data_6YBO
# 
_entry.id   6YBO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.331 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6YBO         
WWPDB D_1292107353 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB 'PDB entries for the same citation' 6YBF unspecified 
PDB 'PDB entries for the same citation' 6YBI unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6YBO 
_pdbx_database_status.recvd_initial_deposition_date   2020-03-17 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Gavira, J.A.'           1 0000-0002-7386-6484 
'Martinez-Rodriguez, S.' 2 0000-0001-6675-1550 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Acta Crystallogr D Struct Biol' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2059-7983 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            76 
_citation.language                  ? 
_citation.page_first                751 
_citation.page_last                 758 
_citation.title                     
'Attaining atomic resolution from in situ data collection at room temperature using counter-diffusion-based low-cost microchips.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1107/S2059798320008475 
_citation.pdbx_database_id_PubMed   32744257 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Gavira, J.A.'           1 0000-0002-7386-6484 
primary 'Rodriguez-Ruiz, I.'     2 0000-0003-3949-3888 
primary 'Martinez-Rodriguez, S.' 3 0000-0001-6675-1550 
primary 'Basu, S.'               4 ?                   
primary 'Teychene, S.'           5 ?                   
primary 'McCarthy, A.A.'         6 ?                   
primary 'Mueller-Dieckman, C.'   7 ?                   
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6YBO 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     93.940 
_cell.length_a_esd                 ? 
_cell.length_b                     99.370 
_cell.length_b_esd                 ? 
_cell.length_c                     103.040 
_cell.length_c_esd                 ? 
_cell.volume                       961859.626 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6YBO 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
_symmetry.space_group_name_Hall            'I 2 2' 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'Xylose isomerase' 43283.297 1   5.3.1.5 ? ? ? 
2 non-polymer syn 'MAGNESIUM ION'    24.305    2   ?       ? ? ? 
3 non-polymer syn 'SODIUM ION'       22.990    1   ?       ? ? ? 
4 water       nat water              18.015    281 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MNYQPTPEDRFTFGLWTVGWQGRDPFGDATRRALDPVESVRRLAELGAHGVTFHDDDLIPFGSSDSEREEHVKRFRQALD
DTGMKVPMATTNLFTHPVFKDGGFTANDRDVRRYALRKTIRNIDLAVELGAETYVAWGGREGAESGGAKDVRDALDRMKE
AFDLLGEYVTSQGYDIRFAIEPKPNEPRGDILLPTVGHALAFIERLERPELYGVNPEVGHEQMAGLNFPHGIAQALWAGK
LFHIDLNGQNGIKYDQDLRFGAGDLRAAFWLVDLLESAGYSGPRHFDFKPPRTEDFDGVWASAAGCMRNYLILKERAAAF
RADPEVQEALRASRLDELARPTAADGLQALLDDRSAFEEFDVDAAAARGMAFERLDQLAMDHLLGARG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MNYQPTPEDRFTFGLWTVGWQGRDPFGDATRRALDPVESVRRLAELGAHGVTFHDDDLIPFGSSDSEREEHVKRFRQALD
DTGMKVPMATTNLFTHPVFKDGGFTANDRDVRRYALRKTIRNIDLAVELGAETYVAWGGREGAESGGAKDVRDALDRMKE
AFDLLGEYVTSQGYDIRFAIEPKPNEPRGDILLPTVGHALAFIERLERPELYGVNPEVGHEQMAGLNFPHGIAQALWAGK
LFHIDLNGQNGIKYDQDLRFGAGDLRAAFWLVDLLESAGYSGPRHFDFKPPRTEDFDGVWASAAGCMRNYLILKERAAAF
RADPEVQEALRASRLDELARPTAADGLQALLDDRSAFEEFDVDAAAARGMAFERLDQLAMDHLLGARG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASN n 
1 3   TYR n 
1 4   GLN n 
1 5   PRO n 
1 6   THR n 
1 7   PRO n 
1 8   GLU n 
1 9   ASP n 
1 10  ARG n 
1 11  PHE n 
1 12  THR n 
1 13  PHE n 
1 14  GLY n 
1 15  LEU n 
1 16  TRP n 
1 17  THR n 
1 18  VAL n 
1 19  GLY n 
1 20  TRP n 
1 21  GLN n 
1 22  GLY n 
1 23  ARG n 
1 24  ASP n 
1 25  PRO n 
1 26  PHE n 
1 27  GLY n 
1 28  ASP n 
1 29  ALA n 
1 30  THR n 
1 31  ARG n 
1 32  ARG n 
1 33  ALA n 
1 34  LEU n 
1 35  ASP n 
1 36  PRO n 
1 37  VAL n 
1 38  GLU n 
1 39  SER n 
1 40  VAL n 
1 41  ARG n 
1 42  ARG n 
1 43  LEU n 
1 44  ALA n 
1 45  GLU n 
1 46  LEU n 
1 47  GLY n 
1 48  ALA n 
1 49  HIS n 
1 50  GLY n 
1 51  VAL n 
1 52  THR n 
1 53  PHE n 
1 54  HIS n 
1 55  ASP n 
1 56  ASP n 
1 57  ASP n 
1 58  LEU n 
1 59  ILE n 
1 60  PRO n 
1 61  PHE n 
1 62  GLY n 
1 63  SER n 
1 64  SER n 
1 65  ASP n 
1 66  SER n 
1 67  GLU n 
1 68  ARG n 
1 69  GLU n 
1 70  GLU n 
1 71  HIS n 
1 72  VAL n 
1 73  LYS n 
1 74  ARG n 
1 75  PHE n 
1 76  ARG n 
1 77  GLN n 
1 78  ALA n 
1 79  LEU n 
1 80  ASP n 
1 81  ASP n 
1 82  THR n 
1 83  GLY n 
1 84  MET n 
1 85  LYS n 
1 86  VAL n 
1 87  PRO n 
1 88  MET n 
1 89  ALA n 
1 90  THR n 
1 91  THR n 
1 92  ASN n 
1 93  LEU n 
1 94  PHE n 
1 95  THR n 
1 96  HIS n 
1 97  PRO n 
1 98  VAL n 
1 99  PHE n 
1 100 LYS n 
1 101 ASP n 
1 102 GLY n 
1 103 GLY n 
1 104 PHE n 
1 105 THR n 
1 106 ALA n 
1 107 ASN n 
1 108 ASP n 
1 109 ARG n 
1 110 ASP n 
1 111 VAL n 
1 112 ARG n 
1 113 ARG n 
1 114 TYR n 
1 115 ALA n 
1 116 LEU n 
1 117 ARG n 
1 118 LYS n 
1 119 THR n 
1 120 ILE n 
1 121 ARG n 
1 122 ASN n 
1 123 ILE n 
1 124 ASP n 
1 125 LEU n 
1 126 ALA n 
1 127 VAL n 
1 128 GLU n 
1 129 LEU n 
1 130 GLY n 
1 131 ALA n 
1 132 GLU n 
1 133 THR n 
1 134 TYR n 
1 135 VAL n 
1 136 ALA n 
1 137 TRP n 
1 138 GLY n 
1 139 GLY n 
1 140 ARG n 
1 141 GLU n 
1 142 GLY n 
1 143 ALA n 
1 144 GLU n 
1 145 SER n 
1 146 GLY n 
1 147 GLY n 
1 148 ALA n 
1 149 LYS n 
1 150 ASP n 
1 151 VAL n 
1 152 ARG n 
1 153 ASP n 
1 154 ALA n 
1 155 LEU n 
1 156 ASP n 
1 157 ARG n 
1 158 MET n 
1 159 LYS n 
1 160 GLU n 
1 161 ALA n 
1 162 PHE n 
1 163 ASP n 
1 164 LEU n 
1 165 LEU n 
1 166 GLY n 
1 167 GLU n 
1 168 TYR n 
1 169 VAL n 
1 170 THR n 
1 171 SER n 
1 172 GLN n 
1 173 GLY n 
1 174 TYR n 
1 175 ASP n 
1 176 ILE n 
1 177 ARG n 
1 178 PHE n 
1 179 ALA n 
1 180 ILE n 
1 181 GLU n 
1 182 PRO n 
1 183 LYS n 
1 184 PRO n 
1 185 ASN n 
1 186 GLU n 
1 187 PRO n 
1 188 ARG n 
1 189 GLY n 
1 190 ASP n 
1 191 ILE n 
1 192 LEU n 
1 193 LEU n 
1 194 PRO n 
1 195 THR n 
1 196 VAL n 
1 197 GLY n 
1 198 HIS n 
1 199 ALA n 
1 200 LEU n 
1 201 ALA n 
1 202 PHE n 
1 203 ILE n 
1 204 GLU n 
1 205 ARG n 
1 206 LEU n 
1 207 GLU n 
1 208 ARG n 
1 209 PRO n 
1 210 GLU n 
1 211 LEU n 
1 212 TYR n 
1 213 GLY n 
1 214 VAL n 
1 215 ASN n 
1 216 PRO n 
1 217 GLU n 
1 218 VAL n 
1 219 GLY n 
1 220 HIS n 
1 221 GLU n 
1 222 GLN n 
1 223 MET n 
1 224 ALA n 
1 225 GLY n 
1 226 LEU n 
1 227 ASN n 
1 228 PHE n 
1 229 PRO n 
1 230 HIS n 
1 231 GLY n 
1 232 ILE n 
1 233 ALA n 
1 234 GLN n 
1 235 ALA n 
1 236 LEU n 
1 237 TRP n 
1 238 ALA n 
1 239 GLY n 
1 240 LYS n 
1 241 LEU n 
1 242 PHE n 
1 243 HIS n 
1 244 ILE n 
1 245 ASP n 
1 246 LEU n 
1 247 ASN n 
1 248 GLY n 
1 249 GLN n 
1 250 ASN n 
1 251 GLY n 
1 252 ILE n 
1 253 LYS n 
1 254 TYR n 
1 255 ASP n 
1 256 GLN n 
1 257 ASP n 
1 258 LEU n 
1 259 ARG n 
1 260 PHE n 
1 261 GLY n 
1 262 ALA n 
1 263 GLY n 
1 264 ASP n 
1 265 LEU n 
1 266 ARG n 
1 267 ALA n 
1 268 ALA n 
1 269 PHE n 
1 270 TRP n 
1 271 LEU n 
1 272 VAL n 
1 273 ASP n 
1 274 LEU n 
1 275 LEU n 
1 276 GLU n 
1 277 SER n 
1 278 ALA n 
1 279 GLY n 
1 280 TYR n 
1 281 SER n 
1 282 GLY n 
1 283 PRO n 
1 284 ARG n 
1 285 HIS n 
1 286 PHE n 
1 287 ASP n 
1 288 PHE n 
1 289 LYS n 
1 290 PRO n 
1 291 PRO n 
1 292 ARG n 
1 293 THR n 
1 294 GLU n 
1 295 ASP n 
1 296 PHE n 
1 297 ASP n 
1 298 GLY n 
1 299 VAL n 
1 300 TRP n 
1 301 ALA n 
1 302 SER n 
1 303 ALA n 
1 304 ALA n 
1 305 GLY n 
1 306 CYS n 
1 307 MET n 
1 308 ARG n 
1 309 ASN n 
1 310 TYR n 
1 311 LEU n 
1 312 ILE n 
1 313 LEU n 
1 314 LYS n 
1 315 GLU n 
1 316 ARG n 
1 317 ALA n 
1 318 ALA n 
1 319 ALA n 
1 320 PHE n 
1 321 ARG n 
1 322 ALA n 
1 323 ASP n 
1 324 PRO n 
1 325 GLU n 
1 326 VAL n 
1 327 GLN n 
1 328 GLU n 
1 329 ALA n 
1 330 LEU n 
1 331 ARG n 
1 332 ALA n 
1 333 SER n 
1 334 ARG n 
1 335 LEU n 
1 336 ASP n 
1 337 GLU n 
1 338 LEU n 
1 339 ALA n 
1 340 ARG n 
1 341 PRO n 
1 342 THR n 
1 343 ALA n 
1 344 ALA n 
1 345 ASP n 
1 346 GLY n 
1 347 LEU n 
1 348 GLN n 
1 349 ALA n 
1 350 LEU n 
1 351 LEU n 
1 352 ASP n 
1 353 ASP n 
1 354 ARG n 
1 355 SER n 
1 356 ALA n 
1 357 PHE n 
1 358 GLU n 
1 359 GLU n 
1 360 PHE n 
1 361 ASP n 
1 362 VAL n 
1 363 ASP n 
1 364 ALA n 
1 365 ALA n 
1 366 ALA n 
1 367 ALA n 
1 368 ARG n 
1 369 GLY n 
1 370 MET n 
1 371 ALA n 
1 372 PHE n 
1 373 GLU n 
1 374 ARG n 
1 375 LEU n 
1 376 ASP n 
1 377 GLN n 
1 378 LEU n 
1 379 ALA n 
1 380 MET n 
1 381 ASP n 
1 382 HIS n 
1 383 LEU n 
1 384 LEU n 
1 385 GLY n 
1 386 ALA n 
1 387 ARG n 
1 388 GLY n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           1 
_entity_src_nat.pdbx_end_seq_num           388 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Streptomyces rubiginosus' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      1929 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    XYLA_STRRU 
_struct_ref.pdbx_db_accession          P24300 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MNYQPTPEDRFTFGLWTVGWQGRDPFGDATRRALDPVESVRRLAELGAHGVTFHDDDLIPFGSSDSEREEHVKRFRQALD
DTGMKVPMATTNLFTHPVFKDGGFTANDRDVRRYALRKTIRNIDLAVELGAETYVAWGGREGAESGGAKDVRDALDRMKE
AFDLLGEYVTSQGYDIRFAIEPKPNEPRGDILLPTVGHALAFIERLERPELYGVNPEVGHEQMAGLNFPHGIAQALWAGK
LFHIDLNGQNGIKYDQDLRFGAGDLRAAFWLVDLLESAGYSGPRHFDFKPPRTEDFDGVWASAAGCMRNYLILKERAAAF
RADPEVQEALRASRLDELARPTAADGLQALLDDRSAFEEFDVDAAAARGMAFERLDQLAMDHLLGARG
;
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6YBO 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 388 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P24300 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  388 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       388 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION' ? 'Mg 2'           24.305  
NA  non-polymer         . 'SODIUM ION'    ? 'Na 1'           22.990  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6YBO 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.7 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         54 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          COUNTER-DIFFUSION 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293.5 
_exptl_crystal_grow.temp_details    'Room temperature' 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1 M MgCl2, 10% w/v PEG 1K, 0.1 M Hepes pH 7.0' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     293.5 
_diffrn.ambient_temp_details             'Room Temperature' 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      
'Be CRL lenses for vertical focusing and Rh/Pt/Si coated ellipitcal mirror for horizontal focusing' 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-03-06 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9763 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID30B' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9763 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID30B 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate            13.05 
_reflns.entry_id                         6YBO 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.06 
_reflns.d_resolution_low                 41.12 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       200000 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             92.32 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.93 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            8.4 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.987 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.06 
_reflns_shell.d_res_low                   1.09 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           8688 
_reflns_shell.percent_possible_all        40.20 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.614 
_reflns_shell.pdbx_CC_star                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               20.18 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6YBO 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.06 
_refine.ls_d_res_low                             41.12 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     199958 
_refine.ls_number_reflns_R_free                  9998 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    92.32 
_refine.ls_percent_reflns_R_free                 5.00 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1233 
_refine.ls_R_factor_R_free                       0.1310 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1229 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4A8I 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 13.0028 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.0910 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       1.06 
_refine_hist.d_res_low                        41.12 
_refine_hist.number_atoms_solvent             281 
_refine_hist.number_atoms_total               3317 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        3033 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         3 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.0046 ? 3567 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.9041 ? 4900 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.0754 ? 494  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.0070 ? 690  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 7.5613 ? 2532 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.06 1.07  . . 123 2340 34.35  . . . 0.4002 . 0.3693 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.07 1.08  . . 145 2730 39.96  . . . 0.4283 . 0.3793 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.08 1.10  . . 166 3160 46.36  . . . 0.3193 . 0.3493 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.10 1.11  . . 276 5231 77.00  . . . 0.3483 . 0.3338 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.11 1.13  . . 303 5775 84.90  . . . 0.3500 . 0.3203 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.13 1.14  . . 323 6137 90.15  . . . 0.2717 . 0.2559 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.14 1.16  . . 350 6645 97.45  . . . 0.2257 . 0.2182 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.16 1.18  . . 354 6745 99.34  . . . 0.1882 . 0.1918 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.18 1.19  . . 357 6796 99.83  . . . 0.1856 . 0.1748 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.19 1.21  . . 357 6782 99.80  . . . 0.1750 . 0.1668 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.21 1.23  . . 360 6833 99.81  . . . 0.1554 . 0.1568 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.23 1.26  . . 360 6848 99.90  . . . 0.1552 . 0.1425 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.26 1.28  . . 357 6778 99.94  . . . 0.1427 . 0.1323 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.28 1.31  . . 359 6814 99.92  . . . 0.1340 . 0.1254 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.31 1.34  . . 360 6849 99.97  . . . 0.1184 . 0.1112 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.34 1.37  . . 359 6818 100.00 . . . 0.1218 . 0.1089 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.37 1.40  . . 361 6851 99.96  . . . 0.1133 . 0.1038 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.40 1.44  . . 359 6828 99.99  . . . 0.1276 . 0.0950 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.44 1.48  . . 361 6857 100.00 . . . 0.1009 . 0.0869 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.48 1.53  . . 361 6860 100.00 . . . 0.0865 . 0.0830 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.53 1.58  . . 361 6864 99.99  . . . 0.0916 . 0.0828 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.58 1.65  . . 361 6858 100.00 . . . 0.0929 . 0.0852 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.65 1.72  . . 360 6847 99.97  . . . 0.1052 . 0.0925 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.72 1.81  . . 362 6868 100.00 . . . 0.1048 . 0.0978 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.81 1.93  . . 362 6875 100.00 . . . 0.1106 . 0.0995 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.93 2.07  . . 364 6919 100.00 . . . 0.1048 . 0.1003 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.07 2.28  . . 364 6912 100.00 . . . 0.1121 . 0.1054 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.28 2.61  . . 365 6948 100.00 . . . 0.1297 . 0.1216 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.61 3.29  . . 369 7007 100.00 . . . 0.1353 . 0.1292 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.29 41.12 . . 379 7185 99.95  . . . 0.1354 . 0.1288 . . . . . . . . . . . 
# 
_struct.entry_id                     6YBO 
_struct.title                        
'RT structure of Glucose Isomerase obtained at 1.06 A resolution from crystal grown in a Kapton microchip.' 
_struct.pdbx_descriptor              'Lysozyme (E.C.3.2.1.17)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6YBO 
_struct_keywords.text            'D-XYLOSE KETOL ISOMERASE, ISOMERASE' 
_struct_keywords.pdbx_keywords   ISOMERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR A 6   ? ASP A 9   ? THR A 6   ASP A 9   5 ? 4  
HELX_P HELX_P2  AA2 LEU A 15  ? GLY A 19  ? LEU A 15  GLY A 19  1 ? 5  
HELX_P HELX_P3  AA3 ASP A 35  ? GLY A 47  ? ASP A 35  GLY A 47  1 ? 13 
HELX_P HELX_P4  AA4 ASP A 55  ? ILE A 59  ? ASP A 55  ILE A 59  1 ? 5  
HELX_P HELX_P5  AA5 SER A 64  ? GLY A 83  ? SER A 64  GLY A 83  1 ? 20 
HELX_P HELX_P6  AA6 HIS A 96  ? LYS A 100 ? HIS A 96  LYS A 100 5 ? 5  
HELX_P HELX_P7  AA7 ASP A 108 ? LEU A 129 ? ASP A 108 LEU A 129 1 ? 22 
HELX_P HELX_P8  AA8 SER A 145 ? LYS A 149 ? SER A 145 LYS A 149 5 ? 5  
HELX_P HELX_P9  AA9 ASP A 150 ? GLY A 173 ? ASP A 150 GLY A 173 1 ? 24 
HELX_P HELX_P10 AB1 THR A 195 ? GLU A 204 ? THR A 195 GLU A 204 1 ? 10 
HELX_P HELX_P11 AB2 ARG A 208 ? GLU A 210 ? ARG A 208 GLU A 210 5 ? 3  
HELX_P HELX_P12 AB3 GLU A 217 ? MET A 223 ? GLU A 217 MET A 223 1 ? 7  
HELX_P HELX_P13 AB4 ASN A 227 ? ALA A 238 ? ASN A 227 ALA A 238 1 ? 12 
HELX_P HELX_P14 AB5 ASP A 264 ? GLY A 279 ? ASP A 264 GLY A 279 1 ? 16 
HELX_P HELX_P15 AB6 ASP A 295 ? ASP A 323 ? ASP A 295 ASP A 323 1 ? 29 
HELX_P HELX_P16 AB7 ASP A 323 ? SER A 333 ? ASP A 323 SER A 333 1 ? 11 
HELX_P HELX_P17 AB8 ARG A 334 ? ALA A 339 ? ARG A 334 ALA A 339 1 ? 6  
HELX_P HELX_P18 AB9 GLY A 346 ? ASP A 353 ? GLY A 346 ASP A 353 1 ? 8  
HELX_P HELX_P19 AC1 ARG A 354 ? PHE A 357 ? ARG A 354 PHE A 357 5 ? 4  
HELX_P HELX_P20 AC2 ASP A 361 ? ARG A 368 ? ASP A 361 ARG A 368 1 ? 8  
HELX_P HELX_P21 AC3 ALA A 371 ? GLY A 385 ? ALA A 371 GLY A 385 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? A ASP 163 OD1 ? ? ? 1_555 D NA  . NA ? ? A ASP 163 A NA  403 1_555 ? ? ? ? ? ? ? 2.726 ? ? 
metalc2  metalc ? ? A GLU 181 OE2 A ? ? 1_555 B MG  . MG ? ? A GLU 181 A MG  401 1_555 ? ? ? ? ? ? ? 1.983 ? ? 
metalc3  metalc ? ? A GLU 181 OE2 B ? ? 1_555 B MG  . MG ? ? A GLU 181 A MG  401 1_555 ? ? ? ? ? ? ? 2.001 ? ? 
metalc4  metalc ? ? A TYR 212 OH  ? ? ? 1_555 D NA  . NA ? ? A TYR 212 A NA  403 1_555 ? ? ? ? ? ? ? 2.888 ? ? 
metalc5  metalc ? ? A GLU 217 OE1 ? ? ? 1_555 B MG  . MG ? ? A GLU 217 A MG  401 1_555 ? ? ? ? ? ? ? 2.097 ? ? 
metalc6  metalc ? ? A GLU 217 OE2 ? ? ? 1_555 C MG  . MG ? ? A GLU 217 A MG  402 1_555 ? ? ? ? ? ? ? 2.044 ? ? 
metalc7  metalc ? ? A ASP 245 OD2 ? ? ? 1_555 B MG  . MG ? ? A ASP 245 A MG  401 1_555 ? ? ? ? ? ? ? 2.073 ? ? 
metalc8  metalc ? ? A ASP 255 OD1 ? ? ? 1_555 C MG  . MG ? ? A ASP 255 A MG  402 1_555 ? ? ? ? ? ? ? 2.321 ? ? 
metalc9  metalc ? ? A ASP 255 OD2 ? ? ? 1_555 C MG  . MG ? ? A ASP 255 A MG  402 1_555 ? ? ? ? ? ? ? 2.224 ? ? 
metalc10 metalc ? ? A ASP 257 OD1 ? ? ? 1_555 C MG  . MG ? ? A ASP 257 A MG  402 1_555 ? ? ? ? ? ? ? 2.175 ? ? 
metalc11 metalc ? ? A ASP 287 OD2 ? ? ? 1_555 B MG  . MG ? ? A ASP 287 A MG  401 1_555 ? ? ? ? ? ? ? 2.116 ? ? 
metalc12 metalc ? ? B MG  .   MG  ? ? ? 1_555 E HOH . O  ? ? A MG  401 A HOH 509 1_555 ? ? ? ? ? ? ? 2.304 ? ? 
metalc13 metalc ? ? B MG  .   MG  ? ? ? 1_555 E HOH . O  ? ? A MG  401 A HOH 513 1_555 ? ? ? ? ? ? ? 2.283 ? ? 
metalc14 metalc ? ? C MG  .   MG  ? ? ? 1_555 E HOH . O  ? ? A MG  402 A HOH 627 1_555 ? ? ? ? ? ? ? 2.165 ? ? 
metalc15 metalc ? ? D NA  .   NA  ? ? ? 1_555 E HOH . O  ? ? A NA  403 A HOH 534 1_555 ? ? ? ? ? ? ? 2.816 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 186 A . ? GLU 186 A PRO 187 A ? PRO 187 A 1 19.64 
2 GLU 186 A . ? GLU 186 A PRO 187 A ? PRO 187 A 1 7.82  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 8 ? 
AA2 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA1 6 7 ? parallel      
AA1 7 8 ? parallel      
AA2 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 TYR A 212 ? VAL A 214 ? TYR A 212 VAL A 214 
AA1 2 ARG A 177 ? ILE A 180 ? ARG A 177 ILE A 180 
AA1 3 THR A 133 ? ALA A 136 ? THR A 133 ALA A 136 
AA1 4 LYS A 85  ? THR A 90  ? LYS A 85  THR A 90  
AA1 5 GLY A 50  ? HIS A 54  ? GLY A 50  HIS A 54  
AA1 6 PHE A 11  ? GLY A 14  ? PHE A 11  GLY A 14  
AA1 7 ARG A 284 ? PHE A 286 ? ARG A 284 PHE A 286 
AA1 8 ASP A 245 ? LEU A 246 ? ASP A 245 LEU A 246 
AA2 1 GLY A 142 ? ALA A 143 ? GLY A 142 ALA A 143 
AA2 2 ASP A 190 ? ILE A 191 ? ASP A 190 ILE A 191 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O GLY A 213 ? O GLY A 213 N ILE A 180 ? N ILE A 180 
AA1 2 3 O ARG A 177 ? O ARG A 177 N TYR A 134 ? N TYR A 134 
AA1 3 4 O VAL A 135 ? O VAL A 135 N ALA A 89  ? N ALA A 89  
AA1 4 5 O LYS A 85  ? O LYS A 85  N VAL A 51  ? N VAL A 51  
AA1 5 6 O THR A 52  ? O THR A 52  N PHE A 13  ? N PHE A 13  
AA1 6 7 N THR A 12  ? N THR A 12  O PHE A 286 ? O PHE A 286 
AA1 7 8 O HIS A 285 ? O HIS A 285 N LEU A 246 ? N LEU A 246 
AA2 1 2 N ALA A 143 ? N ALA A 143 O ASP A 190 ? O ASP A 190 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG 401 ? 6 'binding site for residue MG A 401' 
AC2 Software A MG 402 ? 5 'binding site for residue MG A 402' 
AC3 Software A NA 403 ? 5 'binding site for residue NA A 403' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 GLU A 181 ? GLU A 181 . ? 1_555 ? 
2  AC1 6 GLU A 217 ? GLU A 217 . ? 1_555 ? 
3  AC1 6 ASP A 245 ? ASP A 245 . ? 1_555 ? 
4  AC1 6 ASP A 287 ? ASP A 287 . ? 1_555 ? 
5  AC1 6 HOH E .   ? HOH A 509 . ? 1_555 ? 
6  AC1 6 HOH E .   ? HOH A 513 . ? 1_555 ? 
7  AC2 5 GLU A 217 ? GLU A 217 . ? 1_555 ? 
8  AC2 5 HIS A 220 ? HIS A 220 . ? 1_555 ? 
9  AC2 5 ASP A 255 ? ASP A 255 . ? 1_555 ? 
10 AC2 5 ASP A 257 ? ASP A 257 . ? 1_555 ? 
11 AC2 5 HOH E .   ? HOH A 627 . ? 1_555 ? 
12 AC3 5 ASP A 163 ? ASP A 163 . ? 1_555 ? 
13 AC3 5 GLU A 207 ? GLU A 207 . ? 1_555 ? 
14 AC3 5 ARG A 208 ? ARG A 208 . ? 1_555 ? 
15 AC3 5 TYR A 212 ? TYR A 212 . ? 1_555 ? 
16 AC3 5 HOH E .   ? HOH A 534 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6YBO 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.010645 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010063 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009705 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_a3 
_atom_type.scat_Cromer_Mann_a4 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_b3 
_atom_type.scat_Cromer_Mann_b4 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C  ? ? 3.54356 2.42580 ?       ? 25.62398 1.50364  ?        ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
MG ? ? 6.67814 2.96430 2.32496 ? 4.14073  0.42890  71.01992 ? 0.0 
;3-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N  ? ? 4.01032 2.96436 ?       ? 19.97189 1.75589  ?        ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
NA ? ? 6.63511 3.01293 1.30238 ? 5.54423  0.54580  90.85902 ? 0.0 
;3-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O  ? ? 4.49882 3.47563 ?       ? 15.80542 1.70748  ?        ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S  ? ? 9.55732 6.39887 ?       ? 1.23737  29.19336 ?        ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . TYR A 1 3   ? 6.94061  11.12011  136.83623 1.000 32.18906 ? 3   TYR A N   1 
ATOM   2    C  CA  . TYR A 1 3   ? 7.51025  11.08939  135.49692 1.000 27.33834 ? 3   TYR A CA  1 
ATOM   3    C  C   . TYR A 1 3   ? 7.84025  12.50342  135.01670 1.000 27.31660 ? 3   TYR A C   1 
ATOM   4    O  O   . TYR A 1 3   ? 7.44471  12.91913  133.92902 1.000 30.08220 ? 3   TYR A O   1 
ATOM   5    C  CB  . TYR A 1 3   ? 6.54906  10.40330  134.53511 1.000 23.89234 ? 3   TYR A CB  1 
ATOM   6    C  CG  . TYR A 1 3   ? 6.15944  9.00093   134.94717 1.000 22.80933 ? 3   TYR A CG  1 
ATOM   7    C  CD1 . TYR A 1 3   ? 7.06468  7.95322   134.85373 1.000 23.26380 ? 3   TYR A CD1 1 
ATOM   8    C  CD2 . TYR A 1 3   ? 4.88107  8.72082   135.41349 1.000 22.86523 ? 3   TYR A CD2 1 
ATOM   9    C  CE1 . TYR A 1 3   ? 6.71068  6.66276   135.21969 1.000 23.89817 ? 3   TYR A CE1 1 
ATOM   10   C  CE2 . TYR A 1 3   ? 4.51888  7.43508   135.78306 1.000 23.84843 ? 3   TYR A CE2 1 
ATOM   11   C  CZ  . TYR A 1 3   ? 5.43754  6.41047   135.68196 1.000 24.97393 ? 3   TYR A CZ  1 
ATOM   12   O  OH  . TYR A 1 3   ? 5.07574  5.13275   136.04931 1.000 27.58975 ? 3   TYR A OH  1 
ATOM   13   N  N   . GLN A 1 4   ? 8.59600  13.22110  135.84188 1.000 26.16231 ? 4   GLN A N   1 
ATOM   14   C  CA  A GLN A 1 4   ? 8.97408  14.60311  135.56382 0.515 25.68733 ? 4   GLN A CA  1 
ATOM   15   C  CA  B GLN A 1 4   ? 8.96225  14.60416  135.56436 0.485 27.65952 ? 4   GLN A CA  1 
ATOM   16   C  C   . GLN A 1 4   ? 10.30395 14.66745  134.82989 1.000 24.53267 ? 4   GLN A C   1 
ATOM   17   O  O   . GLN A 1 4   ? 11.30879 14.17659  135.35566 1.000 25.90301 ? 4   GLN A O   1 
ATOM   18   C  CB  A GLN A 1 4   ? 9.08292  15.37199  136.88196 0.515 29.70160 ? 4   GLN A CB  1 
ATOM   19   C  CB  B GLN A 1 4   ? 9.02734  15.42158  136.84309 0.485 35.35191 ? 4   GLN A CB  1 
ATOM   20   C  CG  A GLN A 1 4   ? 9.53881  16.82308  136.76037 0.515 33.85451 ? 4   GLN A CG  1 
ATOM   21   C  CG  B GLN A 1 4   ? 9.02869  14.61114  138.13155 0.485 43.76358 ? 4   GLN A CG  1 
ATOM   22   C  CD  A GLN A 1 4   ? 8.68919  17.63497  135.80991 0.515 39.76937 ? 4   GLN A CD  1 
ATOM   23   C  CD  B GLN A 1 4   ? 10.18662 13.63882  138.21740 0.485 52.74417 ? 4   GLN A CD  1 
ATOM   24   O  OE1 A GLN A 1 4   ? 7.46496  17.66457  135.92639 0.515 46.41125 ? 4   GLN A OE1 1 
ATOM   25   O  OE1 B GLN A 1 4   ? 9.98678  12.43810  138.39455 0.485 61.79726 ? 4   GLN A OE1 1 
ATOM   26   N  NE2 A GLN A 1 4   ? 9.33636  18.30713  134.86319 0.515 38.25988 ? 4   GLN A NE2 1 
ATOM   27   N  NE2 B GLN A 1 4   ? 11.40390 14.15107  138.08527 0.485 54.43389 ? 4   GLN A NE2 1 
ATOM   28   N  N   . PRO A 1 5   ? 10.35367 15.24480  133.63345 1.000 21.84736 ? 5   PRO A N   1 
ATOM   29   C  CA  . PRO A 1 5   ? 11.63022 15.33553  132.91605 1.000 21.55313 ? 5   PRO A CA  1 
ATOM   30   C  C   . PRO A 1 5   ? 12.51555 16.40807  133.51467 1.000 22.89442 ? 5   PRO A C   1 
ATOM   31   O  O   . PRO A 1 5   ? 12.04411 17.39035  134.09390 1.000 24.56258 ? 5   PRO A O   1 
ATOM   32   C  CB  . PRO A 1 5   ? 11.21679 15.71581  131.48854 1.000 22.99048 ? 5   PRO A CB  1 
ATOM   33   C  CG  . PRO A 1 5   ? 9.82944  16.20747  131.57115 1.000 24.90030 ? 5   PRO A CG  1 
ATOM   34   C  CD  . PRO A 1 5   ? 9.21329  15.74386  132.84493 1.000 23.56698 ? 5   PRO A CD  1 
ATOM   35   N  N   . THR A 1 6   ? 13.81441 16.18352  133.40598 1.000 23.11493 ? 6   THR A N   1 
ATOM   36   C  CA  . THR A 1 6   ? 14.82927 17.16154  133.75731 1.000 24.34544 ? 6   THR A CA  1 
ATOM   37   C  C   . THR A 1 6   ? 15.79937 17.26728  132.59314 1.000 22.80309 ? 6   THR A C   1 
ATOM   38   O  O   . THR A 1 6   ? 15.85536 16.37059  131.74478 1.000 21.57386 ? 6   THR A O   1 
ATOM   39   C  CB  . THR A 1 6   ? 15.59307 16.74731  135.02680 1.000 29.16146 ? 6   THR A CB  1 
ATOM   40   O  OG1 . THR A 1 6   ? 16.40480 15.59835  134.75431 1.000 31.57013 ? 6   THR A OG1 1 
ATOM   41   C  CG2 . THR A 1 6   ? 14.62931 16.44020  136.16642 1.000 32.22623 ? 6   THR A CG2 1 
ATOM   42   N  N   . PRO A 1 7   ? 16.58442 18.35179  132.52118 1.000 24.13068 ? 7   PRO A N   1 
ATOM   43   C  CA  . PRO A 1 7   ? 17.55587 18.47335  131.41600 1.000 24.97157 ? 7   PRO A CA  1 
ATOM   44   C  C   . PRO A 1 7   ? 18.49746 17.28400  131.25992 1.000 24.67035 ? 7   PRO A C   1 
ATOM   45   O  O   . PRO A 1 7   ? 18.95632 17.01271  130.13896 1.000 25.44039 ? 7   PRO A O   1 
ATOM   46   C  CB  . PRO A 1 7   ? 18.30067 19.77504  131.73462 1.000 27.92887 ? 7   PRO A CB  1 
ATOM   47   C  CG  . PRO A 1 7   ? 17.33881 20.56612  132.53911 1.000 28.82892 ? 7   PRO A CG  1 
ATOM   48   C  CD  . PRO A 1 7   ? 16.50862 19.58523  133.32618 1.000 26.31303 ? 7   PRO A CD  1 
ATOM   49   N  N   . GLU A 1 8   ? 18.78613 16.55339  132.34281 1.000 25.89064 ? 8   GLU A N   1 
ATOM   50   C  CA  A GLU A 1 8   ? 19.63665 15.37165  132.25562 0.634 27.50708 ? 8   GLU A CA  1 
ATOM   51   C  CA  B GLU A 1 8   ? 19.65176 15.38157  132.22657 0.366 28.15163 ? 8   GLU A CA  1 
ATOM   52   C  C   . GLU A 1 8   ? 19.04947 14.28985  131.34808 1.000 26.36610 ? 8   GLU A C   1 
ATOM   53   O  O   . GLU A 1 8   ? 19.79224 13.43566  130.84930 1.000 27.63854 ? 8   GLU A O   1 
ATOM   54   C  CB  A GLU A 1 8   ? 19.90379 14.83700  133.66967 0.634 33.23704 ? 8   GLU A CB  1 
ATOM   55   C  CB  B GLU A 1 8   ? 20.03797 14.81853  133.60244 0.366 34.17561 ? 8   GLU A CB  1 
ATOM   56   C  CG  A GLU A 1 8   ? 20.90828 15.66148  134.49129 0.634 38.12525 ? 8   GLU A CG  1 
ATOM   57   C  CG  B GLU A 1 8   ? 21.20703 13.82427  133.54896 0.366 39.75953 ? 8   GLU A CG  1 
ATOM   58   C  CD  A GLU A 1 8   ? 20.30233 16.90595  135.13130 0.634 40.73262 ? 8   GLU A CD  1 
ATOM   59   C  CD  B GLU A 1 8   ? 21.58991 13.25794  134.90623 0.366 44.23881 ? 8   GLU A CD  1 
ATOM   60   O  OE1 A GLU A 1 8   ? 19.08597 17.14281  134.98119 0.634 36.25009 ? 8   GLU A OE1 1 
ATOM   61   O  OE1 B GLU A 1 8   ? 20.79482 13.39188  135.85863 0.366 46.83574 ? 8   GLU A OE1 1 
ATOM   62   O  OE2 A GLU A 1 8   ? 21.05108 17.65328  135.79520 0.634 46.52349 ? 8   GLU A OE2 1 
ATOM   63   O  OE2 B GLU A 1 8   ? 22.68806 12.67018  135.01822 0.366 47.30982 ? 8   GLU A OE2 1 
ATOM   64   N  N   . ASP A 1 9   ? 17.73407 14.30017  131.12781 1.000 23.73060 ? 9   ASP A N   1 
ATOM   65   C  CA  . ASP A 1 9   ? 17.11016 13.31770  130.23853 1.000 21.65906 ? 9   ASP A CA  1 
ATOM   66   C  C   . ASP A 1 9   ? 17.37606 13.57631  128.75420 1.000 19.96502 ? 9   ASP A C   1 
ATOM   67   O  O   . ASP A 1 9   ? 17.01992 12.73396  127.92252 1.000 21.47851 ? 9   ASP A O   1 
ATOM   68   C  CB  . ASP A 1 9   ? 15.60503 13.26707  130.49588 1.000 21.60274 ? 9   ASP A CB  1 
ATOM   69   C  CG  . ASP A 1 9   ? 15.26459 12.74248  131.87913 1.000 24.03693 ? 9   ASP A CG  1 
ATOM   70   O  OD1 . ASP A 1 9   ? 15.88211 11.75195  132.31603 1.000 27.72634 ? 9   ASP A OD1 1 
ATOM   71   O  OD2 . ASP A 1 9   ? 14.36773 13.31820  132.52602 1.000 24.93295 ? 9   ASP A OD2 1 
ATOM   72   N  N   . ARG A 1 10  ? 17.95512 14.72133  128.40433 1.000 17.97217 ? 10  ARG A N   1 
ATOM   73   C  CA  . ARG A 1 10  ? 18.38883 15.03138  127.03744 1.000 17.58079 ? 10  ARG A CA  1 
ATOM   74   C  C   . ARG A 1 10  ? 17.23173 15.11494  126.03884 1.000 15.62711 ? 10  ARG A C   1 
ATOM   75   O  O   . ARG A 1 10  ? 17.39912 14.80896  124.85890 1.000 16.24112 ? 10  ARG A O   1 
ATOM   76   C  CB  . ARG A 1 10  ? 19.48552 14.08922  126.51699 1.000 22.56468 ? 10  ARG A CB  1 
ATOM   77   C  CG  . ARG A 1 10  ? 20.80464 14.10976  127.27573 1.000 31.22964 ? 10  ARG A CG  1 
ATOM   78   C  CD  . ARG A 1 10  ? 21.99421 13.84602  126.33715 1.000 40.20471 ? 10  ARG A CD  1 
ATOM   79   N  NE  . ARG A 1 10  ? 22.27921 14.99599  125.47552 1.000 48.34611 ? 10  ARG A NE  1 
ATOM   80   C  CZ  . ARG A 1 10  ? 23.12078 14.97848  124.44409 1.000 46.18795 ? 10  ARG A CZ  1 
ATOM   81   N  NH1 . ARG A 1 10  ? 23.76490 13.86346  124.12676 1.000 43.88805 ? 10  ARG A NH1 1 
ATOM   82   N  NH2 . ARG A 1 10  ? 23.31671 16.07713  123.72423 1.000 48.58888 ? 10  ARG A NH2 1 
ATOM   83   N  N   . PHE A 1 11  ? 16.06489 15.56915  126.48989 1.000 14.32127 ? 11  PHE A N   1 
ATOM   84   C  CA  . PHE A 1 11  ? 14.93676 15.75171  125.58357 1.000 13.51494 ? 11  PHE A CA  1 
ATOM   85   C  C   . PHE A 1 11  ? 15.08389 17.06689  124.82213 1.000 13.15998 ? 11  PHE A C   1 
ATOM   86   O  O   . PHE A 1 11  ? 15.29012 18.12919  125.42030 1.000 14.80997 ? 11  PHE A O   1 
ATOM   87   C  CB  . PHE A 1 11  ? 13.62442 15.76809  126.36373 1.000 14.09988 ? 11  PHE A CB  1 
ATOM   88   C  CG  . PHE A 1 11  ? 13.26165 14.45330  126.99831 1.000 14.15802 ? 11  PHE A CG  1 
ATOM   89   C  CD1 . PHE A 1 11  ? 13.21671 13.29163  126.24883 1.000 14.61406 ? 11  PHE A CD1 1 
ATOM   90   C  CD2 . PHE A 1 11  ? 12.94518 14.38286  128.34808 1.000 15.16610 ? 11  PHE A CD2 1 
ATOM   91   C  CE1 . PHE A 1 11  ? 12.86384 12.08348  126.82483 1.000 15.66331 ? 11  PHE A CE1 1 
ATOM   92   C  CE2 . PHE A 1 11  ? 12.58404 13.18077  128.92926 1.000 16.30508 ? 11  PHE A CE2 1 
ATOM   93   C  CZ  . PHE A 1 11  ? 12.54811 12.02702  128.16878 1.000 16.06241 ? 11  PHE A CZ  1 
ATOM   94   N  N   . THR A 1 12  ? 14.96385 16.99771  123.50020 1.000 12.43463 ? 12  THR A N   1 
ATOM   95   C  CA  . THR A 1 12  ? 15.09728 18.17702  122.66475 1.000 12.49687 ? 12  THR A CA  1 
ATOM   96   C  C   . THR A 1 12  ? 13.92650 18.24996  121.69550 1.000 11.90325 ? 12  THR A C   1 
ATOM   97   O  O   . THR A 1 12  ? 13.26362 17.24902  121.40558 1.000 12.30754 ? 12  THR A O   1 
ATOM   98   C  CB  . THR A 1 12  ? 16.42314 18.19125  121.89735 1.000 13.49837 ? 12  THR A CB  1 
ATOM   99   O  OG1 . THR A 1 12  ? 16.46318 17.06254  121.02928 1.000 14.36190 ? 12  THR A OG1 1 
ATOM   100  C  CG2 . THR A 1 12  ? 17.61945 18.14322  122.85290 1.000 14.90472 ? 12  THR A CG2 1 
ATOM   101  N  N   . PHE A 1 13  ? 13.67509 19.45928  121.19473 1.000 11.87604 ? 13  PHE A N   1 
ATOM   102  C  CA  . PHE A 1 13  ? 12.54482 19.73058  120.31703 1.000 11.89349 ? 13  PHE A CA  1 
ATOM   103  C  C   . PHE A 1 13  ? 12.97534 20.68539  119.21813 1.000 12.44971 ? 13  PHE A C   1 
ATOM   104  O  O   . PHE A 1 13  ? 13.68566 21.65247  119.48384 1.000 13.71621 ? 13  PHE A O   1 
ATOM   105  C  CB  . PHE A 1 13  ? 11.40665 20.43444  121.06820 1.000 13.05218 ? 13  PHE A CB  1 
ATOM   106  C  CG  . PHE A 1 13  ? 10.70406 19.57947  122.08507 1.000 13.31481 ? 13  PHE A CG  1 
ATOM   107  C  CD1 . PHE A 1 13  ? 11.20680 19.43913  123.36686 1.000 14.23397 ? 13  PHE A CD1 1 
ATOM   108  C  CD2 . PHE A 1 13  ? 9.52229  18.93527  121.75673 1.000 14.44566 ? 13  PHE A CD2 1 
ATOM   109  C  CE1 . PHE A 1 13  ? 10.54561 18.66263  124.29497 1.000 15.48637 ? 13  PHE A CE1 1 
ATOM   110  C  CE2 . PHE A 1 13  ? 8.85562  18.15897  122.68223 1.000 15.45174 ? 13  PHE A CE2 1 
ATOM   111  C  CZ  . PHE A 1 13  ? 9.36827  18.02489  123.95190 1.000 15.82165 ? 13  PHE A CZ  1 
ATOM   112  N  N   . GLY A 1 14  ? 12.48939 20.46832  118.00166 1.000 12.39599 ? 14  GLY A N   1 
ATOM   113  C  CA  . GLY A 1 14  ? 12.71446 21.44260  116.95302 1.000 12.67291 ? 14  GLY A CA  1 
ATOM   114  C  C   . GLY A 1 14  ? 11.86192 22.68128  117.14831 1.000 12.48411 ? 14  GLY A C   1 
ATOM   115  O  O   . GLY A 1 14  ? 10.72620 22.60964  117.61518 1.000 12.83703 ? 14  GLY A O   1 
ATOM   116  N  N   . LEU A 1 15  ? 12.39677 23.84206  116.75285 1.000 13.05971 ? 15  LEU A N   1 
ATOM   117  C  CA  . LEU A 1 15  ? 11.57973 25.05519  116.80044 1.000 13.73670 ? 15  LEU A CA  1 
ATOM   118  C  C   . LEU A 1 15  ? 10.31806 24.90060  115.96995 1.000 13.27892 ? 15  LEU A C   1 
ATOM   119  O  O   . LEU A 1 15  ? 9.27765  25.48016  116.29774 1.000 15.00099 ? 15  LEU A O   1 
ATOM   120  C  CB  . LEU A 1 15  ? 12.36526 26.25874  116.28169 1.000 15.48011 ? 15  LEU A CB  1 
ATOM   121  C  CG  . LEU A 1 15  ? 13.45921 26.79303  117.19135 1.000 18.52684 ? 15  LEU A CG  1 
ATOM   122  C  CD1 . LEU A 1 15  ? 14.18678 27.93169  116.49878 1.000 20.22439 ? 15  LEU A CD1 1 
ATOM   123  C  CD2 . LEU A 1 15  ? 12.84663 27.27880  118.50175 1.000 20.61377 ? 15  LEU A CD2 1 
ATOM   124  N  N   . TRP A 1 16  ? 10.39628 24.12893  114.89091 1.000 12.86347 ? 16  TRP A N   1 
ATOM   125  C  CA  . TRP A 1 16  ? 9.30135  23.96290  113.94792 1.000 12.78469 ? 16  TRP A CA  1 
ATOM   126  C  C   . TRP A 1 16  ? 8.21744  23.02355  114.45509 1.000 12.96723 ? 16  TRP A C   1 
ATOM   127  O  O   . TRP A 1 16  ? 7.19584  22.86430  113.77266 1.000 14.51801 ? 16  TRP A O   1 
ATOM   128  C  CB  . TRP A 1 16  ? 9.86726  23.43160  112.62626 1.000 13.58104 ? 16  TRP A CB  1 
ATOM   129  C  CG  . TRP A 1 16  ? 10.37081 22.02233  112.73194 1.000 13.03892 ? 16  TRP A CG  1 
ATOM   130  C  CD1 . TRP A 1 16  ? 9.63758  20.88823  112.53868 1.000 13.98595 ? 16  TRP A CD1 1 
ATOM   131  C  CD2 . TRP A 1 16  ? 11.69547 21.58846  113.07371 1.000 13.22704 ? 16  TRP A CD2 1 
ATOM   132  N  NE1 . TRP A 1 16  ? 10.41940 19.77902  112.72084 1.000 14.47277 ? 16  TRP A NE1 1 
ATOM   133  C  CE2 . TRP A 1 16  ? 11.68558 20.18043  113.05430 1.000 13.77441 ? 16  TRP A CE2 1 
ATOM   134  C  CE3 . TRP A 1 16  ? 12.88947 22.25196  113.38636 1.000 13.69299 ? 16  TRP A CE3 1 
ATOM   135  C  CZ2 . TRP A 1 16  ? 12.81637 19.42318  113.33380 1.000 14.34286 ? 16  TRP A CZ2 1 
ATOM   136  C  CZ3 . TRP A 1 16  ? 14.01574 21.49141  113.65977 1.000 14.27729 ? 16  TRP A CZ3 1 
ATOM   137  C  CH2 . TRP A 1 16  ? 13.96913 20.09696  113.63689 1.000 14.59031 ? 16  TRP A CH2 1 
ATOM   138  N  N   . THR A 1 17  ? 8.42897  22.38558  115.61129 1.000 12.27250 ? 17  THR A N   1 
ATOM   139  C  CA  . THR A 1 17  ? 7.47862  21.41035  116.14204 1.000 12.32767 ? 17  THR A CA  1 
ATOM   140  C  C   . THR A 1 17  ? 6.37461  22.13412  116.90367 1.000 12.75815 ? 17  THR A C   1 
ATOM   141  O  O   . THR A 1 17  ? 5.25503  22.29916  116.40526 1.000 13.49919 ? 17  THR A O   1 
ATOM   142  C  CB  . THR A 1 17  ? 8.20331  20.34431  116.99028 1.000 12.85833 ? 17  THR A CB  1 
ATOM   143  O  OG1 . THR A 1 17  ? 8.77580  20.90193  118.18999 1.000 13.09886 ? 17  THR A OG1 1 
ATOM   144  C  CG2 . THR A 1 17  ? 9.30111  19.64991  116.18204 1.000 13.71329 ? 17  THR A CG2 1 
ATOM   145  N  N   . VAL A 1 18  ? 6.71189  22.64849  118.08767 1.000 13.32433 ? 18  VAL A N   1 
ATOM   146  C  CA  . VAL A 1 18  ? 5.77140  23.45850  118.84691 1.000 14.21328 ? 18  VAL A CA  1 
ATOM   147  C  C   . VAL A 1 18  ? 5.39969  24.71972  118.08508 1.000 14.35962 ? 18  VAL A C   1 
ATOM   148  O  O   . VAL A 1 18  ? 4.33684  25.30110  118.32550 1.000 16.47380 ? 18  VAL A O   1 
ATOM   149  C  CB  . VAL A 1 18  ? 6.33509  23.77321  120.24838 1.000 15.54030 ? 18  VAL A CB  1 
ATOM   150  C  CG1 . VAL A 1 18  ? 6.47030  22.48855  121.06063 1.000 17.09803 ? 18  VAL A CG1 1 
ATOM   151  C  CG2 . VAL A 1 18  ? 7.67050  24.52208  120.15603 1.000 16.80254 ? 18  VAL A CG2 1 
ATOM   152  N  N   . GLY A 1 19  ? 6.26166  25.17158  117.16896 1.000 13.68693 ? 19  GLY A N   1 
ATOM   153  C  CA  . GLY A 1 19  ? 5.95498  26.33051  116.35087 1.000 14.52353 ? 19  GLY A CA  1 
ATOM   154  C  C   . GLY A 1 19  ? 5.11267  26.08364  115.11744 1.000 14.98554 ? 19  GLY A C   1 
ATOM   155  O  O   . GLY A 1 19  ? 4.83784  27.03560  114.38173 1.000 17.20308 ? 19  GLY A O   1 
ATOM   156  N  N   . TRP A 1 20  ? 4.69161  24.84942  114.85505 1.000 14.07874 ? 20  TRP A N   1 
ATOM   157  C  CA  . TRP A 1 20  ? 3.89688  24.58187  113.66402 1.000 13.95205 ? 20  TRP A CA  1 
ATOM   158  C  C   . TRP A 1 20  ? 2.55436  25.29231  113.76302 1.000 14.23022 ? 20  TRP A C   1 
ATOM   159  O  O   . TRP A 1 20  ? 1.80030  25.09151  114.71704 1.000 14.91758 ? 20  TRP A O   1 
ATOM   160  C  CB  . TRP A 1 20  ? 3.67997  23.08010  113.51502 1.000 14.35537 ? 20  TRP A CB  1 
ATOM   161  C  CG  . TRP A 1 20  ? 2.93925  22.71074  112.25372 1.000 14.76723 ? 20  TRP A CG  1 
ATOM   162  C  CD1 . TRP A 1 20  ? 3.31181  22.98713  110.96827 1.000 17.07545 ? 20  TRP A CD1 1 
ATOM   163  C  CD2 . TRP A 1 20  ? 1.71792  21.96743  112.16323 1.000 14.03867 ? 20  TRP A CD2 1 
ATOM   164  N  NE1 . TRP A 1 20  ? 2.39368  22.47170  110.08905 1.000 18.00277 ? 20  TRP A NE1 1 
ATOM   165  C  CE2 . TRP A 1 20  ? 1.40637  21.83887  110.79630 1.000 15.85715 ? 20  TRP A CE2 1 
ATOM   166  C  CE3 . TRP A 1 20  ? 0.85949  21.39817  113.10835 1.000 14.15915 ? 20  TRP A CE3 1 
ATOM   167  C  CZ2 . TRP A 1 20  ? 0.27559  21.17003  110.35290 1.000 16.35010 ? 20  TRP A CZ2 1 
ATOM   168  C  CZ3 . TRP A 1 20  ? -0.25881 20.73199  112.66895 1.000 14.84828 ? 20  TRP A CZ3 1 
ATOM   169  C  CH2 . TRP A 1 20  ? -0.54484 20.62324  111.30010 1.000 15.90999 ? 20  TRP A CH2 1 
ATOM   170  N  N   . GLN A 1 21  ? 2.24387  26.10982  112.75825 1.000 14.57537 ? 21  GLN A N   1 
ATOM   171  C  CA  . GLN A 1 21  ? 1.03894  26.92971  112.79647 1.000 15.64760 ? 21  GLN A CA  1 
ATOM   172  C  C   . GLN A 1 21  ? -0.22360 26.19002  112.37568 1.000 15.48754 ? 21  GLN A C   1 
ATOM   173  O  O   . GLN A 1 21  ? -1.31557 26.75728  112.48847 1.000 16.70875 ? 21  GLN A O   1 
ATOM   174  C  CB  . GLN A 1 21  ? 1.21736  28.16085  111.91297 1.000 17.68827 ? 21  GLN A CB  1 
ATOM   175  C  CG  . GLN A 1 21  ? 2.19885  29.17495  112.44975 1.000 20.34870 ? 21  GLN A CG  1 
ATOM   176  C  CD  . GLN A 1 21  ? 2.18934  30.43851  111.62762 1.000 25.96209 ? 21  GLN A CD  1 
ATOM   177  O  OE1 . GLN A 1 21  ? 3.10599  30.68838  110.85206 1.000 31.35806 ? 21  GLN A OE1 1 
ATOM   178  N  NE2 . GLN A 1 21  ? 1.13103  31.23008  111.76789 1.000 27.08499 ? 21  GLN A NE2 1 
ATOM   179  N  N   . GLY A 1 22  ? -0.11349 24.96231  111.88633 1.000 15.39871 ? 22  GLY A N   1 
ATOM   180  C  CA  . GLY A 1 22  ? -1.28994 24.18811  111.55831 1.000 15.99560 ? 22  GLY A CA  1 
ATOM   181  C  C   . GLY A 1 22  ? -1.73973 24.23393  110.11476 1.000 17.66759 ? 22  GLY A C   1 
