   THR THR O . n 
W  7  3   LEU 3   3   3   LEU LEU O . n 
W  7  4   LYS 4   4   4   LYS LYS O . n 
W  7  5   ALA 5   5   5   ALA ALA O . n 
W  7  6   LEU 6   6   6   LEU LEU O . n 
W  7  7   ALA 7   7   7   ALA ALA O . n 
W  7  8   GLN 8   8   8   GLN GLN O . n 
W  7  9   SER 9   9   9   SER SER O . n 
W  7  10  LEU 10  10  10  LEU LEU O . n 
W  7  11  GLY 11  11  11  GLY GLY O . n 
W  7  12  ILE 12  12  12  ILE ILE O . n 
W  7  13  THR 13  13  13  THR THR O . n 
W  7  14  LEU 14  14  14  LEU LEU O . n 
W  7  15  LYS 15  15  15  LYS LYS O . n 
W  7  16  TYR 16  16  16  TYR TYR O . n 
W  7  17  LEU 17  17  17  LEU LEU O . n 
W  7  18  PHE 18  18  18  PHE PHE O . n 
W  7  19  SER 19  19  19  SER SER O . n 
W  7  20  LYS 20  20  20  LYS LYS O . n 
W  7  21  PRO 21  21  21  PRO PRO O . n 
W  7  22  VAL 22  22  22  VAL VAL O . n 
W  7  23  THR 23  23  23  THR THR O . n 
W  7  24  VAL 24  24  24  VAL VAL O . n 
W  7  25  PRO 25  25  25  PRO PRO O . n 
W  7  26  TYR 26  26  26  TYR TYR O . n 
W  7  27  PRO 27  27  27  PRO PRO O . n 
W  7  28  ASP 28  28  28  ASP ASP O . n 
W  7  29  ALA 29  29  29  ALA ALA O . n 
W  7  30  PRO 30  30  30  PRO PRO O . n 
W  7  31  VAL 31  31  31  VAL VAL O . n 
W  7  32  ALA 32  32  32  ALA ALA O . n 
W  7  33  LEU 33  33  33  LEU LEU O . n 
W  7  34  LYS 34  34  34  LYS LYS O . n 
W  7  35  PRO 35  35  35  PRO PRO O . n 
W  7  36  ARG 36  36  36  ARG ARG O . n 
W  7  37  PHE 37  37  37  PHE PHE O . n 
W  7  38  HIS 38  38  38  HIS HIS O . n 
W  7  39  GLY 39  39  39  GLY GLY O . n 
W  7  40  ARG 40  40  40  ARG ARG O . n 
W  7  41  HIS 41  41  41  HIS HIS O . n 
W  7  42  VAL 42  42  42  VAL VAL O . n 
W  7  43  LEU 43  43  43  LEU LEU O . n 
W  7  44  THR 44  44  44  THR THR O . n 
W  7  45  ARG 45  45  45  ARG ARG O . n 
W  7  46  HIS 46  46  46  HIS HIS O . n 
W  7  47  PRO 47  47  47  PRO PRO O . n 
W  7  48  ASN 48  48  48  ASN ASN O . n 
W  7  49  GLY 49  49  49  GLY GLY O . n 
W  7  50  LEU 50  50  50  LEU LEU O . n 
W  7  51  GLU 51  51  51  GLU GLU O . n 
W  7  52  LYS 52  52  52  LYS LYS O . n 
W  7  53  CYS 53  53  53  CYS CYS O . n 
W  7  54  ILE 54  54  54  ILE ILE O . n 
W  7  55  GLY 55  55  55  GLY GLY O . n 
W  7  56  CYS 56  56  56  CYS CYS O . n 
W  7  57  SER 57  57  57  SER SER O . n 
W  7  58  LEU 58  58  58  LEU LEU O . n 
W  7  59  CYS 59  59  59  CYS CYS O . n 
W  7  60  ALA 60  60  60  ALA ALA O . n 
W  7  61  ALA 61  61  61  ALA ALA O . n 
W  7  62  ALA 62  62  62  ALA ALA O . n 
W  7  63  CYS 63  63  63  CYS CYS O . n 
W  7  64  PRO 64  64  64  PRO PRO O . n 
W  7  65  ALA 65  65  65  ALA ALA O . n 
W  7  66  TYR 66  66  66  TYR TYR O . n 
W  7  67  ALA 67  67  67  ALA ALA O . n 
W  7  68  ILE 68  68  68  ILE ILE O . n 
W  7  69  TYR 69  69  69  TYR TYR O . n 
W  7  70  VAL 70  70  70  VAL VAL O . n 
W  7  71  GLU 71  71  71  GLU GLU O . n 
W  7  72  PRO 72  72  72  PRO PRO O . n 
W  7  73  ALA 73  73  73  ALA ALA O . n 
W  7  74  GLU 74  74  74  GLU GLU O . n 
W  7  75  ASN 75  75  75  ASN ASN O . n 
W  7  76  ASP 76  76  76  ASP ASP O . n 
W  7  77  PRO 77  77  77  PRO PRO O . n 
W  7  78  GLU 78  78  78  GLU GLU O . n 
W  7  79  ASN 79  79  79  ASN ASN O . n 
W  7  80  PRO 80  80  80  PRO PRO O . n 
W  7  81  VAL 81  81  81  VAL VAL O . n 
W  7  82  SER 82  82  82  SER SER O . n 
W  7  83  ALA 83  83  83  ALA ALA O . n 
W  7  84  GLY 84  84  84  GLY GLY O . n 
W  7  85  GLU 85  85  85  GLU GLU O . n 
W  7  86  ARG 86  86  86  ARG ARG O . n 
W  7  87  TYR 87  87  87  TYR TYR O . n 
W  7  88  ALA 88  88  88  ALA ALA O . n 
W  7  89  LYS 89  89  89  LYS LYS O . n 
W  7  90  VAL 90  90  90  VAL VAL O . n 
W  7  91  TYR 91  91  91  TYR TYR O . n 
W  7  92  GLU 92  92  92  GLU GLU O . n 
W  7  93  ILE 93  93  93  ILE ILE O . n 
W  7  94  ASN 94  94  94  ASN ASN O . n 
W  7  95  MET 95  95  95  MET MET O . n 
W  7  96  LEU 96  96  96  LEU LEU O . n 
W  7  97  ARG 97  97  97  ARG ARG O . n 
W  7  98  CYS 98  98  98  CYS CYS O . n 
W  7  99  ILE 99  99  99  ILE ILE O . n 
W  7  100 PHE 100 100 100 PHE PHE O . n 
W  7  101 CYS 101 101 101 CYS CYS O . n 
W  7  102 GLY 102 102 102 GLY GLY O . n 
W  7  103 LEU 103 103 103 LEU LEU O . n 
W  7  104 CYS 104 104 104 CYS CYS O . n 
W  7  105 GLU 105 105 105 GLU GLU O . n 
W  7  106 GLU 106 106 106 GLU GLU O . n 
W  7  107 ALA 107 107 107 ALA ALA O . n 
W  7  108 CYS 108 108 108 CYS CYS O . n 
W  7  109 PRO 109 109 109 PRO PRO O . n 
W  7  110 THR 110 110 110 THR THR O . n 
W  7  111 GLY 111 111 111 GLY GLY O . n 
W  7  112 ALA 112 112 112 ALA ALA O . n 
W  7  113 ILE 113 113 113 ILE ILE O . n 
W  7  114 VAL 114 114 114 VAL VAL O . n 
W  7  115 LEU 115 115 115 LEU LEU O . n 
W  7  116 GLY 116 116 116 GLY GLY O . n 
W  7  117 TYR 117 117 117 TYR TYR O . n 
W  7  118 ASP 118 118 118 ASP ASP O . n 
W  7  119 PHE 119 119 119 PHE PHE O . n 
W  7  120 GLU 120 120 120 GLU GLU O . n 
W  7  121 MET 121 121 121 MET MET O . n 
W  7  122 ALA 122 122 122 ALA ALA O . n 
W  7  123 ASP 123 123 123 ASP ASP O . n 
W  7  124 TYR 124 124 124 TYR TYR O . n 
W  7  125 GLU 125 125 125 GLU GLU O . n 
W  7  126 TYR 126 126 126 TYR TYR O . n 
W  7  127 SER 127 127 127 SER SER O . n 
W  7  128 ASP 128 128 128 ASP ASP O . n 
W  7  129 LEU 129 129 129 LEU LEU O . n 
W  7  130 VAL 130 130 130 VAL VAL O . n 
W  7  131 TYR 131 131 131 TYR TYR O . n 
W  7  132 GLY 132 132 132 GLY GLY O . n 
W  7  133 LYS 133 133 133 LYS LYS O . n 
W  7  134 GLU 134 134 134 GLU GLU O . n 
W  7  135 ASP 135 135 135 ASP ASP O . n 
W  7  136 MET 136 136 136 MET MET O . n 
W  7  137 LEU 137 137 137 LEU LEU O . n 
W  7  138 VAL 138 138 138 VAL VAL O . n 
W  7  139 ASP 139 139 139 ASP ASP O . n 
W  7  140 VAL 140 140 140 VAL VAL O . n 
W  7  141 VAL 141 141 141 VAL VAL O . n 
W  7  142 GLY 142 142 142 GLY GLY O . n 
W  7  143 THR 143 143 143 THR THR O . n 
W  7  144 LYS 144 144 144 LYS LYS O . n 
W  7  145 PRO 145 145 145 PRO PRO O . n 
W  7  146 GLN 146 146 146 GLN GLN O . n 
W  7  147 ARG 147 147 147 ARG ARG O . n 
W  7  148 ARG 148 148 148 ARG ARG O . n 
W  7  149 GLU 149 149 149 GLU GLU O . n 
W  7  150 ALA 150 150 150 ALA ALA O . n 
W  7  151 LYS 151 151 151 LYS LYS O . n 
W  7  152 ARG 152 152 152 ARG ARG O . n 
W  7  153 THR 153 153 153 THR THR O . n 
W  7  154 GLY 154 154 154 GLY GLY O . n 
W  7  155 LYS 155 155 155 LYS LYS O . n 
W  7  156 PRO 156 156 156 PRO PRO O . n 
W  7  157 VAL 157 157 157 VAL VAL O . n 
W  7  158 LYS 158 158 158 LYS LYS O . n 
W  7  159 VAL 159 159 159 VAL VAL O . n 
W  7  160 GLY 160 160 160 GLY GLY O . n 
W  7  161 TYR 161 161 161 TYR TYR O . n 
W  7  162 VAL 162 162 162 VAL VAL O . n 
W  7  163 VAL 163 163 163 VAL VAL O . n 
W  7  164 PRO 164 164 164 PRO PRO O . n 
W  7  165 TYR 165 165 165 TYR TYR O . n 
W  7  166 VAL 166 166 166 VAL VAL O . n 
W  7  167 ARG 167 167 167 ARG ARG O . n 
W  7  168 PRO 168 168 168 PRO PRO O . n 
W  7  169 GLU 169 169 169 GLU GLU O . n 
W  7  170 LEU 170 170 170 LEU LEU O . n 
W  7  171 GLU 171 171 171 GLU GLU O . n 
W  7  172 GLY 172 172 172 GLY GLY O . n 
W  7  173 PHE 173 173 173 PHE PHE O . n 
W  7  174 LYS 174 174 174 LYS LYS O . n 
W  7  175 ALA 175 175 175 ALA ALA O . n 
W  7  176 PRO 176 176 176 PRO PRO O . n 
W  7  177 THR 177 177 177 THR THR O . n 
W  7  178 GLU 178 178 178 GLU GLU O . n 
W  7  179 GLY 179 179 179 GLY GLY O . n 
W  7  180 GLY 180 180 180 GLY GLY O . n 
W  7  181 LYS 181 181 181 LYS LYS O . n 
W  7  182 ARG 182 182 ?   ?   ?   O . n 
X  8  1   MET 1   1   ?   ?   ?   I . n 
X  8  2   SER 2   2   ?   ?   ?   I . n 
X  8  3   ALA 3   3   3   ALA ALA I . n 
X  8  4   SER 4   4   4   SER SER I . n 
X  8  5   SER 5   5   5   SER SER I . n 
X  8  6   GLU 6   6   6   GLU GLU I . n 
X  8  7   ARG 7   7   7   ARG ARG I . n 
X  8  8   GLU 8   8   8   GLU GLU I . n 
X  8  9   LEU 9   9   9   LEU LEU I . n 
X  8  10  TYR 10  10  10  TYR TYR I . n 
X  8  11  GLU 11  11  11  GLU GLU I . n 
X  8  12  ALA 12  12  12  ALA ALA I . n 
X  8  13  TRP 13  13  13  TRP TRP I . n 
X  8  14  VAL 14  14  14  VAL VAL I . n 
X  8  15  GLU 15  15  15  GLU GLU I . n 
X  8  16  LEU 16  16  16  LEU LEU I . n 
X  8  17  LEU 17  17  17  LEU LEU I . n 
X  8  18  SER 18  18  18  SER SER I . n 
X  8  19  TRP 19  19  19  TRP TRP I . n 
X  8  20  MET 20  20  20  MET MET I . n 
X  8  21  ARG 21  21  21  ARG ARG I . n 
X  8  22  GLU 22  22  22  GLU GLU I . n 
X  8  23  TYR 23  23  23  TYR TYR I . n 
X  8  24  ALA 24  24  24  ALA ALA I . n 
X  8  25  GLN 25  25  25  GLN GLN I . n 
X  8  26  ALA 26  26  26  ALA ALA I . n 
X  8  27  LYS 27  27  27  LYS LYS I . n 
X  8  28  GLY 28  28  28  GLY GLY I . n 
X  8  29  VAL 29  29  29  VAL VAL I . n 
X  8  30  ARG 30  30  30  ARG ARG I . n 
X  8  31  PHE 31  31  31  PHE PHE I . n 
X  8  32  GLU 32  32  32  GLU GLU I . n 
X  8  33  LYS 33  33  33  LYS LYS I . n 
X  8  34  GLU 34  34  34  GLU GLU I . n 
X  8  35  ALA 35  35  35  ALA ALA I . n 
X  8  36  ASP 36  36  36  ASP ASP I . n 
X  8  37  PHE 37  37  37  PHE PHE I . n 
X  8  38  PRO 38  38  38  PRO PRO I . n 
X  8  39  ASP 39  39  39  ASP ASP I . n 
X  8  40  PHE 40  40  40  PHE PHE I . n 
X  8  41  ILE 41  41  41  ILE ILE I . n 
X  8  42  TYR 42  42  42  TYR TYR I . n 
X  8  43  ARG 43  43  43  ARG ARG I . n 
X  8  44  MET 44  44  44  MET MET I . n 
X  8  45  GLU 45  45  45  GLU GLU I . n 
X  8  46  ARG 46  46  46  ARG ARG I . n 
X  8  47  PRO 47  47  47  PRO PRO I . n 
X  8  48  TYR 48  48  48  TYR TYR I . n 
X  8  49  ASP 49  49  49  ASP ASP I . n 
X  8  50  LEU 50  50  50  LEU LEU I . n 
X  8  51  PRO 51  51  51  PRO PRO I . n 
X  8  52  THR 52  52  52  THR THR I . n 
X  8  53  THR 53  53  53  THR THR I . n 
X  8  54  ILE 54  54  54  ILE ILE I . n 
X  8  55  MET 55  55  55  MET MET I . n 
X  8  56  THR 56  56  56  THR THR I . n 
X  8  57  ALA 57  57  57  ALA ALA I . n 
X  8  58  SER 58  58  58  SER SER I . n 
X  8  59  LEU 59  59  59  LEU LEU I . n 
X  8  60  SER 60  60  60  SER SER I . n 
X  8  61  ASP 61  61  61  ASP ASP I . n 
X  8  62  GLY 62  62  62  GLY GLY I . n 
X  8  63  LEU 63  63  63  LEU LEU I . n 
X  8  64  GLY 64  64  64  GLY GLY I . n 
X  8  65  GLU 65  65  65  GLU GLU I . n 
X  8  66  PRO 66  66  66  PRO PRO I . n 
X  8  67  PHE 67  67  67  PHE PHE I . n 
X  8  68  LEU 68  68  68  LEU LEU I . n 
X  8  69  LEU 69  69  69  LEU LEU I . n 
X  8  70  ALA 70  70  70  ALA ALA I . n 
X  8  71  ASP 71  71  71  ASP ASP I . n 
X  8  72  VAL 72  72  72  VAL VAL I . n 
X  8  73  SER 73  73  73  SER SER I . n 
X  8  74  PRO 74  74  74  PRO PRO I . n 
X  8  75  ARG 75  75  75  ARG ARG I . n 
X  8  76  HIS 76  76  76  HIS HIS I . n 
X  8  77  ALA 77  77  77  ALA ALA I . n 
X  8  78  LYS 78  78  78  LYS LYS I . n 
X  8  79  LEU 79  79  79  LEU LEU I . n 
X  8  80  LYS 80  80  80  LYS LYS I . n 
X  8  81  ARG 81  81  81  ARG ARG I . n 
X  8  82  ILE 82  82  82  ILE ILE I . n 
X  8  83  GLY 83  83  83  GLY GLY I . n 
X  8  84  LEU 84  84  84  LEU LEU I . n 
X  8  85  ARG 85  85  85  ARG ARG I . n 
X  8  86  LEU 86  86  86  LEU LEU I . n 
X  8  87  PRO 87  87  87  PRO PRO I . n 
X  8  88  ARG 88  88  88  ARG ARG I . n 
X  8  89  ALA 89  89  89  ALA ALA I . n 
X  8  90  HIS 90  90  90  HIS HIS I . n 
X  8  91  ILE 91  91  91  ILE ILE I . n 
X  8  92  HIS 92  92  92  HIS HIS I . n 
X  8  93  LEU 93  93  93  LEU LEU I . n 
X  8  94  HIS 94  94  94  HIS HIS I . n 
X  8  95  ALA 95  95  95  ALA ALA I . n 
X  8  96  HIS 96  96  96  HIS HIS I . n 
X  8  97  TYR 97  97  97  TYR TYR I . n 
X  8  98  GLU 98  98  98  GLU GLU I . n 
X  8  99  PRO 99  99  99  PRO PRO I . n 
X  8  100 GLY 100 100 100 GLY GLY I . n 
X  8  101 LYS 101 101 101 LYS LYS I . n 
X  8  102 GLY 102 102 102 GLY GLY I . n 
X  8  103 LEU 103 103 103 LEU LEU I . n 
X  8  104 VAL 104 104 104 VAL VAL I . n 
X  8  105 THR 105 105 105 THR THR I . n 
X  8  106 GLY 106 106 106 GLY GLY I . n 
X  8  107 LYS 107 107 107 LYS LYS I . n 
X  8  108 ILE 108 108 108 ILE ILE I . n 
X  8  109 PRO 109 109 109 PRO PRO I . n 
X  8  110 LEU 110 110 110 LEU LEU I . n 
X  8  111 THR 111 111 111 THR THR I . n 
X  8  112 LYS 112 112 112 LYS LYS I . n 
X  8  113 GLU 113 113 113 GLU GLU I . n 
X  8  114 ARG 114 114 114 ARG ARG I . n 
X  8  115 PHE 115 115 115 PHE PHE I . n 
X  8  116 PHE 116 116 116 PHE PHE I . n 
X  8  117 ALA 117 117 117 ALA ALA I . n 
X  8  118 LEU 118 118 118 LEU LEU I . n 
X  8  119 ALA 119 119 119 ALA ALA I . n 
X  8  120 ASP 120 120 120 ASP ASP I . n 
X  8  121 ARG 121 121 121 ARG ARG I . n 
X  8  122 ALA 122 122 122 ALA ALA I . n 
X  8  123 ARG 123 123 123 ARG ARG I . n 
X  8  124 GLU 124 124 124 GLU GLU I . n 
X  8  125 ALA 125 125 125 ALA ALA I . n 
X  8  126 LEU 126 126 126 LEU LEU I . n 
X  8  127 ALA 127 127 127 ALA ALA I . n 
X  8  128 PHE 128 128 128 PHE PHE I . n 
X  8  129 ALA 129 129 129 ALA ALA I . n 
Y  9  1   MET 1   1   1   MET MET X . n 
Y  9  2   VAL 2   2   2   VAL VAL X . n 
Y  9  3   ARG 3   3   3   ARG ARG X . n 
Y  9  4   VAL 4   4   4   VAL VAL X . n 
Y  9  5   GLY 5   5   5   GLY GLY X . n 
Y  9  6   MET 6   6   6   MET MET X . n 
Y  9  7   ARG 7   7   7   ARG ARG X . n 
Y  9  8   ALA 8   8   8   ALA ALA X . n 
Y  9  9   ALA 9   9   9   ALA ALA X . n 
Y  9  10  PRO 10  10  10  PRO PRO X . n 
Y  9  11  ARG 11  11  11  ARG ARG X . n 
Y  9  12  VAL 12  12  12  VAL VAL X . n 
Y  9  13  SER 13  13  13  SER SER X . n 
Y  9  14  LEU 14  14  14  LEU LEU X . n 
Y  9  15  GLU 15  15  15  GLU GLU X . n 
Y  9  16  ALA 16  16  16  ALA ALA X . n 
Y  9  17  LEU 17  17  17  LEU LEU X . n 
Y  9  18  LYS 18  18  18  LYS LYS X . n 
Y  9  19  ALA 19  19  19  ALA ALA X . n 
Y  9  20  ALA 20  20  20  ALA ALA X . n 
Y  9  21  LEU 21  21  21  LEU LEU X . n 
Y  9  22  GLY 22  22  22  GLY GLY X . n 
Y  9  23  GLY 23  23  23  GLY GLY X . n 
Y  9  24  LEU 24  24  24  LEU LEU X . n 
Y  9  25  LYS 25  25  25  LYS LYS X . n 
Y  9  26  LEU 26  26  26  LEU LEU X . n 
Y  9  27  SER 27  27  27  SER SER X . n 
Y  9  28  GLU 28  28  28  GLU GLU X . n 
Y  9  29  ALA 29  29  29  ALA ALA X . n 
Y  9  30  LYS 30  30  30  LYS LYS X . n 
Y  9  31  VAL 31  31  31  VAL VAL X . n 
Y  9  32  TYR 32  32  32  TYR TYR X . n 
Y  9  33  LEU 33  33  33  LEU LEU X . n 
Y  9  34  ILE 34  34  34  ILE ILE X . n 
Y  9  35  THR 35  35  35  THR THR X . n 
Y  9  36  ASP 36  36  36  ASP ASP X . n 
Y  9  37  TRP 37  37  37  TRP TRP X . n 
Y  9  38  GLN 38  38  38  GLN GLN X . n 
Y  9  39  ASP 39  39  39  ASP ASP X . n 
Y  9  40  LYS 40  40  40  LYS LYS X . n 
Y  9  41  ARG 41  41  41  ARG ARG X . n 
Y  9  42  ASP 42  42  42  ASP ASP X . n 
Y  9  43  GLN 43  43  43  GLN GLN X . n 
Y  9  44  ALA 44  44  44  ALA ALA X . n 
Y  9  45  ARG 45  45  45  ARG ARG X . n 
Y  9  46  TYR 46  46  46  TYR TYR X . n 
Y  9  47  ALA 47  47  47  ALA ALA X . n 
Y  9  48  LEU 48  48  48  LEU LEU X . n 
Y  9  49  LEU 49  49  49  LEU LEU X . n 
Y  9  50  LEU 50  50  50  LEU LEU X . n 
Y  9  51  HIS 51  51  51  HIS HIS X . n 
Y  9  52  THR 52  52  52  THR THR X . n 
Y  9  53  GLY 53  53  53  GLY GLY X . n 
Y  9  54  LYS 54  54  54  LYS LYS X . n 
Y  9  55  LYS 55  55  55  LYS LYS X . n 
Y  9  56  ASP 56  56  56  ASP ASP X . n 
Y  9  57  LEU 57  57  57  LEU LEU X . n 
Y  9  58  LEU 58  58  58  LEU LEU X . n 
Y  9  59  VAL 59  59  59  VAL VAL X . n 
Y  9  60  PRO 60  60  60  PRO PRO X . n 
Y  9  61  ASP 61  61  61  ASP ASP X . n 
Y  9  62  ALA 62  62  62  ALA ALA X . n 
Y  9  63  PHE 63  63  63  PHE PHE X . n 
Y  9  64  GLY 64  64  64  GLY GLY X . n 
Y  9  65  PRO 65  65  65  PRO PRO X . n 
Y  9  66  ALA 66  66  66  ALA ALA X . n 
Y  9  67  PHE 67  67  67  PHE PHE X . n 
Y  9  68  PRO 68  68  68  PRO PRO X . n 
Y  9  69  GLY 69  69  69  GLY GLY X . n 
Y  9  70  GLY 70  70  70  GLY GLY X . n 
Y  9  71  GLU 71  71  71  GLU GLU X . n 
Y  9  72  GLU 72  72  72  GLU GLU X . n 
Y  9  73  ALA 73  73  73  ALA ALA X . n 
Y  9  74  LEU 74  74  74  LEU LEU X . n 
Y  9  75  SER 75  75  75  SER SER X . n 
Y  9  76  GLU 76  76  76  GLU GLU X . n 
Y  9  77  LEU 77  77  77  LEU LEU X . n 
Y  9  78  VAL 78  78  78  VAL VAL X . n 
Y  9  79  GLY 79  79  79  GLY GLY X . n 
Y  9  80  LEU 80  80  80  LEU LEU X . n 
Y  9  81  LEU 81  81  81  LEU LEU X . n 
Y  9  82  LEU 82  82  82  LEU LEU X . n 
Y  9  83  ALA 83  83  83  ALA ALA X . n 
Y  9  84  GLN 84  84  84  GLN GLN X . n 
Y  9  85  GLY 85  85  85  GLY GLY X . n 
Y  9  86  ALA 86  86  86  ALA ALA X . n 
Y  9  87  ARG 87  87  87  ARG ARG X . n 
Y  9  88  ARG 88  88  88  ARG ARG X . n 
Y  9  89  PHE 89  89  89  PHE PHE X . n 
Y  9  90  TYR 90  90  90  TYR TYR X . n 
Y  9  91  GLU 91  91  91  GLU GLU X . n 
Y  9  92  ALA 92  92  92  ALA ALA X . n 
Y  9  93  VAL 93  93  93  VAL VAL X . n 
Y  9  94  VAL 94  94  94  VAL VAL X . n 
Y  9  95  SER 95  95  95  SER SER X . n 
Y  9  96  PRO 96  96  96  PRO PRO X . n 
Y  9  97  GLY 97  97  97  GLY GLY X . n 
Y  9  98  GLU 98  98  98  GLU GLU X . n 
Y  9  99  MET 99  99  99  MET MET X . n 
Y  9  100 THR 100 100 100 THR THR X . n 
Y  9  101 ALA 101 101 101 ALA ALA X . n 
Y  9  102 LEU 102 102 102 LEU LEU X . n 
Y  9  103 LEU 103 103 103 LEU LEU X . n 
Y  9  104 ASP 104 104 104 ASP ASP X . n 
Y  9  105 LEU 105 105 105 LEU LEU X . n 
Y  9  106 PRO 106 106 106 PRO PRO X . n 
Y  9  107 PRO 107 107 107 PRO PRO X . n 
Y  9  108 GLU 108 108 108 GLU GLU X . n 
Y  9  109 GLU 109 109 109 GLU GLU X . n 
Y  9  110 LEU 110 110 110 LEU LEU X . n 
Y  9  111 LEU 111 111 111 LEU LEU X . n 
Y  9  112 LYS 112 112 112 LYS LYS X . n 
Y  9  113 ARG 113 113 113 ARG ARG X . n 
Y  9  114 VAL 114 114 114 VAL VAL X . n 
Y  9  115 MET 115 115 115 MET MET X . n 
Y  9  116 ALA 116 116 116 ALA ALA X . n 
Y  9  117 ILE 117 117 117 ILE ILE X . n 
Y  9  118 ALA 118 118 118 ALA ALA X . n 
Y  9  119 ASN 119 119 119 ASN ASN X . n 
Y  9  120 PRO 120 120 120 PRO PRO X . n 
Y  9  121 THR 121 121 121 THR THR X . n 
Y  9  122 ASP 122 122 122 ASP ASP X . n 
Y  9  123 PRO 123 123 123 PRO PRO X . n 
Y  9  124 GLY 124 124 124 GLY GLY X . n 
Y  9  125 ILE 125 125 125 ILE ILE X . n 
Y  9  126 TYR 126 126 126 TYR TYR X . n 
Y  9  127 LEU 127 127 127 LEU LEU X . n 
Y  9  128 LYS 128 128 ?   ?   ?   X . n 
Y  9  129 ARG 129 129 ?   ?   ?   X . n 
Y  9  130 ALA 130 130 ?   ?   ?   X . n 
Y  9  131 ALA 131 131 ?   ?   ?   X . n 
Z  10 1   MET 1   1   1   MET MET P . n 
Z  10 2   ALA 2   2   2   ALA ALA P . n 
Z  10 3   PRO 3   3   3   PRO PRO P . n 
Z  10 4   ILE 4   4   4   ILE ILE P . n 
Z  10 5   GLN 5   5   5   GLN GLN P . n 
Z  10 6   GLU 6   6   6   GLU GLU P . n 
Z  10 7   TYR 7   7   7   TYR TYR P . n 
Z  10 8   VAL 8   8   8   VAL VAL P . n 
Z  10 9   GLY 9   9   9   GLY GLY P . n 
Z  10 10  THR 10  10  10  THR THR P . n 
Z  10 11  LEU 11  11  11  LEU LEU P . n 
Z  10 12  ILE 12  12  12  ILE ILE P . n 
Z  10 13  TYR 13  13  13  TYR TYR P . n 
Z  10 14  VAL 14  14  14  VAL VAL P . n 
Z  10 15  GLY 15  15  15  GLY GLY P . n 
Z  10 16  VAL 16  16  16  VAL VAL P . n 
Z  10 17  ALA 17  17  17  ALA ALA P . n 
Z  10 18  LEU 18  18  18  LEU LEU P . n 
Z  10 19  PHE 19  19  19  PHE PHE P . n 
Z  10 20  ILE 20  20  20  ILE ILE P . n 
Z  10 21  GLY 21  21  21  GLY GLY P . n 
Z  10 22  VAL 22  22  22  VAL VAL P . n 
Z  10 23  ALA 23  23  23  ALA ALA P . n 
Z  10 24  ALA 24  24  24  ALA ALA P . n 
Z  10 25  LEU 25  25  25  LEU LEU P . n 
Z  10 26  LEU 26  26  26  LEU LEU P . n 
Z  10 27  VAL 27  27  27  VAL VAL P . n 
Z  10 28  GLY 28  28  28  GLY GLY P . n 
Z  10 29  ALA 29  29  29  ALA ALA P . n 
Z  10 30  LEU 30  30  30  LEU LEU P . n 
Z  10 31  LEU 31  31  31  LEU LEU P . n 
Z  10 32  GLY 32  32  32  GLY GLY P . n 
Z  10 33  PRO 33  33  33  PRO PRO P . n 
Z  10 34  LYS 34  34  34  LYS LYS P . n 
Z  10 35  LYS 35  35  35  LYS LYS P . n 
Z  10 36  PRO 36  36  36  PRO PRO P . n 
Z  10 37  GLY 37  37  37  GLY GLY P . n 
Z  10 38  ARG 38  38  38  ARG ARG P . n 
Z  10 39  ALA 39  39  39  ALA ALA P . n 
Z  10 40  LYS 40  40  40  LYS LYS P . n 
Z  10 41  LEU 41  41  41  LEU LEU P . n 
Z  10 42  MET 42  42  42  MET MET P . n 
Z  10 43  PRO 43  43  43  PRO PRO P . n 
Z  10 44  TYR 44  44  44  TYR TYR P . n 
Z  10 45  GLU 45  45  45  GLU GLU P . n 
Z  10 46  SER 46  46  46  SER SER P . n 
Z  10 47  GLY 47  47  47  GLY GLY P . n 
Z  10 48  ASN 48  48  48  ASN ASN P . n 
Z  10 49  ASP 49  49  49  ASP ASP P . n 
Z  10 50  PRO 50  50  50  PRO PRO P . n 
Z  10 51  ALA 51  51  51  ALA ALA P . n 
Z  10 52  GLY 52  52  52  GLY GLY P . n 
Z  10 53  GLU 53  53  53  GLU GLU P . n 
Z  10 54  VAL 54  54  54  VAL VAL P . n 
Z  10 55  LYS 55  55  55  LYS LYS P . n 
Z  10 56  ARG 56  56  56  ARG ARG P . n 
Z  10 57  PHE 57  57  57  PHE PHE P . n 
Z  10 58  PRO 58  58  58  PRO PRO P . n 
Z  10 59  VAL 59  59  59  VAL VAL P . n 
Z  10 60  HIS 60  60  60  HIS HIS P . n 
Z  10 61  PHE 61  61  61  PHE PHE P . n 
Z  10 62  TYR 62  62  62  TYR TYR P . n 
Z  10 63  VAL 63  63  63  VAL VAL P . n 
Z  10 64  VAL 64  64  64  VAL VAL P . n 
Z  10 65  ALA 65  65  65  ALA ALA P . n 
Z  10 66  MET 66  66  66  MET MET P . n 
Z  10 67  LEU 67  67  67  LEU LEU P . n 
Z  10 68  PHE 68  68  68  PHE PHE P . n 
Z  10 69  ILE 69  69  69  ILE ILE P . n 
Z  10 70  LEU 70  70  70  LEU LEU P . n 
Z  10 71  PHE 71  71  71  PHE PHE P . n 
Z  10 72  ASP 72  72  72  ASP ASP P . n 
Z  10 73  VAL 73  73  73  VAL VAL P . n 
Z  10 74  GLU 74  74  74  GLU GLU P . n 
Z  10 75  VAL 75  75  75  VAL VAL P . n 
Z  10 76  ALA 76  76  76  ALA ALA P . n 
Z  10 77  PHE 77  77  77  PHE PHE P . n 
Z  10 78  LEU 78  78  78  LEU LEU P . n 
Z  10 79  TRP 79  79  79  TRP TRP P . n 
Z  10 80  PRO 80  80  80  PRO PRO P . n 
Z  10 81  TYR 81  81  81  TYR TYR P . n 
Z  10 82  ALA 82  82  82  ALA ALA P . n 
Z  10 83  VAL 83  83  83  VAL VAL P . n 
Z  10 84  SER 84  84  84  SER SER P . n 
Z  10 85  ALA 85  85  85  ALA ALA P . n 
Z  10 86  GLY 86  86  86  GLY GLY P . n 
Z  10 87  GLY 87  87  87  GLY GLY P . n 
Z  10 88  LEU 88  88  88  LEU LEU P . n 
Z  10 89  GLY 89  89  89  GLY GLY P . n 
Z  10 90  LEU 90  90  90  LEU LEU P . n 
Z  10 91  TYR 91  91  91  TYR TYR P . n 
Z  10 92  GLY 92  92  92  GLY GLY P . n 
Z  10 93  PHE 93  93  93  PHE PHE P . n 
Z  10 94  LEU 94  94  94  LEU LEU P . n 
Z  10 95  GLY 95  95  95  GLY GLY P . n 
Z  10 96  VAL 96  96  96  VAL VAL P . n 
Z  10 97  LEU 97  97  97  LEU LEU P . n 
Z  10 98  ALA 98  98  98  ALA ALA P . n 
Z  10 99  PHE 99  99  99  PHE PHE P . n 
Z  10 100 THR 100 100 100 THR THR P . n 
Z  10 101 LEU 101 101 101 LEU LEU P . n 
Z  10 102 LEU 102 102 102 LEU LEU P . n 
Z  10 103 LEU 103 103 103 LEU LEU P . n 
Z  10 104 PHE 104 104 104 PHE PHE P . n 
Z  10 105 VAL 105 105 105 VAL VAL P . n 
Z  10 106 GLY 106 106 106 GLY GLY P . n 
Z  10 107 PHE 107 107 107 PHE PHE P . n 
Z  10 108 LEU 108 108 108 LEU LEU P . n 
Z  10 109 TYR 109 109 109 TYR TYR P . n 
Z  10 110 GLU 110 110 110 GLU GLU P . n 
Z  10 111 TRP 111 111 111 TRP TRP P . n 
Z  10 112 TRP 112 112 112 TRP TRP P . n 
Z  10 113 LYS 113 113 113 LYS LYS P . n 
Z  10 114 GLY 114 114 114 GLY GLY P . n 
Z  10 115 VAL 115 115 115 VAL VAL P . n 
Z  10 116 MET 116 116 116 MET MET P . n 
Z  10 117 ARG 117 117 117 ARG ARG P . n 
Z  10 118 TRP 118 118 ?   ?   ?   P . n 
Z  10 119 HIS 119 119 ?   ?   ?   P . n 
AA 11 1   MET 1   1   1   MET MET R . n 
AA 11 2   SER 2   2   2   SER SER R . n 
AA 11 3   LEU 3   3   3   LEU LEU R . n 
AA 11 4   LEU 4   4   4   LEU LEU R . n 
AA 11 5   GLU 5   5   5   GLU GLU R . n 
AA 11 6   GLY 6   6   6   GLY GLY R . n 
AA 11 7   LEU 7   7   7   LEU LEU R . n 
AA 11 8   ALA 8   8   8   ALA ALA R . n 
AA 11 9   LEU 9   9   9   LEU LEU R . n 
AA 11 10  PHE 10  10  10  PHE PHE R . n 
AA 11 11  LEU 11  11  11  LEU LEU R . n 
AA 11 12  LEU 12  12  12  LEU LEU R . n 
AA 11 13  LEU 13  13  13  LEU LEU R . n 
AA 11 14  LEU 14  14  14  LEU LEU R . n 
AA 11 15  SER 15  15  15  SER SER R . n 
AA 11 16  GLY 16  16  16  GLY GLY R . n 
AA 11 17  VAL 17  17  17  VAL VAL R . n 
AA 11 18  LEU 18  18  18  LEU LEU R . n 
AA 11 19  VAL 19  19  19  VAL VAL R . n 
AA 11 20  VAL 20  20  20  VAL VAL R . n 
AA 11 21  THR 21  21  21  THR THR R . n 
AA 11 22  LEU 22  22  22  LEU LEU R . n 
AA 11 23  ARG 23  23  23  ARG ARG R . n 
AA 11 24  ASN 24  24  24  ASN ASN R . n 
AA 11 25  ALA 25  25  25  ALA ALA R . n 
AA 11 26  ILE 26  26  26  ILE ILE R . n 
AA 11 27  HIS 27  27  27  HIS HIS R . n 
AA 11 28  ALA 28  28  28  ALA ALA R . n 
AA 11 29  ALA 29  29  29  ALA ALA R . n 
AA 11 30  LEU 30  30  30  LEU LEU R . n 
AA 11 31  ALA 31  31  31  ALA ALA R . n 
AA 11 32  LEU 32  32  32  LEU LEU R . n 
AA 11 33  ILE 33  33  33  ILE ILE R . n 
AA 11 34  LEU 34  34  34  LEU LEU R . n 
AA 11 35  ASN 35  35  35  ASN ASN R . n 
AA 11 36  PHE 36  36  36  PHE PHE R . n 
AA 11 37  LEU 37  37  37  LEU LEU R . n 
AA 11 38  VAL 38  38  38  VAL VAL R . n 
AA 11 39  LEU 39  39  39  LEU LEU R . n 
AA 11 40  ALA 40  40  40  ALA ALA R . n 
AA 11 41  GLY 41  41  41  GLY GLY R . n 
AA 11 42  VAL 42  42  42  VAL VAL R . n 
AA 11 43  TYR 43  43  43  TYR TYR R . n 
AA 11 44  VAL 44  44  44  VAL VAL R . n 
AA 11 45  ALA 45  45  45  ALA ALA R . n 
AA 11 46  LEU 46  46  46  LEU LEU R . n 
AA 11 47  ASP 47  47  47  ASP ASP R . n 
AA 11 48  ALA 48  48  48  ALA ALA R . n 
AA 11 49  ARG 49  49  49  ARG ARG R . n 
AA 11 50  PHE 50  50  50  PHE PHE R . n 
AA 11 51  LEU 51  51  51  LEU LEU R . n 
AA 11 52  GLY 52  52  52  GLY GLY R . n 
AA 11 53  PHE 53  53  53  PHE PHE R . n 
AA 11 54  ILE 54  54  54  ILE ILE R . n 
AA 11 55  GLN 55  55  55  GLN GLN R . n 
AA 11 56  VAL 56  56  56  VAL VAL R . n 
AA 11 57  ILE 57  57  57  ILE ILE R . n 
AA 11 58  VAL 58  58  58  VAL VAL R . n 
AA 11 59  TYR 59  59  59  TYR TYR R . n 
AA 11 60  ALA 60  60  60  ALA ALA R . n 
AA 11 61  GLY 61  61  61  GLY GLY R . n 
AA 11 62  ALA 62  62  62  ALA ALA R . n 
AA 11 63  ILE 63  63  63  ILE ILE R . n 
AA 11 64  VAL 64  64  64  VAL VAL R . n 
AA 11 65  VAL 65  65  65  VAL VAL R . n 
AA 11 66  LEU 66  66  66  LEU LEU R . n 
AA 11 67  PHE 67  67  67  PHE PHE R . n 
AA 11 68  LEU 68  68  68  LEU LEU R . n 
AA 11 69  PHE 69  69  69  PHE PHE R . n 
AA 11 70  VAL 70  70  70  VAL VAL R . n 
AA 11 71  ILE 71  71  71  ILE ILE R . n 
AA 11 72  MET 72  72  72  MET MET R . n 
AA 11 73  LEU 73  73  73  LEU LEU R . n 
AA 11 74  LEU 74  74  74  LEU LEU R . n 
AA 11 75  PHE 75  75  75  PHE PHE R . n 
AA 11 76  ALA 76  76  76  ALA ALA R . n 
AA 11 77  ALA 77  77  77  ALA ALA R . n 
AA 11 78  GLN 78  78  78  GLN GLN R . n 
AA 11 79  GLY 79  79  79  GLY GLY R . n 
AA 11 80  GLU 80  80  80  GLU GLU R . n 
AA 11 81  ILE 81  81  81  ILE ILE R . n 
AA 11 82  GLY 82  82  82  GLY GLY R . n 
AA 11 83  PHE 83  83  83  PHE PHE R . n 
AA 11 84  ASP 84  84  84  ASP ASP R . n 
AA 11 85  PRO 85  85  85  PRO PRO R . n 
AA 11 86  LEU 86  86  86  LEU LEU R . n 
AA 11 87  VAL 87  87  87  VAL VAL R . n 
AA 11 88  ARG 88  88  88  ARG ARG R . n 
AA 11 89  SER 89  89  89  SER SER R . n 
AA 11 90  ARG 90  90  90  ARG ARG R . n 
AA 11 91  PRO 91  91  91  PRO PRO R . n 
AA 11 92  LEU 92  92  92  LEU LEU R . n 
AA 11 93  ALA 93  93  93  ALA ALA R . n 
AA 11 94  ALA 94  94  94  ALA ALA R . n 
AA 11 95  LEU 95  95  95  LEU LEU R . n 
AA 11 96  LEU 96  96  96  LEU LEU R . n 
AA 11 97  ALA 97  97  97  ALA ALA R . n 
AA 11 98  LEU 98  98  98  LEU LEU R . n 
AA 11 99  GLY 99  99  99  GLY GLY R . n 
AA 11 100 VAL 100 100 100 VAL VAL R . n 
AA 11 101 ALA 101 101 101 ALA ALA R . n 
AA 11 102 GLY 102 102 102 GLY GLY R . n 
AA 11 103 ILE 103 103 103 ILE ILE R . n 
AA 11 104 LEU 104 104 104 LEU LEU R . n 
AA 11 105 ALA 105 105 105 ALA ALA R . n 
AA 11 106 ALA 106 106 106 ALA ALA R . n 
AA 11 107 GLY 107 107 107 GLY GLY R . n 
AA 11 108 LEU 108 108 108 LEU LEU R . n 
AA 11 109 TRP 109 109 109 TRP TRP R . n 
AA 11 110 GLY 110 110 110 GLY GLY R . n 
AA 11 111 LEU 111 111 111 LEU LEU R . n 
AA 11 112 ASP 112 112 112 ASP ASP R . n 
AA 11 113 LEU 113 113 113 LEU LEU R . n 
AA 11 114 ALA 114 114 114 ALA ALA R . n 
AA 11 115 PHE 115 115 115 PHE PHE R . n 
AA 11 116 THR 116 116 116 THR THR R . n 
AA 11 117 GLN 117 117 117 GLN GLN R . n 
AA 11 118 ASP 118 118 118 ASP ASP R . n 
AA 11 119 LEU 119 119 119 LEU LEU R . n 
AA 11 120 LYS 120 120 120 LYS LYS R . n 
AA 11 121 GLY 121 121 121 GLY GLY R . n 
AA 11 122 GLY 122 122 122 GLY GLY R . n 
AA 11 123 LEU 123 123 123 LEU LEU R . n 
AA 11 124 PRO 124 124 124 PRO PRO R . n 
AA 11 125 GLN 125 125 125 GLN GLN R . n 
AA 11 126 ALA 126 126 126 ALA ALA R . n 
AA 11 127 LEU 127 127 127 LEU LEU R . n 
AA 11 128 GLY 128 128 128 GLY GLY R . n 
AA 11 129 PRO 129 129 129 PRO PRO R . n 
AA 11 130 LEU 130 130 130 LEU LEU R . n 
AA 11 131 LEU 131 131 131 LEU LEU R . n 
AA 11 132 TYR 132 132 132 TYR TYR R . n 
AA 11 133 GLY 133 133 133 GLY GLY R . n 
AA 11 134 ASP 134 134 134 ASP ASP R . n 
AA 11 135 TRP 135 135 135 TRP TRP R . n 
AA 11 136 LEU 136 136 136 LEU LEU R . n 
AA 11 137 PHE 137 137 137 PHE PHE R . n 
AA 11 138 VAL 138 138 138 VAL VAL R . n 
AA 11 139 LEU 139 139 139 LEU LEU R . n 
AA 11 140 LEU 140 140 140 LEU LEU R . n 
AA 11 141 ALA 141 141 141 ALA ALA R . n 
AA 11 142 VAL 142 142 142 VAL VAL R . n 
AA 11 143 GLY 143 143 143 GLY GLY R . n 
AA 11 144 PHE 144 144 144 PHE PHE R . n 
AA 11 145 LEU 145 145 145 LEU LEU R . n 
AA 11 146 LEU 146 146 146 LEU LEU R . n 
AA 11 147 MET 147 147 147 MET MET R . n 
AA 11 148 ALA 148 148 148 ALA ALA R . n 
AA 11 149 ALA 149 149 149 ALA ALA R . n 
AA 11 150 THR 150 150 150 THR THR R . n 
AA 11 151 VAL 151 151 151 VAL VAL R . n 
AA 11 152 VAL 152 152 152 VAL VAL R . n 
AA 11 153 ALA 153 153 153 ALA ALA R . n 
AA 11 154 VAL 154 154 154 VAL VAL R . n 
AA 11 155 ALA 155 155 155 ALA ALA R . n 
AA 11 156 LEU 156 156 156 LEU LEU R . n 
AA 11 157 VAL 157 157 157 VAL VAL R . n 
AA 11 158 GLU 158 158 158 GLU GLU R . n 
AA 11 159 PRO 159 159 159 PRO PRO R . n 
AA 11 160 GLY 160 160 160 GLY GLY R . n 
AA 11 161 LYS 161 161 ?   ?   ?   R . n 
AA 11 162 ALA 162 162 ?   ?   ?   R . n 
AA 11 163 SER 163 163 ?   ?   ?   R . n 
AA 11 164 ARG 164 164 ?   ?   ?   R . n 
AA 11 165 ALA 165 165 ?   ?   ?   R . n 
AA 11 166 LYS 166 166 ?   ?   ?   R . n 
AA 11 167 GLU 167 167 ?   ?   ?   R . n 
AA 11 168 ALA 168 168 ?   ?   ?   R . n 
AA 11 169 GLU 169 169 ?   ?   ?   R . n 
AA 11 170 LYS 170 170 ?   ?   ?   R . n 
AA 11 171 ARG 171 171 ?   ?   ?   R . n 
AA 11 172 GLU 172 172 ?   ?   ?   R . n 
AA 11 173 GLU 173 173 ?   ?   ?   R . n 
AA 11 174 VAL 174 174 ?   ?   ?   R . n 
AA 11 175 ALA 175 175 ?   ?   ?   R . n 
AA 11 176 ARG 176 176 ?   ?   ?   R . n 
BA 12 1   MET 1   1   1   MET MET S . n 
BA 12 2   SER 2   2   2   SER SER S . n 
BA 12 3   TYR 3   3   3   TYR TYR S . n 
BA 12 4   LEU 4   4   4   LEU LEU S . n 
BA 12 5   LEU 5   5   5   LEU LEU S . n 
BA 12 6   THR 6   6   6   THR THR S . n 
BA 12 7   SER 7   7   7   SER SER S . n 
BA 12 8   ALA 8   8   8   ALA ALA S . n 
BA 12 9   LEU 9   9   9   LEU LEU S . n 
BA 12 10  LEU 10  10  10  LEU LEU S . n 
BA 12 11  PHE 11  11  11  PHE PHE S . n 
BA 12 12  ALA 12  12  12  ALA ALA S . n 
BA 12 13  LEU 13  13  13  LEU LEU S . n 
BA 12 14  GLY 14  14  14  GLY GLY S . n 
BA 12 15  VAL 15  15  15  VAL VAL S . n 
BA 12 16  TYR 16  16  16  TYR TYR S . n 
BA 12 17  GLY 17  17  17  GLY GLY S . n 
BA 12 18  VAL 18  18  18  VAL VAL S . n 
BA 12 19  LEU 19  19  19  LEU LEU S . n 
BA 12 20  THR 20  20  20  THR THR S . n 
BA 12 21  ARG 21  21  21  ARG ARG S . n 
BA 12 22  ARG 22  22  22  ARG ARG S . n 
BA 12 23  THR 23  23  23  THR THR S . n 
BA 12 24  ALA 24  24  24  ALA ALA S . n 
BA 12 25  ILE 25  25  25  ILE ILE S . n 
BA 12 26  LEU 26  26  26  LEU LEU S . n 
BA 12 27  VAL 27  27  27  VAL VAL S . n 
BA 12 28  PHE 28  28  28  PHE PHE S . n 
BA 12 29  LEU 29  29  29  LEU LEU S . n 
BA 12 30  SER 30  30  30  SER SER S . n 
BA 12 31  ILE 31  31  31  ILE ILE S . n 
BA 12 32  GLU 32  32  32  GLU GLU S . n 
BA 12 33  LEU 33  33  33  LEU LEU S . n 
BA 12 34  MET 34  34  34  MET MET S . n 
BA 12 35  LEU 35  35  35  LEU LEU S . n 
BA 12 36  ASN 36  36  36  ASN ASN S . n 
BA 12 37  ALA 37  37  37  ALA ALA S . n 
BA 12 38  ALA 38  38  38  ALA ALA S . n 
BA 12 39  ASN 39  39  39  ASN ASN S . n 
BA 12 40  LEU 40  40  40  LEU LEU S . n 
BA 12 41  SER 41  41  41  SER SER S . n 
BA 12 42  LEU 42  42  42  LEU LEU S . n 
BA 12 43  VAL 43  43  43  VAL VAL S . n 
BA 12 44  GLY 44  44  44  GLY GLY S . n 
BA 12 45  PHE 45  45  45  PHE PHE S . n 
BA 12 46  ALA 46  46  46  ALA ALA S . n 
BA 12 47  ARG 47  47  47  ARG ARG S . n 
BA 12 48  ALA 48  48  48  ALA ALA S . n 
BA 12 49  TYR 49  49  49  TYR TYR S . n 
BA 12 50  GLY 50  50  50  GLY GLY S . n 
BA 12 51  LEU 51  51  51  LEU LEU S . n 
BA 12 52  ASP 52  52  52  ASP ASP S . n 
BA 12 53  GLY 53  53  53  GLY GLY S . n 
BA 12 54  GLN 54  54  54  GLN GLN S . n 
BA 12 55  VAL 55  55  55  VAL VAL S . n 
BA 12 56  ALA 56  56  56  ALA ALA S . n 
BA 12 57  ALA 57  57  57  ALA ALA S . n 
BA 12 58  LEU 58  58  58  LEU LEU S . n 
BA 12 59  MET 59  59  59  MET MET S . n 
BA 12 60  VAL 60  60  60  VAL VAL S . n 
BA 12 61  ILE 61  61  61  ILE ILE S . n 
BA 12 62  ALA 62  62  62  ALA ALA S . n 
BA 12 63  VAL 63  63  63  VAL VAL S . n 
BA 12 64  ALA 64  64  64  ALA ALA S . n 
BA 12 65  ALA 65  65  65  ALA ALA S . n 
BA 12 66  ALA 66  66  66  ALA ALA S . n 
BA 12 67  GLU 67  67  67  GLU GLU S . n 
BA 12 68  VAL 68  68  68  VAL VAL S . n 
BA 12 69  ALA 69  69  69  ALA ALA S . n 
BA 12 70  VAL 70  70  70  VAL VAL S . n 
BA 12 71  GLY 71  71  71  GLY GLY S . n 
BA 12 72  LEU 72  72  72  LEU LEU S . n 
BA 12 73  GLY 73  73  73  GLY GLY S . n 
BA 12 74  LEU 74  74  74  LEU LEU S . n 
BA 12 75  ILE 75  75  75  ILE ILE S . n 
BA 12 76  VAL 76  76  76  VAL VAL S . n 
BA 12 77  ALA 77  77  77  ALA ALA S . n 
BA 12 78  ILE 78  78  78  ILE ILE S . n 
BA 12 79  PHE 79  79  79  PHE PHE S . n 
BA 12 80  ARG 80  80  80  ARG ARG S . n 
BA 12 81  HIS 81  81  81  HIS HIS S . n 
BA 12 82  ARG 82  82  82  ARG ARG S . n 
BA 12 83  GLU 83  83  83  GLU GLU S . n 
BA 12 84  SER 84  84  84  SER SER S . n 
BA 12 85  THR 85  85  85  THR THR S . n 
BA 12 86  ALA 86  86  86  ALA ALA S . n 
BA 12 87  VAL 87  87  87  VAL VAL S . n 
BA 12 88  ASP 88  88  88  ASP ASP S . n 
BA 12 89  ASP 89  89  89  ASP ASP S . n 
BA 12 90  LEU 90  90  90  LEU LEU S . n 
BA 12 91  SER 91  91  91  SER SER S . n 
BA 12 92  GLU 92  92  92  GLU GLU S . n 
BA 12 93  LEU 93  93  93  LEU LEU S . n 
BA 12 94  ARG 94  94  94  ARG ARG S . n 
BA 12 95  GLY 95  95  95  GLY GLY S . n 
CA 13 1   MET 1   1   1   MET MET T . n 
CA 13 2   ALA 2   2   2   ALA ALA T . n 
CA 13 3   LEU 3   3   3   LEU LEU T . n 
CA 13 4   LEU 4   4   4   LEU LEU T . n 
CA 13 5   GLY 5   5   5   GLY GLY T . n 
CA 13 6   THR 6   6   6   THR THR T . n 
CA 13 7   ILE 7   7   7   ILE ILE T . n 
CA 13 8   LEU 8   8   8   LEU LEU T . n 
CA 13 9   LEU 9   9   9   LEU LEU T . n 
CA 13 10  PRO 10  10  10  PRO PRO T . n 
CA 13 11  LEU 11  11  11  LEU LEU T . n 
CA 13 12  LEU 12  12  12  LEU LEU T . n 
CA 13 13  GLY 13  13  13  GLY GLY T . n 
CA 13 14  PHE 14  14  14  PHE PHE T . n 
CA 13 15  ALA 15  15  15  ALA ALA T . n 
CA 13 16  LEU 16  16  16  LEU LEU T . n 
CA 13 17  LEU 17  17  17  LEU LEU T . n 
CA 13 18  GLY 18  18  18  GLY GLY T . n 
CA 13 19  LEU 19  19  19  LEU LEU T . n 
CA 13 20  PHE 20  20  20  PHE PHE T . n 
CA 13 21  GLY 21  21  21  GLY GLY T . n 
CA 13 22  LYS 22  22  22  LYS LYS T . n 
CA 13 23  ARG 23  23  23  ARG ARG T . n 
CA 13 24  MET 24  24  24  MET MET T . n 
CA 13 25  ARG 25  25  25  ARG ARG T . n 
CA 13 26  GLU 26  26  26  GLU GLU T . n 
CA 13 27  PRO 27  27  27  PRO PRO T . n 
CA 13 28  LEU 28  28  28  LEU LEU T . n 
CA 13 29  PRO 29  29  29  PRO PRO T . n 
CA 13 30  GLY 30  30  30  GLY GLY T . n 
CA 13 31  VAL 31  31  31  VAL VAL T . n 
CA 13 32  LEU 32  32  32  LEU LEU T . n 
CA 13 33  ALA 33  33  33  ALA ALA T . n 
CA 13 34  SER 34  34  34  SER SER T . n 
CA 13 35  GLY 35  35  35  GLY GLY T . n 
CA 13 36  LEU 36  36  36  LEU LEU T . n 
CA 13 37  VAL 37  37  37  VAL VAL T . n 
CA 13 38  LEU 38  38  38  LEU LEU T . n 
CA 13 39  ALA 39  39  39  ALA ALA T . n 
CA 13 40  SER 40  40  40  SER SER T . n 
CA 13 41  PHE 41  41  41  PHE PHE T . n 
CA 13 42  LEU 42  42  42  LEU LEU T . n 
CA 13 43  LEU 43  43  43  LEU LEU T . n 
CA 13 44  GLY 44  44  44  GLY GLY T . n 
CA 13 45  ALA 45  45  45  ALA ALA T . n 
CA 13 46  GLY 46  46  46  GLY GLY T . n 
CA 13 47  LEU 47  47  47  LEU LEU T . n 
CA 13 48  LEU 48  48  48  LEU LEU T . n 
CA 13 49  LEU 49  49  49  LEU LEU T . n 
CA 13 50  SER 50  50  50  SER SER T . n 
CA 13 51  GLY 51  51  51  GLY GLY T . n 
CA 13 52  GLY 52  52  52  GLY GLY T . n 
CA 13 53  ALA 53  53  53  ALA ALA T . n 
CA 13 54  ARG 54  54  54  ARG ARG T . n 
CA 13 55  PHE 55  55  55  PHE PHE T . n 
CA 13 56  GLN 56  56  56  GLN GLN T . n 
CA 13 57  ALA 57  57  57  ALA ALA T . n 
CA 13 58  GLU 58  58  58  GLU GLU T . n 
CA 13 59  TRP 59  59  59  TRP TRP T . n 
CA 13 60  LEU 60  60  60  LEU LEU T . n 
CA 13 61  PRO 61  61  61  PRO PRO T . n 
CA 13 62  GLY 62  62  62  GLY GLY T . n 
CA 13 63  ILE 63  63  63  ILE ILE T . n 
CA 13 64  PRO 64  64  64  PRO PRO T . n 
CA 13 65  PHE 65  65  65  PHE PHE T . n 
CA 13 66  SER 66  66  66  SER SER T . n 
CA 13 67  LEU 67  67  67  LEU LEU T . n 
CA 13 68  LEU 68  68  68  LEU LEU T . n 
CA 13 69  LEU 69  69  69  LEU LEU T . n 
CA 13 70  ASP 70  70  70  ASP ASP T . n 
CA 13 71  ASN 71  71  71  ASN ASN T . n 
CA 13 72  LEU 72  72  72  LEU LEU T . n 
CA 13 73  SER 73  73  73  SER SER T . n 
CA 13 74  GLY 74  74  74  GLY GLY T . n 
CA 13 75  PHE 75  75  75  PHE PHE T . n 
CA 13 76  MET 76  76  76  MET MET T . n 
CA 13 77  LEU 77  77  77  LEU LEU T . n 
CA 13 78  LEU 78  78  78  LEU LEU T . n 
CA 13 79  ILE 79  79  79  ILE ILE T . n 
CA 13 80  VAL 80  80  80  VAL VAL T . n 
CA 13 81  THR 81  81  81  THR THR T . n 
CA 13 82  GLY 82  82  82  GLY GLY T . n 
CA 13 83  VAL 83  83  83  VAL VAL T . n 
CA 13 84  GLY 84  84  84  GLY GLY T . n 
CA 13 85  PHE 85  85  85  PHE PHE T . n 
CA 13 86  LEU 86  86  86  LEU LEU T . n 
CA 13 87  ILE 87  87  87  ILE ILE T . n 
CA 13 88  HIS 88  88  88  HIS HIS T . n 
CA 13 89  VAL 89  89  89  VAL VAL T . n 
CA 13 90  TYR 90  90  90  TYR TYR T . n 
CA 13 91  ALA 91  91  91  ALA ALA T . n 
CA 13 92  ILE 92  92  92  ILE ILE T . n 
CA 13 93  GLY 93  93  93  GLY GLY T . n 
CA 13 94  TYR 94  94  94  TYR TYR T . n 
CA 13 95  MET 95  95  95  MET MET T . n 
CA 13 96  GLY 96  96  96  GLY GLY T . n 
CA 13 97  GLY 97  97  97  GLY GLY T . n 
CA 13 98  ASP 98  98  98  ASP ASP T . n 
CA 13 99  PRO 99  99  99  PRO PRO T . n 
CA 13 100 GLY 100 100 100 GLY GLY T . n 
CA 13 101 TYR 101 101 101 TYR TYR T . n 
CA 13 102 SER 102 102 102 SER SER T . n 
CA 13 103 ARG 103 103 103 ARG ARG T . n 
CA 13 104 PHE 104 104 104 PHE PHE T . n 
CA 13 105 PHE 105 105 105 PHE PHE T . n 
CA 13 106 ALA 106 106 106 ALA ALA T . n 
CA 13 107 TYR 107 107 107 TYR TYR T . n 
CA 13 108 PHE 108 108 108 PHE PHE T . n 
CA 13 109 ASN 109 109 109 ASN ASN T . n 
CA 13 110 LEU 110 110 110 LEU LEU T . n 
CA 13 111 PHE 111 111 111 PHE PHE T . n 
CA 13 112 ILE 112 112 112 ILE ILE T . n 
CA 13 113 ALA 113 113 113 ALA ALA T . n 
CA 13 114 MET 114 114 114 MET MET T . n 
CA 13 115 MET 115 115 115 MET MET T . n 
CA 13 116 LEU 116 116 116 LEU LEU T . n 
CA 13 117 THR 117 117 117 THR THR T . n 
CA 13 118 LEU 118 118 118 LEU LEU T . n 
CA 13 119 VAL 119 119 119 VAL VAL T . n 
CA 13 120 LEU 120 120 120 LEU LEU T . n 
CA 13 121 ALA 121 121 121 ALA ALA T . n 
CA 13 122 ASP 122 122 122 ASP ASP T . n 
CA 13 123 SER 123 123 123 SER SER T . n 
CA 13 124 TYR 124 124 124 TYR TYR T . n 
CA 13 125 PRO 125 125 125 PRO PRO T . n 
CA 13 126 VAL 126 126 126 VAL VAL T . n 
CA 13 127 MET 127 127 127 MET MET T . n 
CA 13 128 PHE 128 128 128 PHE PHE T . n 
CA 13 129 ILE 129 129 129 ILE ILE T . n 
CA 13 130 GLY 130 130 130 GLY GLY T . n 
CA 13 131 TRP 131 131 131 TRP TRP T . n 
CA 13 132 GLU 132 132 132 GLU GLU T . n 
CA 13 133 GLY 133 133 133 GLY GLY T . n 
CA 13 134 VAL 134 134 134 VAL VAL T . n 
CA 13 135 GLY 135 135 135 GLY GLY T . n 
CA 13 136 LEU 136 136 136 LEU LEU T . n 
CA 13 137 ALA 137 137 137 ALA ALA T . n 
CA 13 138 SER 138 138 138 SER SER T . n 
CA 13 139 PHE 139 139 139 PHE PHE T . n 
CA 13 140 LEU 140 140 140 LEU LEU T . n 
CA 13 141 LEU 141 141 141 LEU LEU T . n 
CA 13 142 ILE 142 142 142 ILE ILE T . n 
CA 13 143 GLY 143 143 143 GLY GLY T . n 
CA 13 144 PHE 144 144 144 PHE PHE T . n 
CA 13 145 TRP 145 145 145 TRP TRP T . n 
CA 13 146 TYR 146 146 146 TYR TYR T . n 
CA 13 147 LYS 147 147 147 LYS LYS T . n 
CA 13 148 ASN 148 148 148 ASN ASN T . n 
CA 13 149 PRO 149 149 149 PRO PRO T . n 
CA 13 150 GLN 150 150 150 GLN GLN T . n 
CA 13 151 TYR 151 151 151 TYR TYR T . n 
CA 13 152 ALA 152 152 152 ALA ALA T . n 
CA 13 153 ASP 153 153 153 ASP ASP T . n 
CA 13 154 SER 154 154 154 SER SER T . n 
CA 13 155 ALA 155 155 155 ALA ALA T . n 
CA 13 156 ARG 156 156 156 ARG ARG T . n 
CA 13 157 LYS 157 157 157 LYS LYS T . n 
CA 13 158 ALA 158 158 158 ALA ALA T . n 
CA 13 159 PHE 159 159 159 PHE PHE T . n 
CA 13 160 ILE 160 160 160 ILE ILE T . n 
CA 13 161 VAL 161 161 161 VAL VAL T . n 
CA 13 162 ASN 162 162 162 ASN ASN T . n 
CA 13 163 ARG 163 163 163 ARG ARG T . n 
CA 13 164 ILE 164 164 164 ILE ILE T . n 
CA 13 165 GLY 165 165 165 GLY GLY T . n 
CA 13 166 ASP 166 166 166 ASP ASP T . n 
CA 13 167 LEU 167 167 167 LEU LEU T . n 
CA 13 168 GLY 168 168 168 GLY GLY T . n 
CA 13 169 PHE 169 169 169 PHE PHE T . n 
CA 13 170 MET 170 170 170 MET MET T . n 
CA 13 171 LEU 171 171 171 LEU LEU T . n 
CA 13 172 GLY 172 172 172 GLY GLY T . n 
CA 13 173 MET 173 173 173 MET MET T . n 
CA 13 174 ALA 174 174 174 ALA ALA T . n 
CA 13 175 ILE 175 175 175 ILE ILE T . n 
CA 13 176 LEU 176 176 176 LEU LEU T . n 
CA 13 177 TRP 177 177 177 TRP TRP T . n 
CA 13 178 ALA 178 178 178 ALA ALA T . n 
CA 13 179 LEU 179 179 179 LEU LEU T . n 
CA 13 180 TYR 180 180 180 TYR TYR T . n 
CA 13 181 GLY 181 181 181 GLY GLY T . n 
CA 13 182 THR 182 182 182 THR THR T . n 
CA 13 183 LEU 183 183 183 LEU LEU T . n 
CA 13 184 SER 184 184 184 SER SER T . n 
CA 13 185 ILE 185 185 185 ILE ILE T . n 
CA 13 186 SER 186 186 186 SER SER T . n 
CA 13 187 GLU 187 187 187 GLU GLU T . n 
CA 13 188 LEU 188 188 188 LEU LEU T . n 
CA 13 189 LYS 189 189 189 LYS LYS T . n 
CA 13 190 GLU 190 190 190 GLU GLU T . n 
CA 13 191 ALA 191 191 191 ALA ALA T . n 
CA 13 192 MET 192 192 192 MET MET T . n 
CA 13 193 GLU 193 193 193 GLU GLU T . n 
CA 13 194 GLY 194 194 194 GLY GLY T . n 
CA 13 195 PRO 195 195 195 PRO PRO T . n 
CA 13 196 LEU 196 196 196 LEU LEU T . n 
CA 13 197 LYS 197 197 197 LYS LYS T . n 
CA 13 198 ASN 198 198 198 ASN ASN T . n 
CA 13 199 PRO 199 199 199 PRO PRO T . n 
CA 13 200 ASP 200 200 200 ASP ASP T . n 
CA 13 201 LEU 201 201 201 LEU LEU T . n 
CA 13 202 LEU 202 202 202 LEU LEU T . n 
CA 13 203 ALA 203 203 203 ALA ALA T . n 
CA 13 204 LEU 204 204 204 LEU LEU T . n 
CA 13 205 ALA 205 205 205 ALA ALA T . n 
CA 13 206 GLY 206 206 206 GLY GLY T . n 
CA 13 207 LEU 207 207 207 LEU LEU T . n 
CA 13 208 LEU 208 208 208 LEU LEU T . n 
CA 13 209 LEU 209 209 209 LEU LEU T . n 
CA 13 210 PHE 210 210 210 PHE PHE T . n 
CA 13 211 LEU 211 211 211 LEU LEU T . n 
CA 13 212 GLY 212 212 212 GLY GLY T . n 
CA 13 213 ALA 213 213 213 ALA ALA T . n 
CA 13 214 VAL 214 214 214 VAL VAL T . n 
CA 13 215 GLY 215 215 215 GLY GLY T . n 
CA 13 216 LYS 216 216 216 LYS LYS T . n 
CA 13 217 SER 217 217 217 SER SER T . n 
CA 13 218 ALA 218 218 218 ALA ALA T . n 
CA 13 219 GLN 219 219 219 GLN GLN T . n 
CA 13 220 ILE 220 220 220 ILE ILE T . n 
CA 13 221 PRO 221 221 221 PRO PRO T . n 
CA 13 222 LEU 222 222 222 LEU LEU T . n 
CA 13 223 MET 223 223 223 MET MET T . n 
CA 13 224 VAL 224 224 224 VAL VAL T . n 
CA 13 225 TRP 225 225 225 TRP TRP T . n 
CA 13 226 LEU 226 226 226 LEU LEU T . n 
CA 13 227 PRO 227 227 227 PRO PRO T . n 
CA 13 228 ASP 228 228 228 ASP ASP T . n 
CA 13 229 ALA 229 229 229 ALA ALA T . n 
CA 13 230 MET 230 230 230 MET MET T . n 
CA 13 231 ALA 231 231 231 ALA ALA T . n 
CA 13 232 GLY 232 232 232 GLY GLY T . n 
CA 13 233 PRO 233 233 233 PRO PRO T . n 
CA 13 234 THR 234 234 234 THR THR T . n 
CA 13 235 PRO 235 235 235 PRO PRO T . n 
CA 13 236 VAL 236 236 236 VAL VAL T . n 
CA 13 237 SER 237 237 237 SER SER T . n 
CA 13 238 ALA 238 238 238 ALA ALA T . n 
CA 13 239 LEU 239 239 239 LEU LEU T . n 
CA 13 240 ILE 240 240 240 ILE ILE T . n 
CA 13 241 HIS 241 241 241 HIS HIS T . n 
CA 13 242 ALA 242 242 242 ALA ALA T . n 
CA 13 243 ALA 243 243 243 ALA ALA T . n 
CA 13 244 THR 244 244 244 THR THR T . n 
CA 13 245 MET 245 245 245 MET MET T . n 
CA 13 246 VAL 246 246 246 VAL VAL T . n 
CA 13 247 THR 247 247 247 THR THR T . n 
CA 13 248 ALA 248 248 248 ALA ALA T . n 
CA 13 249 GLY 249 249 249 GLY GLY T . n 
CA 13 250 VAL 250 250 250 VAL VAL T . n 
CA 13 251 TYR 251 251 251 TYR TYR T . n 
CA 13 252 LEU 252 252 252 LEU LEU T . n 
CA 13 253 ILE 253 253 253 ILE ILE T . n 
CA 13 254 ALA 254 254 254 ALA ALA T . n 
CA 13 255 ARG 255 255 255 ARG ARG T . n 
CA 13 256 SER 256 256 256 SER SER T . n 
CA 13 257 SER 257 257 257 SER SER T . n 
CA 13 258 PHE 258 258 258 PHE PHE T . n 
CA 13 259 LEU 259 259 259 LEU LEU T . n 
CA 13 260 TYR 260 260 260 TYR TYR T . n 
CA 13 261 SER 261 261 261 SER SER T . n 
CA 13 262 VAL 262 262 262 VAL VAL T . n 
CA 13 263 LEU 263 263 263 LEU LEU T . n 
CA 13 264 PRO 264 264 264 PRO PRO T . n 
CA 13 265 ASP 265 265 265 ASP ASP T . n 
CA 13 266 VAL 266 266 266 VAL VAL T . n 
CA 13 267 SER 267 267 267 SER SER T . n 
CA 13 268 TYR 268 268 268 TYR TYR T . n 
CA 13 269 ALA 269 269 269 ALA ALA T . n 
CA 13 270 ILE 270 270 270 ILE ILE T . n 
CA 13 271 ALA 271 271 271 ALA ALA T . n 
CA 13 272 VAL 272 272 272 VAL VAL T . n 
CA 13 273 VAL 273 273 273 VAL VAL T . n 
CA 13 274 GLY 274 274 274 GLY GLY T . n 
CA 13 275 LEU 275 275 275 LEU LEU T . n 
CA 13 276 LEU 276 276 276 LEU LEU T . n 
CA 13 277 THR 277 277 277 THR THR T . n 
CA 13 278 ALA 278 278 278 ALA ALA T . n 
CA 13 279 ALA 279 279 279 ALA ALA T . n 
CA 13 280 TYR 280 280 280 TYR TYR T . n 
CA 13 281 GLY 281 281 281 GLY GLY T . n 
CA 13 282 ALA 282 282 282 ALA ALA T . n 
CA 13 283 LEU 283 283 283 LEU LEU T . n 
CA 13 284 SER 284 284 284 SER SER T . n 
CA 13 285 ALA 285 285 285 ALA ALA T . n 
CA 13 286 PHE 286 286 286 PHE PHE T . n 
CA 13 287 GLY 287 287 287 GLY GLY T . n 
CA 13 288 GLN 288 288 288 GLN GLN T . n 
CA 13 289 THR 289 289 289 THR THR T . n 
CA 13 290 ASP 290 290 290 ASP ASP T . n 
CA 13 291 ILE 291 291 291 ILE ILE T . n 
CA 13 292 LYS 292 292 292 LYS LYS T . n 
CA 13 293 LYS 293 293 293 LYS LYS T . n 
CA 13 294 ILE 294 294 294 ILE ILE T . n 
CA 13 295 VAL 295 295 295 VAL VAL T . n 
CA 13 296 ALA 296 296 296 ALA ALA T . n 
CA 13 297 TYR 297 297 297 TYR TYR T . n 
CA 13 298 SER 298 298 298 SER SER T . n 
CA 13 299 THR 299 299 299 THR THR T . n 
CA 13 300 ILE 300 300 300 ILE ILE T . n 
CA 13 301 SER 301 301 301 SER SER T . n 
CA 13 302 GLN 302 302 302 GLN GLN T . n 
CA 13 303 LEU 303 303 303 LEU LEU T . n 
CA 13 304 GLY 304 304 304 GLY GLY T . n 
CA 13 305 TYR 305 305 305 TYR TYR T . n 
CA 13 306 MET 306 306 306 MET MET T . n 
CA 13 307 PHE 307 307 307 PHE PHE T . n 
CA 13 308 LEU 308 308 308 LEU LEU T . n 
CA 13 309 ALA 309 309 309 ALA ALA T . n 
CA 13 310 ALA 310 310 310 ALA ALA T . n 
CA 13 311 GLY 311 311 311 GLY GLY T . n 
CA 13 312 VAL 312 312 312 VAL VAL T . n 
CA 13 313 GLY 313 313 313 GLY GLY T . n 
CA 13 314 ALA 314 314 314 ALA ALA T . n 
CA 13 315 TYR 315 315 315 TYR TYR T . n 
CA 13 316 TRP 316 316 316 TRP TRP T . n 
CA 13 317 VAL 317 317 317 VAL VAL T . n 
CA 13 318 ALA 318 318 318 ALA ALA T . n 
CA 13 319 LEU 319 319 319 LEU LEU T . n 
CA 13 320 PHE 320 320 320 PHE PHE T . n 
CA 13 321 HIS 321 321 321 HIS HIS T . n 
CA 13 322 VAL 322 322 322 VAL VAL T . n 
CA 13 323 PHE 323 323 323 PHE PHE T . n 
CA 13 324 THR 324 324 324 THR THR T . n 
CA 13 325 HIS 325 325 325 HIS HIS T . n 
CA 13 326 ALA 326 326 326 ALA ALA T . n 
CA 13 327 PHE 327 327 327 PHE PHE T . n 
CA 13 328 PHE 328 328 328 PHE PHE T . n 
CA 13 329 LYS 329 329 329 LYS LYS T . n 
CA 13 330 ALA 330 330 330 ALA ALA T . n 
CA 13 331 LEU 331 331 331 LEU LEU T . n 
CA 13 332 LEU 332 332 332 LEU LEU T . n 
CA 13 333 PHE 333 333 333 PHE PHE T . n 
CA 13 334 LEU 334 334 334 LEU LEU T . n 
CA 13 335 ALA 335 335 335 ALA ALA T . n 
CA 13 336 SER 336 336 336 SER SER T . n 
CA 13 337 GLY 337 337 337 GLY GLY T . n 
CA 13 338 SER 338 338 338 SER SER T . n 
CA 13 339 VAL 339 339 339 VAL VAL T . n 
CA 13 340 ILE 340 340 340 ILE ILE T . n 
CA 13 341 HIS 341 341 341 HIS HIS T . n 
CA 13 342 ALA 342 342 342 ALA ALA T . n 
CA 13 343 LEU 343 343 343 LEU LEU T . n 
CA 13 344 GLY 344 344 344 GLY GLY T . n 
CA 13 345 GLY 345 345 345 GLY GLY T . n 
CA 13 346 GLU 346 346 346 GLU GLU T . n 
CA 13 347 GLN 347 347 347 GLN GLN T . n 
CA 13 348 ASP 348 348 348 ASP ASP T . n 
CA 13 349 VAL 349 349 349 VAL VAL T . n 
CA 13 350 ARG 350 350 350 ARG ARG T . n 
CA 13 351 LYS 351 351 351 LYS LYS T . n 
CA 13 352 MET 352 352 352 MET MET T . n 
CA 13 353 GLY 353 353 353 GLY GLY T . n 
CA 13 354 GLY 354 354 354 GLY GLY T . n 
CA 13 355 LEU 355 355 355 LEU LEU T . n 
CA 13 356 TRP 356 356 356 TRP TRP T . n 
CA 13 357 LYS 357 357 357 LYS LYS T . n 
CA 13 358 HIS 358 358 358 HIS HIS T . n 
CA 13 359 LEU 359 359 359 LEU LEU T . n 
CA 13 360 PRO 360 360 360 PRO PRO T . n 
CA 13 361 GLN 361 361 361 GLN GLN T . n 
CA 13 362 THR 362 362 362 THR THR T . n 
CA 13 363 ARG 363 363 363 ARG ARG T . n 
CA 13 364 TRP 364 364 364 TRP TRP T . n 
CA 13 365 HIS 365 365 365 HIS HIS T . n 
CA 13 366 ALA 366 366 366 ALA ALA T . n 
CA 13 367 LEU 367 367 367 LEU LEU T . n 
CA 13 368 ILE 368 368 368 ILE ILE T . n 
CA 13 369 GLY 369 369 369 GLY GLY T . n 
CA 13 370 ALA 370 370 370 ALA ALA T . n 
CA 13 371 LEU 371 371 371 LEU LEU T . n 
CA 13 372 ALA 372 372 372 ALA ALA T . n 
CA 13 373 LEU 373 373 373 LEU LEU T . n 
CA 13 374 GLY 374 374 374 GLY GLY T . n 
CA 13 375 GLY 375 375 375 GLY GLY T . n 
CA 13 376 LEU 376 376 376 LEU LEU T . n 
CA 13 377 PRO 377 377 377 PRO PRO T . n 
CA 13 378 LEU 378 378 378 LEU LEU T . n 
CA 13 379 LEU 379 379 379 LEU LEU T . n 
CA 13 380 SER 380 380 380 SER SER T . n 
CA 13 381 GLY 381 381 381 GLY GLY T . n 
CA 13 382 PHE 382 382 382 PHE PHE T . n 
CA 13 383 TRP 383 383 383 TRP TRP T . n 
CA 13 384 SER 384 384 384 SER SER T . n 
CA 13 385 LYS 385 385 385 LYS LYS T . n 
CA 13 386 ASP 386 386 386 ASP ASP T . n 
CA 13 387 ALA 387 387 387 ALA ALA T . n 
CA 13 388 ILE 388 388 388 ILE ILE T . n 
CA 13 389 LEU 389 389 389 LEU LEU T . n 
CA 13 390 ALA 390 390 390 ALA ALA T . n 
CA 13 391 ALA 391 391 391 ALA ALA T . n 
CA 13 392 THR 392 392 392 THR THR T . n 
CA 13 393 LEU 393 393 393 LEU LEU T . n 
CA 13 394 THR 394 394 394 THR THR T . n 
CA 13 395 TYR 395 395 395 TYR TYR T . n 
CA 13 396 PRO 396 396 396 PRO PRO T . n 
CA 13 397 PHE 397 397 397 PHE PHE T . n 
CA 13 398 GLY 398 398 398 GLY GLY T . n 
CA 13 399 GLY 399 399 399 GLY GLY T . n 
CA 13 400 VAL 400 400 400 VAL VAL T . n 
CA 13 401 GLY 401 401 401 GLY GLY T . n 
CA 13 402 PHE 402 402 402 PHE PHE T . n 
CA 13 403 TYR 403 403 403 TYR TYR T . n 
CA 13 404 VAL 404 404 404 VAL VAL T . n 
CA 13 405 GLY 405 405 405 GLY GLY T . n 
CA 13 406 ALA 406 406 406 ALA ALA T . n 
CA 13 407 LEU 407 407 407 LEU LEU T . n 
CA 13 408 LEU 408 408 408 LEU LEU T . n 
CA 13 409 VAL 409 409 409 VAL VAL T . n 
CA 13 410 ALA 410 410 410 ALA ALA T . n 
CA 13 411 VAL 411 411 411 VAL VAL T . n 
CA 13 412 LEU 412 412 412 LEU LEU T . n 
CA 13 413 THR 413 413 413 THR THR T . n 
CA 13 414 ALA 414 414 414 ALA ALA T . n 
CA 13 415 MET 415 415 415 MET MET T . n 
CA 13 416 TYR 416 416 416 TYR TYR T . n 
CA 13 417 ALA 417 417 417 ALA ALA T . n 
CA 13 418 MET 418 418 418 MET MET T . n 
CA 13 419 ARG 419 419 419 ARG ARG T . n 
CA 13 420 TRP 420 420 420 TRP TRP T . n 
CA 13 421 PHE 421 421 421 PHE PHE T . n 
CA 13 422 VAL 422 422 422 VAL VAL T . n 
CA 13 423 LEU 423 423 423 LEU LEU T . n 
CA 13 424 VAL 424 424 424 VAL VAL T . n 
CA 13 425 PHE 425 425 425 PHE PHE T . n 
CA 13 426 LEU 426 426 426 LEU LEU T . n 
CA 13 427 GLY 427 427 427 GLY GLY T . n 
CA 13 428 GLU 428 428 428 GLU GLU T . n 
CA 13 429 GLU 429 429 429 GLU GLU T . n 
CA 13 430 ARG 430 430 430 ARG ARG T . n 
CA 13 431 GLY 431 431 431 GLY GLY T . n 
CA 13 432 HIS 432 432 432 HIS HIS T . n 
CA 13 433 HIS 433 433 433 HIS HIS T . n 
CA 13 434 HIS 434 434 434 HIS HIS T . n 
CA 13 435 PRO 435 435 435 PRO PRO T . n 
CA 13 436 HIS 436 436 436 HIS HIS T . n 
CA 13 437 GLU 437 437 437 GLU GLU T . n 
CA 13 438 ALA 438 438 438 ALA ALA T . n 
CA 13 439 PRO 439 439 439 PRO PRO T . n 
CA 13 440 PRO 440 440 440 PRO PRO T . n 
CA 13 441 VAL 441 441 441 VAL VAL T . n 
CA 13 442 MET 442 442 442 MET MET T . n 
CA 13 443 LEU 443 443 443 LEU LEU T . n 
CA 13 444 TRP 444 444 444 TRP TRP T . n 
CA 13 445 PRO 445 445 445 PRO PRO T . n 
CA 13 446 ASN 446 446 446 ASN ASN T . n 
CA 13 447 HIS 447 447 447 HIS HIS T . n 
CA 13 448 LEU 448 448 448 LEU LEU T . n 
CA 13 449 LEU 449 449 449 LEU LEU T . n 
CA 13 450 ALA 450 450 450 ALA ALA T . n 
CA 13 451 LEU 451 451 451 LEU LEU T . n 
CA 13 452 GLY 452 452 452 GLY GLY T . n 
CA 13 453 SER 453 453 453 SER SER T . n 
CA 13 454 VAL 454 454 454 VAL VAL T . n 
CA 13 455 LEU 455 455 455 LEU LEU T . n 
CA 13 456 ALA 456 456 456 ALA ALA T . n 
CA 13 457 GLY 457 457 457 GLY GLY T . n 
CA 13 458 TYR 458 458 458 TYR TYR T . n 
CA 13 459 LEU 459 459 459 LEU LEU T . n 
CA 13 460 ALA 460 460 460 ALA ALA T . n 
CA 13 461 LEU 461 461 461 LEU LEU T . n 
CA 13 462 PRO 462 462 462 PRO PRO T . n 
CA 13 463 HIS 463 463 463 HIS HIS T . n 
CA 13 464 PRO 464 464 464 PRO PRO T . n 
CA 13 465 LEU 465 465 465 LEU LEU T . n 
CA 13 466 PRO 466 466 466 PRO PRO T . n 
CA 13 467 ASN 467 467 467 ASN ASN T . n 
CA 13 468 VAL 468 468 468 VAL VAL T . n 
CA 13 469 LEU 469 469 469 LEU LEU T . n 
CA 13 470 GLU 470 470 470 GLU GLU T . n 
CA 13 471 PRO 471 471 471 PRO PRO T . n 
CA 13 472 PHE 472 472 472 PHE PHE T . n 
CA 13 473 LEU 473 473 473 LEU LEU T . n 
CA 13 474 LYS 474 474 474 LYS LYS T . n 
CA 13 475 PRO 475 475 475 PRO PRO T . n 
CA 13 476 ALA 476 476 476 ALA ALA T . n 
CA 13 477 LEU 477 477 477 LEU LEU T . n 
CA 13 478 ALA 478 478 478 ALA ALA T . n 
CA 13 479 GLU 479 479 479 GLU GLU T . n 
CA 13 480 VAL 480 480 480 VAL VAL T . n 
CA 13 481 GLU 481 481 481 GLU GLU T . n 
CA 13 482 ALA 482 482 482 ALA ALA T . n 
CA 13 483 HIS 483 483 483 HIS HIS T . n 
CA 13 484 HIS 484 484 484 HIS HIS T . n 
CA 13 485 LEU 485 485 485 LEU LEU T . n 
CA 13 486 SER 486 486 486 SER SER T . n 
CA 13 487 LEU 487 487 487 LEU LEU T . n 
CA 13 488 GLY 488 488 488 GLY GLY T . n 
CA 13 489 ALA 489 489 489 ALA ALA T . n 
CA 13 490 GLU 490 490 490 GLU GLU T . n 
CA 13 491 TRP 491 491 491 TRP TRP T . n 
CA 13 492 GLY 492 492 492 GLY GLY T . n 
CA 13 493 LEU 493 493 493 LEU LEU T . n 
CA 13 494 ILE 494 494 494 ILE ILE T . n 
CA 13 495 ALA 495 495 495 ALA ALA T . n 
CA 13 496 LEU 496 496 496 LEU LEU T . n 
CA 13 497 SER 497 497 497 SER SER T . n 
CA 13 498 ALA 498 498 498 ALA ALA T . n 
CA 13 499 ALA 499 499 499 ALA ALA T . n 
CA 13 500 VAL 500 500 500 VAL VAL T . n 
CA 13 501 ALA 501 501 501 ALA ALA T . n 
CA 13 502 LEU 502 502 502 LEU LEU T . n 
CA 13 503 LEU 503 503 503 LEU LEU T . n 
CA 13 504 GLY 504 504 504 GLY GLY T . n 
CA 13 505 LEU 505 505 505 LEU LEU T . n 
CA 13 506 TRP 506 506 506 TRP TRP T . n 
CA 13 507 ALA 507 507 507 ALA ALA T . n 
CA 13 508 GLY 508 508 508 GLY GLY T . n 
CA 13 509 PHE 509 509 509 PHE PHE T . n 
CA 13 510 VAL 510 510 510 VAL VAL T . n 
CA 13 511 PHE 511 511 511 PHE PHE T . n 
CA 13 512 PHE 512 512 512 PHE PHE T . n 
CA 13 513 GLN 513 513 513 GLN GLN T . n 
CA 13 514 ARG 514 514 514 ARG ARG T . n 
CA 13 515 LYS 515 515 515 LYS LYS T . n 
CA 13 516 VAL 516 516 516 VAL VAL T . n 
CA 13 517 PHE 517 517 517 PHE PHE T . n 
CA 13 518 PRO 518 518 518 PRO PRO T . n 
CA 13 519 ALA 519 519 519 ALA ALA T . n 
CA 13 520 TRP 520 520 520 TRP TRP T . n 
CA 13 521 TYR 521 521 521 TYR TYR T . n 
CA 13 522 LEU 522 522 522 LEU LEU T . n 
CA 13 523 ALA 523 523 523 ALA ALA T . n 
CA 13 524 PHE 524 524 524 PHE PHE T . n 
CA 13 525 GLU 525 525 525 GLU GLU T . n 
CA 13 526 ALA 526 526 526 ALA ALA T . n 
CA 13 527 ALA 527 527 527 ALA ALA T . n 
CA 13 528 SER 528 528 528 SER SER T . n 
CA 13 529 ARG 529 529 529 ARG ARG T . n 
CA 13 530 GLU 530 530 530 GLU GLU T . n 
CA 13 531 ALA 531 531 531 ALA ALA T . n 
CA 13 532 PHE 532 532 532 PHE PHE T . n 
CA 13 533 TYR 533 533 533 TYR TYR T . n 
CA 13 534 VAL 534 534 534 VAL VAL T . n 
CA 13 535 ASP 535 535 535 ASP ASP T . n 
CA 13 536 ARG 536 536 536 ARG ARG T . n 
CA 13 537 ALA 537 537 537 ALA ALA T . n 
CA 13 538 TYR 538 538 538 TYR TYR T . n 
CA 13 539 ASN 539 539 539 ASN ASN T . n 
CA 13 540 ALA 540 540 540 ALA ALA T . n 
CA 13 541 LEU 541 541 541 LEU LEU T . n 
CA 13 542 ILE 542 542 542 ILE ILE T . n 
CA 13 543 VAL 543 543 543 VAL VAL T . n 
CA 13 544 ASN 544 544 544 ASN ASN T . n 
CA 13 545 PRO 545 545 545 PRO PRO T . n 
CA 13 546 LEU 546 546 546 LEU LEU T . n 
CA 13 547 LYS 547 547 547 LYS LYS T . n 
CA 13 548 ALA 548 548 548 ALA ALA T . n 
CA 13 549 LEU 549 549 549 LEU LEU T . n 
CA 13 550 ALA 550 550 550 ALA ALA T . n 
CA 13 551 GLU 551 551 551 GLU GLU T . n 
CA 13 552 ALA 552 552 552 ALA ALA T . n 
CA 13 553 LEU 553 553 553 LEU LEU T . n 
CA 13 554 PHE 554 554 554 PHE PHE T . n 
CA 13 555 TYR 555 555 555 TYR TYR T . n 
CA 13 556 GLY 556 556 556 GLY GLY T . n 
CA 13 557 ASP 557 557 557 ASP ASP T . n 
CA 13 558 ARG 558 558 558 ARG ARG T . n 
CA 13 559 GLY 559 559 559 GLY GLY T . n 
CA 13 560 LEU 560 560 560 LEU LEU T . n 
CA 13 561 LEU 561 561 561 LEU LEU T . n 
CA 13 562 SER 562 562 562 SER SER T . n 
CA 13 563 GLY 563 563 563 GLY GLY T . n 
CA 13 564 TYR 564 564 564 TYR TYR T . n 
CA 13 565 PHE 565 565 565 PHE PHE T . n 
CA 13 566 GLY 566 566 566 GLY GLY T . n 
CA 13 567 LEU 567 567 567 LEU LEU T . n 
CA 13 568 GLY 568 568 568 GLY GLY T . n 
CA 13 569 GLY 569 569 569 GLY GLY T . n 
CA 13 570 ALA 570 570 570 ALA ALA T . n 
CA 13 571 ALA 571 571 571 ALA ALA T . n 
CA 13 572 ARG 572 572 572 ARG ARG T . n 
CA 13 573 SER 573 573 573 SER SER T . n 
CA 13 574 LEU 574 574 574 LEU LEU T . n 
CA 13 575 GLY 575 575 575 GLY GLY T . n 
CA 13 576 GLN 576 576 576 GLN GLN T . n 
CA 13 577 GLY 577 577 577 GLY GLY T . n 
CA 13 578 LEU 578 578 578 LEU LEU T . n 
CA 13 579 ALA 579 579 579 ALA ALA T . n 
CA 13 580 ARG 580 580 580 ARG ARG T . n 
CA 13 581 LEU 581 581 581 LEU LEU T . n 
CA 13 582 GLN 582 582 582 GLN GLN T . n 
CA 13 583 THR 583 583 583 THR THR T . n 
CA 13 584 GLY 584 584 584 GLY GLY T . n 
CA 13 585 TYR 585 585 585 TYR TYR T . n 
CA 13 586 LEU 586 586 586 LEU LEU T . n 
CA 13 587 ARG 587 587 587 ARG ARG T . n 
CA 13 588 VAL 588 588 588 VAL VAL T . n 
CA 13 589 TYR 589 589 589 TYR TYR T . n 
CA 13 590 ALA 590 590 590 ALA ALA T . n 
CA 13 591 LEU 591 591 591 LEU LEU T . n 
CA 13 592 LEU 592 592 592 LEU LEU T . n 
CA 13 593 PHE 593 593 593 PHE PHE T . n 
CA 13 594 VAL 594 594 594 VAL VAL T . n 
CA 13 595 LEU 595 595 595 LEU LEU T . n 
CA 13 596 GLY 596 596 596 GLY GLY T . n 
CA 13 597 ALA 597 597 597 ALA ALA T . n 
CA 13 598 LEU 598 598 598 LEU LEU T . n 
CA 13 599 LEU 599 599 599 LEU LEU T . n 
CA 13 600 LEU 600 600 600 LEU LEU T . n 
CA 13 601 LEU 601 601 601 LEU LEU T . n 
CA 13 602 GLY 602 602 602 GLY GLY T . n 
CA 13 603 VAL 603 603 603 VAL VAL T . n 
CA 13 604 MET 604 604 604 MET MET T . n 
CA 13 605 ARG 605 605 605 ARG ARG T . n 
CA 13 606 TRP 606 606 ?   ?   ?   T . n 
DA 14 1   MET 1   1   1   MET MET U . n 
DA 14 2   VAL 2   2   2   VAL VAL U . n 
DA 14 3   VAL 3   3   3   VAL VAL U . n 
DA 14 4   LEU 4   4   4   LEU LEU U . n 
DA 14 5   ALA 5   5   5   ALA ALA U . n 
DA 14 6   VAL 6   6   6   VAL VAL U . n 
DA 14 7   LEU 7   7   7   LEU LEU U . n 
DA 14 8   LEU 8   8   8   LEU LEU U . n 
DA 14 9   PRO 9   9   9   PRO PRO U . n 
DA 14 10  VAL 10  10  10  VAL VAL U . n 
DA 14 11  VAL 11  11  11  VAL VAL U . n 
DA 14 12  PHE 12  12  12  PHE PHE U . n 
DA 14 13  GLY 13  13  13  GLY GLY U . n 
DA 14 14  ALA 14  14  14  ALA ALA U . n 
DA 14 15  LEU 15  15  15  LEU LEU U . n 
DA 14 16  LEU 16  16  16  LEU LEU U . n 
DA 14 17  LEU 17  17  17  LEU LEU U . n 
DA 14 18  LEU 18  18  18  LEU LEU U . n 
DA 14 19  GLY 19  19  19  GLY GLY U . n 
DA 14 20  LEU 20  20  20  LEU LEU U . n 
DA 14 21  PRO 21  21  21  PRO PRO U . n 
DA 14 22  ARG 22  22  22  ARG ARG U . n 
DA 14 23  ALA 23  23  23  ALA ALA U . n 
DA 14 24  LEU 24  24  24  LEU LEU U . n 
DA 14 25  GLY 25  25  25  GLY GLY U . n 
DA 14 26  VAL 26  26  26  VAL VAL U . n 
DA 14 27  LEU 27  27  27  LEU LEU U . n 
DA 14 28  GLY 28  28  28  GLY GLY U . n 
DA 14 29  ALA 29  29  29  ALA ALA U . n 
DA 14 30  GLY 30  30  30  GLY GLY U . n 
DA 14 31  LEU 31  31  31  LEU LEU U . n 
DA 14 32  SER 32  32  32  SER SER U . n 
DA 14 33  PHE 33  33  33  PHE PHE U . n 
DA 14 34  LEU 34  34  34  LEU LEU U . n 
DA 14 35  LEU 35  35  35  LEU LEU U . n 
DA 14 36  ASN 36  36  36  ASN ASN U . n 
DA 14 37  LEU 37  37  37  LEU LEU U . n 
DA 14 38  TYR 38  38  38  TYR TYR U . n 
DA 14 39  LEU 39  39  39  LEU LEU U . n 
DA 14 40  PHE 40  40  40  PHE PHE U . n 
DA 14 41  LEU 41  41  41  LEU LEU U . n 
DA 14 42  THR 42  42  42  THR THR U . n 
DA 14 43  HIS 43  43  43  HIS HIS U . n 
DA 14 44  PRO 44  44  44  PRO PRO U . n 
DA 14 45  GLY 45  45  45  GLY GLY U . n 
DA 14 46  GLY 46  46  46  GLY GLY U . n 
DA 14 47  VAL 47  47  47  VAL VAL U . n 
DA 14 48  ALA 48  48  48  ALA ALA U . n 
DA 14 49  HIS 49  49  49  HIS HIS U . n 
DA 14 50  ALA 50  50  50  ALA ALA U . n 
DA 14 51  PHE 51  51  51  PHE PHE U . n 
DA 14 52  GLN 52  52  52  GLN GLN U . n 
DA 14 53  ALA 53  53  53  ALA ALA U . n 
DA 14 54  PRO 54  54  54  PRO PRO U . n 
DA 14 55  LEU 55  55  55  LEU LEU U . n 
DA 14 56  LEU 56  56  56  LEU LEU U . n 
DA 14 57  PRO 57  57  57  PRO PRO U . n 
DA 14 58  GLY 58  58  58  GLY GLY U . n 
DA 14 59  ALA 59  59  59  ALA ALA U . n 
DA 14 60  GLY 60  60  60  GLY GLY U . n 
DA 14 61  VAL 61  61  61  VAL VAL U . n 
DA 14 62  TYR 62  62  62  TYR TYR U . n 
DA 14 63  TRP 63  63  63  TRP TRP U . n 
DA 14 64  ALA 64  64  64  ALA ALA U . n 
DA 14 65  PHE 65  65  65  PHE PHE U . n 
DA 14 66  GLY 66  66  66  GLY GLY U . n 
DA 14 67  LEU 67  67  67  LEU LEU U . n 
DA 14 68  ASP 68  68  68  ASP ASP U . n 
DA 14 69  GLY 69  69  69  GLY GLY U . n 
DA 14 70  LEU 70  70  70  LEU LEU U . n 
DA 14 71  SER 71  71  71  SER SER U . n 
DA 14 72  ALA 72  72  72  ALA ALA U . n 
DA 14 73  LEU 73  73  73  LEU LEU U . n 
DA 14 74  PHE 74  74  74  PHE PHE U . n 
DA 14 75  PHE 75  75  75  PHE PHE U . n 
DA 14 76  LEU 76  76  76  LEU LEU U . n 
DA 14 77  THR 77  77  77  THR THR U . n 
DA 14 78  ILE 78  78  78  ILE ILE U . n 
DA 14 79  ALA 79  79  79  ALA ALA U . n 
DA 14 80  LEU 80  80  80  LEU LEU U . n 
DA 14 81  THR 81  81  81  THR THR U . n 
DA 14 82  VAL 82  82  82  VAL VAL U . n 
DA 14 83  PHE 83  83  83  PHE PHE U . n 
DA 14 84  LEU 84  84  84  LEU LEU U . n 
DA 14 85  GLY 85  85  85  GLY GLY U . n 
DA 14 86  ALA 86  86  86  ALA ALA U . n 
DA 14 87  LEU 87  87  87  LEU LEU U . n 
DA 14 88  VAL 88  88  88  VAL VAL U . n 
DA 14 89  ALA 89  89  89  ALA ALA U . n 
DA 14 90  ARG 90  90  90  ARG ARG U . n 
DA 14 91  VAL 91  91  91  VAL VAL U . n 
DA 14 92  GLU 92  92  92  GLU GLU U . n 
DA 14 93  GLY 93  93  93  GLY GLY U . n 
DA 14 94  ARG 94  94  94  ARG ARG U . n 
DA 14 95  PHE 95  95  95  PHE PHE U . n 
DA 14 96  LEU 96  96  96  LEU LEU U . n 
DA 14 97  GLY 97  97  97  GLY GLY U . n 
DA 14 98  LEU 98  98  98  LEU LEU U . n 
DA 14 99  ALA 99  99  99  ALA ALA U . n 
DA 14 100 LEU 100 100 100 LEU LEU U . n 
DA 14 101 LEU 101 101 101 LEU LEU U . n 
DA 14 102 MET 102 102 102 MET MET U . n 
DA 14 103 GLU 103 103 103 GLU GLU U . n 
DA 14 104 GLY 104 104 104 GLY GLY U . n 
DA 14 105 LEU 105 105 105 LEU LEU U . n 
DA 14 106 LEU 106 106 106 LEU LEU U . n 
DA 14 107 LEU 107 107 107 LEU LEU U . n 
DA 14 108 GLY 108 108 108 GLY GLY U . n 
DA 14 109 LEU 109 109 109 LEU LEU U . n 
DA 14 110 PHE 110 110 110 PHE PHE U . n 
DA 14 111 ALA 111 111 111 ALA ALA U . n 
DA 14 112 ALA 112 112 112 ALA ALA U . n 
DA 14 113 ARG 113 113 113 ARG ARG U . n 
DA 14 114 ASP 114 114 114 ASP ASP U . n 
DA 14 115 LEU 115 115 115 LEU LEU U . n 
DA 14 116 LEU 116 116 116 LEU LEU U . n 
DA 14 117 VAL 117 117 117 VAL VAL U . n 
DA 14 118 PHE 118 118 118 PHE PHE U . n 
DA 14 119 TYR 119 119 119 TYR TYR U . n 
DA 14 120 VAL 120 120 120 VAL VAL U . n 
DA 14 121 PHE 121 121 121 PHE PHE U . n 
DA 14 122 PHE 122 122 122 PHE PHE U . n 
DA 14 123 GLU 123 123 123 GLU GLU U . n 
DA 14 124 ALA 124 124 124 ALA ALA U . n 
DA 14 125 ALA 125 125 125 ALA ALA U . n 
DA 14 126 LEU 126 126 126 LEU LEU U . n 
DA 14 127 ILE 127 127 127 ILE ILE U . n 
DA 14 128 PRO 128 128 128 PRO PRO U . n 
DA 14 129 ALA 129 129 129 ALA ALA U . n 
DA 14 130 LEU 130 130 130 LEU LEU U . n 
DA 14 131 LEU 131 131 131 LEU LEU U . n 
DA 14 132 MET 132 132 132 MET MET U . n 
DA 14 133 LEU 133 133 133 LEU LEU U . n 
DA 14 134 TYR 134 134 134 TYR TYR U . n 
DA 14 135 LEU 135 135 135 LEU LEU U . n 
DA 14 136 TYR 136 136 136 TYR TYR U . n 
DA 14 137 GLY 137 137 137 GLY GLY U . n 
DA 14 138 GLY 138 138 138 GLY GLY U . n 
DA 14 139 GLU 139 139 139 GLU GLU U . n 
DA 14 140 GLY 140 140 140 GLY GLY U . n 
DA 14 141 ARG 141 141 141 ARG ARG U . n 
DA 14 142 THR 142 142 142 THR THR U . n 
DA 14 143 ARG 143 143 143 ARG ARG U . n 
DA 14 144 ALA 144 144 144 ALA ALA U . n 
DA 14 145 LEU 145 145 145 LEU LEU U . n 
DA 14 146 TYR 146 146 146 TYR TYR U . n 
DA 14 147 THR 147 147 147 THR THR U . n 
DA 14 148 PHE 148 148 148 PHE PHE U . n 
DA 14 149 VAL 149 149 149 VAL VAL U . n 
DA 14 150 LEU 150 150 150 LEU LEU U . n 
DA 14 151 PHE 151 151 151 PHE PHE U . n 
DA 14 152 THR 152 152 152 THR THR U . n 
DA 14 153 LEU 153 153 153 LEU LEU U . n 
DA 14 154 VAL 154 154 154 VAL VAL U . n 
DA 14 155 GLY 155 155 155 GLY GLY U . n 
DA 14 156 SER 156 156 156 SER SER U . n 
DA 14 157 LEU 157 157 157 LEU LEU U . n 
DA 14 158 PRO 158 158 158 PRO PRO U . n 
DA 14 159 MET 159 159 159 MET MET U . n 
DA 14 160 LEU 160 160 160 LEU LEU U . n 
DA 14 161 ALA 161 161 161 ALA ALA U . n 
DA 14 162 ALA 162 162 162 ALA ALA U . n 
DA 14 163 VAL 163 163 163 VAL VAL U . n 
DA 14 164 LEU 164 164 164 LEU LEU U . n 
DA 14 165 GLY 165 165 165 GLY GLY U . n 
DA 14 166 ALA 166 166 166 ALA ALA U . n 
DA 14 167 ARG 167 167 167 ARG ARG U . n 
DA 14 168 LEU 168 168 168 LEU LEU U . n 
DA 14 169 LEU 169 169 169 LEU LEU U . n 
DA 14 170 SER 170 170 170 SER SER U . n 
DA 14 171 GLY 171 171 171 GLY GLY U . n 
DA 14 172 SER 172 172 172 SER SER U . n 
DA 14 173 PRO 173 173 173 PRO PRO U . n 
DA 14 174 THR 174 174 174 THR THR U . n 
DA 14 175 PHE 175 175 175 PHE PHE U . n 
DA 14 176 LEU 176 176 176 LEU LEU U . n 
DA 14 177 LEU 177 177 177 LEU LEU U . n 
DA 14 178 GLU 178 178 178 GLU GLU U . n 
DA 14 179 ASP 179 179 179 ASP ASP U . n 
DA 14 180 LEU 180 180 180 LEU LEU U . n 
DA 14 181 LEU 181 181 181 LEU LEU U . n 
DA 14 182 ALA 182 182 182 ALA ALA U . n 
DA 14 183 HIS 183 183 183 HIS HIS U . n 
DA 14 184 PRO 184 184 184 PRO PRO U . n 
DA 14 185 LEU 185 185 185 LEU LEU U . n 
DA 14 186 GLN 186 186 186 GLN GLN U . n 
DA 14 187 GLU 187 187 187 GLU GLU U . n 
DA 14 188 GLU 188 188 188 GLU GLU U . n 
DA 14 189 ALA 189 189 189 ALA ALA U . n 
DA 14 190 ALA 190 190 190 ALA ALA U . n 
DA 14 191 PHE 191 191 191 PHE PHE U . n 
DA 14 192 TRP 192 192 192 TRP TRP U . n 
DA 14 193 VAL 193 193 193 VAL VAL U . n 
DA 14 194 PHE 194 194 194 PHE PHE U . n 
DA 14 195 LEU 195 195 195 LEU LEU U . n 
DA 14 196 GLY 196 196 196 GLY GLY U . n 
DA 14 197 PHE 197 197 197 PHE PHE U . n 
DA 14 198 ALA 198 198 198 ALA ALA U . n 
DA 14 199 LEU 199 199 199 LEU LEU U . n 
DA 14 200 ALA 200 200 200 ALA ALA U . n 
DA 14 201 PHE 201 201 201 PHE PHE U . n 
DA 14 202 ALA 202 202 202 ALA ALA U . n 
DA 14 203 ILE 203 203 203 ILE ILE U . n 
DA 14 204 LYS 204 204 204 LYS LYS U . n 
DA 14 205 THR 205 205 205 THR THR U . n 
DA 14 206 PRO 206 206 206 PRO PRO U . n 
DA 14 207 LEU 207 207 207 LEU LEU U . n 
DA 14 208 PHE 208 208 208 PHE PHE U . n 
DA 14 209 PRO 209 209 209 PRO PRO U . n 
DA 14 210 LEU 210 210 210 LEU LEU U . n 
DA 14 211 HIS 211 211 211 HIS HIS U . n 
DA 14 212 ALA 212 212 212 ALA ALA U . n 
DA 14 213 TRP 213 213 213 TRP TRP U . n 
DA 14 214 LEU 214 214 214 LEU LEU U . n 
DA 14 215 PRO 215 215 215 PRO PRO U . n 
DA 14 216 PRO 216 216 216 PRO PRO U . n 
DA 14 217 PHE 217 217 217 PHE PHE U . n 
DA 14 218 HIS 218 218 218 HIS HIS U . n 
DA 14 219 GLN 219 219 219 GLN GLN U . n 
DA 14 220 GLU 220 220 220 GLU GLU U . n 
DA 14 221 ASN 221 221 221 ASN ASN U . n 
DA 14 222 HIS 222 222 222 HIS HIS U . n 
DA 14 223 PRO 223 223 223 PRO PRO U . n 
DA 14 224 SER 224 224 224 SER SER U . n 
DA 14 225 GLY 225 225 225 GLY GLY U . n 
DA 14 226 LEU 226 226 226 LEU LEU U . n 
DA 14 227 ALA 227 227 227 ALA ALA U . n 
DA 14 228 ASP 228 228 228 ASP ASP U . n 
DA 14 229 ALA 229 229 229 ALA ALA U . n 
DA 14 230 LEU 230 230 230 LEU LEU U . n 
DA 14 231 GLY 231 231 231 GLY GLY U . n 
DA 14 232 THR 232 232 232 THR THR U . n 
DA 14 233 LEU 233 233 233 LEU LEU U . n 
DA 14 234 TYR 234 234 234 TYR TYR U . n 
DA 14 235 LYS 235 235 235 LYS LYS U . n 
DA 14 236 VAL 236 236 236 VAL VAL U . n 
DA 14 237 GLY 237 237 237 GLY GLY U . n 
DA 14 238 VAL 238 238 238 VAL VAL U . n 
DA 14 239 PHE 239 239 239 PHE PHE U . n 
DA 14 240 ALA 240 240 240 ALA ALA U . n 
DA 14 241 PHE 241 241 241 PHE PHE U . n 
DA 14 242 PHE 242 242 242 PHE PHE U . n 
DA 14 243 ARG 243 243 243 ARG ARG U . n 
DA 14 244 PHE 244 244 244 PHE PHE U . n 
DA 14 245 ALA 245 245 245 ALA ALA U . n 
DA 14 246 ILE 246 246 246 ILE ILE U . n 
DA 14 247 PRO 247 247 247 PRO PRO U . n 
DA 14 248 LEU 248 248 248 LEU LEU U . n 
DA 14 249 ALA 249 249 249 ALA ALA U . n 
DA 14 250 PRO 250 250 250 PRO PRO U . n 
DA 14 251 GLU 251 251 251 GLU GLU U . n 
DA 14 252 GLY 252 252 252 GLY GLY U . n 
DA 14 253 PHE 253 253 253 PHE PHE U . n 
DA 14 254 ALA 254 254 254 ALA ALA U . n 
DA 14 255 GLN 255 255 255 GLN GLN U . n 
DA 14 256 ALA 256 256 256 ALA ALA U . n 
DA 14 257 GLN 257 257 257 GLN GLN U . n 
DA 14 258 GLY 258 258 258 GLY GLY U . n 
DA 14 259 LEU 259 259 259 LEU LEU U . n 
DA 14 260 LEU 260 260 260 LEU LEU U . n 
DA 14 261 LEU 261 261 261 LEU LEU U . n 
DA 14 262 PHE 262 262 262 PHE PHE U . n 
DA 14 263 LEU 263 263 263 LEU LEU U . n 
DA 14 264 ALA 264 264 264 ALA ALA U . n 
DA 14 265 ALA 265 265 265 ALA ALA U . n 
DA 14 266 LEU 266 266 266 LEU LEU U . n 
DA 14 267 SER 267 267 267 SER SER U . n 
DA 14 268 ALA 268 268 268 ALA ALA U . n 
DA 14 269 LEU 269 269 269 LEU LEU U . n 
DA 14 270 TYR 270 270 270 TYR TYR U . n 
DA 14 271 GLY 271 271 271 GLY GLY U . n 
DA 14 272 ALA 272 272 272 ALA ALA U . n 
DA 14 273 TRP 273 273 273 TRP TRP U . n 
DA 14 274 VAL 274 274 274 VAL VAL U . n 
DA 14 275 ALA 275 275 275 ALA ALA U . n 
DA 14 276 PHE 276 276 276 PHE PHE U . n 
DA 14 277 ALA 277 277 277 ALA ALA U . n 
DA 14 278 ALA 278 278 278 ALA ALA U . n 
DA 14 279 LYS 279 279 279 LYS LYS U . n 
DA 14 280 ASP 280 280 280 ASP ASP U . n 
DA 14 281 PHE 281 281 281 PHE PHE U . n 
DA 14 282 LYS 282 282 282 LYS LYS U . n 
DA 14 283 THR 283 283 283 THR THR U . n 
DA 14 284 LEU 284 284 284 LEU LEU U . n 
DA 14 285 LEU 285 285 285 LEU LEU U . n 
DA 14 286 ALA 286 286 286 ALA ALA U . n 
DA 14 287 TYR 287 287 287 TYR TYR U . n 
DA 14 288 ALA 288 288 288 ALA ALA U . n 
DA 14 289 GLY 289 289 289 GLY GLY U . n 
DA 14 290 LEU 290 290 290 LEU LEU U . n 
DA 14 291 SER 291 291 291 SER SER U . n 
DA 14 292 HIS 292 292 292 HIS HIS U . n 
DA 14 293 MET 293 293 293 MET MET U . n 
DA 14 294 GLY 294 294 294 GLY GLY U . n 
DA 14 295 VAL 295 295 295 VAL VAL U . n 
DA 14 296 ALA 296 296 296 ALA ALA U . n 
DA 14 297 ALA 297 297 297 ALA ALA U . n 
DA 14 298 LEU 298 298 298 LEU LEU U . n 
DA 14 299 GLY 299 299 299 GLY GLY U . n 
DA 14 300 VAL 300 300 300 VAL VAL U . n 
DA 14 301 PHE 301 301 301 PHE PHE U . n 
DA 14 302 SER 302 302 302 SER SER U . n 
DA 14 303 GLY 303 303 303 GLY GLY U . n 
DA 14 304 THR 304 304 304 THR THR U . n 
DA 14 305 PRO 305 305 305 PRO PRO U . n 
DA 14 306 GLU 306 306 306 GLU GLU U . n 
DA 14 307 GLY 307 307 307 GLY GLY U . n 
DA 14 308 ALA 308 308 308 ALA ALA U . n 
DA 14 309 MET 309 309 309 MET MET U . n 
DA 14 310 GLY 310 310 310 GLY GLY U . n 
DA 14 311 GLY 311 311 311 GLY GLY U . n 
DA 14 312 LEU 312 312 312 LEU LEU U . n 
DA 14 313 TYR 313 313 313 TYR TYR U . n 
DA 14 314 LEU 314 314 314 LEU LEU U . n 
DA 14 315 LEU 315 315 315 LEU LEU U . n 
DA 14 316 ALA 316 316 316 ALA ALA U . n 
DA 14 317 ALA 317 317 317 ALA ALA U . n 
DA 14 318 SER 318 318 318 SER SER U . n 
DA 14 319 GLY 319 319 319 GLY GLY U . n 
DA 14 320 VAL 320 320 320 VAL VAL U . n 
DA 14 321 TYR 321 321 321 TYR TYR U . n 
DA 14 322 THR 322 322 322 THR THR U . n 
DA 14 323 GLY 323 323 323 GLY GLY U . n 
DA 14 324 GLY 324 324 324 GLY GLY U . n 
DA 14 325 LEU 325 325 325 LEU LEU U . n 
DA 14 326 PHE 326 326 326 PHE PHE U . n 
DA 14 327 LEU 327 327 327 LEU LEU U . n 
DA 14 328 LEU 328 328 328 LEU LEU U . n 
DA 14 329 ALA 329 329 329 ALA ALA U . n 
DA 14 330 GLY 330 330 330 GLY GLY U . n 
DA 14 331 ARG 331 331 331 ARG ARG U . n 
DA 14 332 LEU 332 332 332 LEU LEU U . n 
DA 14 333 TYR 333 333 333 TYR TYR U . n 
DA 14 334 GLU 334 334 334 GLU GLU U . n 
DA 14 335 ARG 335 335 335 ARG ARG U . n 
DA 14 336 THR 336 336 336 THR THR U . n 
DA 14 337 GLY 337 337 337 GLY GLY U . n 
DA 14 338 THR 338 338 338 THR THR U . n 
DA 14 339 LEU 339 339 339 LEU LEU U . n 
DA 14 340 GLU 340 340 340 GLU GLU U . n 
DA 14 341 ILE 341 341 341 ILE ILE U . n 
DA 14 342 GLY 342 342 342 GLY GLY U . n 
DA 14 343 ARG 343 343 343 ARG ARG U . n 
DA 14 344 TYR 344 344 344 TYR TYR U . n 
DA 14 345 ARG 345 345 345 ARG ARG U . n 
DA 14 346 GLY 346 346 346 GLY GLY U . n 
DA 14 347 LEU 347 347 347 LEU LEU U . n 
DA 14 348 ALA 348 348 348 ALA ALA U . n 
DA 14 349 GLN 349 349 349 GLN GLN U . n 
DA 14 350 SER 350 350 350 SER SER U . n 
DA 14 351 ALA 351 351 351 ALA ALA U . n 
DA 14 352 PRO 352 352 352 PRO PRO U . n 
DA 14 353 GLY 353 353 353 GLY GLY U . n 
DA 14 354 LEU 354 354 354 LEU LEU U . n 
DA 14 355 ALA 355 355 355 ALA ALA U . n 
DA 14 356 ALA 356 356 356 ALA ALA U . n 
DA 14 357 LEU 357 357 357 LEU LEU U . n 
DA 14 358 ALA 358 358 358 ALA ALA U . n 
DA 14 359 LEU 359 359 359 LEU LEU U . n 
DA 14 360 ILE 360 360 360 ILE ILE U . n 
DA 14 361 LEU 361 361 361 LEU LEU U . n 
DA 14 362 PHE 362 362 362 PHE PHE U . n 
DA 14 363 LEU 363 363 363 LEU LEU U . n 
DA 14 364 ALA 364 364 364 ALA ALA U . n 
DA 14 365 MET 365 365 365 MET MET U . n 
DA 14 366 VAL 366 366 366 VAL VAL U . n 
DA 14 367 GLY 367 367 367 GLY GLY U . n 
DA 14 368 LEU 368 368 368 LEU LEU U . n 
DA 14 369 PRO 369 369 369 PRO PRO U . n 
DA 14 370 GLY 370 370 370 GLY GLY U . n 
DA 14 371 LEU 371 371 371 LEU LEU U . n 
DA 14 372 SER 372 372 372 SER SER U . n 
DA 14 373 GLY 373 373 373 GLY GLY U . n 
DA 14 374 PHE 374 374 374 PHE PHE U . n 
DA 14 375 PRO 375 375 375 PRO PRO U . n 
DA 14 376 GLY 376 376 376 GLY GLY U . n 
DA 14 377 GLU 377 377 377 GLU GLU U . n 
DA 14 378 PHE 378 378 378 PHE PHE U . n 
DA 14 379 LEU 379 379 379 LEU LEU U . n 
DA 14 380 THR 380 380 380 THR THR U . n 
DA 14 381 LEU 381 381 381 LEU LEU U . n 
DA 14 382 LEU 382 382 382 LEU LEU U . n 
DA 14 383 GLY 383 383 383 GLY GLY U . n 
DA 14 384 ALA 384 384 384 ALA ALA U . n 
DA 14 385 TYR 385 385 385 TYR TYR U . n 
DA 14 386 LYS 386 386 386 LYS LYS U . n 
DA 14 387 ALA 387 387 387 ALA ALA U . n 
DA 14 388 SER 388 388 388 SER SER U . n 
DA 14 389 PRO 389 389 389 PRO PRO U . n 
DA 14 390 TRP 390 390 390 TRP TRP U . n 
DA 14 391 LEU 391 391 391 LEU LEU U . n 
DA 14 392 ALA 392 392 392 ALA ALA U . n 
DA 14 393 ALA 393 393 393 ALA ALA U . n 
DA 14 394 LEU 394 394 394 LEU LEU U . n 
DA 14 395 ALA 395 395 395 ALA ALA U . n 
DA 14 396 PHE 396 396 396 PHE PHE U . n 
DA 14 397 LEU 397 397 397 LEU LEU U . n 
DA 14 398 SER 398 398 398 SER SER U . n 
DA 14 399 VAL 399 399 399 VAL VAL U . n 
DA 14 400 ILE 400 400 400 ILE ILE U . n 
DA 14 401 ALA 401 401 401 ALA ALA U . n 
DA 14 402 SER 402 402 402 SER SER U . n 
DA 14 403 ALA 403 403 403 ALA ALA U . n 
DA 14 404 ALA 404 404 404 ALA ALA U . n 
DA 14 405 TYR 405 405 405 TYR TYR U . n 
DA 14 406 ALA 406 406 406 ALA ALA U . n 
DA 14 407 LEU 407 407 407 LEU LEU U . n 
DA 14 408 THR 408 408 408 THR THR U . n 
DA 14 409 ALA 409 409 409 ALA ALA U . n 
DA 14 410 PHE 410 410 410 PHE PHE U . n 
DA 14 411 GLN 411 411 411 GLN GLN U . n 
DA 14 412 LYS 412 412 412 LYS LYS U . n 
DA 14 413 THR 413 413 413 THR THR U . n 
DA 14 414 PHE 414 414 414 PHE PHE U . n 
DA 14 415 TRP 415 415 415 TRP TRP U . n 
DA 14 416 GLU 416 416 416 GLU GLU U . n 
DA 14 417 GLU 417 417 417 GLU GLU U . n 
DA 14 418 GLY 418 418 418 GLY GLY U . n 
DA 14 419 GLY 419 419 419 GLY GLY U . n 
DA 14 420 SER 420 420 420 SER SER U . n 
DA 14 421 GLY 421 421 421 GLY GLY U . n 
DA 14 422 VAL 422 422 422 VAL VAL U . n 
DA 14 423 LYS 423 423 423 LYS LYS U . n 
DA 14 424 ASP 424 424 424 ASP ASP U . n 
DA 14 425 LEU 425 425 425 LEU LEU U . n 
DA 14 426 ALA 426 426 426 ALA ALA U . n 
DA 14 427 GLY 427 427 427 GLY GLY U . n 
DA 14 428 ALA 428 428 428 ALA ALA U . n 
DA 14 429 GLU 429 429 429 GLU GLU U . n 
DA 14 430 TRP 430 430 430 TRP TRP U . n 
DA 14 431 GLY 431 431 431 GLY GLY U . n 
DA 14 432 PHE 432 432 432 PHE PHE U . n 
DA 14 433 ALA 433 433 433 ALA ALA U . n 
DA 14 434 LEU 434 434 434 LEU LEU U . n 
DA 14 435 LEU 435 435 435 LEU LEU U . n 
DA 14 436 SER 436 436 436 SER SER U . n 
DA 14 437 VAL 437 437 437 VAL VAL U . n 
DA 14 438 LEU 438 438 438 LEU LEU U . n 
DA 14 439 ALA 439 439 439 ALA ALA U . n 
DA 14 440 LEU 440 440 440 LEU LEU U . n 
DA 14 441 LEU 441 441 441 LEU LEU U . n 
DA 14 442 LEU 442 442 442 LEU LEU U . n 
DA 14 443 MET 443 443 443 MET MET U . n 
DA 14 444 GLY 444 444 444 GLY GLY U . n 
DA 14 445 VAL 445 445 445 VAL VAL U . n 
DA 14 446 PHE 446 446 446 PHE PHE U . n 
DA 14 447 PRO 447 447 447 PRO PRO U . n 
DA 14 448 GLY 448 448 448 GLY GLY U . n 
DA 14 449 TYR 449 449 449 TYR TYR U . n 
DA 14 450 PHE 450 450 450 PHE PHE U . n 
DA 14 451 ALA 451 451 451 ALA ALA U . n 
DA 14 452 ARG 452 452 452 ARG ARG U . n 
DA 14 453 GLY 453 453 453 GLY GLY U . n 
DA 14 454 LEU 454 454 454 LEU LEU U . n 
DA 14 455 HIS 455 455 455 HIS HIS U . n 
DA 14 456 PRO 456 456 456 PRO PRO U . n 
DA 14 457 LEU 457 457 457 LEU LEU U . n 
DA 14 458 ALA 458 458 458 ALA ALA U . n 
DA 14 459 GLU 459 459 459 GLU GLU U . n 
DA 14 460 ALA 460 460 460 ALA ALA U . n 
DA 14 461 PHE 461 461 461 PHE PHE U . n 
DA 14 462 ALA 462 462 462 ALA ALA U . n 
DA 14 463 LYS 463 463 463 LYS LYS U . n 
DA 14 464 LEU 464 464 464 LEU LEU U . n 
DA 14 465 LEU 465 465 465 LEU LEU U . n 
DA 14 466 GLY 466 466 466 GLY GLY U . n 
DA 14 467 GLY 467 467 467 GLY GLY U . n 
DA 14 468 GLY 468 468 ?   ?   ?   U . n 
DA 14 469 ALA 469 469 ?   ?   ?   U . n 
EA 15 1   MET 1   1   1   MET MET V . n 
EA 15 2   THR 2   2   2   THR THR V . n 
EA 15 3   LEU 3   3   3   LEU LEU V . n 
EA 15 4   ALA 4   4   4   ALA ALA V . n 
EA 15 5   ILE 5   5   5   ILE ILE V . n 
EA 15 6   LEU 6   6   6   LEU LEU V . n 
EA 15 7   ALA 7   7   7   ALA ALA V . n 
EA 15 8   VAL 8   8   8   VAL VAL V . n 
EA 15 9   PHE 9   9   9   PHE PHE V . n 
EA 15 10  SER 10  10  10  SER SER V . n 
EA 15 11  VAL 11  11  11  VAL VAL V . n 
EA 15 12  ALA 12  12  12  ALA ALA V . n 
EA 15 13  LEU 13  13  13  LEU LEU V . n 
EA 15 14  THR 14  14  14  THR THR V . n 
EA 15 15  LEU 15  15  15  LEU LEU V . n 
EA 15 16  LEU 16  16  16  LEU LEU V . n 
EA 15 17  GLY 17  17  17  GLY GLY V . n 
EA 15 18  PHE 18  18  18  PHE PHE V . n 
EA 15 19  VAL 19  19  19  VAL VAL V . n 
EA 15 20  LEU 20  20  20  LEU LEU V . n 
EA 15 21  PRO 21  21  21  PRO PRO V . n 
EA 15 22  PRO 22  22  22  PRO PRO V . n 
EA 15 23  GLN 23  23  23  GLN GLN V . n 
EA 15 24  GLY 24  24  24  GLY GLY V . n 
EA 15 25  VAL 25  25  25  VAL VAL V . n 
EA 15 26  LYS 26  26  26  LYS LYS V . n 
EA 15 27  ARG 27  27  27  ARG ARG V . n 
EA 15 28  ALA 28  28  28  ALA ALA V . n 
EA 15 29  THR 29  29  29  THR THR V . n 
EA 15 30  LEU 30  30  30  LEU LEU V . n 
EA 15 31  LEU 31  31  31  LEU LEU V . n 
EA 15 32  GLY 32  32  32  GLY GLY V . n 
EA 15 33  LEU 33  33  33  LEU LEU V . n 
EA 15 34  ALA 34  34  34  ALA ALA V . n 
EA 15 35  LEU 35  35  35  LEU LEU V . n 
EA 15 36  ALA 36  36  36  ALA ALA V . n 
EA 15 37  LEU 37  37  37  LEU LEU V . n 
EA 15 38  ALA 38  38  38  ALA ALA V . n 
EA 15 39  SER 39  39  39  SER SER V . n 
EA 15 40  LEU 40  40  40  LEU LEU V . n 
EA 15 41  LEU 41  41  41  LEU LEU V . n 
EA 15 42  LEU 42  42  42  LEU LEU V . n 
EA 15 43  THR 43  43  43  THR THR V . n 
EA 15 44  TRP 44  44  44  TRP TRP V . n 
EA 15 45  GLY 45  45  45  GLY GLY V . n 
EA 15 46  LYS 46  46  46  LYS LYS V . n 
EA 15 47  PRO 47  47  47  PRO PRO V . n 
EA 15 48  PHE 48  48  48  PHE PHE V . n 
EA 15 49  ALA 49  49  49  ALA ALA V . n 
EA 15 50  PHE 50  50  50  PHE PHE V . n 
EA 15 51  GLY 51  51  51  GLY GLY V . n 
EA 15 52  PRO 52  52  52  PRO PRO V . n 
EA 15 53  TYR 53  53  53  TYR TYR V . n 
EA 15 54  ALA 54  54  54  ALA ALA V . n 
EA 15 55  VAL 55  55  55  VAL VAL V . n 
EA 15 56  ASP 56  56  56  ASP ASP V . n 
EA 15 57  GLY 57  57  57  GLY GLY V . n 
EA 15 58  VAL 58  58  58  VAL VAL V . n 
EA 15 59  SER 59  59  59  SER SER V . n 
EA 15 60  GLN 60  60  60  GLN GLN V . n 
EA 15 61  VAL 61  61  61  VAL VAL V . n 
EA 15 62  PHE 62  62  62  PHE PHE V . n 
EA 15 63  THR 63  63  63  THR THR V . n 
EA 15 64  LEU 64  64  64  LEU LEU V . n 
EA 15 65  LEU 65  65  65  LEU LEU V . n 
EA 15 66  ALA 66  66  66  ALA ALA V . n 
EA 15 67  LEU 67  67  67  LEU LEU V . n 
EA 15 68  LEU 68  68  68  LEU LEU V . n 
EA 15 69  GLY 69  69  69  GLY GLY V . n 
EA 15 70  ALA 70  70  70  ALA ALA V . n 
EA 15 71  LEU 71  71  71  LEU LEU V . n 
EA 15 72  TRP 72  72  72  TRP TRP V . n 