ATOM   182  O  O   . GLY A 1 22  ? -2.83439 23.74908  109.81793 1.000 18.01892 ? 22  GLY A O   1 
ATOM   183  N  N   A ARG A 1 23  ? -0.93986 24.79125  109.20554 0.562 18.93484 ? 23  ARG A N   1 
ATOM   184  N  N   B ARG A 1 23  ? -0.94067 24.80152  109.21576 0.438 18.98693 ? 23  ARG A N   1 
ATOM   185  C  CA  A ARG A 1 23  ? -1.28059 24.77197  107.78554 0.562 21.98954 ? 23  ARG A CA  1 
ATOM   186  C  CA  B ARG A 1 23  ? -1.25789 24.73170  107.79729 0.438 20.98846 ? 23  ARG A CA  1 
ATOM   187  C  C   A ARG A 1 23  ? -1.00637 23.37248  107.23931 0.562 22.98878 ? 23  ARG A C   1 
ATOM   188  C  C   B ARG A 1 23  ? -1.02191 23.31335  107.29964 0.438 20.79308 ? 23  ARG A C   1 
ATOM   189  O  O   A ARG A 1 23  ? 0.10205  22.84866  107.39075 0.562 26.72154 ? 23  ARG A O   1 
ATOM   190  O  O   B ARG A 1 23  ? 0.03968  22.72715  107.53491 0.438 22.17472 ? 23  ARG A O   1 
ATOM   191  C  CB  A ARG A 1 23  ? -0.47239 25.82847  107.02397 0.562 28.02717 ? 23  ARG A CB  1 
ATOM   192  C  CB  B ARG A 1 23  ? -0.39799 25.71382  107.00314 0.438 24.78075 ? 23  ARG A CB  1 
ATOM   193  C  CG  A ARG A 1 23  ? -1.14299 26.27110  105.72526 0.562 35.90155 ? 23  ARG A CG  1 
ATOM   194  C  CG  B ARG A 1 23  ? -0.90935 25.92818  105.58601 0.438 28.37391 ? 23  ARG A CG  1 
ATOM   195  C  CD  A ARG A 1 23  ? -0.46770 27.44036  104.98938 0.562 43.36903 ? 23  ARG A CD  1 
ATOM   196  C  CD  B ARG A 1 23  ? -0.11438 26.97615  104.81890 0.438 31.18443 ? 23  ARG A CD  1 
ATOM   197  N  NE  A ARG A 1 23  ? 0.06438  28.50951  105.83296 0.562 48.23080 ? 23  ARG A NE  1 
ATOM   198  N  NE  B ARG A 1 23  ? 1.25557  26.56525  104.51450 0.438 34.08195 ? 23  ARG A NE  1 
ATOM   199  C  CZ  A ARG A 1 23  ? -0.66699 29.50177  106.33274 0.562 45.89046 ? 23  ARG A CZ  1 
ATOM   200  C  CZ  B ARG A 1 23  ? 1.58536  25.57911  103.68401 0.438 34.84322 ? 23  ARG A CZ  1 
ATOM   201  N  NH1 A ARG A 1 23  ? -1.97455 29.54417  106.10239 0.562 36.97828 ? 23  ARG A NH1 1 
ATOM   202  N  NH1 B ARG A 1 23  ? 0.64505  24.87611  103.06657 0.438 38.11067 ? 23  ARG A NH1 1 
ATOM   203  N  NH2 A ARG A 1 23  ? -0.09652 30.44389  107.07444 0.562 50.73327 ? 23  ARG A NH2 1 
ATOM   204  N  NH2 B ARG A 1 23  ? 2.86324  25.29360  103.46955 0.438 32.18604 ? 23  ARG A NH2 1 
ATOM   205  N  N   . ASP A 1 24  ? -2.01945 22.75305  106.63506 1.000 21.15861 ? 24  ASP A N   1 
ATOM   206  C  CA  . ASP A 1 24  ? -1.87838 21.41663  106.06779 1.000 22.29518 ? 24  ASP A CA  1 
ATOM   207  C  C   . ASP A 1 24  ? -2.28578 21.51762  104.59084 1.000 27.11154 ? 24  ASP A C   1 
ATOM   208  O  O   . ASP A 1 24  ? -2.59565 22.63180  104.14929 1.000 26.72892 ? 24  ASP A O   1 
ATOM   209  C  CB  . ASP A 1 24  ? -2.58362 20.38629  106.97005 1.000 20.24554 ? 24  ASP A CB  1 
ATOM   210  C  CG  . ASP A 1 24  ? -4.09747 20.45793  106.92958 1.000 18.09949 ? 24  ASP A CG  1 
ATOM   211  O  OD1 . ASP A 1 24  ? -4.69960 20.98447  105.96880 1.000 19.03567 ? 24  ASP A OD1 1 
ATOM   212  O  OD2 . ASP A 1 24  ? -4.69318 19.93149  107.88866 1.000 17.84205 ? 24  ASP A OD2 1 
ATOM   213  N  N   A PRO A 1 25  ? -2.23024 20.46034  103.77328 0.526 35.64507 ? 25  PRO A N   1 
ATOM   214  N  N   B PRO A 1 25  ? -2.31921 20.41891  103.81230 0.474 26.81821 ? 25  PRO A N   1 
ATOM   215  C  CA  A PRO A 1 25  ? -2.55752 20.65107  102.34754 0.526 37.31446 ? 25  PRO A CA  1 
ATOM   216  C  CA  B PRO A 1 25  ? -2.58763 20.56031  102.37006 0.474 28.48571 ? 25  PRO A CA  1 
ATOM   217  C  C   A PRO A 1 25  ? -3.95518 21.19255  102.08749 0.526 29.52060 ? 25  PRO A C   1 
ATOM   218  C  C   B PRO A 1 25  ? -3.98257 21.05167  102.05886 0.474 26.62888 ? 25  PRO A C   1 
ATOM   219  O  O   A PRO A 1 25  ? -4.18725 21.76258  101.01168 0.526 26.66105 ? 25  PRO A O   1 
ATOM   220  O  O   B PRO A 1 25  ? -4.25182 21.40308  100.90199 0.474 28.14089 ? 25  PRO A O   1 
ATOM   221  C  CB  A PRO A 1 25  ? -2.35314 19.25682  101.74142 0.526 42.42691 ? 25  PRO A CB  1 
ATOM   222  C  CB  B PRO A 1 25  ? -2.39458 19.14074  101.81295 0.474 30.86600 ? 25  PRO A CB  1 
ATOM   223  C  CG  A PRO A 1 25  ? -1.32627 18.63752  102.61523 0.526 41.75134 ? 25  PRO A CG  1 
ATOM   224  C  CG  B PRO A 1 25  ? -2.28306 18.22869  102.96349 0.474 26.66548 ? 25  PRO A CG  1 
ATOM   225  C  CD  A PRO A 1 25  ? -1.64685 19.12649  104.00817 0.526 39.72042 ? 25  PRO A CD  1 
ATOM   226  C  CD  B PRO A 1 25  ? -2.28143 18.99832  104.22495 0.474 25.81720 ? 25  PRO A CD  1 
ATOM   227  N  N   . PHE A 1 26  ? -4.87719 21.07124  103.04497 1.000 23.62808 ? 26  PHE A N   1 
ATOM   228  C  CA  . PHE A 1 26  ? -6.27196 21.41380  102.82788 1.000 19.18367 ? 26  PHE A CA  1 
ATOM   229  C  C   . PHE A 1 26  ? -6.76095 22.53586  103.72938 1.000 18.41308 ? 26  PHE A C   1 
ATOM   230  O  O   . PHE A 1 26  ? -7.96871 22.77460  103.78933 1.000 21.31057 ? 26  PHE A O   1 
ATOM   231  C  CB  . PHE A 1 26  ? -7.13886 20.16821  103.02817 1.000 22.09725 ? 26  PHE A CB  1 
ATOM   232  C  CG  . PHE A 1 26  ? -6.76490 19.03430  102.12255 1.000 28.02552 ? 26  PHE A CG  1 
ATOM   233  C  CD1 . PHE A 1 26  ? -7.28034 18.96081  100.83794 1.000 31.20562 ? 26  PHE A CD1 1 
ATOM   234  C  CD2 . PHE A 1 26  ? -5.85951 18.07045  102.53393 1.000 34.17442 ? 26  PHE A CD2 1 
ATOM   235  C  CE1 . PHE A 1 26  ? -6.92680 17.92588  99.98919  1.000 35.17295 ? 26  PHE A CE1 1 
ATOM   236  C  CE2 . PHE A 1 26  ? -5.49378 17.04035  101.68751 1.000 36.80331 ? 26  PHE A CE2 1 
ATOM   237  C  CZ  . PHE A 1 26  ? -6.03315 16.96598  100.41580 1.000 36.37671 ? 26  PHE A CZ  1 
ATOM   238  N  N   . GLY A 1 27  ? -5.87541 23.22813  104.43488 1.000 18.27000 ? 27  GLY A N   1 
ATOM   239  C  CA  . GLY A 1 27  ? -6.36270 24.16304  105.42907 1.000 19.76229 ? 27  GLY A CA  1 
ATOM   240  C  C   . GLY A 1 27  ? -5.34733 25.20811  105.81735 1.000 19.08197 ? 27  GLY A C   1 
ATOM   241  O  O   . GLY A 1 27  ? -4.13287 24.99011  105.75257 1.000 20.43037 ? 27  GLY A O   1 
ATOM   242  N  N   . ASP A 1 28  ? -5.87127 26.34673  106.25535 1.000 18.09794 ? 28  ASP A N   1 
ATOM   243  C  CA  . ASP A 1 28  ? -5.03907 27.45605  106.68239 1.000 18.86755 ? 28  ASP A CA  1 
ATOM   244  C  C   . ASP A 1 28  ? -4.55424 27.26375  108.12223 1.000 17.82263 ? 28  ASP A C   1 
ATOM   245  O  O   . ASP A 1 28  ? -5.00250 26.37897  108.85338 1.000 17.66652 ? 28  ASP A O   1 
ATOM   246  C  CB  . ASP A 1 28  ? -5.80496 28.76716  106.54166 1.000 23.04000 ? 28  ASP A CB  1 
ATOM   247  C  CG  . ASP A 1 28  ? -6.07500 29.12988  105.09109 1.000 30.70283 ? 28  ASP A CG  1 
ATOM   248  O  OD1 . ASP A 1 28  ? -5.33809 28.65552  104.20211 1.000 34.45838 ? 28  ASP A OD1 1 
ATOM   249  O  OD2 . ASP A 1 28  ? -7.02772 29.88791  104.83679 1.000 36.01581 ? 28  ASP A OD2 1 
ATOM   250  N  N   . ALA A 1 29  ? -3.61839 28.12012  108.52508 1.000 17.92546 ? 29  ALA A N   1 
ATOM   251  C  CA  . ALA A 1 29  ? -3.05927 28.05456  109.86793 1.000 17.27450 ? 29  ALA A CA  1 
ATOM   252  C  C   . ALA A 1 29  ? -4.14404 28.27323  110.91304 1.000 16.49440 ? 29  ALA A C   1 
ATOM   253  O  O   . ALA A 1 29  ? -5.04629 29.09514  110.73510 1.000 18.86742 ? 29  ALA A O   1 
ATOM   254  C  CB  . ALA A 1 29  ? -1.98507 29.13034  110.02068 1.000 19.13955 ? 29  ALA A CB  1 
ATOM   255  N  N   . THR A 1 30  ? -4.04642 27.53540  112.01809 1.000 15.29749 ? 30  THR A N   1 
ATOM   256  C  CA  . THR A 1 30  ? -4.96853 27.69480  113.13365 1.000 15.37728 ? 30  THR A CA  1 
ATOM   257  C  C   . THR A 1 30  ? -4.32984 28.35484  114.34370 1.000 16.26331 ? 30  THR A C   1 
ATOM   258  O  O   . THR A 1 30  ? -5.03793 28.64299  115.31444 1.000 18.04778 ? 30  THR A O   1 
ATOM   259  C  CB  . THR A 1 30  ? -5.53860 26.33950  113.56712 1.000 15.63979 ? 30  THR A CB  1 
ATOM   260  O  OG1 . THR A 1 30  ? -4.46676 25.52011  114.04051 1.000 15.60095 ? 30  THR A OG1 1 
ATOM   261  C  CG2 . THR A 1 30  ? -6.24285 25.64315  112.40306 1.000 16.99724 ? 30  THR A CG2 1 
ATOM   262  N  N   . ARG A 1 31  ? -3.01779 28.58298  114.31951 1.000 15.74582 ? 31  ARG A N   1 
ATOM   263  C  CA  . ARG A 1 31  ? -2.30193 29.20420  115.41988 1.000 15.98566 ? 31  ARG A CA  1 
ATOM   264  C  C   . ARG A 1 31  ? -1.38098 30.28525  114.87960 1.000 17.85790 ? 31  ARG A C   1 
ATOM   265  O  O   . ARG A 1 31  ? -0.87528 30.19309  113.75748 1.000 19.01798 ? 31  ARG A O   1 
ATOM   266  C  CB  . ARG A 1 31  ? -1.46612 28.17278  116.18886 1.000 15.66148 ? 31  ARG A CB  1 
ATOM   267  C  CG  . ARG A 1 31  ? -2.30849 27.16436  116.95059 1.000 15.34061 ? 31  ARG A CG  1 
ATOM   268  C  CD  . ARG A 1 31  ? -1.47582 26.25045  117.82438 1.000 14.95022 ? 31  ARG A CD  1 
ATOM   269  N  NE  . ARG A 1 31  ? -0.59695 25.35821  117.07095 1.000 14.34896 ? 31  ARG A NE  1 
ATOM   270  C  CZ  . ARG A 1 31  ? -0.88698 24.09633  116.76611 1.000 14.48989 ? 31  ARG A CZ  1 
ATOM   271  N  NH1 . ARG A 1 31  ? -2.05284 23.55851  117.11386 1.000 14.62368 ? 31  ARG A NH1 1 
ATOM   272  N  NH2 . ARG A 1 31  ? -0.00719 23.36049  116.10444 1.000 16.38893 ? 31  ARG A NH2 1 
ATOM   273  N  N   . ARG A 1 32  ? -1.15687 31.30812  115.70132 1.000 19.56760 ? 32  ARG A N   1 
ATOM   274  C  CA  A ARG A 1 32  ? -0.21751 32.36867  115.36555 0.680 21.68759 ? 32  ARG A CA  1 
ATOM   275  C  CA  B ARG A 1 32  ? -0.22135 32.35559  115.33105 0.320 21.62423 ? 32  ARG A CA  1 
ATOM   276  C  C   . ARG A 1 32  ? 1.21471  31.84500  115.42981 1.000 20.82633 ? 32  ARG A C   1 
ATOM   277  O  O   . ARG A 1 32  ? 1.50766  30.83278  116.07235 1.000 20.28029 ? 32  ARG A O   1 
ATOM   278  C  CB  A ARG A 1 32  ? -0.35366 33.53635  116.34629 0.680 25.99938 ? 32  ARG A CB  1 
ATOM   279  C  CB  B ARG A 1 32  ? -0.41033 33.58148  116.22498 0.320 25.27768 ? 32  ARG A CB  1 
ATOM   280  C  CG  A ARG A 1 32  ? 0.21308  33.24313  117.72778 0.680 29.81395 ? 32  ARG A CG  1 
ATOM   281  C  CG  B ARG A 1 32  ? -1.78736 34.21779  116.10077 0.320 28.62847 ? 32  ARG A CG  1 
ATOM   282  C  CD  A ARG A 1 32  ? 0.44995  34.50856  118.53597 0.680 33.50643 ? 32  ARG A CD  1 
ATOM   283  C  CD  B ARG A 1 32  ? -1.75019 35.70667  116.40216 0.320 34.43803 ? 32  ARG A CD  1 
ATOM   284  N  NE  A ARG A 1 32  ? 0.79731  34.22165  119.92791 0.680 35.26074 ? 32  ARG A NE  1 
ATOM   285  N  NE  B ARG A 1 32  ? -1.56541 35.97850  117.82457 0.320 40.80970 ? 32  ARG A NE  1 
ATOM   286  C  CZ  A ARG A 1 32  ? 2.03821  34.04194  120.37485 0.680 34.52694 ? 32  ARG A CZ  1 
ATOM   287  C  CZ  B ARG A 1 32  ? -2.55945 36.23828  118.66762 0.320 45.50065 ? 32  ARG A CZ  1 
ATOM   288  N  NH1 A ARG A 1 32  ? 3.06397  34.11736  119.53998 0.680 31.82577 ? 32  ARG A NH1 1 
ATOM   289  N  NH1 B ARG A 1 32  ? -3.81210 36.25793  118.23193 0.320 47.73172 ? 32  ARG A NH1 1 
ATOM   290  N  NH2 A ARG A 1 32  ? 2.25656  33.78903  121.66037 0.680 37.09268 ? 32  ARG A NH2 1 
ATOM   291  N  NH2 B ARG A 1 32  ? -2.30233 36.47698  119.94621 0.320 47.38089 ? 32  ARG A NH2 1 
ATOM   292  N  N   . ALA A 1 33  ? 2.11703  32.55957  114.76587 1.000 21.62547 ? 33  ALA A N   1 
ATOM   293  C  CA  . ALA A 1 33  ? 3.52526  32.19741  114.80720 1.000 22.49550 ? 33  ALA A CA  1 
ATOM   294  C  C   . ALA A 1 33  ? 4.08991  32.43721  116.20059 1.000 21.78253 ? 33  ALA A C   1 
ATOM   295  O  O   . ALA A 1 33  ? 3.71964  33.39231  116.88953 1.000 25.16914 ? 33  ALA A O   1 
ATOM   296  C  CB  . ALA A 1 33  ? 4.31106  33.01178  113.78034 1.000 25.11713 ? 33  ALA A CB  1 
ATOM   297  N  N   . LEU A 1 34  ? 4.98277  31.55239  116.61882 1.000 20.04234 ? 34  LEU A N   1 
ATOM   298  C  CA  . LEU A 1 34  ? 5.68775  31.69401  117.88204 1.000 20.78097 ? 34  LEU A CA  1 
ATOM   299  C  C   . LEU A 1 34  ? 7.04695  32.32846  117.64675 1.000 20.59898 ? 34  LEU A C   1 
ATOM   300  O  O   . LEU A 1 34  ? 7.76367  31.96366  116.71138 1.000 22.39599 ? 34  LEU A O   1 
ATOM   301  C  CB  . LEU A 1 34  ? 5.92119  30.32928  118.52677 1.000 23.96345 ? 34  LEU A CB  1 
ATOM   302  C  CG  . LEU A 1 34  ? 4.79236  29.66953  119.30765 1.000 28.05034 ? 34  LEU A CG  1 
ATOM   303  C  CD1 . LEU A 1 34  ? 5.26250  28.31272  119.80947 1.000 27.34338 ? 34  LEU A CD1 1 
ATOM   304  C  CD2 . LEU A 1 34  ? 4.36255  30.55331  120.46613 1.000 33.18940 ? 34  LEU A CD2 1 
ATOM   305  N  N   . ASP A 1 35  ? 7.40080  33.26771  118.50379 1.000 20.78662 ? 35  ASP A N   1 
ATOM   306  C  CA  A ASP A 1 35  ? 8.76063  33.80050  118.53099 0.752 21.59264 ? 35  ASP A CA  1 
ATOM   307  C  CA  B ASP A 1 35  ? 8.75810  33.77170  118.48264 0.248 21.28585 ? 35  ASP A CA  1 
ATOM   308  C  C   . ASP A 1 35  ? 9.68596  32.70413  119.04946 1.000 20.51062 ? 35  ASP A C   1 
ATOM   309  O  O   . ASP A 1 35  ? 9.38019  32.10130  120.08501 1.000 20.36870 ? 35  ASP A O   1 
ATOM   310  C  CB  A ASP A 1 35  ? 8.74266  34.97447  119.51747 0.752 24.73299 ? 35  ASP A CB  1 
ATOM   311  C  CB  B ASP A 1 35  ? 8.89902  35.07586  119.25888 0.248 23.43252 ? 35  ASP A CB  1 
ATOM   312  C  CG  A ASP A 1 35  ? 10.06924 35.72347  119.60909 0.752 28.24207 ? 35  ASP A CG  1 
ATOM   313  C  CG  B ASP A 1 35  ? 10.27434 35.69441  119.09521 0.248 26.27087 ? 35  ASP A CG  1 
ATOM   314  O  OD1 A ASP A 1 35  ? 11.14049 35.17210  119.28701 0.752 24.95545 ? 35  ASP A OD1 1 
ATOM   315  O  OD1 B ASP A 1 35  ? 10.53449 36.31200  118.04038 0.248 26.97855 ? 35  ASP A OD1 1 
ATOM   316  O  OD2 A ASP A 1 35  ? 10.03541 36.89544  120.03533 0.752 35.08511 ? 35  ASP A OD2 1 
ATOM   317  O  OD2 B ASP A 1 35  ? 11.10216 35.55164  120.01495 0.248 28.72472 ? 35  ASP A OD2 1 
ATOM   318  N  N   . PRO A 1 36  ? 10.80640 32.41389  118.37670 1.000 20.50155 ? 36  PRO A N   1 
ATOM   319  C  CA  . PRO A 1 36  ? 11.72825 31.38604  118.89541 1.000 20.49481 ? 36  PRO A CA  1 
ATOM   320  C  C   . PRO A 1 36  ? 12.13495 31.59366  120.34331 1.000 19.96316 ? 36  PRO A C   1 
ATOM   321  O  O   . PRO A 1 36  ? 12.34334 30.61353  121.06583 1.000 20.53629 ? 36  PRO A O   1 
ATOM   322  C  CB  . PRO A 1 36  ? 12.93062 31.48339  117.94663 1.000 22.82162 ? 36  PRO A CB  1 
ATOM   323  C  CG  . PRO A 1 36  ? 12.36367 32.01433  116.68218 1.000 24.22497 ? 36  PRO A CG  1 
ATOM   324  C  CD  . PRO A 1 36  ? 11.23896 32.94002  117.07046 1.000 22.64763 ? 36  PRO A CD  1 
ATOM   325  N  N   . VAL A 1 37  ? 12.25176 32.84750  120.78772 1.000 20.02321 ? 37  VAL A N   1 
ATOM   326  C  CA  . VAL A 1 37  ? 12.62902 33.11623  122.17247 1.000 21.65366 ? 37  VAL A CA  1 
ATOM   327  C  C   . VAL A 1 37  ? 11.56565 32.59920  123.13424 1.000 20.76285 ? 37  VAL A C   1 
ATOM   328  O  O   . VAL A 1 37  ? 11.88591 32.05085  124.19792 1.000 21.52339 ? 37  VAL A O   1 
ATOM   329  C  CB  . VAL A 1 37  ? 12.91961 34.61582  122.36723 1.000 24.89755 ? 37  VAL A CB  1 
ATOM   330  C  CG1 . VAL A 1 37  ? 12.99749 34.97015  123.85019 1.000 26.91098 ? 37  VAL A CG1 1 
ATOM   331  C  CG2 . VAL A 1 37  ? 14.19511 34.99747  121.64203 1.000 26.25014 ? 37  VAL A CG2 1 
ATOM   332  N  N   A GLU A 1 38  ? 10.28285 32.77604  122.78926 0.647 20.55525 ? 38  GLU A N   1 
ATOM   333  N  N   B GLU A 1 38  ? 10.28990 32.74385  122.77460 0.353 20.37184 ? 38  GLU A N   1 
ATOM   334  C  CA  A GLU A 1 38  ? 9.22796  32.25034  123.65129 0.647 21.79542 ? 38  GLU A CA  1 
ATOM   335  C  CA  B GLU A 1 38  ? 9.23838  32.26059  123.66193 0.353 21.72410 ? 38  GLU A CA  1 
ATOM   336  C  C   A GLU A 1 38  ? 9.27679  30.73128  123.70751 0.647 19.82390 ? 38  GLU A C   1 
ATOM   337  C  C   B GLU A 1 38  ? 9.17055  30.73699  123.68081 0.353 19.60495 ? 38  GLU A C   1 
ATOM   338  O  O   A GLU A 1 38  ? 9.11522  30.13982  124.78164 0.647 20.12483 ? 38  GLU A O   1 
ATOM   339  O  O   B GLU A 1 38  ? 8.83426  30.14860  124.71516 0.353 18.93222 ? 38  GLU A O   1 
ATOM   340  C  CB  A GLU A 1 38  ? 7.83754  32.72238  123.21344 0.647 26.14469 ? 38  GLU A CB  1 
ATOM   341  C  CB  B GLU A 1 38  ? 7.89622  32.89671  123.29931 0.353 26.13669 ? 38  GLU A CB  1 
ATOM   342  C  CG  A GLU A 1 38  ? 6.73855  32.11338  124.10288 0.647 30.08529 ? 38  GLU A CG  1 
ATOM   343  C  CG  B GLU A 1 38  ? 7.84929  34.40160  123.55277 0.353 31.07274 ? 38  GLU A CG  1 
ATOM   344  C  CD  A GLU A 1 38  ? 5.34268  32.65108  123.84750 0.647 35.76046 ? 38  GLU A CD  1 
ATOM   345  C  CD  B GLU A 1 38  ? 8.18550  34.76532  124.98969 0.353 36.72842 ? 38  GLU A CD  1 
ATOM   346  O  OE1 A GLU A 1 38  ? 5.16431  33.46971  122.92069 0.647 36.56629 ? 38  GLU A OE1 1 
ATOM   347  O  OE1 B GLU A 1 38  ? 7.62674  34.13154  125.91016 0.353 40.04738 ? 38  GLU A OE1 1 
ATOM   348  O  OE2 A GLU A 1 38  ? 4.42046  32.24941  124.59154 0.647 41.71292 ? 38  GLU A OE2 1 
ATOM   349  O  OE2 B GLU A 1 38  ? 9.00744  35.68365  125.19923 0.353 39.10632 ? 38  GLU A OE2 1 
ATOM   350  N  N   . SER A 1 39  ? 9.50127  30.08334  122.56160 1.000 18.76667 ? 39  SER A N   1 
ATOM   351  C  CA  . SER A 1 39  ? 9.56118  28.62490  122.54447 1.000 18.41574 ? 39  SER A CA  1 
ATOM   352  C  C   . SER A 1 39  ? 10.67732 28.10772  123.43889 1.000 17.11605 ? 39  SER A C   1 
ATOM   353  O  O   . SER A 1 39  ? 10.48286 27.13854  124.18130 1.000 18.13670 ? 39  SER A O   1 
ATOM   354  C  CB  . SER A 1 39  ? 9.75075  28.11999  121.11659 1.000 21.33534 ? 39  SER A CB  1 
ATOM   355  O  OG  . SER A 1 39  ? 8.60997  28.41510  120.33775 1.000 24.37166 ? 39  SER A OG  1 
ATOM   356  N  N   . VAL A 1 40  ? 11.85305 28.74324  123.38198 1.000 16.64005 ? 40  VAL A N   1 
ATOM   357  C  CA  . VAL A 1 40  ? 12.96481 28.32464  124.23070 1.000 16.93269 ? 40  VAL A CA  1 
ATOM   358  C  C   . VAL A 1 40  ? 12.57344 28.42386  125.69795 1.000 17.21288 ? 40  VAL A C   1 
ATOM   359  O  O   . VAL A 1 40  ? 12.80885 27.49951  126.48539 1.000 17.60421 ? 40  VAL A O   1 
ATOM   360  C  CB  . VAL A 1 40  ? 14.22393 29.15745  123.92131 1.000 18.25395 ? 40  VAL A CB  1 
ATOM   361  C  CG1 . VAL A 1 40  ? 15.29941 28.92149  124.98241 1.000 19.61078 ? 40  VAL A CG1 1 
ATOM   362  C  CG2 . VAL A 1 40  ? 14.76426 28.82570  122.54058 1.000 19.45108 ? 40  VAL A CG2 1 
ATOM   363  N  N   A ARG A 1 41  ? 11.93573 29.53141  126.08272 0.565 17.47603 ? 41  ARG A N   1 
ATOM   364  N  N   B ARG A 1 41  ? 11.95778 29.54617  126.07886 0.435 18.16148 ? 41  ARG A N   1 
ATOM   365  C  CA  A ARG A 1 41  ? 11.56170 29.72082  127.48043 0.565 18.42729 ? 41  ARG A CA  1 
ATOM   366  C  CA  B ARG A 1 41  ? 11.60031 29.76910  127.47438 0.435 20.10979 ? 41  ARG A CA  1 
ATOM   367  C  C   A ARG A 1 41  ? 10.52022 28.69840  127.92403 0.565 18.20733 ? 41  ARG A C   1 
ATOM   368  C  C   B ARG A 1 41  ? 10.53563 28.78287  127.93787 0.435 19.43487 ? 41  ARG A C   1 
ATOM   369  O  O   A ARG A 1 41  ? 10.64968 28.09473  128.99630 0.565 19.25978 ? 41  ARG A O   1 
ATOM   370  O  O   B ARG A 1 41  ? 10.60216 28.27176  129.06241 0.435 20.82598 ? 41  ARG A O   1 
ATOM   371  C  CB  A ARG A 1 41  ? 11.05476 31.14622  127.70271 0.565 20.62826 ? 41  ARG A CB  1 
ATOM   372  C  CB  B ARG A 1 41  ? 11.10994 31.20417  127.65659 0.435 24.10981 ? 41  ARG A CB  1 
ATOM   373  C  CG  A ARG A 1 41  ? 12.11166 32.23447  127.51643 0.565 24.20429 ? 41  ARG A CG  1 
ATOM   374  C  CG  B ARG A 1 41  ? 10.75679 31.55846  129.08977 0.435 29.04042 ? 41  ARG A CG  1 
ATOM   375  C  CD  A ARG A 1 41  ? 11.48578 33.62593  127.57476 0.565 29.70718 ? 41  ARG A CD  1 
ATOM   376  C  CD  B ARG A 1 41  ? 10.12154 32.93998  129.19863 0.435 33.74394 ? 41  ARG A CD  1 
ATOM   377  N  NE  A ARG A 1 41  ? 12.45343 34.70272  127.37221 0.565 34.73297 ? 41  ARG A NE  1 
ATOM   378  N  NE  B ARG A 1 41  ? 9.22378  33.03296  130.34828 0.435 39.13135 ? 41  ARG A NE  1 
ATOM   379  C  CZ  A ARG A 1 41  ? 12.11670 35.95746  127.08908 0.565 39.87939 ? 41  ARG A CZ  1 
ATOM   380  C  CZ  B ARG A 1 41  ? 8.05139  32.41037  130.44183 0.435 43.09299 ? 41  ARG A CZ  1 
ATOM   381  N  NH1 A ARG A 1 41  ? 13.05379 36.88186  126.92215 0.565 43.26988 ? 41  ARG A NH1 1 
ATOM   382  N  NH1 B ARG A 1 41  ? 7.61151  31.64967  129.44718 0.435 43.35399 ? 41  ARG A NH1 1 
ATOM   383  N  NH2 A ARG A 1 41  ? 10.83783 36.28822  126.97147 0.565 42.87687 ? 41  ARG A NH2 1 
ATOM   384  N  NH2 B ARG A 1 41  ? 7.31066  32.55600  131.53188 0.435 45.79553 ? 41  ARG A NH2 1 
ATOM   385  N  N   A ARG A 1 42  ? 9.47401  28.49773  127.11640 0.565 17.41313 ? 42  ARG A N   1 
ATOM   386  N  N   B ARG A 1 42  ? 9.53803  28.51045  127.09021 0.435 18.46748 ? 42  ARG A N   1 
ATOM   387  C  CA  A ARG A 1 42  ? 8.41686  27.56067  127.49240 0.565 17.67709 ? 42  ARG A CA  1 
ATOM   388  C  CA  B ARG A 1 42  ? 8.47115  27.59092  127.47972 0.435 19.31795 ? 42  ARG A CA  1 
ATOM   389  C  C   A ARG A 1 42  ? 8.93605  26.12694  127.55489 0.565 17.49758 ? 42  ARG A C   1 
ATOM   390  C  C   B ARG A 1 42  ? 8.97852  26.16068  127.57395 0.435 18.20524 ? 42  ARG A C   1 
ATOM   391  O  O   A ARG A 1 42  ? 8.57437  25.36691  128.46049 0.565 18.47431 ? 42  ARG A O   1 
ATOM   392  O  O   B ARG A 1 42  ? 8.64205  25.43815  128.51844 0.435 20.16023 ? 42  ARG A O   1 
ATOM   393  C  CB  A ARG A 1 42  ? 7.23552  27.67412  126.52575 0.565 19.20499 ? 42  ARG A CB  1 
ATOM   394  C  CB  B ARG A 1 42  ? 7.29835  27.68352  126.50446 0.435 23.56109 ? 42  ARG A CB  1 
ATOM   395  C  CG  A ARG A 1 42  ? 6.51104  29.02404  126.52460 0.565 23.82782 ? 42  ARG A CG  1 
ATOM   396  C  CG  B ARG A 1 42  ? 6.43042  28.90471  126.72208 0.435 29.82078 ? 42  ARG A CG  1 
ATOM   397  C  CD  A ARG A 1 42  ? 5.87289  29.34254  127.87325 0.565 30.46139 ? 42  ARG A CD  1 
ATOM   398  C  CD  B ARG A 1 42  ? 5.89071  28.96642  128.14792 0.435 34.94751 ? 42  ARG A CD  1 
ATOM   399  N  NE  A ARG A 1 42  ? 4.94486  28.30451  128.31844 0.565 36.98173 ? 42  ARG A NE  1 
ATOM   400  N  NE  B ARG A 1 42  ? 4.71449  28.12308  128.35231 0.435 39.89012 ? 42  ARG A NE  1 
ATOM   401  C  CZ  A ARG A 1 42  ? 3.62007  28.42802  128.31764 0.565 40.56937 ? 42  ARG A CZ  1 
ATOM   402  C  CZ  B ARG A 1 42  ? 4.73417  26.94843  128.97415 0.435 41.34959 ? 42  ARG A CZ  1 
ATOM   403  N  NH1 A ARG A 1 42  ? 3.05454  29.54735  127.88787 0.565 46.20922 ? 42  ARG A NH1 1 
ATOM   404  N  NH1 B ARG A 1 42  ? 5.87567  26.47077  129.45074 0.435 38.10781 ? 42  ARG A NH1 1 
ATOM   405  N  NH2 A ARG A 1 42  ? 2.85878  27.43114  128.74849 0.565 37.84442 ? 42  ARG A NH2 1 
ATOM   406  N  NH2 B ARG A 1 42  ? 3.61549  26.25095  129.12248 0.435 45.39487 ? 42  ARG A NH2 1 
ATOM   407  N  N   . LEU A 1 43  ? 9.78404  25.73372  126.60057 1.000 16.67933 ? 43  LEU A N   1 
ATOM   408  C  CA  . LEU A 1 43  ? 10.33294 24.38374  126.63234 1.000 16.35763 ? 43  LEU A CA  1 
ATOM   409  C  C   . LEU A 1 43  ? 11.24620 24.18292  127.83376 1.000 16.48938 ? 43  LEU A C   1 
ATOM   410  O  O   . LEU A 1 43  ? 11.24867 23.10841  128.44257 1.000 17.11553 ? 43  LEU A O   1 
ATOM   411  C  CB  . LEU A 1 43  ? 11.08148 24.09480  125.33574 1.000 16.82603 ? 43  LEU A CB  1 
ATOM   412  C  CG  . LEU A 1 43  ? 10.16422 23.86796  124.13334 1.000 19.13501 ? 43  LEU A CG  1 
ATOM   413  C  CD1 . LEU A 1 43  ? 10.98281 23.85620  122.85925 1.000 20.83763 ? 43  LEU A CD1 1 
ATOM   414  C  CD2 . LEU A 1 43  ? 9.36853  22.57325  124.28359 1.000 21.67697 ? 43  LEU A CD2 1 
ATOM   415  N  N   . ALA A 1 44  ? 12.02792 25.20539  128.19389 1.000 16.45746 ? 44  ALA A N   1 
ATOM   416  C  CA  . ALA A 1 44  ? 12.86609 25.09173  129.38333 1.000 17.69287 ? 44  ALA A CA  1 
ATOM   417  C  C   . ALA A 1 44  ? 12.01940 24.85149  130.62598 1.000 18.07955 ? 44  ALA A C   1 
ATOM   418  O  O   . ALA A 1 44  ? 12.38260 24.03790  131.48302 1.000 19.24655 ? 44  ALA A O   1 
ATOM   419  C  CB  . ALA A 1 44  ? 13.73509 26.33712  129.54324 1.000 19.01701 ? 44  ALA A CB  1 
ATOM   420  N  N   A GLU A 1 45  ? 10.87205 25.53526  130.72681 0.640 18.53438 ? 45  GLU A N   1 
ATOM   421  N  N   B GLU A 1 45  ? 10.88237 25.54435  130.73643 0.360 18.57920 ? 45  GLU A N   1 
ATOM   422  C  CA  A GLU A 1 45  ? 10.00018 25.37718  131.88836 0.640 20.24938 ? 45  GLU A CA  1 
ATOM   423  C  CA  B GLU A 1 45  ? 10.01159 25.36285  131.89349 0.360 20.05613 ? 45  GLU A CA  1 
ATOM   424  C  C   A GLU A 1 45  ? 9.40679  23.97556  131.97065 0.640 19.66307 ? 45  GLU A C   1 
ATOM   425  C  C   B GLU A 1 45  ? 9.50138  23.92986  131.98102 0.360 19.28471 ? 45  GLU A C   1 
ATOM   426  O  O   A GLU A 1 45  ? 9.07524  23.50675  133.06602 0.640 21.58368 ? 45  GLU A O   1 
ATOM   427  O  O   B GLU A 1 45  ? 9.33712  23.38677  133.07979 0.360 21.30365 ? 45  GLU A O   1 
ATOM   428  C  CB  A GLU A 1 45  ? 8.88524  26.42592  131.85730 0.640 23.34563 ? 45  GLU A CB  1 
ATOM   429  C  CB  B GLU A 1 45  ? 8.84663  26.34993  131.82046 0.360 22.88135 ? 45  GLU A CB  1 
ATOM   430  C  CG  A GLU A 1 45  ? 9.36561  27.85636  132.02818 0.640 27.69812 ? 45  GLU A CG  1 
ATOM   431  C  CG  B GLU A 1 45  ? 8.03239  26.46163  133.09489 0.360 26.96372 ? 45  GLU A CG  1 
ATOM   432  C  CD  A GLU A 1 45  ? 8.27960  28.88019  131.74875 0.640 34.91410 ? 45  GLU A CD  1 
ATOM   433  C  CD  B GLU A 1 45  ? 6.90953  27.47254  132.97480 0.360 34.00582 ? 45  GLU A CD  1 
ATOM   434  O  OE1 A GLU A 1 45  ? 7.28867  28.53810  131.06970 0.640 35.84918 ? 45  GLU A OE1 1 
ATOM   435  O  OE1 B GLU A 1 45  ? 6.76927  28.08434  131.89498 0.360 35.76353 ? 45  GLU A OE1 1 
ATOM   436  O  OE2 A GLU A 1 45  ? 8.41589  30.03052  132.21148 0.640 41.74675 ? 45  GLU A OE2 1 
ATOM   437  O  OE2 B GLU A 1 45  ? 6.16368  27.65365  133.95842 0.360 39.20156 ? 45  GLU A OE2 1 
ATOM   438  N  N   . LEU A 1 46  ? 9.25333  23.29820  130.83162 1.000 18.34110 ? 46  LEU A N   1 
ATOM   439  C  CA  . LEU A 1 46  ? 8.73330  21.93480  130.79983 1.000 18.28963 ? 46  LEU A CA  1 
ATOM   440  C  C   . LEU A 1 46  ? 9.79039  20.88600  131.11891 1.000 18.02474 ? 46  LEU A C   1 
ATOM   441  O  O   . LEU A 1 46  ? 9.44052  19.71273  131.28183 1.000 20.10512 ? 46  LEU A O   1 
ATOM   442  C  CB  . LEU A 1 46  ? 8.12730  21.64278  129.42447 1.000 20.54245 ? 46  LEU A CB  1 
ATOM   443  C  CG  . LEU A 1 46  ? 6.84263  22.38648  129.05946 1.000 25.42018 ? 46  LEU A CG  1 
ATOM   444  C  CD1 . LEU A 1 46  ? 6.39667  21.99386  127.66435 1.000 28.16059 ? 46  LEU A CD1 1 
ATOM   445  C  CD2 . LEU A 1 46  ? 5.74852  22.10110  130.07493 1.000 28.04700 ? 46  LEU A CD2 1 
ATOM   446  N  N   . GLY A 1 47  ? 11.06042 21.26623  131.20409 1.000 17.56619 ? 47  GLY A N   1 
ATOM   447  C  CA  . GLY A 1 47  ? 12.11603 20.32447  131.50718 1.000 17.84696 ? 47  GLY A CA  1 
ATOM   448  C  C   . GLY A 1 47  ? 12.92888 19.85084  130.32395 1.000 17.18165 ? 47  GLY A C   1 
ATOM   449  O  O   . GLY A 1 47  ? 13.69825 18.89374  130.46856 1.000 18.39097 ? 47  GLY A O   1 
ATOM   450  N  N   . ALA A 1 48  ? 12.78493 20.48382  129.16335 1.000 16.05156 ? 48  ALA A N   1 
ATOM   451  C  CA  . ALA A 1 48  ? 13.59560 20.13928  128.00863 1.000 15.88348 ? 48  ALA A CA  1 
ATOM   452  C  C   . ALA A 1 48  ? 15.06142 20.50184  128.24035 1.000 15.59630 ? 48  ALA A C   1 
ATOM   453  O  O   . ALA A 1 48  ? 15.40171 21.38249  129.02779 1.000 17.75926 ? 48  ALA A O   1 
ATOM   454  C  CB  . ALA A 1 48  ? 13.07995 20.87344  126.77438 1.000 17.37866 ? 48  ALA A CB  1 
ATOM   455  N  N   . HIS A 1 49  ? 15.92600 19.80996  127.51009 1.000 14.77142 ? 49  HIS A N   1 
ATOM   456  C  CA  . HIS A 1 49  ? 17.36598 20.01395  127.51903 1.000 14.92614 ? 49  HIS A CA  1 
ATOM   457  C  C   . HIS A 1 49  ? 17.81338 20.98650  126.43844 1.000 14.56748 ? 49  HIS A C   1 
ATOM   458  O  O   . HIS A 1 49  ? 18.79526 21.72054  126.62253 1.000 15.64338 ? 49  HIS A O   1 
ATOM   459  C  CB  . HIS A 1 49  ? 18.02009 18.64516  127.29487 1.000 16.74573 ? 49  HIS A CB  1 
ATOM   460  C  CG  . HIS A 1 49  ? 19.48070 18.69241  126.98651 1.000 19.62076 ? 49  HIS A CG  1 
ATOM   461  N  ND1 . HIS A 1 49  ? 20.44343 18.74245  127.96681 1.000 22.98592 ? 49  HIS A ND1 1 
ATOM   462  C  CD2 . HIS A 1 49  ? 20.14566 18.66201  125.80819 1.000 21.50808 ? 49  HIS A CD2 1 
ATOM   463  C  CE1 . HIS A 1 49  ? 21.63996 18.76156  127.40722 1.000 24.52724 ? 49  HIS A CE1 1 
ATOM   464  N  NE2 . HIS A 1 49  ? 21.48729 18.71108  126.09719 1.000 23.91711 ? 49  HIS A NE2 1 
ATOM   465  N  N   . GLY A 1 50  ? 17.11850 21.00318  125.30933 1.000 14.72708 ? 50  GLY A N   1 
ATOM   466  C  CA  . GLY A 1 50  ? 17.57558 21.84981  124.23023 1.000 15.11323 ? 50  GLY A CA  1 
ATOM   467  C  C   . GLY A 1 50  ? 16.58931 21.92233  123.09049 1.000 13.93117 ? 50  GLY A C   1 
ATOM   468  O  O   . GLY A 1 50  ? 15.50149 21.33786  123.12288 1.000 14.24093 ? 50  GLY A O   1 
ATOM   469  N  N   . VAL A 1 51  ? 17.01240 22.66779  122.07470 1.000 13.92014 ? 51  VAL A N   1 
ATOM   470  C  CA  A VAL A 1 51  ? 16.20365 22.91355  120.88821 0.609 14.03963 ? 51  VAL A CA  1 
ATOM   471  C  CA  B VAL A 1 51  ? 16.21825 22.98503  120.90300 0.391 14.33464 ? 51  VAL A CA  1 
ATOM   472  C  C   . VAL A 1 51  ? 17.08104 22.75077  119.66320 1.000 13.88567 ? 51  VAL A C   1 
ATOM   473  O  O   . VAL A 1 51  ? 18.31070 22.77886  119.72897 1.000 16.14245 ? 51  VAL A O   1 
ATOM   474  C  CB  A VAL A 1 51  ? 15.52349 24.30562  120.83411 0.609 16.24304 ? 51  VAL A CB  1 
ATOM   475  C  CB  B VAL A 1 51  ? 15.76029 24.45567  121.01654 0.391 17.05846 ? 51  VAL A CB  1 
ATOM   476  C  CG1 A VAL A 1 51  ? 14.42834 24.42220  121.86676 0.609 16.94415 ? 51  VAL A CG1 1 
ATOM   477  C  CG1 B VAL A 1 51  ? 16.96254 25.40053  120.96912 0.391 19.46129 ? 51  VAL A CG1 1 
ATOM   478  C  CG2 A VAL A 1 51  ? 16.54897 25.42110  120.97958 0.609 18.56781 ? 51  VAL A CG2 1 
ATOM   479  C  CG2 B VAL A 1 51  ? 14.73014 24.79559  119.97903 0.391 18.29524 ? 51  VAL A CG2 1 
ATOM   480  N  N   . THR A 1 52  ? 16.41980 22.53765  118.52846 1.000 12.81109 ? 52  THR A N   1 
ATOM   481  C  CA  . THR A 1 52  ? 17.07459 22.39884  117.23638 1.000 12.80698 ? 52  THR A CA  1 
ATOM   482  C  C   . THR A 1 52  ? 16.37045 23.31994  116.24829 1.000 12.25101 ? 52  THR A C   1 
ATOM   483  O  O   . THR A 1 52  ? 15.28017 23.82249  116.52279 1.000 13.17845 ? 52  THR A O   1 
ATOM   484  C  CB  . THR A 1 52  ? 17.01064 20.95541  116.74306 1.000 13.17863 ? 52  THR A CB  1 
ATOM   485  O  OG1 . THR A 1 52  ? 15.64861 20.64113  116.44174 1.000 13.87224 ? 52  THR A OG1 1 
ATOM   486  C  CG2 . THR A 1 52  ? 17.54543 19.99101  117.80547 1.000 14.17947 ? 52  THR A CG2 1 
ATOM   487  N  N   . PHE A 1 53  ? 17.00547 23.57453  115.10365 1.000 12.78111 ? 53  PHE A N   1 
ATOM   488  C  CA  . PHE A 1 53  ? 16.43421 24.53666  114.16852 1.000 13.38944 ? 53  PHE A CA  1 
ATOM   489  C  C   . PHE A 1 53  ? 16.88670 24.24634  112.74840 1.000 12.89753 ? 53  PHE A C   1 
ATOM   490  O  O   . PHE A 1 53  ? 17.99500 23.75176  112.52015 1.000 13.87129 ? 53  PHE A O   1 
ATOM   491  C  CB  . PHE A 1 53  ? 16.81503 25.98760  114.53199 1.000 15.42180 ? 53  PHE A CB  1 
ATOM   492  C  CG  . PHE A 1 53  ? 18.28499 26.31101  114.35632 1.000 16.33360 ? 53  PHE A CG  1 
ATOM   493  C  CD1 . PHE A 1 53  ? 19.21485 25.95650  115.32244 1.000 18.99469 ? 53  PHE A CD1 1 
ATOM   494  C  CD2 . PHE A 1 53  ? 18.73210 26.98079  113.23223 1.000 17.14724 ? 53  PHE A CD2 1 
ATOM   495  C  CE1 . PHE A 1 53  ? 20.56078 26.26267  115.15887 1.000 21.17717 ? 53  PHE A CE1 1 
ATOM   496  C  CE2 . PHE A 1 53  ? 20.07291 27.28034  113.06550 1.000 18.50490 ? 53  PHE A CE2 1 
ATOM   497  C  CZ  . PHE A 1 53  ? 20.98736 26.92447  114.03033 1.000 20.35827 ? 53  PHE A CZ  1 
ATOM   498  N  N   . HIS A 1 54  ? 15.99661 24.55640  111.79985 1.000 13.08930 ? 54  HIS A N   1 
ATOM   499  C  CA  . HIS A 1 54  ? 16.41431 24.85737  110.43527 1.000 13.23733 ? 54  HIS A CA  1 
ATOM   500  C  C   . HIS A 1 54  ? 16.84469 26.31551  110.36887 1.000 13.73898 ? 54  HIS A C   1 
ATOM   501  O  O   . HIS A 1 54  ? 16.29856 27.17030  111.07168 1.000 14.39452 ? 54  HIS A O   1 
ATOM   502  C  CB  . HIS A 1 54  ? 15.25463 24.74275  109.43316 1.000 13.99450 ? 54  HIS A CB  1 
ATOM   503  C  CG  . HIS A 1 54  ? 14.59724 23.39974  109.37324 1.000 14.27734 ? 54  HIS A CG  1 
ATOM   504  N  ND1 . HIS A 1 54  ? 13.63485 23.00423  110.27410 1.000 15.14751 ? 54  HIS A ND1 1 
ATOM   505  C  CD2 . HIS A 1 54  ? 14.73662 22.37474  108.49826 1.000 14.87222 ? 54  HIS A CD2 1 
ATOM   506  C  CE1 . HIS A 1 54  ? 13.22349 21.78647  109.96765 1.000 16.07362 ? 54  HIS A CE1 1 
ATOM   507  N  NE2 . HIS A 1 54  ? 13.88038 21.37798  108.89861 1.000 15.75893 ? 54  HIS A NE2 1 
ATOM   508  N  N   . ASP A 1 55  ? 17.79004 26.60788  109.46897 1.000 13.97576 ? 55  ASP A N   1 
ATOM   509  C  CA  . ASP A 1 55  ? 18.16684 27.99418  109.21076 1.000 14.37218 ? 55  ASP A CA  1 
ATOM   510  C  C   . ASP A 1 55  ? 16.96395 28.92738  109.14918 1.000 14.31750 ? 55  ASP A C   1 
ATOM   511  O  O   . ASP A 1 55  ? 16.91704 29.94751  109.84564 1.000 15.88067 ? 55  ASP A O   1 
ATOM   512  C  CB  . ASP A 1 55  ? 19.06393 28.13908  107.96851 1.000 14.51870 ? 55  ASP A CB  1 
ATOM   513  C  CG  . ASP A 1 55  ? 18.48972 27.52757  106.68124 1.000 14.35947 ? 55  ASP A CG  1 
ATOM   514  O  OD1 . ASP A 1 55  ? 17.46193 26.80908  106.66603 1.000 14.39706 ? 55  ASP A OD1 1 
ATOM   515  O  OD2 . ASP A 1 55  ? 19.13090 27.80745  105.64127 1.000 15.98478 ? 55  ASP A OD2 1 
ATOM   516  N  N   . ASP A 1 56  ? 15.96419 28.56729  108.34634 1.000 14.26949 ? 56  ASP A N   1 
ATOM   517  C  CA  . ASP A 1 56  ? 14.84454 29.45971  108.08556 1.000 15.23958 ? 56  ASP A CA  1 
ATOM   518  C  C   . ASP A 1 56  ? 13.83359 29.51645  109.22528 1.000 15.39105 ? 56  ASP A C   1 
ATOM   519  O  O   . ASP A 1 56  ? 12.93604 30.36303  109.18243 1.000 17.65553 ? 56  ASP A O   1 
ATOM   520  C  CB  . ASP A 1 56  ? 14.15128 29.06978  106.77759 1.000 17.34840 ? 56  ASP A CB  1 
ATOM   521  C  CG  . ASP A 1 56  ? 15.06512 29.21380  105.55622 1.000 21.05662 ? 56  ASP A CG  1 
ATOM   522  O  OD1 . ASP A 1 56  ? 16.10656 29.89836  105.64209 1.000 23.87688 ? 56  ASP A OD1 1 
ATOM   523  O  OD2 . ASP A 1 56  ? 14.71337 28.66641  104.49514 1.000 24.37534 ? 56  ASP A OD2 1 
ATOM   524  N  N   . ASP A 1 57  ? 13.94572 28.64223  110.22970 1.000 14.65680 ? 57  ASP A N   1 
ATOM   525  C  CA  . ASP A 1 57  ? 13.11739 28.78378  111.42433 1.000 15.26293 ? 57  ASP A CA  1 
ATOM   526  C  C   . ASP A 1 57  ? 13.60368 29.93489  112.28756 1.000 16.87532 ? 57  ASP A C   1 
ATOM   527  O  O   . ASP A 1 57  ? 12.80687 30.58463  112.97609 1.000 19.35657 ? 57  ASP A O   1 
ATOM   528  C  CB  . ASP A 1 57  ? 13.21212 27.53599  112.30655 1.000 15.05569 ? 57  ASP A CB  1 
ATOM   529  C  CG  . ASP A 1 57  ? 12.68277 26.27580  111.65218 1.000 15.73255 ? 57  ASP A CG  1 
ATOM   530  O  OD1 . ASP A 1 57  ? 11.76655 26.34833  110.80470 1.000 17.73941 ? 57  ASP A OD1 1 
ATOM   531  O  OD2 . ASP A 1 57  ? 13.18794 25.20201  112.03381 1.000 15.75995 ? 57  ASP A OD2 1 
ATOM   532  N  N   . LEU A 1 58  ? 14.91269 30.16040  112.30508 1.000 17.28123 ? 58  LEU A N   1 
ATOM   533  C  CA  . LEU A 1 58  ? 15.54260 31.12479  113.19004 1.000 18.84203 ? 58  LEU A CA  1 
ATOM   534  C  C   . LEU A 1 58  ? 15.75366 32.46631  112.51430 1.000 20.33250 ? 58  LEU A C   1 
ATOM   535  O  O   . LEU A 1 58  ? 15.55756 33.51237  113.13797 1.000 23.26826 ? 58  LEU A O   1 
ATOM   536  C  CB  . LEU A 1 58  ? 16.89041 30.56352  113.64853 1.000 20.46380 ? 58  LEU A CB  1 
ATOM   537  C  CG  . LEU A 1 58  ? 17.68966 31.41052  114.62876 1.000 24.32054 ? 58  LEU A CG  1 
ATOM   538  C  CD1 . LEU A 1 58  ? 16.88466 31.63016  115.89776 1.000 28.26930 ? 58  LEU A CD1 1 
ATOM   539  C  CD2 . LEU A 1 58  ? 19.01835 30.74605  114.94176 1.000 25.61169 ? 58  LEU A CD2 1 
ATOM   540  N  N   . ILE A 1 59  ? 16.13947 32.44859  111.24607 1.000 20.23304 ? 59  ILE A N   1 
ATOM   541  C  CA  . ILE A 1 59  ? 16.41773 33.66074  110.48990 1.000 21.87539 ? 59  ILE A CA  1 
ATOM   542  C  C   . ILE A 1 59  ? 15.46408 33.66669  109.30387 1.000 23.35240 ? 59  ILE A C   1 
ATOM   543  O  O   . ILE A 1 59  ? 15.58056 32.80341  108.42313 1.000 23.33180 ? 59  ILE A O   1 
ATOM   544  C  CB  . ILE A 1 59  ? 17.88360 33.68618  110.03871 1.000 24.56477 ? 59  ILE A CB  1 
ATOM   545  C  CG1 . ILE A 1 59  ? 18.80612 33.67105  111.25843 1.000 27.58986 ? 59  ILE A CG1 1 
ATOM   546  C  CG2 . ILE A 1 59  ? 18.15526 34.91167  109.18352 1.000 26.98635 ? 59  ILE A CG2 1 
ATOM   547  C  CD1 . ILE A 1 59  ? 20.00498 32.77955  111.09388 1.000 31.45346 ? 59  ILE A CD1 1 
ATOM   548  N  N   . PRO A 1 60  ? 14.50229 34.58886  109.25145 1.000 27.15283 ? 60  PRO A N   1 
ATOM   549  C  CA  . PRO A 1 60  ? 13.55505 34.60561  108.13117 1.000 28.92900 ? 60  PRO A CA  1 
ATOM   550  C  C   . PRO A 1 60  ? 14.29438 34.64295  106.80346 1.000 27.13621 ? 60  PRO A C   1 
ATOM   551  O  O   . PRO A 1 60  ? 15.28255 35.36289  106.64487 1.000 27.38450 ? 60  PRO A O   1 
ATOM   552  C  CB  . PRO A 1 60  ? 12.76473 35.89763  108.36190 1.000 34.33821 ? 60  PRO A CB  1 
ATOM   553  C  CG  . PRO A 1 60  ? 12.84716 36.12764  109.83130 1.000 36.18638 ? 60  PRO A CG  1 
ATOM   554  C  CD  . PRO A 1 60  ? 14.21422 35.64444  110.23832 1.000 31.78381 ? 60  PRO A CD  1 
ATOM   555  N  N   . PHE A 1 61  ? 13.82076 33.83886  105.85277 1.000 27.13635 ? 61  PHE A N   1 
ATOM   556  C  CA  . PHE A 1 61  ? 14.44575 33.78728  104.53815 1.000 27.52045 ? 61  PHE A CA  1 
ATOM   557  C  C   . PHE A 1 61  ? 14.53243 35.18126  103.93353 1.000 30.40357 ? 61  PHE A C   1 
ATOM   558  O  O   . PHE A 1 61  ? 13.56726 35.94879  103.96827 1.000 32.87881 ? 61  PHE A O   1 
ATOM   559  C  CB  . PHE A 1 61  ? 13.64164 32.87301  103.61237 1.000 26.85630 ? 61  PHE A CB  1 
ATOM   560  C  CG  . PHE A 1 61  ? 14.27817 32.67555  102.26871 1.000 27.67023 ? 61  PHE A CG  1 
ATOM   561  C  CD1 . PHE A 1 61  ? 15.20525 31.66835  102.06496 1.000 32.09085 ? 61  PHE A CD1 1 
ATOM   562  C  CD2 . PHE A 1 61  ? 13.96477 33.51463  101.21318 1.000 27.74774 ? 61  PHE A CD2 1 
ATOM   563  C  CE1 . PHE A 1 61  ? 15.79841 31.49618  100.82873 1.000 33.44660 ? 61  PHE A CE1 1 
ATOM   564  C  CE2 . PHE A 1 61  ? 14.55458 33.35001  99.97839  1.000 29.63199 ? 61  PHE A CE2 1 
ATOM   565  C  CZ  . PHE A 1 61  ? 15.47146 32.34001  99.78353  1.000 31.50813 ? 61  PHE A CZ  1 
ATOM   566  N  N   . GLY A 1 62  ? 15.69914 35.50365  103.37911 1.000 32.95515 ? 62  GLY A N   1 
ATOM   567  C  CA  . GLY A 1 62  ? 15.92343 36.79167  102.76093 1.000 36.44769 ? 62  GLY A CA  1 
ATOM   568  C  C   . GLY A 1 62  ? 16.41616 37.87761  103.69207 1.000 39.56490 ? 62  GLY A C   1 
ATOM   569  O  O   . GLY A 1 62  ? 16.56806 39.02312  103.24963 1.000 45.37083 ? 62  GLY A O   1 
ATOM   570  N  N   . SER A 1 63  ? 16.67548 37.55784  104.95930 1.000 36.89653 ? 63  SER A N   1 
ATOM   571  C  CA  . SER A 1 63  ? 17.10907 38.56208  105.92206 1.000 36.83780 ? 63  SER A CA  1 
ATOM   572  C  C   . SER A 1 63  ? 18.45568 39.14625  105.51693 1.000 39.75403 ? 63  SER A C   1 
ATOM   573  O  O   . SER A 1 63  ? 19.30982 38.45237  104.95929 1.000 40.41442 ? 63  SER A O   1 
ATOM   574  C  CB  . SER A 1 63  ? 17.24755 37.92138  107.30345 1.000 35.45081 ? 63  SER A CB  1 
ATOM   575  O  OG  . SER A 1 63  ? 15.98187 37.67702  107.88850 1.000 36.13299 ? 63  SER A OG  1 
ATOM   576  N  N   . SER A 1 64  ? 18.64215 40.43361  105.80267 1.000 41.25624 ? 64  SER A N   1 
ATOM   577  C  CA  . SER A 1 64  ? 19.93759 41.06368  105.61301 1.000 42.53339 ? 64  SER A CA  1 
ATOM   578  C  C   . SER A 1 64  ? 20.90899 40.57837  106.68498 1.000 41.03513 ? 64  SER A C   1 
ATOM   579  O  O   . SER A 1 64  ? 20.51660 39.98004  107.68819 1.000 38.53501 ? 64  SER A O   1 
ATOM   580  C  CB  . SER A 1 64  ? 19.80670 42.58170  105.70642 1.000 45.74284 ? 64  SER A CB  1 
ATOM   581  O  OG  . SER A 1 64  ? 19.50171 42.97810  107.03267 1.000 47.57926 ? 64  SER A OG  1 
ATOM   582  N  N   . ASP A 1 65  ? 22.19863 40.85183  106.46696 1.000 43.53285 ? 65  ASP A N   1 
ATOM   583  C  CA  A ASP A 1 65  ? 23.21554 40.43707  107.43021 0.552 45.32820 ? 65  ASP A CA  1 
ATOM   584  C  CA  B ASP A 1 65  ? 23.20952 40.43028  107.43173 0.448 45.23236 ? 65  ASP A CA  1 
ATOM   585  C  C   . ASP A 1 65  ? 22.96832 41.05828  108.79915 1.000 44.41806 ? 65  ASP A C   1 
ATOM   586  O  O   . ASP A 1 65  ? 23.16871 40.40705  109.83144 1.000 44.16357 ? 65  ASP A O   1 
ATOM   587  C  CB  A ASP A 1 65  ? 24.60803 40.80503  106.91779 0.552 49.17288 ? 65  ASP A CB  1 
ATOM   588  C  CB  B ASP A 1 65  ? 24.60827 40.76136  106.91279 0.448 48.30381 ? 65  ASP A CB  1 
ATOM   589  C  CG  A ASP A 1 65  ? 25.11405 39.84335  105.86254 0.552 52.28742 ? 65  ASP A CG  1 
ATOM   590  C  CG  B ASP A 1 65  ? 24.99753 39.91688  105.71633 0.448 50.62803 ? 65  ASP A CG  1 
ATOM   591  O  OD1 A ASP A 1 65  ? 24.30417 39.05122  105.33686 0.552 54.38499 ? 65  ASP A OD1 1 
ATOM   592  O  OD1 B ASP A 1 65  ? 24.85668 38.67708  105.78889 0.448 51.06163 ? 65  ASP A OD1 1 
ATOM   593  O  OD2 A ASP A 1 65  ? 26.32516 39.87783  105.56172 0.552 54.26931 ? 65  ASP A OD2 1 
ATOM   594  O  OD2 B ASP A 1 65  ? 25.43911 40.49433  104.70150 0.448 52.86006 ? 65  ASP A OD2 1 
ATOM   595  N  N   . SER A 1 66  ? 22.52928 42.31943  108.82786 1.000 44.08100 ? 66  SER A N   1 
ATOM   596  C  CA  A SER A 1 66  ? 22.24779 42.98132  110.09831 0.464 44.33756 ? 66  SER A CA  1 
ATOM   597  C  CA  B SER A 1 66  ? 22.26003 42.96695  110.10700 0.536 43.13223 ? 66  SER A CA  1 
ATOM   598  C  C   . SER A 1 66  ? 21.05334 42.34649  110.80038 1.000 41.95475 ? 66  SER A C   1 
ATOM   599  O  O   . SER A 1 66  ? 21.08170 42.12707  112.01738 1.000 44.45684 ? 66  SER A O   1 
ATOM   600  C  CB  A SER A 1 66  ? 22.01090 44.47354  109.86411 0.464 48.19691 ? 66  SER A CB  1 
ATOM   601  C  CB  B SER A 1 66  ? 22.07631 44.47179  109.91805 0.536 45.17630 ? 66  SER A CB  1 
ATOM   602  O  OG  A SER A 1 66  ? 21.54989 45.10796  111.04370 0.464 51.71691 ? 66  SER A OG  1 
ATOM   603  O  OG  B SER A 1 66  ? 21.11858 44.74223  108.91211 0.536 47.78880 ? 66  SER A OG  1 
ATOM   604  N  N   . GLU A 1 67  ? 19.98788 42.05386  110.04855 1.000 37.72546 ? 67  GLU A N   1 
ATOM   605  C  CA  A GLU A 1 67  ? 18.83584 41.38314  110.63957 0.666 36.29626 ? 67  GLU A CA  1 
ATOM   606  C  CA  B GLU A 1 67  ? 18.83299 41.37909  110.63493 0.334 37.26715 ? 67  GLU A CA  1 
ATOM   607  C  C   . GLU A 1 67  ? 19.21609 40.00111  111.15460 1.000 33.78107 ? 67  GLU A C   1 
ATOM   608  O  O   . GLU A 1 67  ? 18.78777 39.59536  112.24161 1.000 32.90892 ? 67  GLU A O   1 
ATOM   609  C  CB  A GLU A 1 67  ? 17.70730 41.29473  109.61245 0.666 39.68803 ? 67  GLU A CB  1 
ATOM   610  C  CB  B GLU A 1 67  ? 17.71791 41.25358  109.59754 0.334 41.89394 ? 67  GLU A CB  1 
ATOM   611  C  CG  A GLU A 1 67  ? 17.07109 42.63904  109.30103 0.666 42.90974 ? 67  GLU A CG  1 
ATOM   612  C  CG  B GLU A 1 67  ? 17.14333 42.57578  109.12872 0.334 46.41424 ? 67  GLU A CG  1 
ATOM   613  C  CD  A GLU A 1 67  ? 16.19691 42.60465  108.06489 0.666 45.94934 ? 67  GLU A CD  1 
ATOM   614  C  CD  B GLU A 1 67  ? 16.27890 43.24299  110.17435 0.334 51.30281 ? 67  GLU A CD  1 
ATOM   615  O  OE1 A GLU A 1 67  ? 16.36099 41.68182  107.23965 0.666 42.42413 ? 67  GLU A OE1 1 
ATOM   616  O  OE1 B GLU A 1 67  ? 15.66216 42.52106  110.98554 0.334 54.08177 ? 67  GLU A OE1 1 
ATOM   617  O  OE2 A GLU A 1 67  ? 15.34405 43.50457  107.91768 0.666 51.80344 ? 67  GLU A OE2 1 
ATOM   618  O  OE2 B GLU A 1 67  ? 16.20744 44.48970  110.17651 0.334 52.64505 ? 67  GLU A OE2 1 
ATOM   619  N  N   . ARG A 1 68  ? 20.02484 39.27111  110.38480 1.000 31.65819 ? 68  ARG A N   1 
ATOM   620  C  CA  . ARG A 1 68  ? 20.49677 37.95286  110.79065 1.000 31.04948 ? 68  ARG A CA  1 
ATOM   621  C  C   . ARG A 1 68  ? 21.21797 38.02572  112.13111 1.000 29.34245 ? 68  ARG A C   1 
ATOM   622  O  O   . ARG A 1 68  ? 20.97366 37.21284  113.03055 1.000 28.24185 ? 68  ARG A O   1 
ATOM   623  C  CB  . ARG A 1 68  ? 21.43263 37.43385  109.70105 1.000 34.04777 ? 68  ARG A CB  1 
ATOM   624  C  CG  . ARG A 1 68  ? 22.10500 36.11524  109.97430 1.000 36.75233 ? 68  ARG A CG  1 
ATOM   625  C  CD  . ARG A 1 68  ? 23.16081 35.86143  108.90983 1.000 42.09205 ? 68  ARG A CD  1 
ATOM   626  N  NE  . ARG A 1 68  ? 23.83997 34.58618  109.09930 1.000 43.39614 ? 68  ARG A NE  1 
ATOM   627  C  CZ  . ARG A 1 68  ? 23.33339 33.41427  108.73307 1.000 39.46132 ? 68  ARG A CZ  1 
ATOM   628  N  NH1 . ARG A 1 68  ? 22.14478 33.35788  108.14788 1.000 41.00974 ? 68  ARG A NH1 1 
ATOM   629  N  NH2 . ARG A 1 68  ? 24.01839 32.29937  108.94539 1.000 38.09890 ? 68  ARG A NH2 1 
ATOM   630  N  N   . GLU A 1 69  ? 22.09890 39.01707  112.28519 1.000 31.32596 ? 69  GLU A N   1 
ATOM   631  C  CA  A GLU A 1 69  ? 22.84180 39.18022  113.53103 0.554 32.88031 ? 69  GLU A CA  1 
ATOM   632  C  CA  B GLU A 1 69  ? 22.83902 39.16574  113.53406 0.446 32.95645 ? 69  GLU A CA  1 
ATOM   633  C  C   . GLU A 1 69  ? 21.90495 39.40074  114.71340 1.000 30.39811 ? 69  GLU A C   1 
ATOM   634  O  O   . GLU A 1 69  ? 22.11304 38.83999  115.79697 1.000 29.51199 ? 69  GLU A O   1 
ATOM   635  C  CB  A GLU A 1 69  ? 23.80273 40.35885  113.38017 0.554 38.85340 ? 69  GLU A CB  1 
ATOM   636  C  CB  B GLU A 1 69  ? 23.85217 40.30405  113.41545 0.446 38.75275 ? 69  GLU A CB  1 
ATOM   637  C  CG  A GLU A 1 69  ? 24.61822 40.70383  114.60919 0.554 43.51347 ? 69  GLU A CG  1 
ATOM   638  C  CG  B GLU A 1 69  ? 25.30112 39.86324  113.55603 0.446 44.67901 ? 69  GLU A CG  1 
ATOM   639  C  CD  A GLU A 1 69  ? 25.64544 41.78075  114.31751 0.554 48.83963 ? 69  GLU A CD  1 
ATOM   640  C  CD  B GLU A 1 69  ? 25.89833 39.36952  112.25184 0.446 48.80719 ? 69  GLU A CD  1 
ATOM   641  O  OE1 A GLU A 1 69  ? 26.44624 41.59839  113.37665 0.554 53.12382 ? 69  GLU A OE1 1 
ATOM   642  O  OE1 B GLU A 1 69  ? 25.22710 38.59584  111.53559 0.446 51.47720 ? 69  GLU A OE1 1 
ATOM   643  O  OE2 A GLU A 1 69  ? 25.64502 42.81295  115.01906 0.554 51.39951 ? 69  GLU A OE2 1 
ATOM   644  O  OE2 B GLU A 1 69  ? 27.04521 39.75756  111.94418 0.446 50.42440 ? 69  GLU A OE2 1 
ATOM   645  N  N   . GLU A 1 70  ? 20.86905 40.22236  114.52468 1.000 29.55985 ? 70  GLU A N   1 
ATOM   646  C  CA  A GLU A 1 70  ? 19.95550 40.50746  115.62536 0.536 30.36357 ? 70  GLU A CA  1 
ATOM   647  C  CA  B GLU A 1 70  ? 19.94021 40.51291  115.61351 0.464 29.99919 ? 70  GLU A CA  1 
ATOM   648  C  C   . GLU A 1 70  ? 19.13866 39.27754  116.00388 1.000 27.84574 ? 70  GLU A C   1 
ATOM   649  O  O   . GLU A 1 70  ? 18.91479 39.02170  117.19289 1.000 27.22627 ? 70  GLU A O   1 
ATOM   650  C  CB  A GLU A 1 70  ? 19.05787 41.69580  115.27903 0.536 35.32323 ? 70  GLU A CB  1 
ATOM   651  C  CB  B GLU A 1 70  ? 19.00943 41.65820  115.21242 0.464 34.47993 ? 70  GLU A CB  1 
ATOM   652  C  CG  A GLU A 1 70  ? 19.81026 43.01260  115.13134 0.536 40.05263 ? 70  GLU A CG  1 
ATOM   653  C  CG  B GLU A 1 70  ? 18.08266 42.13262  116.32209 0.464 39.59551 ? 70  GLU A CG  1 
ATOM   654  C  CD  A GLU A 1 70  ? 20.53363 43.42539  116.40059 0.536 46.17126 ? 70  GLU A CD  1 
ATOM   655  C  CD  B GLU A 1 70  ? 18.81566 42.43292  117.61404 0.464 45.70284 ? 70  GLU A CD  1 
ATOM   656  O  OE1 A GLU A 1 70  ? 19.85115 43.71795  117.40536 0.536 52.69297 ? 70  GLU A OE1 1 
ATOM   657  O  OE1 B GLU A 1 70  ? 19.85406 43.12555  117.56334 0.464 50.17957 ? 70  GLU A OE1 1 
ATOM   658  O  OE2 A GLU A 1 70  ? 21.78282 43.46467  116.39205 0.536 47.49754 ? 70  GLU A OE2 1 
ATOM   659  O  OE2 B GLU A 1 70  ? 18.34810 41.98473  118.68242 0.464 48.38800 ? 70  GLU A OE2 1 
ATOM   660  N  N   . HIS A 1 71  ? 18.69462 38.49909  115.01358 1.000 25.41899 ? 71  HIS A N   1 
ATOM   661  C  CA  . HIS A 1 71  ? 17.94519 37.28398  115.31730 1.000 23.62609 ? 71  HIS A CA  1 
ATOM   662  C  C   . HIS A 1 71  ? 18.79377 36.30415  116.11501 1.000 22.35697 ? 71  HIS A C   1 
ATOM   663  O  O   . HIS A 1 71  ? 18.30885 35.68542  117.06828 1.000 22.78293 ? 71  HIS A O   1 
ATOM   664  C  CB  . HIS A 1 71  ? 17.44745 36.62626  114.03023 1.000 24.69366 ? 71  HIS A CB  1 
ATOM   665  C  CG  . HIS A 1 71  ? 16.29100 37.33252  113.39530 1.000 28.15271 ? 71  HIS A CG  1 
ATOM   666  N  ND1 . HIS A 1 71  ? 15.03029 37.34886  113.95277 1.000 30.70366 ? 71  HIS A ND1 1 
ATOM   667  C  CD2 . HIS A 1 71  ? 16.20108 38.03533  112.24161 1.000 31.54363 ? 71  HIS A CD2 1 
ATOM   668  C  CE1 . HIS A 1 71  ? 14.21578 38.03870  113.17407 1.000 33.11556 ? 71  HIS A CE1 1 
ATOM   669  N  NE2 . HIS A 1 71  ? 14.90120 38.46496  112.12853 1.000 33.93361 ? 71  HIS A NE2 1 
ATOM   670  N  N   . VAL A 1 72  ? 20.06771 36.15774  115.74471 1.000 21.87816 ? 72  VAL A N   1 
ATOM   671  C  CA  . VAL A 1 72  ? 20.94253 35.22982  116.45426 1.000 22.51384 ? 72  VAL A CA  1 
ATOM   672  C  C   . VAL A 1 72  ? 21.22955 35.73033  117.86578 1.000 22.44566 ? 72  VAL A C   1 
ATOM   673  O  O   . VAL A 1 72  ? 21.22867 34.94957  118.82447 1.000 22.16257 ? 72  VAL A O   1 
ATOM   674  C  CB  . VAL A 1 72  ? 22.22803 34.97410  115.64652 1.000 24.49873 ? 72  VAL A CB  1 
ATOM   675  C  CG1 . VAL A 1 72  ? 23.19921 34.12034  116.44476 1.000 25.93798 ? 72  VAL A CG1 1 
ATOM   676  C  CG2 . VAL A 1 72  ? 21.89535 34.31052  114.31294 1.000 26.15842 ? 72  VAL A CG2 1 
ATOM   677  N  N   . LYS A 1 73  ? 21.46086 37.03892  118.01775 1.000 23.59051 ? 73  LYS A N   1 
ATOM   678  C  CA  A LYS A 1 73  ? 21.76431 37.60417  119.33055 0.553 24.46501 ? 73  LYS A CA  1 
ATOM   679  C  CA  B LYS A 1 73  ? 21.77148 37.58224  119.33602 0.447 24.96085 ? 73  LYS A CA  1 
ATOM   680  C  C   . LYS A 1 73  ? 20.61558 37.38052  120.30979 1.000 23.55485 ? 73  LYS A C   1 
ATOM   681  O  O   . LYS A 1 73  ? 20.83397 36.99136  121.46372 1.000 23.47843 ? 73  LYS A O   1 
ATOM   682  C  CB  A LYS A 1 73  ? 22.06831 39.09547  119.18004 0.553 27.34438 ? 73  LYS A CB  1 
ATOM   683  C  CB  B LYS A 1 73  ? 22.15584 39.05807  119.22479 0.447 29.29986 ? 73  LYS A CB  1 
ATOM   684  C  CG  A LYS A 1 73  ? 22.39695 39.81206  120.47506 0.553 30.71291 ? 73  LYS A CG  1 
ATOM   685  C  CG  B LYS A 1 73  ? 23.57049 39.28127  118.71367 0.447 34.50421 ? 73  LYS A CG  1 
ATOM   686  C  CD  A LYS A 1 73  ? 22.50038 41.31381  120.24297 0.553 36.03158 ? 73  LYS A CD  1 
ATOM   687  C  CD  B LYS A 1 73  ? 23.81800 40.74093  118.37044 0.447 40.59488 ? 73  LYS A CD  1 
ATOM   688  C  CE  A LYS A 1 73  ? 23.69270 41.65612  119.36312 0.553 40.89055 ? 73  LYS A CE  1 
ATOM   689  C  CE  B LYS A 1 73  ? 25.28186 40.98776  118.03593 0.447 44.99260 ? 73  LYS A CE  1 
ATOM   690  N  NZ  A LYS A 1 73  ? 23.80180 43.12064  119.11129 0.553 44.44721 ? 73  LYS A NZ  1 
ATOM   691  N  NZ  B LYS A 1 73  ? 25.53198 42.39094  117.60095 0.447 47.57388 ? 73  LYS A NZ  1 
ATOM   692  N  N   . ARG A 1 74  ? 19.37716 37.63403  119.86249 1.000 23.09412 ? 74  ARG A N   1 
ATOM   693  C  CA  A ARG A 1 74  ? 18.20596 37.42105  120.71502 0.745 24.28957 ? 74  ARG A CA  1 
ATOM   694  C  CA  B ARG A 1 74  ? 18.22441 37.43031  120.73082 0.255 23.09978 ? 74  ARG A CA  1 
ATOM   695  C  C   . ARG A 1 74  ? 18.08776 35.96315  121.12626 1.000 21.85727 ? 74  ARG A C   1 
ATOM   696  O  O   . ARG A 1 74  ? 17.76990 35.65030  122.28068 1.000 21.64823 ? 74  ARG A O   1 
ATOM   697  C  CB  A ARG A 1 74  ? 16.92583 37.79556  119.96427 0.745 28.98619 ? 74  ARG A CB  1 
ATOM   698  C  CB  B ARG A 1 74  ? 16.96242 37.93068  120.02541 0.255 25.13748 ? 74  ARG A CB  1 
ATOM   699  C  CG  A ARG A 1 74  ? 16.61124 39.26568  119.84868 0.745 33.02602 ? 74  ARG A CG  1 
ATOM   700  C  CG  B ARG A 1 74  ? 15.88716 38.44703  120.95867 0.255 26.97780 ? 74  ARG A CG  1 
ATOM   701  C  CD  A ARG A 1 74  ? 15.29186 39.44808  119.10404 0.745 37.60132 ? 74  ARG A CD  1 
ATOM   702  C  CD  B ARG A 1 74  ? 14.51866 38.45744  120.29311 0.255 28.18333 ? 74  ARG A CD  1 
ATOM   703  N  NE  A ARG A 1 74  ? 14.12687 39.26239  119.97073 0.745 40.83178 ? 74  ARG A NE  1 
ATOM   704  N  NE  B ARG A 1 74  ? 14.58134 38.75569  118.86381 0.255 28.29618 ? 74  ARG A NE  1 
ATOM   705  C  CZ  A ARG A 1 74  ? 13.25937 38.25809  119.86866 0.745 39.23216 ? 74  ARG A CZ  1 
ATOM   706  C  CZ  B ARG A 1 74  ? 14.01728 38.00818  117.92010 0.255 28.41950 ? 74  ARG A CZ  1 
ATOM   707  N  NH1 A ARG A 1 74  ? 13.42084 37.32267  118.94160 0.745 36.81243 ? 74  ARG A NH1 1 
ATOM   708  N  NH1 B ARG A 1 74  ? 13.35211 36.90950  118.25216 0.255 27.87576 ? 74  ARG A NH1 1 
ATOM   709  N  NH2 A ARG A 1 74  ? 12.22894 38.18572  120.69953 0.745 37.77780 ? 74  ARG A NH2 1 
ATOM   710  N  NH2 B ARG A 1 74  ? 14.11805 38.35719  116.64472 0.255 29.84705 ? 74  ARG A NH2 1 
ATOM   711  N  N   . PHE A 1 75  ? 18.30633 35.05643  120.17724 1.000 19.95930 ? 75  PHE A N   1 
ATOM   712  C  CA  . PHE A 1 75  ? 18.21503 33.62962  120.45405 1.000 19.00991 ? 75  PHE A CA  1 
ATOM   713  C  C   . PHE A 1 75  ? 19.28794 33.20583  121.45061 1.000 18.91327 ? 75  PHE A C   1 
ATOM   714  O  O   . PHE A 1 75  ? 19.01509 32.45957  122.39811 1.000 18.86077 ? 75  PHE A O   1 
ATOM   715  C  CB  . PHE A 1 75  ? 18.35588 32.89245  119.12200 1.000 19.26241 ? 75  PHE A CB  1 
ATOM   716  C  CG  . PHE A 1 75  ? 18.15719 31.40824  119.20227 1.000 19.82538 ? 75  PHE A CG  1 
ATOM   717  C  CD1 . PHE A 1 75  ? 16.92452 30.87237  119.52682 1.000 21.34361 ? 75  PHE A CD1 1 
ATOM   718  C  CD2 . PHE A 1 75  ? 19.19011 30.54781  118.87834 1.000 21.42466 ? 75  PHE A CD2 1 
ATOM   719  C  CE1 . PHE A 1 75  ? 16.74157 29.50165  119.56841 1.000 22.97063 ? 75  PHE A CE1 1 
ATOM   720  C  CE2 . PHE A 1 75  ? 19.01339 29.18185  118.91682 1.000 23.52064 ? 75  PHE A CE2 1 
ATOM   721  C  CZ  . PHE A 1 75  ? 17.78912 28.65893  119.26096 1.000 23.50516 ? 75  PHE A CZ  1 
ATOM   722  N  N   A ARG A 1 76  ? 20.51806 33.68883  121.26398 0.646 19.61045 ? 76  ARG A N   1 
ATOM   723  N  N   B ARG A 1 76  ? 20.51783 33.68233  121.24125 0.354 19.48106 ? 76  ARG A N   1 
ATOM   724  C  CA  A ARG A 1 76  ? 21.60129 33.31460  122.16804 0.646 20.85662 ? 76  ARG A CA  1 
ATOM   725  C  CA  B ARG A 1 76  ? 21.61716 33.39970  122.15641 0.354 20.88990 ? 76  ARG A CA  1 
ATOM   726  C  C   A ARG A 1 76  ? 21.32824 33.78139  123.59087 0.646 20.16871 ? 76  ARG A C   1 
ATOM   727  C  C   B ARG A 1 76  ? 21.30926 33.90176  123.56330 0.354 20.02057 ? 76  ARG A C   1 
ATOM   728  O  O   A ARG A 1 76  ? 21.65740 33.07928  124.55367 0.646 20.32871 ? 76  ARG A O   1 
ATOM   729  O  O   B ARG A 1 76  ? 21.63798 33.23611  124.55226 0.354 20.41677 ? 76  ARG A O   1 
ATOM   730  C  CB  A ARG A 1 76  ? 22.92351 33.88004  121.65790 0.646 23.62691 ? 76  ARG A CB  1 
ATOM   731  C  CB  B ARG A 1 76  ? 22.89221 34.03860  121.60105 0.354 24.22733 ? 76  ARG A CB  1 
ATOM   732  C  CG  A ARG A 1 76  ? 23.45550 33.14621  120.44864 0.646 27.04335 ? 76  ARG A CG  1 
ATOM   733  C  CG  B ARG A 1 76  ? 24.11409 33.92857  122.48565 0.354 26.94559 ? 76  ARG A CG  1 
ATOM   734  C  CD  A ARG A 1 76  ? 24.96658 33.03850  120.49539 0.646 29.12320 ? 76  ARG A CD  1 
ATOM   735  C  CD  B ARG A 1 76  ? 24.79067 32.58311  122.30291 0.354 26.54420 ? 76  ARG A CD  1 
ATOM   736  N  NE  A ARG A 1 76  ? 25.42299 31.99798  121.41430 0.646 29.11433 ? 76  ARG A NE  1 
ATOM   737  N  NE  B ARG A 1 76  ? 24.43813 31.68729  123.39823 0.354 24.41815 ? 76  ARG A NE  1 
ATOM   738  C  CZ  A ARG A 1 76  ? 26.59440 31.37963  121.31306 0.646 29.92695 ? 76  ARG A CZ  1 
ATOM   739  C  CZ  B ARG A 1 76  ? 24.87004 30.43831  123.52807 0.354 24.74543 ? 76  ARG A CZ  1 
ATOM   740  N  NH1 A ARG A 1 76  ? 26.93640 30.44331  122.18935 0.646 33.07087 ? 76  ARG A NH1 1 
ATOM   741  N  NH1 B ARG A 1 76  ? 25.68277 29.90649  122.62376 0.354 26.36750 ? 76  ARG A NH1 1 
ATOM   742  N  NH2 A ARG A 1 76  ? 27.42462 31.69852  120.33206 0.646 30.60493 ? 76  ARG A NH2 1 
ATOM   743  N  NH2 B ARG A 1 76  ? 24.48804 29.72157  124.57404 0.354 24.13006 ? 76  ARG A NH2 1 
ATOM   744  N  N   A GLN A 1 77  ? 20.72627 34.96275  123.74587 0.646 20.27706 ? 77  GLN A N   1 
ATOM   745  N  N   B GLN A 1 77  ? 20.66755 35.06986  123.66870 0.354 20.42146 ? 77  GLN A N   1 
ATOM   746  C  CA  A GLN A 1 77  ? 20.38382 35.42450  125.08513 0.646 20.74025 ? 77  GLN A CA  1 
ATOM   747  C  CA  B GLN A 1 77  ? 20.24639 35.59694  124.96502 0.354 21.67400 ? 77  GLN A CA  1 
ATOM   748  C  C   A GLN A 1 77  ? 19.33742 34.52485  125.72307 0.646 20.23162 ? 77  GLN A C   1 
ATOM   749  C  C   B GLN A 1 77  ? 19.31681 34.62069  125.67907 0.354 20.44596 ? 77  GLN A C   1 
ATOM   750  O  O   A GLN A 1 77  ? 19.40611 34.24837  126.92729 0.646 21.26736 ? 77  GLN A O   1 
ATOM   751  O  O   B GLN A 1 77  ? 19.46372 34.36311  126.87937 0.354 21.52976 ? 77  GLN A O   1 
ATOM   752  C  CB  A GLN A 1 77  ? 19.91184 36.87677  125.06377 0.646 22.65853 ? 77  GLN A CB  1 
ATOM   753  C  CB  B GLN A 1 77  ? 19.55183 36.94571  124.75182 0.354 24.54976 ? 77  GLN A CB  1 
ATOM   754  C  CG  A GLN A 1 77  ? 19.72786 37.46808  126.46519 0.646 26.61167 ? 77  GLN A CG  1 
ATOM   755  C  CG  B GLN A 1 77  ? 18.93971 37.56817  125.99849 0.354 28.16008 ? 77  GLN A CG  1 
ATOM   756  C  CD  A GLN A 1 77  ? 21.02849 37.51381  127.25627 0.646 29.87047 ? 77  GLN A CD  1 
ATOM   757  C  CD  B GLN A 1 77  ? 18.57605 39.03036  125.79985 0.354 34.51291 ? 77  GLN A CD  1 
ATOM   758  O  OE1 A GLN A 1 77  ? 22.00102 38.13545  126.83064 0.646 35.26583 ? 77  GLN A OE1 1 
ATOM   759  O  OE1 B GLN A 1 77  ? 17.96235 39.40323  124.79731 0.354 37.81446 ? 77  GLN A OE1 1 
ATOM   760  N  NE2 A GLN A 1 77  ? 21.05385 36.84172  128.40440 0.646 28.95032 ? 77  GLN A NE2 1 
ATOM   761  N  NE2 B GLN A 1 77  ? 18.95208 39.86588  126.75926 0.354 39.12242 ? 77  GLN A NE2 1 
ATOM   762  N  N   . ALA A 1 78  ? 18.35915 34.05738  124.93910 1.000 19.53383 ? 78  ALA A N   1 
ATOM   763  C  CA  . ALA A 1 78  ? 17.37894 33.13422  125.50471 1.000 19.73681 ? 78  ALA A CA  1 
ATOM   764  C  C   . ALA A 1 78  ? 18.03426 31.83219  125.94751 1.000 17.95640 ? 78  ALA A C   1 
ATOM   765  O  O   . ALA A 1 78  ? 17.67739 31.28050  126.99464 1.000 18.12842 ? 78  ALA A O   1 
ATOM   766  C  CB  . ALA A 1 78  ? 16.25495 32.86594  124.50038 1.000 21.63448 ? 78  ALA A CB  1 
ATOM   767  N  N   . LEU A 1 79  ? 18.98448 31.31940  125.15686 1.000 17.39512 ? 79  LEU A N   1 
ATOM   768  C  CA  . LEU A 1 79  ? 19.71243 30.12349  125.56870 1.000 17.37016 ? 79  LEU A CA  1 
ATOM   769  C  C   . LEU A 1 79  ? 20.48601 30.37312  126.85567 1.000 17.67279 ? 79  LEU A C   1 
ATOM   770  O  O   . LEU A 1 79  ? 20.48611 29.52969  127.76042 1.000 18.62599 ? 79  LEU A O   1 
ATOM   771  C  CB  . LEU A 1 79  ? 20.67875 29.68369  124.47322 1.000 17.78090 ? 79  LEU A CB  1 
ATOM   772  C  CG  . LEU A 1 79  ? 20.08440 29.32539  123.11588 1.000 19.05989 ? 79  LEU A CG  1 
ATOM   773  C  CD1 . LEU A 1 79  ? 21.20939 29.08657  122.13116 1.000 20.69873 ? 79  LEU A CD1 1 
ATOM   774  C  CD2 . LEU A 1 79  ? 19.17592 28.10228  123.23210 1.000 19.63238 ? 79  LEU A CD2 1 
ATOM   775  N  N   . ASP A 1 80  ? 21.15527 31.52971  126.95012 1.000 17.75700 ? 80  ASP A N   1 
ATOM   776  C  CA  . ASP A 1 80  ? 21.92470 31.86655  128.14602 1.000 18.64740 ? 80  ASP A CA  1 
ATOM   777  C  C   . ASP A 1 80  ? 21.02193 32.01604  129.36444 1.000 19.53567 ? 80  ASP A C   1 
ATOM   778  O  O   . ASP A 1 80  ? 21.40381 31.63589  130.47792 1.000 21.61587 ? 80  ASP A O   1 
ATOM   779  C  CB  . ASP A 1 80  ? 22.69300 33.17174  127.91703 1.000 20.22438 ? 80  ASP A CB  1 
ATOM   780  C  CG  . ASP A 1 80  ? 23.84816 33.02338  126.93937 1.000 22.43446 ? 80  ASP A CG  1 
ATOM   781  O  OD1 . ASP A 1 80  ? 24.19577 31.88152  126.57358 1.000 22.42557 ? 80  ASP A OD1 1 
ATOM   782  O  OD2 . ASP A 1 80  ? 24.42223 34.06067  126.53930 1.000 25.67924 ? 80  ASP A OD2 1 
ATOM   783  N  N   . ASP A 1 81  ? 19.83349 32.59528  129.17464 1.000 19.65799 ? 81  ASP A N   1 
ATOM   784  C  CA  . ASP A 1 81  ? 18.91229 32.83096  130.28342 1.000 21.40022 ? 81  ASP A CA  1 
ATOM   785  C  C   . ASP A 1 81  ? 18.31431 31.53669  130.81524 1.000 20.93400 ? 81  ASP A C   1 
ATOM   786  O  O   . ASP A 1 81  ? 17.86741 31.48848  131.96695 1.000 22.94799 ? 81  ASP A O   1 
ATOM   787  C  CB  . ASP A 1 81  ? 17.76245 33.72826  129.82492 1.000 25.19826 ? 81  ASP A CB  1 
ATOM   788  C  CG  . ASP A 1 81  ? 18.17746 35.17089  129.63411 1.000 32.64842 ? 81  ASP A CG  1 
ATOM   789  O  OD1 . ASP A 1 81  ? 19.28602 35.54758  130.07366 1.000 36.64266 ? 81  ASP A OD1 1 
ATOM   790  O  OD2 . ASP A 1 81  ? 17.37685 35.93064  129.04756 1.000 37.66421 ? 81  ASP A OD2 1 
ATOM   791  N  N   . THR A 1 82  ? 18.25653 30.49135  129.98819 1.000 19.46263 ? 82  THR A N   1 
ATOM   792  C  CA  . THR A 1 82  ? 17.55976 29.26803  130.35582 1.000 19.26520 ? 82  THR A CA  1 
ATOM   793  C  C   . THR A 1 82  ? 18.47473 28.07574  130.57439 1.000 19.69108 ? 82  THR A C   1 
ATOM   794  O  O   . THR A 1 82  ? 18.03376 27.08699  131.16669 1.000 22.32390 ? 82  THR A O   1 
ATOM   795  C  CB  . THR A 1 82  ? 16.54377 28.88331  129.26669 1.000 19.95133 ? 82  THR A CB  1 
ATOM   796  O  OG1 . THR A 1 82  ? 17.23070 28.68989  128.02116 1.000 18.93559 ? 82  THR A OG1 1 
ATOM   797  C  CG2 . THR A 1 82  ? 15.47817 29.96686  129.10673 1.000 22.38163 ? 82  THR A CG2 1 
ATOM   798  N  N   . GLY A 1 83  ? 19.71225 28.12609  130.09274 1.000 19.02304 ? 83  GLY A N   1 
ATOM   799  C  CA  . GLY A 1 83  ? 20.56770 26.95708  130.11277 1.000 18.90930 ? 83  GLY A CA  1 
ATOM   800  C  C   . GLY A 1 83  ? 20.28190 25.94414  129.02387 1.000 18.27277 ? 83  GLY A C   1 
ATOM   801  O  O   . GLY A 1 83  ? 20.84511 24.84319  129.05655 1.000 20.26131 ? 83  GLY A O   1 
ATOM   802  N  N   . MET A 1 84  ? 19.42754 26.28033  128.06052 1.000 16.72821 ? 84  MET A N   1 
ATOM   803  C  CA  . MET A 1 84  ? 19.10580 25.37568  126.96883 1.000 16.35356 ? 84  MET A CA  1 
ATOM   804  C  C   . MET A 1 84  ? 20.28259 25.26766  126.00250 1.000 16.53439 ? 84  MET A C   1 
ATOM   805  O  O   . MET A 1 84  ? 21.03717 26.22248  125.79582 1.000 18.07491 ? 84  MET A O   1 
ATOM   806  C  CB  . MET A 1 84  ? 17.86887 25.89042  126.24110 1.000 16.95764 ? 84  MET A CB  1 
ATOM   807  C  CG  . MET A 1 84  ? 16.59478 25.76030  127.07093 1.000 18.54987 ? 84  MET A CG  1 
ATOM   808  S  SD  . MET A 1 84  ? 15.82732 24.13835  126.98329 1.000 21.11678 ? 84  MET A SD  1 
ATOM   809  C  CE  . MET A 1 84  ? 14.96265 24.27874  125.42197 1.000 23.81049 ? 84  MET A CE  1 
ATOM   810  N  N   A LYS A 1 85  ? 20.44440 24.07723  125.42544 0.650 16.16216 ? 85  LYS A N   1 
ATOM   811  N  N   B LYS A 1 85  ? 20.41939 24.09535  125.39371 0.350 16.38380 ? 85  LYS A N   1 
ATOM   812  C  CA  A LYS A 1 85  ? 21.49125 23.77668  124.45919 0.650 16.08997 ? 85  LYS A CA  1 
ATOM   813  C  CA  B LYS A 1 85  ? 21.49288 23.81270  124.45690 0.350 17.31549 ? 85  LYS A CA  1 
ATOM   814  C  C   A LYS A 1 85  ? 20.89713 23.68600  123.05801 0.650 14.84803 ? 85  LYS A C   1 
ATOM   815  C  C   B LYS A 1 85  ? 20.91374 23.59326  123.06387 0.350 16.32208 ? 85  LYS A C   1 
ATOM   816  O  O   A LYS A 1 85  ? 19.67834 23.61428  122.87817 0.650 15.30996 ? 85  LYS A O   1 
ATOM   817  O  O   B LYS A 1 85  ? 19.71216 23.38155  122.89323 0.350 16.92712 ? 85  LYS A O   1 
ATOM   818  C  CB  A LYS A 1 85  ? 22.16757 22.44474  124.80643 0.650 18.28251 ? 85  LYS A CB  1 
ATOM   819  C  CB  B LYS A 1 85  ? 22.28936 22.58532  124.91984 0.350 20.55111 ? 85  LYS A CB  1 
ATOM   820  C  CG  A LYS A 1 85  ? 22.81067 22.38755  126.18826 0.650 22.25367 ? 85  LYS A CG  1 
ATOM   821  C  CG  B LYS A 1 85  ? 22.90497 22.75646  126.31538 0.350 24.92177 ? 85  LYS A CG  1 
ATOM   822  C  CD  A LYS A 1 85  ? 23.76069 23.55256  126.41840 0.650 27.42481 ? 85  LYS A CD  1 
ATOM   823  C  CD  B LYS A 1 85  ? 23.75476 21.56184  126.73671 0.350 29.99414 ? 85  LYS A CD  1 
ATOM   824  C  CE  A LYS A 1 85  ? 24.33919 23.51585  127.82600 0.650 33.39580 ? 85  LYS A CE  1 
ATOM   825  C  CE  B LYS A 1 85  ? 24.30469 21.74328  128.15056 0.350 33.46973 ? 85  LYS A CE  1 
ATOM   826  N  NZ  A LYS A 1 85  ? 24.43825 24.87428  128.42631 0.650 38.36913 ? 85  LYS A NZ  1 
ATOM   827  N  NZ  B LYS A 1 85  ? 24.53663 20.44509  128.84699 0.350 35.06583 ? 85  LYS A NZ  1 
ATOM   828  N  N   . VAL A 1 86  ? 21.78369 23.66983  122.06334 1.000 15.33323 ? 86  VAL A N   1 
ATOM   829  C  CA  . VAL A 1 86  ? 21.41461 23.45228  120.66304 1.000 15.52146 ? 86  VAL A CA  1 
ATOM   830  C  C   . VAL A 1 86  ? 22.26555 22.30321  120.13508 1.000 15.64785 ? 86  VAL A C   1 
ATOM   831  O  O   . VAL A 1 86  ? 23.35737 22.53739  119.60079 1.000 17.73704 ? 86  VAL A O   1 
ATOM   832  C  CB  . VAL A 1 86  ? 21.61810 24.71858  119.81829 1.000 17.76241 ? 86  VAL A CB  1 
ATOM   833  C  CG1 . VAL A 1 86  ? 21.19344 24.47402  118.37383 1.000 19.41481 ? 86  VAL A CG1 1 
ATOM   834  C  CG2 . VAL A 1 86  ? 20.85182 25.88247  120.40291 1.000 20.15460 ? 86  VAL A CG2 1 
ATOM   835  N  N   . PRO A 1 87  ? 21.81790 21.05104  120.26686 1.000 14.66771 ? 87  PRO A N   1 
ATOM   836  C  CA  . PRO A 1 87  ? 22.69064 19.92417  119.90760 1.000 14.91885 ? 87  PRO A CA  1 
ATOM   837  C  C   . PRO A 1 87  ? 22.70147 19.60131  118.43024 1.000 13.93607 ? 87  PRO A C   1 
ATOM   838  O  O   . PRO A 1 87  ? 23.59284 18.86899  117.98318 1.000 15.01561 ? 87  PRO A O   1 
ATOM   839  C  CB  . PRO A 1 87  ? 22.11634 18.74798  120.71668 1.000 17.03679 ? 87  PRO A CB  1 
ATOM   840  C  CG  . PRO A 1 87  ? 21.21985 19.36816  121.75020 1.000 18.25361 ? 87  PRO A CG  1 
ATOM   841  C  CD  . PRO A 1 87  ? 20.70053 20.62955  121.12571 1.000 15.94283 ? 87  PRO A CD  1 
ATOM   842  N  N   . MET A 1 88  ? 21.74868 20.12324  117.66569 1.000 13.39825 ? 88  MET A N   1 
ATOM   843  C  CA  . MET A 1 88  ? 21.59698 19.75012  116.27062 1.000 13.39711 ? 88  MET A CA  1 
ATOM   844  C  C   . MET A 1 88  ? 20.99890 20.92268  115.51537 1.000 13.18649 ? 88  MET A C   1 
ATOM   845  O  O   . MET A 1 88  ? 20.19110 21.68573  116.05362 1.000 13.94864 ? 88  MET A O   1 
ATOM   846  C  CB  . MET A 1 88  ? 20.70352 18.50858  116.16459 1.000 13.48482 ? 88  MET A CB  1 
ATOM   847  C  CG  . MET A 1 88  ? 20.41146 18.01145  114.74320 1.000 13.99299 ? 88  MET A CG  1 
ATOM   848  S  SD  . MET A 1 88  ? 19.06758 18.85695  113.88199 1.000 14.53232 ? 88  MET A SD  1 
ATOM   849  C  CE  . MET A 1 88  ? 17.66636 17.92172  114.46703 1.000 16.94331 ? 88  MET A CE  1 
ATOM   850  N  N   . ALA A 1 89  ? 21.41220 21.06404  114.25825 1.000 13.10665 ? 89  ALA A N   1 
ATOM   851  C  CA  . ALA A 1 89  ? 20.79683 22.01778  113.35045 1.000 14.05799 ? 89  ALA A CA  1 
ATOM   852  C  C   . ALA A 1 89  ? 20.68952 21.37924  111.97691 1.000 12.70158 ? 89  ALA A C   1 
ATOM   853  O  O   . ALA A 1 89  ? 21.30267 20.34812  111.69505 1.000 13.37944 ? 89  ALA A O   1 
ATOM   854  C  CB  . ALA A 1 89  ? 21.59322 23.32262  113.26481 1.000 17.29819 ? 89  ALA A CB  1 
ATOM   855  N  N   . THR A 1 90  ? 19.92408 22.03370  111.11264 1.000 13.05201 ? 90  THR A N   1 
ATOM   856  C  CA  . THR A 1 90  ? 19.64005 21.50818  109.78781 1.000 13.18191 ? 90  THR A CA  1 
ATOM   857  C  C   . THR A 1 90  ? 19.31455 22.67205  108.85608 1.000 13.33316 ? 90  THR A C   1 
ATOM   858  O  O   . THR A 1 90  ? 19.22481 23.82696  109.27914 1.000 13.94563 ? 90  THR A O   1 
ATOM   859  C  CB  . THR A 1 90  ? 18.54404 20.43266  109.87293 1.000 14.08487 ? 90  THR A CB  1 
ATOM   860  O  OG1 . THR A 1 90  ? 18.34504 19.83493  108.59001 1.000 14.90736 ? 90  THR A OG1 1 
ATOM   861  C  CG2 . THR A 1 90  ? 17.22930 21.00067  110.38096 1.000 15.52179 ? 90  THR A CG2 1 
ATOM   862  N  N   . THR A 1 91  ? 19.17819 22.36210  107.56867 1.000 13.76392 ? 91  THR A N   1 
ATOM   863  C  CA  . THR A 1 91  ? 18.91607 23.35517  106.53170 1.000 13.45275 ? 91  THR A CA  1 
ATOM   864  C  C   . THR A 1 91  ? 17.51879 23.13331  105.97873 1.000 13.08302 ? 91  THR A C   1 
ATOM   865  O  O   . THR A 1 91  ? 17.11475 21.99369  105.74878 1.000 14.70170 ? 91  THR A O   1 
ATOM   866  C  CB  . THR A 1 91  ? 19.88510 23.20978  105.34364 1.000 14.88175 ? 91  THR A CB  1 
ATOM   867  O  OG1 . THR A 1 91  ? 21.18488 22.81407  105.79042 1.000 15.97865 ? 91  THR A OG1 1 
ATOM   868  C  CG2 . THR A 1 91  ? 20.00275 24.52183  104.58923 1.000 15.87612 ? 91  THR A CG2 1 
ATOM   869  N  N   . ASN A 1 92  ? 16.79415 24.21518  105.72060 1.000 12.42037 ? 92  ASN A N   1 
ATOM   870  C  CA  . ASN A 1 92  ? 15.54002 24.10529  104.98452 1.000 12.70614 ? 92  ASN A CA  1 
ATOM   871  C  C   . ASN A 1 92  ? 15.85848 24.14731  103.49038 1.000 12.80109 ? 92  ASN A C   1 
ATOM   872  O  O   . ASN A 1 92  ? 16.11679 25.21264  102.92464 1.000 13.76322 ? 92  ASN A O   1 
ATOM   873  C  CB  . ASN A 1 92  ? 14.55481 25.19437  105.38595 1.000 13.75391 ? 92  ASN A CB  1 
ATOM   874  C  CG  . ASN A 1 92  ? 13.20530 24.99672  104.73906 1.000 14.29730 ? 92  ASN A CG  1 
ATOM   875  O  OD1 . ASN A 1 92  ? 13.12766 24.58492  103.58031 1.000 14.66478 ? 92  ASN A OD1 1 
ATOM   876  N  ND2 . ASN A 1 92  ? 12.14324 25.25804  105.47244 1.000 15.69954 ? 92  ASN A ND2 1 
ATOM   877  N  N   . LEU A 1 93  ? 15.84749 22.97916  102.84985 1.000 12.76381 ? 93  LEU A N   1 
ATOM   878  C  CA  . LEU A 1 93  ? 15.99305 22.85217  101.40501 1.000 13.21830 ? 93  LEU A CA  1 
ATOM   879  C  C   . LEU A 1 93  ? 14.70409 22.33546  100.78350 1.000 13.10550 ? 93  LEU A C   1 
ATOM   880  O  O   . LEU A 1 93  ? 14.72610 21.56661  99.82411  1.000 14.24973 ? 93  LEU A O   1 
ATOM   881  C  CB  . LEU A 1 93  ? 17.18155 21.96421  101.03449 1.000 14.17299 ? 93  LEU A CB  1 
ATOM   882  C  CG  . LEU A 1 93  ? 18.53578 22.45389  101.55553 1.000 15.32561 ? 93  LEU A CG  1 
ATOM   883  C  CD1 . LEU A 1 93  ? 19.61426 21.44402  101.23100 1.000 17.12780 ? 93  LEU A CD1 1 
ATOM   884  C  CD2 . LEU A 1 93  ? 18.87945 23.81137  100.95952 1.000 16.72377 ? 93  LEU A CD2 1 
ATOM   885  N  N   . PHE A 1 94  ? 13.56705 22.73953  101.34587 1.000 13.25465 ? 94  PHE A N   1 
ATOM   886  C  CA  . PHE A 1 94  ? 12.29841 22.19371  100.88416 1.000 13.31879 ? 94  PHE A CA  1 
ATOM   887  C  C   . PHE A 1 94  ? 11.15976 23.19940  100.76377 1.000 13.42959 ? 94  PHE A C   1 
ATOM   888  O  O   . PHE A 1 94  ? 10.25014 22.95403  99.96962  1.000 14.17376 ? 94  PHE A O   1 
ATOM   889  C  CB  . PHE A 1 94  ? 11.84674 20.98953  101.74149 1.000 14.50859 ? 94  PHE A CB  1 
ATOM   890  C  CG  . PHE A 1 94  ? 11.86096 21.24475  103.22790 1.000 14.97332 ? 94  PHE A CG  1 
ATOM   891  C  CD1 . PHE A 1 94  ? 10.76019 21.79573  103.85320 1.000 16.43196 ? 94  PHE A CD1 1 
ATOM   892  C  CD2 . PHE A 1 94  ? 12.96556 20.91651  103.99833 1.000 15.60440 ? 94  PHE A CD2 1 
ATOM   893  C  CE1 . PHE A 1 94  ? 10.76146 22.02760  105.21546 1.000 18.34783 ? 94  PHE A CE1 1 
ATOM   894  C  CE2 . PHE A 1 94  ? 12.97158 21.14536  105.36668 1.000 16.72385 ? 94  PHE A CE2 1 
ATOM   895  C  CZ  . PHE A 1 94  ? 11.87033 21.70472  105.97187 1.000 18.25835 ? 94  PHE A CZ  1 
ATOM   896  N  N   . THR A 1 95  ? 11.16214 24.31938  101.48656 1.000 13.65743 ? 95  THR A N   1 
ATOM   897  C  CA  . THR A 1 95  ? 9.99069  25.19785  101.47712 1.000 14.74868 ? 95  THR A CA  1 
ATOM   898  C  C   . THR A 1 95  ? 9.95989  26.12991  100.27136 1.000 14.93440 ? 95  THR A C   1 
ATOM   899  O  O   . THR A 1 95  ? 8.92053  26.27816  99.61682  1.000 15.89683 ? 95  THR A O   1 
ATOM   900  C  CB  . THR A 1 95  ? 9.92796  26.00492  102.77327 1.000 16.50654 ? 95  THR A CB  1 
ATOM   901  O  OG1 . THR A 1 95  ? 9.74979  25.10886  103.86994 1.000 16.69483 ? 95  THR A OG1 1 
ATOM   902  C  CG2 . THR A 1 95  ? 8.79750  27.02015  102.73557 1.000 19.07285 ? 95  THR A CG2 1 
ATOM   903  N  N   . HIS A 1 96  ? 11.06809 26.79710  99.99398  1.000 14.99963 ? 96  HIS A N   1 
ATOM   904  C  CA  . HIS A 1 96  ? 11.06994 27.81470  98.95984  1.000 15.37803 ? 96  HIS A CA  1 
ATOM   905  C  C   . HIS A 1 96  ? 10.82253 27.17930  97.59294  1.000 14.49834 ? 96  HIS A C   1 
ATOM   906  O  O   . HIS A 1 96  ? 11.35898 26.10640  97.30252  1.000 14.17454 ? 96  HIS A O   1 
ATOM   907  C  CB  . HIS A 1 96  ? 12.40516 28.55187  98.94707  1.000 16.72789 ? 96  HIS A CB  1 
ATOM   908  C  CG  . HIS A 1 96  ? 12.38063 29.79937  98.12676  1.000 17.77585 ? 96  HIS A CG  1 
ATOM   909  N  ND1 . HIS A 1 96  ? 12.38181 29.77782  96.74828  1.000 17.57952 ? 96  HIS A ND1 1 
ATOM   910  C  CD2 . HIS A 1 96  ? 12.30814 31.10223  98.48739  1.000 20.49507 ? 96  HIS A CD2 1 
ATOM   911  C  CE1 . HIS A 1 96  ? 12.32526 31.01746  96.29537  1.000 19.07919 ? 96  HIS A CE1 1 
ATOM   912  N  NE2 . HIS A 1 96  ? 12.28058 31.83935  97.32938  1.000 20.96799 ? 96  HIS A NE2 1 
ATOM   913  N  N   . PRO A 1 97  ? 10.03365 27.82895  96.72708  1.000 15.18666 ? 97  PRO A N   1 
ATOM   914  C  CA  . PRO A 1 97  ? 9.77558  27.27040  95.38578  1.000 15.12518 ? 97  PRO A CA  1 
ATOM   915  C  C   . PRO A 1 97  ? 11.01508 26.92663  94.57375  1.000 14.14335 ? 97  PRO A C   1 
ATOM   916  O  O   . PRO A 1 97  ? 10.93167 26.05190  93.70138  1.000 14.93004 ? 97  PRO A O   1 
ATOM   917  C  CB  . PRO A 1 97  ? 8.91879  28.34843  94.70700  1.000 17.96247 ? 97  PRO A CB  1 
ATOM   918  C  CG  . PRO A 1 97  ? 8.33272  29.13173  95.80848  1.000 20.33419 ? 97  PRO A CG  1 
ATOM   919  C  CD  . PRO A 1 97  ? 9.24203  29.04308  96.98913  1.000 17.51079 ? 97  PRO A CD  1 
ATOM   920  N  N   . VAL A 1 98  ? 12.16312 27.55771  94.83811  1.000 14.13601 ? 98  VAL A N   1 
ATOM   921  C  CA  . VAL A 1 98  ? 13.36143 27.22305  94.07204  1.000 14.81085 ? 98  VAL A CA  1 
ATOM   922  C  C   . VAL A 1 98  ? 13.74183 25.75801  94.24337  1.000 13.95905 ? 98  VAL A C   1 
ATOM   923  O  O   . VAL A 1 98  ? 14.36682 25.16629  93.35134  1.000 14.46949 ? 98  VAL A O   1 
ATOM   924  C  CB  . VAL A 1 98  ? 14.52499 28.17818  94.41105  1.000 16.61712 ? 98  VAL A CB  1 
ATOM   925  C  CG1 . VAL A 1 98  ? 15.07575 27.90008  95.81296  1.000 17.14499 ? 98  VAL A CG1 1 
ATOM   926  C  CG2 . VAL A 1 98  ? 15.62808 28.07254  93.35979  1.000 19.42403 ? 98  VAL A CG2 1 
ATOM   927  N  N   . PHE A 1 99  ? 13.35867 25.14314  95.36985  1.000 12.96128 ? 99  PHE A N   1 
ATOM   928  C  CA  . PHE A 1 99  ? 13.67947 23.75101  95.66675  1.000 12.80948 ? 99  PHE A CA  1 
ATOM   929  C  C   . PHE A 1 99  ? 12.60236 22.77206  95.20610  1.000 12.40376 ? 99  PHE A C   1 
ATOM   930  O  O   . PHE A 1 99  ? 12.58376 21.62839  95.66821  1.000 12.74259 ? 99  PHE A O   1 
ATOM   931  C  CB  . PHE A 1 99  ? 13.98029 23.57980  97.16044  1.000 13.62447 ? 99  PHE A CB  1 
ATOM   932  C  CG  . PHE A 1 99  ? 15.14380 24.40806  97.62344  1.000 14.51607 ? 99  PHE A CG  1 
ATOM   933  C  CD1 . PHE A 1 99  ? 16.37029 24.30502  96.98306  1.000 15.87895 ? 99  PHE A CD1 1 
ATOM   934  C  CD2 . PHE A 1 99  ? 15.01867 25.29733  98.67900  1.000 15.72664 ? 99  PHE A CD2 1 
ATOM   935  C  CE1 . PHE A 1 99  ? 17.44718 25.06084  97.38691  1.000 17.36423 ? 99  PHE A CE1 1 
ATOM   936  C  CE2 . PHE A 1 99  ? 16.10514 26.05545  99.09652  1.000 17.31955 ? 99  PHE A CE2 1 
ATOM   937  C  CZ  . PHE A 1 99  ? 17.31262 25.93589  98.44207  1.000 17.65961 ? 99  PHE A CZ  1 
ATOM   938  N  N   . LYS A 1 100 ? 11.73833 23.17284  94.27032  1.000 12.31908 ? 100 LYS A N   1 
ATOM   939  C  CA  . LYS A 1 100 ? 10.61702 22.31219  93.89713  1.000 12.39802 ? 100 LYS A CA  1 
ATOM   940  C  C   . LYS A 1 100 ? 11.05233 20.97759  93.28523  1.000 12.28664 ? 100 LYS A C   1 
ATOM   941  O  O   . LYS A 1 100 ? 10.29776 20.00518  93.35036  1.000 13.72191 ? 100 LYS A O   1 
ATOM   942  C  CB  . LYS A 1 100 ? 9.64024  23.05750  92.99096  1.000 13.53418 ? 100 LYS A CB  1 
ATOM   943  C  CG  . LYS A 1 100 ? 10.21044 23.44756  91.64340  1.000 14.26894 ? 100 LYS A CG  1 
ATOM   944  C  CD  . LYS A 1 100 ? 9.27871  24.42664  90.94280  1.000 16.28920 ? 100 LYS A CD  1 
ATOM   945  C  CE  . LYS A 1 100 ? 9.69200  24.69113  89.50270  1.000 18.12943 ? 100 LYS A CE  1 
ATOM   946  N  NZ  . LYS A 1 100 ? 10.86915 25.60183  89.40352  1.000 19.91679 ? 100 LYS A NZ  1 
ATOM   947  N  N   . ASP A 1 101 ? 12.24199 20.90298  92.68340  1.000 11.68592 ? 101 ASP A N   1 
ATOM   948  C  CA  . ASP A 1 101 ? 12.77036 19.64322  92.17007  1.000 12.31981 ? 101 ASP A CA  1 
ATOM   949  C  C   . ASP A 1 101 ? 13.94679 19.12878  92.99157  1.000 12.41062 ? 101 ASP A C   1 
ATOM   950  O  O   . ASP A 1 101 ? 14.67835 18.24346  92.53898  1.000 13.96364 ? 101 ASP A O   1 
ATOM   951  C  CB  . ASP A 1 101 ? 13.16544 19.74706  90.69425  1.000 13.51563 ? 101 ASP A CB  1 
ATOM   952  C  CG  . ASP A 1 101 ? 13.49872 18.38547  90.08990  1.000 14.70860 ? 101 ASP A CG  1 
ATOM   953  O  OD1 . ASP A 1 101 ? 12.76111 17.42004  90.39063  1.000 15.51317 ? 101 ASP A OD1 1 
ATOM   954  O  OD2 . ASP A 1 101 ? 14.51683 18.27534  89.37506  1.000 16.80665 ? 101 ASP A OD2 1 
ATOM   955  N  N   . GLY A 1 102 ? 14.14410 19.65741  94.18847  1.000 12.62809 ? 102 GLY A N   1 
ATOM   956  C  CA  . GLY A 1 102 ? 15.24445 19.24611  95.03322  1.000 13.08010 ? 102 GLY A CA  1 
ATOM   957  C  C   . GLY A 1 102 ? 16.22085 20.37538  95.29054  1.000 12.61822 ? 102 GLY A C   1 
ATOM   958  O  O   . GLY A 1 102 ? 16.14000 21.46349  94.72062  1.000 13.60375 ? 102 GLY A O   1 
ATOM   959  N  N   . GLY A 1 103 ? 17.15467 20.07250  96.18494  1.000 13.00389 ? 103 GLY A N   1 
ATOM   960  C  CA  . GLY A 1 103 ? 18.30358 20.90645  96.46686  1.000 13.44250 ? 103 GLY A CA  1 
ATOM   961  C  C   . GLY A 1 103 ? 19.54753 20.26713  95.88893  1.000 13.02552 ? 103 GLY A C   1 
ATOM   962  O  O   . GLY A 1 103 ? 20.00282 20.64298  94.80862  1.000 14.93159 ? 103 GLY A O   1 
ATOM   963  N  N   . PHE A 1 104 ? 20.07525 19.25452  96.57995  1.000 12.62443 ? 104 PHE A N   1 
ATOM   964  C  CA  . PHE A 1 104 ? 21.30613 18.61875  96.12941  1.000 13.18689 ? 104 PHE A CA  1 
ATOM   965  C  C   . PHE A 1 104 ? 21.14464 17.85057  94.82417  1.000 12.52655 ? 104 PHE A C   1 
ATOM   966  O  O   . PHE A 1 104 ? 22.14935 17.62859  94.13702  1.000 13.78846 ? 104 PHE A O   1 
ATOM   967  C  CB  . PHE A 1 104 ? 21.86001 17.66266  97.18603  1.000 14.30431 ? 104 PHE A CB  1 
ATOM   968  C  CG  . PHE A 1 104 ? 22.26010 18.31680  98.48420  1.000 15.57597 ? 104 PHE A CG  1 
ATOM   969  C  CD1 . PHE A 1 104 ? 22.52555 19.67553  98.57517  1.000 16.94703 ? 104 PHE A CD1 1 
ATOM   970  C  CD2 . PHE A 1 104 ? 22.40780 17.54250  99.61584  1.000 18.49368 ? 104 PHE A CD2 1 
ATOM   971  C  CE1 . PHE A 1 104 ? 22.91116 20.24571  99.77785  1.000 18.80757 ? 104 PHE A CE1 1 
ATOM   972  C  CE2 . PHE A 1 104 ? 22.78557 18.11105  100.81395 1.000 20.91987 ? 104 PHE A CE2 1 
ATOM   973  C  CZ  . PHE A 1 104 ? 23.03481 19.46152  100.89186 1.000 20.46099 ? 104 PHE A CZ  1 
ATOM   974  N  N   . THR A 1 105 ? 19.92644 17.41603  94.48170  1.000 11.90899 ? 105 THR A N   1 
ATOM   975  C  CA  . THR A 1 105 ? 19.69083 16.62030  93.27923  1.000 12.13489 ? 105 THR A CA  1 
ATOM   976  C  C   . THR A 1 105 ? 18.71293 17.27774  92.31461  1.000 12.01176 ? 105 THR A C   1 
ATOM   977  O  O   . THR A 1 105 ? 18.17442 16.60153  91.43723  1.000 12.64406 ? 105 THR A O   1 
ATOM   978  C  CB  . THR A 1 105 ? 19.26902 15.17689  93.59443  1.000 12.67052 ? 105 THR A CB  1 
ATOM   979  O  OG1 . THR A 1 105 ? 17.92520 15.13764  94.09669  1.000 12.70842 ? 105 THR A OG1 1 
ATOM   980  C  CG2 . THR A 1 105 ? 20.21690 14.51325  94.56829  1.000 14.21389 ? 105 THR A CG2 1 
ATOM   981  N  N   . ALA A 1 106 ? 18.47839 18.57970  92.45299  1.000 12.23281 ? 106 ALA A N   1 
ATOM   982  C  CA  . ALA A 1 106 ? 17.71905 19.31074  91.44824  1.000 12.69018 ? 106 ALA A CA  1 
ATOM   983  C  C   . ALA A 1 106 ? 18.33778 19.09470  90.07537  1.000 12.03722 ? 106 ALA A C   1 
ATOM   984  O  O   . ALA A 1 106 ? 19.56344 19.04643  89.92858  1.000 12.89565 ? 106 ALA A O   1 
ATOM   985  C  CB  . ALA A 1 106 ? 17.78281 20.80439  91.76400  1.000 13.99126 ? 106 ALA A CB  1 
ATOM   986  N  N   . ASN A 1 107 ? 17.49125 19.00102  89.04728  1.000 12.29877 ? 107 ASN A N   1 
ATOM   987  C  CA  . ASN A 1 107 ? 18.05130 18.86757  87.70589  1.000 12.74945 ? 107 ASN A CA  1 
ATOM   988  C  C   . ASN A 1 107 ? 18.85302 20.09766  87.30190  1.000 13.02734 ? 107 ASN A C   1 
ATOM   989  O  O   . ASN A 1 107 ? 19.85294 19.97560  86.59240  1.000 14.26363 ? 107 ASN A O   1 
ATOM   990  C  CB  . ASN A 1 107 ? 16.96600 18.57872  86.66680  1.000 12.90285 ? 107 ASN A CB  1 
ATOM   991  C  CG  . ASN A 1 107 ? 16.43740 17.15918  86.75152  1.000 12.78314 ? 107 ASN A CG  1 
ATOM   992  O  OD1 . ASN A 1 107 ? 16.90803 16.35396  87.55082  1.000 12.97238 ? 107 ASN A OD1 1 
ATOM   993  N  ND2 . ASN A 1 107 ? 15.46815 16.83921  85.91007  1.000 13.28055 ? 107 ASN A ND2 1 
ATOM   994  N  N   . ASP A 1 108 ? 18.43677 21.28331  87.74039  1.000 13.27831 ? 108 ASP A N   1 
ATOM   995  C  CA  . ASP A 1 108 ? 19.14547 22.51504  87.40594  1.000 14.01680 ? 108 ASP A CA  1 
ATOM   996  C  C   . ASP A 1 108 ? 20.42229 22.62911  88.23341  1.000 14.08435 ? 108 ASP A C   1 
ATOM   997  O  O   . ASP A 1 108 ? 20.38215 22.64589  89.47067  1.000 14.48718 ? 108 ASP A O   1 
ATOM   998  C  CB  . ASP A 1 108 ? 18.24496 23.71525  87.67742  1.000 15.02518 ? 108 ASP A CB  1 
ATOM   999  C  CG  . ASP A 1 108 ? 17.13005 23.83641  86.66827  1.000 17.75382 ? 108 ASP A CG  1 
ATOM   1000 O  OD1 . ASP A 1 108 ? 17.42571 23.88813  85.45833  1.000 19.61491 ? 108 ASP A OD1 1 
ATOM   1001 O  OD2 . ASP A 1 108 ? 15.95027 23.85036  87.08398  1.000 20.36383 ? 108 ASP A OD2 1 
ATOM   1002 N  N   . ARG A 1 109 ? 21.55421 22.76826  87.54631  1.000 14.63407 ? 109 ARG A N   1 
ATOM   1003 C  CA  . ARG A 1 109 ? 22.83853 22.82522  88.23219  1.000 15.12437 ? 109 ARG A CA  1 
ATOM   1004 C  C   . ARG A 1 109 ? 22.95670 24.05472  89.12809  1.000 15.19300 ? 109 ARG A C   1 
ATOM   1005 O  O   . ARG A 1 109 ? 23.55299 23.98186  90.20595  1.000 15.86269 ? 109 ARG A O   1 
ATOM   1006 C  CB  . ARG A 1 109 ? 23.96745 22.79423  87.20253  1.000 16.50560 ? 109 ARG A CB  1 
ATOM   1007 C  CG  . ARG A 1 109 ? 25.36351 22.90172  87.79114  1.000 17.65775 ? 109 ARG A CG  1 
ATOM   1008 C  CD  . ARG A 1 109 ? 26.40735 22.66458  86.71886  1.000 19.42106 ? 109 ARG A CD  1 
ATOM   1009 N  NE  . ARG A 1 109 ? 27.76332 22.91756  87.19946  1.000 20.85070 ? 109 ARG A NE  1 
ATOM   1010 C  CZ  . ARG A 1 109 ? 28.35362 24.10734  87.19939  1.000 22.73186 ? 109 ARG A CZ  1 
ATOM   1011 N  NH1 . ARG A 1 109 ? 27.71311 25.17628  86.74756  1.000 24.32058 ? 109 ARG A NH1 1 
ATOM   1012 N  NH2 . ARG A 1 109 ? 29.58872 24.22224  87.66082  1.000 23.99156 ? 109 ARG A NH2 1 
ATOM   1013 N  N   A ASP A 1 110 ? 22.42659 25.20099  88.68961  0.774 15.51631 ? 110 ASP A N   1 
ATOM   1014 N  N   B ASP A 1 110 ? 22.40653 25.19315  88.69214  0.226 15.37310 ? 110 ASP A N   1 
ATOM   1015 C  CA  A ASP A 1 110 ? 22.55557 26.40496  89.50437  0.774 16.58051 ? 110 ASP A CA  1 
ATOM   1016 C  CA  B ASP A 1 110 ? 22.50510 26.41948  89.48043  0.226 16.10959 ? 110 ASP A CA  1 
ATOM   1017 C  C   A ASP A 1 110 ? 21.81840 26.27082  90.83426  0.774 15.78862 ? 110 ASP A C   1 
ATOM   1018 C  C   B ASP A 1 110 ? 21.81186 26.26769  90.82578  0.226 15.63277 ? 110 ASP A C   1 
ATOM   1019 O  O   A ASP A 1 110 ? 22.27697 26.79479  91.85628  0.774 16.94568 ? 110 ASP A O   1 
ATOM   1020 O  O   B ASP A 1 110 ? 22.27524 26.80320  91.83987  0.226 16.78009 ? 110 ASP A O   1 
ATOM   1021 C  CB  A ASP A 1 110 ? 22.18358 27.67696  88.72839  0.774 18.66969 ? 110 ASP A CB  1 
ATOM   1022 C  CB  B ASP A 1 110 ? 21.89369 27.58252  88.70550  0.226 17.80341 ? 110 ASP A CB  1 
ATOM   1023 C  CG  A ASP A 1 110 ? 20.79432 27.64168  88.09776  0.774 21.47370 ? 110 ASP A CG  1 