EA 15 73  THR 73  73  73  THR THR V . n 
EA 15 74  VAL 74  74  74  VAL VAL V . n 
EA 15 75  GLY 75  75  75  GLY GLY V . n 
EA 15 76  LEU 76  76  76  LEU LEU V . n 
EA 15 77  VAL 77  77  77  VAL VAL V . n 
EA 15 78  ARG 78  78  78  ARG ARG V . n 
EA 15 79  SER 79  79  79  SER SER V . n 
EA 15 80  GLY 80  80  80  GLY GLY V . n 
EA 15 81  ARG 81  81  81  ARG ARG V . n 
EA 15 82  PHE 82  82  82  PHE PHE V . n 
EA 15 83  GLU 83  83  83  GLU GLU V . n 
EA 15 84  PHE 84  84  84  PHE PHE V . n 
EA 15 85  TYR 85  85  85  TYR TYR V . n 
EA 15 86  LEU 86  86  86  LEU LEU V . n 
EA 15 87  LEU 87  87  87  LEU LEU V . n 
EA 15 88  VAL 88  88  88  VAL VAL V . n 
EA 15 89  LEU 89  89  89  LEU LEU V . n 
EA 15 90  TYR 90  90  90  TYR TYR V . n 
EA 15 91  ALA 91  91  91  ALA ALA V . n 
EA 15 92  ALA 92  92  92  ALA ALA V . n 
EA 15 93  LEU 93  93  93  LEU LEU V . n 
EA 15 94  GLY 94  94  94  GLY GLY V . n 
EA 15 95  MET 95  95  95  MET MET V . n 
EA 15 96  HIS 96  96  96  HIS HIS V . n 
EA 15 97  LEU 97  97  97  LEU LEU V . n 
EA 15 98  LEU 98  98  98  LEU LEU V . n 
EA 15 99  ALA 99  99  99  ALA ALA V . n 
EA 15 100 SER 100 100 100 SER SER V . n 
EA 15 101 THR 101 101 101 THR THR V . n 
EA 15 102 ARG 102 102 102 ARG ARG V . n 
EA 15 103 HIS 103 103 103 HIS HIS V . n 
EA 15 104 LEU 104 104 104 LEU LEU V . n 
EA 15 105 LEU 105 105 105 LEU LEU V . n 
EA 15 106 LEU 106 106 106 LEU LEU V . n 
EA 15 107 MET 107 107 107 MET MET V . n 
EA 15 108 LEU 108 108 108 LEU LEU V . n 
EA 15 109 VAL 109 109 109 VAL VAL V . n 
EA 15 110 ALA 110 110 110 ALA ALA V . n 
EA 15 111 LEU 111 111 111 LEU LEU V . n 
EA 15 112 GLU 112 112 112 GLU GLU V . n 
EA 15 113 ALA 113 113 113 ALA ALA V . n 
EA 15 114 LEU 114 114 114 LEU LEU V . n 
EA 15 115 SER 115 115 115 SER SER V . n 
EA 15 116 LEU 116 116 116 LEU LEU V . n 
EA 15 117 PRO 117 117 117 PRO PRO V . n 
EA 15 118 LEU 118 118 118 LEU LEU V . n 
EA 15 119 TYR 119 119 119 TYR TYR V . n 
EA 15 120 ALA 120 120 120 ALA ALA V . n 
EA 15 121 LEU 121 121 121 LEU LEU V . n 
EA 15 122 ALA 122 122 122 ALA ALA V . n 
EA 15 123 THR 123 123 123 THR THR V . n 
EA 15 124 TRP 124 124 124 TRP TRP V . n 
EA 15 125 ARG 125 125 125 ARG ARG V . n 
EA 15 126 ARG 126 126 126 ARG ARG V . n 
EA 15 127 GLY 127 127 127 GLY GLY V . n 
EA 15 128 GLN 128 128 128 GLN GLN V . n 
EA 15 129 GLY 129 129 129 GLY GLY V . n 
EA 15 130 LEU 130 130 130 LEU LEU V . n 
EA 15 131 GLU 131 131 131 GLU GLU V . n 
EA 15 132 ALA 132 132 132 ALA ALA V . n 
EA 15 133 ALA 133 133 133 ALA ALA V . n 
EA 15 134 LEU 134 134 134 LEU LEU V . n 
EA 15 135 LYS 135 135 135 LYS LYS V . n 
EA 15 136 TYR 136 136 136 TYR TYR V . n 
EA 15 137 PHE 137 137 137 PHE PHE V . n 
EA 15 138 LEU 138 138 138 LEU LEU V . n 
EA 15 139 LEU 139 139 139 LEU LEU V . n 
EA 15 140 GLY 140 140 140 GLY GLY V . n 
EA 15 141 ALA 141 141 141 ALA ALA V . n 
EA 15 142 LEU 142 142 142 LEU LEU V . n 
EA 15 143 ALA 143 143 143 ALA ALA V . n 
EA 15 144 ALA 144 144 144 ALA ALA V . n 
EA 15 145 ALA 145 145 145 ALA ALA V . n 
EA 15 146 PHE 146 146 146 PHE PHE V . n 
EA 15 147 PHE 147 147 147 PHE PHE V . n 
EA 15 148 LEU 148 148 148 LEU LEU V . n 
EA 15 149 TYR 149 149 149 TYR TYR V . n 
EA 15 150 GLY 150 150 150 GLY GLY V . n 
EA 15 151 ALA 151 151 151 ALA ALA V . n 
EA 15 152 ALA 152 152 152 ALA ALA V . n 
EA 15 153 LEU 153 153 153 LEU LEU V . n 
EA 15 154 PHE 154 154 154 PHE PHE V . n 
EA 15 155 TYR 155 155 155 TYR TYR V . n 
EA 15 156 GLY 156 156 156 GLY GLY V . n 
EA 15 157 ALA 157 157 157 ALA ALA V . n 
EA 15 158 THR 158 158 158 THR THR V . n 
EA 15 159 GLY 159 159 159 GLY GLY V . n 
EA 15 160 SER 160 160 160 SER SER V . n 
EA 15 161 LEU 161 161 161 LEU LEU V . n 
EA 15 162 VAL 162 162 162 VAL VAL V . n 
EA 15 163 LEU 163 163 163 LEU LEU V . n 
EA 15 164 GLY 164 164 164 GLY GLY V . n 
EA 15 165 ALA 165 165 165 ALA ALA V . n 
EA 15 166 PRO 166 166 166 PRO PRO V . n 
EA 15 167 GLY 167 167 167 GLY GLY V . n 
EA 15 168 GLU 168 168 168 GLU GLU V . n 
EA 15 169 GLY 169 169 169 GLY GLY V . n 
EA 15 170 PRO 170 170 170 PRO PRO V . n 
EA 15 171 LEU 171 171 171 LEU LEU V . n 
EA 15 172 TYR 172 172 172 TYR TYR V . n 
EA 15 173 ALA 173 173 173 ALA ALA V . n 
EA 15 174 LEU 174 174 174 LEU LEU V . n 
EA 15 175 ALA 175 175 175 ALA ALA V . n 
EA 15 176 LEU 176 176 176 LEU LEU V . n 
EA 15 177 GLY 177 177 177 GLY GLY V . n 
EA 15 178 LEU 178 178 178 LEU LEU V . n 
EA 15 179 LEU 179 179 179 LEU LEU V . n 
EA 15 180 LEU 180 180 180 LEU LEU V . n 
EA 15 181 VAL 181 181 181 VAL VAL V . n 
EA 15 182 GLY 182 182 182 GLY GLY V . n 
EA 15 183 LEU 183 183 183 LEU LEU V . n 
EA 15 184 GLY 184 184 184 GLY GLY V . n 
EA 15 185 PHE 185 185 185 PHE PHE V . n 
EA 15 186 LYS 186 186 186 LYS LYS V . n 
EA 15 187 ALA 187 187 187 ALA ALA V . n 
EA 15 188 ALA 188 188 188 ALA ALA V . n 
EA 15 189 LEU 189 189 189 LEU LEU V . n 
EA 15 190 ALA 190 190 190 ALA ALA V . n 
EA 15 191 PRO 191 191 191 PRO PRO V . n 
EA 15 192 PHE 192 192 192 PHE PHE V . n 
EA 15 193 HIS 193 193 193 HIS HIS V . n 
EA 15 194 PHE 194 194 194 PHE PHE V . n 
EA 15 195 TRP 195 195 195 TRP TRP V . n 
EA 15 196 THR 196 196 196 THR THR V . n 
EA 15 197 PRO 197 197 197 PRO PRO V . n 
EA 15 198 ASP 198 198 198 ASP ASP V . n 
EA 15 199 VAL 199 199 199 VAL VAL V . n 
EA 15 200 TYR 200 200 200 TYR TYR V . n 
EA 15 201 GLN 201 201 201 GLN GLN V . n 
EA 15 202 GLY 202 202 202 GLY GLY V . n 
EA 15 203 SER 203 203 203 SER SER V . n 
EA 15 204 PRO 204 204 204 PRO PRO V . n 
EA 15 205 THR 205 205 205 THR THR V . n 
EA 15 206 PRO 206 206 206 PRO PRO V . n 
EA 15 207 VAL 207 207 207 VAL VAL V . n 
EA 15 208 VAL 208 208 208 VAL VAL V . n 
EA 15 209 LEU 209 209 209 LEU LEU V . n 
EA 15 210 PHE 210 210 210 PHE PHE V . n 
EA 15 211 MET 211 211 211 MET MET V . n 
EA 15 212 ALA 212 212 212 ALA ALA V . n 
EA 15 213 THR 213 213 213 THR THR V . n 
EA 15 214 SER 214 214 214 SER SER V . n 
EA 15 215 VAL 215 215 215 VAL VAL V . n 
EA 15 216 LYS 216 216 216 LYS LYS V . n 
EA 15 217 ALA 217 217 217 ALA ALA V . n 
EA 15 218 ALA 218 218 218 ALA ALA V . n 
EA 15 219 ALA 219 219 219 ALA ALA V . n 
EA 15 220 PHE 220 220 220 PHE PHE V . n 
EA 15 221 ALA 221 221 221 ALA ALA V . n 
EA 15 222 ALA 222 222 222 ALA ALA V . n 
EA 15 223 LEU 223 223 223 LEU LEU V . n 
EA 15 224 LEU 224 224 224 LEU LEU V . n 
EA 15 225 ARG 225 225 225 ARG ARG V . n 
EA 15 226 VAL 226 226 226 VAL VAL V . n 
EA 15 227 ALA 227 227 227 ALA ALA V . n 
EA 15 228 ALA 228 228 228 ALA ALA V . n 
EA 15 229 PRO 229 229 229 PRO PRO V . n 
EA 15 230 PRO 230 230 230 PRO PRO V . n 
EA 15 231 GLU 231 231 231 GLU GLU V . n 
EA 15 232 ALA 232 232 232 ALA ALA V . n 
EA 15 233 LEU 233 233 233 LEU LEU V . n 
EA 15 234 ALA 234 234 234 ALA ALA V . n 
EA 15 235 LEU 235 235 235 LEU LEU V . n 
EA 15 236 LEU 236 236 236 LEU LEU V . n 
EA 15 237 VAL 237 237 237 VAL VAL V . n 
EA 15 238 ALA 238 238 238 ALA ALA V . n 
EA 15 239 LEU 239 239 239 LEU LEU V . n 
EA 15 240 SER 240 240 240 SER SER V . n 
EA 15 241 VAL 241 241 241 VAL VAL V . n 
EA 15 242 VAL 242 242 242 VAL VAL V . n 
EA 15 243 VAL 243 243 243 VAL VAL V . n 
EA 15 244 GLY 244 244 244 GLY GLY V . n 
EA 15 245 ASN 245 245 245 ASN ASN V . n 
EA 15 246 LEU 246 246 246 LEU LEU V . n 
EA 15 247 ALA 247 247 247 ALA ALA V . n 
EA 15 248 ALA 248 248 248 ALA ALA V . n 
EA 15 249 LEU 249 249 249 LEU LEU V . n 
EA 15 250 ALA 250 250 250 ALA ALA V . n 
EA 15 251 GLN 251 251 251 GLN GLN V . n 
EA 15 252 LYS 252 252 252 LYS LYS V . n 
EA 15 253 GLU 253 253 253 GLU GLU V . n 
EA 15 254 ALA 254 254 254 ALA ALA V . n 
EA 15 255 LYS 255 255 255 LYS LYS V . n 
EA 15 256 ARG 256 256 256 ARG ARG V . n 
EA 15 257 LEU 257 257 257 LEU LEU V . n 
EA 15 258 LEU 258 258 258 LEU LEU V . n 
EA 15 259 ALA 259 259 259 ALA ALA V . n 
EA 15 260 TYR 260 260 260 TYR TYR V . n 
EA 15 261 SER 261 261 261 SER SER V . n 
EA 15 262 SER 262 262 262 SER SER V . n 
EA 15 263 ILE 263 263 263 ILE ILE V . n 
EA 15 264 ALA 264 264 264 ALA ALA V . n 
EA 15 265 HIS 265 265 265 HIS HIS V . n 
EA 15 266 ALA 266 266 266 ALA ALA V . n 
EA 15 267 GLY 267 267 267 GLY GLY V . n 
EA 15 268 TYR 268 268 268 TYR TYR V . n 
EA 15 269 MET 269 269 269 MET MET V . n 
EA 15 270 ALA 270 270 270 ALA ALA V . n 
EA 15 271 LEU 271 271 271 LEU LEU V . n 
EA 15 272 ALA 272 272 272 ALA ALA V . n 
EA 15 273 LEU 273 273 273 LEU LEU V . n 
EA 15 274 TYR 274 274 274 TYR TYR V . n 
EA 15 275 THR 275 275 275 THR THR V . n 
EA 15 276 GLY 276 276 276 GLY GLY V . n 
EA 15 277 ASN 277 277 277 ASN ASN V . n 
EA 15 278 ALA 278 278 278 ALA ALA V . n 
EA 15 279 GLN 279 279 279 GLN GLN V . n 
EA 15 280 ALA 280 280 280 ALA ALA V . n 
EA 15 281 LEU 281 281 281 LEU LEU V . n 
EA 15 282 GLY 282 282 282 GLY GLY V . n 
EA 15 283 PHE 283 283 283 PHE PHE V . n 
EA 15 284 TYR 284 284 284 TYR TYR V . n 
EA 15 285 LEU 285 285 285 LEU LEU V . n 
EA 15 286 LEU 286 286 286 LEU LEU V . n 
EA 15 287 THR 287 287 287 THR THR V . n 
EA 15 288 TYR 288 288 288 TYR TYR V . n 
EA 15 289 VAL 289 289 289 VAL VAL V . n 
EA 15 290 LEU 290 290 290 LEU LEU V . n 
EA 15 291 ALA 291 291 291 ALA ALA V . n 
EA 15 292 THR 292 292 292 THR THR V . n 
EA 15 293 GLY 293 293 293 GLY GLY V . n 
EA 15 294 LEU 294 294 294 LEU LEU V . n 
EA 15 295 ALA 295 295 295 ALA ALA V . n 
EA 15 296 PHE 296 296 296 PHE PHE V . n 
EA 15 297 ALA 297 297 297 ALA ALA V . n 
EA 15 298 VAL 298 298 298 VAL VAL V . n 
EA 15 299 LEU 299 299 299 LEU LEU V . n 
EA 15 300 SER 300 300 300 SER SER V . n 
EA 15 301 GLN 301 301 301 GLN GLN V . n 
EA 15 302 ILE 302 302 302 ILE ILE V . n 
EA 15 303 SER 303 303 303 SER SER V . n 
EA 15 304 PRO 304 304 304 PRO PRO V . n 
EA 15 305 ASP 305 305 305 ASP ASP V . n 
EA 15 306 ARG 306 306 306 ARG ARG V . n 
EA 15 307 VAL 307 307 307 VAL VAL V . n 
EA 15 308 PRO 308 308 308 PRO PRO V . n 
EA 15 309 LEU 309 309 309 LEU LEU V . n 
EA 15 310 GLU 310 310 310 GLU GLU V . n 
EA 15 311 ALA 311 311 311 ALA ALA V . n 
EA 15 312 LEU 312 312 312 LEU LEU V . n 
EA 15 313 ARG 313 313 313 ARG ARG V . n 
EA 15 314 GLY 314 314 314 GLY GLY V . n 
EA 15 315 LEU 315 315 315 LEU LEU V . n 
EA 15 316 TYR 316 316 316 TYR TYR V . n 
EA 15 317 ARG 317 317 317 ARG ARG V . n 
EA 15 318 LYS 318 318 318 LYS LYS V . n 
EA 15 319 ASP 319 319 319 ASP ASP V . n 
EA 15 320 PRO 320 320 320 PRO PRO V . n 
EA 15 321 LEU 321 321 321 LEU LEU V . n 
EA 15 322 LEU 322 322 322 LEU LEU V . n 
EA 15 323 GLY 323 323 323 GLY GLY V . n 
EA 15 324 LEU 324 324 324 LEU LEU V . n 
EA 15 325 ALA 325 325 325 ALA ALA V . n 
EA 15 326 PHE 326 326 326 PHE PHE V . n 
EA 15 327 LEU 327 327 327 LEU LEU V . n 
EA 15 328 VAL 328 328 328 VAL VAL V . n 
EA 15 329 ALA 329 329 329 ALA ALA V . n 
EA 15 330 MET 330 330 330 MET MET V . n 
EA 15 331 LEU 331 331 331 LEU LEU V . n 
EA 15 332 SER 332 332 332 SER SER V . n 
EA 15 333 LEU 333 333 333 LEU LEU V . n 
EA 15 334 LEU 334 334 334 LEU LEU V . n 
EA 15 335 GLY 335 335 335 GLY GLY V . n 
EA 15 336 LEU 336 336 336 LEU LEU V . n 
EA 15 337 PRO 337 337 337 PRO PRO V . n 
EA 15 338 PRO 338 338 338 PRO PRO V . n 
EA 15 339 LEU 339 339 339 LEU LEU V . n 
EA 15 340 ALA 340 340 340 ALA ALA V . n 
EA 15 341 GLY 341 341 341 GLY GLY V . n 
EA 15 342 PHE 342 342 342 PHE PHE V . n 
EA 15 343 TRP 343 343 343 TRP TRP V . n 
EA 15 344 GLY 344 344 344 GLY GLY V . n 
EA 15 345 LYS 345 345 345 LYS LYS V . n 
EA 15 346 TYR 346 346 346 TYR TYR V . n 
EA 15 347 LEU 347 347 347 LEU LEU V . n 
EA 15 348 ALA 348 348 348 ALA ALA V . n 
EA 15 349 PHE 349 349 349 PHE PHE V . n 
EA 15 350 ALA 350 350 350 ALA ALA V . n 
EA 15 351 GLU 351 351 351 GLU GLU V . n 
EA 15 352 ALA 352 352 352 ALA ALA V . n 
EA 15 353 ALA 353 353 353 ALA ALA V . n 
EA 15 354 ARG 354 354 354 ARG ARG V . n 
EA 15 355 ALA 355 355 355 ALA ALA V . n 
EA 15 356 GLY 356 356 356 GLY GLY V . n 
EA 15 357 ALA 357 357 357 ALA ALA V . n 
EA 15 358 TRP 358 358 358 TRP TRP V . n 
EA 15 359 GLY 359 359 359 GLY GLY V . n 
EA 15 360 VAL 360 360 360 VAL VAL V . n 
EA 15 361 LEU 361 361 361 LEU LEU V . n 
EA 15 362 VAL 362 362 362 VAL VAL V . n 
EA 15 363 LEU 363 363 363 LEU LEU V . n 
EA 15 364 ALA 364 364 364 ALA ALA V . n 
EA 15 365 LEU 365 365 365 LEU LEU V . n 
EA 15 366 VAL 366 366 366 VAL VAL V . n 
EA 15 367 THR 367 367 367 THR THR V . n 
EA 15 368 SER 368 368 368 SER SER V . n 
EA 15 369 ALA 369 369 369 ALA ALA V . n 
EA 15 370 VAL 370 370 370 VAL VAL V . n 
EA 15 371 SER 371 371 371 SER SER V . n 
EA 15 372 ALA 372 372 372 ALA ALA V . n 
EA 15 373 TYR 373 373 373 TYR TYR V . n 
EA 15 374 TYR 374 374 374 TYR TYR V . n 
EA 15 375 TYR 375 375 375 TYR TYR V . n 
EA 15 376 LEU 376 376 376 LEU LEU V . n 
EA 15 377 GLY 377 377 377 GLY GLY V . n 
EA 15 378 LEU 378 378 378 LEU LEU V . n 
EA 15 379 GLY 379 379 379 GLY GLY V . n 
EA 15 380 LEU 380 380 380 LEU LEU V . n 
EA 15 381 ALA 381 381 381 ALA ALA V . n 
EA 15 382 VAL 382 382 382 VAL VAL V . n 
EA 15 383 PHE 383 383 383 PHE PHE V . n 
EA 15 384 ALA 384 384 384 ALA ALA V . n 
EA 15 385 ARG 385 385 385 ARG ARG V . n 
EA 15 386 PRO 386 386 386 PRO PRO V . n 
EA 15 387 GLU 387 387 387 GLU GLU V . n 
EA 15 388 GLU 388 388 388 GLU GLU V . n 
EA 15 389 THR 389 389 389 THR THR V . n 
EA 15 390 PRO 390 390 390 PRO PRO V . n 
EA 15 391 PHE 391 391 391 PHE PHE V . n 
EA 15 392 ARG 392 392 392 ARG ARG V . n 
EA 15 393 PRO 393 393 393 PRO PRO V . n 
EA 15 394 GLY 394 394 394 GLY GLY V . n 
EA 15 395 PRO 395 395 395 PRO PRO V . n 
EA 15 396 PRO 396 396 396 PRO PRO V . n 
EA 15 397 TRP 397 397 397 TRP TRP V . n 
EA 15 398 ALA 398 398 398 ALA ALA V . n 
EA 15 399 ARG 399 399 399 ARG ARG V . n 
EA 15 400 ALA 400 400 400 ALA ALA V . n 
EA 15 401 ALA 401 401 401 ALA ALA V . n 
EA 15 402 VAL 402 402 402 VAL VAL V . n 
EA 15 403 VAL 403 403 403 VAL VAL V . n 
EA 15 404 ALA 404 404 404 ALA ALA V . n 
EA 15 405 ALA 405 405 405 ALA ALA V . n 
EA 15 406 GLY 406 406 406 GLY GLY V . n 
EA 15 407 VAL 407 407 407 VAL VAL V . n 
EA 15 408 LEU 408 408 408 LEU LEU V . n 
EA 15 409 LEU 409 409 409 LEU LEU V . n 
EA 15 410 LEU 410 410 410 LEU LEU V . n 
EA 15 411 ALA 411 411 411 ALA ALA V . n 
EA 15 412 LEU 412 412 412 LEU LEU V . n 
EA 15 413 GLY 413 413 413 GLY GLY V . n 
EA 15 414 LEU 414 414 414 LEU LEU V . n 
EA 15 415 LEU 415 415 415 LEU LEU V . n 
EA 15 416 PRO 416 416 416 PRO PRO V . n 
EA 15 417 GLY 417 417 417 GLY GLY V . n 
EA 15 418 LEU 418 418 418 LEU LEU V . n 
EA 15 419 VAL 419 419 419 VAL VAL V . n 
EA 15 420 LEU 420 420 420 LEU LEU V . n 
EA 15 421 PRO 421 421 421 PRO PRO V . n 
EA 15 422 ALA 422 422 422 ALA ALA V . n 
EA 15 423 LEU 423 423 423 LEU LEU V . n 
EA 15 424 ALA 424 424 424 ALA ALA V . n 
EA 15 425 ALA 425 425 425 ALA ALA V . n 
EA 15 426 GLY 426 426 426 GLY GLY V . n 
EA 15 427 GLY 427 427 427 GLY GLY V . n 
FA 16 1   MET 1   1   ?   ?   ?   Q . n 
FA 16 2   THR 2   2   2   THR THR Q . n 
FA 16 3   TRP 3   3   3   TRP TRP Q . n 
FA 16 4   SER 4   4   4   SER SER Q . n 
FA 16 5   TYR 5   5   5   TYR TYR Q . n 
FA 16 6   PRO 6   6   6   PRO PRO Q . n 
FA 16 7   VAL 7   7   7   VAL VAL Q . n 
FA 16 8   ASP 8   8   8   ASP ASP Q . n 
FA 16 9   PRO 9   9   9   PRO PRO Q . n 
FA 16 10  TYR 10  10  10  TYR TYR Q . n 
FA 16 11  TRP 11  11  11  TRP TRP Q . n 
FA 16 12  MET 12  12  12  MET MET Q . n 
FA 16 13  VAL 13  13  13  VAL VAL Q . n 
FA 16 14  ALA 14  14  14  ALA ALA Q . n 
FA 16 15  LEU 15  15  15  LEU LEU Q . n 
FA 16 16  LYS 16  16  16  LYS LYS Q . n 
FA 16 17  ALA 17  17  17  ALA ALA Q . n 
FA 16 18  LEU 18  18  18  LEU LEU Q . n 
FA 16 19  LEU 19  19  19  LEU LEU Q . n 
FA 16 20  VAL 20  20  20  VAL VAL Q . n 
FA 16 21  VAL 21  21  21  VAL VAL Q . n 
FA 16 22  VAL 22  22  22  VAL VAL Q . n 
FA 16 23  GLY 23  23  23  GLY GLY Q . n 
FA 16 24  LEU 24  24  24  LEU LEU Q . n 
FA 16 25  LEU 25  25  25  LEU LEU Q . n 
FA 16 26  THR 26  26  26  THR THR Q . n 
FA 16 27  ALA 27  27  27  ALA ALA Q . n 
FA 16 28  PHE 28  28  28  PHE PHE Q . n 
FA 16 29  ALA 29  29  29  ALA ALA Q . n 
FA 16 30  PHE 30  30  30  PHE PHE Q . n 
FA 16 31  MET 31  31  31  MET MET Q . n 
FA 16 32  THR 32  32  32  THR THR Q . n 
FA 16 33  LEU 33  33  33  LEU LEU Q . n 
FA 16 34  ILE 34  34  34  ILE ILE Q . n 
FA 16 35  GLU 35  35  35  GLU GLU Q . n 
FA 16 36  ARG 36  36  36  ARG ARG Q . n 
FA 16 37  ARG 37  37  37  ARG ARG Q . n 
FA 16 38  LEU 38  38  38  LEU LEU Q . n 
FA 16 39  LEU 39  39  39  LEU LEU Q . n 
FA 16 40  ALA 40  40  40  ALA ALA Q . n 
FA 16 41  ARG 41  41  41  ARG ARG Q . n 
FA 16 42  PHE 42  42  42  PHE PHE Q . n 
FA 16 43  GLN 43  43  43  GLN GLN Q . n 
FA 16 44  VAL 44  44  44  VAL VAL Q . n 
FA 16 45  ARG 45  45  45  ARG ARG Q . n 
FA 16 46  MET 46  46  46  MET MET Q . n 
FA 16 47  GLY 47  47  47  GLY GLY Q . n 
FA 16 48  PRO 48  48  48  PRO PRO Q . n 
FA 16 49  ASN 49  49  49  ASN ASN Q . n 
FA 16 50  ARG 50  50  50  ARG ARG Q . n 
FA 16 51  VAL 51  51  51  VAL VAL Q . n 
FA 16 52  GLY 52  52  52  GLY GLY Q . n 
FA 16 53  PRO 53  53  53  PRO PRO Q . n 
FA 16 54  PHE 54  54  54  PHE PHE Q . n 
FA 16 55  GLY 55  55  55  GLY GLY Q . n 
FA 16 56  LEU 56  56  56  LEU LEU Q . n 
FA 16 57  LEU 57  57  57  LEU LEU Q . n 
FA 16 58  GLN 58  58  58  GLN GLN Q . n 
FA 16 59  PRO 59  59  59  PRO PRO Q . n 
FA 16 60  LEU 60  60  60  LEU LEU Q . n 
FA 16 61  ALA 61  61  61  ALA ALA Q . n 
FA 16 62  ASP 62  62  62  ASP ASP Q . n 
FA 16 63  ALA 63  63  63  ALA ALA Q . n 
FA 16 64  ILE 64  64  64  ILE ILE Q . n 
FA 16 65  LYS 65  65  65  LYS LYS Q . n 
FA 16 66  SER 66  66  66  SER SER Q . n 
FA 16 67  ILE 67  67  67  ILE ILE Q . n 
FA 16 68  PHE 68  68  68  PHE PHE Q . n 
FA 16 69  LYS 69  69  69  LYS LYS Q . n 
FA 16 70  GLU 70  70  70  GLU GLU Q . n 
FA 16 71  ASP 71  71  71  ASP ASP Q . n 
FA 16 72  ILE 72  72  72  ILE ILE Q . n 
FA 16 73  VAL 73  73  73  VAL VAL Q . n 
FA 16 74  VAL 74  74  74  VAL VAL Q . n 
FA 16 75  ALA 75  75  75  ALA ALA Q . n 
FA 16 76  GLN 76  76  76  GLN GLN Q . n 
FA 16 77  ALA 77  77  77  ALA ALA Q . n 
FA 16 78  ASP 78  78  78  ASP ASP Q . n 
FA 16 79  ARG 79  79  79  ARG ARG Q . n 
FA 16 80  PHE 80  80  80  PHE PHE Q . n 
FA 16 81  LEU 81  81  81  LEU LEU Q . n 
FA 16 82  PHE 82  82  82  PHE PHE Q . n 
FA 16 83  VAL 83  83  83  VAL VAL Q . n 
FA 16 84  LEU 84  84  84  LEU LEU Q . n 
FA 16 85  ALA 85  85  85  ALA ALA Q . n 
FA 16 86  PRO 86  86  86  PRO PRO Q . n 
FA 16 87  LEU 87  87  87  LEU LEU Q . n 
FA 16 88  ILE 88  88  88  ILE ILE Q . n 
FA 16 89  SER 89  89  89  SER SER Q . n 
FA 16 90  VAL 90  90  90  VAL VAL Q . n 
FA 16 91  VAL 91  91  91  VAL VAL Q . n 
FA 16 92  PHE 92  92  92  PHE PHE Q . n 
FA 16 93  ALA 93  93  93  ALA ALA Q . n 
FA 16 94  LEU 94  94  94  LEU LEU Q . n 
FA 16 95  LEU 95  95  95  LEU LEU Q . n 
FA 16 96  ALA 96  96  96  ALA ALA Q . n 
FA 16 97  PHE 97  97  97  PHE PHE Q . n 
FA 16 98  GLY 98  98  98  GLY GLY Q . n 
FA 16 99  LEU 99  99  99  LEU LEU Q . n 
FA 16 100 ILE 100 100 100 ILE ILE Q . n 
FA 16 101 PRO 101 101 101 PRO PRO Q . n 
FA 16 102 PHE 102 102 102 PHE PHE Q . n 
FA 16 103 GLY 103 103 103 GLY GLY Q . n 
FA 16 104 PRO 104 104 104 PRO PRO Q . n 
FA 16 105 PRO 105 105 105 PRO PRO Q . n 
FA 16 106 GLY 106 106 106 GLY GLY Q . n 
FA 16 107 SER 107 107 107 SER SER Q . n 
FA 16 108 PHE 108 108 108 PHE PHE Q . n 
FA 16 109 PHE 109 109 109 PHE PHE Q . n 
FA 16 110 GLY 110 110 110 GLY GLY Q . n 
FA 16 111 TYR 111 111 111 TYR TYR Q . n 
FA 16 112 GLN 112 112 112 GLN GLN Q . n 
FA 16 113 PRO 113 113 113 PRO PRO Q . n 
FA 16 114 TRP 114 114 114 TRP TRP Q . n 
FA 16 115 VAL 115 115 115 VAL VAL Q . n 
FA 16 116 ILE 116 116 116 ILE ILE Q . n 
FA 16 117 ASN 117 117 117 ASN ASN Q . n 
FA 16 118 LEU 118 118 118 LEU LEU Q . n 
FA 16 119 ASP 119 119 119 ASP ASP Q . n 
FA 16 120 LEU 120 120 120 LEU LEU Q . n 
FA 16 121 GLY 121 121 121 GLY GLY Q . n 
FA 16 122 ILE 122 122 122 ILE ILE Q . n 
FA 16 123 LEU 123 123 123 LEU LEU Q . n 
FA 16 124 TYR 124 124 124 TYR TYR Q . n 
FA 16 125 LEU 125 125 125 LEU LEU Q . n 
FA 16 126 PHE 126 126 126 PHE PHE Q . n 
FA 16 127 ALA 127 127 127 ALA ALA Q . n 
FA 16 128 VAL 128 128 128 VAL VAL Q . n 
FA 16 129 SER 129 129 129 SER SER Q . n 
FA 16 130 GLU 130 130 130 GLU GLU Q . n 
FA 16 131 LEU 131 131 131 LEU LEU Q . n 
FA 16 132 ALA 132 132 132 ALA ALA Q . n 
FA 16 133 VAL 133 133 133 VAL VAL Q . n 
FA 16 134 TYR 134 134 134 TYR TYR Q . n 
FA 16 135 GLY 135 135 135 GLY GLY Q . n 
FA 16 136 ILE 136 136 136 ILE ILE Q . n 
FA 16 137 PHE 137 137 137 PHE PHE Q . n 
FA 16 138 LEU 138 138 138 LEU LEU Q . n 
FA 16 139 SER 139 139 139 SER SER Q . n 
FA 16 140 GLY 140 140 140 GLY GLY Q . n 
FA 16 141 TRP 141 141 141 TRP TRP Q . n 
FA 16 142 ALA 142 142 142 ALA ALA Q . n 
FA 16 143 SER 143 143 143 SER SER Q . n 
FA 16 144 GLY 144 144 144 GLY GLY Q . n 
FA 16 145 SER 145 145 145 SER SER Q . n 
FA 16 146 LYS 146 146 146 LYS LYS Q . n 
FA 16 147 TYR 147 147 147 TYR TYR Q . n 
FA 16 148 SER 148 148 148 SER SER Q . n 
FA 16 149 LEU 149 149 149 LEU LEU Q . n 
FA 16 150 LEU 150 150 150 LEU LEU Q . n 
FA 16 151 GLY 151 151 151 GLY GLY Q . n 
FA 16 152 SER 152 152 152 SER SER Q . n 
FA 16 153 LEU 153 153 153 LEU LEU Q . n 
FA 16 154 ARG 154 154 154 ARG ARG Q . n 
FA 16 155 SER 155 155 155 SER SER Q . n 
FA 16 156 SER 156 156 156 SER SER Q . n 
FA 16 157 ALA 157 157 157 ALA ALA Q . n 
FA 16 158 SER 158 158 158 SER SER Q . n 
FA 16 159 LEU 159 159 159 LEU LEU Q . n 
FA 16 160 ILE 160 160 160 ILE ILE Q . n 
FA 16 161 SER 161 161 161 SER SER Q . n 
FA 16 162 TYR 162 162 162 TYR TYR Q . n 
FA 16 163 GLU 163 163 163 GLU GLU Q . n 
FA 16 164 LEU 164 164 164 LEU LEU Q . n 
FA 16 165 GLY 165 165 165 GLY GLY Q . n 
FA 16 166 LEU 166 166 166 LEU LEU Q . n 
FA 16 167 GLY 167 167 167 GLY GLY Q . n 
FA 16 168 LEU 168 168 168 LEU LEU Q . n 
FA 16 169 ALA 169 169 169 ALA ALA Q . n 
FA 16 170 LEU 170 170 170 LEU LEU Q . n 
FA 16 171 LEU 171 171 171 LEU LEU Q . n 
FA 16 172 ALA 172 172 172 ALA ALA Q . n 
FA 16 173 PRO 173 173 173 PRO PRO Q . n 
FA 16 174 VAL 174 174 174 VAL VAL Q . n 
FA 16 175 LEU 175 175 175 LEU LEU Q . n 
FA 16 176 LEU 176 176 176 LEU LEU Q . n 
FA 16 177 VAL 177 177 177 VAL VAL Q . n 
FA 16 178 GLY 178 178 178 GLY GLY Q . n 
FA 16 179 SER 179 179 179 SER SER Q . n 
FA 16 180 LEU 180 180 180 LEU LEU Q . n 
FA 16 181 ASN 181 181 181 ASN ASN Q . n 
FA 16 182 LEU 182 182 182 LEU LEU Q . n 
FA 16 183 ASN 183 183 183 ASN ASN Q . n 
FA 16 184 ASP 184 184 184 ASP ASP Q . n 
FA 16 185 ILE 185 185 185 ILE ILE Q . n 
FA 16 186 VAL 186 186 186 VAL VAL Q . n 
FA 16 187 ASN 187 187 187 ASN ASN Q . n 
FA 16 188 TRP 188 188 188 TRP TRP Q . n 
FA 16 189 GLN 189 189 189 GLN GLN Q . n 
FA 16 190 LYS 190 190 190 LYS LYS Q . n 
FA 16 191 GLU 191 191 191 GLU GLU Q . n 
FA 16 192 HIS 192 192 192 HIS HIS Q . n 
FA 16 193 GLY 193 193 193 GLY GLY Q . n 
FA 16 194 TRP 194 194 194 TRP TRP Q . n 
FA 16 195 LEU 195 195 195 LEU LEU Q . n 
FA 16 196 PHE 196 196 196 PHE PHE Q . n 
FA 16 197 LEU 197 197 197 LEU LEU Q . n 
FA 16 198 TYR 198 198 198 TYR TYR Q . n 
FA 16 199 ALA 199 199 199 ALA ALA Q . n 
FA 16 200 PHE 200 200 200 PHE PHE Q . n 
FA 16 201 PRO 201 201 201 PRO PRO Q . n 
FA 16 202 ALA 202 202 202 ALA ALA Q . n 
FA 16 203 PHE 203 203 203 PHE PHE Q . n 
FA 16 204 LEU 204 204 204 LEU LEU Q . n 
FA 16 205 VAL 205 205 205 VAL VAL Q . n 
FA 16 206 TYR 206 206 206 TYR TYR Q . n 
FA 16 207 LEU 207 207 207 LEU LEU Q . n 
FA 16 208 ILE 208 208 208 ILE ILE Q . n 
FA 16 209 ALA 209 209 209 ALA ALA Q . n 
FA 16 210 SER 210 210 210 SER SER Q . n 
FA 16 211 MET 211 211 211 MET MET Q . n 
FA 16 212 ALA 212 212 212 ALA ALA Q . n 
FA 16 213 GLU 213 213 213 GLU GLU Q . n 
FA 16 214 ALA 214 214 214 ALA ALA Q . n 
FA 16 215 ALA 215 215 215 ALA ALA Q . n 
FA 16 216 ARG 216 216 216 ARG ARG Q . n 
FA 16 217 THR 217 217 217 THR THR Q . n 
FA 16 218 PRO 218 218 218 PRO PRO Q . n 
FA 16 219 PHE 219 219 219 PHE PHE Q . n 
FA 16 220 ASP 220 220 220 ASP ASP Q . n 
FA 16 221 LEU 221 221 221 LEU LEU Q . n 
FA 16 222 PRO 222 222 222 PRO PRO Q . n 
FA 16 223 GLU 223 223 223 GLU GLU Q . n 
FA 16 224 ALA 224 224 224 ALA ALA Q . n 
FA 16 225 GLU 225 225 225 GLU GLU Q . n 
FA 16 226 GLN 226 226 226 GLN GLN Q . n 
FA 16 227 GLU 227 227 227 GLU GLU Q . n 
FA 16 228 LEU 228 228 228 LEU LEU Q . n 
FA 16 229 VAL 229 229 229 VAL VAL Q . n 
FA 16 230 GLY 230 230 230 GLY GLY Q . n 
FA 16 231 GLY 231 231 231 GLY GLY Q . n 
FA 16 232 TYR 232 232 232 TYR TYR Q . n 
FA 16 233 HIS 233 233 233 HIS HIS Q . n 
FA 16 234 THR 234 234 234 THR THR Q . n 
FA 16 235 GLU 235 235 235 GLU GLU Q . n 
FA 16 236 TYR 236 236 236 TYR TYR Q . n 
FA 16 237 SER 237 237 237 SER SER Q . n 
FA 16 238 SER 238 238 238 SER SER Q . n 
FA 16 239 ILE 239 239 239 ILE ILE Q . n 
FA 16 240 LYS 240 240 240 LYS LYS Q . n 
FA 16 241 TRP 241 241 241 TRP TRP Q . n 
FA 16 242 ALA 242 242 242 ALA ALA Q . n 
FA 16 243 LEU 243 243 243 LEU LEU Q . n 
FA 16 244 PHE 244 244 244 PHE PHE Q . n 
FA 16 245 GLN 245 245 245 GLN GLN Q . n 
FA 16 246 MET 246 246 246 MET MET Q . n 
FA 16 247 ALA 247 247 247 ALA ALA Q . n 
FA 16 248 GLU 248 248 248 GLU GLU Q . n 
FA 16 249 TYR 249 249 249 TYR TYR Q . n 
FA 16 250 ILE 250 250 250 ILE ILE Q . n 
FA 16 251 HIS 251 251 251 HIS HIS Q . n 
FA 16 252 PHE 252 252 252 PHE PHE Q . n 
FA 16 253 ILE 253 253 253 ILE ILE Q . n 
FA 16 254 THR 254 254 254 THR THR Q . n 
FA 16 255 ALA 255 255 255 ALA ALA Q . n 
FA 16 256 SER 256 256 256 SER SER Q . n 
FA 16 257 ALA 257 257 257 ALA ALA Q . n 
FA 16 258 LEU 258 258 258 LEU LEU Q . n 
FA 16 259 ILE 259 259 259 ILE ILE Q . n 
FA 16 260 PRO 260 260 260 PRO PRO Q . n 
FA 16 261 THR 261 261 261 THR THR Q . n 
FA 16 262 LEU 262 262 262 LEU LEU Q . n 
FA 16 263 PHE 263 263 263 PHE PHE Q . n 
FA 16 264 LEU 264 264 264 LEU LEU Q . n 
FA 16 265 GLY 265 265 265 GLY GLY Q . n 
FA 16 266 GLY 266 266 266 GLY GLY Q . n 
FA 16 267 TRP 267 267 267 TRP TRP Q . n 
FA 16 268 THR 268 268 268 THR THR Q . n 
FA 16 269 MET 269 269 269 MET MET Q . n 
FA 16 270 PRO 270 270 270 PRO PRO Q . n 
FA 16 271 VAL 271 271 271 VAL VAL Q . n 
FA 16 272 LEU 272 272 272 LEU LEU Q . n 
FA 16 273 GLU 273 273 273 GLU GLU Q . n 
FA 16 274 VAL 274 274 274 VAL VAL Q . n 
FA 16 275 PRO 275 275 275 PRO PRO Q . n 
FA 16 276 TYR 276 276 276 TYR TYR Q . n 
FA 16 277 LEU 277 277 277 LEU LEU Q . n 
FA 16 278 TRP 278 278 278 TRP TRP Q . n 
FA 16 279 MET 279 279 279 MET MET Q . n 
FA 16 280 PHE 280 280 280 PHE PHE Q . n 
FA 16 281 LEU 281 281 281 LEU LEU Q . n 
FA 16 282 LYS 282 282 282 LYS LYS Q . n 
FA 16 283 ILE 283 283 283 ILE ILE Q . n 
FA 16 284 ALA 284 284 284 ALA ALA Q . n 
FA 16 285 PHE 285 285 285 PHE PHE Q . n 
FA 16 286 PHE 286 286 286 PHE PHE Q . n 
FA 16 287 LEU 287 287 287 LEU LEU Q . n 
FA 16 288 PHE 288 288 288 PHE PHE Q . n 
FA 16 289 PHE 289 289 289 PHE PHE Q . n 
FA 16 290 PHE 290 290 290 PHE PHE Q . n 
FA 16 291 ILE 291 291 291 ILE ILE Q . n 
FA 16 292 TRP 292 292 292 TRP TRP Q . n 
FA 16 293 ILE 293 293 293 ILE ILE Q . n 
FA 16 294 ARG 294 294 294 ARG ARG Q . n 
FA 16 295 ALA 295 295 295 ALA ALA Q . n 
FA 16 296 THR 296 296 296 THR THR Q . n 
FA 16 297 TRP 297 297 297 TRP TRP Q . n 
FA 16 298 PHE 298 298 298 PHE PHE Q . n 
FA 16 299 ARG 299 299 299 ARG ARG Q . n 
FA 16 300 LEU 300 300 300 LEU LEU Q . n 
FA 16 301 ARG 301 301 301 ARG ARG Q . n 
FA 16 302 TYR 302 302 302 TYR TYR Q . n 
FA 16 303 ASP 303 303 303 ASP ASP Q . n 
FA 16 304 GLN 304 304 304 GLN GLN Q . n 
FA 16 305 LEU 305 305 305 LEU LEU Q . n 
FA 16 306 LEU 306 306 306 LEU LEU Q . n 
FA 16 307 ARG 307 307 307 ARG ARG Q . n 
FA 16 308 PHE 308 308 308 PHE PHE Q . n 
FA 16 309 GLY 309 309 309 GLY GLY Q . n 
FA 16 310 TRP 310 310 310 TRP TRP Q . n 
FA 16 311 GLY 311 311 311 GLY GLY Q . n 
FA 16 312 PHE 312 312 312 PHE PHE Q . n 
FA 16 313 LEU 313 313 313 LEU LEU Q . n 
FA 16 314 PHE 314 314 314 PHE PHE Q . n 
FA 16 315 PRO 315 315 315 PRO PRO Q . n 
FA 16 316 LEU 316 316 316 LEU LEU Q . n 
FA 16 317 ALA 317 317 317 ALA ALA Q . n 
FA 16 318 LEU 318 318 318 LEU LEU Q . n 
FA 16 319 LEU 319 319 319 LEU LEU Q . n 
FA 16 320 TRP 320 320 320 TRP TRP Q . n 
FA 16 321 PHE 321 321 321 PHE PHE Q . n 
FA 16 322 LEU 322 322 322 LEU LEU Q . n 
FA 16 323 VAL 323 323 323 VAL VAL Q . n 
FA 16 324 THR 324 324 324 THR THR Q . n 
FA 16 325 ALA 325 325 325 ALA ALA Q . n 
FA 16 326 LEU 326 326 326 LEU LEU Q . n 
FA 16 327 VAL 327 327 327 VAL VAL Q . n 
FA 16 328 VAL 328 328 328 VAL VAL Q . n 
FA 16 329 ALA 329 329 329 ALA ALA Q . n 
FA 16 330 LEU 330 330 330 LEU LEU Q . n 
FA 16 331 ASP 331 331 331 ASP ASP Q . n 
FA 16 332 LEU 332 332 332 LEU LEU Q . n 
FA 16 333 PRO 333 333 333 PRO PRO Q . n 
FA 16 334 ARG 334 334 334 ARG ARG Q . n 
FA 16 335 THR 335 335 335 THR THR Q . n 
FA 16 336 TYR 336 336 336 TYR TYR Q . n 
FA 16 337 LEU 337 337 337 LEU LEU Q . n 
FA 16 338 LEU 338 338 338 LEU LEU Q . n 
FA 16 339 TYR 339 339 339 TYR TYR Q . n 
FA 16 340 LEU 340 340 340 LEU LEU Q . n 
FA 16 341 SER 341 341 341 SER SER Q . n 
FA 16 342 ALA 342 342 342 ALA ALA Q . n 
FA 16 343 LEU 343 343 343 LEU LEU Q . n 
FA 16 344 SER 344 344 344 SER SER Q . n 
FA 16 345 PHE 345 345 345 PHE PHE Q . n 
FA 16 346 LEU 346 346 346 LEU LEU Q . n 
FA 16 347 VAL 347 347 347 VAL VAL Q . n 
FA 16 348 LEU 348 348 348 LEU LEU Q . n 
FA 16 349 LEU 349 349 349 LEU LEU Q . n 
FA 16 350 GLY 350 350 350 GLY GLY Q . n 
FA 16 351 ALA 351 351 351 ALA ALA Q . n 
FA 16 352 VAL 352 352 352 VAL VAL Q . n 
FA 16 353 LEU 353 353 353 LEU LEU Q . n 
FA 16 354 TYR 354 354 354 TYR TYR Q . n 
FA 16 355 THR 355 355 ?   ?   ?   Q . n 
FA 16 356 PRO 356 356 ?   ?   ?   Q . n 
FA 16 357 LYS 357 357 ?   ?   ?   Q . n 
FA 16 358 PRO 358 358 ?   ?   ?   Q . n 
FA 16 359 ALA 359 359 ?   ?   ?   Q . n 
FA 16 360 ARG 360 360 ?   ?   ?   Q . n 
FA 16 361 LYS 361 361 ?   ?   ?   Q . n 
FA 16 362 GLY 362 362 ?   ?   ?   Q . n 
FA 16 363 GLY 363 363 ?   ?   ?   Q . n 
FA 16 364 GLY 364 364 ?   ?   ?   Q . n 
FA 16 365 ALA 365 365 ?   ?   ?   Q . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
GA 17 SF4 1 501 501 SF4 SF4 1 . 
HA 18 FMN 1 502 502 FMN FMN 1 . 
IA 19 FES 1 201 201 FES FES 2 . 
JA 17 SF4 1 801 801 SF4 SF4 3 . 
KA 17 SF4 1 802 802 SF4 SF4 3 . 
LA 17 SF4 1 803 803 SF4 SF4 3 . 
MA 19 FES 1 804 804 FES FES 3 . 
NA 17 SF4 1 201 201 SF4 SF4 6 . 
OA 17 SF4 1 201 201 SF4 SF4 9 . 
PA 17 SF4 1 202 202 SF4 SF4 9 . 
QA 17 SF4 1 501 501 SF4 SF4 B . 
RA 18 FMN 1 502 502 FMN FMN B . 
SA 19 FES 1 201 201 FES FES C . 
TA 17 SF4 1 801 801 SF4 SF4 D . 
UA 17 SF4 1 802 802 SF4 SF4 D . 
VA 17 SF4 1 803 803 SF4 SF4 D . 
WA 19 FES 1 804 804 FES FES D . 
XA 17 SF4 1 201 201 SF4 SF4 G . 
YA 17 SF4 1 201 201 SF4 SF4 O . 
ZA 17 SF4 1 202 202 SF4 SF4 O . 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.12_2829 1 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25      2 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .         3 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? XSCALE      ? ? ? .         4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .         5 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   100.570 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6Y11 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     96.280 
_cell.length_a_esd                 ? 
_cell.length_b                     340.890 
_cell.length_b_esd                 ? 
_cell.length_c                     263.300 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6Y11 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6Y11 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.95 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         68.90 
_exptl_crystal.description                 'Data was merged from eleven isomorphous crystals.' 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
'100 mM Bis-Tris pH 6.0, 26% (w/v) polyethylene glycol (PEG) 4000, 100 mM KCl, 100 mM glutaric acid pH 6.0 and 0.6% DDM' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M-F' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-08-02 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6Y11 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.10 
_reflns.d_resolution_low                 58.67 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       300514 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  21.2 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            6.7 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.998 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.10 
_reflns_shell.d_res_low                   3.15 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         0.5 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           14755 
_reflns_shell.percent_possible_all        100 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             15 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.306 
_reflns_shell.pdbx_CC_star                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                397.980 
_refine.B_iso_mean                               100.9513 
_refine.B_iso_min                                11.000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  
'Model refined against data which was anisotropically truncated along a*, b* and c* to: 3.1, 3.4 and 3.1 angstrom, respectively.' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6Y11 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.1090 
_refine.ls_d_res_low                             58.6660 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     268255 
_refine.ls_number_reflns_R_free                  2770 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    90.0500 
_refine.ls_percent_reflns_R_free                 1.0300 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2110 
_refine.ls_R_factor_R_free                       0.2289 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2044 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4hea 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 22.6100 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       3.1090 
_refine_hist.d_res_low                        58.6660 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               74086 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       9550 
_refine_hist.pdbx_B_iso_mean_ligand           97.92 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        73896 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         190 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.007 ? 76190  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.881 ? 103910 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.051 ? 11640  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.007 ? 13100  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 6.774 ? 44628  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_asym_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.pdbx_weight 
_refine_ls_restr_ncs.pdbx_ens_id 
'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1  TORSIONAL ? N 3848 1.907 ? 1  
'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2  TORSIONAL ? V 3848 1.907 ? 1  
'X-RAY DIFFRACTION' 1 ? ? ? ? ? 3  TORSIONAL ? 1 4344 1.907 ? 2  
'X-RAY DIFFRACTION' 2 ? ? ? ? ? 4  TORSIONAL ? B 4344 1.907 ? 2  
'X-RAY DIFFRACTION' 1 ? ? ? ? ? 5  TORSIONAL ? M 4210 1.907 ? 3  
'X-RAY DIFFRACTION' 2 ? ? ? ? ? 6  TORSIONAL ? U 4210 1.907 ? 3  
'X-RAY DIFFRACTION' 1 ? ? ? ? ? 7  TORSIONAL ? L 5562 1.907 ? 4  
'X-RAY DIFFRACTION' 2 ? ? ? ? ? 8  TORSIONAL ? T 5562 1.907 ? 4  
'X-RAY DIFFRACTION' 1 ? ? ? ? ? 9  TORSIONAL ? 7 1292 1.907 ? 5  
'X-RAY DIFFRACTION' 2 ? ? ? ? ? 10 TORSIONAL ? I 1292 1.907 ? 5  
'X-RAY DIFFRACTION' 1 ? ? ? ? ? 11 TORSIONAL ? 6 1622 1.907 ? 6  
'X-RAY DIFFRACTION' 2 ? ? ? ? ? 12 TORSIONAL ? G 1622 1.907 ? 6  
'X-RAY DIFFRACTION' 1 ? ? ? ? ? 13 TORSIONAL ? 9 1768 1.907 ? 7  
'X-RAY DIFFRACTION' 2 ? ? ? ? ? 14 TORSIONAL ? O 1768 1.907 ? 7  
'X-RAY DIFFRACTION' 1 ? ? ? ? ? 15 TORSIONAL ? W 1244 1.907 ? 8  
'X-RAY DIFFRACTION' 2 ? ? ? ? ? 16 TORSIONAL ? X 1244 1.907 ? 8  
'X-RAY DIFFRACTION' 1 ? ? ? ? ? 17 TORSIONAL ? 5 1998 1.907 ? 9  
'X-RAY DIFFRACTION' 2 ? ? ? ? ? 18 TORSIONAL ? F 1998 1.907 ? 9  
'X-RAY DIFFRACTION' 1 ? ? ? ? ? 19 TORSIONAL ? 4 3852 1.907 ? 10 
'X-RAY DIFFRACTION' 2 ? ? ? ? ? 20 TORSIONAL ? E 3852 1.907 ? 10 
'X-RAY DIFFRACTION' 1 ? ? ? ? ? 21 TORSIONAL ? A 1088 1.907 ? 11 
'X-RAY DIFFRACTION' 2 ? ? ? ? ? 22 TORSIONAL ? P 1088 1.907 ? 11 
'X-RAY DIFFRACTION' 1 ? ? ? ? ? 23 TORSIONAL ? K 860  1.907 ? 12 
'X-RAY DIFFRACTION' 2 ? ? ? ? ? 24 TORSIONAL ? S 860  1.907 ? 12 
'X-RAY DIFFRACTION' 1 ? ? ? ? ? 25 TORSIONAL ? J 1426 1.907 ? 13 
'X-RAY DIFFRACTION' 2 ? ? ? ? ? 26 TORSIONAL ? R 1426 1.907 ? 13 
'X-RAY DIFFRACTION' 1 ? ? ? ? ? 27 TORSIONAL ? H 3328 1.907 ? 14 
'X-RAY DIFFRACTION' 2 ? ? ? ? ? 28 TORSIONAL ? Q 3328 1.907 ? 14 
'X-RAY DIFFRACTION' 1 ? ? ? ? ? 29 TORSIONAL ? 3 7502 1.907 ? 15 
'X-RAY DIFFRACTION' 2 ? ? ? ? ? 30 TORSIONAL ? D 7502 1.907 ? 15 
'X-RAY DIFFRACTION' 1 ? ? ? ? ? 31 TORSIONAL ? 2 1770 1.907 ? 16 
'X-RAY DIFFRACTION' 2 ? ? ? ? ? 32 TORSIONAL ? C 1770 1.907 ? 16 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.1116 3.1652  3374  . 30  3344  23.0000 . . . 0.3263 0.0000 0.3502 . . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 3.1652 3.2227  7088  . 72  7016  47.0000 . . . 0.3306 0.0000 0.3096 . . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 3.2227 3.2846  9490  . 86  9404  64.0000 . . . 0.3036 0.0000 0.2870 . . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 3.2846 3.3516  11622 . 144 11478 77.0000 . . . 0.3129 0.0000 0.2705 . . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 3.3516 3.4244  13584 . 117 13467 90.0000 . . . 0.3129 0.0000 0.2595 . . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 3.4244 3.5040  14719 . 155 14564 99.0000 . . . 0.2915 0.0000 0.2460 . . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 3.5040 3.5915  14831 . 160 14671 99.0000 . . . 0.2634 0.0000 0.2414 . . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 3.5915 3.6885  14898 . 145 14753 99.0000 . . . 0.2701 0.0000 0.2369 . . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 3.6885 3.7969  14766 . 162 14604 99.0000 . . . 0.2588 0.0000 0.2271 . . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 3.7969 3.9193  14863 . 149 14714 99.0000 . . . 0.2094 0.0000 0.2256 . . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 3.9193 4.0592  14880 . 151 14729 99.0000 . . . 0.2315 0.0000 0.2180 . . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 4.0592 4.2214  14835 . 148 14687 99.0000 . . . 0.2382 0.0000 0.2091 . . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 4.2214 4.4131  14825 . 156 14669 99.0000 . . . 0.2236 0.0000 0.2006 . . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 4.4131 4.6453  14843 . 155 14688 99.0000 . . . 0.2008 0.0000 0.1944 . . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 4.6453 4.9355  14827 . 164 14663 99.0000 . . . 0.2136 0.0000 0.1932 . . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 4.9355 5.3152  14913 . 169 14744 99.0000 . . . 0.2135 0.0000 0.1949 . . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 5.3152 5.8477  14865 . 154 14711 99.0000 . . . 0.2313 0.0000 0.2044 . . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 5.8477 6.6882  14855 . 153 14702 99.0000 . . . 0.2183 0.0000 0.1991 . . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 6.6882 8.4052  14927 . 125 14802 99.0000 . . . 0.2049 0.0000 0.1780 . . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 8.4052 33.9228 15036 . 164 14872 99.0000 . . . 0.2231 0.0000 0.1945 . . . . . . . 20 . . . 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1  1 'chain N' 
1  2 'chain V' 
2  1 'chain 1' 
2  2 'chain B' 
3  1 'chain M' 
3  2 'chain U' 
4  1 'chain L' 
4  2 'chain T' 
5  1 'chain 7' 
5  2 'chain I' 
6  1 'chain 6' 
6  2 'chain G' 
7  1 'chain 9' 
7  2 'chain O' 
8  1 'chain W' 
8  2 'chain X' 
9  1 'chain 5' 
9  2 'chain F' 
10 1 'chain 4' 
10 2 'chain E' 
11 1 'chain A' 
11 2 'chain P' 
12 1 'chain K' 
12 2 'chain S' 
13 1 'chain J' 
13 2 'chain R' 
14 1 'chain H' 
14 2 'chain Q' 
15 1 'chain 3' 
15 2 'chain D' 
16 1 'chain 2' 
16 2 'chain C' 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_comp_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_comp_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.selection_details 
1  1 1 O  MET 1  . O  GLY 427 . N MET 1  N GLY 427 ? 'chain N' 
1  2 1 EA MET 1  . EA GLY 427 . V MET 1  V GLY 427 ? 'chain V' 
2  1 1 A  THR 2  . A  ARG 438 . 1 THR 2  1 ARG 438 ? 'chain 1' 
2  2 1 Q  THR 2  . Q  ARG 438 . B THR 2  B ARG 438 ? 'chain B' 
3  1 1 N  MET 1  . N  GLY 467 . M MET 1  M GLY 467 ? 'chain M' 
3  2 1 DA MET 1  . DA GLY 467 . U MET 1  U GLY 467 ? 'chain U' 
4  1 1 M  MET 1  . M  ARG 605 . L MET 1  L ARG 605 ? 'chain L' 
4  2 1 CA MET 1  . CA ARG 605 . T MET 1  T ARG 605 ? 'chain T' 
5  1 1 H  ALA 3  . H  ALA 129 . 7 ALA 3  7 ALA 129 ? 'chain 7' 
5  2 1 X  ALA 3  . X  ALA 129 . I ALA 3  I ALA 129 ? 'chain I' 
6  1 1 F  ARG 16 . F  GLY 181 . 6 ARG 16 6 GLY 181 ? 'chain 6' 
6  2 1 V  ARG 16 . V  GLY 181 . G ARG 16 G GLY 181 ? 'chain G' 
7  1 1 G  THR 2  . G  LYS 181 . 9 THR 2  9 LYS 181 ? 'chain 9' 
7  2 1 W  THR 2  . W  LYS 181 . O THR 2  O LYS 181 ? 'chain O' 
8  1 1 I  MET 1  . I  LEU 127 . W MET 1  W LEU 127 ? 'chain W' 
8  2 1 Y  MET 1  . Y  LEU 127 . X MET 1  X LEU 127 ? 'chain X' 
9  1 1 E  MET 1  . E  TRP 196 . 5 MET 1  5 TRP 196 ? 'chain 5' 
9  2 1 U  MET 1  . U  TRP 196 . F MET 1  F TRP 196 ? 'chain F' 
10 1 1 D  MET 26 . D  ARG 409 . 4 MET 26 4 ARG 409 ? 'chain 4' 
10 2 1 T  MET 26 . T  ARG 409 . E MET 26 E ARG 409 ? 'chain E' 
11 1 1 J  MET 1  . J  ARG 117 . A MET 1  A ARG 117 ? 'chain A' 
11 2 1 Z  MET 1  . Z  ARG 117 . P MET 1  P ARG 117 ? 'chain P' 
12 1 1 L  MET 1  . L  GLY 95  . K MET 1  K GLY 95  ? 'chain K' 
12 2 1 BA MET 1  . BA GLY 95  . S MET 1  S GLY 95  ? 'chain S' 
13 1 1 K  MET 1  . K  GLY 160 . J MET 1  J GLY 160 ? 'chain J' 
13 2 1 AA MET 1  . AA GLY 160 . R MET 1  R GLY 160 ? 'chain R' 
14 1 1 P  THR 2  . P  TYR 354 . H THR 2  H TYR 354 ? 'chain H' 
14 2 1 FA THR 2  . FA TYR 354 . Q THR 2  Q TYR 354 ? 'chain Q' 
15 1 1 C  MET 1  . C  VAL 777 . 3 MET 1  3 VAL 777 ? 'chain 3' 
15 2 1 S  MET 1  . S  VAL 777 . D MET 1  D VAL 777 ? 'chain D' 
16 1 1 B  PHE 3  . B  GLU 180 . 2 PHE 3  2 GLU 180 ? 'chain 2' 
16 2 1 R  PHE 3  . R  GLU 180 . C PHE 3  C GLU 180 ? 'chain C' 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1  ? 
2  ? 
3  ? 
4  ? 
5  ? 
6  ? 
7  ? 
8  ? 
9  ? 
10 ? 
11 ? 
12 ? 
13 ? 
14 ? 
15 ? 
16 ? 
# 
_struct.entry_id                     6Y11 
_struct.title                        'Respiratory complex I from Thermus thermophilus' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6Y11 
_struct_keywords.text            
'Respiratory chain, complex I, NADH:ubiquinone oxidoreductase, electron transfer, proton translocation, MEMBRANE PROTEIN' 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 14 ? 
O  N N 15 ? 
P  N N 16 ? 
Q  N N 1  ? 
R  N N 2  ? 
S  N N 3  ? 
T  N N 4  ? 
U  N N 5  ? 
V  N N 6  ? 
W  N N 7  ? 
X  N N 8  ? 
Y  N N 9  ? 
Z  N N 10 ? 
AA N N 11 ? 
BA N N 12 ? 
CA N N 13 ? 
DA N N 14 ? 
EA N N 15 ? 
FA N N 16 ? 
GA N N 17 ? 
HA N N 18 ? 
IA N N 19 ? 
JA N N 17 ? 
KA N N 17 ? 
LA N N 17 ? 
MA N N 19 ? 
NA N N 17 ? 
OA N N 17 ? 
PA N N 17 ? 
QA N N 17 ? 
RA N N 18 ? 
SA N N 19 ? 
TA N N 17 ? 
UA N N 17 ? 
VA N N 17 ? 
WA N N 19 ? 
XA N N 17 ? 
YA N N 17 ? 
ZA N N 17 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1  UNP NQO1_THET8   Q56222 ? 1  
;MTGPILSGLDPRFERTLYAHVGKEGSWTLDYYLRHGGYETAKRVLKEKTPDEVIEEVKRSGLRGRGGAGFPTGLKWSFMP
KDDGKQHYLICNADESEPGSFKDRYILEDVPHLLIEGMILAGYAIRATVGYIYVRGEYRRAADRLEQAIKEARARGYLGK
NLFGTDFSFDLHVHRGAGAYICGEETALMNSLEGLRANPRLKPPFPAQSGLWGKPTTINNVETLASVVPIMERGADWFAQ
MGTEQSKGMKLYQISGPVKRPGVYELPMGTTFRELIYEWAGGPLEPIQAIIPGGSSTPPLPFTEEVLDTPMSYEHLQAKG
SMLGTGGVILIPERVSMVDAMWNLTRFYAHESCGKCTPCREGVAGFMVNLFAKIGTGQGEEKDVENLEALLPLIEGRSFC
PLADAAVWPVKGSLRHFKDQYLALAREKRPVPRPSLWR
;
1 
2  UNP NQO2_THET8   Q56221 ? 2  
;MGFFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHL
QVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAG
KRLEEIELPGKCGHHVHEVEV
;
1 
3  UNP NQO3_THET8   Q56223 ? 3  
;MVRVKVNDRIVEVPPGTSVMDAVFHAGYDVPLFCSEKHLSPIGACRMCLVRIGLPKKGPDGKPLLNEKGEPEIQWQPKLA
ASCVTAVADGMVVDTLSDVVREAQAGMVEFTLLNHPLDCPTCDKGGACELQDRTVEYGLYEKYYQKGPLELPVYTRFEFT
RRHVDKHHPLSPFVILDRERCIHCKRCVRYFEEVPGDEVLDFIERGVHTFIGTMDFGLPSGFSGNITDICPVGALLDLTA
RFRARNWEMEETPTTCALCPVGCGITADTRSGELLRIRAREVPEVNEIWICDAGRFGHEWADQNRLKTPLVRKEGRLVEA
TWEEAFLALKEGLKEARGEEVGLYLAHDATLEEGLLASELAKALKTPHLDFQGRTAAPASLFPPASLEDLLQADFALVLG
DPTEEAPILHLRLSEFVRDLKPPHRYNHGTPFADLQIKERMPRRTDKMALFAPYRAPLMKWAAIHEVHRPGEEREILLAL
LGDKEGSEMVAKAKEAWEKAKNPVLILGAGVLQDTVAAERARLLAERKGAKVLAMTPAANARGLEAMGVLPGAKGASWDE
PGALYAYYGFVPPEEALKGKRFVVMHLSHLHPLAERYAHVVLPAPTFYEKRGHLVNLEGRVLPLSPAPIENGEAEGALQV
LALLAEALGVRPPFRLHLEAQKALKARKVPEAMGRLSFRLKELRPKERKGAFYLRPTMWKAHQAVGKAQEAARAELWAHP
ETARAEALPEGAQVAVETPFGRVEARVVHREDVPKGHLYLSALGPAAGLRVEGRVLVPAGGEA
;
1 
4  UNP NQO4_THET8   Q56220 ? 4  
;MREEFLEEIPLDAPPEEAKELRTEVMTLNVGPQHPSTHGVLRLMVTLSGEEVLEVVPHIGYLHTGFEKTMEHRTYLQNIT
YTPRMDYLHSFAHDLAYALAVEKLLGAVVPPRAETIRVILNELSRLASHLVFLGTGLLDLGALTPFFYAFRERETILDLF
EWVTGQRFHHNYIRIGGVKEDLPEEFVPELKKLLEVLPHRIDEYEALFAESPIFYERARGVGVIPPEVAIDLGLTGGSLR
ASGVNYDVRKAYPYSGYETYTFDVPLGERGDVFDRMLVRIREMRESVKIIKQALERLEPGPVRDPNPQITPPPRHLLETS
MEAVIYHFKHYTEGFHPPKGEVYVPTESARGELGYYIVSDGGSMPYRVKVRAPSFVNLQSLPYACKGEQVPDMVAIIASL
DPVMGDVDR
;
1 
5  UNP NQO5_THET8   Q56219 ? 5  
;MRLERVLEEARAKGYPIEDNGLGNLWVVLPRERFKEEMAHYKAMGFNFLADIVGLDYLTYPDPRPERFAVVYELVSLPGW
KDGDGSRFFVRVYVPEEDPRLPTVTDLWGSANFLEREVYDLFGIVFEGHPDLRKILTPEDLEGHPLRKDYPLGETPTLFR
EGRYIIPAEFRAALTGKDPGLTFYKGGSRKGYRSLWADLKKAREVKG
;
1 
6  UNP NQO6_THET8   Q56218 ? 6  
;MALKDLFERDVQELEREGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDARNDLARFGSEVFRASPRQADVMIV
AGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFNNYAIVQNVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVRG
QAYNERGERLPPVAAWKRTRG
;
1 
7  UNP NQO9_THET8   Q56224 ? 7  
;MTLKALAQSLGITLKYLFSKPVTVPYPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENP
VSAGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVDVVGTKPQRREAKRTGKPVKVG
YVVPYVRPELEGFKAPTEGGKR
;
1 
8  UNP NQO15_THET8  Q5SKZ7 ? 8  
;MSASSERELYEAWVELLSWMREYAQAKGVRFEKEADFPDFIYRMERPYDLPTTIMTASLSDGLGEPFLLADVSPRHAKLK
RIGLRLPRAHIHLHAHYEPGKGLVTGKIPLTKERFFALADRAREALAFA
;
1 
9  UNP Q5SI52_THET8 Q5SI52 ? 9  
;MVRVGMRAAPRVSLEALKAALGGLKLSEAKVYLITDWQDKRDQARYALLLHTGKKDLLVPDAFGPAFPGGEEALSELVGL
LLAQGARRFYEAVVSPGEMTALLDLPPEELLKRVMAIANPTDPGIYLKRAA
;
1 
10 UNP NQO7_THET8   Q56217 ? 10 
;MAPIQEYVGTLIYVGVALFIGVAALLVGALLGPKKPGRAKLMPYESGNDPAGEVKRFPVHFYVVAMLFILFDVEVAFLWP
YAVSAGGLGLYGFLGVLAFTLLLFVGFLYEWWKGVMRWH
;
1 
11 UNP NQO10_THET8  Q56225 ? 11 
;MSLLEGLALFLLLLSGVLVVTLRNAIHAALALILNFLVLAGVYVALDARFLGFIQVIVYAGAIVVLFLFVIMLLFAAQGE
IGFDPLVRSRPLAALLALGVAGILAAGLWGLDLAFTQDLKGGLPQALGPLLYGDWLFVLLAVGFLLMAATVVAVALVEPG
KASRAKEAEKREEVAR
;
1 
12 UNP NQO11_THET8  Q56226 ? 12 
;MSYLLTSALLFALGVYGVLTRRTAILVFLSIELMLNAANLSLVGFARAYGLDGQVAALMVIAVAAAEVAVGLGLIVAIFR
HRESTAVDDLSELRG
;
1 
13 UNP NQO12_THET8  Q56227 ? 13 
;MALLGTILLPLLGFALLGLFGKRMREPLPGVLASGLVLASFLLGAGLLLSGGARFQAEWLPGIPFSLLLDNLSGFMLLIV
TGVGFLIHVYAIGYMGGDPGYSRFFAYFNLFIAMMLTLVLADSYPVMFIGWEGVGLASFLLIGFWYKNPQYADSARKAFI
VNRIGDLGFMLGMAILWALYGTLSISELKEAMEGPLKNPDLLALAGLLLFLGAVGKSAQIPLMVWLPDAMAGPTPVSALI
HAATMVTAGVYLIARSSFLYSVLPDVSYAIAVVGLLTAAYGALSAFGQTDIKKIVAYSTISQLGYMFLAAGVGAYWVALF
HVFTHAFFKALLFLASGSVIHALGGEQDVRKMGGLWKHLPQTRWHALIGALALGGLPLLSGFWSKDAILAATLTYPFGGV
GFYVGALLVAVLTAMYAMRWFVLVFLGEERGHHHPHEAPPVMLWPNHLLALGSVLAGYLALPHPLPNVLEPFLKPALAEV
EAHHLSLGAEWGLIALSAAVALLGLWAGFVFFQRKVFPAWYLAFEAASREAFYVDRAYNALIVNPLKALAEALFYGDRGL
LSGYFGLGGAARSLGQGLARLQTGYLRVYALLFVLGALLLLGVMRW
;
1 
14 UNP NQO13_THET8  Q56228 ? 14 
;MVVLAVLLPVVFGALLLLGLPRALGVLGAGLSFLLNLYLFLTHPGGVAHAFQAPLLPGAGVYWAFGLDGLSALFFLTIAL
TVFLGALVARVEGRFLGLALLMEGLLLGLFAARDLLVFYVFFEAALIPALLMLYLYGGEGRTRALYTFVLFTLVGSLPML
AAVLGARLLSGSPTFLLEDLLAHPLQEEAAFWVFLGFALAFAIKTPLFPLHAWLPPFHQENHPSGLADALGTLYKVGVFA
FFRFAIPLAPEGFAQAQGLLLFLAALSALYGAWVAFAAKDFKTLLAYAGLSHMGVAALGVFSGTPEGAMGGLYLLAASGV
YTGGLFLLAGRLYERTGTLEIGRYRGLAQSAPGLAALALILFLAMVGLPGLSGFPGEFLTLLGAYKASPWLAALAFLSVI
ASAAYALTAFQKTFWEEGGSGVKDLAGAEWGFALLSVLALLLMGVFPGYFARGLHPLAEAFAKLLGGGA
;
1 
15 UNP NQO14_THET8  Q56229 ? 15 
;MTLAILAVFSVALTLLGFVLPPQGVKRATLLGLALALASLLLTWGKPFAFGPYAVDGVSQVFTLLALLGALWTVGLVRSG
RFEFYLLVLYAALGMHLLASTRHLLLMLVALEALSLPLYALATWRRGQGLEAALKYFLLGALAAAFFLYGAALFYGATGS
LVLGAPGEGPLYALALGLLLVGLGFKAALAPFHFWTPDVYQGSPTPVVLFMATSVKAAAFAALLRVAAPPEALALLVALS
VVVGNLAALAQKEAKRLLAYSSIAHAGYMALALYTGNAQALGFYLLTYVLATGLAFAVLSQISPDRVPLEALRGLYRKDP
LLGLAFLVAMLSLLGLPPLAGFWGKYLAFAEAARAGAWGVLVLALVTSAVSAYYYLGLGLAVFARPEETPFRPGPPWARA
AVVAAGVLLLALGLLPGLVLPALAAGG
;
1 
16 UNP NQO8_THET8   Q60019 ? 16 
;MTWSYPVDPYWMVALKALLVVVGLLTAFAFMTLIERRLLARFQVRMGPNRVGPFGLLQPLADAIKSIFKEDIVVAQADRF
LFVLAPLISVVFALLAFGLIPFGPPGSFFGYQPWVINLDLGILYLFAVSELAVYGIFLSGWASGSKYSLLGSLRSSASLI
SYELGLGLALLAPVLLVGSLNLNDIVNWQKEHGWLFLYAFPAFLVYLIASMAEAARTPFDLPEAEQELVGGYHTEYSSIK
WALFQMAEYIHFITASALIPTLFLGGWTMPVLEVPYLWMFLKIAFFLFFFIWIRATWFRLRYDQLLRFGWGFLFPLALLW
FLVTALVVALDLPRTYLLYLSALSFLVLLGAVLYTPKPARKGGGA
;
1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  6Y11 1 1 ? 438 ? Q56222 1 ? 438 ? 1 438 
2  2  6Y11 2 1 ? 181 ? Q56221 1 ? 181 ? 1 181 
3  3  6Y11 3 1 ? 783 ? Q56223 1 ? 783 ? 1 783 
4  4  6Y11 4 1 ? 409 ? Q56220 1 ? 409 ? 1 409 
5  5  6Y11 5 1 ? 207 ? Q56219 1 ? 207 ? 1 207 
6  6  6Y11 6 1 ? 181 ? Q56218 1 ? 181 ? 1 181 
7  7  6Y11 9 1 ? 182 ? Q56224 1 ? 182 ? 1 182 
8  8  6Y11 7 1 ? 129 ? Q5SKZ7 1 ? 129 ? 1 129 
9  9  6Y11 W 1 ? 131 ? Q5SI52 1 ? 131 ? 1 131 
10 10 6Y11 A 1 ? 119 ? Q56217 1 ? 119 ? 1 119 
11 11 6Y11 J 1 ? 176 ? Q56225 1 ? 176 ? 1 176 
12 12 6Y11 K 1 ? 95  ? Q56226 1 ? 95  ? 1 95  
13 13 6Y11 L 1 ? 606 ? Q56227 1 ? 606 ? 1 606 
14 14 6Y11 M 1 ? 469 ? Q56228 1 ? 469 ? 1 469 
15 15 6Y11 N 1 ? 427 ? Q56229 1 ? 427 ? 1 427 
16 16 6Y11 H 1 ? 365 ? Q60019 1 ? 365 ? 1 365 
17 1  6Y11 B 1 ? 438 ? Q56222 1 ? 438 ? 1 438 
18 2  6Y11 C 1 ? 181 ? Q56221 1 ? 181 ? 1 181 
19 3  6Y11 D 1 ? 783 ? Q56223 1 ? 783 ? 1 783 
20 4  6Y11 E 1 ? 409 ? Q56220 1 ? 409 ? 1 409 
21 5  6Y11 F 1 ? 207 ? Q56219 1 ? 207 ? 1 207 
22 6  6Y11 G 1 ? 181 ? Q56218 1 ? 181 ? 1 181 
23 7  6Y11 O 1 ? 182 ? Q56224 1 ? 182 ? 1 182 
24 8  6Y11 I 1 ? 129 ? Q5SKZ7 1 ? 129 ? 1 129 
25 9  6Y11 X 1 ? 131 ? Q5SI52 1 ? 131 ? 1 131 
26 10 6Y11 P 1 ? 119 ? Q56217 1 ? 119 ? 1 119 
27 11 6Y11 R 1 ? 176 ? Q56225 1 ? 176 ? 1 176 
28 12 6Y11 S 1 ? 95  ? Q56226 1 ? 95  ? 1 95  
29 13 6Y11 T 1 ? 606 ? Q56227 1 ? 606 ? 1 606 
30 14 6Y11 U 1 ? 469 ? Q56228 1 ? 469 ? 1 469 
31 15 6Y11 V 1 ? 427 ? Q56229 1 ? 427 ? 1 427 
32 16 6Y11 Q 1 ? 365 ? Q60019 1 ? 365 ? 1 365 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? hexadecameric 16 
2 author_defined_assembly ? hexadecameric 16 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,GA,HA,IA,JA,KA,LA,MA,NA,OA,PA       
2 1 Q,R,S,T,U,V,W,X,Y,Z,AA,BA,CA,DA,EA,FA,QA,RA,SA,TA,UA,VA,WA,XA,YA,ZA 
# 
loop_
_pdbx_struct_assembly_auth_evidence.id 
_pdbx_struct_assembly_auth_evidence.assembly_id 
_pdbx_struct_assembly_auth_evidence.experimental_support 
_pdbx_struct_assembly_auth_evidence.details 
1 1 'mass spectrometry' ? 
2 2 'mass spectrometry' ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 THR A  28  ? HIS A  35  ? THR 1 28  HIS 1 35  1 ? 8  
HELX_P HELX_P2   AA2 TYR A  38  ? LYS A  48  ? TYR 1 38  LYS 1 48  1 ? 11 
HELX_P HELX_P3   AA3 THR A  49  ? GLY A  61  ? THR 1 49  GLY 1 61  1 ? 13 
HELX_P HELX_P4   AA4 PRO A  71  ? SER A  77  ? PRO 1 71  SER 1 77  1 ? 7  
HELX_P HELX_P5   AA5 PHE A  101 ? VAL A  110 ? PHE 1 101 VAL 1 110 1 ? 10 
HELX_P HELX_P6   AA6 VAL A  110 ? ILE A  125 ? VAL 1 110 ILE 1 125 1 ? 16 
HELX_P HELX_P7   AA7 TYR A  138 ? ARG A  155 ? TYR 1 138 ARG 1 155 1 ? 18 
HELX_P HELX_P8   AA8 ALA A  179 ? GLY A  183 ? ALA 1 179 GLY 1 183 5 ? 5  
HELX_P HELX_P9   AA9 GLU A  184 ? GLY A  194 ? GLU 1 184 GLY 1 194 1 ? 11 
HELX_P HELX_P10  AB1 GLY A  210 ? LYS A  214 ? GLY 1 210 LYS 1 214 5 ? 5  
HELX_P HELX_P11  AB2 VAL A  221 ? ARG A  233 ? VAL 1 221 ARG 1 233 1 ? 13 
HELX_P HELX_P12  AB3 ALA A  235 ? GLN A  240 ? ALA 1 235 GLN 1 240 1 ? 6  
HELX_P HELX_P13  AB4 THR A  271 ? GLU A  278 ? THR 1 271 GLU 1 278 1 ? 8  
HELX_P HELX_P14  AB5 THR A  303 ? ASP A  308 ? THR 1 303 ASP 1 308 1 ? 6  
HELX_P HELX_P15  AB6 LEU A  316 ? GLY A  320 ? LEU 1 316 GLY 1 320 5 ? 5  
HELX_P HELX_P16  AB7 SER A  336 ? GLU A  351 ? SER 1 336 GLU 1 351 1 ? 16 
HELX_P HELX_P17  AB8 CYS A  356 ? PHE A  366 ? CYS 1 356 PHE 1 366 1 ? 11 
HELX_P HELX_P18  AB9 PHE A  366 ? THR A  376 ? PHE 1 366 THR 1 376 1 ? 11 
HELX_P HELX_P19  AC1 GLU A  380 ? GLY A  396 ? GLU 1 380 GLY 1 396 1 ? 17 
HELX_P HELX_P20  AC2 PRO A  401 ? LYS A  428 ? PRO 1 401 LYS 1 428 1 ? 28 
HELX_P HELX_P21  AC3 LYS B  7   ? ALA B  16  ? LYS 2 7   ALA 2 16  1 ? 10 
HELX_P HELX_P22  AC4 GLY B  22  ? ALA B  25  ? GLY 2 22  ALA 2 25  5 ? 4  
HELX_P HELX_P23  AC5 ALA B  26  ? GLY B  39  ? ALA 2 26  GLY 2 39  1 ? 14 
HELX_P HELX_P24  AC6 ARG B  42  ? GLY B  54  ? ARG 2 42  GLY 2 54  1 ? 13 
HELX_P HELX_P25  AC7 THR B  56  ? SER B  65  ? THR 2 56  SER 2 65  1 ? 10 
HELX_P HELX_P26  AC8 THR B  85  ? ALA B  91  ? THR 2 85  ALA 2 91  1 ? 7  
HELX_P HELX_P27  AC9 GLY B  92  ? GLY B  105 ? GLY 2 92  GLY 2 105 1 ? 14 
HELX_P HELX_P28  AD1 THR B  146 ? ALA B  159 ? THR 2 146 ALA 2 159 1 ? 14 
HELX_P HELX_P29  AD2 ARG B  162 ? ILE B  166 ? ARG 2 162 ILE 2 166 5 ? 5  
HELX_P HELX_P30  AD3 SER C  18  ? ALA C  26  ? SER 3 18  ALA 3 26  1 ? 9  
HELX_P HELX_P31  AD4 SER C  97  ? LEU C  113 ? SER 3 97  LEU 3 113 1 ? 17 
HELX_P HELX_P32  AD5 CYS C  128 ? GLY C  138 ? CYS 3 128 GLY 3 138 1 ? 11 
HELX_P HELX_P33  AD6 LYS C  185 ? VAL C  194 ? LYS 3 185 VAL 3 194 1 ? 10 
HELX_P HELX_P34  AD7 ARG C  205 ? THR C  209 ? ARG 3 205 THR 3 209 5 ? 5  
HELX_P HELX_P35  AD8 GLY C  224 ? CYS C  230 ? GLY 3 224 CYS 3 230 1 ? 7  
HELX_P HELX_P36  AD9 THR C  239 ? ARG C  241 ? THR 3 239 ARG 3 241 5 ? 3  
HELX_P HELX_P37  AE1 CYS C  291 ? GLY C  297 ? CYS 3 291 GLY 3 297 1 ? 7  
HELX_P HELX_P38  AE2 THR C  321 ? GLU C  335 ? THR 3 321 GLU 3 335 1 ? 15 
HELX_P HELX_P39  AE3 THR C  350 ? LEU C  364 ? THR 3 350 LEU 3 364 1 ? 15 
HELX_P HELX_P40  AE4 PRO C  378 ? PHE C  382 ? PRO 3 378 PHE 3 382 5 ? 5  
HELX_P HELX_P41  AE5 SER C  386 ? ALA C  393 ? SER 3 386 ALA 3 393 1 ? 8  
HELX_P HELX_P42  AE6 ASP C  401 ? ALA C  406 ? ASP 3 401 ALA 3 406 1 ? 6  
HELX_P HELX_P43  AE7 ILE C  408 ? ARG C  418 ? ILE 3 408 ARG 3 418 1 ? 11 
HELX_P HELX_P44  AE8 ALA C  456 ? ALA C  462 ? ALA 3 456 ALA 3 462 5 ? 7  
HELX_P HELX_P45  AE9 GLU C  472 ? GLY C  482 ? GLU 3 472 GLY 3 482 1 ? 11 
HELX_P HELX_P46  AF1 SER C  487 ? ALA C  500 ? SER 3 487 ALA 3 500 1 ? 14 
HELX_P HELX_P47  AF2 GLY C  508 ? GLN C  513 ? GLY 3 508 GLN 3 513 1 ? 6  
HELX_P HELX_P48  AF3 ASP C  514 ? LYS C  528 ? ASP 3 514 LYS 3 528 1 ? 15 
HELX_P HELX_P49  AF4 ASN C  540 ? MET C  547 ? ASN 3 540 MET 3 547 1 ? 8  
HELX_P HELX_P50  AF5 PRO C  573 ? LYS C  578 ? PRO 3 573 LYS 3 578 1 ? 6  
HELX_P HELX_P51  AF6 LEU C  593 ? ALA C  598 ? LEU 3 593 ALA 3 598 1 ? 6  
HELX_P HELX_P52  AF7 THR C  606 ? LYS C  610 ? THR 3 606 LYS 3 610 5 ? 5  
HELX_P HELX_P53  AF8 GLY C  636 ? ALA C  647 ? GLY 3 636 ALA 3 647 1 ? 12 
HELX_P HELX_P54  AF9 LEU C  656 ? ARG C  667 ? LEU 3 656 ARG 3 667 1 ? 12 
HELX_P HELX_P55  AG1 LYS C  700 ? ALA C  704 ? LYS 3 700 ALA 3 704 5 ? 5  
HELX_P HELX_P56  AG2 VAL C  705 ? GLN C  709 ? VAL 3 705 GLN 3 709 5 ? 5  
HELX_P HELX_P57  AG3 HIS C  719 ? ALA C  727 ? HIS 3 719 ALA 3 727 1 ? 9  
HELX_P HELX_P58  AG4 GLY D  65  ? MET D  70  ? GLY 4 65  MET 4 70  1 ? 6  
HELX_P HELX_P59  AG5 GLU D  71  ? ARG D  73  ? GLU 4 71  ARG 4 73  5 ? 3  
HELX_P HELX_P60  AG6 THR D  74  ? ILE D  79  ? THR 4 74  ILE 4 79  1 ? 6  
HELX_P HELX_P61  AG7 HIS D  89  ? GLY D  106 ? HIS 4 89  GLY 4 106 1 ? 18 
HELX_P HELX_P62  AG8 PRO D  110 ? LEU D  140 ? PRO 4 110 LEU 4 140 1 ? 31 
HELX_P HELX_P63  AG9 PRO D  145 ? GLY D  165 ? PRO 4 145 GLY 4 165 1 ? 21 
HELX_P HELX_P64  AH1 GLU D  185 ? ALA D  209 ? GLU 4 185 ALA 4 209 1 ? 25 
HELX_P HELX_P65  AH2 ILE D  213 ? ARG D  219 ? ILE 4 213 ARG 4 219 1 ? 7  
HELX_P HELX_P66  AH3 PRO D  225 ? LEU D  232 ? PRO 4 225 LEU 4 232 1 ? 8  
HELX_P HELX_P67  AH4 LEU D  239 ? GLY D  243 ? LEU 4 239 GLY 4 243 5 ? 5  
HELX_P HELX_P68  AH5 ASP D  247 ? TYR D  252 ? ASP 4 247 TYR 4 252 1 ? 6  
HELX_P HELX_P69  AH6 GLY D  256 ? TYR D  260 ? GLY 4 256 TYR 4 260 5 ? 5  
HELX_P HELX_P70  AH7 ASP D  271 ? ARG D  296 ? ASP 4 271 ARG 4 296 1 ? 26 
HELX_P HELX_P71  AH8 HIS D  315 ? THR D  319 ? HIS 4 315 THR 4 319 5 ? 5  
HELX_P HELX_P72  AH9 SER D  320 ? GLU D  333 ? SER 4 320 GLU 4 333 1 ? 14 
HELX_P HELX_P73  AI1 ALA D  372 ? ASN D  377 ? ALA 4 372 ASN 4 377 1 ? 6  
HELX_P HELX_P74  AI2 SER D  380 ? CYS D  385 ? SER 4 380 CYS 4 385 1 ? 6  
HELX_P HELX_P75  AI3 GLN D  389 ? LEU D  400 ? GLN 4 389 LEU 4 400 1 ? 12 
HELX_P HELX_P76  AI4 VAL D  403 ? ASP D  408 ? VAL 4 403 ASP 4 408 1 ? 6  
HELX_P HELX_P77  AI5 ARG E  2   ? LYS E  13  ? ARG 5 2   LYS 5 13  1 ? 12 
HELX_P HELX_P78  AI6 PRO E  30  ? MET E  44  ? PRO 5 30  MET 5 44  1 ? 15 
HELX_P HELX_P79  AI7 SER E  110 ? PHE E  122 ? SER 5 110 PHE 5 122 1 ? 13 
HELX_P HELX_P80  AI8 ILE E  166 ? ARG E  171 ? ILE 5 166 ARG 5 171 1 ? 6  
HELX_P HELX_P81  AI9 GLY E  186 ? GLY E  191 ? GLY 5 186 GLY 5 191 5 ? 6  
HELX_P HELX_P82  AJ1 PHE F  21  ? SER F  35  ? PHE 6 21  SER 6 35  1 ? 15 
HELX_P HELX_P83  AJ2 ALA F  44  ? ALA F  52  ? ALA 6 44  ALA 6 52  1 ? 9  
HELX_P HELX_P84  AJ3 SER F  53  ? ASP F  55  ? SER 6 53  ASP 6 55  5 ? 3  
HELX_P HELX_P85  AJ4 SER F  71  ? ALA F  75  ? SER 6 71  ALA 6 75  5 ? 5  
HELX_P HELX_P86  AJ5 MET F  88  ? GLN F  98  ? MET 6 88  GLN 6 98  1 ? 11 
HELX_P HELX_P87  AJ6 GLY F  109 ? SER F  114 ? GLY 6 109 SER 6 114 1 ? 6  
HELX_P HELX_P88  AJ7 ASN F  126 ? VAL F  130 ? ASN 6 126 VAL 6 130 5 ? 5  
HELX_P HELX_P89  AJ8 ARG F  143 ? ARG F  159 ? ARG 6 143 ARG 6 159 1 ? 17 
HELX_P HELX_P90  AJ9 LEU G  3   ? SER G  19  ? LEU 9 3   SER 9 19  1 ? 17 
HELX_P HELX_P91  AK1 SER G  57  ? ALA G  62  ? SER 9 57  ALA 9 62  1 ? 6  
HELX_P HELX_P92  AK2 GLY G  102 ? CYS G  108 ? GLY 9 102 CYS 9 108 1 ? 7  
HELX_P HELX_P93  AK3 GLU G  125 ? ASP G  128 ? GLU 9 125 ASP 9 128 5 ? 4  
HELX_P HELX_P94  AK4 GLY G  132 ? MET G  136 ? GLY 9 132 MET 9 136 5 ? 5  
HELX_P HELX_P95  AK5 THR G  143 ? GLY G  154 ? THR 9 143 GLY 9 154 1 ? 12 
HELX_P HELX_P96  AK6 ARG G  167 ? GLU G  171 ? ARG 9 167 GLU 9 171 5 ? 5  
HELX_P HELX_P97  AK7 SER H  4   ? GLY H  28  ? SER 7 4   GLY 7 28  1 ? 25 
HELX_P HELX_P98  AK8 PHE H  37  ? TYR H  42  ? PHE 7 37  TYR 7 42  1 ? 6  
HELX_P HELX_P99  AK9 THR H  111 ? ALA H  127 ? THR 7 111 ALA 7 127 1 ? 17 
HELX_P HELX_P100 AL1 ALA I  9   ? GLY I  22  ? ALA W 9   GLY W 22  1 ? 14 
HELX_P HELX_P101 AL2 GLY I  69  ? GLN I  84  ? GLY W 69  GLN W 84  1 ? 16 
HELX_P HELX_P102 AL3 SER I  95  ? LEU I  103 ? SER W 95  LEU W 103 1 ? 9  
HELX_P HELX_P103 AL4 PRO I  106 ? ALA I  118 ? PRO W 106 ALA W 118 1 ? 13 
HELX_P HELX_P104 AL5 ASP I  122 ? LEU I  127 ? ASP W 122 LEU W 127 5 ? 6  
HELX_P HELX_P105 AL6 PRO J  3   ? LEU J  31  ? PRO A 3   LEU A 31  1 ? 29 
HELX_P HELX_P106 AL7 GLY J  37  ? MET J  42  ? GLY A 37  MET A 42  1 ? 6  
HELX_P HELX_P107 AL8 VAL J  59  ? SER J  84  ? VAL A 59  SER A 84  1 ? 26 
HELX_P HELX_P108 AL9 LEU J  88  ? GLY J  114 ? LEU A 88  GLY A 114 1 ? 27 
HELX_P HELX_P109 AM1 SER K  2   ? LEU K  22  ? SER J 2   LEU J 22  1 ? 21 
HELX_P HELX_P110 AM2 ASN K  24  ? LEU K  46  ? ASN J 24  LEU J 46  1 ? 23 
HELX_P HELX_P111 AM3 ARG K  49  ? VAL K  58  ? ARG J 49  VAL J 58  1 ? 10 
HELX_P HELX_P112 AM4 ALA K  62  ? LEU K  74  ? ALA J 62  LEU J 74  1 ? 13 
HELX_P HELX_P113 AM5 ARG K  88  ? TRP K  109 ? ARG J 88  TRP J 109 1 ? 22 
HELX_P HELX_P114 AM6 LEU K  123 ? TYR K  132 ? LEU J 123 TYR J 132 1 ? 10 
HELX_P HELX_P115 AM7 TRP K  135 ? GLU K  158 ? TRP J 135 GLU J 158 1 ? 24 
HELX_P HELX_P116 AM8 SER L  2   ? ARG L  21  ? SER K 2   ARG K 21  1 ? 20 
HELX_P HELX_P117 AM9 THR L  23  ? GLY L  50  ? THR K 23  GLY K 50  1 ? 28 
HELX_P HELX_P118 AN1 LEU L  51  ? PHE L  79  ? LEU K 51  PHE K 79  1 ? 29 
HELX_P HELX_P119 AN2 ALA L  86  ? LEU L  90  ? ALA K 86  LEU K 90  5 ? 5  
HELX_P HELX_P120 AN3 ALA M  2   ? PHE M  20  ? ALA L 2   PHE L 20  1 ? 19 
HELX_P HELX_P121 AN4 PRO M  27  ? SER M  50  ? PRO L 27  SER L 50  1 ? 24 
HELX_P HELX_P122 AN5 ASP M  70  ? MET M  95  ? ASP L 70  MET L 95  1 ? 26 
HELX_P HELX_P123 AN6 GLY M  100 ? LEU M  120 ? GLY L 100 LEU L 120 1 ? 21 
HELX_P HELX_P124 AN7 SER M  123 ? GLY M  143 ? SER L 123 GLY L 143 1 ? 21 
HELX_P HELX_P125 AN8 PRO M  149 ? LEU M  179 ? PRO L 149 LEU L 179 1 ? 31 
HELX_P HELX_P126 AN9 SER M  184 ? GLU M  193 ? SER L 184 GLU L 193 1 ? 10 
HELX_P HELX_P127 AO1 ASN M  198 ? SER M  217 ? ASN L 198 SER L 217 1 ? 20 
HELX_P HELX_P128 AO2 PRO M  221 ? GLY M  232 ? PRO L 221 GLY L 232 5 ? 12 
HELX_P HELX_P129 AO3 PRO M  233 ? ALA M  242 ? PRO L 233 ALA L 242 1 ? 10 
HELX_P HELX_P130 AO4 VAL M  246 ? SER M  256 ? VAL L 246 SER L 256 1 ? 11 
HELX_P HELX_P131 AO5 SER M  256 ? VAL M  262 ? SER L 256 VAL L 262 1 ? 7  
HELX_P HELX_P132 AO6 LEU M  263 ? GLY M  287 ? LEU L 263 GLY L 287 1 ? 25 
HELX_P HELX_P133 AO7 ASP M  290 ? VAL M  312 ? ASP L 290 VAL L 312 1 ? 23 
HELX_P HELX_P134 AO8 ALA M  314 ? LEU M  343 ? ALA L 314 LEU L 343 1 ? 30 
HELX_P HELX_P135 AO9 GLN M  361 ? GLY M  375 ? GLN L 361 GLY L 375 1 ? 15 
HELX_P HELX_P136 AP1 LEU M  379 ? TYR M  395 ? LEU L 379 TYR L 395 1 ? 17 
HELX_P HELX_P137 AP2 GLY M  399 ? LEU M  426 ? GLY L 399 LEU L 426 1 ? 28 
HELX_P HELX_P138 AP3 PRO M  439 ? ALA M  456 ? PRO L 439 ALA L 456 1 ? 18 
HELX_P HELX_P139 AP4 GLY M  457 ? ALA M  460 ? GLY L 457 ALA L 460 5 ? 4  
HELX_P HELX_P140 AP5 VAL M  468 ? LEU M  477 ? VAL L 468 LEU L 477 1 ? 10 
HELX_P HELX_P141 AP6 GLY M  488 ? LYS M  515 ? GLY L 488 LYS L 515 1 ? 28 
HELX_P HELX_P142 AP7 PRO M  518 ? GLU M  530 ? PRO L 518 GLU L 530 1 ? 13 
HELX_P HELX_P143 AP8 TYR M  533 ? ILE M  542 ? TYR L 533 ILE L 542 1 ? 10 
HELX_P HELX_P144 AP9 ILE M  542 ? LEU M  581 ? ILE L 542 LEU L 581 1 ? 40 
HELX_P HELX_P145 AQ1 TYR M  585 ? MET M  604 ? TYR L 585 MET L 604 1 ? 20 
HELX_P HELX_P146 AQ2 VAL N  2   ? LEU N  18  ? VAL M 2   LEU M 18  1 ? 17 
HELX_P HELX_P147 AQ3 PRO N  21  ? LEU N  41  ? PRO M 21  LEU M 41  1 ? 21 
HELX_P HELX_P148 AQ4 ASP N  68  ? VAL N  88  ? ASP M 68  VAL M 88  1 ? 21 
HELX_P HELX_P149 AQ5 PHE N  95  ? ALA N  112 ? PHE M 95  ALA M 112 1 ? 18 
HELX_P HELX_P150 AQ6 ASP N  114 ? ALA N  125 ? ASP M 114 ALA M 125 1 ? 12 
HELX_P HELX_P151 AQ7 ALA N  125 ? LEU N  135 ? ALA M 125 LEU M 135 1 ? 11 
HELX_P HELX_P152 AQ8 GLY N  140 ? LEU N  169 ? GLY M 140 LEU M 169 1 ? 30 
HELX_P HELX_P153 AQ9 LEU N  176 ? HIS N  183 ? LEU M 176 HIS M 183 1 ? 8  
HELX_P HELX_P154 AR1 ALA N  189 ? LYS N  204 ? ALA M 189 LYS M 204 1 ? 16 
HELX_P HELX_P155 AR2 LEU N  207 ? HIS N  211 ? LEU M 207 HIS M 211 5 ? 5  
HELX_P HELX_P156 AR3 TRP N  213 ? ASN N  221 ? TRP M 213 ASN M 221 1 ? 9  
HELX_P HELX_P157 AR4 GLY N  225 ? LEU N  233 ? GLY M 225 LEU M 233 1 ? 9  
HELX_P HELX_P158 AR5 VAL N  236 ? PHE N  244 ? VAL M 236 PHE M 244 1 ? 9  
HELX_P HELX_P159 AR6 PHE N  244 ? ALA N  249 ? PHE M 244 ALA M 249 1 ? 6  
HELX_P HELX_P160 AR7 ALA N  249 ? ALA N  278 ? ALA M 249 ALA M 278 1 ? 30 
HELX_P HELX_P161 AR8 ASP N  280 ? SER N  302 ? ASP M 280 SER M 302 1 ? 23 
HELX_P HELX_P162 AR9 THR N  304 ? GLY N  337 ? THR M 304 GLY M 337 1 ? 34 
HELX_P HELX_P163 AS1 GLY N  346 ? ALA N  351 ? GLY M 346 ALA M 351 1 ? 6  
HELX_P HELX_P164 AS2 GLY N  353 ? GLY N  367 ? GLY M 353 GLY M 367 1 ? 15 
HELX_P HELX_P165 AS3 SER N  372 ? SER N  388 ? SER M 372 SER M 388 1 ? 17 
HELX_P HELX_P166 AS4 SER N  388 ? PHE N  396 ? SER M 388 PHE M 396 1 ? 9  
HELX_P HELX_P167 AS5 SER N  398 ? TRP N  415 ? SER M 398 TRP M 415 1 ? 18 
HELX_P HELX_P168 AS6 ALA N  426 ? PHE N  446 ? ALA M 426 PHE M 446 1 ? 21 
HELX_P HELX_P169 AS7 GLY N  453 ? LEU N  464 ? GLY M 453 LEU M 464 1 ? 12 
HELX_P HELX_P170 AS8 THR O  2   ? GLY O  17  ? THR N 2   GLY N 17  1 ? 16 
HELX_P HELX_P171 AS9 PRO O  21  ? THR O  43  ? PRO N 21  THR N 43  1 ? 23 
HELX_P HELX_P172 AT1 ASP O  56  ? VAL O  77  ? ASP N 56  VAL N 77  1 ? 22 
HELX_P HELX_P173 AT2 PHE O  82  ? SER O  100 ? PHE N 82  SER N 100 1 ? 19 
HELX_P HELX_P174 AT3 HIS O  103 ? ALA O  122 ? HIS N 103 ALA N 122 1 ? 20 
HELX_P HELX_P175 AT4 ARG O  126 ? THR O  158 ? ARG N 126 THR N 158 1 ? 33 
HELX_P HELX_P176 AT5 GLY O  169 ? ALA O  187 ? GLY N 169 ALA N 187 1 ? 19 
HELX_P HELX_P177 AT6 PHE O  194 ? SER O  203 ? PHE N 194 SER N 203 1 ? 10 
HELX_P HELX_P178 AT7 PRO O  204 ? LEU O  224 ? PRO N 204 LEU N 224 1 ? 21 
HELX_P HELX_P179 AT8 PRO O  229 ? ALA O  250 ? PRO N 229 ALA N 250 1 ? 22 
HELX_P HELX_P180 AT9 GLU O  253 ? ALA O  270 ? GLU N 253 ALA N 270 1 ? 18 
HELX_P HELX_P181 AU1 ALA O  278 ? SER O  303 ? ALA N 278 SER N 303 1 ? 26 
HELX_P HELX_P182 AU2 LEU O  309 ? ARG O  313 ? LEU N 309 ARG N 313 5 ? 5  
HELX_P HELX_P183 AU3 GLY O  314 ? ASP O  319 ? GLY N 314 ASP N 319 1 ? 6  
HELX_P HELX_P184 AU4 ASP O  319 ? GLY O  335 ? ASP N 319 GLY N 335 1 ? 17 
HELX_P HELX_P185 AU5 LEU O  339 ? GLY O  356 ? LEU N 339 GLY N 356 1 ? 18 
HELX_P HELX_P186 AU6 TRP O  358 ? LEU O  380 ? TRP N 358 LEU N 380 1 ? 23 
HELX_P HELX_P187 AU7 ALA O  381 ? ALA O  384 ? ALA N 381 ALA N 384 5 ? 4  
HELX_P HELX_P188 AU8 PRO O  395 ? LEU O  415 ? PRO N 395 LEU N 415 1 ? 21 
HELX_P HELX_P189 AU9 VAL O  419 ? ALA O  424 ? VAL N 419 ALA N 424 5 ? 6  
HELX_P HELX_P190 AV1 PRO P  9   ? GLN P  43  ? PRO H 9   GLN H 43  1 ? 35 
HELX_P HELX_P191 AV2 LEU P  57  ? ILE P  67  ? LEU H 57  ILE H 67  1 ? 11 
HELX_P HELX_P192 AV3 ASP P  78  ? LEU P  95  ? ASP H 78  LEU H 95  1 ? 18 
HELX_P HELX_P193 AV4 LEU P  120 ? SER P  143 ? LEU H 120 SER H 143 1 ? 24 
HELX_P HELX_P194 AV5 SER P  145 ? GLY P  178 ? SER H 145 GLY H 178 1 ? 34 
HELX_P HELX_P195 AV6 ASN P  181 ? HIS P  192 ? ASN H 181 HIS H 192 1 ? 12 
HELX_P HELX_P196 AV7 LEU P  195 ? GLU P  213 ? LEU H 195 GLU H 213 1 ? 19 
HELX_P HELX_P197 AV8 ILE P  239 ? PHE P  263 ? ILE H 239 PHE H 263 1 ? 25 
HELX_P HELX_P198 AV9 TYR P  276 ? TRP P  297 ? TYR H 276 TRP H 297 1 ? 22 
HELX_P HELX_P199 AW1 TYR P  302 ? PHE P  312 ? TYR H 302 PHE H 312 1 ? 11 
HELX_P HELX_P200 AW2 PHE P  312 ? ASP P  331 ? PHE H 312 ASP H 331 1 ? 20 
HELX_P HELX_P201 AW3 ARG P  334 ? ALA P  351 ? ARG H 334 ALA H 351 1 ? 18 
HELX_P HELX_P202 AW4 THR Q  28  ? HIS Q  35  ? THR B 28  HIS B 35  1 ? 8  
HELX_P HELX_P203 AW5 TYR Q  38  ? LYS Q  48  ? TYR B 38  LYS B 48  1 ? 11 
HELX_P HELX_P204 AW6 THR Q  49  ? GLY Q  61  ? THR B 49  GLY B 61  1 ? 13 
HELX_P HELX_P205 AW7 PRO Q  71  ? SER Q  77  ? PRO B 71  SER B 77  1 ? 7  
HELX_P HELX_P206 AW8 LYS Q  102 ? VAL Q  110 ? LYS B 102 VAL B 110 1 ? 9  
HELX_P HELX_P207 AW9 VAL Q  110 ? ARG Q  126 ? VAL B 110 ARG B 126 1 ? 17 
HELX_P HELX_P208 AX1 ARG Q  139 ? ARG Q  155 ? ARG B 139 ARG B 155 1 ? 17 
HELX_P HELX_P209 AX2 ALA Q  179 ? GLY Q  183 ? ALA B 179 GLY B 183 5 ? 5  
HELX_P HELX_P210 AX3 GLU Q  184 ? GLY Q  194 ? GLU B 184 GLY B 194 1 ? 11 
HELX_P HELX_P211 AX4 GLY Q  210 ? LYS Q  214 ? GLY B 210 LYS B 214 5 ? 5  
HELX_P HELX_P212 AX5 ASN Q  220 ? ARG Q  233 ? ASN B 220 ARG B 233 1 ? 14 
HELX_P HELX_P213 AX6 ALA Q  235 ? GLN Q  240 ? ALA B 235 GLN B 240 1 ? 6  
HELX_P HELX_P214 AX7 THR Q  271 ? GLU Q  278 ? THR B 271 GLU B 278 1 ? 8  
HELX_P HELX_P215 AX8 THR Q  303 ? ASP Q  308 ? THR B 303 ASP B 308 1 ? 6  
HELX_P HELX_P216 AX9 LEU Q  316 ? GLY Q  320 ? LEU B 316 GLY B 320 5 ? 5  
HELX_P HELX_P217 AY1 SER Q  336 ? SER Q  352 ? SER B 336 SER B 352 1 ? 17 
HELX_P HELX_P218 AY2 CYS Q  356 ? THR Q  376 ? CYS B 356 THR B 376 1 ? 21 
HELX_P HELX_P219 AY3 GLU Q  380 ? GLY Q  396 ? GLU B 380 GLY B 396 1 ? 17 
HELX_P HELX_P220 AY4 PRO Q  401 ? GLU Q  427 ? PRO B 401 GLU B 427 1 ? 27 
HELX_P HELX_P221 AY5 LYS R  7   ? ALA R  16  ? LYS C 7   ALA C 16  1 ? 10 
HELX_P HELX_P222 AY6 GLY R  22  ? ALA R  25  ? GLY C 22  ALA C 25  5 ? 4  
HELX_P HELX_P223 AY7 ALA R  26  ? GLY R  39  ? ALA C 26  GLY C 39  1 ? 14 
HELX_P HELX_P224 AY8 ARG R  42  ? GLY R  54  ? ARG C 42  GLY C 54  1 ? 13 
HELX_P HELX_P225 AY9 THR R  56  ? SER R  65  ? THR C 56  SER C 65  1 ? 10 
HELX_P HELX_P226 AZ1 THR R  85  ? ALA R  91  ? THR C 85  ALA C 91  1 ? 7  
HELX_P HELX_P227 AZ2 GLY R  92  ? GLY R  105 ? GLY C 92  GLY C 105 1 ? 14 
HELX_P HELX_P228 AZ3 THR R  146 ? ALA R  159 ? THR C 146 ALA C 159 1 ? 14 
HELX_P HELX_P229 AZ4 ARG R  162 ? ILE R  166 ? ARG C 162 ILE C 166 5 ? 5  
HELX_P HELX_P230 AZ5 SER S  18  ? ALA S  26  ? SER D 18  ALA D 26  1 ? 9  
HELX_P HELX_P231 AZ6 SER S  97  ? LEU S  113 ? SER D 97  LEU D 113 1 ? 17 
HELX_P HELX_P232 AZ7 CYS S  128 ? GLY S  138 ? CYS D 128 GLY D 138 1 ? 11 
HELX_P HELX_P233 AZ8 LYS S  185 ? VAL S  194 ? LYS D 185 VAL D 194 1 ? 10 
HELX_P HELX_P234 AZ9 ARG S  205 ? THR S  209 ? ARG D 205 THR D 209 5 ? 5  
HELX_P HELX_P235 BA1 GLY S  224 ? CYS S  230 ? GLY D 224 CYS D 230 1 ? 7  
HELX_P HELX_P236 BA2 THR S  239 ? ARG S  241 ? THR D 239 ARG D 241 5 ? 3  
HELX_P HELX_P237 BA3 CYS S  291 ? GLY S  297 ? CYS D 291 GLY D 297 1 ? 7  
HELX_P HELX_P238 BA4 THR S  321 ? GLU S  335 ? THR D 321 GLU D 335 1 ? 15 
HELX_P HELX_P239 BA5 THR S  350 ? LEU S  364 ? THR D 350 LEU D 364 1 ? 15 
HELX_P HELX_P240 BA6 PRO S  378 ? PHE S  382 ? PRO D 378 PHE D 382 5 ? 5  
HELX_P HELX_P241 BA7 SER S  386 ? ALA S  393 ? SER D 386 ALA D 393 1 ? 8  
HELX_P HELX_P242 BA8 ASP S  401 ? ALA S  406 ? ASP D 401 ALA D 406 1 ? 6  
HELX_P HELX_P243 BA9 ALA S  406 ? ARG S  418 ? ALA D 406 ARG D 418 1 ? 13 
HELX_P HELX_P244 BB1 ALA S  456 ? ALA S  462 ? ALA D 456 ALA D 462 5 ? 7  
HELX_P HELX_P245 BB2 GLU S  472 ? GLY S  482 ? GLU D 472 GLY D 482 1 ? 11 
HELX_P HELX_P246 BB3 SER S  487 ? ALA S  500 ? SER D 487 ALA D 500 1 ? 14 
HELX_P HELX_P247 BB4 GLY S  508 ? GLN S  513 ? GLY D 508 GLN D 513 1 ? 6  
HELX_P HELX_P248 BB5 ASP S  514 ? LYS S  528 ? ASP D 514 LYS D 528 1 ? 15 
HELX_P HELX_P249 BB6 ASN S  540 ? MET S  547 ? ASN D 540 MET D 547 1 ? 8  
HELX_P HELX_P250 BB7 PRO S  573 ? LYS S  578 ? PRO D 573 LYS D 578 1 ? 6  
HELX_P HELX_P251 BB8 LEU S  593 ? ALA S  598 ? LEU D 593 ALA D 598 1 ? 6  
HELX_P HELX_P252 BB9 THR S  606 ? LYS S  610 ? THR D 606 LYS D 610 5 ? 5  
HELX_P HELX_P253 BC1 GLY S  636 ? ALA S  647 ? GLY D 636 ALA D 647 1 ? 12 
HELX_P HELX_P254 BC2 LEU S  656 ? ARG S  667 ? LEU D 656 ARG D 667 1 ? 12 
HELX_P HELX_P255 BC3 LYS S  700 ? ALA S  704 ? LYS D 700 ALA D 704 5 ? 5  
HELX_P HELX_P256 BC4 VAL S  705 ? GLN S  709 ? VAL D 705 GLN D 709 5 ? 5  
HELX_P HELX_P257 BC5 HIS S  719 ? ALA S  727 ? HIS D 719 ALA D 727 1 ? 9  
HELX_P HELX_P258 BC6 GLY T  65  ? MET T  70  ? GLY E 65  MET E 70  1 ? 6  
HELX_P HELX_P259 BC7 GLU T  71  ? ARG T  73  ? GLU E 71  ARG E 73  5 ? 3  
HELX_P HELX_P260 BC8 LEU T  76  ? TYR T  81  ? LEU E 76  TYR E 81  5 ? 6  
HELX_P HELX_P261 BC9 HIS T  89  ? GLY T  106 ? HIS E 89  GLY E 106 1 ? 18 
HELX_P HELX_P262 BD1 PRO T  110 ? LEU T  140 ? PRO E 110 LEU E 140 1 ? 31 
HELX_P HELX_P263 BD2 PRO T  145 ? GLY T  165 ? PRO E 145 GLY E 165 1 ? 21 
HELX_P HELX_P264 BD3 GLU T  185 ? ALA T  209 ? GLU E 185 ALA E 209 1 ? 25 
HELX_P HELX_P265 BD4 ILE T  213 ? ARG T  219 ? ILE E 213 ARG E 219 1 ? 7  
HELX_P HELX_P266 BD5 PRO T  225 ? LEU T  232 ? PRO E 225 LEU E 232 1 ? 8  
HELX_P HELX_P267 BD6 LEU T  239 ? GLY T  243 ? LEU E 239 GLY E 243 5 ? 5  
HELX_P HELX_P268 BD7 ASP T  247 ? TYR T  252 ? ASP E 247 TYR E 252 1 ? 6  
HELX_P HELX_P269 BD8 GLY T  256 ? TYR T  260 ? GLY E 256 TYR E 260 5 ? 5  
HELX_P HELX_P270 BD9 ASP T  271 ? ARG T  296 ? ASP E 271 ARG E 296 1 ? 26 
HELX_P HELX_P271 BE1 HIS T  315 ? THR T  319 ? HIS E 315 THR E 319 5 ? 5  
HELX_P HELX_P272 BE2 SER T  320 ? GLU T  333 ? SER E 320 GLU E 333 1 ? 14 
HELX_P HELX_P273 BE3 ALA T  372 ? ASN T  377 ? ALA E 372 ASN E 377 1 ? 6  
HELX_P HELX_P274 BE4 SER T  380 ? CYS T  385 ? SER E 380 CYS E 385 1 ? 6  
HELX_P HELX_P275 BE5 PRO T  391 ? LEU T  400 ? PRO E 391 LEU E 400 1 ? 10 
HELX_P HELX_P276 BE6 VAL T  403 ? ASP T  408 ? VAL E 403 ASP E 408 1 ? 6  
HELX_P HELX_P277 BE7 ARG U  2   ? LYS U  13  ? ARG F 2   LYS F 13  1 ? 12 
HELX_P HELX_P278 BE8 PRO U  30  ? MET U  44  ? PRO F 30  MET F 44  1 ? 15 
HELX_P HELX_P279 BE9 SER U  110 ? PHE U  122 ? SER F 110 PHE F 122 1 ? 13 
HELX_P HELX_P280 BF1 ILE U  166 ? ARG U  171 ? ILE F 166 ARG F 171 1 ? 6  
HELX_P HELX_P281 BF2 GLY U  186 ? GLY U  191 ? GLY F 186 GLY F 191 5 ? 6  
HELX_P HELX_P282 BF3 PHE V  21  ? SER V  35  ? PHE G 21  SER G 35  1 ? 15 
HELX_P HELX_P283 BF4 ALA V  44  ? ALA V  52  ? ALA G 44  ALA G 52  1 ? 9  
HELX_P HELX_P284 BF5 SER V  53  ? ASP V  55  ? SER G 53  ASP G 55  5 ? 3  
HELX_P HELX_P285 BF6 SER V  71  ? ALA V  75  ? SER G 71  ALA G 75  5 ? 5  
HELX_P HELX_P286 BF7 MET V  88  ? GLN V  98  ? MET G 88  GLN G 98  1 ? 11 
HELX_P HELX_P287 BF8 GLY V  109 ? SER V  114 ? GLY G 109 SER G 114 1 ? 6  
HELX_P HELX_P288 BF9 ASN V  126 ? VAL V  130 ? ASN G 126 VAL G 130 5 ? 5  
HELX_P HELX_P289 BG1 ARG V  143 ? ARG V  159 ? ARG G 143 ARG G 159 1 ? 17 
HELX_P HELX_P290 BG2 LEU W  3   ? SER W  19  ? LEU O 3   SER O 19  1 ? 17 
HELX_P HELX_P291 BG3 SER W  57  ? ALA W  62  ? SER O 57  ALA O 62  1 ? 6  
HELX_P HELX_P292 BG4 GLY W  102 ? CYS W  108 ? GLY O 102 CYS O 108 1 ? 7  
HELX_P HELX_P293 BG5 GLU W  125 ? ASP W  128 ? GLU O 125 ASP O 128 5 ? 4  
HELX_P HELX_P294 BG6 GLY W  132 ? MET W  136 ? GLY O 132 MET O 136 5 ? 5  
HELX_P HELX_P295 BG7 THR W  143 ? GLY W  154 ? THR O 143 GLY O 154 1 ? 12 
HELX_P HELX_P296 BG8 ARG W  167 ? GLU W  171 ? ARG O 167 GLU O 171 5 ? 5  
HELX_P HELX_P297 BG9 SER X  4   ? GLY X  28  ? SER I 4   GLY I 28  1 ? 25 
HELX_P HELX_P298 BH1 PHE X  37  ? TYR X  42  ? PHE I 37  TYR I 42  1 ? 6  
HELX_P HELX_P299 BH2 THR X  111 ? ALA X  127 ? THR I 111 ALA I 127 1 ? 17 
HELX_P HELX_P300 BH3 ALA Y  9   ? GLY Y  22  ? ALA X 9   GLY X 22  1 ? 14 
HELX_P HELX_P301 BH4 GLY Y  69  ? GLN Y  84  ? GLY X 69  GLN X 84  1 ? 16 
HELX_P HELX_P302 BH5 SER Y  95  ? LEU Y  103 ? SER X 95  LEU X 103 1 ? 9  
HELX_P HELX_P303 BH6 PRO Y  106 ? ALA Y  118 ? PRO X 106 ALA X 118 1 ? 13 
HELX_P HELX_P304 BH7 ASP Y  122 ? LEU Y  127 ? ASP X 122 LEU X 127 5 ? 6  
HELX_P HELX_P305 BH8 PRO Z  3   ? LEU Z  31  ? PRO P 3   LEU P 31  1 ? 29 
HELX_P HELX_P306 BH9 GLY Z  37  ? MET Z  42  ? GLY P 37  MET P 42  1 ? 6  
HELX_P HELX_P307 BI1 VAL Z  59  ? SER Z  84  ? VAL P 59  SER P 84  1 ? 26 
HELX_P HELX_P308 BI2 LEU Z  88  ? GLY Z  114 ? LEU P 88  GLY P 114 1 ? 27 
HELX_P HELX_P309 BI3 SER AA 2   ? LEU AA 22  ? SER R 2   LEU R 22  1 ? 21 
HELX_P HELX_P310 BI4 ASN AA 24  ? LEU AA 46  ? ASN R 24  LEU R 46  1 ? 23 
HELX_P HELX_P311 BI5 ALA AA 48  ? VAL AA 58  ? ALA R 48  VAL R 58  1 ? 11 
HELX_P HELX_P312 BI6 ALA AA 62  ? LEU AA 74  ? ALA R 62  LEU R 74  1 ? 13 
HELX_P HELX_P313 BI7 ARG AA 88  ? TRP AA 109 ? ARG R 88  TRP R 109 1 ? 22 
HELX_P HELX_P314 BI8 LEU AA 123 ? TYR AA 132 ? LEU R 123 TYR R 132 1 ? 10 
HELX_P HELX_P315 BI9 TRP AA 135 ? GLU AA 158 ? TRP R 135 GLU R 158 1 ? 24 
HELX_P HELX_P316 BJ1 SER BA 2   ? ARG BA 21  ? SER S 2   ARG S 21  1 ? 20 
HELX_P HELX_P317 BJ2 THR BA 23  ? GLY BA 50  ? THR S 23  GLY S 50  1 ? 28 
HELX_P HELX_P318 BJ3 LEU BA 51  ? PHE BA 79  ? LEU S 51  PHE S 79  1 ? 29 
HELX_P HELX_P319 BJ4 ALA BA 86  ? LEU BA 90  ? ALA S 86  LEU S 90  5 ? 5  
HELX_P HELX_P320 BJ5 ALA CA 2   ? PHE CA 20  ? ALA T 2   PHE T 20  1 ? 19 
HELX_P HELX_P321 BJ6 GLU CA 26  ? SER CA 50  ? GLU T 26  SER T 50  1 ? 25 
HELX_P HELX_P322 BJ7 ASP CA 70  ? MET CA 95  ? ASP T 70  MET T 95  1 ? 26 
HELX_P HELX_P323 BJ8 GLY CA 100 ? LEU CA 120 ? GLY T 100 LEU T 120 1 ? 21 
HELX_P HELX_P324 BJ9 SER CA 123 ? GLY CA 143 ? SER T 123 GLY T 143 1 ? 21 
HELX_P HELX_P325 BK1 PRO CA 149 ? LEU CA 179 ? PRO T 149 LEU T 179 1 ? 31 
HELX_P HELX_P326 BK2 SER CA 184 ? GLU CA 193 ? SER T 184 GLU T 193 1 ? 10 
HELX_P HELX_P327 BK3 ASN CA 198 ? SER CA 217 ? ASN T 198 SER T 217 1 ? 20 
HELX_P HELX_P328 BK4 PRO CA 221 ? GLY CA 232 ? PRO T 221 GLY T 232 5 ? 12 
HELX_P HELX_P329 BK5 PRO CA 233 ? ALA CA 242 ? PRO T 233 ALA T 242 1 ? 10 
HELX_P HELX_P330 BK6 VAL CA 246 ? SER CA 256 ? VAL T 246 SER T 256 1 ? 11 
HELX_P HELX_P331 BK7 SER CA 256 ? VAL CA 262 ? SER T 256 VAL T 262 1 ? 7  
HELX_P HELX_P332 BK8 LEU CA 263 ? SER CA 284 ? LEU T 263 SER T 284 1 ? 22 
HELX_P HELX_P333 BK9 ASP CA 290 ? VAL CA 312 ? ASP T 290 VAL T 312 1 ? 23 
HELX_P HELX_P334 BL1 ALA CA 314 ? LEU CA 343 ? ALA T 314 LEU T 343 1 ? 30 
HELX_P HELX_P335 BL2 GLN CA 361 ? GLY CA 375 ? GLN T 361 GLY T 375 1 ? 15 
HELX_P HELX_P336 BL3 LEU CA 379 ? TYR CA 395 ? LEU T 379 TYR T 395 1 ? 17 
HELX_P HELX_P337 BL4 GLY CA 399 ? LEU CA 426 ? GLY T 399 LEU T 426 1 ? 28 
HELX_P HELX_P338 BL5 PRO CA 439 ? ALA CA 456 ? PRO T 439 ALA T 456 1 ? 18 
HELX_P HELX_P339 BL6 GLY CA 457 ? ALA CA 460 ? GLY T 457 ALA T 460 5 ? 4  
HELX_P HELX_P340 BL7 VAL CA 468 ? LYS CA 474 ? VAL T 468 LYS T 474 1 ? 7  
HELX_P HELX_P341 BL8 GLY CA 488 ? LYS CA 515 ? GLY T 488 LYS T 515 1 ? 28 
HELX_P HELX_P342 BL9 PRO CA 518 ? GLU CA 530 ? PRO T 518 GLU T 530 1 ? 13 
HELX_P HELX_P343 BM1 TYR CA 533 ? ILE CA 542 ? TYR T 533 ILE T 542 1 ? 10 
HELX_P HELX_P344 BM2 ILE CA 542 ? LEU CA 581 ? ILE T 542 LEU T 581 1 ? 40 
HELX_P HELX_P345 BM3 TYR CA 585 ? MET CA 604 ? TYR T 585 MET T 604 1 ? 20 
HELX_P HELX_P346 BM4 VAL DA 2   ? LEU DA 18  ? VAL U 2   LEU U 18  1 ? 17 
HELX_P HELX_P347 BM5 ARG DA 22  ? LEU DA 41  ? ARG U 22  LEU U 41  1 ? 20 
HELX_P HELX_P348 BM6 ASP DA 68  ? VAL DA 88  ? ASP U 68  VAL U 88  1 ? 21 
HELX_P HELX_P349 BM7 PHE DA 95  ? ALA DA 112 ? PHE U 95  ALA U 112 1 ? 18 
HELX_P HELX_P350 BM8 ASP DA 114 ? ALA DA 125 ? ASP U 114 ALA U 125 1 ? 12 
HELX_P HELX_P351 BM9 ALA DA 125 ? LEU DA 135 ? ALA U 125 LEU U 135 1 ? 11 
HELX_P HELX_P352 BN1 GLY DA 140 ? LEU DA 169 ? GLY U 140 LEU U 169 1 ? 30 
HELX_P HELX_P353 BN2 LEU DA 176 ? HIS DA 183 ? LEU U 176 HIS U 183 1 ? 8  
HELX_P HELX_P354 BN3 ALA DA 189 ? LYS DA 204 ? ALA U 189 LYS U 204 1 ? 16 
HELX_P HELX_P355 BN4 LEU DA 207 ? HIS DA 211 ? LEU U 207 HIS U 211 5 ? 5  
HELX_P HELX_P356 BN5 TRP DA 213 ? ASN DA 221 ? TRP U 213 ASN U 221 1 ? 9  
HELX_P HELX_P357 BN6 GLY DA 225 ? LEU DA 233 ? GLY U 225 LEU U 233 1 ? 9  
HELX_P HELX_P358 BN7 VAL DA 236 ? PHE DA 244 ? VAL U 236 PHE U 244 1 ? 9  
HELX_P HELX_P359 BN8 PHE DA 244 ? ALA DA 249 ? PHE U 244 ALA U 249 1 ? 6  
HELX_P HELX_P360 BN9 ALA DA 249 ? ALA DA 278 ? ALA U 249 ALA U 278 1 ? 30 
HELX_P HELX_P361 BO1 ASP DA 280 ? SER DA 302 ? ASP U 280 SER U 302 1 ? 23 
HELX_P HELX_P362 BO2 THR DA 304 ? GLY DA 337 ? THR U 304 GLY U 337 1 ? 34 
HELX_P HELX_P363 BO3 GLY DA 346 ? ALA DA 351 ? GLY U 346 ALA U 351 1 ? 6  
HELX_P HELX_P364 BO4 GLY DA 353 ? GLY DA 367 ? GLY U 353 GLY U 367 1 ? 15 
HELX_P HELX_P365 BO5 SER DA 372 ? SER DA 388 ? SER U 372 SER U 388 1 ? 17 
HELX_P HELX_P366 BO6 SER DA 388 ? PHE DA 396 ? SER U 388 PHE U 396 1 ? 9  
HELX_P HELX_P367 BO7 SER DA 398 ? PHE DA 414 ? SER U 398 PHE U 414 1 ? 17 
HELX_P HELX_P368 BO8 ALA DA 426 ? PHE DA 446 ? ALA U 426 PHE U 446 1 ? 21 
HELX_P HELX_P369 BO9 GLY DA 453 ? LEU DA 464 ? GLY U 453 LEU U 464 1 ? 12 
HELX_P HELX_P370 BP1 THR EA 2   ? GLY EA 17  ? THR V 2   GLY V 17  1 ? 16 
HELX_P HELX_P371 BP2 PRO EA 21  ? THR EA 43  ? PRO V 21  THR V 43  1 ? 23 
HELX_P HELX_P372 BP3 ASP EA 56  ? VAL EA 77  ? ASP V 56  VAL V 77  1 ? 22 
HELX_P HELX_P373 BP4 PHE EA 82  ? SER EA 100 ? PHE V 82  SER V 100 1 ? 19 
HELX_P HELX_P374 BP5 HIS EA 103 ? ALA EA 122 ? HIS V 103 ALA V 122 1 ? 20 
HELX_P HELX_P375 BP6 ARG EA 126 ? THR EA 158 ? ARG V 126 THR V 158 1 ? 33 
HELX_P HELX_P376 BP7 GLY EA 169 ? ALA EA 187 ? GLY V 169 ALA V 187 1 ? 19 
HELX_P HELX_P377 BP8 PHE EA 194 ? SER EA 203 ? PHE V 194 SER V 203 1 ? 10 
HELX_P HELX_P378 BP9 PRO EA 204 ? ARG EA 225 ? PRO V 204 ARG V 225 1 ? 22 
HELX_P HELX_P379 BQ1 PRO EA 229 ? ALA EA 250 ? PRO V 229 ALA V 250 1 ? 22 
HELX_P HELX_P380 BQ2 GLU EA 253 ? ALA EA 270 ? GLU V 253 ALA V 270 1 ? 18 
HELX_P HELX_P381 BQ3 ALA EA 278 ? SER EA 303 ? ALA V 278 SER V 303 1 ? 26 
HELX_P HELX_P382 BQ4 PRO EA 308 ? ARG EA 313 ? PRO V 308 ARG V 313 1 ? 6  
HELX_P HELX_P383 BQ5 GLY EA 314 ? ASP EA 319 ? GLY V 314 ASP V 319 1 ? 6  
HELX_P HELX_P384 BQ6 ASP EA 319 ? GLY EA 335 ? ASP V 319 GLY V 335 1 ? 17 
HELX_P HELX_P385 BQ7 LEU EA 339 ? ALA EA 355 ? LEU V 339 ALA V 355 1 ? 17 
HELX_P HELX_P386 BQ8 TRP EA 358 ? LEU EA 380 ? TRP V 358 LEU V 380 1 ? 23 
HELX_P HELX_P387 BQ9 ALA EA 381 ? ALA EA 384 ? ALA V 381 ALA V 384 5 ? 4  
HELX_P HELX_P388 BR1 PRO EA 395 ? LEU EA 415 ? PRO V 395 LEU V 415 1 ? 21 
HELX_P HELX_P389 BR2 VAL EA 419 ? LEU EA 423 ? VAL V 419 LEU V 423 5 ? 5  
HELX_P HELX_P390 BR3 PRO FA 9   ? GLN FA 43  ? PRO Q 9   GLN Q 43  1 ? 35 
HELX_P HELX_P391 BR4 LEU FA 57  ? ILE FA 67  ? LEU Q 57  ILE Q 67  1 ? 11 
HELX_P HELX_P392 BR5 ASP FA 78  ? LEU FA 95  ? ASP Q 78  LEU Q 95  1 ? 18 
HELX_P HELX_P393 BR6 LEU FA 120 ? SER FA 143 ? LEU Q 120 SER Q 143 1 ? 24 
HELX_P HELX_P394 BR7 SER FA 145 ? GLY FA 178 ? SER Q 145 GLY Q 178 1 ? 34 
HELX_P HELX_P395 BR8 ASN FA 181 ? HIS FA 192 ? ASN Q 181 HIS Q 192 1 ? 12 
HELX_P HELX_P396 BR9 LEU FA 195 ? GLU FA 213 ? LEU Q 195 GLU Q 213 1 ? 19 
HELX_P HELX_P397 BS1 ILE FA 239 ? PHE FA 263 ? ILE Q 239 PHE Q 263 1 ? 25 
HELX_P HELX_P398 BS2 TYR FA 276 ? TRP FA 297 ? TYR Q 276 TRP Q 297 1 ? 22 
HELX_P HELX_P399 BS3 TYR FA 302 ? PHE FA 312 ? TYR Q 302 PHE Q 312 1 ? 11 
HELX_P HELX_P400 BS4 PHE FA 312 ? ASP FA 331 ? PHE Q 312 ASP Q 331 1 ? 20 
HELX_P HELX_P401 BS5 ARG FA 334 ? ALA FA 351 ? ARG Q 334 ALA Q 351 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ? ? B CYS 144 SG  ? ? ? 1_555 B  CYS 172 SG  ? ? 2 CYS 144 2 CYS 172 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf2  disulf ? ? R CYS 144 SG  ? ? ? 1_555 R  CYS 172 SG  ? ? C CYS 144 C CYS 172 1_555 ? ? ? ? ? ? ? 2.099 ? ? 