ATOM   1024 C  CG  B ASP A 1 110 ? 22.79169 28.07183  87.59505  0.226 21.55085 ? 110 ASP A CG  1 
ATOM   1025 O  OD1 A ASP A 1 110 ? 20.04522 26.65763  88.25330  0.774 20.85068 ? 110 ASP A OD1 1 
ATOM   1026 O  OD1 B ASP A 1 110 ? 23.98185 27.70015  87.58232  0.226 22.74158 ? 110 ASP A OD1 1 
ATOM   1027 O  OD2 A ASP A 1 110 ? 20.45075 28.64278  87.42588  0.774 26.03889 ? 110 ASP A OD2 1 
ATOM   1028 O  OD2 B ASP A 1 110 ? 22.30590 28.81685  86.72451  0.226 24.73524 ? 110 ASP A OD2 1 
ATOM   1029 N  N   . VAL A 1 111 ? 20.69358 25.54581  90.84952  1.000 14.74514 ? 111 VAL A N   1 
ATOM   1030 C  CA  . VAL A 1 111 ? 19.98872 25.29541  92.10447  1.000 14.28868 ? 111 VAL A CA  1 
ATOM   1031 C  C   . VAL A 1 111 ? 20.81975 24.41412  93.02439  1.000 13.73740 ? 111 VAL A C   1 
ATOM   1032 O  O   . VAL A 1 111 ? 20.85181 24.63066  94.24062  1.000 14.45651 ? 111 VAL A O   1 
ATOM   1033 C  CB  . VAL A 1 111 ? 18.59557 24.69623  91.83163  1.000 14.88983 ? 111 VAL A CB  1 
ATOM   1034 C  CG1 . VAL A 1 111 ? 17.90858 24.29777  93.13830  1.000 15.89560 ? 111 VAL A CG1 1 
ATOM   1035 C  CG2 . VAL A 1 111 ? 17.73593 25.68766  91.05737  1.000 16.13957 ? 111 VAL A CG2 1 
ATOM   1036 N  N   . ARG A 1 112 ? 21.49580 23.40217  92.46970  1.000 13.43704 ? 112 ARG A N   1 
ATOM   1037 C  CA  . ARG A 1 112 ? 22.33241 22.53871  93.29962  1.000 13.24931 ? 112 ARG A CA  1 
ATOM   1038 C  C   . ARG A 1 112 ? 23.45385 23.32758  93.96481  1.000 13.86226 ? 112 ARG A C   1 
ATOM   1039 O  O   . ARG A 1 112 ? 23.77014 23.10368  95.14117  1.000 14.67539 ? 112 ARG A O   1 
ATOM   1040 C  CB  . ARG A 1 112 ? 22.91058 21.37623  92.48898  1.000 13.43933 ? 112 ARG A CB  1 
ATOM   1041 C  CG  . ARG A 1 112 ? 21.86515 20.49820  91.84894  1.000 13.36537 ? 112 ARG A CG  1 
ATOM   1042 C  CD  . ARG A 1 112 ? 22.41545 19.18230  91.33188  1.000 13.36248 ? 112 ARG A CD  1 
ATOM   1043 N  NE  . ARG A 1 112 ? 23.44448 19.29053  90.29483  1.000 14.00393 ? 112 ARG A NE  1 
ATOM   1044 C  CZ  . ARG A 1 112 ? 23.21675 19.28926  88.98183  1.000 13.86172 ? 112 ARG A CZ  1 
ATOM   1045 N  NH1 . ARG A 1 112 ? 21.97776 19.26252  88.50859  1.000 14.16318 ? 112 ARG A NH1 1 
ATOM   1046 N  NH2 . ARG A 1 112 ? 24.23861 19.34677  88.13215  1.000 14.89250 ? 112 ARG A NH2 1 
ATOM   1047 N  N   . ARG A 1 113 ? 24.07589 24.25152  93.22423  1.000 14.25391 ? 113 ARG A N   1 
ATOM   1048 C  CA  . ARG A 1 113 ? 25.14047 25.07435  93.79528  1.000 14.68816 ? 113 ARG A CA  1 
ATOM   1049 C  C   . ARG A 1 113 ? 24.60079 25.98660  94.89082  1.000 14.70896 ? 113 ARG A C   1 
ATOM   1050 O  O   . ARG A 1 113 ? 25.23614 26.14654  95.94066  1.000 15.68401 ? 113 ARG A O   1 
ATOM   1051 C  CB  . ARG A 1 113 ? 25.84301 25.86348  92.68585  1.000 15.81177 ? 113 ARG A CB  1 
ATOM   1052 C  CG  . ARG A 1 113 ? 26.61232 24.95845  91.74255  1.000 16.45649 ? 113 ARG A CG  1 
ATOM   1053 C  CD  . ARG A 1 113 ? 27.23490 25.68729  90.54847  1.000 17.62757 ? 113 ARG A CD  1 
ATOM   1054 N  NE  . ARG A 1 113 ? 28.29639 26.64443  90.88209  1.000 18.63182 ? 113 ARG A NE  1 
ATOM   1055 C  CZ  . ARG A 1 113 ? 29.58091 26.32386  91.02408  1.000 20.02691 ? 113 ARG A CZ  1 
ATOM   1056 N  NH1 . ARG A 1 113 ? 29.97210 25.06004  90.91062  1.000 20.49708 ? 113 ARG A NH1 1 
ATOM   1057 N  NH2 . ARG A 1 113 ? 30.47721 27.27175  91.29145  1.000 21.24116 ? 113 ARG A NH2 1 
ATOM   1058 N  N   . TYR A 1 114 ? 23.42370 26.58004  94.66909  1.000 15.04054 ? 114 TYR A N   1 
ATOM   1059 C  CA  . TYR A 1 114 ? 22.79796 27.41771  95.68939  1.000 14.76244 ? 114 TYR A CA  1 
ATOM   1060 C  C   . TYR A 1 114 ? 22.47645 26.61479  96.94486  1.000 14.48693 ? 114 TYR A C   1 
ATOM   1061 O  O   . TYR A 1 114 ? 22.71270 27.07811  98.06886  1.000 15.29246 ? 114 TYR A O   1 
ATOM   1062 C  CB  . TYR A 1 114 ? 21.53659 28.05988  95.11540  1.000 16.04438 ? 114 TYR A CB  1 
ATOM   1063 C  CG  . TYR A 1 114 ? 20.72856 28.84466  96.11341  1.000 17.00739 ? 114 TYR A CG  1 
ATOM   1064 C  CD1 . TYR A 1 114 ? 21.18534 30.05731  96.61001  1.000 19.61786 ? 114 TYR A CD1 1 
ATOM   1065 C  CD2 . TYR A 1 114 ? 19.50497 28.37198  96.56405  1.000 17.79597 ? 114 TYR A CD2 1 
ATOM   1066 C  CE1 . TYR A 1 114 ? 20.44081 30.77815  97.52765  1.000 21.19196 ? 114 TYR A CE1 1 
ATOM   1067 C  CE2 . TYR A 1 114 ? 18.75872 29.07943  97.47826  1.000 19.88756 ? 114 TYR A CE2 1 
ATOM   1068 C  CZ  . TYR A 1 114 ? 19.22799 30.27822  97.96185  1.000 21.53152 ? 114 TYR A CZ  1 
ATOM   1069 O  OH  . TYR A 1 114 ? 18.46878 30.97683  98.87454  1.000 25.16414 ? 114 TYR A OH  1 
ATOM   1070 N  N   . ALA A 1 115 ? 21.93895 25.40350  96.77112  1.000 14.15542 ? 115 ALA A N   1 
ATOM   1071 C  CA  . ALA A 1 115 ? 21.62672 24.55490  97.91598  1.000 13.81670 ? 115 ALA A CA  1 
ATOM   1072 C  C   . ALA A 1 115 ? 22.86163 24.30009  98.76951  1.000 13.74955 ? 115 ALA A C   1 
ATOM   1073 O  O   . ALA A 1 115 ? 22.79137 24.33431  100.00529 1.000 14.50248 ? 115 ALA A O   1 
ATOM   1074 C  CB  . ALA A 1 115 ? 21.03842 23.23354  97.42688  1.000 14.30786 ? 115 ALA A CB  1 
ATOM   1075 N  N   . LEU A 1 116 ? 24.00212 24.02950  98.13001  1.000 13.73935 ? 116 LEU A N   1 
ATOM   1076 C  CA  . LEU A 1 116 ? 25.23637 23.81106  98.87702  1.000 14.51696 ? 116 LEU A CA  1 
ATOM   1077 C  C   . LEU A 1 116 ? 25.65798 25.06443  99.63122  1.000 14.68790 ? 116 LEU A C   1 
ATOM   1078 O  O   . LEU A 1 116 ? 26.06350 24.98990  100.79428 1.000 15.47843 ? 116 LEU A O   1 
ATOM   1079 C  CB  . LEU A 1 116 ? 26.35016 23.33573  97.94551  1.000 16.19345 ? 116 LEU A CB  1 
ATOM   1080 C  CG  . LEU A 1 116 ? 26.29710 21.84415  97.61916  1.000 19.09342 ? 116 LEU A CG  1 
ATOM   1081 C  CD1 . LEU A 1 116 ? 27.16128 21.52156  96.41373  1.000 21.64721 ? 116 LEU A CD1 1 
ATOM   1082 C  CD2 . LEU A 1 116 ? 26.73296 21.02257  98.83134  1.000 21.11308 ? 116 LEU A CD2 1 
ATOM   1083 N  N   . ARG A 1 117 ? 25.58665 26.22824  98.97795  1.000 14.97601 ? 117 ARG A N   1 
ATOM   1084 C  CA  . ARG A 1 117 ? 25.98888 27.46153  99.64793  1.000 15.53547 ? 117 ARG A CA  1 
ATOM   1085 C  C   . ARG A 1 117 ? 25.07755 27.78523  100.82970 1.000 15.44363 ? 117 ARG A C   1 
ATOM   1086 O  O   . ARG A 1 117 ? 25.54722 28.25221  101.87477 1.000 16.40567 ? 117 ARG A O   1 
ATOM   1087 C  CB  . ARG A 1 117 ? 26.00768 28.61007  98.64560  1.000 16.99834 ? 117 ARG A CB  1 
ATOM   1088 C  CG  . ARG A 1 117 ? 27.11616 28.50874  97.58845  1.000 18.90156 ? 117 ARG A CG  1 
ATOM   1089 C  CD  . ARG A 1 117 ? 28.51637 28.70097  98.19125  1.000 20.32059 ? 117 ARG A CD  1 
ATOM   1090 N  NE  . ARG A 1 117 ? 28.62750 29.96732  98.91704  1.000 21.49454 ? 117 ARG A NE  1 
ATOM   1091 C  CZ  . ARG A 1 117 ? 28.80335 31.15700  98.35394  1.000 23.40568 ? 117 ARG A CZ  1 
ATOM   1092 N  NH1 . ARG A 1 117 ? 28.97168 31.27582  97.04235  1.000 24.54049 ? 117 ARG A NH1 1 
ATOM   1093 N  NH2 . ARG A 1 117 ? 28.83962 32.22941  99.12222  1.000 25.88054 ? 117 ARG A NH2 1 
ATOM   1094 N  N   . LYS A 1 118 ? 23.76985 27.55648  100.68042 1.000 14.88644 ? 118 LYS A N   1 
ATOM   1095 C  CA  . LYS A 1 118 ? 22.83571 27.79616  101.77989 1.000 14.76662 ? 118 LYS A CA  1 
ATOM   1096 C  C   . LYS A 1 118 ? 23.14686 26.88191  102.96066 1.000 14.55120 ? 118 LYS A C   1 
ATOM   1097 O  O   . LYS A 1 118 ? 23.09294 27.30636  104.12147 1.000 15.40982 ? 118 LYS A O   1 
ATOM   1098 C  CB  . LYS A 1 118 ? 21.40397 27.58174  101.27425 1.000 15.08288 ? 118 LYS A CB  1 
ATOM   1099 C  CG  . LYS A 1 118 ? 20.29329 27.98480  102.23223 1.000 15.33040 ? 118 LYS A CG  1 
ATOM   1100 C  CD  . LYS A 1 118 ? 18.92655 27.85103  101.54088 1.000 15.91932 ? 118 LYS A CD  1 
ATOM   1101 C  CE  . LYS A 1 118 ? 17.78292 28.52161  102.30447 1.000 16.25926 ? 118 LYS A CE  1 
ATOM   1102 N  NZ  . LYS A 1 118 ? 17.35343 27.77509  103.52282 1.000 15.59990 ? 118 LYS A NZ  1 
ATOM   1103 N  N   . THR A 1 119 ? 23.48686 25.62331  102.67239 1.000 14.22018 ? 119 THR A N   1 
ATOM   1104 C  CA  . THR A 1 119 ? 23.83149 24.66387  103.71584 1.000 14.28467 ? 119 THR A CA  1 
ATOM   1105 C  C   . THR A 1 119 ? 25.10670 25.07215  104.43940 1.000 14.78899 ? 119 THR A C   1 
ATOM   1106 O  O   . THR A 1 119 ? 25.15666 25.06911  105.67426 1.000 15.54423 ? 119 THR A O   1 
ATOM   1107 C  CB  . THR A 1 119 ? 23.97943 23.27137  103.10064 1.000 14.58351 ? 119 THR A CB  1 
ATOM   1108 O  OG1 . THR A 1 119 ? 22.74911 22.88132  102.48230 1.000 15.17272 ? 119 THR A OG1 1 
ATOM   1109 C  CG2 . THR A 1 119 ? 24.31715 22.24586  104.15810 1.000 15.56161 ? 119 THR A CG2 1 
ATOM   1110 N  N   . ILE A 1 120 ? 26.14432 25.43269  103.68102 1.000 15.14817 ? 120 ILE A N   1 
ATOM   1111 C  CA  . ILE A 1 120 ? 27.43286 25.77852  104.27840 1.000 15.67610 ? 120 ILE A CA  1 
ATOM   1112 C  C   . ILE A 1 120 ? 27.29993 26.96428  105.22727 1.000 15.99508 ? 120 ILE A C   1 
ATOM   1113 O  O   . ILE A 1 120 ? 27.88034 26.96855  106.31935 1.000 17.18252 ? 120 ILE A O   1 
ATOM   1114 C  CB  . ILE A 1 120 ? 28.48646 26.00755  103.17777 1.000 17.58803 ? 120 ILE A CB  1 
ATOM   1115 C  CG1 . ILE A 1 120 ? 28.88922 24.66262  102.56297 1.000 20.06074 ? 120 ILE A CG1 1 
ATOM   1116 C  CG2 . ILE A 1 120 ? 29.69273 26.76035  103.72602 1.000 19.05260 ? 120 ILE A CG2 1 
ATOM   1117 C  CD1 . ILE A 1 120 ? 29.58339 24.77557  101.22733 1.000 23.42630 ? 120 ILE A CD1 1 
ATOM   1118 N  N   . ARG A 1 121 ? 26.52133 27.97661  104.83624 1.000 16.54216 ? 121 ARG A N   1 
ATOM   1119 C  CA  . ARG A 1 121 ? 26.31307 29.13713  105.69625 1.000 18.04771 ? 121 ARG A CA  1 
ATOM   1120 C  C   . ARG A 1 121 ? 25.72467 28.72220  107.03751 1.000 17.32217 ? 121 ARG A C   1 
ATOM   1121 O  O   . ARG A 1 121 ? 26.09956 29.25692  108.08737 1.000 18.83323 ? 121 ARG A O   1 
ATOM   1122 C  CB  . ARG A 1 121 ? 25.38377 30.12349  104.98943 1.000 21.94948 ? 121 ARG A CB  1 
ATOM   1123 C  CG  . ARG A 1 121 ? 25.21786 31.46175  105.67632 1.000 29.60278 ? 121 ARG A CG  1 
ATOM   1124 C  CD  . ARG A 1 121 ? 24.45162 32.41385  104.77615 1.000 36.93923 ? 121 ARG A CD  1 
ATOM   1125 N  NE  . ARG A 1 121 ? 24.53792 33.79856  105.22225 1.000 41.99204 ? 121 ARG A NE  1 
ATOM   1126 C  CZ  . ARG A 1 121 ? 23.57897 34.69789  105.03370 1.000 47.28620 ? 121 ARG A CZ  1 
ATOM   1127 N  NH1 . ARG A 1 121 ? 22.45957 34.35444  104.40885 1.000 50.97020 ? 121 ARG A NH1 1 
ATOM   1128 N  NH2 . ARG A 1 121 ? 23.73895 35.94003  105.46727 1.000 51.02899 ? 121 ARG A NH2 1 
ATOM   1129 N  N   . ASN A 1 122 ? 24.80689 27.75633  107.02761 1.000 16.07850 ? 122 ASN A N   1 
ATOM   1130 C  CA  . ASN A 1 122 ? 24.19567 27.34284  108.28506 1.000 15.49358 ? 122 ASN A CA  1 
ATOM   1131 C  C   . ASN A 1 122 ? 25.06143 26.38402  109.08955 1.000 15.56498 ? 122 ASN A C   1 
ATOM   1132 O  O   . ASN A 1 122 ? 24.91122 26.31672  110.31338 1.000 16.55356 ? 122 ASN A O   1 
ATOM   1133 C  CB  . ASN A 1 122 ? 22.81020 26.74223  108.07436 1.000 15.49946 ? 122 ASN A CB  1 
ATOM   1134 C  CG  . ASN A 1 122 ? 21.95593 26.84232  109.32115 1.000 15.95477 ? 122 ASN A CG  1 
ATOM   1135 O  OD1 . ASN A 1 122 ? 21.78935 27.92325  109.88193 1.000 16.65065 ? 122 ASN A OD1 1 
ATOM   1136 N  ND2 . ASN A 1 122 ? 21.40245 25.71601  109.75791 1.000 17.17996 ? 122 ASN A ND2 1 
ATOM   1137 N  N   . ILE A 1 123 ? 25.95388 25.63258  108.44033 1.000 15.35814 ? 123 ILE A N   1 
ATOM   1138 C  CA  . ILE A 1 123 ? 26.92247 24.84210  109.19619 1.000 15.64592 ? 123 ILE A CA  1 
ATOM   1139 C  C   . ILE A 1 123 ? 27.76714 25.75322  110.07688 1.000 16.05330 ? 123 ILE A C   1 
ATOM   1140 O  O   . ILE A 1 123 ? 28.00816 25.45624  111.25136 1.000 16.76823 ? 123 ILE A O   1 
ATOM   1141 C  CB  . ILE A 1 123 ? 27.78720 23.97457  108.26286 1.000 16.78500 ? 123 ILE A CB  1 
ATOM   1142 C  CG1 . ILE A 1 123 ? 26.93377 22.88351  107.60549 1.000 17.29627 ? 123 ILE A CG1 1 
ATOM   1143 C  CG2 . ILE A 1 123 ? 28.95317 23.36441  109.03257 1.000 18.91582 ? 123 ILE A CG2 1 
ATOM   1144 C  CD1 . ILE A 1 123 ? 27.63757 22.14280  106.48291 1.000 19.02947 ? 123 ILE A CD1 1 
ATOM   1145 N  N   . ASP A 1 124 ? 28.21844 26.88618  109.52330 1.000 17.04829 ? 124 ASP A N   1 
ATOM   1146 C  CA  . ASP A 1 124 ? 28.99739 27.83715  110.31439 1.000 17.94556 ? 124 ASP A CA  1 
ATOM   1147 C  C   . ASP A 1 124 ? 28.22240 28.29032  111.54491 1.000 18.24199 ? 124 ASP A C   1 
ATOM   1148 O  O   . ASP A 1 124 ? 28.77470 28.35942  112.65075 1.000 19.57754 ? 124 ASP A O   1 
ATOM   1149 C  CB  . ASP A 1 124 ? 29.36377 29.06040  109.46839 1.000 19.72971 ? 124 ASP A CB  1 
ATOM   1150 C  CG  . ASP A 1 124 ? 30.40527 28.76457  108.40192 1.000 22.33520 ? 124 ASP A CG  1 
ATOM   1151 O  OD1 . ASP A 1 124 ? 31.09529 27.72924  108.48305 1.000 22.48635 ? 124 ASP A OD1 1 
ATOM   1152 O  OD2 . ASP A 1 124 ? 30.53390 29.58742  107.47745 1.000 26.80813 ? 124 ASP A OD2 1 
ATOM   1153 N  N   . LEU A 1 125 ? 26.94092 28.61151  111.36551 1.000 17.91792 ? 125 LEU A N   1 
ATOM   1154 C  CA  . LEU A 1 125 ? 26.11957 29.06311  112.48092 1.000 18.05574 ? 125 LEU A CA  1 
ATOM   1155 C  C   . LEU A 1 125 ? 25.89774 27.94641  113.49252 1.000 17.93686 ? 125 LEU A C   1 
ATOM   1156 O  O   . LEU A 1 125 ? 25.95513 28.18076  114.70694 1.000 19.06532 ? 125 LEU A O   1 
ATOM   1157 C  CB  . LEU A 1 125 ? 24.78998 29.59377  111.95265 1.000 19.08366 ? 125 LEU A CB  1 
ATOM   1158 C  CG  . LEU A 1 125 ? 23.81413 30.07879  113.02311 1.000 21.37212 ? 125 LEU A CG  1 
ATOM   1159 C  CD1 . LEU A 1 125 ? 24.41877 31.19913  113.86661 1.000 23.41319 ? 125 LEU A CD1 1 
ATOM   1160 C  CD2 . LEU A 1 125 ? 22.50108 30.51678  112.38551 1.000 22.41908 ? 125 LEU A CD2 1 
ATOM   1161 N  N   . ALA A 1 126 ? 25.65094 26.72760  113.00766 1.000 17.46751 ? 126 ALA A N   1 
ATOM   1162 C  CA  . ALA A 1 126 ? 25.43919 25.59288  113.89691 1.000 17.64857 ? 126 ALA A CA  1 
ATOM   1163 C  C   . ALA A 1 126 ? 26.63856 25.38280  114.80791 1.000 17.69868 ? 126 ALA A C   1 
ATOM   1164 O  O   . ALA A 1 126 ? 26.48520 25.14511  116.01107 1.000 18.39118 ? 126 ALA A O   1 
ATOM   1165 C  CB  . ALA A 1 126 ? 25.17018 24.33750  113.06812 1.000 18.66194 ? 126 ALA A CB  1 
ATOM   1166 N  N   . VAL A 1 127 ? 27.84476 25.46306  114.24426 1.000 18.11689 ? 127 VAL A N   1 
ATOM   1167 C  CA  . VAL A 1 127 ? 29.05357 25.29716  115.04252 1.000 19.67435 ? 127 VAL A CA  1 
ATOM   1168 C  C   . VAL A 1 127 ? 29.17047 26.40460  116.08404 1.000 20.59676 ? 127 VAL A C   1 
ATOM   1169 O  O   . VAL A 1 127 ? 29.52530 26.14937  117.24058 1.000 21.91814 ? 127 VAL A O   1 
ATOM   1170 C  CB  . VAL A 1 127 ? 30.28706 25.21817  114.12534 1.000 21.90566 ? 127 VAL A CB  1 
ATOM   1171 C  CG1 . VAL A 1 127 ? 31.57016 25.28621  114.94057 1.000 24.89992 ? 127 VAL A CG1 1 
ATOM   1172 C  CG2 . VAL A 1 127 ? 30.23985 23.94288  113.30592 1.000 22.53119 ? 127 VAL A CG2 1 
ATOM   1173 N  N   A GLU A 1 128 ? 28.87889 27.64708  115.68055 0.688 20.45369 ? 128 GLU A N   1 
ATOM   1174 N  N   B GLU A 1 128 ? 28.85972 27.64789  115.70576 0.312 21.38057 ? 128 GLU A N   1 
ATOM   1175 C  CA  A GLU A 1 128 ? 28.90148 28.78380  116.59809 0.688 21.73010 ? 128 GLU A CA  1 
ATOM   1176 C  CA  B GLU A 1 128 ? 28.96238 28.74377  116.66813 0.312 22.95530 ? 128 GLU A CA  1 
ATOM   1177 C  C   A GLU A 1 128 ? 28.00478 28.53996  117.80595 0.688 21.63396 ? 128 GLU A C   1 
ATOM   1178 C  C   B GLU A 1 128 ? 27.97668 28.58364  117.82202 0.312 22.35187 ? 128 GLU A C   1 
ATOM   1179 O  O   A GLU A 1 128 ? 28.36640 28.88206  118.93812 0.688 24.00899 ? 128 GLU A O   1 
ATOM   1180 O  O   B GLU A 1 128 ? 28.24621 29.04859  118.93596 0.312 24.39980 ? 128 GLU A O   1 
ATOM   1181 C  CB  A GLU A 1 128 ? 28.47117 30.04534  115.83707 0.688 24.67309 ? 128 GLU A CB  1 
ATOM   1182 C  CB  B GLU A 1 128 ? 28.78689 30.09437  115.96901 0.312 26.45596 ? 128 GLU A CB  1 
ATOM   1183 C  CG  A GLU A 1 128 ? 28.29141 31.31194  116.67046 0.688 29.10222 ? 128 GLU A CG  1 
ATOM   1184 C  CG  B GLU A 1 128 ? 29.08196 31.30558  116.85389 0.312 31.00852 ? 128 GLU A CG  1 
ATOM   1185 C  CD  A GLU A 1 128 ? 28.01835 32.53609  115.80446 0.688 36.05026 ? 128 GLU A CD  1 
ATOM   1186 C  CD  B GLU A 1 128 ? 30.56724 31.55222  117.05414 0.312 36.79641 ? 128 GLU A CD  1 
ATOM   1187 O  OE1 A GLU A 1 128 ? 28.39406 32.51854  114.61260 0.688 39.27945 ? 128 GLU A OE1 1 
ATOM   1188 O  OE1 B GLU A 1 128 ? 31.35579 31.23691  116.13790 0.312 38.25472 ? 128 GLU A OE1 1 
ATOM   1189 O  OE2 A GLU A 1 128 ? 27.42697 33.51336  116.31126 0.688 42.30630 ? 128 GLU A OE2 1 
ATOM   1190 O  OE2 B GLU A 1 128 ? 30.94442 32.07203  118.12676 0.312 41.30547 ? 128 GLU A OE2 1 
ATOM   1191 N  N   . LEU A 1 129 ? 26.84540 27.92201  117.58693 1.000 20.60272 ? 129 LEU A N   1 
ATOM   1192 C  CA  . LEU A 1 129 ? 25.86427 27.68023  118.63812 1.000 20.95092 ? 129 LEU A CA  1 
ATOM   1193 C  C   . LEU A 1 129 ? 26.11431 26.38830  119.40729 1.000 21.92492 ? 129 LEU A C   1 
ATOM   1194 O  O   . LEU A 1 129 ? 25.37200 26.09629  120.35211 1.000 25.40549 ? 129 LEU A O   1 
ATOM   1195 C  CB  . LEU A 1 129 ? 24.45037 27.68607  118.05241 1.000 21.84359 ? 129 LEU A CB  1 
ATOM   1196 C  CG  . LEU A 1 129 ? 23.97093 29.04609  117.54366 1.000 25.04969 ? 129 LEU A CG  1 
ATOM   1197 C  CD1 . LEU A 1 129 ? 22.65461 28.89455  116.80417 1.000 26.95693 ? 129 LEU A CD1 1 
ATOM   1198 C  CD2 . LEU A 1 129 ? 23.81880 30.01813  118.70323 1.000 28.55448 ? 129 LEU A CD2 1 
ATOM   1199 N  N   . GLY A 1 130 ? 27.12897 25.61242  119.02848 1.000 21.67625 ? 130 GLY A N   1 
ATOM   1200 C  CA  . GLY A 1 130 ? 27.50466 24.42838  119.77538 1.000 22.31393 ? 130 GLY A CA  1 
ATOM   1201 C  C   . GLY A 1 130 ? 26.90495 23.12146  119.30511 1.000 20.65206 ? 130 GLY A C   1 
ATOM   1202 O  O   . GLY A 1 130 ? 26.96967 22.12988  120.04114 1.000 22.02946 ? 130 GLY A O   1 
ATOM   1203 N  N   . ALA A 1 131 ? 26.33330 23.07319  118.10569 1.000 18.38717 ? 131 ALA A N   1 
ATOM   1204 C  CA  . ALA A 1 131 ? 25.71614 21.84158  117.63670 1.000 17.76408 ? 131 ALA A CA  1 
ATOM   1205 C  C   . ALA A 1 131 ? 26.77024 20.78129  117.33784 1.000 18.34690 ? 131 ALA A C   1 
ATOM   1206 O  O   . ALA A 1 131 ? 27.83863 21.07708  116.79832 1.000 21.89548 ? 131 ALA A O   1 
ATOM   1207 C  CB  . ALA A 1 131 ? 24.87524 22.11505  116.39231 1.000 18.06580 ? 131 ALA A CB  1 
ATOM   1208 N  N   A GLU A 1 132 ? 26.45326 19.53228  117.67817 0.539 17.99617 ? 132 GLU A N   1 
ATOM   1209 N  N   B GLU A 1 132 ? 26.46470 19.53614  117.71253 0.461 17.80037 ? 132 GLU A N   1 
ATOM   1210 C  CA  A GLU A 1 132 ? 27.35043 18.41295  117.43002 0.539 19.42754 ? 132 GLU A CA  1 
ATOM   1211 C  CA  B GLU A 1 132 ? 27.35173 18.40918  117.44624 0.461 18.98456 ? 132 GLU A CA  1 
ATOM   1212 C  C   A GLU A 1 132 ? 26.93068 17.57372  116.23704 0.539 16.64500 ? 132 GLU A C   1 
ATOM   1213 C  C   B GLU A 1 132 ? 26.95907 17.64060  116.19223 0.461 16.74507 ? 132 GLU A C   1 
ATOM   1214 O  O   A GLU A 1 132 ? 27.73665 16.78605  115.72804 0.539 16.61586 ? 132 GLU A O   1 
ATOM   1215 O  O   B GLU A 1 132 ? 27.80743 16.97603  115.58559 0.461 17.26024 ? 132 GLU A O   1 
ATOM   1216 C  CB  A GLU A 1 132 ? 27.41655 17.51920  118.67029 0.539 24.80243 ? 132 GLU A CB  1 
ATOM   1217 C  CB  B GLU A 1 132 ? 27.39617 17.45860  118.65478 0.461 23.02684 ? 132 GLU A CB  1 
ATOM   1218 C  CG  A GLU A 1 132 ? 27.95595 18.24679  119.88708 0.539 30.15063 ? 132 GLU A CG  1 
ATOM   1219 C  CG  B GLU A 1 132 ? 26.09643 16.70819  118.92111 0.461 27.40292 ? 132 GLU A CG  1 
ATOM   1220 C  CD  A GLU A 1 132 ? 27.62194 17.55088  121.19163 0.539 37.41884 ? 132 GLU A CD  1 
ATOM   1221 C  CD  B GLU A 1 132 ? 26.16012 15.71469  120.08518 0.461 33.25325 ? 132 GLU A CD  1 
ATOM   1222 O  OE1 A GLU A 1 132 ? 27.25891 16.35765  121.15877 0.539 41.69402 ? 132 GLU A OE1 1 
ATOM   1223 O  OE1 B GLU A 1 132 ? 27.26822 15.40764  120.58214 0.461 38.17445 ? 132 GLU A OE1 1 
ATOM   1224 O  OE2 A GLU A 1 132 ? 27.72017 18.20113  122.25203 0.539 42.69789 ? 132 GLU A OE2 1 
ATOM   1225 O  OE2 B GLU A 1 132 ? 25.08030 15.23281  120.49994 0.461 34.99888 ? 132 GLU A OE2 1 
ATOM   1226 N  N   . THR A 1 133 ? 25.69671 17.72767  115.78051 1.000 15.33298 ? 133 THR A N   1 
ATOM   1227 C  CA  . THR A 1 133 ? 25.17518 16.95591  114.66665 1.000 14.62242 ? 133 THR A CA  1 
ATOM   1228 C  C   . THR A 1 133 ? 24.47682 17.90403  113.71294 1.000 13.62055 ? 133 THR A C   1 
ATOM   1229 O  O   . THR A 1 133 ? 23.77372 18.82496  114.13756 1.000 15.18466 ? 133 THR A O   1 
ATOM   1230 C  CB  . THR A 1 133 ? 24.17367 15.90863  115.16489 1.000 17.46653 ? 133 THR A CB  1 
ATOM   1231 O  OG1 . THR A 1 133 ? 24.79275 15.10018  116.17014 1.000 20.08733 ? 133 THR A OG1 1 
ATOM   1232 C  CG2 . THR A 1 133 ? 23.70430 15.00680  114.02350 1.000 19.22226 ? 133 THR A CG2 1 
ATOM   1233 N  N   . TYR A 1 134 ? 24.67489 17.67215  112.42175 1.000 13.13361 ? 134 TYR A N   1 
ATOM   1234 C  CA  . TYR A 1 134 ? 24.04219 18.45809  111.37093 1.000 12.55022 ? 134 TYR A CA  1 
ATOM   1235 C  C   . TYR A 1 134 ? 23.20042 17.48634  110.54940 1.000 12.80214 ? 134 TYR A C   1 
ATOM   1236 O  O   . TYR A 1 134 ? 23.73715 16.57122  109.92278 1.000 14.20071 ? 134 TYR A O   1 
ATOM   1237 C  CB  . TYR A 1 134 ? 25.08253 19.18742  110.50962 1.000 13.53708 ? 134 TYR A CB  1 
ATOM   1238 C  CG  . TYR A 1 134 ? 24.44231 20.35336  109.79506 1.000 13.89067 ? 134 TYR A CG  1 
ATOM   1239 C  CD1 . TYR A 1 134 ? 24.33904 21.59707  110.40866 1.000 14.89468 ? 134 TYR A CD1 1 
ATOM   1240 C  CD2 . TYR A 1 134 ? 23.84589 20.18454  108.55365 1.000 14.60066 ? 134 TYR A CD2 1 
ATOM   1241 C  CE1 . TYR A 1 134 ? 23.70128 22.64910  109.78494 1.000 15.01804 ? 134 TYR A CE1 1 
ATOM   1242 C  CE2 . TYR A 1 134 ? 23.19809 21.23178  107.91885 1.000 14.88947 ? 134 TYR A CE2 1 
ATOM   1243 C  CZ  . TYR A 1 134 ? 23.12674 22.45606  108.54429 1.000 14.68928 ? 134 TYR A CZ  1 
ATOM   1244 O  OH  . TYR A 1 134 ? 22.49052 23.50961  107.94514 1.000 16.05951 ? 134 TYR A OH  1 
ATOM   1245 N  N   . VAL A 1 135 ? 21.87993 17.66191  110.56509 1.000 12.59770 ? 135 VAL A N   1 
ATOM   1246 C  CA  . VAL A 1 135 ? 20.96029 16.73875  109.90211 1.000 12.68690 ? 135 VAL A CA  1 
ATOM   1247 C  C   . VAL A 1 135 ? 20.66552 17.22111  108.49214 1.000 12.68475 ? 135 VAL A C   1 
ATOM   1248 O  O   . VAL A 1 135 ? 20.57469 18.42127  108.21685 1.000 13.77426 ? 135 VAL A O   1 
ATOM   1249 C  CB  . VAL A 1 135 ? 19.66915 16.59396  110.73570 1.000 13.95984 ? 135 VAL A CB  1 
ATOM   1250 C  CG1 . VAL A 1 135 ? 18.51968 15.98300  109.92282 1.000 15.89252 ? 135 VAL A CG1 1 
ATOM   1251 C  CG2 . VAL A 1 135 ? 19.94654 15.76167  111.96935 1.000 15.09115 ? 135 VAL A CG2 1 
ATOM   1252 N  N   . ALA A 1 136 ? 20.48785 16.26683  107.58469 1.000 12.92196 ? 136 ALA A N   1 
ATOM   1253 C  CA  . ALA A 1 136 ? 20.01087 16.55028  106.23691 1.000 13.37210 ? 136 ALA A CA  1 
ATOM   1254 C  C   . ALA A 1 136 ? 18.80898 15.66741  105.94658 1.000 12.74678 ? 136 ALA A C   1 
ATOM   1255 O  O   . ALA A 1 136 ? 18.93591 14.44096  105.90646 1.000 13.76907 ? 136 ALA A O   1 
ATOM   1256 C  CB  . ALA A 1 136 ? 21.11275 16.28993  105.20742 1.000 15.92472 ? 136 ALA A CB  1 
ATOM   1257 N  N   . TRP A 1 137 ? 17.64497 16.29104  105.75632 1.000 12.90185 ? 137 TRP A N   1 
ATOM   1258 C  CA  . TRP A 1 137 ? 16.44291 15.61087  105.28344 1.000 12.71660 ? 137 TRP A CA  1 
ATOM   1259 C  C   . TRP A 1 137 ? 16.18791 16.08328  103.85860 1.000 12.41064 ? 137 TRP A C   1 
ATOM   1260 O  O   . TRP A 1 137 ? 15.78633 17.23121  103.63789 1.000 13.83298 ? 137 TRP A O   1 
ATOM   1261 C  CB  . TRP A 1 137 ? 15.23792 15.91834  106.16741 1.000 13.36430 ? 137 TRP A CB  1 
ATOM   1262 C  CG  . TRP A 1 137 ? 13.96771 15.36962  105.56816 1.000 13.27824 ? 137 TRP A CG  1 
ATOM   1263 C  CD1 . TRP A 1 137 ? 13.70649 14.07099  105.25032 1.000 14.92816 ? 137 TRP A CD1 1 
ATOM   1264 C  CD2 . TRP A 1 137 ? 12.81282 16.12012  105.17078 1.000 13.19679 ? 137 TRP A CD2 1 
ATOM   1265 N  NE1 . TRP A 1 137 ? 12.44840 13.96251  104.69883 1.000 15.13834 ? 137 TRP A NE1 1 
ATOM   1266 C  CE2 . TRP A 1 137 ? 11.88117 15.20780  104.63801 1.000 13.41006 ? 137 TRP A CE2 1 
ATOM   1267 C  CE3 . TRP A 1 137 ? 12.47456 17.47361  105.21957 1.000 14.97823 ? 137 TRP A CE3 1 
ATOM   1268 C  CZ2 . TRP A 1 137 ? 10.63308 15.60637  104.16328 1.000 13.23249 ? 137 TRP A CZ2 1 
ATOM   1269 C  CZ3 . TRP A 1 137 ? 11.24116 17.86759  104.74529 1.000 15.60236 ? 137 TRP A CZ3 1 
ATOM   1270 C  CH2 . TRP A 1 137 ? 10.33341 16.93797  104.22378 1.000 14.20147 ? 137 TRP A CH2 1 
ATOM   1271 N  N   . GLY A 1 138 ? 16.41455 15.19582  102.90033 1.000 12.50179 ? 138 GLY A N   1 
ATOM   1272 C  CA  . GLY A 1 138 ? 16.26274 15.54116  101.49696 1.000 12.96341 ? 138 GLY A CA  1 
ATOM   1273 C  C   . GLY A 1 138 ? 14.83628 15.38677  101.01050 1.000 12.39232 ? 138 GLY A C   1 
ATOM   1274 O  O   . GLY A 1 138 ? 14.54491 14.55061  100.15397 1.000 12.85271 ? 138 GLY A O   1 
ATOM   1275 N  N   . GLY A 1 139 ? 13.92987 16.18533  101.57496 1.000 12.82100 ? 139 GLY A N   1 
ATOM   1276 C  CA  . GLY A 1 139 ? 12.51115 15.99658  101.33261 1.000 13.14984 ? 139 GLY A CA  1 
ATOM   1277 C  C   . GLY A 1 139 ? 12.05697 16.28387  99.91798  1.000 12.26125 ? 139 GLY A C   1 
ATOM   1278 O  O   . GLY A 1 139 ? 11.00876 15.77348  99.51002  1.000 14.17142 ? 139 GLY A O   1 
ATOM   1279 N  N   . ARG A 1 140 ? 12.80268 17.09060  99.16414  1.000 11.86991 ? 140 ARG A N   1 
ATOM   1280 C  CA  . ARG A 1 140 ? 12.46234 17.35140  97.76969  1.000 11.95052 ? 140 ARG A CA  1 
ATOM   1281 C  C   . ARG A 1 140 ? 13.28280 16.52883  96.79169  1.000 11.20769 ? 140 ARG A C   1 
ATOM   1282 O  O   . ARG A 1 140 ? 13.12147 16.71476  95.58035  1.000 12.02872 ? 140 ARG A O   1 
ATOM   1283 C  CB  . ARG A 1 140 ? 12.60781 18.84298  97.42917  1.000 12.90921 ? 140 ARG A CB  1 
ATOM   1284 C  CG  . ARG A 1 140 ? 11.67235 19.74839  98.18446  1.000 13.62542 ? 140 ARG A CG  1 
ATOM   1285 C  CD  . ARG A 1 140 ? 10.26932 19.77599  97.61659  1.000 13.90424 ? 140 ARG A CD  1 
ATOM   1286 N  NE  . ARG A 1 140 ? 9.45038  20.61053  98.48352  1.000 13.43952 ? 140 ARG A NE  1 
ATOM   1287 C  CZ  . ARG A 1 140 ? 8.12506  20.55087  98.56872  1.000 13.79604 ? 140 ARG A CZ  1 
ATOM   1288 N  NH1 . ARG A 1 140 ? 7.42478  19.73742  97.78891  1.000 13.89566 ? 140 ARG A NH1 1 
ATOM   1289 N  NH2 . ARG A 1 140 ? 7.49259  21.32290  99.44520  1.000 16.01067 ? 140 ARG A NH2 1 
ATOM   1290 N  N   . GLU A 1 141 ? 14.14750 15.63316  97.26768  1.000 11.12482 ? 141 GLU A N   1 
ATOM   1291 C  CA  . GLU A 1 141 ? 15.00571 14.85288  96.38249  1.000 11.14812 ? 141 GLU A CA  1 
ATOM   1292 C  C   . GLU A 1 141 ? 14.21703 13.62170  95.95356  1.000 11.08968 ? 141 GLU A C   1 
ATOM   1293 O  O   . GLU A 1 141 ? 13.97316 12.72552  96.76130  1.000 12.01338 ? 141 GLU A O   1 
ATOM   1294 C  CB  . GLU A 1 141 ? 16.29875 14.44336  97.08403  1.000 12.07651 ? 141 GLU A CB  1 
ATOM   1295 C  CG  . GLU A 1 141 ? 16.95568 15.51766  97.95896  1.000 13.16132 ? 141 GLU A CG  1 
ATOM   1296 C  CD  . GLU A 1 141 ? 17.29929 16.82350  97.25819  1.000 15.16354 ? 141 GLU A CD  1 
ATOM   1297 O  OE1 . GLU A 1 141 ? 17.62472 16.84865  96.06194  1.000 13.49320 ? 141 GLU A OE1 1 
ATOM   1298 O  OE2 . GLU A 1 141 ? 17.23995 17.86937  97.91980  1.000 21.61988 ? 141 GLU A OE2 1 
ATOM   1299 N  N   . GLY A 1 142 ? 13.78030 13.58481  94.70532  1.000 11.11306 ? 142 GLY A N   1 
ATOM   1300 C  CA  . GLY A 1 142 ? 12.93927 12.47878  94.26996  1.000 11.65959 ? 142 GLY A CA  1 
ATOM   1301 C  C   . GLY A 1 142 ? 12.15213 12.85584  93.02582  1.000 11.13001 ? 142 GLY A C   1 
ATOM   1302 O  O   . GLY A 1 142 ? 12.60319 13.65434  92.21174  1.000 12.25737 ? 142 GLY A O   1 
ATOM   1303 N  N   . ALA A 1 143 ? 10.97187 12.25640  92.89183  1.000 10.58729 ? 143 ALA A N   1 
ATOM   1304 C  CA  . ALA A 1 143 ? 10.22825 12.38623  91.64541  1.000 10.96808 ? 143 ALA A CA  1 
ATOM   1305 C  C   . ALA A 1 143 ? 8.79246  11.93755  91.84052  1.000 9.94758  ? 143 ALA A C   1 
ATOM   1306 O  O   . ALA A 1 143 ? 8.48528  11.12755  92.71710  1.000 11.03711 ? 143 ALA A O   1 
ATOM   1307 C  CB  . ALA A 1 143 ? 10.86524 11.53018  90.54906  1.000 12.87500 ? 143 ALA A CB  1 
ATOM   1308 N  N   . GLU A 1 144 ? 7.92672  12.43315  90.95410  1.000 10.20788 ? 144 GLU A N   1 
ATOM   1309 C  CA  . GLU A 1 144 ? 6.58012  11.91266  90.78478  1.000 10.60423 ? 144 GLU A CA  1 
ATOM   1310 C  C   . GLU A 1 144 ? 6.44523  10.99833  89.58196  1.000 11.65015 ? 144 GLU A C   1 
ATOM   1311 O  O   . GLU A 1 144 ? 5.46011  10.26333  89.49944  1.000 14.83295 ? 144 GLU A O   1 
ATOM   1312 C  CB  . GLU A 1 144 ? 5.55037  13.04412  90.66226  1.000 11.42979 ? 144 GLU A CB  1 
ATOM   1313 C  CG  . GLU A 1 144 ? 5.28562  13.79940  91.95201  1.000 12.07834 ? 144 GLU A CG  1 
ATOM   1314 C  CD  . GLU A 1 144 ? 6.45477  14.64541  92.39451  1.000 11.84676 ? 144 GLU A CD  1 
ATOM   1315 O  OE1 . GLU A 1 144 ? 6.81543  15.58778  91.65112  1.000 12.16171 ? 144 GLU A OE1 1 
ATOM   1316 O  OE2 . GLU A 1 144 ? 7.00817  14.38521  93.47276  1.000 12.95087 ? 144 GLU A OE2 1 
ATOM   1317 N  N   . SER A 1 145 ? 7.39065  11.03758  88.64559  1.000 11.39703 ? 145 SER A N   1 
ATOM   1318 C  CA  . SER A 1 145 ? 7.28975  10.29047  87.40211  1.000 11.66591 ? 145 SER A CA  1 
ATOM   1319 C  C   . SER A 1 145 ? 8.65730  9.72393   87.05094  1.000 11.53248 ? 145 SER A C   1 
ATOM   1320 O  O   . SER A 1 145 ? 9.68841  10.21878  87.50222  1.000 12.75829 ? 145 SER A O   1 
ATOM   1321 C  CB  . SER A 1 145 ? 6.71695  11.16673  86.28208  1.000 12.67639 ? 145 SER A CB  1 
ATOM   1322 O  OG  . SER A 1 145 ? 7.43880  12.37899  86.16805  1.000 13.93012 ? 145 SER A OG  1 
ATOM   1323 N  N   . GLY A 1 146 ? 8.65862  8.67000   86.24028  1.000 11.92924 ? 146 GLY A N   1 
ATOM   1324 C  CA  . GLY A 1 146 ? 9.86528  7.87676   86.06607  1.000 12.87413 ? 146 GLY A CA  1 
ATOM   1325 C  C   . GLY A 1 146 ? 10.95104 8.53392   85.23834  1.000 13.77079 ? 146 GLY A C   1 
ATOM   1326 O  O   . GLY A 1 146 ? 12.13990 8.31772   85.49214  1.000 16.58777 ? 146 GLY A O   1 
ATOM   1327 N  N   . GLY A 1 147 ? 10.57228 9.33980   84.24364  1.000 12.90555 ? 147 GLY A N   1 
ATOM   1328 C  CA  . GLY A 1 147 ? 11.55956 9.93759   83.35918  1.000 13.65101 ? 147 GLY A CA  1 
ATOM   1329 C  C   . GLY A 1 147 ? 12.19727 11.19756  83.89616  1.000 12.83557 ? 147 GLY A C   1 
ATOM   1330 O  O   . GLY A 1 147 ? 13.19643 11.66201  83.33808  1.000 14.35327 ? 147 GLY A O   1 
ATOM   1331 N  N   . ALA A 1 148 ? 11.64344 11.75374  84.97298  1.000 12.43321 ? 148 ALA A N   1 
ATOM   1332 C  CA  . ALA A 1 148 ? 12.05649 13.05701  85.47802  1.000 12.64342 ? 148 ALA A CA  1 
ATOM   1333 C  C   . ALA A 1 148 ? 13.41248 13.02545  86.15581  1.000 12.54822 ? 148 ALA A C   1 
ATOM   1334 O  O   . ALA A 1 148 ? 14.04844 14.07312  86.29826  1.000 13.68376 ? 148 ALA A O   1 
ATOM   1335 C  CB  . ALA A 1 148 ? 11.01128 13.55985  86.46694  1.000 13.53301 ? 148 ALA A CB  1 
ATOM   1336 N  N   . LYS A 1 149 ? 13.84690 11.85806  86.60579  1.000 12.96296 ? 149 LYS A N   1 
ATOM   1337 C  CA  . LYS A 1 149 ? 15.01655 11.76174  87.45464  1.000 14.83580 ? 149 LYS A CA  1 
ATOM   1338 C  C   . LYS A 1 149 ? 15.72199 10.46801  87.10866  1.000 16.00425 ? 149 LYS A C   1 
ATOM   1339 O  O   . LYS A 1 149 ? 15.15766 9.39028   87.30898  1.000 19.24794 ? 149 LYS A O   1 
ATOM   1340 C  CB  . LYS A 1 149 ? 14.57279 11.78155  88.92623  1.000 17.08003 ? 149 LYS A CB  1 
ATOM   1341 C  CG  . LYS A 1 149 ? 15.63457 12.09782  89.95293  1.000 17.17292 ? 149 LYS A CG  1 
ATOM   1342 C  CD  . LYS A 1 149 ? 16.16360 13.51561  89.80805  1.000 15.52707 ? 149 LYS A CD  1 
ATOM   1343 C  CE  . LYS A 1 149 ? 15.10392 14.60499  89.90254  1.000 14.16605 ? 149 LYS A CE  1 
ATOM   1344 N  NZ  . LYS A 1 149 ? 15.74262 15.96094  90.02161  1.000 13.87034 ? 149 LYS A NZ  1 
ATOM   1345 N  N   . ASP A 1 150 ? 16.94228 10.57440  86.57724  1.000 14.71423 ? 150 ASP A N   1 
ATOM   1346 C  CA  . ASP A 1 150 ? 17.81597 9.41624   86.44561  1.000 14.49823 ? 150 ASP A CA  1 
ATOM   1347 C  C   . ASP A 1 150 ? 18.45761 9.20814   87.80647  1.000 12.97019 ? 150 ASP A C   1 
ATOM   1348 O  O   . ASP A 1 150 ? 19.22990 10.04967  88.27274  1.000 13.48894 ? 150 ASP A O   1 
ATOM   1349 C  CB  . ASP A 1 150 ? 18.86639 9.64081   85.36360  1.000 16.12183 ? 150 ASP A CB  1 
ATOM   1350 C  CG  . ASP A 1 150 ? 19.73951 8.42659   85.15222  1.000 19.27335 ? 150 ASP A CG  1 
ATOM   1351 O  OD1 . ASP A 1 150 ? 20.42831 8.00743   86.09460  1.000 18.78924 ? 150 ASP A OD1 1 
ATOM   1352 O  OD2 . ASP A 1 150 ? 19.74070 7.88184   84.03004  1.000 26.19388 ? 150 ASP A OD2 1 
ATOM   1353 N  N   . VAL A 1 151 ? 18.10627 8.10368   88.45985  1.000 12.42231 ? 151 VAL A N   1 
ATOM   1354 C  CA  . VAL A 1 151 ? 18.47744 7.93740   89.85403  1.000 12.53241 ? 151 VAL A CA  1 
ATOM   1355 C  C   . VAL A 1 151 ? 19.96901 7.70168   90.01688  1.000 12.34418 ? 151 VAL A C   1 
ATOM   1356 O  O   . VAL A 1 151 ? 20.54876 8.11185   91.02516  1.000 12.88241 ? 151 VAL A O   1 
ATOM   1357 C  CB  . VAL A 1 151 ? 17.60058 6.86074   90.50782  1.000 13.40612 ? 151 VAL A CB  1 
ATOM   1358 C  CG1 . VAL A 1 151 ? 18.10319 6.51750   91.90092  1.000 14.63762 ? 151 VAL A CG1 1 
ATOM   1359 C  CG2 . VAL A 1 151 ? 16.17292 7.35434   90.57258  1.000 15.97219 ? 151 VAL A CG2 1 
ATOM   1360 N  N   A ARG A 1 152 ? 20.61881 7.03644   89.06039  0.611 12.42735 ? 152 ARG A N   1 
ATOM   1361 N  N   B ARG A 1 152 ? 20.61649 7.05146   89.04298  0.389 12.48035 ? 152 ARG A N   1 
ATOM   1362 C  CA  A ARG A 1 152 ? 22.06768 6.90773   89.15794  0.611 12.83596 ? 152 ARG A CA  1 
ATOM   1363 C  CA  B ARG A 1 152 ? 22.06691 6.89613   89.11169  0.389 12.97162 ? 152 ARG A CA  1 
ATOM   1364 C  C   A ARG A 1 152 ? 22.73780 8.27639   89.11318  0.611 12.34912 ? 152 ARG A C   1 
ATOM   1365 C  C   B ARG A 1 152 ? 22.76658 8.24784   89.06696  0.389 12.40975 ? 152 ARG A C   1 
ATOM   1366 O  O   A ARG A 1 152 ? 23.59372 8.58338   89.95059  0.611 13.47421 ? 152 ARG A O   1 
ATOM   1367 O  O   B ARG A 1 152 ? 23.70440 8.49579   89.83364  0.389 12.85396 ? 152 ARG A O   1 
ATOM   1368 C  CB  A ARG A 1 152 ? 22.61009 5.94555   88.09953  0.611 14.37371 ? 152 ARG A CB  1 
ATOM   1369 C  CB  B ARG A 1 152 ? 22.56952 5.98772   87.98832  0.389 14.61881 ? 152 ARG A CB  1 
ATOM   1370 C  CG  A ARG A 1 152 ? 22.10394 4.52138   88.30630  0.611 17.06693 ? 152 ARG A CG  1 
ATOM   1371 C  CG  B ARG A 1 152 ? 22.15441 4.53129   88.13259  0.389 17.21987 ? 152 ARG A CG  1 
ATOM   1372 C  CD  A ARG A 1 152 ? 22.78603 3.53180   87.38641  0.611 20.24416 ? 152 ARG A CD  1 
ATOM   1373 C  CD  B ARG A 1 152 ? 22.43641 3.75671   86.85535  0.389 20.93509 ? 152 ARG A CD  1 
ATOM   1374 N  NE  A ARG A 1 152 ? 22.44815 3.78903   85.99216  0.611 22.56673 ? 152 ARG A NE  1 
ATOM   1375 N  NE  B ARG A 1 152 ? 21.59841 4.21478   85.75197  0.389 24.53653 ? 152 ARG A NE  1 
ATOM   1376 C  CZ  A ARG A 1 152 ? 23.13104 3.30595   84.96155  0.611 27.46056 ? 152 ARG A CZ  1 
ATOM   1377 C  CZ  B ARG A 1 152 ? 21.86006 3.98727   84.46937  0.389 29.01302 ? 152 ARG A CZ  1 
ATOM   1378 N  NH1 A ARG A 1 152 ? 24.18522 2.53139   85.17391  0.611 28.40702 ? 152 ARG A NH1 1 
ATOM   1379 N  NH1 B ARG A 1 152 ? 22.94259 3.30455   84.12343  0.389 30.66418 ? 152 ARG A NH1 1 
ATOM   1380 N  NH2 A ARG A 1 152 ? 22.75695 3.59372   83.72270  0.611 31.87484 ? 152 ARG A NH2 1 
ATOM   1381 N  NH2 B ARG A 1 152 ? 21.03921 4.44391   83.53329  0.389 31.87604 ? 152 ARG A NH2 1 
ATOM   1382 N  N   . ASP A 1 153 ? 22.32912 9.13313   88.16938  1.000 12.46165 ? 153 ASP A N   1 
ATOM   1383 C  CA  . ASP A 1 153 ? 22.89862 10.47927  88.12524  1.000 12.53452 ? 153 ASP A CA  1 
ATOM   1384 C  C   . ASP A 1 153 ? 22.56630 11.25458  89.39699  1.000 11.96024 ? 153 ASP A C   1 
ATOM   1385 O  O   . ASP A 1 153 ? 23.40671 11.99173  89.92402  1.000 12.89263 ? 153 ASP A O   1 
ATOM   1386 C  CB  . ASP A 1 153 ? 22.38875 11.25328  86.90260  1.000 13.34662 ? 153 ASP A CB  1 
ATOM   1387 C  CG  . ASP A 1 153 ? 22.93539 10.73153  85.58749  1.000 15.60296 ? 153 ASP A CG  1 
ATOM   1388 O  OD1 . ASP A 1 153 ? 24.05939 10.20199  85.56097  1.000 18.49382 ? 153 ASP A OD1 1 
ATOM   1389 O  OD2 . ASP A 1 153 ? 22.22943 10.87744  84.57404  1.000 16.47003 ? 153 ASP A OD2 1 
ATOM   1390 N  N   . ALA A 1 154 ? 21.33843 11.10336  89.90471  1.000 11.66209 ? 154 ALA A N   1 
ATOM   1391 C  CA  . ALA A 1 154 ? 20.96313 11.80280  91.12845  1.000 11.86659 ? 154 ALA A CA  1 
ATOM   1392 C  C   . ALA A 1 154 ? 21.80901 11.35212  92.30991  1.000 11.74482 ? 154 ALA A C   1 
ATOM   1393 O  O   . ALA A 1 154 ? 22.19956 12.17635  93.14304  1.000 12.75768 ? 154 ALA A O   1 
ATOM   1394 C  CB  . ALA A 1 154 ? 19.47809 11.61052  91.42474  1.000 12.66817 ? 154 ALA A CB  1 
ATOM   1395 N  N   . LEU A 1 155 ? 22.09906 10.05033  92.40213  1.000 11.72018 ? 155 LEU A N   1 
ATOM   1396 C  CA  . LEU A 1 155 ? 22.95506 9.56971   93.48376  1.000 12.23916 ? 155 LEU A CA  1 
ATOM   1397 C  C   . LEU A 1 155 ? 24.38141 10.08471  93.32834  1.000 12.27033 ? 155 LEU A C   1 
ATOM   1398 O  O   . LEU A 1 155 ? 25.04151 10.39502  94.32374  1.000 13.46542 ? 155 LEU A O   1 
ATOM   1399 C  CB  . LEU A 1 155 ? 22.90852 8.04614   93.57951  1.000 13.47860 ? 155 LEU A CB  1 
ATOM   1400 C  CG  . LEU A 1 155 ? 21.58012 7.47970   94.08601  1.000 15.62571 ? 155 LEU A CG  1 
ATOM   1401 C  CD1 . LEU A 1 155 ? 21.55099 5.97155   93.89750  1.000 17.58265 ? 155 LEU A CD1 1 
ATOM   1402 C  CD2 . LEU A 1 155 ? 21.34138 7.88278   95.54252  1.000 19.18250 ? 155 LEU A CD2 1 
ATOM   1403 N  N   . ASP A 1 156 ? 24.87718 10.19784  92.08989  1.000 12.30166 ? 156 ASP A N   1 
ATOM   1404 C  CA  . ASP A 1 156 ? 26.16917 10.85204  91.87892  1.000 12.87488 ? 156 ASP A CA  1 
ATOM   1405 C  C   . ASP A 1 156 ? 26.15411 12.27891  92.41747  1.000 12.57041 ? 156 ASP A C   1 
ATOM   1406 O  O   . ASP A 1 156 ? 27.11367 12.71620  93.06405  1.000 13.66968 ? 156 ASP A O   1 
ATOM   1407 C  CB  . ASP A 1 156 ? 26.51498 10.90713  90.38747  1.000 14.17266 ? 156 ASP A CB  1 
ATOM   1408 C  CG  . ASP A 1 156 ? 27.00360 9.58739   89.81917  1.000 15.93313 ? 156 ASP A CG  1 
ATOM   1409 O  OD1 . ASP A 1 156 ? 27.40892 8.68647   90.57751  1.000 16.48280 ? 156 ASP A OD1 1 
ATOM   1410 O  OD2 . ASP A 1 156 ? 27.02831 9.48316   88.56902  1.000 18.28388 ? 156 ASP A OD2 1 
ATOM   1411 N  N   . ARG A 1 157 ? 25.08104 13.02821  92.13811  1.000 12.54363 ? 157 ARG A N   1 
ATOM   1412 C  CA  . ARG A 1 157 ? 24.98402 14.40036  92.63031  1.000 12.47898 ? 157 ARG A CA  1 
ATOM   1413 C  C   . ARG A 1 157 ? 24.84043 14.44586  94.14551  1.000 12.46590 ? 157 ARG A C   1 
ATOM   1414 O  O   . ARG A 1 157 ? 25.38040 15.34555  94.79761  1.000 13.15691 ? 157 ARG A O   1 
ATOM   1415 C  CB  . ARG A 1 157 ? 23.81655 15.12976  91.96848  1.000 12.93150 ? 157 ARG A CB  1 
ATOM   1416 C  CG  . ARG A 1 157 ? 23.90962 15.27693  90.44633  1.000 13.68483 ? 157 ARG A CG  1 
ATOM   1417 C  CD  . ARG A 1 157 ? 25.07462 16.15701  89.96575  1.000 14.82216 ? 157 ARG A CD  1 
ATOM   1418 N  NE  . ARG A 1 157 ? 26.38474 15.51071  90.00276  1.000 15.84863 ? 157 ARG A NE  1 
ATOM   1419 C  CZ  . ARG A 1 157 ? 26.80016 14.59825  89.12823  1.000 16.75670 ? 157 ARG A CZ  1 
ATOM   1420 N  NH1 . ARG A 1 157 ? 25.99402 14.19293  88.15587  1.000 16.68339 ? 157 ARG A NH1 1 
ATOM   1421 N  NH2 . ARG A 1 157 ? 28.02244 14.08139  89.22784  1.000 18.86450 ? 157 ARG A NH2 1 
ATOM   1422 N  N   . MET A 1 158 ? 24.10706 13.49863  94.72398  1.000 12.46756 ? 158 MET A N   1 
ATOM   1423 C  CA  A MET A 1 158 ? 23.95362 13.45364  96.17736  0.707 12.61120 ? 158 MET A CA  1 
ATOM   1424 C  CA  B MET A 1 158 ? 23.96634 13.48681  96.17342  0.293 12.99443 ? 158 MET A CA  1 
ATOM   1425 C  C   . MET A 1 158 ? 25.29367 13.16909  96.84696  1.000 12.65620 ? 158 MET A C   1 
ATOM   1426 O  O   . MET A 1 158 ? 25.65921 13.81339  97.84046  1.000 13.65778 ? 158 MET A O   1 
ATOM   1427 C  CB  A MET A 1 158 ? 22.91310 12.39107  96.55009  0.707 13.39622 ? 158 MET A CB  1 
ATOM   1428 C  CB  B MET A 1 158 ? 22.88272 12.50265  96.59509  0.293 14.28348 ? 158 MET A CB  1 
ATOM   1429 C  CG  A MET A 1 158 ? 22.46333 12.44320  98.00705  0.707 14.78043 ? 158 MET A CG  1 
ATOM   1430 C  CG  B MET A 1 158 ? 22.35941 12.77967  97.97694  0.293 16.37429 ? 158 MET A CG  1 
ATOM   1431 S  SD  A MET A 1 158 ? 21.08983 13.57926  98.31029  0.707 16.61104 ? 158 MET A SD  1 
ATOM   1432 S  SD  B MET A 1 158 ? 21.16914 11.53757  98.44860  0.293 19.77773 ? 158 MET A SD  1 
ATOM   1433 C  CE  A MET A 1 158 ? 19.70705 12.51663  97.92392  0.707 18.50180 ? 158 MET A CE  1 
ATOM   1434 C  CE  B MET A 1 158 ? 19.96419 11.71831  97.13665  0.293 21.56573 ? 158 MET A CE  1 
ATOM   1435 N  N   . LYS A 1 159 ? 26.03932 12.19920  96.30343  1.000 12.73140 ? 159 LYS A N   1 
ATOM   1436 C  CA  . LYS A 1 159 ? 27.37350 11.89839  96.81406  1.000 13.20855 ? 159 LYS A CA  1 
ATOM   1437 C  C   . LYS A 1 159 ? 28.28969 13.10747  96.68769  1.000 13.37479 ? 159 LYS A C   1 
ATOM   1438 O  O   . LYS A 1 159 ? 29.02177 13.44870  97.62479  1.000 14.28382 ? 159 LYS A O   1 
ATOM   1439 C  CB  . LYS A 1 159 ? 27.95396 10.69078  96.07581  1.000 14.30317 ? 159 LYS A CB  1 
ATOM   1440 C  CG  . LYS A 1 159 ? 29.44438 10.51262  96.30390  1.000 15.53854 ? 159 LYS A CG  1 
ATOM   1441 C  CD  . LYS A 1 159 ? 29.95915 9.22731   95.68148  1.000 17.05076 ? 159 LYS A CD  1 
ATOM   1442 C  CE  . LYS A 1 159 ? 31.47875 9.21952   95.56087  1.000 17.71319 ? 159 LYS A CE  1 
ATOM   1443 N  NZ  . LYS A 1 159 ? 32.14894 9.35794   96.88074  1.000 17.42149 ? 159 LYS A NZ  1 
ATOM   1444 N  N   . GLU A 1 160 ? 28.24734 13.77724  95.53308  1.000 13.86155 ? 160 GLU A N   1 
ATOM   1445 C  CA  . GLU A 1 160 ? 29.08221 14.95308  95.31933  1.000 14.19329 ? 160 GLU A CA  1 
ATOM   1446 C  C   . GLU A 1 160 ? 28.81302 16.00891  96.38034  1.000 14.07410 ? 160 GLU A C   1 
ATOM   1447 O  O   . GLU A 1 160 ? 29.74252 16.59208  96.94941  1.000 15.17413 ? 160 GLU A O   1 
ATOM   1448 C  CB  . GLU A 1 160 ? 28.82287 15.51993  93.92352  1.000 15.09958 ? 160 GLU A CB  1 
ATOM   1449 C  CG  . GLU A 1 160 ? 29.74565 16.66044  93.56676  1.000 16.74591 ? 160 GLU A CG  1 
ATOM   1450 C  CD  . GLU A 1 160 ? 29.45359 17.26637  92.21212  1.000 17.71477 ? 160 GLU A CD  1 
ATOM   1451 O  OE1 . GLU A 1 160 ? 28.45170 16.88826  91.55253  1.000 17.73062 ? 160 GLU A OE1 1 
ATOM   1452 O  OE2 . GLU A 1 160 ? 30.24513 18.13821  91.81601  1.000 19.62945 ? 160 GLU A OE2 1 
ATOM   1453 N  N   . ALA A 1 161 ? 27.53527 16.26373  96.66002  1.000 13.99335 ? 161 ALA A N   1 
ATOM   1454 C  CA  . ALA A 1 161 ? 27.16906 17.26580  97.65188  1.000 14.25378 ? 161 ALA A CA  1 
ATOM   1455 C  C   . ALA A 1 161 ? 27.67987 16.88902  99.03397  1.000 13.70275 ? 161 ALA A C   1 
ATOM   1456 O  O   . ALA A 1 161 ? 28.28864 17.71140  99.72302  1.000 14.57261 ? 161 ALA A O   1 
ATOM   1457 C  CB  . ALA A 1 161 ? 25.65269 17.43825  97.67647  1.000 15.01573 ? 161 ALA A CB  1 
ATOM   1458 N  N   . PHE A 1 162 ? 27.42012 15.65496  99.47192  1.000 13.41125 ? 162 PHE A N   1 
ATOM   1459 C  CA  . PHE A 1 162 ? 27.86554 15.26465  100.80445 1.000 13.56433 ? 162 PHE A CA  1 
ATOM   1460 C  C   . PHE A 1 162 ? 29.38388 15.22131  100.90261 1.000 13.97452 ? 162 PHE A C   1 
ATOM   1461 O  O   . PHE A 1 162 ? 29.94342 15.56296  101.94728 1.000 14.80165 ? 162 PHE A O   1 
ATOM   1462 C  CB  . PHE A 1 162 ? 27.22273 13.94697  101.23289 1.000 13.91715 ? 162 PHE A CB  1 
ATOM   1463 C  CG  . PHE A 1 162 ? 25.81375 14.10948  101.74058 1.000 14.66671 ? 162 PHE A CG  1 
ATOM   1464 C  CD1 . PHE A 1 162 ? 25.56839 14.72034  102.96016 1.000 17.19042 ? 162 PHE A CD1 1 
ATOM   1465 C  CD2 . PHE A 1 162 ? 24.73673 13.67318  101.00664 1.000 15.97303 ? 162 PHE A CD2 1 
ATOM   1466 C  CE1 . PHE A 1 162 ? 24.27524 14.87608  103.43004 1.000 18.76847 ? 162 PHE A CE1 1 
ATOM   1467 C  CE2 . PHE A 1 162 ? 23.44475 13.82984  101.47760 1.000 17.47401 ? 162 PHE A CE2 1 
ATOM   1468 C  CZ  . PHE A 1 162 ? 23.21853 14.42628  102.68449 1.000 18.41161 ? 162 PHE A CZ  1 
ATOM   1469 N  N   . ASP A 1 163 ? 30.06789 14.81055  99.83459  1.000 14.26332 ? 163 ASP A N   1 
ATOM   1470 C  CA  . ASP A 1 163 ? 31.52659 14.82306  99.86278  1.000 15.15284 ? 163 ASP A CA  1 
ATOM   1471 C  C   . ASP A 1 163 ? 32.06874 16.24589  100.00399 1.000 15.46061 ? 163 ASP A C   1 
ATOM   1472 O  O   . ASP A 1 163 ? 33.02344 16.48496  100.75440 1.000 16.61832 ? 163 ASP A O   1 
ATOM   1473 C  CB  . ASP A 1 163 ? 32.08332 14.16045  98.60266  1.000 15.66930 ? 163 ASP A CB  1 
ATOM   1474 C  CG  . ASP A 1 163 ? 32.02333 12.64198  98.63919  1.000 16.02253 ? 163 ASP A CG  1 
ATOM   1475 O  OD1 . ASP A 1 163 ? 31.87589 12.05769  99.72671  1.000 16.73386 ? 163 ASP A OD1 1 
ATOM   1476 O  OD2 . ASP A 1 163 ? 32.16152 12.02945  97.56425  1.000 17.26992 ? 163 ASP A OD2 1 
ATOM   1477 N  N   . LEU A 1 164 ? 31.46024 17.20595  99.30229  1.000 15.48080 ? 164 LEU A N   1 
ATOM   1478 C  CA  . LEU A 1 164 ? 31.88077 18.59859  99.42226  1.000 16.01440 ? 164 LEU A CA  1 
ATOM   1479 C  C   . LEU A 1 164 ? 31.65866 19.12487  100.83471 1.000 16.10315 ? 164 LEU A C   1 
ATOM   1480 O  O   . LEU A 1 164 ? 32.50173 19.85362  101.36981 1.000 17.22702 ? 164 LEU A O   1 
ATOM   1481 C  CB  . LEU A 1 164 ? 31.14065 19.45969  98.40056  1.000 17.66591 ? 164 LEU A CB  1 
ATOM   1482 C  CG  . LEU A 1 164 ? 31.62899 19.38558  96.95533  1.000 21.80693 ? 164 LEU A CG  1 
ATOM   1483 C  CD1 . LEU A 1 164 ? 30.57474 19.92791  95.99682  1.000 23.64329 ? 164 LEU A CD1 1 
ATOM   1484 C  CD2 . LEU A 1 164 ? 32.92755 20.15823  96.79819  1.000 25.09923 ? 164 LEU A CD2 1 
ATOM   1485 N  N   . LEU A 1 165 ? 30.53104 18.76359  101.45806 1.000 15.56217 ? 165 LEU A N   1 
ATOM   1486 C  CA  . LEU A 1 165 ? 30.28010 19.19137  102.83106 1.000 15.92229 ? 165 LEU A CA  1 
ATOM   1487 C  C   . LEU A 1 165 ? 31.30742 18.59762  103.78789 1.000 16.17052 ? 165 LEU A C   1 
ATOM   1488 O  O   . LEU A 1 165 ? 31.73443 19.26166  104.73870 1.000 17.55505 ? 165 LEU A O   1 
ATOM   1489 C  CB  . LEU A 1 165 ? 28.85467 18.81834  103.24968 1.000 16.71044 ? 165 LEU A CB  1 
ATOM   1490 C  CG  . LEU A 1 165 ? 27.72858 19.50629  102.47297 1.000 18.89660 ? 165 LEU A CG  1 
ATOM   1491 C  CD1 . LEU A 1 165 ? 26.36877 18.99016  102.92411 1.000 21.26610 ? 165 LEU A CD1 1 
ATOM   1492 C  CD2 . LEU A 1 165 ? 27.80293 21.01994  102.62069 1.000 20.04094 ? 165 LEU A CD2 1 
ATOM   1493 N  N   . GLY A 1 166 ? 31.70739 17.34366  103.55393 1.000 16.36612 ? 166 GLY A N   1 
ATOM   1494 C  CA  . GLY A 1 166 ? 32.74383 16.73489  104.37241 1.000 17.02950 ? 166 GLY A CA  1 
ATOM   1495 C  C   . GLY A 1 166 ? 34.08739 17.41464  104.19631 1.000 17.76038 ? 166 GLY A C   1 
ATOM   1496 O  O   . GLY A 1 166 ? 34.82983 17.60429  105.16235 1.000 18.94881 ? 166 GLY A O   1 
ATOM   1497 N  N   . GLU A 1 167 ? 34.41315 17.79641  102.95868 1.000 17.87075 ? 167 GLU A N   1 
ATOM   1498 C  CA  . GLU A 1 167 ? 35.62825 18.56248  102.71239 1.000 19.24844 ? 167 GLU A CA  1 
ATOM   1499 C  C   . GLU A 1 167 ? 35.57687 19.90053  103.43650 1.000 19.17233 ? 167 GLU A C   1 
ATOM   1500 O  O   . GLU A 1 167 ? 36.58017 20.34734  104.00476 1.000 20.37905 ? 167 GLU A O   1 
ATOM   1501 C  CB  . GLU A 1 167 ? 35.82272 18.75248  101.20548 1.000 22.02823 ? 167 GLU A CB  1 
ATOM   1502 C  CG  . GLU A 1 167 ? 37.14163 19.41663  100.84005 1.000 26.33004 ? 167 GLU A CG  1 
ATOM   1503 C  CD  . GLU A 1 167 ? 37.29164 19.66913  99.35219  1.000 33.67328 ? 167 GLU A CD  1 
ATOM   1504 O  OE1 . GLU A 1 167 ? 36.46568 19.15594  98.56856  1.000 34.91997 ? 167 GLU A OE1 1 
ATOM   1505 O  OE2 . GLU A 1 167 ? 38.24551 20.37692  98.96535  1.000 41.40812 ? 167 GLU A OE2 1 
ATOM   1506 N  N   . TYR A 1 168 ? 34.40383 20.53653  103.46196 1.000 18.55817 ? 168 TYR A N   1 
ATOM   1507 C  CA  . TYR A 1 168 ? 34.28713 21.83352  104.11836 1.000 18.37819 ? 168 TYR A CA  1 
ATOM   1508 C  C   . TYR A 1 168 ? 34.52742 21.72071  105.62002 1.000 18.65730 ? 168 TYR A C   1 
ATOM   1509 O  O   . TYR A 1 168 ? 35.31839 22.47986  106.19287 1.000 19.78200 ? 168 TYR A O   1 
ATOM   1510 C  CB  . TYR A 1 168 ? 32.92124 22.46566  103.82836 1.000 18.69176 ? 168 TYR A CB  1 
ATOM   1511 C  CG  . TYR A 1 168 ? 32.79192 23.82477  104.47654 1.000 19.10722 ? 168 TYR A CG  1 
ATOM   1512 C  CD1 . TYR A 1 168 ? 33.50792 24.91329  103.98907 1.000 19.79205 ? 168 TYR A CD1 1 
ATOM   1513 C  CD2 . TYR A 1 168 ? 31.99721 24.01671  105.59774 1.000 19.32854 ? 168 TYR A CD2 1 
ATOM   1514 C  CE1 . TYR A 1 168 ? 33.42320 26.15552  104.59089 1.000 20.32693 ? 168 TYR A CE1 1 
ATOM   1515 C  CE2 . TYR A 1 168 ? 31.90415 25.26417  106.20227 1.000 19.58834 ? 168 TYR A CE2 1 
ATOM   1516 C  CZ  . TYR A 1 168 ? 32.61888 26.32712  105.68896 1.000 20.41124 ? 168 TYR A CZ  1 
ATOM   1517 O  OH  . TYR A 1 168 ? 32.54724 27.57190  106.27376 1.000 22.52157 ? 168 TYR A OH  1 
ATOM   1518 N  N   . VAL A 1 169 ? 33.84983 20.77669  106.27949 1.000 18.87975 ? 169 VAL A N   1 
ATOM   1519 C  CA  A VAL A 1 169 ? 34.00941 20.70433  107.72654 0.567 19.42175 ? 169 VAL A CA  1 
ATOM   1520 C  CA  B VAL A 1 169 ? 33.97784 20.60410  107.72840 0.433 19.58904 ? 169 VAL A CA  1 
ATOM   1521 C  C   . VAL A 1 169 ? 35.42146 20.28207  108.10599 1.000 20.34081 ? 169 VAL A C   1 
ATOM   1522 O  O   . VAL A 1 169 ? 35.96630 20.78521  109.09851 1.000 22.13463 ? 169 VAL A O   1 
ATOM   1523 C  CB  A VAL A 1 169 ? 32.91100 19.87782  108.42495 0.567 20.00146 ? 169 VAL A CB  1 
ATOM   1524 C  CB  B VAL A 1 169 ? 33.01192 19.49929  108.19846 0.433 20.59487 ? 169 VAL A CB  1 
ATOM   1525 C  CG1 A VAL A 1 169 ? 31.53549 20.43807  108.09347 0.567 20.46343 ? 169 VAL A CG1 1 
ATOM   1526 C  CG1 B VAL A 1 169 ? 33.46455 18.89795  109.52350 0.433 20.93748 ? 169 VAL A CG1 1 
ATOM   1527 C  CG2 A VAL A 1 169 ? 33.01816 18.41268  108.05331 0.567 20.60809 ? 169 VAL A CG2 1 
ATOM   1528 C  CG2 B VAL A 1 169 ? 31.58664 20.02995  108.28098 0.433 21.61144 ? 169 VAL A CG2 1 
ATOM   1529 N  N   . THR A 1 170 ? 36.05014 19.39856  107.32921 1.000 21.29998 ? 170 THR A N   1 
ATOM   1530 C  CA  A THR A 1 170 ? 37.42922 18.99033  107.59077 0.660 23.72125 ? 170 THR A CA  1 
ATOM   1531 C  CA  B THR A 1 170 ? 37.41510 19.01738  107.66293 0.340 22.77587 ? 170 THR A CA  1 
ATOM   1532 C  C   . THR A 1 170 ? 38.38902 20.16228  107.41239 1.000 24.38819 ? 170 THR A C   1 
ATOM   1533 O  O   . THR A 1 170 ? 39.31691 20.36127  108.20436 1.000 26.99389 ? 170 THR A O   1 
ATOM   1534 C  CB  A THR A 1 170 ? 37.79947 17.86449  106.62282 0.660 26.93451 ? 170 THR A CB  1 
ATOM   1535 C  CB  B THR A 1 170 ? 37.82854 17.72984  106.94832 0.340 23.84484 ? 170 THR A CB  1 
ATOM   1536 O  OG1 A THR A 1 170 ? 36.92871 16.74480  106.82943 0.660 28.14677 ? 170 THR A OG1 1 
ATOM   1537 O  OG1 B THR A 1 170 ? 37.60859 17.86142  105.54033 0.340 24.56989 ? 170 THR A OG1 1 
ATOM   1538 C  CG2 A THR A 1 170 ? 39.24203 17.43120  106.82900 0.660 28.43645 ? 170 THR A CG2 1 
ATOM   1539 C  CG2 B THR A 1 170 ? 37.02409 16.54845  107.48190 0.340 24.17444 ? 170 THR A CG2 1 
ATOM   1540 N  N   . SER A 1 171 ? 38.18415 20.94083  106.34532 1.000 24.73856 ? 171 SER A N   1 
ATOM   1541 C  CA  . SER A 1 171 ? 39.03891 22.09169  106.06699 1.000 27.25066 ? 171 SER A CA  1 
ATOM   1542 C  C   . SER A 1 171 ? 38.95309 23.14991  107.15954 1.000 27.14949 ? 171 SER A C   1 
ATOM   1543 O  O   . SER A 1 171 ? 39.95588 23.80848  107.46150 1.000 29.15757 ? 171 SER A O   1 
ATOM   1544 C  CB  . SER A 1 171 ? 38.67113 22.67838  104.70484 1.000 31.05319 ? 171 SER A CB  1 
ATOM   1545 O  OG  . SER A 1 171 ? 37.56247 23.55932  104.81112 1.000 34.41387 ? 171 SER A OG  1 
ATOM   1546 N  N   . GLN A 1 172 ? 37.78022 23.32374  107.76409 1.000 25.15985 ? 172 GLN A N   1 
ATOM   1547 C  CA  . GLN A 1 172 ? 37.58724 24.31603  108.81204 1.000 25.06621 ? 172 GLN A CA  1 
ATOM   1548 C  C   . GLN A 1 172 ? 37.94626 23.79914  110.19886 1.000 25.78013 ? 172 GLN A C   1 
ATOM   1549 O  O   . GLN A 1 172 ? 38.00032 24.59422  111.14296 1.000 28.93640 ? 172 GLN A O   1 
ATOM   1550 C  CB  . GLN A 1 172 ? 36.13419 24.80570  108.81444 1.000 25.99261 ? 172 GLN A CB  1 
ATOM   1551 C  CG  . GLN A 1 172 ? 35.67297 25.38130  107.48598 1.000 29.12120 ? 172 GLN A CG  1 
ATOM   1552 C  CD  . GLN A 1 172 ? 36.37865 26.66873  107.12489 1.000 38.64532 ? 172 GLN A CD  1 
ATOM   1553 O  OE1 . GLN A 1 172 ? 37.31843 26.67845  106.32951 1.000 45.55569 ? 172 GLN A OE1 1 
ATOM   1554 N  NE2 . GLN A 1 172 ? 35.91790 27.77080  107.70057 1.000 44.01667 ? 172 GLN A NE2 1 
ATOM   1555 N  N   . GLY A 1 173 ? 38.19456 22.49994  110.34405 1.000 24.94015 ? 173 GLY A N   1 
ATOM   1556 C  CA  . GLY A 1 173 ? 38.48992 21.93391  111.64660 1.000 26.06774 ? 173 GLY A CA  1 
ATOM   1557 C  C   . GLY A 1 173 ? 37.29370 21.81533  112.56332 1.000 26.52261 ? 173 GLY A C   1 
ATOM   1558 O  O   . GLY A 1 173 ? 37.45743 21.81935  113.78598 1.000 29.58378 ? 173 GLY A O   1 
ATOM   1559 N  N   . TYR A 1 174 ? 36.08955 21.70508  112.00755 1.000 23.73814 ? 174 TYR A N   1 
ATOM   1560 C  CA  . TYR A 1 174 ? 34.88843 21.61356  112.82399 1.000 23.42909 ? 174 TYR A CA  1 
ATOM   1561 C  C   . TYR A 1 174 ? 34.69224 20.19497  113.35515 1.000 25.26490 ? 174 TYR A C   1 
ATOM   1562 O  O   . TYR A 1 174 ? 34.97550 19.20929  112.66712 1.000 28.47430 ? 174 TYR A O   1 
ATOM   1563 C  CB  . TYR A 1 174 ? 33.65256 21.98958  112.00910 1.000 23.06351 ? 174 TYR A CB  1 
ATOM   1564 C  CG  . TYR A 1 174 ? 33.51591 23.43372  111.55946 1.000 22.65075 ? 174 TYR A CG  1 
ATOM   1565 C  CD1 . TYR A 1 174 ? 34.15180 24.47093  112.22018 1.000 23.97198 ? 174 TYR A CD1 1 
ATOM   1566 C  CD2 . TYR A 1 174 ? 32.68411 23.75432  110.48654 1.000 22.72863 ? 174 TYR A CD2 1 
ATOM   1567 C  CE1 . TYR A 1 174 ? 33.99063 25.78601  111.80210 1.000 25.14018 ? 174 TYR A CE1 1 
ATOM   1568 C  CE2 . TYR A 1 174 ? 32.51556 25.06074  110.06629 1.000 24.24489 ? 174 TYR A CE2 1 
ATOM   1569 C  CZ  . TYR A 1 174 ? 33.17156 26.07311  110.72617 1.000 25.56239 ? 174 TYR A CZ  1 
ATOM   1570 O  OH  . TYR A 1 174 ? 33.00113 27.37243  110.30469 1.000 27.79516 ? 174 TYR A OH  1 
ATOM   1571 N  N   A ASP A 1 175 ? 34.10885 20.07608  114.55117 0.448 26.33069 ? 175 ASP A N   1 
ATOM   1572 N  N   B ASP A 1 175 ? 34.29628 20.13875  114.62574 0.552 25.05524 ? 175 ASP A N   1 
ATOM   1573 C  CA  A ASP A 1 175 ? 33.91371 18.78065  115.21899 0.448 28.52575 ? 175 ASP A CA  1 
ATOM   1574 C  CA  B ASP A 1 175 ? 33.82244 18.92855  115.27754 0.552 27.11633 ? 175 ASP A CA  1 
ATOM   1575 C  C   A ASP A 1 175 ? 32.60104 18.08855  114.82008 0.448 26.66941 ? 175 ASP A C   1 
ATOM   1576 C  C   B ASP A 1 175 ? 32.30152 18.89856  115.16999 0.552 25.17950 ? 175 ASP A C   1 
ATOM   1577 O  O   A ASP A 1 175 ? 32.31246 16.98427  115.28602 0.448 29.28790 ? 175 ASP A O   1 
ATOM   1578 O  O   B ASP A 1 175 ? 31.56452 19.10311  116.13469 0.552 26.65754 ? 175 ASP A O   1 
ATOM   1579 C  CB  A ASP A 1 175 ? 33.97306 18.98993  116.74335 0.448 32.72191 ? 175 ASP A CB  1 
ATOM   1580 C  CB  B ASP A 1 175 ? 34.25047 18.90993  116.74446 0.552 31.99309 ? 175 ASP A CB  1 
ATOM   1581 C  CG  A ASP A 1 175 ? 34.02499 17.68528  117.56128 0.448 37.75705 ? 175 ASP A CG  1 
ATOM   1582 C  CG  B ASP A 1 175 ? 35.74947 18.99589  116.92552 0.552 39.23425 ? 175 ASP A CG  1 
ATOM   1583 O  OD1 A ASP A 1 175 ? 34.05687 16.55744  117.02013 0.448 40.20598 ? 175 ASP A OD1 1 
ATOM   1584 O  OD1 B ASP A 1 175 ? 36.47727 18.20427  116.29252 0.552 41.32681 ? 175 ASP A OD1 1 
ATOM   1585 O  OD2 A ASP A 1 175 ? 34.05187 17.81790  118.80203 0.448 42.11003 ? 175 ASP A OD2 1 
ATOM   1586 O  OD2 B ASP A 1 175 ? 36.20118 19.85599  117.71144 0.552 46.75302 ? 175 ASP A OD2 1 
ATOM   1587 N  N   . ILE A 1 176 ? 31.83890 18.68066  113.94840 1.000 22.50201 ? 176 ILE A N   1 
ATOM   1588 C  CA  . ILE A 1 176 ? 30.45479 18.30616  113.71938 1.000 19.81456 ? 176 ILE A CA  1 
ATOM   1589 C  C   . ILE A 1 176 ? 30.40470 17.08640  112.80563 1.000 18.86063 ? 176 ILE A C   1 
ATOM   1590 O  O   . ILE A 1 176 ? 31.30223 16.85838  111.98870 1.000 22.33619 ? 176 ILE A O   1 
ATOM   1591 C  CB  . ILE A 1 176 ? 29.73480 19.54344  113.14553 1.000 20.72858 ? 176 ILE A CB  1 
ATOM   1592 C  CG1 . ILE A 1 176 ? 28.22040 19.41360  113.26452 1.000 20.91315 ? 176 ILE A CG1 1 
ATOM   1593 C  CG2 . ILE A 1 176 ? 30.20599 19.83105  111.72729 1.000 23.30808 ? 176 ILE A CG2 1 
ATOM   1594 C  CD1 . ILE A 1 176 ? 27.49987 20.73270  113.12234 1.000 22.61208 ? 176 ILE A CD1 1 
ATOM   1595 N  N   A ARG A 1 177 ? 29.34544 16.28816  112.96064 0.729 17.16045 ? 177 ARG A N   1 
ATOM   1596 N  N   B ARG A 1 177 ? 29.36997 16.27151  112.96635 0.271 17.24114 ? 177 ARG A N   1 
ATOM   1597 C  CA  A ARG A 1 177 ? 29.08182 15.12660  112.12440 0.729 16.94919 ? 177 ARG A CA  1 
ATOM   1598 C  CA  B ARG A 1 177 ? 29.13978 15.18468  112.02972 0.271 17.07112 ? 177 ARG A CA  1 
ATOM   1599 C  C   A ARG A 1 177 ? 27.72184 15.28691  111.46069 0.729 15.65518 ? 177 ARG A C   1 
ATOM   1600 C  C   B ARG A 1 177 ? 27.74903 15.31703  111.42893 0.271 15.81203 ? 177 ARG A C   1 
ATOM   1601 O  O   A ARG A 1 177 ? 26.85906 16.01685  111.95016 0.729 17.30610 ? 177 ARG A O   1 
ATOM   1602 O  O   B ARG A 1 177 ? 26.89913 16.05920  111.92618 0.271 17.19107 ? 177 ARG A O   1 
ATOM   1603 C  CB  A ARG A 1 177 ? 29.08361 13.83593  112.94973 0.729 20.16399 ? 177 ARG A CB  1 
ATOM   1604 C  CB  B ARG A 1 177 ? 29.33524 13.80061  112.66557 0.271 19.57676 ? 177 ARG A CB  1 
ATOM   1605 C  CG  A ARG A 1 177 ? 30.43268 13.52693  113.57644 0.729 24.97295 ? 177 ARG A CG  1 
ATOM   1606 C  CG  B ARG A 1 177 ? 28.61866 13.62231  113.98358 0.271 23.44163 ? 177 ARG A CG  1 
ATOM   1607 C  CD  A ARG A 1 177 ? 30.47528 12.13720  114.18848 0.729 28.95735 ? 177 ARG A CD  1 
ATOM   1608 C  CD  B ARG A 1 177 ? 29.42362 12.79302  114.98291 0.271 27.86659 ? 177 ARG A CD  1 
ATOM   1609 N  NE  A ARG A 1 177 ? 29.42746 11.94319  115.18593 0.729 31.89458 ? 177 ARG A NE  1 
ATOM   1610 N  NE  B ARG A 1 177 ? 28.63388 11.92061  115.86507 0.271 30.37808 ? 177 ARG A NE  1 
ATOM   1611 C  CZ  A ARG A 1 177 ? 29.26507 10.82579  115.88663 0.729 33.09000 ? 177 ARG A CZ  1 
ATOM   1612 C  CZ  B ARG A 1 177 ? 27.46247 12.20075  116.44375 0.271 31.17989 ? 177 ARG A CZ  1 
ATOM   1613 N  NH1 A ARG A 1 177 ? 30.08538 9.80016   115.69976 0.729 34.79411 ? 177 ARG A NH1 1 
ATOM   1614 N  NH1 B ARG A 1 177 ? 26.85488 13.37355  116.30162 0.271 30.02129 ? 177 ARG A NH1 1 
ATOM   1615 N  NH2 A ARG A 1 177 ? 28.28382 10.73412  116.77471 0.729 31.99034 ? 177 ARG A NH2 1 
ATOM   1616 N  NH2 B ARG A 1 177 ? 26.89947 11.28045  117.21147 0.271 33.85508 ? 177 ARG A NH2 1 
ATOM   1617 N  N   . PHE A 1 178 ? 27.53469 14.59042  110.34359 1.000 14.24160 ? 178 PHE A N   1 
ATOM   1618 C  CA  . PHE A 1 178 ? 26.30778 14.67359  109.56544 1.000 13.42104 ? 178 PHE A CA  1 
ATOM   1619 C  C   . PHE A 1 178 ? 25.42315 13.46579  109.82829 1.000 13.14883 ? 178 PHE A C   1 
ATOM   1620 O  O   . PHE A 1 178 ? 25.91351 12.35756  110.04234 1.000 14.92590 ? 178 PHE A O   1 
ATOM   1621 C  CB  . PHE A 1 178 ? 26.63903 14.72157  108.07449 1.000 14.82230 ? 178 PHE A CB  1 
ATOM   1622 C  CG  . PHE A 1 178 ? 27.36752 15.96080  107.66542 1.000 16.30410 ? 178 PHE A CG  1 
ATOM   1623 C  CD1 . PHE A 1 178 ? 26.68611 17.15947  107.51945 1.000 17.93311 ? 178 PHE A CD1 1 
ATOM   1624 C  CD2 . PHE A 1 178 ? 28.73397 15.94055  107.45606 1.000 18.08107 ? 178 PHE A CD2 1 
ATOM   1625 C  CE1 . PHE A 1 178 ? 27.34938 18.31418  107.15925 1.000 19.72239 ? 178 PHE A CE1 1 
ATOM   1626 C  CE2 . PHE A 1 178 ? 29.40790 17.09734  107.09299 1.000 19.63237 ? 178 PHE A CE2 1 
ATOM   1627 C  CZ  . PHE A 1 178 ? 28.71329 18.28108  106.94639 1.000 20.25320 ? 178 PHE A CZ  1 
ATOM   1628 N  N   . ALA A 1 179 ? 24.10867 13.68373  109.77981 1.000 13.09758 ? 179 ALA A N   1 
ATOM   1629 C  CA  . ALA A 1 179 ? 23.15066 12.59427  109.91042 1.000 13.37911 ? 179 ALA A CA  1 
ATOM   1630 C  C   . ALA A 1 179 ? 22.08169 12.75285  108.84188 1.000 13.50835 ? 179 ALA A C   1 
ATOM   1631 O  O   . ALA A 1 179 ? 21.42168 13.79118  108.77024 1.000 16.36671 ? 179 ALA A O   1 
ATOM   1632 C  CB  . ALA A 1 179 ? 22.53092 12.58221  111.31146 1.000 14.30309 ? 179 ALA A CB  1 
ATOM   1633 N  N   . ILE A 1 180 ? 21.93661 11.73615  108.00723 1.000 11.81186 ? 180 ILE A N   1 
ATOM   1634 C  CA  . ILE A 1 180 ? 20.95478 11.72305  106.92864 1.000 12.02895 ? 180 ILE A CA  1 
ATOM   1635 C  C   . ILE A 1 180 ? 19.64822 11.16796  107.47399 1.000 11.03135 ? 180 ILE A C   1 
ATOM   1636 O  O   . ILE A 1 180 ? 19.63105 10.09731  108.09318 1.000 11.92349 ? 180 ILE A O   1 
ATOM   1637 C  CB  . ILE A 1 180 ? 21.46369 10.85436  105.76926 1.000 15.05859 ? 180 ILE A CB  1 
ATOM   1638 C  CG1 . ILE A 1 180 ? 22.71296 11.48168  105.15277 1.000 18.93971 ? 180 ILE A CG1 1 
ATOM   1639 C  CG2 . ILE A 1 180 ? 20.37415 10.65832  104.73024 1.000 17.40918 ? 180 ILE A CG2 1 
ATOM   1640 C  CD1 . ILE A 1 180 ? 23.41707 10.60191  104.12734 1.000 23.45473 ? 180 ILE A CD1 1 
ATOM   1641 N  N   . GLU A 1 181 ? 18.54776 11.88541  107.21558 1.000 11.40043 ? 181 GLU A N   1 
ATOM   1642 C  CA  A GLU A 1 181 ? 17.22622 11.48103  107.67780 0.574 11.88725 ? 181 GLU A CA  1 
ATOM   1643 C  CA  B GLU A 1 181 ? 17.22693 11.48074  107.67585 0.426 11.74257 ? 181 GLU A CA  1 
ATOM   1644 C  C   . GLU A 1 181 ? 16.43719 10.90568  106.51294 1.000 11.95826 ? 181 GLU A C   1 
ATOM   1645 O  O   . GLU A 1 181 ? 16.06344 11.65685  105.59933 1.000 14.48343 ? 181 GLU A O   1 
ATOM   1646 C  CB  A GLU A 1 181 ? 16.47904 12.67326  108.26865 0.574 13.05941 ? 181 GLU A CB  1 
ATOM   1647 C  CB  B GLU A 1 181 ? 16.48166 12.67403  108.25800 0.426 12.62531 ? 181 GLU A CB  1 
ATOM   1648 C  CG  A GLU A 1 181 ? 15.12765 12.30373  108.87717 0.574 13.93702 ? 181 GLU A CG  1 
ATOM   1649 C  CG  B GLU A 1 181 ? 15.04365 12.35439  108.62151 0.426 13.34160 ? 181 GLU A CG  1 
ATOM   1650 C  CD  A GLU A 1 181 ? 14.36679 13.50763  109.41492 0.574 15.68928 ? 181 GLU A CD  1 
ATOM   1651 C  CD  B GLU A 1 181 ? 14.49697 13.29061  109.67443 0.426 14.66707 ? 181 GLU A CD  1 
ATOM   1652 O  OE1 A GLU A 1 181 ? 14.95130 14.60048  109.53349 0.574 18.58109 ? 181 GLU A OE1 1 
ATOM   1653 O  OE1 B GLU A 1 181 ? 15.19067 14.26353  110.03366 0.426 16.33730 ? 181 GLU A OE1 1 
ATOM   1654 O  OE2 A GLU A 1 181 ? 13.17175 13.36327  109.72769 0.574 18.00720 ? 181 GLU A OE2 1 
ATOM   1655 O  OE2 B GLU A 1 181 ? 13.37460 13.04873  110.15112 0.426 15.01515 ? 181 GLU A OE2 1 
ATOM   1656 N  N   . PRO A 1 182 ? 16.14022 9.61354   106.50296 1.000 11.24954 ? 182 PRO A N   1 
ATOM   1657 C  CA  . PRO A 1 182 ? 15.35254 9.03405   105.41406 1.000 11.56586 ? 182 PRO A CA  1 
ATOM   1658 C  C   . PRO A 1 182 ? 13.86851 9.30026   105.59328 1.000 10.97061 ? 182 PRO A C   1 
ATOM   1659 O  O   . PRO A 1 182 ? 13.35938 9.49555   106.69657 1.000 11.48210 ? 182 PRO A O   1 
ATOM   1660 C  CB  . PRO A 1 182 ? 15.62180 7.52810   105.52907 1.000 13.38502 ? 182 PRO A CB  1 
ATOM   1661 C  CG  . PRO A 1 182 ? 16.56064 7.34387   106.66971 1.000 13.73886 ? 182 PRO A CG  1 
ATOM   1662 C  CD  . PRO A 1 182 ? 16.61160 8.60361   107.45711 1.000 12.31921 ? 182 PRO A CD  1 
ATOM   1663 N  N   . LYS A 1 183 ? 13.16448 9.26401   104.45987 1.000 10.52974 ? 183 LYS A N   1 
ATOM   1664 C  CA  . LYS A 1 183 ? 11.70471 9.27398   104.41183 1.000 10.04118 ? 183 LYS A CA  1 
ATOM   1665 C  C   . LYS A 1 183 ? 11.30060 8.66026   103.08540 1.000 9.55037  ? 183 LYS A C   1 
ATOM   1666 O  O   . LYS A 1 183 ? 11.95625 8.94802   102.07972 1.000 10.58610 ? 183 LYS A O   1 
ATOM   1667 C  CB  . LYS A 1 183 ? 11.15220 10.69812  104.50870 1.000 10.62338 ? 183 LYS A CB  1 
ATOM   1668 C  CG  . LYS A 1 183 ? 9.65241  10.77543  104.70590 1.000 11.11852 ? 183 LYS A CG  1 
ATOM   1669 C  CD  . LYS A 1 183 ? 9.15754  12.20658  104.75931 1.000 11.76626 ? 183 LYS A CD  1 
ATOM   1670 C  CE  . LYS A 1 183 ? 7.69627  12.27870  105.14573 1.000 12.79370 ? 183 LYS A CE  1 
ATOM   1671 N  NZ  . LYS A 1 183 ? 7.19973  13.68806  105.12180 1.000 16.55520 ? 183 LYS A NZ  1 
ATOM   1672 N  N   . PRO A 1 184 ? 10.25948 7.82471   103.01964 1.000 9.09860  ? 184 PRO A N   1 
ATOM   1673 C  CA  A PRO A 1 184 ? 10.02497 7.12465   101.74853 0.757 9.73006  ? 184 PRO A CA  1 
ATOM   1674 C  CA  B PRO A 1 184 ? 9.98460  7.10678   101.76467 0.243 9.43715  ? 184 PRO A CA  1 
ATOM   1675 C  C   . PRO A 1 184 ? 9.30513  7.94619   100.69261 1.000 9.01095  ? 184 PRO A C   1 
ATOM   1676 O  O   . PRO A 1 184 ? 9.51973  7.73579   99.49714  1.000 9.35836  ? 184 PRO A O   1 
ATOM   1677 C  CB  A PRO A 1 184 ? 9.21787  5.89041   102.16447 0.757 11.25979 ? 184 PRO A CB  1 
ATOM   1678 C  CB  B PRO A 1 184 ? 9.07860  5.94893   102.21228 0.243 9.72535  ? 184 PRO A CB  1 
ATOM   1679 C  CG  A PRO A 1 184 ? 8.53837  6.30832   103.42579 0.757 11.13845 ? 184 PRO A CG  1 
ATOM   1680 C  CG  B PRO A 1 184 ? 9.29178  5.82475   103.69819 0.243 9.04880  ? 184 PRO A CG  1 
ATOM   1681 C  CD  A PRO A 1 184 ? 9.52339  7.19467   104.13676 0.757 10.70462 ? 184 PRO A CD  1 
ATOM   1682 C  CD  B PRO A 1 184 ? 9.51877  7.23970   104.15286 0.243 9.50169  ? 184 PRO A CD  1 
ATOM   1683 N  N   . ASN A 1 185 ? 8.45230  8.86535   101.11459 1.000 8.79819  ? 185 ASN A N   1 
ATOM   1684 C  CA  . ASN A 1 185 ? 7.63301  9.66880   100.22068 1.000 9.31377  ? 185 ASN A CA  1 
ATOM   1685 C  C   . ASN A 1 185 ? 7.10971  10.83289  101.04468 1.000 9.26217  ? 185 ASN A C   1 
ATOM   1686 O  O   . ASN A 1 185 ? 7.19239  10.81819  102.27733 1.000 9.90888  ? 185 ASN A O   1 
ATOM   1687 C  CB  . ASN A 1 185 ? 6.50662  8.83396   99.59019  1.000 9.90260  ? 185 ASN A CB  1 
ATOM   1688 C  CG  . ASN A 1 185 ? 5.45386  8.42039   100.60577 1.000 9.80411  ? 185 ASN A CG  1 
ATOM   1689 O  OD1 . ASN A 1 185 ? 4.69347  9.25301   101.08500 1.000 11.40267 ? 185 ASN A OD1 1 
ATOM   1690 N  ND2 . ASN A 1 185 ? 5.42111  7.14624   100.95846 1.000 10.77005 ? 185 ASN A ND2 1 
ATOM   1691 N  N   A GLU A 1 186 ? 6.61111  11.85249  100.33914 0.712 9.72264  ? 186 GLU A N   1 
ATOM   1692 N  N   B GLU A 1 186 ? 6.51206  11.80485  100.34412 0.288 9.70056  ? 186 GLU A N   1 
ATOM   1693 C  CA  A GLU A 1 186 ? 5.89359  13.00717  100.87672 0.712 10.16404 ? 186 GLU A CA  1 
ATOM   1694 C  CA  B GLU A 1 186 ? 5.87918  13.01326  100.86702 0.288 10.15686 ? 186 GLU A CA  1 
ATOM   1695 C  C   A GLU A 1 186 ? 6.88331  14.06939  101.35338 0.712 10.23293 ? 186 GLU A C   1 
ATOM   1696 C  C   B GLU A 1 186 ? 6.95423  14.00872  101.28307 0.288 10.68728 ? 186 GLU A C   1 
ATOM   1697 O  O   A GLU A 1 186 ? 7.47842  13.93759  102.42568 0.712 10.39664 ? 186 GLU A O   1 
ATOM   1698 O  O   B GLU A 1 186 ? 7.69588  13.75184  102.23551 0.288 10.83687 ? 186 GLU A O   1 
ATOM   1699 C  CB  A GLU A 1 186 ? 4.88618  12.63264  101.97044 0.712 10.22501 ? 186 GLU A CB  1 
ATOM   1700 C  CB  B GLU A 1 186 ? 4.90635  12.73073  102.02121 0.288 10.21340 ? 186 GLU A CB  1 
ATOM   1701 C  CG  A GLU A 1 186 ? 3.90908  13.75294  102.23137 0.712 11.38298 ? 186 GLU A CG  1 
ATOM   1702 C  CG  B GLU A 1 186 ? 4.05121  13.94289  102.37546 0.288 11.19607 ? 186 GLU A CG  1 
ATOM   1703 C  CD  A GLU A 1 186 ? 3.35008  13.72172  103.62858 0.712 14.40362 ? 186 GLU A CD  1 
ATOM   1704 C  CD  B GLU A 1 186 ? 3.05806  13.68709  103.49955 0.288 13.56254 ? 186 GLU A CD  1 
ATOM   1705 O  OE1 A GLU A 1 186 ? 4.08723  13.35625  104.54558 0.712 17.51777 ? 186 GLU A OE1 1 
ATOM   1706 O  OE1 B GLU A 1 186 ? 2.87908  12.52400  103.91632 0.288 14.19540 ? 186 GLU A OE1 1 
ATOM   1707 O  OE2 A GLU A 1 186 ? 2.17898  14.08970  103.81365 0.712 16.98271 ? 186 GLU A OE2 1 
ATOM   1708 O  OE2 B GLU A 1 186 ? 2.44071  14.66581  103.96047 0.288 15.09687 ? 186 GLU A OE2 1 
ATOM   1709 N  N   . PRO A 1 187 ? 7.07292  15.16183  100.60742 1.000 11.03163 ? 187 PRO A N   1 
ATOM   1710 C  CA  . PRO A 1 187 ? 6.17527  15.68292  99.57654  1.000 12.10425 ? 187 PRO A CA  1 
ATOM   1711 C  C   . PRO A 1 187 ? 6.39259  15.15585  98.16391  1.000 13.07465 ? 187 PRO A C   1 
ATOM   1712 O  O   . PRO A 1 187 ? 5.51421  15.37640  97.33775  1.000 16.96503 ? 187 PRO A O   1 
ATOM   1713 C  CB  . PRO A 1 187 ? 6.44091  17.19347  99.63965  1.000 14.00275 ? 187 PRO A CB  1 
ATOM   1714 C  CG  . PRO A 1 187 ? 7.87429  17.28381  100.05144 1.000 14.12701 ? 187 PRO A CG  1 
ATOM   1715 C  CD  . PRO A 1 187 ? 8.06152  16.16821  101.03439 1.000 12.63480 ? 187 PRO A CD  1 
ATOM   1716 N  N   . ARG A 1 188 ? 7.50488  14.48612  97.87051  1.000 11.48371 ? 188 ARG A N   1 
ATOM   1717 C  CA  . ARG A 1 188 ? 7.67735  13.90057  96.54593  1.000 10.77956 ? 188 ARG A CA  1 
ATOM   1718 C  C   . ARG A 1 188 ? 7.00017  12.53493  96.48966  1.000 10.46274 ? 188 ARG A C   1 
ATOM   1719 O  O   . ARG A 1 188 ? 6.84440  11.84361  97.49807  1.000 10.89774 ? 188 ARG A O   1 
ATOM   1720 C  CB  . ARG A 1 188 ? 9.15223  13.72279  96.16473  1.000 11.41488 ? 188 ARG A CB  1 
ATOM   1721 C  CG  . ARG A 1 188 ? 10.06750 14.93964  96.27323  1.000 12.29099 ? 188 ARG A CG  1 
ATOM   1722 C  CD  . ARG A 1 188 ? 9.59218  16.16133  95.49857  1.000 13.03302 ? 188 ARG A CD  1 
ATOM   1723 N  NE  . ARG A 1 188 ? 9.29822  15.94182  94.07885  1.000 12.65188 ? 188 ARG A NE  1 
ATOM   1724 C  CZ  . ARG A 1 188 ? 10.14159 16.15322  93.06858  1.000 12.71236 ? 188 ARG A CZ  1 
ATOM   1725 N  NH1 . ARG A 1 188 ? 11.39614 16.52808  93.27461  1.000 13.69335 ? 188 ARG A NH1 1 
ATOM   1726 N  NH2 . ARG A 1 188 ? 9.70896  15.97739  91.82453  1.000 13.38780 ? 188 ARG A NH2 1 
ATOM   1727 N  N   . GLY A 1 189 ? 6.63526  12.11860  95.27693  1.000 9.91102  ? 189 GLY A N   1 
ATOM   1728 C  CA  . GLY A 1 189 ? 5.97378  10.83078  95.12057  1.000 10.17833 ? 189 GLY A CA  1 
ATOM   1729 C  C   . GLY A 1 189 ? 6.81241  9.67351   95.63242  1.000 9.54608  ? 189 GLY A C   1 
ATOM   1730 O  O   . GLY A 1 189 ? 6.28981  8.74272   96.24901  1.000 10.72122 ? 189 GLY A O   1 
ATOM   1731 N  N   . ASP A 1 190 ? 8.11633  9.71252   95.36671  1.000 9.25526  ? 190 ASP A N   1 
ATOM   1732 C  CA  . ASP A 1 190 ? 9.10436  8.84151   95.97428  1.000 9.57713  ? 190 ASP A CA  1 
ATOM   1733 C  C   . ASP A 1 190 ? 10.31301 9.70369   96.27200  1.000 9.66462  ? 190 ASP A C   1 
ATOM   1734 O  O   . ASP A 1 190 ? 10.71974 10.51159  95.43941  1.000 11.69544 ? 190 ASP A O   1 
ATOM   1735 C  CB  . ASP A 1 190 ? 9.52394  7.69395   95.05197  1.000 10.92812 ? 190 ASP A CB  1 
ATOM   1736 C  CG  . ASP A 1 190 ? 8.42998  6.69917   94.83435  1.000 10.98423 ? 190 ASP A CG  1 
ATOM   1737 O  OD1 . ASP A 1 190 ? 8.09853  5.96598   95.78140  1.000 11.87220 ? 190 ASP A OD1 1 
ATOM   1738 O  OD2 . ASP A 1 190 ? 7.90566  6.62286   93.70488  1.000 11.73673 ? 190 ASP A OD2 1 
ATOM   1739 N  N   . ILE A 1 191 ? 10.87362 9.53460   97.45581  1.000 9.54463  ? 191 ILE A N   1 
ATOM   1740 C  CA  . ILE A 1 191 ? 12.05763 10.26587  97.88921  1.000 9.57230  ? 191 ILE A CA  1 
ATOM   1741 C  C   . ILE A 1 191 ? 13.26572 9.34657   97.77764  1.000 9.42394  ? 191 ILE A C   1 
ATOM   1742 O  O   . ILE A 1 191 ? 13.17445 8.14437   98.04671  1.000 10.88785 ? 191 ILE A O   1 
ATOM   1743 C  CB  . ILE A 1 191 ? 11.85168 10.80563  99.32120  1.000 10.13745 ? 191 ILE A CB  1 
ATOM   1744 C  CG1 . ILE A 1 191 ? 10.74635 11.86804  99.32396  1.000 11.08946 ? 191 ILE A CG1 1 
ATOM   1745 C  CG2 . ILE A 1 191 ? 13.14144 11.35901  99.91187  1.000 11.81000 ? 191 ILE A CG2 1 
ATOM   1746 C  CD1 . ILE A 1 191 ? 10.30804 12.29359  100.70459 1.000 12.63446 ? 191 ILE A CD1 1 
ATOM   1747 N  N   . LEU A 1 192 ? 14.39986 9.90471   97.35932  1.000 9.98668  ? 192 LEU A N   1 
ATOM   1748 C  CA  . LEU A 1 192 ? 15.64787 9.14508   97.30499  1.000 10.72886 ? 192 LEU A CA  1 
ATOM   1749 C  C   . LEU A 1 192 ? 16.14615 8.82486   98.71446  1.000 10.21477 ? 192 LEU A C   1 
ATOM   1750 O  O   . LEU A 1 192 ? 15.94088 9.59241   99.65208  1.000 11.89480 ? 192 LEU A O   1 
ATOM   1751 C  CB  . LEU A 1 192 ? 16.70935 9.93550   96.53991  1.000 12.74738 ? 192 LEU A CB  1 
ATOM   1752 C  CG  . LEU A 1 192 ? 16.29616 10.32354  95.11764  1.000 16.66907 ? 192 LEU A CG  1 
ATOM   1753 C  CD1 . LEU A 1 192 ? 17.41602 11.10943  94.46145  1.000 19.19740 ? 192 LEU A CD1 1 
ATOM   1754 C  CD2 . LEU A 1 192 ? 15.93594 9.08502   94.30962  1.000 20.67359 ? 192 LEU A CD2 1 
ATOM   1755 N  N   . LEU A 1 193 ? 16.81509 7.68255   98.84963  1.000 10.78655 ? 193 LEU A N   1 
ATOM   1756 C  CA  . LEU A 1 193 ? 17.24433 7.15228   100.15073 1.000 11.35973 ? 193 LEU A CA  1 
ATOM   1757 C  C   . LEU A 1 193 ? 16.03352 6.97335   101.06648 1.000 10.49716 ? 193 LEU A C   1 
ATOM   1758 O  O   . LEU A 1 193 ? 15.94186 7.60448   102.12392 1.000 12.08566 ? 193 LEU A O   1 
ATOM   1759 C  CB  . LEU A 1 193 ? 18.32187 8.01583   100.81452 1.000 12.55063 ? 193 LEU A CB  1 
ATOM   1760 C  CG  . LEU A 1 193 ? 19.53435 8.36938   99.95860  1.000 14.79587 ? 193 LEU A CG  1 
ATOM   1761 C  CD1 . LEU A 1 193 ? 20.51721 9.17119   100.78928 1.000 17.58887 ? 193 LEU A CD1 1 
ATOM   1762 C  CD2 . LEU A 1 193 ? 20.19038 7.12065   99.37697  1.000 16.06479 ? 193 LEU A CD2 1 
ATOM   1763 N  N   . PRO A 1 194 ? 15.08561 6.11162   100.69022 1.000 9.63677  ? 194 PRO A N   1 
ATOM   1764 C  CA  . PRO A 1 194 ? 13.76465 6.14059   101.33793 1.000 9.86971  ? 194 PRO A CA  1 
ATOM   1765 C  C   . PRO A 1 194 ? 13.69774 5.52952   102.72397 1.000 10.10774 ? 194 PRO A C   1 
ATOM   1766 O  O   . PRO A 1 194 ? 12.69816 5.75644   103.41129 1.000 11.88222 ? 194 PRO A O   1 
ATOM   1767 C  CB  . PRO A 1 194 ? 12.89384 5.34380   100.35702 1.000 10.30355 ? 194 PRO A CB  1 
ATOM   1768 C  CG  . PRO A 1 194 ? 13.87498 4.43554   99.65118  1.000 10.66403 ? 194 PRO A CG  1 
ATOM   1769 C  CD  . PRO A 1 194 ? 15.06718 5.30641   99.45659  1.000 10.46748 ? 194 PRO A CD  1 
ATOM   1770 N  N   . THR A 1 195 ? 14.68354 4.73064   103.13567 1.000 9.55871  ? 195 THR A N   1 
ATOM   1771 C  CA  . THR A 1 195 ? 14.66785 4.06711   104.43501 1.000 10.18251 ? 195 THR A CA  1 
ATOM   1772 C  C   . THR A 1 195 ? 16.04860 4.13470   105.05753 1.000 9.87102  ? 195 THR A C   1 
ATOM   1773 O  O   . THR A 1 195 ? 17.03801 4.44924   104.38945 1.000 10.44449 ? 195 THR A O   1 
ATOM   1774 C  CB  . THR A 1 195 ? 14.26093 2.57768   104.36573 1.000 10.92113 ? 195 THR A CB  1 
ATOM   1775 O  OG1 . THR A 1 195 ? 15.37632 1.78535   103.94700 1.000 11.00421 ? 195 THR A OG1 1 
ATOM   1776 C  CG2 . THR A 1 195 ? 13.06630 2.34295   103.46059 1.000 12.05797 ? 195 THR A CG2 1 
ATOM   1777 N  N   . VAL A 1 196 ? 16.10586 3.77576   106.34182 1.000 10.35012 ? 196 VAL A N   1 
ATOM   1778 C  CA  A VAL A 1 196 ? 17.37394 3.67205   107.07040 0.709 10.77734 ? 196 VAL A CA  1 
ATOM   1779 C  CA  B VAL A 1 196 ? 17.39967 3.77574   106.99311 0.291 10.66749 ? 196 VAL A CA  1 
ATOM   1780 C  C   . VAL A 1 196 ? 18.37436 2.83397   106.29043 1.000 10.18757 ? 196 VAL A C   1 
ATOM   1781 O  O   . VAL A 1 196 ? 19.56264 3.13587   106.23656 1.000 11.02887 ? 196 VAL A O   1 
ATOM   1782 C  CB  A VAL A 1 196 ? 17.13093 3.06775   108.46611 0.709 12.22233 ? 196 VAL A CB  1 
ATOM   1783 C  CB  B VAL A 1 196 ? 17.27110 3.56131   108.51518 0.291 11.93162 ? 196 VAL A CB  1 
ATOM   1784 C  CG1 A VAL A 1 196 ? 18.44131 2.54907   109.08654 0.709 13.61348 ? 196 VAL A CG1 1 
ATOM   1785 C  CG1 B VAL A 1 196 ? 16.84082 2.15959   108.81819 0.291 12.89112 ? 196 VAL A CG1 1 
ATOM   1786 C  CG2 A VAL A 1 196 ? 16.49990 4.09368   109.36701 0.709 13.56873 ? 196 VAL A CG2 1 
ATOM   1787 C  CG2 B VAL A 1 196 ? 18.57055 3.90682   109.22571 0.291 12.60551 ? 196 VAL A CG2 1 
ATOM   1788 N  N   . GLY A 1 197 ? 17.90821 1.70816   105.73444 1.000 10.31554 ? 197 GLY A N   1 
ATOM   1789 C  CA  . GLY A 1 197 ? 18.82146 0.82809   105.02066 1.000 10.70830 ? 197 GLY A CA  1 
ATOM   1790 C  C   . GLY A 1 197 ? 19.47054 1.50458   103.82759 1.000 10.16123 ? 197 GLY A C   1 
ATOM   1791 O  O   . GLY A 1 197 ? 20.68749 1.41710   103.62325 1.000 11.14613 ? 197 GLY A O   1 
ATOM   1792 N  N   . HIS A 1 198 ? 18.65613 2.17423   103.00702 1.000 10.00083 ? 198 HIS A N   1 
ATOM   1793 C  CA  . HIS A 1 198 ? 19.19656 2.83868   101.82469 1.000 10.31574 ? 198 HIS A CA  1 
ATOM   1794 C  C   . HIS A 1 198 ? 20.19207 3.92458   102.20824 1.000 10.26547 ? 198 HIS A C   1 
ATOM   1795 O  O   . HIS A 1 198 ? 21.19817 4.12413   101.52086 1.000 11.12088 ? 198 HIS A O   1 
ATOM   1796 C  CB  . HIS A 1 198 ? 18.06758 3.44834   100.99182 1.000 10.25515 ? 198 HIS A CB  1 
ATOM   1797 C  CG  . HIS A 1 198 ? 17.09751 2.44719   100.45235 1.000 10.06701 ? 198 HIS A CG  1 
ATOM   1798 N  ND1 . HIS A 1 198 ? 16.14675 1.83688   101.24351 1.000 10.96692 ? 198 HIS A ND1 1 
ATOM   1799 C  CD2 . HIS A 1 198 ? 16.94246 1.94900   99.20089  1.000 10.88748 ? 198 HIS A CD2 1 
ATOM   1800 C  CE1 . HIS A 1 198 ? 15.44706 1.00647   100.49007 1.000 10.94559 ? 198 HIS A CE1 1 
ATOM   1801 N  NE2 . HIS A 1 198 ? 15.90419 1.06002   99.24988  1.000 11.20382 ? 198 HIS A NE2 1 
ATOM   1802 N  N   . ALA A 1 199 ? 19.90626 4.66139   103.28191 1.000 10.15875 ? 199 ALA A N   1 
ATOM   1803 C  CA  . ALA A 1 199 ? 20.82523 5.70078   103.73265 1.000 10.69195 ? 199 ALA A CA  1 
ATOM   1804 C  C   . ALA A 1 199 ? 22.13382 5.10884   104.24228 1.000 10.83888 ? 199 ALA A C   1 
ATOM   1805 O  O   . ALA A 1 199 ? 23.21090 5.62159   103.91874 1.000 12.24373 ? 199 ALA A O   1 
ATOM   1806 C  CB  . ALA A 1 199 ? 20.15049 6.56071   104.80196 1.000 12.39021 ? 199 ALA A CB  1 
ATOM   1807 N  N   . LEU A 1 200 ? 22.06313 4.03058   105.03476 1.000 10.71269 ? 200 LEU A N   1 
ATOM   1808 C  CA  . LEU A 1 200 ? 23.27893 3.37032   105.51132 1.000 11.32354 ? 200 LEU A CA  1 
ATOM   1809 C  C   . LEU A 1 200 ? 24.13098 2.88092   104.34689 1.000 11.94516 ? 200 LEU A C   1 
ATOM   1810 O  O   . LEU A 1 200 ? 25.36261 2.97306   104.38642 1.000 13.64475 ? 200 LEU A O   1 
ATOM   1811 C  CB  . LEU A 1 200 ? 22.92913 2.18774   106.41128 1.000 12.30562 ? 200 LEU A CB  1 
ATOM   1812 C  CG  . LEU A 1 200 ? 22.37085 2.50450   107.79734 1.000 13.41001 ? 200 LEU A CG  1 
ATOM   1813 C  CD1 . LEU A 1 200 ? 21.88608 1.23120   108.46533 1.000 15.29694 ? 200 LEU A CD1 1 
ATOM   1814 C  CD2 . LEU A 1 200 ? 23.41879 3.18698   108.65410 1.000 15.02742 ? 200 LEU A CD2 1 
ATOM   1815 N  N   . ALA A 1 201 ? 23.49104 2.33012   103.30804 1.000 11.49515 ? 201 ALA A N   1 
ATOM   1816 C  CA  . ALA A 1 201 ? 24.23768 1.81582   102.16617 1.000 12.12893 ? 201 ALA A CA  1 
ATOM   1817 C  C   . ALA A 1 201 ? 24.93111 2.94437   101.41845 1.000 11.97773 ? 201 ALA A C   1 
ATOM   1818 O  O   . ALA A 1 201 ? 26.07998 2.80416   100.98931 1.000 13.72655 ? 201 ALA A O   1 
ATOM   1819 C  CB  . ALA A 1 201 ? 23.29495 1.07182   101.22598 1.000 13.33703 ? 201 ALA A CB  1 
ATOM   1820 N  N   . PHE A 1 202 ? 24.22421 4.05639   101.22709 1.000 11.42355 ? 202 PHE A N   1 
ATOM   1821 C  CA  . PHE A 1 202 ? 24.77068 5.21900   100.53577 1.000 12.08123 ? 202 PHE A CA  1 
ATOM   1822 C  C   . PHE A 1 202 ? 26.00119 5.77764   101.25021 1.000 12.32157 ? 202 PHE A C   1 
ATOM   1823 O  O   . PHE A 1 202 ? 26.99315 6.14770   100.60628 1.000 13.02638 ? 202 PHE A O   1 
ATOM   1824 C  CB  . PHE A 1 202 ? 23.65366 6.25876   100.42465 1.000 12.66336 ? 202 PHE A CB  1 
ATOM   1825 C  CG  . PHE A 1 202 ? 24.09907 7.59287   99.91758  1.000 13.08923 ? 202 PHE A CG  1 
ATOM   1826 C  CD1 . PHE A 1 202 ? 24.25876 7.83059   98.56163  1.000 14.65479 ? 202 PHE A CD1 1 
ATOM   1827 C  CD2 . PHE A 1 202 ? 24.33056 8.63432   100.79853 1.000 14.21490 ? 202 PHE A CD2 1 
ATOM   1828 C  CE1 . PHE A 1 202 ? 24.65731 9.07271   98.10376  1.000 15.87610 ? 202 PHE A CE1 1 
ATOM   1829 C  CE2 . PHE A 1 202 ? 24.71785 9.87869   100.34516 1.000 15.07785 ? 202 PHE A CE2 1 
ATOM   1830 C  CZ  . PHE A 1 202 ? 24.88466 10.09406  98.99507  1.000 15.56906 ? 202 PHE A CZ  1 
ATOM   1831 N  N   . ILE A 1 203 ? 25.95390 5.84511   102.58401 1.000 12.37899 ? 203 ILE A N   1 
ATOM   1832 C  CA  . ILE A 1 203 ? 27.05554 6.41424   103.35898 1.000 13.23580 ? 203 ILE A CA  1 
ATOM   1833 C  C   . ILE A 1 203 ? 28.36263 5.68730   103.07623 1.000 14.02590 ? 203 ILE A C   1 
ATOM   1834 O  O   . ILE A 1 203 ? 29.43802 6.30050   103.06146 1.000 15.07771 ? 203 ILE A O   1 
ATOM   1835 C  CB  . ILE A 1 203 ? 26.69618 6.38706   104.85540 1.000 14.76416 ? 203 ILE A CB  1 
ATOM   1836 C  CG1 . ILE A 1 203 ? 25.66708 7.47301   105.15708 1.000 15.68729 ? 203 ILE A CG1 1 
ATOM   1837 C  CG2 . ILE A 1 203 ? 27.95346 6.52159   105.73541 1.000 16.52870 ? 203 ILE A CG2 1 
ATOM   1838 C  CD1 . ILE A 1 203 ? 24.98194 7.31270   106.49715 1.000 17.61827 ? 203 ILE A CD1 1 
ATOM   1839 N  N   . GLU A 1 204 ? 28.29312 4.37479   102.84566 1.000 14.29531 ? 204 GLU A N   1 
ATOM   1840 C  CA  . GLU A 1 204 ? 29.49253 3.57691   102.62260 1.000 16.37600 ? 204 GLU A CA  1 
ATOM   1841 C  C   . GLU A 1 204 ? 30.19927 3.91305   101.31406 1.000 18.16290 ? 204 GLU A C   1 
ATOM   1842 O  O   . GLU A 1 204 ? 31.34977 3.50161   101.13339 1.000 22.12685 ? 204 GLU A O   1 
ATOM   1843 C  CB  . GLU A 1 204 ? 29.14795 2.08676   102.69868 1.000 17.44248 ? 204 GLU A CB  1 
ATOM   1844 C  CG  . GLU A 1 204 ? 28.62764 1.65424   104.06834 1.000 19.77637 ? 204 GLU A CG  1 
ATOM   1845 C  CD  . GLU A 1 204 ? 29.65534 1.80744   105.17173 1.000 25.37979 ? 204 GLU A CD  1 
ATOM   1846 O  OE1 . GLU A 1 204 ? 30.84486 1.55648   104.90899 1.000 29.52151 ? 204 GLU A OE1 1 
ATOM   1847 O  OE2 . GLU A 1 204 ? 29.27414 2.16484   106.30716 1.000 27.31881 ? 204 GLU A OE2 1 
ATOM   1848 N  N   . ARG A 1 205 ? 29.56337 4.66610   100.41903 1.000 16.22097 ? 205 ARG A N   1 
ATOM   1849 C  CA  . ARG A 1 205 ? 30.16785 5.10032   99.16631  1.000 17.04693 ? 205 ARG A CA  1 
ATOM   1850 C  C   . ARG A 1 205 ? 30.67029 6.53935   99.21444  1.000 16.33205 ? 205 ARG A C   1 
ATOM   1851 O  O   . ARG A 1 205 ? 31.19504 7.03528   98.21261  1.000 17.63720 ? 205 ARG A O   1 
ATOM   1852 C  CB  . ARG A 1 205 ? 29.17350 4.91462   98.01379  1.000 20.31365 ? 205 ARG A CB  1 
ATOM   1853 C  CG  . ARG A 1 205 ? 28.86239 3.45198   97.72036  1.000 25.02890 ? 205 ARG A CG  1 
ATOM   1854 C  CD  . ARG A 1 205 ? 29.97916 2.83224   96.87936  1.000 30.40681 ? 205 ARG A CD  1 
ATOM   1855 N  NE  . ARG A 1 205 ? 29.70883 1.44529   96.50848  1.000 33.94448 ? 205 ARG A NE  1 
ATOM   1856 C  CZ  . ARG A 1 205 ? 29.77951 0.42026   97.35290  1.000 31.46187 ? 205 ARG A CZ  1 
ATOM   1857 N  NH1 . ARG A 1 205 ? 30.12321 0.62012   98.62072  1.000 32.86117 ? 205 ARG A NH1 1 
ATOM   1858 N  NH2 . ARG A 1 205 ? 29.51382 -0.80852  96.92897  1.000 28.32082 ? 205 ARG A NH2 1 
ATOM   1859 N  N   . LEU A 1 206 ? 30.52784 7.21991   100.34918 1.000 15.55569 ? 206 LEU A N   1 
ATOM   1860 C  CA  . LEU A 1 206 ? 31.06897 8.56255   100.49477 1.000 15.48366 ? 206 LEU A CA  1 
ATOM   1861 C  C   . LEU A 1 206 ? 32.57997 8.49388   100.70963 1.000 16.77602 ? 206 LEU A C   1 
ATOM   1862 O  O   . LEU A 1 206 ? 33.13026 7.46179   101.09643 1.000 18.09259 ? 206 LEU A O   1 
ATOM   1863 C  CB  . LEU A 1 206 ? 30.38787 9.28647   101.65887 1.000 14.93359 ? 206 LEU A CB  1 
ATOM   1864 C  CG  . LEU A 1 206 ? 28.88370 9.48415   101.44741 1.000 15.10451 ? 206 LEU A CG  1 