metalc1  metalc ? ? A CYS 353 SG  ? ? ? 1_555 GA SF4 .   FE4 ? ? 1 CYS 353 1 SF4 501 1_555 ? ? ? ? ? ? ? 2.326 ? ? 
metalc2  metalc ? ? A CYS 356 SG  ? ? ? 1_555 GA SF4 .   FE1 ? ? 1 CYS 356 1 SF4 501 1_555 ? ? ? ? ? ? ? 2.316 ? ? 
metalc3  metalc ? ? A CYS 359 SG  ? ? ? 1_555 GA SF4 .   FE2 ? ? 1 CYS 359 1 SF4 501 1_555 ? ? ? ? ? ? ? 2.319 ? ? 
metalc4  metalc ? ? B CYS 83  SG  ? ? ? 1_555 IA FES .   FE1 ? ? 2 CYS 83  2 FES 201 1_555 ? ? ? ? ? ? ? 2.326 ? ? 
metalc5  metalc ? ? B CYS 88  SG  ? ? ? 1_555 IA FES .   FE1 ? ? 2 CYS 88  2 FES 201 1_555 ? ? ? ? ? ? ? 2.325 ? ? 
metalc6  metalc ? ? B CYS 124 SG  ? ? ? 1_555 IA FES .   FE2 ? ? 2 CYS 124 2 FES 201 1_555 ? ? ? ? ? ? ? 2.324 ? ? 
metalc7  metalc ? ? B CYS 128 SG  ? ? ? 1_555 IA FES .   FE2 ? ? 2 CYS 128 2 FES 201 1_555 ? ? ? ? ? ? ? 2.326 ? ? 
metalc8  metalc ? ? C CYS 34  SG  ? ? ? 1_555 MA FES .   FE1 ? ? 3 CYS 34  3 FES 804 1_555 ? ? ? ? ? ? ? 2.313 ? ? 
metalc9  metalc ? ? C CYS 45  SG  ? ? ? 1_555 MA FES .   FE1 ? ? 3 CYS 45  3 FES 804 1_555 ? ? ? ? ? ? ? 2.313 ? ? 
metalc10 metalc ? ? C CYS 48  SG  ? ? ? 1_555 MA FES .   FE2 ? ? 3 CYS 48  3 FES 804 1_555 ? ? ? ? ? ? ? 2.309 ? ? 
metalc11 metalc ? ? C CYS 83  SG  ? ? ? 1_555 MA FES .   FE2 ? ? 3 CYS 83  3 FES 804 1_555 ? ? ? ? ? ? ? 2.318 ? ? 
metalc12 metalc ? ? C HIS 115 NE2 ? ? ? 1_555 JA SF4 .   FE3 ? ? 3 HIS 115 3 SF4 801 1_555 ? ? ? ? ? ? ? 2.126 ? ? 
metalc13 metalc ? ? C CYS 119 SG  ? ? ? 1_555 JA SF4 .   FE2 ? ? 3 CYS 119 3 SF4 801 1_555 ? ? ? ? ? ? ? 2.312 ? ? 
metalc14 metalc ? ? C CYS 122 SG  ? ? ? 1_555 JA SF4 .   FE4 ? ? 3 CYS 122 3 SF4 801 1_555 ? ? ? ? ? ? ? 2.307 ? ? 
metalc15 metalc ? ? C CYS 128 SG  ? ? ? 1_555 JA SF4 .   FE1 ? ? 3 CYS 128 3 SF4 801 1_555 ? ? ? ? ? ? ? 2.325 ? ? 
metalc16 metalc ? ? C CYS 181 SG  ? ? ? 1_555 KA SF4 .   FE2 ? ? 3 CYS 181 3 SF4 802 1_555 ? ? ? ? ? ? ? 2.301 ? ? 
metalc17 metalc ? ? C CYS 184 SG  ? ? ? 1_555 KA SF4 .   FE1 ? ? 3 CYS 184 3 SF4 802 1_555 ? ? ? ? ? ? ? 2.329 ? ? 
metalc18 metalc ? ? C CYS 187 SG  ? ? ? 1_555 KA SF4 .   FE3 ? ? 3 CYS 187 3 SF4 802 1_555 ? ? ? ? ? ? ? 2.339 ? ? 
metalc19 metalc ? ? C CYS 230 SG  ? ? ? 1_555 KA SF4 .   FE4 ? ? 3 CYS 230 3 SF4 802 1_555 ? ? ? ? ? ? ? 2.314 ? ? 
metalc20 metalc ? ? C CYS 256 SG  ? ? ? 1_555 LA SF4 .   FE1 ? ? 3 CYS 256 3 SF4 803 1_555 ? ? ? ? ? ? ? 2.304 ? ? 
metalc21 metalc ? ? C CYS 259 SG  ? ? ? 1_555 LA SF4 .   FE4 ? ? 3 CYS 259 3 SF4 803 1_555 ? ? ? ? ? ? ? 2.360 ? ? 
metalc22 metalc ? ? C CYS 263 SG  ? ? ? 1_555 LA SF4 .   FE3 ? ? 3 CYS 263 3 SF4 803 1_555 ? ? ? ? ? ? ? 2.313 ? ? 
metalc23 metalc ? ? C CYS 291 SG  ? ? ? 1_555 LA SF4 .   FE2 ? ? 3 CYS 291 3 SF4 803 1_555 ? ? ? ? ? ? ? 2.317 ? ? 
metalc24 metalc ? ? F CYS 45  SG  ? ? ? 1_555 NA SF4 .   FE3 ? ? 6 CYS 45  6 SF4 201 1_555 ? ? ? ? ? ? ? 2.297 ? ? 
metalc25 metalc ? ? F CYS 46  SG  ? ? ? 1_555 NA SF4 .   FE2 ? ? 6 CYS 46  6 SF4 201 1_555 ? ? ? ? ? ? ? 2.323 ? ? 
metalc26 metalc ? ? F CYS 111 SG  ? ? ? 1_555 NA SF4 .   FE1 ? ? 6 CYS 111 6 SF4 201 1_555 ? ? ? ? ? ? ? 2.312 ? ? 
metalc27 metalc ? ? F CYS 140 SG  ? ? ? 1_555 NA SF4 .   FE4 ? ? 6 CYS 140 6 SF4 201 1_555 ? ? ? ? ? ? ? 2.332 ? ? 
metalc28 metalc ? ? G CYS 53  SG  ? ? ? 1_555 PA SF4 .   FE3 ? ? 9 CYS 53  9 SF4 202 1_555 ? ? ? ? ? ? ? 2.323 ? ? 
metalc29 metalc ? ? G CYS 56  SG  ? ? ? 1_555 PA SF4 .   FE4 ? ? 9 CYS 56  9 SF4 202 1_555 ? ? ? ? ? ? ? 2.306 ? ? 
metalc30 metalc ? ? G CYS 59  SG  ? ? ? 1_555 PA SF4 .   FE2 ? ? 9 CYS 59  9 SF4 202 1_555 ? ? ? ? ? ? ? 2.312 ? ? 
metalc31 metalc ? ? G CYS 63  SG  ? ? ? 1_555 OA SF4 .   FE4 ? ? 9 CYS 63  9 SF4 201 1_555 ? ? ? ? ? ? ? 2.311 ? ? 
metalc32 metalc ? ? G CYS 98  SG  ? ? ? 1_555 OA SF4 .   FE2 ? ? 9 CYS 98  9 SF4 201 1_555 ? ? ? ? ? ? ? 2.334 ? ? 
metalc33 metalc ? ? G CYS 101 SG  ? ? ? 1_555 OA SF4 .   FE1 ? ? 9 CYS 101 9 SF4 201 1_555 ? ? ? ? ? ? ? 2.609 ? ? 
metalc34 metalc ? ? G CYS 104 SG  ? ? ? 1_555 OA SF4 .   FE3 ? ? 9 CYS 104 9 SF4 201 1_555 ? ? ? ? ? ? ? 2.297 ? ? 
metalc35 metalc ? ? G CYS 108 SG  ? ? ? 1_555 PA SF4 .   FE1 ? ? 9 CYS 108 9 SF4 202 1_555 ? ? ? ? ? ? ? 2.285 ? ? 
metalc36 metalc ? ? Q CYS 353 SG  ? ? ? 1_555 QA SF4 .   FE4 ? ? B CYS 353 B SF4 501 1_555 ? ? ? ? ? ? ? 2.321 ? ? 
metalc37 metalc ? ? Q CYS 356 SG  ? ? ? 1_555 QA SF4 .   FE1 ? ? B CYS 356 B SF4 501 1_555 ? ? ? ? ? ? ? 2.304 ? ? 
metalc38 metalc ? ? Q CYS 359 SG  ? ? ? 1_555 QA SF4 .   FE2 ? ? B CYS 359 B SF4 501 1_555 ? ? ? ? ? ? ? 2.317 ? ? 
metalc39 metalc ? ? Q CYS 400 SG  ? ? ? 1_555 QA SF4 .   FE3 ? ? B CYS 400 B SF4 501 1_555 ? ? ? ? ? ? ? 2.309 ? ? 
metalc40 metalc ? ? R CYS 83  SG  ? ? ? 1_555 SA FES .   FE1 ? ? C CYS 83  C FES 201 1_555 ? ? ? ? ? ? ? 2.331 ? ? 
metalc41 metalc ? ? R CYS 88  SG  ? ? ? 1_555 SA FES .   FE1 ? ? C CYS 88  C FES 201 1_555 ? ? ? ? ? ? ? 2.328 ? ? 
metalc42 metalc ? ? R CYS 124 SG  ? ? ? 1_555 SA FES .   FE2 ? ? C CYS 124 C FES 201 1_555 ? ? ? ? ? ? ? 2.330 ? ? 
metalc43 metalc ? ? R CYS 128 SG  ? ? ? 1_555 SA FES .   FE2 ? ? C CYS 128 C FES 201 1_555 ? ? ? ? ? ? ? 2.324 ? ? 
metalc44 metalc ? ? S CYS 34  SG  ? ? ? 1_555 WA FES .   FE1 ? ? D CYS 34  D FES 804 1_555 ? ? ? ? ? ? ? 2.318 ? ? 
metalc45 metalc ? ? S CYS 45  SG  ? ? ? 1_555 WA FES .   FE1 ? ? D CYS 45  D FES 804 1_555 ? ? ? ? ? ? ? 2.319 ? ? 
metalc46 metalc ? ? S CYS 48  SG  ? ? ? 1_555 WA FES .   FE2 ? ? D CYS 48  D FES 804 1_555 ? ? ? ? ? ? ? 2.314 ? ? 
metalc47 metalc ? ? S CYS 83  SG  ? ? ? 1_555 WA FES .   FE2 ? ? D CYS 83  D FES 804 1_555 ? ? ? ? ? ? ? 2.316 ? ? 
metalc48 metalc ? ? S HIS 115 NE2 ? ? ? 1_555 TA SF4 .   FE3 ? ? D HIS 115 D SF4 801 1_555 ? ? ? ? ? ? ? 2.173 ? ? 
metalc49 metalc ? ? S CYS 119 SG  ? ? ? 1_555 TA SF4 .   FE2 ? ? D CYS 119 D SF4 801 1_555 ? ? ? ? ? ? ? 2.308 ? ? 
metalc50 metalc ? ? S CYS 122 SG  ? ? ? 1_555 TA SF4 .   FE4 ? ? D CYS 122 D SF4 801 1_555 ? ? ? ? ? ? ? 2.303 ? ? 
metalc51 metalc ? ? S CYS 128 SG  ? ? ? 1_555 TA SF4 .   FE1 ? ? D CYS 128 D SF4 801 1_555 ? ? ? ? ? ? ? 2.315 ? ? 
metalc52 metalc ? ? S CYS 181 SG  ? ? ? 1_555 UA SF4 .   FE2 ? ? D CYS 181 D SF4 802 1_555 ? ? ? ? ? ? ? 2.303 ? ? 
metalc53 metalc ? ? S CYS 184 SG  ? ? ? 1_555 UA SF4 .   FE1 ? ? D CYS 184 D SF4 802 1_555 ? ? ? ? ? ? ? 2.338 ? ? 
metalc54 metalc ? ? S CYS 187 SG  ? ? ? 1_555 UA SF4 .   FE3 ? ? D CYS 187 D SF4 802 1_555 ? ? ? ? ? ? ? 2.328 ? ? 
metalc55 metalc ? ? S CYS 230 SG  ? ? ? 1_555 UA SF4 .   FE4 ? ? D CYS 230 D SF4 802 1_555 ? ? ? ? ? ? ? 2.311 ? ? 
metalc56 metalc ? ? S CYS 256 SG  ? ? ? 1_555 VA SF4 .   FE1 ? ? D CYS 256 D SF4 803 1_555 ? ? ? ? ? ? ? 2.331 ? ? 
metalc57 metalc ? ? S CYS 259 SG  ? ? ? 1_555 VA SF4 .   FE4 ? ? D CYS 259 D SF4 803 1_555 ? ? ? ? ? ? ? 2.344 ? ? 
metalc58 metalc ? ? S CYS 263 SG  ? ? ? 1_555 VA SF4 .   FE3 ? ? D CYS 263 D SF4 803 1_555 ? ? ? ? ? ? ? 2.324 ? ? 
metalc59 metalc ? ? S CYS 291 SG  ? ? ? 1_555 VA SF4 .   FE2 ? ? D CYS 291 D SF4 803 1_555 ? ? ? ? ? ? ? 2.334 ? ? 
metalc60 metalc ? ? V CYS 45  SG  ? ? ? 1_555 XA SF4 .   FE3 ? ? G CYS 45  G SF4 201 1_555 ? ? ? ? ? ? ? 2.293 ? ? 
metalc61 metalc ? ? V CYS 46  SG  ? ? ? 1_555 XA SF4 .   FE2 ? ? G CYS 46  G SF4 201 1_555 ? ? ? ? ? ? ? 2.303 ? ? 
metalc62 metalc ? ? V CYS 111 SG  ? ? ? 1_555 XA SF4 .   FE1 ? ? G CYS 111 G SF4 201 1_555 ? ? ? ? ? ? ? 2.319 ? ? 
metalc63 metalc ? ? V CYS 140 SG  ? ? ? 1_555 XA SF4 .   FE4 ? ? G CYS 140 G SF4 201 1_555 ? ? ? ? ? ? ? 2.312 ? ? 
metalc64 metalc ? ? W CYS 53  SG  ? ? ? 1_555 ZA SF4 .   FE3 ? ? O CYS 53  O SF4 202 1_555 ? ? ? ? ? ? ? 2.326 ? ? 
metalc65 metalc ? ? W CYS 56  SG  ? ? ? 1_555 ZA SF4 .   FE4 ? ? O CYS 56  O SF4 202 1_555 ? ? ? ? ? ? ? 2.320 ? ? 
metalc66 metalc ? ? W CYS 59  SG  ? ? ? 1_555 ZA SF4 .   FE2 ? ? O CYS 59  O SF4 202 1_555 ? ? ? ? ? ? ? 2.309 ? ? 
metalc67 metalc ? ? W CYS 63  SG  ? ? ? 1_555 YA SF4 .   FE4 ? ? O CYS 63  O SF4 201 1_555 ? ? ? ? ? ? ? 2.310 ? ? 
metalc68 metalc ? ? W CYS 98  SG  ? ? ? 1_555 YA SF4 .   FE2 ? ? O CYS 98  O SF4 201 1_555 ? ? ? ? ? ? ? 2.311 ? ? 
metalc69 metalc ? ? W CYS 101 SG  ? ? ? 1_555 YA SF4 .   FE1 ? ? O CYS 101 O SF4 201 1_555 ? ? ? ? ? ? ? 2.347 ? ? 
metalc70 metalc ? ? W CYS 104 SG  ? ? ? 1_555 YA SF4 .   FE3 ? ? O CYS 104 O SF4 201 1_555 ? ? ? ? ? ? ? 2.294 ? ? 
metalc71 metalc ? ? W CYS 108 SG  ? ? ? 1_555 ZA SF4 .   FE1 ? ? O CYS 108 O SF4 202 1_555 ? ? ? ? ? ? ? 2.293 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1   SG  ? A  CYS 353 ? 1 CYS 353 ? 1_555 FE4 ? GA SF4 . ? 1 SF4 501 ? 1_555 S1 ? GA SF4 .   ? 1 SF4 501 ? 1_555 116.9 ? 
2   SG  ? A  CYS 353 ? 1 CYS 353 ? 1_555 FE4 ? GA SF4 . ? 1 SF4 501 ? 1_555 S2 ? GA SF4 .   ? 1 SF4 501 ? 1_555 109.8 ? 
3   S1  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE4 ? GA SF4 . ? 1 SF4 501 ? 1_555 S2 ? GA SF4 .   ? 1 SF4 501 ? 1_555 104.7 ? 
4   SG  ? A  CYS 353 ? 1 CYS 353 ? 1_555 FE4 ? GA SF4 . ? 1 SF4 501 ? 1_555 S3 ? GA SF4 .   ? 1 SF4 501 ? 1_555 115.6 ? 
5   S1  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE4 ? GA SF4 . ? 1 SF4 501 ? 1_555 S3 ? GA SF4 .   ? 1 SF4 501 ? 1_555 105.2 ? 
6   S2  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE4 ? GA SF4 . ? 1 SF4 501 ? 1_555 S3 ? GA SF4 .   ? 1 SF4 501 ? 1_555 103.4 ? 
7   SG  ? A  CYS 356 ? 1 CYS 356 ? 1_555 FE1 ? GA SF4 . ? 1 SF4 501 ? 1_555 S2 ? GA SF4 .   ? 1 SF4 501 ? 1_555 117.8 ? 
8   SG  ? A  CYS 356 ? 1 CYS 356 ? 1_555 FE1 ? GA SF4 . ? 1 SF4 501 ? 1_555 S3 ? GA SF4 .   ? 1 SF4 501 ? 1_555 112.0 ? 
9   S2  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE1 ? GA SF4 . ? 1 SF4 501 ? 1_555 S3 ? GA SF4 .   ? 1 SF4 501 ? 1_555 103.0 ? 
10  SG  ? A  CYS 356 ? 1 CYS 356 ? 1_555 FE1 ? GA SF4 . ? 1 SF4 501 ? 1_555 S4 ? GA SF4 .   ? 1 SF4 501 ? 1_555 110.1 ? 
11  S2  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE1 ? GA SF4 . ? 1 SF4 501 ? 1_555 S4 ? GA SF4 .   ? 1 SF4 501 ? 1_555 105.3 ? 
12  S3  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE1 ? GA SF4 . ? 1 SF4 501 ? 1_555 S4 ? GA SF4 .   ? 1 SF4 501 ? 1_555 107.9 ? 
13  SG  ? A  CYS 359 ? 1 CYS 359 ? 1_555 FE2 ? GA SF4 . ? 1 SF4 501 ? 1_555 S1 ? GA SF4 .   ? 1 SF4 501 ? 1_555 126.2 ? 
14  SG  ? A  CYS 359 ? 1 CYS 359 ? 1_555 FE2 ? GA SF4 . ? 1 SF4 501 ? 1_555 S3 ? GA SF4 .   ? 1 SF4 501 ? 1_555 107.9 ? 
15  S1  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE2 ? GA SF4 . ? 1 SF4 501 ? 1_555 S3 ? GA SF4 .   ? 1 SF4 501 ? 1_555 104.7 ? 
16  SG  ? A  CYS 359 ? 1 CYS 359 ? 1_555 FE2 ? GA SF4 . ? 1 SF4 501 ? 1_555 S4 ? GA SF4 .   ? 1 SF4 501 ? 1_555 103.2 ? 
17  S1  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE2 ? GA SF4 . ? 1 SF4 501 ? 1_555 S4 ? GA SF4 .   ? 1 SF4 501 ? 1_555 106.0 ? 
18  S3  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE2 ? GA SF4 . ? 1 SF4 501 ? 1_555 S4 ? GA SF4 .   ? 1 SF4 501 ? 1_555 107.8 ? 
19  SG  ? B  CYS 83  ? 2 CYS 83  ? 1_555 FE1 ? IA FES . ? 2 FES 201 ? 1_555 S1 ? IA FES .   ? 2 FES 201 ? 1_555 113.2 ? 
20  SG  ? B  CYS 83  ? 2 CYS 83  ? 1_555 FE1 ? IA FES . ? 2 FES 201 ? 1_555 S2 ? IA FES .   ? 2 FES 201 ? 1_555 119.7 ? 
21  S1  ? IA FES .   ? 2 FES 201 ? 1_555 FE1 ? IA FES . ? 2 FES 201 ? 1_555 S2 ? IA FES .   ? 2 FES 201 ? 1_555 91.0  ? 
22  SG  ? B  CYS 83  ? 2 CYS 83  ? 1_555 FE1 ? IA FES . ? 2 FES 201 ? 1_555 SG ? B  CYS 88  ? 2 CYS 88  ? 1_555 102.2 ? 
23  S1  ? IA FES .   ? 2 FES 201 ? 1_555 FE1 ? IA FES . ? 2 FES 201 ? 1_555 SG ? B  CYS 88  ? 2 CYS 88  ? 1_555 116.7 ? 
24  S2  ? IA FES .   ? 2 FES 201 ? 1_555 FE1 ? IA FES . ? 2 FES 201 ? 1_555 SG ? B  CYS 88  ? 2 CYS 88  ? 1_555 114.9 ? 
25  SG  ? B  CYS 124 ? 2 CYS 124 ? 1_555 FE2 ? IA FES . ? 2 FES 201 ? 1_555 S1 ? IA FES .   ? 2 FES 201 ? 1_555 108.1 ? 
26  SG  ? B  CYS 124 ? 2 CYS 124 ? 1_555 FE2 ? IA FES . ? 2 FES 201 ? 1_555 S2 ? IA FES .   ? 2 FES 201 ? 1_555 114.8 ? 
27  S1  ? IA FES .   ? 2 FES 201 ? 1_555 FE2 ? IA FES . ? 2 FES 201 ? 1_555 S2 ? IA FES .   ? 2 FES 201 ? 1_555 91.0  ? 
28  SG  ? B  CYS 124 ? 2 CYS 124 ? 1_555 FE2 ? IA FES . ? 2 FES 201 ? 1_555 SG ? B  CYS 128 ? 2 CYS 128 ? 1_555 111.6 ? 
29  S1  ? IA FES .   ? 2 FES 201 ? 1_555 FE2 ? IA FES . ? 2 FES 201 ? 1_555 SG ? B  CYS 128 ? 2 CYS 128 ? 1_555 116.9 ? 
30  S2  ? IA FES .   ? 2 FES 201 ? 1_555 FE2 ? IA FES . ? 2 FES 201 ? 1_555 SG ? B  CYS 128 ? 2 CYS 128 ? 1_555 113.0 ? 
31  SG  ? C  CYS 34  ? 3 CYS 34  ? 1_555 FE1 ? MA FES . ? 3 FES 804 ? 1_555 S1 ? MA FES .   ? 3 FES 804 ? 1_555 104.5 ? 
32  SG  ? C  CYS 34  ? 3 CYS 34  ? 1_555 FE1 ? MA FES . ? 3 FES 804 ? 1_555 S2 ? MA FES .   ? 3 FES 804 ? 1_555 111.1 ? 
33  S1  ? MA FES .   ? 3 FES 804 ? 1_555 FE1 ? MA FES . ? 3 FES 804 ? 1_555 S2 ? MA FES .   ? 3 FES 804 ? 1_555 91.3  ? 
34  SG  ? C  CYS 34  ? 3 CYS 34  ? 1_555 FE1 ? MA FES . ? 3 FES 804 ? 1_555 SG ? C  CYS 45  ? 3 CYS 45  ? 1_555 125.5 ? 
35  S1  ? MA FES .   ? 3 FES 804 ? 1_555 FE1 ? MA FES . ? 3 FES 804 ? 1_555 SG ? C  CYS 45  ? 3 CYS 45  ? 1_555 112.4 ? 
36  S2  ? MA FES .   ? 3 FES 804 ? 1_555 FE1 ? MA FES . ? 3 FES 804 ? 1_555 SG ? C  CYS 45  ? 3 CYS 45  ? 1_555 106.7 ? 
37  SG  ? C  CYS 48  ? 3 CYS 48  ? 1_555 FE2 ? MA FES . ? 3 FES 804 ? 1_555 S1 ? MA FES .   ? 3 FES 804 ? 1_555 113.2 ? 
38  SG  ? C  CYS 48  ? 3 CYS 48  ? 1_555 FE2 ? MA FES . ? 3 FES 804 ? 1_555 S2 ? MA FES .   ? 3 FES 804 ? 1_555 109.8 ? 
39  S1  ? MA FES .   ? 3 FES 804 ? 1_555 FE2 ? MA FES . ? 3 FES 804 ? 1_555 S2 ? MA FES .   ? 3 FES 804 ? 1_555 91.2  ? 
40  SG  ? C  CYS 48  ? 3 CYS 48  ? 1_555 FE2 ? MA FES . ? 3 FES 804 ? 1_555 SG ? C  CYS 83  ? 3 CYS 83  ? 1_555 111.4 ? 
41  S1  ? MA FES .   ? 3 FES 804 ? 1_555 FE2 ? MA FES . ? 3 FES 804 ? 1_555 SG ? C  CYS 83  ? 3 CYS 83  ? 1_555 107.7 ? 
42  S2  ? MA FES .   ? 3 FES 804 ? 1_555 FE2 ? MA FES . ? 3 FES 804 ? 1_555 SG ? C  CYS 83  ? 3 CYS 83  ? 1_555 121.9 ? 
43  NE2 ? C  HIS 115 ? 3 HIS 115 ? 1_555 FE3 ? JA SF4 . ? 3 SF4 801 ? 1_555 S1 ? JA SF4 .   ? 3 SF4 801 ? 1_555 130.3 ? 
44  NE2 ? C  HIS 115 ? 3 HIS 115 ? 1_555 FE3 ? JA SF4 . ? 3 SF4 801 ? 1_555 S2 ? JA SF4 .   ? 3 SF4 801 ? 1_555 86.5  ? 
45  S1  ? JA SF4 .   ? 3 SF4 801 ? 1_555 FE3 ? JA SF4 . ? 3 SF4 801 ? 1_555 S2 ? JA SF4 .   ? 3 SF4 801 ? 1_555 104.8 ? 
46  NE2 ? C  HIS 115 ? 3 HIS 115 ? 1_555 FE3 ? JA SF4 . ? 3 SF4 801 ? 1_555 S4 ? JA SF4 .   ? 3 SF4 801 ? 1_555 117.5 ? 
47  S1  ? JA SF4 .   ? 3 SF4 801 ? 1_555 FE3 ? JA SF4 . ? 3 SF4 801 ? 1_555 S4 ? JA SF4 .   ? 3 SF4 801 ? 1_555 106.3 ? 
48  S2  ? JA SF4 .   ? 3 SF4 801 ? 1_555 FE3 ? JA SF4 . ? 3 SF4 801 ? 1_555 S4 ? JA SF4 .   ? 3 SF4 801 ? 1_555 104.6 ? 
49  SG  ? C  CYS 119 ? 3 CYS 119 ? 1_555 FE2 ? JA SF4 . ? 3 SF4 801 ? 1_555 S1 ? JA SF4 .   ? 3 SF4 801 ? 1_555 114.8 ? 
50  SG  ? C  CYS 119 ? 3 CYS 119 ? 1_555 FE2 ? JA SF4 . ? 3 SF4 801 ? 1_555 S3 ? JA SF4 .   ? 3 SF4 801 ? 1_555 118.9 ? 
51  S1  ? JA SF4 .   ? 3 SF4 801 ? 1_555 FE2 ? JA SF4 . ? 3 SF4 801 ? 1_555 S3 ? JA SF4 .   ? 3 SF4 801 ? 1_555 106.3 ? 
52  SG  ? C  CYS 119 ? 3 CYS 119 ? 1_555 FE2 ? JA SF4 . ? 3 SF4 801 ? 1_555 S4 ? JA SF4 .   ? 3 SF4 801 ? 1_555 106.3 ? 
53  S1  ? JA SF4 .   ? 3 SF4 801 ? 1_555 FE2 ? JA SF4 . ? 3 SF4 801 ? 1_555 S4 ? JA SF4 .   ? 3 SF4 801 ? 1_555 106.9 ? 
54  S3  ? JA SF4 .   ? 3 SF4 801 ? 1_555 FE2 ? JA SF4 . ? 3 SF4 801 ? 1_555 S4 ? JA SF4 .   ? 3 SF4 801 ? 1_555 102.3 ? 
55  SG  ? C  CYS 122 ? 3 CYS 122 ? 1_555 FE4 ? JA SF4 . ? 3 SF4 801 ? 1_555 S1 ? JA SF4 .   ? 3 SF4 801 ? 1_555 109.6 ? 
56  SG  ? C  CYS 122 ? 3 CYS 122 ? 1_555 FE4 ? JA SF4 . ? 3 SF4 801 ? 1_555 S2 ? JA SF4 .   ? 3 SF4 801 ? 1_555 112.1 ? 
57  S1  ? JA SF4 .   ? 3 SF4 801 ? 1_555 FE4 ? JA SF4 . ? 3 SF4 801 ? 1_555 S2 ? JA SF4 .   ? 3 SF4 801 ? 1_555 104.8 ? 
58  SG  ? C  CYS 122 ? 3 CYS 122 ? 1_555 FE4 ? JA SF4 . ? 3 SF4 801 ? 1_555 S3 ? JA SF4 .   ? 3 SF4 801 ? 1_555 116.2 ? 
59  S1  ? JA SF4 .   ? 3 SF4 801 ? 1_555 FE4 ? JA SF4 . ? 3 SF4 801 ? 1_555 S3 ? JA SF4 .   ? 3 SF4 801 ? 1_555 105.8 ? 
60  S2  ? JA SF4 .   ? 3 SF4 801 ? 1_555 FE4 ? JA SF4 . ? 3 SF4 801 ? 1_555 S3 ? JA SF4 .   ? 3 SF4 801 ? 1_555 107.6 ? 
61  SG  ? C  CYS 128 ? 3 CYS 128 ? 1_555 FE1 ? JA SF4 . ? 3 SF4 801 ? 1_555 S2 ? JA SF4 .   ? 3 SF4 801 ? 1_555 111.6 ? 
62  SG  ? C  CYS 128 ? 3 CYS 128 ? 1_555 FE1 ? JA SF4 . ? 3 SF4 801 ? 1_555 S3 ? JA SF4 .   ? 3 SF4 801 ? 1_555 115.3 ? 
63  S2  ? JA SF4 .   ? 3 SF4 801 ? 1_555 FE1 ? JA SF4 . ? 3 SF4 801 ? 1_555 S3 ? JA SF4 .   ? 3 SF4 801 ? 1_555 107.8 ? 
64  SG  ? C  CYS 128 ? 3 CYS 128 ? 1_555 FE1 ? JA SF4 . ? 3 SF4 801 ? 1_555 S4 ? JA SF4 .   ? 3 SF4 801 ? 1_555 114.1 ? 
65  S2  ? JA SF4 .   ? 3 SF4 801 ? 1_555 FE1 ? JA SF4 . ? 3 SF4 801 ? 1_555 S4 ? JA SF4 .   ? 3 SF4 801 ? 1_555 105.1 ? 
66  S3  ? JA SF4 .   ? 3 SF4 801 ? 1_555 FE1 ? JA SF4 . ? 3 SF4 801 ? 1_555 S4 ? JA SF4 .   ? 3 SF4 801 ? 1_555 102.0 ? 
67  SG  ? C  CYS 181 ? 3 CYS 181 ? 1_555 FE2 ? KA SF4 . ? 3 SF4 802 ? 1_555 S1 ? KA SF4 .   ? 3 SF4 802 ? 1_555 109.9 ? 
68  SG  ? C  CYS 181 ? 3 CYS 181 ? 1_555 FE2 ? KA SF4 . ? 3 SF4 802 ? 1_555 S3 ? KA SF4 .   ? 3 SF4 802 ? 1_555 116.3 ? 
69  S1  ? KA SF4 .   ? 3 SF4 802 ? 1_555 FE2 ? KA SF4 . ? 3 SF4 802 ? 1_555 S3 ? KA SF4 .   ? 3 SF4 802 ? 1_555 108.4 ? 
70  SG  ? C  CYS 181 ? 3 CYS 181 ? 1_555 FE2 ? KA SF4 . ? 3 SF4 802 ? 1_555 S4 ? KA SF4 .   ? 3 SF4 802 ? 1_555 111.5 ? 
71  S1  ? KA SF4 .   ? 3 SF4 802 ? 1_555 FE2 ? KA SF4 . ? 3 SF4 802 ? 1_555 S4 ? KA SF4 .   ? 3 SF4 802 ? 1_555 104.6 ? 
72  S3  ? KA SF4 .   ? 3 SF4 802 ? 1_555 FE2 ? KA SF4 . ? 3 SF4 802 ? 1_555 S4 ? KA SF4 .   ? 3 SF4 802 ? 1_555 105.5 ? 
73  SG  ? C  CYS 184 ? 3 CYS 184 ? 1_555 FE1 ? KA SF4 . ? 3 SF4 802 ? 1_555 S2 ? KA SF4 .   ? 3 SF4 802 ? 1_555 108.6 ? 
74  SG  ? C  CYS 184 ? 3 CYS 184 ? 1_555 FE1 ? KA SF4 . ? 3 SF4 802 ? 1_555 S3 ? KA SF4 .   ? 3 SF4 802 ? 1_555 117.9 ? 
75  S2  ? KA SF4 .   ? 3 SF4 802 ? 1_555 FE1 ? KA SF4 . ? 3 SF4 802 ? 1_555 S3 ? KA SF4 .   ? 3 SF4 802 ? 1_555 105.8 ? 
76  SG  ? C  CYS 184 ? 3 CYS 184 ? 1_555 FE1 ? KA SF4 . ? 3 SF4 802 ? 1_555 S4 ? KA SF4 .   ? 3 SF4 802 ? 1_555 115.2 ? 
77  S2  ? KA SF4 .   ? 3 SF4 802 ? 1_555 FE1 ? KA SF4 . ? 3 SF4 802 ? 1_555 S4 ? KA SF4 .   ? 3 SF4 802 ? 1_555 101.6 ? 
78  S3  ? KA SF4 .   ? 3 SF4 802 ? 1_555 FE1 ? KA SF4 . ? 3 SF4 802 ? 1_555 S4 ? KA SF4 .   ? 3 SF4 802 ? 1_555 106.0 ? 
79  SG  ? C  CYS 187 ? 3 CYS 187 ? 1_555 FE3 ? KA SF4 . ? 3 SF4 802 ? 1_555 S1 ? KA SF4 .   ? 3 SF4 802 ? 1_555 117.2 ? 
80  SG  ? C  CYS 187 ? 3 CYS 187 ? 1_555 FE3 ? KA SF4 . ? 3 SF4 802 ? 1_555 S2 ? KA SF4 .   ? 3 SF4 802 ? 1_555 110.5 ? 
81  S1  ? KA SF4 .   ? 3 SF4 802 ? 1_555 FE3 ? KA SF4 . ? 3 SF4 802 ? 1_555 S2 ? KA SF4 .   ? 3 SF4 802 ? 1_555 106.1 ? 
82  SG  ? C  CYS 187 ? 3 CYS 187 ? 1_555 FE3 ? KA SF4 . ? 3 SF4 802 ? 1_555 S4 ? KA SF4 .   ? 3 SF4 802 ? 1_555 114.5 ? 
83  S1  ? KA SF4 .   ? 3 SF4 802 ? 1_555 FE3 ? KA SF4 . ? 3 SF4 802 ? 1_555 S4 ? KA SF4 .   ? 3 SF4 802 ? 1_555 105.2 ? 
84  S2  ? KA SF4 .   ? 3 SF4 802 ? 1_555 FE3 ? KA SF4 . ? 3 SF4 802 ? 1_555 S4 ? KA SF4 .   ? 3 SF4 802 ? 1_555 102.0 ? 
85  SG  ? C  CYS 230 ? 3 CYS 230 ? 1_555 FE4 ? KA SF4 . ? 3 SF4 802 ? 1_555 S1 ? KA SF4 .   ? 3 SF4 802 ? 1_555 110.8 ? 
86  SG  ? C  CYS 230 ? 3 CYS 230 ? 1_555 FE4 ? KA SF4 . ? 3 SF4 802 ? 1_555 S2 ? KA SF4 .   ? 3 SF4 802 ? 1_555 110.4 ? 
87  S1  ? KA SF4 .   ? 3 SF4 802 ? 1_555 FE4 ? KA SF4 . ? 3 SF4 802 ? 1_555 S2 ? KA SF4 .   ? 3 SF4 802 ? 1_555 105.3 ? 
88  SG  ? C  CYS 230 ? 3 CYS 230 ? 1_555 FE4 ? KA SF4 . ? 3 SF4 802 ? 1_555 S3 ? KA SF4 .   ? 3 SF4 802 ? 1_555 116.2 ? 
89  S1  ? KA SF4 .   ? 3 SF4 802 ? 1_555 FE4 ? KA SF4 . ? 3 SF4 802 ? 1_555 S3 ? KA SF4 .   ? 3 SF4 802 ? 1_555 108.5 ? 
90  S2  ? KA SF4 .   ? 3 SF4 802 ? 1_555 FE4 ? KA SF4 . ? 3 SF4 802 ? 1_555 S3 ? KA SF4 .   ? 3 SF4 802 ? 1_555 105.0 ? 
91  SG  ? C  CYS 256 ? 3 CYS 256 ? 1_555 FE1 ? LA SF4 . ? 3 SF4 803 ? 1_555 S2 ? LA SF4 .   ? 3 SF4 803 ? 1_555 110.3 ? 
92  SG  ? C  CYS 256 ? 3 CYS 256 ? 1_555 FE1 ? LA SF4 . ? 3 SF4 803 ? 1_555 S3 ? LA SF4 .   ? 3 SF4 803 ? 1_555 114.2 ? 
93  S2  ? LA SF4 .   ? 3 SF4 803 ? 1_555 FE1 ? LA SF4 . ? 3 SF4 803 ? 1_555 S3 ? LA SF4 .   ? 3 SF4 803 ? 1_555 107.6 ? 
94  SG  ? C  CYS 256 ? 3 CYS 256 ? 1_555 FE1 ? LA SF4 . ? 3 SF4 803 ? 1_555 S4 ? LA SF4 .   ? 3 SF4 803 ? 1_555 113.8 ? 
95  S2  ? LA SF4 .   ? 3 SF4 803 ? 1_555 FE1 ? LA SF4 . ? 3 SF4 803 ? 1_555 S4 ? LA SF4 .   ? 3 SF4 803 ? 1_555 104.4 ? 
96  S3  ? LA SF4 .   ? 3 SF4 803 ? 1_555 FE1 ? LA SF4 . ? 3 SF4 803 ? 1_555 S4 ? LA SF4 .   ? 3 SF4 803 ? 1_555 105.9 ? 
97  SG  ? C  CYS 259 ? 3 CYS 259 ? 1_555 FE4 ? LA SF4 . ? 3 SF4 803 ? 1_555 S1 ? LA SF4 .   ? 3 SF4 803 ? 1_555 113.9 ? 
98  SG  ? C  CYS 259 ? 3 CYS 259 ? 1_555 FE4 ? LA SF4 . ? 3 SF4 803 ? 1_555 S2 ? LA SF4 .   ? 3 SF4 803 ? 1_555 113.6 ? 
99  S1  ? LA SF4 .   ? 3 SF4 803 ? 1_555 FE4 ? LA SF4 . ? 3 SF4 803 ? 1_555 S2 ? LA SF4 .   ? 3 SF4 803 ? 1_555 103.4 ? 
100 SG  ? C  CYS 259 ? 3 CYS 259 ? 1_555 FE4 ? LA SF4 . ? 3 SF4 803 ? 1_555 S3 ? LA SF4 .   ? 3 SF4 803 ? 1_555 114.6 ? 
101 S1  ? LA SF4 .   ? 3 SF4 803 ? 1_555 FE4 ? LA SF4 . ? 3 SF4 803 ? 1_555 S3 ? LA SF4 .   ? 3 SF4 803 ? 1_555 102.1 ? 
102 S2  ? LA SF4 .   ? 3 SF4 803 ? 1_555 FE4 ? LA SF4 . ? 3 SF4 803 ? 1_555 S3 ? LA SF4 .   ? 3 SF4 803 ? 1_555 108.1 ? 
103 SG  ? C  CYS 263 ? 3 CYS 263 ? 1_555 FE3 ? LA SF4 . ? 3 SF4 803 ? 1_555 S1 ? LA SF4 .   ? 3 SF4 803 ? 1_555 110.6 ? 
104 SG  ? C  CYS 263 ? 3 CYS 263 ? 1_555 FE3 ? LA SF4 . ? 3 SF4 803 ? 1_555 S2 ? LA SF4 .   ? 3 SF4 803 ? 1_555 116.0 ? 
105 S1  ? LA SF4 .   ? 3 SF4 803 ? 1_555 FE3 ? LA SF4 . ? 3 SF4 803 ? 1_555 S2 ? LA SF4 .   ? 3 SF4 803 ? 1_555 102.6 ? 
106 SG  ? C  CYS 263 ? 3 CYS 263 ? 1_555 FE3 ? LA SF4 . ? 3 SF4 803 ? 1_555 S4 ? LA SF4 .   ? 3 SF4 803 ? 1_555 113.2 ? 
107 S1  ? LA SF4 .   ? 3 SF4 803 ? 1_555 FE3 ? LA SF4 . ? 3 SF4 803 ? 1_555 S4 ? LA SF4 .   ? 3 SF4 803 ? 1_555 108.7 ? 
108 S2  ? LA SF4 .   ? 3 SF4 803 ? 1_555 FE3 ? LA SF4 . ? 3 SF4 803 ? 1_555 S4 ? LA SF4 .   ? 3 SF4 803 ? 1_555 104.9 ? 
109 SG  ? C  CYS 291 ? 3 CYS 291 ? 1_555 FE2 ? LA SF4 . ? 3 SF4 803 ? 1_555 S1 ? LA SF4 .   ? 3 SF4 803 ? 1_555 114.3 ? 
110 SG  ? C  CYS 291 ? 3 CYS 291 ? 1_555 FE2 ? LA SF4 . ? 3 SF4 803 ? 1_555 S3 ? LA SF4 .   ? 3 SF4 803 ? 1_555 109.0 ? 
111 S1  ? LA SF4 .   ? 3 SF4 803 ? 1_555 FE2 ? LA SF4 . ? 3 SF4 803 ? 1_555 S3 ? LA SF4 .   ? 3 SF4 803 ? 1_555 101.3 ? 
112 SG  ? C  CYS 291 ? 3 CYS 291 ? 1_555 FE2 ? LA SF4 . ? 3 SF4 803 ? 1_555 S4 ? LA SF4 .   ? 3 SF4 803 ? 1_555 116.8 ? 
113 S1  ? LA SF4 .   ? 3 SF4 803 ? 1_555 FE2 ? LA SF4 . ? 3 SF4 803 ? 1_555 S4 ? LA SF4 .   ? 3 SF4 803 ? 1_555 108.0 ? 
114 S3  ? LA SF4 .   ? 3 SF4 803 ? 1_555 FE2 ? LA SF4 . ? 3 SF4 803 ? 1_555 S4 ? LA SF4 .   ? 3 SF4 803 ? 1_555 105.9 ? 
115 SG  ? F  CYS 45  ? 6 CYS 45  ? 1_555 FE3 ? NA SF4 . ? 6 SF4 201 ? 1_555 S1 ? NA SF4 .   ? 6 SF4 201 ? 1_555 107.4 ? 
116 SG  ? F  CYS 45  ? 6 CYS 45  ? 1_555 FE3 ? NA SF4 . ? 6 SF4 201 ? 1_555 S2 ? NA SF4 .   ? 6 SF4 201 ? 1_555 114.3 ? 
117 S1  ? NA SF4 .   ? 6 SF4 201 ? 1_555 FE3 ? NA SF4 . ? 6 SF4 201 ? 1_555 S2 ? NA SF4 .   ? 6 SF4 201 ? 1_555 104.0 ? 
118 SG  ? F  CYS 45  ? 6 CYS 45  ? 1_555 FE3 ? NA SF4 . ? 6 SF4 201 ? 1_555 S4 ? NA SF4 .   ? 6 SF4 201 ? 1_555 117.5 ? 
119 S1  ? NA SF4 .   ? 6 SF4 201 ? 1_555 FE3 ? NA SF4 . ? 6 SF4 201 ? 1_555 S4 ? NA SF4 .   ? 6 SF4 201 ? 1_555 109.5 ? 
120 S2  ? NA SF4 .   ? 6 SF4 201 ? 1_555 FE3 ? NA SF4 . ? 6 SF4 201 ? 1_555 S4 ? NA SF4 .   ? 6 SF4 201 ? 1_555 103.4 ? 
121 SG  ? F  CYS 46  ? 6 CYS 46  ? 1_555 FE2 ? NA SF4 . ? 6 SF4 201 ? 1_555 S1 ? NA SF4 .   ? 6 SF4 201 ? 1_555 112.8 ? 
122 SG  ? F  CYS 46  ? 6 CYS 46  ? 1_555 FE2 ? NA SF4 . ? 6 SF4 201 ? 1_555 S3 ? NA SF4 .   ? 6 SF4 201 ? 1_555 115.4 ? 
123 S1  ? NA SF4 .   ? 6 SF4 201 ? 1_555 FE2 ? NA SF4 . ? 6 SF4 201 ? 1_555 S3 ? NA SF4 .   ? 6 SF4 201 ? 1_555 102.7 ? 
124 SG  ? F  CYS 46  ? 6 CYS 46  ? 1_555 FE2 ? NA SF4 . ? 6 SF4 201 ? 1_555 S4 ? NA SF4 .   ? 6 SF4 201 ? 1_555 110.6 ? 
125 S1  ? NA SF4 .   ? 6 SF4 201 ? 1_555 FE2 ? NA SF4 . ? 6 SF4 201 ? 1_555 S4 ? NA SF4 .   ? 6 SF4 201 ? 1_555 107.5 ? 
126 S3  ? NA SF4 .   ? 6 SF4 201 ? 1_555 FE2 ? NA SF4 . ? 6 SF4 201 ? 1_555 S4 ? NA SF4 .   ? 6 SF4 201 ? 1_555 107.2 ? 
127 SG  ? F  CYS 111 ? 6 CYS 111 ? 1_555 FE1 ? NA SF4 . ? 6 SF4 201 ? 1_555 S2 ? NA SF4 .   ? 6 SF4 201 ? 1_555 112.4 ? 
128 SG  ? F  CYS 111 ? 6 CYS 111 ? 1_555 FE1 ? NA SF4 . ? 6 SF4 201 ? 1_555 S3 ? NA SF4 .   ? 6 SF4 201 ? 1_555 104.5 ? 
129 S2  ? NA SF4 .   ? 6 SF4 201 ? 1_555 FE1 ? NA SF4 . ? 6 SF4 201 ? 1_555 S3 ? NA SF4 .   ? 6 SF4 201 ? 1_555 108.7 ? 
130 SG  ? F  CYS 111 ? 6 CYS 111 ? 1_555 FE1 ? NA SF4 . ? 6 SF4 201 ? 1_555 S4 ? NA SF4 .   ? 6 SF4 201 ? 1_555 121.4 ? 
131 S2  ? NA SF4 .   ? 6 SF4 201 ? 1_555 FE1 ? NA SF4 . ? 6 SF4 201 ? 1_555 S4 ? NA SF4 .   ? 6 SF4 201 ? 1_555 101.8 ? 
132 S3  ? NA SF4 .   ? 6 SF4 201 ? 1_555 FE1 ? NA SF4 . ? 6 SF4 201 ? 1_555 S4 ? NA SF4 .   ? 6 SF4 201 ? 1_555 107.5 ? 
133 SG  ? F  CYS 140 ? 6 CYS 140 ? 1_555 FE4 ? NA SF4 . ? 6 SF4 201 ? 1_555 S1 ? NA SF4 .   ? 6 SF4 201 ? 1_555 115.5 ? 
134 SG  ? F  CYS 140 ? 6 CYS 140 ? 1_555 FE4 ? NA SF4 . ? 6 SF4 201 ? 1_555 S2 ? NA SF4 .   ? 6 SF4 201 ? 1_555 113.5 ? 
135 S1  ? NA SF4 .   ? 6 SF4 201 ? 1_555 FE4 ? NA SF4 . ? 6 SF4 201 ? 1_555 S2 ? NA SF4 .   ? 6 SF4 201 ? 1_555 102.3 ? 
136 SG  ? F  CYS 140 ? 6 CYS 140 ? 1_555 FE4 ? NA SF4 . ? 6 SF4 201 ? 1_555 S3 ? NA SF4 .   ? 6 SF4 201 ? 1_555 112.8 ? 
137 S1  ? NA SF4 .   ? 6 SF4 201 ? 1_555 FE4 ? NA SF4 . ? 6 SF4 201 ? 1_555 S3 ? NA SF4 .   ? 6 SF4 201 ? 1_555 103.0 ? 
138 S2  ? NA SF4 .   ? 6 SF4 201 ? 1_555 FE4 ? NA SF4 . ? 6 SF4 201 ? 1_555 S3 ? NA SF4 .   ? 6 SF4 201 ? 1_555 108.7 ? 
139 SG  ? G  CYS 53  ? 9 CYS 53  ? 1_555 FE3 ? PA SF4 . ? 9 SF4 202 ? 1_555 S1 ? PA SF4 .   ? 9 SF4 202 ? 1_555 109.3 ? 
140 SG  ? G  CYS 53  ? 9 CYS 53  ? 1_555 FE3 ? PA SF4 . ? 9 SF4 202 ? 1_555 S2 ? PA SF4 .   ? 9 SF4 202 ? 1_555 122.3 ? 
141 S1  ? PA SF4 .   ? 9 SF4 202 ? 1_555 FE3 ? PA SF4 . ? 9 SF4 202 ? 1_555 S2 ? PA SF4 .   ? 9 SF4 202 ? 1_555 102.5 ? 
142 SG  ? G  CYS 53  ? 9 CYS 53  ? 1_555 FE3 ? PA SF4 . ? 9 SF4 202 ? 1_555 S4 ? PA SF4 .   ? 9 SF4 202 ? 1_555 108.9 ? 
143 S1  ? PA SF4 .   ? 9 SF4 202 ? 1_555 FE3 ? PA SF4 . ? 9 SF4 202 ? 1_555 S4 ? PA SF4 .   ? 9 SF4 202 ? 1_555 105.5 ? 
144 S2  ? PA SF4 .   ? 9 SF4 202 ? 1_555 FE3 ? PA SF4 . ? 9 SF4 202 ? 1_555 S4 ? PA SF4 .   ? 9 SF4 202 ? 1_555 107.2 ? 
145 SG  ? G  CYS 56  ? 9 CYS 56  ? 1_555 FE4 ? PA SF4 . ? 9 SF4 202 ? 1_555 S1 ? PA SF4 .   ? 9 SF4 202 ? 1_555 114.8 ? 
146 SG  ? G  CYS 56  ? 9 CYS 56  ? 1_555 FE4 ? PA SF4 . ? 9 SF4 202 ? 1_555 S2 ? PA SF4 .   ? 9 SF4 202 ? 1_555 120.6 ? 
147 S1  ? PA SF4 .   ? 9 SF4 202 ? 1_555 FE4 ? PA SF4 . ? 9 SF4 202 ? 1_555 S2 ? PA SF4 .   ? 9 SF4 202 ? 1_555 103.0 ? 
148 SG  ? G  CYS 56  ? 9 CYS 56  ? 1_555 FE4 ? PA SF4 . ? 9 SF4 202 ? 1_555 S3 ? PA SF4 .   ? 9 SF4 202 ? 1_555 105.5 ? 
149 S1  ? PA SF4 .   ? 9 SF4 202 ? 1_555 FE4 ? PA SF4 . ? 9 SF4 202 ? 1_555 S3 ? PA SF4 .   ? 9 SF4 202 ? 1_555 102.8 ? 
150 S2  ? PA SF4 .   ? 9 SF4 202 ? 1_555 FE4 ? PA SF4 . ? 9 SF4 202 ? 1_555 S3 ? PA SF4 .   ? 9 SF4 202 ? 1_555 108.7 ? 
151 SG  ? G  CYS 59  ? 9 CYS 59  ? 1_555 FE2 ? PA SF4 . ? 9 SF4 202 ? 1_555 S1 ? PA SF4 .   ? 9 SF4 202 ? 1_555 115.5 ? 
152 SG  ? G  CYS 59  ? 9 CYS 59  ? 1_555 FE2 ? PA SF4 . ? 9 SF4 202 ? 1_555 S3 ? PA SF4 .   ? 9 SF4 202 ? 1_555 109.2 ? 
153 S1  ? PA SF4 .   ? 9 SF4 202 ? 1_555 FE2 ? PA SF4 . ? 9 SF4 202 ? 1_555 S3 ? PA SF4 .   ? 9 SF4 202 ? 1_555 103.1 ? 
154 SG  ? G  CYS 59  ? 9 CYS 59  ? 1_555 FE2 ? PA SF4 . ? 9 SF4 202 ? 1_555 S4 ? PA SF4 .   ? 9 SF4 202 ? 1_555 115.9 ? 
155 S1  ? PA SF4 .   ? 9 SF4 202 ? 1_555 FE2 ? PA SF4 . ? 9 SF4 202 ? 1_555 S4 ? PA SF4 .   ? 9 SF4 202 ? 1_555 105.4 ? 
156 S3  ? PA SF4 .   ? 9 SF4 202 ? 1_555 FE2 ? PA SF4 . ? 9 SF4 202 ? 1_555 S4 ? PA SF4 .   ? 9 SF4 202 ? 1_555 106.6 ? 
157 SG  ? G  CYS 63  ? 9 CYS 63  ? 1_555 FE4 ? OA SF4 . ? 9 SF4 201 ? 1_555 S1 ? OA SF4 .   ? 9 SF4 201 ? 1_555 119.4 ? 
158 SG  ? G  CYS 63  ? 9 CYS 63  ? 1_555 FE4 ? OA SF4 . ? 9 SF4 201 ? 1_555 S2 ? OA SF4 .   ? 9 SF4 201 ? 1_555 113.7 ? 
159 S1  ? OA SF4 .   ? 9 SF4 201 ? 1_555 FE4 ? OA SF4 . ? 9 SF4 201 ? 1_555 S2 ? OA SF4 .   ? 9 SF4 201 ? 1_555 104.4 ? 
160 SG  ? G  CYS 63  ? 9 CYS 63  ? 1_555 FE4 ? OA SF4 . ? 9 SF4 201 ? 1_555 S3 ? OA SF4 .   ? 9 SF4 201 ? 1_555 108.4 ? 
161 S1  ? OA SF4 .   ? 9 SF4 201 ? 1_555 FE4 ? OA SF4 . ? 9 SF4 201 ? 1_555 S3 ? OA SF4 .   ? 9 SF4 201 ? 1_555 101.8 ? 
162 S2  ? OA SF4 .   ? 9 SF4 201 ? 1_555 FE4 ? OA SF4 . ? 9 SF4 201 ? 1_555 S3 ? OA SF4 .   ? 9 SF4 201 ? 1_555 108.3 ? 
163 SG  ? G  CYS 98  ? 9 CYS 98  ? 1_555 FE2 ? OA SF4 . ? 9 SF4 201 ? 1_555 S1 ? OA SF4 .   ? 9 SF4 201 ? 1_555 119.0 ? 
164 SG  ? G  CYS 98  ? 9 CYS 98  ? 1_555 FE2 ? OA SF4 . ? 9 SF4 201 ? 1_555 S3 ? OA SF4 .   ? 9 SF4 201 ? 1_555 111.3 ? 
165 S1  ? OA SF4 .   ? 9 SF4 201 ? 1_555 FE2 ? OA SF4 . ? 9 SF4 201 ? 1_555 S3 ? OA SF4 .   ? 9 SF4 201 ? 1_555 102.4 ? 
166 SG  ? G  CYS 98  ? 9 CYS 98  ? 1_555 FE2 ? OA SF4 . ? 9 SF4 201 ? 1_555 S4 ? OA SF4 .   ? 9 SF4 201 ? 1_555 113.2 ? 
167 S1  ? OA SF4 .   ? 9 SF4 201 ? 1_555 FE2 ? OA SF4 . ? 9 SF4 201 ? 1_555 S4 ? OA SF4 .   ? 9 SF4 201 ? 1_555 104.8 ? 
168 S3  ? OA SF4 .   ? 9 SF4 201 ? 1_555 FE2 ? OA SF4 . ? 9 SF4 201 ? 1_555 S4 ? OA SF4 .   ? 9 SF4 201 ? 1_555 104.7 ? 
169 SG  ? G  CYS 101 ? 9 CYS 101 ? 1_555 FE1 ? OA SF4 . ? 9 SF4 201 ? 1_555 S2 ? OA SF4 .   ? 9 SF4 201 ? 1_555 116.2 ? 
170 SG  ? G  CYS 101 ? 9 CYS 101 ? 1_555 FE1 ? OA SF4 . ? 9 SF4 201 ? 1_555 S3 ? OA SF4 .   ? 9 SF4 201 ? 1_555 105.0 ? 
171 S2  ? OA SF4 .   ? 9 SF4 201 ? 1_555 FE1 ? OA SF4 . ? 9 SF4 201 ? 1_555 S3 ? OA SF4 .   ? 9 SF4 201 ? 1_555 107.3 ? 
172 SG  ? G  CYS 101 ? 9 CYS 101 ? 1_555 FE1 ? OA SF4 . ? 9 SF4 201 ? 1_555 S4 ? OA SF4 .   ? 9 SF4 201 ? 1_555 115.6 ? 
173 S2  ? OA SF4 .   ? 9 SF4 201 ? 1_555 FE1 ? OA SF4 . ? 9 SF4 201 ? 1_555 S4 ? OA SF4 .   ? 9 SF4 201 ? 1_555 108.0 ? 
174 S3  ? OA SF4 .   ? 9 SF4 201 ? 1_555 FE1 ? OA SF4 . ? 9 SF4 201 ? 1_555 S4 ? OA SF4 .   ? 9 SF4 201 ? 1_555 103.6 ? 
175 SG  ? G  CYS 104 ? 9 CYS 104 ? 1_555 FE3 ? OA SF4 . ? 9 SF4 201 ? 1_555 S1 ? OA SF4 .   ? 9 SF4 201 ? 1_555 116.6 ? 
176 SG  ? G  CYS 104 ? 9 CYS 104 ? 1_555 FE3 ? OA SF4 . ? 9 SF4 201 ? 1_555 S2 ? OA SF4 .   ? 9 SF4 201 ? 1_555 115.2 ? 
177 S1  ? OA SF4 .   ? 9 SF4 201 ? 1_555 FE3 ? OA SF4 . ? 9 SF4 201 ? 1_555 S2 ? OA SF4 .   ? 9 SF4 201 ? 1_555 104.6 ? 
178 SG  ? G  CYS 104 ? 9 CYS 104 ? 1_555 FE3 ? OA SF4 . ? 9 SF4 201 ? 1_555 S4 ? OA SF4 .   ? 9 SF4 201 ? 1_555 106.6 ? 
179 S1  ? OA SF4 .   ? 9 SF4 201 ? 1_555 FE3 ? OA SF4 . ? 9 SF4 201 ? 1_555 S4 ? OA SF4 .   ? 9 SF4 201 ? 1_555 104.1 ? 
180 S2  ? OA SF4 .   ? 9 SF4 201 ? 1_555 FE3 ? OA SF4 . ? 9 SF4 201 ? 1_555 S4 ? OA SF4 .   ? 9 SF4 201 ? 1_555 109.1 ? 
181 SG  ? G  CYS 108 ? 9 CYS 108 ? 1_555 FE1 ? PA SF4 . ? 9 SF4 202 ? 1_555 S2 ? PA SF4 .   ? 9 SF4 202 ? 1_555 110.4 ? 
182 SG  ? G  CYS 108 ? 9 CYS 108 ? 1_555 FE1 ? PA SF4 . ? 9 SF4 202 ? 1_555 S3 ? PA SF4 .   ? 9 SF4 202 ? 1_555 114.6 ? 
183 S2  ? PA SF4 .   ? 9 SF4 202 ? 1_555 FE1 ? PA SF4 . ? 9 SF4 202 ? 1_555 S3 ? PA SF4 .   ? 9 SF4 202 ? 1_555 107.4 ? 
184 SG  ? G  CYS 108 ? 9 CYS 108 ? 1_555 FE1 ? PA SF4 . ? 9 SF4 202 ? 1_555 S4 ? PA SF4 .   ? 9 SF4 202 ? 1_555 112.0 ? 
185 S2  ? PA SF4 .   ? 9 SF4 202 ? 1_555 FE1 ? PA SF4 . ? 9 SF4 202 ? 1_555 S4 ? PA SF4 .   ? 9 SF4 202 ? 1_555 107.0 ? 
186 S3  ? PA SF4 .   ? 9 SF4 202 ? 1_555 FE1 ? PA SF4 . ? 9 SF4 202 ? 1_555 S4 ? PA SF4 .   ? 9 SF4 202 ? 1_555 105.0 ? 
187 SG  ? Q  CYS 353 ? B CYS 353 ? 1_555 FE4 ? QA SF4 . ? B SF4 501 ? 1_555 S1 ? QA SF4 .   ? B SF4 501 ? 1_555 114.8 ? 
188 SG  ? Q  CYS 353 ? B CYS 353 ? 1_555 FE4 ? QA SF4 . ? B SF4 501 ? 1_555 S2 ? QA SF4 .   ? B SF4 501 ? 1_555 110.1 ? 
189 S1  ? QA SF4 .   ? B SF4 501 ? 1_555 FE4 ? QA SF4 . ? B SF4 501 ? 1_555 S2 ? QA SF4 .   ? B SF4 501 ? 1_555 108.0 ? 
190 SG  ? Q  CYS 353 ? B CYS 353 ? 1_555 FE4 ? QA SF4 . ? B SF4 501 ? 1_555 S3 ? QA SF4 .   ? B SF4 501 ? 1_555 117.6 ? 
191 S1  ? QA SF4 .   ? B SF4 501 ? 1_555 FE4 ? QA SF4 . ? B SF4 501 ? 1_555 S3 ? QA SF4 .   ? B SF4 501 ? 1_555 104.0 ? 
192 S2  ? QA SF4 .   ? B SF4 501 ? 1_555 FE4 ? QA SF4 . ? B SF4 501 ? 1_555 S3 ? QA SF4 .   ? B SF4 501 ? 1_555 101.1 ? 
193 SG  ? Q  CYS 356 ? B CYS 356 ? 1_555 FE1 ? QA SF4 . ? B SF4 501 ? 1_555 S2 ? QA SF4 .   ? B SF4 501 ? 1_555 120.1 ? 
194 SG  ? Q  CYS 356 ? B CYS 356 ? 1_555 FE1 ? QA SF4 . ? B SF4 501 ? 1_555 S3 ? QA SF4 .   ? B SF4 501 ? 1_555 113.4 ? 
195 S2  ? QA SF4 .   ? B SF4 501 ? 1_555 FE1 ? QA SF4 . ? B SF4 501 ? 1_555 S3 ? QA SF4 .   ? B SF4 501 ? 1_555 101.2 ? 
196 SG  ? Q  CYS 356 ? B CYS 356 ? 1_555 FE1 ? QA SF4 . ? B SF4 501 ? 1_555 S4 ? QA SF4 .   ? B SF4 501 ? 1_555 107.1 ? 
197 S2  ? QA SF4 .   ? B SF4 501 ? 1_555 FE1 ? QA SF4 . ? B SF4 501 ? 1_555 S4 ? QA SF4 .   ? B SF4 501 ? 1_555 106.6 ? 
198 S3  ? QA SF4 .   ? B SF4 501 ? 1_555 FE1 ? QA SF4 . ? B SF4 501 ? 1_555 S4 ? QA SF4 .   ? B SF4 501 ? 1_555 107.7 ? 
199 SG  ? Q  CYS 359 ? B CYS 359 ? 1_555 FE2 ? QA SF4 . ? B SF4 501 ? 1_555 S1 ? QA SF4 .   ? B SF4 501 ? 1_555 126.8 ? 
200 SG  ? Q  CYS 359 ? B CYS 359 ? 1_555 FE2 ? QA SF4 . ? B SF4 501 ? 1_555 S3 ? QA SF4 .   ? B SF4 501 ? 1_555 111.0 ? 
201 S1  ? QA SF4 .   ? B SF4 501 ? 1_555 FE2 ? QA SF4 . ? B SF4 501 ? 1_555 S3 ? QA SF4 .   ? B SF4 501 ? 1_555 103.7 ? 
202 SG  ? Q  CYS 359 ? B CYS 359 ? 1_555 FE2 ? QA SF4 . ? B SF4 501 ? 1_555 S4 ? QA SF4 .   ? B SF4 501 ? 1_555 100.3 ? 
203 S1  ? QA SF4 .   ? B SF4 501 ? 1_555 FE2 ? QA SF4 . ? B SF4 501 ? 1_555 S4 ? QA SF4 .   ? B SF4 501 ? 1_555 106.2 ? 
204 S3  ? QA SF4 .   ? B SF4 501 ? 1_555 FE2 ? QA SF4 . ? B SF4 501 ? 1_555 S4 ? QA SF4 .   ? B SF4 501 ? 1_555 107.6 ? 
205 SG  ? Q  CYS 400 ? B CYS 400 ? 1_555 FE3 ? QA SF4 . ? B SF4 501 ? 1_555 S1 ? QA SF4 .   ? B SF4 501 ? 1_555 113.5 ? 
206 SG  ? Q  CYS 400 ? B CYS 400 ? 1_555 FE3 ? QA SF4 . ? B SF4 501 ? 1_555 S2 ? QA SF4 .   ? B SF4 501 ? 1_555 112.6 ? 
207 S1  ? QA SF4 .   ? B SF4 501 ? 1_555 FE3 ? QA SF4 . ? B SF4 501 ? 1_555 S2 ? QA SF4 .   ? B SF4 501 ? 1_555 107.3 ? 
208 SG  ? Q  CYS 400 ? B CYS 400 ? 1_555 FE3 ? QA SF4 . ? B SF4 501 ? 1_555 S4 ? QA SF4 .   ? B SF4 501 ? 1_555 111.0 ? 
209 S1  ? QA SF4 .   ? B SF4 501 ? 1_555 FE3 ? QA SF4 . ? B SF4 501 ? 1_555 S4 ? QA SF4 .   ? B SF4 501 ? 1_555 105.9 ? 
210 S2  ? QA SF4 .   ? B SF4 501 ? 1_555 FE3 ? QA SF4 . ? B SF4 501 ? 1_555 S4 ? QA SF4 .   ? B SF4 501 ? 1_555 106.0 ? 
211 SG  ? R  CYS 83  ? C CYS 83  ? 1_555 FE1 ? SA FES . ? C FES 201 ? 1_555 S1 ? SA FES .   ? C FES 201 ? 1_555 109.5 ? 
212 SG  ? R  CYS 83  ? C CYS 83  ? 1_555 FE1 ? SA FES . ? C FES 201 ? 1_555 S2 ? SA FES .   ? C FES 201 ? 1_555 120.0 ? 
213 S1  ? SA FES .   ? C FES 201 ? 1_555 FE1 ? SA FES . ? C FES 201 ? 1_555 S2 ? SA FES .   ? C FES 201 ? 1_555 90.2  ? 
214 SG  ? R  CYS 83  ? C CYS 83  ? 1_555 FE1 ? SA FES . ? C FES 201 ? 1_555 SG ? R  CYS 88  ? C CYS 88  ? 1_555 106.8 ? 
215 S1  ? SA FES .   ? C FES 201 ? 1_555 FE1 ? SA FES . ? C FES 201 ? 1_555 SG ? R  CYS 88  ? C CYS 88  ? 1_555 115.9 ? 
216 S2  ? SA FES .   ? C FES 201 ? 1_555 FE1 ? SA FES . ? C FES 201 ? 1_555 SG ? R  CYS 88  ? C CYS 88  ? 1_555 114.1 ? 
217 SG  ? R  CYS 124 ? C CYS 124 ? 1_555 FE2 ? SA FES . ? C FES 201 ? 1_555 S1 ? SA FES .   ? C FES 201 ? 1_555 107.7 ? 
218 SG  ? R  CYS 124 ? C CYS 124 ? 1_555 FE2 ? SA FES . ? C FES 201 ? 1_555 S2 ? SA FES .   ? C FES 201 ? 1_555 116.4 ? 
219 S1  ? SA FES .   ? C FES 201 ? 1_555 FE2 ? SA FES . ? C FES 201 ? 1_555 S2 ? SA FES .   ? C FES 201 ? 1_555 90.3  ? 
220 SG  ? R  CYS 124 ? C CYS 124 ? 1_555 FE2 ? SA FES . ? C FES 201 ? 1_555 SG ? R  CYS 128 ? C CYS 128 ? 1_555 116.1 ? 
221 S1  ? SA FES .   ? C FES 201 ? 1_555 FE2 ? SA FES . ? C FES 201 ? 1_555 SG ? R  CYS 128 ? C CYS 128 ? 1_555 114.2 ? 
222 S2  ? SA FES .   ? C FES 201 ? 1_555 FE2 ? SA FES . ? C FES 201 ? 1_555 SG ? R  CYS 128 ? C CYS 128 ? 1_555 109.5 ? 
223 SG  ? S  CYS 34  ? D CYS 34  ? 1_555 FE1 ? WA FES . ? D FES 804 ? 1_555 S1 ? WA FES .   ? D FES 804 ? 1_555 107.3 ? 
224 SG  ? S  CYS 34  ? D CYS 34  ? 1_555 FE1 ? WA FES . ? D FES 804 ? 1_555 S2 ? WA FES .   ? D FES 804 ? 1_555 112.7 ? 
225 S1  ? WA FES .   ? D FES 804 ? 1_555 FE1 ? WA FES . ? D FES 804 ? 1_555 S2 ? WA FES .   ? D FES 804 ? 1_555 89.9  ? 
226 SG  ? S  CYS 34  ? D CYS 34  ? 1_555 FE1 ? WA FES . ? D FES 804 ? 1_555 SG ? S  CYS 45  ? D CYS 45  ? 1_555 119.7 ? 
227 S1  ? WA FES .   ? D FES 804 ? 1_555 FE1 ? WA FES . ? D FES 804 ? 1_555 SG ? S  CYS 45  ? D CYS 45  ? 1_555 112.2 ? 
228 S2  ? WA FES .   ? D FES 804 ? 1_555 FE1 ? WA FES . ? D FES 804 ? 1_555 SG ? S  CYS 45  ? D CYS 45  ? 1_555 111.0 ? 
229 SG  ? S  CYS 48  ? D CYS 48  ? 1_555 FE2 ? WA FES . ? D FES 804 ? 1_555 S1 ? WA FES .   ? D FES 804 ? 1_555 115.1 ? 
230 SG  ? S  CYS 48  ? D CYS 48  ? 1_555 FE2 ? WA FES . ? D FES 804 ? 1_555 S2 ? WA FES .   ? D FES 804 ? 1_555 113.2 ? 
231 S1  ? WA FES .   ? D FES 804 ? 1_555 FE2 ? WA FES . ? D FES 804 ? 1_555 S2 ? WA FES .   ? D FES 804 ? 1_555 90.1  ? 
232 SG  ? S  CYS 48  ? D CYS 48  ? 1_555 FE2 ? WA FES . ? D FES 804 ? 1_555 SG ? S  CYS 83  ? D CYS 83  ? 1_555 110.0 ? 
233 S1  ? WA FES .   ? D FES 804 ? 1_555 FE2 ? WA FES . ? D FES 804 ? 1_555 SG ? S  CYS 83  ? D CYS 83  ? 1_555 110.0 ? 
234 S2  ? WA FES .   ? D FES 804 ? 1_555 FE2 ? WA FES . ? D FES 804 ? 1_555 SG ? S  CYS 83  ? D CYS 83  ? 1_555 117.3 ? 
235 NE2 ? S  HIS 115 ? D HIS 115 ? 1_555 FE3 ? TA SF4 . ? D SF4 801 ? 1_555 S1 ? TA SF4 .   ? D SF4 801 ? 1_555 119.1 ? 
236 NE2 ? S  HIS 115 ? D HIS 115 ? 1_555 FE3 ? TA SF4 . ? D SF4 801 ? 1_555 S2 ? TA SF4 .   ? D SF4 801 ? 1_555 91.2  ? 
237 S1  ? TA SF4 .   ? D SF4 801 ? 1_555 FE3 ? TA SF4 . ? D SF4 801 ? 1_555 S2 ? TA SF4 .   ? D SF4 801 ? 1_555 103.2 ? 
238 NE2 ? S  HIS 115 ? D HIS 115 ? 1_555 FE3 ? TA SF4 . ? D SF4 801 ? 1_555 S4 ? TA SF4 .   ? D SF4 801 ? 1_555 124.1 ? 
239 S1  ? TA SF4 .   ? D SF4 801 ? 1_555 FE3 ? TA SF4 . ? D SF4 801 ? 1_555 S4 ? TA SF4 .   ? D SF4 801 ? 1_555 108.4 ? 
240 S2  ? TA SF4 .   ? D SF4 801 ? 1_555 FE3 ? TA SF4 . ? D SF4 801 ? 1_555 S4 ? TA SF4 .   ? D SF4 801 ? 1_555 105.5 ? 
241 SG  ? S  CYS 119 ? D CYS 119 ? 1_555 FE2 ? TA SF4 . ? D SF4 801 ? 1_555 S1 ? TA SF4 .   ? D SF4 801 ? 1_555 110.3 ? 
242 SG  ? S  CYS 119 ? D CYS 119 ? 1_555 FE2 ? TA SF4 . ? D SF4 801 ? 1_555 S3 ? TA SF4 .   ? D SF4 801 ? 1_555 120.1 ? 
243 S1  ? TA SF4 .   ? D SF4 801 ? 1_555 FE2 ? TA SF4 . ? D SF4 801 ? 1_555 S3 ? TA SF4 .   ? D SF4 801 ? 1_555 104.5 ? 
244 SG  ? S  CYS 119 ? D CYS 119 ? 1_555 FE2 ? TA SF4 . ? D SF4 801 ? 1_555 S4 ? TA SF4 .   ? D SF4 801 ? 1_555 109.0 ? 
245 S1  ? TA SF4 .   ? D SF4 801 ? 1_555 FE2 ? TA SF4 . ? D SF4 801 ? 1_555 S4 ? TA SF4 .   ? D SF4 801 ? 1_555 108.8 ? 
246 S3  ? TA SF4 .   ? D SF4 801 ? 1_555 FE2 ? TA SF4 . ? D SF4 801 ? 1_555 S4 ? TA SF4 .   ? D SF4 801 ? 1_555 103.5 ? 
247 SG  ? S  CYS 122 ? D CYS 122 ? 1_555 FE4 ? TA SF4 . ? D SF4 801 ? 1_555 S1 ? TA SF4 .   ? D SF4 801 ? 1_555 112.3 ? 
248 SG  ? S  CYS 122 ? D CYS 122 ? 1_555 FE4 ? TA SF4 . ? D SF4 801 ? 1_555 S2 ? TA SF4 .   ? D SF4 801 ? 1_555 113.3 ? 
249 S1  ? TA SF4 .   ? D SF4 801 ? 1_555 FE4 ? TA SF4 . ? D SF4 801 ? 1_555 S2 ? TA SF4 .   ? D SF4 801 ? 1_555 103.5 ? 
250 SG  ? S  CYS 122 ? D CYS 122 ? 1_555 FE4 ? TA SF4 . ? D SF4 801 ? 1_555 S3 ? TA SF4 .   ? D SF4 801 ? 1_555 115.4 ? 
251 S1  ? TA SF4 .   ? D SF4 801 ? 1_555 FE4 ? TA SF4 . ? D SF4 801 ? 1_555 S3 ? TA SF4 .   ? D SF4 801 ? 1_555 104.5 ? 
252 S2  ? TA SF4 .   ? D SF4 801 ? 1_555 FE4 ? TA SF4 . ? D SF4 801 ? 1_555 S3 ? TA SF4 .   ? D SF4 801 ? 1_555 106.7 ? 
253 SG  ? S  CYS 128 ? D CYS 128 ? 1_555 FE1 ? TA SF4 . ? D SF4 801 ? 1_555 S2 ? TA SF4 .   ? D SF4 801 ? 1_555 110.3 ? 
254 SG  ? S  CYS 128 ? D CYS 128 ? 1_555 FE1 ? TA SF4 . ? D SF4 801 ? 1_555 S3 ? TA SF4 .   ? D SF4 801 ? 1_555 117.4 ? 
255 S2  ? TA SF4 .   ? D SF4 801 ? 1_555 FE1 ? TA SF4 . ? D SF4 801 ? 1_555 S3 ? TA SF4 .   ? D SF4 801 ? 1_555 106.4 ? 
256 SG  ? S  CYS 128 ? D CYS 128 ? 1_555 FE1 ? TA SF4 . ? D SF4 801 ? 1_555 S4 ? TA SF4 .   ? D SF4 801 ? 1_555 112.2 ? 
257 S2  ? TA SF4 .   ? D SF4 801 ? 1_555 FE1 ? TA SF4 . ? D SF4 801 ? 1_555 S4 ? TA SF4 .   ? D SF4 801 ? 1_555 106.3 ? 
258 S3  ? TA SF4 .   ? D SF4 801 ? 1_555 FE1 ? TA SF4 . ? D SF4 801 ? 1_555 S4 ? TA SF4 .   ? D SF4 801 ? 1_555 103.5 ? 
259 SG  ? S  CYS 181 ? D CYS 181 ? 1_555 FE2 ? UA SF4 . ? D SF4 802 ? 1_555 S1 ? UA SF4 .   ? D SF4 802 ? 1_555 110.4 ? 
260 SG  ? S  CYS 181 ? D CYS 181 ? 1_555 FE2 ? UA SF4 . ? D SF4 802 ? 1_555 S3 ? UA SF4 .   ? D SF4 802 ? 1_555 116.1 ? 
261 S1  ? UA SF4 .   ? D SF4 802 ? 1_555 FE2 ? UA SF4 . ? D SF4 802 ? 1_555 S3 ? UA SF4 .   ? D SF4 802 ? 1_555 108.6 ? 
262 SG  ? S  CYS 181 ? D CYS 181 ? 1_555 FE2 ? UA SF4 . ? D SF4 802 ? 1_555 S4 ? UA SF4 .   ? D SF4 802 ? 1_555 111.7 ? 
263 S1  ? UA SF4 .   ? D SF4 802 ? 1_555 FE2 ? UA SF4 . ? D SF4 802 ? 1_555 S4 ? UA SF4 .   ? D SF4 802 ? 1_555 105.7 ? 
264 S3  ? UA SF4 .   ? D SF4 802 ? 1_555 FE2 ? UA SF4 . ? D SF4 802 ? 1_555 S4 ? UA SF4 .   ? D SF4 802 ? 1_555 103.7 ? 
265 SG  ? S  CYS 184 ? D CYS 184 ? 1_555 FE1 ? UA SF4 . ? D SF4 802 ? 1_555 S2 ? UA SF4 .   ? D SF4 802 ? 1_555 111.1 ? 
266 SG  ? S  CYS 184 ? D CYS 184 ? 1_555 FE1 ? UA SF4 . ? D SF4 802 ? 1_555 S3 ? UA SF4 .   ? D SF4 802 ? 1_555 118.9 ? 
267 S2  ? UA SF4 .   ? D SF4 802 ? 1_555 FE1 ? UA SF4 . ? D SF4 802 ? 1_555 S3 ? UA SF4 .   ? D SF4 802 ? 1_555 105.9 ? 
268 SG  ? S  CYS 184 ? D CYS 184 ? 1_555 FE1 ? UA SF4 . ? D SF4 802 ? 1_555 S4 ? UA SF4 .   ? D SF4 802 ? 1_555 112.9 ? 
269 S2  ? UA SF4 .   ? D SF4 802 ? 1_555 FE1 ? UA SF4 . ? D SF4 802 ? 1_555 S4 ? UA SF4 .   ? D SF4 802 ? 1_555 102.0 ? 
270 S3  ? UA SF4 .   ? D SF4 802 ? 1_555 FE1 ? UA SF4 . ? D SF4 802 ? 1_555 S4 ? UA SF4 .   ? D SF4 802 ? 1_555 104.5 ? 
271 SG  ? S  CYS 187 ? D CYS 187 ? 1_555 FE3 ? UA SF4 . ? D SF4 802 ? 1_555 S1 ? UA SF4 .   ? D SF4 802 ? 1_555 119.3 ? 
272 SG  ? S  CYS 187 ? D CYS 187 ? 1_555 FE3 ? UA SF4 . ? D SF4 802 ? 1_555 S2 ? UA SF4 .   ? D SF4 802 ? 1_555 111.0 ? 
273 S1  ? UA SF4 .   ? D SF4 802 ? 1_555 FE3 ? UA SF4 . ? D SF4 802 ? 1_555 S2 ? UA SF4 .   ? D SF4 802 ? 1_555 105.7 ? 
274 SG  ? S  CYS 187 ? D CYS 187 ? 1_555 FE3 ? UA SF4 . ? D SF4 802 ? 1_555 S4 ? UA SF4 .   ? D SF4 802 ? 1_555 111.2 ? 
275 S1  ? UA SF4 .   ? D SF4 802 ? 1_555 FE3 ? UA SF4 . ? D SF4 802 ? 1_555 S4 ? UA SF4 .   ? D SF4 802 ? 1_555 106.0 ? 
276 S2  ? UA SF4 .   ? D SF4 802 ? 1_555 FE3 ? UA SF4 . ? D SF4 802 ? 1_555 S4 ? UA SF4 .   ? D SF4 802 ? 1_555 102.0 ? 
277 SG  ? S  CYS 230 ? D CYS 230 ? 1_555 FE4 ? UA SF4 . ? D SF4 802 ? 1_555 S1 ? UA SF4 .   ? D SF4 802 ? 1_555 111.9 ? 
278 SG  ? S  CYS 230 ? D CYS 230 ? 1_555 FE4 ? UA SF4 . ? D SF4 802 ? 1_555 S2 ? UA SF4 .   ? D SF4 802 ? 1_555 109.7 ? 
279 S1  ? UA SF4 .   ? D SF4 802 ? 1_555 FE4 ? UA SF4 . ? D SF4 802 ? 1_555 S2 ? UA SF4 .   ? D SF4 802 ? 1_555 105.3 ? 
280 SG  ? S  CYS 230 ? D CYS 230 ? 1_555 FE4 ? UA SF4 . ? D SF4 802 ? 1_555 S3 ? UA SF4 .   ? D SF4 802 ? 1_555 115.5 ? 
281 S1  ? UA SF4 .   ? D SF4 802 ? 1_555 FE4 ? UA SF4 . ? D SF4 802 ? 1_555 S3 ? UA SF4 .   ? D SF4 802 ? 1_555 108.5 ? 
282 S2  ? UA SF4 .   ? D SF4 802 ? 1_555 FE4 ? UA SF4 . ? D SF4 802 ? 1_555 S3 ? UA SF4 .   ? D SF4 802 ? 1_555 105.2 ? 
283 SG  ? S  CYS 256 ? D CYS 256 ? 1_555 FE1 ? VA SF4 . ? D SF4 803 ? 1_555 S2 ? VA SF4 .   ? D SF4 803 ? 1_555 111.4 ? 
284 SG  ? S  CYS 256 ? D CYS 256 ? 1_555 FE1 ? VA SF4 . ? D SF4 803 ? 1_555 S3 ? VA SF4 .   ? D SF4 803 ? 1_555 113.0 ? 
285 S2  ? VA SF4 .   ? D SF4 803 ? 1_555 FE1 ? VA SF4 . ? D SF4 803 ? 1_555 S3 ? VA SF4 .   ? D SF4 803 ? 1_555 103.7 ? 
286 SG  ? S  CYS 256 ? D CYS 256 ? 1_555 FE1 ? VA SF4 . ? D SF4 803 ? 1_555 S4 ? VA SF4 .   ? D SF4 803 ? 1_555 115.9 ? 
287 S2  ? VA SF4 .   ? D SF4 803 ? 1_555 FE1 ? VA SF4 . ? D SF4 803 ? 1_555 S4 ? VA SF4 .   ? D SF4 803 ? 1_555 105.8 ? 
288 S3  ? VA SF4 .   ? D SF4 803 ? 1_555 FE1 ? VA SF4 . ? D SF4 803 ? 1_555 S4 ? VA SF4 .   ? D SF4 803 ? 1_555 106.0 ? 
289 SG  ? S  CYS 259 ? D CYS 259 ? 1_555 FE4 ? VA SF4 . ? D SF4 803 ? 1_555 S1 ? VA SF4 .   ? D SF4 803 ? 1_555 114.4 ? 
290 SG  ? S  CYS 259 ? D CYS 259 ? 1_555 FE4 ? VA SF4 . ? D SF4 803 ? 1_555 S2 ? VA SF4 .   ? D SF4 803 ? 1_555 116.0 ? 
291 S1  ? VA SF4 .   ? D SF4 803 ? 1_555 FE4 ? VA SF4 . ? D SF4 803 ? 1_555 S2 ? VA SF4 .   ? D SF4 803 ? 1_555 104.5 ? 
292 SG  ? S  CYS 259 ? D CYS 259 ? 1_555 FE4 ? VA SF4 . ? D SF4 803 ? 1_555 S3 ? VA SF4 .   ? D SF4 803 ? 1_555 110.6 ? 
293 S1  ? VA SF4 .   ? D SF4 803 ? 1_555 FE4 ? VA SF4 . ? D SF4 803 ? 1_555 S3 ? VA SF4 .   ? D SF4 803 ? 1_555 106.9 ? 
294 S2  ? VA SF4 .   ? D SF4 803 ? 1_555 FE4 ? VA SF4 . ? D SF4 803 ? 1_555 S3 ? VA SF4 .   ? D SF4 803 ? 1_555 103.4 ? 
295 SG  ? S  CYS 263 ? D CYS 263 ? 1_555 FE3 ? VA SF4 . ? D SF4 803 ? 1_555 S1 ? VA SF4 .   ? D SF4 803 ? 1_555 116.6 ? 
296 SG  ? S  CYS 263 ? D CYS 263 ? 1_555 FE3 ? VA SF4 . ? D SF4 803 ? 1_555 S2 ? VA SF4 .   ? D SF4 803 ? 1_555 110.5 ? 
297 S1  ? VA SF4 .   ? D SF4 803 ? 1_555 FE3 ? VA SF4 . ? D SF4 803 ? 1_555 S2 ? VA SF4 .   ? D SF4 803 ? 1_555 105.0 ? 
298 SG  ? S  CYS 263 ? D CYS 263 ? 1_555 FE3 ? VA SF4 . ? D SF4 803 ? 1_555 S4 ? VA SF4 .   ? D SF4 803 ? 1_555 112.8 ? 
299 S1  ? VA SF4 .   ? D SF4 803 ? 1_555 FE3 ? VA SF4 . ? D SF4 803 ? 1_555 S4 ? VA SF4 .   ? D SF4 803 ? 1_555 105.3 ? 
300 S2  ? VA SF4 .   ? D SF4 803 ? 1_555 FE3 ? VA SF4 . ? D SF4 803 ? 1_555 S4 ? VA SF4 .   ? D SF4 803 ? 1_555 105.8 ? 
301 SG  ? S  CYS 291 ? D CYS 291 ? 1_555 FE2 ? VA SF4 . ? D SF4 803 ? 1_555 S1 ? VA SF4 .   ? D SF4 803 ? 1_555 113.6 ? 
302 SG  ? S  CYS 291 ? D CYS 291 ? 1_555 FE2 ? VA SF4 . ? D SF4 803 ? 1_555 S3 ? VA SF4 .   ? D SF4 803 ? 1_555 109.8 ? 
303 S1  ? VA SF4 .   ? D SF4 803 ? 1_555 FE2 ? VA SF4 . ? D SF4 803 ? 1_555 S3 ? VA SF4 .   ? D SF4 803 ? 1_555 106.6 ? 
304 SG  ? S  CYS 291 ? D CYS 291 ? 1_555 FE2 ? VA SF4 . ? D SF4 803 ? 1_555 S4 ? VA SF4 .   ? D SF4 803 ? 1_555 115.6 ? 
305 S1  ? VA SF4 .   ? D SF4 803 ? 1_555 FE2 ? VA SF4 . ? D SF4 803 ? 1_555 S4 ? VA SF4 .   ? D SF4 803 ? 1_555 104.8 ? 
306 S3  ? VA SF4 .   ? D SF4 803 ? 1_555 FE2 ? VA SF4 . ? D SF4 803 ? 1_555 S4 ? VA SF4 .   ? D SF4 803 ? 1_555 105.7 ? 
307 SG  ? V  CYS 45  ? G CYS 45  ? 1_555 FE3 ? XA SF4 . ? G SF4 201 ? 1_555 S1 ? XA SF4 .   ? G SF4 201 ? 1_555 107.4 ? 
308 SG  ? V  CYS 45  ? G CYS 45  ? 1_555 FE3 ? XA SF4 . ? G SF4 201 ? 1_555 S2 ? XA SF4 .   ? G SF4 201 ? 1_555 112.9 ? 
309 S1  ? XA SF4 .   ? G SF4 201 ? 1_555 FE3 ? XA SF4 . ? G SF4 201 ? 1_555 S2 ? XA SF4 .   ? G SF4 201 ? 1_555 105.0 ? 
310 SG  ? V  CYS 45  ? G CYS 45  ? 1_555 FE3 ? XA SF4 . ? G SF4 201 ? 1_555 S4 ? XA SF4 .   ? G SF4 201 ? 1_555 119.1 ? 
311 S1  ? XA SF4 .   ? G SF4 201 ? 1_555 FE3 ? XA SF4 . ? G SF4 201 ? 1_555 S4 ? XA SF4 .   ? G SF4 201 ? 1_555 110.6 ? 
312 S2  ? XA SF4 .   ? G SF4 201 ? 1_555 FE3 ? XA SF4 . ? G SF4 201 ? 1_555 S4 ? XA SF4 .   ? G SF4 201 ? 1_555 101.0 ? 
313 SG  ? V  CYS 46  ? G CYS 46  ? 1_555 FE2 ? XA SF4 . ? G SF4 201 ? 1_555 S1 ? XA SF4 .   ? G SF4 201 ? 1_555 109.7 ? 
314 SG  ? V  CYS 46  ? G CYS 46  ? 1_555 FE2 ? XA SF4 . ? G SF4 201 ? 1_555 S3 ? XA SF4 .   ? G SF4 201 ? 1_555 115.3 ? 
315 S1  ? XA SF4 .   ? G SF4 201 ? 1_555 FE2 ? XA SF4 . ? G SF4 201 ? 1_555 S3 ? XA SF4 .   ? G SF4 201 ? 1_555 105.5 ? 
316 SG  ? V  CYS 46  ? G CYS 46  ? 1_555 FE2 ? XA SF4 . ? G SF4 201 ? 1_555 S4 ? XA SF4 .   ? G SF4 201 ? 1_555 110.3 ? 
317 S1  ? XA SF4 .   ? G SF4 201 ? 1_555 FE2 ? XA SF4 . ? G SF4 201 ? 1_555 S4 ? XA SF4 .   ? G SF4 201 ? 1_555 107.6 ? 
318 S3  ? XA SF4 .   ? G SF4 201 ? 1_555 FE2 ? XA SF4 . ? G SF4 201 ? 1_555 S4 ? XA SF4 .   ? G SF4 201 ? 1_555 108.0 ? 
319 SG  ? V  CYS 111 ? G CYS 111 ? 1_555 FE1 ? XA SF4 . ? G SF4 201 ? 1_555 S2 ? XA SF4 .   ? G SF4 201 ? 1_555 112.9 ? 
320 SG  ? V  CYS 111 ? G CYS 111 ? 1_555 FE1 ? XA SF4 . ? G SF4 201 ? 1_555 S3 ? XA SF4 .   ? G SF4 201 ? 1_555 107.6 ? 
321 S2  ? XA SF4 .   ? G SF4 201 ? 1_555 FE1 ? XA SF4 . ? G SF4 201 ? 1_555 S3 ? XA SF4 .   ? G SF4 201 ? 1_555 106.8 ? 
322 SG  ? V  CYS 111 ? G CYS 111 ? 1_555 FE1 ? XA SF4 . ? G SF4 201 ? 1_555 S4 ? XA SF4 .   ? G SF4 201 ? 1_555 119.9 ? 
323 S2  ? XA SF4 .   ? G SF4 201 ? 1_555 FE1 ? XA SF4 . ? G SF4 201 ? 1_555 S4 ? XA SF4 .   ? G SF4 201 ? 1_555 99.7  ? 
324 S3  ? XA SF4 .   ? G SF4 201 ? 1_555 FE1 ? XA SF4 . ? G SF4 201 ? 1_555 S4 ? XA SF4 .   ? G SF4 201 ? 1_555 109.1 ? 
325 SG  ? V  CYS 140 ? G CYS 140 ? 1_555 FE4 ? XA SF4 . ? G SF4 201 ? 1_555 S1 ? XA SF4 .   ? G SF4 201 ? 1_555 115.9 ? 
326 SG  ? V  CYS 140 ? G CYS 140 ? 1_555 FE4 ? XA SF4 . ? G SF4 201 ? 1_555 S2 ? XA SF4 .   ? G SF4 201 ? 1_555 109.6 ? 
327 S1  ? XA SF4 .   ? G SF4 201 ? 1_555 FE4 ? XA SF4 . ? G SF4 201 ? 1_555 S2 ? XA SF4 .   ? G SF4 201 ? 1_555 103.2 ? 
328 SG  ? V  CYS 140 ? G CYS 140 ? 1_555 FE4 ? XA SF4 . ? G SF4 201 ? 1_555 S3 ? XA SF4 .   ? G SF4 201 ? 1_555 114.9 ? 
329 S1  ? XA SF4 .   ? G SF4 201 ? 1_555 FE4 ? XA SF4 . ? G SF4 201 ? 1_555 S3 ? XA SF4 .   ? G SF4 201 ? 1_555 106.0 ? 
330 S2  ? XA SF4 .   ? G SF4 201 ? 1_555 FE4 ? XA SF4 . ? G SF4 201 ? 1_555 S3 ? XA SF4 .   ? G SF4 201 ? 1_555 106.3 ? 
331 SG  ? W  CYS 53  ? O CYS 53  ? 1_555 FE3 ? ZA SF4 . ? O SF4 202 ? 1_555 S1 ? ZA SF4 .   ? O SF4 202 ? 1_555 110.6 ? 
332 SG  ? W  CYS 53  ? O CYS 53  ? 1_555 FE3 ? ZA SF4 . ? O SF4 202 ? 1_555 S2 ? ZA SF4 .   ? O SF4 202 ? 1_555 120.8 ? 
333 S1  ? ZA SF4 .   ? O SF4 202 ? 1_555 FE3 ? ZA SF4 . ? O SF4 202 ? 1_555 S2 ? ZA SF4 .   ? O SF4 202 ? 1_555 102.2 ? 
334 SG  ? W  CYS 53  ? O CYS 53  ? 1_555 FE3 ? ZA SF4 . ? O SF4 202 ? 1_555 S4 ? ZA SF4 .   ? O SF4 202 ? 1_555 111.7 ? 
335 S1  ? ZA SF4 .   ? O SF4 202 ? 1_555 FE3 ? ZA SF4 . ? O SF4 202 ? 1_555 S4 ? ZA SF4 .   ? O SF4 202 ? 1_555 103.7 ? 
336 S2  ? ZA SF4 .   ? O SF4 202 ? 1_555 FE3 ? ZA SF4 . ? O SF4 202 ? 1_555 S4 ? ZA SF4 .   ? O SF4 202 ? 1_555 106.2 ? 
337 SG  ? W  CYS 56  ? O CYS 56  ? 1_555 FE4 ? ZA SF4 . ? O SF4 202 ? 1_555 S1 ? ZA SF4 .   ? O SF4 202 ? 1_555 117.0 ? 
338 SG  ? W  CYS 56  ? O CYS 56  ? 1_555 FE4 ? ZA SF4 . ? O SF4 202 ? 1_555 S2 ? ZA SF4 .   ? O SF4 202 ? 1_555 118.9 ? 
339 S1  ? ZA SF4 .   ? O SF4 202 ? 1_555 FE4 ? ZA SF4 . ? O SF4 202 ? 1_555 S2 ? ZA SF4 .   ? O SF4 202 ? 1_555 102.0 ? 
340 SG  ? W  CYS 56  ? O CYS 56  ? 1_555 FE4 ? ZA SF4 . ? O SF4 202 ? 1_555 S3 ? ZA SF4 .   ? O SF4 202 ? 1_555 104.4 ? 
341 S1  ? ZA SF4 .   ? O SF4 202 ? 1_555 FE4 ? ZA SF4 . ? O SF4 202 ? 1_555 S3 ? ZA SF4 .   ? O SF4 202 ? 1_555 103.1 ? 
342 S2  ? ZA SF4 .   ? O SF4 202 ? 1_555 FE4 ? ZA SF4 . ? O SF4 202 ? 1_555 S3 ? ZA SF4 .   ? O SF4 202 ? 1_555 110.4 ? 
343 SG  ? W  CYS 59  ? O CYS 59  ? 1_555 FE2 ? ZA SF4 . ? O SF4 202 ? 1_555 S1 ? ZA SF4 .   ? O SF4 202 ? 1_555 113.0 ? 
344 SG  ? W  CYS 59  ? O CYS 59  ? 1_555 FE2 ? ZA SF4 . ? O SF4 202 ? 1_555 S3 ? ZA SF4 .   ? O SF4 202 ? 1_555 113.5 ? 
345 S1  ? ZA SF4 .   ? O SF4 202 ? 1_555 FE2 ? ZA SF4 . ? O SF4 202 ? 1_555 S3 ? ZA SF4 .   ? O SF4 202 ? 1_555 103.1 ? 
346 SG  ? W  CYS 59  ? O CYS 59  ? 1_555 FE2 ? ZA SF4 . ? O SF4 202 ? 1_555 S4 ? ZA SF4 .   ? O SF4 202 ? 1_555 114.7 ? 
347 S1  ? ZA SF4 .   ? O SF4 202 ? 1_555 FE2 ? ZA SF4 . ? O SF4 202 ? 1_555 S4 ? ZA SF4 .   ? O SF4 202 ? 1_555 103.1 ? 
348 S3  ? ZA SF4 .   ? O SF4 202 ? 1_555 FE2 ? ZA SF4 . ? O SF4 202 ? 1_555 S4 ? ZA SF4 .   ? O SF4 202 ? 1_555 108.2 ? 
349 SG  ? W  CYS 63  ? O CYS 63  ? 1_555 FE4 ? YA SF4 . ? O SF4 201 ? 1_555 S1 ? YA SF4 .   ? O SF4 201 ? 1_555 119.9 ? 
350 SG  ? W  CYS 63  ? O CYS 63  ? 1_555 FE4 ? YA SF4 . ? O SF4 201 ? 1_555 S2 ? YA SF4 .   ? O SF4 201 ? 1_555 114.0 ? 
351 S1  ? YA SF4 .   ? O SF4 201 ? 1_555 FE4 ? YA SF4 . ? O SF4 201 ? 1_555 S2 ? YA SF4 .   ? O SF4 201 ? 1_555 104.8 ? 
352 SG  ? W  CYS 63  ? O CYS 63  ? 1_555 FE4 ? YA SF4 . ? O SF4 201 ? 1_555 S3 ? YA SF4 .   ? O SF4 201 ? 1_555 106.0 ? 
353 S1  ? YA SF4 .   ? O SF4 201 ? 1_555 FE4 ? YA SF4 . ? O SF4 201 ? 1_555 S3 ? YA SF4 .   ? O SF4 201 ? 1_555 104.3 ? 
354 S2  ? YA SF4 .   ? O SF4 201 ? 1_555 FE4 ? YA SF4 . ? O SF4 201 ? 1_555 S3 ? YA SF4 .   ? O SF4 201 ? 1_555 106.8 ? 
355 SG  ? W  CYS 98  ? O CYS 98  ? 1_555 FE2 ? YA SF4 . ? O SF4 201 ? 1_555 S1 ? YA SF4 .   ? O SF4 201 ? 1_555 116.4 ? 
356 SG  ? W  CYS 98  ? O CYS 98  ? 1_555 FE2 ? YA SF4 . ? O SF4 201 ? 1_555 S3 ? YA SF4 .   ? O SF4 201 ? 1_555 115.8 ? 
357 S1  ? YA SF4 .   ? O SF4 201 ? 1_555 FE2 ? YA SF4 . ? O SF4 201 ? 1_555 S3 ? YA SF4 .   ? O SF4 201 ? 1_555 104.8 ? 
358 SG  ? W  CYS 98  ? O CYS 98  ? 1_555 FE2 ? YA SF4 . ? O SF4 201 ? 1_555 S4 ? YA SF4 .   ? O SF4 201 ? 1_555 109.5 ? 
359 S1  ? YA SF4 .   ? O SF4 201 ? 1_555 FE2 ? YA SF4 . ? O SF4 201 ? 1_555 S4 ? YA SF4 .   ? O SF4 201 ? 1_555 105.0 ? 
360 S3  ? YA SF4 .   ? O SF4 201 ? 1_555 FE2 ? YA SF4 . ? O SF4 201 ? 1_555 S4 ? YA SF4 .   ? O SF4 201 ? 1_555 104.2 ? 
361 SG  ? W  CYS 101 ? O CYS 101 ? 1_555 FE1 ? YA SF4 . ? O SF4 201 ? 1_555 S2 ? YA SF4 .   ? O SF4 201 ? 1_555 114.8 ? 
362 SG  ? W  CYS 101 ? O CYS 101 ? 1_555 FE1 ? YA SF4 . ? O SF4 201 ? 1_555 S3 ? YA SF4 .   ? O SF4 201 ? 1_555 105.2 ? 
363 S2  ? YA SF4 .   ? O SF4 201 ? 1_555 FE1 ? YA SF4 . ? O SF4 201 ? 1_555 S3 ? YA SF4 .   ? O SF4 201 ? 1_555 106.7 ? 
364 SG  ? W  CYS 101 ? O CYS 101 ? 1_555 FE1 ? YA SF4 . ? O SF4 201 ? 1_555 S4 ? YA SF4 .   ? O SF4 201 ? 1_555 118.0 ? 
365 S2  ? YA SF4 .   ? O SF4 201 ? 1_555 FE1 ? YA SF4 . ? O SF4 201 ? 1_555 S4 ? YA SF4 .   ? O SF4 201 ? 1_555 107.4 ? 
366 S3  ? YA SF4 .   ? O SF4 201 ? 1_555 FE1 ? YA SF4 . ? O SF4 201 ? 1_555 S4 ? YA SF4 .   ? O SF4 201 ? 1_555 103.5 ? 
367 SG  ? W  CYS 104 ? O CYS 104 ? 1_555 FE3 ? YA SF4 . ? O SF4 201 ? 1_555 S1 ? YA SF4 .   ? O SF4 201 ? 1_555 117.3 ? 
368 SG  ? W  CYS 104 ? O CYS 104 ? 1_555 FE3 ? YA SF4 . ? O SF4 201 ? 1_555 S2 ? YA SF4 .   ? O SF4 201 ? 1_555 114.1 ? 
369 S1  ? YA SF4 .   ? O SF4 201 ? 1_555 FE3 ? YA SF4 . ? O SF4 201 ? 1_555 S2 ? YA SF4 .   ? O SF4 201 ? 1_555 104.6 ? 
370 SG  ? W  CYS 104 ? O CYS 104 ? 1_555 FE3 ? YA SF4 . ? O SF4 201 ? 1_555 S4 ? YA SF4 .   ? O SF4 201 ? 1_555 107.9 ? 
371 S1  ? YA SF4 .   ? O SF4 201 ? 1_555 FE3 ? YA SF4 . ? O SF4 201 ? 1_555 S4 ? YA SF4 .   ? O SF4 201 ? 1_555 104.1 ? 
372 S2  ? YA SF4 .   ? O SF4 201 ? 1_555 FE3 ? YA SF4 . ? O SF4 201 ? 1_555 S4 ? YA SF4 .   ? O SF4 201 ? 1_555 108.1 ? 
373 SG  ? W  CYS 108 ? O CYS 108 ? 1_555 FE1 ? ZA SF4 . ? O SF4 202 ? 1_555 S2 ? ZA SF4 .   ? O SF4 202 ? 1_555 114.1 ? 
374 SG  ? W  CYS 108 ? O CYS 108 ? 1_555 FE1 ? ZA SF4 . ? O SF4 202 ? 1_555 S3 ? ZA SF4 .   ? O SF4 202 ? 1_555 109.7 ? 
375 S2  ? ZA SF4 .   ? O SF4 202 ? 1_555 FE1 ? ZA SF4 . ? O SF4 202 ? 1_555 S3 ? ZA SF4 .   ? O SF4 202 ? 1_555 109.2 ? 
376 SG  ? W  CYS 108 ? O CYS 108 ? 1_555 FE1 ? ZA SF4 . ? O SF4 202 ? 1_555 S4 ? ZA SF4 .   ? O SF4 202 ? 1_555 111.0 ? 
377 S2  ? ZA SF4 .   ? O SF4 202 ? 1_555 FE1 ? ZA SF4 . ? O SF4 202 ? 1_555 S4 ? ZA SF4 .   ? O SF4 202 ? 1_555 105.4 ? 
378 S3  ? ZA SF4 .   ? O SF4 202 ? 1_555 FE1 ? ZA SF4 . ? O SF4 202 ? 1_555 S4 ? ZA SF4 .   ? O SF4 202 ? 1_555 107.2 ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ALA 131 B  . ? ALA 131 2 PRO 132 B  ? PRO 132 2 1 -4.29 
2  HIS 34  D  . ? HIS 34  4 PRO 35  D  ? PRO 35  4 1 -5.44 
3  CYS 140 F  . ? CYS 140 6 PRO 141 F  ? PRO 141 6 1 -7.03 
4  TYR 26  G  . ? TYR 26  9 PRO 27  G  ? PRO 27  9 1 -1.36 
5  ILE 220 M  . ? ILE 220 L PRO 221 M  ? PRO 221 L 1 -2.34 
6  LEU 20  N  . ? LEU 20  M PRO 21  N  ? PRO 21  M 1 -7.22 
7  THR 205 N  . ? THR 205 M PRO 206 N  ? PRO 206 M 1 -6.84 
8  ALA 190 O  . ? ALA 190 N PRO 191 O  ? PRO 191 N 1 0.45  
9  PRO 337 O  . ? PRO 337 N PRO 338 O  ? PRO 338 N 1 0.22  
10 LEU 221 P  . ? LEU 221 H PRO 222 P  ? PRO 222 H 1 -6.91 
11 ALA 131 R  . ? ALA 131 C PRO 132 R  ? PRO 132 C 1 -5.00 
12 HIS 34  T  . ? HIS 34  E PRO 35  T  ? PRO 35  E 1 -5.97 
13 CYS 140 V  . ? CYS 140 G PRO 141 V  ? PRO 141 G 1 -7.54 
14 TYR 26  W  . ? TYR 26  O PRO 27  W  ? PRO 27  O 1 -0.70 
15 ILE 220 CA . ? ILE 220 T PRO 221 CA ? PRO 221 T 1 -2.74 
16 LEU 20  DA . ? LEU 20  U PRO 21  DA ? PRO 21  U 1 -8.05 
17 THR 205 DA . ? THR 205 U PRO 206 DA ? PRO 206 U 1 -6.68 
18 ALA 190 EA . ? ALA 190 V PRO 191 EA ? PRO 191 V 1 0.30  
19 PRO 337 EA . ? PRO 337 V PRO 338 EA ? PRO 338 V 1 0.51  
20 GLY 52  FA . ? GLY 52  Q PRO 53  FA ? PRO 53  Q 1 28.43 
21 LEU 221 FA . ? LEU 221 Q PRO 222 FA ? PRO 222 Q 1 -6.45 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 5 ? 
AA3 ? 3 ? 
AA4 ? 5 ? 
AA5 ? 3 ? 
AA6 ? 2 ? 
AA7 ? 3 ? 
AA8 ? 7 ? 
AA9 ? 5 ? 
AB1 ? 2 ? 
AB2 ? 7 ? 
AB3 ? 3 ? 
AB4 ? 3 ? 
AB5 ? 3 ? 
AB6 ? 5 ? 
AB7 ? 2 ? 
AB8 ? 2 ? 
AB9 ? 4 ? 
AC1 ? 2 ? 
AC2 ? 2 ? 
AC3 ? 3 ? 
AC4 ? 7 ? 
AC5 ? 6 ? 
AC6 ? 2 ? 
AC7 ? 2 ? 
AC8 ? 2 ? 
AC9 ? 4 ? 
AD1 ? 5 ? 
AD2 ? 3 ? 
AD3 ? 5 ? 
AD4 ? 3 ? 
AD5 ? 2 ? 
AD6 ? 3 ? 
AD7 ? 7 ? 
AD8 ? 5 ? 
AD9 ? 2 ? 
AE1 ? 6 ? 
AE2 ? 3 ? 
AE3 ? 3 ? 
AE4 ? 3 ? 
AE5 ? 5 ? 
AE6 ? 2 ? 
AE7 ? 2 ? 
AE8 ? 4 ? 
AE9 ? 2 ? 
AF1 ? 2 ? 
AF2 ? 3 ? 
AF3 ? 7 ? 
AF4 ? 6 ? 
AF5 ? 2 ? 
AF6 ? 2 ? 
AF7 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? parallel      
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? parallel      
AA8 4 5 ? parallel      
AA8 5 6 ? parallel      
AA8 6 7 ? parallel      
AA9 1 2 ? parallel      
AA9 2 3 ? parallel      
AA9 3 4 ? parallel      
AA9 4 5 ? parallel      
AB1 1 2 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? parallel      
AB2 3 4 ? anti-parallel 
AB2 4 5 ? parallel      
AB2 5 6 ? anti-parallel 
AB2 6 7 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? parallel      
AB6 3 4 ? anti-parallel 
AB6 4 5 ? anti-parallel 
AB7 1 2 ? parallel      
AB8 1 2 ? anti-parallel 
AB9 1 2 ? parallel      
AB9 2 3 ? parallel      
AB9 3 4 ? parallel      
AC1 1 2 ? parallel      
AC2 1 2 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC4 3 4 ? anti-parallel 
AC4 4 5 ? anti-parallel 
AC4 5 6 ? anti-parallel 
AC4 6 7 ? anti-parallel 
AC5 1 2 ? parallel      
AC5 2 3 ? anti-parallel 
AC5 3 4 ? anti-parallel 
AC5 4 5 ? parallel      
AC5 5 6 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC9 1 2 ? parallel      
AC9 2 3 ? parallel      
AC9 3 4 ? parallel      
AD1 1 2 ? anti-parallel 
AD1 2 3 ? parallel      
AD1 3 4 ? anti-parallel 
AD1 4 5 ? anti-parallel 
AD2 1 2 ? parallel      
AD2 2 3 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? parallel      
AD3 3 4 ? anti-parallel 
AD3 4 5 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD4 2 3 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD6 2 3 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD7 2 3 ? anti-parallel 
AD7 3 4 ? parallel      
AD7 4 5 ? parallel      
AD7 5 6 ? parallel      
AD7 6 7 ? parallel      
AD8 1 2 ? parallel      
AD8 2 3 ? parallel      
AD8 3 4 ? parallel      
AD8 4 5 ? parallel      
AD9 1 2 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE1 2 3 ? parallel      
AE1 3 4 ? anti-parallel 
AE1 4 5 ? parallel      
AE1 5 6 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE2 2 3 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE3 2 3 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE4 2 3 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE5 2 3 ? parallel      
AE5 3 4 ? anti-parallel 
AE5 4 5 ? anti-parallel 
AE6 1 2 ? parallel      
AE7 1 2 ? anti-parallel 
AE8 1 2 ? parallel      
AE8 2 3 ? parallel      
AE8 3 4 ? parallel      
AE9 1 2 ? parallel      
AF1 1 2 ? anti-parallel 
AF2 1 2 ? anti-parallel 
AF2 2 3 ? anti-parallel 
AF3 1 2 ? anti-parallel 
AF3 2 3 ? anti-parallel 
AF3 3 4 ? anti-parallel 
AF3 4 5 ? anti-parallel 
AF3 5 6 ? anti-parallel 
AF3 6 7 ? anti-parallel 
AF4 1 2 ? parallel      
AF4 2 3 ? anti-parallel 
AF4 3 4 ? anti-parallel 
AF4 4 5 ? parallel      
AF4 5 6 ? anti-parallel 
AF5 1 2 ? anti-parallel 
AF6 1 2 ? anti-parallel 
AF7 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU A  171 ? ARG A  175 ? LEU 1 171 ARG 1 175 
AA1 2 ALA A  127 ? VAL A  134 ? ALA 1 127 VAL 1 134 
AA1 3 HIS A  87  ? ALA A  93  ? HIS 1 87  ALA 1 93  
AA1 4 THR A  217 ? ASN A  220 ? THR 1 217 ASN 1 220 
AA2 1 GLY A  262 ? PRO A  267 ? GLY 1 262 PRO 1 267 
AA2 2 MET A  249 ? SER A  255 ? MET 1 249 SER 1 255 
AA2 3 GLY A  327 ? PRO A  332 ? GLY 1 327 PRO 1 332 
AA2 4 ILE A  287 ? ILE A  291 ? ILE 1 287 ILE 1 291 
AA2 5 LEU A  300 ? PRO A  301 ? LEU 1 300 PRO 1 301 
AA3 1 PHE B  117 ? VAL B  122 ? PHE 2 117 VAL 2 122 
AA3 2 TYR B  78  ? CYS B  83  ? TYR 2 78  CYS 2 83  
AA3 3 ILE B  134 ? VAL B  136 ? ILE 2 134 VAL 2 136 
AA4 1 ARG C  9   ? VAL C  13  ? ARG 3 9   VAL 3 13  
AA4 2 VAL C  2   ? VAL C  6   ? VAL 3 2   VAL 3 6   
AA4 3 MET C  91  ? ASP C  94  ? MET 3 91  ASP 3 94  
AA4 4 LEU C  49  ? GLY C  53  ? LEU 3 49  GLY 3 53  
AA4 5 ALA C  80  ? ALA C  81  ? ALA 3 80  ALA 3 81  
AA5 1 HIS C  168 ? SER C  171 ? HIS 3 168 SER 3 171 
AA5 2 VAL C  174 ? LEU C  176 ? VAL 3 174 LEU 3 176 
AA5 3 LEU C  235 ? ASP C  237 ? LEU 3 235 ASP 3 237 
AA6 1 ASP C  201 ? PHE C  202 ? ASP 3 201 PHE 3 202 
AA6 2 ILE C  211 ? GLY C  212 ? ILE 3 211 GLY 3 212 
AA7 1 GLU C  250 ? THR C  255 ? GLU 3 250 THR 3 255 
AA7 2 GLY C  264 ? ARG C  270 ? GLY 3 264 ARG 3 270 
AA7 3 GLU C  273 ? ALA C  279 ? GLU 3 273 ALA 3 279 
AA8 1 LEU C  317 ? GLU C  319 ? LEU 3 317 GLU 3 319 
AA8 2 LEU C  310 ? ARG C  312 ? LEU 3 310 ARG 3 312 
AA8 3 VAL C  600 ? PRO C  603 ? VAL 3 600 PRO 3 603 
AA8 4 PHE C  582 ? LEU C  587 ? PHE 3 582 LEU 3 587 
AA8 5 TYR C  565 ? TYR C  568 ? TYR 3 565 TYR 3 568 
AA8 6 VAL C  341 ? LEU C  345 ? VAL 3 341 LEU 3 345 
AA8 7 LEU C  369 ? PHE C  371 ? LEU 3 369 PHE 3 371 
AA9 1 ILE C  464 ? VAL C  467 ? ILE 3 464 VAL 3 467 
AA9 2 MET C  448 ? ALA C  452 ? MET 3 448 ALA 3 452 
AA9 3 PHE C  395 ? LEU C  399 ? PHE 3 395 LEU 3 399 
AA9 4 PRO C  503 ? LEU C  507 ? PRO 3 503 LEU 3 507 
AA9 5 LYS C  531 ? ALA C  534 ? LYS 3 531 ALA 3 534 
AB1 1 GLY C  612 ? VAL C  615 ? GLY 3 612 VAL 3 615 
AB1 2 VAL C  621 ? LEU C  624 ? VAL 3 621 LEU 3 624 
AB2 1 ARG C  770 ? VAL C  771 ? ARG 3 770 VAL 3 771 
AB2 2 PHE C  692 ? PRO C  696 ? PHE 3 692 PRO 3 696 
AB2 3 LEU C  758 ? ALA C  762 ? LEU 3 758 ALA 3 762 
AB2 4 ALA C  714 ? ALA C  718 ? ALA 3 714 ALA 3 718 
AB2 5 GLY C  741 ? HIS C  749 ? GLY 3 741 HIS 3 749 
AB2 6 GLN C  733 ? THR C  738 ? GLN 3 733 THR 3 738 
AB2 7 ARG C  774 ? LEU C  776 ? ARG 3 774 LEU 3 776 
AB3 1 THR D  27  ? VAL D  30  ? THR 4 27  VAL 4 30  
AB3 2 ARG D  42  ? THR D  46  ? ARG 4 42  THR 4 46  
AB3 3 GLU D  54  ? HIS D  58  ? GLU 4 54  HIS 4 58  
AB4 1 GLY D  340 ? VAL D  342 ? GLY 4 340 VAL 4 342 
AB4 2 GLY D  351 ? SER D  359 ? GLY 4 351 SER 4 359 
AB4 3 PRO D  345 ? SER D  348 ? PRO 4 345 SER 4 348 
AB5 1 GLY D  340 ? VAL D  342 ? GLY 4 340 VAL 4 342 
AB5 2 GLY D  351 ? SER D  359 ? GLY 4 351 SER 4 359 
AB5 3 ARG D  367 ? ARG D  371 ? ARG 4 367 ARG 4 371 
AB6 1 ILE E  17  ? ASP E  19  ? ILE 5 17  ASP 5 19  
AB6 2 LEU E  25  ? VAL E  28  ? LEU 5 25  VAL 5 28  
AB6 3 PHE E  88  ? VAL E  94  ? PHE 5 88  VAL 5 94  
AB6 4 PHE E  68  ? VAL E  75  ? PHE 5 68  VAL 5 75  
AB6 5 PHE E  48  ? ASP E  56  ? PHE 5 48  ASP 5 56  
AB7 1 ARG E  100 ? PRO E  102 ? ARG 5 100 PRO 5 102 
AB7 2 VAL E  125 ? GLU E  127 ? VAL 5 125 GLU 5 127 
AB8 1 THR E  157 ? LEU E  158 ? THR 5 157 LEU 5 158 
AB8 2 TYR E  164 ? ILE E  165 ? TYR 5 164 ILE 5 165 
AB9 1 PRO F  38  ? GLY F  42  ? PRO 6 38  GLY 6 42  
AB9 2 VAL F  77  ? ALA F  81  ? VAL 6 77  ALA 6 81  
AB9 3 TRP F  104 ? MET F  108 ? TRP 6 104 MET 6 108 
AB9 4 VAL F  135 ? VAL F  137 ? VAL 6 135 VAL 6 137 
AC1 1 VAL G  31  ? ALA G  32  ? VAL 9 31  ALA 9 32  
AC1 2 TYR G  161 ? VAL G  162 ? TYR 9 161 VAL 9 162 
AC2 1 GLY G  39  ? LEU G  43  ? GLY 9 39  LEU 9 43  
AC2 2 ILE G  113 ? GLY G  116 ? ILE 9 113 GLY 9 116 
AC3 1 ILE G  68  ? GLU G  74  ? ILE 9 68  GLU 9 74  
AC3 2 ARG G  86  ? ASN G  94  ? ARG 9 86  ASN 9 94  
AC3 3 VAL G  130 ? TYR G  131 ? VAL 9 130 TYR 9 131 
AC4 1 ARG H  30  ? ASP H  36  ? ARG 7 30  ASP 7 36  
AC4 2 ILE H  54  ? SER H  60  ? ILE 7 54  SER 7 60  
AC4 3 PRO H  66  ? VAL H  72  ? PRO 7 66  VAL 7 72  
AC4 4 ILE H  82  ? LEU H  86  ? ILE 7 82  LEU 7 86  
AC4 5 ILE H  91  ? GLU H  98  ? ILE 7 91  GLU 7 98  
AC4 6 GLY H  102 ? THR H  105 ? GLY 7 102 THR 7 105 
AC4 7 ILE H  108 ? PRO H  109 ? ILE 7 108 PRO 7 109 
AC5 1 VAL I  2   ? ARG I  3   ? VAL W 2   ARG W 3   
AC5 2 ASP I  56  ? PHE I  63  ? ASP W 56  PHE W 63  
AC5 3 TYR I  46  ? HIS I  51  ? TYR W 46  HIS W 51  
AC5 4 LYS I  30  ? THR I  35  ? LYS W 30  THR W 35  
AC5 5 ARG I  88  ? VAL I  93  ? ARG W 88  VAL W 93  
AC5 6 ASN I  119 ? PRO I  120 ? ASN W 119 PRO W 120 
AC6 1 ALA M  53  ? ALA M  57  ? ALA L 53  ALA L 57  
AC6 2 PHE M  65  ? LEU M  69  ? PHE L 65  LEU L 69  
AC7 1 PHE N  51  ? LEU N  56  ? PHE M 51  LEU M 56  
AC7 2 VAL N  61  ? PHE N  65  ? VAL M 61  PHE M 65  
AC8 1 PHE O  48  ? ALA O  49  ? PHE N 48  ALA N 49  
AC8 2 ALA O  54  ? VAL O  55  ? ALA N 54  VAL N 55  
AC9 1 LEU Q  171 ? ARG Q  175 ? LEU B 171 ARG B 175 
AC9 2 ALA Q  127 ? VAL Q  134 ? ALA B 127 VAL B 134 
AC9 3 HIS Q  87  ? ALA Q  93  ? HIS B 87  ALA B 93  
AC9 4 THR Q  216 ? ASN Q  219 ? THR B 216 ASN B 219 
AD1 1 GLY Q  262 ? PRO Q  267 ? GLY B 262 PRO B 267 
AD1 2 MET Q  249 ? SER Q  255 ? MET B 249 SER B 255 
AD1 3 GLY Q  327 ? PRO Q  332 ? GLY B 327 PRO B 332 
AD1 4 ILE Q  287 ? ILE Q  291 ? ILE B 287 ILE B 291 
AD1 5 LEU Q  300 ? PRO Q  301 ? LEU B 300 PRO B 301 
AD2 1 PHE R  117 ? VAL R  122 ? PHE C 117 VAL C 122 
AD2 2 TYR R  78  ? CYS R  83  ? TYR C 78  CYS C 83  
AD2 3 ILE R  134 ? VAL R  136 ? ILE C 134 VAL C 136 
AD3 1 ARG S  9   ? VAL S  13  ? ARG D 9   VAL D 13  
AD3 2 VAL S  2   ? VAL S  6   ? VAL D 2   VAL D 6   
AD3 3 MET S  91  ? ASP S  94  ? MET D 91  ASP D 94  
AD3 4 LEU S  49  ? GLY S  53  ? LEU D 49  GLY D 53  
AD3 5 ALA S  80  ? ALA S  81  ? ALA D 80  ALA D 81  
AD4 1 HIS S  168 ? SER S  171 ? HIS D 168 SER D 171 
AD4 2 VAL S  174 ? LEU S  176 ? VAL D 174 LEU D 176 
AD4 3 LEU S  235 ? ASP S  237 ? LEU D 235 ASP D 237 
AD5 1 ASP S  201 ? PHE S  202 ? ASP D 201 PHE D 202 
AD5 2 ILE S  211 ? GLY S  212 ? ILE D 211 GLY D 212 
AD6 1 GLU S  250 ? THR S  255 ? GLU D 250 THR D 255 
AD6 2 GLY S  264 ? ARG S  270 ? GLY D 264 ARG D 270 
AD6 3 GLU S  273 ? ALA S  279 ? GLU D 273 ALA D 279 
AD7 1 LEU S  317 ? GLU S  319 ? LEU D 317 GLU D 319 
AD7 2 LEU S  310 ? ARG S  312 ? LEU D 310 ARG D 312 
AD7 3 VAL S  600 ? PRO S  603 ? VAL D 600 PRO D 603 
AD7 4 PHE S  582 ? LEU S  587 ? PHE D 582 LEU D 587 
AD7 5 TYR S  565 ? TYR S  568 ? TYR D 565 TYR D 568 
AD7 6 VAL S  341 ? LEU S  345 ? VAL D 341 LEU D 345 
AD7 7 LEU S  369 ? PHE S  371 ? LEU D 369 PHE D 371 
AD8 1 ILE S  464 ? VAL S  467 ? ILE D 464 VAL D 467 
AD8 2 MET S  448 ? ALA S  452 ? MET D 448 ALA D 452 
AD8 3 ALA S  396 ? LEU S  399 ? ALA D 396 LEU D 399 
AD8 4 VAL S  504 ? LEU S  507 ? VAL D 504 LEU D 507 
AD8 5 VAL S  532 ? ALA S  534 ? VAL D 532 ALA D 534 
AD9 1 GLY S  612 ? VAL S  615 ? GLY D 612 VAL D 615 
AD9 2 VAL S  621 ? LEU S  624 ? VAL D 621 LEU D 624 
AE1 1 GLN S  733 ? THR S  738 ? GLN D 733 THR D 738 
AE1 2 GLY S  741 ? HIS S  749 ? GLY D 741 HIS D 749 
AE1 3 ALA S  714 ? ALA S  718 ? ALA D 714 ALA D 718 
AE1 4 LEU S  758 ? ALA S  762 ? LEU D 758 ALA D 762 
AE1 5 PHE S  692 ? PRO S  696 ? PHE D 692 PRO D 696 
AE1 6 ARG S  770 ? VAL S  771 ? ARG D 770 VAL D 771 
AE2 1 THR T  27  ? VAL T  30  ? THR E 27  VAL E 30  
AE2 2 ARG T  42  ? THR T  46  ? ARG E 42  THR E 46  
AE2 3 GLU T  54  ? HIS T  58  ? GLU E 54  HIS E 58  
AE3 1 GLY T  340 ? VAL T  342 ? GLY E 340 VAL E 342 
AE3 2 GLY T  351 ? SER T  359 ? GLY E 351 SER E 359 
AE3 3 PRO T  345 ? SER T  348 ? PRO E 345 SER E 348 
AE4 1 GLY T  340 ? VAL T  342 ? GLY E 340 VAL E 342 
AE4 2 GLY T  351 ? SER T  359 ? GLY E 351 SER E 359 
AE4 3 ARG T  367 ? ARG T  371 ? ARG E 367 ARG E 371 
AE5 1 ILE U  17  ? ASN U  20  ? ILE F 17  ASN F 20  
AE5 2 ASN U  24  ? VAL U  28  ? ASN F 24  VAL F 28  
AE5 3 ARG U  87  ? VAL U  94  ? ARG F 87  VAL F 94  
AE5 4 PHE U  68  ? VAL U  75  ? PHE F 68  VAL F 75  
AE5 5 PHE U  48  ? ASP U  56  ? PHE F 48  ASP F 56  
AE6 1 ARG U  100 ? PRO U  102 ? ARG F 100 PRO F 102 
AE6 2 VAL U  125 ? GLU U  127 ? VAL F 125 GLU F 127 
AE7 1 THR U  157 ? LEU U  158 ? THR F 157 LEU F 158 
AE7 2 TYR U  164 ? ILE U  165 ? TYR F 164 ILE F 165 
AE8 1 PRO V  38  ? GLY V  42  ? PRO G 38  GLY G 42  
AE8 2 VAL V  77  ? ALA V  81  ? VAL G 77  ALA G 81  
AE8 3 TRP V  104 ? MET V  108 ? TRP G 104 MET G 108 
AE8 4 VAL V  135 ? VAL V  137 ? VAL G 135 VAL G 137 
AE9 1 VAL W  31  ? ALA W  32  ? VAL O 31  ALA O 32  
AE9 2 TYR W  161 ? VAL W  162 ? TYR O 161 VAL O 162 
AF1 1 GLY W  39  ? LEU W  43  ? GLY O 39  LEU O 43  
AF1 2 ILE W  113 ? GLY W  116 ? ILE O 113 GLY O 116 
AF2 1 ILE W  68  ? GLU W  74  ? ILE O 68  GLU O 74  
AF2 2 ARG W  86  ? ASN W  94  ? ARG O 86  ASN O 94  
AF2 3 VAL W  130 ? TYR W  131 ? VAL O 130 TYR O 131 
AF3 1 ARG X  30  ? ASP X  36  ? ARG I 30  ASP I 36  
AF3 2 ILE X  54  ? SER X  60  ? ILE I 54  SER I 60  
AF3 3 PRO X  66  ? VAL X  72  ? PRO I 66  VAL I 72  
AF3 4 ILE X  82  ? LEU X  86  ? ILE I 82  LEU I 86  
AF3 5 ILE X  91  ? GLU X  98  ? ILE I 91  GLU I 98  
AF3 6 GLY X  102 ? THR X  105 ? GLY I 102 THR I 105 
AF3 7 ILE X  108 ? PRO X  109 ? ILE I 108 PRO I 109 
AF4 1 VAL Y  2   ? ARG Y  3   ? VAL X 2   ARG X 3   
AF4 2 ASP Y  56  ? PHE Y  63  ? ASP X 56  PHE X 63  
AF4 3 TYR Y  46  ? HIS Y  51  ? TYR X 46  HIS X 51  
AF4 4 LYS Y  30  ? THR Y  35  ? LYS X 30  THR X 35  
AF4 5 ARG Y  88  ? VAL Y  93  ? ARG X 88  VAL X 93  
AF4 6 ASN Y  119 ? PRO Y  120 ? ASN X 119 PRO X 120 
AF5 1 ALA CA 53  ? ALA CA 57  ? ALA T 53  ALA T 57  
AF5 2 PHE CA 65  ? LEU CA 69  ? PHE T 65  LEU T 69  
AF6 1 PHE DA 51  ? LEU DA 56  ? PHE U 51  LEU U 56  
AF6 2 VAL DA 61  ? PHE DA 65  ? VAL U 61  PHE U 65  
AF7 1 PHE EA 48  ? ALA EA 49  ? PHE V 48  ALA V 49  
AF7 2 ALA EA 54  ? VAL EA 55  ? ALA V 54  VAL V 55  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O HIS A  172 ? O HIS 1 172 N ILE A  132 ? N ILE 1 132 
AA1 2 3 O TYR A  131 ? O TYR 1 131 N CYS A  91  ? N CYS 1 91  
AA1 3 4 N ILE A  90  ? N ILE 1 90  O THR A  217 ? O THR 1 217 
AA2 1 2 O TYR A  264 ? O TYR 1 264 N TYR A  252 ? N TYR 1 252 
AA2 2 3 N GLN A  253 ? N GLN 1 253 O VAL A  328 ? O VAL 1 328 
AA2 3 4 O ILE A  331 ? O ILE 1 331 N ALA A  289 ? N ALA 1 289 
AA2 4 5 N ILE A  290 ? N ILE 1 290 O LEU A  300 ? O LEU 1 300 
AA3 1 2 O SER B  118 ? O SER 2 118 N TYR B  78  ? N TYR 2 78  
AA3 2 3 N GLN B  81  ? N GLN 2 81  O GLN B  135 ? O GLN 2 135 
AA4 1 2 O VAL C  11  ? O VAL 3 11  N VAL C  4   ? N VAL 3 4   
AA4 2 3 N LYS C  5   ? N LYS 3 5   O VAL C  93  ? O VAL 3 93  
AA4 3 4 O VAL C  92  ? O VAL 3 92  N GLY C  53  ? N GLY 3 53  
AA4 4 5 N VAL C  50  ? N VAL 3 50  O ALA C  80  ? O ALA 3 80  
AA5 1 2 N HIS C  168 ? N HIS 3 168 O LEU C  176 ? O LEU 3 176 
AA5 2 3 N ILE C  175 ? N ILE 3 175 O LEU C  236 ? O LEU 3 236 
AA6 1 2 N ASP C  201 ? N ASP 3 201 O GLY C  212 ? O GLY 3 212 
AA7 1 2 N THR C  254 ? N THR 3 254 O ILE C  265 ? O ILE 3 265 
AA7 2 3 N ASP C  268 ? N ASP 3 268 O ARG C  276 ? O ARG 3 276 
AA8 1 2 O VAL C  318 ? O VAL 3 318 N VAL C  311 ? N VAL 3 311 
AA8 2 3 N LEU C  310 ? N LEU 3 310 O VAL C  601 ? O VAL 3 601 
AA8 3 4 O VAL C  600 ? O VAL 3 600 N MET C  585 ? N MET 3 585 
AA8 4 5 O HIS C  586 ? O HIS 3 586 N TYR C  568 ? N TYR 3 568 
AA8 5 6 O TYR C  565 ? O TYR 3 565 N GLY C  342 ? N GLY 3 342 
AA8 6 7 N LEU C  343 ? N LEU 3 343 O ASP C  370 ? O ASP 3 370 
AA9 1 2 O ILE C  464 ? O ILE 3 464 N LEU C  450 ? N LEU 3 450 
AA9 2 3 O ALA C  449 ? O ALA 3 449 N VAL C  398 ? N VAL 3 398 
AA9 3 4 N PHE C  395 ? N PHE 3 395 O VAL C  504 ? O VAL 3 504 
AA9 4 5 N LEU C  507 ? N LEU 3 507 O LEU C  533 ? O LEU 3 533 
AB1 1 2 N GLY C  612 ? N GLY 3 612 O LEU C  624 ? O LEU 3 624 
AB2 1 2 O VAL C  771 ? O VAL 3 771 N PHE C  692 ? N PHE 3 692 
AB2 2 3 N TYR C  693 ? N TYR 3 693 O LEU C  760 ? O LEU 3 760 
AB2 3 4 O TYR C  759 ? O TYR 3 759 N TRP C  717 ? N TRP 3 717 
AB2 4 5 N LEU C  716 ? N LEU 3 716 O ARG C  746 ? O ARG 3 746 
AB2 5 6 O ALA C  745 ? O ALA 3 745 N VAL C  734 ? N VAL 3 734 
AB2 6 7 N GLU C  737 ? N GLU 3 737 O ARG C  774 ? O ARG 3 774 
AB3 1 2 N VAL D  30  ? N VAL 4 30  O LEU D  43  ? O LEU 4 43  
AB3 2 3 N THR D  46  ? N THR 4 46  O GLU D  54  ? O GLU 4 54  
AB4 1 2 N GLY D  340 ? N GLY 4 340 O SER D  359 ? O SER 4 359 
AB4 2 3 O GLY D  351 ? O GLY 4 351 N SER D  348 ? N SER 4 348 
AB5 1 2 N GLY D  340 ? N GLY 4 340 O SER D  359 ? O SER 4 359 
AB5 2 3 N TYR D  356 ? N TYR 4 356 O LYS D  369 ? O LYS 4 369 
AB6 1 2 N GLU E  18  ? N GLU 5 18  O TRP E  26  ? O TRP 5 26  
AB6 2 3 N LEU E  25  ? N LEU 5 25  O PHE E  89  ? O PHE 5 89  
AB6 3 4 O VAL E  92  ? O VAL 5 92  N VAL E  70  ? N VAL 5 70  
AB6 4 5 O VAL E  75  ? O VAL 5 75  N PHE E  48  ? N PHE 5 48  
AB7 1 2 N LEU E  101 ? N LEU 5 101 O GLU E  127 ? O GLU 5 127 
AB8 1 2 N THR E  157 ? N THR 5 157 O ILE E  165 ? O ILE 5 165 
AB9 1 2 N PHE F  41  ? N PHE 6 41  O ILE F  79  ? O ILE 6 79  
AB9 2 3 N VAL F  80  ? N VAL 6 80  O ILE F  106 ? O ILE 6 106 
AB9 3 4 N SER F  107 ? N SER 6 107 O VAL F  135 ? O VAL 6 135 
AC1 1 2 N VAL G  31  ? N VAL 9 31  O VAL G  162 ? O VAL 9 162 
AC2 1 2 N VAL G  42  ? N VAL 9 42  O VAL G  114 ? O VAL 9 114 
AC3 1 2 N TYR G  69  ? N TYR 9 69  O GLU G  92  ? O GLU 9 92  
AC3 2 3 N ILE G  93  ? N ILE 9 93  O TYR G  131 ? O TYR 9 131 
AC4 1 2 N GLU H  32  ? N GLU 7 32  O SER H  58  ? O SER 7 58  
AC4 2 3 N LEU H  59  ? N LEU 7 59  O PHE H  67  ? O PHE 7 67  
AC4 3 4 N ASP H  71  ? N ASP 7 71  O GLY H  83  ? O GLY 7 83  
AC4 4 5 N ILE H  82  ? N ILE 7 82  O ALA H  95  ? O ALA 7 95  
AC4 5 6 N HIS H  96  ? N HIS 7 96  O VAL H  104 ? O VAL 7 104 
AC4 6 7 N THR H  105 ? N THR 7 105 O ILE H  108 ? O ILE 7 108 
AC5 1 2 N VAL I  2   ? N VAL W 2   O LEU I  58  ? O LEU W 58  
AC5 2 3 O LEU I  57  ? O LEU W 57  N LEU I  50  ? N LEU W 50  
AC5 3 4 O LEU I  49  ? O LEU W 49  N TYR I  32  ? N TYR W 32  
AC5 4 5 N VAL I  31  ? N VAL W 31  O TYR I  90  ? O TYR W 90  
AC5 5 6 N GLU I  91  ? N GLU W 91  O ASN I  119 ? O ASN W 119 
AC6 1 2 N ALA M  53  ? N ALA L 53  O LEU M  69  ? O LEU L 69  
AC7 1 2 N LEU N  56  ? N LEU M 56  O VAL N  61  ? O VAL M 61  
AC8 1 2 N PHE O  48  ? N PHE N 48  O VAL O  55  ? O VAL N 55  
AC9 1 2 O HIS Q  172 ? O HIS B 172 N ILE Q  132 ? N ILE B 132 
AC9 2 3 O TYR Q  131 ? O TYR B 131 N CYS Q  91  ? N CYS B 91  
AC9 3 4 N ILE Q  90  ? N ILE B 90  O THR Q  217 ? O THR B 217 
AD1 1 2 O TYR Q  264 ? O TYR B 264 N TYR Q  252 ? N TYR B 252 
AD1 2 3 N GLN Q  253 ? N GLN B 253 O VAL Q  328 ? O VAL B 328 
AD1 3 4 O ILE Q  331 ? O ILE B 331 N ALA Q  289 ? N ALA B 289 
AD1 4 5 N ILE Q  290 ? N ILE B 290 O LEU Q  300 ? O LEU B 300 
AD2 1 2 O SER R  118 ? O SER C 118 N LEU R  80  ? N LEU C 80  
AD2 2 3 N GLN R  81  ? N GLN C 81  O GLN R  135 ? O GLN C 135 
AD3 1 2 O VAL S  11  ? O VAL D 11  N VAL S  4   ? N VAL D 4   
AD3 2 3 N LYS S  5   ? N LYS D 5   O VAL S  93  ? O VAL D 93  
AD3 3 4 O ASP S  94  ? O ASP D 94  N ARG S  51  ? N ARG D 51  
AD3 4 5 N VAL S  50  ? N VAL D 50  O ALA S  80  ? O ALA D 80  
AD4 1 2 N HIS S  168 ? N HIS D 168 O LEU S  176 ? O LEU D 176 
AD4 2 3 N ILE S  175 ? N ILE D 175 O LEU S  236 ? O LEU D 236 
AD5 1 2 N ASP S  201 ? N ASP D 201 O GLY S  212 ? O GLY D 212 
AD6 1 2 N GLU S  250 ? N GLU D 250 O THR S  269 ? O THR D 269 
AD6 2 3 N THR S  266 ? N THR D 266 O ARG S  278 ? O ARG D 278 
AD7 1 2 O VAL S  318 ? O VAL D 318 N VAL S  311 ? N VAL D 311 
AD7 2 3 N LEU S  310 ? N LEU D 310 O VAL S  601 ? O VAL D 601 
AD7 3 4 O VAL S  600 ? O VAL D 600 N MET S  585 ? N MET D 585 
AD7 4 5 O HIS S  586 ? O HIS D 586 N TYR S  568 ? N TYR D 568 
AD7 5 6 O TYR S  567 ? O TYR D 567 N GLY S  342 ? N GLY D 342 
AD7 6 7 N LEU S  343 ? N LEU D 343 O ASP S  370 ? O ASP D 370 
AD8 1 2 O ILE S  464 ? O ILE D 464 N LEU S  450 ? N LEU D 450 
AD8 2 3 O ALA S  449 ? O ALA D 449 N ALA S  396 ? N ALA D 396 
AD8 3 4 N LEU S  397 ? N LEU D 397 O ILE S  506 ? O ILE D 506 
AD8 4 5 N LEU S  505 ? N LEU D 505 O LEU S  533 ? O LEU D 533 
AD9 1 2 N GLY S  612 ? N GLY D 612 O LEU S  624 ? O LEU D 624 
AE1 1 2 N VAL S  736 ? N VAL D 736 O VAL S  743 ? O VAL D 743 
AE1 2 3 O VAL S  748 ? O VAL D 748 N LEU S  716 ? N LEU D 716 
AE1 3 4 N TRP S  717 ? N TRP D 717 O TYR S  759 ? O TYR D 759 
AE1 4 5 O LEU S  760 ? O LEU D 760 N TYR S  693 ? N TYR D 693 
AE1 5 6 N PHE S  692 ? N PHE D 692 O VAL S  771 ? O VAL D 771 
AE2 1 2 N VAL T  30  ? N VAL E 30  O LEU T  43  ? O LEU E 43  
AE2 2 3 N THR T  46  ? N THR E 46  O GLU T  54  ? O GLU E 54  
AE3 1 2 N GLY T  340 ? N GLY E 340 O SER T  359 ? O SER E 359 
AE3 2 3 O GLY T  351 ? O GLY E 351 N SER T  348 ? N SER E 348 
AE4 1 2 N GLY T  340 ? N GLY E 340 O SER T  359 ? O SER E 359 
AE4 2 3 N VAL T  358 ? N VAL E 358 O ARG T  367 ? O ARG E 367 
AE5 1 2 N GLU U  18  ? N GLU F 18  O TRP U  26  ? O TRP F 26  
AE5 2 3 N LEU U  25  ? N LEU F 25  O PHE U  89  ? O PHE F 89  
AE5 3 4 O VAL U  92  ? O VAL F 92  N VAL U  70  ? N VAL F 70  
AE5 4 5 O VAL U  71  ? O VAL F 71  N VAL U  53  ? N VAL F 53  
AE6 1 2 N LEU U  101 ? N LEU F 101 O GLU U  127 ? O GLU F 127 
AE7 1 2 N THR U  157 ? N THR F 157 O ILE U  165 ? O ILE F 165 
AE8 1 2 N ALA V  39  ? N ALA G 39  O VAL V  77  ? O VAL G 77  
AE8 2 3 N VAL V  80  ? N VAL G 80  O ILE V  106 ? O ILE G 106 
AE8 3 4 N SER V  107 ? N SER G 107 O VAL V  135 ? O VAL G 135 
AE9 1 2 N VAL W  31  ? N VAL O 31  O VAL W  162 ? O VAL O 162 
AF1 1 2 N VAL W  42  ? N VAL O 42  O VAL W  114 ? O VAL O 114 
AF2 1 2 N TYR W  69  ? N TYR O 69  O GLU W  92  ? O GLU O 92  
AF2 2 3 N ILE W  93  ? N ILE O 93  O TYR W  131 ? O TYR O 131 
AF3 1 2 N GLU X  32  ? N GLU I 32  O SER X  58  ? O SER I 58  
AF3 2 3 N LEU X  59  ? N LEU I 59  O LEU X  68  ? O LEU I 68  
AF3 3 4 N ASP X  71  ? N ASP I 71  O GLY X  83  ? O GLY I 83  
AF3 4 5 N LEU X  84  ? N LEU I 84  O LEU X  93  ? O LEU I 93  
AF3 5 6 N HIS X  96  ? N HIS I 96  O VAL X  104 ? O VAL I 104 
AF3 6 7 N THR X  105 ? N THR I 105 O ILE X  108 ? O ILE I 108 
AF4 1 2 N VAL Y  2   ? N VAL X 2   O LEU Y  58  ? O LEU X 58  
AF4 2 3 O VAL Y  59  ? O VAL X 59  N LEU Y  48  ? N LEU X 48  
AF4 3 4 O LEU Y  49  ? O LEU X 49  N TYR Y  32  ? N TYR X 32  
AF4 4 5 N VAL Y  31  ? N VAL X 31  O TYR Y  90  ? O TYR X 90  
AF4 5 6 N GLU Y  91  ? N GLU X 91  O ASN Y  119 ? O ASN X 119 
AF5 1 2 N ALA CA 53  ? N ALA T 53  O LEU CA 69  ? O LEU T 69  
AF6 1 2 N LEU DA 56  ? N LEU U 56  O VAL DA 61  ? O VAL U 61  
AF7 1 2 N PHE EA 48  ? N PHE V 48  O VAL EA 55  ? O VAL V 55  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software 1 SF4 501 ? 10 'binding site for residue SF4 1 501' 
AC2 Software 1 FMN 502 ? 12 'binding site for residue FMN 1 502' 
AC3 Software 2 FES 201 ? 9  'binding site for residue FES 2 201' 
AC4 Software 3 SF4 801 ? 8  'binding site for residue SF4 3 801' 
AC5 Software 3 SF4 802 ? 7  'binding site for residue SF4 3 802' 
AC6 Software 3 SF4 803 ? 9  'binding site for residue SF4 3 803' 
AC7 Software 3 FES 804 ? 9  'binding site for residue FES 3 804' 
AC8 Software 6 SF4 201 ? 11 'binding site for residue SF4 6 201' 
AC9 Software 9 SF4 201 ? 10 'binding site for residue SF4 9 201' 
AD1 Software 9 SF4 202 ? 11 'binding site for residue SF4 9 202' 
AD2 Software B SF4 501 ? 9  'binding site for residue SF4 B 501' 
AD3 Software B FMN 502 ? 14 'binding site for residue FMN B 502' 
AD4 Software C FES 201 ? 9  'binding site for residue FES C 201' 
AD5 Software D SF4 801 ? 9  'binding site for residue SF4 D 801' 
AD6 Software D SF4 802 ? 8  'binding site for residue SF4 D 802' 
AD7 Software D SF4 803 ? 9  'binding site for residue SF4 D 803' 
AD8 Software D FES 804 ? 9  'binding site for residue FES D 804' 
AD9 Software G SF4 201 ? 10 'binding site for residue SF4 G 201' 
AE1 Software O SF4 201 ? 9  'binding site for residue SF4 O 201' 
AE2 Software O SF4 202 ? 12 'binding site for residue SF4 O 202' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 10 ILE A 181 ? ILE 1 181 . ? 1_555 ? 
2   AC1 10 PRO A 199 ? PRO 1 199 . ? 1_555 ? 
3   AC1 10 SER A 352 ? SER 1 352 . ? 1_555 ? 
4   AC1 10 CYS A 353 ? CYS 1 353 . ? 1_555 ? 
5   AC1 10 GLY A 354 ? GLY 1 354 . ? 1_555 ? 
6   AC1 10 LYS A 355 ? LYS 1 355 . ? 1_555 ? 
7   AC1 10 CYS A 356 ? CYS 1 356 . ? 1_555 ? 
8   AC1 10 CYS A 359 ? CYS 1 359 . ? 1_555 ? 
9   AC1 10 CYS A 400 ? CYS 1 400 . ? 1_555 ? 
10  AC1 10 LEU A 402 ? LEU 1 402 . ? 1_555 ? 
11  AC2 12 GLY A 64  ? GLY 1 64  . ? 1_555 ? 
12  AC2 12 ARG A 65  ? ARG 1 65  . ? 1_555 ? 
13  AC2 12 GLY A 66  ? GLY 1 66  . ? 1_555 ? 
14  AC2 12 LYS A 75  ? LYS 1 75  . ? 1_555 ? 
15  AC2 12 ASN A 92  ? ASN 1 92  . ? 1_555 ? 
16  AC2 12 ASP A 94  ? ASP 1 94  . ? 1_555 ? 
17  AC2 12 GLY A 183 ? GLY 1 183 . ? 1_555 ? 
18  AC2 12 GLU A 184 ? GLU 1 184 . ? 1_555 ? 
19  AC2 12 ASN A 219 ? ASN 1 219 . ? 1_555 ? 
20  AC2 12 ASN A 220 ? ASN 1 220 . ? 1_555 ? 
21  AC2 12 THR A 223 ? THR 1 223 . ? 1_555 ? 
22  AC2 12 PRO A 401 ? PRO 1 401 . ? 1_555 ? 
23  AC3 9  CYS B 83  ? CYS 2 83  . ? 1_555 ? 
24  AC3 9  THR B 85  ? THR 2 85  . ? 1_555 ? 
25  AC3 9  SER B 87  ? SER 2 87  . ? 1_555 ? 
26  AC3 9  CYS B 88  ? CYS 2 88  . ? 1_555 ? 
27  AC3 9  CYS B 124 ? CYS 2 124 . ? 1_555 ? 
28  AC3 9  LEU B 125 ? LEU 2 125 . ? 1_555 ? 
29  AC3 9  GLY B 126 ? GLY 2 126 . ? 1_555 ? 
30  AC3 9  SER B 127 ? SER 2 127 . ? 1_555 ? 
31  AC3 9  CYS B 128 ? CYS 2 128 . ? 1_555 ? 
32  AC4 8  HIS C 115 ? HIS 3 115 . ? 1_555 ? 
33  AC4 8  ASP C 118 ? ASP 3 118 . ? 1_555 ? 
34  AC4 8  CYS C 119 ? CYS 3 119 . ? 1_555 ? 
35  AC4 8  CYS C 122 ? CYS 3 122 . ? 1_555 ? 
36  AC4 8  CYS C 128 ? CYS 3 128 . ? 1_555 ? 
37  AC4 8  GLN C 131 ? GLN 3 131 . ? 1_555 ? 
38  AC4 8  GLY C 233 ? GLY 3 233 . ? 1_555 ? 
39  AC4 8  ILE D 325 ? ILE 4 325 . ? 1_555 ? 
40  AC5 7  CYS C 181 ? CYS 3 181 . ? 1_555 ? 
41  AC5 7  ILE C 182 ? ILE 3 182 . ? 1_555 ? 
42  AC5 7  CYS C 184 ? CYS 3 184 . ? 1_555 ? 
43  AC5 7  CYS C 187 ? CYS 3 187 . ? 1_555 ? 
44  AC5 7  CYS C 230 ? CYS 3 230 . ? 1_555 ? 
45  AC5 7  VAL C 232 ? VAL 3 232 . ? 1_555 ? 
46  AC5 7  ALA C 234 ? ALA 3 234 . ? 1_555 ? 
47  AC6 9  CYS C 256 ? CYS 3 256 . ? 1_555 ? 
48  AC6 9  LEU C 258 ? LEU 3 258 . ? 1_555 ? 
49  AC6 9  CYS C 259 ? CYS 3 259 . ? 1_555 ? 
50  AC6 9  VAL C 261 ? VAL 3 261 . ? 1_555 ? 
51  AC6 9  GLY C 262 ? GLY 3 262 . ? 1_555 ? 
52  AC6 9  CYS C 263 ? CYS 3 263 . ? 1_555 ? 
53  AC6 9  ILE C 290 ? ILE 3 290 . ? 1_555 ? 
54  AC6 9  CYS C 291 ? CYS 3 291 . ? 1_555 ? 
55  AC6 9  PRO C 407 ? PRO 3 407 . ? 1_555 ? 
56  AC7 9  LEU C 32  ? LEU 3 32  . ? 1_555 ? 
57  AC7 9  CYS C 34  ? CYS 3 34  . ? 1_555 ? 
58  AC7 9  SER C 35  ? SER 3 35  . ? 1_555 ? 
59  AC7 9  GLY C 43  ? GLY 3 43  . ? 1_555 ? 
60  AC7 9  ALA C 44  ? ALA 3 44  . ? 1_555 ? 
61  AC7 9  CYS C 45  ? CYS 3 45  . ? 1_555 ? 
62  AC7 9  ARG C 46  ? ARG 3 46  . ? 1_555 ? 
63  AC7 9  CYS C 48  ? CYS 3 48  . ? 1_555 ? 
64  AC7 9  CYS C 83  ? CYS 3 83  . ? 1_555 ? 
65  AC8 11 ARG D 84  ? ARG 4 84  . ? 1_555 ? 
66  AC8 11 HIS D 169 ? HIS 4 169 . ? 1_555 ? 
67  AC8 11 ALA F 44  ? ALA 6 44  . ? 1_555 ? 
68  AC8 11 CYS F 45  ? CYS 6 45  . ? 1_555 ? 
69  AC8 11 CYS F 46  ? CYS 6 46  . ? 1_555 ? 
70  AC8 11 GLY F 82  ? GLY 6 82  . ? 1_555 ? 
71  AC8 11 ARG F 83  ? ARG 6 83  . ? 1_555 ? 
72  AC8 11 ALA F 110 ? ALA 6 110 . ? 1_555 ? 
73  AC8 11 CYS F 111 ? CYS 6 111 . ? 1_555 ? 
74  AC8 11 CYS F 140 ? CYS 6 140 . ? 1_555 ? 
75  AC8 11 PRO F 141 ? PRO 6 141 . ? 1_555 ? 
76  AC9 10 CYS G 63  ? CYS 9 63  . ? 1_555 ? 
77  AC9 10 PRO G 64  ? PRO 9 64  . ? 1_555 ? 
78  AC9 10 ILE G 68  ? ILE 9 68  . ? 1_555 ? 
79  AC9 10 CYS G 98  ? CYS 9 98  . ? 1_555 ? 
80  AC9 10 ILE G 99  ? ILE 9 99  . ? 1_555 ? 
81  AC9 10 PHE G 100 ? PHE 9 100 . ? 1_555 ? 
82  AC9 10 CYS G 101 ? CYS 9 101 . ? 1_555 ? 
83  AC9 10 GLY G 102 ? GLY 9 102 . ? 1_555 ? 
84  AC9 10 LEU G 103 ? LEU 9 103 . ? 1_555 ? 
85  AC9 10 CYS G 104 ? CYS 9 104 . ? 1_555 ? 
86  AD1 11 CYS G 53  ? CYS 9 53  . ? 1_555 ? 
87  AD1 11 ILE G 54  ? ILE 9 54  . ? 1_555 ? 
88  AD1 11 GLY G 55  ? GLY 9 55  . ? 1_555 ? 
89  AD1 11 CYS G 56  ? CYS 9 56  . ? 1_555 ? 
90  AD1 11 SER G 57  ? SER 9 57  . ? 1_555 ? 
91  AD1 11 CYS G 59  ? CYS 9 59  . ? 1_555 ? 
92  AD1 11 CYS G 108 ? CYS 9 108 . ? 1_555 ? 
93  AD1 11 PRO G 109 ? PRO 9 109 . ? 1_555 ? 
94  AD1 11 THR G 110 ? THR 9 110 . ? 1_555 ? 
95  AD1 11 ALA G 112 ? ALA 9 112 . ? 1_555 ? 
96  AD1 11 ILE G 113 ? ILE 9 113 . ? 1_555 ? 
97  AD2 9  PRO Q 199 ? PRO B 199 . ? 1_555 ? 
98  AD2 9  SER Q 352 ? SER B 352 . ? 1_555 ? 
99  AD2 9  CYS Q 353 ? CYS B 353 . ? 1_555 ? 
100 AD2 9  GLY Q 354 ? GLY B 354 . ? 1_555 ? 
101 AD2 9  LYS Q 355 ? LYS B 355 . ? 1_555 ? 
102 AD2 9  CYS Q 356 ? CYS B 356 . ? 1_555 ? 
103 AD2 9  CYS Q 359 ? CYS B 359 . ? 1_555 ? 
104 AD2 9  SER Q 398 ? SER B 398 . ? 1_555 ? 
105 AD2 9  CYS Q 400 ? CYS B 400 . ? 1_555 ? 
106 AD3 14 GLY Q 64  ? GLY B 64  . ? 1_555 ? 
107 AD3 14 ARG Q 65  ? ARG B 65  . ? 1_555 ? 
108 AD3 14 GLY Q 66  ? GLY B 66  . ? 1_555 ? 
109 AD3 14 LYS Q 75  ? LYS B 75  . ? 1_555 ? 
110 AD3 14 ASN Q 92  ? ASN B 92  . ? 1_555 ? 
111 AD3 14 ASP Q 94  ? ASP B 94  . ? 1_555 ? 
112 AD3 14 SER Q 96  ? SER B 96  . ? 1_555 ? 
113 AD3 14 TYR Q 180 ? TYR B 180 . ? 1_555 ? 
114 AD3 14 GLY Q 183 ? GLY B 183 . ? 1_555 ? 
115 AD3 14 GLU Q 184 ? GLU B 184 . ? 1_555 ? 
116 AD3 14 ASN Q 219 ? ASN B 219 . ? 1_555 ? 
117 AD3 14 ASN Q 220 ? ASN B 220 . ? 1_555 ? 
118 AD3 14 THR Q 223 ? THR B 223 . ? 1_555 ? 
119 AD3 14 LEU Q 402 ? LEU B 402 . ? 1_555 ? 
120 AD4 9  CYS R 83  ? CYS C 83  . ? 1_555 ? 
121 AD4 9  THR R 85  ? THR C 85  . ? 1_555 ? 
122 AD4 9  SER R 87  ? SER C 87  . ? 1_555 ? 
123 AD4 9  CYS R 88  ? CYS C 88  . ? 1_555 ? 
124 AD4 9  CYS R 124 ? CYS C 124 . ? 1_555 ? 
125 AD4 9  LEU R 125 ? LEU C 125 . ? 1_555 ? 
126 AD4 9  GLY R 126 ? GLY C 126 . ? 1_555 ? 
127 AD4 9  SER R 127 ? SER C 127 . ? 1_555 ? 
128 AD4 9  CYS R 128 ? CYS C 128 . ? 1_555 ? 
129 AD5 9  HIS S 115 ? HIS D 115 . ? 1_555 ? 
130 AD5 9  ASP S 118 ? ASP D 118 . ? 1_555 ? 
131 AD5 9  CYS S 119 ? CYS D 119 . ? 1_555 ? 
132 AD5 9  CYS S 122 ? CYS D 122 . ? 1_555 ? 
133 AD5 9  CYS S 128 ? CYS D 128 . ? 1_555 ? 
134 AD5 9  GLN S 131 ? GLN D 131 . ? 1_555 ? 
135 AD5 9  VAL S 232 ? VAL D 232 . ? 1_555 ? 
136 AD5 9  GLY S 233 ? GLY D 233 . ? 1_555 ? 
137 AD5 9  ILE T 325 ? ILE E 325 . ? 1_555 ? 
138 AD6 8  CYS S 181 ? CYS D 181 . ? 1_555 ? 
139 AD6 8  ILE S 182 ? ILE D 182 . ? 1_555 ? 
140 AD6 8  CYS S 184 ? CYS D 184 . ? 1_555 ? 
141 AD6 8  CYS S 187 ? CYS D 187 . ? 1_555 ? 
142 AD6 8  CYS S 230 ? CYS D 230 . ? 1_555 ? 
143 AD6 8  VAL S 232 ? VAL D 232 . ? 1_555 ? 
144 AD6 8  ALA S 234 ? ALA D 234 . ? 1_555 ? 
145 AD6 8  LEU S 235 ? LEU D 235 . ? 1_555 ? 
146 AD7 9  CYS S 256 ? CYS D 256 . ? 1_555 ? 
147 AD7 9  LEU S 258 ? LEU D 258 . ? 1_555 ? 
148 AD7 9  CYS S 259 ? CYS D 259 . ? 1_555 ? 
149 AD7 9  VAL S 261 ? VAL D 261 . ? 1_555 ? 
150 AD7 9  GLY S 262 ? GLY D 262 . ? 1_555 ? 
151 AD7 9  CYS S 263 ? CYS D 263 . ? 1_555 ? 
152 AD7 9  ILE S 290 ? ILE D 290 . ? 1_555 ? 
153 AD7 9  CYS S 291 ? CYS D 291 . ? 1_555 ? 
154 AD7 9  ILE S 408 ? ILE D 408 . ? 1_555 ? 
155 AD8 9  LEU S 32  ? LEU D 32  . ? 1_555 ? 
156 AD8 9  CYS S 34  ? CYS D 34  . ? 1_555 ? 
157 AD8 9  SER S 35  ? SER D 35  . ? 1_555 ? 
158 AD8 9  GLY S 43  ? GLY D 43  . ? 1_555 ? 
159 AD8 9  CYS S 45  ? CYS D 45  . ? 1_555 ? 
160 AD8 9  ARG S 46  ? ARG D 46  . ? 1_555 ? 
161 AD8 9  MET S 47  ? MET D 47  . ? 1_555 ? 
162 AD8 9  CYS S 48  ? CYS D 48  . ? 1_555 ? 
163 AD8 9  CYS S 83  ? CYS D 83  . ? 1_555 ? 
164 AD9 10 ARG T 84  ? ARG E 84  . ? 1_555 ? 
165 AD9 10 HIS T 169 ? HIS E 169 . ? 1_555 ? 
166 AD9 10 ALA V 44  ? ALA G 44  . ? 1_555 ? 
167 AD9 10 CYS V 45  ? CYS G 45  . ? 1_555 ? 
168 AD9 10 CYS V 46  ? CYS G 46  . ? 1_555 ? 
169 AD9 10 GLY V 82  ? GLY G 82  . ? 1_555 ? 
170 AD9 10 ALA V 110 ? ALA G 110 . ? 1_555 ? 
171 AD9 10 CYS V 111 ? CYS G 111 . ? 1_555 ? 
172 AD9 10 CYS V 140 ? CYS G 140 . ? 1_555 ? 
173 AD9 10 PRO V 141 ? PRO G 141 . ? 1_555 ? 
174 AE1 9  HIS W 41  ? HIS O 41  . ? 1_555 ? 
175 AE1 9  CYS W 63  ? CYS O 63  . ? 1_555 ? 
176 AE1 9  ILE W 68  ? ILE O 68  . ? 1_555 ? 
177 AE1 9  CYS W 98  ? CYS O 98  . ? 1_555 ? 
178 AE1 9  ILE W 99  ? ILE O 99  . ? 1_555 ? 
179 AE1 9  PHE W 100 ? PHE O 100 . ? 1_555 ? 
180 AE1 9  CYS W 101 ? CYS O 101 . ? 1_555 ? 
181 AE1 9  GLY W 102 ? GLY O 102 . ? 1_555 ? 
182 AE1 9  CYS W 104 ? CYS O 104 . ? 1_555 ? 
183 AE2 12 CYS W 53  ? CYS O 53  . ? 1_555 ? 
184 AE2 12 ILE W 54  ? ILE O 54  . ? 1_555 ? 
185 AE2 12 GLY W 55  ? GLY O 55  . ? 1_555 ? 
186 AE2 12 CYS W 56  ? CYS O 56  . ? 1_555 ? 
187 AE2 12 SER W 57  ? SER O 57  . ? 1_555 ? 
188 AE2 12 CYS W 59  ? CYS O 59  . ? 1_555 ? 
189 AE2 12 TYR W 91  ? TYR O 91  . ? 1_555 ? 
190 AE2 12 CYS W 108 ? CYS O 108 . ? 1_555 ? 
191 AE2 12 PRO W 109 ? PRO O 109 . ? 1_555 ? 
192 AE2 12 THR W 110 ? THR O 110 . ? 1_555 ? 
193 AE2 12 ALA W 112 ? ALA O 112 . ? 1_555 ? 
194 AE2 12 ILE W 113 ? ILE O 113 . ? 1_555 ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 SG  1 CYS 400 ? ? FE3 1 SF4 501 ? ? 1.85 
2  1 CD1 E LEU 47  ? ? O   E GLU 51  ? ? 2.00 
3  1 NZ  9 LYS 52  ? ? O   7 MET 44  ? ? 2.03 
4  1 OG  V SER 59  ? ? OG  V SER 100 ? ? 2.07 
5  1 O   Q ALA 29  ? ? OG1 Q THR 32  ? ? 2.09 
6  1 O   H ARG 50  ? ? N   H GLY 52  ? ? 2.09 
7  1 O   B ALA 372 ? ? OG1 B THR 376 ? ? 2.10 
8  1 OH  H TYR 162 ? ? O   H LEU 305 ? ? 2.10 
9  1 O   Q ALA 215 ? ? NH1 Q ARG 294 ? ? 2.10 
10 1 O   H SER 152 ? ? OG  H SER 155 ? ? 2.10 
11 1 OD2 D ASP 94  ? ? OG  D SER 97  ? ? 2.11 
12 1 O   M GLY 93  ? ? OH  M TYR 136 ? ? 2.11 
13 1 NH2 4 ARG 314 ? ? O   9 CYS 108 ? ? 2.12 
14 1 OH  1 TYR 131 ? ? O   2 LYS 17  ? ? 2.12 
15 1 O   T ILE 340 ? ? N   T GLY 345 ? ? 2.13 
16 1 OE1 P GLN 5   ? ? OH  Q TYR 10  ? ? 2.13 
17 1 OE2 D GLU 198 ? ? NH1 D ARG 440 ? ? 2.14 
18 1 O   H ALA 29  ? ? OG1 H THR 32  ? ? 2.14 
19 1 OG  J SER 15  ? ? O   J ALA 31  ? ? 2.15 
20 1 O   E GLU 333 ? ? OG  E SER 363 ? ? 2.15 
21 1 OH  B TYR 32  ? ? OE1 B GLU 116 ? ? 2.15 
22 1 OG1 4 THR 144 ? ? O   H ALA 295 ? ? 2.16 
23 1 OE2 D GLU 352 ? ? NE2 D GLN 661 ? ? 2.16 
24 1 OD1 T ASP 557 ? ? NE2 U HIS 211 ? ? 2.16 
25 1 NH1 3 ARG 9   ? ? O   3 ALA 26  ? ? 2.16 
26 1 NZ  5 LYS 35  ? ? O   5 THR 103 ? ? 2.16 
27 1 NH1 4 ARG 314 ? ? O   9 GLU 106 ? ? 2.16 
28 1 O   E ARG 84  ? ? NH2 G ARG 83  ? ? 2.17 
29 1 OH  T TYR 305 ? ? O   T ALA 406 ? ? 2.17 
30 1 OG  B SER 296 ? ? OH  B TYR 348 ? ? 2.17 
31 1 OE2 A GLU 6   ? ? OG1 H THR 2   ? ? 2.17 
32 1 OE1 A GLN 5   ? ? OH  H TYR 10  ? ? 2.17 
33 1 OH  I TYR 23  ? ? NH1 I ARG 123 ? ? 2.17 
34 1 ND2 B ASN 190 ? ? O   B ASN 198 ? ? 2.17 
35 1 O   J ASP 47  ? ? N   J GLY 122 ? ? 2.17 
36 1 OD2 3 ASP 8   ? ? OH  3 TYR 28  ? ? 2.17 
37 1 O   6 GLY 160 ? ? NH1 6 ARG 169 ? ? 2.18 
38 1 OH  4 TYR 81  ? ? O   6 MET 117 ? ? 2.18 
39 1 O   1 ALA 372 ? ? OG1 1 THR 376 ? ? 2.18 
40 1 O   G MET 50  ? ? OG  G SER 53  ? ? 2.18 
41 1 ND2 E ASN 306 ? ? OH  F TYR 192 ? ? 2.18 
42 1 O   6 MET 50  ? ? OG  6 SER 53  ? ? 2.18 
43 1 O   1 ALA 425 ? ? NZ  1 LYS 428 ? ? 2.18 
44 1 OD2 3 ASP 94  ? ? OG  3 SER 97  ? ? 2.19 
45 1 OE2 E GLU 341 ? ? OH  F TYR 57  ? ? 2.19 
46 1 OE2 9 GLU 171 ? ? NH2 7 ARG 43  ? ? 2.19 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_1            9 
_pdbx_validate_rmsd_bond.auth_comp_id_1            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_1             101 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            SG 
_pdbx_validate_rmsd_bond.auth_asym_id_2            9 
_pdbx_validate_rmsd_bond.auth_comp_id_2            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_2             101 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.699 
_pdbx_validate_rmsd_bond.bond_target_value         1.812 
_pdbx_validate_rmsd_bond.bond_deviation            -0.113 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.016 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 TYR 1 38  ? ? 69.43   -6.08   
2   1 GLU 1 47  ? ? -93.84  -62.02  
3   1 LYS 1 81  ? ? 71.19   -16.33  
4   1 ASP 1 82  ? ? -168.69 114.27  
5   1 PRO 1 401 ? ? -67.29  0.39    
6   1 ASN 2 137 ? ? 68.18   -28.45  
7   1 ASP 2 138 ? ? -157.25 -1.51   
8   1 ASN 3 7   ? ? 66.83   -28.52  
9   1 ASP 3 8   ? ? -157.91 0.41    
10  1 ALA 3 44  ? ? -121.08 -54.31  
11  1 LEU 3 117 ? ? 70.82   44.76   
12  1 GLU 3 193 ? ? -91.05  -61.24  
13  1 LEU 3 218 ? ? 56.40   71.21   
14  1 VAL 3 282 ? ? -150.06 85.80   
15  1 GLU 3 287 ? ? -78.28  -70.57  
16  1 GLN 3 303 ? ? -95.60  -62.97  
17  1 GLU 3 314 ? ? -106.57 74.81   
18  1 GLU 3 335 ? ? -98.86  32.96   
19  1 ASN 3 540 ? ? -93.66  33.31   
20  1 MET 3 673 ? ? 71.07   -4.10   
21  1 HIS 3 702 ? ? -66.87  3.46    
22  1 PRO 3 765 ? ? -84.13  42.51   
23  1 GLN 4 33  ? ? 75.03   -7.41   
24  1 MET 4 85  ? ? -92.05  -61.99  
25  1 THR 4 332 ? ? -95.96  -64.45  
26  1 ASP 4 401 ? ? 50.42   71.00   
27  1 PRO 5 99  ? ? -77.74  49.65   
28  1 ILE 5 135 ? ? -97.79  -61.60  
29  1 ASP 5 149 ? ? -67.79  2.29    
30  1 LEU 5 195 ? ? -101.66 79.33   
31  1 GLU 6 17  ? ? 69.64   -3.97   
32  1 ALA 6 56  ? ? -90.96  46.89   
33  1 ARG 6 57  ? ? -131.15 -38.29  
34  1 PRO 6 102 ? ? -69.32  79.81   
35  1 SER 6 114 ? ? -118.45 -169.72 
36  1 ARG 6 178 ? ? -172.17 148.49  
37  1 THR 9 23  ? ? 178.62  163.88  
38  1 SER 9 57  ? ? 54.83   17.16   
39  1 PHE 9 100 ? ? 64.31   63.88   
40  1 GLU 9 178 ? ? 68.73   -5.98   
41  1 MET 7 44  ? ? -95.69  -62.71  
42  1 ARG 7 88  ? ? 72.45   -6.01   
43  1 HIS 7 90  ? ? 39.82   59.96   
44  1 TRP W 37  ? ? 60.60   73.11   
45  1 ALA J 76  ? ? 53.94   9.31    
46  1 VAL J 157 ? ? -84.73  -70.76  
47  1 GLU J 158 ? ? 26.40   63.73   
48  1 LEU K 51  ? ? 72.41   -6.31   
49  1 GLU K 83  ? ? -78.41  -162.98 
50  1 SER K 84  ? ? -35.70  132.00  
51  1 PRO L 10  ? ? -83.97  38.53   
52  1 PHE L 20  ? ? -91.29  -67.38  
53  1 TRP L 59  ? ? -149.83 -159.99 
54  1 ASP L 70  ? ? -124.86 -167.82 
55  1 ASN L 198 ? ? 42.12   70.04   
56  1 MET L 245 ? ? 70.30   -11.77  
57  1 GLN L 361 ? ? 71.66   -12.45  
58  1 PRO L 396 ? ? -63.94  -178.97 
59  1 GLU L 428 ? ? 179.55  174.99  
60  1 PHE L 517 ? ? 54.12   74.76   
61  1 ARG M 90  ? ? 72.25   -4.62   
62  1 GLU M 92  ? ? 52.90   15.82   
63  1 ALA M 125 ? ? -57.89  -8.49   
64  1 LYS M 235 ? ? -93.12  34.54   
65  1 THR M 304 ? ? 51.03   81.81   
66  1 ASP N 56  ? ? -126.12 -169.99 
67  1 PRO N 191 ? ? -84.77  37.88   
68  1 THR N 213 ? ? -95.29  -64.74  
69  1 ALA N 227 ? ? -99.13  38.60   
70  1 ALA N 228 ? ? -39.91  127.39  
71  1 ALA N 278 ? ? 71.97   -12.34  
72  1 PRO N 338 ? ? -96.35  51.42   
73  1 PRO N 393 ? ? -77.51  43.02   
74  1 ALA N 422 ? ? -112.59 76.97   
75  1 ALA N 424 ? ? -79.85  -159.46 
76  1 VAL H 44  ? ? -48.53  -5.95   
77  1 ARG H 45  ? ? -59.70  175.19  
78  1 ARG H 50  ? ? -72.69  -139.47 
79  1 VAL H 51  ? ? -30.33  1.52    
80  1 PHE H 108 ? ? -92.08  34.77   
81  1 TYR H 111 ? ? -112.77 -71.35  
82  1 GLN H 112 ? ? -161.06 117.35  
83  1 TRP H 194 ? ? 47.71   71.99   
84  1 ALA H 215 ? ? -61.23  -71.05  
85  1 ARG H 216 ? ? 177.18  176.31  
86  1 PHE H 219 ? ? 62.85   -5.11   
87  1 ASP H 220 ? ? -92.89  48.32   
88  1 TYR H 232 ? ? 67.96   -4.79   
89  1 THR H 234 ? ? 79.66   -2.09   
90  1 SER H 238 ? ? -94.07  -63.15  
91  1 TRP H 267 ? ? -33.07  -71.81  
92  1 THR H 268 ? ? 24.34   57.11   
93  1 LEU H 272 ? ? 73.41   -11.69  
94  1 GLU H 273 ? ? 33.22   48.63   
95  1 ARG H 301 ? ? 76.81   -0.76   
96  1 TYR H 302 ? ? 66.98   -11.80  
97  1 LEU H 332 ? ? -70.48  -75.44  
98  1 TYR B 38  ? ? 70.55   -6.75   
99  1 GLU B 47  ? ? -92.79  -62.09  
100 1 LYS B 81  ? ? 71.99   -14.92  
101 1 ASP B 82  ? ? -167.77 112.35  
102 1 ASN C 137 ? ? 68.60   -29.06  
103 1 ASP C 138 ? ? -158.56 -1.47   
104 1 ASN D 7   ? ? 66.89   -27.96  
105 1 ASP D 8   ? ? -157.85 -0.26   
106 1 ALA D 44  ? ? -120.65 -53.97  
107 1 CYS D 48  ? ? -79.68  20.20   
108 1 GLU D 193 ? ? -91.45  -60.32  
109 1 LEU D 218 ? ? 58.47   72.15   
110 1 GLU D 287 ? ? -78.61  -72.21  
111 1 GLN D 303 ? ? -94.92  -62.94  
112 1 GLU D 314 ? ? -108.42 77.82   
113 1 GLU D 335 ? ? -98.64  30.18   
114 1 HIS D 468 ? ? -102.77 -169.36 
115 1 SER D 487 ? ? -69.52  -177.26 
116 1 ASN D 540 ? ? -90.64  31.67   
117 1 ARG D 667 ? ? -67.41  0.42    
118 1 MET D 673 ? ? 71.61   -5.64   
119 1 HIS D 702 ? ? -68.33  5.17    
120 1 PRO D 765 ? ? -84.53  43.06   
121 1 GLN E 33  ? ? 73.32   -6.32   
122 1 MET E 85  ? ? -92.72  -61.00  
123 1 THR E 332 ? ? -95.67  -63.09  
124 1 ASP E 401 ? ? 48.96   70.16   
125 1 PRO F 99  ? ? -77.79  49.56   
126 1 ILE F 135 ? ? -96.94  -61.44  
127 1 LEU F 195 ? ? -101.01 77.41   
128 1 GLU G 17  ? ? 70.71   -5.93   
129 1 ALA G 56  ? ? -91.49  46.68   
130 1 ARG G 57  ? ? -130.18 -38.87  
131 1 PRO G 102 ? ? -68.80  80.25   
132 1 SER G 114 ? ? -116.81 -169.73 
133 1 THR O 23  ? ? 177.86  164.86  
134 1 SER O 57  ? ? 55.59   17.96   
135 1 PHE O 100 ? ? 61.85   63.81   
136 1 GLU O 178 ? ? 69.34   -5.14   
137 1 MET I 44  ? ? -96.69  -63.37  
138 1 ARG I 88  ? ? 73.47   -5.72   
139 1 TRP X 37  ? ? 58.95   73.30   
140 1 ALA R 76  ? ? 53.06   8.72    
141 1 VAL R 157 ? ? -87.68  -71.35  
142 1 GLU R 158 ? ? 25.33   63.18   
143 1 LEU S 51  ? ? 72.44   -7.08   
144 1 GLU S 83  ? ? -79.02  -161.51 
145 1 SER S 84  ? ? -34.66  129.23  
146 1 PRO T 10  ? ? -84.20  39.57   
147 1 PHE T 20  ? ? -92.05  -67.87  
148 1 ASP T 70  ? ? -123.84 -166.71 
149 1 MET T 245 ? ? 70.18   -12.35  
150 1 GLN T 361 ? ? 72.31   -10.64  
151 1 PHE T 517 ? ? 53.50   73.73   
152 1 ARG U 90  ? ? 72.86   -4.35   
153 1 GLU U 92  ? ? 52.70   17.41   
154 1 LYS U 235 ? ? -93.91  33.67   
155 1 THR U 304 ? ? 51.69   81.53   
156 1 GLU U 416 ? ? -74.96  -169.69 
157 1 ASP V 56  ? ? -126.44 -169.41 
158 1 PRO V 191 ? ? -84.40  38.16   
159 1 THR V 213 ? ? -95.41  -64.63  
160 1 ALA V 227 ? ? -99.01  38.34   
161 1 ALA V 228 ? ? -39.89  126.80  
162 1 ALA V 278 ? ? 70.93   -13.04  
163 1 PRO V 338 ? ? -95.99  49.45   
164 1 PRO V 393 ? ? -79.05  41.87   
165 1 ALA V 422 ? ? -114.24 78.81   
166 1 ALA V 424 ? ? -79.28  -161.88 
167 1 VAL Q 44  ? ? -52.65  1.76    
168 1 ARG Q 45  ? ? -58.21  174.14  
169 1 GLU Q 70  ? ? 60.03   69.25   
170 1 PHE Q 108 ? ? -92.58  35.61   
171 1 TYR Q 111 ? ? -113.18 -70.88  
172 1 GLN Q 112 ? ? -161.58 117.61  
173 1 TRP Q 194 ? ? 49.38   70.44   
174 1 ALA Q 215 ? ? -63.00  -73.11  
175 1 ARG Q 216 ? ? 174.35  178.35  
176 1 PHE Q 219 ? ? 63.06   -5.89   
177 1 ASP Q 220 ? ? -92.30  46.94   
178 1 TYR Q 232 ? ? 66.61   -5.05   
179 1 THR Q 234 ? ? 80.38   -1.65   
180 1 SER Q 238 ? ? -91.57  -64.72  
181 1 TRP Q 267 ? ? -33.05  -71.59  
182 1 THR Q 268 ? ? 23.84   55.99   
183 1 LEU Q 272 ? ? 72.64   -12.35  
184 1 GLU Q 273 ? ? 32.75   48.14   
185 1 ARG Q 301 ? ? 75.97   -0.22   
186 1 TYR Q 302 ? ? 71.54   -12.37  
187 1 LEU Q 332 ? ? -73.15  -75.06  
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1  1 PRO L 435 ? ? HIS L 436 ? ? -146.97 
2  1 GLN H 43  ? ? VAL H 44  ? ? -144.73 
3  1 GLY H 52  ? ? PRO H 53  ? ? 31.71   
4  1 THR H 217 ? ? PRO H 218 ? ? 117.62  
5  1 GLY H 266 ? ? TRP H 267 ? ? -130.07 
6  1 LEU H 332 ? ? PRO H 333 ? ? 149.42  
7  1 PRO O 21  ? ? VAL O 22  ? ? -148.64 
8  1 PRO T 435 ? ? HIS T 436 ? ? -149.07 
9  1 GLN Q 43  ? ? VAL Q 44  ? ? -144.99 
10 1 THR Q 217 ? ? PRO Q 218 ? ? 116.57  
11 1 GLY Q 266 ? ? TRP Q 267 ? ? -129.93 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[1][1]_esd 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][2]_esd 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[1][3]_esd 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[2][2]_esd 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.T[2][3]_esd 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[3][3]_esd 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[1][1]_esd 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][2]_esd 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[1][3]_esd 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[2][2]_esd 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.L[2][3]_esd 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[3][3]_esd 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][1]_esd 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][2]_esd 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[1][3]_esd 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][1]_esd 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][2]_esd 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][3]_esd 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][1]_esd 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][2]_esd 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[3][3]_esd 
1   'X-RAY DIFFRACTION' ? refined -6.3055  -19.9258  149.2943 1.1650 ? -0.0656 ? -0.3461 ? 1.2199  ? -0.2265 ? 0.5083 ? 0.2022  ? 
0.0197  ? 0.1929  ? 0.0903  ? 0.0070  ? 0.6172  ? -0.0270 ? 0.0241  ? 0.0143  ? -0.0360 ? -0.0514 ? 0.0663  ? -0.1460 ? -0.1366 ? 
-0.0766 ? 
2   'X-RAY DIFFRACTION' ? refined -22.7326 -27.8435  140.1337 0.9783 ? 0.2914  ? 0.2680  ? 0.9250  ? 0.1304  ? 0.7496 ? 0.0019  ? 
0.0016  ? -0.0030 ? 0.0019  ? -0.0002 ? 0.0061  ? 0.0590  ? 0.0629  ? -0.0222 ? 0.0080  ? 0.0444  ? 0.0016  ? -0.0277 ? 0.0014  ? 
-0.0007 ? 
3   'X-RAY DIFFRACTION' ? refined -17.4876 -25.9550  126.8080 0.8791 ? -0.1225 ? 0.2732  ? 1.2862  ? -0.2948 ? 0.5554 ? 0.3141  ? 
-0.0944 ? 0.2103  ? 0.0331  ? -0.0605 ? 0.1402  ? 0.1304  ? -0.0794 ? 0.0526  ? 0.0603  ? 0.0787  ? -0.0378 ? -0.0957 ? -0.1095 ? 
0.0959  ? 
4   'X-RAY DIFFRACTION' ? refined -2.7157  -31.1511  136.1637 0.7806 ? -0.3141 ? -0.1109 ? 1.0608  ? -0.0284 ? 0.2861 ? 0.0995  ? 
-0.0117 ? -0.0573 ? 0.0473  ? 0.0422  ? 0.0615  ? 0.0092  ? 0.0557  ? -0.0493 ? 0.0134  ? 0.0173  ? -0.0197 ? -0.0724 ? 0.1602  ? 
0.0582  ? 
5   'X-RAY DIFFRACTION' ? refined -8.3096  -32.7616  127.6824 0.7015 ? -0.1521 ? -0.1056 ? 0.6352  ? -0.0434 ? 0.2897 ? 0.0357  ? 
0.0174  ? 0.0670  ? 0.0078  ? 0.0350  ? 0.1288  ? -0.1248 ? 0.1857  ? -0.0486 ? -0.0893 ? -0.0089 ? -0.0239 ? 0.1219  ? 0.1308  ? 
-0.1354 ? 
6   'X-RAY DIFFRACTION' ? refined 1.4510   -7.9408   129.4492 0.3907 ? -0.1656 ? 0.1279  ? 1.3078  ? -0.3875 ? 0.2156 ? 0.0292  ? 
0.0327  ? -0.0541 ? 0.1194  ? -0.0584 ? 0.1101  ? -0.0730 ? -0.1329 ? 0.1127  ? 0.0171  ? -0.2703 ? 0.1683  ? 0.0495  ? -0.3213 ? 
-0.9487 ? 
7   'X-RAY DIFFRACTION' ? refined 11.3040  -5.1911   113.1600 0.6787 ? -0.2750 ? 0.1532  ? 0.5121  ? -0.2577 ? 0.3134 ? 0.1684  ? 
-0.1251 ? 0.0468  ? 0.1118  ? -0.0923 ? 0.6262  ? 0.0053  ? -0.2265 ? 0.0714  ? 0.0506  ? 0.0118  ? -0.0266 ? 0.1951  ? -0.2762 ? 
0.2661  ? 
8   'X-RAY DIFFRACTION' ? refined 4.2391   -49.9395  127.5131 0.6198 ? -0.1624 ? -0.0126 ? 0.7504  ? -0.0224 ? 0.3615 ? 0.0092  ? 
0.0008  ? 0.0024  ? 0.0051  ? -0.0042 ? 0.0025  ? -0.0232 ? -0.0168 ? 0.1001  ? 0.0344  ? -0.0685 ? 0.0979  ? -0.0227 ? 0.0836  ? 
0.0002  ? 
9   'X-RAY DIFFRACTION' ? refined 9.7687   -42.8051  124.9594 0.7597 ? 0.0875  ? 0.0048  ? 0.5440  ? 0.0325  ? 0.4961 ? 0.0064  ? 
0.0042  ? 0.0034  ? 0.0039  ? 0.0037  ? 0.0023  ? 0.0097  ? -0.0162 ? 0.0312  ? 0.0793  ? 0.0380  ? -0.1438 ? -0.0236 ? -0.0043 ? 
0.0003  ? 
10  'X-RAY DIFFRACTION' ? refined 11.9861  -44.4933  116.3397 0.4398 ? 0.1350  ? -0.1523 ? 0.5353  ? -0.0107 ? 0.3365 ? 0.0420  ? 
-0.0040 ? 0.0456  ? 0.0008  ? -0.0023 ? 0.0466  ? 0.0054  ? -0.0361 ? -0.0093 ? -0.0198 ? 0.0180  ? 0.0249  ? 0.0160  ? -0.0464 ? 
0.0184  ? 
11  'X-RAY DIFFRACTION' ? refined 18.4084  -34.9991  122.6519 1.0951 ? 0.1162  ? -0.0366 ? 1.1009  ? 0.0668  ? 1.0646 ? -0.0002 ? 
-0.0001 ? 0.0006  ? 0.0021  ? 0.0010  ? 0.0055  ? 0.0022  ? -0.0025 ? 0.0352  ? -0.0324 ? 0.0103  ? 0.0289  ? 0.0055  ? -0.0596 ? 
0.0000  ? 
12  'X-RAY DIFFRACTION' ? refined 18.9070  -19.3449  128.6410 0.9847 ? -0.2478 ? -0.4146 ? 0.9771  ? -0.1697 ? 0.4877 ? 0.0046  ? 
0.0005  ? 0.0145  ? 0.0001  ? 0.0031  ? 0.0282  ? -0.0211 ? 0.0101  ? 0.0217  ? -0.0231 ? -0.0371 ? 0.0101  ? -0.0458 ? -0.0612 ? 
-0.0437 ? 
13  'X-RAY DIFFRACTION' ? refined 28.7730  -17.7163  126.8192 0.8605 ? -0.3879 ? -0.0426 ? 1.2077  ? -0.0509 ? 0.3436 ? 0.0179  ? 
-0.0015 ? 0.0196  ? 0.0185  ? -0.0108 ? 0.0280  ? -0.0104 ? 0.0126  ? 0.0041  ? -0.0474 ? 0.0104  ? 0.0114  ? -0.0391 ? -0.0646 ? 
0.0120  ? 
14  'X-RAY DIFFRACTION' ? refined 31.8463  -30.3705  124.4566 0.7402 ? -0.0829 ? 0.0737  ? 0.7865  ? -0.1094 ? 0.4451 ? 0.0011  ? 
0.0016  ? 0.0007  ? 0.0024  ? 0.0005  ? 0.0000  ? -0.0143 ? 0.0420  ? 0.0660  ? -0.0201 ? 0.0374  ? 0.0085  ? -0.0123 ? -0.0179 ? 
0.0003  ? 
15  'X-RAY DIFFRACTION' ? refined 17.1228  -21.5297  129.7611 0.6563 ? -0.2289 ? 0.0107  ? 0.8480  ? -0.1007 ? 0.4690 ? 0.0045  ? 
-0.0034 ? -0.0018 ? 0.0034  ? 0.0046  ? 0.0047  ? -0.0232 ? -0.0189 ? 0.0618  ? -0.0413 ? 0.0005  ? 0.0726  ? 0.0014  ? -0.0924 ? 
-0.0001 ? 
16  'X-RAY DIFFRACTION' ? refined 18.1501  -25.1145  135.6936 0.8854 ? -0.1585 ? -0.5232 ? 1.3118  ? -0.1686 ? 0.8226 ? 0.0015  ? 
0.0010  ? 0.0008  ? 0.0014  ? 0.0002  ? -0.0001 ? -0.0006 ? 0.0134  ? -0.0135 ? 0.0158  ? -0.0056 ? 0.0080  ? 0.0042  ? -0.0086 ? 
-0.0590 ? 
17  'X-RAY DIFFRACTION' ? refined 29.3546  -22.9932  138.2243 0.9872 ? -0.2152 ? -0.4730 ? 1.1945  ? -0.2936 ? 0.7462 ? 0.0064  ? 
0.0060  ? -0.0054 ? 0.0050  ? -0.0051 ? 0.0062  ? 0.0025  ? -0.0047 ? 0.0088  ? 0.0108  ? -0.0133 ? 0.0067  ? 0.0048  ? 0.0024  ? 
-0.0225 ? 
18  'X-RAY DIFFRACTION' ? refined 25.2768  -33.3941  143.7365 1.3132 ? -0.1323 ? -0.2040 ? 1.1841  ? 0.0704  ? 1.1201 ? 0.0074  ? 
-0.0021 ? 0.0019  ? 0.0022  ? -0.0019 ? 0.0011  ? -0.0022 ? -0.0050 ? 0.0001  ? 0.0025  ? -0.0105 ? -0.0173 ? 0.0089  ? 0.0119  ? 
-0.0002 ? 
19  'X-RAY DIFFRACTION' ? refined 16.5563  -16.5174  145.4066 1.3556 ? 0.0507  ? 0.0161  ? 2.0086  ? -0.3795 ? 0.6210 ? -0.0007 ? 
-0.0005 ? -0.0000 ? 0.0005  ? 0.0048  ? 0.0112  ? 0.0499  ? 0.0106  ? 0.0339  ? 0.0247  ? -0.0153 ? 0.0110  ? 0.0122  ? -0.0094 ? 
0.0005  ? 
20  'X-RAY DIFFRACTION' ? refined -7.8548  -20.6915  95.0214  0.4634 ? 0.0537  ? -0.1955 ? 0.4275  ? -0.1242 ? 0.3206 ? 0.8501  ? 
0.6690  ? -0.3780 ? 0.7815  ? -0.3115 ? 0.1492  ? -0.1936 ? -0.2422 ? -0.1144 ? 0.0455  ? -0.0194 ? -0.2717 ? -0.1677 ? -0.2412 ? 
-0.5766 ? 
21  'X-RAY DIFFRACTION' ? refined 9.8758   -24.4079  96.2290  0.3108 ? -0.1262 ? -0.2213 ? 0.7478  ? -0.0313 ? 0.2226 ? 0.2248  ? 
0.1882  ? -0.0444 ? 0.1845  ? -0.0171 ? 0.0138  ? 0.1355  ? 0.2846  ? -0.1109 ? -0.0447 ? 0.1037  ? -0.0632 ? 0.0738  ? 0.0804  ? 
0.6799  ? 
22  'X-RAY DIFFRACTION' ? refined 6.0489   -42.7154  87.2157  0.2304 ? -0.1968 ? -0.1064 ? -0.1512 ? 0.0820  ? 0.5663 ? 0.0476  ? 
-0.0639 ? -0.0941 ? 0.1949  ? 0.1449  ? 0.3977  ? 0.1082  ? -0.1770 ? 0.1364  ? -0.2278 ? 0.1515  ? -0.0256 ? -0.2170 ? 0.0950  ? 
0.4504  ? 
23  'X-RAY DIFFRACTION' ? refined 6.2809   -70.5103  60.3169  0.3611 ? 0.0995  ? 0.2368  ? 0.5030  ? 0.0075  ? 0.3119 ? 0.1399  ? 
0.1420  ? -0.0531 ? 0.2312  ? -0.0178 ? 0.0430  ? -0.0394 ? 0.0291  ? 0.0289  ? -0.0942 ? -0.0733 ? 0.0407  ? 0.1179  ? -0.1444 ? 
-0.2164 ? 
24  'X-RAY DIFFRACTION' ? refined -11.3953 -54.3657  91.1481  0.2338 ? 0.0496  ? -0.1180 ? 0.4755  ? -0.0051 ? 0.0856 ? 0.0271  ? 
0.1001  ? 0.0776  ? 0.5163  ? 0.1196  ? 0.4835  ? 0.0250  ? -0.2784 ? -0.0906 ? 0.3616  ? 0.2690  ? -0.0968 ? 0.0122  ? -0.2854 ? 
1.2833  ? 
25  'X-RAY DIFFRACTION' ? refined -8.6220  -69.3555  87.8098  0.2221 ? -0.0772 ? 0.0897  ? 0.7574  ? 0.1792  ? 0.3108 ? 0.0201  ? 
0.0132  ? 0.0178  ? 0.2529  ? 0.0313  ? 0.0263  ? -0.0173 ? -0.1394 ? -0.0792 ? 0.1889  ? 0.0054  ? 0.1689  ? 0.1330  ? 0.2195  ? 
-0.1514 ? 
26  'X-RAY DIFFRACTION' ? refined -3.2406  -57.8607  65.8650  0.3113 ? -0.0903 ? -0.2653 ? 0.4090  ? 0.1572  ? 0.4998 ? 0.0361  ? 
-0.0230 ? 0.0051  ? 0.0264  ? 0.0058  ? 0.1970  ? -0.1235 ? -0.1058 ? 0.0830  ? 0.0778  ? -0.0367 ? -0.1077 ? -0.2116 ? -0.0097 ? 
-0.0632 ? 
27  'X-RAY DIFFRACTION' ? refined -1.6605  -63.9080  86.3847  0.2029 ? -0.2099 ? -0.1040 ? 0.1404  ? -0.0789 ? 0.6003 ? 0.1702  ? 
-0.0097 ? 0.0320  ? 0.1293  ? -0.1106 ? 0.1751  ? 0.1570  ? -0.0887 ? -0.1722 ? -0.0307 ? -0.0256 ? 0.0441  ? 0.1253  ? 0.0774  ? 
-0.1057 ? 
28  'X-RAY DIFFRACTION' ? refined 10.6330  -71.8503  96.3348  0.2211 ? -0.2993 ? -0.0949 ? 0.2771  ? 0.1295  ? 0.5848 ? 0.0375  ? 
0.0466  ? -0.0289 ? 0.0808  ? 0.0421  ? 0.3091  ? 0.0507  ? 0.0822  ? 0.0268  ? -0.0455 ? 0.2129  ? -0.1163 ? 0.0041  ? -0.0841 ? 
0.4454  ? 
29  'X-RAY DIFFRACTION' ? refined 5.6442   -7.6322   50.5450  0.4897 ? 0.0628  ? -0.2781 ? -0.0126 ? -0.0323 ? 0.7749 ? 0.1410  ? 
-0.1021 ? -0.0476 ? 0.4055  ? 0.1215  ? 0.1306  ? -0.0046 ? 0.1449  ? 0.1456  ? 0.3619  ? -0.0329 ? -0.1791 ? -0.0039 ? -0.0045 ? 
-0.2128 ? 
30  'X-RAY DIFFRACTION' ? refined 21.1629  2.1414    54.2234  1.2439 ? -0.0581 ? 0.4293  ? 0.2685  ? 0.0325  ? 0.7009 ? 0.0200  ? 
-0.0255 ? 0.0185  ? 0.0242  ? -0.0198 ? 0.0213  ? 0.1084  ? -0.0052 ? 0.0915  ? 0.2016  ? -0.1272 ? -0.1769 ? 0.1007  ? 0.0424  ? 
0.1189  ? 
31  'X-RAY DIFFRACTION' ? refined 0.0044   8.1818    38.4983  0.8855 ? 0.3514  ? -0.1806 ? 0.8211  ? 0.3587  ? 0.6696 ? 0.0944  ? 
0.0608  ? -0.0047 ? 0.0562  ? 0.0218  ? 0.0334  ? -0.1174 ? -0.1017 ? 0.0302  ? 0.1245  ? -0.0187 ? -0.0499 ? -0.1696 ? -0.0583 ? 
-0.2891 ? 
32  'X-RAY DIFFRACTION' ? refined 4.5547   -1.6404   58.8116  0.8645 ? -0.0131 ? -0.0586 ? 0.0674  ? 0.1925  ? 0.3613 ? 0.0347  ? 
0.0567  ? -0.0111 ? 0.1713  ? -0.1285 ? 0.1561  ? 0.2273  ? 0.0097  ? 0.1117  ? 0.2552  ? -0.0030 ? 0.1351  ? -0.0488 ? -0.1125 ? 
0.3920  ? 
33  'X-RAY DIFFRACTION' ? refined -24.9317 6.1718    62.3280  1.8065 ? 0.7441  ? 0.1640  ? 2.3933  ? 0.0055  ? 2.1408 ? 0.0032  ? 
0.0001  ? -0.0017 ? -0.0001 ? -0.0001 ? 0.0000  ? -0.0325 ? 0.0187  ? -0.0042 ? 0.0166  ? -0.0244 ? -0.0060 ? 0.0320  ? 0.0299  ? 
-0.0002 ? 
34  'X-RAY DIFFRACTION' ? refined -19.8756 -4.3045   65.1166  0.9400 ? 0.2704  ? 0.3152  ? 1.0209  ? 0.1490  ? 1.0610 ? 0.0079  ? 
0.0001  ? -0.0021 ? 0.0028  ? 0.0024  ? 0.0044  ? 0.0979  ? -0.0110 ? 0.0229  ? -0.0302 ? 0.0622  ? 0.0453  ? -0.0305 ? 0.0996  ? 
0.0001  ? 
35  'X-RAY DIFFRACTION' ? refined -26.1906 -2.6803   52.4264  0.8894 ? 0.3658  ? -0.3668 ? 0.9733  ? 0.1487  ? 0.7907 ? 0.0045  ? 
0.0054  ? 0.0024  ? 0.0057  ? 0.0026  ? 0.0016  ? 0.0020  ? -0.0245 ? 0.0111  ? -0.0131 ? -0.0355 ? -0.0319 ? 0.0091  ? 0.0029  ? 
-0.0164 ? 
36  'X-RAY DIFFRACTION' ? refined -15.3305 -11.8472  60.2384  0.1943 ? 0.1682  ? -0.0443 ? 0.6665  ? 0.0867  ? 0.5577 ? 0.0715  ? 
-0.0421 ? 0.0007  ? 0.0565  ? -0.0256 ? 0.0734  ? -0.0180 ? 0.0942  ? -0.0194 ? -0.0259 ? -0.0454 ? 0.0317  ? -0.0440 ? -0.0485 ? 
-0.0206 ? 
37  'X-RAY DIFFRACTION' ? refined -14.0478 2.9937    53.6678  0.3458 ? 0.3116  ? 0.0732  ? 0.6005  ? 0.2650  ? 0.5431 ? 0.1260  ? 
-0.0369 ? 0.0257  ? 0.0207  ? 0.0227  ? 0.1001  ? -0.0843 ? -0.0432 ? 0.0233  ? -0.0053 ? -0.0454 ? 0.0075  ? 0.0215  ? 0.0458  ? 
-0.2151 ? 
38  'X-RAY DIFFRACTION' ? refined -19.8066 -10.5555  53.1819  0.2784 ? 0.2598  ? -0.0437 ? 0.5440  ? 0.0922  ? 0.2853 ? 0.0320  ? 
-0.0214 ? 0.0128  ? 0.0143  ? -0.0116 ? 0.0094  ? 0.0346  ? -0.0359 ? -0.0227 ? -0.0304 ? -0.0081 ? 0.0418  ? -0.0041 ? -0.0125 ? 
0.0775  ? 
39  'X-RAY DIFFRACTION' ? refined -11.0507 -13.5628  46.5213  0.2157 ? 0.0989  ? -0.0638 ? 0.7442  ? -0.3616 ? 0.3913 ? 0.0606  ? 
-0.0575 ? -0.0418 ? 0.0728  ? 0.0288  ? 0.0358  ? 0.0125  ? 0.0004  ? -0.0148 ? 0.0005  ? -0.0105 ? 0.0136  ? 0.0150  ? 0.0271  ? 
-0.0804 ? 
40  'X-RAY DIFFRACTION' ? refined -11.8783 -18.8819  44.2171  0.2335 ? 0.0814  ? -0.2728 ? 0.3089  ? 0.1153  ? 0.3445 ? 0.0932  ? 
-0.0174 ? -0.1053 ? 0.0497  ? -0.0083 ? 0.1325  ? 0.0416  ? 0.1253  ? -0.0133 ? -0.0190 ? -0.0642 ? -0.0385 ? -0.0484 ? -0.1162 ? 
-0.0306 ? 
41  'X-RAY DIFFRACTION' ? refined 4.0400   -30.1811  61.9333  0.3846 ? -0.0010 ? -0.1091 ? 0.0705  ? 0.0538  ? 0.4326 ? 0.0033  ? 
-0.0110 ? -0.0257 ? 0.0488  ? 0.0513  ? 0.3574  ? 0.1718  ? 0.0005  ? -0.0390 ? 0.0137  ? 0.1040  ? -0.0747 ? 0.0098  ? -0.0600 ? 
0.4149  ? 
42  'X-RAY DIFFRACTION' ? refined -4.0922  -26.5619  80.4397  0.5811 ? -0.0619 ? 0.0411  ? 0.6968  ? -0.0657 ? 0.8114 ? 0.0051  ? 
-0.0006 ? 0.0017  ? 0.0011  ? -0.0026 ? 0.0045  ? -0.0202 ? -0.0226 ? 0.0242  ? 0.0365  ? 0.0007  ? -0.0716 ? 0.0431  ? 0.0166  ? 
-0.0001 ? 
43  'X-RAY DIFFRACTION' ? refined -3.9333  -9.8957   81.4624  0.5312 ? 0.0260  ? 0.2312  ? 0.5230  ? 0.0400  ? 0.3812 ? 0.0204  ? 
-0.0031 ? -0.0080 ? 0.0005  ? 0.0002  ? 0.0084  ? -0.0280 ? 0.0071  ? -0.0437 ? 0.0038  ? 0.0053  ? -0.0022 ? 0.0276  ? -0.0074 ? 
-0.0236 ? 
44  'X-RAY DIFFRACTION' ? refined 39.0928  -29.7404  30.7708  0.4605 ? -0.0454 ? 0.0372  ? 0.3388  ? 0.2562  ? 0.5115 ? 0.0220  ? 
-0.0133 ? -0.0221 ? 0.0147  ? 0.0192  ? 0.0278  ? 0.0099  ? 0.0032  ? 0.0460  ? 0.0551  ? -0.0030 ? 0.0107  ? -0.0935 ? 0.0016  ? 
-0.0088 ? 
45  'X-RAY DIFFRACTION' ? refined 21.1535  -13.7576  41.7443  0.7331 ? 0.2372  ? 0.2582  ? 0.8399  ? 0.1304  ? 0.4904 ? 0.0173  ? 
0.0270  ? 0.0183  ? 0.0940  ? 0.0567  ? 0.0382  ? -0.0412 ? -0.0237 ? 0.0352  ? -0.1698 ? -0.1380 ? 0.0973  ? 0.0027  ? -0.1044 ? 
-0.0108 ? 
46  'X-RAY DIFFRACTION' ? refined 26.3412  -14.5764  35.3510  1.9230 ? -0.6578 ? 0.2335  ? 2.4451  ? -0.3399 ? 1.5102 ? 0.0198  ? 
0.0094  ? -0.0140 ? 0.0071  ? -0.0010 ? 0.0125  ? -0.1002 ? 0.0487  ? 0.0482  ? 0.0329  ? -0.1469 ? -0.1346 ? -0.0789 ? 0.0034  ? 
-0.0023 ? 
47  'X-RAY DIFFRACTION' ? refined 20.6653  -27.0053  43.9696  0.4318 ? 0.0259  ? -0.0583 ? 0.0857  ? 0.1138  ? 0.7226 ? 0.1659  ? 
-0.0538 ? -0.0039 ? 0.2592  ? -0.0585 ? 0.1120  ? -0.1614 ? -0.0173 ? 0.0748  ? 0.1174  ? -0.1265 ? -0.1481 ? -0.1346 ? 0.1118  ? 
-0.6249 ? 
48  'X-RAY DIFFRACTION' ? refined 26.5384  12.5860   32.1618  0.8029 ? -0.2306 ? 0.1839  ? 0.5153  ? 0.4427  ? 0.5861 ? 0.0132  ? 
0.0220  ? -0.0221 ? 0.0796  ? -0.0084 ? 0.0565  ? 0.0026  ? 0.0191  ? 0.0032  ? 0.0126  ? 0.0054  ? -0.0145 ? -0.0117 ? -0.0371 ? 
0.0159  ? 
49  'X-RAY DIFFRACTION' ? refined 33.4756  -6.6266   53.1058  0.4297 ? -0.2586 ? 0.0219  ? 0.4459  ? -0.0615 ? 0.6162 ? 0.0092  ? 
0.0412  ? 0.0219  ? 0.2119  ? 0.0836  ? 0.0642  ? -0.0753 ? -0.0190 ? 0.0391  ? 0.1710  ? -0.1294 ? -0.0057 ? 0.0276  ? -0.0748 ? 
-0.0728 ? 
50  'X-RAY DIFFRACTION' ? refined 31.2586  -21.5077  73.7288  0.4321 ? -0.2476 ? -0.0566 ? 0.1407  ? 0.0912  ? 0.5059 ? 0.0117  ? 
0.0070  ? 0.0232  ? 0.0045  ? 0.0033  ? 0.0811  ? 0.0246  ? 0.0252  ? 0.0304  ? -0.0663 ? 0.0389  ? 0.0292  ? -0.0101 ? -0.0351 ? 
0.0801  ? 
51  'X-RAY DIFFRACTION' ? refined 19.6711  -27.3575  74.1199  0.4280 ? -0.1431 ? -0.1107 ? 0.0217  ? -0.0298 ? 0.4650 ? 0.0205  ? 
-0.0533 ? -0.0207 ? 0.1626  ? 0.0174  ? 0.0957  ? -0.0082 ? -0.0075 ? 0.1108  ? -0.0610 ? -0.0212 ? 0.0479  ? -0.1416 ? 0.0479  ? 
-0.0523 ? 
52  'X-RAY DIFFRACTION' ? refined 23.3549  -26.4501  73.8040  0.4454 ? -0.3140 ? 0.0044  ? 0.1135  ? -0.0562 ? 0.4120 ? 0.0385  ? 
0.0735  ? 0.0039  ? 0.1212  ? 0.0402  ? 0.1543  ? 0.0908  ? -0.0635 ? 0.1550  ? 0.1514  ? 0.0606  ? -0.0208 ? -0.0797 ? 0.0796  ? 
0.6563  ? 
53  'X-RAY DIFFRACTION' ? refined 27.8222  -25.3391  59.4561  0.3588 ? 0.0935  ? 0.0076  ? 0.1794  ? 0.1496  ? 0.4394 ? 0.0772  ? 
-0.0776 ? 0.0886  ? 0.0743  ? -0.0851 ? 0.0952  ? 0.0617  ? 0.0490  ? -0.0474 ? -0.1403 ? -0.0867 ? -0.0043 ? 0.0234  ? 0.0447  ? 
-0.0018 ? 
54  'X-RAY DIFFRACTION' ? refined 37.4879  -21.3949  59.9752  0.1745 ? 0.0537  ? -0.1396 ? 0.1879  ? 0.0806  ? 0.3372 ? 0.0433  ? 
0.0042  ? 0.0431  ? 0.0304  ? 0.0180  ? 0.0485  ? 0.0160  ? -0.1052 ? -0.0333 ? -0.0232 ? 0.0169  ? -0.0191 ? 0.0207  ? -0.1049 ? 
0.0352  ? 
55  'X-RAY DIFFRACTION' ? refined 37.7269  -11.9381  68.7265  0.5509 ? -0.1239 ? -0.0631 ? 0.6667  ? -0.0421 ? 0.2136 ? 0.0301  ? 
-0.0003 ? -0.0191 ? 0.0535  ? -0.0325 ? 0.0328  ? -0.0363 ? 0.0168  ? 0.0346  ? -0.0206 ? -0.0824 ? 0.0242  ? -0.0601 ? -0.0167 ? 
-0.0344 ? 
56  'X-RAY DIFFRACTION' ? refined 37.3519  -25.2672  102.8545 0.2819 ? -0.0779 ? -0.0730 ? 1.1705  ? 0.0693  ? 0.5474 ? 0.1338  ? 
0.0159  ? -0.0673 ? 0.0030  ? -0.0251 ? 0.2537  ? 0.1152  ? 0.2463  ? -0.0353 ? -0.0328 ? 0.1153  ? -0.0623 ? 0.0674  ? 0.0841  ? 
0.1471  ? 
57  'X-RAY DIFFRACTION' ? refined 29.1217  -24.4638  92.3528  0.5568 ? -0.1068 ? -0.2521 ? 0.2609  ? -0.0267 ? 0.4845 ? 0.3427  ? 
-0.1508 ? -0.3253 ? 0.1220  ? 0.1930  ? 0.3556  ? 0.1503  ? -0.1069 ? -0.0512 ? -0.0987 ? 0.1864  ? -0.1037 ? 0.0150  ? 0.0233  ? 
0.3708  ? 
58  'X-RAY DIFFRACTION' ? refined 25.3104  -25.2309  102.4962 0.8079 ? -0.3701 ? -0.2726 ? 0.6425  ? 0.2199  ? 0.8149 ? 0.0150  ? 
0.0226  ? -0.0053 ? 0.0417  ? -0.0072 ? 0.0033  ? -0.1138 ? 0.1309  ? 0.1849  ? -0.0259 ? -0.0369 ? -0.0150 ? -0.1590 ? 0.1068  ? 
-0.0104 ? 
59  'X-RAY DIFFRACTION' ? refined 30.0644  -22.5674  112.7057 0.7586 ? -0.0525 ? -0.1156 ? 0.8117  ? -0.2389 ? 0.5412 ? 0.0032  ? 
-0.0049 ? -0.0039 ? 0.0056  ? 0.0091  ? 0.0167  ? -0.0864 ? -0.0592 ? -0.0062 ? 0.0521  ? 0.0194  ? 0.0406  ? 0.0077  ? 0.0839  ? 
-0.0000 ? 
60  'X-RAY DIFFRACTION' ? refined 31.6600  -36.6854  112.8937 0.3642 ? -0.1571 ? -0.1457 ? 0.5479  ? 0.1402  ? 0.2999 ? 0.0170  ? 
-0.0233 ? -0.0231 ? 0.0494  ? 0.0540  ? 0.0594  ? -0.0025 ? -0.0406 ? 0.0000  ? -0.0066 ? 0.0551  ? -0.0140 ? 0.0317  ? 0.1682  ? 
0.0827  ? 
61  'X-RAY DIFFRACTION' ? refined -0.5709  -53.1477  51.7627  0.4404 ? -0.1326 ? -0.0726 ? 0.4396  ? -0.0252 ? 0.3257 ? 0.0113  ? 
-0.0025 ? -0.0010 ? 0.0004  ? 0.0003  ? 0.0007  ? 0.0263  ? -0.0168 ? -0.0148 ? 0.0353  ? -0.0117 ? -0.0373 ? -0.0045 ? 0.0021  ? 
-0.0081 ? 
62  'X-RAY DIFFRACTION' ? refined 0.5253   -48.5800  41.3620  0.4137 ? 0.1783  ? -0.1342 ? 0.3872  ? -0.1802 ? 0.2748 ? 0.0905  ? 
-0.0898 ? 0.0110  ? 0.0900  ? 0.0073  ? 0.1511  ? -0.0945 ? -0.0418 ? 0.0540  ? -0.0209 ? -0.0056 ? 0.0129  ? -0.0467 ? 0.0204  ? 
-0.1770 ? 
63  'X-RAY DIFFRACTION' ? refined 15.4030  -42.3137  52.8276  0.7120 ? 0.3040  ? 0.4172  ? 1.0554  ? 0.0366  ? 0.7562 ? 0.0247  ? 
0.0107  ? 0.0191  ? 0.0052  ? 0.0083  ? 0.0157  ? -0.0081 ? -0.0167 ? 0.0042  ? -0.0022 ? 0.0350  ? -0.0114 ? 0.0052  ? -0.0199 ? 
0.0380  ? 
64  'X-RAY DIFFRACTION' ? refined 1.4393   -47.5863  47.2344  0.3934 ? 0.0423  ? -0.1071 ? 0.4342  ? -0.1556 ? 0.3647 ? 0.1431  ? 
0.0425  ? -0.0975 ? 0.1247  ? -0.1193 ? 0.1394  ? -0.0602 ? -0.0755 ? 0.0166  ? -0.0372 ? -0.0113 ? -0.0064 ? 0.0269  ? 0.2279  ? 
-0.1049 ? 
65  'X-RAY DIFFRACTION' ? refined 6.4947   -43.7300  41.0874  0.3801 ? 0.0037  ? -0.1736 ? 0.3892  ? -0.0794 ? 0.1967 ? -0.0004 ? 
-0.0091 ? 0.0154  ? 0.1484  ? -0.1195 ? 0.1157  ? -0.0383 ? 0.0348  ? 0.0134  ? 0.0764  ? 0.0135  ? -0.0210 ? -0.1012 ? -0.0624 ? 
0.0386  ? 
66  'X-RAY DIFFRACTION' ? refined 0.2738   -44.7500  59.4299  0.6902 ? 0.1018  ? -0.0539 ? 0.6248  ? 0.0258  ? 0.4022 ? 0.0053  ? 
-0.0001 ? -0.0010 ? -0.0002 ? -0.0005 ? 0.0013  ? 0.0112  ? 0.0004  ? 0.0036  ? 0.0082  ? -0.0209 ? -0.0495 ? -0.0058 ? 0.0070  ? 
-0.0001 ? 
67  'X-RAY DIFFRACTION' ? refined -4.8683  -37.2656  53.8513  0.5406 ? -0.3876 ? -0.1346 ? 0.9048  ? -0.0612 ? 0.6282 ? 0.0409  ? 
0.0256  ? 0.0159  ? 0.0156  ? 0.0096  ? 0.0060  ? 0.0306  ? -0.0233 ? 0.0142  ? -0.0076 ? 0.0554  ? -0.0194 ? -0.0302 ? 0.0433  ? 
0.0041  ? 
68  'X-RAY DIFFRACTION' ? refined 10.2500  -37.9378  42.2253  0.3418 ? 0.1011  ? -0.0353 ? 0.5915  ? 0.1154  ? 0.3301 ? 0.0073  ? 
-0.0064 ? 0.0073  ? 0.0053  ? -0.0063 ? 0.0129  ? 0.0002  ? -0.0082 ? -0.0012 ? 0.0113  ? 0.0016  ? 0.0024  ? 0.0059  ? -0.0001 ? 
-0.0159 ? 
69  'X-RAY DIFFRACTION' ? refined 19.2383  -12.1725  7.0446   0.2572 ? 0.1429  ? 0.1626  ? 0.2614  ? 0.0523  ? 0.3184 ? 0.1819  ? 
-0.0108 ? 0.0169  ? 0.0718  ? 0.0181  ? 0.5452  ? 0.1657  ? -0.0957 ? 0.1311  ? -0.0792 ? 0.0975  ? 0.0250  ? -0.0441 ? 0.2735  ? 
0.6804  ? 
70  'X-RAY DIFFRACTION' ? refined 8.0878   12.5700   -1.7883  1.1220 ? -0.2399 ? 0.1435  ? 0.8937  ? 0.2488  ? 0.4581 ? 0.0901  ? 
-0.0433 ? -0.0832 ? 0.0209  ? 0.0401  ? 0.0739  ? 0.0464  ? 0.1044  ? 0.0243  ? 0.0512  ? -0.1685 ? 0.0626  ? 0.2257  ? 0.0081  ? 
-0.0881 ? 
71  'X-RAY DIFFRACTION' ? refined 20.0379  -23.3495  -11.3872 1.0836 ? 0.1315  ? -0.2336 ? 0.8882  ? -0.3132 ? 0.5308 ? 0.0407  ? 
-0.0051 ? -0.0005 ? 0.0692  ? -0.0576 ? 0.0675  ? 0.0082  ? 0.0397  ? 0.0090  ? -0.0473 ? -0.0729 ? 0.0629  ? 0.0387  ? 0.0562  ? 
-0.0492 ? 
72  'X-RAY DIFFRACTION' ? refined 17.3132  -11.0997  -5.3488  0.5576 ? 0.2916  ? -0.3105 ? 0.8127  ? 0.2685  ? 0.8022 ? 0.0867  ? 
-0.0539 ? -0.0030 ? 0.0563  ? -0.0054 ? -0.0001 ? -0.0241 ? 0.0377  ? 0.0101  ? 0.0201  ? 0.0735  ? 0.0226  ? -0.0657 ? 0.0296  ? 
0.4198  ? 
73  'X-RAY DIFFRACTION' ? refined 1.9860   -26.3053  -13.1370 0.9449 ? 0.0039  ? 0.0092  ? 0.8071  ? 0.0910  ? 0.4959 ? 0.0001  ? 
0.0060  ? -0.0068 ? 0.0087  ? -0.0080 ? 0.0046  ? 0.1919  ? -0.2506 ? -0.1517 ? 0.2606  ? -0.0790 ? 0.1385  ? 0.2005  ? -0.1666 ? 
-0.0014 ? 
74  'X-RAY DIFFRACTION' ? refined 14.4553  1.5549    -15.6059 0.4753 ? 0.0483  ? 0.1269  ? 0.5323  ? 0.1992  ? 0.2524 ? 0.0038  ? 
0.0108  ? 0.0327  ? 0.0333  ? 0.0816  ? 0.1895  ? -0.0113 ? -0.0074 ? -0.0239 ? -0.1334 ? -0.0981 ? -0.1294 ? -0.1292 ? -0.0161 ? 
-0.3685 ? 
75  'X-RAY DIFFRACTION' ? refined 10.6796  -20.5183  -16.5439 1.1172 ? 0.2273  ? -0.0373 ? 1.0031  ? -0.1103 ? 0.3580 ? 0.0974  ? 
-0.0500 ? -0.0386 ? 0.0682  ? 0.0058  ? 0.0201  ? 0.1519  ? 0.0295  ? -0.0221 ? -0.0292 ? 0.0748  ? -0.0759 ? 0.0459  ? 0.0535  ? 
0.0186  ? 
76  'X-RAY DIFFRACTION' ? refined 13.7596  -10.9430  -16.6435 0.5140 ? 0.2390  ? 0.0000  ? 0.9621  ? 0.2425  ? 0.2821 ? 0.0427  ? 
0.0496  ? 0.0199  ? 0.0978  ? 0.0273  ? 0.0409  ? -0.0296 ? -0.0751 ? -0.0019 ? -0.1238 ? 0.0327  ? 0.0321  ? -0.0529 ? -0.0747 ? 
0.2080  ? 
77  'X-RAY DIFFRACTION' ? refined 7.4857   -4.0597   -9.7457  0.7446 ? 0.0803  ? -0.3627 ? 0.3413  ? 0.0538  ? 0.5394 ? 0.0273  ? 
-0.0084 ? 0.0007  ? 0.0159  ? -0.0253 ? 0.0510  ? -0.0648 ? -0.0362 ? 0.0408  ? 0.0334  ? 0.0528  ? -0.0169 ? -0.0477 ? 0.0160  ? 
0.0670  ? 
78  'X-RAY DIFFRACTION' ? refined -8.1200  -15.7841  2.8127   1.8536 ? 0.1757  ? -0.1945 ? 1.9178  ? 0.3235  ? 1.8555 ? 0.0005  ? 
-0.0017 ? -0.0011 ? 0.0126  ? 0.0055  ? 0.0028  ? 0.0110  ? -0.0016 ? 0.0036  ? -0.0148 ? 0.0243  ? 0.0068  ? 0.0158  ? -0.0162 ? 
0.0001  ? 
79  'X-RAY DIFFRACTION' ? refined -14.5872 -19.3776  -8.3379  0.5276 ? -0.1348 ? 0.0833  ? 0.3942  ? 0.1193  ? 0.6674 ? 0.0027  ? 
0.0033  ? -0.0027 ? 0.0038  ? -0.0032 ? 0.0027  ? -0.0256 ? -0.0306 ? -0.0114 ? 0.0116  ? 0.0103  ? -0.0231 ? 0.0287  ? 0.0552  ? 
0.0002  ? 
80  'X-RAY DIFFRACTION' ? refined -69.9149 -1.7544   -75.5720 0.6685 ? 0.1957  ? -0.1058 ? 2.2871  ? 0.3596  ? 0.7817 ? 0.0068  ? 
-0.0213 ? 0.0058  ? 0.3579  ? -0.0591 ? 0.0121  ? -0.1190 ? 0.5475  ? 0.1726  ? -0.3296 ? -0.2785 ? -0.0123 ? -0.1721 ? 0.2602  ? 
-0.2007 ? 
81  'X-RAY DIFFRACTION' ? refined -71.3465 -24.2021  -76.1985 0.5279 ? -0.0373 ? -0.1298 ? 0.7781  ? -0.0096 ? 0.2734 ? 0.1322  ? 
0.0185  ? -0.0387 ? 0.0598  ? 0.0012  ? 0.0069  ? -0.0180 ? -0.0576 ? 0.1577  ? -0.2093 ? -0.0711 ? 0.1425  ? -0.0053 ? -0.1820 ? 
-0.0449 ? 
82  'X-RAY DIFFRACTION' ? refined -93.6487 -21.8742  -73.8363 0.7451 ? -0.3289 ? -0.4187 ? 0.9074  ? 0.1062  ? 0.7889 ? 0.0106  ? 
-0.0101 ? -0.0084 ? 0.0092  ? 0.0061  ? 0.0029  ? 0.0489  ? -0.0067 ? -0.0743 ? 0.0567  ? 0.0537  ? -0.0407 ? 0.0841  ? 0.0127  ? 
0.0322  ? 
83  'X-RAY DIFFRACTION' ? refined -75.4571 -30.5251  -95.5607 0.8021 ? 0.0554  ? 0.1282  ? 1.1490  ? 0.0824  ? 0.8144 ? 0.0157  ? 
-0.0294 ? -0.0214 ? 0.0371  ? 0.0234  ? 0.0105  ? 0.0023  ? -0.1748 ? -0.1327 ? 0.0634  ? 0.0191  ? 0.1901  ? 0.0429  ? -0.0666 ? 
-0.0008 ? 
84  'X-RAY DIFFRACTION' ? refined -77.2372 -44.0462  -65.9776 0.6625 ? 0.0276  ? 0.3233  ? 0.8804  ? -0.1321 ? 0.3285 ? 0.1427  ? 
-0.1299 ? -0.2239 ? 0.1635  ? 0.1447  ? 0.4215  ? 0.0071  ? -0.0490 ? 0.0773  ? 0.0457  ? 0.0808  ? -0.0790 ? -0.0368 ? 0.1099  ? 
0.2154  ? 
85  'X-RAY DIFFRACTION' ? refined -24.5967 -23.9506  -32.4531 0.5641 ? 0.0958  ? 0.3023  ? 0.3411  ? -0.0691 ? 0.3273 ? 0.0040  ? 
0.0203  ? 0.0027  ? 0.1534  ? 0.0491  ? 0.2024  ? -0.0048 ? 0.0861  ? -0.0259 ? 0.1207  ? -0.0296 ? 0.0165  ? -0.1567 ? -0.3172 ? 
-0.0201 ? 
86  'X-RAY DIFFRACTION' ? refined -41.1405 9.2081    -49.7170 0.4728 ? 0.0121  ? -0.2953 ? 1.0922  ? -0.0839 ? 0.5497 ? 0.0177  ? 
0.0189  ? 0.0190  ? 0.3788  ? -0.1893 ? 0.1142  ? -0.1169 ? -0.1713 ? 0.1316  ? -0.1638 ? -0.1534 ? 0.0843  ? -0.0535 ? -0.0679 ? 
-0.5108 ? 
87  'X-RAY DIFFRACTION' ? refined -41.8563 -11.0953  -52.2918 0.6459 ? -0.1419 ? 0.0798  ? 1.0227  ? 0.0929  ? 0.2920 ? 0.0981  ? 
-0.0781 ? -0.0977 ? 0.4485  ? 0.1145  ? 0.1361  ? 0.1129  ? 0.1850  ? 0.0310  ? 0.0500  ? -0.0506 ? 0.1984  ? -0.1523 ? 0.2441  ? 
-0.2669 ? 
88  'X-RAY DIFFRACTION' ? refined -53.2918 -2.3859   -59.4341 0.8544 ? 0.6140  ? 0.3486  ? 1.4762  ? 0.5404  ? 0.9652 ? 0.1564  ? 
0.1867  ? 0.0532  ? 0.3247  ? 0.0919  ? 0.0429  ? 0.0790  ? 0.2309  ? 0.1251  ? 0.1348  ? -0.0947 ? 0.3078  ? -0.0638 ? 0.0349  ? 
-0.1435 ? 
89  'X-RAY DIFFRACTION' ? refined -6.0777  10.5525   -15.7494 0.8469 ? -0.2508 ? 0.0865  ? 0.9447  ? 0.0601  ? 1.1837 ? 0.0389  ? 
0.0140  ? 0.0518  ? 0.0577  ? 0.0209  ? 0.0534  ? 0.1596  ? -0.4452 ? -0.2292 ? 0.0283  ? 0.1684  ? 0.3051  ? 0.0672  ? -0.1887 ? 
0.0014  ? 
90  'X-RAY DIFFRACTION' ? refined 3.8984   -8.6247   -23.9744 0.7321 ? 0.1863  ? 0.3530  ? 1.0029  ? 0.4266  ? 0.5350 ? 0.0175  ? 
-0.0261 ? 0.0142  ? 0.0430  ? -0.0032 ? 0.0396  ? -0.0446 ? 0.0112  ? -0.0029 ? 0.0901  ? 0.1324  ? 0.1126  ? -0.0635 ? -0.0080 ? 
0.1332  ? 
91  'X-RAY DIFFRACTION' ? refined -18.1343 -3.5687   -27.2080 0.5045 ? 0.0121  ? -0.1758 ? 1.5278  ? 0.1167  ? 0.2761 ? 0.0338  ? 
-0.0215 ? 0.0108  ? 0.0469  ? -0.0090 ? 0.0905  ? 0.0231  ? 0.2233  ? 0.0526  ? 0.0525  ? -0.0861 ? -0.0529 ? -0.0140 ? -0.0631 ? 
-0.2145 ? 
92  'X-RAY DIFFRACTION' ? refined -29.0125 -6.5869   -26.6087 0.7585 ? -0.2947 ? -0.3745 ? 0.4535  ? 0.2353  ? 0.5909 ? 0.0866  ? 
-0.0688 ? 0.1060  ? 0.0513  ? -0.0805 ? 0.1618  ? -0.0097 ? -0.0584 ? 0.0367  ? 0.1013  ? -0.0296 ? -0.0940 ? -0.0944 ? -0.0339 ? 
-0.0984 ? 
93  'X-RAY DIFFRACTION' ? refined -21.4445 13.0529   -30.9235 0.2369 ? 0.0556  ? -0.0158 ? 0.5051  ? 0.1554  ? 0.5143 ? 0.0308  ? 
0.0074  ? 0.0222  ? -0.0005 ? 0.0039  ? 0.0134  ? 0.0585  ? -0.1804 ? -0.0212 ? -0.0604 ? -0.0920 ? 0.0210  ? -0.0620 ? 0.1367  ? 
0.0005  ? 
94  'X-RAY DIFFRACTION' ? refined 40.0342  -7.5462   11.7592  0.4098 ? -0.5388 ? 0.0883  ? 1.1904  ? 0.1250  ? 0.5699 ? 0.0312  ? 
-0.0186 ? -0.0251 ? 0.1096  ? -0.0666 ? 0.1670  ? 0.2289  ? -0.1775 ? 0.2425  ? 0.1845  ? -0.0290 ? 0.2810  ? -0.0062 ? -0.0075 ? 
0.2417  ? 
95  'X-RAY DIFFRACTION' ? refined 30.3823  -15.9922  19.6250  0.4749 ? 0.0493  ? -0.1326 ? 1.4415  ? 0.2991  ? 0.5223 ? 0.0174  ? 
0.0293  ? -0.0683 ? 0.0207  ? -0.0945 ? 0.3382  ? -0.1348 ? -0.2013 ? 0.1249  ? -0.1034 ? -0.0027 ? 0.2055  ? -0.0225 ? -0.2224 ? 
-0.2438 ? 
96  'X-RAY DIFFRACTION' ? refined 28.5909  -7.7416   4.5193   0.6165 ? -0.1672 ? -0.0088 ? 0.8960  ? 0.2447  ? 0.3960 ? 0.0072  ? 
-0.0510 ? -0.0275 ? 0.5456  ? 0.4811  ? 0.6731  ? -0.2846 ? -0.1771 ? -0.0162 ? -0.4205 ? -0.0100 ? 0.0713  ? 0.0444  ? -0.6788 ? 
-0.2575 ? 
97  'X-RAY DIFFRACTION' ? refined 25.1723  0.1399    11.4031  0.3745 ? 0.0056  ? -0.1141 ? 0.3808  ? 0.0118  ? 0.1713 ? 0.0880  ? 
-0.0027 ? 0.0831  ? 0.0843  ? 0.0595  ? 0.1017  ? 0.0539  ? 0.0279  ? 0.0730  ? -0.0424 ? -0.1280 ? 0.0047  ? -0.1264 ? 0.0996  ? 
-0.0769 ? 
98  'X-RAY DIFFRACTION' ? refined 38.7678  6.0417    15.5771  0.9157 ? 0.1075  ? -0.1418 ? 0.4947  ? 0.3286  ? 0.6791 ? 0.1844  ? 
0.0136  ? 0.0859  ? 0.0030  ? 0.0005  ? 0.2497  ? 0.0602  ? 0.1597  ? -0.0074 ? -0.0334 ? 0.0126  ? 0.0940  ? -0.0532 ? 0.1216  ? 
0.3773  ? 
99  'X-RAY DIFFRACTION' ? refined 17.9486  12.4568   7.7808   0.3495 ? -0.1909 ? -0.0884 ? 0.5258  ? 0.1162  ? 0.2341 ? 0.1245  ? 
-0.2902 ? -0.1315 ? 0.6949  ? 0.3197  ? 0.1477  ? -0.0155 ? 0.4256  ? 0.0509  ? -0.3942 ? 0.2048  ? -0.0622 ? -0.2260 ? 0.3394  ? 
0.2362  ? 
100 'X-RAY DIFFRACTION' ? refined 25.3975  24.9692   12.1856  2.9357 ? -0.2176 ? -0.7371 ? 3.2746  ? -0.1595 ? 2.7658 ? 0.0088  ? 
0.0067  ? 0.0053  ? 0.0084  ? 0.0093  ? 0.0095  ? 0.0222  ? 0.0460  ? -0.0209 ? -0.0975 ? 0.0631  ? -0.0309 ? 0.0055  ? 0.0344  ? 
0.0002  ? 
101 'X-RAY DIFFRACTION' ? refined 41.7416  -103.3456 -5.7386  0.7588 ? -0.0148 ? -0.1194 ? 1.0556  ? -0.1087 ? 0.2963 ? 0.0205  ? 
-0.0168 ? 0.0029  ? 0.0569  ? -0.0099 ? 0.0035  ? 0.1136  ? -0.0363 ? -0.0139 ? -0.0569 ? -0.0210 ? 0.0098  ? 0.1974  ? -0.0068 ? 
0.0168  ? 
102 'X-RAY DIFFRACTION' ? refined 24.9840  -95.1937  3.2402   0.8337 ? -0.2424 ? -0.3747 ? 0.7649  ? -0.1287 ? 0.6657 ? 0.0257  ? 
-0.0260 ? -0.0244 ? 0.0302  ? 0.0409  ? 0.0974  ? 0.0650  ? -0.0965 ? -0.0562 ? -0.0648 ? 0.0464  ? -0.0109 ? 0.0179  ? 0.0007  ? 
0.1304  ? 
103 'X-RAY DIFFRACTION' ? refined 38.4935  -96.0557  11.1870  1.5054 ? 0.6378  ? -0.2063 ? 1.0459  ? -0.0480 ? 0.5671 ? 0.0510  ? 
0.0370  ? -0.0259 ? 0.0253  ? -0.0159 ? 0.0146  ? -0.0292 ? 0.0277  ? -0.1417 ? -0.0519 ? -0.0452 ? -0.0428 ? 0.3836  ? 0.4020  ? 
-0.0645 ? 
104 'X-RAY DIFFRACTION' ? refined 41.9291  -94.9540  10.5990  0.6252 ? 0.2163  ? 0.0679  ? 0.8566  ? -0.0348 ? 0.2829 ? 0.2759  ? 
-0.1459 ? -0.0801 ? 0.1321  ? -0.0286 ? 0.0951  ? -0.0360 ? 0.1189  ? 0.0864  ? -0.0531 ? -0.0186 ? -0.1189 ? 0.1589  ? 0.0257  ? 
-0.1212 ? 
105 'X-RAY DIFFRACTION' ? refined 52.1456  -116.2211 17.5666  0.6622 ? -0.1083 ? 0.0987  ? 1.3356  ? -0.6086 ? 0.6250 ? 0.0055  ? 
-0.0284 ? 0.0303  ? 0.0652  ? -0.0844 ? 0.1238  ? -0.0561 ? -0.2109 ? 0.0852  ? 0.2139  ? -0.0317 ? 0.0090  ? -0.0757 ? 0.0065  ? 
-0.2191 ? 
106 'X-RAY DIFFRACTION' ? refined 59.7677  -117.7791 36.0006  1.4872 ? -0.2844 ? 0.1308  ? 2.0262  ? 0.6903  ? 0.9651 ? 0.0107  ? 
0.0023  ? -0.0078 ? 0.0088  ? 0.0003  ? 0.0160  ? -0.0431 ? 0.0331  ? -0.0228 ? -0.0167 ? 0.0208  ? 0.0195  ? 0.1272  ? -0.1035 ? 
-0.0201 ? 
107 'X-RAY DIFFRACTION' ? refined 58.5523  -118.4216 26.4281  0.3245 ? 0.1163  ? -0.1842 ? 0.5734  ? -0.2143 ? 0.4138 ? 0.1525  ? 
-0.0615 ? -0.0190 ? 0.1159  ? 0.0675  ? 0.0402  ? -0.0836 ? 0.1542  ? 0.0532  ? -0.0117 ? -0.0546 ? 0.0791  ? -0.0571 ? -0.0497 ? 
-0.2286 ? 
108 'X-RAY DIFFRACTION' ? refined 52.2884  -73.4184  15.5396  0.5846 ? 0.0542  ? 0.0998  ? 0.5131  ? -0.0900 ? 0.2365 ? 0.0614  ? 
-0.1274 ? -0.0062 ? 0.4467  ? 0.0036  ? 0.0004  ? -0.0585 ? 0.0946  ? -0.1364 ? 0.0326  ? -0.1421 ? 0.2394  ? 0.1206  ? 0.0028  ? 
0.0074  ? 
109 'X-RAY DIFFRACTION' ? refined 57.7920  -80.3766  18.1500  0.3233 ? 0.0705  ? 0.0136  ? 0.4505  ? 0.0421  ? 0.2006 ? 0.0929  ? 
-0.0519 ? -0.0789 ? 0.1289  ? 0.0960  ? 0.0938  ? 0.1201  ? -0.0713 ? -0.0221 ? -0.0677 ? 0.1288  ? 0.0622  ? 0.0454  ? -0.1613 ? 
0.0291  ? 
110 'X-RAY DIFFRACTION' ? refined 62.6005  -76.2655  24.4860  0.4229 ? -0.1244 ? 0.2025  ? 0.2255  ? -0.0417 ? 0.3155 ? 0.0276  ? 
0.0201  ? 0.0000  ? 0.0418  ? -0.0375 ? 0.0514  ? -0.0238 ? 0.0439  ? -0.0160 ? -0.0433 ? 0.0564  ? -0.0034 ? 0.0218  ? -0.0536 ? 
0.0346  ? 
111 'X-RAY DIFFRACTION' ? refined 56.0106  -82.3868  29.9017  0.6173 ? 0.1009  ? 0.1210  ? 0.4478  ? 0.1241  ? 0.3955 ? 0.0060  ? 
0.0005  ? -0.0016 ? 0.0015  ? 0.0017  ? 0.0014  ? 0.0507  ? 0.0392  ? -0.0609 ? -0.0021 ? -0.0092 ? 0.0146  ? -0.0111 ? -0.0079 ? 
-0.0005 ? 
112 'X-RAY DIFFRACTION' ? refined 66.1969  -88.1261  20.3876  0.6915 ? 0.0553  ? 0.0764  ? 0.8701  ? 0.0274  ? 0.4912 ? 0.0025  ? 
-0.0018 ? 0.0005  ? 0.0004  ? -0.0011 ? 0.0082  ? 0.0161  ? -0.0184 ? -0.0097 ? 0.0154  ? 0.0421  ? 0.0012  ? -0.0107 ? -0.0332 ? 
0.0002  ? 
113 'X-RAY DIFFRACTION' ? refined 66.6832  -103.7799 14.4441  1.2584 ? -0.0759 ? -0.0172 ? 1.2261  ? -0.0607 ? 0.2861 ? 0.0084  ? 
-0.0016 ? 0.0030  ? 0.0005  ? -0.0009 ? 0.0029  ? 0.0346  ? 0.0070  ? -0.0032 ? 0.0117  ? 0.0256  ? -0.0004 ? 0.0011  ? -0.0627 ? 
0.0137  ? 
114 'X-RAY DIFFRACTION' ? refined 76.6135  -105.4234 15.8455  0.9106 ? 0.5890  ? 0.1647  ? 1.4395  ? 0.1860  ? 0.5021 ? 0.0399  ? 
-0.0037 ? -0.0022 ? 0.0097  ? -0.0043 ? 0.0112  ? -0.0135 ? -0.0243 ? -0.0090 ? 0.0305  ? 0.0165  ? 0.0172  ? 0.0015  ? -0.0443 ? 
0.0088  ? 
115 'X-RAY DIFFRACTION' ? refined 79.8203  -93.1733  18.6976  0.8682 ? -0.1231 ? -0.1379 ? 1.1091  ? 0.2114  ? 0.8785 ? 0.0027  ? 
0.0020  ? 0.0007  ? 0.0018  ? -0.0003 ? 0.0003  ? 0.0274  ? -0.0367 ? -0.0364 ? 0.0149  ? 0.0298  ? 0.0017  ? 0.0303  ? -0.0302 ? 
-0.0002 ? 
116 'X-RAY DIFFRACTION' ? refined 65.4591  -99.7845  10.6990  1.2997 ? 0.0788  ? -0.3864 ? 1.4074  ? 0.2185  ? 0.4067 ? 0.1292  ? 
-0.0031 ? 0.0718  ? 0.0197  ? 0.0058  ? 0.0420  ? 0.0168  ? 0.0109  ? -0.0051 ? 0.0037  ? 0.0125  ? 0.0091  ? -0.0189 ? -0.0242 ? 
0.0507  ? 
117 'X-RAY DIFFRACTION' ? refined 77.3839  -100.1643 5.0714   0.5943 ? 0.2276  ? 0.2915  ? 1.1558  ? 0.0095  ? 0.4860 ? 0.0024  ? 
-0.0026 ? 0.0024  ? 0.0021  ? -0.0030 ? 0.0045  ? -0.0024 ? 0.0175  ? 0.0056  ? -0.0111 ? -0.0162 ? -0.0083 ? 0.0173  ? -0.0151 ? 
-0.0028 ? 
118 'X-RAY DIFFRACTION' ? refined 67.4519  -101.1541 -1.2486  1.4403 ? 0.1204  ? 0.5453  ? 1.7024  ? -0.3720 ? 0.8610 ? 0.0493  ? 
-0.0025 ? 0.0187  ? 0.0107  ? 0.0057  ? 0.0112  ? -0.0487 ? 0.0276  ? -0.0636 ? 0.0013  ? -0.0811 ? 0.0955  ? 0.0771  ? -0.1605 ? 
-0.0762 ? 
119 'X-RAY DIFFRACTION' ? refined 39.0350  -102.3643 47.7173  0.5542 ? 0.0777  ? 0.0412  ? 0.0355  ? -0.0791 ? 0.3309 ? 0.3079  ? 
-0.1180 ? -0.0416 ? 0.2886  ? -0.0979 ? 0.0560  ? -0.0710 ? -0.0449 ? 0.2677  ? 0.0456  ? 0.0591  ? -0.2877 ? 0.0633  ? 0.0324  ? 
-0.5729 ? 
120 'X-RAY DIFFRACTION' ? refined 56.7390  -99.0743  48.5335  0.6694 ? 0.2176  ? -0.2076 ? 0.2486  ? -0.0797 ? 0.2390 ? 0.4730  ? 
-0.1435 ? -0.1799 ? 0.0401  ? 0.0527  ? 0.0739  ? 0.0783  ? -0.0698 ? 0.1282  ? 0.1539  ? 0.0380  ? -0.1368 ? 0.0564  ? 0.0506  ? 
0.3303  ? 
121 'X-RAY DIFFRACTION' ? refined 53.9529  -80.3951  55.9496  0.4786 ? -0.1233 ? -0.1514 ? 0.2254  ? 0.2210  ? 0.5257 ? 0.1458  ? 
0.0964  ? 0.0108  ? 0.2522  ? -0.0665 ? 0.3196  ? 0.0342  ? 0.0260  ? -0.2368 ? 0.0575  ? -0.0086 ? -0.3252 ? 0.1705  ? 0.1147  ? 
0.1367  ? 
122 'X-RAY DIFFRACTION' ? refined 54.2902  -52.4094  82.6441  0.0578 ? -0.0075 ? -0.0416 ? 0.2501  ? -0.0659 ? 0.2221 ? 0.2568  ? 
0.0141  ? -0.0254 ? 0.2047  ? -0.2016 ? 0.2003  ? -0.0089 ? -0.0742 ? -0.0511 ? 0.1096  ? -0.0957 ? -0.1006 ? -0.0449 ? 0.0212  ? 
-0.1677 ? 
123 'X-RAY DIFFRACTION' ? refined 35.1442  -63.1691  49.4317  0.0093 ? 0.2144  ? -0.1948 ? -0.2532 ? 0.1808  ? 0.6148 ? 0.0778  ? 
0.0199  ? -0.0531 ? 0.2664  ? -0.0717 ? 0.0729  ? 0.0127  ? 0.2653  ? 0.3449  ? -0.1858 ? 0.0779  ? 0.3461  ? 0.1239  ? -0.0811 ? 
0.3935  ? 
124 'X-RAY DIFFRACTION' ? refined 50.8501  -49.3272  71.8733  0.2025 ? 0.1283  ? -0.1534 ? 0.1802  ? -0.1351 ? 0.5692 ? 0.1296  ? 
-0.0502 ? -0.0447 ? 0.0239  ? 0.0317  ? 0.0409  ? 0.1439  ? 0.0831  ? 0.1149  ? 0.0144  ? 0.0182  ? -0.1779 ? -0.0418 ? 0.1092  ? 
0.2466  ? 
125 'X-RAY DIFFRACTION' ? refined 45.0260  -64.7059  77.2596  0.2172 ? 0.0669  ? -0.1176 ? -0.1992 ? 0.1130  ? 0.3456 ? 0.0308  ? 
0.0211  ? -0.0706 ? 0.0114  ? -0.0369 ? 0.1302  ? -0.0905 ? -0.1548 ? -0.1180 ? -0.0135 ? 0.0080  ? -0.0869 ? 0.1701  ? 0.0848  ? 
-0.2708 ? 
126 'X-RAY DIFFRACTION' ? refined 46.4723  -59.0388  56.6585  0.4961 ? 0.1098  ? 0.2112  ? 0.5593  ? 0.2397  ? 0.2852 ? 0.0830  ? 
-0.0939 ? -0.0147 ? 0.1309  ? -0.0520 ? 0.2511  ? -0.0819 ? 0.1320  ? -0.0612 ? -0.0121 ? -0.2630 ? -0.1870 ? 0.1913  ? 0.3922  ? 
-0.6044 ? 
127 'X-RAY DIFFRACTION' ? refined 58.9242  -51.0062  46.6910  0.8762 ? -0.1417 ? -0.1162 ? 0.4221  ? 0.2922  ? 0.8690 ? 0.1109  ? 
-0.0141 ? -0.1199 ? 0.0980  ? 0.1675  ? 0.3781  ? 0.1013  ? -0.1817 ? -0.1698 ? 0.0325  ? 0.1677  ? -0.1792 ? -0.0899 ? -0.0884 ? 
0.1727  ? 
128 'X-RAY DIFFRACTION' ? refined 50.3439  -111.5475 114.1019 0.2632 ? -0.2140 ? -0.0159 ? 0.9806  ? 0.0775  ? 0.3329 ? 0.0057  ? 
0.0175  ? 0.0032  ? 0.0826  ? -0.0188 ? 0.0284  ? 0.0162  ? 0.0922  ? -0.1198 ? -0.0080 ? 0.0108  ? 0.1085  ? -0.0120 ? 0.0331  ? 
0.0320  ? 
129 'X-RAY DIFFRACTION' ? refined 54.5325  -116.1877 86.2733  0.7637 ? -0.4050 ? -0.4259 ? 0.8064  ? 0.3258  ? 0.8003 ? 0.1440  ? 
0.1747  ? -0.1708 ? 0.4230  ? -0.2054 ? 0.2416  ? -0.0032 ? -0.1234 ? -0.0966 ? 0.0227  ? -0.0173 ? -0.3389 ? 0.1522  ? -0.0215 ? 
-0.3059 ? 
130 'X-RAY DIFFRACTION' ? refined 69.1013  -124.9065 89.1306  0.5652 ? 0.1076  ? -0.1863 ? 1.0856  ? 0.3762  ? 0.7586 ? 0.2000  ? 
0.0576  ? 0.0191  ? 0.0774  ? 0.0461  ? 0.0254  ? 0.2486  ? 0.3446  ? -0.2034 ? 0.1860  ? 0.0586  ? -0.2236 ? 0.0356  ? -0.0492 ? 
0.1202  ? 
131 'X-RAY DIFFRACTION' ? refined 49.3683  -130.8047 109.7524 0.7261 ? -0.3728 ? 0.1320  ? 0.9783  ? 0.1001  ? 0.4984 ? 0.0231  ? 
0.0163  ? -0.0097 ? 0.0461  ? 0.0163  ? 0.0212  ? -0.0362 ? -0.0060 ? 0.0205  ? 0.0341  ? -0.0116 ? 0.0183  ? 0.0833  ? 0.0716  ? 
-0.0233 ? 
132 'X-RAY DIFFRACTION' ? refined 51.7508  -121.7878 85.4553  0.6664 ? -0.3700 ? -0.3769 ? 0.5197  ? 0.2283  ? 0.5605 ? 0.1852  ? 
-0.0401 ? -0.0184 ? 0.1971  ? -0.0939 ? 0.0206  ? 0.3233  ? -0.1233 ? -0.2244 ? -0.2529 ? 0.0163  ? 0.1810  ? 0.4962  ? -0.2600 ? 
0.4546  ? 
133 'X-RAY DIFFRACTION' ? refined 22.8138  -128.6790 81.7648  0.8462 ? -0.5191 ? -0.0300 ? 1.0104  ? 0.2954  ? 0.6640 ? 0.0058  ? 
0.0083  ? -0.0082 ? 0.0135  ? -0.0070 ? 0.0307  ? 0.0169  ? -0.0500 ? -0.0038 ? 0.0651  ? -0.0427 ? -0.0003 ? -0.0006 ? 0.0483  ? 
-0.0011 ? 
134 'X-RAY DIFFRACTION' ? refined 27.9928  -118.2745 78.5863  0.5878 ? -0.2031 ? -0.2915 ? 0.4246  ? -0.0729 ? 0.4947 ? 0.0723  ? 