ATOM   1865 C  CD1 . LEU A 1 206 ? 28.25820 10.14831  102.67068 1.000 15.66481 ? 206 LEU A CD1 1 
ATOM   1866 C  CD2 . LEU A 1 206 ? 28.62361 10.28916  100.18422 1.000 16.94103 ? 206 LEU A CD2 1 
ATOM   1867 N  N   A GLU A 1 207 ? 33.25559 9.61711   100.45544 0.674 17.35883 ? 207 GLU A N   1 
ATOM   1868 N  N   B GLU A 1 207 ? 33.24838 9.62104   100.44773 0.326 17.08036 ? 207 GLU A N   1 
ATOM   1869 C  CA  A GLU A 1 207 ? 34.71408 9.62152   100.55325 0.674 19.34894 ? 207 GLU A CA  1 
ATOM   1870 C  CA  B GLU A 1 207 ? 34.70391 9.66782   100.56544 0.326 18.54864 ? 207 GLU A CA  1 
ATOM   1871 C  C   A GLU A 1 207 ? 35.20528 9.47787   101.99062 0.674 19.63702 ? 207 GLU A C   1 
ATOM   1872 C  C   B GLU A 1 207 ? 35.15735 9.41633   101.99683 0.326 19.85473 ? 207 GLU A C   1 
ATOM   1873 O  O   A GLU A 1 207 ? 36.27161 8.89335   102.21677 0.674 21.15783 ? 207 GLU A O   1 
ATOM   1874 O  O   B GLU A 1 207 ? 36.12998 8.68820   102.23027 0.326 22.72267 ? 207 GLU A O   1 
ATOM   1875 C  CB  A GLU A 1 207 ? 35.29973 10.87754  99.90816  0.674 22.21597 ? 207 GLU A CB  1 
ATOM   1876 C  CB  B GLU A 1 207 ? 35.22605 11.02027  100.07859 0.326 19.69723 ? 207 GLU A CB  1 
ATOM   1877 C  CG  A GLU A 1 207 ? 35.18965 10.91789  98.38367  0.674 25.27592 ? 207 GLU A CG  1 
ATOM   1878 C  CG  B GLU A 1 207 ? 36.74254 11.08938  99.93697  0.326 22.55682 ? 207 GLU A CG  1 
ATOM   1879 C  CD  A GLU A 1 207 ? 35.70201 9.65829   97.70350  0.674 29.95981 ? 207 GLU A CD  1 
ATOM   1880 C  CD  B GLU A 1 207 ? 37.21448 12.37273  99.27688  0.326 29.47833 ? 207 GLU A CD  1 
ATOM   1881 O  OE1 A GLU A 1 207 ? 36.88412 9.31156   97.91876  0.674 34.38943 ? 207 GLU A OE1 1 
ATOM   1882 O  OE1 B GLU A 1 207 ? 36.43889 12.96227  98.49495  0.326 33.12573 ? 207 GLU A OE1 1 
ATOM   1883 O  OE2 A GLU A 1 207 ? 34.92339 9.02910   96.94539  0.674 30.25704 ? 207 GLU A OE2 1 
ATOM   1884 O  OE2 B GLU A 1 207 ? 38.36206 12.79057  99.54050  0.326 33.53391 ? 207 GLU A OE2 1 
ATOM   1885 N  N   . ARG A 1 208 ? 34.47018 10.01481  102.96576 1.000 19.24648 ? 208 ARG A N   1 
ATOM   1886 C  CA  . ARG A 1 208 ? 34.85423 9.95857   104.37736 1.000 20.21116 ? 208 ARG A CA  1 
ATOM   1887 C  C   . ARG A 1 208 ? 33.67017 9.41840   105.16719 1.000 18.75285 ? 208 ARG A C   1 
ATOM   1888 O  O   . ARG A 1 208 ? 32.98534 10.17220  105.86796 1.000 18.81345 ? 208 ARG A O   1 
ATOM   1889 C  CB  . ARG A 1 208 ? 35.22778 11.35090  104.89148 1.000 23.77442 ? 208 ARG A CB  1 
ATOM   1890 C  CG  . ARG A 1 208 ? 36.37658 12.04847  104.16641 1.000 28.92103 ? 208 ARG A CG  1 
ATOM   1891 C  CD  . ARG A 1 208 ? 36.58714 13.44140  104.76145 1.000 35.65264 ? 208 ARG A CD  1 
ATOM   1892 N  NE  . ARG A 1 208 ? 37.89434 14.02017  104.46126 1.000 41.97060 ? 208 ARG A NE  1 
ATOM   1893 C  CZ  . ARG A 1 208 ? 38.16506 14.74739  103.38212 1.000 46.49735 ? 208 ARG A CZ  1 
ATOM   1894 N  NH1 . ARG A 1 208 ? 37.21619 14.98794  102.48631 1.000 49.52516 ? 208 ARG A NH1 1 
ATOM   1895 N  NH2 . ARG A 1 208 ? 39.38610 15.23575  103.20053 1.000 50.09965 ? 208 ARG A NH2 1 
ATOM   1896 N  N   . PRO A 1 209 ? 33.38471 8.11591   105.06364 1.000 18.45845 ? 209 PRO A N   1 
ATOM   1897 C  CA  . PRO A 1 209 ? 32.14251 7.60061   105.66851 1.000 17.99511 ? 209 PRO A CA  1 
ATOM   1898 C  C   . PRO A 1 209 ? 32.04728 7.81551   107.16531 1.000 17.36931 ? 209 PRO A C   1 
ATOM   1899 O  O   . PRO A 1 209 ? 30.93433 7.83831   107.70235 1.000 17.09785 ? 209 PRO A O   1 
ATOM   1900 C  CB  . PRO A 1 209 ? 32.14449 6.10766   105.30835 1.000 20.28705 ? 209 PRO A CB  1 
ATOM   1901 C  CG  . PRO A 1 209 ? 33.15175 5.94301   104.23811 1.000 23.97005 ? 209 PRO A CG  1 
ATOM   1902 C  CD  . PRO A 1 209 ? 34.12399 7.08133   104.32226 1.000 21.33098 ? 209 PRO A CD  1 
ATOM   1903 N  N   . GLU A 1 210 ? 33.17798 7.97478   107.85601 1.000 18.02414 ? 210 GLU A N   1 
ATOM   1904 C  CA  . GLU A 1 210 ? 33.15530 8.13172   109.30606 1.000 19.43299 ? 210 GLU A CA  1 
ATOM   1905 C  C   . GLU A 1 210 ? 32.43718 9.40287   109.74446 1.000 18.51644 ? 210 GLU A C   1 
ATOM   1906 O  O   . GLU A 1 210 ? 32.01608 9.49383   110.90266 1.000 20.35629 ? 210 GLU A O   1 
ATOM   1907 C  CB  . GLU A 1 210 ? 34.57796 8.10608   109.87913 1.000 23.91349 ? 210 GLU A CB  1 
ATOM   1908 C  CG  . GLU A 1 210 ? 35.47501 9.28809   109.48438 1.000 29.50178 ? 210 GLU A CG  1 
ATOM   1909 C  CD  . GLU A 1 210 ? 36.21128 9.10315   108.15768 1.000 35.20432 ? 210 GLU A CD  1 
ATOM   1910 O  OE1 . GLU A 1 210 ? 35.86371 8.19479   107.36991 1.000 32.63872 ? 210 GLU A OE1 1 
ATOM   1911 O  OE2 . GLU A 1 210 ? 37.14861 9.88695   107.89893 1.000 44.10444 ? 210 GLU A OE2 1 
ATOM   1912 N  N   . LEU A 1 211 ? 32.28844 10.38362  108.85390 1.000 16.83359 ? 211 LEU A N   1 
ATOM   1913 C  CA  . LEU A 1 211 ? 31.64428 11.64362  109.20193 1.000 16.56477 ? 211 LEU A CA  1 
ATOM   1914 C  C   . LEU A 1 211 ? 30.12495 11.58561  109.13801 1.000 15.31391 ? 211 LEU A C   1 
ATOM   1915 O  O   . LEU A 1 211 ? 29.47719 12.57632  109.49822 1.000 16.48447 ? 211 LEU A O   1 
ATOM   1916 C  CB  . LEU A 1 211 ? 32.11699 12.75118  108.25335 1.000 19.44664 ? 211 LEU A CB  1 
ATOM   1917 C  CG  . LEU A 1 211 ? 33.56310 13.23236  108.32282 1.000 25.48687 ? 211 LEU A CG  1 
ATOM   1918 C  CD1 . LEU A 1 211 ? 33.79249 14.37210  107.33415 1.000 27.46511 ? 211 LEU A CD1 1 
ATOM   1919 C  CD2 . LEU A 1 211 ? 33.92043 13.66969  109.73246 1.000 30.68193 ? 211 LEU A CD2 1 
ATOM   1920 N  N   . TYR A 1 212 ? 29.54226 10.47764  108.67381 1.000 13.80491 ? 212 TYR A N   1 
ATOM   1921 C  CA  . TYR A 1 212 ? 28.12791 10.44679  108.33880 1.000 13.39991 ? 212 TYR A CA  1 
ATOM   1922 C  C   . TYR A 1 212 ? 27.43542 9.28490   109.02006 1.000 13.03065 ? 212 TYR A C   1 
ATOM   1923 O  O   . TYR A 1 212 ? 27.93222 8.15640   109.03460 1.000 14.36289 ? 212 TYR A O   1 
ATOM   1924 C  CB  . TYR A 1 212 ? 27.88952 10.31111  106.82752 1.000 14.25721 ? 212 TYR A CB  1 
ATOM   1925 C  CG  . TYR A 1 212 ? 28.65704 11.31352  106.00642 1.000 14.98393 ? 212 TYR A CG  1 
ATOM   1926 C  CD1 . TYR A 1 212 ? 29.98556 11.07104  105.68728 1.000 16.09065 ? 212 TYR A CD1 1 
ATOM   1927 C  CD2 . TYR A 1 212 ? 28.07947 12.49756  105.56040 1.000 15.58756 ? 212 TYR A CD2 1 
ATOM   1928 C  CE1 . TYR A 1 212 ? 30.72364 11.96369  104.95371 1.000 16.62982 ? 212 TYR A CE1 1 
ATOM   1929 C  CE2 . TYR A 1 212 ? 28.82366 13.41430  104.81185 1.000 15.98217 ? 212 TYR A CE2 1 
ATOM   1930 C  CZ  . TYR A 1 212 ? 30.14528 13.12836  104.51824 1.000 16.55771 ? 212 TYR A CZ  1 
ATOM   1931 O  OH  . TYR A 1 212 ? 30.92309 13.99644  103.78648 1.000 18.29912 ? 212 TYR A OH  1 
ATOM   1932 N  N   . GLY A 1 213 ? 26.25426 9.57378   109.54715 1.000 12.72852 ? 213 GLY A N   1 
ATOM   1933 C  CA  . GLY A 1 213 ? 25.38594 8.56885   110.11945 1.000 12.70060 ? 213 GLY A CA  1 
ATOM   1934 C  C   . GLY A 1 213 ? 23.95536 8.82727   109.71150 1.000 11.28350 ? 213 GLY A C   1 
ATOM   1935 O  O   . GLY A 1 213 ? 23.68886 9.57143   108.76207 1.000 11.95698 ? 213 GLY A O   1 
ATOM   1936 N  N   . VAL A 1 214 ? 23.02755 8.23158   110.44631 1.000 11.37967 ? 214 VAL A N   1 
ATOM   1937 C  CA  . VAL A 1 214 ? 21.61026 8.38390   110.16026 1.000 11.43528 ? 214 VAL A CA  1 
ATOM   1938 C  C   . VAL A 1 214 ? 20.90343 9.08467   111.31041 1.000 11.37514 ? 214 VAL A C   1 
ATOM   1939 O  O   . VAL A 1 214 ? 21.31399 9.01430   112.47564 1.000 12.65311 ? 214 VAL A O   1 
ATOM   1940 C  CB  . VAL A 1 214 ? 20.90419 7.05577   109.80378 1.000 12.40080 ? 214 VAL A CB  1 
ATOM   1941 C  CG1 . VAL A 1 214 ? 21.37292 6.55944   108.43989 1.000 15.65293 ? 214 VAL A CG1 1 
ATOM   1942 C  CG2 . VAL A 1 214 ? 21.11033 5.99957   110.88125 1.000 13.17214 ? 214 VAL A CG2 1 
ATOM   1943 N  N   . ASN A 1 215 ? 19.79979 9.75327   110.94509 1.000 11.15087 ? 215 ASN A N   1 
ATOM   1944 C  CA  . ASN A 1 215 ? 18.81945 10.33799  111.85356 1.000 11.15576 ? 215 ASN A CA  1 
ATOM   1945 C  C   . ASN A 1 215 ? 17.46859 9.72022   111.51332 1.000 10.91145 ? 215 ASN A C   1 
ATOM   1946 O  O   . ASN A 1 215 ? 16.65954 10.33720  110.81093 1.000 12.30488 ? 215 ASN A O   1 
ATOM   1947 C  CB  . ASN A 1 215 ? 18.71667 11.85240  111.69140 1.000 12.56032 ? 215 ASN A CB  1 
ATOM   1948 C  CG  . ASN A 1 215 ? 17.75492 12.45269  112.68641 1.000 13.72817 ? 215 ASN A CG  1 
ATOM   1949 O  OD1 . ASN A 1 215 ? 17.81299 12.11719  113.86805 1.000 15.83110 ? 215 ASN A OD1 1 
ATOM   1950 N  ND2 . ASN A 1 215 ? 16.86256 13.32969  112.23599 1.000 14.91167 ? 215 ASN A ND2 1 
ATOM   1951 N  N   . PRO A 1 216 ? 17.19623 8.50079   111.96435 1.000 10.66416 ? 216 PRO A N   1 
ATOM   1952 C  CA  . PRO A 1 216 ? 15.91540 7.86498   111.63317 1.000 10.62687 ? 216 PRO A CA  1 
ATOM   1953 C  C   . PRO A 1 216 ? 14.77809 8.51479   112.39373 1.000 9.92644  ? 216 PRO A C   1 
ATOM   1954 O  O   . PRO A 1 216 ? 14.95107 8.97835   113.52001 1.000 12.20790 ? 216 PRO A O   1 
ATOM   1955 C  CB  . PRO A 1 216 ? 16.11081 6.41902   112.10628 1.000 12.01745 ? 216 PRO A CB  1 
ATOM   1956 C  CG  . PRO A 1 216 ? 17.58735 6.26979   112.35618 1.000 12.92139 ? 216 PRO A CG  1 
ATOM   1957 C  CD  . PRO A 1 216 ? 18.04688 7.62275   112.77389 1.000 11.62888 ? 216 PRO A CD  1 
ATOM   1958 N  N   . GLU A 1 217 ? 13.59490 8.49161   111.78995 1.000 9.56244  ? 217 GLU A N   1 
ATOM   1959 C  CA  . GLU A 1 217 ? 12.38390 9.01690   112.40493 1.000 9.50340  ? 217 GLU A CA  1 
ATOM   1960 C  C   . GLU A 1 217 ? 11.34715 7.90933   112.50005 1.000 9.15634  ? 217 GLU A C   1 
ATOM   1961 O  O   . GLU A 1 217 ? 11.08348 7.22301   111.50852 1.000 9.60536  ? 217 GLU A O   1 
ATOM   1962 C  CB  . GLU A 1 217 ? 11.81291 10.19981  111.61184 1.000 9.97458  ? 217 GLU A CB  1 
ATOM   1963 C  CG  . GLU A 1 217 ? 10.52565 10.75214  112.23279 1.000 10.75227 ? 217 GLU A CG  1 
ATOM   1964 C  CD  . GLU A 1 217 ? 9.97234  11.96150  111.52479 1.000 11.11601 ? 217 GLU A CD  1 
ATOM   1965 O  OE1 . GLU A 1 217 ? 10.72871 12.90781  111.25721 1.000 13.06993 ? 217 GLU A OE1 1 
ATOM   1966 O  OE2 . GLU A 1 217 ? 8.76239  11.94676  111.21444 1.000 11.59086 ? 217 GLU A OE2 1 
ATOM   1967 N  N   . VAL A 1 218 ? 10.75288 7.75202   113.68888 1.000 9.28024  ? 218 VAL A N   1 
ATOM   1968 C  CA  . VAL A 1 218 ? 9.78032  6.68520   113.93796 1.000 9.37180  ? 218 VAL A CA  1 
ATOM   1969 C  C   . VAL A 1 218 ? 8.76983  6.60997   112.80617 1.000 8.78522  ? 218 VAL A C   1 
ATOM   1970 O  O   . VAL A 1 218 ? 8.57596  5.56492   112.18153 1.000 9.80137  ? 218 VAL A O   1 
ATOM   1971 C  CB  . VAL A 1 218 ? 9.06128  6.89561   115.28589 1.000 9.91469  ? 218 VAL A CB  1 
ATOM   1972 C  CG1 . VAL A 1 218 ? 7.95990  5.85323   115.46760 1.000 11.83479 ? 218 VAL A CG1 1 
ATOM   1973 C  CG2 . VAL A 1 218 ? 10.03375 6.86133   116.46172 1.000 11.24829 ? 218 VAL A CG2 1 
ATOM   1974 N  N   . GLY A 1 219 ? 8.09243  7.72386   112.55039 1.000 9.08206  ? 219 GLY A N   1 
ATOM   1975 C  CA  . GLY A 1 219 ? 6.98562  7.68999   111.61696 1.000 9.81419  ? 219 GLY A CA  1 
ATOM   1976 C  C   . GLY A 1 219 ? 7.40313  7.39684   110.19262 1.000 9.18767  ? 219 GLY A C   1 
ATOM   1977 O  O   . GLY A 1 219 ? 6.63523  6.81248   109.42687 1.000 10.27069 ? 219 GLY A O   1 
ATOM   1978 N  N   . HIS A 1 220 ? 8.61311  7.80472   109.80830 1.000 9.17110  ? 220 HIS A N   1 
ATOM   1979 C  CA  . HIS A 1 220 ? 9.04611  7.63700   108.42350 1.000 9.37196  ? 220 HIS A CA  1 
ATOM   1980 C  C   . HIS A 1 220 ? 9.24502  6.17257   108.06954 1.000 9.62217  ? 220 HIS A C   1 
ATOM   1981 O  O   . HIS A 1 220 ? 8.78937  5.71868   107.02084 1.000 10.03119 ? 220 HIS A O   1 
ATOM   1982 C  CB  . HIS A 1 220 ? 10.30210 8.45891   108.16682 1.000 10.14588 ? 220 HIS A CB  1 
ATOM   1983 C  CG  . HIS A 1 220 ? 10.03493 9.92812   108.21742 1.000 10.04913 ? 220 HIS A CG  1 
ATOM   1984 N  ND1 . HIS A 1 220 ? 11.00996 10.88273  108.05143 1.000 11.19103 ? 220 HIS A ND1 1 
ATOM   1985 C  CD2 . HIS A 1 220 ? 8.88075  10.60405  108.43785 1.000 10.87532 ? 220 HIS A CD2 1 
ATOM   1986 C  CE1 . HIS A 1 220 ? 10.46194 12.08265  108.18537 1.000 11.18912 ? 220 HIS A CE1 1 
ATOM   1987 N  NE2 . HIS A 1 220 ? 9.17041  11.94076  108.42075 1.000 11.46956 ? 220 HIS A NE2 1 
ATOM   1988 N  N   . GLU A 1 221 ? 9.90181  5.40342   108.93673 1.000 9.34211  ? 221 GLU A N   1 
ATOM   1989 C  CA  . GLU A 1 221 ? 10.05361 3.98578   108.63129 1.000 9.33099  ? 221 GLU A CA  1 
ATOM   1990 C  C   . GLU A 1 221 ? 8.69908  3.29100   108.63777 1.000 9.23932  ? 221 GLU A C   1 
ATOM   1991 O  O   . GLU A 1 221 ? 8.46090  2.36169   107.85975 1.000 9.93892  ? 221 GLU A O   1 
ATOM   1992 C  CB  . GLU A 1 221 ? 11.02294 3.30985   109.60746 1.000 10.50456 ? 221 GLU A CB  1 
ATOM   1993 C  CG  . GLU A 1 221 ? 12.43739 3.88434   109.64350 1.000 11.59490 ? 221 GLU A CG  1 
ATOM   1994 C  CD  . GLU A 1 221 ? 13.17291 3.82739   108.31172 1.000 12.62115 ? 221 GLU A CD  1 
ATOM   1995 O  OE1 . GLU A 1 221 ? 13.45078 2.74010   107.76868 1.000 14.10008 ? 221 GLU A OE1 1 
ATOM   1996 O  OE2 . GLU A 1 221 ? 13.56856 4.90416   107.84240 1.000 14.75000 ? 221 GLU A OE2 1 
ATOM   1997 N  N   . GLN A 1 222 ? 7.79757  3.73858   109.51413 1.000 9.26909  ? 222 GLN A N   1 
ATOM   1998 C  CA  . GLN A 1 222 ? 6.45685  3.17503   109.58247 1.000 9.69226  ? 222 GLN A CA  1 
ATOM   1999 C  C   . GLN A 1 222 ? 5.61221  3.51099   108.35213 1.000 9.80499  ? 222 GLN A C   1 
ATOM   2000 O  O   . GLN A 1 222 ? 4.68425  2.76474   108.04360 1.000 10.69919 ? 222 GLN A O   1 
ATOM   2001 C  CB  . GLN A 1 222 ? 5.79222  3.57961   110.89985 1.000 10.45401 ? 222 GLN A CB  1 
ATOM   2002 C  CG  . GLN A 1 222 ? 6.49606  2.91755   112.09778 1.000 11.44160 ? 222 GLN A CG  1 
ATOM   2003 C  CD  . GLN A 1 222 ? 6.00003  3.34543   113.46371 1.000 12.33140 ? 222 GLN A CD  1 
ATOM   2004 O  OE1 . GLN A 1 222 ? 5.23278  4.28551   113.59715 1.000 13.38921 ? 222 GLN A OE1 1 
ATOM   2005 N  NE2 . GLN A 1 222 ? 6.47546  2.65905   114.50286 1.000 13.28477 ? 222 GLN A NE2 1 
ATOM   2006 N  N   . MET A 1 223 ? 5.94108  4.58162   107.61789 1.000 9.76213  ? 223 MET A N   1 
ATOM   2007 C  CA  . MET A 1 223 ? 5.28929  4.88303   106.33480 1.000 10.48991 ? 223 MET A CA  1 
ATOM   2008 C  C   . MET A 1 223 ? 5.61924  3.85895   105.25783 1.000 10.90489 ? 223 MET A C   1 
ATOM   2009 O  O   . MET A 1 223 ? 4.94959  3.82890   104.22292 1.000 12.83745 ? 223 MET A O   1 
ATOM   2010 C  CB  . MET A 1 223 ? 5.67556  6.28845   105.85909 1.000 11.09050 ? 223 MET A CB  1 
ATOM   2011 C  CG  . MET A 1 223 ? 5.05068  7.40207   106.67285 1.000 11.75823 ? 223 MET A CG  1 
ATOM   2012 S  SD  . MET A 1 223 ? 5.76904  9.00336   106.26354 1.000 12.89357 ? 223 MET A SD  1 
ATOM   2013 C  CE  . MET A 1 223 ? 5.05535  9.26003   104.63795 1.000 12.73716 ? 223 MET A CE  1 
ATOM   2014 N  N   . ALA A 1 224 ? 6.64000  3.04195   105.46704 1.000 10.37109 ? 224 ALA A N   1 
ATOM   2015 C  CA  . ALA A 1 224 ? 6.93821  1.91599   104.59901 1.000 11.51617 ? 224 ALA A CA  1 
ATOM   2016 C  C   . ALA A 1 224 ? 6.53485  0.59586   105.23713 1.000 11.17642 ? 224 ALA A C   1 
ATOM   2017 O  O   . ALA A 1 224 ? 6.85641  -0.47145  104.70583 1.000 12.75721 ? 224 ALA A O   1 
ATOM   2018 C  CB  . ALA A 1 224 ? 8.41335  1.91228   104.19984 1.000 13.86496 ? 224 ALA A CB  1 
ATOM   2019 N  N   . GLY A 1 225 ? 5.83388  0.64854   106.37138 1.000 10.11807 ? 225 GLY A N   1 
ATOM   2020 C  CA  . GLY A 1 225 ? 5.41578  -0.55860  107.05453 1.000 10.66424 ? 225 GLY A CA  1 
ATOM   2021 C  C   . GLY A 1 225 ? 6.53355  -1.33237  107.70257 1.000 10.25521 ? 225 GLY A C   1 
ATOM   2022 O  O   . GLY A 1 225 ? 6.34717  -2.50637  108.02079 1.000 12.00615 ? 225 GLY A O   1 
ATOM   2023 N  N   . LEU A 1 226 ? 7.67815  -0.69780  107.93216 1.000 9.72274  ? 226 LEU A N   1 
ATOM   2024 C  CA  . LEU A 1 226 ? 8.83303  -1.37611  108.48524 1.000 10.10980 ? 226 LEU A CA  1 
ATOM   2025 C  C   . LEU A 1 226 ? 8.82328  -1.32444  110.00794 1.000 9.95925  ? 226 LEU A C   1 
ATOM   2026 O  O   . LEU A 1 226 ? 8.14340  -0.50751  110.62608 1.000 11.66204 ? 226 LEU A O   1 
ATOM   2027 C  CB  . LEU A 1 226 ? 10.10926 -0.74854  107.93543 1.000 11.13482 ? 226 LEU A CB  1 
ATOM   2028 C  CG  . LEU A 1 226 ? 10.25711 -0.85376  106.41268 1.000 12.86930 ? 226 LEU A CG  1 
ATOM   2029 C  CD1 . LEU A 1 226 ? 11.52897 -0.16695  105.97316 1.000 15.55542 ? 226 LEU A CD1 1 
ATOM   2030 C  CD2 . LEU A 1 226 ? 10.23155 -2.29902  105.93360 1.000 14.88198 ? 226 LEU A CD2 1 
ATOM   2031 N  N   . ASN A 1 227 ? 9.59484  -2.22484  110.60091 1.000 9.71606  ? 227 ASN A N   1 
ATOM   2032 C  CA  . ASN A 1 227 ? 9.73851  -2.32403  112.04660 1.000 9.66624  ? 227 ASN A CA  1 
ATOM   2033 C  C   . ASN A 1 227 ? 10.81833 -1.33645  112.47977 1.000 9.49337  ? 227 ASN A C   1 
ATOM   2034 O  O   . ASN A 1 227 ? 11.99917 -1.50819  112.16043 1.000 10.41062 ? 227 ASN A O   1 
ATOM   2035 C  CB  . ASN A 1 227 ? 10.07616 -3.76867  112.39679 1.000 10.71408 ? 227 ASN A CB  1 
ATOM   2036 C  CG  . ASN A 1 227 ? 10.18087 -4.00152  113.88145 1.000 11.16026 ? 227 ASN A CG  1 
ATOM   2037 O  OD1 . ASN A 1 227 ? 10.85050 -3.25745  114.58619 1.000 11.78770 ? 227 ASN A OD1 1 
ATOM   2038 N  ND2 . ASN A 1 227 ? 9.53034  -5.04506  114.36461 1.000 12.68824 ? 227 ASN A ND2 1 
ATOM   2039 N  N   . PHE A 1 228 ? 10.40578 -0.27414  113.16880 1.000 9.43712  ? 228 PHE A N   1 
ATOM   2040 C  CA  . PHE A 1 228 ? 11.35284 0.77901   113.52347 1.000 9.85757  ? 228 PHE A CA  1 
ATOM   2041 C  C   . PHE A 1 228 ? 12.42157 0.29259   114.48350 1.000 10.11184 ? 228 PHE A C   1 
ATOM   2042 O  O   . PHE A 1 228 ? 13.61216 0.52159   114.20793 1.000 10.82923 ? 228 PHE A O   1 
ATOM   2043 C  CB  . PHE A 1 228 ? 10.62381 2.03334   114.00853 1.000 10.44352 ? 228 PHE A CB  1 
ATOM   2044 C  CG  . PHE A 1 228 ? 11.53300 3.20498   114.22559 1.000 10.00246 ? 228 PHE A CG  1 
ATOM   2045 C  CD1 . PHE A 1 228 ? 12.07540 3.87019   113.14650 1.000 10.75764 ? 228 PHE A CD1 1 
ATOM   2046 C  CD2 . PHE A 1 228 ? 11.84203 3.65785   115.49092 1.000 11.04006 ? 228 PHE A CD2 1 
ATOM   2047 C  CE1 . PHE A 1 228 ? 12.89739 4.96995   113.31550 1.000 11.27551 ? 228 PHE A CE1 1 
ATOM   2048 C  CE2 . PHE A 1 228 ? 12.66911 4.76301   115.66633 1.000 11.51759 ? 228 PHE A CE2 1 
ATOM   2049 C  CZ  . PHE A 1 228 ? 13.19108 5.42533   114.57894 1.000 11.49381 ? 228 PHE A CZ  1 
ATOM   2050 N  N   . PRO A 1 229 ? 12.09893 -0.40516  115.58160 1.000 10.14944 ? 229 PRO A N   1 
ATOM   2051 C  CA  . PRO A 1 229 ? 13.17499 -0.96233  116.41479 1.000 11.23081 ? 229 PRO A CA  1 
ATOM   2052 C  C   . PRO A 1 229 ? 14.16368 -1.82703  115.64969 1.000 10.62135 ? 229 PRO A C   1 
ATOM   2053 O  O   . PRO A 1 229 ? 15.36030 -1.76720  115.94385 1.000 11.58320 ? 229 PRO A O   1 
ATOM   2054 C  CB  . PRO A 1 229 ? 12.41132 -1.74569  117.49182 1.000 12.88965 ? 229 PRO A CB  1 
ATOM   2055 C  CG  . PRO A 1 229 ? 11.08643 -1.05389  117.60640 1.000 13.20982 ? 229 PRO A CG  1 
ATOM   2056 C  CD  . PRO A 1 229 ? 10.76687 -0.59038  116.20337 1.000 11.45060 ? 229 PRO A CD  1 
ATOM   2057 N  N   . HIS A 1 230 ? 13.71754 -2.64426  114.69378 1.000 10.40174 ? 230 HIS A N   1 
ATOM   2058 C  CA  . HIS A 1 230 ? 14.67216 -3.43695  113.91516 1.000 10.69826 ? 230 HIS A CA  1 
ATOM   2059 C  C   . HIS A 1 230 ? 15.62399 -2.54443  113.12833 1.000 10.55863 ? 230 HIS A C   1 
ATOM   2060 O  O   . HIS A 1 230 ? 16.82205 -2.83511  113.03317 1.000 12.25563 ? 230 HIS A O   1 
ATOM   2061 C  CB  . HIS A 1 230 ? 13.95655 -4.37506  112.94649 1.000 11.12898 ? 230 HIS A CB  1 
ATOM   2062 C  CG  . HIS A 1 230 ? 13.29710 -5.54893  113.58819 1.000 11.10971 ? 230 HIS A CG  1 
ATOM   2063 N  ND1 . HIS A 1 230 ? 12.81309 -6.60243  112.84608 1.000 12.47692 ? 230 HIS A ND1 1 
ATOM   2064 C  CD2 . HIS A 1 230 ? 13.06218 -5.85405  114.88792 1.000 12.60612 ? 230 HIS A CD2 1 
ATOM   2065 C  CE1 . HIS A 1 230 ? 12.30502 -7.50563  113.66378 1.000 13.65321 ? 230 HIS A CE1 1 
ATOM   2066 N  NE2 . HIS A 1 230 ? 12.44950 -7.07906  114.90704 1.000 13.61304 ? 230 HIS A NE2 1 
ATOM   2067 N  N   . GLY A 1 231 ? 15.09685 -1.48161  112.51317 1.000 10.78820 ? 231 GLY A N   1 
ATOM   2068 C  CA  . GLY A 1 231 ? 15.94800 -0.57693  111.75588 1.000 11.22144 ? 231 GLY A CA  1 
ATOM   2069 C  C   . GLY A 1 231 ? 16.95593 0.14263   112.62859 1.000 10.93863 ? 231 GLY A C   1 
ATOM   2070 O  O   . GLY A 1 231 ? 18.11102 0.32925   112.23661 1.000 12.10374 ? 231 GLY A O   1 
ATOM   2071 N  N   . ILE A 1 232 ? 16.52353 0.56309   113.81914 1.000 10.90326 ? 232 ILE A N   1 
ATOM   2072 C  CA  . ILE A 1 232 ? 17.43265 1.17917   114.77843 1.000 11.15111 ? 232 ILE A CA  1 
ATOM   2073 C  C   . ILE A 1 232 ? 18.51350 0.19562   115.20043 1.000 11.08442 ? 232 ILE A C   1 
ATOM   2074 O  O   . ILE A 1 232 ? 19.68306 0.56949   115.34189 1.000 12.05504 ? 232 ILE A O   1 
ATOM   2075 C  CB  . ILE A 1 232 ? 16.63890 1.73416   115.98117 1.000 12.30977 ? 232 ILE A CB  1 
ATOM   2076 C  CG1 . ILE A 1 232 ? 15.68286 2.84761   115.53697 1.000 13.49911 ? 232 ILE A CG1 1 
ATOM   2077 C  CG2 . ILE A 1 232 ? 17.57860 2.21470   117.08729 1.000 14.30455 ? 232 ILE A CG2 1 
ATOM   2078 C  CD1 . ILE A 1 232 ? 16.36280 3.94570   114.76668 1.000 15.66816 ? 232 ILE A CD1 1 
ATOM   2079 N  N   . ALA A 1 233 ? 18.14369 -1.07114  115.41006 1.000 10.89326 ? 233 ALA A N   1 
ATOM   2080 C  CA  . ALA A 1 233 ? 19.14746 -2.06848  115.75737 1.000 11.27733 ? 233 ALA A CA  1 
ATOM   2081 C  C   . ALA A 1 233 ? 20.19565 -2.20181  114.65928 1.000 11.12130 ? 233 ALA A C   1 
ATOM   2082 O  O   . ALA A 1 233 ? 21.38638 -2.33079  114.95478 1.000 12.15694 ? 233 ALA A O   1 
ATOM   2083 C  CB  . ALA A 1 233 ? 18.48694 -3.41090  116.04813 1.000 12.41538 ? 233 ALA A CB  1 
ATOM   2084 N  N   . GLN A 1 234 ? 19.78131 -2.17733  113.38511 1.000 10.92831 ? 234 GLN A N   1 
ATOM   2085 C  CA  . GLN A 1 234 ? 20.77081 -2.24906  112.31367 1.000 11.03161 ? 234 GLN A CA  1 
ATOM   2086 C  C   . GLN A 1 234 ? 21.66942 -1.01563  112.29940 1.000 11.17111 ? 234 GLN A C   1 
ATOM   2087 O  O   . GLN A 1 234 ? 22.88033 -1.12645  112.07308 1.000 12.22696 ? 234 GLN A O   1 
ATOM   2088 C  CB  . GLN A 1 234 ? 20.11643 -2.49515  110.95276 1.000 11.72328 ? 234 GLN A CB  1 
ATOM   2089 C  CG  . GLN A 1 234 ? 21.16549 -2.70189  109.87637 1.000 12.62147 ? 234 GLN A CG  1 
ATOM   2090 C  CD  . GLN A 1 234 ? 20.63564 -3.20211  108.54854 1.000 12.63960 ? 234 GLN A CD  1 
ATOM   2091 O  OE1 . GLN A 1 234 ? 19.47264 -3.58132  108.40026 1.000 13.50304 ? 234 GLN A OE1 1 
ATOM   2092 N  NE2 . GLN A 1 234 ? 21.51591 -3.21241  107.56357 1.000 13.43559 ? 234 GLN A NE2 1 
ATOM   2093 N  N   . ALA A 1 235 ? 21.10090 0.16748   112.54575 1.000 11.30833 ? 235 ALA A N   1 
ATOM   2094 C  CA  . ALA A 1 235 ? 21.91559 1.37965   112.60597 1.000 11.78931 ? 235 ALA A CA  1 
ATOM   2095 C  C   . ALA A 1 235 ? 22.91209 1.32793   113.75865 1.000 11.80948 ? 235 ALA A C   1 
ATOM   2096 O  O   . ALA A 1 235 ? 24.06991 1.73100   113.60075 1.000 13.28356 ? 235 ALA A O   1 
ATOM   2097 C  CB  . ALA A 1 235 ? 21.02280 2.61338   112.72775 1.000 13.10640 ? 235 ALA A CB  1 
ATOM   2098 N  N   . LEU A 1 236 ? 22.47480 0.85489   114.93279 1.000 11.72641 ? 236 LEU A N   1 
ATOM   2099 C  CA  . LEU A 1 236 ? 23.38711 0.69175   116.06601 1.000 12.60531 ? 236 LEU A CA  1 
ATOM   2100 C  C   . LEU A 1 236 ? 24.47075 -0.32947  115.74983 1.000 13.28211 ? 236 LEU A C   1 
ATOM   2101 O  O   . LEU A 1 236 ? 25.64697 -0.12972  116.08215 1.000 14.29401 ? 236 LEU A O   1 
ATOM   2102 C  CB  . LEU A 1 236 ? 22.59056 0.24552   117.28945 1.000 13.48025 ? 236 LEU A CB  1 
ATOM   2103 C  CG  . LEU A 1 236 ? 21.77096 1.31595   118.00858 1.000 14.80743 ? 236 LEU A CG  1 
ATOM   2104 C  CD1 . LEU A 1 236 ? 20.73586 0.68141   118.93823 1.000 16.53853 ? 236 LEU A CD1 1 
ATOM   2105 C  CD2 . LEU A 1 236 ? 22.66151 2.27688   118.77640 1.000 16.25469 ? 236 LEU A CD2 1 
ATOM   2106 N  N   . TRP A 1 237 ? 24.08469 -1.43552  115.11486 1.000 13.13615 ? 237 TRP A N   1 
ATOM   2107 C  CA  . TRP A 1 237 ? 25.03330 -2.48542  114.75344 1.000 13.62843 ? 237 TRP A CA  1 
ATOM   2108 C  C   . TRP A 1 237 ? 26.13113 -1.94516  113.84425 1.000 14.64003 ? 237 TRP A C   1 
ATOM   2109 O  O   . TRP A 1 237 ? 27.29722 -2.34825  113.95225 1.000 17.03556 ? 237 TRP A O   1 
ATOM   2110 C  CB  . TRP A 1 237 ? 24.25627 -3.61711  114.08243 1.000 13.94394 ? 237 TRP A CB  1 
ATOM   2111 C  CG  . TRP A 1 237 ? 25.04799 -4.82435  113.71066 1.000 13.90940 ? 237 TRP A CG  1 
ATOM   2112 C  CD1 . TRP A 1 237 ? 25.49031 -5.80480  114.55089 1.000 15.00440 ? 237 TRP A CD1 1 
ATOM   2113 C  CD2 . TRP A 1 237 ? 25.44658 -5.21621  112.39293 1.000 14.47899 ? 237 TRP A CD2 1 
ATOM   2114 N  NE1 . TRP A 1 237 ? 26.15209 -6.77234  113.84187 1.000 15.90461 ? 237 TRP A NE1 1 
ATOM   2115 C  CE2 . TRP A 1 237 ? 26.13980 -6.43680  112.51426 1.000 15.41779 ? 237 TRP A CE2 1 
ATOM   2116 C  CE3 . TRP A 1 237 ? 25.28569 -4.65403  111.12264 1.000 16.22493 ? 237 TRP A CE3 1 
ATOM   2117 C  CZ2 . TRP A 1 237 ? 26.67612 -7.10108  111.41930 1.000 17.37806 ? 237 TRP A CZ2 1 
ATOM   2118 C  CZ3 . TRP A 1 237 ? 25.82222 -5.31782  110.03380 1.000 18.52015 ? 237 TRP A CZ3 1 
ATOM   2119 C  CH2 . TRP A 1 237 ? 26.50404 -6.53045  110.19109 1.000 18.78661 ? 237 TRP A CH2 1 
ATOM   2120 N  N   . ALA A 1 238 ? 25.77936 -1.01598  112.95674 1.000 14.53358 ? 238 ALA A N   1 
ATOM   2121 C  CA  . ALA A 1 238 ? 26.72215 -0.39476  112.03864 1.000 15.81455 ? 238 ALA A CA  1 
ATOM   2122 C  C   . ALA A 1 238 ? 27.49568 0.75939   112.66575 1.000 16.06120 ? 238 ALA A C   1 
ATOM   2123 O  O   . ALA A 1 238 ? 28.40582 1.29013   112.02035 1.000 18.32895 ? 238 ALA A O   1 
ATOM   2124 C  CB  . ALA A 1 238 ? 25.96078 0.10766   110.80855 1.000 17.52849 ? 238 ALA A CB  1 
ATOM   2125 N  N   . GLY A 1 239 ? 27.14273 1.16909   113.88659 1.000 15.19276 ? 239 GLY A N   1 
ATOM   2126 C  CA  . GLY A 1 239 ? 27.79345 2.29511   114.53114 1.000 15.28631 ? 239 GLY A CA  1 
ATOM   2127 C  C   . GLY A 1 239 ? 27.38200 3.63774   113.98060 1.000 14.79908 ? 239 GLY A C   1 
ATOM   2128 O  O   . GLY A 1 239 ? 28.17878 4.58114   114.00145 1.000 17.06685 ? 239 GLY A O   1 
ATOM   2129 N  N   . LYS A 1 240 ? 26.14427 3.75786   113.49788 1.000 13.09802 ? 240 LYS A N   1 
ATOM   2130 C  CA  . LYS A 1 240 ? 25.72864 4.91888   112.71940 1.000 13.51934 ? 240 LYS A CA  1 
ATOM   2131 C  C   . LYS A 1 240 ? 24.52897 5.66377   113.28927 1.000 12.99765 ? 240 LYS A C   1 
ATOM   2132 O  O   . LYS A 1 240 ? 23.99918 6.55537   112.61272 1.000 14.33841 ? 240 LYS A O   1 
ATOM   2133 C  CB  . LYS A 1 240 ? 25.43862 4.51637   111.27156 1.000 15.27250 ? 240 LYS A CB  1 
ATOM   2134 C  CG  . LYS A 1 240 ? 26.64055 4.00762   110.53070 1.000 17.91914 ? 240 LYS A CG  1 
ATOM   2135 C  CD  . LYS A 1 240 ? 27.60658 5.14931   110.29966 1.000 20.28439 ? 240 LYS A CD  1 
ATOM   2136 C  CE  . LYS A 1 240 ? 28.70969 4.78510   109.32839 1.000 20.67031 ? 240 LYS A CE  1 
ATOM   2137 N  NZ  . LYS A 1 240 ? 29.69873 5.89264   109.29567 1.000 19.73675 ? 240 LYS A NZ  1 
ATOM   2138 N  N   . LEU A 1 241 ? 24.08190 5.34236   114.49981 1.000 13.00082 ? 241 LEU A N   1 
ATOM   2139 C  CA  . LEU A 1 241 ? 22.93926 6.05237   115.06893 1.000 13.05380 ? 241 LEU A CA  1 
ATOM   2140 C  C   . LEU A 1 241 ? 23.43359 7.32943   115.73414 1.000 13.69620 ? 241 LEU A C   1 
ATOM   2141 O  O   . LEU A 1 241 ? 23.76563 7.35629   116.91946 1.000 16.91268 ? 241 LEU A O   1 
ATOM   2142 C  CB  . LEU A 1 241 ? 22.17618 5.17751   116.05141 1.000 13.64529 ? 241 LEU A CB  1 
ATOM   2143 C  CG  . LEU A 1 241 ? 20.86012 5.82769   116.50291 1.000 14.26671 ? 241 LEU A CG  1 
ATOM   2144 C  CD1 . LEU A 1 241 ? 19.86984 5.90709   115.34269 1.000 15.94200 ? 241 LEU A CD1 1 
ATOM   2145 C  CD2 . LEU A 1 241 ? 20.24254 5.09775   117.68513 1.000 16.20370 ? 241 LEU A CD2 1 
ATOM   2146 N  N   . PHE A 1 242 ? 23.48595 8.41119   114.96015 1.000 13.06320 ? 242 PHE A N   1 
ATOM   2147 C  CA  . PHE A 1 242 ? 24.04869 9.65877   115.46529 1.000 14.27265 ? 242 PHE A CA  1 
ATOM   2148 C  C   . PHE A 1 242 ? 23.00807 10.53199  116.15218 1.000 14.89391 ? 242 PHE A C   1 
ATOM   2149 O  O   . PHE A 1 242 ? 23.36219 11.38538  116.97259 1.000 17.48364 ? 242 PHE A O   1 
ATOM   2150 C  CB  . PHE A 1 242 ? 24.67173 10.47869  114.32574 1.000 15.31192 ? 242 PHE A CB  1 
ATOM   2151 C  CG  . PHE A 1 242 ? 25.97248 9.93070   113.77460 1.000 15.41949 ? 242 PHE A CG  1 
ATOM   2152 C  CD1 . PHE A 1 242 ? 26.51898 8.72776   114.20145 1.000 16.38035 ? 242 PHE A CD1 1 
ATOM   2153 C  CD2 . PHE A 1 242 ? 26.65516 10.66244  112.81496 1.000 16.39067 ? 242 PHE A CD2 1 
ATOM   2154 C  CE1 . PHE A 1 242 ? 27.72265 8.27424   113.66216 1.000 17.65425 ? 242 PHE A CE1 1 
ATOM   2155 C  CE2 . PHE A 1 242 ? 27.84037 10.21350  112.28203 1.000 17.69448 ? 242 PHE A CE2 1 
ATOM   2156 C  CZ  . PHE A 1 242 ? 28.37565 9.02377   112.70425 1.000 18.17610 ? 242 PHE A CZ  1 
ATOM   2157 N  N   . HIS A 1 243 ? 21.73801 10.34315  115.82654 1.000 13.47660 ? 243 HIS A N   1 
ATOM   2158 C  CA  . HIS A 1 243 ? 20.65233 11.18816  116.29749 1.000 12.81749 ? 243 HIS A CA  1 
ATOM   2159 C  C   . HIS A 1 243 ? 19.38437 10.39813  116.00308 1.000 12.19405 ? 243 HIS A C   1 
ATOM   2160 O  O   . HIS A 1 243 ? 19.41768 9.43226   115.24596 1.000 13.09085 ? 243 HIS A O   1 
ATOM   2161 C  CB  . HIS A 1 243 ? 20.69481 12.52639  115.54325 1.000 14.03748 ? 243 HIS A CB  1 
ATOM   2162 C  CG  . HIS A 1 243 ? 19.91027 13.63246  116.17852 1.000 14.10767 ? 243 HIS A CG  1 
ATOM   2163 N  ND1 . HIS A 1 243 ? 18.58844 13.88354  115.87748 1.000 14.15936 ? 243 HIS A ND1 1 
ATOM   2164 C  CD2 . HIS A 1 243 ? 20.27368 14.57024  117.08637 1.000 15.55198 ? 243 HIS A CD2 1 
ATOM   2165 C  CE1 . HIS A 1 243 ? 18.17350 14.92676  116.57710 1.000 15.12811 ? 243 HIS A CE1 1 
ATOM   2166 N  NE2 . HIS A 1 243 ? 19.17595 15.36190  117.31900 1.000 16.12909 ? 243 HIS A NE2 1 
ATOM   2167 N  N   . ILE A 1 244 ? 18.26515 10.79142  116.60800 1.000 12.22449 ? 244 ILE A N   1 
ATOM   2168 C  CA  . ILE A 1 244 ? 17.00070 10.10423  116.35963 1.000 11.87466 ? 244 ILE A CA  1 
ATOM   2169 C  C   . ILE A 1 244 ? 15.87245 11.10739  116.49405 1.000 11.98441 ? 244 ILE A C   1 
ATOM   2170 O  O   . ILE A 1 244 ? 15.93551 12.03064  117.30986 1.000 14.50692 ? 244 ILE A O   1 
ATOM   2171 C  CB  . ILE A 1 244 ? 16.83001 8.88601   117.30147 1.000 12.77090 ? 244 ILE A CB  1 
ATOM   2172 C  CG1 . ILE A 1 244 ? 15.73050 7.94437   116.80672 1.000 14.21154 ? 244 ILE A CG1 1 
ATOM   2173 C  CG2 . ILE A 1 244 ? 16.60926 9.32366   118.75547 1.000 15.13802 ? 244 ILE A CG2 1 
ATOM   2174 C  CD1 . ILE A 1 244 ? 15.73763 6.61025   117.51900 1.000 15.74981 ? 244 ILE A CD1 1 
ATOM   2175 N  N   . ASP A 1 245 ? 14.83320 10.91982  115.67915 1.000 11.05499 ? 245 ASP A N   1 
ATOM   2176 C  CA  . ASP A 1 245 ? 13.59899 11.69611  115.74834 1.000 11.10588 ? 245 ASP A CA  1 
ATOM   2177 C  C   . ASP A 1 245 ? 12.48624 10.79748  116.26754 1.000 10.81553 ? 245 ASP A C   1 
ATOM   2178 O  O   . ASP A 1 245 ? 12.14159 9.78499   115.64626 1.000 12.19526 ? 245 ASP A O   1 
ATOM   2179 C  CB  . ASP A 1 245 ? 13.15279 12.21590  114.37669 1.000 12.24675 ? 245 ASP A CB  1 
ATOM   2180 C  CG  . ASP A 1 245 ? 13.84497 13.48447  113.91556 1.000 12.87445 ? 245 ASP A CG  1 
ATOM   2181 O  OD1 . ASP A 1 245 ? 14.74647 14.00986  114.57361 1.000 13.94470 ? 245 ASP A OD1 1 
ATOM   2182 O  OD2 . ASP A 1 245 ? 13.47056 13.97466  112.82675 1.000 15.44857 ? 245 ASP A OD2 1 
ATOM   2183 N  N   . LEU A 1 246 ? 11.89021 11.20532  117.37217 1.000 10.61053 ? 246 LEU A N   1 
ATOM   2184 C  CA  . LEU A 1 246 ? 10.85313 10.45514  118.05912 1.000 10.88553 ? 246 LEU A CA  1 
ATOM   2185 C  C   . LEU A 1 246 ? 9.49732  11.10750  117.82614 1.000 10.69335 ? 246 LEU A C   1 
ATOM   2186 O  O   . LEU A 1 246 ? 9.34274  12.32403  117.99286 1.000 12.28394 ? 246 LEU A O   1 
ATOM   2187 C  CB  . LEU A 1 246 ? 11.15429 10.41991  119.55812 1.000 11.61869 ? 246 LEU A CB  1 
ATOM   2188 C  CG  . LEU A 1 246 ? 12.49793 9.79605   119.92721 1.000 13.76272 ? 246 LEU A CG  1 
ATOM   2189 C  CD1 . LEU A 1 246 ? 12.78627 10.04541  121.39549 1.000 16.56856 ? 246 LEU A CD1 1 
ATOM   2190 C  CD2 . LEU A 1 246 ? 12.51443 8.31258   119.60225 1.000 16.17289 ? 246 LEU A CD2 1 
ATOM   2191 N  N   . ASN A 1 247 ? 8.51551  10.29365  117.46872 1.000 9.99618  ? 247 ASN A N   1 
ATOM   2192 C  CA  . ASN A 1 247 ? 7.14366  10.73885  117.23456 1.000 9.66916  ? 247 ASN A CA  1 
ATOM   2193 C  C   . ASN A 1 247 ? 6.27213  9.50053   117.12620 1.000 9.69751  ? 247 ASN A C   1 
ATOM   2194 O  O   . ASN A 1 247 ? 6.70742  8.39473   117.46787 1.000 10.66898 ? 247 ASN A O   1 
ATOM   2195 C  CB  . ASN A 1 247 ? 7.04368  11.68430  116.04302 1.000 10.02229 ? 247 ASN A CB  1 
ATOM   2196 C  CG  . ASN A 1 247 ? 7.39241  11.03619  114.72383 1.000 10.12681 ? 247 ASN A CG  1 
ATOM   2197 O  OD1 . ASN A 1 247 ? 7.54713  9.82309   114.59194 1.000 10.74507 ? 247 ASN A OD1 1 
ATOM   2198 N  ND2 . ASN A 1 247 ? 7.49980  11.87667  113.72140 1.000 11.63283 ? 247 ASN A ND2 1 
ATOM   2199 N  N   . GLY A 1 248 ? 5.03511  9.69131   116.66186 1.000 10.00491 ? 248 GLY A N   1 
ATOM   2200 C  CA  . GLY A 1 248 ? 4.12408  8.59218   116.44852 1.000 10.69939 ? 248 GLY A CA  1 
ATOM   2201 C  C   . GLY A 1 248 ? 3.44137  8.68944   115.09770 1.000 10.11667 ? 248 GLY A C   1 
ATOM   2202 O  O   . GLY A 1 248 ? 3.30904  9.76211   114.50436 1.000 11.04471 ? 248 GLY A O   1 
ATOM   2203 N  N   . GLN A 1 249 ? 2.98308  7.53224   114.63087 1.000 9.37149  ? 249 GLN A N   1 
ATOM   2204 C  CA  . GLN A 1 249 ? 2.42870  7.37191   113.29589 1.000 9.29314  ? 249 GLN A CA  1 
ATOM   2205 C  C   . GLN A 1 249 ? 1.47615  6.18905   113.33749 1.000 9.67532  ? 249 GLN A C   1 
ATOM   2206 O  O   . GLN A 1 249 ? 1.83000  5.13813   113.86582 1.000 11.23227 ? 249 GLN A O   1 
ATOM   2207 C  CB  . GLN A 1 249 ? 3.57520  7.07535   112.32187 1.000 9.91170  ? 249 GLN A CB  1 
ATOM   2208 C  CG  . GLN A 1 249 ? 3.16626  6.74532   110.87875 1.000 10.02155 ? 249 GLN A CG  1 
ATOM   2209 C  CD  . GLN A 1 249 ? 2.62241  7.92503   110.10371 1.000 9.78158  ? 249 GLN A CD  1 
ATOM   2210 O  OE1 . GLN A 1 249 ? 2.84921  9.07958   110.45502 1.000 10.75548 ? 249 GLN A OE1 1 
ATOM   2211 N  NE2 . GLN A 1 249 ? 1.90065  7.63301   109.04031 1.000 11.93210 ? 249 GLN A NE2 1 
ATOM   2212 N  N   . ASN A 1 250 ? 0.28278  6.35363   112.76327 1.000 10.90776 ? 250 ASN A N   1 
ATOM   2213 C  CA  . ASN A 1 250 ? -0.67185 5.24844   112.66207 1.000 13.47713 ? 250 ASN A CA  1 
ATOM   2214 C  C   . ASN A 1 250 ? -0.61407 4.63368   111.26457 1.000 15.80574 ? 250 ASN A C   1 
ATOM   2215 O  O   . ASN A 1 250 ? -1.44157 4.90125   110.39547 1.000 20.59984 ? 250 ASN A O   1 
ATOM   2216 C  CB  . ASN A 1 250 ? -2.08093 5.72119   112.99504 1.000 16.72517 ? 250 ASN A CB  1 
ATOM   2217 C  CG  . ASN A 1 250 ? -2.26225 5.96112   114.45756 1.000 19.28332 ? 250 ASN A CG  1 
ATOM   2218 O  OD1 . ASN A 1 250 ? -2.21208 5.02926   115.26189 1.000 24.04465 ? 250 ASN A OD1 1 
ATOM   2219 N  ND2 . ASN A 1 250 ? -2.45003 7.22149   114.82790 1.000 20.20323 ? 250 ASN A ND2 1 
ATOM   2220 N  N   . GLY A 1 251 ? 0.41411  3.83185   111.04419 1.000 16.61060 ? 251 GLY A N   1 
ATOM   2221 C  CA  . GLY A 1 251 ? 0.47792  3.01973   109.84704 1.000 18.33533 ? 251 GLY A CA  1 
ATOM   2222 C  C   . GLY A 1 251 ? 0.87406  3.77661   108.59205 1.000 16.32996 ? 251 GLY A C   1 
ATOM   2223 O  O   . GLY A 1 251 ? 1.53289  4.81626   108.60954 1.000 16.01970 ? 251 GLY A O   1 
ATOM   2224 N  N   . ILE A 1 252 ? 0.47337  3.19658   107.46862 1.000 14.84389 ? 252 ILE A N   1 
ATOM   2225 C  CA  . ILE A 1 252 ? 0.94494  3.61946   106.16014 1.000 13.20802 ? 252 ILE A CA  1 
ATOM   2226 C  C   . ILE A 1 252 ? -0.04440 4.65497   105.63814 1.000 12.92332 ? 252 ILE A C   1 
ATOM   2227 O  O   . ILE A 1 252 ? -1.14236 4.32495   105.17817 1.000 14.58758 ? 252 ILE A O   1 
ATOM   2228 C  CB  . ILE A 1 252 ? 1.11405  2.43185   105.21317 1.000 13.39079 ? 252 ILE A CB  1 
ATOM   2229 C  CG1 . ILE A 1 252 ? 2.08857  1.41200   105.81795 1.000 15.56023 ? 252 ILE A CG1 1 
ATOM   2230 C  CG2 . ILE A 1 252 ? 1.61368  2.90219   103.85520 1.000 14.21500 ? 252 ILE A CG2 1 
ATOM   2231 C  CD1 . ILE A 1 252 ? 2.26975  0.17468   104.97826 1.000 16.93472 ? 252 ILE A CD1 1 
ATOM   2232 N  N   . LYS A 1 253 ? 0.35468  5.90906   105.71405 1.000 12.19625 ? 253 LYS A N   1 
ATOM   2233 C  CA  A LYS A 1 253 ? -0.44652 7.06201   105.32639 0.611 12.40029 ? 253 LYS A CA  1 
ATOM   2234 C  CA  B LYS A 1 253 ? -0.43449 7.05558   105.27191 0.389 12.79446 ? 253 LYS A CA  1 
ATOM   2235 C  C   . LYS A 1 253 ? 0.49410  8.26197   105.31363 1.000 11.60791 ? 253 LYS A C   1 
ATOM   2236 O  O   . LYS A 1 253 ? 1.71086  8.11512   105.49086 1.000 12.56145 ? 253 LYS A O   1 
ATOM   2237 C  CB  A LYS A 1 253 ? -1.67978 7.22588   106.22396 0.611 13.65829 ? 253 LYS A CB  1 
ATOM   2238 C  CB  B LYS A 1 253 ? -1.73258 7.24184   106.07303 0.389 14.35229 ? 253 LYS A CB  1 
ATOM   2239 C  CG  A LYS A 1 253 ? -1.34939 7.54283   107.66802 0.611 14.06673 ? 253 LYS A CG  1 
ATOM   2240 C  CG  B LYS A 1 253 ? -1.64300 6.93989   107.56921 0.389 15.19769 ? 253 LYS A CG  1 
ATOM   2241 C  CD  A LYS A 1 253 ? -2.57794 7.74259   108.56546 0.611 15.56012 ? 253 LYS A CD  1 
ATOM   2242 C  CD  B LYS A 1 253 ? -2.84152 7.49360   108.36227 0.389 14.40211 ? 253 LYS A CD  1 
ATOM   2243 C  CE  A LYS A 1 253 ? -3.51652 6.55907   108.51927 0.611 15.16439 ? 253 LYS A CE  1 
ATOM   2244 C  CE  B LYS A 1 253 ? -4.02805 6.54454   108.37523 0.389 14.23125 ? 253 LYS A CE  1 
ATOM   2245 N  NZ  A LYS A 1 253 ? -4.44568 6.52388   109.68706 0.611 15.52417 ? 253 LYS A NZ  1 
ATOM   2246 N  NZ  B LYS A 1 253 ? -3.68623 5.21422   108.93470 0.389 13.66728 ? 253 LYS A NZ  1 
ATOM   2247 N  N   . TYR A 1 254 ? -0.07399 9.44688   105.11961 1.000 11.34601 ? 254 TYR A N   1 
ATOM   2248 C  CA  . TYR A 1 254 ? 0.66653  10.69236  105.23509 1.000 11.27488 ? 254 TYR A CA  1 
ATOM   2249 C  C   . TYR A 1 254 ? 1.43953  10.75116  106.55419 1.000 10.47584 ? 254 TYR A C   1 
ATOM   2250 O  O   . TYR A 1 254 ? 1.08373  10.10029  107.54298 1.000 11.01675 ? 254 TYR A O   1 
ATOM   2251 C  CB  . TYR A 1 254 ? -0.28737 11.89251  105.09185 1.000 12.00752 ? 254 TYR A CB  1 
ATOM   2252 C  CG  . TYR A 1 254 ? -1.16597 12.11839  106.30331 1.000 11.52202 ? 254 TYR A CG  1 
ATOM   2253 C  CD1 . TYR A 1 254 ? -2.31859 11.36537  106.52229 1.000 12.33109 ? 254 TYR A CD1 1 
ATOM   2254 C  CD2 . TYR A 1 254 ? -0.82372 13.06756  107.25572 1.000 11.99985 ? 254 TYR A CD2 1 
ATOM   2255 C  CE1 . TYR A 1 254 ? -3.10525 11.55938  107.65712 1.000 12.56247 ? 254 TYR A CE1 1 
ATOM   2256 C  CE2 . TYR A 1 254 ? -1.60357 13.26684  108.39049 1.000 12.39174 ? 254 TYR A CE2 1 
ATOM   2257 C  CZ  . TYR A 1 254 ? -2.73593 12.50595  108.59219 1.000 12.40988 ? 254 TYR A CZ  1 
ATOM   2258 O  OH  . TYR A 1 254 ? -3.49500 12.68236  109.73434 1.000 14.46310 ? 254 TYR A OH  1 
ATOM   2259 N  N   . ASP A 1 255 ? 2.49690  11.54910  106.56197 1.000 10.51067 ? 255 ASP A N   1 
ATOM   2260 C  CA  . ASP A 1 255 ? 3.37382  11.70111  107.72331 1.000 10.77928 ? 255 ASP A CA  1 
ATOM   2261 C  C   . ASP A 1 255 ? 2.63147  12.47257  108.81095 1.000 10.23996 ? 255 ASP A C   1 
ATOM   2262 O  O   . ASP A 1 255 ? 2.39387  13.67603  108.68429 1.000 11.74554 ? 255 ASP A O   1 
ATOM   2263 C  CB  . ASP A 1 255 ? 4.60949  12.45072  107.23245 1.000 11.25871 ? 255 ASP A CB  1 
ATOM   2264 C  CG  . ASP A 1 255 ? 5.69679  12.64632  108.27951 1.000 12.07655 ? 255 ASP A CG  1 
ATOM   2265 O  OD1 . ASP A 1 255 ? 5.94726  11.76195  109.11729 1.000 11.70415 ? 255 ASP A OD1 1 
ATOM   2266 O  OD2 . ASP A 1 255 ? 6.39209  13.68852  108.19020 1.000 13.71693 ? 255 ASP A OD2 1 
ATOM   2267 N  N   . GLN A 1 256 ? 2.23092  11.77339  109.87334 1.000 10.23694 ? 256 GLN A N   1 
ATOM   2268 C  CA  . GLN A 1 256 ? 1.36977  12.37646  110.88995 1.000 10.59876 ? 256 GLN A CA  1 
ATOM   2269 C  C   . GLN A 1 256 ? 2.13790  13.19207  111.91913 1.000 10.54063 ? 256 GLN A C   1 
ATOM   2270 O  O   . GLN A 1 256 ? 1.60725  14.18060  112.43304 1.000 12.16102 ? 256 GLN A O   1 
ATOM   2271 C  CB  . GLN A 1 256 ? 0.56591  11.30157  111.60797 1.000 10.89508 ? 256 GLN A CB  1 
ATOM   2272 C  CG  . GLN A 1 256 ? -0.39122 10.55212  110.72131 1.000 11.89396 ? 256 GLN A CG  1 
ATOM   2273 C  CD  . GLN A 1 256 ? -1.35067 9.76635   111.56906 1.000 12.34829 ? 256 GLN A CD  1 
ATOM   2274 O  OE1 . GLN A 1 256 ? -1.00463 8.74938   112.14441 1.000 13.61504 ? 256 GLN A OE1 1 
ATOM   2275 N  NE2 . GLN A 1 256 ? -2.56407 10.27566  111.70313 1.000 14.33107 ? 256 GLN A NE2 1 
ATOM   2276 N  N   . ASP A 1 257 ? 3.34725  12.76186  112.27855 1.000 10.33416 ? 257 ASP A N   1 
ATOM   2277 C  CA  . ASP A 1 257 ? 4.15376  13.45534  113.28418 1.000 10.91277 ? 257 ASP A CA  1 
ATOM   2278 C  C   . ASP A 1 257 ? 3.37790  13.63215  114.59943 1.000 10.73643 ? 257 ASP A C   1 
ATOM   2279 O  O   . ASP A 1 257 ? 3.37254  14.70135  115.20418 1.000 12.09860 ? 257 ASP A O   1 
ATOM   2280 C  CB  . ASP A 1 257 ? 4.66291  14.80482  112.75052 1.000 12.23423 ? 257 ASP A CB  1 
ATOM   2281 C  CG  . ASP A 1 257 ? 5.74894  14.68029  111.69513 1.000 12.68337 ? 257 ASP A CG  1 
ATOM   2282 O  OD1 . ASP A 1 257 ? 6.27984  13.58314  111.44175 1.000 12.36668 ? 257 ASP A OD1 1 
ATOM   2283 O  OD2 . ASP A 1 257 ? 6.07016  15.72507  111.09244 1.000 15.89991 ? 257 ASP A OD2 1 
ATOM   2284 N  N   . LEU A 1 258 ? 2.71608  12.56858  115.05006 1.000 10.62940 ? 258 LEU A N   1 
ATOM   2285 C  CA  . LEU A 1 258 ? 2.02368  12.62662  116.33267 1.000 10.99982 ? 258 LEU A CA  1 