-0.0364 ? 0.0123  ? 0.0338  ? -0.0253 ? 0.0288  ? 0.0343  ? -0.0231 ? -0.0555 ? 0.0077  ? 0.1106  ? -0.0547 ? 0.0143  ? 0.0903  ? 
0.1814  ? 
135 'X-RAY DIFFRACTION' ? refined 30.1227  -117.9378 87.0987  0.4867 ? -0.3559 ? -0.1759 ? 0.3249  ? -0.0180 ? 0.3540 ? 0.0409  ? 
0.0345  ? 0.0905  ? 0.3517  ? 0.1637  ? 0.3410  ? -0.1373 ? -0.0110 ? 0.1622  ? 0.0029  ? -0.1749 ? 0.1708  ? -0.0543 ? -0.1373 ? 
-0.8465 ? 
136 'X-RAY DIFFRACTION' ? refined 30.8908  -111.1256 92.3893  0.3270 ? 0.0837  ? -0.0903 ? 0.9924  ? 0.0021  ? 0.3937 ? 0.0031  ? 
-0.0059 ? -0.0048 ? 0.0374  ? 0.0355  ? 0.0310  ? -0.0363 ? 0.1391  ? 0.0285  ? -0.0806 ? 0.0531  ? 0.0596  ? 0.0035  ? 0.1043  ? 
0.0235  ? 
137 'X-RAY DIFFRACTION' ? refined 46.1048  -96.7352  88.0058  0.4017 ? -0.1091 ? 0.1831  ? 0.5372  ? 0.0627  ? 0.2958 ? 0.0269  ? 
0.0028  ? 0.0167  ? 0.0778  ? 0.0925  ? 0.1151  ? 0.0385  ? -0.1540 ? -0.0327 ? 0.1201  ? 0.0272  ? 0.0308  ? -0.0788 ? -0.0291 ? 
0.0601  ? 
138 'X-RAY DIFFRACTION' ? refined 43.7680  -105.5287 62.3712  0.1500 ? -0.0247 ? -0.0984 ? 0.1264  ? 0.0061  ? 0.2425 ? 0.5304  ? 
-0.1038 ? -0.3815 ? 0.1588  ? 0.1428  ? 0.3046  ? 0.0015  ? -0.0722 ? 0.2535  ? -0.0755 ? 0.1399  ? 0.0242  ? -0.0769 ? 0.0468  ? 
0.2139  ? 
139 'X-RAY DIFFRACTION' ? refined 87.0591  -93.1099  112.4164 0.4382 ? 0.1765  ? 0.0307  ? 0.4452  ? 0.2475  ? 0.3227 ? 0.0017  ? 
-0.0011 ? 0.0025  ? 0.0008  ? -0.0014 ? 0.0028  ? -0.0313 ? -0.0127 ? -0.0024 ? -0.0253 ? -0.0075 ? -0.0053 ? -0.0117 ? 0.0072  ? 
-0.0500 ? 
140 'X-RAY DIFFRACTION' ? refined 69.0800  -108.9012 101.5607 0.7301 ? -0.2450 ? -0.4351 ? 0.7544  ? -0.1643 ? 0.7717 ? 0.2751  ? 
0.0019  ? 0.1958  ? 0.0009  ? -0.0012 ? 0.1389  ? -0.0088 ? 0.0707  ? -0.1039 ? 0.0664  ? -0.1540 ? -0.0020 ? 0.0536  ? -0.1352 ? 
-0.2925 ? 
141 'X-RAY DIFFRACTION' ? refined 69.1700  -105.5427 105.2164 0.6673 ? 0.1296  ? -0.2336 ? 0.7204  ? 0.1484  ? 0.6441 ? 0.0215  ? 
0.0237  ? -0.0209 ? 0.0237  ? -0.0232 ? 0.0133  ? -0.1400 ? -0.2313 ? 0.1251  ? -0.0777 ? -0.0230 ? -0.1007 ? 0.1829  ? 0.0290  ? 
-0.0001 ? 
142 'X-RAY DIFFRACTION' ? refined 67.1516  -97.9698  98.5621  0.3045 ? -0.2043 ? -0.0452 ? 0.2579  ? 0.0574  ? 0.3816 ? 0.1547  ? 
-0.1039 ? -0.0064 ? 0.1368  ? -0.1368 ? 0.2447  ? -0.0356 ? -0.0728 ? 0.2677  ? -0.1260 ? -0.0554 ? -0.1094 ? -0.0194 ? 0.1443  ? 
-0.1428 ? 
143 'X-RAY DIFFRACTION' ? refined 82.5770  -88.5376  95.3549  0.3723 ? -0.1840 ? 0.0803  ? 0.9910  ? 0.2111  ? 0.7662 ? 0.0009  ? 
0.0020  ? -0.0024 ? 0.0021  ? -0.0041 ? 0.0107  ? 0.0032  ? 0.0868  ? 0.0449  ? -0.0140 ? -0.0110 ? 0.0266  ? -0.0523 ? -0.0408 ? 
-0.0008 ? 
144 'X-RAY DIFFRACTION' ? refined 72.7020  -86.2769  105.6824 0.4374 ? -0.2961 ? 0.0087  ? 0.8224  ? 0.1762  ? 0.5118 ? 0.0042  ? 
-0.0067 ? 0.0075  ? 0.0187  ? -0.0029 ? 0.0263  ? 0.0413  ? -0.0413 ? 0.0405  ? 0.0222  ? 0.0106  ? 0.0308  ? -0.0223 ? -0.0399 ? 
-0.0121 ? 
145 'X-RAY DIFFRACTION' ? refined 74.6304  -135.5213 111.5597 1.4049 ? 0.2278  ? -0.4926 ? 1.4916  ? 0.6268  ? 1.0871 ? 0.0315  ? 
0.0081  ? 0.0013  ? 0.0151  ? -0.0125 ? 0.0097  ? -0.0300 ? 0.0152  ? 0.0443  ? -0.0019 ? -0.0249 ? -0.0581 ? -0.0096 ? 0.0321  ? 
-0.0628 ? 
146 'X-RAY DIFFRACTION' ? refined 84.9016  -117.5720 97.1822  0.5121 ? -0.1022 ? 0.2815  ? 1.0483  ? 0.1211  ? 0.5463 ? 0.0147  ? 
0.0349  ? -0.0238 ? 0.1454  ? -0.0571 ? 0.0396  ? -0.0126 ? 0.0531  ? -0.0028 ? -0.0133 ? -0.0107 ? -0.0245 ? -0.0163 ? 0.0496  ? 
-0.0280 ? 
147 'X-RAY DIFFRACTION' ? refined 77.9386  -107.0346 75.2440  0.1642 ? -0.0684 ? -0.0289 ? 0.1287  ? 0.0457  ? 0.3349 ? 0.0118  ? 
-0.0026 ? -0.0058 ? 0.0155  ? 0.0023  ? 0.0188  ? 0.0444  ? -0.0137 ? -0.0314 ? 0.0455  ? 0.0467  ? 0.0106  ? 0.0741  ? -0.0583 ? 
-0.0007 ? 
148 'X-RAY DIFFRACTION' ? refined 67.8535  -95.4517  69.4818  0.5835 ? 0.0063  ? 0.0314  ? 0.0470  ? -0.0053 ? 0.3759 ? 0.0281  ? 
0.0397  ? 0.0070  ? 0.0800  ? -0.0178 ? 0.0446  ? -0.0008 ? 0.0067  ? -0.1264 ? 0.1043  ? -0.0181 ? -0.0254 ? 0.0834  ? 0.0164  ? 
0.0331  ? 
149 'X-RAY DIFFRACTION' ? refined 71.4615  -96.4359  69.6357  0.2778 ? 0.1695  ? 0.1416  ? 0.1597  ? 0.1086  ? 0.3998 ? 0.0783  ? 
-0.0383 ? 0.0553  ? 0.0717  ? 0.0217  ? 0.0850  ? 0.0370  ? -0.0702 ? -0.1076 ? -0.0415 ? 0.0833  ? -0.0615 ? 0.0017  ? 0.0013  ? 
0.5120  ? 
150 'X-RAY DIFFRACTION' ? refined 76.5087  -101.3011 85.0190  0.1652 ? 0.1214  ? 0.0370  ? 0.2960  ? -0.0117 ? 0.3349 ? 0.1314  ? 
-0.0556 ? -0.0380 ? 0.1406  ? 0.0001  ? 0.1636  ? 0.0155  ? -0.0458 ? 0.0554  ? 0.0378  ? 0.0177  ? 0.0380  ? -0.0506 ? -0.0209 ? 
-0.0061 ? 
151 'X-RAY DIFFRACTION' ? refined 82.1752  -99.4217  82.6897  0.2626 ? 0.0795  ? -0.0305 ? 0.1458  ? 0.0830  ? 0.4907 ? 0.0662  ? 
-0.0141 ? 0.0008  ? 0.0044  ? -0.0019 ? 0.0318  ? 0.0726  ? 0.0572  ? 0.0575  ? 0.0225  ? 0.0554  ? 0.0221  ? -0.0398 ? -0.0732 ? 
0.0902  ? 
152 'X-RAY DIFFRACTION' ? refined 85.6647  -110.7842 75.5474  1.0830 ? -0.1989 ? 0.2167  ? 1.5589  ? 0.0763  ? 0.7921 ? 0.0036  ? 
-0.0020 ? -0.0041 ? -0.0002 ? 0.0010  ? 0.0038  ? -0.0488 ? -0.0063 ? -0.0389 ? 0.0258  ? -0.0606 ? -0.0347 ? 0.0649  ? -0.0190 ? 
-0.0007 ? 
153 'X-RAY DIFFRACTION' ? refined 84.9367  -97.7240  40.3209  0.3190 ? -0.0117 ? -0.0303 ? 1.1474  ? -0.0649 ? 0.3944 ? 0.7179  ? 
0.0379  ? -0.1020 ? 0.0849  ? 0.1380  ? 0.7734  ? 0.1837  ? 0.0284  ? 0.0289  ? 0.0051  ? 0.1291  ? -0.0721 ? 0.0697  ? 0.1039  ? 
0.1742  ? 
154 'X-RAY DIFFRACTION' ? refined 77.1306  -98.5853  50.7936  0.3851 ? 0.0518  ? -0.0043 ? 0.6002  ? 0.0132  ? 0.6054 ? 0.0064  ? 
0.0028  ? -0.0083 ? 0.0053  ? -0.0078 ? 0.0055  ? -0.0357 ? -0.1950 ? -0.2629 ? 0.0743  ? 0.0055  ? 0.0576  ? 0.2049  ? 0.0733  ? 
0.0006  ? 
155 'X-RAY DIFFRACTION' ? refined 73.6115  -97.8325  40.9208  0.4819 ? 0.2680  ? 0.0303  ? 0.5897  ? -0.0246 ? 0.2948 ? 0.0406  ? 
-0.0129 ? -0.0227 ? 0.0190  ? 0.0337  ? 0.0722  ? 0.0158  ? -0.0901 ? -0.0104 ? -0.0222 ? 0.0610  ? -0.0502 ? -0.0289 ? 0.1295  ? 
0.0695  ? 
156 'X-RAY DIFFRACTION' ? refined 78.3109  -100.3576 30.9296  0.5269 ? 0.1587  ? 0.1885  ? 0.5184  ? -0.1401 ? 0.3852 ? 0.1140  ? 
-0.0093 ? 0.0030  ? 0.1348  ? -0.1373 ? 0.1425  ? 0.0632  ? 0.0138  ? 0.1266  ? 0.0621  ? 0.0802  ? 0.0409  ? -0.0527 ? -0.1391 ? 
0.2747  ? 
157 'X-RAY DIFFRACTION' ? refined 79.7850  -86.4733  30.7530  0.2592 ? -0.1194 ? 0.1845  ? 0.2231  ? -0.0435 ? 0.2656 ? 0.0226  ? 
0.0221  ? -0.0160 ? 0.0205  ? -0.0174 ? 0.0179  ? 0.0180  ? -0.0173 ? 0.0123  ? 0.0428  ? 0.0138  ? 0.0008  ? -0.0525 ? 0.0481  ? 
0.1014  ? 
158 'X-RAY DIFFRACTION' ? refined 47.5959  -69.2063  91.4010  0.9971 ? 0.1454  ? 0.2847  ? 1.0474  ? -0.3000 ? 1.0619 ? 0.0002  ? 
0.0003  ? -0.0003 ? 0.0016  ? 0.0011  ? 0.0003  ? 0.0487  ? 0.0184  ? -0.0333 ? -0.0730 ? -0.0045 ? 0.0425  ? -0.0048 ? 0.0007  ? 
-0.0001 ? 
159 'X-RAY DIFFRACTION' ? refined 50.8476  -66.2608  100.7889 2.0594 ? 0.1315  ? -0.2464 ? 2.0978  ? -0.3019 ? 2.0713 ? 0.0040  ? 
0.0028  ? -0.0027 ? 0.0012  ? -0.0012 ? 0.0018  ? -0.0282 ? -0.0002 ? 0.0114  ? -0.0032 ? -0.0357 ? 0.0356  ? -0.0174 ? -0.0052 ? 
-0.0000 ? 
160 'X-RAY DIFFRACTION' ? refined 42.5167  -79.1020  109.1831 1.3388 ? -0.2011 ? -0.0591 ? 1.5636  ? -0.0547 ? 1.1927 ? 0.0029  ? 
-0.0059 ? -0.0013 ? 0.0115  ? 0.0028  ? 0.0009  ? -0.0374 ? -0.0200 ? 0.0100  ? 0.0110  ? -0.0255 ? 0.0001  ? -0.0077 ? -0.0179 ? 
-0.0001 ? 
161 'X-RAY DIFFRACTION' ? refined 59.2910  -81.0262  92.4302  0.6419 ? -0.3531 ? -0.0009 ? 1.5012  ? 0.1712  ? 0.4449 ? 0.0224  ? 
0.0216  ? 0.0036  ? 0.0861  ? 0.0243  ? 0.0084  ? 0.0045  ? 0.0213  ? 0.0067  ? 0.1118  ? -0.0686 ? 0.0094  ? -0.0262 ? -0.0639 ? 
-0.0147 ? 
162 'X-RAY DIFFRACTION' ? refined 43.1804  -78.0582  98.3106  1.3248 ? -0.1510 ? 0.1643  ? 1.3210  ? -0.6799 ? 1.5957 ? 0.0008  ? 
0.0013  ? 0.0011  ? 0.0033  ? 0.0022  ? 0.0019  ? 0.0317  ? -0.0322 ? -0.0348 ? -0.0010 ? 0.0512  ? 0.0484  ? -0.0014 ? -0.0467 ? 
-0.0009 ? 
163 'X-RAY DIFFRACTION' ? refined 57.8467  -72.3362  99.7179  0.5277 ? -0.0403 ? 0.0030  ? 0.8572  ? -0.0563 ? 0.3222 ? 0.0065  ? 
-0.0035 ? 0.0074  ? 0.0018  ? -0.0045 ? 0.0073  ? -0.1058 ? 0.0794  ? -0.0409 ? -0.0213 ? -0.0323 ? -0.0663 ? -0.0049 ? 0.0560  ? 
0.0003  ? 
164 'X-RAY DIFFRACTION' ? refined 51.3323  -84.2118  102.6890 0.7664 ? -0.0664 ? -0.3095 ? 1.1617  ? -0.0488 ? 0.4813 ? 0.0009  ? 
0.0059  ? -0.0006 ? 0.0877  ? -0.0250 ? 0.0073  ? 0.0395  ? 0.0496  ? -0.0527 ? 0.0759  ? 0.0615  ? -0.0109 ? -0.0128 ? 0.0285  ? 
0.0013  ? 
165 'X-RAY DIFFRACTION' ? refined 49.1959  -78.0665  83.7288  0.8985 ? -0.5052 ? 0.3774  ? 0.9785  ? -0.2229 ? 0.6247 ? 0.0469  ? 
-0.0569 ? -0.0299 ? 0.0738  ? 0.0445  ? 0.0333  ? -0.0090 ? 0.0004  ? -0.0362 ? -0.0000 ? -0.1005 ? -0.0411 ? 0.0168  ? 0.0535  ? 
-0.0473 ? 
166 'X-RAY DIFFRACTION' ? refined 50.0138  -85.0229  94.4842  0.4412 ? 0.1500  ? -0.1716 ? 0.7402  ? -0.2727 ? 0.5634 ? 0.0998  ? 
-0.0214 ? 0.0646  ? 0.0556  ? -0.0216 ? 0.0406  ? -0.0469 ? 0.1948  ? -0.0255 ? -0.0418 ? -0.0518 ? 0.0304  ? -0.0593 ? -0.2191 ? 
-0.0892 ? 
167 'X-RAY DIFFRACTION' ? refined 69.4757  -101.6070 130.8069 0.3784 ? 0.0080  ? 0.0875  ? 0.3623  ? 0.0035  ? 0.3551 ? 0.1032  ? 
0.1014  ? 0.1183  ? 0.1449  ? 0.0638  ? 0.1036  ? 0.3572  ? 0.1043  ? 0.1284  ? 0.0622  ? -0.1119 ? -0.1984 ? -0.1000 ? 0.3117  ? 
0.0978  ? 
168 'X-RAY DIFFRACTION' ? refined 60.9449  -124.6878 144.6070 1.3978 ? -0.0879 ? -0.7474 ? 0.8375  ? 0.0151  ? 1.0376 ? 0.0689  ? 
-0.0440 ? 0.0682  ? 0.0785  ? -0.1093 ? 0.1553  ? 0.0209  ? -0.1613 ? 0.0795  ? -0.1444 ? -0.1783 ? 0.1288  ? -0.1814 ? 0.0695  ? 
-0.1367 ? 
169 'X-RAY DIFFRACTION' ? refined 59.8240  -136.9371 148.9541 1.1499 ? -0.0782 ? 0.0721  ? 0.5553  ? 0.4781  ? 0.8500 ? 0.1245  ? 
-0.1087 ? 0.1743  ? 0.1057  ? -0.1182 ? 0.3493  ? 0.0632  ? 0.0630  ? 0.0913  ? -0.1180 ? -0.0072 ? 0.0943  ? -0.0791 ? 0.0199  ? 
0.1113  ? 
170 'X-RAY DIFFRACTION' ? refined 46.3151  -127.0161 133.8943 0.5927 ? 0.0628  ? -0.3360 ? 0.9078  ? 0.0804  ? 0.7094 ? 0.0037  ? 
0.0078  ? -0.0077 ? 0.0223  ? -0.0193 ? 0.0173  ? -0.0389 ? 0.0136  ? -0.0216 ? 0.0300  ? -0.0195 ? 0.0210  ? 0.0142  ? 0.0003  ? 
-0.0006 ? 
171 'X-RAY DIFFRACTION' ? refined 67.9691  -98.7538  154.9777 1.1540 ? -0.3186 ? 0.0018  ? 0.4636  ? 0.0958  ? 0.4521 ? 0.0144  ? 
-0.0007 ? -0.0222 ? 0.0030  ? 0.0054  ? 0.0381  ? -0.0163 ? 0.0329  ? 0.0111  ? -0.0628 ? -0.0169 ? -0.0461 ? 0.0028  ? -0.0140 ? 
-0.0122 ? 
172 'X-RAY DIFFRACTION' ? refined 68.5242  -111.4087 151.1504 0.4379 ? -0.2461 ? -0.2697 ? 0.6412  ? 0.3791  ? 0.4965 ? 0.1918  ? 
0.0345  ? -0.1768 ? 0.0369  ? 0.0173  ? 0.2295  ? 0.0356  ? 0.1366  ? 0.1167  ? -0.0714 ? 0.1071  ? 0.1395  ? 0.0062  ? -0.0882 ? 
0.3499  ? 
173 'X-RAY DIFFRACTION' ? refined 55.4701  -110.9552 140.3101 0.8315 ? -0.1802 ? -0.0613 ? 0.4239  ? 0.0238  ? 0.4648 ? 0.0030  ? 
-0.0004 ? 0.0022  ? 0.0025  ? 0.0006  ? 0.0016  ? 0.0101  ? -0.0186 ? -0.0500 ? 0.0023  ? 0.0469  ? -0.0001 ? 0.0142  ? -0.0014 ? 
0.0004  ? 
174 'X-RAY DIFFRACTION' ? refined 45.0920  -95.8904  143.8590 0.9399 ? 0.0023  ? -0.2349 ? 1.0245  ? 0.3990  ? 0.7238 ? 0.0009  ? 
-0.0021 ? 0.0005  ? 0.0040  ? 0.0037  ? 0.0061  ? 0.0092  ? 0.0962  ? 0.0182  ? -0.0028 ? 0.0432  ? 0.0072  ? 0.0078  ? -0.0343 ? 
-0.0001 ? 
175 'X-RAY DIFFRACTION' ? refined 53.4777  -95.9832  165.5754 0.5270 ? -0.2815 ? 0.0855  ? 0.4128  ? -0.2192 ? 0.3697 ? 0.0112  ? 
0.0422  ? 0.0030  ? 0.1647  ? 0.0180  ? 0.0060  ? -0.0143 ? -0.0234 ? -0.0409 ? 0.0611  ? -0.0651 ? -0.0221 ? 0.0107  ? -0.0388 ? 
-0.2404 ? 
176 'X-RAY DIFFRACTION' ? refined 74.9093  -113.8151 170.6594 0.4705 ? 0.0157  ? 0.2797  ? 0.6734  ? 0.1459  ? 0.6048 ? 0.1355  ? 
-0.0300 ? 0.1196  ? 0.0060  ? -0.0257 ? 0.1046  ? 0.0872  ? -0.0153 ? 0.0367  ? 0.0485  ? -0.0453 ? 0.0685  ? -0.0383 ? 0.0683  ? 
0.1075  ? 
177 'X-RAY DIFFRACTION' ? refined 56.9360  -128.5313 154.2114 0.5549 ? 0.1279  ? -0.0654 ? 1.1036  ? 0.1524  ? 0.2691 ? 0.0069  ? 
0.0382  ? 0.0030  ? 0.3255  ? 0.0663  ? 0.0164  ? 0.0092  ? 0.0162  ? -0.0264 ? 0.3553  ? -0.0548 ? -0.0849 ? 0.1603  ? -0.0396 ? 
-0.0191 ? 
178 'X-RAY DIFFRACTION' ? refined 58.4173  -101.5519 160.0179 0.6838 ? -0.0945 ? -0.1207 ? 0.5751  ? 0.0891  ? 0.2842 ? 0.1158  ? 
0.0645  ? 0.0936  ? 0.2446  ? 0.0943  ? 0.0853  ? 0.1531  ? 0.1069  ? 0.0115  ? 0.2048  ? 0.0472  ? -0.2306 ? -0.0645 ? -0.2427 ? 
0.0114  ? 
179 'X-RAY DIFFRACTION' ? refined 59.4094  -114.4679 157.4260 0.5141 ? -0.2178 ? 0.1374  ? 0.6477  ? 0.2528  ? 0.3908 ? 0.0141  ? 
0.0187  ? -0.0328 ? 0.0983  ? -0.0216 ? 0.0762  ? -0.0214 ? -0.0172 ? -0.0519 ? 0.1185  ? -0.0332 ? -0.0071 ? 0.1004  ? 0.0346  ? 
0.0314  ? 
180 'X-RAY DIFFRACTION' ? refined 40.1835  -107.5246 140.6136 0.5448 ? -0.0792 ? 0.0179  ? 0.9895  ? 0.1887  ? 0.4120 ? 0.0020  ? 
-0.0025 ? -0.0015 ? 0.0031  ? 0.0020  ? 0.0013  ? 0.0168  ? 0.0012  ? 0.0468  ? 0.0328  ? 0.0237  ? 0.0095  ? -0.0296 ? 0.0016  ? 
-0.0000 ? 
181 'X-RAY DIFFRACTION' ? refined 33.5179  -102.5849 151.3303 0.8095 ? 0.0605  ? -0.3261 ? 1.1599  ? -0.0156 ? 0.8396 ? 0.0063  ? 
-0.0014 ? -0.0014 ? 0.0022  ? -0.0042 ? 0.0072  ? -0.0148 ? 0.0236  ? -0.0033 ? -0.0021 ? -0.0048 ? 0.0005  ? -0.0000 ? 0.0341  ? 
0.0001  ? 
182 'X-RAY DIFFRACTION' ? refined -22.1386 -120.8593 219.0262 0.4199 ? -0.1655 ? 0.0761  ? 0.7272  ? 0.0648  ? 0.5794 ? 0.0038  ? 
-0.0215 ? -0.0043 ? 0.1198  ? 0.0189  ? 0.0033  ? -0.0348 ? 0.1291  ? 0.0819  ? 0.1989  ? -0.0985 ? 0.3405  ? 0.0037  ? 0.2424  ? 
-0.0181 ? 
183 'X-RAY DIFFRACTION' ? refined -17.5485 -102.1910 217.4127 0.5135 ? -0.1331 ? -0.3797 ? 1.6128  ? 0.1392  ? 0.4255 ? 0.1634  ? 
-0.0106 ? 0.0753  ? 0.0111  ? -0.0183 ? 0.1477  ? 0.0114  ? -0.0571 ? -0.0220 ? 0.2172  ? -0.1083 ? -0.0388 ? -0.2831 ? -0.4077 ? 
-0.0213 ? 
184 'X-RAY DIFFRACTION' ? refined -33.2477 -91.7318  222.9615 0.6749 ? 0.0254  ? -0.0121 ? 0.5864  ? -0.0433 ? 0.3210 ? 0.0735  ? 
0.0157  ? 0.0377  ? 0.1636  ? -0.0165 ? 0.0113  ? -0.0091 ? 0.0993  ? -0.0416 ? -0.1069 ? -0.0027 ? -0.1409 ? 0.0216  ? -0.1864 ? 
0.0116  ? 
185 'X-RAY DIFFRACTION' ? refined -46.7139 -100.5338 215.4896 1.0159 ? 0.1835  ? -0.0781 ? 1.1921  ? 0.2863  ? 0.6782 ? -0.0014 ? 
-0.0030 ? 0.0004  ? 0.0045  ? 0.0077  ? 0.0097  ? -0.0349 ? -0.1039 ? -0.0558 ? -0.0587 ? 0.0054  ? -0.0320 ? 0.0152  ? 0.0324  ? 
0.0001  ? 
186 'X-RAY DIFFRACTION' ? refined -22.7546 -98.3324  242.0745 1.0274 ? -0.1104 ? 0.2232  ? 1.2786  ? 0.1162  ? 0.8249 ? 0.0003  ? 
0.0050  ? 0.0029  ? 0.0229  ? 0.0091  ? 0.0032  ? -0.1638 ? 0.1196  ? -0.2047 ? -0.1327 ? -0.1979 ? 0.1246  ? 0.1142  ? -0.0701 ? 
0.0005  ? 
187 'X-RAY DIFFRACTION' ? refined -32.0118 -79.6921  218.2295 0.8856 ? 0.0201  ? -0.4062 ? 1.1915  ? -0.0273 ? 0.7627 ? 0.0403  ? 
0.1353  ? -0.0295 ? 0.4549  ? -0.1180 ? 0.0312  ? 0.2052  ? 0.5680  ? -0.1415 ? -0.2721 ? -0.0990 ? 0.4012  ? 0.0116  ? 0.2868  ? 
0.0623  ? 
188 'X-RAY DIFFRACTION' ? refined 23.1789  -98.1833  175.6339 0.4061 ? 0.0386  ? -0.2804 ? 0.3136  ? -0.0092 ? 0.2926 ? 0.3074  ? 
-0.2598 ? 0.0528  ? 0.9594  ? 0.2792  ? 0.2819  ? 0.0254  ? -0.0335 ? -0.1435 ? -0.1830 ? -0.0630 ? -0.2749 ? 0.0169  ? -0.0654 ? 
-0.2144 ? 
189 'X-RAY DIFFRACTION' ? refined 6.1639   -132.5272 193.4928 0.2730 ? -0.0976 ? 0.0953  ? 0.8985  ? 0.0767  ? 0.5575 ? 0.0830  ? 
0.0320  ? 0.0179  ? 0.1726  ? 0.1238  ? 0.1069  ? -0.2081 ? -0.0305 ? -0.1484 ? 0.0882  ? -0.2879 ? 0.0502  ? 0.1292  ? 0.0164  ? 
-0.5359 ? 
190 'X-RAY DIFFRACTION' ? refined 12.9011  -113.2506 193.5066 0.3519 ? -0.1184 ? -0.1072 ? 1.1543  ? 0.1103  ? 0.1649 ? 0.0875  ? 
-0.0023 ? -0.1407 ? 0.0668  ? 0.0165  ? 0.1980  ? 0.0213  ? -0.0114 ? -0.0553 ? 0.1469  ? -0.1558 ? -0.0097 ? 0.0619  ? 0.4923  ? 
-0.5049 ? 
191 'X-RAY DIFFRACTION' ? refined -7.0389  -109.7359 199.0760 0.7844 ? 0.1625  ? -0.3656 ? 0.7521  ? 0.0408  ? 0.4072 ? 0.2003  ? 
-0.1315 ? 0.1720  ? 0.2640  ? 0.0288  ? 0.2647  ? -0.0533 ? -0.2672 ? 0.0911  ? 0.1297  ? -0.0193 ? -0.3446 ? -0.0834 ? 0.1194  ? 
0.0759  ? 
192 'X-RAY DIFFRACTION' ? refined -5.4071  -120.1989 202.9143 1.1091 ? -0.0190 ? -0.6730 ? 1.7599  ? -0.0436 ? 1.0123 ? 0.0843  ? 
-0.0558 ? 0.0252  ? 0.0296  ? -0.0218 ? 0.0178  ? 0.0070  ? -0.2166 ? -0.1266 ? 0.1379  ? -0.0186 ? -0.2221 ? 0.0675  ? 0.2303  ? 
-0.0733 ? 
193 'X-RAY DIFFRACTION' ? refined 40.5214  -140.0347 154.8265 0.4619 ? -0.0078 ? 0.0655  ? 0.0667  ? 0.0962  ? 0.8464 ? 0.0039  ? 
-0.0044 ? 0.0075  ? 0.0059  ? -0.0143 ? 0.0521  ? -0.0514 ? -0.0378 ? 0.0641  ? -0.1500 ? -0.0093 ? 0.0704  ? -0.0017 ? 0.0099  ? 
-0.0444 ? 
194 'X-RAY DIFFRACTION' ? refined 42.7495  -135.3833 169.3201 0.5578 ? -0.0510 ? -0.0561 ? 0.8168  ? 0.0935  ? 0.4191 ? 0.0148  ? 
0.0207  ? -0.0028 ? 0.0369  ? 0.0045  ? 0.0082  ? -0.0505 ? 0.1513  ? 0.1632  ? -0.0583 ? -0.0029 ? 0.3373  ? -0.0321 ? -0.0481 ? 
-0.0007 ? 
195 'X-RAY DIFFRACTION' ? refined 42.3012  -126.0229 156.3653 0.3982 ? 0.0420  ? 0.0671  ? 0.6219  ? 0.1136  ? 0.6104 ? 0.0276  ? 
-0.0188 ? -0.0355 ? 0.0116  ? 0.0218  ? 0.0402  ? -0.1496 ? 0.0705  ? 0.0434  ? -0.0815 ? 0.1897  ? -0.1846 ? -0.1111 ? -0.2241 ? 
-0.0008 ? 
196 'X-RAY DIFFRACTION' ? refined 45.6086  -115.4992 166.2026 0.5832 ? -0.2016 ? -0.2573 ? 0.9132  ? 0.1202  ? 0.2104 ? 0.0110  ? 
-0.0284 ? 0.0030  ? 0.1097  ? -0.0612 ? 0.1487  ? -0.0472 ? -0.1593 ? 0.0025  ? -0.0340 ? 0.1442  ? 0.1532  ? 0.0835  ? -0.2040 ? 
-0.0067 ? 
197 'X-RAY DIFFRACTION' ? refined 27.6601  -119.0984 172.4475 0.5124 ? -0.1373 ? -0.2675 ? 1.2425  ? 0.2261  ? 0.1849 ? 0.0475  ? 
0.0009  ? 0.0431  ? -0.0012 ? -0.0179 ? 0.0735  ? 0.1664  ? -0.0454 ? -0.0576 ? 0.1017  ? -0.0943 ? -0.0241 ? -0.0632 ? -0.2280 ? 
0.1875  ? 
198 'X-RAY DIFFRACTION' ? refined 21.8793  -124.3964 171.8876 0.5171 ? 0.0551  ? -0.1424 ? 1.2644  ? 0.2158  ? 0.5382 ? 0.0476  ? 
0.0073  ? -0.0603 ? 0.0834  ? -0.0949 ? 0.1505  ? -0.1090 ? -0.1163 ? 0.0629  ? 0.1910  ? 0.3024  ? -0.0350 ? -0.2103 ? -0.1977 ? 
0.0278  ? 
199 'X-RAY DIFFRACTION' ? refined 82.2445  -110.1763 127.0268 0.2705 ? 0.0117  ? -0.1850 ? 0.6259  ? 0.0921  ? 0.5328 ? 0.0656  ? 
0.0172  ? -0.0391 ? 0.1008  ? -0.0107 ? 0.0739  ? 0.0791  ? 0.1675  ? -0.2474 ? -0.1375 ? -0.0066 ? 0.4384  ? 0.0087  ? 0.0444  ? 
0.0518  ? 
200 'X-RAY DIFFRACTION' ? refined 76.6199  -121.9779 132.7758 0.5212 ? -0.0154 ? 0.0873  ? 0.4810  ? 0.0584  ? 0.1000 ? 0.0574  ? 
0.0454  ? 0.0512  ? 0.0323  ? 0.0273  ? 0.0364  ? -0.0979 ? -0.1749 ? -0.1160 ? 0.0400  ? -0.0637 ? -0.0400 ? 0.0531  ? 0.0366  ? 
-0.6848 ? 
201 'X-RAY DIFFRACTION' ? refined 68.3439  -139.0695 134.4240 0.6073 ? 0.2964  ? 0.3199  ? 0.7640  ? 0.3726  ? 0.6101 ? 0.1916  ? 
0.0926  ? -0.1725 ? 0.3105  ? -0.1814 ? 0.1830  ? -0.0239 ? -0.2524 ? -0.1013 ? 0.1637  ? 0.0578  ? -0.0339 ? -0.1460 ? 0.0058  ? 
0.0942  ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1   'X-RAY DIFFRACTION' 1   ? ? 1 2   ? ? 1 38  ? 
;chain '1' and (resid 2 through 38 )
;
2   'X-RAY DIFFRACTION' 2   ? ? 1 39  ? ? 1 60  ? 
;chain '1' and (resid 39 through 60 )
;
3   'X-RAY DIFFRACTION' 3   ? ? 1 61  ? ? 1 86  ? 
;chain '1' and (resid 61 through 86 )
;
4   'X-RAY DIFFRACTION' 4   ? ? 1 87  ? ? 1 155 ? 
;chain '1' and (resid 87 through 155 )
;
5   'X-RAY DIFFRACTION' 5   ? ? 1 156 ? ? 1 232 ? 
;chain '1' and (resid 156 through 232 )
;
6   'X-RAY DIFFRACTION' 6   ? ? 1 233 ? ? 1 366 ? 
;chain '1' and (resid 233 through 366 )
;
7   'X-RAY DIFFRACTION' 7   ? ? 1 367 ? ? 1 438 ? 
;chain '1' and (resid 367 through 438 )
;
8   'X-RAY DIFFRACTION' 8   ? ? 2 3   ? ? 2 22  ? 
;chain '2' and (resid 3 through 22 )
;
9   'X-RAY DIFFRACTION' 9   ? ? 2 23  ? ? 2 38  ? 
;chain '2' and (resid 23 through 38 )
;
10  'X-RAY DIFFRACTION' 10  ? ? 2 39  ? ? 2 66  ? 
;chain '2' and (resid 39 through 66 )
;
11  'X-RAY DIFFRACTION' 11  ? ? 2 67  ? ? 2 77  ? 
;chain '2' and (resid 67 through 77 )
;
12  'X-RAY DIFFRACTION' 12  ? ? 2 78  ? ? 2 92  ? 
;chain '2' and (resid 78 through 92 )
;
13  'X-RAY DIFFRACTION' 13  ? ? 2 93  ? ? 2 104 ? 
;chain '2' and (resid 93 through 104 )
;
14  'X-RAY DIFFRACTION' 14  ? ? 2 105 ? ? 2 116 ? 
;chain '2' and (resid 105 through 116 )
;
15  'X-RAY DIFFRACTION' 15  ? ? 2 117 ? ? 2 132 ? 
;chain '2' and (resid 117 through 132 )
;
16  'X-RAY DIFFRACTION' 16  ? ? 2 133 ? ? 2 146 ? 
;chain '2' and (resid 133 through 146 )
;
17  'X-RAY DIFFRACTION' 17  ? ? 2 147 ? ? 2 158 ? 
;chain '2' and (resid 147 through 158 )
;
18  'X-RAY DIFFRACTION' 18  ? ? 2 159 ? ? 2 165 ? 
;chain '2' and (resid 159 through 165 )
;
19  'X-RAY DIFFRACTION' 19  ? ? 2 166 ? ? 2 180 ? 
;chain '2' and (resid 166 through 180 )
;
20  'X-RAY DIFFRACTION' 20  ? ? 3 1   ? ? 3 137 ? 
;chain '3' and (resid 1 through 137 )
;
21  'X-RAY DIFFRACTION' 21  ? ? 3 138 ? ? 3 193 ? 
;chain '3' and (resid 138 through 193 )
;
22  'X-RAY DIFFRACTION' 22  ? ? 3 194 ? ? 3 309 ? 
;chain '3' and (resid 194 through 309 )
;
23  'X-RAY DIFFRACTION' 23  ? ? 3 310 ? ? 3 350 ? 
;chain '3' and (resid 310 through 350 )
;
24  'X-RAY DIFFRACTION' 24  ? ? 3 351 ? ? 3 460 ? 
;chain '3' and (resid 351 through 460 )
;
25  'X-RAY DIFFRACTION' 25  ? ? 3 461 ? ? 3 595 ? 
;chain '3' and (resid 461 through 595 )
;
26  'X-RAY DIFFRACTION' 26  ? ? 3 596 ? ? 3 667 ? 
;chain '3' and (resid 596 through 667 )
;
27  'X-RAY DIFFRACTION' 27  ? ? 3 668 ? ? 3 719 ? 
;chain '3' and (resid 668 through 719 )
;
28  'X-RAY DIFFRACTION' 28  ? ? 3 720 ? ? 3 777 ? 
;chain '3' and (resid 720 through 777 )
;
29  'X-RAY DIFFRACTION' 29  ? ? 4 26  ? ? 4 139 ? 
;chain '4' and (resid 26 through 139 )
;
30  'X-RAY DIFFRACTION' 30  ? ? 4 140 ? ? 4 208 ? 
;chain '4' and (resid 140 through 208 )
;
31  'X-RAY DIFFRACTION' 31  ? ? 4 209 ? ? 4 247 ? 
;chain '4' and (resid 209 through 247 )
;
32  'X-RAY DIFFRACTION' 32  ? ? 4 248 ? ? 4 409 ? 
;chain '4' and (resid 248 through 409 )
;
33  'X-RAY DIFFRACTION' 33  ? ? 5 1   ? ? 5 13  ? 
;chain '5' and (resid 1 through 13 )
;
34  'X-RAY DIFFRACTION' 34  ? ? 5 14  ? ? 5 31  ? 
;chain '5' and (resid 14 through 31 )
;
35  'X-RAY DIFFRACTION' 35  ? ? 5 32  ? ? 5 43  ? 
;chain '5' and (resid 32 through 43 )
;
36  'X-RAY DIFFRACTION' 36  ? ? 5 44  ? ? 5 67  ? 
;chain '5' and (resid 44 through 67 )
;
37  'X-RAY DIFFRACTION' 37  ? ? 5 68  ? ? 5 86  ? 
;chain '5' and (resid 68 through 86 )
;
38  'X-RAY DIFFRACTION' 38  ? ? 5 87  ? ? 5 109 ? 
;chain '5' and (resid 87 through 109 )
;
39  'X-RAY DIFFRACTION' 39  ? ? 5 110 ? ? 5 121 ? 
;chain '5' and (resid 110 through 121 )
;
40  'X-RAY DIFFRACTION' 40  ? ? 5 122 ? ? 5 141 ? 
;chain '5' and (resid 122 through 141 )
;
41  'X-RAY DIFFRACTION' 41  ? ? 5 142 ? ? 5 175 ? 
;chain '5' and (resid 142 through 175 )
;
42  'X-RAY DIFFRACTION' 42  ? ? 5 176 ? ? 5 185 ? 
;chain '5' and (resid 176 through 185 )
;
43  'X-RAY DIFFRACTION' 43  ? ? 5 186 ? ? 5 196 ? 
;chain '5' and (resid 186 through 196 )
;
44  'X-RAY DIFFRACTION' 44  ? ? 6 20  ? ? 6 34  ? 
;chain '6' and (resid 20 through 34 )
;
45  'X-RAY DIFFRACTION' 45  ? ? 6 35  ? ? 6 56  ? 
;chain '6' and (resid 35 through 56 )
;
46  'X-RAY DIFFRACTION' 46  ? ? 6 57  ? ? 6 77  ? 
;chain '6' and (resid 57 through 77 )
;
47  'X-RAY DIFFRACTION' 47  ? ? 6 78  ? ? 6 181 ? 
;chain '6' and (resid 78 through 181 )
;
48  'X-RAY DIFFRACTION' 48  ? ? 9 2   ? ? 9 18  ? 
;chain '9' and (resid 2 through 18 )
;
49  'X-RAY DIFFRACTION' 49  ? ? 9 19  ? ? 9 38  ? 
;chain '9' and (resid 19 through 38 )
;
50  'X-RAY DIFFRACTION' 50  ? ? 9 39  ? ? 9 48  ? 
;chain '9' and (resid 39 through 48 )
;
51  'X-RAY DIFFRACTION' 51  ? ? 9 49  ? ? 9 74  ? 
;chain '9' and (resid 49 through 74 )
;
52  'X-RAY DIFFRACTION' 52  ? ? 9 75  ? ? 9 112 ? 
;chain '9' and (resid 75 through 112 )
;
53  'X-RAY DIFFRACTION' 53  ? ? 9 113 ? ? 9 135 ? 
;chain '9' and (resid 113 through 135 )
;
54  'X-RAY DIFFRACTION' 54  ? ? 9 136 ? ? 9 167 ? 
;chain '9' and (resid 136 through 167 )
;
55  'X-RAY DIFFRACTION' 55  ? ? 9 168 ? ? 9 181 ? 
;chain '9' and (resid 168 through 181 )
;
56  'X-RAY DIFFRACTION' 56  ? ? 7 3   ? ? 7 27  ? 
;chain '7' and (resid 3 through 27 )
;
57  'X-RAY DIFFRACTION' 57  ? ? 7 28  ? ? 7 60  ? 
;chain '7' and (resid 28 through 60 )
;
58  'X-RAY DIFFRACTION' 58  ? ? 7 61  ? ? 7 81  ? 
;chain '7' and (resid 61 through 81 )
;
59  'X-RAY DIFFRACTION' 59  ? ? 7 82  ? ? 7 111 ? 
;chain '7' and (resid 82 through 111 )
;
60  'X-RAY DIFFRACTION' 60  ? ? 7 112 ? ? 7 129 ? 
;chain '7' and (resid 112 through 129 )
;
61  'X-RAY DIFFRACTION' 61  ? ? W 1   ? ? W 9   ? 
;chain 'W' and (resid 1 through 9 )
;
62  'X-RAY DIFFRACTION' 62  ? ? W 10  ? ? W 35  ? 
;chain 'W' and (resid 10 through 35 )
;
63  'X-RAY DIFFRACTION' 63  ? ? W 36  ? ? W 46  ? 
;chain 'W' and (resid 36 through 46 )
;
64  'X-RAY DIFFRACTION' 64  ? ? W 47  ? ? W 69  ? 
;chain 'W' and (resid 47 through 69 )
;
65  'X-RAY DIFFRACTION' 65  ? ? W 70  ? ? W 95  ? 
;chain 'W' and (resid 70 through 95 )
;
66  'X-RAY DIFFRACTION' 66  ? ? W 96  ? ? W 106 ? 
;chain 'W' and (resid 96 through 106 )
;
67  'X-RAY DIFFRACTION' 67  ? ? W 107 ? ? W 117 ? 
;chain 'W' and (resid 107 through 117 )
;
68  'X-RAY DIFFRACTION' 68  ? ? W 118 ? ? W 127 ? 
;chain 'W' and (resid 118 through 127 )
;
69  'X-RAY DIFFRACTION' 69  ? ? A 2   ? ? A 88  ? 
;chain 'A' and (resid 2 through 88 )
;
70  'X-RAY DIFFRACTION' 70  ? ? A 89  ? ? A 117 ? 
;chain 'A' and (resid 89 through 117 )
;
71  'X-RAY DIFFRACTION' 71  ? ? J 1   ? ? J 24  ? 
;chain 'J' and (resid 1 through 24 )
;
72  'X-RAY DIFFRACTION' 72  ? ? J 25  ? ? J 73  ? 
;chain 'J' and (resid 25 through 73 )
;
73  'X-RAY DIFFRACTION' 73  ? ? J 74  ? ? J 108 ? 
;chain 'J' and (resid 74 through 108 )
;
74  'X-RAY DIFFRACTION' 74  ? ? J 109 ? ? J 160 ? 
;chain 'J' and (resid 109 through 160 )
;
75  'X-RAY DIFFRACTION' 75  ? ? K 1   ? ? K 23  ? 
;chain 'K' and (resid 1 through 23 )
;
76  'X-RAY DIFFRACTION' 76  ? ? K 24  ? ? K 51  ? 
;chain 'K' and (resid 24 through 51 )
;
77  'X-RAY DIFFRACTION' 77  ? ? K 52  ? ? K 78  ? 
;chain 'K' and (resid 52 through 78 )
;
78  'X-RAY DIFFRACTION' 78  ? ? K 79  ? ? K 86  ? 
;chain 'K' and (resid 79 through 86 )
;
79  'X-RAY DIFFRACTION' 79  ? ? K 87  ? ? K 95  ? 
;chain 'K' and (resid 87 through 95 )
;
80  'X-RAY DIFFRACTION' 80  ? ? L 1   ? ? L 70  ? 
;chain 'L' and (resid 1 through 70 )
;
81  'X-RAY DIFFRACTION' 81  ? ? L 71  ? ? L 425 ? 
;chain 'L' and (resid 71 through 425 )
;
82  'X-RAY DIFFRACTION' 82  ? ? L 426 ? ? L 458 ? 
;chain 'L' and (resid 426 through 458 )
;
83  'X-RAY DIFFRACTION' 83  ? ? L 459 ? ? L 510 ? 
;chain 'L' and (resid 459 through 510 )
;
84  'X-RAY DIFFRACTION' 84  ? ? L 511 ? ? L 542 ? 
;chain 'L' and (resid 511 through 542 )
;
85  'X-RAY DIFFRACTION' 85  ? ? L 543 ? ? L 605 ? 
;chain 'L' and (resid 543 through 605 )
;
86  'X-RAY DIFFRACTION' 86  ? ? M 1   ? ? M 114 ? 
;chain 'M' and (resid 1 through 114 )
;
87  'X-RAY DIFFRACTION' 87  ? ? M 115 ? ? M 414 ? 
;chain 'M' and (resid 115 through 414 )
;
88  'X-RAY DIFFRACTION' 88  ? ? M 415 ? ? M 467 ? 
;chain 'M' and (resid 415 through 467 )
;
89  'X-RAY DIFFRACTION' 89  ? ? N 1   ? ? N 127 ? 
;chain 'N' and (resid 1 through 127 )
;
90  'X-RAY DIFFRACTION' 90  ? ? N 128 ? ? N 187 ? 
;chain 'N' and (resid 128 through 187 )
;
91  'X-RAY DIFFRACTION' 91  ? ? N 188 ? ? N 357 ? 
;chain 'N' and (resid 188 through 357 )
;
92  'X-RAY DIFFRACTION' 92  ? ? N 358 ? ? N 395 ? 
;chain 'N' and (resid 358 through 395 )
;
93  'X-RAY DIFFRACTION' 93  ? ? N 396 ? ? N 427 ? 
;chain 'N' and (resid 396 through 427 )
;
94  'X-RAY DIFFRACTION' 94  ? ? H 2   ? ? H 42  ? 
;chain 'H' and (resid 2 through 42 )
;
95  'X-RAY DIFFRACTION' 95  ? ? H 43  ? ? H 104 ? 
;chain 'H' and (resid 43 through 104 )
;
96  'X-RAY DIFFRACTION' 96  ? ? H 105 ? ? H 147 ? 
;chain 'H' and (resid 105 through 147 )
;
97  'X-RAY DIFFRACTION' 97  ? ? H 148 ? ? H 262 ? 
;chain 'H' and (resid 148 through 262 )
;
98  'X-RAY DIFFRACTION' 98  ? ? H 263 ? ? H 296 ? 
;chain 'H' and (resid 263 through 296 )
;
99  'X-RAY DIFFRACTION' 99  ? ? H 297 ? ? H 334 ? 
;chain 'H' and (resid 297 through 334 )
;
100 'X-RAY DIFFRACTION' 100 ? ? H 335 ? ? H 354 ? 
;chain 'H' and (resid 335 through 354 )
;
101 'X-RAY DIFFRACTION' 101 ? ? B 2   ? ? B 38  ? 
;chain 'B' and (resid 2 through 38 )
;
102 'X-RAY DIFFRACTION' 102 ? ? B 39  ? ? B 60  ? 
;chain 'B' and (resid 39 through 60 )
;
103 'X-RAY DIFFRACTION' 103 ? ? B 61  ? ? B 124 ? 
;chain 'B' and (resid 61 through 124 )
;
104 'X-RAY DIFFRACTION' 104 ? ? B 125 ? ? B 267 ? 
;chain 'B' and (resid 125 through 267 )
;
105 'X-RAY DIFFRACTION' 105 ? ? B 268 ? ? B 366 ? 
;chain 'B' and (resid 268 through 366 )
;
106 'X-RAY DIFFRACTION' 106 ? ? B 367 ? ? B 395 ? 
;chain 'B' and (resid 367 through 395 )
;
107 'X-RAY DIFFRACTION' 107 ? ? B 396 ? ? B 438 ? 
;chain 'B' and (resid 396 through 438 )
;
108 'X-RAY DIFFRACTION' 108 ? ? C 3   ? ? C 22  ? 
;chain 'C' and (resid 3 through 22 )
;
109 'X-RAY DIFFRACTION' 109 ? ? C 23  ? ? C 38  ? 
;chain 'C' and (resid 23 through 38 )
;
110 'X-RAY DIFFRACTION' 110 ? ? C 39  ? ? C 53  ? 
;chain 'C' and (resid 39 through 53 )
;
111 'X-RAY DIFFRACTION' 111 ? ? C 54  ? ? C 66  ? 
;chain 'C' and (resid 54 through 66 )
;
112 'X-RAY DIFFRACTION' 112 ? ? C 67  ? ? C 77  ? 
;chain 'C' and (resid 67 through 77 )
;
113 'X-RAY DIFFRACTION' 113 ? ? C 78  ? ? C 92  ? 
;chain 'C' and (resid 78 through 92 )
;
114 'X-RAY DIFFRACTION' 114 ? ? C 93  ? ? C 104 ? 
;chain 'C' and (resid 93 through 104 )
;
115 'X-RAY DIFFRACTION' 115 ? ? C 105 ? ? C 116 ? 
;chain 'C' and (resid 105 through 116 )
;
116 'X-RAY DIFFRACTION' 116 ? ? C 117 ? ? C 146 ? 
;chain 'C' and (resid 117 through 146 )
;
117 'X-RAY DIFFRACTION' 117 ? ? C 147 ? ? C 158 ? 
;chain 'C' and (resid 147 through 158 )
;
118 'X-RAY DIFFRACTION' 118 ? ? C 159 ? ? C 180 ? 
;chain 'C' and (resid 159 through 180 )
;
119 'X-RAY DIFFRACTION' 119 ? ? D 1   ? ? D 128 ? 
;chain 'D' and (resid 1 through 128 )
;
120 'X-RAY DIFFRACTION' 120 ? ? D 129 ? ? D 193 ? 
;chain 'D' and (resid 129 through 193 )
;
121 'X-RAY DIFFRACTION' 121 ? ? D 194 ? ? D 309 ? 
;chain 'D' and (resid 194 through 309 )
;
122 'X-RAY DIFFRACTION' 122 ? ? D 310 ? ? D 350 ? 
;chain 'D' and (resid 310 through 350 )
;
123 'X-RAY DIFFRACTION' 123 ? ? D 351 ? ? D 546 ? 
;chain 'D' and (resid 351 through 546 )
;
124 'X-RAY DIFFRACTION' 124 ? ? D 547 ? ? D 594 ? 
;chain 'D' and (resid 547 through 594 )
;
125 'X-RAY DIFFRACTION' 125 ? ? D 595 ? ? D 667 ? 
;chain 'D' and (resid 595 through 667 )
;
126 'X-RAY DIFFRACTION' 126 ? ? D 668 ? ? D 719 ? 
;chain 'D' and (resid 668 through 719 )
;
127 'X-RAY DIFFRACTION' 127 ? ? D 720 ? ? D 777 ? 
;chain 'D' and (resid 720 through 777 )
;
128 'X-RAY DIFFRACTION' 128 ? ? E 26  ? ? E 53  ? 
;chain 'E' and (resid 26 through 53 )
;
129 'X-RAY DIFFRACTION' 129 ? ? E 54  ? ? E 139 ? 
;chain 'E' and (resid 54 through 139 )
;
130 'X-RAY DIFFRACTION' 130 ? ? E 140 ? ? E 208 ? 
;chain 'E' and (resid 140 through 208 )
;
131 'X-RAY DIFFRACTION' 131 ? ? E 209 ? ? E 232 ? 
;chain 'E' and (resid 209 through 232 )
;
132 'X-RAY DIFFRACTION' 132 ? ? E 233 ? ? E 409 ? 
;chain 'E' and (resid 233 through 409 )
;
133 'X-RAY DIFFRACTION' 133 ? ? F 1   ? ? F 13  ? 
;chain 'F' and (resid 1 through 13 )
;
134 'X-RAY DIFFRACTION' 134 ? ? F 14  ? ? F 31  ? 
;chain 'F' and (resid 14 through 31 )
;
135 'X-RAY DIFFRACTION' 135 ? ? F 32  ? ? F 86  ? 
;chain 'F' and (resid 32 through 86 )
;
136 'X-RAY DIFFRACTION' 136 ? ? F 87  ? ? F 121 ? 
;chain 'F' and (resid 87 through 121 )
;
137 'X-RAY DIFFRACTION' 137 ? ? F 122 ? ? F 175 ? 
;chain 'F' and (resid 122 through 175 )
;
138 'X-RAY DIFFRACTION' 138 ? ? F 176 ? ? F 196 ? 
;chain 'F' and (resid 176 through 196 )
;
139 'X-RAY DIFFRACTION' 139 ? ? G 20  ? ? G 34  ? 
;chain 'G' and (resid 20 through 34 )
;
140 'X-RAY DIFFRACTION' 140 ? ? G 35  ? ? G 56  ? 
;chain 'G' and (resid 35 through 56 )
;
141 'X-RAY DIFFRACTION' 141 ? ? G 57  ? ? G 88  ? 
;chain 'G' and (resid 57 through 88 )
;
142 'X-RAY DIFFRACTION' 142 ? ? G 89  ? ? G 158 ? 
;chain 'G' and (resid 89 through 158 )
;
143 'X-RAY DIFFRACTION' 143 ? ? G 159 ? ? G 168 ? 
;chain 'G' and (resid 159 through 168 )
;
144 'X-RAY DIFFRACTION' 144 ? ? G 169 ? ? G 181 ? 
;chain 'G' and (resid 169 through 181 )
;
145 'X-RAY DIFFRACTION' 145 ? ? O 2   ? ? O 18  ? 
;chain 'O' and (resid 2 through 18 )
;
146 'X-RAY DIFFRACTION' 146 ? ? O 19  ? ? O 30  ? 
;chain 'O' and (resid 19 through 30 )
;
147 'X-RAY DIFFRACTION' 147 ? ? O 31  ? ? O 48  ? 
;chain 'O' and (resid 31 through 48 )
;
148 'X-RAY DIFFRACTION' 148 ? ? O 49  ? ? O 74  ? 
;chain 'O' and (resid 49 through 74 )
;
149 'X-RAY DIFFRACTION' 149 ? ? O 75  ? ? O 112 ? 
;chain 'O' and (resid 75 through 112 )
;
150 'X-RAY DIFFRACTION' 150 ? ? O 113 ? ? O 125 ? 
;chain 'O' and (resid 113 through 125 )
;
151 'X-RAY DIFFRACTION' 151 ? ? O 126 ? ? O 168 ? 
;chain 'O' and (resid 126 through 168 )
;
152 'X-RAY DIFFRACTION' 152 ? ? O 169 ? ? O 181 ? 
;chain 'O' and (resid 169 through 181 )
;
153 'X-RAY DIFFRACTION' 153 ? ? I 3   ? ? I 27  ? 
;chain 'I' and (resid 3 through 27 )
;
154 'X-RAY DIFFRACTION' 154 ? ? I 28  ? ? I 60  ? 
;chain 'I' and (resid 28 through 60 )
;
155 'X-RAY DIFFRACTION' 155 ? ? I 61  ? ? I 81  ? 
;chain 'I' and (resid 61 through 81 )
;
156 'X-RAY DIFFRACTION' 156 ? ? I 82  ? ? I 111 ? 
;chain 'I' and (resid 82 through 111 )
;
157 'X-RAY DIFFRACTION' 157 ? ? I 112 ? ? I 129 ? 
;chain 'I' and (resid 112 through 129 )
;
158 'X-RAY DIFFRACTION' 158 ? ? X 1   ? ? X 9   ? 
;chain 'X' and (resid 1 through 9 )
;
159 'X-RAY DIFFRACTION' 159 ? ? X 10  ? ? X 21  ? 
;chain 'X' and (resid 10 through 21 )
;
160 'X-RAY DIFFRACTION' 160 ? ? X 22  ? ? X 29  ? 
;chain 'X' and (resid 22 through 29 )
;
161 'X-RAY DIFFRACTION' 161 ? ? X 30  ? ? X 46  ? 
;chain 'X' and (resid 30 through 46 )
;
162 'X-RAY DIFFRACTION' 162 ? ? X 47  ? ? X 59  ? 
;chain 'X' and (resid 47 through 59 )
;
163 'X-RAY DIFFRACTION' 163 ? ? X 60  ? ? X 83  ? 
;chain 'X' and (resid 60 through 83 )
;
164 'X-RAY DIFFRACTION' 164 ? ? X 84  ? ? X 93  ? 
;chain 'X' and (resid 84 through 93 )
;
165 'X-RAY DIFFRACTION' 165 ? ? X 94  ? ? X 106 ? 
;chain 'X' and (resid 94 through 106 )
;
166 'X-RAY DIFFRACTION' 166 ? ? X 107 ? ? X 127 ? 
;chain 'X' and (resid 107 through 127 )
;
167 'X-RAY DIFFRACTION' 167 ? ? P 2   ? ? P 58  ? 
;chain 'P' and (resid 2 through 58 )
;
168 'X-RAY DIFFRACTION' 168 ? ? P 59  ? ? P 83  ? 
;chain 'P' and (resid 59 through 83 )
;
169 'X-RAY DIFFRACTION' 169 ? ? P 84  ? ? P 112 ? 
;chain 'P' and (resid 84 through 112 )
;
170 'X-RAY DIFFRACTION' 170 ? ? P 113 ? ? P 117 ? 
;chain 'P' and (resid 113 through 117 )
;
171 'X-RAY DIFFRACTION' 171 ? ? R 1   ? ? R 24  ? 
;chain 'R' and (resid 1 through 24 )
;
172 'X-RAY DIFFRACTION' 172 ? ? R 25  ? ? R 62  ? 
;chain 'R' and (resid 25 through 62 )
;
173 'X-RAY DIFFRACTION' 173 ? ? R 63  ? ? R 73  ? 
;chain 'R' and (resid 63 through 73 )
;
174 'X-RAY DIFFRACTION' 174 ? ? R 74  ? ? R 87  ? 
;chain 'R' and (resid 74 through 87 )
;
175 'X-RAY DIFFRACTION' 175 ? ? R 88  ? ? R 108 ? 
;chain 'R' and (resid 88 through 108 )
;
176 'X-RAY DIFFRACTION' 176 ? ? R 109 ? ? R 123 ? 
;chain 'R' and (resid 109 through 123 )
;
177 'X-RAY DIFFRACTION' 177 ? ? R 124 ? ? R 160 ? 
;chain 'R' and (resid 124 through 160 )
;
178 'X-RAY DIFFRACTION' 178 ? ? S 1   ? ? S 23  ? 
;chain 'S' and (resid 1 through 23 )
;
179 'X-RAY DIFFRACTION' 179 ? ? S 24  ? ? S 76  ? 
;chain 'S' and (resid 24 through 76 )
;
180 'X-RAY DIFFRACTION' 180 ? ? S 77  ? ? S 86  ? 
;chain 'S' and (resid 77 through 86 )
;
181 'X-RAY DIFFRACTION' 181 ? ? S 87  ? ? S 95  ? 
;chain 'S' and (resid 87 through 95 )
;
182 'X-RAY DIFFRACTION' 182 ? ? T 1   ? ? T 70  ? 
;chain 'T' and (resid 1 through 70 )
;
183 'X-RAY DIFFRACTION' 183 ? ? T 71  ? ? T 290 ? 
;chain 'T' and (resid 71 through 290 )
;
184 'X-RAY DIFFRACTION' 184 ? ? T 291 ? ? T 425 ? 
;chain 'T' and (resid 291 through 425 )
;
185 'X-RAY DIFFRACTION' 185 ? ? T 426 ? ? T 455 ? 
;chain 'T' and (resid 426 through 455 )
;
186 'X-RAY DIFFRACTION' 186 ? ? T 456 ? ? T 488 ? 
;chain 'T' and (resid 456 through 488 )
;
187 'X-RAY DIFFRACTION' 187 ? ? T 489 ? ? T 542 ? 
;chain 'T' and (resid 489 through 542 )
;
188 'X-RAY DIFFRACTION' 188 ? ? T 543 ? ? T 605 ? 
;chain 'T' and (resid 543 through 605 )
;
189 'X-RAY DIFFRACTION' 189 ? ? U 1   ? ? U 95  ? 
;chain 'U' and (resid 1 through 95 )
;
190 'X-RAY DIFFRACTION' 190 ? ? U 96  ? ? U 304 ? 
;chain 'U' and (resid 96 through 304 )
;
191 'X-RAY DIFFRACTION' 191 ? ? U 305 ? ? U 414 ? 
;chain 'U' and (resid 305 through 414 )
;
192 'X-RAY DIFFRACTION' 192 ? ? U 415 ? ? U 467 ? 
;chain 'U' and (resid 415 through 467 )
;
193 'X-RAY DIFFRACTION' 193 ? ? V 1   ? ? V 42  ? 
;chain 'V' and (resid 1 through 42 )
;
194 'X-RAY DIFFRACTION' 194 ? ? V 43  ? ? V 75  ? 
;chain 'V' and (resid 43 through 75 )
;
195 'X-RAY DIFFRACTION' 195 ? ? V 76  ? ? V 127 ? 
;chain 'V' and (resid 76 through 127 )
;
196 'X-RAY DIFFRACTION' 196 ? ? V 128 ? ? V 225 ? 
;chain 'V' and (resid 128 through 225 )
;
197 'X-RAY DIFFRACTION' 197 ? ? V 226 ? ? V 357 ? 
;chain 'V' and (resid 226 through 357 )
;
198 'X-RAY DIFFRACTION' 198 ? ? V 358 ? ? V 427 ? 
;chain 'V' and (resid 358 through 427 )
;
199 'X-RAY DIFFRACTION' 199 ? ? Q 2   ? ? Q 104 ? 
;chain 'Q' and (resid 2 through 104 )
;
200 'X-RAY DIFFRACTION' 200 ? ? Q 105 ? ? Q 296 ? 
;chain 'Q' and (resid 105 through 296 )
;
201 'X-RAY DIFFRACTION' 201 ? ? Q 297 ? ? Q 354 ? 
;chain 'Q' and (resid 297 through 354 )
;
# 
_pdbx_entry_details.entry_id                 6Y11 
_pdbx_entry_details.has_ligand_of_interest   N 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 1 MET 1   ? A  MET 1   
2   1 Y 1 2 MET 1   ? B  MET 1   
3   1 Y 1 2 GLY 2   ? B  GLY 2   
4   1 Y 1 2 VAL 181 ? B  VAL 181 
5   1 Y 1 3 LYS 56  ? C  LYS 56  
6   1 Y 1 3 LYS 57  ? C  LYS 57  
7   1 Y 1 3 GLY 58  ? C  GLY 58  
8   1 Y 1 3 PRO 59  ? C  PRO 59  
9   1 Y 1 3 ASP 60  ? C  ASP 60  
10  1 Y 1 3 GLY 61  ? C  GLY 61  
11  1 Y 1 3 LYS 62  ? C  LYS 62  
12  1 Y 1 3 PRO 63  ? C  PRO 63  
13  1 Y 1 3 LEU 64  ? C  LEU 64  
14  1 Y 1 3 LEU 65  ? C  LEU 65  
15  1 Y 1 3 ASN 66  ? C  ASN 66  
16  1 Y 1 3 GLU 67  ? C  GLU 67  
17  1 Y 1 3 LYS 68  ? C  LYS 68  
18  1 Y 1 3 GLY 69  ? C  GLY 69  
19  1 Y 1 3 GLU 70  ? C  GLU 70  
20  1 Y 1 3 PRO 71  ? C  PRO 71  
21  1 Y 1 3 GLU 72  ? C  GLU 72  
22  1 Y 1 3 TYR 144 ? C  TYR 144 
23  1 Y 1 3 GLN 145 ? C  GLN 145 
24  1 Y 1 3 LYS 146 ? C  LYS 146 
25  1 Y 1 3 GLY 147 ? C  GLY 147 
26  1 Y 1 3 PRO 778 ? C  PRO 778 
27  1 Y 1 3 ALA 779 ? C  ALA 779 
28  1 Y 1 3 GLY 780 ? C  GLY 780 
29  1 Y 1 3 GLY 781 ? C  GLY 781 
30  1 Y 1 3 GLU 782 ? C  GLU 782 
31  1 Y 1 3 ALA 783 ? C  ALA 783 
32  1 Y 1 4 MET 1   ? D  MET 1   
33  1 Y 1 4 ARG 2   ? D  ARG 2   
34  1 Y 1 4 GLU 3   ? D  GLU 3   
35  1 Y 1 4 GLU 4   ? D  GLU 4   
36  1 Y 1 4 PHE 5   ? D  PHE 5   
37  1 Y 1 4 LEU 6   ? D  LEU 6   
38  1 Y 1 4 GLU 7   ? D  GLU 7   
39  1 Y 1 4 GLU 8   ? D  GLU 8   
40  1 Y 1 4 ILE 9   ? D  ILE 9   
41  1 Y 1 4 PRO 10  ? D  PRO 10  
42  1 Y 1 4 LEU 11  ? D  LEU 11  
43  1 Y 1 4 ASP 12  ? D  ASP 12  
44  1 Y 1 4 ALA 13  ? D  ALA 13  
45  1 Y 1 4 PRO 14  ? D  PRO 14  
46  1 Y 1 4 PRO 15  ? D  PRO 15  
47  1 Y 1 4 GLU 16  ? D  GLU 16  
48  1 Y 1 4 GLU 17  ? D  GLU 17  
49  1 Y 1 4 ALA 18  ? D  ALA 18  
50  1 Y 1 4 LYS 19  ? D  LYS 19  
51  1 Y 1 4 GLU 20  ? D  GLU 20  
52  1 Y 1 4 LEU 21  ? D  LEU 21  
53  1 Y 1 4 ARG 22  ? D  ARG 22  
54  1 Y 1 4 THR 23  ? D  THR 23  
55  1 Y 1 4 GLU 24  ? D  GLU 24  
56  1 Y 1 4 VAL 25  ? D  VAL 25  
57  1 Y 1 5 ALA 197 ? E  ALA 197 
58  1 Y 1 5 ASP 198 ? E  ASP 198 
59  1 Y 1 5 LEU 199 ? E  LEU 199 
60  1 Y 1 5 LYS 200 ? E  LYS 200 
61  1 Y 1 5 LYS 201 ? E  LYS 201 
62  1 Y 1 5 ALA 202 ? E  ALA 202 
63  1 Y 1 5 ARG 203 ? E  ARG 203 
64  1 Y 1 5 GLU 204 ? E  GLU 204 
65  1 Y 1 5 VAL 205 ? E  VAL 205 
66  1 Y 1 5 LYS 206 ? E  LYS 206 
67  1 Y 1 5 GLY 207 ? E  GLY 207 
68  1 Y 1 6 MET 1   ? F  MET 1   
69  1 Y 1 6 ALA 2   ? F  ALA 2   
70  1 Y 1 6 LEU 3   ? F  LEU 3   
71  1 Y 1 6 LYS 4   ? F  LYS 4   
72  1 Y 1 6 ASP 5   ? F  ASP 5   
73  1 Y 1 6 LEU 6   ? F  LEU 6   
74  1 Y 1 6 PHE 7   ? F  PHE 7   
75  1 Y 1 6 GLU 8   ? F  GLU 8   
76  1 Y 1 6 ARG 9   ? F  ARG 9   
77  1 Y 1 6 ASP 10  ? F  ASP 10  
78  1 Y 1 6 VAL 11  ? F  VAL 11  
79  1 Y 1 6 GLN 12  ? F  GLN 12  
80  1 Y 1 6 GLU 13  ? F  GLU 13  
81  1 Y 1 6 LEU 14  ? F  LEU 14  
82  1 Y 1 6 GLU 15  ? F  GLU 15  
83  1 Y 1 9 MET 1   ? G  MET 1   
84  1 Y 1 9 ARG 182 ? G  ARG 182 
85  1 Y 1 7 MET 1   ? H  MET 1   
86  1 Y 1 7 SER 2   ? H  SER 2   
87  1 Y 1 W LYS 128 ? I  LYS 128 
88  1 Y 1 W ARG 129 ? I  ARG 129 
89  1 Y 1 W ALA 130 ? I  ALA 130 
90  1 Y 1 W ALA 131 ? I  ALA 131 
91  1 Y 1 A TRP 118 ? J  TRP 118 
92  1 Y 1 A HIS 119 ? J  HIS 119 
93  1 Y 1 J LYS 161 ? K  LYS 161 
94  1 Y 1 J ALA 162 ? K  ALA 162 
95  1 Y 1 J SER 163 ? K  SER 163 
96  1 Y 1 J ARG 164 ? K  ARG 164 
97  1 Y 1 J ALA 165 ? K  ALA 165 
98  1 Y 1 J LYS 166 ? K  LYS 166 
99  1 Y 1 J GLU 167 ? K  GLU 167 
100 1 Y 1 J ALA 168 ? K  ALA 168 
101 1 Y 1 J GLU 169 ? K  GLU 169 
102 1 Y 1 J LYS 170 ? K  LYS 170 
103 1 Y 1 J ARG 171 ? K  ARG 171 
104 1 Y 1 J GLU 172 ? K  GLU 172 
105 1 Y 1 J GLU 173 ? K  GLU 173 
106 1 Y 1 J VAL 174 ? K  VAL 174 
107 1 Y 1 J ALA 175 ? K  ALA 175 
108 1 Y 1 J ARG 176 ? K  ARG 176 
109 1 Y 1 L TRP 606 ? M  TRP 606 
110 1 Y 1 M GLY 468 ? N  GLY 468 
111 1 Y 1 M ALA 469 ? N  ALA 469 
112 1 Y 1 H MET 1   ? P  MET 1   
113 1 Y 1 H THR 355 ? P  THR 355 
114 1 Y 1 H PRO 356 ? P  PRO 356 
115 1 Y 1 H LYS 357 ? P  LYS 357 
116 1 Y 1 H PRO 358 ? P  PRO 358 
117 1 Y 1 H ALA 359 ? P  ALA 359 
118 1 Y 1 H ARG 360 ? P  ARG 360 
119 1 Y 1 H LYS 361 ? P  LYS 361 
120 1 Y 1 H GLY 362 ? P  GLY 362 
121 1 Y 1 H GLY 363 ? P  GLY 363 
122 1 Y 1 H GLY 364 ? P  GLY 364 
123 1 Y 1 H ALA 365 ? P  ALA 365 
124 1 Y 1 B MET 1   ? Q  MET 1   
125 1 Y 1 C MET 1   ? R  MET 1   
126 1 Y 1 C GLY 2   ? R  GLY 2   
127 1 Y 1 C VAL 181 ? R  VAL 181 
128 1 Y 1 D LYS 56  ? S  LYS 56  
129 1 Y 1 D LYS 57  ? S  LYS 57  
130 1 Y 1 D GLY 58  ? S  GLY 58  
131 1 Y 1 D PRO 59  ? S  PRO 59  
132 1 Y 1 D ASP 60  ? S  ASP 60  
133 1 Y 1 D GLY 61  ? S  GLY 61  
134 1 Y 1 D LYS 62  ? S  LYS 62  
135 1 Y 1 D PRO 63  ? S  PRO 63  
136 1 Y 1 D LEU 64  ? S  LEU 64  
137 1 Y 1 D LEU 65  ? S  LEU 65  
138 1 Y 1 D ASN 66  ? S  ASN 66  
139 1 Y 1 D GLU 67  ? S  GLU 67  
140 1 Y 1 D LYS 68  ? S  LYS 68  
141 1 Y 1 D GLY 69  ? S  GLY 69  
142 1 Y 1 D GLU 70  ? S  GLU 70  
143 1 Y 1 D PRO 71  ? S  PRO 71  
144 1 Y 1 D GLU 72  ? S  GLU 72  
145 1 Y 1 D TYR 144 ? S  TYR 144 
146 1 Y 1 D GLN 145 ? S  GLN 145 
147 1 Y 1 D LYS 146 ? S  LYS 146 
148 1 Y 1 D GLY 147 ? S  GLY 147 
149 1 Y 1 D PRO 778 ? S  PRO 778 
150 1 Y 1 D ALA 779 ? S  ALA 779 
151 1 Y 1 D GLY 780 ? S  GLY 780 
152 1 Y 1 D GLY 781 ? S  GLY 781 
153 1 Y 1 D GLU 782 ? S  GLU 782 
154 1 Y 1 D ALA 783 ? S  ALA 783 
155 1 Y 1 E MET 1   ? T  MET 1   
156 1 Y 1 E ARG 2   ? T  ARG 2   
157 1 Y 1 E GLU 3   ? T  GLU 3   
158 1 Y 1 E GLU 4   ? T  GLU 4   
159 1 Y 1 E PHE 5   ? T  PHE 5   
160 1 Y 1 E LEU 6   ? T  LEU 6   
161 1 Y 1 E GLU 7   ? T  GLU 7   
162 1 Y 1 E GLU 8   ? T  GLU 8   
163 1 Y 1 E ILE 9   ? T  ILE 9   
164 1 Y 1 E PRO 10  ? T  PRO 10  
165 1 Y 1 E LEU 11  ? T  LEU 11  
166 1 Y 1 E ASP 12  ? T  ASP 12  
167 1 Y 1 E ALA 13  ? T  ALA 13  
168 1 Y 1 E PRO 14  ? T  PRO 14  
169 1 Y 1 E PRO 15  ? T  PRO 15  
170 1 Y 1 E GLU 16  ? T  GLU 16  
171 1 Y 1 E GLU 17  ? T  GLU 17  
172 1 Y 1 E ALA 18  ? T  ALA 18  
173 1 Y 1 E LYS 19  ? T  LYS 19  
174 1 Y 1 E GLU 20  ? T  GLU 20  
175 1 Y 1 E LEU 21  ? T  LEU 21  
176 1 Y 1 E ARG 22  ? T  ARG 22  
177 1 Y 1 E THR 23  ? T  THR 23  
178 1 Y 1 E GLU 24  ? T  GLU 24  
179 1 Y 1 E VAL 25  ? T  VAL 25  
180 1 Y 1 F ALA 197 ? U  ALA 197 
181 1 Y 1 F ASP 198 ? U  ASP 198 
182 1 Y 1 F LEU 199 ? U  LEU 199 
183 1 Y 1 F LYS 200 ? U  LYS 200 
184 1 Y 1 F LYS 201 ? U  LYS 201 
185 1 Y 1 F ALA 202 ? U  ALA 202 
186 1 Y 1 F ARG 203 ? U  ARG 203 
187 1 Y 1 F GLU 204 ? U  GLU 204 
188 1 Y 1 F VAL 205 ? U  VAL 205 
189 1 Y 1 F LYS 206 ? U  LYS 206 
190 1 Y 1 F GLY 207 ? U  GLY 207 
191 1 Y 1 G MET 1   ? V  MET 1   
192 1 Y 1 G ALA 2   ? V  ALA 2   
193 1 Y 1 G LEU 3   ? V  LEU 3   
194 1 Y 1 G LYS 4   ? V  LYS 4   
195 1 Y 1 G ASP 5   ? V  ASP 5   
196 1 Y 1 G LEU 6   ? V  LEU 6   
197 1 Y 1 G PHE 7   ? V  PHE 7   
198 1 Y 1 G GLU 8   ? V  GLU 8   
199 1 Y 1 G ARG 9   ? V  ARG 9   
200 1 Y 1 G ASP 10  ? V  ASP 10  
201 1 Y 1 G VAL 11  ? V  VAL 11  
202 1 Y 1 G GLN 12  ? V  GLN 12  
203 1 Y 1 G GLU 13  ? V  GLU 13  
204 1 Y 1 G LEU 14  ? V  LEU 14  
205 1 Y 1 G GLU 15  ? V  GLU 15  
206 1 Y 1 O MET 1   ? W  MET 1   
207 1 Y 1 O ARG 182 ? W  ARG 182 
208 1 Y 1 I MET 1   ? X  MET 1   
209 1 Y 1 I SER 2   ? X  SER 2   
210 1 Y 1 X LYS 128 ? Y  LYS 128 
211 1 Y 1 X ARG 129 ? Y  ARG 129 
212 1 Y 1 X ALA 130 ? Y  ALA 130 
213 1 Y 1 X ALA 131 ? Y  ALA 131 
214 1 Y 1 P TRP 118 ? Z  TRP 118 
215 1 Y 1 P HIS 119 ? Z  HIS 119 
216 1 Y 1 R LYS 161 ? AA LYS 161 
217 1 Y 1 R ALA 162 ? AA ALA 162 
218 1 Y 1 R SER 163 ? AA SER 163 
219 1 Y 1 R ARG 164 ? AA ARG 164 
220 1 Y 1 R ALA 165 ? AA ALA 165 
221 1 Y 1 R LYS 166 ? AA LYS 166 
222 1 Y 1 R GLU 167 ? AA GLU 167 
223 1 Y 1 R ALA 168 ? AA ALA 168 
224 1 Y 1 R GLU 169 ? AA GLU 169 
225 1 Y 1 R LYS 170 ? AA LYS 170 
226 1 Y 1 R ARG 171 ? AA ARG 171 
227 1 Y 1 R GLU 172 ? AA GLU 172 
228 1 Y 1 R GLU 173 ? AA GLU 173 
229 1 Y 1 R VAL 174 ? AA VAL 174 
230 1 Y 1 R ALA 175 ? AA ALA 175 
231 1 Y 1 R ARG 176 ? AA ARG 176 
232 1 Y 1 T TRP 606 ? CA TRP 606 
233 1 Y 1 U GLY 468 ? DA GLY 468 
234 1 Y 1 U ALA 469 ? DA ALA 469 
235 1 Y 1 Q MET 1   ? FA MET 1   
236 1 Y 1 Q THR 355 ? FA THR 355 
237 1 Y 1 Q PRO 356 ? FA PRO 356 
238 1 Y 1 Q LYS 357 ? FA LYS 357 
239 1 Y 1 Q PRO 358 ? FA PRO 358 
240 1 Y 1 Q ALA 359 ? FA ALA 359 
241 1 Y 1 Q ARG 360 ? FA ARG 360 
242 1 Y 1 Q LYS 361 ? FA LYS 361 
243 1 Y 1 Q GLY 362 ? FA GLY 362 
244 1 Y 1 Q GLY 363 ? FA GLY 363 
245 1 Y 1 Q GLY 364 ? FA GLY 364 
246 1 Y 1 Q ALA 365 ? FA ALA 365 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N      N  N N 1   
ALA CA     C  N S 2   
ALA C      C  N N 3   
ALA O      O  N N 4   
ALA CB     C  N N 5   
ALA OXT    O  N N 6   
ALA H      H  N N 7   
ALA H2     H  N N 8   
ALA HA     H  N N 9   
ALA HB1    H  N N 10  
ALA HB2    H  N N 11  
ALA HB3    H  N N 12  
ALA HXT    H  N N 13  
ARG N      N  N N 14  
ARG CA     C  N S 15  
ARG C      C  N N 16  
ARG O      O  N N 17  
ARG CB     C  N N 18  
ARG CG     C  N N 19  
ARG CD     C  N N 20  
ARG NE     N  N N 21  
ARG CZ     C  N N 22  
ARG NH1    N  N N 23  
ARG NH2    N  N N 24  
ARG OXT    O  N N 25  
ARG H      H  N N 26  
ARG H2     H  N N 27  
ARG HA     H  N N 28  
ARG HB2    H  N N 29  
ARG HB3    H  N N 30  
ARG HG2    H  N N 31  
ARG HG3    H  N N 32  
ARG HD2    H  N N 33  
ARG HD3    H  N N 34  
ARG HE     H  N N 35  
ARG HH11   H  N N 36  
ARG HH12   H  N N 37  
ARG HH21   H  N N 38  
ARG HH22   H  N N 39  
ARG HXT    H  N N 40  
ASN N      N  N N 41  
ASN CA     C  N S 42  
ASN C      C  N N 43  
ASN O      O  N N 44  
ASN CB     C  N N 45  
ASN CG     C  N N 46  
ASN OD1    O  N N 47  
ASN ND2    N  N N 48  
ASN OXT    O  N N 49  
ASN H      H  N N 50  
ASN H2     H  N N 51  
ASN HA     H  N N 52  
ASN HB2    H  N N 53  
ASN HB3    H  N N 54  
ASN HD21   H  N N 55  
ASN HD22   H  N N 56  
ASN HXT    H  N N 57  
ASP N      N  N N 58  
ASP CA     C  N S 59  
ASP C      C  N N 60  
ASP O      O  N N 61  
ASP CB     C  N N 62  
ASP CG     C  N N 63  
ASP OD1    O  N N 64  
ASP OD2    O  N N 65  
ASP OXT    O  N N 66  
ASP H      H  N N 67  
ASP H2     H  N N 68  
ASP HA     H  N N 69  
ASP HB2    H  N N 70  
ASP HB3    H  N N 71  
ASP HD2    H  N N 72  
ASP HXT    H  N N 73  
CYS N      N  N N 74  
CYS CA     C  N R 75  
CYS C      C  N N 76  
CYS O      O  N N 77  
CYS CB     C  N N 78  
CYS SG     S  N N 79  
CYS OXT    O  N N 80  
CYS H      H  N N 81  
CYS H2     H  N N 82  
CYS HA     H  N N 83  
CYS HB2    H  N N 84  
CYS HB3    H  N N 85  
CYS HG     H  N N 86  
CYS HXT    H  N N 87  
FES FE1    FE N N 88  
FES FE2    FE N N 89  
FES S1     S  N N 90  
FES S2     S  N N 91  
FMN N1     N  N N 92  
FMN C2     C  N N 93  
FMN O2     O  N N 94  
FMN N3     N  N N 95  
FMN C4     C  N N 96  
FMN O4     O  N N 97  
FMN C4A    C  N N 98  
FMN N5     N  N N 99  
FMN C5A    C  Y N 100 
FMN C6     C  Y N 101 
FMN C7     C  Y N 102 
FMN C7M    C  N N 103 
FMN C8     C  Y N 104 
FMN C8M    C  N N 105 
FMN C9     C  Y N 106 
FMN C9A    C  Y N 107 
FMN N10    N  N N 108 
FMN C10    C  N N 109 
FMN "C1'"  C  N N 110 
FMN "C2'"  C  N S 111 
FMN "O2'"  O  N N 112 
FMN "C3'"  C  N S 113 
FMN "O3'"  O  N N 114 
FMN "C4'"  C  N R 115 
FMN "O4'"  O  N N 116 
FMN "C5'"  C  N N 117 
FMN "O5'"  O  N N 118 
FMN P      P  N N 119 
FMN O1P    O  N N 120 
FMN O2P    O  N N 121 
FMN O3P    O  N N 122 
FMN HN3    H  N N 123 
FMN H6     H  N N 124 
FMN HM71   H  N N 125 
FMN HM72   H  N N 126 
FMN HM73   H  N N 127 
FMN HM81   H  N N 128 
FMN HM82   H  N N 129 
FMN HM83   H  N N 130 
FMN H9     H  N N 131 
FMN "H1'1" H  N N 132 
FMN "H1'2" H  N N 133 
FMN "H2'"  H  N N 134 
FMN "HO2'" H  N N 135 
FMN "H3'"  H  N N 136 
FMN "HO3'" H  N N 137 
FMN "H4'"  H  N N 138 
FMN "HO4'" H  N N 139 
FMN "H5'1" H  N N 140 
FMN "H5'2" H  N N 141 
FMN HOP2   H  N N 142 
FMN HOP3   H  N N 143 
GLN N      N  N N 144 
GLN CA     C  N S 145 
GLN C      C  N N 146 
GLN O      O  N N 147 
GLN CB     C  N N 148 
GLN CG     C  N N 149 
GLN CD     C  N N 150 
GLN OE1    O  N N 151 
GLN NE2    N  N N 152 
GLN OXT    O  N N 153 
GLN H      H  N N 154 
GLN H2     H  N N 155 
GLN HA     H  N N 156 
GLN HB2    H  N N 157 
GLN HB3    H  N N 158 
GLN HG2    H  N N 159 
GLN HG3    H  N N 160 
GLN HE21   H  N N 161 
GLN HE22   H  N N 162 
GLN HXT    H  N N 163 
GLU N      N  N N 164 
GLU CA     C  N S 165 
GLU C      C  N N 166 
GLU O      O  N N 167 
GLU CB     C  N N 168 
GLU CG     C  N N 169 
GLU CD     C  N N 170 
GLU OE1    O  N N 171 
GLU OE2    O  N N 172 
GLU OXT    O  N N 173 
GLU H      H  N N 174 
GLU H2     H  N N 175 
GLU HA     H  N N 176 
GLU HB2    H  N N 177 
GLU HB3    H  N N 178 
GLU HG2    H  N N 179 
GLU HG3    H  N N 180 
GLU HE2    H  N N 181 
GLU HXT    H  N N 182 
GLY N      N  N N 183 
GLY CA     C  N N 184 
GLY C      C  N N 185 
GLY O      O  N N 186 
GLY OXT    O  N N 187 
GLY H      H  N N 188 
GLY H2     H  N N 189 
GLY HA2    H  N N 190 
GLY HA3    H  N N 191 
GLY HXT    H  N N 192 
HIS N      N  N N 193 
HIS CA     C  N S 194 
HIS C      C  N N 195 
HIS O      O  N N 196 
HIS CB     C  N N 197 
HIS CG     C  Y N 198 
HIS ND1    N  Y N 199 
HIS CD2    C  Y N 200 
HIS CE1    C  Y N 201 
HIS NE2    N  Y N 202 
HIS OXT    O  N N 203 
HIS H      H  N N 204 
HIS H2     H  N N 205 
HIS HA     H  N N 206 
HIS HB2    H  N N 207 
HIS HB3    H  N N 208 
HIS HD1    H  N N 209 
HIS HD2    H  N N 210 
HIS HE1    H  N N 211 
HIS HE2    H  N N 212 
HIS HXT    H  N N 213 
ILE N      N  N N 214 
ILE CA     C  N S 215 
ILE C      C  N N 216 
ILE O      O  N N 217 
ILE CB     C  N S 218 
ILE CG1    C  N N 219 
ILE CG2    C  N N 220 
ILE CD1    C  N N 221 
ILE OXT    O  N N 222 
ILE H      H  N N 223 
ILE H2     H  N N 224 
ILE HA     H  N N 225 
ILE HB     H  N N 226 
ILE HG12   H  N N 227 
ILE HG13   H  N N 228 
ILE HG21   H  N N 229 
ILE HG22   H  N N 230 
ILE HG23   H  N N 231 
ILE HD11   H  N N 232 
ILE HD12   H  N N 233 
ILE HD13   H  N N 234 
ILE HXT    H  N N 235 
LEU N      N  N N 236 
LEU CA     C  N S 237 
LEU C      C  N N 238 
LEU O      O  N N 239 
LEU CB     C  N N 240 
LEU CG     C  N N 241 
LEU CD1    C  N N 242 
LEU CD2    C  N N 243 
LEU OXT    O  N N 244 
LEU H      H  N N 245 
LEU H2     H  N N 246 
LEU HA     H  N N 247 
LEU HB2    H  N N 248 
LEU HB3    H  N N 249 
LEU HG     H  N N 250 
LEU HD11   H  N N 251 
LEU HD12   H  N N 252 
LEU HD13   H  N N 253 
LEU HD21   H  N N 254 
LEU HD22   H  N N 255 
LEU HD23   H  N N 256 
LEU HXT    H  N N 257 
LYS N      N  N N 258 
LYS CA     C  N S 259 
LYS C      C  N N 260 
LYS O      O  N N 261 
LYS CB     C  N N 262 
LYS CG     C  N N 263 
LYS CD     C  N N 264 
LYS CE     C  N N 265 
LYS NZ     N  N N 266 
LYS OXT    O  N N 267 
LYS H      H  N N 268 
LYS H2     H  N N 269 
LYS HA     H  N N 270 
LYS HB2    H  N N 271 
LYS HB3    H  N N 272 
LYS HG2    H  N N 273 
LYS HG3    H  N N 274 
LYS HD2    H  N N 275 
LYS HD3    H  N N 276 
LYS HE2    H  N N 277 
LYS HE3    H  N N 278 
LYS HZ1    H  N N 279 
LYS HZ2    H  N N 280 
LYS HZ3    H  N N 281 
LYS HXT    H  N N 282 
MET N      N  N N 283 
MET CA     C  N S 284 
MET C      C  N N 285 
MET O      O  N N 286 
MET CB     C  N N 287 
MET CG     C  N N 288 
MET SD     S  N N 289 
MET CE     C  N N 290 
MET OXT    O  N N 291 
MET H      H  N N 292 
MET H2     H  N N 293 
MET HA     H  N N 294 
MET HB2    H  N N 295 
MET HB3    H  N N 296 
MET HG2    H  N N 297 
MET HG3    H  N N 298 
MET HE1    H  N N 299 
MET HE2    H  N N 300 
MET HE3    H  N N 301 
MET HXT    H  N N 302 
PHE N      N  N N 303 
PHE CA     C  N S 304 
PHE C      C  N N 305 
PHE O      O  N N 306 
PHE CB     C  N N 307 
PHE CG     C  Y N 308 
PHE CD1    C  Y N 309 
PHE CD2    C  Y N 310 
PHE CE1    C  Y N 311 
PHE CE2    C  Y N 312 
PHE CZ     C  Y N 313 
PHE OXT    O  N N 314 
PHE H      H  N N 315 
PHE H2     H  N N 316 
PHE HA     H  N N 317 
PHE HB2    H  N N 318 
PHE HB3    H  N N 319 
PHE HD1    H  N N 320 
PHE HD2    H  N N 321 
PHE HE1    H  N N 322 
PHE HE2    H  N N 323 
PHE HZ     H  N N 324 
PHE HXT    H  N N 325 
PRO N      N  N N 326 
PRO CA     C  N S 327 
PRO C      C  N N 328 
PRO O      O  N N 329 
PRO CB     C  N N 330 
PRO CG     C  N N 331 
PRO CD     C  N N 332 
PRO OXT    O  N N 333 
PRO H      H  N N 334 
PRO HA     H  N N 335 
PRO HB2    H  N N 336 
PRO HB3    H  N N 337 
PRO HG2    H  N N 338 
PRO HG3    H  N N 339 
PRO HD2    H  N N 340 
PRO HD3    H  N N 341 
PRO HXT    H  N N 342 
SER N      N  N N 343 
SER CA     C  N S 344 
SER C      C  N N 345 
SER O      O  N N 346 
SER CB     C  N N 347 
SER OG     O  N N 348 
SER OXT    O  N N 349 
SER H      H  N N 350 
SER H2     H  N N 351 
SER HA     H  N N 352 
SER HB2    H  N N 353 
SER HB3    H  N N 354 
SER HG     H  N N 355 
SER HXT    H  N N 356 
SF4 FE1    FE N N 357 
SF4 FE2    FE N N 358 
SF4 FE3    FE N N 359 
SF4 FE4    FE N N 360 
SF4 S1     S  N N 361 
SF4 S2     S  N N 362 
SF4 S3     S  N N 363 
SF4 S4     S  N N 364 
THR N      N  N N 365 
THR CA     C  N S 366 
THR C      C  N N 367 
THR O      O  N N 368 
THR CB     C  N R 369 
THR OG1    O  N N 370 
THR CG2    C  N N 371 
THR OXT    O  N N 372 
THR H      H  N N 373 
THR H2     H  N N 374 
THR HA     H  N N 375 
THR HB     H  N N 376 
THR HG1    H  N N 377 
THR HG21   H  N N 378 
THR HG22   H  N N 379 
THR HG23   H  N N 380 
THR HXT    H  N N 381 
TRP N      N  N N 382 
TRP CA     C  N S 383 
TRP C      C  N N 384 
TRP O      O  N N 385 
TRP CB     C  N N 386 
TRP CG     C  Y N 387 
TRP CD1    C  Y N 388 
TRP CD2    C  Y N 389 
TRP NE1    N  Y N 390 
TRP CE2    C  Y N 391 
TRP CE3    C  Y N 392 
TRP CZ2    C  Y N 393 
TRP CZ3    C  Y N 394 
TRP CH2    C  Y N 395 
TRP OXT    O  N N 396 
TRP H      H  N N 397 
TRP H2     H  N N 398 
TRP HA     H  N N 399 
TRP HB2    H  N N 400 
TRP HB3    H  N N 401 
TRP HD1    H  N N 402 
TRP HE1    H  N N 403 
TRP HE3    H  N N 404 
TRP HZ2    H  N N 405 
TRP HZ3    H  N N 406 
TRP HH2    H  N N 407 
TRP HXT    H  N N 408 
TYR N      N  N N 409 
TYR CA     C  N S 410 
TYR C      C  N N 411 
TYR O      O  N N 412 
TYR CB     C  N N 413 
TYR CG     C  Y N 414 
TYR CD1    C  Y N 415 
TYR CD2    C  Y N 416 
TYR CE1    C  Y N 417 
TYR CE2    C  Y N 418 
TYR CZ     C  Y N 419 
TYR OH     O  N N 420 
TYR OXT    O  N N 421 
TYR H      H  N N 422 
TYR H2     H  N N 423 
TYR HA     H  N N 424 
TYR HB2    H  N N 425 
TYR HB3    H  N N 426 
TYR HD1    H  N N 427 
TYR HD2    H  N N 428 
TYR HE1    H  N N 429 
TYR HE2    H  N N 430 
TYR HH     H  N N 431 
TYR HXT    H  N N 432 
VAL N      N  N N 433 
VAL CA     C  N S 434 
VAL C      C  N N 435 
VAL O      O  N N 436 
VAL CB     C  N N 437 
VAL CG1    C  N N 438 
VAL CG2    C  N N 439 
VAL OXT    O  N N 440 
VAL H      H  N N 441 
VAL H2     H  N N 442 
VAL HA     H  N N 443 
VAL HB     H  N N 444 
VAL HG11   H  N N 445 
VAL HG12   H  N N 446 
VAL HG13   H  N N 447 
VAL HG21   H  N N 448 
VAL HG22   H  N N 449 
VAL HG23   H  N N 450 
VAL HXT    H  N N 451 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N     CA     sing N N 1   
ALA N     H      sing N N 2   
ALA N     H2     sing N N 3   
ALA CA    C      sing N N 4   
ALA CA    CB     sing N N 5   
ALA CA    HA     sing N N 6   
ALA C     O      doub N N 7   
ALA C     OXT    sing N N 8   
ALA CB    HB1    sing N N 9   
ALA CB    HB2    sing N N 10  
ALA CB    HB3    sing N N 11  
ALA OXT   HXT    sing N N 12  
ARG N     CA     sing N N 13  
ARG N     H      sing N N 14  
ARG N     H2     sing N N 15  
ARG CA    C      sing N N 16  
ARG CA    CB     sing N N 17  
ARG CA    HA     sing N N 18  
ARG C     O      doub N N 19  
ARG C     OXT    sing N N 20  
ARG CB    CG     sing N N 21  
ARG CB    HB2    sing N N 22  
ARG CB    HB3    sing N N 23  
ARG CG    CD     sing N N 24  
ARG CG    HG2    sing N N 25  
ARG CG    HG3    sing N N 26  
ARG CD    NE     sing N N 27  
ARG CD    HD2    sing N N 28  
ARG CD    HD3    sing N N 29  
ARG NE    CZ     sing N N 30  
ARG NE    HE     sing N N 31  
ARG CZ    NH1    sing N N 32  
ARG CZ    NH2    doub N N 33  
ARG NH1   HH11   sing N N 34  
ARG NH1   HH12   sing N N 35  
ARG NH2   HH21   sing N N 36  
ARG NH2   HH22   sing N N 37  
ARG OXT   HXT    sing N N 38  
ASN N     CA     sing N N 39  
ASN N     H      sing N N 40  
ASN N     H2     sing N N 41  
ASN CA    C      sing N N 42  
ASN CA    CB     sing N N 43  
ASN CA    HA     sing N N 44  
ASN C     O      doub N N 45  
ASN C     OXT    sing N N 46  
ASN CB    CG     sing N N 47  
ASN CB    HB2    sing N N 48  
ASN CB    HB3    sing N N 49  
ASN CG    OD1    doub N N 50  
ASN CG    ND2    sing N N 51  
ASN ND2   HD21   sing N N 52  
ASN ND2   HD22   sing N N 53  
ASN OXT   HXT    sing N N 54  
ASP N     CA     sing N N 55  
ASP N     H      sing N N 56  
ASP N     H2     sing N N 57  
ASP CA    C      sing N N 58  
ASP CA    CB     sing N N 59  
ASP CA    HA     sing N N 60  
ASP C     O      doub N N 61  
ASP C     OXT    sing N N 62  
ASP CB    CG     sing N N 63  
ASP CB    HB2    sing N N 64  
ASP CB    HB3    sing N N 65  
ASP CG    OD1    doub N N 66  
ASP CG    OD2    sing N N 67  
ASP OD2   HD2    sing N N 68  
ASP OXT   HXT    sing N N 69  
CYS N     CA     sing N N 70  
CYS N     H      sing N N 71  
CYS N     H2     sing N N 72  
CYS CA    C      sing N N 73  
CYS CA    CB     sing N N 74  
CYS CA    HA     sing N N 75  
CYS C     O      doub N N 76  
CYS C     OXT    sing N N 77  
CYS CB    SG     sing N N 78  
CYS CB    HB2    sing N N 79  
CYS CB    HB3    sing N N 80  
CYS SG    HG     sing N N 81  
CYS OXT   HXT    sing N N 82  
FES FE1   S1     sing N N 83  
FES FE1   S2     sing N N 84  
FES FE2   S1     sing N N 85  
FES FE2   S2     sing N N 86  
FMN N1    C2     sing N N 87  
FMN N1    C10    doub N N 88  
FMN C2    O2     doub N N 89  
FMN C2    N3     sing N N 90  
FMN N3    C4     sing N N 91  
FMN N3    HN3    sing N N 92  
FMN C4    O4     doub N N 93  
FMN C4    C4A    sing N N 94  
FMN C4A   N5     doub N N 95  
FMN C4A   C10    sing N N 96  
FMN N5    C5A    sing N N 97  
FMN C5A   C6     doub Y N 98  
FMN C5A   C9A    sing Y N 99  
FMN C6    C7     sing Y N 100 
FMN C6    H6     sing N N 101 
FMN C7    C7M    sing N N 102 
FMN C7    C8     doub Y N 103 
FMN C7M   HM71   sing N N 104 
FMN C7M   HM72   sing N N 105 
FMN C7M   HM73   sing N N 106 
FMN C8    C8M    sing N N 107 
FMN C8    C9     sing Y N 108 
FMN C8M   HM81   sing N N 109 
FMN C8M   HM82   sing N N 110 
FMN C8M   HM83   sing N N 111 
FMN C9    C9A    doub Y N 112 
FMN C9    H9     sing N N 113 
FMN C9A   N10    sing N N 114 
FMN N10   C10    sing N N 115 
FMN N10   "C1'"  sing N N 116 
FMN "C1'" "C2'"  sing N N 117 
FMN "C1'" "H1'1" sing N N 118 
FMN "C1'" "H1'2" sing N N 119 
FMN "C2'" "O2'"  sing N N 120 
FMN "C2'" "C3'"  sing N N 121 
FMN "C2'" "H2'"  sing N N 122 
FMN "O2'" "HO2'" sing N N 123 
FMN "C3'" "O3'"  sing N N 124 
FMN "C3'" "C4'"  sing N N 125 
FMN "C3'" "H3'"  sing N N 126 
FMN "O3'" "HO3'" sing N N 127 
FMN "C4'" "O4'"  sing N N 128 
FMN "C4'" "C5'"  sing N N 129 
FMN "C4'" "H4'"  sing N N 130 
FMN "O4'" "HO4'" sing N N 131 
FMN "C5'" "O5'"  sing N N 132 
FMN "C5'" "H5'1" sing N N 133 
FMN "C5'" "H5'2" sing N N 134 
FMN "O5'" P      sing N N 135 
FMN P     O1P    doub N N 136 
FMN P     O2P    sing N N 137 
FMN P     O3P    sing N N 138 
FMN O2P   HOP2   sing N N 139 
FMN O3P   HOP3   sing N N 140 
GLN N     CA     sing N N 141 
GLN N     H      sing N N 142 
GLN N     H2     sing N N 143 
GLN CA    C      sing N N 144 
GLN CA    CB     sing N N 145 
GLN CA    HA     sing N N 146 
GLN C     O      doub N N 147 
GLN C     OXT    sing N N 148 
GLN CB    CG     sing N N 149 
GLN CB    HB2    sing N N 150 
GLN CB    HB3    sing N N 151 
GLN CG    CD     sing N N 152 
GLN CG    HG2    sing N N 153 
GLN CG    HG3    sing N N 154 
GLN CD    OE1    doub N N 155 
GLN CD    NE2    sing N N 156 
GLN NE2   HE21   sing N N 157 
GLN NE2   HE22   sing N N 158 
GLN OXT   HXT    sing N N 159 
GLU N     CA     sing N N 160 
GLU N     H      sing N N 161 
GLU N     H2     sing N N 162 
GLU CA    C      sing N N 163 
GLU CA    CB     sing N N 164 
GLU CA    HA     sing N N 165 
GLU C     O      doub N N 166 
GLU C     OXT    sing N N 167 
GLU CB    CG     sing N N 168 
GLU CB    HB2    sing N N 169 
GLU CB    HB3    sing N N 170 
GLU CG    CD     sing N N 171 
GLU CG    HG2    sing N N 172 
GLU CG    HG3    sing N N 173 
GLU CD    OE1    doub N N 174 
GLU CD    OE2    sing N N 175 
GLU OE2   HE2    sing N N 176 
GLU OXT   HXT    sing N N 177 
GLY N     CA     sing N N 178 
GLY N     H      sing N N 179 
GLY N     H2     sing N N 180 
GLY CA    C      sing N N 181 
GLY CA    HA2    sing N N 182 
GLY CA    HA3    sing N N 183 
GLY C     O      doub N N 184 
GLY C     OXT    sing N N 185 
GLY OXT   HXT    sing N N 186 
HIS N     CA     sing N N 187 
HIS N     H      sing N N 188 
HIS N     H2     sing N N 189 
HIS CA    C      sing N N 190 
HIS CA    CB     sing N N 191 
HIS CA    HA     sing N N 192 
HIS C     O      doub N N 193 
HIS C     OXT    sing N N 194 
HIS CB    CG     sing N N 195 
HIS CB    HB2    sing N N 196 
HIS CB    HB3    sing N N 197 
HIS CG    ND1    sing Y N 198 
HIS CG    CD2    doub Y N 199 
HIS ND1   CE1    doub Y N 200 
HIS ND1   HD1    sing N N 201 
HIS CD2   NE2    sing Y N 202 
HIS CD2   HD2    sing N N 203 
HIS CE1   NE2    sing Y N 204 
HIS CE1   HE1    sing N N 205 
HIS NE2   HE2    sing N N 206 
HIS OXT   HXT    sing N N 207 
ILE N     CA     sing N N 208 
ILE N     H      sing N N 209 
ILE N     H2     sing N N 210 
ILE CA    C      sing N N 211 
ILE CA    CB     sing N N 212 
ILE CA    HA     sing N N 213 
ILE C     O      doub N N 214 
ILE C     OXT    sing N N 215 
ILE CB    CG1    sing N N 216 
ILE CB    CG2    sing N N 217 
ILE CB    HB     sing N N 218 
ILE CG1   CD1    sing N N 219 
ILE CG1   HG12   sing N N 220 
ILE CG1   HG13   sing N N 221 
ILE CG2   HG21   sing N N 222 
ILE CG2   HG22   sing N N 223 
ILE CG2   HG23   sing N N 224 
ILE CD1   HD11   sing N N 225 
ILE CD1   HD12   sing N N 226 
ILE CD1   HD13   sing N N 227 
ILE OXT   HXT    sing N N 228 
LEU N     CA     sing N N 229 
LEU N     H      sing N N 230 
LEU N     H2     sing N N 231 
LEU CA    C      sing N N 232 
LEU CA    CB     sing N N 233 
LEU CA    HA     sing N N 234 
LEU C     O      doub N N 235 
LEU C     OXT    sing N N 236 
LEU CB    CG     sing N N 237 
LEU CB    HB2    sing N N 238 
LEU CB    HB3    sing N N 239 
LEU CG    CD1    sing N N 240 
LEU CG    CD2    sing N N 241 
LEU CG    HG     sing N N 242 
LEU CD1   HD11   sing N N 243 
LEU CD1   HD12   sing N N 244 
LEU CD1   HD13   sing N N 245 
LEU CD2   HD21   sing N N 246 
LEU CD2   HD22   sing N N 247 
LEU CD2   HD23   sing N N 248 
LEU OXT   HXT    sing N N 249 
LYS N     CA     sing N N 250 
LYS N     H      sing N N 251 
LYS N     H2     sing N N 252 
LYS CA    C      sing N N 253 
LYS CA    CB     sing N N 254 
LYS CA    HA     sing N N 255 
LYS C     O      doub N N 256 
LYS C     OXT    sing N N 257 
LYS CB    CG     sing N N 258 
LYS CB    HB2    sing N N 259 
LYS CB    HB3    sing N N 260 
LYS CG    CD     sing N N 261 
LYS CG    HG2    sing N N 262 
LYS CG    HG3    sing N N 263 
LYS CD    CE     sing N N 264 
LYS CD    HD2    sing N N 265 
LYS CD    HD3    sing N N 266 
LYS CE    NZ     sing N N 267 
LYS CE    HE2    sing N N 268 
LYS CE    HE3    sing N N 269 
LYS NZ    HZ1    sing N N 270 
LYS NZ    HZ2    sing N N 271 
LYS NZ    HZ3    sing N N 272 
LYS OXT   HXT    sing N N 273 
MET N     CA     sing N N 274 
MET N     H      sing N N 275 
MET N     H2     sing N N 276 
MET CA    C      sing N N 277 
MET CA    CB     sing N N 278 
MET CA    HA     sing N N 279 
MET C     O      doub N N 280 
MET C     OXT    sing N N 281 
MET CB    CG     sing N N 282 
MET CB    HB2    sing N N 283 
MET CB    HB3    sing N N 284 
MET CG    SD     sing N N 285 
MET CG    HG2    sing N N 286 
MET CG    HG3    sing N N 287 
MET SD    CE     sing N N 288 
MET CE    HE1    sing N N 289 
MET CE    HE2    sing N N 290 
MET CE    HE3    sing N N 291 
MET OXT   HXT    sing N N 292 
PHE N     CA     sing N N 293 
PHE N     H      sing N N 294 
PHE N     H2     sing N N 295 
PHE CA    C      sing N N 296 
PHE CA    CB     sing N N 297 
PHE CA    HA     sing N N 298 
PHE C     O      doub N N 299 
PHE C     OXT    sing N N 300 
PHE CB    CG     sing N N 301 
PHE CB    HB2    sing N N 302 
PHE CB    HB3    sing N N 303 
PHE CG    CD1    doub Y N 304 
PHE CG    CD2    sing Y N 305 
PHE CD1   CE1    sing Y N 306 
PHE CD1   HD1    sing N N 307 
PHE CD2   CE2    doub Y N 308 
PHE CD2   HD2    sing N N 309 
PHE CE1   CZ     doub Y N 310 
PHE CE1   HE1    sing N N 311 
PHE CE2   CZ     sing Y N 312 
PHE CE2   HE2    sing N N 313 
PHE CZ    HZ     sing N N 314 
PHE OXT   HXT    sing N N 315 
PRO N     CA     sing N N 316 
PRO N     CD     sing N N 317 
PRO N     H      sing N N 318 
PRO CA    C      sing N N 319 
PRO CA    CB     sing N N 320 
PRO CA    HA     sing N N 321 
PRO C     O      doub N N 322 
PRO C     OXT    sing N N 323 
PRO CB    CG     sing N N 324 
PRO CB    HB2    sing N N 325 
PRO CB    HB3    sing N N 326 
PRO CG    CD     sing N N 327 
PRO CG    HG2    sing N N 328 
PRO CG    HG3    sing N N 329 
PRO CD    HD2    sing N N 330 
PRO CD    HD3    sing N N 331 
PRO OXT   HXT    sing N N 332 
SER N     CA     sing N N 333 
SER N     H      sing N N 334 
SER N     H2     sing N N 335 
SER CA    C      sing N N 336 
SER CA    CB     sing N N 337 
SER CA    HA     sing N N 338 
SER C     O      doub N N 339 
SER C     OXT    sing N N 340 
SER CB    OG     sing N N 341 
SER CB    HB2    sing N N 342 
SER CB    HB3    sing N N 343 
SER OG    HG     sing N N 344 
SER OXT   HXT    sing N N 345 
SF4 FE1   S2     sing N N 346 
SF4 FE1   S3     sing N N 347 
SF4 FE1   S4     sing N N 348 
SF4 FE2   S1     sing N N 349 
SF4 FE2   S3     sing N N 350 
SF4 FE2   S4     sing N N 351 
SF4 FE3   S1     sing N N 352 
SF4 FE3   S2     sing N N 353 
SF4 FE3   S4     sing N N 354 
SF4 FE4   S1     sing N N 355 
SF4 FE4   S2     sing N N 356 
SF4 FE4   S3     sing N N 357 
THR N     CA     sing N N 358 
THR N     H      sing N N 359 
THR N     H2     sing N N 360 
THR CA    C      sing N N 361 
THR CA    CB     sing N N 362 
THR CA    HA     sing N N 363 
THR C     O      doub N N 364 
THR C     OXT    sing N N 365 
THR CB    OG1    sing N N 366 
THR CB    CG2    sing N N 367 
THR CB    HB     sing N N 368 
THR OG1   HG1    sing N N 369 
THR CG2   HG21   sing N N 370 
THR CG2   HG22   sing N N 371 
THR CG2   HG23   sing N N 372 
THR OXT   HXT    sing N N 373 
TRP N     CA     sing N N 374 
TRP N     H      sing N N 375 
TRP N     H2     sing N N 376 
TRP CA    C      sing N N 377 
TRP CA    CB     sing N N 378 
TRP CA    HA     sing N N 379 
TRP C     O      doub N N 380 
TRP C     OXT    sing N N 381 
TRP CB    CG     sing N N 382 
TRP CB    HB2    sing N N 383 
TRP CB    HB3    sing N N 384 
TRP CG    CD1    doub Y N 385 
TRP CG    CD2    sing Y N 386 
TRP CD1   NE1    sing Y N 387 
TRP CD1   HD1    sing N N 388 
TRP CD2   CE2    doub Y N 389 
TRP CD2   CE3    sing Y N 390 
TRP NE1   CE2    sing Y N 391 
TRP NE1   HE1    sing N N 392 
TRP CE2   CZ2    sing Y N 393 
TRP CE3   CZ3    doub Y N 394 
TRP CE3   HE3    sing N N 395 
TRP CZ2   CH2    doub Y N 396 
TRP CZ2   HZ2    sing N N 397 
TRP CZ3   CH2    sing Y N 398 
TRP CZ3   HZ3    sing N N 399 
TRP CH2   HH2    sing N N 400 
TRP OXT   HXT    sing N N 401 
TYR N     CA     sing N N 402 
TYR N     H      sing N N 403 
TYR N     H2     sing N N 404 
TYR CA    C      sing N N 405 
TYR CA    CB     sing N N 406 
TYR CA    HA     sing N N 407 
TYR C     O      doub N N 408 
TYR C     OXT    sing N N 409 
TYR CB    CG     sing N N 410 
TYR CB    HB2    sing N N 411 
TYR CB    HB3    sing N N 412 
TYR CG    CD1    doub Y N 413 
TYR CG    CD2    sing Y N 414 
TYR CD1   CE1    sing Y N 415 
TYR CD1   HD1    sing N N 416 
TYR CD2   CE2    doub Y N 417 
TYR CD2   HD2    sing N N 418 
TYR CE1   CZ     doub Y N 419 
TYR CE1   HE1    sing N N 420 
TYR CE2   CZ     sing Y N 421 
TYR CE2   HE2    sing N N 422 
TYR CZ    OH     sing N N 423 
TYR OH    HH     sing N N 424 
TYR OXT   HXT    sing N N 425 
VAL N     CA     sing N N 426 
VAL N     H      sing N N 427 
VAL N     H2     sing N N 428 
VAL CA    C      sing N N 429 
VAL CA    CB     sing N N 430 
VAL CA    HA     sing N N 431 
VAL C     O      doub N N 432 
VAL C     OXT    sing N N 433 
VAL CB    CG1    sing N N 434 
VAL CB    CG2    sing N N 435 
VAL CB    HB     sing N N 436 
VAL CG1   HG11   sing N N 437 
VAL CG1   HG12   sing N N 438 
VAL CG1   HG13   sing N N 439 
VAL CG2   HG21   sing N N 440 
VAL CG2   HG22   sing N N 441 
VAL CG2   HG23   sing N N 442 
VAL OXT   HXT    sing N N 443 
# 
_pdbx_audit_support.funding_organization   'Medical Research Council (MRC, United Kingdom)' 
_pdbx_audit_support.country                'United Kingdom' 
_pdbx_audit_support.grant_number           MC_U105674180 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   4HEA 
_pdbx_initial_refinement_model.details          ? 
# 
_pdbx_reflns_twin.domain_id                    1 
_pdbx_reflns_twin.crystal_id                   1 
_pdbx_reflns_twin.diffrn_id                    1 
_pdbx_reflns_twin.fraction                     0.490 
_pdbx_reflns_twin.operator                     -h,-k,h+l 
_pdbx_reflns_twin.type                         ? 
_pdbx_reflns_twin.mean_F_square_over_mean_F2   ? 
_pdbx_reflns_twin.mean_I2_over_mean_I_square   ? 
# 
_atom_sites.entry_id                    6Y11 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.010386 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001938 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.002933 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003864 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . THR A  1  2   ? -17.246  0.701    150.834  1.00 214.89 ? 2   THR 1 N     1 
ATOM   2     C  CA    . THR A  1  2   ? -17.053  1.141    149.458  1.00 216.43 ? 2   THR 1 CA    1 
ATOM   3     C  C     . THR A  1  2   ? -18.195  0.618    148.581  1.00 235.62 ? 2   THR 1 C     1 
ATOM   4     O  O     . THR A  1  2   ? -18.784  -0.420   148.881  1.00 234.57 ? 2   THR 1 O     1 
ATOM   5     C  CB    . THR A  1  2   ? -15.694  0.650    148.904  1.00 201.29 ? 2   THR 1 CB    1 
ATOM   6     O  OG1   . THR A  1  2   ? -14.680  0.802    149.905  1.00 194.98 ? 2   THR 1 OG1   1 
ATOM   7     C  CG2   . THR A  1  2   ? -15.284  1.453    147.685  1.00 196.95 ? 2   THR 1 CG2   1 
ATOM   8     N  N     . GLY A  1  3   ? -18.498  1.328    147.495  1.00 256.72 ? 3   GLY 1 N     1 
ATOM   9     C  CA    . GLY A  1  3   ? -19.461  0.853    146.527  1.00 275.25 ? 3   GLY 1 CA    1 
ATOM   10    C  C     . GLY A  1  3   ? -19.007  -0.468   145.941  1.00 292.89 ? 3   GLY 1 C     1 
ATOM   11    O  O     . GLY A  1  3   ? -17.842  -0.620   145.555  1.00 296.43 ? 3   GLY 1 O     1 
ATOM   12    N  N     . PRO A  1  4   ? -19.910  -1.463   145.880  1.00 306.59 ? 4   PRO 1 N     1 
ATOM   13    C  CA    . PRO A  1  4   ? -19.463  -2.841   145.637  1.00 312.26 ? 4   PRO 1 CA    1 
ATOM   14    C  C     . PRO A  1  4   ? -18.974  -3.081   144.214  1.00 312.34 ? 4   PRO 1 C     1 
ATOM   15    O  O     . PRO A  1  4   ? -19.788  -3.299   143.310  1.00 315.79 ? 4   PRO 1 O     1 
ATOM   16    C  CB    . PRO A  1  4   ? -20.726  -3.669   145.943  1.00 315.18 ? 4   PRO 1 CB    1 
ATOM   17    C  CG    . PRO A  1  4   ? -21.552  -2.780   146.831  1.00 313.98 ? 4   PRO 1 CG    1 
ATOM   18    C  CD    . PRO A  1  4   ? -21.328  -1.412   146.263  1.00 311.31 ? 4   PRO 1 CD    1 
ATOM   19    N  N     . ILE A  1  5   ? -17.648  -3.081   144.035  1.00 303.96 ? 5   ILE 1 N     1 
ATOM   20    C  CA    . ILE A  1  5   ? -16.922  -3.609   142.879  1.00 293.15 ? 5   ILE 1 CA    1 
ATOM   21    C  C     . ILE A  1  5   ? -15.477  -3.815   143.331  1.00 277.45 ? 5   ILE 1 C     1 
ATOM   22    O  O     . ILE A  1  5   ? -14.879  -2.924   143.946  1.00 279.28 ? 5   ILE 1 O     1 
ATOM   23    C  CB    . ILE A  1  5   ? -16.996  -2.680   141.650  1.00 298.04 ? 5   ILE 1 CB    1 
ATOM   24    C  CG1   . ILE A  1  5   ? -18.235  -2.983   140.797  1.00 303.22 ? 5   ILE 1 CG1   1 
ATOM   25    C  CG2   . ILE A  1  5   ? -15.764  -2.796   140.786  1.00 298.63 ? 5   ILE 1 CG2   1 
ATOM   26    C  CD1   . ILE A  1  5   ? -18.518  -1.936   139.723  1.00 307.07 ? 5   ILE 1 CD1   1 
ATOM   27    N  N     . LEU A  1  6   ? -14.912  -4.993   143.057  1.00 262.92 ? 6   LEU 1 N     1 
ATOM   28    C  CA    . LEU A  1  6   ? -13.527  -5.290   143.414  1.00 249.86 ? 6   LEU 1 CA    1 
ATOM   29    C  C     . LEU A  1  6   ? -12.622  -4.991   142.216  1.00 236.99 ? 6   LEU 1 C     1 
ATOM   30    O  O     . LEU A  1  6   ? -12.693  -5.666   141.181  1.00 234.25 ? 6   LEU 1 O     1 
ATOM   31    C  CB    . LEU A  1  6   ? -13.398  -6.739   143.880  1.00 250.02 ? 6   LEU 1 CB    1 
ATOM   32    C  CG    . LEU A  1  6   ? -14.079  -7.079   145.218  1.00 251.16 ? 6   LEU 1 CG    1 
ATOM   33    C  CD1   . LEU A  1  6   ? -14.032  -8.574   145.545  1.00 252.03 ? 6   LEU 1 CD1   1 
ATOM   34    C  CD2   . LEU A  1  6   ? -13.478  -6.256   146.345  1.00 249.57 ? 6   LEU 1 CD2   1 
ATOM   35    N  N     . SER A  1  7   ? -11.769  -3.969   142.360  1.00 225.91 ? 7   SER 1 N     1 
ATOM   36    C  CA    . SER A  1  7   ? -10.847  -3.552   141.308  1.00 216.05 ? 7   SER 1 CA    1 
ATOM   37    C  C     . SER A  1  7   ? -9.407   -3.421   141.794  1.00 214.04 ? 7   SER 1 C     1 
ATOM   38    O  O     . SER A  1  7   ? -8.589   -2.804   141.099  1.00 213.54 ? 7   SER 1 O     1 
ATOM   39    C  CB    . SER A  1  7   ? -11.302  -2.221   140.689  1.00 207.20 ? 7   SER 1 CB    1 
ATOM   40    O  OG    . SER A  1  7   ? -12.647  -2.283   140.253  1.00 202.53 ? 7   SER 1 OG    1 
ATOM   41    N  N     . GLY A  1  8   ? -9.076   -3.973   142.958  1.00 210.52 ? 8   GLY 1 N     1 
ATOM   42    C  CA    . GLY A  1  8   ? -7.737   -3.815   143.497  1.00 199.36 ? 8   GLY 1 CA    1 
ATOM   43    C  C     . GLY A  1  8   ? -7.530   -4.398   144.878  1.00 189.47 ? 8   GLY 1 C     1 
ATOM   44    O  O     . GLY A  1  8   ? -7.924   -5.533   145.160  1.00 187.08 ? 8   GLY 1 O     1 
ATOM   45    N  N     . LEU A  1  9   ? -6.900   -3.616   145.751  1.00 184.54 ? 9   LEU 1 N     1 
ATOM   46    C  CA    . LEU A  1  9   ? -6.510   -4.053   147.082  1.00 171.79 ? 9   LEU 1 CA    1 
ATOM   47    C  C     . LEU A  1  9   ? -7.609   -3.836   148.124  1.00 168.30 ? 9   LEU 1 C     1 
ATOM   48    O  O     . LEU A  1  9   ? -7.308   -3.622   149.304  1.00 160.26 ? 9   LEU 1 O     1 
ATOM   49    C  CB    . LEU A  1  9   ? -5.206   -3.354   147.479  1.00 160.94 ? 9   LEU 1 CB    1 
ATOM   50    C  CG    . LEU A  1  9   ? -4.378   -3.949   148.615  1.00 152.03 ? 9   LEU 1 CG    1 
ATOM   51    C  CD1   . LEU A  1  9   ? -4.436   -5.469   148.577  1.00 147.19 ? 9   LEU 1 CD1   1 
ATOM   52    C  CD2   . LEU A  1  9   ? -2.938   -3.457   148.547  1.00 154.00 ? 9   LEU 1 CD2   1 
ATOM   53    N  N     . ASP A  1  10  ? -8.872   -3.823   147.712  1.00 172.40 ? 10  ASP 1 N     1 
ATOM   54    C  CA    . ASP A  1  10  ? -9.965   -3.718   148.671  1.00 169.94 ? 10  ASP 1 CA    1 
ATOM   55    C  C     . ASP A  1  10  ? -9.913   -4.900   149.643  1.00 168.57 ? 10  ASP 1 C     1 
ATOM   56    O  O     . ASP A  1  10  ? -9.674   -6.039   149.225  1.00 168.61 ? 10  ASP 1 O     1 
ATOM   57    C  CB    . ASP A  1  10  ? -11.309  -3.679   147.937  1.00 165.80 ? 10  ASP 1 CB    1 
ATOM   58    C  CG    . ASP A  1  10  ? -12.380  -2.908   148.699  1.00 163.40 ? 10  ASP 1 CG    1 
ATOM   59    O  OD1   . ASP A  1  10  ? -12.086  -1.792   149.172  1.00 162.15 ? 10  ASP 1 OD1   1 
ATOM   60    O  OD2   . ASP A  1  10  ? -13.515  -3.418   148.830  1.00 163.54 ? 10  ASP 1 OD2   1 
ATOM   61    N  N     . PRO A  1  11  ? -10.148  -4.671   150.941  1.00 167.55 ? 11  PRO 1 N     1 
ATOM   62    C  CA    . PRO A  1  11  ? -9.828   -5.698   151.950  1.00 168.01 ? 11  PRO 1 CA    1 
ATOM   63    C  C     . PRO A  1  11  ? -10.728  -6.928   151.947  1.00 168.51 ? 11  PRO 1 C     1 
ATOM   64    O  O     . PRO A  1  11  ? -10.390  -7.910   152.621  1.00 168.80 ? 11  PRO 1 O     1 
ATOM   65    C  CB    . PRO A  1  11  ? -9.943   -4.928   153.275  1.00 167.64 ? 11  PRO 1 CB    1 
ATOM   66    C  CG    . PRO A  1  11  ? -10.874  -3.796   152.975  1.00 166.28 ? 11  PRO 1 CG    1 
ATOM   67    C  CD    . PRO A  1  11  ? -10.631  -3.418   151.546  1.00 167.37 ? 11  PRO 1 CD    1 
ATOM   68    N  N     . ARG A  1  12  ? -11.831  -6.923   151.206  1.00 168.89 ? 12  ARG 1 N     1 
ATOM   69    C  CA    . ARG A  1  12  ? -12.784  -8.025   151.206  1.00 172.97 ? 12  ARG 1 CA    1 
ATOM   70    C  C     . ARG A  1  12  ? -12.449  -9.112   150.185  1.00 180.26 ? 12  ARG 1 C     1 
ATOM   71    O  O     . ARG A  1  12  ? -13.243  -10.043  150.003  1.00 178.30 ? 12  ARG 1 O     1 
ATOM   72    C  CB    . ARG A  1  12  ? -14.195  -7.475   150.979  1.00 165.28 ? 12  ARG 1 CB    1 
ATOM   73    C  CG    . ARG A  1  12  ? -14.197  -6.190   150.176  1.00 164.76 ? 12  ARG 1 CG    1 
ATOM   74    C  CD    . ARG A  1  12  ? -15.594  -5.658   149.929  1.00 167.86 ? 12  ARG 1 CD    1 
ATOM   75    N  NE    . ARG A  1  12  ? -15.588  -4.578   148.950  1.00 170.60 ? 12  ARG 1 NE    1 
ATOM   76    C  CZ    . ARG A  1  12  ? -16.677  -4.091   148.367  1.00 177.17 ? 12  ARG 1 CZ    1 
ATOM   77    N  NH1   . ARG A  1  12  ? -17.871  -4.586   148.656  1.00 178.79 ? 12  ARG 1 NH1   1 
ATOM   78    N  NH2   . ARG A  1  12  ? -16.570  -3.093   147.502  1.00 181.44 ? 12  ARG 1 NH2   1 
ATOM   79    N  N     . PHE A  1  13  ? -11.291  -9.028   149.536  1.00 185.81 ? 13  PHE 1 N     1 
ATOM   80    C  CA    . PHE A  1  13  ? -10.860  -10.066  148.605  1.00 188.89 ? 13  PHE 1 CA    1 
ATOM   81    C  C     . PHE A  1  13  ? -10.290  -11.274  149.349  1.00 187.56 ? 13  PHE 1 C     1 
ATOM   82    O  O     . PHE A  1  13  ? -9.552   -11.132  150.330  1.00 188.41 ? 13  PHE 1 O     1 
ATOM   83    C  CB    . PHE A  1  13  ? -9.818   -9.508   147.630  1.00 193.00 ? 13  PHE 1 CB    1 
ATOM   84    C  CG    . PHE A  1  13  ? -9.122   -10.565  146.810  1.00 195.20 ? 13  PHE 1 CG    1 
ATOM   85    C  CD1   . PHE A  1  13  ? -9.835   -11.354  145.925  1.00 195.96 ? 13  PHE 1 CD1   1 
ATOM   86    C  CD2   . PHE A  1  13  ? -7.757   -10.757  146.910  1.00 195.17 ? 13  PHE 1 CD2   1 
ATOM   87    C  CE1   . PHE A  1  13  ? -9.197   -12.329  145.174  1.00 195.75 ? 13  PHE 1 CE1   1 
ATOM   88    C  CE2   . PHE A  1  13  ? -7.119   -11.729  146.154  1.00 194.54 ? 13  PHE 1 CE2   1 
ATOM   89    C  CZ    . PHE A  1  13  ? -7.840   -12.512  145.288  1.00 194.18 ? 13  PHE 1 CZ    1 
ATOM   90    N  N     . GLU A  1  14  ? -10.650  -12.470  148.882  1.00 183.20 ? 14  GLU 1 N     1 
ATOM   91    C  CA    . GLU A  1  14  ? -10.228  -13.731  149.490  1.00 172.28 ? 14  GLU 1 CA    1 
ATOM   92    C  C     . GLU A  1  14  ? -9.259   -14.455  148.565  1.00 164.11 ? 14  GLU 1 C     1 
ATOM   93    O  O     . GLU A  1  14  ? -9.619   -14.807  147.436  1.00 157.95 ? 14  GLU 1 O     1 
ATOM   94    C  CB    . GLU A  1  14  ? -11.421  -14.644  149.785  1.00 159.50 ? 14  GLU 1 CB    1 
ATOM   95    C  CG    . GLU A  1  14  ? -12.190  -14.334  151.056  1.00 143.49 ? 14  GLU 1 CG    1 
ATOM   96    C  CD    . GLU A  1  14  ? -13.233  -15.389  151.370  1.00 121.53 ? 14  GLU 1 CD    1 
ATOM   97    O  OE1   . GLU A  1  14  ? -14.209  -15.517  150.605  1.00 114.25 ? 14  GLU 1 OE1   1 
ATOM   98    O  OE2   . GLU A  1  14  ? -13.068  -16.107  152.374  1.00 111.33 ? 14  GLU 1 OE2   1 
ATOM   99    N  N     . ARG A  1  15  ? -8.048   -14.707  149.056  1.00 157.04 ? 15  ARG 1 N     1 
ATOM   100   C  CA    . ARG A  1  15  ? -7.096   -15.535  148.326  1.00 142.29 ? 15  ARG 1 CA    1 
ATOM   101   C  C     . ARG A  1  15  ? -7.562   -16.987  148.342  1.00 131.69 ? 15  ARG 1 C     1 
ATOM   102   O  O     . ARG A  1  15  ? -7.728   -17.580  149.412  1.00 124.18 ? 15  ARG 1 O     1 
ATOM   103   C  CB    . ARG A  1  15  ? -5.699   -15.397  148.940  1.00 136.30 ? 15  ARG 1 CB    1 
ATOM   104   C  CG    . ARG A  1  15  ? -5.278   -13.957  149.318  1.00 127.64 ? 15  ARG 1 CG    1 
ATOM   105   C  CD    . ARG A  1  15  ? -4.650   -13.192  148.132  1.00 114.59 ? 15  ARG 1 CD    1 
ATOM   106   N  NE    . ARG A  1  15  ? -4.760   -11.739  148.266  1.00 110.63 ? 15  ARG 1 NE    1 
ATOM   107   C  CZ    . ARG A  1  15  ? -3.935   -10.854  147.709  1.00 104.60 ? 15  ARG 1 CZ    1 
ATOM   108   N  NH1   . ARG A  1  15  ? -2.906   -11.250  146.974  1.00 102.61 ? 15  ARG 1 NH1   1 
ATOM   109   N  NH2   . ARG A  1  15  ? -4.147   -9.558   147.890  1.00 98.04  ? 15  ARG 1 NH2   1 
ATOM   110   N  N     . THR A  1  16  ? -7.794   -17.551  147.160  1.00 132.25 ? 16  THR 1 N     1 
ATOM   111   C  CA    . THR A  1  16  ? -8.298   -18.915  147.045  1.00 139.81 ? 16  THR 1 CA    1 
ATOM   112   C  C     . THR A  1  16  ? -7.349   -19.847  146.310  1.00 143.50 ? 16  THR 1 C     1 
ATOM   113   O  O     . THR A  1  16  ? -7.049   -20.933  146.817  1.00 146.23 ? 16  THR 1 O     1 
ATOM   114   C  CB    . THR A  1  16  ? -9.680   -18.917  146.358  1.00 141.45 ? 16  THR 1 CB    1 
ATOM   115   O  OG1   . THR A  1  16  ? -10.544  -17.987  147.020  1.00 138.03 ? 16  THR 1 OG1   1 
ATOM   116   C  CG2   . THR A  1  16  ? -10.297  -20.311  146.401  1.00 144.13 ? 16  THR 1 CG2   1 
ATOM   117   N  N     . LEU A  1  17  ? -6.860   -19.446  145.135  1.00 135.76 ? 17  LEU 1 N     1 
ATOM   118   C  CA    . LEU A  1  17  ? -6.087   -20.344  144.280  1.00 127.62 ? 17  LEU 1 CA    1 
ATOM   119   C  C     . LEU A  1  17  ? -4.652   -20.526  144.777  1.00 115.93 ? 17  LEU 1 C     1 
ATOM   120   O  O     . LEU A  1  17  ? -4.245   -21.640  145.125  1.00 111.58 ? 17  LEU 1 O     1 
ATOM   121   C  CB    . LEU A  1  17  ? -6.097   -19.812  142.841  1.00 137.89 ? 17  LEU 1 CB    1 
ATOM   122   C  CG    . LEU A  1  17  ? -7.479   -19.593  142.216  1.00 148.06 ? 17  LEU 1 CG    1 
ATOM   123   C  CD1   . LEU A  1  17  ? -7.377   -19.217  140.739  1.00 150.67 ? 17  LEU 1 CD1   1 
ATOM   124   C  CD2   . LEU A  1  17  ? -8.369   -20.815  142.414  1.00 151.70 ? 17  LEU 1 CD2   1 
ATOM   125   N  N     . TYR A  1  18  ? -3.871   -19.440  144.819  1.00 114.46 ? 18  TYR 1 N     1 
ATOM   126   C  CA    . TYR A  1  18  ? -2.472   -19.483  145.250  1.00 122.35 ? 18  TYR 1 CA    1 
ATOM   127   C  C     . TYR A  1  18  ? -2.314   -19.488  146.775  1.00 138.20 ? 18  TYR 1 C     1 
ATOM   128   O  O     . TYR A  1  18  ? -1.177   -19.447  147.268  1.00 142.22 ? 18  TYR 1 O     1 
ATOM   129   C  CB    . TYR A  1  18  ? -1.683   -18.312  144.627  1.00 116.48 ? 18  TYR 1 CB    1 
ATOM   130   C  CG    . TYR A  1  18  ? -0.785   -18.700  143.445  1.00 122.84 ? 18  TYR 1 CG    1 
ATOM   131   C  CD1   . TYR A  1  18  ? -1.323   -19.092  142.231  1.00 119.42 ? 18  TYR 1 CD1   1 
ATOM   132   C  CD2   . TYR A  1  18  ? 0.602    -18.664  143.545  1.00 133.87 ? 18  TYR 1 CD2   1 
ATOM   133   C  CE1   . TYR A  1  18  ? -0.506   -19.455  141.159  1.00 117.10 ? 18  TYR 1 CE1   1 
ATOM   134   C  CE2   . TYR A  1  18  ? 1.423    -19.025  142.467  1.00 130.43 ? 18  TYR 1 CE2   1 
ATOM   135   C  CZ    . TYR A  1  18  ? 0.857    -19.420  141.278  1.00 118.53 ? 18  TYR 1 CZ    1 
ATOM   136   O  OH    . TYR A  1  18  ? 1.644    -19.781  140.204  1.00 109.64 ? 18  TYR 1 OH    1 
ATOM   137   N  N     . ALA A  1  19  ? -3.423   -19.569  147.521  1.00 136.86 ? 19  ALA 1 N     1 
ATOM   138   C  CA    . ALA A  1  19  ? -3.385   -19.499  148.980  1.00 129.08 ? 19  ALA 1 CA    1 
ATOM   139   C  C     . ALA A  1  19  ? -2.388   -20.492  149.573  1.00 131.53 ? 19  ALA 1 C     1 
ATOM   140   O  O     . ALA A  1  19  ? -1.481   -20.110  150.318  1.00 136.14 ? 19  ALA 1 O     1 
ATOM   141   C  CB    . ALA A  1  19  ? -4.788   -19.737  149.543  1.00 123.05 ? 19  ALA 1 CB    1 
ATOM   142   N  N     . HIS A  1  20  ? -2.536   -21.775  149.241  1.00 129.12 ? 20  HIS 1 N     1 
ATOM   143   C  CA    . HIS A  1  20  ? -1.655   -22.810  149.771  1.00 129.59 ? 20  HIS 1 CA    1 
ATOM   144   C  C     . HIS A  1  20  ? -0.356   -22.968  148.963  1.00 122.12 ? 20  HIS 1 C     1 
ATOM   145   O  O     . HIS A  1  20  ? 0.408    -23.902  149.234  1.00 120.13 ? 20  HIS 1 O     1 
ATOM   146   C  CB    . HIS A  1  20  ? -2.408   -24.152  149.842  1.00 133.66 ? 20  HIS 1 CB    1 
ATOM   147   C  CG    . HIS A  1  20  ? -3.692   -24.095  150.620  1.00 133.50 ? 20  HIS 1 CG    1 
ATOM   148   N  ND1   . HIS A  1  20  ? -4.842   -24.737  150.207  1.00 137.04 ? 20  HIS 1 ND1   1 
ATOM   149   C  CD2   . HIS A  1  20  ? -4.005   -23.482  151.787  1.00 134.56 ? 20  HIS 1 CD2   1 
ATOM   150   C  CE1   . HIS A  1  20  ? -5.809   -24.517  151.082  1.00 134.86 ? 20  HIS 1 CE1   1 
ATOM   151   N  NE2   . HIS A  1  20  ? -5.327   -23.757  152.049  1.00 137.11 ? 20  HIS 1 NE2   1 
ATOM   152   N  N     . VAL A  1  21  ? -0.074   -22.084  148.002  1.00 118.45 ? 21  VAL 1 N     1 
ATOM   153   C  CA    . VAL A  1  21  ? 1.152    -22.176  147.205  1.00 124.21 ? 21  VAL 1 CA    1 
ATOM   154   C  C     . VAL A  1  21  ? 2.334    -21.681  148.027  1.00 115.49 ? 21  VAL 1 C     1 
ATOM   155   O  O     . VAL A  1  21  ? 2.280    -20.606  148.635  1.00 111.84 ? 21  VAL 1 O     1 
ATOM   156   C  CB    . VAL A  1  21  ? 1.024    -21.374  145.899  1.00 132.97 ? 21  VAL 1 CB    1 
ATOM   157   C  CG1   . VAL A  1  21  ? 2.406    -21.116  145.279  1.00 132.52 ? 21  VAL 1 CG1   1 
ATOM   158   C  CG2   . VAL A  1  21  ? 0.133    -22.100  144.910  1.00 131.30 ? 21  VAL 1 CG2   1 
ATOM   159   N  N     . GLY A  1  22  ? 3.417    -22.457  148.031  1.00 119.83 ? 22  GLY 1 N     1 
ATOM   160   C  CA    . GLY A  1  22  ? 4.615    -22.123  148.749  1.00 136.44 ? 22  GLY 1 CA    1 
ATOM   161   C  C     . GLY A  1  22  ? 4.720    -22.789  150.105  1.00 147.16 ? 22  GLY 1 C     1 
ATOM   162   O  O     . GLY A  1  22  ? 5.832    -23.043  150.574  1.00 149.35 ? 22  GLY 1 O     1 
ATOM   163   N  N     . LYS A  1  23  ? 3.589    -23.089  150.737  1.00 149.72 ? 23  LYS 1 N     1 
ATOM   164   C  CA    . LYS A  1  23  ? 3.626    -23.732  152.041  1.00 143.83 ? 23  LYS 1 CA    1 
ATOM   165   C  C     . LYS A  1  23  ? 4.143    -25.154  151.899  1.00 143.44 ? 23  LYS 1 C     1 
ATOM   166   O  O     . LYS A  1  23  ? 3.679    -25.910  151.041  1.00 138.25 ? 23  LYS 1 O     1 
ATOM   167   C  CB    . LYS A  1  23  ? 2.243    -23.729  152.690  1.00 133.71 ? 23  LYS 1 CB    1 
ATOM   168   C  CG    . LYS A  1  23  ? 1.590    -22.363  152.786  1.00 123.38 ? 23  LYS 1 CG    1 
ATOM   169   C  CD    . LYS A  1  23  ? 2.522    -21.359  153.449  1.00 110.53 ? 23  LYS 1 CD    1 
ATOM   170   C  CE    . LYS A  1  23  ? 1.790    -20.113  153.922  1.00 100.12 ? 23  LYS 1 CE    1 
ATOM   171   N  NZ    . LYS A  1  23  ? 2.540    -19.395  154.988  1.00 92.47  ? 23  LYS 1 NZ    1 
ATOM   172   N  N     . GLU A  1  24  ? 5.135    -25.499  152.714  1.00 147.40 ? 24  GLU 1 N     1 
ATOM   173   C  CA    . GLU A  1  24  ? 5.749    -26.814  152.632  1.00 151.47 ? 24  GLU 1 CA    1 
ATOM   174   C  C     . GLU A  1  24  ? 4.712    -27.891  152.917  1.00 138.89 ? 24  GLU 1 C     1 
ATOM   175   O  O     . GLU A  1  24  ? 3.869    -27.744  153.804  1.00 142.20 ? 24  GLU 1 O     1 
ATOM   176   C  CB    . GLU A  1  24  ? 6.917    -26.911  153.614  1.00 167.11 ? 24  GLU 1 CB    1 
ATOM   177   C  CG    . GLU A  1  24  ? 7.725    -28.186  153.485  1.00 179.18 ? 24  GLU 1 CG    1 
ATOM   178   C  CD    . GLU A  1  24  ? 8.659    -28.404  154.654  1.00 189.44 ? 24  GLU 1 CD    1 
ATOM   179   O  OE1   . GLU A  1  24  ? 8.403    -27.838  155.737  1.00 193.92 ? 24  GLU 1 OE1   1 
ATOM   180   O  OE2   . GLU A  1  24  ? 9.642    -29.154  154.492  1.00 192.94 ? 24  GLU 1 OE2   1 
ATOM   181   N  N     . GLY A  1  25  ? 4.769    -28.976  152.152  1.00 120.96 ? 25  GLY 1 N     1 
ATOM   182   C  CA    . GLY A  1  25  ? 3.789    -30.025  152.323  1.00 107.61 ? 25  GLY 1 CA    1 
ATOM   183   C  C     . GLY A  1  25  ? 2.401    -29.668  151.844  1.00 98.80  ? 25  GLY 1 C     1 
ATOM   184   O  O     . GLY A  1  25  ? 1.430    -30.302  152.264  1.00 104.55 ? 25  GLY 1 O     1 
ATOM   185   N  N     . SER A  1  26  ? 2.277    -28.654  150.980  1.00 84.84  ? 26  SER 1 N     1 
ATOM   186   C  CA    . SER A  1  26  ? 0.973    -28.290  150.438  1.00 78.48  ? 26  SER 1 CA    1 
ATOM   187   C  C     . SER A  1  26  ? 0.436    -29.328  149.466  1.00 75.44  ? 26  SER 1 C     1 
ATOM   188   O  O     . SER A  1  26  ? -0.776   -29.361  149.231  1.00 75.00  ? 26  SER 1 O     1 
ATOM   189   C  CB    . SER A  1  26  ? 1.039    -26.936  149.740  1.00 74.96  ? 26  SER 1 CB    1 
ATOM   190   O  OG    . SER A  1  26  ? 2.209    -26.840  148.951  1.00 74.89  ? 26  SER 1 OG    1 
ATOM   191   N  N     . TRP A  1  27  ? 1.299    -30.193  148.932  1.00 74.60  ? 27  TRP 1 N     1 
ATOM   192   C  CA    . TRP A  1  27  ? 0.901    -31.215  147.977  1.00 85.88  ? 27  TRP 1 CA    1 
ATOM   193   C  C     . TRP A  1  27  ? 0.409    -32.475  148.661  1.00 89.58  ? 27  TRP 1 C     1 
ATOM   194   O  O     . TRP A  1  27  ? 0.042    -33.435  147.976  1.00 86.28  ? 27  TRP 1 O     1 
ATOM   195   C  CB    . TRP A  1  27  ? 2.068    -31.575  147.038  1.00 88.84  ? 27  TRP 1 CB    1 
ATOM   196   C  CG    . TRP A  1  27  ? 3.343    -32.038  147.743  1.00 93.45  ? 27  TRP 1 CG    1 
ATOM   197   C  CD1   . TRP A  1  27  ? 3.659    -33.311  148.122  1.00 85.85  ? 27  TRP 1 CD1   1 
ATOM   198   C  CD2   . TRP A  1  27  ? 4.460    -31.222  148.131  1.00 95.83  ? 27  TRP 1 CD2   1 
ATOM   199   N  NE1   . TRP A  1  27  ? 4.892    -33.334  148.732  1.00 74.07  ? 27  TRP 1 NE1   1 
ATOM   200   C  CE2   . TRP A  1  27  ? 5.403    -32.063  148.748  1.00 92.87  ? 27  TRP 1 CE2   1 
ATOM   201   C  CE3   . TRP A  1  27  ? 4.748    -29.860  148.025  1.00 92.63  ? 27  TRP 1 CE3   1 
ATOM   202   C  CZ2   . TRP A  1  27  ? 6.610    -31.587  149.252  1.00 90.62  ? 27  TRP 1 CZ2   1 
ATOM   203   C  CZ3   . TRP A  1  27  ? 5.950    -29.393  148.529  1.00 86.86  ? 27  TRP 1 CZ3   1 
ATOM   204   C  CH2   . TRP A  1  27  ? 6.862    -30.250  149.131  1.00 86.62  ? 27  TRP 1 CH2   1 
ATOM   205   N  N     . THR A  1  28  ? 0.387    -32.502  149.989  1.00 94.09  ? 28  THR 1 N     1 
ATOM   206   C  CA    . THR A  1  28  ? -0.157   -33.660  150.672  1.00 99.55  ? 28  THR 1 CA    1 
ATOM   207   C  C     . THR A  1  28  ? -1.679   -33.578  150.659  1.00 108.63 ? 28  THR 1 C     1 
ATOM   208   O  O     . THR A  1  28  ? -2.273   -32.525  150.933  1.00 109.91 ? 28  THR 1 O     1 
ATOM   209   C  CB    . THR A  1  28  ? 0.366    -33.770  152.107  1.00 96.57  ? 28  THR 1 CB    1 
ATOM   210   O  OG1   . THR A  1  28  ? 0.078    -32.576  152.837  1.00 90.12  ? 28  THR 1 OG1   1 
ATOM   211   C  CG2   . THR A  1  28  ? 1.870    -33.994  152.116  1.00 102.70 ? 28  THR 1 CG2   1 
ATOM   212   N  N     . LEU A  1  29  ? -2.296   -34.704  150.308  1.00 108.61 ? 29  LEU 1 N     1 
ATOM   213   C  CA    . LEU A  1  29  ? -3.746   -34.821  150.364  1.00 113.65 ? 29  LEU 1 CA    1 
ATOM   214   C  C     . LEU A  1  29  ? -4.275   -34.504  151.759  1.00 124.15 ? 29  LEU 1 C     1 
ATOM   215   O  O     . LEU A  1  29  ? -5.379   -33.972  151.895  1.00 123.36 ? 29  LEU 1 O     1 
ATOM   216   C  CB    . LEU A  1  29  ? -4.150   -36.222  149.904  1.00 117.13 ? 29  LEU 1 CB    1 
ATOM   217   C  CG    . LEU A  1  29  ? -5.613   -36.609  150.060  1.00 119.92 ? 29  LEU 1 CG    1 
ATOM   218   C  CD1   . LEU A  1  29  ? -6.496   -35.618  149.356  1.00 127.88 ? 29  LEU 1 CD1   1 
ATOM   219   C  CD2   . LEU A  1  29  ? -5.814   -37.992  149.481  1.00 112.14 ? 29  LEU 1 CD2   1 
ATOM   220   N  N     . ASP A  1  30  ? -3.489   -34.791  152.802  1.00 136.06 ? 30  ASP 1 N     1 
ATOM   221   C  CA    . ASP A  1  30  ? -3.931   -34.510  154.164  1.00 142.77 ? 30  ASP 1 CA    1 
ATOM   222   C  C     . ASP A  1  30  ? -3.991   -33.012  154.420  1.00 128.10 ? 30  ASP 1 C     1 
ATOM   223   O  O     . ASP A  1  30  ? -4.916   -32.525  155.075  1.00 126.60 ? 30  ASP 1 O     1 
ATOM   224   C  CB    . ASP A  1  30  ? -3.016   -35.196  155.172  1.00 152.16 ? 30  ASP 1 CB    1 
ATOM   225   C  CG    . ASP A  1  30  ? -2.961   -36.689  154.976  1.00 153.22 ? 30  ASP 1 CG    1 
ATOM   226   O  OD1   . ASP A  1  30  ? -2.384   -37.150  153.973  1.00 153.45 ? 30  ASP 1 OD1   1 
ATOM   227   O  OD2   . ASP A  1  30  ? -3.498   -37.409  155.838  1.00 155.70 ? 30  ASP 1 OD2   1 
ATOM   228   N  N     . TYR A  1  31  ? -3.006   -32.274  153.919  1.00 118.44 ? 31  TYR 1 N     1 
ATOM   229   C  CA    . TYR A  1  31  ? -3.077   -30.820  153.936  1.00 111.38 ? 31  TYR 1 CA    1 
ATOM   230   C  C     . TYR A  1  31  ? -4.318   -30.329  153.204  1.00 100.84 ? 31  TYR 1 C     1 
ATOM   231   O  O     . TYR A  1  31  ? -5.098   -29.517  153.730  1.00 109.42 ? 31  TYR 1 O     1 
ATOM   232   C  CB    . TYR A  1  31  ? -1.811   -30.251  153.294  1.00 110.30 ? 31  TYR 1 CB    1 
ATOM   233   C  CG    . TYR A  1  31  ? -1.741   -28.754  153.259  1.00 105.77 ? 31  TYR 1 CG    1 
ATOM   234   C  CD1   . TYR A  1  31  ? -2.429   -28.031  152.307  1.00 101.81 ? 31  TYR 1 CD1   1 
ATOM   235   C  CD2   . TYR A  1  31  ? -1.003   -28.062  154.190  1.00 105.83 ? 31  TYR 1 CD2   1 
ATOM   236   C  CE1   . TYR A  1  31  ? -2.374   -26.665  152.279  1.00 96.07  ? 31  TYR 1 CE1   1 
ATOM   237   C  CE2   . TYR A  1  31  ? -0.946   -26.693  154.167  1.00 109.13 ? 31  TYR 1 CE2   1 
ATOM   238   C  CZ    . TYR A  1  31  ? -1.630   -26.000  153.213  1.00 93.15  ? 31  TYR 1 CZ    1 
ATOM   239   O  OH    . TYR A  1  31  ? -1.562   -24.630  153.202  1.00 74.61  ? 31  TYR 1 OH    1 
ATOM   240   N  N     . TYR A  1  32  ? -4.508   -30.812  151.976  1.00 81.58  ? 32  TYR 1 N     1 
ATOM   241   C  CA    . TYR A  1  32  ? -5.636   -30.361  151.170  1.00 96.98  ? 32  TYR 1 CA    1 
ATOM   242   C  C     . TYR A  1  32  ? -6.963   -30.610  151.884  1.00 112.31 ? 32  TYR 1 C     1 
ATOM   243   O  O     . TYR A  1  32  ? -7.869   -29.772  151.831  1.00 122.02 ? 32  TYR 1 O     1 
ATOM   244   C  CB    . TYR A  1  32  ? -5.599   -31.056  149.807  1.00 99.04  ? 32  TYR 1 CB    1 
ATOM   245   C  CG    . TYR A  1  32  ? -6.589   -30.501  148.814  1.00 102.67 ? 32  TYR 1 CG    1 
ATOM   246   C  CD1   . TYR A  1  32  ? -6.471   -29.211  148.332  1.00 108.71 ? 32  TYR 1 CD1   1 
ATOM   247   C  CD2   . TYR A  1  32  ? -7.645   -31.269  148.359  1.00 105.24 ? 32  TYR 1 CD2   1 
ATOM   248   C  CE1   . TYR A  1  32  ? -7.385   -28.696  147.430  1.00 110.12 ? 32  TYR 1 CE1   1 
ATOM   249   C  CE2   . TYR A  1  32  ? -8.560   -30.762  147.449  1.00 110.17 ? 32  TYR 1 CE2   1 
ATOM   250   C  CZ    . TYR A  1  32  ? -8.426   -29.474  146.991  1.00 108.10 ? 32  TYR 1 CZ    1 
ATOM   251   O  OH    . TYR A  1  32  ? -9.335   -28.964  146.092  1.00 104.10 ? 32  TYR 1 OH    1 
ATOM   252   N  N     . LEU A  1  33  ? -7.084   -31.748  152.570  1.00 113.26 ? 33  LEU 1 N     1 
ATOM   253   C  CA    . LEU A  1  33  ? -8.299   -32.054  153.322  1.00 110.70 ? 33  LEU 1 CA    1 
ATOM   254   C  C     . LEU A  1  33  ? -8.442   -31.162  154.547  1.00 101.41 ? 33  LEU 1 C     1 
ATOM   255   O  O     . LEU A  1  33  ? -9.506   -30.580  154.783  1.00 105.91 ? 33  LEU 1 O     1 
ATOM   256   C  CB    . LEU A  1  33  ? -8.305   -33.522  153.742  1.00 120.02 ? 33  LEU 1 CB    1 
ATOM   257   C  CG    . LEU A  1  33  ? -8.546   -34.541  152.632  1.00 127.94 ? 33  LEU 1 CG    1 
ATOM   258   C  CD1   . LEU A  1  33  ? -8.631   -35.943  153.219  1.00 130.55 ? 33  LEU 1 CD1   1 
ATOM   259   C  CD2   . LEU A  1  33  ? -9.799   -34.183  151.841  1.00 127.90 ? 33  LEU 1 CD2   1 
ATOM   260   N  N     . ARG A  1  34  ? -7.386   -31.067  155.356  1.00 103.33 ? 34  ARG 1 N     1 
ATOM   261   C  CA    . ARG A  1  34  ? -7.436   -30.265  156.571  1.00 112.59 ? 34  ARG 1 CA    1 
ATOM   262   C  C     . ARG A  1  34  ? -7.720   -28.804  156.282  1.00 103.53 ? 34  ARG 1 C     1 
ATOM   263   O  O     . ARG A  1  34  ? -8.120   -28.070  157.195  1.00 100.84 ? 34  ARG 1 O     1 
ATOM   264   C  CB    . ARG A  1  34  ? -6.125   -30.414  157.335  1.00 123.02 ? 34  ARG 1 CB    1 
ATOM   265   C  CG    . ARG A  1  34  ? -6.130   -31.595  158.289  1.00 131.21 ? 34  ARG 1 CG    1 
ATOM   266   C  CD    . ARG A  1  34  ? -4.822   -32.365  158.247  1.00 138.29 ? 34  ARG 1 CD    1 
ATOM   267   N  NE    . ARG A  1  34  ? -3.672   -31.497  158.460  1.00 140.72 ? 34  ARG 1 NE    1 
ATOM   268   C  CZ    . ARG A  1  34  ? -2.413   -31.866  158.255  1.00 138.28 ? 34  ARG 1 CZ    1 
ATOM   269   N  NH1   . ARG A  1  34  ? -2.136   -33.092  157.836  1.00 137.60 ? 34  ARG 1 NH1   1 
ATOM   270   N  NH2   . ARG A  1  34  ? -1.432   -31.007  158.473  1.00 133.07 ? 34  ARG 1 NH2   1 
ATOM   271   N  N     . HIS A  1  35  ? -7.521   -28.361  155.045  1.00 96.38  ? 35  HIS 1 N     1 
ATOM   272   C  CA    . HIS A  1  35  ? -7.941   -27.024  154.655  1.00 97.53  ? 35  HIS 1 CA    1 
ATOM   273   C  C     . HIS A  1  35  ? -9.269   -27.013  153.909  1.00 94.81  ? 35  HIS 1 C     1 
ATOM   274   O  O     . HIS A  1  35  ? -9.647   -25.976  153.353  1.00 97.01  ? 35  HIS 1 O     1 
ATOM   275   C  CB    . HIS A  1  35  ? -6.849   -26.362  153.821  1.00 100.05 ? 35  HIS 1 CB    1 
ATOM   276   C  CG    . HIS A  1  35  ? -5.714   -25.851  154.645  1.00 88.82  ? 35  HIS 1 CG    1 
ATOM   277   N  ND1   . HIS A  1  35  ? -4.715   -26.673  155.124  1.00 86.52  ? 35  HIS 1 ND1   1 
ATOM   278   C  CD2   . HIS A  1  35  ? -5.450   -24.614  155.127  1.00 83.53  ? 35  HIS 1 CD2   1 
ATOM   279   C  CE1   . HIS A  1  35  ? -3.865   -25.957  155.838  1.00 86.06  ? 35  HIS 1 CE1   1 
ATOM   280   N  NE2   . HIS A  1  35  ? -4.288   -24.704  155.856  1.00 85.67  ? 35  HIS 1 NE2   1 
ATOM   281   N  N     . GLY A  1  36  ? -9.992   -28.127  153.897  1.00 93.45  ? 36  GLY 1 N     1 
ATOM   282   C  CA    . GLY A  1  36  ? -11.326  -28.160  153.341  1.00 94.88  ? 36  GLY 1 CA    1 
ATOM   283   C  C     . GLY A  1  36  ? -11.425  -28.665  151.924  1.00 95.47  ? 36  GLY 1 C     1 
ATOM   284   O  O     . GLY A  1  36  ? -12.420  -28.373  151.252  1.00 104.50 ? 36  GLY 1 O     1 
ATOM   285   N  N     . GLY A  1  37  ? -10.418  -29.376  151.434  1.00 92.66  ? 37  GLY 1 N     1 
ATOM   286   C  CA    . GLY A  1  37  ? -10.446  -29.844  150.062  1.00 96.31  ? 37  GLY 1 CA    1 
ATOM   287   C  C     . GLY A  1  37  ? -11.477  -30.929  149.820  1.00 92.91  ? 37  GLY 1 C     1 
ATOM   288   O  O     . GLY A  1  37  ? -11.914  -31.637  150.726  1.00 99.71  ? 37  GLY 1 O     1 
ATOM   289   N  N     . TYR A  1  38  ? -11.888  -31.027  148.554  1.00 82.67  ? 38  TYR 1 N     1 
ATOM   290   C  CA    . TYR A  1  38  ? -12.768  -32.084  148.049  1.00 89.23  ? 38  TYR 1 CA    1 
ATOM   291   C  C     . TYR A  1  38  ? -14.190  -31.972  148.579  1.00 94.12  ? 38  TYR 1 C     1 
ATOM   292   O  O     . TYR A  1  38  ? -15.079  -32.707  148.135  1.00 91.61  ? 38  TYR 1 O     1 
ATOM   293   C  CB    . TYR A  1  38  ? -12.203  -33.469  148.370  1.00 95.07  ? 38  TYR 1 CB    1 
ATOM   294   C  CG    . TYR A  1  38  ? -11.041  -33.846  147.488  1.00 96.90  ? 38  TYR 1 CG    1 
ATOM   295   C  CD1   . TYR A  1  38  ? -11.223  -34.103  146.145  1.00 104.12 ? 38  TYR 1 CD1   1 
ATOM   296   C  CD2   . TYR A  1  38  ? -9.760   -33.929  147.990  1.00 79.01  ? 38  TYR 1 CD2   1 
ATOM   297   C  CE1   . TYR A  1  38  ? -10.164  -34.444  145.327  1.00 102.73 ? 38  TYR 1 CE1   1 
ATOM   298   C  CE2   . TYR A  1  38  ? -8.698   -34.266  147.174  1.00 81.61  ? 38  TYR 1 CE2   1 
ATOM   299   C  CZ    . TYR A  1  38  ? -8.901   -34.525  145.849  1.00 104.86 ? 38  TYR 1 CZ    1 
ATOM   300   O  OH    . TYR A  1  38  ? -7.831   -34.862  145.050  1.00 119.39 ? 38  TYR 1 OH    1 
ATOM   301   N  N     . GLU A  1  39  ? -14.427  -31.041  149.503  1.00 91.72  ? 39  GLU 1 N     1 
ATOM   302   C  CA    . GLU A  1  39  ? -15.787  -30.811  149.971  1.00 100.69 ? 39  GLU 1 CA    1 
ATOM   303   C  C     . GLU A  1  39  ? -16.673  -30.362  148.825  1.00 98.16  ? 39  GLU 1 C     1 
ATOM   304   O  O     . GLU A  1  39  ? -17.833  -30.780  148.715  1.00 95.63  ? 39  GLU 1 O     1 
ATOM   305   C  CB    . GLU A  1  39  ? -15.776  -29.772  151.090  1.00 108.62 ? 39  GLU 1 CB    1 
ATOM   306   C  CG    . GLU A  1  39  ? -16.006  -30.338  152.470  1.00 114.87 ? 39  GLU 1 CG    1 
ATOM   307   C  CD    . GLU A  1  39  ? -16.259  -29.249  153.472  1.00 118.49 ? 39  GLU 1 CD    1 
ATOM   308   O  OE1   . GLU A  1  39  ? -15.649  -28.171  153.333  1.00 116.46 ? 39  GLU 1 OE1   1 
ATOM   309   O  OE2   . GLU A  1  39  ? -17.068  -29.460  154.392  1.00 123.98 ? 39  GLU 1 OE2   1 
ATOM   310   N  N     . THR A  1  40  ? -16.126  -29.527  147.946  1.00 95.18  ? 40  THR 1 N     1 
ATOM   311   C  CA    . THR A  1  40  ? -16.908  -28.979  146.848  1.00 92.48  ? 40  THR 1 CA    1 
ATOM   312   C  C     . THR A  1  40  ? -17.250  -30.046  145.817  1.00 100.16 ? 40  THR 1 C     1 
ATOM   313   O  O     . THR A  1  40  ? -18.398  -30.149  145.370  1.00 105.85 ? 40  THR 1 O     1 
ATOM   314   C  CB    . THR A  1  40  ? -16.141  -27.833  146.207  1.00 81.65  ? 40  THR 1 CB    1 
ATOM   315   O  OG1   . THR A  1  40  ? -15.689  -26.943  147.233  1.00 70.59  ? 40  THR 1 OG1   1 
ATOM   316   C  CG2   . THR A  1  40  ? -17.012  -27.114  145.255  1.00 80.00  ? 40  THR 1 CG2   1 
ATOM   317   N  N     . ALA A  1  41  ? -16.265  -30.846  145.418  1.00 102.04 ? 41  ALA 1 N     1 
ATOM   318   C  CA    . ALA A  1  41  ? -16.553  -31.951  144.514  1.00 107.99 ? 41  ALA 1 CA    1 
ATOM   319   C  C     . ALA A  1  41  ? -17.567  -32.901  145.134  1.00 107.53 ? 41  ALA 1 C     1 
ATOM   320   O  O     . ALA A  1  41  ? -18.524  -33.326  144.476  1.00 103.51 ? 41  ALA 1 O     1 
ATOM   321   C  CB    . ALA A  1  41  ? -15.267  -32.691  144.158  1.00 110.74 ? 41  ALA 1 CB    1 
ATOM   322   N  N     . LYS A  1  42  ? -17.365  -33.243  146.408  1.00 112.61 ? 42  LYS 1 N     1 
ATOM   323   C  CA    . LYS A  1  42  ? -18.238  -34.197  147.084  1.00 111.33 ? 42  LYS 1 CA    1 
ATOM   324   C  C     . LYS A  1  42  ? -19.684  -33.716  147.084  1.00 98.70  ? 42  LYS 1 C     1 
ATOM   325   O  O     . LYS A  1  42  ? -20.605  -34.491  146.802  1.00 97.29  ? 42  LYS 1 O     1 
ATOM   326   C  CB    . LYS A  1  42  ? -17.748  -34.426  148.511  1.00 118.79 ? 42  LYS 1 CB    1 
ATOM   327   C  CG    . LYS A  1  42  ? -18.558  -35.437  149.306  1.00 129.44 ? 42  LYS 1 CG    1 
ATOM   328   C  CD    . LYS A  1  42  ? -17.983  -35.583  150.707  1.00 137.68 ? 42  LYS 1 CD    1 
ATOM   329   C  CE    . LYS A  1  42  ? -16.796  -36.531  150.714  1.00 131.60 ? 42  LYS 1 CE    1 
ATOM   330   N  NZ    . LYS A  1  42  ? -16.486  -37.064  152.067  1.00 120.97 ? 42  LYS 1 NZ    1 
ATOM   331   N  N     . ARG A  1  43  ? -19.909  -32.442  147.412  1.00 91.87  ? 43  ARG 1 N     1 
ATOM   332   C  CA    . ARG A  1  43  ? -21.274  -31.919  147.385  1.00 97.32  ? 43  ARG 1 CA    1 
ATOM   333   C  C     . ARG A  1  43  ? -21.840  -31.894  145.962  1.00 106.73 ? 43  ARG 1 C     1 
ATOM   334   O  O     . ARG A  1  43  ? -22.928  -32.430  145.711  1.00 110.22 ? 43  ARG 1 O     1 
ATOM   335   C  CB    . ARG A  1  43  ? -21.318  -30.534  148.040  1.00 96.86  ? 43  ARG 1 CB    1 
ATOM   336   C  CG    . ARG A  1  43  ? -20.363  -29.511  147.477  1.00 96.73  ? 43  ARG 1 CG    1 
ATOM   337   C  CD    . ARG A  1  43  ? -20.600  -28.124  148.028  1.00 97.95  ? 43  ARG 1 CD    1 
ATOM   338   N  NE    . ARG A  1  43  ? -21.854  -27.574  147.535  1.00 107.40 ? 43  ARG 1 NE    1 
ATOM   339   C  CZ    . ARG A  1  43  ? -22.315  -26.373  147.858  1.00 118.44 ? 43  ARG 1 CZ    1 
ATOM   340   N  NH1   . ARG A  1  43  ? -21.618  -25.593  148.672  1.00 122.45 ? 43  ARG 1 NH1   1 
ATOM   341   N  NH2   . ARG A  1  43  ? -23.467  -25.956  147.365  1.00 122.51 ? 43  ARG 1 NH2   1 
ATOM   342   N  N     . VAL A  1  44  ? -21.114  -31.285  145.014  1.00 104.68 ? 44  VAL 1 N     1 
ATOM   343   C  CA    . VAL A  1  44  ? -21.677  -31.027  143.687  1.00 94.33  ? 44  VAL 1 CA    1 
ATOM   344   C  C     . VAL A  1  44  ? -21.984  -32.333  142.950  1.00 80.75  ? 44  VAL 1 C     1 
ATOM   345   O  O     . VAL A  1  44  ? -22.987  -32.427  142.230  1.00 73.05  ? 44  VAL 1 O     1 
ATOM   346   C  CB    . VAL A  1  44  ? -20.739  -30.112  142.877  1.00 93.97  ? 44  VAL 1 CB    1 
ATOM   347   C  CG1   . VAL A  1  44  ? -21.301  -29.849  141.491  1.00 96.81  ? 44  VAL 1 CG1   1 
ATOM   348   C  CG2   . VAL A  1  44  ? -20.529  -28.779  143.602  1.00 93.46  ? 44  VAL 1 CG2   1 
ATOM   349   N  N     . LEU A  1  45  ? -21.138  -33.360  143.110  1.00 92.72  ? 45  LEU 1 N     1 
ATOM   350   C  CA    . LEU A  1  45  ? -21.336  -34.611  142.366  1.00 104.22 ? 45  LEU 1 CA    1 
ATOM   351   C  C     . LEU A  1  45  ? -22.660  -35.291  142.700  1.00 99.21  ? 45  LEU 1 C     1 
ATOM   352   O  O     . LEU A  1  45  ? -23.240  -35.963  141.839  1.00 82.98  ? 45  LEU 1 O     1 
ATOM   353   C  CB    . LEU A  1  45  ? -20.172  -35.568  142.623  1.00 121.23 ? 45  LEU 1 CB    1 
ATOM   354   C  CG    . LEU A  1  45  ? -18.908  -35.290  141.807  1.00 130.88 ? 45  LEU 1 CG    1 
ATOM   355   C  CD1   . LEU A  1  45  ? -17.782  -36.246  142.166  1.00 127.02 ? 45  LEU 1 CD1   1 
ATOM   356   C  CD2   . LEU A  1  45  ? -19.198  -35.358  140.316  1.00 138.10 ? 45  LEU 1 CD2   1 
ATOM   357   N  N     . LYS A  1  46  ? -23.127  -35.175  143.940  1.00 109.42 ? 46  LYS 1 N     1 
ATOM   358   C  CA    . LYS A  1  46  ? -24.382  -35.804  144.331  1.00 115.02 ? 46  LYS 1 CA    1 
ATOM   359   C  C     . LYS A  1  46  ? -25.566  -34.853  144.289  1.00 125.28 ? 46  LYS 1 C     1 
ATOM   360   O  O     . LYS A  1  46  ? -26.707  -35.313  144.167  1.00 127.88 ? 46  LYS 1 O     1 
ATOM   361   C  CB    . LYS A  1  46  ? -24.281  -36.365  145.750  1.00 112.27 ? 46  LYS 1 CB    1 
ATOM   362   C  CG    . LYS A  1  46  ? -22.884  -36.763  146.162  1.00 124.04 ? 46  LYS 1 CG    1 
ATOM   363   C  CD    . LYS A  1  46  ? -22.931  -37.802  147.264  1.00 135.81 ? 46  LYS 1 CD    1 
ATOM   364   C  CE    . LYS A  1  46  ? -21.596  -37.917  147.966  1.00 145.57 ? 46  LYS 1 CE    1 
ATOM   365   N  NZ    . LYS A  1  46  ? -21.753  -38.498  149.321  1.00 155.19 ? 46  LYS 1 NZ    1 
ATOM   366   N  N     . GLU A  1  47  ? -25.326  -33.547  144.388  1.00 133.91 ? 47  GLU 1 N     1 
ATOM   367   C  CA    . GLU A  1  47  ? -26.424  -32.587  144.422  1.00 137.19 ? 47  GLU 1 CA    1 
ATOM   368   C  C     . GLU A  1  47  ? -26.738  -32.049  143.026  1.00 128.34 ? 47  GLU 1 C     1 
ATOM   369   O  O     . GLU A  1  47  ? -27.834  -32.265  142.503  1.00 130.03 ? 47  GLU 1 O     1 
ATOM   370   C  CB    . GLU A  1  47  ? -26.085  -31.441  145.386  1.00 147.22 ? 47  GLU 1 CB    1 
ATOM   371   C  CG    . GLU A  1  47  ? -25.885  -31.875  146.842  1.00 158.70 ? 47  GLU 1 CG    1 
ATOM   372   C  CD    . GLU A  1  47  ? -25.320  -30.773  147.728  1.00 172.47 ? 47  GLU 1 CD    1 
ATOM   373   O  OE1   . GLU A  1  47  ? -24.887  -29.732  147.192  1.00 178.66 ? 47  GLU 1 OE1   1 
ATOM   374   O  OE2   . GLU A  1  47  ? -25.308  -30.946  148.965  1.00 174.52 ? 47  GLU 1 OE2   1 
ATOM   375   N  N     . LYS A  1  48  ? -25.776  -31.375  142.405  1.00 116.96 ? 48  LYS 1 N     1 
ATOM   376   C  CA    . LYS A  1  48  ? -26.001  -30.738  141.113  1.00 115.97 ? 48  LYS 1 CA    1 
ATOM   377   C  C     . LYS A  1  48  ? -25.813  -31.723  139.957  1.00 117.95 ? 48  LYS 1 C     1 
ATOM   378   O  O     . LYS A  1  48  ? -25.038  -32.675  140.043  1.00 113.84 ? 48  LYS 1 O     1 
ATOM   379   C  CB    . LYS A  1  48  ? -25.056  -29.545  140.947  1.00 113.28 ? 48  LYS 1 CB    1 
ATOM   380   C  CG    . LYS A  1  48  ? -25.394  -28.358  141.840  1.00 107.53 ? 48  LYS 1 CG    1 
ATOM   381   C  CD    . LYS A  1  48  ? -24.418  -27.213  141.628  1.00 104.07 ? 48  LYS 1 CD    1 
ATOM   382   C  CE    . LYS A  1  48  ? -24.760  -26.014  142.495  1.00 102.14 ? 48  LYS 1 CE    1 
ATOM   383   N  NZ    . LYS A  1  48  ? -26.078  -25.430  142.121  1.00 101.55 ? 48  LYS 1 NZ    1 
ATOM   384   N  N     . THR A  1  49  ? -26.561  -31.493  138.879  1.00 121.57 ? 49  THR 1 N     1 
ATOM   385   C  CA    . THR A  1  49  ? -26.421  -32.252  137.641  1.00 113.59 ? 49  THR 1 CA    1 
ATOM   386   C  C     . THR A  1  49  ? -25.360  -31.612  136.751  1.00 111.75 ? 49  THR 1 C     1 
ATOM   387   O  O     . THR A  1  49  ? -24.890  -30.501  137.017  1.00 116.55 ? 49  THR 1 O     1 
ATOM   388   C  CB    . THR A  1  49  ? -27.776  -32.335  136.924  1.00 103.86 ? 49  THR 1 CB    1 
ATOM   389   O  OG1   . THR A  1  49  ? -28.243  -31.027  136.588  1.00 101.96 ? 49  THR 1 OG1   1 
ATOM   390   C  CG2   . THR A  1  49  ? -28.817  -33.020  137.803  1.00 103.31 ? 49  THR 1 CG2   1 
ATOM   391   N  N     . PRO A  1  50  ? -24.935  -32.297  135.678  1.00 97.01  ? 50  PRO 1 N     1 
ATOM   392   C  CA    . PRO A  1  50  ? -23.971  -31.662  134.761  1.00 91.93  ? 50  PRO 1 CA    1 
ATOM   393   C  C     . PRO A  1  50  ? -24.499  -30.386  134.118  1.00 81.28  ? 50  PRO 1 C     1 
ATOM   394   O  O     . PRO A  1  50  ? -23.745  -29.417  133.965  1.00 72.75  ? 50  PRO 1 O     1 
ATOM   395   C  CB    . PRO A  1  50  ? -23.701  -32.763  133.728  1.00 85.99  ? 50  PRO 1 CB    1 
ATOM   396   C  CG    . PRO A  1  50  ? -24.022  -34.031  134.425  1.00 83.65  ? 50  PRO 1 CG    1 
ATOM   397   C  CD    . PRO A  1  50  ? -25.153  -33.717  135.337  1.00 88.83  ? 50  PRO 1 CD    1 
ATOM   398   N  N     . ASP A  1  51  ? -25.773  -30.363  133.718  1.00 88.39  ? 51  ASP 1 N     1 
ATOM   399   C  CA    . ASP A  1  51  ? -26.377  -29.126  133.228  1.00 96.88  ? 51  ASP 1 CA    1 
ATOM   400   C  C     . ASP A  1  51  ? -26.315  -28.025  134.281  1.00 92.83  ? 51  ASP 1 C     1 
ATOM   401   O  O     . ASP A  1  51  ? -26.109  -26.853  133.953  1.00 83.04  ? 51  ASP 1 O     1 
ATOM   402   C  CB    . ASP A  1  51  ? -27.817  -29.385  132.796  1.00 107.71 ? 51  ASP 1 CB    1 
ATOM   403   C  CG    . ASP A  1  51  ? -27.898  -30.080  131.461  1.00 111.68 ? 51  ASP 1 CG    1 
ATOM   404   O  OD1   . ASP A  1  51  ? -27.382  -29.527  130.474  1.00 105.44 ? 51  ASP 1 OD1   1 
ATOM   405   O  OD2   . ASP A  1  51  ? -28.459  -31.188  131.401  1.00 114.15 ? 51  ASP 1 OD2   1 
ATOM   406   N  N     . GLU A  1  52  ? -26.464  -28.386  135.558  1.00 100.84 ? 52  GLU 1 N     1 
ATOM   407   C  CA    . GLU A  1  52  ? -26.451  -27.378  136.614  1.00 114.65 ? 52  GLU 1 CA    1 
ATOM   408   C  C     . GLU A  1  52  ? -25.043  -26.839  136.848  1.00 115.64 ? 52  GLU 1 C     1 
ATOM   409   O  O     . GLU A  1  52  ? -24.860  -25.630  137.017  1.00 114.40 ? 52  GLU 1 O     1 
ATOM   410   C  CB    . GLU A  1  52  ? -27.031  -27.957  137.907  1.00 121.08 ? 52  GLU 1 CB    1 
ATOM   411   C  CG    . GLU A  1  52  ? -28.526  -28.239  137.876  1.00 135.56 ? 52  GLU 1 CG    1 
ATOM   412   C  CD    . GLU A  1  52  ? -29.076  -28.617  139.238  1.00 152.58 ? 52  GLU 1 CD    1 
ATOM   413   O  OE1   . GLU A  1  52  ? -28.651  -28.025  140.252  1.00 158.98 ? 52  GLU 1 OE1   1 
ATOM   414   O  OE2   . GLU A  1  52  ? -29.946  -29.507  139.293  1.00 156.78 ? 52  GLU 1 OE2   1 
ATOM   415   N  N     . VAL A  1  53  ? -24.026  -27.707  136.829  1.00 106.63 ? 53  VAL 1 N     1 
ATOM   416   C  CA    . VAL A  1  53  ? -22.664  -27.213  137.016  1.00 96.07  ? 53  VAL 1 CA    1 
ATOM   417   C  C     . VAL A  1  53  ? -22.172  -26.483  135.770  1.00 85.03  ? 53  VAL 1 C     1 
ATOM   418   O  O     . VAL A  1  53  ? -21.245  -25.670  135.858  1.00 70.05  ? 53  VAL 1 O     1 
ATOM   419   C  CB    . VAL A  1  53  ? -21.719  -28.364  137.423  1.00 102.05 ? 53  VAL 1 CB    1 
ATOM   420   C  CG1   . VAL A  1  53  ? -21.729  -29.462  136.398  1.00 94.69  ? 53  VAL 1 CG1   1 
ATOM   421   C  CG2   . VAL A  1  53  ? -20.293  -27.866  137.709  1.00 110.49 ? 53  VAL 1 CG2   1 
ATOM   422   N  N     . ILE A  1  54  ? -22.802  -26.714  134.614  1.00 100.66 ? 54  ILE 1 N     1 
ATOM   423   C  CA    . ILE A  1  54  ? -22.503  -25.924  133.422  1.00 104.75 ? 54  ILE 1 CA    1 
ATOM   424   C  C     . ILE A  1  54  ? -23.144  -24.548  133.521  1.00 102.49 ? 54  ILE 1 C     1 
ATOM   425   O  O     . ILE A  1  54  ? -22.503  -23.526  133.255  1.00 93.01  ? 54  ILE 1 O     1 
ATOM   426   C  CB    . ILE A  1  54  ? -22.972  -26.663  132.152  1.00 106.45 ? 54  ILE 1 CB    1 
ATOM   427   C  CG1   . ILE A  1  54  ? -22.052  -27.844  131.840  1.00 117.25 ? 54  ILE 1 CG1   1 
ATOM   428   C  CG2   . ILE A  1  54  ? -23.061  -25.704  130.957  1.00 101.01 ? 54  ILE 1 CG2   1 
ATOM   429   C  CD1   . ILE A  1  54  ? -22.507  -28.687  130.673  1.00 122.08 ? 54  ILE 1 CD1   1 
ATOM   430   N  N     . GLU A  1  55  ? -24.431  -24.505  133.881  1.00 108.12 ? 55  GLU 1 N     1 
ATOM   431   C  CA    . GLU A  1  55  ? -25.111  -23.228  134.072  1.00 116.83 ? 55  GLU 1 CA    1 
ATOM   432   C  C     . GLU A  1  55  ? -24.460  -22.414  135.181  1.00 113.61 ? 55  GLU 1 C     1 
ATOM   433   O  O     . GLU A  1  55  ? -24.461  -21.184  135.121  1.00 114.83 ? 55  GLU 1 O     1 
ATOM   434   C  CB    . GLU A  1  55  ? -26.596  -23.448  134.376  1.00 126.05 ? 55  GLU 1 CB    1 
ATOM   435   C  CG    . GLU A  1  55  ? -27.520  -23.496  133.152  1.00 125.13 ? 55  GLU 1 CG    1 
ATOM   436   C  CD    . GLU A  1  55  ? -27.617  -22.169  132.421  1.00 115.10 ? 55  GLU 1 CD    1 
ATOM   437   O  OE1   . GLU A  1  55  ? -26.979  -22.030  131.361  1.00 113.89 ? 55  GLU 1 OE1   1 
ATOM   438   O  OE2   . GLU A  1  55  ? -28.326  -21.261  132.899  1.00 107.32 ? 55  GLU 1 OE2   1 
ATOM   439   N  N     . GLU A  1  56  ? -23.895  -23.075  136.197  1.00 109.17 ? 56  GLU 1 N     1 
ATOM   440   C  CA    . GLU A  1  56  ? -23.213  -22.347  137.265  1.00 110.12 ? 56  GLU 1 CA    1 
ATOM   441   C  C     . GLU A  1  56  ? -22.015  -21.586  136.719  1.00 88.74  ? 56  GLU 1 C     1 
ATOM   442   O  O     . GLU A  1  56  ? -21.811  -20.414  137.047  1.00 91.67  ? 56  GLU 1 O     1 
ATOM   443   C  CB    . GLU A  1  56  ? -22.771  -23.309  138.370  1.00 127.30 ? 56  GLU 1 CB    1 
ATOM   444   C  CG    . GLU A  1  56  ? -22.348  -22.628  139.675  1.00 144.44 ? 56  GLU 1 CG    1 
ATOM   445   C  CD    . GLU A  1  56  ? -23.519  -22.217  140.549  1.00 162.78 ? 56  GLU 1 CD    1 
ATOM   446   O  OE1   . GLU A  1  56  ? -24.526  -22.950  140.565  1.00 171.91 ? 56  GLU 1 OE1   1 
ATOM   447   O  OE2   . GLU A  1  56  ? -23.440  -21.165  141.219  1.00 165.39 ? 56  GLU 1 OE2   1 
ATOM   448   N  N     . VAL A  1  57  ? -21.221  -22.229  135.864  1.00 70.07  ? 57  VAL 1 N     1 
ATOM   449   C  CA    . VAL A  1  57  ? -20.069  -21.533  135.318  1.00 70.10  ? 57  VAL 1 CA    1 
ATOM   450   C  C     . VAL A  1  57  ? -20.516  -20.508  134.283  1.00 73.06  ? 57  VAL 1 C     1 
ATOM   451   O  O     . VAL A  1  57  ? -19.924  -19.424  134.177  1.00 75.31  ? 57  VAL 1 O     1 
ATOM   452   C  CB    . VAL A  1  57  ? -19.050  -22.534  134.731  1.00 70.12  ? 57  VAL 1 CB    1 
ATOM   453   C  CG1   . VAL A  1  57  ? -17.742  -21.830  134.432  1.00 70.14  ? 57  VAL 1 CG1   1 
ATOM   454   C  CG2   . VAL A  1  57  ? -18.819  -23.691  135.696  1.00 70.07  ? 57  VAL 1 CG2   1 
ATOM   455   N  N     . LYS A  1  58  ? -21.574  -20.808  133.525  1.00 86.21  ? 58  LYS 1 N     1 
ATOM   456   C  CA    . LYS A  1  58  ? -22.117  -19.822  132.595  1.00 103.89 ? 58  LYS 1 CA    1 
ATOM   457   C  C     . LYS A  1  58  ? -22.560  -18.564  133.325  1.00 102.77 ? 58  LYS 1 C     1 
ATOM   458   O  O     . LYS A  1  58  ? -22.404  -17.450  132.811  1.00 92.30  ? 58  LYS 1 O     1 
ATOM   459   C  CB    . LYS A  1  58  ? -23.288  -20.417  131.800  1.00 114.75 ? 58  LYS 1 CB    1 
ATOM   460   C  CG    . LYS A  1  58  ? -23.630  -19.662  130.509  1.00 124.96 ? 58  LYS 1 CG    1 
ATOM   461   C  CD    . LYS A  1  58  ? -24.830  -20.281  129.799  1.00 133.42 ? 58  LYS 1 CD    1 
ATOM   462   C  CE    . LYS A  1  58  ? -24.518  -21.688  129.324  1.00 139.13 ? 58  LYS 1 CE    1 
ATOM   463   N  NZ    . LYS A  1  58  ? -25.542  -22.232  128.388  1.00 138.63 ? 58  LYS 1 NZ    1 
ATOM   464   N  N     . ARG A  1  59  ? -23.125  -18.726  134.520  1.00 111.57 ? 59  ARG 1 N     1 
ATOM   465   C  CA    . ARG A  1  59  ? -23.513  -17.578  135.329  1.00 116.09 ? 59  ARG 1 CA    1 
ATOM   466   C  C     . ARG A  1  59  ? -22.290  -16.888  135.922  1.00 113.95 ? 59  ARG 1 C     1 
ATOM   467   O  O     . ARG A  1  59  ? -22.256  -15.657  136.029  1.00 115.63 ? 59  ARG 1 O     1 
ATOM   468   C  CB    . ARG A  1  59  ? -24.479  -18.026  136.427  1.00 122.90 ? 59  ARG 1 CB    1 
ATOM   469   C  CG    . ARG A  1  59  ? -25.894  -18.306  135.936  1.00 138.09 ? 59  ARG 1 CG    1 
ATOM   470   C  CD    . ARG A  1  59  ? -26.751  -18.797  137.086  1.00 152.51 ? 59  ARG 1 CD    1 
ATOM   471   N  NE    . ARG A  1  59  ? -27.592  -19.923  136.694  1.00 164.44 ? 59  ARG 1 NE    1 
ATOM   472   C  CZ    . ARG A  1  59  ? -28.810  -20.153  137.177  1.00 173.04 ? 59  ARG 1 CZ    1 
ATOM   473   N  NH1   . ARG A  1  59  ? -29.335  -19.336  138.077  1.00 178.96 ? 59  ARG 1 NH1   1 
ATOM   474   N  NH2   . ARG A  1  59  ? -29.495  -21.210  136.768  1.00 172.00 ? 59  ARG 1 NH2   1 
ATOM   475   N  N     . SER A  1  60  ? -21.273  -17.665  136.311  1.00 105.97 ? 60  SER 1 N     1 
ATOM   476   C  CA    . SER A  1  60  ? -20.034  -17.076  136.803  1.00 104.26 ? 60  SER 1 CA    1 
ATOM   477   C  C     . SER A  1  60  ? -19.362  -16.228  135.742  1.00 102.71 ? 60  SER 1 C     1 
ATOM   478   O  O     . SER A  1  60  ? -18.586  -15.328  136.078  1.00 94.70  ? 60  SER 1 O     1 
ATOM   479   C  CB    . SER A  1  60  ? -19.065  -18.162  137.278  1.00 96.78  ? 60  SER 1 CB    1 
ATOM   480   O  OG    . SER A  1  60  ? -18.555  -18.914  136.193  1.00 99.83  ? 60  SER 1 OG    1 
ATOM   481   N  N     . GLY A  1  61  ? -19.635  -16.504  134.471  1.00 113.50 ? 61  GLY 1 N     1 
ATOM   482   C  CA    . GLY A  1  61  ? -19.018  -15.729  133.418  1.00 121.62 ? 61  GLY 1 CA    1 
ATOM   483   C  C     . GLY A  1  61  ? -17.545  -16.012  133.282  1.00 118.48 ? 61  GLY 1 C     1 
ATOM   484   O  O     . GLY A  1  61  ? -16.783  -15.138  132.861  1.00 106.72 ? 61  GLY 1 O     1 
ATOM   485   N  N     . LEU A  1  62  ? -17.123  -17.214  133.651  1.00 124.22 ? 62  LEU 1 N     1 
ATOM   486   C  CA    . LEU A  1  62  ? -15.719  -17.579  133.592  1.00 131.56 ? 62  LEU 1 CA    1 
ATOM   487   C  C     . LEU A  1  62  ? -15.293  -17.718  132.138  1.00 134.84 ? 62  LEU 1 C     1 
ATOM   488   O  O     . LEU A  1  62  ? -15.800  -18.580  131.414  1.00 135.14 ? 62  LEU 1 O     1 
ATOM   489   C  CB    . LEU A  1  62  ? -15.496  -18.876  134.362  1.00 137.66 ? 62  LEU 1 CB    1 
ATOM   490   C  CG    . LEU A  1  62  ? -14.138  -19.568  134.300  1.00 148.95 ? 62  LEU 1 CG    1 
ATOM   491   C  CD1   . LEU A  1  62  ? -13.025  -18.610  134.656  1.00 155.30 ? 62  LEU 1 CD1   1 
ATOM   492   C  CD2   . LEU A  1  62  ? -14.119  -20.779  135.232  1.00 150.57 ? 62  LEU 1 CD2   1 
ATOM   493   N  N     . ARG A  1  63  ? -14.366  -16.866  131.716  1.00 137.96 ? 63  ARG 1 N     1 
ATOM   494   C  CA    . ARG A  1  63  ? -13.836  -16.874  130.362  1.00 135.71 ? 63  ARG 1 CA    1 
ATOM   495   C  C     . ARG A  1  63  ? -12.507  -17.616  130.341  1.00 117.82 ? 63  ARG 1 C     1 
ATOM   496   O  O     . ARG A  1  63  ? -11.802  -17.692  131.349  1.00 120.13 ? 63  ARG 1 O     1 
ATOM   497   C  CB    . ARG A  1  63  ? -13.660  -15.451  129.818  1.00 150.89 ? 63  ARG 1 CB    1 
ATOM   498   C  CG    . ARG A  1  63  ? -14.972  -14.731  129.493  1.00 166.27 ? 63  ARG 1 CG    1 
ATOM   499   C  CD    . ARG A  1  63  ? -14.776  -13.274  129.026  1.00 176.20 ? 63  ARG 1 CD    1 
ATOM   500   N  NE    . ARG A  1  63  ? -14.641  -13.169  127.573  1.00 181.31 ? 63  ARG 1 NE    1 
ATOM   501   C  CZ    . ARG A  1  63  ? -14.438  -12.031  126.913  1.00 183.86 ? 63  ARG 1 CZ    1 
ATOM   502   N  NH1   . ARG A  1  63  ? -14.360  -10.879  127.565  1.00 183.68 ? 63  ARG 1 NH1   1 
ATOM   503   N  NH2   . ARG A  1  63  ? -14.321  -12.045  125.593  1.00 184.33 ? 63  ARG 1 NH2   1 
ATOM   504   N  N     . GLY A  1  64  ? -12.198  -18.207  129.192  1.00 103.51 ? 64  GLY 1 N     1 
ATOM   505   C  CA    . GLY A  1  64  ? -11.012  -19.030  129.062  1.00 104.46 ? 64  GLY 1 CA    1 
ATOM   506   C  C     . GLY A  1  64  ? -9.732   -18.400  129.563  1.00 108.44 ? 64  GLY 1 C     1 
ATOM   507   O  O     . GLY A  1  64  ? -9.369   -17.303  129.135  1.00 116.30 ? 64  GLY 1 O     1 
ATOM   508   N  N     . ARG A  1  65  ? -9.039   -19.086  130.470  1.00 100.53 ? 65  ARG 1 N     1 
ATOM   509   C  CA    . ARG A  1  65  ? -7.797   -18.580  131.043  1.00 90.22  ? 65  ARG 1 CA    1 
ATOM   510   C  C     . ARG A  1  65  ? -6.563   -19.005  130.268  1.00 89.84  ? 65  ARG 1 C     1 
ATOM   511   O  O     . ARG A  1  65  ? -5.449   -18.667  130.678  1.00 72.74  ? 65  ARG 1 O     1 
ATOM   512   C  CB    . ARG A  1  65  ? -7.662   -19.031  132.500  1.00 84.36  ? 65  ARG 1 CB    1 
ATOM   513   C  CG    . ARG A  1  65  ? -8.759   -18.493  133.393  1.00 76.90  ? 65  ARG 1 CG    1 
ATOM   514   C  CD    . ARG A  1  65  ? -8.680   -16.984  133.504  1.00 81.28  ? 65  ARG 1 CD    1 
ATOM   515   N  NE    . ARG A  1  65  ? -10.005  -16.378  133.581  1.00 103.72 ? 65  ARG 1 NE    1 
ATOM   516   C  CZ    . ARG A  1  65  ? -10.627  -16.066  134.713  1.00 125.64 ? 65  ARG 1 CZ    1 
ATOM   517   N  NH1   . ARG A  1  65  ? -10.046  -16.305  135.877  1.00 133.01 ? 65  ARG 1 NH1   1 
ATOM   518   N  NH2   . ARG A  1  65  ? -11.830  -15.511  134.676  1.00 131.03 ? 65  ARG 1 NH2   1 
ATOM   519   N  N     . GLY A  1  66  ? -6.730   -19.745  129.175  1.00 94.28  ? 66  GLY 1 N     1 
ATOM   520   C  CA    . GLY A  1  66  ? -5.605   -20.090  128.330  1.00 103.79 ? 66  GLY 1 CA    1 
ATOM   521   C  C     . GLY A  1  66  ? -5.077   -18.950  127.488  1.00 114.37 ? 66  GLY 1 C     1 
ATOM   522   O  O     . GLY A  1  66  ? -4.053   -19.128  126.820  1.00 115.22 ? 66  GLY 1 O     1 
ATOM   523   N  N     . GLY A  1  67  ? -5.751   -17.802  127.489  1.00 129.35 ? 67  GLY 1 N     1 
ATOM   524   C  CA    . GLY A  1  67  ? -5.380   -16.657  126.674  1.00 140.64 ? 67  GLY 1 CA    1 
ATOM   525   C  C     . GLY A  1  67  ? -6.422   -16.262  125.648  1.00 155.52 ? 67  GLY 1 C     1 
ATOM   526   O  O     . GLY A  1  67  ? -6.442   -15.102  125.211  1.00 152.69 ? 67  GLY 1 O     1 
ATOM   527   N  N     . ALA A  1  68  ? -7.286   -17.194  125.243  1.00 171.59 ? 68  ALA 1 N     1 
ATOM   528   C  CA    . ALA A  1  68  ? -8.361   -16.882  124.307  1.00 178.12 ? 68  ALA 1 CA    1 
ATOM   529   C  C     . ALA A  1  68  ? -9.445   -16.041  124.971  1.00 172.46 ? 68  ALA 1 C     1 
ATOM   530   O  O     . ALA A  1  68  ? -9.737   -14.921  124.537  1.00 174.34 ? 68  ALA 1 O     1 
ATOM   531   C  CB    . ALA A  1  68  ? -8.949   -18.179  123.750  1.00 186.00 ? 68  ALA 1 CB    1 
ATOM   532   N  N     . GLY A  1  69  ? -10.071  -16.577  126.010  1.00 160.68 ? 69  GLY 1 N     1 
ATOM   533   C  CA    . GLY A  1  69  ? -11.146  -15.893  126.683  1.00 149.03 ? 69  GLY 1 CA    1 
ATOM   534   C  C     . GLY A  1  69  ? -12.537  -16.393  126.361  1.00 136.99 ? 69  GLY 1 C     1 
ATOM   535   O  O     . GLY A  1  69  ? -13.507  -15.677  126.633  1.00 141.23 ? 69  GLY 1 O     1 
ATOM   536   N  N     . PHE A  1  70  ? -12.668  -17.575  125.769  1.00 123.21 ? 70  PHE 1 N     1 
ATOM   537   C  CA    . PHE A  1  70  ? -13.990  -18.078  125.427  1.00 123.85 ? 70  PHE 1 CA    1 
ATOM   538   C  C     . PHE A  1  70  ? -14.762  -18.444  126.694  1.00 115.70 ? 70  PHE 1 C     1 
ATOM   539   O  O     . PHE A  1  70  ? -14.208  -19.079  127.599  1.00 109.27 ? 70  PHE 1 O     1 
ATOM   540   C  CB    . PHE A  1  70  ? -13.893  -19.300  124.505  1.00 134.56 ? 70  PHE 1 CB    1 
ATOM   541   C  CG    . PHE A  1  70  ? -15.129  -19.528  123.647  1.00 140.42 ? 70  PHE 1 CG    1 
ATOM   542   C  CD1   . PHE A  1  70  ? -16.168  -20.329  124.089  1.00 144.36 ? 70  PHE 1 CD1   1 
ATOM   543   C  CD2   . PHE A  1  70  ? -15.248  -18.936  122.398  1.00 136.28 ? 70  PHE 1 CD2   1 
ATOM   544   C  CE1   . PHE A  1  70  ? -17.300  -20.533  123.308  1.00 141.09 ? 70  PHE 1 CE1   1 
ATOM   545   C  CE2   . PHE A  1  70  ? -16.382  -19.140  121.619  1.00 133.18 ? 70  PHE 1 CE2   1 
ATOM   546   C  CZ    . PHE A  1  70  ? -17.403  -19.937  122.077  1.00 134.52 ? 70  PHE 1 CZ    1 
ATOM   547   N  N     . PRO A  1  71  ? -16.049  -18.081  126.779  1.00 116.92 ? 71  PRO 1 N     1 
ATOM   548   C  CA    . PRO A  1  71  ? -16.843  -18.437  127.963  1.00 120.51 ? 71  PRO 1 CA    1 
ATOM   549   C  C     . PRO A  1  71  ? -17.002  -19.937  128.117  1.00 115.67 ? 71  PRO 1 C     1 
ATOM   550   O  O     . PRO A  1  71  ? -17.648  -20.583  127.290  1.00 120.51 ? 71  PRO 1 O     1 
ATOM   551   C  CB    . PRO A  1  71  ? -18.188  -17.749  127.695  1.00 129.59 ? 71  PRO 1 CB    1 
ATOM   552   C  CG    . PRO A  1  71  ? -17.836  -16.599  126.806  1.00 130.68 ? 71  PRO 1 CG    1 
ATOM   553   C  CD    . PRO A  1  71  ? -16.771  -17.144  125.902  1.00 123.51 ? 71  PRO 1 CD    1 
ATOM   554   N  N     . THR A  1  72  ? -16.395  -20.494  129.168  1.00 101.35 ? 72  THR 1 N     1 
ATOM   555   C  CA    . THR A  1  72  ? -16.361  -21.939  129.336  1.00 85.77  ? 72  THR 1 CA    1 
ATOM   556   C  C     . THR A  1  72  ? -17.749  -22.531  129.525  1.00 76.39  ? 72  THR 1 C     1 
ATOM   557   O  O     . THR A  1  72  ? -17.965  -23.695  129.184  1.00 72.29  ? 72  THR 1 O     1 
ATOM   558   C  CB    . THR A  1  72  ? -15.452  -22.302  130.509  1.00 78.72  ? 72  THR 1 CB    1 
ATOM   559   O  OG1   . THR A  1  72  ? -16.200  -22.241  131.723  1.00 80.54  ? 72  THR 1 OG1   1 
ATOM   560   C  CG2   . THR A  1  72  ? -14.281  -21.344  130.598  1.00 72.64  ? 72  THR 1 CG2   1 
ATOM   561   N  N     . GLY A  1  73  ? -18.714  -21.743  129.995  1.00 81.51  ? 73  GLY 1 N     1 
ATOM   562   C  CA    . GLY A  1  73  ? -20.062  -22.268  130.142  1.00 94.73  ? 73  GLY 1 CA    1 
ATOM   563   C  C     . GLY A  1  73  ? -20.720  -22.552  128.804  1.00 105.58 ? 73  GLY 1 C     1 
ATOM   564   O  O     . GLY A  1  73  ? -21.207  -23.660  128.560  1.00 106.49 ? 73  GLY 1 O     1 
ATOM   565   N  N     . LEU A  1  74  ? -20.755  -21.550  127.919  1.00 104.70 ? 74  LEU 1 N     1 
ATOM   566   C  CA    . LEU A  1  74  ? -21.278  -21.774  126.574  1.00 93.91  ? 74  LEU 1 CA    1 
ATOM   567   C  C     . LEU A  1  74  ? -20.399  -22.748  125.810  1.00 82.80  ? 74  LEU 1 C     1 
ATOM   568   O  O     . LEU A  1  74  ? -20.879  -23.455  124.921  1.00 94.93  ? 74  LEU 1 O     1 
ATOM   569   C  CB    . LEU A  1  74  ? -21.391  -20.445  125.819  1.00 98.50  ? 74  LEU 1 CB    1 
ATOM   570   C  CG    . LEU A  1  74  ? -21.891  -20.449  124.364  1.00 104.43 ? 74  LEU 1 CG    1 
ATOM   571   C  CD1   . LEU A  1  74  ? -23.376  -20.780  124.281  1.00 107.92 ? 74  LEU 1 CD1   1 
ATOM   572   C  CD2   . LEU A  1  74  ? -21.598  -19.130  123.657  1.00 106.22 ? 74  LEU 1 CD2   1 
ATOM   573   N  N     . LYS A  1  75  ? -19.113  -22.798  126.152  1.00 72.09  ? 75  LYS 1 N     1 
ATOM   574   C  CA    . LYS A  1  75  ? -18.212  -23.772  125.555  1.00 71.81  ? 75  LYS 1 CA    1 
ATOM   575   C  C     . LYS A  1  75  ? -18.659  -25.189  125.886  1.00 71.67  ? 75  LYS 1 C     1 
ATOM   576   O  O     . LYS A  1  75  ? -18.758  -26.051  125.006  1.00 71.45  ? 75  LYS 1 O     1 
ATOM   577   C  CB    . LYS A  1  75  ? -16.787  -23.513  126.057  1.00 71.82  ? 75  LYS 1 CB    1 
ATOM   578   C  CG    . LYS A  1  75  ? -15.703  -24.304  125.359  1.00 73.05  ? 75  LYS 1 CG    1 
ATOM   579   C  CD    . LYS A  1  75  ? -14.335  -24.030  125.973  1.00 71.60  ? 75  LYS 1 CD    1 
ATOM   580   C  CE    . LYS A  1  75  ? -13.217  -24.353  124.997  1.00 75.00  ? 75  LYS 1 CE    1 
ATOM   581   N  NZ    . LYS A  1  75  ? -11.875  -24.177  125.610  1.00 75.42  ? 75  LYS 1 NZ    1 
ATOM   582   N  N     . TRP A  1  76  ? -18.961  -25.437  127.157  1.00 71.82  ? 76  TRP 1 N     1 
ATOM   583   C  CA    . TRP A  1  76  ? -19.494  -26.724  127.574  1.00 84.40  ? 76  TRP 1 CA    1 
ATOM   584   C  C     . TRP A  1  76  ? -20.898  -26.947  127.027  1.00 90.11  ? 76  TRP 1 C     1 
ATOM   585   O  O     . TRP A  1  76  ? -21.320  -28.099  126.881  1.00 89.29  ? 76  TRP 1 O     1 
ATOM   586   C  CB    . TRP A  1  76  ? -19.492  -26.812  129.107  1.00 83.89  ? 76  TRP 1 CB    1 
ATOM   587   C  CG    . TRP A  1  76  ? -18.126  -26.671  129.749  1.00 85.42  ? 76  TRP 1 CG    1 
ATOM   588   C  CD1   . TRP A  1  76  ? -16.943  -26.485  129.111  1.00 72.15  ? 76  TRP 1 CD1   1 
ATOM   589   C  CD2   . TRP A  1  76  ? -17.819  -26.695  131.154  1.00 91.92  ? 76  TRP 1 CD2   1 
ATOM   590   N  NE1   . TRP A  1  76  ? -15.919  -26.396  130.018  1.00 71.87  ? 76  TRP 1 NE1   1 
ATOM   591   C  CE2   . TRP A  1  76  ? -16.431  -26.523  131.280  1.00 77.85  ? 76  TRP 1 CE2   1 
ATOM   592   C  CE3   . TRP A  1  76  ? -18.582  -26.850  132.312  1.00 98.63  ? 76  TRP 1 CE3   1 
ATOM   593   C  CZ2   . TRP A  1  76  ? -15.791  -26.498  132.514  1.00 80.56  ? 76  TRP 1 CZ2   1 
ATOM   594   C  CZ3   . TRP A  1  76  ? -17.940  -26.826  133.536  1.00 88.63  ? 76  TRP 1 CZ3   1 
ATOM   595   C  CH2   . TRP A  1  76  ? -16.562  -26.652  133.627  1.00 83.91  ? 76  TRP 1 CH2   1 
ATOM   596   N  N     . SER A  1  77  ? -21.621  -25.868  126.711  1.00 88.37  ? 77  SER 1 N     1 
ATOM   597   C  CA    . SER A  1  77  ? -22.949  -25.985  126.121  1.00 90.81  ? 77  SER 1 CA    1 
ATOM   598   C  C     . SER A  1  77  ? -22.911  -26.484  124.687  1.00 86.69  ? 77  SER 1 C     1 
ATOM   599   O  O     . SER A  1  77  ? -23.966  -26.823  124.142  1.00 84.54  ? 77  SER 1 O     1 
ATOM   600   C  CB    . SER A  1  77  ? -23.665  -24.634  126.169  1.00 89.14  ? 77  SER 1 CB    1 
ATOM   601   O  OG    . SER A  1  77  ? -23.329  -23.838  125.045  1.00 89.04  ? 77  SER 1 OG    1 
ATOM   602   N  N     . PHE A  1  78  ? -21.730  -26.544  124.077  1.00 71.47  ? 78  PHE 1 N     1 
ATOM   603   C  CA    . PHE A  1  78  ? -21.585  -27.054  122.724  1.00 72.33  ? 78  PHE 1 CA    1 
ATOM   604   C  C     . PHE A  1  78  ? -21.291  -28.546  122.698  1.00 74.28  ? 78  PHE 1 C     1 
ATOM   605   O  O     . PHE A  1  78  ? -21.400  -29.164  121.636  1.00 70.86  ? 78  PHE 1 O     1 
ATOM   606   C  CB    . PHE A  1  78  ? -20.485  -26.289  121.977  1.00 75.73  ? 78  PHE 1 CB    1 
ATOM   607   C  CG    . PHE A  1  78  ? -20.844  -24.861  121.651  1.00 74.78  ? 78  PHE 1 CG    1 
ATOM   608   C  CD1   . PHE A  1  78  ? -22.143  -24.511  121.354  1.00 71.43  ? 78  PHE 1 CD1   1 
ATOM   609   C  CD2   . PHE A  1  78  ? -19.875  -23.878  121.614  1.00 71.42  ? 78  PHE 1 CD2   1 
ATOM   610   C  CE1   . PHE A  1  78  ? -22.473  -23.205  121.045  1.00 71.59  ? 78  PHE 1 CE1   1 
ATOM   611   C  CE2   . PHE A  1  78  ? -20.207  -22.570  121.308  1.00 71.60  ? 78  PHE 1 CE2   1 
ATOM   612   C  CZ    . PHE A  1  78  ? -21.506  -22.237  121.023  1.00 71.68  ? 78  PHE 1 CZ    1 
ATOM   613   N  N     . MET A  1  79  ? -20.950  -29.140  123.840  1.00 84.59  ? 79  MET 1 N     1 
ATOM   614   C  CA    . MET A  1  79  ? -20.700  -30.564  123.889  1.00 88.24  ? 79  MET 1 CA    1 
ATOM   615   C  C     . MET A  1  79  ? -21.982  -31.321  123.572  1.00 85.12  ? 79  MET 1 C     1 
ATOM   616   O  O     . MET A  1  79  ? -23.085  -30.805  123.774  1.00 87.34  ? 79  MET 1 O     1 
ATOM   617   C  CB    . MET A  1  79  ? -20.189  -30.957  125.273  1.00 97.63  ? 79  MET 1 CB    1 
ATOM   618   C  CG    . MET A  1  79  ? -18.820  -30.429  125.591  1.00 103.66 ? 79  MET 1 CG    1 
ATOM   619   S  SD    . MET A  1  79  ? -17.568  -31.558  124.959  1.00 107.06 ? 79  MET 1 SD    1 
ATOM   620   C  CE    . MET A  1  79  ? -18.028  -33.101  125.754  1.00 111.39 ? 79  MET 1 CE    1 
ATOM   621   N  N     . PRO A  1  80  ? -21.862  -32.554  123.081  1.00 81.04  ? 80  PRO 1 N     1 
ATOM   622   C  CA    . PRO A  1  80  ? -23.075  -33.311  122.757  1.00 86.75  ? 80  PRO 1 CA    1 
ATOM   623   C  C     . PRO A  1  80  ? -23.985  -33.471  123.953  1.00 101.02 ? 80  PRO 1 C     1 
ATOM   624   O  O     . PRO A  1  80  ? -25.206  -33.572  123.793  1.00 115.38 ? 80  PRO 1 O     1 
ATOM   625   C  CB    . PRO A  1  80  ? -22.513  -34.652  122.270  1.00 70.57  ? 80  PRO 1 CB    1 
ATOM   626   C  CG    . PRO A  1  80  ? -21.185  -34.283  121.707  1.00 70.43  ? 80  PRO 1 CG    1 
ATOM   627   C  CD    . PRO A  1  80  ? -20.652  -33.294  122.691  1.00 70.56  ? 80  PRO 1 CD    1 
ATOM   628   N  N     . LYS A  1  81  ? -23.403  -33.509  125.153  1.00 99.63  ? 81  LYS 1 N     1 
ATOM   629   C  CA    . LYS A  1  81  ? -24.100  -33.457  126.432  1.00 104.89 ? 81  LYS 1 CA    1 
ATOM   630   C  C     . LYS A  1  81  ? -24.865  -34.743  126.717  1.00 106.90 ? 81  LYS 1 C     1 
ATOM   631   O  O     . LYS A  1  81  ? -25.229  -35.008  127.866  1.00 111.37 ? 81  LYS 1 O     1 
ATOM   632   C  CB    . LYS A  1  81  ? -25.044  -32.248  126.453  1.00 103.20 ? 81  LYS 1 CB    1 
ATOM   633   C  CG    . LYS A  1  81  ? -25.577  -31.840  127.809  1.00 95.79  ? 81  LYS 1 CG    1 
ATOM   634   C  CD    . LYS A  1  81  ? -26.142  -30.432  127.760  1.00 90.34  ? 81  LYS 1 CD    1 
ATOM   635   C  CE    . LYS A  1  81  ? -25.124  -29.413  128.239  1.00 90.18  ? 81  LYS 1 CE    1 
ATOM   636   N  NZ    . LYS A  1  81  ? -23.962  -29.273  127.325  1.00 87.43  ? 81  LYS 1 NZ    1 
ATOM   637   N  N     . ASP A  1  82  ? -25.080  -35.558  125.684  1.00 102.42 ? 82  ASP 1 N     1 
ATOM   638   C  CA    . ASP A  1  82  ? -25.419  -36.969  125.802  1.00 99.15  ? 82  ASP 1 CA    1 
ATOM   639   C  C     . ASP A  1  82  ? -25.304  -37.600  124.423  1.00 103.37 ? 82  ASP 1 C     1 
ATOM   640   O  O     . ASP A  1  82  ? -26.040  -37.217  123.507  1.00 110.21 ? 82  ASP 1 O     1 
ATOM   641   C  CB    . ASP A  1  82  ? -26.814  -37.178  126.381  1.00 99.17  ? 82  ASP 1 CB    1 
ATOM   642   C  CG    . ASP A  1  82  ? -26.904  -38.437  127.198  1.00 115.95 ? 82  ASP 1 CG    1 
ATOM   643   O  OD1   . ASP A  1  82  ? -26.524  -39.506  126.686  1.00 118.03 ? 82  ASP 1 OD1   1 
ATOM   644   O  OD2   . ASP A  1  82  ? -27.347  -38.360  128.356  1.00 127.31 ? 82  ASP 1 OD2   1 
ATOM   645   N  N     . ASP A  1  83  ? -24.358  -38.516  124.237  1.00 98.67  ? 83  ASP 1 N     1 
ATOM   646   C  CA    . ASP A  1  83  ? -24.282  -39.230  122.969  1.00 86.38  ? 83  ASP 1 CA    1 
ATOM   647   C  C     . ASP A  1  83  ? -24.027  -40.723  123.090  1.00 87.64  ? 83  ASP 1 C     1 
ATOM   648   O  O     . ASP A  1  83  ? -24.168  -41.428  122.087  1.00 93.72  ? 83  ASP 1 O     1 
ATOM   649   C  CB    . ASP A  1  83  ? -23.195  -38.619  122.079  1.00 77.44  ? 83  ASP 1 CB    1 
ATOM   650   C  CG    . ASP A  1  83  ? -21.850  -38.562  122.761  1.00 78.64  ? 83  ASP 1 CG    1 
ATOM   651   O  OD1   . ASP A  1  83  ? -21.764  -38.783  123.983  1.00 79.91  ? 83  ASP 1 OD1   1 
ATOM   652   O  OD2   . ASP A  1  83  ? -20.859  -38.278  122.072  1.00 74.99  ? 83  ASP 1 OD2   1 
ATOM   653   N  N     . GLY A  1  84  ? -23.635  -41.226  124.256  1.00 87.24  ? 84  GLY 1 N     1 
ATOM   654   C  CA    . GLY A  1  84  ? -23.209  -42.591  124.404  1.00 87.69  ? 84  GLY 1 CA    1 
ATOM   655   C  C     . GLY A  1  84  ? -21.729  -42.804  124.176  1.00 87.92  ? 84  GLY 1 C     1 
ATOM   656   O  O     . GLY A  1  84  ? -21.183  -43.816  124.629  1.00 87.30  ? 84  GLY 1 O     1 
ATOM   657   N  N     . LYS A  1  85  ? -21.069  -41.873  123.495  1.00 89.86  ? 85  LYS 1 N     1 
ATOM   658   C  CA    . LYS A  1  85  ? -19.639  -41.969  123.258  1.00 84.23  ? 85  LYS 1 CA    1 
ATOM   659   C  C     . LYS A  1  85  ? -18.872  -41.516  124.488  1.00 78.06  ? 85  LYS 1 C     1 
ATOM   660   O  O     . LYS A  1  85  ? -19.338  -40.677  125.265  1.00 70.38  ? 85  LYS 1 O     1 
ATOM   661   C  CB    . LYS A  1  85  ? -19.222  -41.118  122.056  1.00 81.58  ? 85  LYS 1 CB    1 
ATOM   662   C  CG    . LYS A  1  85  ? -19.683  -41.629  120.700  1.00 80.10  ? 85  LYS 1 CG    1 
ATOM   663   C  CD    . LYS A  1  85  ? -19.043  -40.811  119.590  1.00 70.02  ? 85  LYS 1 CD    1 
ATOM   664   C  CE    . LYS A  1  85  ? -18.624  -41.677  118.421  1.00 81.22  ? 85  LYS 1 CE    1 
ATOM   665   N  NZ    . LYS A  1  85  ? -18.364  -40.863  117.204  1.00 87.10  ? 85  LYS 1 NZ    1 
ATOM   666   N  N     . GLN A  1  86  ? -17.691  -42.095  124.668  1.00 80.70  ? 86  GLN 1 N     1 
ATOM   667   C  CA    . GLN A  1  86  ? -16.814  -41.643  125.733  1.00 80.21  ? 86  GLN 1 CA    1 
ATOM   668   C  C     . GLN A  1  86  ? -16.330  -40.229  125.434  1.00 78.31  ? 86  GLN 1 C     1 
ATOM   669   O  O     . GLN A  1  86  ? -15.956  -39.909  124.301  1.00 86.55  ? 86  GLN 1 O     1 
ATOM   670   C  CB    . GLN A  1  86  ? -15.620  -42.591  125.871  1.00 75.59  ? 86  GLN 1 CB    1 
ATOM   671   C  CG    . GLN A  1  86  ? -14.421  -41.997  126.585  1.00 70.07  ? 86  GLN 1 CG    1 
ATOM   672   C  CD    . GLN A  1  86  ? -14.588  -42.027  128.087  1.00 73.09  ? 86  GLN 1 CD    1 
ATOM   673   O  OE1   . GLN A  1  86  ? -15.462  -41.367  128.637  1.00 78.41  ? 86  GLN 1 OE1   1 
ATOM   674   N  NE2   . GLN A  1  86  ? -13.741  -42.784  128.762  1.00 79.29  ? 86  GLN 1 NE2   1 
ATOM   675   N  N     . HIS A  1  87  ? -16.319  -39.383  126.454  1.00 60.47  ? 87  HIS 1 N     1 
ATOM   676   C  CA    . HIS A  1  87  ? -15.735  -38.057  126.344  1.00 66.74  ? 87  HIS 1 CA    1 
ATOM   677   C  C     . HIS A  1  87  ? -14.454  -38.008  127.158  1.00 80.49  ? 87  HIS 1 C     1 
ATOM   678   O  O     . HIS A  1  87  ? -14.278  -38.761  128.121  1.00 93.70  ? 87  HIS 1 O     1 
ATOM   679   C  CB    . HIS A  1  87  ? -16.695  -36.956  126.826  1.00 71.30  ? 87  HIS 1 CB    1 
ATOM   680   C  CG    . HIS A  1  87  ? -18.056  -37.018  126.207  1.00 91.28  ? 87  HIS 1 CG    1 
ATOM   681   N  ND1   . HIS A  1  87  ? -19.155  -36.388  126.754  1.00 93.86  ? 87  HIS 1 ND1   1 
ATOM   682   C  CD2   . HIS A  1  87  ? -18.488  -37.607  125.066  1.00 97.07  ? 87  HIS 1 CD2   1 
ATOM   683   C  CE1   . HIS A  1  87  ? -20.209  -36.601  125.987  1.00 95.83  ? 87  HIS 1 CE1   1 
ATOM   684   N  NE2   . HIS A  1  87  ? -19.831  -37.338  124.957  1.00 97.90  ? 87  HIS 1 NE2   1 
ATOM   685   N  N     . TYR A  1  88  ? -13.559  -37.120  126.757  1.00 79.80  ? 88  TYR 1 N     1 
ATOM   686   C  CA    . TYR A  1  88  ? -12.292  -36.937  127.441  1.00 93.16  ? 88  TYR 1 CA    1 
ATOM   687   C  C     . TYR A  1  88  ? -12.169  -35.479  127.853  1.00 107.00 ? 88  TYR 1 C     1 
ATOM   688   O  O     . TYR A  1  88  ? -12.608  -34.577  127.128  1.00 101.83 ? 88  TYR 1 O     1 
ATOM   689   C  CB    . TYR A  1  88  ? -11.101  -37.358  126.555  1.00 91.42  ? 88  TYR 1 CB    1 
ATOM   690   C  CG    . TYR A  1  88  ? -10.940  -38.864  126.401  1.00 95.55  ? 88  TYR 1 CG    1 
ATOM   691   C  CD1   . TYR A  1  88  ? -10.297  -39.617  127.366  1.00 98.02  ? 88  TYR 1 CD1   1 
ATOM   692   C  CD2   . TYR A  1  88  ? -11.431  -39.529  125.293  1.00 89.88  ? 88  TYR 1 CD2   1 
ATOM   693   C  CE1   . TYR A  1  88  ? -10.146  -40.993  127.228  1.00 92.61  ? 88  TYR 1 CE1   1 
ATOM   694   C  CE2   . TYR A  1  88  ? -11.284  -40.907  125.154  1.00 89.53  ? 88  TYR 1 CE2   1 
ATOM   695   C  CZ    . TYR A  1  88  ? -10.643  -41.632  126.125  1.00 90.94  ? 88  TYR 1 CZ    1 
ATOM   696   O  OH    . TYR A  1  88  ? -10.492  -42.998  126.001  1.00 89.65  ? 88  TYR 1 OH    1 
ATOM   697   N  N     . LEU A  1  89  ? -11.615  -35.257  129.038  1.00 118.80 ? 89  LEU 1 N     1 
ATOM   698   C  CA    . LEU A  1  89  ? -11.324  -33.914  129.525  1.00 122.47 ? 89  LEU 1 CA    1 
ATOM   699   C  C     . LEU A  1  89  ? -9.822   -33.685  129.474  1.00 136.09 ? 89  LEU 1 C     1 
ATOM   700   O  O     . LEU A  1  89  ? -9.050   -34.474  130.031  1.00 146.94 ? 89  LEU 1 O     1 
ATOM   701   C  CB    . LEU A  1  89  ? -11.838  -33.704  130.949  1.00 110.41 ? 89  LEU 1 CB    1 
ATOM   702   C  CG    . LEU A  1  89  ? -11.529  -32.312  131.507  1.00 91.84  ? 89  LEU 1 CG    1 
ATOM   703   C  CD1   . LEU A  1  89  ? -12.008  -31.210  130.577  1.00 72.03  ? 89  LEU 1 CD1   1 
ATOM   704   C  CD2   . LEU A  1  89  ? -12.109  -32.143  132.897  1.00 99.51  ? 89  LEU 1 CD2   1 
ATOM   705   N  N     . ILE A  1  90  ? -9.413   -32.597  128.830  1.00 133.68 ? 90  ILE 1 N     1 
ATOM   706   C  CA    . ILE A  1  90  ? -8.008   -32.343  128.544  1.00 125.82 ? 90  ILE 1 CA    1 
ATOM   707   C  C     . ILE A  1  90  ? -7.558   -31.147  129.365  1.00 121.55 ? 90  ILE 1 C     1 
ATOM   708   O  O     . ILE A  1  90  ? -8.131   -30.054  129.261  1.00 112.57 ? 90  ILE 1 O     1 
ATOM   709   C  CB    . ILE A  1  90  ? -7.770   -32.107  127.045  1.00 127.46 ? 90  ILE 1 CB    1 
ATOM   710   C  CG1   . ILE A  1  90  ? -8.106   -33.373  126.249  1.00 132.24 ? 90  ILE 1 CG1   1 
ATOM   711   C  CG2   . ILE A  1  90  ? -6.339   -31.672  126.800  1.00 130.20 ? 90  ILE 1 CG2   1 
ATOM   712   C  CD1   . ILE A  1  90  ? -7.712   -33.327  124.778  1.00 136.21 ? 90  ILE 1 CD1   1 
ATOM   713   N  N     . CYS A  1  91  ? -6.553   -31.369  130.205  1.00 137.44 ? 91  CYS 1 N     1 
ATOM   714   C  CA    . CYS A  1  91  ? -5.883   -30.297  130.918  1.00 159.87 ? 91  CYS 1 CA    1 
ATOM   715   C  C     . CYS A  1  91  ? -4.641   -29.884  130.137  1.00 143.92 ? 91  CYS 1 C     1 
ATOM   716   O  O     . CYS A  1  91  ? -3.796   -30.728  129.810  1.00 141.81 ? 91  CYS 1 O     1 
ATOM   717   C  CB    . CYS A  1  91  ? -5.499   -30.746  132.323  1.00 197.45 ? 91  CYS 1 CB    1 
ATOM   718   S  SG    . CYS A  1  91  ? -4.813   -29.445  133.343  1.00 227.99 ? 91  CYS 1 SG    1 
ATOM   719   N  N     . ASN A  1  92  ? -4.530   -28.591  129.843  1.00 135.31 ? 92  ASN 1 N     1 
ATOM   720   C  CA    . ASN A  1  92  ? -3.426   -28.055  129.045  1.00 135.59 ? 92  ASN 1 CA    1 
ATOM   721   C  C     . ASN A  1  92  ? -2.402   -27.447  129.995  1.00 122.02 ? 92  ASN 1 C     1 
ATOM   722   O  O     . ASN A  1  92  ? -2.433   -26.252  130.293  1.00 126.23 ? 92  ASN 1 O     1 
ATOM   723   C  CB    . ASN A  1  92  ? -3.941   -27.033  128.034  1.00 151.39 ? 92  ASN 1 CB    1 
ATOM   724   C  CG    . ASN A  1  92  ? -2.842   -26.493  127.118  1.00 166.38 ? 92  ASN 1 CG    1 
ATOM   725   O  OD1   . ASN A  1  92  ? -1.747   -27.046  127.045  1.00 177.59 ? 92  ASN 1 OD1   1 
ATOM   726   N  ND2   . ASN A  1  92  ? -3.146   -25.414  126.404  1.00 165.04 ? 92  ASN 1 ND2   1 
ATOM   727   N  N     . ALA A  1  93  ? -1.489   -28.284  130.485  1.00 103.68 ? 93  ALA 1 N     1 
ATOM   728   C  CA    . ALA A  1  93  ? -0.417   -27.837  131.354  1.00 87.37  ? 93  ALA 1 CA    1 
ATOM   729   C  C     . ALA A  1  93  ? 0.848    -27.490  130.577  1.00 88.01  ? 93  ALA 1 C     1 
ATOM   730   O  O     . ALA A  1  93  ? 1.930    -27.423  131.168  1.00 93.08  ? 93  ALA 1 O     1 
ATOM   731   C  CB    . ALA A  1  93  ? -0.122   -28.902  132.409  1.00 89.50  ? 93  ALA 1 CB    1 
ATOM   732   N  N     . ASP A  1  94  ? 0.739    -27.275  129.269  1.00 90.28  ? 94  ASP 1 N     1 
ATOM   733   C  CA    . ASP A  1  94  ? 1.861    -26.779  128.472  1.00 100.75 ? 94  ASP 1 CA    1 
ATOM   734   C  C     . ASP A  1  94  ? 1.881    -25.267  128.636  1.00 103.33 ? 94  ASP 1 C     1 
ATOM   735   O  O     . ASP A  1  94  ? 1.063    -24.556  128.051  1.00 121.42 ? 94  ASP 1 O     1 
ATOM   736   C  CB    . ASP A  1  94  ? 1.709    -27.193  127.009  1.00 107.88 ? 94  ASP 1 CB    1 
ATOM   737   C  CG    . ASP A  1  94  ? 2.845    -26.692  126.121  1.00 110.42 ? 94  ASP 1 CG    1 
ATOM   738   O  OD1   . ASP A  1  94  ? 3.887    -27.376  126.026  1.00 110.38 ? 94  ASP 1 OD1   1 
ATOM   739   O  OD2   . ASP A  1  94  ? 2.691    -25.638  125.481  1.00 114.14 ? 94  ASP 1 OD2   1 
ATOM   740   N  N     . GLU A  1  95  ? 2.785    -24.768  129.473  1.00 86.38  ? 95  GLU 1 N     1 
ATOM   741   C  CA    . GLU A  1  95  ? 2.921    -23.335  129.724  1.00 97.08  ? 95  GLU 1 CA    1 
ATOM   742   C  C     . GLU A  1  95  ? 4.232    -22.909  129.067  1.00 114.80 ? 95  GLU 1 C     1 
ATOM   743   O  O     . GLU A  1  95  ? 5.294    -22.933  129.689  1.00 129.41 ? 95  GLU 1 O     1 
ATOM   744   C  CB    . GLU A  1  95  ? 2.883    -23.031  131.236  1.00 110.73 ? 95  GLU 1 CB    1 
ATOM   745   C  CG    . GLU A  1  95  ? 3.186    -21.578  131.648  1.00 112.86 ? 95  GLU 1 CG    1 
ATOM   746   C  CD    . GLU A  1  95  ? 3.184    -21.371  133.158  1.00 109.37 ? 95  GLU 1 CD    1 
ATOM   747   O  OE1   . GLU A  1  95  ? 3.928    -22.081  133.863  1.00 106.07 ? 95  GLU 1 OE1   1 
ATOM   748   O  OE2   . GLU A  1  95  ? 2.408    -20.524  133.644  1.00 109.78 ? 95  GLU 1 OE2   1 
ATOM   749   N  N     . SER A  1  96  ? 4.145    -22.500  127.798  1.00 115.53 ? 96  SER 1 N     1 
ATOM   750   C  CA    . SER A  1  96  ? 5.326    -22.219  126.999  1.00 112.95 ? 96  SER 1 CA    1 
ATOM   751   C  C     . SER A  1  96  ? 5.475    -20.762  126.575  1.00 109.82 ? 96  SER 1 C     1 
ATOM   752   O  O     . SER A  1  96  ? 6.547    -20.397  126.079  1.00 108.86 ? 96  SER 1 O     1 
ATOM   753   C  CB    . SER A  1  96  ? 5.337    -23.110  125.743  1.00 113.89 ? 96  SER 1 CB    1 
ATOM   754   O  OG    . SER A  1  96  ? 5.304    -24.489  126.081  1.00 115.99 ? 96  SER 1 OG    1 
ATOM   755   N  N     . GLU A  1  97  ? 4.468    -19.915  126.781  1.00 113.50 ? 97  GLU 1 N     1 
ATOM   756   C  CA    . GLU A  1  97  ? 4.579    -18.522  126.347  1.00 128.99 ? 97  GLU 1 CA    1 
ATOM   757   C  C     . GLU A  1  97  ? 5.439    -17.735  127.335  1.00 138.51 ? 97  GLU 1 C     1 
ATOM   758   O  O     . GLU A  1  97  ? 5.291    -17.907  128.551  1.00 146.38 ? 97  GLU 1 O     1 
ATOM   759   C  CB    . GLU A  1  97  ? 3.193    -17.880  126.211  1.00 138.94 ? 97  GLU 1 CB    1 
ATOM   760   C  CG    . GLU A  1  97  ? 3.220    -16.410  125.770  1.00 147.39 ? 97  GLU 1 CG    1 
ATOM   761   C  CD    . GLU A  1  97  ? 2.014    -16.006  124.937  1.00 148.29 ? 97  GLU 1 CD    1 
ATOM   762   O  OE1   . GLU A  1  97  ? 1.125    -16.852  124.726  1.00 149.83 ? 97  GLU 1 OE1   1 
ATOM   763   O  OE2   . GLU A  1  97  ? 1.965    -14.847  124.474  1.00 148.18 ? 97  GLU 1 OE2   1 
ATOM   764   N  N     . PRO A  1  98  ? 6.375    -16.916  126.852  1.00 145.88 ? 98  PRO 1 N     1 
ATOM   765   C  CA    . PRO A  1  98  ? 7.248    -16.155  127.756  1.00 151.88 ? 98  PRO 1 CA    1 
ATOM   766   C  C     . PRO A  1  98  ? 6.469    -15.174  128.622  1.00 157.00 ? 98  PRO 1 C     1 
ATOM   767   O  O     . PRO A  1  98  ? 5.394    -14.696  128.253  1.00 160.28 ? 98  PRO 1 O     1 
ATOM   768   C  CB    . PRO A  1  98  ? 8.195    -15.423  126.796  1.00 151.09 ? 98  PRO 1 CB    1 
ATOM   769   C  CG    . PRO A  1  98  ? 8.175    -16.246  125.550  1.00 151.60 ? 98  PRO 1 CG    1 
ATOM   770   C  CD    . PRO A  1  98  ? 6.781    -16.779  125.445  1.00 149.19 ? 98  PRO 1 CD    1 
ATOM   771   N  N     . GLY A  1  99  ? 7.027    -14.873  129.791  1.00 155.12 ? 99  GLY 1 N     1 
ATOM   772   C  CA    . GLY A  1  99  ? 6.365    -13.984  130.721  1.00 156.54 ? 99  GLY 1 CA    1 
ATOM   773   C  C     . GLY A  1  99  ? 5.209    -14.596  131.482  1.00 152.90 ? 99  GLY 1 C     1 
ATOM   774   O  O     . GLY A  1  99  ? 4.625    -13.912  132.330  1.00 154.52 ? 99  GLY 1 O     1 
ATOM   775   N  N     . SER A  1  100 ? 4.864    -15.857  131.213  1.00 146.27 ? 100 SER 1 N     1 
ATOM   776   C  CA    . SER A  1  100 ? 3.764    -16.564  131.870  1.00 137.83 ? 100 SER 1 CA    1 
ATOM   777   C  C     . SER A  1  100 ? 4.332    -17.750  132.639  1.00 128.80 ? 100 SER 1 C     1 
ATOM   778   O  O     . SER A  1  100 ? 4.796    -18.724  132.033  1.00 124.92 ? 100 SER 1 O     1 
ATOM   779   C  CB    . SER A  1  100 ? 2.722    -17.033  130.854  1.00 142.06 ? 100 SER 1 CB    1 
ATOM   780   O  OG    . SER A  1  100 ? 1.810    -17.951  131.436  1.00 152.16 ? 100 SER 1 OG    1 
ATOM   781   N  N     . PHE A  1  101 ? 4.300    -17.663  133.972  1.00 126.63 ? 101 PHE 1 N     1 
ATOM   782   C  CA    . PHE A  1  101 ? 4.796    -18.712  134.855  1.00 121.56 ? 101 PHE 1 CA    1 
ATOM   783   C  C     . PHE A  1  101 ? 3.814    -19.008  135.987  1.00 108.22 ? 101 PHE 1 C     1 
ATOM   784   O  O     . PHE A  1  101 ? 4.217    -19.461  137.063  1.00 107.52 ? 101 PHE 1 O     1 
ATOM   785   C  CB    . PHE A  1  101 ? 6.176    -18.342  135.409  1.00 126.62 ? 101 PHE 1 CB    1 
ATOM   786   C  CG    . PHE A  1  101 ? 6.330    -16.881  135.778  1.00 132.86 ? 101 PHE 1 CG    1 
ATOM   787   C  CD1   . PHE A  1  101 ? 5.953    -16.425  137.025  1.00 137.53 ? 101 PHE 1 CD1   1 
ATOM   788   C  CD2   . PHE A  1  101 ? 6.857    -15.967  134.879  1.00 136.09 ? 101 PHE 1 CD2   1 
ATOM   789   C  CE1   . PHE A  1  101 ? 6.102    -15.091  137.374  1.00 140.88 ? 101 PHE 1 CE1   1 
ATOM   790   C  CE2   . PHE A  1  101 ? 6.999    -14.626  135.227  1.00 136.85 ? 101 PHE 1 CE2   1 
ATOM   791   C  CZ    . PHE A  1  101 ? 6.621    -14.194  136.475  1.00 138.75 ? 101 PHE 1 CZ    1 
ATOM   792   N  N     . LYS A  1  102 ? 2.521    -18.773  135.754  1.00 96.09  ? 102 LYS 1 N     1 
ATOM   793   C  CA    . LYS A  1  102 ? 1.537    -18.862  136.828  1.00 93.07  ? 102 LYS 1 CA    1 
ATOM   794   C  C     . LYS A  1  102 ? 1.106    -20.303  137.093  1.00 96.06  ? 102 LYS 1 C     1 
ATOM   795   O  O     . LYS A  1  102 ? 1.000    -20.712  138.255  1.00 108.33 ? 102 LYS 1 O     1 
ATOM   796   C  CB    . LYS A  1  102 ? 0.331    -17.981  136.489  1.00 80.51  ? 102 LYS 1 CB    1 
ATOM   797   C  CG    . LYS A  1  102 ? -0.319   -18.311  135.153  1.00 71.80  ? 102 LYS 1 CG    1 
ATOM   798   C  CD    . LYS A  1  102 ? -1.770   -17.852  135.097  1.00 72.02  ? 102 LYS 1 CD    1 
ATOM   799   C  CE    . LYS A  1  102 ? -2.424   -18.121  133.742  1.00 63.57  ? 102 LYS 1 CE    1 
ATOM   800   N  NZ    . LYS A  1  102 ? -2.441   -19.562  133.369  1.00 63.86  ? 102 LYS 1 NZ    1 
ATOM   801   N  N     . ASP A  1  103 ? 0.871    -21.092  136.041  1.00 80.74  ? 103 ASP 1 N     1 
ATOM   802   C  CA    . ASP A  1  103 ? 0.382    -22.455  136.240  1.00 81.04  ? 103 ASP 1 CA    1 
ATOM   803   C  C     . ASP A  1  103 ? 1.445    -23.373  136.831  1.00 77.16  ? 103 ASP 1 C     1 
ATOM   804   O  O     . ASP A  1  103 ? 1.096    -24.381  137.464  1.00 75.45  ? 103 ASP 1 O     1 
ATOM   805   C  CB    . ASP A  1  103 ? -0.126   -23.045  134.915  1.00 96.92  ? 103 ASP 1 CB    1 
ATOM   806   C  CG    . ASP A  1  103 ? -1.326   -22.297  134.347  1.00 106.16 ? 103 ASP 1 CG    1 
ATOM   807   O  OD1   . ASP A  1  103 ? -2.024   -21.609  135.115  1.00 114.44 ? 103 ASP 1 OD1   1 
ATOM   808   O  OD2   . ASP A  1  103 ? -1.592   -22.414  133.133  1.00 97.67  ? 103 ASP 1 OD2   1 
ATOM   809   N  N     . ARG A  1  104 ? 2.724    -23.043  136.632  1.00 78.73  ? 104 ARG 1 N     1 
ATOM   810   C  CA    . ARG A  1  104 ? 3.822    -23.868  137.128  1.00 91.22  ? 104 ARG 1 CA    1 
ATOM   811   C  C     . ARG A  1  104 ? 3.664    -24.174  138.611  1.00 98.52  ? 104 ARG 1 C     1 
ATOM   812   O  O     . ARG A  1  104 ? 3.703    -25.336  139.033  1.00 90.73  ? 104 ARG 1 O     1 
ATOM   813   C  CB    . ARG A  1  104 ? 5.153    -23.157  136.864  1.00 95.13  ? 104 ARG 1 CB    1 
ATOM   814   C  CG    . ARG A  1  104 ? 6.363    -23.855  137.459  1.00 101.22 ? 104 ARG 1 CG    1 
ATOM   815   C  CD    . ARG A  1  104 ? 7.621    -23.581  136.646  1.00 104.14 ? 104 ARG 1 CD    1 
ATOM   816   N  NE    . ARG A  1  104 ? 8.463    -22.558  137.254  1.00 103.60 ? 104 ARG 1 NE    1 
ATOM   817   C  CZ    . ARG A  1  104 ? 9.521    -22.811  138.017  1.00 103.79 ? 104 ARG 1 CZ    1 
ATOM   818   N  NH1   . ARG A  1  104 ? 9.882    -24.061  138.268  1.00 107.49 ? 104 ARG 1 NH1   1 
ATOM   819   N  NH2   . ARG A  1  104 ? 10.223   -21.812  138.526  1.00 102.06 ? 104 ARG 1 NH2   1 
ATOM   820   N  N     . TYR A  1  105 ? 3.436    -23.138  139.412  1.00 112.34 ? 105 TYR 1 N     1 
ATOM   821   C  CA    . TYR A  1  105 ? 3.441    -23.327  140.853  1.00 116.87 ? 105 TYR 1 CA    1 
ATOM   822   C  C     . TYR A  1  105 ? 2.124    -23.910  141.346  1.00 104.21 ? 105 TYR 1 C     1 
ATOM   823   O  O     . TYR A  1  105 ? 2.113    -24.615  142.361  1.00 116.63 ? 105 TYR 1 O     1 
ATOM   824   C  CB    . TYR A  1  105 ? 3.771    -22.002  141.544  1.00 127.19 ? 105 TYR 1 CB    1 
ATOM   825   C  CG    . TYR A  1  105 ? 5.093    -21.456  141.064  1.00 133.55 ? 105 TYR 1 CG    1 
ATOM   826   C  CD1   . TYR A  1  105 ? 6.264    -22.150  141.298  1.00 138.05 ? 105 TYR 1 CD1   1 
ATOM   827   C  CD2   . TYR A  1  105 ? 5.170    -20.274  140.345  1.00 140.06 ? 105 TYR 1 CD2   1 
ATOM   828   C  CE1   . TYR A  1  105 ? 7.474    -21.685  140.844  1.00 146.23 ? 105 TYR 1 CE1   1 
ATOM   829   C  CE2   . TYR A  1  105 ? 6.384    -19.796  139.888  1.00 149.55 ? 105 TYR 1 CE2   1 
ATOM   830   C  CZ    . TYR A  1  105 ? 7.534    -20.508  140.139  1.00 154.51 ? 105 TYR 1 CZ    1 
ATOM   831   O  OH    . TYR A  1  105 ? 8.752    -20.046  139.690  1.00 161.23 ? 105 TYR 1 OH    1 
ATOM   832   N  N     . ILE A  1  106 ? 1.025    -23.673  140.624  1.00 78.33  ? 106 ILE 1 N     1 
ATOM   833   C  CA    . ILE A  1  106 ? -0.211   -24.404  140.901  1.00 77.63  ? 106 ILE 1 CA    1 
ATOM   834   C  C     . ILE A  1  106 ? 0.039    -25.902  140.790  1.00 79.18  ? 106 ILE 1 C     1 
ATOM   835   O  O     . ILE A  1  106 ? -0.313   -26.681  141.687  1.00 79.01  ? 106 ILE 1 O     1 
ATOM   836   C  CB    . ILE A  1  106 ? -1.346   -23.956  139.955  1.00 82.41  ? 106 ILE 1 CB    1 
ATOM   837   C  CG1   . ILE A  1  106 ? -1.827   -22.541  140.302  1.00 83.58  ? 106 ILE 1 CG1   1 
ATOM   838   C  CG2   . ILE A  1  106 ? -2.505   -24.944  139.987  1.00 72.97  ? 106 ILE 1 CG2   1 
ATOM   839   C  CD1   . ILE A  1  106 ? -3.058   -22.100  139.526  1.00 74.07  ? 106 ILE 1 CD1   1 
ATOM   840   N  N     . LEU A  1  107 ? 0.701    -26.316  139.709  1.00 84.14  ? 107 LEU 1 N     1 
ATOM   841   C  CA    . LEU A  1  107 ? 0.971    -27.737  139.503  1.00 91.26  ? 107 LEU 1 CA    1 
ATOM   842   C  C     . LEU A  1  107 ? 1.949    -28.272  140.541  1.00 95.15  ? 107 LEU 1 C     1 
ATOM   843   O  O     . LEU A  1  107 ? 1.820    -29.416  140.990  1.00 93.59  ? 107 LEU 1 O     1 
ATOM   844   C  CB    . LEU A  1  107 ? 1.515    -27.963  138.094  1.00 96.06  ? 107 LEU 1 CB    1 
ATOM   845   C  CG    . LEU A  1  107 ? 0.626    -27.497  136.944  1.00 112.63 ? 107 LEU 1 CG    1 
ATOM   846   C  CD1   . LEU A  1  107 ? 1.163    -28.006  135.622  1.00 118.85 ? 107 LEU 1 CD1   1 
ATOM   847   C  CD2   . LEU A  1  107 ? -0.809   -27.953  137.172  1.00 119.85 ? 107 LEU 1 CD2   1 
ATOM   848   N  N     . GLU A  1  108 ? 2.925    -27.457  140.935  1.00 97.55  ? 108 GLU 1 N     1 
ATOM   849   C  CA    . GLU A  1  108 ? 3.951    -27.932  141.858  1.00 104.18 ? 108 GLU 1 CA    1 
ATOM   850   C  C     . GLU A  1  108 ? 3.456    -28.040  143.302  1.00 106.44 ? 108 GLU 1 C     1 
ATOM   851   O  O     . GLU A  1  108 ? 3.878    -28.949  144.028  1.00 99.81  ? 108 GLU 1 O     1 
ATOM   852   C  CB    . GLU A  1  108 ? 5.179    -27.016  141.782  1.00 108.76 ? 108 GLU 1 CB    1 
ATOM   853   C  CG    . GLU A  1  108 ? 5.934    -27.101  140.456  1.00 102.29 ? 108 GLU 1 CG    1 
ATOM   854   C  CD    . GLU A  1  108 ? 7.296    -26.451  140.512  1.00 104.58 ? 108 GLU 1 CD    1 
ATOM   855   O  OE1   . GLU A  1  108 ? 7.712    -26.042  141.609  1.00 111.77 ? 108 GLU 1 OE1   1 
ATOM   856   O  OE2   . GLU A  1  108 ? 7.949    -26.343  139.456  1.00 104.67 ? 108 GLU 1 OE2   1 
ATOM   857   N  N     . ASP A  1  109 ? 2.584    -27.126  143.750  1.00 115.57 ? 109 ASP 1 N     1 
ATOM   858   C  CA    . ASP A  1  109 ? 2.256    -27.006  145.166  1.00 117.98 ? 109 ASP 1 CA    1 
ATOM   859   C  C     . ASP A  1  109 ? 0.799    -27.293  145.532  1.00 123.79 ? 109 ASP 1 C     1 
ATOM   860   O  O     . ASP A  1  109 ? 0.542    -27.667  146.682  1.00 132.96 ? 109 ASP 1 O     1 
ATOM   861   C  CB    . ASP A  1  109 ? 2.623    -25.603  145.676  1.00 112.08 ? 109 ASP 1 CB    1 
ATOM   862   C  CG    . ASP A  1  109 ? 3.959    -25.119  145.138  1.00 105.66 ? 109 ASP 1 CG    1 
ATOM   863   O  OD1   . ASP A  1  109 ? 4.891    -25.937  145.029  1.00 102.30 ? 109 ASP 1 OD1   1 
ATOM   864   O  OD2   . ASP A  1  109 ? 4.084    -23.918  144.829  1.00 103.86 ? 109 ASP 1 OD2   1 
ATOM   865   N  N     . VAL A  1  110 ? -0.149   -27.147  144.605  1.00 114.50 ? 110 VAL 1 N     1 
ATOM   866   C  CA    . VAL A  1  110 ? -1.561   -27.385  144.908  1.00 106.63 ? 110 VAL 1 CA    1 
ATOM   867   C  C     . VAL A  1  110 ? -2.203   -28.179  143.772  1.00 112.39 ? 110 VAL 1 C     1 
ATOM   868   O  O     . VAL A  1  110 ? -3.119   -27.681  143.101  1.00 114.92 ? 110 VAL 1 O     1 
ATOM   869   C  CB    . VAL A  1  110 ? -2.314   -26.062  145.167  1.00 88.35  ? 110 VAL 1 CB    1 
ATOM   870   C  CG1   . VAL A  1  110 ? -2.042   -25.544  146.580  1.00 89.17  ? 110 VAL 1 CG1   1 
ATOM   871   C  CG2   . VAL A  1  110 ? -1.935   -24.999  144.141  1.00 74.73  ? 110 VAL 1 CG2   1 
ATOM   872   N  N     . PRO A  1  111 ? -1.767   -29.418  143.524  1.00 115.31 ? 111 PRO 1 N     1 
ATOM   873   C  CA    . PRO A  1  111 ? -2.363   -30.184  142.418  1.00 117.68 ? 111 PRO 1 CA    1 
ATOM   874   C  C     . PRO A  1  111 ? -3.810   -30.591  142.663  1.00 118.62 ? 111 PRO 1 C     1 
ATOM   875   O  O     . PRO A  1  111 ? -4.581   -30.719  141.700  1.00 114.21 ? 111 PRO 1 O     1 
ATOM   876   C  CB    . PRO A  1  111 ? -1.434   -31.405  142.299  1.00 120.79 ? 111 PRO 1 CB    1 