ATOM   2286 C  C   . LEU A 1 258 ? 3.02840  12.67242  117.48082 1.000 10.58054 ? 258 LEU A C   1 
ATOM   2287 O  O   . LEU A 1 258 ? 4.20611  12.33679  117.32954 1.000 11.27518 ? 258 LEU A O   1 
ATOM   2288 C  CB  . LEU A 1 258 ? 1.12935  11.40294  116.51296 1.000 13.24034 ? 258 LEU A CB  1 
ATOM   2289 C  CG  . LEU A 1 258 ? 0.07102  11.15785  115.44061 1.000 16.76052 ? 258 LEU A CG  1 
ATOM   2290 C  CD1 . LEU A 1 258 ? -0.60967 9.81812   115.65929 1.000 19.81527 ? 258 LEU A CD1 1 
ATOM   2291 C  CD2 . LEU A 1 258 ? -0.94246 12.28904  115.39556 1.000 19.41224 ? 258 LEU A CD2 1 
ATOM   2292 N  N   . ARG A 1 259 ? 2.54400  13.05950  118.65675 1.000 11.12592 ? 259 ARG A N   1 
ATOM   2293 C  CA  . ARG A 1 259 ? 3.42814  13.05247  119.81147 1.000 11.96999 ? 259 ARG A CA  1 
ATOM   2294 C  C   . ARG A 1 259 ? 3.94306  11.64095  120.08507 1.000 11.39700 ? 259 ARG A C   1 
ATOM   2295 O  O   . ARG A 1 259 ? 3.28512  10.63555  119.80662 1.000 11.95027 ? 259 ARG A O   1 
ATOM   2296 C  CB  . ARG A 1 259 ? 2.75321  13.67358  121.03150 1.000 13.53751 ? 259 ARG A CB  1 
ATOM   2297 C  CG  . ARG A 1 259 ? 1.86004  12.76131  121.80415 1.000 14.19554 ? 259 ARG A CG  1 
ATOM   2298 C  CD  . ARG A 1 259 ? 1.14213  13.53732  122.93470 1.000 13.96441 ? 259 ARG A CD  1 
ATOM   2299 N  NE  . ARG A 1 259 ? 0.36394  12.61761  123.74839 1.000 14.22667 ? 259 ARG A NE  1 
ATOM   2300 C  CZ  . ARG A 1 259 ? -0.77090 12.03966  123.36984 1.000 13.45401 ? 259 ARG A CZ  1 
ATOM   2301 N  NH1 . ARG A 1 259 ? -1.37408 12.37735  122.23267 1.000 14.37498 ? 259 ARG A NH1 1 
ATOM   2302 N  NH2 . ARG A 1 259 ? -1.32925 11.15302  124.16743 1.000 14.56225 ? 259 ARG A NH2 1 
ATOM   2303 N  N   . PHE A 1 260 ? 5.15511  11.56755  120.61937 1.000 11.76095 ? 260 PHE A N   1 
ATOM   2304 C  CA  . PHE A 1 260 ? 5.75118  10.27620  120.92710 1.000 11.56893 ? 260 PHE A CA  1 
ATOM   2305 C  C   . PHE A 1 260 ? 4.91216  9.51229   121.93893 1.000 11.75794 ? 260 PHE A C   1 
ATOM   2306 O  O   . PHE A 1 260 ? 4.43582  10.07723  122.92552 1.000 12.93768 ? 260 PHE A O   1 
ATOM   2307 C  CB  . PHE A 1 260 ? 7.17785  10.43779  121.44478 1.000 12.13161 ? 260 PHE A CB  1 
ATOM   2308 C  CG  . PHE A 1 260 ? 7.84575  9.12436   121.73632 1.000 11.88771 ? 260 PHE A CG  1 
ATOM   2309 C  CD1 . PHE A 1 260 ? 8.16651  8.26042   120.70840 1.000 12.46121 ? 260 PHE A CD1 1 
ATOM   2310 C  CD2 . PHE A 1 260 ? 8.11273  8.72860   123.03466 1.000 13.71473 ? 260 PHE A CD2 1 
ATOM   2311 C  CE1 . PHE A 1 260 ? 8.75165  7.03855   120.95912 1.000 13.35260 ? 260 PHE A CE1 1 
ATOM   2312 C  CE2 . PHE A 1 260 ? 8.70561  7.50404   123.29286 1.000 14.78799 ? 260 PHE A CE2 1 
ATOM   2313 C  CZ  . PHE A 1 260 ? 9.02295  6.65581   122.25868 1.000 14.86095 ? 260 PHE A CZ  1 
ATOM   2314 N  N   . GLY A 1 261 ? 4.73234  8.21554   121.66818 1.000 12.18531 ? 261 GLY A N   1 
ATOM   2315 C  CA  . GLY A 1 261 ? 3.87772  7.33869   122.42079 1.000 12.90686 ? 261 GLY A CA  1 
ATOM   2316 C  C   . GLY A 1 261 ? 2.55098  7.08375   121.74074 1.000 12.71453 ? 261 GLY A C   1 
ATOM   2317 O  O   . GLY A 1 261 ? 1.99237  5.99515   121.88058 1.000 14.26072 ? 261 GLY A O   1 
ATOM   2318 N  N   . ALA A 1 262 ? 2.04517  8.07045   121.00554 1.000 12.67384 ? 262 ALA A N   1 
ATOM   2319 C  CA  . ALA A 1 262 ? 0.91315  7.85116   120.12532 1.000 13.31067 ? 262 ALA A CA  1 
ATOM   2320 C  C   . ALA A 1 262 ? 1.35059  6.99332   118.93329 1.000 11.88023 ? 262 ALA A C   1 
ATOM   2321 O  O   . ALA A 1 262 ? 2.53641  6.75678   118.70097 1.000 13.14472 ? 262 ALA A O   1 
ATOM   2322 C  CB  . ALA A 1 262 ? 0.31893  9.18630   119.67372 1.000 15.07925 ? 262 ALA A CB  1 
ATOM   2323 N  N   . GLY A 1 263 ? 0.38574  6.53560   118.16596 1.000 12.21761 ? 263 GLY A N   1 
ATOM   2324 C  CA  . GLY A 1 263 ? 0.69105  5.63056   117.08580 1.000 12.32420 ? 263 GLY A CA  1 
ATOM   2325 C  C   . GLY A 1 263 ? 0.86722  4.23583   117.62168 1.000 11.32407 ? 263 GLY A C   1 
ATOM   2326 O  O   . GLY A 1 263 ? 0.03952  3.73895   118.38661 1.000 13.09846 ? 263 GLY A O   1 
ATOM   2327 N  N   . ASP A 1 264 ? 1.96271  3.59743   117.23274 1.000 10.61413 ? 264 ASP A N   1 
ATOM   2328 C  CA  . ASP A 1 264 ? 2.23420  2.20144   117.57753 1.000 10.33880 ? 264 ASP A CA  1 
ATOM   2329 C  C   . ASP A 1 264 ? 2.91204  2.16601   118.94436 1.000 10.23064 ? 264 ASP A C   1 
ATOM   2330 O  O   . ASP A 1 264 ? 4.12588  2.33315   119.07966 1.000 10.57476 ? 264 ASP A O   1 
ATOM   2331 C  CB  . ASP A 1 264 ? 3.09000  1.56468   116.49295 1.000 11.56926 ? 264 ASP A CB  1 
ATOM   2332 C  CG  . ASP A 1 264 ? 3.28518  0.08087   116.68509 1.000 11.93796 ? 264 ASP A CG  1 
ATOM   2333 O  OD1 . ASP A 1 264 ? 3.12658  -0.41977  117.81883 1.000 11.93447 ? 264 ASP A OD1 1 
ATOM   2334 O  OD2 . ASP A 1 264 ? 3.65533  -0.57240  115.69589 1.000 14.00055 ? 264 ASP A OD2 1 
ATOM   2335 N  N   . LEU A 1 265 ? 2.10581  1.95429   119.97659 1.000 10.77530 ? 265 LEU A N   1 
ATOM   2336 C  CA  . LEU A 1 265 ? 2.60037  2.01868   121.34677 1.000 10.75366 ? 265 LEU A CA  1 
ATOM   2337 C  C   . LEU A 1 265 ? 3.57647  0.89313   121.65907 1.000 10.60612 ? 265 LEU A C   1 
ATOM   2338 O  O   . LEU A 1 265 ? 4.58136  1.11259   122.33884 1.000 11.49543 ? 265 LEU A O   1 
ATOM   2339 C  CB  . LEU A 1 265 ? 1.40676  1.98126   122.29336 1.000 12.55130 ? 265 LEU A CB  1 
ATOM   2340 C  CG  . LEU A 1 265 ? 1.70578  1.98362   123.79384 1.000 14.60947 ? 265 LEU A CG  1 
ATOM   2341 C  CD1 . LEU A 1 265 ? 2.58156  3.16182   124.19896 1.000 15.73309 ? 265 LEU A CD1 1 
ATOM   2342 C  CD2 . LEU A 1 265 ? 0.39988  1.99081   124.55022 1.000 17.04893 ? 265 LEU A CD2 1 
ATOM   2343 N  N   A ARG A 1 266 ? 3.29632  -0.32418  121.20308 0.511 10.84009 ? 266 ARG A N   1 
ATOM   2344 N  N   B ARG A 1 266 ? 3.28504  -0.32686  121.20552 0.489 10.88923 ? 266 ARG A N   1 
ATOM   2345 C  CA  A ARG A 1 266 ? 4.23138  -1.40017  121.49997 0.511 11.29299 ? 266 ARG A CA  1 
ATOM   2346 C  CA  B ARG A 1 266 ? 4.21391  -1.42313  121.45447 0.489 11.43774 ? 266 ARG A CA  1 
ATOM   2347 C  C   A ARG A 1 266 ? 5.56220  -1.21008  120.79025 0.511 10.68207 ? 266 ARG A C   1 
ATOM   2348 C  C   B ARG A 1 266 ? 5.55925  -1.16809  120.80559 0.489 10.70996 ? 266 ARG A C   1 
ATOM   2349 O  O   A ARG A 1 266 ? 6.60422  -1.55381  121.35436 0.511 11.46909 ? 266 ARG A O   1 
ATOM   2350 O  O   B ARG A 1 266 ? 6.60155  -1.45388  121.40290 0.489 11.46313 ? 266 ARG A O   1 
ATOM   2351 C  CB  A ARG A 1 266 ? 3.59981  -2.76300  121.25182 0.511 12.95505 ? 266 ARG A CB  1 
ATOM   2352 C  CB  B ARG A 1 266 ? 3.63782  -2.75478  120.99391 0.489 13.28884 ? 266 ARG A CB  1 
ATOM   2353 C  CG  A ARG A 1 266 ? 2.60960  -3.10284  122.35418 0.511 14.57843 ? 266 ARG A CG  1 
ATOM   2354 C  CG  B ARG A 1 266 ? 2.51931  -3.23313  121.87199 0.489 14.98738 ? 266 ARG A CG  1 
ATOM   2355 C  CD  A ARG A 1 266 ? 3.01499  -4.34496  123.10297 0.511 14.80792 ? 266 ARG A CD  1 
ATOM   2356 C  CD  B ARG A 1 266 ? 2.43987  -4.74178  121.89868 0.489 15.43666 ? 266 ARG A CD  1 
ATOM   2357 N  NE  A ARG A 1 266 ? 2.80331  -5.53356  122.29685 0.511 14.80543 ? 266 ARG A NE  1 
ATOM   2358 N  NE  B ARG A 1 266 ? 3.32435  -5.41008  122.82029 0.489 15.23517 ? 266 ARG A NE  1 
ATOM   2359 C  CZ  A ARG A 1 266 ? 3.27945  -6.73562  122.58598 0.511 14.13321 ? 266 ARG A CZ  1 
ATOM   2360 C  CZ  B ARG A 1 266 ? 3.51330  -6.71975  122.78822 0.489 14.65677 ? 266 ARG A CZ  1 
ATOM   2361 N  NH1 A ARG A 1 266 ? 3.01953  -7.75547  121.77552 0.511 14.19029 ? 266 ARG A NH1 1 
ATOM   2362 N  NH1 B ARG A 1 266 ? 2.86785  -7.44712  121.88373 0.489 14.49318 ? 266 ARG A NH1 1 
ATOM   2363 N  NH2 A ARG A 1 266 ? 4.02266  -6.91345  123.67339 0.511 14.38490 ? 266 ARG A NH2 1 
ATOM   2364 N  NH2 B ARG A 1 266 ? 4.33285  -7.29927  123.65398 0.489 15.86357 ? 266 ARG A NH2 1 
ATOM   2365 N  N   . ALA A 1 267 ? 5.55921  -0.63769  119.58347 1.000 10.44395 ? 267 ALA A N   1 
ATOM   2366 C  CA  . ALA A 1 267 ? 6.82592  -0.32736  118.93688 1.000 10.81587 ? 267 ALA A CA  1 
ATOM   2367 C  C   . ALA A 1 267 ? 7.59446  0.72292   119.72744 1.000 10.39237 ? 267 ALA A C   1 
ATOM   2368 O  O   . ALA A 1 267 ? 8.82771  0.68973   119.77898 1.000 11.48687 ? 267 ALA A O   1 
ATOM   2369 C  CB  . ALA A 1 267 ? 6.60111  0.15459   117.50857 1.000 11.76614 ? 267 ALA A CB  1 
ATOM   2370 N  N   . ALA A 1 268 ? 6.88511  1.67084   120.34065 1.000 10.21062 ? 268 ALA A N   1 
ATOM   2371 C  CA  . ALA A 1 268 ? 7.54873  2.67013   121.17595 1.000 10.99634 ? 268 ALA A CA  1 
ATOM   2372 C  C   . ALA A 1 268 ? 8.21511  2.02030   122.38411 1.000 10.72061 ? 268 ALA A C   1 
ATOM   2373 O  O   . ALA A 1 268 ? 9.33972  2.38392   122.75260 1.000 11.60026 ? 268 ALA A O   1 
ATOM   2374 C  CB  . ALA A 1 268 ? 6.55572  3.75162   121.60310 1.000 12.12250 ? 268 ALA A CB  1 
ATOM   2375 N  N   . PHE A 1 269 ? 7.53563  1.05412   123.01013 1.000 10.83219 ? 269 PHE A N   1 
ATOM   2376 C  CA  . PHE A 1 269 ? 8.12204  0.29513   124.11369 1.000 10.77530 ? 269 PHE A CA  1 
ATOM   2377 C  C   . PHE A 1 269 ? 9.40129  -0.40854  123.67943 1.000 10.62272 ? 269 PHE A C   1 
ATOM   2378 O  O   . PHE A 1 269 ? 10.43498 -0.30390  124.35011 1.000 11.59304 ? 269 PHE A O   1 
ATOM   2379 C  CB  . PHE A 1 269 ? 7.09254  -0.70848  124.64238 1.000 11.57174 ? 269 PHE A CB  1 
ATOM   2380 C  CG  . PHE A 1 269 ? 7.64320  -1.70084  125.63631 1.000 11.87005 ? 269 PHE A CG  1 
ATOM   2381 C  CD1 . PHE A 1 269 ? 7.72942  -1.39311  126.98385 1.000 13.55469 ? 269 PHE A CD1 1 
ATOM   2382 C  CD2 . PHE A 1 269 ? 8.05435  -2.95325  125.21899 1.000 13.40169 ? 269 PHE A CD2 1 
ATOM   2383 C  CE1 . PHE A 1 269 ? 8.21425  -2.31456  127.88553 1.000 14.85963 ? 269 PHE A CE1 1 
ATOM   2384 C  CE2 . PHE A 1 269 ? 8.53550  -3.87539  126.11473 1.000 14.83910 ? 269 PHE A CE2 1 
ATOM   2385 C  CZ  . PHE A 1 269 ? 8.62258  -3.55361  127.45493 1.000 15.37753 ? 269 PHE A CZ  1 
ATOM   2386 N  N   . TRP A 1 270 ? 9.35364  -1.14393  122.56487 1.000 10.46400 ? 270 TRP A N   1 
ATOM   2387 C  CA  . TRP A 1 270 ? 10.54566 -1.86788  122.13601 1.000 10.53968 ? 270 TRP A CA  1 
ATOM   2388 C  C   . TRP A 1 270 ? 11.66119 -0.92087  121.72114 1.000 10.50569 ? 270 TRP A C   1 
ATOM   2389 O  O   . TRP A 1 270 ? 12.83971 -1.24673  121.88538 1.000 11.67144 ? 270 TRP A O   1 
ATOM   2390 C  CB  . TRP A 1 270 ? 10.21858 -2.87855  121.03373 1.000 11.25474 ? 270 TRP A CB  1 
ATOM   2391 C  CG  . TRP A 1 270 ? 9.35624  -3.99969  121.50468 1.000 11.29764 ? 270 TRP A CG  1 
ATOM   2392 C  CD1 . TRP A 1 270 ? 8.09672  -4.30005  121.07060 1.000 12.45284 ? 270 TRP A CD1 1 
ATOM   2393 C  CD2 . TRP A 1 270 ? 9.68673  -4.98483  122.49996 1.000 11.68225 ? 270 TRP A CD2 1 
ATOM   2394 N  NE1 . TRP A 1 270 ? 7.61231  -5.39459  121.75149 1.000 13.11493 ? 270 TRP A NE1 1 
ATOM   2395 C  CE2 . TRP A 1 270 ? 8.57188  -5.83979  122.62113 1.000 12.53047 ? 270 TRP A CE2 1 
ATOM   2396 C  CE3 . TRP A 1 270 ? 10.81597 -5.23534  123.28297 1.000 13.26818 ? 270 TRP A CE3 1 
ATOM   2397 C  CZ2 . TRP A 1 270 ? 8.54668  -6.91946  123.50062 1.000 14.12560 ? 270 TRP A CZ2 1 
ATOM   2398 C  CZ3 . TRP A 1 270 ? 10.78329 -6.31170  124.16581 1.000 14.53292 ? 270 TRP A CZ3 1 
ATOM   2399 C  CH2 . TRP A 1 270 ? 9.66262  -7.13828  124.26030 1.000 14.83714 ? 270 TRP A CH2 1 
ATOM   2400 N  N   . LEU A 1 271 ? 11.31588 0.24118   121.16682 1.000 10.39478 ? 271 LEU A N   1 
ATOM   2401 C  CA  . LEU A 1 271 ? 12.33357 1.23417   120.84297 1.000 10.68139 ? 271 LEU A CA  1 
ATOM   2402 C  C   . LEU A 1 271 ? 13.04152 1.73424   122.09346 1.000 10.65079 ? 271 LEU A C   1 
ATOM   2403 O  O   . LEU A 1 271 ? 14.27249 1.81413   122.12550 1.000 11.38313 ? 271 LEU A O   1 
ATOM   2404 C  CB  . LEU A 1 271 ? 11.69151 2.40355   120.10663 1.000 11.28467 ? 271 LEU A CB  1 
ATOM   2405 C  CG  . LEU A 1 271 ? 12.63328 3.57400   119.83830 1.000 12.32402 ? 271 LEU A CG  1 
ATOM   2406 C  CD1 . LEU A 1 271 ? 13.76930 3.18177   118.90982 1.000 13.33398 ? 271 LEU A CD1 1 
ATOM   2407 C  CD2 . LEU A 1 271 ? 11.84742 4.76355   119.31517 1.000 13.81378 ? 271 LEU A CD2 1 
ATOM   2408 N  N   . VAL A 1 272 ? 12.27625 2.11778   123.11910 1.000 10.90243 ? 272 VAL A N   1 
ATOM   2409 C  CA  . VAL A 1 272 ? 12.90385 2.62656   124.33621 1.000 11.56497 ? 272 VAL A CA  1 
ATOM   2410 C  C   . VAL A 1 272 ? 13.76284 1.54708   124.98375 1.000 11.69708 ? 272 VAL A C   1 
ATOM   2411 O  O   . VAL A 1 272 ? 14.88573 1.81184   125.43126 1.000 12.68763 ? 272 VAL A O   1 
ATOM   2412 C  CB  . VAL A 1 272 ? 11.83957 3.20599   125.28374 1.000 12.74839 ? 272 VAL A CB  1 
ATOM   2413 C  CG1 . VAL A 1 272 ? 12.47231 3.59751   126.61606 1.000 14.92575 ? 272 VAL A CG1 1 
ATOM   2414 C  CG2 . VAL A 1 272 ? 11.17099 4.41935   124.65395 1.000 13.30037 ? 272 VAL A CG2 1 
ATOM   2415 N  N   . ASP A 1 273 ? 13.25793 0.31179   125.01946 1.000 11.82636 ? 273 ASP A N   1 
ATOM   2416 C  CA  . ASP A 1 273 ? 14.03493 -0.80980  125.53669 1.000 12.31917 ? 273 ASP A CA  1 
ATOM   2417 C  C   . ASP A 1 273 ? 15.38724 -0.90334  124.83991 1.000 12.43544 ? 273 ASP A C   1 
ATOM   2418 O  O   . ASP A 1 273 ? 16.42920 -1.06404  125.48427 1.000 13.89030 ? 273 ASP A O   1 
ATOM   2419 C  CB  . ASP A 1 273 ? 13.23778 -2.10128  125.33590 1.000 13.31603 ? 273 ASP A CB  1 
ATOM   2420 C  CG  . ASP A 1 273 ? 14.00152 -3.33970  125.74376 1.000 15.29937 ? 273 ASP A CG  1 
ATOM   2421 O  OD1 . ASP A 1 273 ? 14.31202 -3.48955  126.93815 1.000 16.84927 ? 273 ASP A OD1 1 
ATOM   2422 O  OD2 . ASP A 1 273 ? 14.29691 -4.16471  124.85812 1.000 17.48457 ? 273 ASP A OD2 1 
ATOM   2423 N  N   . LEU A 1 274 ? 15.38422 -0.79807  123.51290 1.000 12.21175 ? 274 LEU A N   1 
ATOM   2424 C  CA  . LEU A 1 274 ? 16.61282 -0.90835  122.73609 1.000 12.29949 ? 274 LEU A CA  1 
ATOM   2425 C  C   . LEU A 1 274 ? 17.55439 0.26823   122.99221 1.000 12.57716 ? 274 LEU A C   1 
ATOM   2426 O  O   . LEU A 1 274 ? 18.75513 0.07037   123.21465 1.000 13.86258 ? 274 LEU A O   1 
ATOM   2427 C  CB  . LEU A 1 274 ? 16.25023 -1.01187  121.25635 1.000 12.80131 ? 274 LEU A CB  1 
ATOM   2428 C  CG  . LEU A 1 274 ? 17.41088 -1.03294  120.27876 1.000 14.49806 ? 274 LEU A CG  1 
ATOM   2429 C  CD1 . LEU A 1 274 ? 18.31674 -2.23330  120.50521 1.000 16.83043 ? 274 LEU A CD1 1 
ATOM   2430 C  CD2 . LEU A 1 274 ? 16.84990 -1.03409  118.86615 1.000 16.75247 ? 274 LEU A CD2 1 
ATOM   2431 N  N   . LEU A 1 275 ? 17.04000 1.50301   122.93238 1.000 12.33161 ? 275 LEU A N   1 
ATOM   2432 C  CA  . LEU A 1 275 ? 17.90855 2.66182   123.13595 1.000 13.26874 ? 275 LEU A CA  1 
ATOM   2433 C  C   . LEU A 1 275 ? 18.56372 2.62053   124.50386 1.000 14.09861 ? 275 LEU A C   1 
ATOM   2434 O  O   . LEU A 1 275 ? 19.75309 2.92802   124.64446 1.000 15.53226 ? 275 LEU A O   1 
ATOM   2435 C  CB  . LEU A 1 275 ? 17.12492 3.96596   122.99762 1.000 13.77168 ? 275 LEU A CB  1 
ATOM   2436 C  CG  . LEU A 1 275 ? 16.57439 4.28935   121.60609 1.000 14.89735 ? 275 LEU A CG  1 
ATOM   2437 C  CD1 . LEU A 1 275 ? 15.77454 5.57583   121.65924 1.000 16.74925 ? 275 LEU A CD1 1 
ATOM   2438 C  CD2 . LEU A 1 275 ? 17.68272 4.38218   120.56921 1.000 16.09132 ? 275 LEU A CD2 1 
ATOM   2439 N  N   . GLU A 1 276 ? 17.79029 2.26995   125.53086 1.000 13.93589 ? 276 GLU A N   1 
ATOM   2440 C  CA  . GLU A 1 276 ? 18.32753 2.25199   126.88584 1.000 15.19084 ? 276 GLU A CA  1 
ATOM   2441 C  C   . GLU A 1 276 ? 19.28921 1.08701   127.09145 1.000 16.81383 ? 276 GLU A C   1 
ATOM   2442 O  O   . GLU A 1 276 ? 20.33046 1.24861   127.73121 1.000 19.89556 ? 276 GLU A O   1 
ATOM   2443 C  CB  . GLU A 1 276 ? 17.18766 2.25496   127.90340 1.000 15.92211 ? 276 GLU A CB  1 
ATOM   2444 C  CG  . GLU A 1 276 ? 16.31319 3.50787   127.82516 1.000 16.48130 ? 276 GLU A CG  1 
ATOM   2445 C  CD  . GLU A 1 276 ? 17.06916 4.80034   128.09592 1.000 19.08230 ? 276 GLU A CD  1 
ATOM   2446 O  OE1 . GLU A 1 276 ? 18.00708 4.77796   128.91387 1.000 22.52840 ? 276 GLU A OE1 1 
ATOM   2447 O  OE2 . GLU A 1 276 ? 16.73722 5.84105   127.48469 1.000 19.68203 ? 276 GLU A OE2 1 
ATOM   2448 N  N   A SER A 1 277 ? 18.95990 -0.08478  126.54432 0.540 16.64240 ? 277 SER A N   1 
ATOM   2449 N  N   B SER A 1 277 ? 18.98512 -0.08832  126.54162 0.460 16.88131 ? 277 SER A N   1 
ATOM   2450 C  CA  A SER A 1 277 ? 19.83532 -1.24460  126.67204 0.540 17.33635 ? 277 SER A CA  1 
ATOM   2451 C  CA  B SER A 1 277 ? 19.88587 -1.21993  126.74213 0.460 18.57866 ? 277 SER A CA  1 
ATOM   2452 C  C   A SER A 1 277 ? 21.16194 -1.00981  125.96376 0.540 17.60214 ? 277 SER A C   1 
ATOM   2453 C  C   B SER A 1 277 ? 21.15602 -1.11491  125.90461 0.460 18.66225 ? 277 SER A C   1 
ATOM   2454 O  O   A SER A 1 277 ? 22.22580 -1.38058  126.47426 0.540 19.47416 ? 277 SER A O   1 
ATOM   2455 O  O   B SER A 1 277 ? 22.17818 -1.69975  126.27624 0.460 20.55409 ? 277 SER A O   1 
ATOM   2456 C  CB  A SER A 1 277 ? 19.13933 -2.47754  126.09746 0.540 18.79424 ? 277 SER A CB  1 
ATOM   2457 C  CB  B SER A 1 277 ? 19.17051 -2.54326  126.47633 0.460 21.42193 ? 277 SER A CB  1 
ATOM   2458 O  OG  A SER A 1 277 ? 18.05701 -2.87929  126.92106 0.540 21.05404 ? 277 SER A OG  1 
ATOM   2459 O  OG  B SER A 1 277 ? 18.86729 -2.68441  125.10416 0.460 24.18246 ? 277 SER A OG  1 
ATOM   2460 N  N   . ALA A 1 278 ? 21.11742 -0.39292  124.78609 1.000 17.71001 ? 278 ALA A N   1 
ATOM   2461 C  CA  . ALA A 1 278 ? 22.30835 -0.16236  123.98360 1.000 19.48688 ? 278 ALA A CA  1 
ATOM   2462 C  C   . ALA A 1 278 ? 23.14488 0.99721   124.50325 1.000 21.26343 ? 278 ALA A C   1 
ATOM   2463 O  O   . ALA A 1 278 ? 24.28213 1.16779   124.05802 1.000 25.40801 ? 278 ALA A O   1 
ATOM   2464 C  CB  . ALA A 1 278 ? 21.91584 0.09417   122.52479 1.000 20.93274 ? 278 ALA A CB  1 
ATOM   2465 N  N   . GLY A 1 279 ? 22.61842 1.79017   125.43147 1.000 21.11863 ? 279 GLY A N   1 
ATOM   2466 C  CA  . GLY A 1 279 ? 23.35963 2.92878   125.93530 1.000 23.04543 ? 279 GLY A CA  1 
ATOM   2467 C  C   . GLY A 1 279 ? 23.45337 4.08583   124.96614 1.000 23.59028 ? 279 GLY A C   1 
ATOM   2468 O  O   . GLY A 1 279 ? 24.44275 4.82317   124.99378 1.000 26.26891 ? 279 GLY A O   1 
ATOM   2469 N  N   . TYR A 1 280 ? 22.45519 4.26172   124.09742 1.000 21.30928 ? 280 TYR A N   1 
ATOM   2470 C  CA  . TYR A 1 280 ? 22.42691 5.43116   123.22674 1.000 20.49612 ? 280 TYR A CA  1 
ATOM   2471 C  C   . TYR A 1 280 ? 22.51726 6.68665   124.08696 1.000 21.01351 ? 280 TYR A C   1 
ATOM   2472 O  O   . TYR A 1 280 ? 21.75514 6.85496   125.04200 1.000 22.35385 ? 280 TYR A O   1 
ATOM   2473 C  CB  . TYR A 1 280 ? 21.13963 5.43129   122.38206 1.000 19.70295 ? 280 TYR A CB  1 
ATOM   2474 C  CG  . TYR A 1 280 ? 20.87203 6.73716   121.64503 1.000 18.03456 ? 280 TYR A CG  1 
ATOM   2475 C  CD1 . TYR A 1 280 ? 21.67040 7.13081   120.57698 1.000 18.37190 ? 280 TYR A CD1 1 
ATOM   2476 C  CD2 . TYR A 1 280 ? 19.83069 7.57652   122.02773 1.000 17.14511 ? 280 TYR A CD2 1 
ATOM   2477 C  CE1 . TYR A 1 280 ? 21.44041 8.32424   119.91454 1.000 17.74382 ? 280 TYR A CE1 1 
ATOM   2478 C  CE2 . TYR A 1 280 ? 19.59580 8.76902   121.37166 1.000 16.76072 ? 280 TYR A CE2 1 
ATOM   2479 C  CZ  . TYR A 1 280 ? 20.40415 9.13595   120.31922 1.000 16.70921 ? 280 TYR A CZ  1 
ATOM   2480 O  OH  . TYR A 1 280 ? 20.18053 10.32141  119.66463 1.000 17.01885 ? 280 TYR A OH  1 
ATOM   2481 N  N   . SER A 1 281 ? 23.47324 7.55737   123.76749 1.000 21.78781 ? 281 SER A N   1 
ATOM   2482 C  CA  A SER A 1 281 ? 23.77790 8.72576   124.58294 0.719 23.46233 ? 281 SER A CA  1 
ATOM   2483 C  CA  B SER A 1 281 ? 23.74936 8.72452   124.59679 0.281 23.59478 ? 281 SER A CA  1 
ATOM   2484 C  C   . SER A 1 281 ? 23.44033 10.04205  123.89849 1.000 22.37346 ? 281 SER A C   1 
ATOM   2485 O  O   . SER A 1 281 ? 23.72052 11.10662  124.46011 1.000 24.76280 ? 281 SER A O   1 
ATOM   2486 C  CB  A SER A 1 281 ? 25.25924 8.71862   124.98098 0.719 28.36394 ? 281 SER A CB  1 
ATOM   2487 C  CB  B SER A 1 281 ? 25.19815 8.70530   125.09336 0.281 27.62041 ? 281 SER A CB  1 
ATOM   2488 O  OG  A SER A 1 281 ? 26.08259 8.76377   123.82950 0.719 32.72985 ? 281 SER A OG  1 
ATOM   2489 O  OG  B SER A 1 281 ? 25.45327 7.54384   125.86474 0.281 30.88793 ? 281 SER A OG  1 
ATOM   2490 N  N   . GLY A 1 282 ? 22.86133 10.00232  122.70049 1.000 19.62810 ? 282 GLY A N   1 
ATOM   2491 C  CA  . GLY A 1 282 ? 22.52264 11.21181  121.99092 1.000 18.45566 ? 282 GLY A CA  1 
ATOM   2492 C  C   . GLY A 1 282 ? 21.22012 11.81000  122.47214 1.000 16.96751 ? 282 GLY A C   1 
ATOM   2493 O  O   . GLY A 1 282 ? 20.55261 11.30139  123.38264 1.000 17.44445 ? 282 GLY A O   1 
ATOM   2494 N  N   . PRO A 1 283 ? 20.83193 12.91771  121.84741 1.000 16.45708 ? 283 PRO A N   1 
ATOM   2495 C  CA  . PRO A 1 283 ? 19.58045 13.57021  122.23877 1.000 15.96817 ? 283 PRO A CA  1 
ATOM   2496 C  C   . PRO A 1 283 ? 18.38002 12.68707  121.93533 1.000 14.57614 ? 283 PRO A C   1 
ATOM   2497 O  O   . PRO A 1 283 ? 18.37136 11.91061  120.97974 1.000 14.99866 ? 283 PRO A O   1 
ATOM   2498 C  CB  . PRO A 1 283 ? 19.54772 14.83467  121.36906 1.000 18.37466 ? 283 PRO A CB  1 
ATOM   2499 C  CG  . PRO A 1 283 ? 20.94212 15.03093  120.88556 1.000 19.49553 ? 283 PRO A CG  1 
ATOM   2500 C  CD  . PRO A 1 283 ? 21.54903 13.66314  120.79971 1.000 18.21182 ? 283 PRO A CD  1 
ATOM   2501 N  N   . ARG A 1 284 ? 17.36076 12.80815  122.77787 1.000 14.02011 ? 284 ARG A N   1 
ATOM   2502 C  CA  A ARG A 1 284 ? 16.04489 12.22400  122.52178 0.646 13.98307 ? 284 ARG A CA  1 
ATOM   2503 C  CA  B ARG A 1 284 ? 16.05330 12.21807  122.50935 0.354 13.96010 ? 284 ARG A CA  1 
ATOM   2504 C  C   . ARG A 1 284 ? 15.20881 13.35529  121.94110 1.000 12.70742 ? 284 ARG A C   1 
ATOM   2505 O  O   . ARG A 1 284 ? 14.58805 14.12903  122.67286 1.000 13.29424 ? 284 ARG A O   1 
ATOM   2506 C  CB  A ARG A 1 284 ? 15.43842 11.65860  123.80176 0.646 15.32228 ? 284 ARG A CB  1 
ATOM   2507 C  CB  B ARG A 1 284 ? 15.46671 11.60536  123.77475 0.354 15.45553 ? 284 ARG A CB  1 
ATOM   2508 C  CG  A ARG A 1 284 ? 15.86695 10.22664  124.12116 0.646 16.09228 ? 284 ARG A CG  1 
ATOM   2509 C  CG  B ARG A 1 284 ? 16.31918 10.49832  124.40850 0.354 16.86848 ? 284 ARG A CG  1 
ATOM   2510 C  CD  A ARG A 1 284 ? 17.31211 10.14105  124.56396 0.646 16.76676 ? 284 ARG A CD  1 
ATOM   2511 C  CD  B ARG A 1 284 ? 15.91510 10.34137  125.87162 0.354 19.06375 ? 284 ARG A CD  1 
ATOM   2512 N  NE  A ARG A 1 284 ? 17.60258 8.82651   125.11938 0.646 17.92310 ? 284 ARG A NE  1 
ATOM   2513 N  NE  B ARG A 1 284 ? 16.62102 9.29202   126.60730 0.354 20.80199 ? 284 ARG A NE  1 
ATOM   2514 C  CZ  A ARG A 1 284 ? 18.82510 8.36653   125.36035 0.646 19.49417 ? 284 ARG A CZ  1 
ATOM   2515 C  CZ  B ARG A 1 284 ? 16.66043 9.23343   127.93638 0.354 22.19434 ? 284 ARG A CZ  1 
ATOM   2516 N  NH1 A ARG A 1 284 ? 19.89016 9.11259   125.09035 0.646 19.84529 ? 284 ARG A NH1 1 
ATOM   2517 N  NH1 B ARG A 1 284 ? 16.04201 10.16660  128.64585 0.354 24.53809 ? 284 ARG A NH1 1 
ATOM   2518 N  NH2 A ARG A 1 284 ? 18.97779 7.15432   125.87835 0.646 21.23600 ? 284 ARG A NH2 1 
ATOM   2519 N  NH2 B ARG A 1 284 ? 17.30916 8.25423   128.55929 0.354 20.98997 ? 284 ARG A NH2 1 
ATOM   2520 N  N   . HIS A 1 285 ? 15.22900 13.47034  120.61466 1.000 12.59975 ? 285 HIS A N   1 
ATOM   2521 C  CA  . HIS A 1 285 ? 14.66784 14.60931  119.90171 1.000 11.76617 ? 285 HIS A CA  1 
ATOM   2522 C  C   . HIS A 1 285 ? 13.27419 14.27512  119.40393 1.000 11.57972 ? 285 HIS A C   1 
ATOM   2523 O  O   . HIS A 1 285 ? 13.06094 13.21337  118.81598 1.000 13.42897 ? 285 HIS A O   1 
ATOM   2524 C  CB  . HIS A 1 285 ? 15.56907 14.93219  118.71156 1.000 12.61447 ? 285 HIS A CB  1 
ATOM   2525 C  CG  . HIS A 1 285 ? 15.11487 16.09396  117.88500 1.000 12.75980 ? 285 HIS A CG  1 
ATOM   2526 N  ND1 . HIS A 1 285 ? 14.66655 15.94827  116.59193 1.000 13.64618 ? 285 HIS A ND1 1 
ATOM   2527 C  CD2 . HIS A 1 285 ? 15.10595 17.42499  118.13411 1.000 13.85927 ? 285 HIS A CD2 1 
ATOM   2528 C  CE1 . HIS A 1 285 ? 14.38261 17.13925  116.09064 1.000 14.53467 ? 285 HIS A CE1 1 
ATOM   2529 N  NE2 . HIS A 1 285 ? 14.63776 18.05467  117.00686 1.000 14.84717 ? 285 HIS A NE2 1 
ATOM   2530 N  N   . PHE A 1 286 ? 12.34247 15.19535  119.60640 1.000 11.15566 ? 286 PHE A N   1 
ATOM   2531 C  CA  . PHE A 1 286 ? 10.97304 15.02790  119.14817 1.000 11.81536 ? 286 PHE A CA  1 
ATOM   2532 C  C   . PHE A 1 286 ? 10.74561 15.86542  117.90073 1.000 12.73355 ? 286 PHE A C   1 
ATOM   2533 O  O   . PHE A 1 286 ? 10.89322 17.08864  117.92167 1.000 15.40312 ? 286 PHE A O   1 
ATOM   2534 C  CB  . PHE A 1 286 ? 9.98599  15.38628  120.25462 1.000 12.85691 ? 286 PHE A CB  1 
ATOM   2535 C  CG  . PHE A 1 286 ? 10.16226 14.54398  121.47329 1.000 12.56184 ? 286 PHE A CG  1 
ATOM   2536 C  CD1 . PHE A 1 286 ? 9.75591  13.22036  121.47437 1.000 12.88946 ? 286 PHE A CD1 1 
ATOM   2537 C  CD2 . PHE A 1 286 ? 10.78804 15.04683  122.59781 1.000 14.11074 ? 286 PHE A CD2 1 
ATOM   2538 C  CE1 . PHE A 1 286 ? 9.95131  12.42055  122.58255 1.000 13.69911 ? 286 PHE A CE1 1 
ATOM   2539 C  CE2 . PHE A 1 286 ? 10.97631 14.25306  123.70604 1.000 14.79572 ? 286 PHE A CE2 1 
ATOM   2540 C  CZ  . PHE A 1 286 ? 10.56229 12.93994  123.70766 1.000 14.33600 ? 286 PHE A CZ  1 
ATOM   2541 N  N   . ASP A 1 287 ? 10.40278 15.19560  116.81265 1.000 11.84659 ? 287 ASP A N   1 
ATOM   2542 C  CA  . ASP A 1 287 ? 9.97374  15.85244  115.58145 1.000 11.77332 ? 287 ASP A CA  1 
ATOM   2543 C  C   . ASP A 1 287 ? 8.48815  15.54002  115.45538 1.000 11.62618 ? 287 ASP A C   1 
ATOM   2544 O  O   . ASP A 1 287 ? 8.09260  14.51559  114.90380 1.000 12.88419 ? 287 ASP A O   1 
ATOM   2545 C  CB  . ASP A 1 287 ? 10.75983 15.36626  114.37316 1.000 12.47302 ? 287 ASP A CB  1 
ATOM   2546 C  CG  . ASP A 1 287 ? 10.38235 16.09502  113.10098 1.000 13.15410 ? 287 ASP A CG  1 
ATOM   2547 O  OD1 . ASP A 1 287 ? 9.60347  17.06015  113.16146 1.000 13.22077 ? 287 ASP A OD1 1 
ATOM   2548 O  OD2 . ASP A 1 287 ? 10.84028 15.67526  112.02504 1.000 16.39162 ? 287 ASP A OD2 1 
ATOM   2549 N  N   . PHE A 1 288 ? 7.66473  16.41062  116.02110 1.000 12.32263 ? 288 PHE A N   1 
ATOM   2550 C  CA  . PHE A 1 288 ? 6.23809  16.15974  116.10563 1.000 12.79740 ? 288 PHE A CA  1 
ATOM   2551 C  C   . PHE A 1 288 ? 5.49854  17.45253  115.80811 1.000 12.63336 ? 288 PHE A C   1 
ATOM   2552 O  O   . PHE A 1 288 ? 6.07469  18.53784  115.80474 1.000 13.88027 ? 288 PHE A O   1 
ATOM   2553 C  CB  . PHE A 1 288 ? 5.83369  15.56557  117.47261 1.000 14.29981 ? 288 PHE A CB  1 
ATOM   2554 C  CG  . PHE A 1 288 ? 5.52602  16.60399  118.51635 1.000 13.96302 ? 288 PHE A CG  1 
ATOM   2555 C  CD1 . PHE A 1 288 ? 6.51814  17.45193  118.99131 1.000 14.86580 ? 288 PHE A CD1 1 
ATOM   2556 C  CD2 . PHE A 1 288 ? 4.24187  16.76207  118.99919 1.000 15.35951 ? 288 PHE A CD2 1 
ATOM   2557 C  CE1 . PHE A 1 288 ? 6.23159  18.42691  119.92956 1.000 16.28178 ? 288 PHE A CE1 1 
ATOM   2558 C  CE2 . PHE A 1 288 ? 3.95287  17.73161  119.94067 1.000 16.65468 ? 288 PHE A CE2 1 
ATOM   2559 C  CZ  . PHE A 1 288 ? 4.94412  18.56261  120.40620 1.000 17.14292 ? 288 PHE A CZ  1 
ATOM   2560 N  N   . LYS A 1 289 ? 4.20784  17.31439  115.53369 1.000 13.33362 ? 289 LYS A N   1 
ATOM   2561 C  CA  A LYS A 1 289 ? 3.34272  18.45357  115.27670 0.565 14.80641 ? 289 LYS A CA  1 
ATOM   2562 C  CA  B LYS A 1 289 ? 3.32814  18.44642  115.25662 0.435 14.88378 ? 289 LYS A CA  1 
ATOM   2563 C  C   . LYS A 1 289 ? 2.15696  18.37168  116.22022 1.000 14.78206 ? 289 LYS A C   1 
ATOM   2564 O  O   . LYS A 1 289 ? 1.37407  17.40733  116.15367 1.000 16.56554 ? 289 LYS A O   1 
ATOM   2565 C  CB  A LYS A 1 289 ? 2.87630  18.47536  113.82228 0.565 17.46181 ? 289 LYS A CB  1 
ATOM   2566 C  CB  B LYS A 1 289 ? 2.78030  18.33791  113.83353 0.435 17.48696 ? 289 LYS A CB  1 
ATOM   2567 C  CG  A LYS A 1 289 ? 3.97610  18.85783  112.86099 0.565 19.77280 ? 289 LYS A CG  1 
ATOM   2568 C  CG  B LYS A 1 289 ? 3.76197  18.64973  112.73508 0.435 20.27260 ? 289 LYS A CG  1 
ATOM   2569 C  CD  A LYS A 1 289 ? 3.53351  18.73093  111.41790 0.565 22.61325 ? 289 LYS A CD  1 
ATOM   2570 C  CD  B LYS A 1 289 ? 3.10969  18.45584  111.37557 0.435 23.39404 ? 289 LYS A CD  1 
ATOM   2571 C  CE  A LYS A 1 289 ? 4.61162  19.24557  110.48687 0.565 24.53785 ? 289 LYS A CE  1 
ATOM   2572 C  CE  B LYS A 1 289 ? 3.88703  19.17668  110.29067 0.435 26.06981 ? 289 LYS A CE  1 
ATOM   2573 N  NZ  A LYS A 1 289 ? 5.84358  18.42030  110.59417 0.565 23.92150 ? 289 LYS A NZ  1 
ATOM   2574 N  NZ  B LYS A 1 289 ? 3.47677  18.74554  108.92607 0.435 27.11880 ? 289 LYS A NZ  1 
ATOM   2575 N  N   . PRO A 1 290 ? 1.96682  19.33693  117.10496 1.000 14.12863 ? 290 PRO A N   1 
ATOM   2576 C  CA  . PRO A 1 290 ? 0.72172  19.36443  117.85885 1.000 13.38908 ? 290 PRO A CA  1 
ATOM   2577 C  C   . PRO A 1 290 ? -0.42432 19.51296  116.87671 1.000 12.09481 ? 290 PRO A C   1 
ATOM   2578 O  O   . PRO A 1 290 ? -0.37606 20.39651  116.01521 1.000 12.48140 ? 290 PRO A O   1 
ATOM   2579 C  CB  . PRO A 1 290 ? 0.85957  20.61524  118.74275 1.000 15.85553 ? 290 PRO A CB  1 
ATOM   2580 C  CG  . PRO A 1 290 ? 2.30174  20.98746  118.71195 1.000 18.76976 ? 290 PRO A CG  1 
ATOM   2581 C  CD  . PRO A 1 290 ? 2.84644  20.47427  117.41543 1.000 17.25097 ? 290 PRO A CD  1 
ATOM   2582 N  N   . PRO A 1 291 ? -1.44709 18.66718  116.93970 1.000 12.15756 ? 291 PRO A N   1 
ATOM   2583 C  CA  . PRO A 1 291 ? -2.50515 18.74189  115.92514 1.000 12.20031 ? 291 PRO A CA  1 
ATOM   2584 C  C   . PRO A 1 291 ? -3.12658 20.12702  115.83142 1.000 11.51445 ? 291 PRO A C   1 
ATOM   2585 O  O   . PRO A 1 291 ? -3.20107 20.88249  116.80383 1.000 12.13157 ? 291 PRO A O   1 
ATOM   2586 C  CB  . PRO A 1 291 ? -3.51851 17.69555  116.39147 1.000 13.96350 ? 291 PRO A CB  1 
ATOM   2587 C  CG  . PRO A 1 291 ? -2.67093 16.67544  117.11065 1.000 15.30700 ? 291 PRO A CG  1 
ATOM   2588 C  CD  . PRO A 1 291 ? -1.58098 17.47443  117.79285 1.000 14.01043 ? 291 PRO A CD  1 
ATOM   2589 N  N   . ARG A 1 292 ? -3.59957 20.45473  114.62848 1.000 12.14875 ? 292 ARG A N   1 
ATOM   2590 C  CA  . ARG A 1 292 ? -4.10098 21.80622  114.38655 1.000 13.52227 ? 292 ARG A CA  1 
ATOM   2591 C  C   . ARG A 1 292 ? -5.42783 22.07871  115.08419 1.000 12.58402 ? 292 ARG A C   1 
ATOM   2592 O  O   . ARG A 1 292 ? -5.86236 23.23277  115.11343 1.000 14.01294 ? 292 ARG A O   1 
ATOM   2593 C  CB  . ARG A 1 292 ? -4.15055 22.13059  112.89864 1.000 16.11292 ? 292 ARG A CB  1 
ATOM   2594 C  CG  . ARG A 1 292 ? -5.25476 21.42910  112.19189 1.000 16.69432 ? 292 ARG A CG  1 
ATOM   2595 C  CD  . ARG A 1 292 ? -5.14373 21.53382  110.66445 1.000 16.41679 ? 292 ARG A CD  1 
ATOM   2596 N  NE  . ARG A 1 292 ? -5.46463 22.83904  110.07052 1.000 15.87663 ? 292 ARG A NE  1 
ATOM   2597 C  CZ  . ARG A 1 292 ? -6.70248 23.22386  109.74123 1.000 15.03211 ? 292 ARG A CZ  1 
ATOM   2598 N  NH1 . ARG A 1 292 ? -7.74081 22.45926  110.05387 1.000 13.78172 ? 292 ARG A NH1 1 
ATOM   2599 N  NH2 . ARG A 1 292 ? -6.92399 24.39215  109.14131 1.000 16.59779 ? 292 ARG A NH2 1 
ATOM   2600 N  N   . THR A 1 293 ? -6.04851 21.05532  115.68662 1.000 11.79060 ? 293 THR A N   1 
ATOM   2601 C  CA  . THR A 1 293 ? -7.20404 21.24594  116.56190 1.000 12.02631 ? 293 THR A CA  1 
ATOM   2602 C  C   . THR A 1 293 ? -6.86656 21.99889  117.84405 1.000 11.97550 ? 293 THR A C   1 
ATOM   2603 O  O   . THR A 1 293 ? -7.78057 22.47584  118.52066 1.000 13.08284 ? 293 THR A O   1 
ATOM   2604 C  CB  . THR A 1 293 ? -7.77530 19.87826  116.95697 1.000 12.45873 ? 293 THR A CB  1 
ATOM   2605 O  OG1 . THR A 1 293 ? -6.73743 19.06036  117.51215 1.000 12.17045 ? 293 THR A OG1 1 
ATOM   2606 C  CG2 . THR A 1 293 ? -8.38053 19.16494  115.75570 1.000 13.35841 ? 293 THR A CG2 1 
ATOM   2607 N  N   . GLU A 1 294 ? -5.59327 22.08878  118.20629 1.000 11.73738 ? 294 GLU A N   1 
ATOM   2608 C  CA  . GLU A 1 294 ? -5.17854 22.56266  119.51907 1.000 12.20364 ? 294 GLU A CA  1 
ATOM   2609 C  C   . GLU A 1 294 ? -4.85502 24.05019  119.51886 1.000 12.55109 ? 294 GLU A C   1 
ATOM   2610 O  O   . GLU A 1 294 ? -4.34293 24.60475  118.54025 1.000 13.68832 ? 294 GLU A O   1 
ATOM   2611 C  CB  . GLU A 1 294 ? -3.94549 21.78318  119.97439 1.000 12.48108 ? 294 GLU A CB  1 
ATOM   2612 C  CG  . GLU A 1 294 ? -4.15878 20.27934  120.01729 1.000 12.62467 ? 294 GLU A CG  1 
ATOM   2613 C  CD  . GLU A 1 294 ? -5.39055 19.89302  120.82363 1.000 12.80923 ? 294 GLU A CD  1 
ATOM   2614 O  OE1 . GLU A 1 294 ? -5.34462 20.04652  122.06722 1.000 14.00343 ? 294 GLU A OE1 1 
ATOM   2615 O  OE2 . GLU A 1 294 ? -6.39172 19.44145  120.23151 1.000 13.36440 ? 294 GLU A OE2 1 
ATOM   2616 N  N   . ASP A 1 295 ? -5.13933 24.69187  120.64942 1.000 13.53952 ? 295 ASP A N   1 
ATOM   2617 C  CA  . ASP A 1 295 ? -4.63227 26.02698  120.92538 1.000 14.94781 ? 295 ASP A CA  1 
ATOM   2618 C  C   . ASP A 1 295 ? -3.25569 25.92103  121.58733 1.000 15.08370 ? 295 ASP A C   1 
ATOM   2619 O  O   . ASP A 1 295 ? -2.66868 24.84405  121.69094 1.000 14.14446 ? 295 ASP A O   1 
ATOM   2620 C  CB  . ASP A 1 295 ? -5.64844 26.84283  121.72619 1.000 16.93396 ? 295 ASP A CB  1 
ATOM   2621 C  CG  . ASP A 1 295 ? -5.91588 26.27498  123.11594 1.000 19.30535 ? 295 ASP A CG  1 
ATOM   2622 O  OD1 . ASP A 1 295 ? -5.14525 25.41960  123.59525 1.000 18.53092 ? 295 ASP A OD1 1 
ATOM   2623 O  OD2 . ASP A 1 295 ? -6.91722 26.69379  123.73114 1.000 24.01971 ? 295 ASP A OD2 1 
ATOM   2624 N  N   A PHE A 1 296 ? -2.70772 27.03393  122.06901 0.789 16.34049 ? 296 PHE A N   1 
ATOM   2625 N  N   B PHE A 1 296 ? -2.76001 27.07670  122.03685 0.211 16.30914 ? 296 PHE A N   1 
ATOM   2626 C  CA  A PHE A 1 296 ? -1.35079 26.96110  122.60193 0.789 18.22070 ? 296 PHE A CA  1 
ATOM   2627 C  CA  B PHE A 1 296 ? -1.44128 27.22008  122.64604 0.211 18.39788 ? 296 PHE A CA  1 
ATOM   2628 C  C   A PHE A 1 296 ? -1.26153 26.12861  123.87144 0.789 17.85817 ? 296 PHE A C   1 
ATOM   2629 C  C   B PHE A 1 296 ? -1.28450 26.29617  123.85561 0.211 18.07124 ? 296 PHE A C   1 
ATOM   2630 O  O   A PHE A 1 296 ? -0.23991 25.47733  124.10545 0.789 18.67473 ? 296 PHE A O   1 
ATOM   2631 O  O   B PHE A 1 296 ? -0.25220 25.63181  124.00205 0.211 18.67834 ? 296 PHE A O   1 
ATOM   2632 C  CB  A PHE A 1 296 ? -0.77120 28.35396  122.80802 0.789 22.27632 ? 296 PHE A CB  1 
ATOM   2633 C  CB  B PHE A 1 296 ? -1.29668 28.71837  122.96825 0.211 22.48891 ? 296 PHE A CB  1 
ATOM   2634 C  CG  A PHE A 1 296 ? -0.28642 28.97466  121.54720 0.789 27.94600 ? 296 PHE A CG  1 
ATOM   2635 C  CG  B PHE A 1 296 ? -0.00202 29.14920  123.61599 0.211 28.13717 ? 296 PHE A CG  1 
ATOM   2636 C  CD1 A PHE A 1 296 ? 0.70590  28.36078  120.81019 0.789 30.64095 ? 296 PHE A CD1 1 
ATOM   2637 C  CD1 B PHE A 1 296 ? 1.08440  29.54890  122.84719 0.211 30.69547 ? 296 PHE A CD1 1 
ATOM   2638 C  CD2 A PHE A 1 296 ? -0.82907 30.15103  121.07888 0.789 34.71031 ? 296 PHE A CD2 1 
ATOM   2639 C  CD2 B PHE A 1 296 ? 0.07017  29.31286  124.98937 0.211 34.73499 ? 296 PHE A CD2 1 
ATOM   2640 C  CE1 A PHE A 1 296 ? 1.15883  28.91678  119.63596 0.789 33.58153 ? 296 PHE A CE1 1 
ATOM   2641 C  CE1 B PHE A 1 296 ? 2.25068  30.00230  123.44720 0.211 33.62077 ? 296 PHE A CE1 1 
ATOM   2642 C  CE2 A PHE A 1 296 ? -0.37551 30.71102  119.90569 0.789 37.48053 ? 296 PHE A CE2 1 
ATOM   2643 C  CE2 B PHE A 1 296 ? 1.22840  29.76908  125.59188 0.211 37.48048 ? 296 PHE A CE2 1 
ATOM   2644 C  CZ  A PHE A 1 296 ? 0.61949  30.09143  119.18416 0.789 35.07805 ? 296 PHE A CZ  1 
ATOM   2645 C  CZ  B PHE A 1 296 ? 2.31795  30.11564  124.81951 0.211 35.11068 ? 296 PHE A CZ  1 
ATOM   2646 N  N   A ASP A 1 297 ? -2.30134 26.13559  124.70621 0.789 17.68608 ? 297 ASP A N   1 
ATOM   2647 N  N   B ASP A 1 297 ? -2.32180 26.19371  124.70016 0.211 18.27530 ? 297 ASP A N   1 
ATOM   2648 C  CA  A ASP A 1 297 ? -2.27436 25.25222  125.86541 0.789 18.34709 ? 297 ASP A CA  1 
ATOM   2649 C  CA  B ASP A 1 297 ? -2.27600 25.28035  125.84591 0.211 19.21721 ? 297 ASP A CA  1 
ATOM   2650 C  C   A ASP A 1 297 ? -2.14503 23.80019  125.42928 0.789 16.93605 ? 297 ASP A C   1 
ATOM   2651 C  C   B ASP A 1 297 ? -2.10836 23.83129  125.39745 0.211 17.74468 ? 297 ASP A C   1 
ATOM   2652 O  O   A ASP A 1 297 ? -1.42915 23.01338  126.05692 0.789 17.41886 ? 297 ASP A O   1 
ATOM   2653 O  O   B ASP A 1 297 ? -1.35827 23.06541  126.01263 0.211 19.03238 ? 297 ASP A O   1 
ATOM   2654 C  CB  A ASP A 1 297 ? -3.51449 25.46639  126.73072 0.789 21.60621 ? 297 ASP A CB  1 
ATOM   2655 C  CB  B ASP A 1 297 ? -3.54364 25.44069  126.69372 0.211 22.02479 ? 297 ASP A CB  1 
ATOM   2656 C  CG  A ASP A 1 297 ? -3.49515 26.80341  127.46491 0.789 28.49535 ? 297 ASP A CG  1 
ATOM   2657 C  CG  B ASP A 1 297 ? -3.46685 24.70726  128.03517 0.211 26.77105 ? 297 ASP A CG  1 
ATOM   2658 O  OD1 A ASP A 1 297 ? -2.39456 27.32847  127.73607 0.789 31.48838 ? 297 ASP A OD1 1 
ATOM   2659 O  OD1 B ASP A 1 297 ? -2.44374 24.05151  128.31336 0.211 28.01577 ? 297 ASP A OD1 1 
ATOM   2660 O  OD2 A ASP A 1 297 ? -4.58336 27.31905  127.78754 0.789 33.83865 ? 297 ASP A OD2 1 
ATOM   2661 O  OD2 B ASP A 1 297 ? -4.43863 24.79143  128.81909 0.211 31.01985 ? 297 ASP A OD2 1 
ATOM   2662 N  N   . GLY A 1 298 ? -2.80252 23.43793  124.32764 1.000 15.64423 ? 298 GLY A N   1 
ATOM   2663 C  CA  . GLY A 1 298 ? -2.67655 22.08629  123.81065 1.000 14.61415 ? 298 GLY A CA  1 
ATOM   2664 C  C   . GLY A 1 298 ? -1.31890 21.79963  123.20216 1.000 13.97319 ? 298 GLY A C   1 
ATOM   2665 O  O   . GLY A 1 298 ? -0.84824 20.66114  123.24840 1.000 15.12753 ? 298 GLY A O   1 
ATOM   2666 N  N   . VAL A 1 299 ? -0.67393 22.81730  122.62510 1.000 13.70855 ? 299 VAL A N   1 
ATOM   2667 C  CA  . VAL A 1 299 ? 0.69529  22.65436  122.13984 1.000 13.70334 ? 299 VAL A CA  1 
ATOM   2668 C  C   . VAL A 1 299 ? 1.60746  22.20567  123.27389 1.000 13.49489 ? 299 VAL A C   1 
ATOM   2669 O  O   . VAL A 1 299 ? 2.37007  21.24099  123.13836 1.000 13.67564 ? 299 VAL A O   1 
ATOM   2670 C  CB  . VAL A 1 299 ? 1.19513  23.96422  121.50128 1.000 14.63423 ? 299 VAL A CB  1 
ATOM   2671 C  CG1 . VAL A 1 299 ? 2.70669  23.93747  121.28949 1.000 16.04343 ? 299 VAL A CG1 1 
ATOM   2672 C  CG2 . VAL A 1 299 ? 0.45941  24.24351  120.19084 1.000 15.56698 ? 299 VAL A CG2 1 
ATOM   2673 N  N   . TRP A 1 300 ? 1.56014  22.91735  124.40399 1.000 13.57354 ? 300 TRP A N   1 
ATOM   2674 C  CA  . TRP A 1 300 ? 2.46938  22.58898  125.49936 1.000 14.16499 ? 300 TRP A CA  1 
ATOM   2675 C  C   . TRP A 1 300 ? 2.08346  21.27812  126.16785 1.000 14.43897 ? 300 TRP A C   1 
ATOM   2676 O  O   . TRP A 1 300 ? 2.96259  20.53867  126.62029 1.000 15.34116 ? 300 TRP A O   1 
ATOM   2677 C  CB  . TRP A 1 300 ? 2.58850  23.75642  126.49293 1.000 15.41705 ? 300 TRP A CB  1 
ATOM   2678 C  CG  . TRP A 1 300 ? 2.95483  25.02448  125.77571 1.000 16.11518 ? 300 TRP A CG  1 
ATOM   2679 C  CD1 . TRP A 1 300 ? 2.20448  26.16146  125.69985 1.000 18.27397 ? 300 TRP A CD1 1 
ATOM   2680 C  CD2 . TRP A 1 300 ? 4.11664  25.25911  124.96063 1.000 17.01730 ? 300 TRP A CD2 1 
ATOM   2681 N  NE1 . TRP A 1 300 ? 2.82749  27.08970  124.90503 1.000 19.59156 ? 300 TRP A NE1 1 
ATOM   2682 C  CE2 . TRP A 1 300 ? 3.99948  26.56107  124.43619 1.000 19.00000 ? 300 TRP A CE2 1 
ATOM   2683 C  CE3 . TRP A 1 300 ? 5.24475  24.50145  124.63181 1.000 18.51949 ? 300 TRP A CE3 1 
ATOM   2684 C  CZ2 . TRP A 1 300 ? 4.96329  27.11986  123.60545 1.000 20.96507 ? 300 TRP A CZ2 1 
ATOM   2685 C  CZ3 . TRP A 1 300 ? 6.19863  25.06145  123.80447 1.000 20.73951 ? 300 TRP A CZ3 1 
ATOM   2686 C  CH2 . TRP A 1 300 ? 6.05086  26.35332  123.30008 1.000 21.48200 ? 300 TRP A CH2 1 
ATOM   2687 N  N   . ALA A 1 301 ? 0.78843  20.94768  126.19831 1.000 14.34824 ? 301 ALA A N   1 
ATOM   2688 C  CA  . ALA A 1 301 ? 0.38227  19.64826  126.72715 1.000 14.76989 ? 301 ALA A CA  1 
ATOM   2689 C  C   . ALA A 1 301 ? 0.91915  18.51217  125.86652 1.000 13.96688 ? 301 ALA A C   1 
ATOM   2690 O  O   . ALA A 1 301 ? 1.37381  17.48460  126.38548 1.000 14.77177 ? 301 ALA A O   1 
ATOM   2691 C  CB  . ALA A 1 301 ? -1.14116 19.57609  126.82411 1.000 16.53063 ? 301 ALA A CB  1 
ATOM   2692 N  N   . SER A 1 302 ? 0.87805  18.68644  124.54683 1.000 13.42565 ? 302 SER A N   1 
ATOM   2693 C  CA  A SER A 1 302 ? 1.36865  17.66267  123.63138 0.824 13.47857 ? 302 SER A CA  1 
ATOM   2694 C  CA  B SER A 1 302 ? 1.36723  17.63694  123.66125 0.176 13.12867 ? 302 SER A CA  1 
ATOM   2695 C  C   . SER A 1 302 ? 2.87981  17.48599  123.76789 1.000 12.61104 ? 302 SER A C   1 
ATOM   2696 O  O   . SER A 1 302 ? 3.39141  16.35965  123.78487 1.000 13.25740 ? 302 SER A O   1 
ATOM   2697 C  CB  A SER A 1 302 ? 0.97870  18.07030  122.20519 0.824 14.63034 ? 302 SER A CB  1 
ATOM   2698 C  CB  B SER A 1 302 ? 0.92453  17.89858  122.22238 0.176 13.84074 ? 302 SER A CB  1 
ATOM   2699 O  OG  A SER A 1 302 ? 1.05513  16.99316  121.28921 0.824 15.18573 ? 302 SER A OG  1 
ATOM   2700 O  OG  B SER A 1 302 ? 1.49188  19.09346  121.72392 0.176 14.74273 ? 302 SER A OG  1 
ATOM   2701 N  N   . ALA A 1 303 ? 3.60722  18.59950  123.88681 1.000 12.78010 ? 303 ALA A N   1 
ATOM   2702 C  CA  . ALA A 1 303 ? 5.05211  18.53014  124.08713 1.000 13.09388 ? 303 ALA A CA  1 
ATOM   2703 C  C   . ALA A 1 303 ? 5.39718  17.83552  125.40193 1.000 12.92538 ? 303 ALA A C   1 
ATOM   2704 O  O   . ALA A 1 303 ? 6.28795  16.97782  125.44954 1.000 13.59072 ? 303 ALA A O   1 
ATOM   2705 C  CB  . ALA A 1 303 ? 5.64864  19.93624  124.06123 1.000 13.85460 ? 303 ALA A CB  1 
ATOM   2706 N  N   . ALA A 1 304 ? 4.69626  18.19434  126.48283 1.000 13.30754 ? 304 ALA A N   1 