ATOM   877   C  CG    . PRO A  1  111 ? -0.189   -31.053  143.099  1.00 121.10 ? 111 PRO 1 CG    1 
ATOM   878   C  CD    . PRO A  1  111 ? -0.689   -30.170  144.189  1.00 118.54 ? 111 PRO 1 CD    1 
ATOM   879   N  N     . HIS A  1  112 ? -4.192   -30.821  143.921  1.00 121.78 ? 112 HIS 1 N     1 
ATOM   880   C  CA    . HIS A  1  112 ? -5.525   -31.333  144.231  1.00 124.37 ? 112 HIS 1 CA    1 
ATOM   881   C  C     . HIS A  1  112 ? -6.629   -30.319  143.931  1.00 115.34 ? 112 HIS 1 C     1 
ATOM   882   O  O     . HIS A  1  112 ? -7.769   -30.714  143.661  1.00 128.36 ? 112 HIS 1 O     1 
ATOM   883   C  CB    . HIS A  1  112 ? -5.563   -31.785  145.693  1.00 130.29 ? 112 HIS 1 CB    1 
ATOM   884   C  CG    . HIS A  1  112 ? -4.686   -32.968  145.975  1.00 130.15 ? 112 HIS 1 CG    1 
ATOM   885   N  ND1   . HIS A  1  112 ? -4.968   -34.232  145.499  1.00 130.01 ? 112 HIS 1 ND1   1 
ATOM   886   C  CD2   . HIS A  1  112 ? -3.540   -33.084  146.692  1.00 132.58 ? 112 HIS 1 CD2   1 
ATOM   887   C  CE1   . HIS A  1  112 ? -4.029   -35.072  145.898  1.00 133.08 ? 112 HIS 1 CE1   1 
ATOM   888   N  NE2   . HIS A  1  112 ? -3.152   -34.402  146.625  1.00 132.29 ? 112 HIS 1 NE2   1 
ATOM   889   N  N     . LEU A  1  113 ? -6.319   -29.021  143.953  1.00 91.48  ? 113 LEU 1 N     1 
ATOM   890   C  CA    . LEU A  1  113 ? -7.282   -28.013  143.508  1.00 90.66  ? 113 LEU 1 CA    1 
ATOM   891   C  C     . LEU A  1  113 ? -7.630   -28.205  142.032  1.00 87.16  ? 113 LEU 1 C     1 
ATOM   892   O  O     . LEU A  1  113 ? -8.808   -28.220  141.648  1.00 78.24  ? 113 LEU 1 O     1 
ATOM   893   C  CB    . LEU A  1  113 ? -6.711   -26.618  143.761  1.00 95.86  ? 113 LEU 1 CB    1 
ATOM   894   C  CG    . LEU A  1  113 ? -7.388   -25.436  143.071  1.00 102.23 ? 113 LEU 1 CG    1 
ATOM   895   C  CD1   . LEU A  1  113 ? -8.775   -25.214  143.637  1.00 106.16 ? 113 LEU 1 CD1   1 
ATOM   896   C  CD2   . LEU A  1  113 ? -6.528   -24.183  143.165  1.00 106.72 ? 113 LEU 1 CD2   1 
ATOM   897   N  N     . LEU A  1  114 ? -6.605   -28.343  141.187  1.00 86.47  ? 114 LEU 1 N     1 
ATOM   898   C  CA    . LEU A  1  114 ? -6.833   -28.632  139.775  1.00 88.28  ? 114 LEU 1 CA    1 
ATOM   899   C  C     . LEU A  1  114 ? -7.568   -29.950  139.589  1.00 91.20  ? 114 LEU 1 C     1 
ATOM   900   O  O     . LEU A  1  114 ? -8.438   -30.064  138.722  1.00 92.21  ? 114 LEU 1 O     1 
ATOM   901   C  CB    . LEU A  1  114 ? -5.503   -28.667  139.020  1.00 87.27  ? 114 LEU 1 CB    1 
ATOM   902   C  CG    . LEU A  1  114 ? -5.554   -29.047  137.533  1.00 90.77  ? 114 LEU 1 CG    1 
ATOM   903   C  CD1   . LEU A  1  114 ? -6.302   -28.021  136.719  1.00 98.27  ? 114 LEU 1 CD1   1 
ATOM   904   C  CD2   . LEU A  1  114 ? -4.160   -29.286  136.956  1.00 85.56  ? 114 LEU 1 CD2   1 
ATOM   905   N  N     . ILE A  1  115 ? -7.216   -30.964  140.385  1.00 81.35  ? 115 ILE 1 N     1 
ATOM   906   C  CA    . ILE A  1  115 ? -7.880   -32.262  140.274  1.00 75.20  ? 115 ILE 1 CA    1 
ATOM   907   C  C     . ILE A  1  115 ? -9.374   -32.124  140.569  1.00 74.20  ? 115 ILE 1 C     1 
ATOM   908   O  O     . ILE A  1  115 ? -10.216  -32.687  139.859  1.00 86.87  ? 115 ILE 1 O     1 
ATOM   909   C  CB    . ILE A  1  115 ? -7.197   -33.287  141.201  1.00 81.38  ? 115 ILE 1 CB    1 
ATOM   910   C  CG1   . ILE A  1  115 ? -5.780   -33.606  140.700  1.00 85.48  ? 115 ILE 1 CG1   1 
ATOM   911   C  CG2   . ILE A  1  115 ? -8.018   -34.570  141.301  1.00 88.89  ? 115 ILE 1 CG2   1 
ATOM   912   C  CD1   . ILE A  1  115 ? -4.920   -34.446  141.659  1.00 96.20  ? 115 ILE 1 CD1   1 
ATOM   913   N  N     . GLU A  1  116 ? -9.726   -31.373  141.618  1.00 69.96  ? 116 GLU 1 N     1 
ATOM   914   C  CA    . GLU A  1  116 ? -11.133  -31.146  141.953  1.00 83.65  ? 116 GLU 1 CA    1 
ATOM   915   C  C     . GLU A  1  116 ? -11.848  -30.393  140.834  1.00 88.55  ? 116 GLU 1 C     1 
ATOM   916   O  O     . GLU A  1  116 ? -12.978  -30.739  140.456  1.00 81.10  ? 116 GLU 1 O     1 
ATOM   917   C  CB    . GLU A  1  116 ? -11.231  -30.400  143.294  1.00 90.51  ? 116 GLU 1 CB    1 
ATOM   918   C  CG    . GLU A  1  116 ? -12.638  -30.288  143.899  1.00 93.95  ? 116 GLU 1 CG    1 
ATOM   919   C  CD    . GLU A  1  116 ? -12.635  -29.864  145.367  1.00 96.77  ? 116 GLU 1 CD    1 
ATOM   920   O  OE1   . GLU A  1  116 ? -11.544  -29.673  145.941  1.00 100.37 ? 116 GLU 1 OE1   1 
ATOM   921   O  OE2   . GLU A  1  116 ? -13.726  -29.750  145.959  1.00 93.86  ? 116 GLU 1 OE2   1 
ATOM   922   N  N     . GLY A  1  117 ? -11.202  -29.361  140.286  1.00 92.43  ? 117 GLY 1 N     1 
ATOM   923   C  CA    . GLY A  1  117 ? -11.811  -28.633  139.183  1.00 87.85  ? 117 GLY 1 CA    1 
ATOM   924   C  C     . GLY A  1  117 ? -12.035  -29.500  137.959  1.00 79.00  ? 117 GLY 1 C     1 
ATOM   925   O  O     . GLY A  1  117 ? -13.047  -29.366  137.267  1.00 85.31  ? 117 GLY 1 O     1 
ATOM   926   N  N     . MET A  1  118 ? -11.094  -30.404  137.676  1.00 73.04  ? 118 MET 1 N     1 
ATOM   927   C  CA    . MET A  1  118 ? -11.257  -31.312  136.543  1.00 83.96  ? 118 MET 1 CA    1 
ATOM   928   C  C     . MET A  1  118 ? -12.338  -32.347  136.804  1.00 80.94  ? 118 MET 1 C     1 
ATOM   929   O  O     . MET A  1  118 ? -13.026  -32.759  135.870  1.00 64.62  ? 118 MET 1 O     1 
ATOM   930   C  CB    . MET A  1  118 ? -9.950   -32.028  136.199  1.00 98.98  ? 118 MET 1 CB    1 
ATOM   931   C  CG    . MET A  1  118 ? -8.812   -31.151  135.745  1.00 105.56 ? 118 MET 1 CG    1 
ATOM   932   S  SD    . MET A  1  118 ? -7.337   -32.122  135.385  1.00 102.87 ? 118 MET 1 SD    1 
ATOM   933   C  CE    . MET A  1  118 ? -7.790   -32.880  133.831  1.00 92.07  ? 118 MET 1 CE    1 
ATOM   934   N  N     . ILE A  1  119 ? -12.486  -32.799  138.048  1.00 84.20  ? 119 ILE 1 N     1 
ATOM   935   C  CA    . ILE A  1  119 ? -13.605  -33.674  138.379  1.00 86.17  ? 119 ILE 1 CA    1 
ATOM   936   C  C     . ILE A  1  119 ? -14.919  -32.959  138.093  1.00 84.35  ? 119 ILE 1 C     1 
ATOM   937   O  O     . ILE A  1  119 ? -15.844  -33.526  137.495  1.00 84.54  ? 119 ILE 1 O     1 
ATOM   938   C  CB    . ILE A  1  119 ? -13.505  -34.113  139.852  1.00 96.43  ? 119 ILE 1 CB    1 
ATOM   939   C  CG1   . ILE A  1  119 ? -12.293  -35.028  140.057  1.00 98.61  ? 119 ILE 1 CG1   1 
ATOM   940   C  CG2   . ILE A  1  119 ? -14.789  -34.791  140.299  1.00 102.94 ? 119 ILE 1 CG2   1 
ATOM   941   C  CD1   . ILE A  1  119 ? -12.023  -35.385  141.502  1.00 97.66  ? 119 ILE 1 CD1   1 
ATOM   942   N  N     . LEU A  1  120 ? -14.999  -31.687  138.483  1.00 84.86  ? 120 LEU 1 N     1 
ATOM   943   C  CA    . LEU A  1  120 ? -16.202  -30.893  138.242  1.00 92.02  ? 120 LEU 1 CA    1 
ATOM   944   C  C     . LEU A  1  120 ? -16.485  -30.747  136.747  1.00 92.52  ? 120 LEU 1 C     1 
ATOM   945   O  O     . LEU A  1  120 ? -17.611  -30.978  136.288  1.00 107.19 ? 120 LEU 1 O     1 
ATOM   946   C  CB    . LEU A  1  120 ? -16.056  -29.523  138.916  1.00 96.76  ? 120 LEU 1 CB    1 
ATOM   947   C  CG    . LEU A  1  120 ? -15.942  -29.540  140.450  1.00 100.81 ? 120 LEU 1 CG    1 
ATOM   948   C  CD1   . LEU A  1  120 ? -15.450  -28.215  141.049  1.00 91.31  ? 120 LEU 1 CD1   1 
ATOM   949   C  CD2   . LEU A  1  120 ? -17.267  -29.967  141.085  1.00 100.45 ? 120 LEU 1 CD2   1 
ATOM   950   N  N     . ALA A  1  121 ? -15.474  -30.351  135.974  1.00 71.11  ? 121 ALA 1 N     1 
ATOM   951   C  CA    . ALA A  1  121 ? -15.666  -30.180  134.535  1.00 61.33  ? 121 ALA 1 CA    1 
ATOM   952   C  C     . ALA A  1  121 ? -16.019  -31.498  133.848  1.00 64.04  ? 121 ALA 1 C     1 
ATOM   953   O  O     . ALA A  1  121 ? -16.870  -31.528  132.949  1.00 57.37  ? 121 ALA 1 O     1 
ATOM   954   C  CB    . ALA A  1  121 ? -14.410  -29.568  133.915  1.00 55.79  ? 121 ALA 1 CB    1 
ATOM   955   N  N     . GLY A  1  122 ? -15.365  -32.594  134.239  1.00 70.55  ? 122 GLY 1 N     1 
ATOM   956   C  CA    . GLY A  1  122 ? -15.684  -33.885  133.657  1.00 77.89  ? 122 GLY 1 CA    1 
ATOM   957   C  C     . GLY A  1  122 ? -17.099  -34.330  133.960  1.00 87.35  ? 122 GLY 1 C     1 
ATOM   958   O  O     . GLY A  1  122 ? -17.775  -34.901  133.103  1.00 97.76  ? 122 GLY 1 O     1 
ATOM   959   N  N     . TYR A  1  123 ? -17.550  -34.116  135.194  1.00 82.50  ? 123 TYR 1 N     1 
ATOM   960   C  CA    . TYR A  1  123 ? -18.952  -34.360  135.504  1.00 83.37  ? 123 TYR 1 CA    1 
ATOM   961   C  C     . TYR A  1  123 ? -19.853  -33.510  134.625  1.00 85.26  ? 123 TYR 1 C     1 
ATOM   962   O  O     . TYR A  1  123 ? -20.869  -33.990  134.111  1.00 77.61  ? 123 TYR 1 O     1 
ATOM   963   C  CB    . TYR A  1  123 ? -19.222  -34.075  136.982  1.00 79.44  ? 123 TYR 1 CB    1 
ATOM   964   C  CG    . TYR A  1  123 ? -20.663  -34.287  137.372  1.00 88.57  ? 123 TYR 1 CG    1 
ATOM   965   C  CD1   . TYR A  1  123 ? -21.234  -35.541  137.323  1.00 97.57  ? 123 TYR 1 CD1   1 
ATOM   966   C  CD2   . TYR A  1  123 ? -21.452  -33.228  137.782  1.00 95.14  ? 123 TYR 1 CD2   1 
ATOM   967   C  CE1   . TYR A  1  123 ? -22.556  -35.738  137.672  1.00 108.92 ? 123 TYR 1 CE1   1 
ATOM   968   C  CE2   . TYR A  1  123 ? -22.780  -33.418  138.131  1.00 104.77 ? 123 TYR 1 CE2   1 
ATOM   969   C  CZ    . TYR A  1  123 ? -23.326  -34.677  138.076  1.00 113.12 ? 123 TYR 1 CZ    1 
ATOM   970   O  OH    . TYR A  1  123 ? -24.645  -34.886  138.422  1.00 117.79 ? 123 TYR 1 OH    1 
ATOM   971   N  N     . ALA A  1  124 ? -19.468  -32.253  134.403  1.00 83.78  ? 124 ALA 1 N     1 
ATOM   972   C  CA    . ALA A  1  124 ? -20.284  -31.358  133.590  1.00 81.70  ? 124 ALA 1 CA    1 
ATOM   973   C  C     . ALA A  1  124 ? -20.422  -31.882  132.169  1.00 82.42  ? 124 ALA 1 C     1 
ATOM   974   O  O     . ALA A  1  124 ? -21.512  -31.846  131.588  1.00 82.15  ? 124 ALA 1 O     1 
ATOM   975   C  CB    . ALA A  1  124 ? -19.668  -29.960  133.581  1.00 83.90  ? 124 ALA 1 CB    1 
ATOM   976   N  N     . ILE A  1  125 ? -19.324  -32.372  131.594  1.00 88.86  ? 125 ILE 1 N     1 
ATOM   977   C  CA    . ILE A  1  125 ? -19.287  -32.738  130.181  1.00 87.63  ? 125 ILE 1 CA    1 
ATOM   978   C  C     . ILE A  1  125 ? -19.365  -34.248  129.974  1.00 75.51  ? 125 ILE 1 C     1 
ATOM   979   O  O     . ILE A  1  125 ? -19.081  -34.729  128.874  1.00 74.07  ? 125 ILE 1 O     1 
ATOM   980   C  CB    . ILE A  1  125 ? -18.040  -32.167  129.489  1.00 83.66  ? 125 ILE 1 CB    1 
ATOM   981   C  CG1   . ILE A  1  125 ? -16.777  -32.848  130.022  1.00 84.85  ? 125 ILE 1 CG1   1 
ATOM   982   C  CG2   . ILE A  1  125 ? -17.966  -30.656  129.678  1.00 76.05  ? 125 ILE 1 CG2   1 
ATOM   983   C  CD1   . ILE A  1  125 ? -15.481  -32.328  129.436  1.00 88.96  ? 125 ILE 1 CD1   1 
ATOM   984   N  N     . ARG A  1  126 ? -19.719  -35.009  131.009  1.00 77.31  ? 126 ARG 1 N     1 
ATOM   985   C  CA    . ARG A  1  126 ? -19.882  -36.461  130.907  1.00 86.26  ? 126 ARG 1 CA    1 
ATOM   986   C  C     . ARG A  1  126 ? -18.605  -37.140  130.423  1.00 88.13  ? 126 ARG 1 C     1 
ATOM   987   O  O     . ARG A  1  126 ? -18.649  -38.129  129.690  1.00 78.17  ? 126 ARG 1 O     1 
ATOM   988   C  CB    . ARG A  1  126 ? -21.061  -36.825  130.001  1.00 96.80  ? 126 ARG 1 CB    1 
ATOM   989   C  CG    . ARG A  1  126 ? -22.413  -36.430  130.576  1.00 110.63 ? 126 ARG 1 CG    1 
ATOM   990   C  CD    . ARG A  1  126 ? -22.785  -35.003  130.181  1.00 115.78 ? 126 ARG 1 CD    1 
ATOM   991   N  NE    . ARG A  1  126 ? -24.178  -34.698  130.479  1.00 120.40 ? 126 ARG 1 NE    1 
ATOM   992   C  CZ    . ARG A  1  126 ? -24.666  -33.468  130.608  1.00 120.94 ? 126 ARG 1 CZ    1 
ATOM   993   N  NH1   . ARG A  1  126 ? -23.877  -32.412  130.471  1.00 121.72 ? 126 ARG 1 NH1   1 
ATOM   994   N  NH2   . ARG A  1  126 ? -25.951  -33.297  130.881  1.00 116.04 ? 126 ARG 1 NH2   1 
ATOM   995   N  N     . ALA A  1  127 ? -17.461  -36.609  130.828  1.00 94.72  ? 127 ALA 1 N     1 
ATOM   996   C  CA    . ALA A  1  127 ? -16.170  -37.188  130.495  1.00 100.41 ? 127 ALA 1 CA    1 
ATOM   997   C  C     . ALA A  1  127 ? -15.723  -38.093  131.633  1.00 100.94 ? 127 ALA 1 C     1 
ATOM   998   O  O     . ALA A  1  127 ? -15.513  -37.624  132.757  1.00 106.79 ? 127 ALA 1 O     1 
ATOM   999   C  CB    . ALA A  1  127 ? -15.142  -36.092  130.237  1.00 103.27 ? 127 ALA 1 CB    1 
ATOM   1000  N  N     . THR A  1  128 ? -15.613  -39.390  131.350  1.00 92.72  ? 128 THR 1 N     1 
ATOM   1001  C  CA    . THR A  1  128 ? -15.221  -40.363  132.359  1.00 86.51  ? 128 THR 1 CA    1 
ATOM   1002  C  C     . THR A  1  128 ? -13.712  -40.495  132.497  1.00 82.87  ? 128 THR 1 C     1 
ATOM   1003  O  O     . THR A  1  128 ? -13.245  -41.078  133.482  1.00 78.29  ? 128 THR 1 O     1 
ATOM   1004  C  CB    . THR A  1  128 ? -15.827  -41.737  132.040  1.00 86.46  ? 128 THR 1 CB    1 
ATOM   1005  O  OG1   . THR A  1  128 ? -15.004  -42.411  131.085  1.00 92.15  ? 128 THR 1 OG1   1 
ATOM   1006  C  CG2   . THR A  1  128 ? -17.231  -41.590  131.467  1.00 84.45  ? 128 THR 1 CG2   1 
ATOM   1007  N  N     . VAL A  1  129 ? -12.944  -39.977  131.539  1.00 75.11  ? 129 VAL 1 N     1 
ATOM   1008  C  CA    . VAL A  1  129 ? -11.489  -40.012  131.584  1.00 57.67  ? 129 VAL 1 CA    1 
ATOM   1009  C  C     . VAL A  1  129 ? -10.946  -38.638  131.208  1.00 65.60  ? 129 VAL 1 C     1 
ATOM   1010  O  O     . VAL A  1  129 ? -11.547  -37.883  130.432  1.00 69.27  ? 129 VAL 1 O     1 
ATOM   1011  C  CB    . VAL A  1  129 ? -10.896  -41.107  130.657  1.00 59.74  ? 129 VAL 1 CB    1 
ATOM   1012  C  CG1   . VAL A  1  129 ? -9.371   -41.176  130.767  1.00 55.10  ? 129 VAL 1 CG1   1 
ATOM   1013  C  CG2   . VAL A  1  129 ? -11.488  -42.471  130.985  1.00 66.51  ? 129 VAL 1 CG2   1 
ATOM   1014  N  N     . GLY A  1  130 ? -9.802   -38.311  131.781  1.00 63.90  ? 130 GLY 1 N     1 
ATOM   1015  C  CA    . GLY A  1  130 ? -9.129   -37.071  131.465  1.00 57.97  ? 130 GLY 1 CA    1 
ATOM   1016  C  C     . GLY A  1  130 ? -7.647   -37.314  131.323  1.00 59.95  ? 130 GLY 1 C     1 
ATOM   1017  O  O     . GLY A  1  130 ? -7.071   -38.199  131.961  1.00 64.37  ? 130 GLY 1 O     1 
ATOM   1018  N  N     . TYR A  1  131 ? -7.043   -36.537  130.439  1.00 63.22  ? 131 TYR 1 N     1 
ATOM   1019  C  CA    . TYR A  1  131 ? -5.604   -36.530  130.247  1.00 68.23  ? 131 TYR 1 CA    1 
ATOM   1020  C  C     . TYR A  1  131 ? -5.080   -35.135  130.542  1.00 77.27  ? 131 TYR 1 C     1 
ATOM   1021  O  O     . TYR A  1  131 ? -5.700   -34.133  130.170  1.00 65.85  ? 131 TYR 1 O     1 
ATOM   1022  C  CB    . TYR A  1  131 ? -5.214   -36.960  128.821  1.00 61.69  ? 131 TYR 1 CB    1 
ATOM   1023  C  CG    . TYR A  1  131 ? -5.374   -38.446  128.547  1.00 60.11  ? 131 TYR 1 CG    1 
ATOM   1024  C  CD1   . TYR A  1  131 ? -6.595   -38.983  128.201  1.00 62.63  ? 131 TYR 1 CD1   1 
ATOM   1025  C  CD2   . TYR A  1  131 ? -4.298   -39.308  128.628  1.00 58.20  ? 131 TYR 1 CD2   1 
ATOM   1026  C  CE1   . TYR A  1  131 ? -6.739   -40.341  127.955  1.00 66.25  ? 131 TYR 1 CE1   1 
ATOM   1027  C  CE2   . TYR A  1  131 ? -4.439   -40.668  128.382  1.00 68.27  ? 131 TYR 1 CE2   1 
ATOM   1028  C  CZ    . TYR A  1  131 ? -5.661   -41.177  128.044  1.00 74.99  ? 131 TYR 1 CZ    1 
ATOM   1029  O  OH    . TYR A  1  131 ? -5.821   -42.524  127.799  1.00 80.16  ? 131 TYR 1 OH    1 
ATOM   1030  N  N     . ILE A  1  132 ? -3.945   -35.081  131.222  1.00 104.22 ? 132 ILE 1 N     1 
ATOM   1031  C  CA    . ILE A  1  132 ? -3.267   -33.837  131.552  1.00 114.21 ? 132 ILE 1 CA    1 
ATOM   1032  C  C     . ILE A  1  132 ? -1.976   -33.822  130.754  1.00 113.88 ? 132 ILE 1 C     1 
ATOM   1033  O  O     . ILE A  1  132 ? -1.043   -34.579  131.058  1.00 118.01 ? 132 ILE 1 O     1 
ATOM   1034  C  CB    . ILE A  1  132 ? -2.985   -33.721  133.053  1.00 125.85 ? 132 ILE 1 CB    1 
ATOM   1035  C  CG1   . ILE A  1  132 ? -4.279   -33.867  133.853  1.00 140.81 ? 132 ILE 1 CG1   1 
ATOM   1036  C  CG2   . ILE A  1  132 ? -2.302   -32.400  133.355  1.00 130.46 ? 132 ILE 1 CG2   1 
ATOM   1037  C  CD1   . ILE A  1  132 ? -4.128   -33.597  135.333  1.00 147.12 ? 132 ILE 1 CD1   1 
ATOM   1038  N  N     . TYR A  1  133 ? -1.910   -32.966  129.738  1.00 106.27 ? 133 TYR 1 N     1 
ATOM   1039  C  CA    . TYR A  1  133 ? -0.753   -32.897  128.851  1.00 104.07 ? 133 TYR 1 CA    1 
ATOM   1040  C  C     . TYR A  1  133 ? 0.132    -31.767  129.347  1.00 86.32  ? 133 TYR 1 C     1 
ATOM   1041  O  O     . TYR A  1  133 ? -0.211   -30.589  129.201  1.00 79.84  ? 133 TYR 1 O     1 
ATOM   1042  C  CB    . TYR A  1  133 ? -1.168   -32.678  127.396  1.00 115.51 ? 133 TYR 1 CB    1 
ATOM   1043  C  CG    . TYR A  1  133 ? -0.013   -32.588  126.406  1.00 123.29 ? 133 TYR 1 CG    1 
ATOM   1044  C  CD1   . TYR A  1  133 ? 0.629    -31.384  126.153  1.00 124.02 ? 133 TYR 1 CD1   1 
ATOM   1045  C  CD2   . TYR A  1  133 ? 0.424    -33.707  125.715  1.00 132.36 ? 133 TYR 1 CD2   1 
ATOM   1046  C  CE1   . TYR A  1  133 ? 1.680    -31.302  125.243  1.00 130.10 ? 133 TYR 1 CE1   1 
ATOM   1047  C  CE2   . TYR A  1  133 ? 1.472    -33.630  124.807  1.00 141.00 ? 133 TYR 1 CE2   1 
ATOM   1048  C  CZ    . TYR A  1  133 ? 2.096    -32.427  124.575  1.00 138.14 ? 133 TYR 1 CZ    1 
ATOM   1049  O  OH    . TYR A  1  133 ? 3.136    -32.358  123.673  1.00 137.92 ? 133 TYR 1 OH    1 
ATOM   1050  N  N     . VAL A  1  134 ? 1.250    -32.141  129.955  1.00 84.34  ? 134 VAL 1 N     1 
ATOM   1051  C  CA    . VAL A  1  134 ? 2.192    -31.199  130.538  1.00 98.52  ? 134 VAL 1 CA    1 
ATOM   1052  C  C     . VAL A  1  134 ? 3.403    -31.098  129.628  1.00 92.06  ? 134 VAL 1 C     1 
ATOM   1053  O  O     . VAL A  1  134 ? 3.763    -32.050  128.923  1.00 90.81  ? 134 VAL 1 O     1 
ATOM   1054  C  CB    . VAL A  1  134 ? 2.599    -31.629  131.966  1.00 126.61 ? 134 VAL 1 CB    1 
ATOM   1055  C  CG1   . VAL A  1  134 ? 1.376    -32.065  132.753  1.00 129.88 ? 134 VAL 1 CG1   1 
ATOM   1056  C  CG2   . VAL A  1  134 ? 3.649    -32.731  131.923  1.00 134.96 ? 134 VAL 1 CG2   1 
ATOM   1057  N  N     . ARG A  1  135 ? 4.023    -29.925  129.615  1.00 57.45  ? 135 ARG 1 N     1 
ATOM   1058  C  CA    . ARG A  1  135 ? 5.242    -29.754  128.842  1.00 63.94  ? 135 ARG 1 CA    1 
ATOM   1059  C  C     . ARG A  1  135 ? 6.398    -30.510  129.486  1.00 83.59  ? 135 ARG 1 C     1 
ATOM   1060  O  O     . ARG A  1  135 ? 6.468    -30.661  130.707  1.00 88.40  ? 135 ARG 1 O     1 
ATOM   1061  C  CB    . ARG A  1  135 ? 5.586    -28.272  128.702  1.00 57.81  ? 135 ARG 1 CB    1 
ATOM   1062  C  CG    . ARG A  1  135 ? 5.656    -27.503  130.002  1.00 61.84  ? 135 ARG 1 CG    1 
ATOM   1063  C  CD    . ARG A  1  135 ? 6.092    -26.057  129.768  1.00 69.46  ? 135 ARG 1 CD    1 
ATOM   1064  N  NE    . ARG A  1  135 ? 7.463    -25.977  129.272  1.00 82.38  ? 135 ARG 1 NE    1 
ATOM   1065  C  CZ    . ARG A  1  135 ? 8.095    -24.843  128.988  1.00 83.21  ? 135 ARG 1 CZ    1 
ATOM   1066  N  NH1   . ARG A  1  135 ? 7.491    -23.675  129.143  1.00 82.53  ? 135 ARG 1 NH1   1 
ATOM   1067  N  NH2   . ARG A  1  135 ? 9.342    -24.881  128.548  1.00 76.59  ? 135 ARG 1 NH2   1 
ATOM   1068  N  N     . GLY A  1  136 ? 7.309    -30.990  128.645  1.00 94.09  ? 136 GLY 1 N     1 
ATOM   1069  C  CA    . GLY A  1  136 ? 8.411    -31.801  129.118  1.00 92.97  ? 136 GLY 1 CA    1 
ATOM   1070  C  C     . GLY A  1  136 ? 9.517    -31.063  129.831  1.00 94.52  ? 136 GLY 1 C     1 
ATOM   1071  O  O     . GLY A  1  136 ? 10.540   -31.670  130.157  1.00 96.93  ? 136 GLY 1 O     1 
ATOM   1072  N  N     . GLU A  1  137 ? 9.339    -29.768  130.091  1.00 97.78  ? 137 GLU 1 N     1 
ATOM   1073  C  CA    . GLU A  1  137 ? 10.305   -28.977  130.836  1.00 106.53 ? 137 GLU 1 CA    1 
ATOM   1074  C  C     . GLU A  1  137 ? 9.944    -28.801  132.308  1.00 125.13 ? 137 GLU 1 C     1 
ATOM   1075  O  O     . GLU A  1  137 ? 10.809   -28.401  133.095  1.00 137.71 ? 137 GLU 1 O     1 
ATOM   1076  C  CB    . GLU A  1  137 ? 10.457   -27.600  130.175  1.00 109.41 ? 137 GLU 1 CB    1 
ATOM   1077  C  CG    . GLU A  1  137 ? 11.401   -27.606  128.980  1.00 118.43 ? 137 GLU 1 CG    1 
ATOM   1078  C  CD    . GLU A  1  137 ? 10.762   -28.200  127.740  1.00 133.93 ? 137 GLU 1 CD    1 
ATOM   1079  O  OE1   . GLU A  1  137 ? 9.524    -28.140  127.630  1.00 142.61 ? 137 GLU 1 OE1   1 
ATOM   1080  O  OE2   . GLU A  1  137 ? 11.487   -28.753  126.889  1.00 140.81 ? 137 GLU 1 OE2   1 
ATOM   1081  N  N     . TYR A  1  138 ? 8.701    -29.088  132.700  1.00 128.22 ? 138 TYR 1 N     1 
ATOM   1082  C  CA    . TYR A  1  138 ? 8.269    -29.015  134.099  1.00 125.53 ? 138 TYR 1 CA    1 
ATOM   1083  C  C     . TYR A  1  138 ? 8.347    -30.426  134.676  1.00 132.44 ? 138 TYR 1 C     1 
ATOM   1084  O  O     . TYR A  1  138 ? 7.414    -31.219  134.522  1.00 143.57 ? 138 TYR 1 O     1 
ATOM   1085  C  CB    . TYR A  1  138 ? 6.851    -28.458  134.213  1.00 113.45 ? 138 TYR 1 CB    1 
ATOM   1086  C  CG    . TYR A  1  138 ? 6.711    -26.966  133.961  1.00 109.59 ? 138 TYR 1 CG    1 
ATOM   1087  C  CD1   . TYR A  1  138 ? 7.787    -26.203  133.553  1.00 116.07 ? 138 TYR 1 CD1   1 
ATOM   1088  C  CD2   . TYR A  1  138 ? 5.493    -26.322  134.137  1.00 100.35 ? 138 TYR 1 CD2   1 
ATOM   1089  C  CE1   . TYR A  1  138 ? 7.655    -24.842  133.317  1.00 111.43 ? 138 TYR 1 CE1   1 
ATOM   1090  C  CE2   . TYR A  1  138 ? 5.355    -24.961  133.903  1.00 96.93  ? 138 TYR 1 CE2   1 
ATOM   1091  C  CZ    . TYR A  1  138 ? 6.439    -24.226  133.497  1.00 105.03 ? 138 TYR 1 CZ    1 
ATOM   1092  O  OH    . TYR A  1  138 ? 6.307    -22.874  133.264  1.00 109.58 ? 138 TYR 1 OH    1 
ATOM   1093  N  N     . ARG A  1  139 ? 9.459    -30.746  135.340  1.00 117.93 ? 139 ARG 1 N     1 
ATOM   1094  C  CA    . ARG A  1  139 ? 9.558    -32.077  135.926  1.00 105.64 ? 139 ARG 1 CA    1 
ATOM   1095  C  C     . ARG A  1  139 ? 9.105    -32.112  137.380  1.00 96.01  ? 139 ARG 1 C     1 
ATOM   1096  O  O     . ARG A  1  139 ? 8.483    -33.090  137.804  1.00 87.63  ? 139 ARG 1 O     1 
ATOM   1097  C  CB    . ARG A  1  139 ? 10.987   -32.623  135.821  1.00 102.64 ? 139 ARG 1 CB    1 
ATOM   1098  C  CG    . ARG A  1  139 ? 11.061   -34.074  136.285  1.00 104.53 ? 139 ARG 1 CG    1 
ATOM   1099  C  CD    . ARG A  1  139 ? 12.452   -34.666  136.337  1.00 106.09 ? 139 ARG 1 CD    1 
ATOM   1100  N  NE    . ARG A  1  139 ? 12.410   -36.082  136.696  1.00 106.80 ? 139 ARG 1 NE    1 
ATOM   1101  C  CZ    . ARG A  1  139 ? 12.294   -36.529  137.941  1.00 112.95 ? 139 ARG 1 CZ    1 
ATOM   1102  N  NH1   . ARG A  1  139 ? 12.203   -35.678  138.949  1.00 119.03 ? 139 ARG 1 NH1   1 
ATOM   1103  N  NH2   . ARG A  1  139 ? 12.271   -37.831  138.182  1.00 113.79 ? 139 ARG 1 NH2   1 
ATOM   1104  N  N     . ARG A  1  140 ? 9.399    -31.077  138.166  1.00 98.95  ? 140 ARG 1 N     1 
ATOM   1105  C  CA    . ARG A  1  140 ? 8.922    -31.062  139.546  1.00 112.46 ? 140 ARG 1 CA    1 
ATOM   1106  C  C     . ARG A  1  140 ? 7.401    -31.050  139.591  1.00 98.20  ? 140 ARG 1 C     1 
ATOM   1107  O  O     . ARG A  1  140 ? 6.782    -31.787  140.370  1.00 95.21  ? 140 ARG 1 O     1 
ATOM   1108  C  CB    . ARG A  1  140 ? 9.502    -29.861  140.296  1.00 134.18 ? 140 ARG 1 CB    1 
ATOM   1109  C  CG    . ARG A  1  140 ? 8.927    -29.656  141.689  1.00 141.83 ? 140 ARG 1 CG    1 
ATOM   1110  C  CD    . ARG A  1  140 ? 9.945    -29.002  142.612  1.00 141.37 ? 140 ARG 1 CD    1 
ATOM   1111  N  NE    . ARG A  1  140 ? 11.003   -29.928  143.001  1.00 140.00 ? 140 ARG 1 NE    1 
ATOM   1112  C  CZ    . ARG A  1  140 ? 12.158   -29.556  143.543  1.00 131.50 ? 140 ARG 1 CZ    1 
ATOM   1113  N  NH1   . ARG A  1  140 ? 12.410   -28.273  143.756  1.00 131.97 ? 140 ARG 1 NH1   1 
ATOM   1114  N  NH2   . ARG A  1  140 ? 13.065   -30.465  143.870  1.00 122.07 ? 140 ARG 1 NH2   1 
ATOM   1115  N  N     . ALA A  1  141 ? 6.782    -30.208  138.762  1.00 90.00  ? 141 ALA 1 N     1 
ATOM   1116  C  CA    . ALA A  1  141 ? 5.326    -30.181  138.671  1.00 90.84  ? 141 ALA 1 CA    1 
ATOM   1117  C  C     . ALA A  1  141 ? 4.770    -31.535  138.247  1.00 95.87  ? 141 ALA 1 C     1 
ATOM   1118  O  O     . ALA A  1  141 ? 3.754    -31.990  138.781  1.00 95.94  ? 141 ALA 1 O     1 
ATOM   1119  C  CB    . ALA A  1  141 ? 4.891    -29.088  137.697  1.00 83.80  ? 141 ALA 1 CB    1 
ATOM   1120  N  N     . ALA A  1  142 ? 5.432    -32.199  137.298  1.00 92.71  ? 142 ALA 1 N     1 
ATOM   1121  C  CA    . ALA A  1  142 ? 4.966    -33.500  136.825  1.00 90.64  ? 142 ALA 1 CA    1 
ATOM   1122  C  C     . ALA A  1  142 ? 5.069    -34.560  137.913  1.00 99.15  ? 142 ALA 1 C     1 
ATOM   1123  O  O     . ALA A  1  142 ? 4.176    -35.403  138.055  1.00 104.81 ? 142 ALA 1 O     1 
ATOM   1124  C  CB    . ALA A  1  142 ? 5.767    -33.926  135.597  1.00 93.85  ? 142 ALA 1 CB    1 
ATOM   1125  N  N     . ASP A  1  143 ? 6.162    -34.547  138.675  1.00 105.62 ? 143 ASP 1 N     1 
ATOM   1126  C  CA    . ASP A  1  143 ? 6.306    -35.485  139.781  1.00 111.75 ? 143 ASP 1 CA    1 
ATOM   1127  C  C     . ASP A  1  143 ? 5.219    -35.257  140.821  1.00 109.35 ? 143 ASP 1 C     1 
ATOM   1128  O  O     . ASP A  1  143 ? 4.581    -36.207  141.288  1.00 99.07  ? 143 ASP 1 O     1 
ATOM   1129  C  CB    . ASP A  1  143 ? 7.690    -35.340  140.415  1.00 120.56 ? 143 ASP 1 CB    1 
ATOM   1130  C  CG    . ASP A  1  143 ? 8.800    -35.836  139.512  1.00 136.76 ? 143 ASP 1 CG    1 
ATOM   1131  O  OD1   . ASP A  1  143 ? 8.513    -36.605  138.573  1.00 146.64 ? 143 ASP 1 OD1   1 
ATOM   1132  O  OD2   . ASP A  1  143 ? 9.965    -35.458  139.746  1.00 140.45 ? 143 ASP 1 OD2   1 
ATOM   1133  N  N     . ARG A  1  144 ? 4.982    -33.992  141.183  1.00 119.21 ? 144 ARG 1 N     1 
ATOM   1134  C  CA    . ARG A  1  144 ? 3.955    -33.697  142.176  1.00 123.65 ? 144 ARG 1 CA    1 
ATOM   1135  C  C     . ARG A  1  144 ? 2.577    -34.081  141.668  1.00 108.13 ? 144 ARG 1 C     1 
ATOM   1136  O  O     . ARG A  1  144 ? 1.743    -34.557  142.440  1.00 110.20 ? 144 ARG 1 O     1 
ATOM   1137  C  CB    . ARG A  1  144 ? 3.994    -32.215  142.558  1.00 133.94 ? 144 ARG 1 CB    1 
ATOM   1138  C  CG    . ARG A  1  144 ? 5.338    -31.774  143.110  1.00 140.42 ? 144 ARG 1 CG    1 
ATOM   1139  C  CD    . ARG A  1  144 ? 5.379    -31.832  144.620  1.00 144.76 ? 144 ARG 1 CD    1 
ATOM   1140  N  NE    . ARG A  1  144 ? 6.311    -30.851  145.165  1.00 147.83 ? 144 ARG 1 NE    1 
ATOM   1141  C  CZ    . ARG A  1  144 ? 7.554    -31.135  145.540  1.00 148.00 ? 144 ARG 1 CZ    1 
ATOM   1142  N  NH1   . ARG A  1  144 ? 8.015    -32.373  145.435  1.00 145.68 ? 144 ARG 1 NH1   1 
ATOM   1143  N  NH2   . ARG A  1  144 ? 8.331    -30.181  146.028  1.00 146.98 ? 144 ARG 1 NH2   1 
ATOM   1144  N  N     . LEU A  1  145 ? 2.340    -33.926  140.367  1.00 90.35  ? 145 LEU 1 N     1 
ATOM   1145  C  CA    . LEU A  1  145 ? 1.045    -34.270  139.797  1.00 81.06  ? 145 LEU 1 CA    1 
ATOM   1146  C  C     . LEU A  1  145 ? 0.837    -35.777  139.792  1.00 76.93  ? 145 LEU 1 C     1 
ATOM   1147  O  O     . LEU A  1  145 ? -0.221   -36.268  140.191  1.00 68.56  ? 145 LEU 1 O     1 
ATOM   1148  C  CB    . LEU A  1  145 ? 0.943    -33.706  138.380  1.00 72.76  ? 145 LEU 1 CB    1 
ATOM   1149  C  CG    . LEU A  1  145 ? 0.438    -32.273  138.233  1.00 70.13  ? 145 LEU 1 CG    1 
ATOM   1150  C  CD1   . LEU A  1  145 ? 0.332    -31.885  136.767  1.00 83.30  ? 145 LEU 1 CD1   1 
ATOM   1151  C  CD2   . LEU A  1  145 ? -0.902   -32.114  138.929  1.00 66.27  ? 145 LEU 1 CD2   1 
ATOM   1152  N  N     . GLU A  1  146 ? 1.842    -36.527  139.338  1.00 76.45  ? 146 GLU 1 N     1 
ATOM   1153  C  CA    . GLU A  1  146 ? 1.748    -37.980  139.373  1.00 78.77  ? 146 GLU 1 CA    1 
ATOM   1154  C  C     . GLU A  1  146 ? 1.558    -38.478  140.800  1.00 77.25  ? 146 GLU 1 C     1 
ATOM   1155  O  O     . GLU A  1  146 ? 0.746    -39.375  141.045  1.00 75.35  ? 146 GLU 1 O     1 
ATOM   1156  C  CB    . GLU A  1  146 ? 2.992    -38.608  138.740  1.00 95.74  ? 146 GLU 1 CB    1 
ATOM   1157  C  CG    . GLU A  1  146 ? 2.771    -40.028  138.225  1.00 102.40 ? 146 GLU 1 CG    1 
ATOM   1158  C  CD    . GLU A  1  146 ? 2.186    -40.059  136.827  1.00 108.71 ? 146 GLU 1 CD    1 
ATOM   1159  O  OE1   . GLU A  1  146 ? 0.995    -40.393  136.694  1.00 114.39 ? 146 GLU 1 OE1   1 
ATOM   1160  O  OE2   . GLU A  1  146 ? 2.914    -39.752  135.859  1.00 111.57 ? 146 GLU 1 OE2   1 
ATOM   1161  N  N     . GLN A  1  147 ? 2.319    -37.925  141.748  1.00 80.69  ? 147 GLN 1 N     1 
ATOM   1162  C  CA    . GLN A  1  147 ? 2.185    -38.305  143.153  1.00 97.73  ? 147 GLN 1 CA    1 
ATOM   1163  C  C     . GLN A  1  147 ? 0.792    -37.987  143.685  1.00 86.59  ? 147 GLN 1 C     1 
ATOM   1164  O  O     . GLN A  1  147 ? 0.204    -38.786  144.419  1.00 74.87  ? 147 GLN 1 O     1 
ATOM   1165  C  CB    . GLN A  1  147 ? 3.253    -37.597  143.991  1.00 111.45 ? 147 GLN 1 CB    1 
ATOM   1166  C  CG    . GLN A  1  147 ? 3.267    -37.999  145.468  1.00 117.71 ? 147 GLN 1 CG    1 
ATOM   1167  C  CD    . GLN A  1  147 ? 4.403    -37.358  146.248  1.00 124.85 ? 147 GLN 1 CD    1 
ATOM   1168  O  OE1   . GLN A  1  147 ? 5.245    -36.665  145.681  1.00 130.70 ? 147 GLN 1 OE1   1 
ATOM   1169  N  NE2   . GLN A  1  147 ? 4.438    -37.600  147.554  1.00 123.50 ? 147 GLN 1 NE2   1 
ATOM   1170  N  N     . ALA A  1  148 ? 0.265    -36.803  143.364  1.00 83.95  ? 148 ALA 1 N     1 
ATOM   1171  C  CA    . ALA A  1  148 ? -1.068   -36.431  143.830  1.00 82.64  ? 148 ALA 1 CA    1 
ATOM   1172  C  C     . ALA A  1  148 ? -2.131   -37.340  143.229  1.00 70.04  ? 148 ALA 1 C     1 
ATOM   1173  O  O     . ALA A  1  148 ? -3.099   -37.702  143.904  1.00 67.99  ? 148 ALA 1 O     1 
ATOM   1174  C  CB    . ALA A  1  148 ? -1.347   -34.967  143.496  1.00 83.04  ? 148 ALA 1 CB    1 
ATOM   1175  N  N     . ILE A  1  149 ? -1.980   -37.701  141.952  1.00 67.39  ? 149 ILE 1 N     1 
ATOM   1176  C  CA    . ILE A  1  149 ? -2.926   -38.619  141.328  1.00 87.81  ? 149 ILE 1 CA    1 
ATOM   1177  C  C     . ILE A  1  149 ? -2.825   -39.993  141.975  1.00 94.01  ? 149 ILE 1 C     1 
ATOM   1178  O  O     . ILE A  1  149 ? -3.837   -40.665  142.194  1.00 100.70 ? 149 ILE 1 O     1 
ATOM   1179  C  CB    . ILE A  1  149 ? -2.706   -38.693  139.804  1.00 97.07  ? 149 ILE 1 CB    1 
ATOM   1180  C  CG1   . ILE A  1  149 ? -2.981   -37.337  139.148  1.00 101.05 ? 149 ILE 1 CG1   1 
ATOM   1181  C  CG2   . ILE A  1  149 ? -3.601   -39.756  139.179  1.00 95.96  ? 149 ILE 1 CG2   1 
ATOM   1182  C  CD1   . ILE A  1  149 ? -3.079   -37.382  137.640  1.00 83.81  ? 149 ILE 1 CD1   1 
ATOM   1183  N  N     . LYS A  1  150 ? -1.607   -40.431  142.291  1.00 89.58  ? 150 LYS 1 N     1 
ATOM   1184  C  CA    . LYS A  1  150 ? -1.442   -41.689  143.010  1.00 89.35  ? 150 LYS 1 CA    1 
ATOM   1185  C  C     . LYS A  1  150 ? -2.126   -41.628  144.368  1.00 96.47  ? 150 LYS 1 C     1 
ATOM   1186  O  O     . LYS A  1  150 ? -2.778   -42.588  144.785  1.00 102.34 ? 150 LYS 1 O     1 
ATOM   1187  C  CB    . LYS A  1  150 ? 0.043    -42.005  143.176  1.00 97.57  ? 150 LYS 1 CB    1 
ATOM   1188  C  CG    . LYS A  1  150 ? 0.753    -42.379  141.893  1.00 101.51 ? 150 LYS 1 CG    1 
ATOM   1189  C  CD    . LYS A  1  150 ? 2.097    -42.998  142.201  1.00 98.93  ? 150 LYS 1 CD    1 
ATOM   1190  C  CE    . LYS A  1  150 ? 2.845    -43.311  140.932  1.00 97.84  ? 150 LYS 1 CE    1 
ATOM   1191  N  NZ    . LYS A  1  150 ? 3.668    -42.154  140.514  1.00 94.94  ? 150 LYS 1 NZ    1 
ATOM   1192  N  N     . GLU A  1  151 ? -1.996   -40.497  145.063  1.00 107.10 ? 151 GLU 1 N     1 
ATOM   1193  C  CA    . GLU A  1  151 ? -2.634   -40.333  146.366  1.00 101.43 ? 151 GLU 1 CA    1 
ATOM   1194  C  C     . GLU A  1  151 ? -4.150   -40.408  146.243  1.00 102.69 ? 151 GLU 1 C     1 
ATOM   1195  O  O     . GLU A  1  151 ? -4.820   -41.083  147.035  1.00 118.91 ? 151 GLU 1 O     1 
ATOM   1196  C  CB    . GLU A  1  151 ? -2.221   -39.000  146.993  1.00 93.90  ? 151 GLU 1 CB    1 
ATOM   1197  C  CG    . GLU A  1  151 ? -0.795   -38.931  147.515  1.00 93.67  ? 151 GLU 1 CG    1 
ATOM   1198  C  CD    . GLU A  1  151 ? -0.513   -37.614  148.201  1.00 101.95 ? 151 GLU 1 CD    1 
ATOM   1199  O  OE1   . GLU A  1  151 ? -0.617   -37.549  149.443  1.00 106.99 ? 151 GLU 1 OE1   1 
ATOM   1200  O  OE2   . GLU A  1  151 ? -0.203   -36.635  147.498  1.00 103.57 ? 151 GLU 1 OE2   1 
ATOM   1201  N  N     . ALA A  1  152 ? -4.710   -39.666  145.289  1.00 87.06  ? 152 ALA 1 N     1 
ATOM   1202  C  CA    . ALA A  1  152 ? -6.155   -39.671  145.089  1.00 82.24  ? 152 ALA 1 CA    1 
ATOM   1203  C  C     . ALA A  1  152 ? -6.652   -41.056  144.689  1.00 95.88  ? 152 ALA 1 C     1 
ATOM   1204  O  O     . ALA A  1  152 ? -7.737   -41.477  145.100  1.00 101.28 ? 152 ALA 1 O     1 
ATOM   1205  C  CB    . ALA A  1  152 ? -6.540   -38.630  144.038  1.00 72.80  ? 152 ALA 1 CB    1 
ATOM   1206  N  N     . ARG A  1  153 ? -5.876   -41.775  143.878  1.00 95.89  ? 153 ARG 1 N     1 
ATOM   1207  C  CA    . ARG A  1  153 ? -6.265   -43.126  143.497  1.00 94.91  ? 153 ARG 1 CA    1 
ATOM   1208  C  C     . ARG A  1  153 ? -6.209   -44.065  144.696  1.00 75.49  ? 153 ARG 1 C     1 
ATOM   1209  O  O     . ARG A  1  153 ? -7.051   -44.958  144.835  1.00 75.96  ? 153 ARG 1 O     1 
ATOM   1210  C  CB    . ARG A  1  153 ? -5.360   -43.632  142.372  1.00 107.81 ? 153 ARG 1 CB    1 
ATOM   1211  C  CG    . ARG A  1  153 ? -5.956   -43.532  140.969  1.00 115.97 ? 153 ARG 1 CG    1 
ATOM   1212  C  CD    . ARG A  1  153 ? -5.016   -44.128  139.926  1.00 120.15 ? 153 ARG 1 CD    1 
ATOM   1213  N  NE    . ARG A  1  153 ? -4.332   -43.103  139.143  1.00 125.95 ? 153 ARG 1 NE    1 
ATOM   1214  C  CZ    . ARG A  1  153 ? -3.634   -43.354  138.040  1.00 130.10 ? 153 ARG 1 CZ    1 
ATOM   1215  N  NH1   . ARG A  1  153 ? -3.524   -44.594  137.587  1.00 135.92 ? 153 ARG 1 NH1   1 
ATOM   1216  N  NH2   . ARG A  1  153 ? -3.037   -42.365  137.393  1.00 124.56 ? 153 ARG 1 NH2   1 
ATOM   1217  N  N     . ALA A  1  154 ? -5.217   -43.881  145.567  1.00 63.70  ? 154 ALA 1 N     1 
ATOM   1218  C  CA    . ALA A  1  154 ? -5.109   -44.706  146.765  1.00 74.66  ? 154 ALA 1 CA    1 
ATOM   1219  C  C     . ALA A  1  154 ? -6.285   -44.472  147.711  1.00 87.77  ? 154 ALA 1 C     1 
ATOM   1220  O  O     . ALA A  1  154 ? -6.979   -45.419  148.095  1.00 79.20  ? 154 ALA 1 O     1 
ATOM   1221  C  CB    . ALA A  1  154 ? -3.778   -44.429  147.467  1.00 86.32  ? 154 ALA 1 CB    1 
ATOM   1222  N  N     . ARG A  1  155 ? -6.534   -43.216  148.092  1.00 106.78 ? 155 ARG 1 N     1 
ATOM   1223  C  CA    . ARG A  1  155 ? -7.587   -42.913  149.063  1.00 116.17 ? 155 ARG 1 CA    1 
ATOM   1224  C  C     . ARG A  1  155 ? -8.980   -42.790  148.439  1.00 120.88 ? 155 ARG 1 C     1 
ATOM   1225  O  O     . ARG A  1  155 ? -9.917   -42.378  149.135  1.00 118.00 ? 155 ARG 1 O     1 
ATOM   1226  C  CB    . ARG A  1  155 ? -7.255   -41.636  149.837  1.00 118.62 ? 155 ARG 1 CB    1 
ATOM   1227  C  CG    . ARG A  1  155 ? -6.110   -41.789  150.824  1.00 122.02 ? 155 ARG 1 CG    1 
ATOM   1228  C  CD    . ARG A  1  155 ? -6.007   -40.582  151.729  1.00 128.42 ? 155 ARG 1 CD    1 
ATOM   1229  N  NE    . ARG A  1  155 ? -4.856   -40.662  152.615  1.00 135.85 ? 155 ARG 1 NE    1 
ATOM   1230  C  CZ    . ARG A  1  155 ? -4.496   -39.694  153.447  1.00 145.04 ? 155 ARG 1 CZ    1 
ATOM   1231  N  NH1   . ARG A  1  155 ? -5.199   -38.573  153.505  1.00 146.39 ? 155 ARG 1 NH1   1 
ATOM   1232  N  NH2   . ARG A  1  155 ? -3.434   -39.843  154.221  1.00 149.88 ? 155 ARG 1 NH2   1 
ATOM   1233  N  N     . GLY A  1  156 ? -9.133   -43.111  147.155  1.00 113.72 ? 156 GLY 1 N     1 
ATOM   1234  C  CA    . GLY A  1  156 ? -10.446  -43.231  146.543  1.00 116.85 ? 156 GLY 1 CA    1 
ATOM   1235  C  C     . GLY A  1  156 ? -11.053  -41.979  145.952  1.00 111.30 ? 156 GLY 1 C     1 
ATOM   1236  O  O     . GLY A  1  156 ? -12.273  -41.941  145.755  1.00 107.29 ? 156 GLY 1 O     1 
ATOM   1237  N  N     . TYR A  1  157 ? -10.250  -40.959  145.646  1.00 115.46 ? 157 TYR 1 N     1 
ATOM   1238  C  CA    . TYR A  1  157 ? -10.777  -39.757  145.003  1.00 124.25 ? 157 TYR 1 CA    1 
ATOM   1239  C  C     . TYR A  1  157 ? -10.858  -39.888  143.481  1.00 131.58 ? 157 TYR 1 C     1 
ATOM   1240  O  O     . TYR A  1  157 ? -11.603  -39.132  142.847  1.00 130.53 ? 157 TYR 1 O     1 
ATOM   1241  C  CB    . TYR A  1  157 ? -9.935   -38.544  145.423  1.00 126.06 ? 157 TYR 1 CB    1 
ATOM   1242  C  CG    . TYR A  1  157 ? -10.086  -38.186  146.903  1.00 128.37 ? 157 TYR 1 CG    1 
ATOM   1243  C  CD1   . TYR A  1  157 ? -11.092  -37.333  147.340  1.00 129.84 ? 157 TYR 1 CD1   1 
ATOM   1244  C  CD2   . TYR A  1  157 ? -9.226   -38.709  147.861  1.00 126.51 ? 157 TYR 1 CD2   1 
ATOM   1245  C  CE1   . TYR A  1  157 ? -11.234  -37.010  148.693  1.00 129.52 ? 157 TYR 1 CE1   1 
ATOM   1246  C  CE2   . TYR A  1  157 ? -9.364   -38.389  149.211  1.00 128.56 ? 157 TYR 1 CE2   1 
ATOM   1247  C  CZ    . TYR A  1  157 ? -10.367  -37.542  149.619  1.00 132.94 ? 157 TYR 1 CZ    1 
ATOM   1248  O  OH    . TYR A  1  157 ? -10.509  -37.224  150.952  1.00 137.66 ? 157 TYR 1 OH    1 
ATOM   1249  N  N     . LEU A  1  158 ? -10.138  -40.846  142.893  1.00 132.62 ? 158 LEU 1 N     1 
ATOM   1250  C  CA    . LEU A  1  158 ? -10.273  -41.226  141.487  1.00 123.21 ? 158 LEU 1 CA    1 
ATOM   1251  C  C     . LEU A  1  158 ? -10.539  -42.723  141.436  1.00 133.72 ? 158 LEU 1 C     1 
ATOM   1252  O  O     . LEU A  1  158 ? -9.645   -43.523  141.729  1.00 135.01 ? 158 LEU 1 O     1 
ATOM   1253  C  CB    . LEU A  1  158 ? -9.023   -40.886  140.683  1.00 107.36 ? 158 LEU 1 CB    1 
ATOM   1254  C  CG    . LEU A  1  158 ? -8.503   -39.455  140.710  1.00 107.49 ? 158 LEU 1 CG    1 
ATOM   1255  C  CD1   . LEU A  1  158 ? -7.394   -39.268  139.686  1.00 113.68 ? 158 LEU 1 CD1   1 
ATOM   1256  C  CD2   . LEU A  1  158 ? -9.647   -38.493  140.445  1.00 105.43 ? 158 LEU 1 CD2   1 
ATOM   1257  N  N     . GLY A  1  159 ? -11.756  -43.102  141.053  1.00 140.56 ? 159 GLY 1 N     1 
ATOM   1258  C  CA    . GLY A  1  159 ? -12.178  -44.484  141.177  1.00 141.39 ? 159 GLY 1 CA    1 
ATOM   1259  C  C     . GLY A  1  159 ? -13.298  -44.808  140.214  1.00 142.65 ? 159 GLY 1 C     1 
ATOM   1260  O  O     . GLY A  1  159 ? -13.760  -43.959  139.450  1.00 139.94 ? 159 GLY 1 O     1 
ATOM   1261  N  N     . LYS A  1  160 ? -13.728  -46.071  140.268  1.00 149.97 ? 160 LYS 1 N     1 
ATOM   1262  C  CA    . LYS A  1  160 ? -14.807  -46.547  139.405  1.00 159.63 ? 160 LYS 1 CA    1 
ATOM   1263  C  C     . LYS A  1  160 ? -16.085  -45.743  139.616  1.00 154.24 ? 160 LYS 1 C     1 
ATOM   1264  O  O     . LYS A  1  160 ? -16.708  -45.287  138.653  1.00 163.18 ? 160 LYS 1 O     1 
ATOM   1265  C  CB    . LYS A  1  160 ? -15.047  -48.033  139.659  1.00 174.06 ? 160 LYS 1 CB    1 
ATOM   1266  C  CG    . LYS A  1  160 ? -13.789  -48.881  139.545  1.00 185.88 ? 160 LYS 1 CG    1 
ATOM   1267  C  CD    . LYS A  1  160 ? -13.254  -48.905  138.122  1.00 194.03 ? 160 LYS 1 CD    1 
ATOM   1268  C  CE    . LYS A  1  160 ? -11.963  -49.701  138.009  1.00 203.23 ? 160 LYS 1 CE    1 
ATOM   1269  N  NZ    . LYS A  1  160 ? -12.160  -51.132  138.365  1.00 208.20 ? 160 LYS 1 NZ    1 
ATOM   1270  N  N     . ASN A  1  161 ? -16.501  -45.569  140.869  1.00 135.58 ? 161 ASN 1 N     1 
ATOM   1271  C  CA    . ASN A  1  161 ? -17.615  -44.687  141.196  1.00 120.17 ? 161 ASN 1 CA    1 
ATOM   1272  C  C     . ASN A  1  161 ? -17.190  -43.723  142.293  1.00 101.65 ? 161 ASN 1 C     1 
ATOM   1273  O  O     . ASN A  1  161 ? -16.670  -44.146  143.330  1.00 97.39  ? 161 ASN 1 O     1 
ATOM   1274  C  CB    . ASN A  1  161 ? -18.852  -45.483  141.630  1.00 121.85 ? 161 ASN 1 CB    1 
ATOM   1275  C  CG    . ASN A  1  161 ? -19.447  -46.311  140.501  1.00 120.95 ? 161 ASN 1 CG    1 
ATOM   1276  O  OD1   . ASN A  1  161 ? -20.466  -45.944  139.922  1.00 117.63 ? 161 ASN 1 OD1   1 
ATOM   1277  N  ND2   . ASN A  1  161 ? -18.809  -47.427  140.181  1.00 120.91 ? 161 ASN 1 ND2   1 
ATOM   1278  N  N     . LEU A  1  162 ? -17.413  -42.430  142.062  1.00 91.96  ? 162 LEU 1 N     1 
ATOM   1279  C  CA    . LEU A  1  162 ? -16.986  -41.391  142.988  1.00 94.77  ? 162 LEU 1 CA    1 
ATOM   1280  C  C     . LEU A  1  162 ? -18.115  -41.060  143.959  1.00 93.38  ? 162 LEU 1 C     1 
ATOM   1281  O  O     . LEU A  1  162 ? -19.193  -40.621  143.544  1.00 96.30  ? 162 LEU 1 O     1 
ATOM   1282  C  CB    . LEU A  1  162 ? -16.541  -40.144  142.222  1.00 94.98  ? 162 LEU 1 CB    1 
ATOM   1283  C  CG    . LEU A  1  162 ? -15.308  -40.290  141.325  1.00 84.73  ? 162 LEU 1 CG    1 
ATOM   1284  C  CD1   . LEU A  1  162 ? -14.883  -38.940  140.748  1.00 76.46  ? 162 LEU 1 CD1   1 
ATOM   1285  C  CD2   . LEU A  1  162 ? -14.170  -40.963  142.076  1.00 72.50  ? 162 LEU 1 CD2   1 
ATOM   1286  N  N     . PHE A  1  163 ? -17.861  -41.283  145.249  1.00 91.08  ? 163 PHE 1 N     1 
ATOM   1287  C  CA    . PHE A  1  163 ? -18.730  -40.830  146.335  1.00 98.84  ? 163 PHE 1 CA    1 
ATOM   1288  C  C     . PHE A  1  163 ? -20.133  -41.435  146.248  1.00 103.82 ? 163 PHE 1 C     1 
ATOM   1289  O  O     . PHE A  1  163 ? -21.109  -40.820  146.680  1.00 100.49 ? 163 PHE 1 O     1 
ATOM   1290  C  CB    . PHE A  1  163 ? -18.802  -39.297  146.373  1.00 99.56  ? 163 PHE 1 CB    1 
ATOM   1291  C  CG    . PHE A  1  163 ? -17.461  -38.611  146.213  1.00 100.32 ? 163 PHE 1 CG    1 
ATOM   1292  C  CD1   . PHE A  1  163 ? -16.345  -39.054  146.895  1.00 107.58 ? 163 PHE 1 CD1   1 
ATOM   1293  C  CD2   . PHE A  1  163 ? -17.321  -37.526  145.367  1.00 95.83  ? 163 PHE 1 CD2   1 
ATOM   1294  C  CE1   . PHE A  1  163 ? -15.118  -38.425  146.736  1.00 105.17 ? 163 PHE 1 CE1   1 
ATOM   1295  C  CE2   . PHE A  1  163 ? -16.096  -36.901  145.206  1.00 93.65  ? 163 PHE 1 CE2   1 
ATOM   1296  C  CZ    . PHE A  1  163 ? -14.998  -37.350  145.890  1.00 94.43  ? 163 PHE 1 CZ    1 
ATOM   1297  N  N     . GLY A  1  164 ? -20.249  -42.640  145.692  1.00 105.50 ? 164 GLY 1 N     1 
ATOM   1298  C  CA    . GLY A  1  164 ? -21.513  -43.341  145.606  1.00 104.55 ? 164 GLY 1 CA    1 
ATOM   1299  C  C     . GLY A  1  164 ? -22.338  -43.023  144.375  1.00 112.99 ? 164 GLY 1 C     1 
ATOM   1300  O  O     . GLY A  1  164 ? -23.136  -43.861  143.943  1.00 112.32 ? 164 GLY 1 O     1 
ATOM   1301  N  N     . THR A  1  165 ? -22.171  -41.833  143.804  1.00 113.22 ? 165 THR 1 N     1 
ATOM   1302  C  CA    . THR A  1  165 ? -22.931  -41.463  142.623  1.00 104.98 ? 165 THR 1 CA    1 
ATOM   1303  C  C     . THR A  1  165 ? -22.485  -42.309  141.433  1.00 109.00 ? 165 THR 1 C     1 
ATOM   1304  O  O     . THR A  1  165 ? -21.423  -42.939  141.451  1.00 111.20 ? 165 THR 1 O     1 
ATOM   1305  C  CB    . THR A  1  165 ? -22.773  -39.967  142.333  1.00 91.24  ? 165 THR 1 CB    1 
ATOM   1306  O  OG1   . THR A  1  165 ? -23.870  -39.519  141.529  1.00 103.88 ? 165 THR 1 OG1   1 
ATOM   1307  C  CG2   . THR A  1  165 ? -21.473  -39.680  141.605  1.00 74.47  ? 165 THR 1 CG2   1 
ATOM   1308  N  N     . ASP A  1  166 ? -23.323  -42.334  140.395  1.00 109.36 ? 166 ASP 1 N     1 
ATOM   1309  C  CA    . ASP A  1  166 ? -23.103  -43.178  139.225  1.00 116.51 ? 166 ASP 1 CA    1 
ATOM   1310  C  C     . ASP A  1  166 ? -22.082  -42.603  138.251  1.00 118.26 ? 166 ASP 1 C     1 
ATOM   1311  O  O     . ASP A  1  166 ? -22.008  -43.076  137.111  1.00 118.42 ? 166 ASP 1 O     1 
ATOM   1312  C  CB    . ASP A  1  166 ? -24.426  -43.420  138.494  1.00 123.56 ? 166 ASP 1 CB    1 
ATOM   1313  C  CG    . ASP A  1  166 ? -25.093  -42.131  138.060  1.00 132.69 ? 166 ASP 1 CG    1 
ATOM   1314  O  OD1   . ASP A  1  166 ? -24.997  -41.128  138.795  1.00 135.00 ? 166 ASP 1 OD1   1 
ATOM   1315  O  OD2   . ASP A  1  166 ? -25.711  -42.118  136.978  1.00 133.69 ? 166 ASP 1 OD2   1 
ATOM   1316  N  N     . PHE A  1  167 ? -21.302  -41.606  138.660  1.00 116.59 ? 167 PHE 1 N     1 
ATOM   1317  C  CA    . PHE A  1  167 ? -20.291  -41.014  137.798  1.00 112.81 ? 167 PHE 1 CA    1 
ATOM   1318  C  C     . PHE A  1  167 ? -18.934  -41.677  138.016  1.00 111.98 ? 167 PHE 1 C     1 
ATOM   1319  O  O     . PHE A  1  167 ? -18.604  -42.117  139.120  1.00 118.24 ? 167 PHE 1 O     1 
ATOM   1320  C  CB    . PHE A  1  167 ? -20.188  -39.505  138.049  1.00 114.06 ? 167 PHE 1 CB    1 
ATOM   1321  C  CG    . PHE A  1  167 ? -19.198  -38.805  137.155  1.00 119.48 ? 167 PHE 1 CG    1 
ATOM   1322  C  CD1   . PHE A  1  167 ? -19.532  -38.470  135.858  1.00 120.84 ? 167 PHE 1 CD1   1 
ATOM   1323  C  CD2   . PHE A  1  167 ? -17.940  -38.468  137.617  1.00 120.54 ? 167 PHE 1 CD2   1 
ATOM   1324  C  CE1   . PHE A  1  167 ? -18.622  -37.829  135.034  1.00 115.78 ? 167 PHE 1 CE1   1 
ATOM   1325  C  CE2   . PHE A  1  167 ? -17.031  -37.821  136.793  1.00 115.22 ? 167 PHE 1 CE2   1 
ATOM   1326  C  CZ    . PHE A  1  167 ? -17.375  -37.504  135.503  1.00 110.86 ? 167 PHE 1 CZ    1 
ATOM   1327  N  N     . SER A  1  168 ? -18.143  -41.726  136.946  1.00 108.98 ? 168 SER 1 N     1 
ATOM   1328  C  CA    . SER A  1  168 ? -16.820  -42.335  136.959  1.00 106.51 ? 168 SER 1 CA    1 
ATOM   1329  C  C     . SER A  1  168 ? -15.793  -41.344  136.434  1.00 106.98 ? 168 SER 1 C     1 
ATOM   1330  O  O     . SER A  1  168 ? -16.084  -40.544  135.541  1.00 125.84 ? 168 SER 1 O     1 
ATOM   1331  C  CB    . SER A  1  168 ? -16.775  -43.605  136.103  1.00 109.00 ? 168 SER 1 CB    1 
ATOM   1332  O  OG    . SER A  1  168 ? -17.641  -44.603  136.615  1.00 106.70 ? 168 SER 1 OG    1 
ATOM   1333  N  N     . PHE A  1  169 ? -14.576  -41.418  136.970  1.00 84.57  ? 169 PHE 1 N     1 
ATOM   1334  C  CA    . PHE A  1  169 ? -13.567  -40.444  136.581  1.00 75.97  ? 169 PHE 1 CA    1 
ATOM   1335  C  C     . PHE A  1  169 ? -12.170  -40.972  136.886  1.00 78.22  ? 169 PHE 1 C     1 
ATOM   1336  O  O     . PHE A  1  169 ? -11.962  -41.638  137.902  1.00 83.59  ? 169 PHE 1 O     1 
ATOM   1337  C  CB    . PHE A  1  169 ? -13.800  -39.106  137.296  1.00 72.55  ? 169 PHE 1 CB    1 
ATOM   1338  C  CG    . PHE A  1  169 ? -13.101  -37.956  136.644  1.00 72.66  ? 169 PHE 1 CG    1 
ATOM   1339  C  CD1   . PHE A  1  169 ? -13.620  -37.386  135.504  1.00 71.39  ? 169 PHE 1 CD1   1 
ATOM   1340  C  CD2   . PHE A  1  169 ? -11.930  -37.445  137.163  1.00 79.76  ? 169 PHE 1 CD2   1 
ATOM   1341  C  CE1   . PHE A  1  169 ? -12.991  -36.333  134.890  1.00 79.09  ? 169 PHE 1 CE1   1 
ATOM   1342  C  CE2   . PHE A  1  169 ? -11.298  -36.383  136.543  1.00 83.05  ? 169 PHE 1 CE2   1 
ATOM   1343  C  CZ    . PHE A  1  169 ? -11.834  -35.833  135.404  1.00 81.24  ? 169 PHE 1 CZ    1 
ATOM   1344  N  N     . ASP A  1  170 ? -11.227  -40.668  135.998  1.00 78.59  ? 170 ASP 1 N     1 
ATOM   1345  C  CA    . ASP A  1  170 ? -9.823   -41.017  136.177  1.00 78.50  ? 170 ASP 1 CA    1 
ATOM   1346  C  C     . ASP A  1  170 ? -8.983   -40.113  135.291  1.00 79.06  ? 170 ASP 1 C     1 
ATOM   1347  O  O     . ASP A  1  170 ? -9.420   -39.714  134.211  1.00 89.25  ? 170 ASP 1 O     1 
ATOM   1348  C  CB    . ASP A  1  170 ? -9.545   -42.484  135.827  1.00 76.03  ? 170 ASP 1 CB    1 
ATOM   1349  C  CG    . ASP A  1  170 ? -8.225   -42.981  136.396  1.00 81.87  ? 170 ASP 1 CG    1 
ATOM   1350  O  OD1   . ASP A  1  170 ? -7.359   -42.154  136.745  1.00 84.43  ? 170 ASP 1 OD1   1 
ATOM   1351  O  OD2   . ASP A  1  170 ? -8.043   -44.213  136.473  1.00 82.63  ? 170 ASP 1 OD2   1 
ATOM   1352  N  N     . LEU A  1  171 ? -7.764   -39.825  135.743  1.00 64.68  ? 171 LEU 1 N     1 
ATOM   1353  C  CA    . LEU A  1  171 ? -6.845   -38.963  135.019  1.00 63.18  ? 171 LEU 1 CA    1 
ATOM   1354  C  C     . LEU A  1  171 ? -5.561   -39.707  134.675  1.00 67.01  ? 171 LEU 1 C     1 
ATOM   1355  O  O     . LEU A  1  171 ? -5.138   -40.625  135.387  1.00 75.64  ? 171 LEU 1 O     1 
ATOM   1356  C  CB    . LEU A  1  171 ? -6.505   -37.712  135.836  1.00 61.05  ? 171 LEU 1 CB    1 
ATOM   1357  C  CG    . LEU A  1  171 ? -7.672   -36.763  136.102  1.00 67.81  ? 171 LEU 1 CG    1 
ATOM   1358  C  CD1   . LEU A  1  171 ? -7.236   -35.570  136.942  1.00 77.53  ? 171 LEU 1 CD1   1 
ATOM   1359  C  CD2   . LEU A  1  171 ? -8.278   -36.311  134.790  1.00 60.81  ? 171 LEU 1 CD2   1 
ATOM   1360  N  N     . HIS A  1  172 ? -4.951   -39.303  133.562  1.00 50.16  ? 172 HIS 1 N     1 
ATOM   1361  C  CA    . HIS A  1  172 ? -3.662   -39.825  133.130  1.00 56.48  ? 172 HIS 1 CA    1 
ATOM   1362  C  C     . HIS A  1  172 ? -2.775   -38.673  132.689  1.00 54.32  ? 172 HIS 1 C     1 
ATOM   1363  O  O     . HIS A  1  172 ? -3.236   -37.751  132.011  1.00 43.28  ? 172 HIS 1 O     1 
ATOM   1364  C  CB    . HIS A  1  172 ? -3.816   -40.824  131.994  1.00 72.89  ? 172 HIS 1 CB    1 
ATOM   1365  C  CG    . HIS A  1  172 ? -4.596   -42.029  132.389  1.00 75.54  ? 172 HIS 1 CG    1 
ATOM   1366  N  ND1   . HIS A  1  172 ? -4.186   -42.874  133.399  1.00 71.29  ? 172 HIS 1 ND1   1 
ATOM   1367  C  CD2   . HIS A  1  172 ? -5.759   -42.535  131.917  1.00 79.32  ? 172 HIS 1 CD2   1 
ATOM   1368  C  CE1   . HIS A  1  172 ? -5.072   -43.845  133.540  1.00 80.98  ? 172 HIS 1 CE1   1 
ATOM   1369  N  NE2   . HIS A  1  172 ? -6.033   -43.666  132.649  1.00 76.23  ? 172 HIS 1 NE2   1 
ATOM   1370  N  N     . VAL A  1  173 ? -1.515   -38.724  133.088  1.00 72.20  ? 173 VAL 1 N     1 
ATOM   1371  C  CA    . VAL A  1  173 ? -0.537   -37.685  132.787  1.00 73.69  ? 173 VAL 1 CA    1 
ATOM   1372  C  C     . VAL A  1  173 ? 0.178    -38.046  131.493  1.00 75.80  ? 173 VAL 1 C     1 
ATOM   1373  O  O     . VAL A  1  173 ? 0.431    -39.223  131.207  1.00 94.53  ? 173 VAL 1 O     1 
ATOM   1374  C  CB    . VAL A  1  173 ? 0.456    -37.514  133.959  1.00 80.87  ? 173 VAL 1 CB    1 
ATOM   1375  C  CG1   . VAL A  1  173 ? 1.283    -36.244  133.793  1.00 82.00  ? 173 VAL 1 CG1   1 
ATOM   1376  C  CG2   . VAL A  1  173 ? -0.271   -37.537  135.307  1.00 93.39  ? 173 VAL 1 CG2   1 
ATOM   1377  N  N     . HIS A  1  174 ? 0.516    -37.027  130.701  1.00 64.46  ? 174 HIS 1 N     1 
ATOM   1378  C  CA    . HIS A  1  174 ? 1.260    -37.209  129.455  1.00 76.90  ? 174 HIS 1 CA    1 
ATOM   1379  C  C     . HIS A  1  174 ? 2.264    -36.072  129.359  1.00 84.10  ? 174 HIS 1 C     1 
ATOM   1380  O  O     . HIS A  1  174 ? 1.877    -34.908  129.213  1.00 79.10  ? 174 HIS 1 O     1 
ATOM   1381  C  CB    . HIS A  1  174 ? 0.336    -37.213  128.233  1.00 80.72  ? 174 HIS 1 CB    1 
ATOM   1382  C  CG    . HIS A  1  174 ? 1.003    -37.660  126.966  1.00 80.56  ? 174 HIS 1 CG    1 
ATOM   1383  N  ND1   . HIS A  1  174 ? 1.050    -38.980  126.568  1.00 81.41  ? 174 HIS 1 ND1   1 
ATOM   1384  C  CD2   . HIS A  1  174 ? 1.660    -36.956  126.011  1.00 78.92  ? 174 HIS 1 CD2   1 
ATOM   1385  C  CE1   . HIS A  1  174 ? 1.700    -39.071  125.420  1.00 79.38  ? 174 HIS 1 CE1   1 
ATOM   1386  N  NE2   . HIS A  1  174 ? 2.082    -37.857  125.062  1.00 82.13  ? 174 HIS 1 NE2   1 
ATOM   1387  N  N     . ARG A  1  175 ? 3.544    -36.408  129.434  1.00 88.62  ? 175 ARG 1 N     1 
ATOM   1388  C  CA    . ARG A  1  175 ? 4.587    -35.402  129.359  1.00 86.42  ? 175 ARG 1 CA    1 
ATOM   1389  C  C     . ARG A  1  175 ? 4.916    -35.091  127.907  1.00 92.08  ? 175 ARG 1 C     1 
ATOM   1390  O  O     . ARG A  1  175 ? 4.935    -35.981  127.052  1.00 114.19 ? 175 ARG 1 O     1 
ATOM   1391  C  CB    . ARG A  1  175 ? 5.839    -35.888  130.084  1.00 95.92  ? 175 ARG 1 CB    1 
ATOM   1392  C  CG    . ARG A  1  175 ? 5.717    -35.946  131.596  1.00 100.20 ? 175 ARG 1 CG    1 
ATOM   1393  C  CD    . ARG A  1  175 ? 7.063    -36.275  132.223  1.00 102.41 ? 175 ARG 1 CD    1 
ATOM   1394  N  NE    . ARG A  1  175 ? 8.018    -35.185  132.073  1.00 110.34 ? 175 ARG 1 NE    1 
ATOM   1395  C  CZ    . ARG A  1  175 ? 9.335    -35.336  132.154  1.00 118.91 ? 175 ARG 1 CZ    1 
ATOM   1396  N  NH1   . ARG A  1  175 ? 9.856    -36.534  132.375  1.00 118.45 ? 175 ARG 1 NH1   1 
ATOM   1397  N  NH2   . ARG A  1  175 ? 10.134   -34.292  132.007  1.00 122.62 ? 175 ARG 1 NH2   1 
ATOM   1398  N  N     . GLY A  1  176 ? 5.173    -33.818  127.636  1.00 73.52  ? 176 GLY 1 N     1 
ATOM   1399  C  CA    . GLY A  1  176 ? 5.501    -33.352  126.307  1.00 70.59  ? 176 GLY 1 CA    1 
ATOM   1400  C  C     . GLY A  1  176 ? 6.990    -33.414  126.052  1.00 80.66  ? 176 GLY 1 C     1 
ATOM   1401  O  O     . GLY A  1  176 ? 7.747    -34.064  126.778  1.00 96.03  ? 176 GLY 1 O     1 
ATOM   1402  N  N     . ALA A  1  177 ? 7.416    -32.723  124.986  1.00 82.82  ? 177 ALA 1 N     1 
ATOM   1403  C  CA    . ALA A  1  177 ? 8.829    -32.701  124.631  1.00 87.93  ? 177 ALA 1 CA    1 
ATOM   1404  C  C     . ALA A  1  177 ? 9.309    -31.319  124.186  1.00 92.32  ? 177 ALA 1 C     1 
ATOM   1405  O  O     . ALA A  1  177 ? 10.273   -31.226  123.410  1.00 87.73  ? 177 ALA 1 O     1 
ATOM   1406  C  CB    . ALA A  1  177 ? 9.111    -33.730  123.529  1.00 90.04  ? 177 ALA 1 CB    1 
ATOM   1407  N  N     . GLY A  1  178 ? 8.650    -30.250  124.618  1.00 99.46  ? 178 GLY 1 N     1 
ATOM   1408  C  CA    . GLY A  1  178 ? 9.161    -28.913  124.399  1.00 110.44 ? 178 GLY 1 CA    1 
ATOM   1409  C  C     . GLY A  1  178 ? 8.962    -28.377  122.998  1.00 123.20 ? 178 GLY 1 C     1 
ATOM   1410  O  O     . GLY A  1  178 ? 9.941    -28.143  122.280  1.00 122.02 ? 178 GLY 1 O     1 
ATOM   1411  N  N     . ALA A  1  179 ? 7.709    -28.182  122.591  1.00 128.07 ? 179 ALA 1 N     1 
ATOM   1412  C  CA    . ALA A  1  179 ? 7.394    -27.524  121.326  1.00 111.04 ? 179 ALA 1 CA    1 
ATOM   1413  C  C     . ALA A  1  179 ? 6.198    -26.608  121.536  1.00 90.01  ? 179 ALA 1 C     1 
ATOM   1414  O  O     . ALA A  1  179 ? 5.110    -27.075  121.892  1.00 91.71  ? 179 ALA 1 O     1 
ATOM   1415  C  CB    . ALA A  1  179 ? 7.114    -28.543  120.220  1.00 102.52 ? 179 ALA 1 CB    1 
ATOM   1416  N  N     . TYR A  1  180 ? 6.413    -25.309  121.314  1.00 58.03  ? 180 TYR 1 N     1 
ATOM   1417  C  CA    . TYR A  1  180 ? 5.394    -24.300  121.595  1.00 47.19  ? 180 TYR 1 CA    1 
ATOM   1418  C  C     . TYR A  1  180 ? 4.091    -24.589  120.857  1.00 45.38  ? 180 TYR 1 C     1 
ATOM   1419  O  O     . TYR A  1  180 ? 3.000    -24.375  121.399  1.00 45.01  ? 180 TYR 1 O     1 
ATOM   1420  C  CB    . TYR A  1  180 ? 5.930    -22.914  121.220  1.00 56.41  ? 180 TYR 1 CB    1 
ATOM   1421  C  CG    . TYR A  1  180 ? 4.918    -21.800  121.356  1.00 67.26  ? 180 TYR 1 CG    1 
ATOM   1422  C  CD1   . TYR A  1  180 ? 4.106    -21.706  122.467  1.00 89.06  ? 180 TYR 1 CD1   1 
ATOM   1423  C  CD2   . TYR A  1  180 ? 4.740    -20.874  120.349  1.00 61.29  ? 180 TYR 1 CD2   1 
ATOM   1424  C  CE1   . TYR A  1  180 ? 3.164    -20.699  122.583  1.00 99.78  ? 180 TYR 1 CE1   1 
ATOM   1425  C  CE2   . TYR A  1  180 ? 3.794    -19.866  120.458  1.00 79.95  ? 180 TYR 1 CE2   1 
ATOM   1426  C  CZ    . TYR A  1  180 ? 3.010    -19.785  121.577  1.00 97.34  ? 180 TYR 1 CZ    1 
ATOM   1427  O  OH    . TYR A  1  180 ? 2.069    -18.785  121.690  1.00 106.91 ? 180 TYR 1 OH    1 
ATOM   1428  N  N     . ILE A  1  181 ? 4.185    -25.063  119.614  1.00 76.59  ? 181 ILE 1 N     1 
ATOM   1429  C  CA    . ILE A  1  181 ? 2.986    -25.290  118.810  1.00 83.73  ? 181 ILE 1 CA    1 
ATOM   1430  C  C     . ILE A  1  181 ? 2.115    -26.366  119.452  1.00 92.30  ? 181 ILE 1 C     1 
ATOM   1431  O  O     . ILE A  1  181 ? 0.894    -26.382  119.259  1.00 98.22  ? 181 ILE 1 O     1 
ATOM   1432  C  CB    . ILE A  1  181 ? 3.392    -25.638  117.358  1.00 97.32  ? 181 ILE 1 CB    1 
ATOM   1433  C  CG1   . ILE A  1  181 ? 2.173    -25.829  116.446  1.00 101.54 ? 181 ILE 1 CG1   1 
ATOM   1434  C  CG2   . ILE A  1  181 ? 4.277    -26.870  117.315  1.00 107.85 ? 181 ILE 1 CG2   1 
ATOM   1435  C  CD1   . ILE A  1  181 ? 1.344    -24.565  116.241  1.00 96.19  ? 181 ILE 1 CD1   1 
ATOM   1436  N  N     . CYS A  1  182 ? 2.714    -27.261  120.248  1.00 86.34  ? 182 CYS 1 N     1 
ATOM   1437  C  CA    . CYS A  1  182 ? 1.939    -28.278  120.958  1.00 78.68  ? 182 CYS 1 CA    1 
ATOM   1438  C  C     . CYS A  1  182 ? 0.960    -27.684  121.961  1.00 72.78  ? 182 CYS 1 C     1 
ATOM   1439  O  O     . CYS A  1  182 ? 0.108    -28.416  122.475  1.00 85.04  ? 182 CYS 1 O     1 
ATOM   1440  C  CB    . CYS A  1  182 ? 2.857    -29.271  121.678  1.00 84.85  ? 182 CYS 1 CB    1 
ATOM   1441  S  SG    . CYS A  1  182 ? 4.050    -30.137  120.663  1.00 86.18  ? 182 CYS 1 SG    1 
ATOM   1442  N  N     . GLY A  1  183 ? 1.054    -26.383  122.245  1.00 66.34  ? 183 GLY 1 N     1 
ATOM   1443  C  CA    . GLY A  1  183 ? 0.069    -25.742  123.092  1.00 61.35  ? 183 GLY 1 CA    1 
ATOM   1444  C  C     . GLY A  1  183 ? -1.222   -25.394  122.387  1.00 54.40  ? 183 GLY 1 C     1 
ATOM   1445  O  O     . GLY A  1  183 ? -2.262   -25.282  123.042  1.00 59.54  ? 183 GLY 1 O     1 
ATOM   1446  N  N     . GLU A  1  184 ? -1.184   -25.218  121.072  1.00 56.57  ? 184 GLU 1 N     1 
ATOM   1447  C  CA    . GLU A  1  184 ? -2.419   -25.064  120.322  1.00 70.33  ? 184 GLU 1 CA    1 
ATOM   1448  C  C     . GLU A  1  184 ? -3.260   -26.323  120.493  1.00 77.38  ? 184 GLU 1 C     1 
ATOM   1449  O  O     . GLU A  1  184 ? -2.789   -27.434  120.230  1.00 88.69  ? 184 GLU 1 O     1 
ATOM   1450  C  CB    . GLU A  1  184 ? -2.107   -24.804  118.845  1.00 86.18  ? 184 GLU 1 CB    1 
ATOM   1451  C  CG    . GLU A  1  184 ? -3.152   -23.975  118.106  1.00 108.51 ? 184 GLU 1 CG    1 
ATOM   1452  C  CD    . GLU A  1  184 ? -4.356   -24.788  117.687  1.00 119.93 ? 184 GLU 1 CD    1 
ATOM   1453  O  OE1   . GLU A  1  184 ? -4.250   -26.028  117.664  1.00 119.16 ? 184 GLU 1 OE1   1 
ATOM   1454  O  OE2   . GLU A  1  184 ? -5.413   -24.190  117.389  1.00 120.21 ? 184 GLU 1 OE2   1 
ATOM   1455  N  N     . GLU A  1  185 ? -4.505   -26.141  120.951  1.00 73.83  ? 185 GLU 1 N     1 
ATOM   1456  C  CA    . GLU A  1  185 ? -5.319   -27.260  121.427  1.00 89.57  ? 185 GLU 1 CA    1 
ATOM   1457  C  C     . GLU A  1  185 ? -5.507   -28.347  120.373  1.00 99.30  ? 185 GLU 1 C     1 
ATOM   1458  O  O     . GLU A  1  185 ? -5.667   -29.520  120.731  1.00 103.72 ? 185 GLU 1 O     1 
ATOM   1459  C  CB    . GLU A  1  185 ? -6.682   -26.756  121.936  1.00 99.64  ? 185 GLU 1 CB    1 
ATOM   1460  C  CG    . GLU A  1  185 ? -7.544   -25.989  120.934  1.00 114.38 ? 185 GLU 1 CG    1 
ATOM   1461  C  CD    . GLU A  1  185 ? -8.929   -25.624  121.476  1.00 119.79 ? 185 GLU 1 CD    1 
ATOM   1462  O  OE1   . GLU A  1  185 ? -9.611   -26.504  122.035  1.00 122.32 ? 185 GLU 1 OE1   1 
ATOM   1463  O  OE2   . GLU A  1  185 ? -9.345   -24.455  121.333  1.00 124.75 ? 185 GLU 1 OE2   1 
ATOM   1464  N  N     . THR A  1  186 ? -5.474   -27.996  119.082  1.00 98.73  ? 186 THR 1 N     1 
ATOM   1465  C  CA    . THR A  1  186 ? -5.651   -29.001  118.042  1.00 96.83  ? 186 THR 1 CA    1 
ATOM   1466  C  C     . THR A  1  186 ? -4.348   -29.703  117.683  1.00 98.76  ? 186 THR 1 C     1 
ATOM   1467  O  O     . THR A  1  186 ? -4.389   -30.846  117.213  1.00 109.23 ? 186 THR 1 O     1 
ATOM   1468  C  CB    . THR A  1  186 ? -6.273   -28.383  116.774  1.00 85.67  ? 186 THR 1 CB    1 
ATOM   1469  O  OG1   . THR A  1  186 ? -5.457   -27.309  116.297  1.00 89.15  ? 186 THR 1 OG1   1 
ATOM   1470  C  CG2   . THR A  1  186 ? -7.672   -27.838  117.049  1.00 64.27  ? 186 THR 1 CG2   1 
ATOM   1471  N  N     . ALA A  1  187 ? -3.198   -29.066  117.923  1.00 82.22  ? 187 ALA 1 N     1 
ATOM   1472  C  CA    . ALA A  1  187 ? -1.920   -29.742  117.737  1.00 84.05  ? 187 ALA 1 CA    1 
ATOM   1473  C  C     . ALA A  1  187 ? -1.568   -30.614  118.932  1.00 72.27  ? 187 ALA 1 C     1 
ATOM   1474  O  O     . ALA A  1  187 ? -0.906   -31.645  118.772  1.00 68.52  ? 187 ALA 1 O     1 
ATOM   1475  C  CB    . ALA A  1  187 ? -0.812   -28.713  117.490  1.00 90.56  ? 187 ALA 1 CB    1 
ATOM   1476  N  N     . LEU A  1  188 ? -2.004   -30.209  120.124  1.00 67.03  ? 188 LEU 1 N     1 
ATOM   1477  C  CA    . LEU A  1  188 ? -1.814   -31.021  121.319  1.00 76.98  ? 188 LEU 1 CA    1 
ATOM   1478  C  C     . LEU A  1  188 ? -2.452   -32.393  121.152  1.00 81.28  ? 188 LEU 1 C     1 
ATOM   1479  O  O     . LEU A  1  188 ? -1.877   -33.408  121.564  1.00 81.78  ? 188 LEU 1 O     1 
ATOM   1480  C  CB    . LEU A  1  188 ? -2.406   -30.297  122.531  1.00 89.88  ? 188 LEU 1 CB    1 
ATOM   1481  C  CG    . LEU A  1  188 ? -2.067   -30.732  123.961  1.00 109.33 ? 188 LEU 1 CG    1 
ATOM   1482  C  CD1   . LEU A  1  188 ? -2.289   -29.587  124.931  1.00 111.53 ? 188 LEU 1 CD1   1 
ATOM   1483  C  CD2   . LEU A  1  188 ? -2.897   -31.941  124.386  1.00 115.58 ? 188 LEU 1 CD2   1 
ATOM   1484  N  N     . MET A  1  189 ? -3.643   -32.444  120.550  1.00 86.50  ? 189 MET 1 N     1 
ATOM   1485  C  CA    . MET A  1  189 ? -4.302   -33.731  120.344  1.00 101.10 ? 189 MET 1 CA    1 
ATOM   1486  C  C     . MET A  1  189 ? -3.450   -34.644  119.467  1.00 98.13  ? 189 MET 1 C     1 
ATOM   1487  O  O     . MET A  1  189 ? -3.267   -35.825  119.784  1.00 104.96 ? 189 MET 1 O     1 
ATOM   1488  C  CB    . MET A  1  189 ? -5.695   -33.523  119.736  1.00 115.68 ? 189 MET 1 CB    1 
ATOM   1489  C  CG    . MET A  1  189 ? -6.675   -32.742  120.624  1.00 120.33 ? 189 MET 1 CG    1 
ATOM   1490  S  SD    . MET A  1  189 ? -8.423   -32.978  120.217  1.00 123.46 ? 189 MET 1 SD    1 
ATOM   1491  C  CE    . MET A  1  189 ? -8.567   -31.967  118.749  1.00 121.36 ? 189 MET 1 CE    1 
ATOM   1492  N  N     . ASN A  1  190 ? -2.887   -34.105  118.386  1.00 80.82  ? 190 ASN 1 N     1 
ATOM   1493  C  CA    . ASN A  1  190 ? -1.998   -34.899  117.543  1.00 74.87  ? 190 ASN 1 CA    1 
ATOM   1494  C  C     . ASN A  1  190 ? -0.773   -35.355  118.332  1.00 70.27  ? 190 ASN 1 C     1 
ATOM   1495  O  O     . ASN A  1  190 ? -0.411   -36.540  118.325  1.00 54.55  ? 190 ASN 1 O     1 
ATOM   1496  C  CB    . ASN A  1  190 ? -1.598   -34.081  116.308  1.00 80.05  ? 190 ASN 1 CB    1 
ATOM   1497  C  CG    . ASN A  1  190 ? -2.756   -33.890  115.327  1.00 94.47  ? 190 ASN 1 CG    1 
ATOM   1498  O  OD1   . ASN A  1  190 ? -3.713   -34.662  115.329  1.00 110.35 ? 190 ASN 1 OD1   1 
ATOM   1499  N  ND2   . ASN A  1  190 ? -2.654   -32.888  114.464  1.00 88.71  ? 190 ASN 1 ND2   1 
ATOM   1500  N  N     . SER A  1  191 ? -0.143   -34.422  119.048  1.00 66.37  ? 191 SER 1 N     1 
ATOM   1501  C  CA    . SER A  1  191 ? 1.072    -34.726  119.798  1.00 71.68  ? 191 SER 1 CA    1 
ATOM   1502  C  C     . SER A  1  191 ? 0.847    -35.878  120.769  1.00 67.62  ? 191 SER 1 C     1 
ATOM   1503  O  O     . SER A  1  191 ? 1.652    -36.814  120.837  1.00 86.47  ? 191 SER 1 O     1 
ATOM   1504  C  CB    . SER A  1  191 ? 1.540    -33.469  120.533  1.00 79.48  ? 191 SER 1 CB    1 
ATOM   1505  O  OG    . SER A  1  191 ? 2.776    -33.688  121.189  1.00 91.74  ? 191 SER 1 OG    1 
ATOM   1506  N  N     . LEU A  1  192 ? -0.257   -35.839  121.513  1.00 57.92  ? 192 LEU 1 N     1 
ATOM   1507  C  CA    . LEU A  1  192 ? -0.552   -36.925  122.444  1.00 66.55  ? 192 LEU 1 CA    1 
ATOM   1508  C  C     . LEU A  1  192 ? -0.877   -38.213  121.700  1.00 69.44  ? 192 LEU 1 C     1 
ATOM   1509  O  O     . LEU A  1  192 ? -0.372   -39.282  122.055  1.00 46.56  ? 192 LEU 1 O     1 
ATOM   1510  C  CB    . LEU A  1  192 ? -1.707   -36.541  123.368  1.00 60.87  ? 192 LEU 1 CB    1 
ATOM   1511  C  CG    . LEU A  1  192 ? -2.042   -37.530  124.491  1.00 65.72  ? 192 LEU 1 CG    1 
ATOM   1512  C  CD1   . LEU A  1  192 ? -2.354   -36.785  125.775  1.00 69.01  ? 192 LEU 1 CD1   1 
ATOM   1513  C  CD2   . LEU A  1  192 ? -3.204   -38.440  124.105  1.00 72.99  ? 192 LEU 1 CD2   1 
ATOM   1514  N  N     . GLU A  1  193 ? -1.689   -38.126  120.642  1.00 69.08  ? 193 GLU 1 N     1 
ATOM   1515  C  CA    . GLU A  1  193 ? -2.093   -39.312  119.898  1.00 67.26  ? 193 GLU 1 CA    1 
ATOM   1516  C  C     . GLU A  1  193 ? -0.899   -40.019  119.278  1.00 61.13  ? 193 GLU 1 C     1 
ATOM   1517  O  O     . GLU A  1  193 ? -0.983   -41.214  118.981  1.00 55.86  ? 193 GLU 1 O     1 
ATOM   1518  C  CB    . GLU A  1  193 ? -3.099   -38.903  118.815  1.00 73.97  ? 193 GLU 1 CB    1 
ATOM   1519  C  CG    . GLU A  1  193 ? -4.228   -39.889  118.546  1.00 98.53  ? 193 GLU 1 CG    1 
ATOM   1520  C  CD    . GLU A  1  193 ? -5.316   -39.330  117.629  1.00 117.50 ? 193 GLU 1 CD    1 
ATOM   1521  O  OE1   . GLU A  1  193 ? -5.948   -38.311  117.987  1.00 119.13 ? 193 GLU 1 OE1   1 
ATOM   1522  O  OE2   . GLU A  1  193 ? -5.568   -39.926  116.563  1.00 125.54 ? 193 GLU 1 OE2   1 
ATOM   1523  N  N     . GLY A  1  194 ? 0.219    -39.322  119.129  1.00 62.96  ? 194 GLY 1 N     1 
ATOM   1524  C  CA    . GLY A  1  194 ? 1.406    -39.902  118.548  1.00 67.42  ? 194 GLY 1 CA    1 
ATOM   1525  C  C     . GLY A  1  194 ? 1.709    -39.472  117.133  1.00 71.85  ? 194 GLY 1 C     1 
ATOM   1526  O  O     . GLY A  1  194 ? 2.405    -40.205  116.423  1.00 84.56  ? 194 GLY 1 O     1 
ATOM   1527  N  N     . LEU A  1  195 ? 1.205    -38.319  116.702  1.00 68.05  ? 195 LEU 1 N     1 
ATOM   1528  C  CA    . LEU A  1  195 ? 1.524    -37.733  115.414  1.00 66.32  ? 195 LEU 1 CA    1 
ATOM   1529  C  C     . LEU A  1  195 ? 2.478    -36.567  115.616  1.00 77.96  ? 195 LEU 1 C     1 
ATOM   1530  O  O     . LEU A  1  195 ? 2.832    -36.205  116.740  1.00 78.39  ? 195 LEU 1 O     1 
ATOM   1531  C  CB    . LEU A  1  195 ? 0.258    -37.247  114.702  1.00 61.50  ? 195 LEU 1 CB    1 
ATOM   1532  C  CG    . LEU A  1  195 ? -1.015   -38.088  114.755  1.00 63.49  ? 195 LEU 1 CG    1 
ATOM   1533  C  CD1   . LEU A  1  195 ? -2.218   -37.345  114.195  1.00 66.59  ? 195 LEU 1 CD1   1 
ATOM   1534  C  CD2   . LEU A  1  195 ? -0.781   -39.356  113.970  1.00 70.94  ? 195 LEU 1 CD2   1 
ATOM   1535  N  N     . ARG A  1  196 ? 2.889    -35.953  114.515  1.00 76.88  ? 196 ARG 1 N     1 
ATOM   1536  C  CA    . ARG A  1  196 ? 3.546    -34.664  114.624  1.00 67.68  ? 196 ARG 1 CA    1 
ATOM   1537  C  C     . ARG A  1  196 ? 2.507    -33.610  114.987  1.00 65.76  ? 196 ARG 1 C     1 
ATOM   1538  O  O     . ARG A  1  196 ? 1.375    -33.630  114.499  1.00 69.30  ? 196 ARG 1 O     1 
ATOM   1539  C  CB    . ARG A  1  196 ? 4.267    -34.314  113.322  1.00 68.00  ? 196 ARG 1 CB    1 
ATOM   1540  C  CG    . ARG A  1  196 ? 5.514    -35.163  113.071  1.00 60.55  ? 196 ARG 1 CG    1 
ATOM   1541  C  CD    . ARG A  1  196 ? 6.032    -35.016  111.657  1.00 58.48  ? 196 ARG 1 CD    1 
ATOM   1542  N  NE    . ARG A  1  196 ? 7.325    -34.352  111.660  1.00 60.23  ? 196 ARG 1 NE    1 
ATOM   1543  C  CZ    . ARG A  1  196 ? 7.504    -33.072  111.360  1.00 66.92  ? 196 ARG 1 CZ    1 
ATOM   1544  N  NH1   . ARG A  1  196 ? 6.470    -32.318  111.027  1.00 79.00  ? 196 ARG 1 NH1   1 
ATOM   1545  N  NH2   . ARG A  1  196 ? 8.715    -32.547  111.397  1.00 67.17  ? 196 ARG 1 NH2   1 
ATOM   1546  N  N     . ALA A  1  197 ? 2.889    -32.701  115.876  1.00 82.01  ? 197 ALA 1 N     1 
ATOM   1547  C  CA    . ALA A  1  197 ? 1.953    -31.728  116.429  1.00 101.10 ? 197 ALA 1 CA    1 
ATOM   1548  C  C     . ALA A  1  197 ? 1.703    -30.604  115.424  1.00 115.88 ? 197 ALA 1 C     1 
ATOM   1549  O  O     . ALA A  1  197 ? 2.161    -29.471  115.577  1.00 121.18 ? 197 ALA 1 O     1 
ATOM   1550  C  CB    . ALA A  1  197 ? 2.475    -31.183  117.750  1.00 107.48 ? 197 ALA 1 CB    1 
ATOM   1551  N  N     . ASN A  1  198 ? 0.954    -30.951  114.353  1.00 111.07 ? 198 ASN 1 N     1 
ATOM   1552  C  CA    . ASN A  1  198 ? 0.421    -29.975  113.407  1.00 93.72  ? 198 ASN 1 CA    1 
ATOM   1553  C  C     . ASN A  1  198 ? -1.083   -29.839  113.609  1.00 104.82 ? 198 ASN 1 C     1 
ATOM   1554  O  O     . ASN A  1  198 ? -1.780   -30.849  113.769  1.00 111.79 ? 198 ASN 1 O     1 
ATOM   1555  C  CB    . ASN A  1  198 ? 0.694    -30.362  111.947  1.00 71.72  ? 198 ASN 1 CB    1 
ATOM   1556  C  CG    . ASN A  1  198 ? 2.166    -30.524  111.647  1.00 61.23  ? 198 ASN 1 CG    1 
ATOM   1557  O  OD1   . ASN A  1  198 ? 3.014    -30.083  112.410  1.00 59.16  ? 198 ASN 1 OD1   1 
ATOM   1558  N  ND2   . ASN A  1  198 ? 2.478    -31.158  110.526  1.00 60.31  ? 198 ASN 1 ND2   1 
ATOM   1559  N  N     . PRO A  1  199 ? -1.612   -28.619  113.620  1.00 99.40  ? 199 PRO 1 N     1 
ATOM   1560  C  CA    . PRO A  1  199 ? -3.043   -28.442  113.897  1.00 100.43 ? 199 PRO 1 CA    1 
ATOM   1561  C  C     . PRO A  1  199 ? -3.919   -29.164  112.883  1.00 111.42 ? 199 PRO 1 C     1 
ATOM   1562  O  O     . PRO A  1  199 ? -3.512   -29.464  111.758  1.00 117.00 ? 199 PRO 1 O     1 
ATOM   1563  C  CB    . PRO A  1  199 ? -3.245   -26.922  113.826  1.00 91.87  ? 199 PRO 1 CB    1 
ATOM   1564  C  CG    . PRO A  1  199 ? -1.963   -26.350  113.359  1.00 84.17  ? 199 PRO 1 CG    1 
ATOM   1565  C  CD    . PRO A  1  199 ? -0.884   -27.343  113.574  1.00 85.12  ? 199 PRO 1 CD    1 
ATOM   1566  N  N     . ARG A  1  200 ? -5.145   -29.447  113.307  1.00 115.73 ? 200 ARG 1 N     1 
ATOM   1567  C  CA    . ARG A  1  200 ? -6.110   -30.184  112.510  1.00 120.41 ? 200 ARG 1 CA    1 
ATOM   1568  C  C     . ARG A  1  200 ? -7.049   -29.210  111.802  1.00 110.81 ? 200 ARG 1 C     1 
ATOM   1569  O  O     . ARG A  1  200 ? -6.992   -27.997  112.003  1.00 110.24 ? 200 ARG 1 O     1 
ATOM   1570  C  CB    . ARG A  1  200 ? -6.899   -31.147  113.405  1.00 123.56 ? 200 ARG 1 CB    1 
ATOM   1571  C  CG    . ARG A  1  200 ? -6.057   -32.080  114.280  1.00 119.10 ? 200 ARG 1 CG    1 
ATOM   1572  C  CD    . ARG A  1  200 ? -6.931   -33.160  114.934  1.00 123.12 ? 200 ARG 1 CD    1 
ATOM   1573  N  NE    . ARG A  1  200 ? -6.166   -34.340  115.331  1.00 135.78 ? 200 ARG 1 NE    1 
ATOM   1574  C  CZ    . ARG A  1  200 ? -6.669   -35.369  116.009  1.00 139.58 ? 200 ARG 1 CZ    1 
ATOM   1575  N  NH1   . ARG A  1  200 ? -7.941   -35.374  116.378  1.00 139.56 ? 200 ARG 1 NH1   1 
ATOM   1576  N  NH2   . ARG A  1  200 ? -5.898   -36.402  116.316  1.00 138.61 ? 200 ARG 1 NH2   1 
ATOM   1577  N  N     . LEU A  1  201 ? -7.925   -29.748  110.956  1.00 100.77 ? 201 LEU 1 N     1 
ATOM   1578  C  CA    . LEU A  1  201 ? -8.923   -28.937  110.263  1.00 97.61  ? 201 LEU 1 CA    1 
ATOM   1579  C  C     . LEU A  1  201 ? -10.082  -28.663  111.218  1.00 97.62  ? 201 LEU 1 C     1 
ATOM   1580  O  O     . LEU A  1  201 ? -10.714  -29.602  111.715  1.00 86.22  ? 201 LEU 1 O     1 
ATOM   1581  C  CB    . LEU A  1  201 ? -9.405   -29.640  108.995  1.00 93.32  ? 201 LEU 1 CB    1 
ATOM   1582  C  CG    . LEU A  1  201 ? -10.116  -28.725  108.000  1.00 65.02  ? 201 LEU 1 CG    1 
ATOM   1583  C  CD1   . LEU A  1  201 ? -9.117   -27.823  107.342  1.00 47.27  ? 201 LEU 1 CD1   1 
ATOM   1584  C  CD2   . LEU A  1  201 ? -10.905  -29.518  106.963  1.00 59.18  ? 201 LEU 1 CD2   1 
ATOM   1585  N  N     . LYS A  1  202 ? -10.317  -27.384  111.525  1.00 105.29 ? 202 LYS 1 N     1 
ATOM   1586  C  CA    . LYS A  1  202 ? -11.305  -26.945  112.514  1.00 108.92 ? 202 LYS 1 CA    1 
ATOM   1587  C  C     . LYS A  1  202 ? -12.778  -27.109  112.124  1.00 94.52  ? 202 LYS 1 C     1 
ATOM   1588  O  O     . LYS A  1  202 ? -13.616  -27.232  113.026  1.00 102.69 ? 202 LYS 1 O     1 
ATOM   1589  C  CB    . LYS A  1  202 ? -11.028  -25.491  112.901  1.00 117.25 ? 202 LYS 1 CB    1 
ATOM   1590  C  CG    . LYS A  1  202 ? -10.802  -25.329  114.394  1.00 126.52 ? 202 LYS 1 CG    1 
ATOM   1591  C  CD    . LYS A  1  202 ? -9.874   -24.175  114.695  1.00 141.40 ? 202 LYS 1 CD    1 
ATOM   1592  C  CE    . LYS A  1  202 ? -9.604   -24.064  116.181  1.00 149.73 ? 202 LYS 1 CE    1 
ATOM   1593  N  NZ    . LYS A  1  202 ? -8.626   -22.978  116.470  1.00 153.87 ? 202 LYS 1 NZ    1 
ATOM   1594  N  N     . PRO A  1  203 ? -13.156  -27.059  110.843  1.00 79.64  ? 203 PRO 1 N     1 
ATOM   1595  C  CA    . PRO A  1  203 ? -14.571  -27.257  110.476  1.00 82.26  ? 203 PRO 1 CA    1 
ATOM   1596  C  C     . PRO A  1  203 ? -15.205  -28.470  111.143  1.00 94.61  ? 203 PRO 1 C     1 
ATOM   1597  O  O     . PRO A  1  203 ? -16.395  -28.428  111.492  1.00 105.13 ? 203 PRO 1 O     1 
ATOM   1598  C  CB    . PRO A  1  203 ? -14.509  -27.407  108.949  1.00 88.42  ? 203 PRO 1 CB    1 
ATOM   1599  C  CG    . PRO A  1  203 ? -13.369  -26.513  108.559  1.00 92.22  ? 203 PRO 1 CG    1 
ATOM   1600  C  CD    . PRO A  1  203 ? -12.431  -26.390  109.745  1.00 84.09  ? 203 PRO 1 CD    1 
ATOM   1601  N  N     . PRO A  1  204 ? -14.475  -29.572  111.337  1.00 95.80  ? 204 PRO 1 N     1 
ATOM   1602  C  CA    . PRO A  1  204 ? -14.891  -30.526  112.381  1.00 92.18  ? 204 PRO 1 CA    1 
ATOM   1603  C  C     . PRO A  1  204 ? -14.360  -30.075  113.736  1.00 112.84 ? 204 PRO 1 C     1 
ATOM   1604  O  O     . PRO A  1  204 ? -13.147  -30.048  113.953  1.00 122.49 ? 204 PRO 1 O     1 
ATOM   1605  C  CB    . PRO A  1  204 ? -14.252  -31.848  111.937  1.00 76.05  ? 204 PRO 1 CB    1 
ATOM   1606  C  CG    . PRO A  1  204 ? -13.730  -31.616  110.568  1.00 86.44  ? 204 PRO 1 CG    1 
ATOM   1607  C  CD    . PRO A  1  204 ? -13.472  -30.169  110.438  1.00 91.40  ? 204 PRO 1 CD    1 
ATOM   1608  N  N     . PHE A  1  205 ? -15.312  -29.709  114.701  1.00 119.64 ? 205 PHE 1 N     1 
ATOM   1609  C  CA    . PHE A  1  205 ? -14.864  -29.075  115.939  1.00 121.49 ? 205 PHE 1 CA    1 
ATOM   1610  C  C     . PHE A  1  205 ? -14.526  -30.126  117.008  1.00 110.14 ? 205 PHE 1 C     1 
ATOM   1611  O  O     . PHE A  1  205 ? -15.083  -31.229  117.006  1.00 116.47 ? 205 PHE 1 O     1 
ATOM   1612  C  CB    . PHE A  1  205 ? -15.951  -28.124  116.459  1.00 138.15 ? 205 PHE 1 CB    1 
ATOM   1613  C  CG    . PHE A  1  205 ? -16.079  -26.827  115.662  1.00 149.29 ? 205 PHE 1 CG    1 
ATOM   1614  C  CD1   . PHE A  1  205 ? -15.135  -25.821  115.772  1.00 148.89 ? 205 PHE 1 CD1   1 
ATOM   1615  C  CD2   . PHE A  1  205 ? -17.161  -26.615  114.815  1.00 155.00 ? 205 PHE 1 CD2   1 
ATOM   1616  C  CE1   . PHE A  1  205 ? -15.259  -24.637  115.045  1.00 152.11 ? 205 PHE 1 CE1   1 
ATOM   1617  C  CE2   . PHE A  1  205 ? -17.286  -25.428  114.086  1.00 156.63 ? 205 PHE 1 CE2   1 
ATOM   1618  C  CZ    . PHE A  1  205 ? -16.332  -24.443  114.205  1.00 155.49 ? 205 PHE 1 CZ    1 
ATOM   1619  N  N     . PRO A  1  206 ? -13.598  -29.828  117.930  1.00 96.67  ? 206 PRO 1 N     1 
ATOM   1620  C  CA    . PRO A  1  206 ? -13.228  -30.826  118.953  1.00 101.76 ? 206 PRO 1 CA    1 
ATOM   1621  C  C     . PRO A  1  206 ? -14.345  -31.158  119.924  1.00 111.93 ? 206 PRO 1 C     1 
ATOM   1622  O  O     . PRO A  1  206 ? -14.318  -32.242  120.528  1.00 110.70 ? 206 PRO 1 O     1 
ATOM   1623  C  CB    . PRO A  1  206 ? -12.035  -30.175  119.666  1.00 87.32  ? 206 PRO 1 CB    1 
ATOM   1624  C  CG    . PRO A  1  206 ? -12.154  -28.715  119.388  1.00 81.40  ? 206 PRO 1 CG    1 
ATOM   1625  C  CD    . PRO A  1  206 ? -12.858  -28.563  118.079  1.00 85.93  ? 206 PRO 1 CD    1 
ATOM   1626  N  N     . ALA A  1  207 ? -15.312  -30.259  120.104  1.00 114.21 ? 207 ALA 1 N     1 
ATOM   1627  C  CA    . ALA A  1  207 ? -16.472  -30.557  120.935  1.00 105.58 ? 207 ALA 1 CA    1 
ATOM   1628  C  C     . ALA A  1  207 ? -17.241  -31.759  120.406  1.00 102.96 ? 207 ALA 1 C     1 
ATOM   1629  O  O     . ALA A  1  207 ? -17.799  -32.533  121.191  1.00 106.86 ? 207 ALA 1 O     1 
ATOM   1630  C  CB    . ALA A  1  207 ? -17.380  -29.330  121.017  1.00 96.53  ? 207 ALA 1 CB    1 
ATOM   1631  N  N     . GLN A  1  208 ? -17.289  -31.923  119.078  1.00 93.08  ? 208 GLN 1 N     1 
ATOM   1632  C  CA    . GLN A  1  208 ? -17.954  -33.055  118.447  1.00 86.55  ? 208 GLN 1 CA    1 
ATOM   1633  C  C     . GLN A  1  208 ? -16.983  -34.128  117.949  1.00 84.70  ? 208 GLN 1 C     1 
ATOM   1634  O  O     . GLN A  1  208 ? -17.418  -35.257  117.688  1.00 88.88  ? 208 GLN 1 O     1 
ATOM   1635  C  CB    . GLN A  1  208 ? -18.831  -32.586  117.274  1.00 79.35  ? 208 GLN 1 CB    1 
ATOM   1636  C  CG    . GLN A  1  208 ? -19.767  -31.404  117.580  1.00 84.56  ? 208 GLN 1 CG    1 
ATOM   1637  C  CD    . GLN A  1  208 ? -19.258  -30.083  117.022  1.00 90.68  ? 208 GLN 1 CD    1 
ATOM   1638  O  OE1   . GLN A  1  208 ? -18.544  -30.054  116.027  1.00 93.50  ? 208 GLN 1 OE1   1 
ATOM   1639  N  NE2   . GLN A  1  208 ? -19.597  -28.990  117.687  1.00 89.06  ? 208 GLN 1 NE2   1 
ATOM   1640  N  N     . SER A  1  209 ? -15.689  -33.809  117.799  1.00 73.72  ? 209 SER 1 N     1 
ATOM   1641  C  CA    . SER A  1  209 ? -14.686  -34.801  117.383  1.00 78.65  ? 209 SER 1 CA    1 
ATOM   1642  C  C     . SER A  1  209 ? -13.313  -34.343  117.874  1.00 69.79  ? 209 SER 1 C     1 
ATOM   1643  O  O     . SER A  1  209 ? -12.695  -33.477  117.249  1.00 77.03  ? 209 SER 1 O     1 
ATOM   1644  C  CB    . SER A  1  209 ? -14.689  -34.986  115.874  1.00 97.81  ? 209 SER 1 CB    1 
ATOM   1645  O  OG    . SER A  1  209 ? -14.161  -36.245  115.481  1.00 103.13 ? 209 SER 1 OG    1 
ATOM   1646  N  N     . GLY A  1  210 ? -12.833  -34.954  118.954  1.00 69.31  ? 210 GLY 1 N     1 
ATOM   1647  C  CA    . GLY A  1  210 ? -11.534  -34.614  119.510  1.00 78.10  ? 210 GLY 1 CA    1 
ATOM   1648  C  C     . GLY A  1  210 ? -10.550  -35.769  119.534  1.00 89.33  ? 210 GLY 1 C     1 
ATOM   1649  O  O     . GLY A  1  210 ? -10.323  -36.418  118.510  1.00 93.21  ? 210 GLY 1 O     1 
ATOM   1650  N  N     . LEU A  1  211 ? -9.954   -36.018  120.699  1.00 87.35  ? 211 LEU 1 N     1 
ATOM   1651  C  CA    . LEU A  1  211 ? -9.019   -37.121  120.889  1.00 78.42  ? 211 LEU 1 CA    1 
ATOM   1652  C  C     . LEU A  1  211 ? -9.622   -38.455  120.461  1.00 78.70  ? 211 LEU 1 C     1 
ATOM   1653  O  O     . LEU A  1  211 ? -10.643  -38.894  121.005  1.00 84.02  ? 211 LEU 1 O     1 
ATOM   1654  C  CB    . LEU A  1  211 ? -8.607   -37.178  122.359  1.00 78.34  ? 211 LEU 1 CB    1 
ATOM   1655  C  CG    . LEU A  1  211 ? -7.150   -37.500  122.666  1.00 95.30  ? 211 LEU 1 CG    1 
ATOM   1656  C  CD1   . LEU A  1  211 ? -6.213   -36.839  121.657  1.00 114.04 ? 211 LEU 1 CD1   1 
ATOM   1657  C  CD2   . LEU A  1  211 ? -6.806   -37.110  124.091  1.00 88.56  ? 211 LEU 1 CD2   1 
ATOM   1658  N  N     . TRP A  1  212 ? -8.961   -39.108  119.504  1.00 74.91  ? 212 TRP 1 N     1 
ATOM   1659  C  CA    . TRP A  1  212 ? -9.425   -40.366  118.918  1.00 65.48  ? 212 TRP 1 CA    1 
ATOM   1660  C  C     . TRP A  1  212 ? -10.888  -40.260  118.489  1.00 70.24  ? 212 TRP 1 C     1 
ATOM   1661  O  O     . TRP A  1  212 ? -11.675  -41.195  118.643  1.00 72.94  ? 212 TRP 1 O     1 
ATOM   1662  C  CB    . TRP A  1  212 ? -9.207   -41.548  119.873  1.00 66.51  ? 212 TRP 1 CB    1 
ATOM   1663  C  CG    . TRP A  1  212 ? -7.754   -41.803  120.240  1.00 85.83  ? 212 TRP 1 CG    1 
ATOM   1664  C  CD1   . TRP A  1  212 ? -6.786   -42.316  119.431  1.00 96.26  ? 212 TRP 1 CD1   1 
ATOM   1665  C  CD2   . TRP A  1  212 ? -7.122   -41.563  121.512  1.00 88.96  ? 212 TRP 1 CD2   1 
ATOM   1666  N  NE1   . TRP A  1  212 ? -5.594   -42.403  120.111  1.00 99.56  ? 212 TRP 1 NE1   1 
ATOM   1667  C  CE2   . TRP A  1  212 ? -5.776   -41.943  121.388  1.00 90.53  ? 212 TRP 1 CE2   1 
ATOM   1668  C  CE3   . TRP A  1  212 ? -7.563   -41.058  122.735  1.00 81.94  ? 212 TRP 1 CE3   1 
ATOM   1669  C  CZ2   . TRP A  1  212 ? -4.870   -41.837  122.441  1.00 80.61  ? 212 TRP 1 CZ2   1 
ATOM   1670  C  CZ3   . TRP A  1  212 ? -6.654   -40.953  123.779  1.00 73.20  ? 212 TRP 1 CZ3   1 
ATOM   1671  C  CH2   . TRP A  1  212 ? -5.330   -41.338  123.624  1.00 75.59  ? 212 TRP 1 CH2   1 
ATOM   1672  N  N     . GLY A  1  213 ? -11.258  -39.102  117.938  1.00 76.95  ? 213 GLY 1 N     1 
ATOM   1673  C  CA    . GLY A  1  213 ? -12.607  -38.880  117.466  1.00 89.74  ? 213 GLY 1 CA    1 
ATOM   1674  C  C     . GLY A  1  213 ? -13.641  -38.585  118.531  1.00 99.13  ? 213 GLY 1 C     1 
ATOM   1675  O  O     . GLY A  1  213 ? -14.777  -38.243  118.180  1.00 100.04 ? 213 GLY 1 O     1 
ATOM   1676  N  N     . LYS A  1  214 ? -13.296  -38.703  119.822  1.00 104.72 ? 214 LYS 1 N     1 
ATOM   1677  C  CA    . LYS A  1  214 ? -14.283  -38.591  120.889  1.00 94.87  ? 214 LYS 1 CA    1 
ATOM   1678  C  C     . LYS A  1  214 ? -14.586  -37.125  121.201  1.00 82.08  ? 214 LYS 1 C     1 
ATOM   1679  O  O     . LYS A  1  214 ? -13.744  -36.251  120.976  1.00 80.07  ? 214 LYS 1 O     1 
ATOM   1680  C  CB    . LYS A  1  214 ? -13.778  -39.298  122.146  1.00 97.71  ? 214 LYS 1 CB    1 
ATOM   1681  C  CG    . LYS A  1  214 ? -13.579  -40.807  122.008  1.00 101.61 ? 214 LYS 1 CG    1 
ATOM   1682  C  CD    . LYS A  1  214 ? -14.792  -41.495  121.408  1.00 102.28 ? 214 LYS 1 CD    1 
ATOM   1683  C  CE    . LYS A  1  214 ? -14.749  -43.001  121.613  1.00 108.15 ? 214 LYS 1 CE    1 
ATOM   1684  N  NZ    . LYS A  1  214 ? -13.361  -43.512  121.495  1.00 114.35 ? 214 LYS 1 NZ    1 
ATOM   1685  N  N     . PRO A  1  215 ? -15.798  -36.829  121.723  1.00 75.63  ? 215 PRO 1 N     1 
ATOM   1686  C  CA    . PRO A  1  215 ? -16.169  -35.431  121.979  1.00 81.91  ? 215 PRO 1 CA    1 
ATOM   1687  C  C     . PRO A  1  215 ? -15.430  -34.880  123.178  1.00 96.14  ? 215 PRO 1 C     1 
ATOM   1688  O  O     . PRO A  1  215 ? -15.934  -34.912  124.301  1.00 105.18 ? 215 PRO 1 O     1 
ATOM   1689  C  CB    . PRO A  1  215 ? -17.683  -35.503  122.232  1.00 81.23  ? 215 PRO 1 CB    1 
ATOM   1690  C  CG    . PRO A  1  215 ? -18.110  -36.790  121.636  1.00 77.23  ? 215 PRO 1 CG    1 
ATOM   1691  C  CD    . PRO A  1  215 ? -16.962  -37.723  121.842  1.00 76.35  ? 215 PRO 1 CD    1 
ATOM   1692  N  N     . THR A  1  216 ? -14.218  -34.396  122.949  1.00 104.78 ? 216 THR 1 N     1 
ATOM   1693  C  CA    . THR A  1  216 ? -13.348  -33.957  124.026  1.00 123.71 ? 216 THR 1 CA    1 
ATOM   1694  C  C     . THR A  1  216 ? -13.456  -32.449  124.211  1.00 126.76 ? 216 THR 1 C     1 
ATOM   1695  O  O     . THR A  1  216 ? -13.816  -31.720  123.284  1.00 134.39 ? 216 THR 1 O     1 
ATOM   1696  C  CB    . THR A  1  216 ? -11.892  -34.358  123.752  1.00 135.96 ? 216 THR 1 CB    1 
ATOM   1697  O  OG1   . THR A  1  216 ? -11.361  -33.568  122.681  1.00 136.39 ? 216 THR 1 OG1   1 
ATOM   1698  C  CG2   . THR A  1  216 ? -11.790  -35.835  123.410  1.00 147.02 ? 216 THR 1 CG2   1 
ATOM   1699  N  N     . THR A  1  217 ? -13.173  -31.992  125.433  1.00 117.29 ? 217 THR 1 N     1 
ATOM   1700  C  CA    . THR A  1  217 ? -13.168  -30.575  125.772  1.00 100.97 ? 217 THR 1 CA    1 
ATOM   1701  C  C     . THR A  1  217 ? -11.857  -30.255  126.474  1.00 94.30  ? 217 THR 1 C     1 
ATOM   1702  O  O     . THR A  1  217 ? -11.402  -31.019  127.333  1.00 97.83  ? 217 THR 1 O     1 
ATOM   1703  C  CB    . THR A  1  217 ? -14.356  -30.194  126.675  1.00 97.24  ? 217 THR 1 CB    1 
ATOM   1704  O  OG1   . THR A  1  217 ? -15.585  -30.390  125.967  1.00 94.87  ? 217 THR 1 OG1   1 
ATOM   1705  C  CG2   . THR A  1  217 ? -14.270  -28.738  127.098  1.00 97.73  ? 217 THR 1 CG2   1 
ATOM   1706  N  N     . ILE A  1  218 ? -11.250  -29.131  126.097  1.00 87.78  ? 218 ILE 1 N     1 
ATOM   1707  C  CA    . ILE A  1  218 ? -9.940   -28.721  126.586  1.00 98.43  ? 218 ILE 1 CA    1 
ATOM   1708  C  C     . ILE A  1  218 ? -10.106  -27.414  127.340  1.00 106.51 ? 218 ILE 1 C     1 
ATOM   1709  O  O     . ILE A  1  218 ? -10.758  -26.488  126.843  1.00 110.64 ? 218 ILE 1 O     1 
ATOM   1710  C  CB    . ILE A  1  218 ? -8.932   -28.559  125.432  1.00 93.43  ? 218 ILE 1 CB    1 
ATOM   1711  C  CG1   . ILE A  1  218 ? -8.903   -29.826  124.573  1.00 93.78  ? 218 ILE 1 CG1   1 
ATOM   1712  C  CG2   . ILE A  1  218 ? -7.545   -28.237  125.973  1.00 85.04  ? 218 ILE 1 CG2   1 
ATOM   1713  C  CD1   . ILE A  1  218 ? -8.545   -29.617  123.104  1.00 85.55  ? 218 ILE 1 CD1   1 
ATOM   1714  N  N     . ASN A  1  219 ? -9.527   -27.336  128.534  1.00 106.47 ? 219 ASN 1 N     1 
ATOM   1715  C  CA    . ASN A  1  219 ? -9.620   -26.126  129.334  1.00 111.56 ? 219 ASN 1 CA    1 
ATOM   1716  C  C     . ASN A  1  219 ? -8.263   -25.808  129.948  1.00 119.68 ? 219 ASN 1 C     1 
ATOM   1717  O  O     . ASN A  1  219 ? -7.420   -26.686  130.145  1.00 125.55 ? 219 ASN 1 O     1 
ATOM   1718  C  CB    . ASN A  1  219 ? -10.682  -26.252  130.435  1.00 124.10 ? 219 ASN 1 CB    1 
ATOM   1719  C  CG    . ASN A  1  219 ? -12.080  -25.918  129.944  1.00 132.24 ? 219 ASN 1 CG    1 
ATOM   1720  O  OD1   . ASN A  1  219 ? -13.011  -26.703  130.108  1.00 145.73 ? 219 ASN 1 OD1   1 
ATOM   1721  N  ND2   . ASN A  1  219 ? -12.231  -24.749  129.346  1.00 125.11 ? 219 ASN 1 ND2   1 
ATOM   1722  N  N     . ASN A  1  220 ? -8.068   -24.528  130.250  1.00 119.01 ? 220 ASN 1 N     1 
ATOM   1723  C  CA    . ASN A  1  220 ? -6.827   -24.077  130.859  1.00 106.89 ? 220 ASN 1 CA    1 
ATOM   1724  C  C     . ASN A  1  220 ? -6.734   -24.542  132.304  1.00 102.86 ? 220 ASN 1 C     1 
ATOM   1725  O  O     . ASN A  1  220 ? -7.743   -24.800  132.964  1.00 107.25 ? 220 ASN 1 O     1 
ATOM   1726  C  CB    . ASN A  1  220 ? -6.725   -22.556  130.803  1.00 105.69 ? 220 ASN 1 CB    1 
ATOM   1727  C  CG    . ASN A  1  220 ? -5.385   -22.057  131.261  1.00 118.94 ? 220 ASN 1 CG    1 
ATOM   1728  O  OD1   . ASN A  1  220 ? -5.279   -21.381  132.279  1.00 127.54 ? 220 ASN 1 OD1   1 
ATOM   1729  N  ND2   . ASN A  1  220 ? -4.343   -22.412  130.525  1.00 121.79 ? 220 ASN 1 ND2   1 
ATOM   1730  N  N     . VAL A  1  221 ? -5.496   -24.655  132.787  1.00 95.61  ? 221 VAL 1 N     1 
ATOM   1731  C  CA    . VAL A  1  221 ? -5.267   -25.078  134.165  1.00 93.65  ? 221 VAL 1 CA    1 
ATOM   1732  C  C     . VAL A  1  221 ? -5.898   -24.082  135.130  1.00 83.46  ? 221 VAL 1 C     1 
ATOM   1733  O  O     . VAL A  1  221 ? -6.584   -24.462  136.088  1.00 78.26  ? 221 VAL 1 O     1 
ATOM   1734  C  CB    . VAL A  1  221 ? -3.758   -25.237  134.427  1.00 103.91 ? 221 VAL 1 CB    1 
ATOM   1735  C  CG1   . VAL A  1  221 ? -3.497   -25.576  135.888  1.00 110.85 ? 221 VAL 1 CG1   1 
ATOM   1736  C  CG2   . VAL A  1  221 ? -3.156   -26.282  133.496  1.00 111.13 ? 221 VAL 1 CG2   1 
ATOM   1737  N  N     . GLU A  1  222 ? -5.679   -22.789  134.889  1.00 77.42  ? 222 GLU 1 N     1 
ATOM   1738  C  CA    . GLU A  1  222 ? -6.249   -21.778  135.772  1.00 72.25  ? 222 GLU 1 CA    1 
ATOM   1739  C  C     . GLU A  1  222 ? -7.771   -21.844  135.772  1.00 76.82  ? 222 GLU 1 C     1 
ATOM   1740  O  O     . GLU A  1  222 ? -8.405   -21.665  136.817  1.00 70.66  ? 222 GLU 1 O     1 
ATOM   1741  C  CB    . GLU A  1  222 ? -5.768   -20.390  135.359  1.00 75.21  ? 222 GLU 1 CB    1 
ATOM   1742  C  CG    . GLU A  1  222 ? -6.108   -19.326  136.366  1.00 90.88  ? 222 GLU 1 CG    1 
ATOM   1743  C  CD    . GLU A  1  222 ? -6.128   -17.955  135.764  1.00 102.05 ? 222 GLU 1 CD    1 
ATOM   1744  O  OE1   . GLU A  1  222 ? -5.306   -17.679  134.872  1.00 100.53 ? 222 GLU 1 OE1   1 
ATOM   1745  O  OE2   . GLU A  1  222 ? -6.964   -17.145  136.191  1.00 108.46 ? 222 GLU 1 OE2   1 
ATOM   1746  N  N     . THR A  1  223 ? -8.372   -22.108  134.607  1.00 83.68  ? 223 THR 1 N     1 
ATOM   1747  C  CA    . THR A  1  223 ? -9.827   -22.229  134.518  1.00 89.96  ? 223 THR 1 CA    1 
ATOM   1748  C  C     . THR A  1  223 ? -10.341  -23.360  135.399  1.00 87.37  ? 223 THR 1 C     1 
ATOM   1749  O  O     . THR A  1  223 ? -11.248  -23.168  136.223  1.00 97.51  ? 223 THR 1 O     1 
ATOM   1750  C  CB    . THR A  1  223 ? -10.248  -22.454  133.060  1.00 92.09  ? 223 THR 1 CB    1 
ATOM   1751  O  OG1   . THR A  1  223 ? -9.468   -21.621  132.193  1.00 93.84  ? 223 THR 1 OG1   1 
ATOM   1752  C  CG2   . THR A  1  223 ? -11.710  -22.137  132.864  1.00 94.43  ? 223 THR 1 CG2   1 
ATOM   1753  N  N     . LEU A  1  224 ? -9.750   -24.543  135.249  1.00 74.78  ? 224 LEU 1 N     1 
ATOM   1754  C  CA    . LEU A  1  224 ? -10.183  -25.708  136.009  1.00 82.76  ? 224 LEU 1 CA    1 
ATOM   1755  C  C     . LEU A  1  224 ? -9.989   -25.495  137.504  1.00 73.42  ? 224 LEU 1 C     1 
ATOM   1756  O  O     . LEU A  1  224 ? -10.846  -25.871  138.310  1.00 49.79  ? 224 LEU 1 O     1 
ATOM   1757  C  CB    . LEU A  1  224 ? -9.408   -26.931  135.512  1.00 94.44  ? 224 LEU 1 CB    1 
ATOM   1758  C  CG    . LEU A  1  224 ? -9.707   -27.305  134.056  1.00 96.96  ? 224 LEU 1 CG    1 
ATOM   1759  C  CD1   . LEU A  1  224 ? -8.881   -28.487  133.556  1.00 90.44  ? 224 LEU 1 CD1   1 
ATOM   1760  C  CD2   . LEU A  1  224 ? -11.198  -27.587  133.881  1.00 98.97  ? 224 LEU 1 CD2   1 
ATOM   1761  N  N     . ALA A  1  225 ? -8.865   -24.892  137.893  1.00 89.34  ? 225 ALA 1 N     1 
ATOM   1762  C  CA    . ALA A  1  225 ? -8.647   -24.581  139.300  1.00 108.72 ? 225 ALA 1 CA    1 
ATOM   1763  C  C     . ALA A  1  225 ? -9.691   -23.601  139.824  1.00 109.56 ? 225 ALA 1 C     1 
ATOM   1764  O  O     . ALA A  1  225 ? -10.190  -23.758  140.945  1.00 125.85 ? 225 ALA 1 O     1 
ATOM   1765  C  CB    . ALA A  1  225 ? -7.240   -24.017  139.499  1.00 112.50 ? 225 ALA 1 CB    1 
ATOM   1766  N  N     . SER A  1  226 ? -10.054  -22.599  139.015  1.00 82.85  ? 226 SER 1 N     1 
ATOM   1767  C  CA    . SER A  1  226 ? -11.048  -21.607  139.409  1.00 65.43  ? 226 SER 1 CA    1 
ATOM   1768  C  C     . SER A  1  226 ? -12.445  -22.199  139.506  1.00 71.69  ? 226 SER 1 C     1 
ATOM   1769  O  O     . SER A  1  226 ? -13.313  -21.619  140.168  1.00 75.95  ? 226 SER 1 O     1 
ATOM   1770  C  CB    . SER A  1  226 ? -11.058  -20.460  138.394  1.00 57.25  ? 226 SER 1 CB    1 
ATOM   1771  O  OG    . SER A  1  226 ? -9.847   -19.728  138.425  1.00 71.37  ? 226 SER 1 OG    1 
ATOM   1772  N  N     . VAL A  1  227 ? -12.674  -23.342  138.855  1.00 74.41  ? 227 VAL 1 N     1 
ATOM   1773  C  CA    . VAL A  1  227 ? -13.974  -23.999  138.963  1.00 75.39  ? 227 VAL 1 CA    1 
ATOM   1774  C  C     . VAL A  1  227 ? -14.293  -24.354  140.414  1.00 72.29  ? 227 VAL 1 C     1 
ATOM   1775  O  O     . VAL A  1  227 ? -15.453  -24.283  140.835  1.00 78.78  ? 227 VAL 1 O     1 
ATOM   1776  C  CB    . VAL A  1  227 ? -14.019  -25.249  138.057  1.00 82.85  ? 227 VAL 1 CB    1 
ATOM   1777  C  CG1   . VAL A  1  227 ? -15.319  -26.002  138.243  1.00 83.87  ? 227 VAL 1 CG1   1 
ATOM   1778  C  CG2   . VAL A  1  227 ? -13.854  -24.860  136.594  1.00 90.80  ? 227 VAL 1 CG2   1 
ATOM   1779  N  N     . VAL A  1  228 ? -13.282  -24.697  141.207  1.00 62.83  ? 228 VAL 1 N     1 
ATOM   1780  C  CA    . VAL A  1  228 ? -13.511  -25.161  142.577  1.00 62.42  ? 228 VAL 1 CA    1 
ATOM   1781  C  C     . VAL A  1  228 ? -14.009  -24.038  143.483  1.00 67.81  ? 228 VAL 1 C     1 
ATOM   1782  O  O     . VAL A  1  228 ? -14.986  -24.253  144.207  1.00 63.93  ? 228 VAL 1 O     1 
ATOM   1783  C  CB    . VAL A  1  228 ? -12.255  -25.810  143.181  1.00 63.89  ? 228 VAL 1 CB    1 
ATOM   1784  C  CG1   . VAL A  1  228 ? -12.525  -26.297  144.609  1.00 57.17  ? 228 VAL 1 CG1   1 
ATOM   1785  C  CG2   . VAL A  1  228 ? -11.779  -26.937  142.313  1.00 62.32  ? 228 VAL 1 CG2   1 
ATOM   1786  N  N     . PRO A  1  229 ? -13.376  -22.856  143.530  1.00 75.11  ? 229 PRO 1 N     1 
ATOM   1787  C  CA    . PRO A  1  229 ? -13.956  -21.781  144.357  1.00 84.20  ? 229 PRO 1 CA    1 
ATOM   1788  C  C     . PRO A  1  229 ? -15.358  -21.406  143.935  1.00 82.56  ? 229 PRO 1 C     1 
ATOM   1789  O  O     . PRO A  1  229 ? -16.217  -21.144  144.787  1.00 88.26  ? 229 PRO 1 O     1 
ATOM   1790  C  CB    . PRO A  1  229 ? -12.989  -20.608  144.156  1.00 74.11  ? 229 PRO 1 CB    1 
ATOM   1791  C  CG    . PRO A  1  229 ? -12.084  -20.997  143.070  1.00 70.77  ? 229 PRO 1 CG    1 
ATOM   1792  C  CD    . PRO A  1  229 ? -12.061  -22.469  142.999  1.00 73.61  ? 229 PRO 1 CD    1 
ATOM   1793  N  N     . ILE A  1  230 ? -15.590  -21.338  142.622  1.00 76.91  ? 230 ILE 1 N     1 
ATOM   1794  C  CA    . ILE A  1  230 ? -16.915  -21.030  142.096  1.00 86.10  ? 230 ILE 1 CA    1 
ATOM   1795  C  C     . ILE A  1  230 ? -17.947  -21.956  142.726  1.00 92.72  ? 230 ILE 1 C     1 
ATOM   1796  O  O     . ILE A  1  230 ? -18.921  -21.511  143.343  1.00 99.91  ? 230 ILE 1 O     1 
ATOM   1797  C  CB    . ILE A  1  230 ? -16.923  -21.148  140.561  1.00 100.45 ? 230 ILE 1 CB    1 
ATOM   1798  C  CG1   . ILE A  1  230 ? -16.097  -20.024  139.927  1.00 108.95 ? 230 ILE 1 CG1   1 
ATOM   1799  C  CG2   . ILE A  1  230 ? -18.344  -21.111  140.030  1.00 104.16 ? 230 ILE 1 CG2   1 
ATOM   1800  C  CD1   . ILE A  1  230 ? -16.031  -20.076  138.410  1.00 110.76 ? 230 ILE 1 CD1   1 
ATOM   1801  N  N     . MET A  1  231 ? -17.713  -23.265  142.621  1.00 90.14  ? 231 MET 1 N     1 
ATOM   1802  C  CA    . MET A  1  231 ? -18.679  -24.232  143.129  1.00 86.17  ? 231 MET 1 CA    1 
ATOM   1803  C  C     . MET A  1  231 ? -18.693  -24.268  144.650  1.00 74.01  ? 231 MET 1 C     1 
ATOM   1804  O  O     . MET A  1  231 ? -19.710  -24.629  145.249  1.00 70.96  ? 231 MET 1 O     1 
ATOM   1805  C  CB    . MET A  1  231 ? -18.363  -25.624  142.579  1.00 96.87  ? 231 MET 1 CB    1 
ATOM   1806  C  CG    . MET A  1  231 ? -18.366  -25.732  141.077  1.00 104.35 ? 231 MET 1 CG    1 
ATOM   1807  S  SD    . MET A  1  231 ? -19.806  -24.956  140.336  1.00 110.27 ? 231 MET 1 SD    1 
ATOM   1808  C  CE    . MET A  1  231 ? -21.148  -25.932  141.004  1.00 107.95 ? 231 MET 1 CE    1 
ATOM   1809  N  N     . GLU A  1  232 ? -17.581  -23.898  145.283  1.00 75.67  ? 232 GLU 1 N     1 
ATOM   1810  C  CA    . GLU A  1  232 ? -17.459  -23.967  146.735  1.00 88.32  ? 232 GLU 1 CA    1 
ATOM   1811  C  C     . GLU A  1  232 ? -18.229  -22.845  147.415  1.00 109.19 ? 232 GLU 1 C     1 
ATOM   1812  O  O     . GLU A  1  232 ? -19.212  -23.088  148.125  1.00 121.90 ? 232 GLU 1 O     1 
ATOM   1813  C  CB    . GLU A  1  232 ? -15.981  -23.898  147.139  1.00 83.84  ? 232 GLU 1 CB    1 
ATOM   1814  C  CG    . GLU A  1  232 ? -15.749  -23.827  148.646  1.00 77.18  ? 232 GLU 1 CG    1 
ATOM   1815  C  CD    . GLU A  1  232 ? -14.287  -23.684  149.016  1.00 74.68  ? 232 GLU 1 CD    1 
ATOM   1816  O  OE1   . GLU A  1  232 ? -13.594  -22.862  148.394  1.00 69.10  ? 232 GLU 1 OE1   1 
ATOM   1817  O  OE2   . GLU A  1  232 ? -13.832  -24.382  149.944  1.00 72.96  ? 232 GLU 1 OE2   1 
ATOM   1818  N  N     . ARG A  1  233 ? -17.807  -21.605  147.189  1.00 138.16 ? 233 ARG 1 N     1 
ATOM   1819  C  CA    . ARG A  1  233 ? -18.424  -20.442  147.816  1.00 137.12 ? 233 ARG 1 CA    1 
ATOM   1820  C  C     . ARG A  1  233 ? -18.890  -19.510  146.705  1.00 131.60 ? 233 ARG 1 C     1 
ATOM   1821  O  O     . ARG A  1  233 ? -18.193  -18.574  146.316  1.00 115.00 ? 233 ARG 1 O     1 
ATOM   1822  C  CB    . ARG A  1  233 ? -17.439  -19.759  148.793  1.00 133.15 ? 233 ARG 1 CB    1 
ATOM   1823  C  CG    . ARG A  1  233 ? -16.040  -19.537  148.251  1.00 125.61 ? 233 ARG 1 CG    1 
ATOM   1824  C  CD    . ARG A  1  233 ? -15.078  -19.383  149.404  1.00 123.36 ? 233 ARG 1 CD    1 
ATOM   1825  N  NE    . ARG A  1  233 ? -13.691  -19.592  149.015  1.00 119.95 ? 233 ARG 1 NE    1 
ATOM   1826  C  CZ    . ARG A  1  233 ? -12.659  -19.113  149.699  1.00 121.94 ? 233 ARG 1 CZ    1 
ATOM   1827  N  NH1   . ARG A  1  233 ? -12.865  -18.407  150.799  1.00 114.79 ? 233 ARG 1 NH1   1 
ATOM   1828  N  NH2   . ARG A  1  233 ? -11.422  -19.350  149.290  1.00 125.46 ? 233 ARG 1 NH2   1 
ATOM   1829  N  N     . GLY A  1  234 ? -20.076  -19.800  146.177  1.00 143.48 ? 234 GLY 1 N     1 
ATOM   1830  C  CA    . GLY A  1  234 ? -20.794  -18.874  145.325  1.00 153.14 ? 234 GLY 1 CA    1 
ATOM   1831  C  C     . GLY A  1  234 ? -20.250  -18.703  143.923  1.00 160.55 ? 234 GLY 1 C     1 
ATOM   1832  O  O     . GLY A  1  234 ? -19.031  -18.698  143.717  1.00 160.86 ? 234 GLY 1 O     1 
ATOM   1833  N  N     . ALA A  1  235 ? -21.144  -18.578  142.942  1.00 162.33 ? 235 ALA 1 N     1 
ATOM   1834  C  CA    . ALA A  1  235 ? -20.751  -18.018  141.656  1.00 159.10 ? 235 ALA 1 CA    1 
ATOM   1835  C  C     . ALA A  1  235 ? -20.767  -16.496  141.684  1.00 156.09 ? 235 ALA 1 C     1 
ATOM   1836  O  O     . ALA A  1  235 ? -19.972  -15.856  140.989  1.00 153.36 ? 235 ALA 1 O     1 
ATOM   1837  C  CB    . ALA A  1  235 ? -21.671  -18.544  140.549  1.00 161.52 ? 235 ALA 1 CB    1 
ATOM   1838  N  N     . ASP A  1  236 ? -21.668  -15.902  142.471  1.00 158.20 ? 236 ASP 1 N     1 
ATOM   1839  C  CA    . ASP A  1  236 ? -21.666  -14.452  142.645  1.00 158.72 ? 236 ASP 1 CA    1 
ATOM   1840  C  C     . ASP A  1  236 ? -20.417  -13.987  143.380  1.00 153.11 ? 236 ASP 1 C     1 
ATOM   1841  O  O     . ASP A  1  236 ? -19.905  -12.893  143.116  1.00 154.52 ? 236 ASP 1 O     1 
ATOM   1842  C  CB    . ASP A  1  236 ? -22.918  -14.011  143.403  1.00 171.49 ? 236 ASP 1 CB    1 
ATOM   1843  C  CG    . ASP A  1  236 ? -24.168  -14.065  142.556  1.00 184.76 ? 236 ASP 1 CG    1 
ATOM   1844  O  OD1   . ASP A  1  236 ? -24.266  -13.286  141.585  1.00 190.78 ? 236 ASP 1 OD1   1 
ATOM   1845  O  OD2   . ASP A  1  236 ? -25.054  -14.890  142.855  1.00 189.36 ? 236 ASP 1 OD2   1 
ATOM   1846  N  N     . TRP A  1  237 ? -19.942  -14.788  144.334  1.00 150.03 ? 237 TRP 1 N     1 
ATOM   1847  C  CA    . TRP A  1  237 ? -18.676  -14.486  144.993  1.00 151.10 ? 237 TRP 1 CA    1 
ATOM   1848  C  C     . TRP A  1  237 ? -17.543  -14.403  143.975  1.00 157.45 ? 237 TRP 1 C     1 
ATOM   1849  O  O     . TRP A  1  237 ? -16.667  -13.537  144.080  1.00 158.53 ? 237 TRP 1 O     1 
ATOM   1850  C  CB    . TRP A  1  237 ? -18.389  -15.532  146.074  1.00 148.72 ? 237 TRP 1 CB    1 
ATOM   1851  C  CG    . TRP A  1  237 ? -17.021  -15.449  146.671  1.00 146.04 ? 237 TRP 1 CG    1 
ATOM   1852  C  CD1   . TRP A  1  237 ? -16.634  -14.690  147.733  1.00 145.74 ? 237 TRP 1 CD1   1 
ATOM   1853  C  CD2   . TRP A  1  237 ? -15.857  -16.157  146.238  1.00 150.09 ? 237 TRP 1 CD2   1 
ATOM   1854  N  NE1   . TRP A  1  237 ? -15.297  -14.877  147.986  1.00 148.72 ? 237 TRP 1 NE1   1 
ATOM   1855  C  CE2   . TRP A  1  237 ? -14.798  -15.776  147.080  1.00 152.73 ? 237 TRP 1 CE2   1 
ATOM   1856  C  CE3   . TRP A  1  237 ? -15.609  -17.073  145.219  1.00 153.62 ? 237 TRP 1 CE3   1 
ATOM   1857  C  CZ2   . TRP A  1  237 ? -13.510  -16.279  146.930  1.00 155.81 ? 237 TRP 1 CZ2   1 
ATOM   1858  C  CZ3   . TRP A  1  237 ? -14.332  -17.570  145.073  1.00 155.02 ? 237 TRP 1 CZ3   1 
ATOM   1859  C  CH2   . TRP A  1  237 ? -13.299  -17.174  145.922  1.00 156.58 ? 237 TRP 1 CH2   1 
ATOM   1860  N  N     . PHE A  1  238 ? -17.539  -15.303  142.986  1.00 165.81 ? 238 PHE 1 N     1 
ATOM   1861  C  CA    . PHE A  1  238 ? -16.565  -15.224  141.897  1.00 178.29 ? 238 PHE 1 CA    1 
ATOM   1862  C  C     . PHE A  1  238 ? -16.791  -13.977  141.043  1.00 198.03 ? 238 PHE 1 C     1 
ATOM   1863  O  O     . PHE A  1  238 ? -15.854  -13.215  140.780  1.00 199.72 ? 238 PHE 1 O     1 
ATOM   1864  C  CB    . PHE A  1  238 ? -16.636  -16.496  141.044  1.00 175.80 ? 238 PHE 1 CB    1 
ATOM   1865  C  CG    . PHE A  1  238 ? -15.631  -16.541  139.920  1.00 174.23 ? 238 PHE 1 CG    1 
ATOM   1866  C  CD1   . PHE A  1  238 ? -14.340  -16.994  140.135  1.00 172.42 ? 238 PHE 1 CD1   1 
ATOM   1867  C  CD2   . PHE A  1  238 ? -15.980  -16.125  138.650  1.00 172.81 ? 238 PHE 1 CD2   1 
ATOM   1868  C  CE1   . PHE A  1  238 ? -13.424  -17.035  139.097  1.00 170.48 ? 238 PHE 1 CE1   1 
ATOM   1869  C  CE2   . PHE A  1  238 ? -15.066  -16.158  137.614  1.00 169.89 ? 238 PHE 1 CE2   1 
ATOM   1870  C  CZ    . PHE A  1  238 ? -13.788  -16.615  137.839  1.00 169.63 ? 238 PHE 1 CZ    1 
ATOM   1871  N  N     . ALA A  1  239 ? -18.033  -13.752  140.600  1.00 216.12 ? 239 ALA 1 N     1 
ATOM   1872  C  CA    . ALA A  1  239 ? -18.381  -12.615  139.743  1.00 230.75 ? 239 ALA 1 CA    1 
ATOM   1873  C  C     . ALA A  1  239 ? -18.247  -11.263  140.437  1.00 237.63 ? 239 ALA 1 C     1 
ATOM   1874  O  O     . ALA A  1  239 ? -18.416  -10.231  139.779  1.00 237.92 ? 239 ALA 1 O     1 
ATOM   1875  C  CB    . ALA A  1  239 ? -19.806  -12.774  139.208  1.00 236.02 ? 239 ALA 1 CB    1 
ATOM   1876  N  N     . GLN A  1  240 ? -17.963  -11.245  141.739  1.00 243.99 ? 240 GLN 1 N     1 
ATOM   1877  C  CA    . GLN A  1  240 ? -17.790  -10.025  142.523  1.00 249.84 ? 240 GLN 1 CA    1 
ATOM   1878  C  C     . GLN A  1  240 ? -16.491  -9.284   142.182  1.00 243.13 ? 240 GLN 1 C     1 
ATOM   1879  O  O     . GLN A  1  240 ? -16.255  -8.197   142.721  1.00 246.83 ? 240 GLN 1 O     1 
ATOM   1880  C  CB    . GLN A  1  240 ? -17.853  -10.399  144.013  1.00 265.37 ? 240 GLN 1 CB    1 
ATOM   1881  C  CG    . GLN A  1  240 ? -17.753  -9.274   145.048  1.00 279.99 ? 240 GLN 1 CG    1 
ATOM   1882  C  CD    . GLN A  1  240 ? -17.772  -9.795   146.483  1.00 291.04 ? 240 GLN 1 CD    1 
ATOM   1883  O  OE1   . GLN A  1  240 ? -18.721  -10.454  146.909  1.00 296.14 ? 240 GLN 1 OE1   1 
ATOM   1884  N  NE2   . GLN A  1  240 ? -16.726  -9.484   147.236  1.00 294.85 ? 240 GLN 1 NE2   1 
ATOM   1885  N  N     . MET A  1  241 ? -15.679  -9.816   141.271  1.00 231.58 ? 241 MET 1 N     1 
ATOM   1886  C  CA    . MET A  1  241 ? -14.368  -9.277   140.940  1.00 218.37 ? 241 MET 1 CA    1 
ATOM   1887  C  C     . MET A  1  241 ? -14.323  -8.895   139.463  1.00 225.07 ? 241 MET 1 C     1 
ATOM   1888  O  O     . MET A  1  241 ? -14.814  -9.641   138.610  1.00 231.66 ? 241 MET 1 O     1 
ATOM   1889  C  CB    . MET A  1  241 ? -13.275  -10.315  141.256  1.00 198.94 ? 241 MET 1 CB    1 
ATOM   1890  C  CG    . MET A  1  241 ? -12.898  -10.422  142.728  1.00 178.47 ? 241 MET 1 CG    1 
ATOM   1891  S  SD    . MET A  1  241 ? -11.829  -11.821  143.124  1.00 157.11 ? 241 MET 1 SD    1 
ATOM   1892  C  CE    . MET A  1  241 ? -13.020  -13.125  143.384  1.00 154.73 ? 241 MET 1 CE    1 
ATOM   1893  N  N     . GLY A  1  242 ? -13.738  -7.727   139.160  1.00 223.28 ? 242 GLY 1 N     1 
ATOM   1894  C  CA    . GLY A  1  242 ? -13.475  -7.322   137.785  1.00 219.64 ? 242 GLY 1 CA    1 
ATOM   1895  C  C     . GLY A  1  242 ? -14.539  -6.436   137.152  1.00 215.38 ? 242 GLY 1 C     1 
ATOM   1896  O  O     . GLY A  1  242 ? -15.530  -6.035   137.774  1.00 220.49 ? 242 GLY 1 O     1 
ATOM   1897  N  N     . THR A  1  243 ? -14.310  -6.112   135.872  1.00 204.97 ? 243 THR 1 N     1 
ATOM   1898  C  CA    . THR A  1  243 ? -15.148  -5.176   135.122  1.00 194.03 ? 243 THR 1 CA    1 
ATOM   1899  C  C     . THR A  1  243 ? -16.414  -5.900   134.655  1.00 199.13 ? 243 THR 1 C     1 
ATOM   1900  O  O     . THR A  1  243 ? -16.644  -7.062   134.998  1.00 203.60 ? 243 THR 1 O     1 
ATOM   1901  C  CB    . THR A  1  243 ? -14.350  -4.574   133.958  1.00 178.89 ? 243 THR 1 CB    1 
ATOM   1902  O  OG1   . THR A  1  243 ? -13.015  -4.297   134.384  1.00 173.70 ? 243 THR 1 OG1   1 
ATOM   1903  C  CG2   . THR A  1  243 ? -14.959  -3.253   133.488  1.00 174.54 ? 243 THR 1 CG2   1 
ATOM   1904  N  N     . GLU A  1  244 ? -17.253  -5.235   133.852  1.00 201.79 ? 244 GLU 1 N     1 
ATOM   1905  C  CA    . GLU A  1  244 ? -18.499  -5.839   133.383  1.00 209.59 ? 244 GLU 1 CA    1 
ATOM   1906  C  C     . GLU A  1  244 ? -18.266  -6.959   132.375  1.00 206.20 ? 244 GLU 1 C     1 
ATOM   1907  O  O     . GLU A  1  244 ? -19.143  -7.813   132.203  1.00 210.83 ? 244 GLU 1 O     1 
ATOM   1908  C  CB    . GLU A  1  244 ? -19.414  -4.769   132.769  1.00 219.83 ? 244 GLU 1 CB    1 
ATOM   1909  C  CG    . GLU A  1  244 ? -20.905  -5.126   132.725  1.00 231.10 ? 244 GLU 1 CG    1 
ATOM   1910  C  CD    . GLU A  1  244 ? -21.679  -4.306   131.702  1.00 238.24 ? 244 GLU 1 CD    1 
ATOM   1911  O  OE1   . GLU A  1  244 ? -21.482  -3.074   131.652  1.00 240.65 ? 244 GLU 1 OE1   1 
ATOM   1912  O  OE2   . GLU A  1  244 ? -22.490  -4.892   130.954  1.00 241.74 ? 244 GLU 1 OE2   1 
ATOM   1913  N  N     . GLN A  1  245 ? -17.113  -6.975   131.705  1.00 193.95 ? 245 GLN 1 N     1 
ATOM   1914  C  CA    . GLN A  1  245 ? -16.794  -8.009   130.730  1.00 184.20 ? 245 GLN 1 CA    1 
ATOM   1915  C  C     . GLN A  1  245 ? -15.638  -8.905   131.154  1.00 180.51 ? 245 GLN 1 C     1 
ATOM   1916  O  O     . GLN A  1  245 ? -15.397  -9.924   130.497  1.00 184.70 ? 245 GLN 1 O     1 
ATOM   1917  C  CB    . GLN A  1  245 ? -16.465  -7.373   129.372  1.00 179.67 ? 245 GLN 1 CB    1 
ATOM   1918  C  CG    . GLN A  1  245 ? -17.683  -7.029   128.537  1.00 180.86 ? 245 GLN 1 CG    1 
ATOM   1919  C  CD    . GLN A  1  245 ? -17.364  -6.938   127.061  1.00 184.20 ? 245 GLN 1 CD    1 
ATOM   1920  O  OE1   . GLN A  1  245 ? -16.595  -6.079   126.636  1.00 184.98 ? 245 GLN 1 OE1   1 
ATOM   1921  N  NE2   . GLN A  1  245 ? -17.961  -7.818   126.268  1.00 188.12 ? 245 GLN 1 NE2   1 
ATOM   1922  N  N     . SER A  1  246 ? -14.924  -8.557   132.222  1.00 172.86 ? 246 SER 1 N     1 
ATOM   1923  C  CA    . SER A  1  246 ? -13.803  -9.335   132.745  1.00 163.82 ? 246 SER 1 CA    1 
ATOM   1924  C  C     . SER A  1  246 ? -14.130  -9.707   134.196  1.00 177.28 ? 246 SER 1 C     1 
ATOM   1925  O  O     . SER A  1  246 ? -13.772  -8.974   135.120  1.00 181.65 ? 246 SER 1 O     1 
ATOM   1926  C  CB    . SER A  1  246 ? -12.490  -8.525   132.637  1.00 145.36 ? 246 SER 1 CB    1 
ATOM   1927  O  OG    . SER A  1  246 ? -12.112  -8.306   131.284  1.00 132.53 ? 246 SER 1 OG    1 
ATOM   1928  N  N     . LYS A  1  247 ? -14.808  -10.841  134.394  1.00 186.34 ? 247 LYS 1 N     1 
ATOM   1929  C  CA    . LYS A  1  247 ? -15.259  -11.267  135.719  1.00 198.09 ? 247 LYS 1 CA    1 
ATOM   1930  C  C     . LYS A  1  247 ? -14.236  -12.174  136.409  1.00 201.58 ? 247 LYS 1 C     1 
ATOM   1931  O  O     . LYS A  1  247 ? -13.456  -12.878  135.759  1.00 204.74 ? 247 LYS 1 O     1 
ATOM   1932  C  CB    . LYS A  1  247 ? -16.603  -11.996  135.616  1.00 203.49 ? 247 LYS 1 CB    1 
ATOM   1933  C  CG    . LYS A  1  247 ? -17.732  -11.160  135.006  1.00 208.93 ? 247 LYS 1 CG    1 
ATOM   1934  C  CD    . LYS A  1  247 ? -18.080  -9.960   135.884  1.00 213.94 ? 247 LYS 1 CD    1 
ATOM   1935  C  CE    . LYS A  1  247 ? -19.237  -9.150   135.306  1.00 214.41 ? 247 LYS 1 CE    1 
ATOM   1936  N  NZ    . LYS A  1  247 ? -19.500  -7.887   136.053  1.00 212.62 ? 247 LYS 1 NZ    1 
ATOM   1937  N  N     . GLY A  1  248 ? -14.265  -12.163  137.749  1.00 194.81 ? 248 GLY 1 N     1 
ATOM   1938  C  CA    . GLY A  1  248 ? -13.410  -13.014  138.559  1.00 178.54 ? 248 GLY 1 CA    1 
ATOM   1939  C  C     . GLY A  1  248 ? -12.017  -12.442  138.775  1.00 161.23 ? 248 GLY 1 C     1 
ATOM   1940  O  O     . GLY A  1  248 ? -11.684  -11.326  138.366  1.00 154.03 ? 248 GLY 1 O     1 
ATOM   1941  N  N     . MET A  1  249 ? -11.184  -13.252  139.425  1.00 156.11 ? 249 MET 1 N     1 
ATOM   1942  C  CA    . MET A  1  249 ? -9.792   -12.922  139.702  1.00 153.13 ? 249 MET 1 CA    1 
ATOM   1943  C  C     . MET A  1  249 ? -8.884   -13.518  138.631  1.00 144.75 ? 249 MET 1 C     1 
ATOM   1944  O  O     . MET A  1  249 ? -9.311   -14.320  137.798  1.00 152.49 ? 249 MET 1 O     1 
ATOM   1945  C  CB    . MET A  1  249 ? -9.387   -13.436  141.086  1.00 167.16 ? 249 MET 1 CB    1 
ATOM   1946  C  CG    . MET A  1  249 ? -9.348   -14.960  141.239  1.00 180.26 ? 249 MET 1 CG    1 
ATOM   1947  S  SD    . MET A  1  249 ? -10.965  -15.754  141.066  1.00 195.95 ? 249 MET 1 SD    1 
ATOM   1948  C  CE    . MET A  1  249 ? -10.633  -17.463  141.520  1.00 196.02 ? 249 MET 1 CE    1 
ATOM   1949  N  N     . LYS A  1  250 ? -7.612   -13.120  138.664  1.00 138.39 ? 250 LYS 1 N     1 
ATOM   1950  C  CA    . LYS A  1  250 ? -6.635   -13.585  137.693  1.00 140.19 ? 250 LYS 1 CA    1 
ATOM   1951  C  C     . LYS A  1  250 ? -5.271   -13.640  138.368  1.00 146.89 ? 250 LYS 1 C     1 
ATOM   1952  O  O     . LYS A  1  250 ? -4.968   -12.849  139.269  1.00 152.80 ? 250 LYS 1 O     1 
ATOM   1953  C  CB    . LYS A  1  250 ? -6.591   -12.673  136.451  1.00 131.87 ? 250 LYS 1 CB    1 
ATOM   1954  C  CG    . LYS A  1  250 ? -5.483   -13.005  135.448  1.00 126.73 ? 250 LYS 1 CG    1 
ATOM   1955  C  CD    . LYS A  1  250 ? -5.681   -14.384  134.824  1.00 116.83 ? 250 LYS 1 CD    1 
ATOM   1956  C  CE    . LYS A  1  250 ? -4.663   -14.679  133.724  1.00 113.77 ? 250 LYS 1 CE    1 
ATOM   1957  N  NZ    . LYS A  1  250 ? -3.264   -14.612  134.222  1.00 109.57 ? 250 LYS 1 NZ    1 
ATOM   1958  N  N     . LEU A  1  251 ? -4.457   -14.595  137.930  1.00 143.28 ? 251 LEU 1 N     1 
ATOM   1959  C  CA    . LEU A  1  251 ? -3.081   -14.740  138.392  1.00 134.73 ? 251 LEU 1 CA    1 
ATOM   1960  C  C     . LEU A  1  251 ? -2.200   -13.889  137.482  1.00 142.64 ? 251 LEU 1 C     1 
ATOM   1961  O  O     . LEU A  1  251 ? -1.847   -14.307  136.377  1.00 149.74 ? 251 LEU 1 O     1 
ATOM   1962  C  CB    . LEU A  1  251 ? -2.671   -16.209  138.360  1.00 118.57 ? 251 LEU 1 CB    1 
ATOM   1963  C  CG    . LEU A  1  251 ? -3.082   -17.198  139.456  1.00 111.01 ? 251 LEU 1 CG    1 
ATOM   1964  C  CD1   . LEU A  1  251 ? -4.511   -17.018  139.936  1.00 111.02 ? 251 LEU 1 CD1   1 
ATOM   1965  C  CD2   . LEU A  1  251 ? -2.898   -18.604  138.914  1.00 110.29 ? 251 LEU 1 CD2   1 
ATOM   1966  N  N     . TYR A  1  252 ? -1.843   -12.688  137.937  1.00 142.69 ? 252 TYR 1 N     1 
ATOM   1967  C  CA    . TYR A  1  252 ? -0.944   -11.827  137.185  1.00 149.22 ? 252 TYR 1 CA    1 
ATOM   1968  C  C     . TYR A  1  252 ? 0.494    -12.208  137.501  1.00 146.98 ? 252 TYR 1 C     1 
ATOM   1969  O  O     . TYR A  1  252 ? 0.804    -12.681  138.593  1.00 146.32 ? 252 TYR 1 O     1 
ATOM   1970  C  CB    . TYR A  1  252 ? -1.172   -10.337  137.502  1.00 162.43 ? 252 TYR 1 CB    1 
ATOM   1971  C  CG    . TYR A  1  252 ? -2.483   -9.751   136.990  1.00 174.63 ? 252 TYR 1 CG    1 
ATOM   1972  C  CD1   . TYR A  1  252 ? -3.669   -9.932   137.682  1.00 183.11 ? 252 TYR 1 CD1   1 
ATOM   1973  C  CD2   . TYR A  1  252 ? -2.526   -9.009   135.818  1.00 178.14 ? 252 TYR 1 CD2   1 
ATOM   1974  C  CE1   . TYR A  1  252 ? -4.866   -9.399   137.217  1.00 185.96 ? 252 TYR 1 CE1   1 
ATOM   1975  C  CE2   . TYR A  1  252 ? -3.720   -8.473   135.344  1.00 181.93 ? 252 TYR 1 CE2   1 
ATOM   1976  C  CZ    . TYR A  1  252 ? -4.887   -8.672   136.047  1.00 184.16 ? 252 TYR 1 CZ    1 
ATOM   1977  O  OH    . TYR A  1  252 ? -6.072   -8.141   135.578  1.00 182.89 ? 252 TYR 1 OH    1 
ATOM   1978  N  N     . GLN A  1  253 ? 1.365    -12.049  136.513  1.00 149.83 ? 253 GLN 1 N     1 
ATOM   1979  C  CA    . GLN A  1  253 ? 2.781    -12.319  136.704  1.00 163.01 ? 253 GLN 1 CA    1 
ATOM   1980  C  C     . GLN A  1  253 ? 3.589    -11.270  135.957  1.00 161.87 ? 253 GLN 1 C     1 
ATOM   1981  O  O     . GLN A  1  253 ? 3.185    -10.794  134.893  1.00 164.16 ? 253 GLN 1 O     1 
ATOM   1982  C  CB    . GLN A  1  253 ? 3.160    -13.746  136.264  1.00 176.49 ? 253 GLN 1 CB    1 
ATOM   1983  C  CG    . GLN A  1  253 ? 2.891    -14.095  134.806  1.00 190.71 ? 253 GLN 1 CG    1 
ATOM   1984  C  CD    . GLN A  1  253 ? 1.441    -14.455  134.527  1.00 201.74 ? 253 GLN 1 CD    1 
ATOM   1985  O  OE1   . GLN A  1  253 ? 0.598    -14.409  135.417  1.00 203.73 ? 253 GLN 1 OE1   1 
ATOM   1986  N  NE2   . GLN A  1  253 ? 1.143    -14.791  133.275  1.00 207.88 ? 253 GLN 1 NE2   1 
ATOM   1987  N  N     . ILE A  1  254 ? 4.727    -10.899  136.534  1.00 154.99 ? 254 ILE 1 N     1 
ATOM   1988  C  CA    . ILE A  1  254 ? 5.551    -9.838   135.972  1.00 144.46 ? 254 ILE 1 CA    1 
ATOM   1989  C  C     . ILE A  1  254 ? 7.013    -10.244  136.075  1.00 130.89 ? 254 ILE 1 C     1 
ATOM   1990  O  O     . ILE A  1  254 ? 7.423    -10.947  137.004  1.00 128.10 ? 254 ILE 1 O     1 
ATOM   1991  C  CB    . ILE A  1  254 ? 5.288    -8.472   136.662  1.00 148.90 ? 254 ILE 1 CB    1 
ATOM   1992  C  CG1   . ILE A  1  254 ? 6.017    -7.339   135.928  1.00 145.56 ? 254 ILE 1 CG1   1 
ATOM   1993  C  CG2   . ILE A  1  254 ? 5.672    -8.519   138.138  1.00 154.98 ? 254 ILE 1 CG2   1 
ATOM   1994  C  CD1   . ILE A  1  254 ? 5.878    -5.979   136.586  1.00 142.99 ? 254 ILE 1 CD1   1 
ATOM   1995  N  N     . SER A  1  255 ? 7.791    -9.827   135.078  1.00 125.55 ? 255 SER 1 N     1 
ATOM   1996  C  CA    . SER A  1  255 ? 9.230    -10.035  135.064  1.00 123.73 ? 255 SER 1 CA    1 
ATOM   1997  C  C     . SER A  1  255 ? 9.873    -8.852   134.356  1.00 130.24 ? 255 SER 1 C     1 
ATOM   1998  O  O     . SER A  1  255 ? 9.221    -8.127   133.601  1.00 136.32 ? 255 SER 1 O     1 
ATOM   1999  C  CB    . SER A  1  255 ? 9.605    -11.354  134.377  1.00 107.82 ? 255 SER 1 CB    1 
ATOM   2000  O  OG    . SER A  1  255 ? 8.821    -11.571  133.215  1.00 89.04  ? 255 SER 1 OG    1 
ATOM   2001  N  N     . GLY A  1  256 ? 11.158   -8.650   134.620  1.00 123.34 ? 256 GLY 1 N     1 
ATOM   2002  C  CA    . GLY A  1  256 ? 11.878   -7.554   134.018  1.00 124.84 ? 256 GLY 1 CA    1 
ATOM   2003  C  C     . GLY A  1  256 ? 12.692   -6.772   135.030  1.00 136.50 ? 256 GLY 1 C     1 
ATOM   2004  O  O     . GLY A  1  256 ? 12.908   -7.214   136.163  1.00 136.01 ? 256 GLY 1 O     1 
ATOM   2005  N  N     . PRO A  1  257 ? 13.136   -5.570   134.643  1.00 142.61 ? 257 PRO 1 N     1 
ATOM   2006  C  CA    . PRO A  1  257 ? 13.887   -4.718   135.576  1.00 138.83 ? 257 PRO 1 CA    1 
ATOM   2007  C  C     . PRO A  1  257 ? 12.996   -4.072   136.628  1.00 130.93 ? 257 PRO 1 C     1 
ATOM   2008  O  O     . PRO A  1  257 ? 12.914   -2.841   136.706  1.00 134.91 ? 257 PRO 1 O     1 
ATOM   2009  C  CB    . PRO A  1  257 ? 14.519   -3.661   134.656  1.00 140.02 ? 257 PRO 1 CB    1 
ATOM   2010  C  CG    . PRO A  1  257 ? 14.312   -4.171   133.236  1.00 142.38 ? 257 PRO 1 CG    1 
ATOM   2011  C  CD    . PRO A  1  257 ? 13.064   -4.980   133.297  1.00 143.04 ? 257 PRO 1 CD    1 
ATOM   2012  N  N     . VAL A  1  258 ? 12.324   -4.889   137.438  1.00 118.22 ? 258 VAL 1 N     1 
ATOM   2013  C  CA    . VAL A  1  258 ? 11.437   -4.408   138.488  1.00 112.34 ? 258 VAL 1 CA    1 
ATOM   2014  C  C     . VAL A  1  258 ? 11.940   -4.936   139.828  1.00 129.17 ? 258 VAL 1 C     1 
ATOM   2015  O  O     . VAL A  1  258 ? 12.713   -5.894   139.895  1.00 132.59 ? 258 VAL 1 O     1 
ATOM   2016  C  CB    . VAL A  1  258 ? 9.969    -4.817   138.231  1.00 104.42 ? 258 VAL 1 CB    1 
ATOM   2017  C  CG1   . VAL A  1  258 ? 9.725    -6.277   138.603  1.00 99.15  ? 258 VAL 1 CG1   1 
ATOM   2018  C  CG2   . VAL A  1  258 ? 9.017    -3.863   138.928  1.00 107.16 ? 258 VAL 1 CG2   1 
ATOM   2019  N  N     . LYS A  1  259 ? 11.497   -4.284   140.908  1.00 132.37 ? 259 LYS 1 N     1 
ATOM   2020  C  CA    . LYS A  1  259 ? 12.064   -4.555   142.226  1.00 123.98 ? 259 LYS 1 CA    1 
ATOM   2021  C  C     . LYS A  1  259 ? 11.799   -5.992   142.668  1.00 113.88 ? 259 LYS 1 C     1 
ATOM   2022  O  O     . LYS A  1  259 ? 12.717   -6.695   143.102  1.00 112.02 ? 259 LYS 1 O     1 
ATOM   2023  C  CB    . LYS A  1  259 ? 11.520   -3.566   143.255  1.00 126.40 ? 259 LYS 1 CB    1 
ATOM   2024  C  CG    . LYS A  1  259 ? 12.127   -3.753   144.638  1.00 137.94 ? 259 LYS 1 CG    1 
ATOM   2025  C  CD    . LYS A  1  259 ? 11.850   -2.566   145.542  1.00 147.34 ? 259 LYS 1 CD    1 
ATOM   2026  C  CE    . LYS A  1  259 ? 12.500   -2.740   146.904  1.00 151.20 ? 259 LYS 1 CE    1 
ATOM   2027  N  NZ    . LYS A  1  259 ? 13.905   -3.228   146.790  1.00 151.50 ? 259 LYS 1 NZ    1 
ATOM   2028  N  N     . ARG A  1  260 ? 10.549   -6.442   142.587  1.00 115.90 ? 260 ARG 1 N     1 
ATOM   2029  C  CA    . ARG A  1  260 ? 10.206   -7.820   142.933  1.00 128.08 ? 260 ARG 1 CA    1 
ATOM   2030  C  C     . ARG A  1  260 ? 9.229    -8.399   141.914  1.00 134.96 ? 260 ARG 1 C     1 
ATOM   2031  O  O     . ARG A  1  260 ? 8.006    -8.292   142.061  1.00 138.01 ? 260 ARG 1 O     1 
ATOM   2032  C  CB    . ARG A  1  260 ? 9.680    -7.911   144.369  1.00 134.10 ? 260 ARG 1 CB    1 
ATOM   2033  C  CG    . ARG A  1  260 ? 8.481    -7.037   144.705  1.00 132.86 ? 260 ARG 1 CG    1 
ATOM   2034  C  CD    . ARG A  1  260 ? 8.186    -7.076   146.194  1.00 128.43 ? 260 ARG 1 CD    1 
ATOM   2035  N  NE    . ARG A  1  260 ? 8.970    -6.086   146.926  1.00 129.65 ? 260 ARG 1 NE    1 
ATOM   2036  C  CZ    . ARG A  1  260 ? 8.556    -4.851   147.195  1.00 129.80 ? 260 ARG 1 CZ    1 
ATOM   2037  N  NH1   . ARG A  1  260 ? 7.359    -4.451   146.797  1.00 126.52 ? 260 ARG 1 NH1   1 
ATOM   2038  N  NH2   . ARG A  1  260 ? 9.340    -4.021   147.870  1.00 129.27 ? 260 ARG 1 NH2   1 
ATOM   2039  N  N     . PRO A  1  261 ? 9.742    -9.004   140.845  1.00 130.53 ? 261 PRO 1 N     1 
ATOM   2040  C  CA    . PRO A  1  261 ? 8.870    -9.701   139.893  1.00 118.88 ? 261 PRO 1 CA    1 
ATOM   2041  C  C     . PRO A  1  261 ? 8.308    -10.974  140.508  1.00 106.71 ? 261 PRO 1 C     1 
ATOM   2042  O  O     . PRO A  1  261 ? 8.765    -11.443  141.550  1.00 97.69  ? 261 PRO 1 O     1 
ATOM   2043  C  CB    . PRO A  1  261 ? 9.802    -10.011  138.719  1.00 113.41 ? 261 PRO 1 CB    1 
ATOM   2044  C  CG    . PRO A  1  261 ? 11.152   -10.060  139.321  1.00 115.47 ? 261 PRO 1 CG    1 
ATOM   2045  C  CD    . PRO A  1  261 ? 11.159   -9.067   140.442  1.00 127.17 ? 261 PRO 1 CD    1 
ATOM   2046  N  N     . GLY A  1  262 ? 7.289    -11.527  139.863  1.00 108.10 ? 262 GLY 1 N     1 
ATOM   2047  C  CA    . GLY A  1  262 ? 6.727    -12.783  140.324  1.00 109.72 ? 262 GLY 1 CA    1 
ATOM   2048  C  C     . GLY A  1  262 ? 5.238    -12.872  140.040  1.00 104.03 ? 262 GLY 1 C     1 
ATOM   2049  O  O     . GLY A  1  262 ? 4.722    -12.195  139.155  1.00 102.24 ? 262 GLY 1 O     1 
ATOM   2050  N  N     . VAL A  1  263 ? 4.570    -13.723  140.826  1.00 108.80 ? 263 VAL 1 N     1 
ATOM   2051  C  CA    . VAL A  1  263 ? 3.156    -14.049  140.661  1.00 120.52 ? 263 VAL 1 CA    1 
ATOM   2052  C  C     . VAL A  1  263 ? 2.359    -13.352  141.760  1.00 127.51 ? 263 VAL 1 C     1 
ATOM   2053  O  O     . VAL A  1  263 ? 2.792    -13.301  142.918  1.00 136.29 ? 263 VAL 1 O     1 
ATOM   2054  C  CB    . VAL A  1  263 ? 2.929    -15.577  140.712  1.00 122.68 ? 263 VAL 1 CB    1 
ATOM   2055  C  CG1   . VAL A  1  263 ? 1.505    -15.937  140.308  1.00 126.13 ? 263 VAL 1 CG1   1 
ATOM   2056  C  CG2   . VAL A  1  263 ? 3.954    -16.317  139.859  1.00 117.20 ? 263 VAL 1 CG2   1 
ATOM   2057  N  N     . TYR A  1  264 ? 1.195    -12.813  141.393  1.00 119.77 ? 264 TYR 1 N     1 
ATOM   2058  C  CA    . TYR A  1  264 ? 0.261    -12.202  142.337  1.00 112.21 ? 264 TYR 1 CA    1 
ATOM   2059  C  C     . TYR A  1  264 ? -1.162   -12.571  141.929  1.00 99.44  ? 264 TYR 1 C     1 
ATOM   2060  O  O     . TYR A  1  264 ? -1.581   -12.279  140.803  1.00 108.04 ? 264 TYR 1 O     1 
ATOM   2061  C  CB    . TYR A  1  264 ? 0.444    -10.676  142.377  1.00 126.94 ? 264 TYR 1 CB    1 
ATOM   2062  C  CG    . TYR A  1  264 ? 1.850    -10.243  142.755  1.00 144.67 ? 264 TYR 1 CG    1 
ATOM   2063  C  CD1   . TYR A  1  264 ? 2.239    -10.155  144.083  1.00 151.91 ? 264 TYR 1 CD1   1 
ATOM   2064  C  CD2   . TYR A  1  264 ? 2.790    -9.929   141.787  1.00 149.09 ? 264 TYR 1 CD2   1 
ATOM   2065  C  CE1   . TYR A  1  264 ? 3.526    -9.765   144.437  1.00 149.78 ? 264 TYR 1 CE1   1 
ATOM   2066  C  CE2   . TYR A  1  264 ? 4.079    -9.539   142.136  1.00 150.72 ? 264 TYR 1 CE2   1 
ATOM   2067  C  CZ    . TYR A  1  264 ? 4.440    -9.459   143.460  1.00 147.58 ? 264 TYR 1 CZ    1 
ATOM   2068  O  OH    . TYR A  1  264 ? 5.717    -9.073   143.803  1.00 142.28 ? 264 TYR 1 OH    1 
ATOM   2069  N  N     . GLU A  1  265 ? -1.902   -13.218  142.830  1.00 83.58  ? 265 GLU 1 N     1 
ATOM   2070  C  CA    . GLU A  1  265 ? -3.317   -13.526  142.602  1.00 79.23  ? 265 GLU 1 CA    1 
ATOM   2071  C  C     . GLU A  1  265 ? -4.128   -12.275  142.923  1.00 91.90  ? 265 GLU 1 C     1 
ATOM   2072  O  O     . GLU A  1  265 ? -4.349   -11.948  144.094  1.00 104.23 ? 265 GLU 1 O     1 
ATOM   2073  C  CB    . GLU A  1  265 ? -3.755   -14.712  143.460  1.00 77.82  ? 265 GLU 1 CB    1 
ATOM   2074  C  CG    . GLU A  1  265 ? -5.183   -15.244  143.194  1.00 94.14  ? 265 GLU 1 CG    1 
ATOM   2075  C  CD    . GLU A  1  265 ? -5.661   -16.250  144.243  1.00 100.76 ? 265 GLU 1 CD    1 
ATOM   2076  O  OE1   . GLU A  1  265 ? -4.811   -16.842  144.932  1.00 103.47 ? 265 GLU 1 OE1   1 
ATOM   2077  O  OE2   . GLU A  1  265 ? -6.888   -16.451  144.383  1.00 96.06  ? 265 GLU 1 OE2   1 
ATOM   2078  N  N     . LEU A  1  266 ? -4.597   -11.575  141.891  1.00 98.42  ? 266 LEU 1 N     1 
ATOM   2079  C  CA    . LEU A  1  266 ? -5.225   -10.274  142.068  1.00 107.80 ? 266 LEU 1 CA    1 
ATOM   2080  C  C     . LEU A  1  266 ? -6.521   -10.194  141.275  1.00 123.46 ? 266 LEU 1 C     1 
ATOM   2081  O  O     . LEU A  1  266 ? -6.702   -10.916  140.292  1.00 114.58 ? 266 LEU 1 O     1 
ATOM   2082  C  CB    . LEU A  1  266 ? -4.290   -9.137   141.618  1.00 101.31 ? 266 LEU 1 CB    1 
ATOM   2083  C  CG    . LEU A  1  266 ? -2.870   -9.099   142.192  1.00 100.81 ? 266 LEU 1 CG    1 
ATOM   2084  C  CD1   . LEU A  1  266 ? -1.948   -8.204   141.364  1.00 112.72 ? 266 LEU 1 CD1   1 
ATOM   2085  C  CD2   . LEU A  1  266 ? -2.897   -8.664   143.653  1.00 88.47  ? 266 LEU 1 CD2   1 
ATOM   2086  N  N     . PRO A  1  267 ? -7.453   -9.344   141.698  1.00 156.11 ? 267 PRO 1 N     1 
ATOM   2087  C  CA    . PRO A  1  267 ? -8.685   -9.155   140.924  1.00 170.71 ? 267 PRO 1 CA    1 
ATOM   2088  C  C     . PRO A  1  267 ? -8.406   -8.516   139.570  1.00 178.63 ? 267 PRO 1 C     1 
ATOM   2089  O  O     . PRO A  1  267 ? -7.371   -7.884   139.351  1.00 186.71 ? 267 PRO 1 O     1 
ATOM   2090  C  CB    . PRO A  1  267 ? -9.527   -8.234   141.816  1.00 176.09 ? 267 PRO 1 CB    1 
ATOM   2091  C  CG    . PRO A  1  267 ? -8.535   -7.539   142.697  1.00 178.70 ? 267 PRO 1 CG    1 
ATOM   2092  C  CD    . PRO A  1  267 ? -7.450   -8.547   142.938  1.00 171.14 ? 267 PRO 1 CD    1 
ATOM   2093  N  N     . MET A  1  268 ? -9.353   -8.698   138.649  1.00 178.42 ? 268 MET 1 N     1 
ATOM   2094  C  CA    . MET A  1  268 ? -9.235   -8.152   137.300  1.00 183.10 ? 268 MET 1 CA    1 
ATOM   2095  C  C     . MET A  1  268 ? -9.520   -6.651   137.301  1.00 167.93 ? 268 MET 1 C     1 
ATOM   2096  O  O     . MET A  1  268 ? -10.536  -6.203   137.842  1.00 164.85 ? 268 MET 1 O     1 
ATOM   2097  C  CB    . MET A  1  268 ? -10.200  -8.876   136.356  1.00 203.51 ? 268 MET 1 CB    1 
ATOM   2098  C  CG    . MET A  1  268 ? -9.741   -8.928   134.912  1.00 221.84 ? 268 MET 1 CG    1 
ATOM   2099  S  SD    . MET A  1  268 ? -8.682   -10.357  134.602  1.00 238.18 ? 268 MET 1 SD    1 
ATOM   2100  C  CE    . MET A  1  268 ? -9.898   -11.624  134.252  1.00 240.52 ? 268 MET 1 CE    1 
ATOM   2101  N  N     . GLY A  1  269 ? -8.619   -5.873   136.706  1.00 157.40 ? 269 GLY 1 N     1 
ATOM   2102  C  CA    . GLY A  1  269 ? -8.780   -4.431   136.593  1.00 156.49 ? 269 GLY 1 CA    1 
ATOM   2103  C  C     . GLY A  1  269 ? -7.707   -3.606   137.271  1.00 160.82 ? 269 GLY 1 C     1 
ATOM   2104  O  O     . GLY A  1  269 ? -7.680   -2.379   137.079  1.00 162.95 ? 269 GLY 1 O     1 
ATOM   2105  N  N     . THR A  1  270 ? -6.835   -4.216   138.074  1.00 162.72 ? 270 THR 1 N     1 
ATOM   2106  C  CA    . THR A  1  270 ? -5.765   -3.474   138.732  1.00 166.59 ? 270 THR 1 CA    1 
ATOM   2107  C  C     . THR A  1  270 ? -4.911   -2.742   137.705  1.00 155.67 ? 270 THR 1 C     1 
ATOM   2108  O  O     . THR A  1  270 ? -4.609   -3.267   136.632  1.00 143.53 ? 270 THR 1 O     1 
ATOM   2109  C  CB    . THR A  1  270 ? -4.884   -4.410   139.569  1.00 179.72 ? 270 THR 1 CB    1 
ATOM   2110  O  OG1   . THR A  1  270 ? -4.111   -5.256   138.711  1.00 185.23 ? 270 THR 1 OG1   1 
ATOM   2111  C  CG2   . THR A  1  270 ? -5.732   -5.277   140.499  1.00 181.74 ? 270 THR 1 CG2   1 
ATOM   2112  N  N     . THR A  1  271 ? -4.519   -1.520   138.041  1.00 162.08 ? 271 THR 1 N     1 
ATOM   2113  C  CA    . THR A  1  271 ? -3.806   -0.705   137.077  1.00 165.62 ? 271 THR 1 CA    1 
ATOM   2114  C  C     . THR A  1  271 ? -2.355   -1.150   136.978  1.00 161.77 ? 271 THR 1 C     1 
ATOM   2115  O  O     . THR A  1  271 ? -1.799   -1.771   137.890  1.00 161.23 ? 271 THR 1 O     1 
ATOM   2116  C  CB    . THR A  1  271 ? -3.870   0.773    137.458  1.00 171.95 ? 271 THR 1 CB    1 
ATOM   2117  O  OG1   . THR A  1  271 ? -3.292   0.954    138.756  1.00 171.36 ? 271 THR 1 OG1   1 
ATOM   2118  C  CG2   . THR A  1  271 ? -5.309   1.254    137.475  1.00 176.30 ? 271 THR 1 CG2   1 
ATOM   2119  N  N     . PHE A  1  272 ? -1.751   -0.847   135.830  1.00 165.98 ? 272 PHE 1 N     1 
ATOM   2120  C  CA    . PHE A  1  272 ? -0.336   -1.138   135.643  1.00 168.53 ? 272 PHE 1 CA    1 
ATOM   2121  C  C     . PHE A  1  272 ? 0.496    -0.433   136.698  1.00 168.93 ? 272 PHE 1 C     1 
ATOM   2122  O  O     . PHE A  1  272 ? 1.481    -0.986   137.198  1.00 168.08 ? 272 PHE 1 O     1 
ATOM   2123  C  CB    . PHE A  1  272 ? 0.110    -0.711   134.245  1.00 175.79 ? 272 PHE 1 CB    1 
ATOM   2124  C  CG    . PHE A  1  272 ? -0.623   -1.405   133.140  1.00 187.00 ? 272 PHE 1 CG    1 
ATOM   2125  C  CD1   . PHE A  1  272 ? -1.901   -1.017   132.782  1.00 191.77 ? 272 PHE 1 CD1   1 
ATOM   2126  C  CD2   . PHE A  1  272 ? -0.033   -2.449   132.458  1.00 193.75 ? 272 PHE 1 CD2   1 
ATOM   2127  C  CE1   . PHE A  1  272 ? -2.574   -1.656   131.767  1.00 195.43 ? 272 PHE 1 CE1   1 
ATOM   2128  C  CE2   . PHE A  1  272 ? -0.702   -3.091   131.444  1.00 197.46 ? 272 PHE 1 CE2   1 
ATOM   2129  C  CZ    . PHE A  1  272 ? -1.974   -2.694   131.098  1.00 198.29 ? 272 PHE 1 CZ    1 
ATOM   2130  N  N     . ARG A  1  273 ? 0.118    0.802    137.033  1.00 168.83 ? 273 ARG 1 N     1 
ATOM   2131  C  CA    . ARG A  1  273 ? 0.824    1.541    138.070  1.00 164.31 ? 273 ARG 1 CA    1 
ATOM   2132  C  C     . ARG A  1  273 ? 0.796    0.781    139.386  1.00 153.27 ? 273 ARG 1 C     1 
ATOM   2133  O  O     . ARG A  1  273 ? 1.838    0.566    140.015  1.00 152.07 ? 273 ARG 1 O     1 
ATOM   2134  C  CB    . ARG A  1  273 ? 0.200    2.928    138.236  1.00 165.70 ? 273 ARG 1 CB    1 
ATOM   2135  C  CG    . ARG A  1  273 ? 0.894    3.811    139.260  1.00 165.16 ? 273 ARG 1 CG    1 
ATOM   2136  C  CD    . ARG A  1  273 ? 0.112    5.093    139.488  1.00 166.99 ? 273 ARG 1 CD    1 
ATOM   2137  N  NE    . ARG A  1  273 ? -0.205   5.766    138.232  1.00 171.85 ? 273 ARG 1 NE    1 
ATOM   2138  C  CZ    . ARG A  1  273 ? 0.662    6.476    137.518  1.00 176.41 ? 273 ARG 1 CZ    1 
ATOM   2139  N  NH1   . ARG A  1  273 ? 1.915    6.622    137.927  1.00 171.74 ? 273 ARG 1 NH1   1 
ATOM   2140  N  NH2   . ARG A  1  273 ? 0.268    7.044    136.387  1.00 181.77 ? 273 ARG 1 NH2   1 
ATOM   2141  N  N     . GLU A  1  274 ? -0.395   0.347    139.806  1.00 138.63 ? 274 GLU 1 N     1 
ATOM   2142  C  CA    . GLU A  1  274 ? -0.519   -0.412   141.042  1.00 120.45 ? 274 GLU 1 CA    1 
ATOM   2143  C  C     . GLU A  1  274 ? 0.314    -1.682   140.992  1.00 119.79 ? 274 GLU 1 C     1 
ATOM   2144  O  O     . GLU A  1  274 ? 1.088    -1.968   141.914  1.00 128.78 ? 274 GLU 1 O     1 
ATOM   2145  C  CB    . GLU A  1  274 ? -1.986   -0.752   141.312  1.00 111.43 ? 274 GLU 1 CB    1 
ATOM   2146  C  CG    . GLU A  1  274 ? -2.177   -1.824   142.380  1.00 110.32 ? 274 GLU 1 CG    1 
ATOM   2147  C  CD    . GLU A  1  274 ? -3.631   -2.095   142.691  1.00 106.30 ? 274 GLU 1 CD    1 
ATOM   2148  O  OE1   . GLU A  1  274 ? -4.479   -1.247   142.355  1.00 103.98 ? 274 GLU 1 OE1   1 
ATOM   2149  O  OE2   . GLU A  1  274 ? -3.927   -3.153   143.279  1.00 97.33  ? 274 GLU 1 OE2   1 
ATOM   2150  N  N     . LEU A  1  275 ? 0.189    -2.441   139.904  1.00 111.97 ? 275 LEU 1 N     1 
ATOM   2151  C  CA    . LEU A  1  275 ? 0.899    -3.712   139.806  1.00 112.77 ? 275 LEU 1 CA    1 
ATOM   2152  C  C     . LEU A  1  275 ? 2.405    -3.512   139.899  1.00 118.80 ? 275 LEU 1 C     1 
ATOM   2153  O  O     . LEU A  1  275 ? 3.082    -4.180   140.688  1.00 122.35 ? 275 LEU 1 O     1 
ATOM   2154  C  CB    . LEU A  1  275 ? 0.531    -4.424   138.502  1.00 115.31 ? 275 LEU 1 CB    1 
ATOM   2155  C  CG    . LEU A  1  275 ? 0.647    -5.954   138.427  1.00 119.61 ? 275 LEU 1 CG    1 
ATOM   2156  C  CD1   . LEU A  1  275 ? 0.022    -6.454   137.141  1.00 118.57 ? 275 LEU 1 CD1   1 
ATOM   2157  C  CD2   . LEU A  1  275 ? 2.086    -6.463   138.528  1.00 120.63 ? 275 LEU 1 CD2   1 
ATOM   2158  N  N     . ILE A  1  276 ? 2.951    -2.593   139.100  1.00 126.46 ? 276 ILE 1 N     1 
ATOM   2159  C  CA    . ILE A  1  276 ? 4.400    -2.438   139.056  1.00 144.57 ? 276 ILE 1 CA    1 
ATOM   2160  C  C     . ILE A  1  276 ? 4.928    -1.814   140.342  1.00 154.08 ? 276 ILE 1 C     1 
ATOM   2161  O  O     . ILE A  1  276 ? 6.017    -2.176   140.807  1.00 157.74 ? 276 ILE 1 O     1 
ATOM   2162  C  CB    . ILE A  1  276 ? 4.820    -1.625   137.817  1.00 154.63 ? 276 ILE 1 CB    1 
ATOM   2163  C  CG1   . ILE A  1  276 ? 4.300    -2.295   136.541  1.00 160.52 ? 276 ILE 1 CG1   1 
ATOM   2164  C  CG2   . ILE A  1  276 ? 6.329    -1.472   137.760  1.00 157.72 ? 276 ILE 1 CG2   1 
ATOM   2165  C  CD1   . ILE A  1  276 ? 4.066    -1.333   135.394  1.00 164.94 ? 276 ILE 1 CD1   1 
ATOM   2166  N  N     . TYR A  1  277 ? 4.180    -0.898   140.958  1.00 160.64 ? 277 TYR 1 N     1 
ATOM   2167  C  CA    . TYR A  1  277 ? 4.719    -0.133   142.080  1.00 167.50 ? 277 TYR 1 CA    1 
ATOM   2168  C  C     . TYR A  1  277 ? 4.388    -0.765   143.429  1.00 165.23 ? 277 TYR 1 C     1 
ATOM   2169  O  O     . TYR A  1  277 ? 5.291    -1.083   144.209  1.00 163.90 ? 277 TYR 1 O     1 
ATOM   2170  C  CB    . TYR A  1  277 ? 4.198    1.306    142.017  1.00 175.42 ? 277 TYR 1 CB    1 
ATOM   2171  C  CG    . TYR A  1  277 ? 4.877    2.123    140.945  1.00 181.73 ? 277 TYR 1 CG    1 
ATOM   2172  C  CD1   . TYR A  1  277 ? 6.199    2.512    141.077  1.00 183.96 ? 277 TYR 1 CD1   1 
ATOM   2173  C  CD2   . TYR A  1  277 ? 4.202    2.492    139.794  1.00 183.21 ? 277 TYR 1 CD2   1 
ATOM   2174  C  CE1   . TYR A  1  277 ? 6.829    3.251    140.092  1.00 183.77 ? 277 TYR 1 CE1   1 
ATOM   2175  C  CE2   . TYR A  1  277 ? 4.825    3.233    138.806  1.00 183.19 ? 277 TYR 1 CE2   1 
ATOM   2176  C  CZ    . TYR A  1  277 ? 6.136    3.608    138.960  1.00 183.69 ? 277 TYR 1 CZ    1 
ATOM   2177  O  OH    . TYR A  1  277 ? 6.750    4.345    137.973  1.00 185.10 ? 277 TYR 1 OH    1 
ATOM   2178  N  N     . GLU A  1  278 ? 3.097    -0.925   143.725  1.00 163.64 ? 278 GLU 1 N     1 
ATOM   2179  C  CA    . GLU A  1  278 ? 2.692    -1.493   145.006  1.00 162.16 ? 278 GLU 1 CA    1 
ATOM   2180  C  C     . GLU A  1  278 ? 3.199    -2.920   145.164  1.00 154.59 ? 278 GLU 1 C     1 
ATOM   2181  O  O     . GLU A  1  278 ? 3.795    -3.269   146.191  1.00 163.63 ? 278 GLU 1 O     1 
ATOM   2182  C  CB    . GLU A  1  278 ? 1.169    -1.443   145.139  1.00 167.00 ? 278 GLU 1 CB    1 
ATOM   2183  C  CG    . GLU A  1  278 ? 0.577    -0.046   145.007  1.00 168.71 ? 278 GLU 1 CG    1 
ATOM   2184  C  CD    . GLU A  1  278 ? 0.683    0.757    146.291  1.00 170.13 ? 278 GLU 1 CD    1 
ATOM   2185  O  OE1   . GLU A  1  278 ? 1.804    0.894    146.825  1.00 169.07 ? 278 GLU 1 OE1   1 
ATOM   2186  O  OE2   . GLU A  1  278 ? -0.360   1.239    146.778  1.00 172.00 ? 278 GLU 1 OE2   1 
ATOM   2187  N  N     . TRP A  1  279 ? 2.974    -3.757   144.155  1.00 138.58 ? 279 TRP 1 N     1 
ATOM   2188  C  CA    . TRP A  1  279 ? 3.288    -5.181   144.247  1.00 133.44 ? 279 TRP 1 CA    1 
ATOM   2189  C  C     . TRP A  1  279 ? 4.711    -5.486   143.790  1.00 122.09 ? 279 TRP 1 C     1 
ATOM   2190  O  O     . TRP A  1  279 ? 5.522    -6.000   144.566  1.00 114.53 ? 279 TRP 1 O     1 
ATOM   2191  C  CB    . TRP A  1  279 ? 2.268    -5.985   143.432  1.00 143.25 ? 279 TRP 1 CB    1 
ATOM   2192  C  CG    . TRP A  1  279 ? 0.857    -5.695   143.838  1.00 151.18 ? 279 TRP 1 CG    1 
ATOM   2193  C  CD1   . TRP A  1  279 ? -0.045   -4.914   143.180  1.00 152.94 ? 279 TRP 1 CD1   1 
ATOM   2194  C  CD2   . TRP A  1  279 ? 0.191    -6.172   145.012  1.00 151.81 ? 279 TRP 1 CD2   1 
ATOM   2195  N  NE1   . TRP A  1  279 ? -1.234   -4.881   143.867  1.00 152.86 ? 279 TRP 1 NE1   1 
ATOM   2196  C  CE2   . TRP A  1  279 ? -1.113   -5.645   144.997  1.00 152.37 ? 279 TRP 1 CE2   1 
ATOM   2197  C  CE3   . TRP A  1  279 ? 0.570    -6.996   146.073  1.00 149.26 ? 279 TRP 1 CE3   1 
ATOM   2198  C  CZ2   . TRP A  1  279 ? -2.038   -5.915   146.001  1.00 151.64 ? 279 TRP 1 CZ2   1 
ATOM   2199  C  CZ3   . TRP A  1  279 ? -0.352   -7.261   147.068  1.00 150.40 ? 279 TRP 1 CZ3   1 
ATOM   2200  C  CH2   . TRP A  1  279 ? -1.638   -6.724   147.025  1.00 151.99 ? 279 TRP 1 CH2   1 
ATOM   2201  N  N     . ALA A  1  280 ? 5.030    -5.167   142.537  1.00 125.90 ? 280 ALA 1 N     1 
ATOM   2202  C  CA    . ALA A  1  280 ? 6.356    -5.458   142.009  1.00 121.80 ? 280 ALA 1 CA    1 
ATOM   2203  C  C     . ALA A  1  280 ? 7.444    -4.563   142.591  1.00 113.49 ? 280 ALA 1 C     1 
ATOM   2204  O  O     . ALA A  1  280 ? 8.623    -4.771   142.283  1.00 102.23 ? 280 ALA 1 O     1 
ATOM   2205  C  CB    . ALA A  1  280 ? 6.329    -5.349   140.484  1.00 123.22 ? 280 ALA 1 CB    1 
ATOM   2206  N  N     . GLY A  1  281 ? 7.084    -3.577   143.409  1.00 112.92 ? 281 GLY 1 N     1 
ATOM   2207  C  CA    . GLY A  1  281 ? 8.066    -2.753   144.073  1.00 110.48 ? 281 GLY 1 CA    1 
ATOM   2208  C  C     . GLY A  1  281 ? 8.634    -1.636   143.234  1.00 114.75 ? 281 GLY 1 C     1 
ATOM   2209  O  O     . GLY A  1  281 ? 9.632    -1.026   143.635  1.00 111.46 ? 281 GLY 1 O     1 
ATOM   2210  N  N     . GLY A  1  282 ? 8.039    -1.352   142.081  1.00 120.16 ? 282 GLY 1 N     1 
ATOM   2211  C  CA    . GLY A  1  282 ? 8.519    -0.306   141.211  1.00 117.43 ? 282 GLY 1 CA    1 
ATOM   2212  C  C     . GLY A  1  282 ? 9.689    -0.762   140.365  1.00 111.79 ? 282 GLY 1 C     1 
ATOM   2213  O  O     . GLY A  1  282 ? 10.446   -1.661   140.745  1.00 116.82 ? 282 GLY 1 O     1 
ATOM   2214  N  N     . PRO A  1  283 ? 9.866    -0.143   139.201  1.00 98.02  ? 283 PRO 1 N     1 
ATOM   2215  C  CA    . PRO A  1  283 ? 10.955   -0.547   138.306  1.00 90.55  ? 283 PRO 1 CA    1 
ATOM   2216  C  C     . PRO A  1  283 ? 12.317   -0.279   138.927  1.00 106.76 ? 283 PRO 1 C     1 
ATOM   2217  O  O     . PRO A  1  283 ? 12.461   0.440    139.915  1.00 117.43 ? 283 PRO 1 O     1 
ATOM   2218  C  CB    . PRO A  1  283 ? 10.733   0.317    137.059  1.00 91.23  ? 283 PRO 1 CB    1 
ATOM   2219  C  CG    . PRO A  1  283 ? 9.306    0.760    137.143  1.00 98.62  ? 283 PRO 1 CG    1 
ATOM   2220  C  CD    . PRO A  1  283 ? 9.011    0.893    138.600  1.00 95.37  ? 283 PRO 1 CD    1 
ATOM   2221  N  N     . LEU A  1  284 ? 13.335   -0.884   138.317  1.00 121.16 ? 284 LEU 1 N     1 
ATOM   2222  C  CA    . LEU A  1  284 ? 14.722   -0.602   138.655  1.00 138.39 ? 284 LEU 1 CA    1 
ATOM   2223  C  C     . LEU A  1  284 ? 15.383   0.329    137.649  1.00 144.38 ? 284 LEU 1 C     1 
ATOM   2224  O  O     . LEU A  1  284 ? 16.427   0.916    137.956  1.00 148.48 ? 284 LEU 1 O     1 
ATOM   2225  C  CB    . LEU A  1  284 ? 15.523   -1.908   138.741  1.00 149.31 ? 284 LEU 1 CB    1 
ATOM   2226  C  CG    . LEU A  1  284 ? 14.877   -3.054   139.526  1.00 158.14 ? 284 LEU 1 CG    1 
ATOM   2227  C  CD1   . LEU A  1  284 ? 15.491   -4.387   139.123  1.00 156.84 ? 284 LEU 1 CD1   1 
ATOM   2228  C  CD2   . LEU A  1  284 ? 15.014   -2.824   141.023  1.00 167.33 ? 284 LEU 1 CD2   1 
ATOM   2229  N  N     . GLU A  1  285 ? 14.794   0.482    136.472  1.00 153.11 ? 285 GLU 1 N     1 
ATOM   2230  C  CA    . GLU A  1  285 ? 15.309   1.320    135.404  1.00 160.68 ? 285 GLU 1 CA    1 
ATOM   2231  C  C     . GLU A  1  285 ? 14.134   2.042    134.767  1.00 156.69 ? 285 GLU 1 C     1 
ATOM   2232  O  O     . GLU A  1  285 ? 12.977   1.673    134.992  1.00 152.60 ? 285 GLU 1 O     1 
ATOM   2233  C  CB    . GLU A  1  285 ? 16.056   0.486    134.353  1.00 170.18 ? 285 GLU 1 CB    1 
ATOM   2234  C  CG    . GLU A  1  285 ? 17.256   -0.273   134.904  1.00 179.20 ? 285 GLU 1 CG    1 
ATOM   2235  C  CD    . GLU A  1  285 ? 18.531   0.545    134.887  1.00 187.96 ? 285 GLU 1 CD    1 
ATOM   2236  O  OE1   . GLU A  1  285 ? 18.780   1.254    133.891  1.00 191.67 ? 285 GLU 1 OE1   1 
ATOM   2237  O  OE2   . GLU A  1  285 ? 19.286   0.482    135.878  1.00 190.31 ? 285 GLU 1 OE2   1 
ATOM   2238  N  N     . PRO A  1  286 ? 14.393   3.089    133.986  1.00 156.46 ? 286 PRO 1 N     1 
ATOM   2239  C  CA    . PRO A  1  286 ? 13.303   3.719    133.232  1.00 151.24 ? 286 PRO 1 CA    1 
ATOM   2240  C  C     . PRO A  1  286 ? 12.825   2.790    132.127  1.00 147.02 ? 286 PRO 1 C     1 
ATOM   2241  O  O     . PRO A  1  286 ? 13.627   2.241    131.369  1.00 152.87 ? 286 PRO 1 O     1 
ATOM   2242  C  CB    . PRO A  1  286 ? 13.945   4.993    132.667  1.00 154.53 ? 286 PRO 1 CB    1 
ATOM   2243  C  CG    . PRO A  1  286 ? 15.162   5.218    133.516  1.00 159.23 ? 286 PRO 1 CG    1 
ATOM   2244  C  CD    . PRO A  1  286 ? 15.643   3.859    133.887  1.00 160.47 ? 286 PRO 1 CD    1 
ATOM   2245  N  N     . ILE A  1  287 ? 11.513   2.629    132.030  1.00 141.40 ? 287 ILE 1 N     1 
ATOM   2246  C  CA    . ILE A  1  287 ? 10.918   1.687    131.091  1.00 132.02 ? 287 ILE 1 CA    1 
ATOM   2247  C  C     . ILE A  1  287 ? 10.421   2.457    129.880  1.00 128.73 ? 287 ILE 1 C     1 
ATOM   2248  O  O     . ILE A  1  287 ? 9.825    3.536    130.009  1.00 134.19 ? 287 ILE 1 O     1 
ATOM   2249  C  CB    . ILE A  1  287 ? 9.782    0.885    131.753  1.00 129.52 ? 287 ILE 1 CB    1 
ATOM   2250  C  CG1   . ILE A  1  287 ? 10.304   -0.460   132.262  1.00 135.58 ? 287 ILE 1 CG1   1 
ATOM   2251  C  CG2   . ILE A  1  287 ? 8.623    0.666    130.794  1.00 127.64 ? 287 ILE 1 CG2   1 
ATOM   2252  C  CD1   . ILE A  1  287 ? 11.333   -0.368   133.349  1.00 138.08 ? 287 ILE 1 CD1   1 
ATOM   2253  N  N     . GLN A  1  288 ? 10.683   1.908    128.693  1.00 115.31 ? 288 GLN 1 N     1 
ATOM   2254  C  CA    . GLN A  1  288 ? 10.204   2.525    127.465  1.00 113.20 ? 288 GLN 1 CA    1 
ATOM   2255  C  C     . GLN A  1  288 ? 8.871    1.961    127.026  1.00 113.13 ? 288 GLN 1 C     1 
ATOM   2256  O  O     . GLN A  1  288 ? 8.088    2.676    126.392  1.00 112.60 ? 288 GLN 1 O     1 
ATOM   2257  C  CB    . GLN A  1  288 ? 11.213   2.343    126.327  1.00 122.89 ? 288 GLN 1 CB    1 
ATOM   2258  C  CG    . GLN A  1  288 ? 11.447   0.901    125.898  1.00 133.53 ? 288 GLN 1 CG    1 
ATOM   2259  C  CD    . GLN A  1  288 ? 12.548   0.764    124.861  1.00 139.97 ? 288 GLN 1 CD    1 
ATOM   2260  O  OE1   . GLN A  1  288 ? 12.742   1.644    124.023  1.00 144.80 ? 288 GLN 1 OE1   1 
ATOM   2261  N  NE2   . GLN A  1  288 ? 13.277   -0.343   124.916  1.00 138.28 ? 288 GLN 1 NE2   1 
ATOM   2262  N  N     . ALA A  1  289 ? 8.565    0.719    127.393  1.00 114.86 ? 289 ALA 1 N     1 
ATOM   2263  C  CA    . ALA A  1  289 ? 7.323    0.110    126.947  1.00 111.02 ? 289 ALA 1 CA    1 
ATOM   2264  C  C     . ALA A  1  289 ? 6.984    -1.058   127.858  1.00 115.62 ? 289 ALA 1 C     1 
ATOM   2265  O  O     . ALA A  1  289 ? 7.796    -1.505   128.669  1.00 113.82 ? 289 ALA 1 O     1 
ATOM   2266  C  CB    . ALA A  1  289 ? 7.420    -0.350   125.491  1.00 93.00  ? 289 ALA 1 CB    1 
ATOM   2267  N  N     . ILE A  1  290 ? 5.756    -1.545   127.708  1.00 119.60 ? 290 ILE 1 N     1 
ATOM   2268  C  CA    . ILE A  1  290 ? 5.235    -2.653   128.493  1.00 117.23 ? 290 ILE 1 CA    1 
ATOM   2269  C  C     . ILE A  1  290 ? 4.539    -3.612   127.541  1.00 121.39 ? 290 ILE 1 C     1 
ATOM   2270  O  O     . ILE A  1  290 ? 3.898    -3.184   126.576  1.00 121.17 ? 290 ILE 1 O     1 
ATOM   2271  C  CB    . ILE A  1  290 ? 4.268    -2.174   129.603  1.00 120.05 ? 290 ILE 1 CB    1 
ATOM   2272  C  CG1   . ILE A  1  290 ? 3.114    -1.340   129.028  1.00 119.85 ? 290 ILE 1 CG1   1 
ATOM   2273  C  CG2   . ILE A  1  290 ? 5.014    -1.378   130.663  1.00 117.65 ? 290 ILE 1 CG2   1 
ATOM   2274  C  CD1   . ILE A  1  290 ? 1.799    -2.097   128.866  1.00 113.03 ? 290 ILE 1 CD1   1 
ATOM   2275  N  N     . ILE A  1  291 ? 4.681    -4.906   127.801  1.00 122.12 ? 291 ILE 1 N     1 
ATOM   2276  C  CA    . ILE A  1  291 ? 3.961    -5.936   127.061  1.00 119.72 ? 291 ILE 1 CA    1 
ATOM   2277  C  C     . ILE A  1  291 ? 3.023    -6.595   128.067  1.00 121.83 ? 291 ILE 1 C     1 
ATOM   2278  O  O     . ILE A  1  291 ? 3.482    -7.390   128.904  1.00 120.39 ? 291 ILE 1 O     1 
ATOM   2279  C  CB    . ILE A  1  291 ? 4.933    -6.931   126.405  1.00 114.51 ? 291 ILE 1 CB    1 
ATOM   2280  C  CG1   . ILE A  1  291 ? 5.891    -6.200   125.459  1.00 115.61 ? 291 ILE 1 CG1   1 
ATOM   2281  C  CG2   . ILE A  1  291 ? 4.185    -7.963   125.609  1.00 114.06 ? 291 ILE 1 CG2   1 
ATOM   2282  C  CD1   . ILE A  1  291 ? 6.969    -7.086   124.855  1.00 115.86 ? 291 ILE 1 CD1   1 
ATOM   2283  N  N     . PRO A  1  292 ? 1.724    -6.224   128.080  1.00 121.52 ? 292 PRO 1 N     1 
ATOM   2284  C  CA    . PRO A  1  292 ? 0.826    -6.624   129.176  1.00 125.83 ? 292 PRO 1 CA    1 
ATOM   2285  C  C     . PRO A  1  292 ? 0.508    -8.107   129.281  1.00 125.53 ? 292 PRO 1 C     1 
ATOM   2286  O  O     . PRO A  1  292 ? 0.786    -8.731   130.310  1.00 136.68 ? 292 PRO 1 O     1 
ATOM   2287  C  CB    . PRO A  1  292 ? -0.450   -5.815   128.888  1.00 121.55 ? 292 PRO 1 CB    1 
ATOM   2288  C  CG    . PRO A  1  292 ? -0.362   -5.448   127.447  1.00 112.80 ? 292 PRO 1 CG    1 
ATOM   2289  C  CD    . PRO A  1  292 ? 1.086    -5.271   127.159  1.00 113.36 ? 292 PRO 1 CD    1 
ATOM   2290  N  N     . GLY A  1  293 ? -0.075   -8.680   128.233  1.00 121.60 ? 293 GLY 1 N     1 
ATOM   2291  C  CA    . GLY A  1  293 ? -0.681   -9.996   128.343  1.00 129.14 ? 293 GLY 1 CA    1 
ATOM   2292  C  C     . GLY A  1  293 ? 0.261    -11.183  128.350  1.00 129.38 ? 293 GLY 1 C     1 
ATOM   2293  O  O     . GLY A  1  293 ? 0.390    -11.871  129.367  1.00 133.89 ? 293 GLY 1 O     1 
ATOM   2294  N  N     . GLY A  1  294 ? 0.900    -11.446  127.217  1.00 128.82 ? 294 GLY 1 N     1 
ATOM   2295  C  CA    . GLY A  1  294 ? 1.885    -12.503  127.079  1.00 139.88 ? 294 GLY 1 CA    1 
ATOM   2296  C  C     . GLY A  1  294 ? 3.108    -11.969  126.363  1.00 150.60 ? 294 GLY 1 C     1 
ATOM   2297  O  O     . GLY A  1  294 ? 3.520    -10.829  126.556  1.00 159.44 ? 294 GLY 1 O     1 
ATOM   2298  N  N     . SER A  1  295 ? 3.701    -12.823  125.533  1.00 144.10 ? 295 SER 1 N     1 
ATOM   2299  C  CA    . SER A  1  295 ? 4.678    -12.335  124.569  1.00 132.74 ? 295 SER 1 CA    1 
ATOM   2300  C  C     . SER A  1  295 ? 3.999    -11.795  123.318  1.00 128.05 ? 295 SER 1 C     1 
ATOM   2301  O  O     . SER A  1  295 ? 4.447    -10.796  122.742  1.00 135.83 ? 295 SER 1 O     1 
ATOM   2302  C  CB    . SER A  1  295 ? 5.649    -13.453  124.203  1.00 131.66 ? 295 SER 1 CB    1 
ATOM   2303  O  OG    . SER A  1  295 ? 6.535    -13.043  123.178  1.00 131.87 ? 295 SER 1 OG    1 
ATOM   2304  N  N     . SER A  1  296 ? 2.903    -12.425  122.904  1.00 117.61 ? 296 SER 1 N     1 
ATOM   2305  C  CA    . SER A  1  296 ? 2.176    -12.055  121.702  1.00 116.01 ? 296 SER 1 CA    1 
ATOM   2306  C  C     . SER A  1  296 ? 1.457    -10.711  121.822  1.00 114.74 ? 296 SER 1 C     1 
ATOM   2307  O  O     . SER A  1  296 ? 0.889    -10.249  120.824  1.00 116.84 ? 296 SER 1 O     1 
ATOM   2308  C  CB    . SER A  1  296 ? 1.174    -13.165  121.362  1.00 127.01 ? 296 SER 1 CB    1 
ATOM   2309  O  OG    . SER A  1  296 ? 1.819    -14.424  121.227  1.00 133.09 ? 296 SER 1 OG    1 
ATOM   2310  N  N     . THR A  1  297 ? 1.478    -10.057  122.988  1.00 114.86 ? 297 THR 1 N     1 
ATOM   2311  C  CA    . THR A  1  297 ? 0.642    -8.858   123.031  1.00 121.42 ? 297 THR 1 CA    1 
ATOM   2312  C  C     . THR A  1  297 ? 1.436    -7.626   122.578  1.00 102.37 ? 297 THR 1 C     1 
ATOM   2313  O  O     . THR A  1  297 ? 2.633    -7.522   122.855  1.00 90.57  ? 297 THR 1 O     1 
ATOM   2314  C  CB    . THR A  1  297 ? 0.081    -8.630   124.440  1.00 141.82 ? 297 THR 1 CB    1 
ATOM   2315  O  OG1   . THR A  1  297 ? 1.131    -8.663   125.412  1.00 148.90 ? 297 THR 1 OG1   1 
ATOM   2316  C  CG2   . THR A  1  297 ? -0.929   -9.715   124.793  1.00 145.48 ? 297 THR 1 CG2   1 
ATOM   2317  N  N     . PRO A  1  298 ? 0.805    -6.703   121.855  1.00 113.19 ? 298 PRO 1 N     1 
ATOM   2318  C  CA    . PRO A  1  298 ? 1.519    -5.517   121.343  1.00 114.89 ? 298 PRO 1 CA    1 
ATOM   2319  C  C     . PRO A  1  298 ? 2.016    -4.627   122.469  1.00 107.99 ? 298 PRO 1 C     1 
ATOM   2320  O  O     . PRO A  1  298 ? 1.261    -4.298   123.397  1.00 103.33 ? 298 PRO 1 O     1 
ATOM   2321  C  CB    . PRO A  1  298 ? 0.450    -4.801   120.504  1.00 127.49 ? 298 PRO 1 CB    1 
ATOM   2322  C  CG    . PRO A  1  298 ? -0.528   -5.878   120.147  1.00 131.82 ? 298 PRO 1 CG    1 
ATOM   2323  C  CD    . PRO A  1  298 ? -0.572   -6.774   121.345  1.00 128.91 ? 298 PRO 1 CD    1 
ATOM   2324  N  N     . PRO A  1  299 ? 3.273    -4.193   122.418  1.00 109.69 ? 299 PRO 1 N     1 
ATOM   2325  C  CA    . PRO A  1  299 ? 3.777    -3.303   123.469  1.00 111.19 ? 299 PRO 1 CA    1 
ATOM   2326  C  C     . PRO A  1  299 ? 3.135    -1.925   123.403  1.00 105.96 ? 299 PRO 1 C     1 
ATOM   2327  O  O     . PRO A  1  299 ? 2.859    -1.394   122.325  1.00 92.27  ? 299 PRO 1 O     1 
ATOM   2328  C  CB    . PRO A  1  299 ? 5.284    -3.242   123.186  1.00 110.02 ? 299 PRO 1 CB    1 
ATOM   2329  C  CG    . PRO A  1  299 ? 5.401    -3.548   121.729  1.00 103.63 ? 299 PRO 1 CG    1 
ATOM   2330  C  CD    . PRO A  1  299 ? 4.329    -4.561   121.457  1.00 106.00 ? 299 PRO 1 CD    1 
ATOM   2331  N  N     . LEU A  1  300 ? 2.889    -1.353   124.581  1.00 111.17 ? 300 LEU 1 N     1 
ATOM   2332  C  CA    . LEU A  1  300 ? 2.374    -0.006   124.700  1.00 112.11 ? 300 LEU 1 CA    1 
ATOM   2333  C  C     . LEU A  1  300 ? 3.379    0.856    125.446  1.00 113.23 ? 300 LEU 1 C     1 
ATOM   2334  O  O     . LEU A  1  300 ? 4.058    0.371    126.356  1.00 102.80 ? 300 LEU 1 O     1 
ATOM   2335  C  CB    . LEU A  1  300 ? 1.030    0.030    125.433  1.00 111.32 ? 300 LEU 1 CB    1 
ATOM   2336  C  CG    . LEU A  1  300 ? -0.074   -0.763   124.746  1.00 111.28 ? 300 LEU 1 CG    1 
ATOM   2337  C  CD1   . LEU A  1  300 ? -1.340   -0.730   125.583  1.00 114.05 ? 300 LEU 1 CD1   1 
ATOM   2338  C  CD2   . LEU A  1  300 ? -0.309   -0.210   123.348  1.00 110.07 ? 300 LEU 1 CD2   1 
ATOM   2339  N  N     . PRO A  1  301 ? 3.508    2.124    125.073  1.00 131.57 ? 301 PRO 1 N     1 
ATOM   2340  C  CA    . PRO A  1  301 ? 4.506    2.980    125.714  1.00 141.94 ? 301 PRO 1 CA    1 
ATOM   2341  C  C     . PRO A  1  301 ? 4.219    3.168    127.195  1.00 153.08 ? 301 PRO 1 C     1 
ATOM   2342  O  O     . PRO A  1  301 ? 3.119    2.915    127.692  1.00 155.66 ? 301 PRO 1 O     1 
ATOM   2343  C  CB    . PRO A  1  301 ? 4.386    4.303    124.946  1.00 141.58 ? 301 PRO 1 CB    1 
ATOM   2344  C  CG    . PRO A  1  301 ? 3.682    3.942    123.660  1.00 139.19 ? 301 PRO 1 CG    1 
ATOM   2345  C  CD    . PRO A  1  301 ? 2.760    2.834    124.023  1.00 136.25 ? 301 PRO 1 CD    1 
ATOM   2346  N  N     . PHE A  1  302 ? 5.248    3.604    127.907  1.00 157.23 ? 302 PHE 1 N     1 
ATOM   2347  C  CA    . PHE A  1  302 ? 5.153    3.860    129.340  1.00 160.68 ? 302 PHE 1 CA    1 
ATOM   2348  C  C     . PHE A  1  302 ? 4.610    5.267    129.531  1.00 164.72 ? 302 PHE 1 C     1 
ATOM   2349  O  O     . PHE A  1  302 ? 5.356    6.242    129.567  1.00 162.39 ? 302 PHE 1 O     1 
ATOM   2350  C  CB    . PHE A  1  302 ? 6.508    3.671    130.005  1.00 165.76 ? 302 PHE 1 CB    1 
ATOM   2351  C  CG    . PHE A  1  302 ? 6.415    3.279    131.438  1.00 174.71 ? 302 PHE 1 CG    1 
ATOM   2352  C  CD1   . PHE A  1  302 ? 5.673    2.181    131.820  1.00 180.35 ? 302 PHE 1 CD1   1 
ATOM   2353  C  CD2   . PHE A  1  302 ? 7.072    4.012    132.409  1.00 179.04 ? 302 PHE 1 CD2   1 
ATOM   2354  C  CE1   . PHE A  1  302 ? 5.580    1.821    133.140  1.00 184.18 ? 302 PHE 1 CE1   1 
ATOM   2355  C  CE2   . PHE A  1  302 ? 6.982    3.655    133.735  1.00 183.21 ? 302 PHE 1 CE2   1 
ATOM   2356  C  CZ    . PHE A  1  302 ? 6.235    2.556    134.100  1.00 184.98 ? 302 PHE 1 CZ    1 
ATOM   2357  N  N     . THR A  1  303 ? 3.289    5.368    129.658  1.00 172.74 ? 303 THR 1 N     1 
ATOM   2358  C  CA    . THR A  1  303 ? 2.598    6.645    129.736  1.00 178.13 ? 303 THR 1 CA    1 
ATOM   2359  C  C     . THR A  1  303 ? 1.740    6.642    130.989  1.00 175.70 ? 303 THR 1 C     1 
ATOM   2360  O  O     . THR A  1  303 ? 1.391    5.586    131.518  1.00 174.10 ? 303 THR 1 O     1 
ATOM   2361  C  CB    . THR A  1  303 ? 1.726    6.894    128.488  1.00 182.07 ? 303 THR 1 CB    1 
ATOM   2362  O  OG1   . THR A  1  303 ? 2.516    6.722    127.310  1.00 187.46 ? 303 THR 1 OG1   1 
ATOM   2363  C  CG2   . THR A  1  303 ? 1.142    8.307    128.472  1.00 182.30 ? 303 THR 1 CG2   1 
ATOM   2364  N  N     . GLU A  1  304 ? 1.407    7.837    131.472  1.00 172.81 ? 304 GLU 1 N     1 
ATOM   2365  C  CA    . GLU A  1  304 ? 0.487    7.940    132.597  1.00 173.67 ? 304 GLU 1 CA    1 
ATOM   2366  C  C     . GLU A  1  304 ? -0.891   7.416    132.219  1.00 169.66 ? 304 GLU 1 C     1 
ATOM   2367  O  O     . GLU A  1  304 ? -1.504   6.643    132.965  1.00 170.61 ? 304 GLU 1 O     1 
ATOM   2368  C  CB    . GLU A  1  304 ? 0.402    9.387    133.075  1.00 175.56 ? 304 GLU 1 CB    1 
ATOM   2369  C  CG    . GLU A  1  304 ? 1.685    9.877    133.697  1.00 175.99 ? 304 GLU 1 CG    1 
ATOM   2370  C  CD    . GLU A  1  304 ? 1.915    9.267    135.058  1.00 174.78 ? 304 GLU 1 CD    1 
ATOM   2371  O  OE1   . GLU A  1  304 ? 1.135    9.563    135.983  1.00 174.64 ? 304 GLU 1 OE1   1 
ATOM   2372  O  OE2   . GLU A  1  304 ? 2.868    8.476    135.201  1.00 173.45 ? 304 GLU 1 OE2   1 
ATOM   2373  N  N     . GLU A  1  305 ? -1.396   7.829    131.057  1.00 165.03 ? 305 GLU 1 N     1 
ATOM   2374  C  CA    . GLU A  1  305 ? -2.700   7.355    130.613  1.00 161.11 ? 305 GLU 1 CA    1 
ATOM   2375  C  C     . GLU A  1  305 ? -2.712   5.851    130.367  1.00 165.47 ? 305 GLU 1 C     1 
ATOM   2376  O  O     . GLU A  1  305 ? -3.788   5.251    130.326  1.00 170.00 ? 305 GLU 1 O     1 
ATOM   2377  C  CB    . GLU A  1  305 ? -3.126   8.113    129.359  1.00 155.16 ? 305 GLU 1 CB    1 
ATOM   2378  C  CG    . GLU A  1  305 ? -4.626   8.136    129.152  1.00 147.84 ? 305 GLU 1 CG    1 
ATOM   2379  C  CD    . GLU A  1  305 ? -5.030   8.939    127.938  1.00 144.10 ? 305 GLU 1 CD    1 
ATOM   2380  O  OE1   . GLU A  1  305 ? -4.984   8.390    126.820  1.00 142.55 ? 305 GLU 1 OE1   1 
ATOM   2381  O  OE2   . GLU A  1  305 ? -5.394   10.123   128.100  1.00 141.89 ? 305 GLU 1 OE2   1 
ATOM   2382  N  N     . VAL A  1  306 ? -1.545   5.230    130.223  1.00 162.51 ? 306 VAL 1 N     1 
ATOM   2383  C  CA    . VAL A  1  306 ? -1.448   3.777    130.107  1.00 161.34 ? 306 VAL 1 CA    1 
ATOM   2384  C  C     . VAL A  1  306 ? -1.388   3.118    131.478  1.00 157.89 ? 306 VAL 1 C     1 
ATOM   2385  O  O     . VAL A  1  306 ? -2.105   2.153    131.751  1.00 157.23 ? 306 VAL 1 O     1 
ATOM   2386  C  CB    . VAL A  1  306 ? -0.222   3.398    129.244  1.00 164.51 ? 306 VAL 1 CB    1 
ATOM   2387  C  CG1   . VAL A  1  306 ? 0.052    1.902    129.318  1.00 163.99 ? 306 VAL 1 CG1   1 
ATOM   2388  C  CG2   . VAL A  1  306 ? -0.434   3.832    127.804  1.00 168.42 ? 306 VAL 1 CG2   1 
ATOM   2389  N  N     . LEU A  1  307 ? -0.497   3.609    132.342  1.00 158.54 ? 307 LEU 1 N     1 
ATOM   2390  C  CA    . LEU A  1  307 ? -0.373   3.074    133.692  1.00 157.95 ? 307 LEU 1 CA    1 
ATOM   2391  C  C     . LEU A  1  307 ? -1.684   3.176    134.459  1.00 167.74 ? 307 LEU 1 C     1 
ATOM   2392  O  O     . LEU A  1  307 ? -1.951   2.357    135.345  1.00 171.61 ? 307 LEU 1 O     1 
ATOM   2393  C  CB    . LEU A  1  307 ? 0.731    3.822    134.434  1.00 154.81 ? 307 LEU 1 CB    1 
ATOM   2394  C  CG    . LEU A  1  307 ? 2.154    3.357    134.132  1.00 154.22 ? 307 LEU 1 CG    1 
ATOM   2395  C  CD1   . LEU A  1  307 ? 3.155    4.397    134.611  1.00 156.96 ? 307 LEU 1 CD1   1 
ATOM   2396  C  CD2   . LEU A  1  307 ? 2.424    2.006    134.763  1.00 155.19 ? 307 LEU 1 CD2   1 
ATOM   2397  N  N     . ASP A  1  308 ? -2.513   4.164    134.130  1.00 173.39 ? 308 ASP 1 N     1 
ATOM   2398  C  CA    . ASP A  1  308 ? -3.822   4.318    134.746  1.00 182.33 ? 308 ASP 1 CA    1 
ATOM   2399  C  C     . ASP A  1  308 ? -4.898   3.513    134.034  1.00 178.91 ? 308 ASP 1 C     1 
ATOM   2400  O  O     . ASP A  1  308 ? -6.072   3.607    134.406  1.00 181.44 ? 308 ASP 1 O     1 
ATOM   2401  C  CB    . ASP A  1  308 ? -4.222   5.796    134.775  1.00 194.44 ? 308 ASP 1 CB    1 
ATOM   2402  C  CG    . ASP A  1  308 ? -3.406   6.602    135.768  1.00 202.48 ? 308 ASP 1 CG    1 
ATOM   2403  O  OD1   . ASP A  1  308 ? -3.531   6.350    136.986  1.00 204.98 ? 308 ASP 1 OD1   1 
ATOM   2404  O  OD2   . ASP A  1  308 ? -2.639   7.487    135.336  1.00 203.66 ? 308 ASP 1 OD2   1 
ATOM   2405  N  N     . THR A  1  309 ? -4.527   2.723    133.027  1.00 177.06 ? 309 THR 1 N     1 
ATOM   2406  C  CA    . THR A  1  309 ? -5.499   1.911    132.307  1.00 177.17 ? 309 THR 1 CA    1 
ATOM   2407  C  C     . THR A  1  309 ? -5.710   0.596    133.042  1.00 171.29 ? 309 THR 1 C     1 
ATOM   2408  O  O     . THR A  1  309 ? -4.731   -0.061   133.414  1.00 170.62 ? 309 THR 1 O     1 
ATOM   2409  C  CB    . THR A  1  309 ? -5.036   1.637    130.881  1.00 179.18 ? 309 THR 1 CB    1 
ATOM   2410  O  OG1   . THR A  1  309 ? -4.838   2.880    130.196  1.00 179.82 ? 309 THR 1 OG1   1 
ATOM   2411  C  CG2   . THR A  1  309 ? -6.065   0.810    130.122  1.00 181.18 ? 309 THR 1 CG2   1 
ATOM   2412  N  N     . PRO A  1  310 ? -6.952   0.189    133.280  1.00 169.14 ? 310 PRO 1 N     1 
ATOM   2413  C  CA    . PRO A  1  310 ? -7.182   -1.088   133.962  1.00 163.93 ? 310 PRO 1 CA    1 
ATOM   2414  C  C     . PRO A  1  310 ? -6.875   -2.249   133.030  1.00 158.60 ? 310 PRO 1 C     1 
ATOM   2415  O  O     . PRO A  1  310 ? -7.339   -2.288   131.890  1.00 159.74 ? 310 PRO 1 O     1 
ATOM   2416  C  CB    . PRO A  1  310 ? -8.671   -1.038   134.331  1.00 167.07 ? 310 PRO 1 CB    1 
ATOM   2417  C  CG    . PRO A  1  310 ? -9.128   0.368    134.020  1.00 171.00 ? 310 PRO 1 CG    1 
ATOM   2418  C  CD    . PRO A  1  310 ? -8.207   0.894    132.981  1.00 169.05 ? 310 PRO 1 CD    1 
ATOM   2419  N  N     . MET A  1  311 ? -6.068   -3.185   133.513  1.00 156.04 ? 311 MET 1 N     1 
ATOM   2420  C  CA    . MET A  1  311 ? -5.805   -4.413   132.772  1.00 151.88 ? 311 MET 1 CA    1 
ATOM   2421  C  C     . MET A  1  311 ? -7.080   -5.250   132.700  1.00 143.21 ? 311 MET 1 C     1 
ATOM   2422  O  O     . MET A  1  311 ? -7.526   -5.812   133.705  1.00 132.27 ? 311 MET 1 O     1 
ATOM   2423  C  CB    . MET A  1  311 ? -4.664   -5.181   133.429  1.00 153.67 ? 311 MET 1 CB    1 
ATOM   2424  C  CG    . MET A  1  311 ? -3.540   -4.281   133.906  1.00 156.88 ? 311 MET 1 CG    1 
ATOM   2425  S  SD    . MET A  1  311 ? -2.277   -5.201   134.788  1.00 158.29 ? 311 MET 1 SD    1 
ATOM   2426  C  CE    . MET A  1  311 ? -1.393   -5.942   133.431  1.00 154.38 ? 311 MET 1 CE    1 
ATOM   2427  N  N     . SER A  1  312 ? -7.676   -5.317   131.511  1.00 147.21 ? 312 SER 1 N     1 
ATOM   2428  C  CA    . SER A  1  312 ? -8.918   -6.050   131.305  1.00 152.59 ? 312 SER 1 CA    1 
ATOM   2429  C  C     . SER A  1  312 ? -9.025   -6.441   129.837  1.00 154.47 ? 312 SER 1 C     1 
ATOM   2430  O  O     . SER A  1  312 ? -8.229   -6.013   128.998  1.00 151.93 ? 312 SER 1 O     1 
ATOM   2431  C  CB    . SER A  1  312 ? -10.132  -5.222   131.739  1.00 155.43 ? 312 SER 1 CB    1 
ATOM   2432  O  OG    . SER A  1  312 ? -10.396  -4.184   130.814  1.00 159.07 ? 312 SER 1 OG    1 
ATOM   2433  N  N     . TYR A  1  313 ? -10.029  -7.275   129.540  1.00 151.64 ? 313 TYR 1 N     1 
ATOM   2434  C  CA    . TYR A  1  313 ? -10.287  -7.712   128.170  1.00 145.49 ? 313 TYR 1 CA    1 
ATOM   2435  C  C     . TYR A  1  313 ? -10.840  -6.591   127.296  1.00 133.13 ? 313 TYR 1 C     1 
ATOM   2436  O  O     . TYR A  1  313 ? -10.947  -6.771   126.078  1.00 123.42 ? 313 TYR 1 O     1 
ATOM   2437  C  CB    . TYR A  1  313 ? -11.257  -8.910   128.161  1.00 153.36 ? 313 TYR 1 CB    1 
ATOM   2438  C  CG    . TYR A  1  313 ? -10.675  -10.254  128.614  1.00 157.65 ? 313 TYR 1 CG    1 
ATOM   2439  C  CD1   . TYR A  1  313 ? -9.354   -10.373  129.005  1.00 163.28 ? 313 TYR 1 CD1   1 
ATOM   2440  C  CD2   . TYR A  1  313 ? -11.455  -11.406  128.638  1.00 154.07 ? 313 TYR 1 CD2   1 
ATOM   2441  C  CE1   . TYR A  1  313 ? -8.824   -11.602  129.415  1.00 163.88 ? 313 TYR 1 CE1   1 
ATOM   2442  C  CE2   . TYR A  1  313 ? -10.929  -12.638  129.047  1.00 152.70 ? 313 TYR 1 CE2   1 
ATOM   2443  C  CZ    . TYR A  1  313 ? -9.617   -12.731  129.434  1.00 156.78 ? 313 TYR 1 CZ    1 
ATOM   2444  O  OH    . TYR A  1  313 ? -9.103   -13.950  129.837  1.00 150.41 ? 313 TYR 1 OH    1 
ATOM   2445  N  N     . GLU A  1  314 ? -11.155  -5.434   127.874  1.00 135.60 ? 314 GLU 1 N     1 
ATOM   2446  C  CA    . GLU A  1  314 ? -11.800  -4.342   127.157  1.00 133.69 ? 314 GLU 1 CA    1 
ATOM   2447  C  C     . GLU A  1  314 ? -10.966  -3.070   127.154  1.00 134.42 ? 314 GLU 1 C     1 
ATOM   2448  O  O     . GLU A  1  314 ? -10.837  -2.424   126.107  1.00 130.19 ? 314 GLU 1 O     1 
ATOM   2449  C  CB    . GLU A  1  314 ? -13.177  -4.073   127.773  1.00 134.45 ? 314 GLU 1 CB    1 
ATOM   2450  C  CG    . GLU A  1  314 ? -13.194  -4.280   129.271  1.00 139.72 ? 314 GLU 1 CG    1 
ATOM   2451  C  CD    . GLU A  1  314 ? -14.578  -4.526   129.810  1.00 151.39 ? 314 GLU 1 CD    1 
ATOM   2452  O  OE1   . GLU A  1  314 ? -15.554  -4.074   129.178  1.00 156.52 ? 314 GLU 1 OE1   1 
ATOM   2453  O  OE2   . GLU A  1  314 ? -14.690  -5.168   130.872  1.00 156.17 ? 314 GLU 1 OE2   1 
ATOM   2454  N  N     . HIS A  1  315 ? -10.402  -2.681   128.304  1.00 143.58 ? 315 HIS 1 N     1 
ATOM   2455  C  CA    . HIS A  1  315 ? -9.632   -1.442   128.380  1.00 154.86 ? 315 HIS 1 CA    1 
ATOM   2456  C  C     . HIS A  1  315 ? -8.336   -1.543   127.592  1.00 150.98 ? 315 HIS 1 C     1 
ATOM   2457  O  O     . HIS A  1  315 ? -7.846   -0.536   127.071  1.00 153.57 ? 315 HIS 1 O     1 
ATOM   2458  C  CB    . HIS A  1  315 ? -9.322   -1.091   129.829  1.00 168.28 ? 315 HIS 1 CB    1 
ATOM   2459  C  CG    . HIS A  1  315 ? -10.534  -0.998   130.694  1.00 178.83 ? 315 HIS 1 CG    1 
ATOM   2460  N  ND1   . HIS A  1  315 ? -11.221  -2.112   131.124  1.00 181.34 ? 315 HIS 1 ND1   1 
ATOM   2461  C  CD2   . HIS A  1  315 ? -11.194  0.071    131.197  1.00 181.81 ? 315 HIS 1 CD2   1 
ATOM   2462  C  CE1   . HIS A  1  315 ? -12.247  -1.734   131.865  1.00 182.44 ? 315 HIS 1 CE1   1 
ATOM   2463  N  NE2   . HIS A  1  315 ? -12.255  -0.414   131.923  1.00 182.69 ? 315 HIS 1 NE2   1 
ATOM   2464  N  N     . LEU A  1  316 ? -7.753   -2.738   127.520  1.00 145.90 ? 316 LEU 1 N     1 
ATOM   2465  C  CA    . LEU A  1  316 ? -6.606   -2.931   126.647  1.00 146.27 ? 316 LEU 1 CA    1 
ATOM   2466  C  C     . LEU A  1  316 ? -7.054   -3.073   125.197  1.00 147.25 ? 316 LEU 1 C     1 
ATOM   2467  O  O     . LEU A  1  316 ? -6.370   -2.589   124.287  1.00 154.33 ? 316 LEU 1 O     1 
ATOM   2468  C  CB    . LEU A  1  316 ? -5.796   -4.147   127.101  1.00 148.61 ? 316 LEU 1 CB    1 
ATOM   2469  C  CG    . LEU A  1  316 ? -4.849   -3.914   128.283  1.00 155.98 ? 316 LEU 1 CG    1 
ATOM   2470  C  CD1   . LEU A  1  316 ? -4.717   -5.162   129.142  1.00 156.83 ? 316 LEU 1 CD1   1 
ATOM   2471  C  CD2   . LEU A  1  316 ? -3.480   -3.442   127.798  1.00 159.78 ? 316 LEU 1 CD2   1 
ATOM   2472  N  N     . GLN A  1  317 ? -8.208   -3.710   124.966  1.00 139.36 ? 317 GLN 1 N     1 
ATOM   2473  C  CA    . GLN A  1  317 ? -8.787   -3.770   123.624  1.00 136.46 ? 317 GLN 1 CA    1 
ATOM   2474  C  C     . GLN A  1  317 ? -8.909   -2.373   123.017  1.00 126.52 ? 317 GLN 1 C     1 
ATOM   2475  O  O     . GLN A  1  317 ? -8.355   -2.094   121.950  1.00 126.13 ? 317 GLN 1 O     1 
ATOM   2476  C  CB    . GLN A  1  317 ? -10.150  -4.480   123.675  1.00 155.55 ? 317 GLN 1 CB    1 
ATOM   2477  C  CG    . GLN A  1  317 ? -11.139  -4.070   122.585  1.00 177.51 ? 317 GLN 1 CG    1 
ATOM   2478  C  CD    . GLN A  1  317 ? -10.825  -4.694   121.233  1.00 199.75 ? 317 GLN 1 CD    1 
ATOM   2479  O  OE1   . GLN A  1  317 ? -10.226  -5.768   121.148  1.00 208.48 ? 317 GLN 1 OE1   1 
ATOM   2480  N  NE2   . GLN A  1  317 ? -11.218  -4.009   120.165  1.00 206.36 ? 317 GLN 1 NE2   1 
ATOM   2481  N  N     . ALA A  1  318 ? -9.601   -1.467   123.712  1.00 128.20 ? 318 ALA 1 N     1 
ATOM   2482  C  CA    . ALA A  1  318 ? -9.752   -0.094   123.245  1.00 135.63 ? 318 ALA 1 CA    1 
ATOM   2483  C  C     . ALA A  1  318 ? -8.446   0.693    123.297  1.00 143.78 ? 318 ALA 1 C     1 
ATOM   2484  O  O     . ALA A  1  318 ? -8.418   1.837    122.826  1.00 144.83 ? 318 ALA 1 O     1 
ATOM   2485  C  CB    . ALA A  1  318 ? -10.835  0.616    124.053  1.00 141.08 ? 318 ALA 1 CB    1 
ATOM   2486  N  N     . LYS A  1  319 ? -7.374   0.115    123.846  1.00 153.75 ? 319 LYS 1 N     1 
ATOM   2487  C  CA    . LYS A  1  319 ? -6.044   0.715    123.829  1.00 160.57 ? 319 LYS 1 CA    1 
ATOM   2488  C  C     . LYS A  1  319 ? -5.129   0.070    122.797  1.00 164.79 ? 319 LYS 1 C     1 
ATOM   2489  O  O     . LYS A  1  319 ? -3.935   0.384    122.757  1.00 165.09 ? 319 LYS 1 O     1 
ATOM   2490  C  CB    . LYS A  1  319 ? -5.407   0.629    125.222  1.00 154.57 ? 319 LYS 1 CB    1 
ATOM   2491  C  CG    . LYS A  1  319 ? -4.452   1.777    125.554  1.00 147.07 ? 319 LYS 1 CG    1 
ATOM   2492  C  CD    . LYS A  1  319 ? -5.223   3.045    125.876  1.00 138.83 ? 319 LYS 1 CD    1 
ATOM   2493  C  CE    . LYS A  1  319 ? -4.311   4.256    125.960  1.00 128.14 ? 319 LYS 1 CE    1 
ATOM   2494  N  NZ    . LYS A  1  319 ? -5.022   5.512    125.598  1.00 122.37 ? 319 LYS 1 NZ    1 
ATOM   2495  N  N     . GLY A  1  320 ? -5.666   -0.817   121.958  1.00 160.50 ? 320 GLY 1 N     1 
ATOM   2496  C  CA    . GLY A  1  320 ? -4.914   -1.456   120.901  1.00 153.25 ? 320 GLY 1 CA    1 
ATOM   2497  C  C     . GLY A  1  320 ? -4.282   -2.788   121.261  1.00 152.62 ? 320 GLY 1 C     1 
ATOM   2498  O  O     . GLY A  1  320 ? -4.115   -3.634   120.380  1.00 157.17 ? 320 GLY 1 O     1 
ATOM   2499  N  N     . SER A  1  321 ? -3.935   -2.998   122.527  1.00 147.45 ? 321 SER 1 N     1 
ATOM   2500  C  CA    . SER A  1  321 ? -3.338   -4.245   122.981  1.00 142.56 ? 321 SER 1 CA    1 
ATOM   2501  C  C     . SER A  1  321 ? -4.428   -5.196   123.477  1.00 140.02 ? 321 SER 1 C     1 
ATOM   2502  O  O     . SER A  1  321 ? -5.621   -4.992   123.239  1.00 135.57 ? 321 SER 1 O     1 
ATOM   2503  C  CB    . SER A  1  321 ? -2.287   -3.956   124.048  1.00 141.77 ? 321 SER 1 CB    1 
ATOM   2504  O  OG    . SER A  1  321 ? -1.413   -5.053   124.252  1.00 139.59 ? 321 SER 1 OG    1 
ATOM   2505  N  N     . MET A  1  322 ? -4.024   -6.253   124.176  1.00 141.09 ? 322 MET 1 N     1 
ATOM   2506  C  CA    . MET A  1  322 ? -4.960   -7.228   124.718  1.00 140.89 ? 322 MET 1 CA    1 
ATOM   2507  C  C     . MET A  1  322 ? -4.360   -7.838   125.974  1.00 135.57 ? 322 MET 1 C     1 
ATOM   2508  O  O     . MET A  1  322 ? -3.157   -7.734   126.225  1.00 143.97 ? 322 MET 1 O     1 
ATOM   2509  C  CB    . MET A  1  322 ? -5.291   -8.329   123.703  1.00 151.81 ? 322 MET 1 CB    1 
ATOM   2510  C  CG    . MET A  1  322 ? -4.074   -8.963   123.067  1.00 161.29 ? 322 MET 1 CG    1 
ATOM   2511  S  SD    . MET A  1  322 ? -4.474   -9.977   121.631  1.00 166.93 ? 322 MET 1 SD    1 
ATOM   2512  C  CE    . MET A  1  322 ? -4.917   -8.727   120.435  1.00 174.60 ? 322 MET 1 CE    1 
ATOM   2513  N  N     . LEU A  1  323 ? -5.219   -8.458   126.773  1.00 124.48 ? 323 LEU 1 N     1 
ATOM   2514  C  CA    . LEU A  1  323 ? -4.813   -9.091   128.024  1.00 119.01 ? 323 LEU 1 CA    1 
ATOM   2515  C  C     . LEU A  1  323 ? -4.884   -10.604  127.825  1.00 112.10 ? 323 LEU 1 C     1 
ATOM   2516  O  O     . LEU A  1  323 ? -5.902   -11.235  128.109  1.00 116.65 ? 323 LEU 1 O     1 
ATOM   2517  C  CB    . LEU A  1  323 ? -5.707   -8.628   129.159  1.00 124.95 ? 323 LEU 1 CB    1 
ATOM   2518  C  CG    . LEU A  1  323 ? -5.410   -9.193   130.544  1.00 136.83 ? 323 LEU 1 CG    1 
ATOM   2519  C  CD1   . LEU A  1  323 ? -4.075   -8.658   131.047  1.00 145.72 ? 323 LEU 1 CD1   1 
ATOM   2520  C  CD2   . LEU A  1  323 ? -6.537   -8.876   131.506  1.00 147.50 ? 323 LEU 1 CD2   1 
ATOM   2521  N  N     . GLY A  1  324 ? -3.800   -11.182  127.320  1.00 112.46 ? 324 GLY 1 N     1 
ATOM   2522  C  CA    . GLY A  1  324 ? -3.773   -12.607  127.063  1.00 118.99 ? 324 GLY 1 CA    1 
ATOM   2523  C  C     . GLY A  1  324 ? -3.598   -13.469  128.298  1.00 124.69 ? 324 GLY 1 C     1 
ATOM   2524  O  O     . GLY A  1  324 ? -4.517   -14.200  128.681  1.00 128.16 ? 324 GLY 1 O     1 
ATOM   2525  N  N     . THR A  1  325 ? -2.420   -13.406  128.924  1.00 128.50 ? 325 THR 1 N     1 
ATOM   2526  C  CA    . THR A  1  325 ? -2.124   -14.211  130.103  1.00 136.67 ? 325 THR 1 CA    1 
ATOM   2527  C  C     . THR A  1  325 ? -1.891   -13.382  131.363  1.00 137.49 ? 325 THR 1 C     1 
ATOM   2528  O  O     . THR A  1  325 ? -1.661   -13.963  132.430  1.00 135.37 ? 325 THR 1 O     1 
ATOM   2529  C  CB    . THR A  1  325 ? -0.891   -15.098  129.852  1.00 146.23 ? 325 THR 1 CB    1 
ATOM   2530  O  OG1   . THR A  1  325 ? 0.106    -14.345  129.155  1.00 152.65 ? 325 THR 1 OG1   1 
ATOM   2531  C  CG2   . THR A  1  325 ? -1.257   -16.322  129.020  1.00 146.97 ? 325 THR 1 CG2   1 
ATOM   2532  N  N     . GLY A  1  326 ? -1.967   -12.053  131.278  1.00 141.53 ? 326 GLY 1 N     1 
ATOM   2533  C  CA    . GLY A  1  326 ? -1.584   -11.186  132.379  1.00 142.24 ? 326 GLY 1 CA    1 
ATOM   2534  C  C     . GLY A  1  326 ? -0.108   -11.174  132.708  1.00 146.91 ? 326 GLY 1 C     1 
ATOM   2535  O  O     . GLY A  1  326 ? 0.281    -10.584  133.720  1.00 157.34 ? 326 GLY 1 O     1 
ATOM   2536  N  N     . GLY A  1  327 ? 0.728    -11.799  131.881  1.00 138.77 ? 327 GLY 1 N     1 
ATOM   2537  C  CA    . GLY A  1  327 ? 2.161    -11.809  132.107  1.00 130.01 ? 327 GLY 1 CA    1 
ATOM   2538  C  C     . GLY A  1  327 ? 2.830    -10.572  131.549  1.00 123.35 ? 327 GLY 1 C     1 
ATOM   2539  O  O     . GLY A  1  327 ? 3.093    -10.489  130.345  1.00 129.13 ? 327 GLY 1 O     1 
ATOM   2540  N  N     . VAL A  1  328 ? 3.114    -9.606   132.418  1.00 108.55 ? 328 VAL 1 N     1 
ATOM   2541  C  CA    . VAL A  1  328 ? 3.641    -8.315   131.996  1.00 101.33 ? 328 VAL 1 CA    1 
ATOM   2542  C  C     . VAL A  1  328 ? 5.151    -8.414   131.877  1.00 105.35 ? 328 VAL 1 C     1 
ATOM   2543  O  O     . VAL A  1  328 ? 5.824    -9.000   132.732  1.00 104.74 ? 328 VAL 1 O     1 
ATOM   2544  C  CB    . VAL A  1  328 ? 3.225    -7.206   132.984  1.00 95.15  ? 328 VAL 1 CB    1 
ATOM   2545  C  CG1   . VAL A  1  328 ? 3.482    -5.829   132.384  1.00 95.18  ? 328 VAL 1 CG1   1 
ATOM   2546  C  CG2   . VAL A  1  328 ? 1.773    -7.364   133.391  1.00 91.21  ? 328 VAL 1 CG2   1 
ATOM   2547  N  N     . ILE A  1  329 ? 5.686    -7.843   130.805  1.00 104.97 ? 329 ILE 1 N     1 
ATOM   2548  C  CA    . ILE A  1  329 ? 7.126    -7.729   130.625  1.00 102.40 ? 329 ILE 1 CA    1 
ATOM   2549  C  C     . ILE A  1  329 ? 7.436    -6.268   130.364  1.00 114.23 ? 329 ILE 1 C     1 
ATOM   2550  O  O     . ILE A  1  329 ? 6.936    -5.686   129.397  1.00 118.55 ? 329 ILE 1 O     1 
ATOM   2551  C  CB    . ILE A  1  329 ? 7.648    -8.616   129.482  1.00 84.59  ? 329 ILE 1 CB    1 
ATOM   2552  C  CG1   . ILE A  1  329 ? 7.271    -10.079  129.735  1.00 83.61  ? 329 ILE 1 CG1   1 
ATOM   2553  C  CG2   . ILE A  1  329 ? 9.148    -8.457   129.324  1.00 70.66  ? 329 ILE 1 CG2   1 
ATOM   2554  C  CD1   . ILE A  1  329 ? 7.712    -11.052  128.650  1.00 77.31  ? 329 ILE 1 CD1   1 
ATOM   2555  N  N     . LEU A  1  330 ? 8.260    -5.678   131.214  1.00 111.19 ? 330 LEU 1 N     1 
ATOM   2556  C  CA    . LEU A  1  330 ? 8.630    -4.285   131.063  1.00 109.80 ? 330 LEU 1 CA    1 
ATOM   2557  C  C     . LEU A  1  330 ? 9.914    -4.203   130.252  1.00 98.77  ? 330 LEU 1 C     1 
ATOM   2558  O  O     . LEU A  1  330 ? 10.898   -4.877   130.567  1.00 96.99  ? 330 LEU 1 O     1 
ATOM   2559  C  CB    . LEU A  1  330 ? 8.808    -3.630   132.430  1.00 129.49 ? 330 LEU 1 CB    1 
ATOM   2560  C  CG    . LEU A  1  330 ? 7.771    -3.978   133.500  1.00 143.73 ? 330 LEU 1 CG    1 
ATOM   2561  C  CD1   . LEU A  1  330 ? 8.034    -3.174   134.757  1.00 149.62 ? 330 LEU 1 CD1   1 
ATOM   2562  C  CD2   . LEU A  1  330 ? 6.362    -3.734   132.998  1.00 147.26 ? 330 LEU 1 CD2   1 
ATOM   2563  N  N     . ILE A  1  331 ? 9.890    -3.411   129.190  1.00 101.20 ? 331 ILE 1 N     1 
ATOM   2564  C  CA    . ILE A  1  331 ? 11.051   -3.201   128.335  1.00 114.68 ? 331 ILE 1 CA    1 
ATOM   2565  C  C     . ILE A  1  331 ? 11.585   -1.805   128.628  1.00 125.84 ? 331 ILE 1 C     1 
ATOM   2566  O  O     . ILE A  1  331 ? 10.861   -0.816   128.441  1.00 126.28 ? 331 ILE 1 O     1 
ATOM   2567  C  CB    . ILE A  1  331 ? 10.708   -3.367   126.848  1.00 119.37 ? 331 ILE 1 CB    1 
ATOM   2568  C  CG1   . ILE A  1  331 ? 9.943    -4.670   126.624  1.00 124.11 ? 331 ILE 1 CG1   1 
ATOM   2569  C  CG2   . ILE A  1  331 ? 11.968   -3.313   126.005  1.00 121.38 ? 331 ILE 1 CG2   1 
ATOM   2570  C  CD1   . ILE A  1  331 ? 9.845    -5.064   125.181  1.00 125.80 ? 331 ILE 1 CD1   1 
ATOM   2571  N  N     . PRO A  1  332 ? 12.808   -1.682   129.129  1.00 128.04 ? 332 PRO 1 N     1 
ATOM   2572  C  CA    . PRO A  1  332 ? 13.375   -0.367   129.422  1.00 133.12 ? 332 PRO 1 CA    1 
ATOM   2573  C  C     . PRO A  1  332 ? 13.985   0.271    128.183  1.00 136.32 ? 332 PRO 1 C     1 
ATOM   2574  O  O     . PRO A  1  332 ? 14.214   -0.377   127.161  1.00 127.40 ? 332 PRO 1 O     1 
ATOM   2575  C  CB    . PRO A  1  332 ? 14.455   -0.686   130.459  1.00 132.72 ? 332 PRO 1 CB    1 
ATOM   2576  C  CG    . PRO A  1  332 ? 14.914   -2.042   130.047  1.00 128.39 ? 332 PRO 1 CG    1 
ATOM   2577  C  CD    . PRO A  1  332 ? 13.672   -2.770   129.615  1.00 124.41 ? 332 PRO 1 CD    1 
ATOM   2578  N  N     . GLU A  1  333 ? 14.237   1.576    128.295  1.00 148.24 ? 333 GLU 1 N     1 
ATOM   2579  C  CA    . GLU A  1  333 ? 14.910   2.311    127.228  1.00 152.71 ? 333 GLU 1 CA    1 
ATOM   2580  C  C     . GLU A  1  333 ? 16.320   1.798    126.971  1.00 151.78 ? 333 GLU 1 C     1 
ATOM   2581  O  O     . GLU A  1  333 ? 16.849   1.995    125.873  1.00 152.80 ? 333 GLU 1 O     1 
ATOM   2582  C  CB    . GLU A  1  333 ? 14.946   3.797    127.581  1.00 158.86 ? 333 GLU 1 CB    1 
ATOM   2583  C  CG    . GLU A  1  333 ? 13.572   4.418    127.730  1.00 167.16 ? 333 GLU 1 CG    1 
ATOM   2584  C  CD    . GLU A  1  333 ? 13.615   5.774    128.385  1.00 176.06 ? 333 GLU 1 CD    1 
ATOM   2585  O  OE1   . GLU A  1  333 ? 14.564   6.021    129.156  1.00 180.48 ? 333 GLU 1 OE1   1 
ATOM   2586  O  OE2   . GLU A  1  333 ? 12.701   6.589    128.141  1.00 177.26 ? 333 GLU 1 OE2   1 
ATOM   2587  N  N     . ARG A  1  334 ? 16.933   1.141    127.958  1.00 148.71 ? 334 ARG 1 N     1 
ATOM   2588  C  CA    . ARG A  1  334 ? 18.301   0.658    127.828  1.00 144.91 ? 334 ARG 1 CA    1 
ATOM   2589  C  C     . ARG A  1  334 ? 18.443   -0.424   126.767  1.00 148.30 ? 334 ARG 1 C     1 
ATOM   2590  O  O     . ARG A  1  334 ? 19.560   -0.672   126.298  1.00 137.05 ? 334 ARG 1 O     1 
ATOM   2591  C  CB    . ARG A  1  334 ? 18.785   0.139    129.180  1.00 141.60 ? 334 ARG 1 CB    1 
ATOM   2592  C  CG    . ARG A  1  334 ? 20.284   0.183    129.381  1.00 144.88 ? 334 ARG 1 CG    1 
ATOM   2593  C  CD    . ARG A  1  334 ? 20.626   0.217    130.861  1.00 150.39 ? 334 ARG 1 CD    1 
ATOM   2594  N  NE    . ARG A  1  334 ? 19.998   -0.870   131.602  1.00 150.57 ? 334 ARG 1 NE    1 
ATOM   2595  C  CZ    . ARG A  1  334 ? 20.624   -1.983   131.970  1.00 150.14 ? 334 ARG 1 CZ    1 
ATOM   2596  N  NH1   . ARG A  1  334 ? 21.904   -2.160   131.676  1.00 150.93 ? 334 ARG 1 NH1   1 
ATOM   2597  N  NH2   . ARG A  1  334 ? 19.971   -2.917   132.641  1.00 148.36 ? 334 ARG 1 NH2   1 
ATOM   2598  N  N     . VAL A  1  335 ? 17.345   -1.052   126.363  1.00 164.01 ? 335 VAL 1 N     1 
ATOM   2599  C  CA    . VAL A  1  335 ? 17.354   -2.070   125.322  1.00 169.37 ? 335 VAL 1 CA    1 
ATOM   2600  C  C     . VAL A  1  335 ? 16.511   -1.562   124.163  1.00 158.72 ? 335 VAL 1 C     1 
ATOM   2601  O  O     . VAL A  1  335 ? 15.435   -0.988   124.367  1.00 165.12 ? 335 VAL 1 O     1 
ATOM   2602  C  CB    . VAL A  1  335 ? 16.824   -3.423   125.843  1.00 178.63 ? 335 VAL 1 CB    1 
ATOM   2603  C  CG1   . VAL A  1  335 ? 16.844   -4.471   124.738  1.00 178.73 ? 335 VAL 1 CG1   1 
ATOM   2604  C  CG2   . VAL A  1  335 ? 17.631   -3.878   127.055  1.00 183.69 ? 335 VAL 1 CG2   1 
ATOM   2605  N  N     . SER A  1  336 ? 17.010   -1.754   122.949  1.00 140.57 ? 336 SER 1 N     1 
ATOM   2606  C  CA    . SER A  1  336 ? 16.303   -1.258   121.781  1.00 128.44 ? 336 SER 1 CA    1 
ATOM   2607  C  C     . SER A  1  336 ? 15.084   -2.125   121.488  1.00 125.03 ? 336 SER 1 C     1 
ATOM   2608  O  O     . SER A  1  336 ? 15.127   -3.357   121.588  1.00 118.82 ? 336 SER 1 O     1 
ATOM   2609  C  CB    . SER A  1  336 ? 17.240   -1.223   120.576  1.00 122.06 ? 336 SER 1 CB    1 
ATOM   2610  O  OG    . SER A  1  336 ? 16.588   -0.725   119.424  1.00 122.95 ? 336 SER 1 OG    1 
ATOM   2611  N  N     . MET A  1  337 ? 13.980   -1.459   121.152  1.00 131.56 ? 337 MET 1 N     1 
ATOM   2612  C  CA    . MET A  1  337 ? 12.795   -2.165   120.679  1.00 130.27 ? 337 MET 1 CA    1 
ATOM   2613  C  C     . MET A  1  337 ? 13.124   -3.035   119.472  1.00 127.68 ? 337 MET 1 C     1 
ATOM   2614  O  O     . MET A  1  337 ? 12.553   -4.119   119.306  1.00 123.88 ? 337 MET 1 O     1 
ATOM   2615  C  CB    . MET A  1  337 ? 11.694   -1.160   120.344  1.00 127.90 ? 337 MET 1 CB    1 
ATOM   2616  C  CG    . MET A  1  337 ? 10.641   -0.995   121.435  1.00 125.86 ? 337 MET 1 CG    1 
ATOM   2617  S  SD    . MET A  1  337 ? 9.375    -2.268   121.302  1.00 126.93 ? 337 MET 1 SD    1 
ATOM   2618  C  CE    . MET A  1  337 ? 8.840    -2.424   122.999  1.00 135.60 ? 337 MET 1 CE    1 
ATOM   2619  N  N     . VAL A  1  338 ? 14.032   -2.568   118.609  1.00 130.37 ? 338 VAL 1 N     1 
ATOM   2620  C  CA    . VAL A  1  338 ? 14.490   -3.387   117.489  1.00 133.63 ? 338 VAL 1 CA    1 
ATOM   2621  C  C     . VAL A  1  338 ? 15.023   -4.721   117.999  1.00 125.46 ? 338 VAL 1 C     1 
ATOM   2622  O  O     . VAL A  1  338 ? 14.659   -5.783   117.492  1.00 117.36 ? 338 VAL 1 O     1 
ATOM   2623  C  CB    . VAL A  1  338 ? 15.540   -2.624   116.658  1.00 139.71 ? 338 VAL 1 CB    1 
ATOM   2624  C  CG1   . VAL A  1  338 ? 16.207   -3.541   115.637  1.00 137.15 ? 338 VAL 1 CG1   1 
ATOM   2625  C  CG2   . VAL A  1  338 ? 14.903   -1.428   115.952  1.00 143.21 ? 338 VAL 1 CG2   1 
ATOM   2626  N  N     . ASP A  1  339 ? 15.871   -4.683   119.032  1.00 121.65 ? 339 ASP 1 N     1 
ATOM   2627  C  CA    . ASP A  1  339 ? 16.446   -5.908   119.590  1.00 101.87 ? 339 ASP 1 CA    1 
ATOM   2628  C  C     . ASP A  1  339 ? 15.386   -6.768   120.280  1.00 103.04 ? 339 ASP 1 C     1 
ATOM   2629  O  O     . ASP A  1  339 ? 15.431   -8.008   120.213  1.00 107.58 ? 339 ASP 1 O     1 
ATOM   2630  C  CB    . ASP A  1  339 ? 17.575   -5.542   120.552  1.00 82.46  ? 339 ASP 1 CB    1 
ATOM   2631  C  CG    . ASP A  1  339 ? 18.353   -6.741   121.009  1.00 77.40  ? 339 ASP 1 CG    1 
ATOM   2632  O  OD1   . ASP A  1  339 ? 18.968   -7.413   120.158  1.00 72.04  ? 339 ASP 1 OD1   1 
ATOM   2633  O  OD2   . ASP A  1  339 ? 18.350   -7.018   122.219  1.00 83.88  ? 339 ASP 1 OD2   1 
ATOM   2634  N  N     . ALA A  1  340 ? 14.438   -6.130   120.968  1.00 101.78 ? 340 ALA 1 N     1 
ATOM   2635