ATOM   2707 C  CA  . ALA A 1 304 ? 4.93368  17.52869  127.75999 1.000 13.94737 ? 304 ALA A CA  1 
ATOM   2708 C  C   . ALA A 1 304 ? 4.65328  16.03723  127.65315 1.000 13.36811 ? 304 ALA A C   1 
ATOM   2709 O  O   . ALA A 1 304 ? 5.36620  15.21779  128.24621 1.000 13.65161 ? 304 ALA A O   1 
ATOM   2710 C  CB  . ALA A 1 304 ? 4.07333  18.16768  128.84834 1.000 15.53353 ? 304 ALA A CB  1 
ATOM   2711 N  N   . GLY A 1 305 ? 3.62063  15.67032  126.89219 1.000 12.71314 ? 305 GLY A N   1 
ATOM   2712 C  CA  . GLY A 1 305 ? 3.28170  14.27090  126.71911 1.000 12.83100 ? 305 GLY A CA  1 
ATOM   2713 C  C   . GLY A 1 305 ? 4.36168  13.46258  126.02726 1.000 12.05176 ? 305 GLY A C   1 
ATOM   2714 O  O   . GLY A 1 305 ? 4.56043  12.29135  126.35425 1.000 13.01759 ? 305 GLY A O   1 
ATOM   2715 N  N   . CYS A 1 306 ? 5.07141  14.06661  125.06394 1.000 12.01479 ? 306 CYS A N   1 
ATOM   2716 C  CA  . CYS A 1 306 ? 6.22229  13.38618  124.46445 1.000 12.16843 ? 306 CYS A CA  1 
ATOM   2717 C  C   . CYS A 1 306 ? 7.18484  12.87616  125.51583 1.000 11.85133 ? 306 CYS A C   1 
ATOM   2718 O  O   . CYS A 1 306 ? 7.62804  11.72062  125.47974 1.000 12.89770 ? 306 CYS A O   1 
ATOM   2719 C  CB  . CYS A 1 306 ? 6.99968  14.29258  123.50613 1.000 12.57072 ? 306 CYS A CB  1 
ATOM   2720 S  SG  . CYS A 1 306 ? 6.21908  14.77555  121.96937 1.000 13.89417 ? 306 CYS A SG  1 
ATOM   2721 N  N   . MET A 1 307 ? 7.57163  13.76338  126.42188 1.000 12.16030 ? 307 MET A N   1 
ATOM   2722 C  CA  . MET A 1 307 ? 8.57305  13.42465  127.42760 1.000 12.66055 ? 307 MET A CA  1 
ATOM   2723 C  C   . MET A 1 307 ? 8.01235  12.44955  128.45146 1.000 12.51647 ? 307 MET A C   1 
ATOM   2724 O  O   . MET A 1 307 ? 8.69660  11.49923  128.85969 1.000 13.38290 ? 307 MET A O   1 
ATOM   2725 C  CB  . MET A 1 307 ? 9.06946  14.70400  128.10433 1.000 13.52418 ? 307 MET A CB  1 
ATOM   2726 C  CG  . MET A 1 307 ? 9.79747  15.62545  127.13656 1.000 14.63248 ? 307 MET A CG  1 
ATOM   2727 S  SD  . MET A 1 307 ? 10.52885 17.08411  127.89240 1.000 15.63273 ? 307 MET A SD  1 
ATOM   2728 C  CE  . MET A 1 307 ? 9.07470  18.10594  128.06320 1.000 17.90020 ? 307 MET A CE  1 
ATOM   2729 N  N   . ARG A 1 308 ? 6.76777  12.67846  128.88049 1.000 13.04715 ? 308 ARG A N   1 
ATOM   2730 C  CA  . ARG A 1 308 ? 6.13110  11.78885  129.84515 1.000 12.94079 ? 308 ARG A CA  1 
ATOM   2731 C  C   . ARG A 1 308 ? 6.08945  10.36123  129.32377 1.000 12.18059 ? 308 ARG A C   1 
ATOM   2732 O  O   . ARG A 1 308 ? 6.40199  9.40983   130.04544 1.000 13.12270 ? 308 ARG A O   1 
ATOM   2733 C  CB  . ARG A 1 308 ? 4.72091  12.29128  130.14754 1.000 13.97156 ? 308 ARG A CB  1 
ATOM   2734 C  CG  . ARG A 1 308 ? 3.96261  11.42245  131.12767 1.000 14.88945 ? 308 ARG A CG  1 
ATOM   2735 C  CD  . ARG A 1 308 ? 2.62022  12.03665  131.45744 1.000 16.40659 ? 308 ARG A CD  1 
ATOM   2736 N  NE  . ARG A 1 308 ? 1.87513  11.23113  132.41407 1.000 17.98419 ? 308 ARG A NE  1 
ATOM   2737 C  CZ  . ARG A 1 308 ? 2.05199  11.28577  133.72821 1.000 21.04861 ? 308 ARG A CZ  1 
ATOM   2738 N  NH1 . ARG A 1 308 ? 2.95592  12.10817  134.24296 1.000 22.92846 ? 308 ARG A NH1 1 
ATOM   2739 N  NH2 . ARG A 1 308 ? 1.31690  10.51964  134.52360 1.000 24.49842 ? 308 ARG A NH2 1 
ATOM   2740 N  N   . ASN A 1 309 ? 5.69685  10.19078  128.06404 1.000 12.11360 ? 309 ASN A N   1 
ATOM   2741 C  CA  . ASN A 1 309 ? 5.56833  8.84101   127.52911 1.000 11.99057 ? 309 ASN A CA  1 
ATOM   2742 C  C   . ASN A 1 309 ? 6.91739  8.15022   127.42782 1.000 11.54457 ? 309 ASN A C   1 
ATOM   2743 O  O   . ASN A 1 309 ? 7.01908  6.95448   127.70916 1.000 12.20962 ? 309 ASN A O   1 
ATOM   2744 C  CB  . ASN A 1 309 ? 4.82771  8.85468   126.19421 1.000 12.13745 ? 309 ASN A CB  1 
ATOM   2745 C  CG  . ASN A 1 309 ? 3.38099  9.21278   126.36416 1.000 12.65670 ? 309 ASN A CG  1 
ATOM   2746 O  OD1 . ASN A 1 309 ? 2.80195  8.95766   127.41043 1.000 14.46642 ? 309 ASN A OD1 1 
ATOM   2747 N  ND2 . ASN A 1 309 ? 2.78116  9.81006   125.33688 1.000 12.76319 ? 309 ASN A ND2 1 
ATOM   2748 N  N   . TYR A 1 310 ? 7.97021  8.88383   127.05396 1.000 11.42508 ? 310 TYR A N   1 
ATOM   2749 C  CA  . TYR A 1 310 ? 9.29851  8.28093   127.06749 1.000 11.69401 ? 310 TYR A CA  1 
ATOM   2750 C  C   . TYR A 1 310 ? 9.65012  7.77557   128.46342 1.000 11.85136 ? 310 TYR A C   1 
ATOM   2751 O  O   . TYR A 1 310 ? 10.13692 6.65194   128.62487 1.000 12.40837 ? 310 TYR A O   1 
ATOM   2752 C  CB  . TYR A 1 310 ? 10.35149 9.26815   126.55181 1.000 12.47322 ? 310 TYR A CB  1 
ATOM   2753 C  CG  . TYR A 1 310 ? 11.67969 8.58958   126.26846 1.000 12.67524 ? 310 TYR A CG  1 
ATOM   2754 C  CD1 . TYR A 1 310 ? 12.54615 8.23624   127.29765 1.000 13.84774 ? 310 TYR A CD1 1 
ATOM   2755 C  CD2 . TYR A 1 310 ? 12.05308 8.27685   124.97597 1.000 13.07067 ? 310 TYR A CD2 1 
ATOM   2756 C  CE1 . TYR A 1 310 ? 13.74572 7.59331   127.03990 1.000 14.75407 ? 310 TYR A CE1 1 
ATOM   2757 C  CE2 . TYR A 1 310 ? 13.24653 7.63983   124.70664 1.000 14.13813 ? 310 TYR A CE2 1 
ATOM   2758 C  CZ  . TYR A 1 310 ? 14.08735 7.29662   125.73659 1.000 15.13484 ? 310 TYR A CZ  1 
ATOM   2759 O  OH  . TYR A 1 310 ? 15.26488 6.65788   125.44260 1.000 17.53022 ? 310 TYR A OH  1 
ATOM   2760 N  N   . LEU A 1 311 ? 9.41006  8.60086   129.48041 1.000 12.48450 ? 311 LEU A N   1 
ATOM   2761 C  CA  . LEU A 1 311 ? 9.78488  8.23232   130.84525 1.000 12.87239 ? 311 LEU A CA  1 
ATOM   2762 C  C   . LEU A 1 311 ? 8.97691  7.04943   131.37194 1.000 12.73530 ? 311 LEU A C   1 
ATOM   2763 O  O   . LEU A 1 311 ? 9.52626  6.18905   132.06947 1.000 14.07768 ? 311 LEU A O   1 
ATOM   2764 C  CB  . LEU A 1 311 ? 9.65995  9.44236   131.76696 1.000 14.36890 ? 311 LEU A CB  1 
ATOM   2765 C  CG  . LEU A 1 311 ? 10.65697 10.56211  131.47066 1.000 16.63158 ? 311 LEU A CG  1 
ATOM   2766 C  CD1 . LEU A 1 311 ? 10.37607 11.78356  132.33400 1.000 19.15300 ? 311 LEU A CD1 1 
ATOM   2767 C  CD2 . LEU A 1 311 ? 12.10384 10.09546  131.64293 1.000 18.28466 ? 311 LEU A CD2 1 
ATOM   2768 N  N   . ILE A 1 312 ? 7.67727  6.97796   131.05449 1.000 12.85409 ? 312 ILE A N   1 
ATOM   2769 C  CA  . ILE A 1 312 ? 6.89599  5.81148   131.46940 1.000 13.08094 ? 312 ILE A CA  1 
ATOM   2770 C  C   . ILE A 1 312 ? 7.44314  4.55598   130.80739 1.000 12.54225 ? 312 ILE A C   1 
ATOM   2771 O  O   . ILE A 1 312 ? 7.65731  3.52765   131.45542 1.000 13.29206 ? 312 ILE A O   1 
ATOM   2772 C  CB  . ILE A 1 312 ? 5.39733  5.99827   131.16360 1.000 14.41528 ? 312 ILE A CB  1 
ATOM   2773 C  CG1 . ILE A 1 312 ? 4.80671  7.18918   131.91764 1.000 16.08037 ? 312 ILE A CG1 1 
ATOM   2774 C  CG2 . ILE A 1 312 ? 4.63327  4.72130   131.48797 1.000 16.76512 ? 312 ILE A CG2 1 
ATOM   2775 C  CD1 . ILE A 1 312 ? 3.44014  7.61601   131.39497 1.000 18.09029 ? 312 ILE A CD1 1 
ATOM   2776 N  N   . LEU A 1 313 ? 7.66730  4.62059   129.49448 1.000 12.09296 ? 313 LEU A N   1 
ATOM   2777 C  CA  . LEU A 1 313 ? 8.14893  3.44681   128.77902 1.000 12.46759 ? 313 LEU A CA  1 
ATOM   2778 C  C   . LEU A 1 313 ? 9.52775  3.02380   129.25659 1.000 12.70939 ? 313 LEU A C   1 
ATOM   2779 O  O   . LEU A 1 313 ? 9.81667  1.82418   129.33526 1.000 13.39664 ? 313 LEU A O   1 
ATOM   2780 C  CB  . LEU A 1 313 ? 8.14195  3.71263   127.27644 1.000 12.81652 ? 313 LEU A CB  1 
ATOM   2781 C  CG  . LEU A 1 313 ? 6.74656  3.89784   126.68347 1.000 14.34366 ? 313 LEU A CG  1 
ATOM   2782 C  CD1 . LEU A 1 313 ? 6.86311  4.34867   125.24639 1.000 16.32428 ? 313 LEU A CD1 1 
ATOM   2783 C  CD2 . LEU A 1 313 ? 5.93637  2.62128   126.79524 1.000 16.70780 ? 313 LEU A CD2 1 
ATOM   2784 N  N   . LYS A 1 314 ? 10.38495 3.99063   129.59149 1.000 12.69915 ? 314 LYS A N   1 
ATOM   2785 C  CA  . LYS A 1 314 ? 11.69968 3.66019   130.13024 1.000 13.31165 ? 314 LYS A CA  1 
ATOM   2786 C  C   . LYS A 1 314 ? 11.57429 2.86216   131.42311 1.000 13.42649 ? 314 LYS A C   1 
ATOM   2787 O  O   . LYS A 1 314 ? 12.28689 1.87203   131.62720 1.000 14.44020 ? 314 LYS A O   1 
ATOM   2788 C  CB  . LYS A 1 314 ? 12.48676 4.95015   130.35390 1.000 15.04276 ? 314 LYS A CB  1 
ATOM   2789 C  CG  . LYS A 1 314 ? 13.85065 4.74659   130.98358 1.000 17.46391 ? 314 LYS A CG  1 
ATOM   2790 C  CD  . LYS A 1 314 ? 14.57414 6.07550   131.14862 1.000 20.95421 ? 314 LYS A CD  1 
ATOM   2791 C  CE  . LYS A 1 314 ? 15.92190 5.90196   131.82381 1.000 26.38500 ? 314 LYS A CE  1 
ATOM   2792 N  NZ  . LYS A 1 314 ? 16.52739 7.22313   132.13328 1.000 33.11733 ? 314 LYS A NZ  1 
ATOM   2793 N  N   . GLU A 1 315 ? 10.67040 3.28789   132.31180 1.000 13.56819 ? 315 GLU A N   1 
ATOM   2794 C  CA  . GLU A 1 315 ? 10.44080 2.56451   133.56176 1.000 14.59769 ? 315 GLU A CA  1 
ATOM   2795 C  C   . GLU A 1 315 ? 9.95715  1.14393   133.29716 1.000 14.03388 ? 315 GLU A C   1 
ATOM   2796 O  O   . GLU A 1 315 ? 10.42331 0.18838   133.92887 1.000 15.18605 ? 315 GLU A O   1 
ATOM   2797 C  CB  . GLU A 1 315 ? 9.42010  3.32638   134.40845 1.000 17.35631 ? 315 GLU A CB  1 
ATOM   2798 C  CG  . GLU A 1 315 ? 8.94142  2.59355   135.64589 1.000 21.39470 ? 315 GLU A CG  1 
ATOM   2799 C  CD  . GLU A 1 315 ? 7.68885  3.21945   136.22439 1.000 27.48402 ? 315 GLU A CD  1 
ATOM   2800 O  OE1 . GLU A 1 315 ? 6.59145  3.04005   135.65431 1.000 28.98192 ? 315 GLU A OE1 1 
ATOM   2801 O  OE2 . GLU A 1 315 ? 7.81326  3.91430   137.24102 1.000 34.35377 ? 315 GLU A OE2 1 
ATOM   2802 N  N   . ARG A 1 316 ? 9.00323  0.98721   132.37520 1.000 13.71879 ? 316 ARG A N   1 
ATOM   2803 C  CA  . ARG A 1 316 ? 8.42647  -0.33107  132.12990 1.000 13.98690 ? 316 ARG A CA  1 
ATOM   2804 C  C   . ARG A 1 316 ? 9.42352  -1.26443  131.45887 1.000 13.75836 ? 316 ARG A C   1 
ATOM   2805 O  O   . ARG A 1 316 ? 9.46177  -2.45816  131.77349 1.000 14.63904 ? 316 ARG A O   1 
ATOM   2806 C  CB  . ARG A 1 316 ? 7.15024  -0.21046  131.30059 1.000 14.77074 ? 316 ARG A CB  1 
ATOM   2807 C  CG  . ARG A 1 316 ? 6.08857  0.69681   131.90407 1.000 15.70599 ? 316 ARG A CG  1 
ATOM   2808 C  CD  . ARG A 1 316 ? 5.66585  0.21104   133.28830 1.000 17.24502 ? 316 ARG A CD  1 
ATOM   2809 N  NE  . ARG A 1 316 ? 4.89193  1.21772   134.01121 1.000 18.93044 ? 316 ARG A NE  1 
ATOM   2810 C  CZ  . ARG A 1 316 ? 3.58913  1.42258   133.85420 1.000 19.09651 ? 316 ARG A CZ  1 
ATOM   2811 N  NH1 . ARG A 1 316 ? 2.89051  0.68608   132.99985 1.000 18.76436 ? 316 ARG A NH1 1 
ATOM   2812 N  NH2 . ARG A 1 316 ? 2.97568  2.36314   134.56142 1.000 21.01829 ? 316 ARG A NH2 1 
ATOM   2813 N  N   . ALA A 1 317 ? 10.23212 -0.74194  130.52967 1.000 13.36444 ? 317 ALA A N   1 
ATOM   2814 C  CA  . ALA A 1 317 ? 11.23204 -1.57652  129.87440 1.000 14.03316 ? 317 ALA A CA  1 
ATOM   2815 C  C   . ALA A 1 317 ? 12.30533 -2.00906  130.86204 1.000 14.65465 ? 317 ALA A C   1 
ATOM   2816 O  O   . ALA A 1 317 ? 12.77523 -3.14862  130.81414 1.000 15.40355 ? 317 ALA A O   1 
ATOM   2817 C  CB  . ALA A 1 317 ? 11.84873 -0.82616  128.69618 1.000 15.32960 ? 317 ALA A CB  1 
ATOM   2818 N  N   . ALA A 1 318 ? 12.69914 -1.11257  131.76967 1.000 14.98234 ? 318 ALA A N   1 
ATOM   2819 C  CA  . ALA A 1 318 ? 13.68640 -1.47367  132.78012 1.000 16.11398 ? 318 ALA A CA  1 
ATOM   2820 C  C   . ALA A 1 318 ? 13.14291 -2.54915  133.71463 1.000 16.06503 ? 318 ALA A C   1 
ATOM   2821 O  O   . ALA A 1 318 ? 13.86115 -3.48857  134.07669 1.000 17.37350 ? 318 ALA A O   1 
ATOM   2822 C  CB  . ALA A 1 318 ? 14.09727 -0.23100  133.56598 1.000 18.18619 ? 318 ALA A CB  1 
ATOM   2823 N  N   . ALA A 1 319 ? 11.87636 -2.42155  134.12174 1.000 15.58013 ? 319 ALA A N   1 
ATOM   2824 C  CA  . ALA A 1 319 ? 11.26427 -3.42628  134.98436 1.000 15.94272 ? 319 ALA A CA  1 
ATOM   2825 C  C   . ALA A 1 319 ? 11.18573 -4.77743  134.28541 1.000 15.42877 ? 319 ALA A C   1 
ATOM   2826 O  O   . ALA A 1 319 ? 11.41473 -5.82145  134.90638 1.000 16.61919 ? 319 ALA A O   1 
ATOM   2827 C  CB  . ALA A 1 319 ? 9.87097  -2.96333  135.40195 1.000 17.22659 ? 319 ALA A CB  1 
ATOM   2828 N  N   . PHE A 1 320 ? 10.85984 -4.76935  132.98950 1.000 14.65683 ? 320 PHE A N   1 
ATOM   2829 C  CA  . PHE A 1 320 ? 10.81726 -5.99134  132.19583 1.000 14.25171 ? 320 PHE A CA  1 
ATOM   2830 C  C   . PHE A 1 320 ? 12.17275 -6.69381  132.21629 1.000 14.45721 ? 320 PHE A C   1 
ATOM   2831 O  O   . PHE A 1 320 ? 12.26426 -7.88952  132.51201 1.000 15.86040 ? 320 PHE A O   1 
ATOM   2832 C  CB  . PHE A 1 320 ? 10.37336 -5.61552  130.76946 1.000 14.46442 ? 320 PHE A CB  1 
ATOM   2833 C  CG  . PHE A 1 320 ? 10.48448 -6.72636  129.75580 1.000 14.55989 ? 320 PHE A CG  1 
ATOM   2834 C  CD1 . PHE A 1 320 ? 9.59079  -7.78208  129.75815 1.000 14.49524 ? 320 PHE A CD1 1 
ATOM   2835 C  CD2 . PHE A 1 320 ? 11.45700 -6.68812  128.77219 1.000 16.51424 ? 320 PHE A CD2 1 
ATOM   2836 C  CE1 . PHE A 1 320 ? 9.68600  -8.79545  128.82064 1.000 15.43164 ? 320 PHE A CE1 1 
ATOM   2837 C  CE2 . PHE A 1 320 ? 11.55731 -7.70255  127.82837 1.000 17.63134 ? 320 PHE A CE2 1 
ATOM   2838 C  CZ  . PHE A 1 320 ? 10.66605 -8.74954  127.84949 1.000 16.77565 ? 320 PHE A CZ  1 
ATOM   2839 N  N   . ARG A 1 321 ? 13.24344 -5.95775  131.91285 1.000 14.72062 ? 321 ARG A N   1 
ATOM   2840 C  CA  . ARG A 1 321 ? 14.55827 -6.58543  131.80712 1.000 16.19811 ? 321 ARG A CA  1 
ATOM   2841 C  C   . ARG A 1 321 ? 15.09521 -7.03727  133.16096 1.000 17.49892 ? 321 ARG A C   1 
ATOM   2842 O  O   . ARG A 1 321 ? 15.88678 -7.98377  133.22192 1.000 19.46187 ? 321 ARG A O   1 
ATOM   2843 C  CB  . ARG A 1 321 ? 15.54533 -5.63547  131.12652 1.000 16.90548 ? 321 ARG A CB  1 
ATOM   2844 C  CG  . ARG A 1 321 ? 15.21720 -5.34239  129.66705 1.000 17.72341 ? 321 ARG A CG  1 
ATOM   2845 C  CD  . ARG A 1 321 ? 15.48656 -6.54893  128.77422 1.000 18.98638 ? 321 ARG A CD  1 
ATOM   2846 N  NE  . ARG A 1 321 ? 15.08112 -6.28888  127.39264 1.000 18.18681 ? 321 ARG A NE  1 
ATOM   2847 C  CZ  . ARG A 1 321 ? 15.06138 -7.19579  126.42042 1.000 18.59334 ? 321 ARG A CZ  1 
ATOM   2848 N  NH1 . ARG A 1 321 ? 15.45152 -8.44335  126.65187 1.000 21.14277 ? 321 ARG A NH1 1 
ATOM   2849 N  NH2 . ARG A 1 321 ? 14.65360 -6.85008  125.20809 1.000 19.19270 ? 321 ARG A NH2 1 
ATOM   2850 N  N   . ALA A 1 322 ? 14.67719 -6.38156  134.24612 1.000 17.44251 ? 322 ALA A N   1 
ATOM   2851 C  CA  . ALA A 1 322 ? 15.15633 -6.70772  135.58474 1.000 18.75436 ? 322 ALA A CA  1 
ATOM   2852 C  C   . ALA A 1 322 ? 14.37443 -7.83258  136.24882 1.000 18.92505 ? 322 ALA A C   1 
ATOM   2853 O  O   . ALA A 1 322 ? 14.80757 -8.32583  137.28959 1.000 21.45179 ? 322 ALA A O   1 
ATOM   2854 C  CB  . ALA A 1 322 ? 15.09225 -5.46336  136.46835 1.000 20.79373 ? 322 ALA A CB  1 
ATOM   2855 N  N   . ASP A 1 323 ? 13.25802 -8.24999  135.69103 1.000 17.16652 ? 323 ASP A N   1 
ATOM   2856 C  CA  . ASP A 1 323 ? 12.38890 -9.22410  136.33441 1.000 16.94977 ? 323 ASP A CA  1 
ATOM   2857 C  C   . ASP A 1 323 ? 13.00564 -10.61430 136.21443 1.000 16.77898 ? 323 ASP A C   1 
ATOM   2858 O  O   . ASP A 1 323 ? 13.25471 -11.07267 135.09776 1.000 16.44859 ? 323 ASP A O   1 
ATOM   2859 C  CB  . ASP A 1 323 ? 11.04341 -9.15990  135.62050 1.000 17.21643 ? 323 ASP A CB  1 
ATOM   2860 C  CG  . ASP A 1 323 ? 9.99797  -10.08990 136.19197 1.000 18.40512 ? 323 ASP A CG  1 
ATOM   2861 O  OD1 . ASP A 1 323 ? 10.31376 -10.98405 136.99564 1.000 19.69076 ? 323 ASP A OD1 1 
ATOM   2862 O  OD2 . ASP A 1 323 ? 8.82262  -9.91136  135.81218 1.000 20.01790 ? 323 ASP A OD2 1 
ATOM   2863 N  N   . PRO A 1 324 ? 13.27468 -11.31306 137.32358 1.000 18.37855 ? 324 PRO A N   1 
ATOM   2864 C  CA  A PRO A 1 324 ? 13.86116 -12.65917 137.21127 0.663 19.09687 ? 324 PRO A CA  1 
ATOM   2865 C  CA  B PRO A 1 324 ? 13.86553 -12.65612 137.20368 0.337 18.34935 ? 324 PRO A CA  1 
ATOM   2866 C  C   . PRO A 1 324 ? 13.02266 -13.61942 136.38497 1.000 17.91000 ? 324 PRO A C   1 
ATOM   2867 O  O   . PRO A 1 324 ? 13.57912 -14.51270 135.73678 1.000 18.17246 ? 324 PRO A O   1 
ATOM   2868 C  CB  A PRO A 1 324 ? 13.97321 -13.11545 138.67380 0.663 21.27624 ? 324 PRO A CB  1 
ATOM   2869 C  CB  B PRO A 1 324 ? 14.01720 -13.11757 138.66158 0.337 19.22637 ? 324 PRO A CB  1 
ATOM   2870 C  CG  A PRO A 1 324 ? 14.08849 -11.84377 139.44649 0.663 21.83414 ? 324 PRO A CG  1 
ATOM   2871 C  CG  B PRO A 1 324 ? 13.06664 -12.27178 139.43585 0.337 19.24152 ? 324 PRO A CG  1 
ATOM   2872 C  CD  A PRO A 1 324 ? 13.18140 -10.87396 138.72790 0.663 19.93487 ? 324 PRO A CD  1 
ATOM   2873 C  CD  B PRO A 1 324 ? 13.00892 -10.94826 138.72638 0.337 19.18345 ? 324 PRO A CD  1 
ATOM   2874 N  N   A GLU A 1 325 ? 11.69329 -13.47603 136.40547 0.652 17.06036 ? 325 GLU A N   1 
ATOM   2875 N  N   B GLU A 1 325 ? 11.69716 -13.47570 136.38866 0.348 17.81658 ? 325 GLU A N   1 
ATOM   2876 C  CA  A GLU A 1 325 ? 10.84932 -14.34268 135.58736 0.652 17.58994 ? 325 GLU A CA  1 
ATOM   2877 C  CA  B GLU A 1 325 ? 10.87906 -14.37108 135.57825 0.348 17.99891 ? 325 GLU A CA  1 
ATOM   2878 C  C   A GLU A 1 325 ? 11.07311 -14.09203 134.10076 0.652 16.11378 ? 325 GLU A C   1 
ATOM   2879 C  C   B GLU A 1 325 ? 11.04480 -14.09002 134.08956 0.348 16.21100 ? 325 GLU A C   1 
ATOM   2880 O  O   A GLU A 1 325 ? 11.04501 -15.03071 133.29458 0.652 16.72401 ? 325 GLU A O   1 
ATOM   2881 O  O   B GLU A 1 325 ? 10.96385 -15.01490 133.27289 0.348 16.74129 ? 325 GLU A O   1 
ATOM   2882 C  CB  A GLU A 1 325 ? 9.37762  -14.15284 135.94602 0.652 20.14429 ? 325 GLU A CB  1 
ATOM   2883 C  CB  B GLU A 1 325 ? 9.41955  -14.29685 136.01913 0.348 20.73319 ? 325 GLU A CB  1 
ATOM   2884 C  CG  A GLU A 1 325 ? 8.47962  -15.19328 135.29653 0.652 23.98727 ? 325 GLU A CG  1 
ATOM   2885 C  CG  B GLU A 1 325 ? 9.22619  -14.78497 137.44457 0.348 24.91826 ? 325 GLU A CG  1 
ATOM   2886 C  CD  A GLU A 1 325 ? 7.07027  -15.21823 135.85415 0.652 32.10872 ? 325 GLU A CD  1 
ATOM   2887 C  CD  B GLU A 1 325 ? 7.77644  -14.81197 137.88307 0.348 31.20520 ? 325 GLU A CD  1 
ATOM   2888 O  OE1 A GLU A 1 325 ? 6.81294  -14.53697 136.86683 0.652 36.71359 ? 325 GLU A OE1 1 
ATOM   2889 O  OE1 B GLU A 1 325 ? 6.93154  -14.19419 137.20269 0.348 34.41999 ? 325 GLU A OE1 1 
ATOM   2890 O  OE2 A GLU A 1 325 ? 6.21903  -15.92845 135.27736 0.652 37.31427 ? 325 GLU A OE2 1 
ATOM   2891 O  OE2 B GLU A 1 325 ? 7.48408  -15.45462 138.91333 0.348 35.53968 ? 325 GLU A OE2 1 
ATOM   2892 N  N   . VAL A 1 326 ? 11.28993 -12.83108 133.71945 1.000 15.23825 ? 326 VAL A N   1 
ATOM   2893 C  CA  . VAL A 1 326 ? 11.61201 -12.51801 132.33095 1.000 14.56045 ? 326 VAL A CA  1 
ATOM   2894 C  C   . VAL A 1 326 ? 12.98099 -13.07049 131.96879 1.000 14.43685 ? 326 VAL A C   1 
ATOM   2895 O  O   . VAL A 1 326 ? 13.16742 -13.62719 130.88546 1.000 14.78275 ? 326 VAL A O   1 
ATOM   2896 C  CB  . VAL A 1 326 ? 11.51677 -11.00298 132.07987 1.000 14.93883 ? 326 VAL A CB  1 
ATOM   2897 C  CG1 . VAL A 1 326 ? 12.08695 -10.65065 130.70259 1.000 15.48735 ? 326 VAL A CG1 1 
ATOM   2898 C  CG2 . VAL A 1 326 ? 10.07895 -10.54552 132.18858 1.000 15.57778 ? 326 VAL A CG2 1 
ATOM   2899 N  N   . GLN A 1 327 ? 13.95951 -12.94282 132.86980 1.000 14.85595 ? 327 GLN A N   1 
ATOM   2900 C  CA  . GLN A 1 327 ? 15.28676 -13.47502 132.57078 1.000 15.75679 ? 327 GLN A CA  1 
ATOM   2901 C  C   . GLN A 1 327 ? 15.23011 -14.98141 132.33986 1.000 15.71919 ? 327 GLN A C   1 
ATOM   2902 O  O   . GLN A 1 327 ? 15.90488 -15.50667 131.44629 1.000 16.65253 ? 327 GLN A O   1 
ATOM   2903 C  CB  . GLN A 1 327 ? 16.27504 -13.07849 133.66531 1.000 17.74059 ? 327 GLN A CB  1 
ATOM   2904 C  CG  . GLN A 1 327 ? 16.47186 -11.57039 133.72039 1.000 20.79787 ? 327 GLN A CG  1 
ATOM   2905 C  CD  . GLN A 1 327 ? 17.23011 -11.10371 134.94079 1.000 26.46829 ? 327 GLN A CD  1 
ATOM   2906 O  OE1 . GLN A 1 327 ? 17.67782 -11.91010 135.75460 1.000 30.97823 ? 327 GLN A OE1 1 
ATOM   2907 N  NE2 . GLN A 1 327 ? 17.36420 -9.78779  135.08531 1.000 28.27767 ? 327 GLN A NE2 1 
ATOM   2908 N  N   A GLU A 1 328 ? 14.40324 -15.68621 133.10921 0.199 15.10724 ? 328 GLU A N   1 
ATOM   2909 N  N   B GLU A 1 328 ? 14.42781 -15.69414 133.13877 0.533 15.89153 ? 328 GLU A N   1 
ATOM   2910 N  N   C GLU A 1 328 ? 14.42090 -15.68610 133.13372 0.268 16.61857 ? 328 GLU A N   1 
ATOM   2911 C  CA  A GLU A 1 328 ? 14.25027 -17.12275 132.91173 0.199 14.64666 ? 328 GLU A CA  1 
ATOM   2912 C  CA  B GLU A 1 328 ? 14.23408 -17.12461 132.91128 0.533 17.07137 ? 328 GLU A CA  1 
ATOM   2913 C  CA  C GLU A 1 328 ? 14.21754 -17.11630 132.92776 0.268 18.37578 ? 328 GLU A CA  1 
ATOM   2914 C  C   A GLU A 1 328 ? 13.50724 -17.43966 131.61599 0.199 14.97696 ? 328 GLU A C   1 
ATOM   2915 C  C   B GLU A 1 328 ? 13.57739 -17.38228 131.56220 0.533 15.24404 ? 328 GLU A C   1 
ATOM   2916 C  C   C GLU A 1 328 ? 13.56232 -17.39010 131.57961 0.268 16.45776 ? 328 GLU A C   1 
ATOM   2917 O  O   A GLU A 1 328 ? 13.79930 -18.45130 130.96713 0.199 16.30307 ? 328 GLU A O   1 
ATOM   2918 O  O   B GLU A 1 328 ? 13.96826 -18.30836 130.84018 0.533 15.18446 ? 328 GLU A O   1 
ATOM   2919 O  O   C GLU A 1 328 ? 13.95045 -18.32508 130.86766 0.268 17.41358 ? 328 GLU A O   1 
ATOM   2920 C  CB  A GLU A 1 328 ? 13.55270 -17.71541 134.13561 0.199 14.41783 ? 328 GLU A CB  1 
ATOM   2921 C  CB  B GLU A 1 328 ? 13.37408 -17.73682 134.02249 0.533 21.39587 ? 328 GLU A CB  1 
ATOM   2922 C  CB  C GLU A 1 328 ? 13.34278 -17.66295 134.05549 0.268 22.73499 ? 328 GLU A CB  1 
ATOM   2923 C  CG  A GLU A 1 328 ? 13.04390 -19.13156 133.99620 0.199 15.45869 ? 328 GLU A CG  1 
ATOM   2924 C  CG  B GLU A 1 328 ? 13.95168 -17.68441 135.42735 0.533 28.67603 ? 328 GLU A CG  1 
ATOM   2925 C  CG  C GLU A 1 328 ? 14.06017 -18.56903 135.03340 0.268 28.63971 ? 328 GLU A CG  1 
ATOM   2926 C  CD  A GLU A 1 328 ? 12.18516 -19.53171 135.17979 0.199 19.05467 ? 328 GLU A CD  1 
ATOM   2927 C  CD  B GLU A 1 328 ? 12.90860 -17.98942 136.49176 0.533 38.52660 ? 328 GLU A CD  1 
ATOM   2928 C  CD  C GLU A 1 328 ? 13.74414 -20.02945 134.79850 0.268 35.53155 ? 328 GLU A CD  1 
ATOM   2929 O  OE1 A GLU A 1 328 ? 12.75165 -20.00555 136.18651 0.199 21.48028 ? 328 GLU A OE1 1 
ATOM   2930 O  OE1 B GLU A 1 328 ? 11.92915 -18.70474 136.18415 0.533 42.18927 ? 328 GLU A OE1 1 
ATOM   2931 O  OE1 C GLU A 1 328 ? 12.66748 -20.48529 135.23993 0.268 37.92937 ? 328 GLU A OE1 1 
ATOM   2932 O  OE2 A GLU A 1 328 ? 10.95035 -19.35172 135.11459 0.199 21.30770 ? 328 GLU A OE2 1 
ATOM   2933 O  OE2 B GLU A 1 328 ? 13.06593 -17.51331 137.63642 0.533 45.89785 ? 328 GLU A OE2 1 
ATOM   2934 O  OE2 C GLU A 1 328 ? 14.57218 -20.72102 134.17031 0.268 39.11909 ? 328 GLU A OE2 1 
ATOM   2935 N  N   . ALA A 1 329 ? 12.55922 -16.58489 131.21854 1.000 14.76472 ? 329 ALA A N   1 
ATOM   2936 C  CA  . ALA A 1 329 ? 11.85325 -16.77881 129.95174 1.000 14.12309 ? 329 ALA A CA  1 
ATOM   2937 C  C   . ALA A 1 329 ? 12.77050 -16.52428 128.75980 1.000 13.66328 ? 329 ALA A C   1 
ATOM   2938 O  O   . ALA A 1 329 ? 12.66674 -17.20447 127.73409 1.000 14.41126 ? 329 ALA A O   1 
ATOM   2939 C  CB  . ALA A 1 329 ? 10.62745 -15.86285 129.89131 1.000 15.25676 ? 329 ALA A CB  1 
ATOM   2940 N  N   . LEU A 1 330 ? 13.67966 -15.55103 128.87947 1.000 13.64931 ? 330 LEU A N   1 
ATOM   2941 C  CA  . LEU A 1 330 ? 14.64537 -15.29864 127.81622 1.000 13.83489 ? 330 LEU A CA  1 
ATOM   2942 C  C   . LEU A 1 330 ? 15.54099 -16.51278 127.59381 1.000 14.02866 ? 330 LEU A C   1 
ATOM   2943 O  O   . LEU A 1 330 ? 15.85022 -16.86607 126.45475 1.000 14.95191 ? 330 LEU A O   1 
ATOM   2944 C  CB  . LEU A 1 330 ? 15.47085 -14.05003 128.13074 1.000 14.46898 ? 330 LEU A CB  1 
ATOM   2945 C  CG  . LEU A 1 330 ? 14.69804 -12.72911 128.04883 1.000 15.78853 ? 330 LEU A CG  1 
ATOM   2946 C  CD1 . LEU A 1 330 ? 15.45522 -11.61663 128.74793 1.000 17.87198 ? 330 LEU A CD1 1 
ATOM   2947 C  CD2 . LEU A 1 330 ? 14.41534 -12.35253 126.59961 1.000 16.47981 ? 330 LEU A CD2 1 
ATOM   2948 N  N   A ARG A 1 331 ? 15.96202 -17.17292 128.67522 0.515 14.35595 ? 331 ARG A N   1 
ATOM   2949 N  N   B ARG A 1 331 ? 15.96674 -17.16755 128.67737 0.485 14.49744 ? 331 ARG A N   1 
ATOM   2950 C  CA  A ARG A 1 331 ? 16.73924 -18.40211 128.53108 0.515 14.72779 ? 331 ARG A CA  1 
ATOM   2951 C  CA  B ARG A 1 331 ? 16.74333 -18.39762 128.54013 0.485 15.16082 ? 331 ARG A CA  1 
ATOM   2952 C  C   A ARG A 1 331 ? 15.89074 -19.52767 127.95342 0.515 14.75570 ? 331 ARG A C   1 
ATOM   2953 C  C   B ARG A 1 331 ? 15.89577 -19.52600 127.96101 0.485 14.89103 ? 331 ARG A C   1 
ATOM   2954 O  O   A ARG A 1 331 ? 16.37222 -20.31949 127.13471 0.515 15.60755 ? 331 ARG A O   1 
ATOM   2955 O  O   B ARG A 1 331 ? 16.38226 -20.31811 127.14609 0.485 15.64878 ? 331 ARG A O   1 
ATOM   2956 C  CB  A ARG A 1 331 ? 17.34518 -18.80888 129.87520 0.515 15.84405 ? 331 ARG A CB  1 
ATOM   2957 C  CB  B ARG A 1 331 ? 17.34735 -18.80169 129.88765 0.485 17.11289 ? 331 ARG A CB  1 
ATOM   2958 C  CG  A ARG A 1 331 ? 18.40574 -17.84300 130.37306 0.515 17.19635 ? 331 ARG A CG  1 
ATOM   2959 C  CG  B ARG A 1 331 ? 18.43932 -17.86495 130.39765 0.485 20.02945 ? 331 ARG A CG  1 
ATOM   2960 C  CD  A ARG A 1 331 ? 19.01102 -18.26872 131.70288 0.515 18.93611 ? 331 ARG A CD  1 
ATOM   2961 C  CD  B ARG A 1 331 ? 19.14463 -18.44070 131.62924 0.485 23.80645 ? 331 ARG A CD  1 
ATOM   2962 N  NE  A ARG A 1 331 ? 20.00107 -17.29229 132.15048 0.515 19.62519 ? 331 ARG A NE  1 
ATOM   2963 N  NE  B ARG A 1 331 ? 18.21439 -18.75751 132.71245 0.485 27.01746 ? 331 ARG A NE  1 
ATOM   2964 C  CZ  A ARG A 1 331 ? 19.79063 -16.39171 133.10286 0.515 21.58583 ? 331 ARG A CZ  1 
ATOM   2965 C  CZ  B ARG A 1 331 ? 17.91642 -17.93351 133.71384 0.485 28.56267 ? 331 ARG A CZ  1 
ATOM   2966 N  NH1 A ARG A 1 331 ? 18.63167 -16.35555 133.74374 0.515 22.47156 ? 331 ARG A NH1 1 
ATOM   2967 N  NH1 B ARG A 1 331 ? 18.47856 -16.73507 133.78205 0.485 31.81461 ? 331 ARG A NH1 1 
ATOM   2968 N  NH2 A ARG A 1 331 ? 20.74901 -15.53519 133.42547 0.515 24.29535 ? 331 ARG A NH2 1 
ATOM   2969 N  NH2 B ARG A 1 331 ? 17.05370 -18.30874 134.64973 0.485 28.26396 ? 331 ARG A NH2 1 
ATOM   2970 N  N   . ALA A 1 332 ? 14.62219 -19.60997 128.35992 1.000 14.62942 ? 332 ALA A N   1 
ATOM   2971 C  CA  . ALA A 1 332 ? 13.74698 -20.64478 127.81691 1.000 14.92408 ? 332 ALA A CA  1 
ATOM   2972 C  C   . ALA A 1 332 ? 13.57772 -20.49912 126.31108 1.000 14.32203 ? 332 ALA A C   1 
ATOM   2973 O  O   . ALA A 1 332 ? 13.40031 -21.49954 125.61049 1.000 15.60566 ? 332 ALA A O   1 
ATOM   2974 C  CB  . ALA A 1 332 ? 12.38230 -20.59984 128.50503 1.000 16.27058 ? 332 ALA A CB  1 
ATOM   2975 N  N   . SER A 1 333 ? 13.63426 -19.26864 125.80353 1.000 13.40599 ? 333 SER A N   1 
ATOM   2976 C  CA  . SER A 1 333 ? 13.51301 -18.97134 124.38073 1.000 12.93907 ? 333 SER A CA  1 
ATOM   2977 C  C   . SER A 1 333 ? 14.86081 -18.92480 123.66883 1.000 13.16516 ? 333 SER A C   1 
ATOM   2978 O  O   . SER A 1 333 ? 14.90742 -18.62089 122.47389 1.000 13.63456 ? 333 SER A O   1 
ATOM   2979 C  CB  . SER A 1 333 ? 12.76962 -17.64517 124.18817 1.000 13.38102 ? 333 SER A CB  1 
ATOM   2980 O  OG  . SER A 1 333 ? 11.42567 -17.72217 124.62546 1.000 13.83702 ? 333 SER A OG  1 
ATOM   2981 N  N   . ARG A 1 334 ? 15.94805 -19.20498 124.38716 1.000 13.31711 ? 334 ARG A N   1 
ATOM   2982 C  CA  . ARG A 1 334 ? 17.29413 -19.33090 123.82894 1.000 13.24344 ? 334 ARG A CA  1 
ATOM   2983 C  C   . ARG A 1 334 ? 17.85766 -18.01198 123.29940 1.000 12.80252 ? 334 ARG A C   1 
ATOM   2984 O  O   . ARG A 1 334 ? 18.70960 -18.00372 122.40550 1.000 13.71283 ? 334 ARG A O   1 
ATOM   2985 C  CB  . ARG A 1 334 ? 17.43669 -20.49337 122.83497 1.000 14.50207 ? 334 ARG A CB  1 
ATOM   2986 C  CG  . ARG A 1 334 ? 17.47569 -21.84712 123.53993 1.000 15.46839 ? 334 ARG A CG  1 
ATOM   2987 C  CD  . ARG A 1 334 ? 16.09901 -22.44452 123.73509 1.000 15.95644 ? 334 ARG A CD  1 
ATOM   2988 N  NE  . ARG A 1 334 ? 15.59216 -23.04328 122.50933 1.000 15.31656 ? 334 ARG A NE  1 
ATOM   2989 C  CZ  . ARG A 1 334 ? 14.31029 -23.28817 122.25189 1.000 15.15510 ? 334 ARG A CZ  1 
ATOM   2990 N  NH1 . ARG A 1 334 ? 13.35428 -22.93831 123.11214 1.000 15.87171 ? 334 ARG A NH1 1 
ATOM   2991 N  NH2 . ARG A 1 334 ? 13.98431 -23.87875 121.11265 1.000 16.00597 ? 334 ARG A NH2 1 
ATOM   2992 N  N   . LEU A 1 335 ? 17.46673 -16.88970 123.91058 1.000 13.24583 ? 335 LEU A N   1 
ATOM   2993 C  CA  . LEU A 1 335 ? 18.12702 -15.63292 123.56869 1.000 13.16627 ? 335 LEU A CA  1 
ATOM   2994 C  C   . LEU A 1 335 ? 19.60009 -15.66899 123.94317 1.000 13.14101 ? 335 LEU A C   1 
ATOM   2995 O  O   . LEU A 1 335 ? 20.42233 -15.01392 123.29763 1.000 14.56514 ? 335 LEU A O   1 
ATOM   2996 C  CB  . LEU A 1 335 ? 17.44291 -14.43166 124.22383 1.000 13.76007 ? 335 LEU A CB  1 
ATOM   2997 C  CG  . LEU A 1 335 ? 16.23229 -13.84566 123.48096 1.000 14.44508 ? 335 LEU A CG  1 
ATOM   2998 C  CD1 . LEU A 1 335 ? 16.63652 -13.32419 122.09216 1.000 15.83955 ? 335 LEU A CD1 1 
ATOM   2999 C  CD2 . LEU A 1 335 ? 15.07327 -14.82682 123.37418 1.000 14.73961 ? 335 LEU A CD2 1 
ATOM   3000 N  N   . ASP A 1 336 ? 19.95148 -16.42489 124.98894 1.000 13.65857 ? 336 ASP A N   1 
ATOM   3001 C  CA  . ASP A 1 336 ? 21.35974 -16.59118 125.34694 1.000 14.45689 ? 336 ASP A CA  1 
ATOM   3002 C  C   . ASP A 1 336 ? 22.13529 -17.29124 124.23494 1.000 14.39093 ? 336 ASP A C   1 
ATOM   3003 O  O   . ASP A 1 336 ? 23.28078 -16.92533 123.93725 1.000 16.08721 ? 336 ASP A O   1 
ATOM   3004 C  CB  . ASP A 1 336 ? 21.49469 -17.35093 126.67779 1.000 16.72684 ? 336 ASP A CB  1 
ATOM   3005 C  CG  . ASP A 1 336 ? 20.82724 -18.73630 126.65832 1.000 19.75261 ? 336 ASP A CG  1 
ATOM   3006 O  OD1 . ASP A 1 336 ? 19.71019 -18.87722 126.11905 1.000 20.91631 ? 336 ASP A OD1 1 
ATOM   3007 O  OD2 . ASP A 1 336 ? 21.43179 -19.69732 127.17275 1.000 23.82667 ? 336 ASP A OD2 1 
ATOM   3008 N  N   A GLU A 1 337 ? 21.51161 -18.27534 123.59479 0.490 14.11130 ? 337 GLU A N   1 
ATOM   3009 N  N   B GLU A 1 337 ? 21.53151 -18.30948 123.60531 0.510 13.60992 ? 337 GLU A N   1 
ATOM   3010 C  CA  A GLU A 1 337 ? 22.18282 -19.02868 122.54893 0.490 15.09316 ? 337 GLU A CA  1 
ATOM   3011 C  CA  B GLU A 1 337 ? 22.22143 -19.02000 122.52711 0.510 13.87043 ? 337 GLU A CA  1 
ATOM   3012 C  C   A GLU A 1 337 ? 22.31790 -18.21469 121.26767 0.490 13.77801 ? 337 GLU A C   1 
ATOM   3013 C  C   B GLU A 1 337 ? 22.35868 -18.16601 121.27994 0.510 13.34122 ? 337 GLU A C   1 
ATOM   3014 O  O   A GLU A 1 337 ? 23.26736 -18.42518 120.50722 0.490 14.80419 ? 337 GLU A O   1 
ATOM   3015 O  O   B GLU A 1 337 ? 23.32395 -18.33461 120.52809 0.510 14.48878 ? 337 GLU A O   1 
ATOM   3016 C  CB  A GLU A 1 337 ? 21.41962 -20.32680 122.31088 0.490 17.26079 ? 337 GLU A CB  1 
ATOM   3017 C  CB  B GLU A 1 337 ? 21.51423 -20.32314 122.14662 0.510 14.31314 ? 337 GLU A CB  1 
ATOM   3018 C  CG  A GLU A 1 337 ? 22.25881 -21.46378 121.81303 0.490 18.63645 ? 337 GLU A CG  1 
ATOM   3019 C  CG  B GLU A 1 337 ? 21.52265 -21.38654 123.20101 0.510 14.25089 ? 337 GLU A CG  1 
ATOM   3020 C  CD  A GLU A 1 337 ? 21.60675 -22.79847 122.10084 0.490 21.58366 ? 337 GLU A CD  1 
ATOM   3021 C  CD  B GLU A 1 337 ? 21.28599 -22.79153 122.65814 0.510 15.85852 ? 337 GLU A CD  1 
ATOM   3022 O  OE1 A GLU A 1 337 ? 21.14545 -23.00824 123.24388 0.490 25.37617 ? 337 GLU A OE1 1 
ATOM   3023 O  OE1 B GLU A 1 337 ? 21.41043 -23.02588 121.43505 0.510 15.48160 ? 337 GLU A OE1 1 
ATOM   3024 O  OE2 A GLU A 1 337 ? 21.52498 -23.62656 121.17752 0.490 22.71270 ? 337 GLU A OE2 1 
ATOM   3025 O  OE2 B GLU A 1 337 ? 20.99034 -23.68145 123.48044 0.510 19.25166 ? 337 GLU A OE2 1 
ATOM   3026 N  N   . LEU A 1 338 ? 21.39827 -17.27141 121.02825 1.000 13.04875 ? 338 LEU A N   1 
ATOM   3027 C  CA  . LEU A 1 338 ? 21.50678 -16.38378 119.87431 1.000 13.08419 ? 338 LEU A CA  1 
ATOM   3028 C  C   . LEU A 1 338 ? 22.76636 -15.53182 119.95207 1.000 13.60951 ? 338 LEU A C   1 
ATOM   3029 O  O   . LEU A 1 338 ? 23.36747 -15.20383 118.92131 1.000 15.11643 ? 338 LEU A O   1 
ATOM   3030 C  CB  . LEU A 1 338 ? 20.26792 -15.49119 119.80564 1.000 13.42595 ? 338 LEU A CB  1 
ATOM   3031 C  CG  . LEU A 1 338 ? 20.20782 -14.50720 118.64388 1.000 13.85734 ? 338 LEU A CG  1 
ATOM   3032 C  CD1 . LEU A 1 338 ? 20.05379 -15.23816 117.31170 1.000 14.72660 ? 338 LEU A CD1 1 
ATOM   3033 C  CD2 . LEU A 1 338 ? 19.07131 -13.52481 118.85573 1.000 15.01684 ? 338 LEU A CD2 1 
ATOM   3034 N  N   . ALA A 1 339 ? 23.19448 -15.19202 121.17115 1.000 13.75569 ? 339 ALA A N   1 
ATOM   3035 C  CA  . ALA A 1 339 ? 24.35147 -14.33779 121.39520 1.000 14.94466 ? 339 ALA A CA  1 
ATOM   3036 C  C   . ALA A 1 339 ? 25.67324 -15.09386 121.33414 1.000 16.07916 ? 339 ALA A C   1 
ATOM   3037 O  O   . ALA A 1 339 ? 26.73217 -14.46208 121.40062 1.000 19.38164 ? 339 ALA A O   1 
ATOM   3038 C  CB  . ALA A 1 339 ? 24.21620 -13.62937 122.74316 1.000 16.38150 ? 339 ALA A CB  1 
ATOM   3039 N  N   . ARG A 1 340 ? 25.63864 -16.41760 121.22231 1.000 14.94335 ? 340 ARG A N   1 
ATOM   3040 C  CA  A ARG A 1 340 ? 26.87194 -17.18166 121.15168 0.514 15.72853 ? 340 ARG A CA  1 
ATOM   3041 C  CA  B ARG A 1 340 ? 26.85326 -17.22366 121.14519 0.486 14.97805 ? 340 ARG A CA  1 
ATOM   3042 C  C   . ARG A 1 340 ? 27.22538 -17.46208 119.68870 1.000 15.68050 ? 340 ARG A C   1 
ATOM   3043 O  O   . ARG A 1 340 ? 26.33923 -17.65857 118.85660 1.000 15.62416 ? 340 ARG A O   1 
ATOM   3044 C  CB  A ARG A 1 340 ? 26.72610 -18.49461 121.92849 0.514 18.14162 ? 340 ARG A CB  1 
ATOM   3045 C  CB  B ARG A 1 340 ? 26.61808 -18.57774 121.78917 0.486 14.97296 ? 340 ARG A CB  1 
ATOM   3046 C  CG  A ARG A 1 340 ? 26.14419 -18.30020 123.35012 0.514 21.45918 ? 340 ARG A CG  1 
ATOM   3047 C  CG  B ARG A 1 340 ? 26.59157 -18.53438 123.29488 0.486 15.80734 ? 340 ARG A CG  1 
ATOM   3048 C  CD  A ARG A 1 340 ? 26.56143 -19.37742 124.35936 0.514 25.79713 ? 340 ARG A CD  1 
ATOM   3049 C  CD  B ARG A 1 340 ? 26.38999 -19.92429 123.85314 0.486 19.48643 ? 340 ARG A CD  1 
ATOM   3050 N  NE  A ARG A 1 340 ? 25.83676 -20.63826 124.22925 0.514 27.25673 ? 340 ARG A NE  1 
ATOM   3051 N  NE  B ARG A 1 340 ? 27.41775 -20.83589 123.36520 0.486 22.88771 ? 340 ARG A NE  1 
ATOM   3052 C  CZ  A ARG A 1 340 ? 24.80197 -20.98871 124.98759 0.514 24.94985 ? 340 ARG A CZ  1 
ATOM   3053 C  CZ  B ARG A 1 340 ? 27.25525 -22.14859 123.24013 0.486 28.38408 ? 340 ARG A CZ  1 
ATOM   3054 N  NH1 A ARG A 1 340 ? 24.34916 -20.16717 125.92535 0.514 22.51226 ? 340 ARG A NH1 1 
ATOM   3055 N  NH1 B ARG A 1 340 ? 26.10340 -22.70977 123.57486 0.486 33.45405 ? 340 ARG A NH1 1 
ATOM   3056 N  NH2 A ARG A 1 340 ? 24.21389 -22.16047 124.80176 0.514 26.21538 ? 340 ARG A NH2 1 
ATOM   3057 N  NH2 B ARG A 1 340 ? 28.24424 -22.89973 122.77873 0.486 30.97217 ? 340 ARG A NH2 1 
ATOM   3058 N  N   . PRO A 1 341 ? 28.51179 -17.46581 119.34350 1.000 16.67925 ? 341 PRO A N   1 
ATOM   3059 C  CA  . PRO A 1 341 ? 28.89024 -17.72270 117.94924 1.000 16.99860 ? 341 PRO A CA  1 
ATOM   3060 C  C   . PRO A 1 341 ? 28.38581 -19.07209 117.45712 1.000 16.33063 ? 341 PRO A C   1 
ATOM   3061 O  O   . PRO A 1 341 ? 28.35727 -20.06228 118.19129 1.000 17.27772 ? 341 PRO A O   1 
ATOM   3062 C  CB  . PRO A 1 341 ? 30.42207 -17.66744 117.97477 1.000 19.87139 ? 341 PRO A CB  1 
ATOM   3063 C  CG  . PRO A 1 341 ? 30.76483 -16.90566 119.20044 1.000 23.19819 ? 341 PRO A CG  1 
ATOM   3064 C  CD  . PRO A 1 341 ? 29.66940 -17.13670 120.19146 1.000 20.03160 ? 341 PRO A CD  1 
ATOM   3065 N  N   . THR A 1 342 ? 27.98297 -19.09093 116.18862 1.000 15.90962 ? 342 THR A N   1 
ATOM   3066 C  CA  . THR A 1 342 ? 27.58261 -20.33415 115.54360 1.000 15.82885 ? 342 THR A CA  1 
ATOM   3067 C  C   . THR A 1 342 ? 28.74491 -21.30761 115.42470 1.000 16.70318 ? 342 THR A C   1 
ATOM   3068 O  O   . THR A 1 342 ? 28.57286 -22.51283 115.63481 1.000 17.57581 ? 342 THR A O   1 
ATOM   3069 C  CB  . THR A 1 342 ? 27.02373 -20.00841 114.16369 1.000 15.64779 ? 342 THR A CB  1 
ATOM   3070 O  OG1 . THR A 1 342 ? 25.87039 -19.18653 114.34497 1.000 15.05851 ? 342 THR A OG1 1 
ATOM   3071 C  CG2 . THR A 1 342 ? 26.65235 -21.27581 113.41254 1.000 16.85691 ? 342 THR A CG2 1 
ATOM   3072 N  N   . ALA A 1 343 ? 29.92191 -20.81187 115.05819 1.000 17.09176 ? 343 ALA A N   1 
ATOM   3073 C  CA  . ALA A 1 343 ? 31.03392 -21.68218 114.70224 1.000 18.86620 ? 343 ALA A CA  1 
ATOM   3074 C  C   . ALA A 1 343 ? 32.36336 -20.99825 115.01403 1.000 20.81228 ? 343 ALA A C   1 
ATOM   3075 O  O   . ALA A 1 343 ? 33.19917 -20.75915 114.14285 1.000 22.16127 ? 343 ALA A O   1 
ATOM   3076 C  CB  . ALA A 1 343 ? 30.93360 -22.11398 113.24030 1.000 20.49109 ? 343 ALA A CB  1 
ATOM   3077 N  N   . ALA A 1 344 ? 32.57112 -20.67098 116.29168 1.000 22.16491 ? 344 ALA A N   1 
ATOM   3078 C  CA  . ALA A 1 344 ? 33.88038 -20.19745 116.72181 1.000 24.53690 ? 344 ALA A CA  1 
ATOM   3079 C  C   . ALA A 1 344 ? 34.95009 -21.26452 116.53971 1.000 25.13883 ? 344 ALA A C   1 
ATOM   3080 O  O   . ALA A 1 344 ? 36.13985 -20.93594 116.50607 1.000 27.62940 ? 344 ALA A O   1 
ATOM   3081 C  CB  . ALA A 1 344 ? 33.83441 -19.72987 118.17796 1.000 26.80125 ? 344 ALA A CB  1 
ATOM   3082 N  N   . ASP A 1 345 ? 34.54997 -22.53190 116.40889 1.000 24.56801 ? 345 ASP A N   1 
ATOM   3083 C  CA  . ASP A 1 345 ? 35.50272 -23.59288 116.11991 1.000 25.35348 ? 345 ASP A CA  1 
ATOM   3084 C  C   . ASP A 1 345 ? 36.05931 -23.50502 114.70329 1.000 25.69933 ? 345 ASP A C   1 
ATOM   3085 O  O   . ASP A 1 345 ? 37.10227 -24.10674 114.42283 1.000 27.76116 ? 345 ASP A O   1 
ATOM   3086 C  CB  . ASP A 1 345 ? 34.90269 -24.97122 116.43697 1.000 25.85395 ? 345 ASP A CB  1 
ATOM   3087 C  CG  . ASP A 1 345 ? 33.52122 -25.19425 115.81527 1.000 26.76729 ? 345 ASP A CG  1 
ATOM   3088 O  OD1 . ASP A 1 345 ? 32.82162 -24.22087 115.44170 1.000 25.86043 ? 345 ASP A OD1 1 
ATOM   3089 O  OD2 . ASP A 1 345 ? 33.12324 -26.37769 115.71763 1.000 29.42170 ? 345 ASP A OD2 1 
ATOM   3090 N  N   . GLY A 1 346 ? 35.40497 -22.76173 113.81707 1.000 24.75032 ? 346 GLY A N   1 
ATOM   3091 C  CA  . GLY A 1 346 ? 35.92082 -22.50550 112.48938 1.000 24.21231 ? 346 GLY A CA  1 
ATOM   3092 C  C   . GLY A 1 346 ? 35.29424 -23.40268 111.43679 1.000 23.19641 ? 346 GLY A C   1 
ATOM   3093 O  O   . GLY A 1 346 ? 34.61386 -24.39062 111.72580 1.000 23.80923 ? 346 GLY A O   1 
ATOM   3094 N  N   . LEU A 1 347 ? 35.56866 -23.04348 110.18020 1.000 22.78241 ? 347 LEU A N   1 
ATOM   3095 C  CA  . LEU A 1 347 ? 34.93523 -23.70731 109.04483 1.000 22.56064 ? 347 LEU A CA  1 
ATOM   3096 C  C   . LEU A 1 347 ? 35.27519 -25.19198 108.98944 1.000 22.98883 ? 347 LEU A C   1 
ATOM   3097 O  O   . LEU A 1 347 ? 34.38949 -26.03372 108.81148 1.000 22.94511 ? 347 LEU A O   1 
ATOM   3098 C  CB  . LEU A 1 347 ? 35.34593 -23.01290 107.74703 1.000 23.06447 ? 347 LEU A CB  1 
ATOM   3099 C  CG  . LEU A 1 347 ? 34.84702 -23.64101 106.44270 1.000 25.39768 ? 347 LEU A CG  1 
ATOM   3100 C  CD1 . LEU A 1 347 ? 33.32120 -23.64909 106.38169 1.000 26.65822 ? 347 LEU A CD1 1 
ATOM   3101 C  CD2 . LEU A 1 347 ? 35.43408 -22.90048 105.25064 1.000 27.28936 ? 347 LEU A CD2 1 
ATOM   3102 N  N   . GLN A 1 348 ? 36.55625 -25.53946 109.12266 1.000 24.38228 ? 348 GLN A N   1 
ATOM   3103 C  CA  . GLN A 1 348 ? 36.92488 -26.94326 108.97946 1.000 25.83132 ? 348 GLN A CA  1 
ATOM   3104 C  C   . GLN A 1 348 ? 36.30190 -27.79396 110.07967 1.000 24.77586 ? 348 GLN A C   1 
ATOM   3105 O  O   . GLN A 1 348 ? 35.82331 -28.90474 109.81974 1.000 25.57100 ? 348 GLN A O   1 
ATOM   3106 C  CB  . GLN A 1 348 ? 38.44199 -27.10456 108.94034 1.000 29.84665 ? 348 GLN A CB  1 
ATOM   3107 C  CG  . GLN A 1 348 ? 38.87910 -28.50388 108.53782 1.000 34.79522 ? 348 GLN A CG  1 
ATOM   3108 C  CD  . GLN A 1 348 ? 38.36857 -28.89235 107.15905 1.000 40.45439 ? 348 GLN A CD  1 
ATOM   3109 O  OE1 . GLN A 1 348 ? 38.63964 -28.20928 106.17095 1.000 45.39704 ? 348 GLN A OE1 1 
ATOM   3110 N  NE2 . GLN A 1 348 ? 37.61149 -29.98483 107.09013 1.000 41.56297 ? 348 GLN A NE2 1 
ATOM   3111 N  N   . ALA A 1 349 ? 36.28645 -27.28556 111.31412 1.000 24.00558 ? 349 ALA A N   1 
ATOM   3112 C  CA  . ALA A 1 349 ? 35.66267 -28.03051 112.40348 1.000 24.64850 ? 349 ALA A CA  1 
ATOM   3113 C  C   . ALA A 1 349 ? 34.17677 -28.23102 112.14244 1.000 23.19005 ? 349 ALA A C   1 
ATOM   3114 O  O   . ALA A 1 349 ? 33.62715 -29.30540 112.41067 1.000 24.33093 ? 349 ALA A O   1 
ATOM   3115 C  CB  . ALA A 1 349 ? 35.88226 -27.30748 113.73167 1.000 26.73358 ? 349 ALA A CB  1 
ATOM   3116 N  N   . LEU A 1 350 ? 33.51310 -27.20770 111.60546 1.000 21.39155 ? 350 LEU A N   1 
ATOM   3117 C  CA  . LEU A 1 350 ? 32.09938 -27.33036 111.27139 1.000 20.41923 ? 350 LEU A CA  1 
ATOM   3118 C  C   . LEU A 1 350 ? 31.87930 -28.40010 110.20827 1.000 20.53478 ? 350 LEU A C   1 
ATOM   3119 O  O   . LEU A 1 350 ? 30.95080 -29.21212 110.30912 1.000 21.39179 ? 350 LEU A O   1 
ATOM   3120 C  CB  . LEU A 1 350 ? 31.57971 -25.97704 110.79128 1.000 20.58795 ? 350 LEU A CB  1 
ATOM   3121 C  CG  . LEU A 1 350 ? 30.15284 -25.93842 110.25395 1.000 21.84609 ? 350 LEU A CG  1 
ATOM   3122 C  CD1 . LEU A 1 350 ? 29.16020 -26.26589 111.35807 1.000 23.38447 ? 350 LEU A CD1 1 
ATOM   3123 C  CD2 . LEU A 1 350 ? 29.86615 -24.56683 109.65635 1.000 23.96187 ? 350 LEU A CD2 1 
ATOM   3124 N  N   . LEU A 1 351 ? 32.72317 -28.40468 109.17032 1.000 21.31528 ? 351 LEU A N   1 
ATOM   3125 C  CA  . LEU A 1 351 ? 32.59478 -29.39149 108.10193 1.000 22.71342 ? 351 LEU A CA  1 
ATOM   3126 C  C   . LEU A 1 351 ? 32.80741 -30.80889 108.61791 1.000 24.36336 ? 351 LEU A C   1 
ATOM   3127 O  O   . LEU A 1 351 ? 32.20322 -31.75634 108.10000 1.000 26.51584 ? 351 LEU A O   1 
ATOM   3128 C  CB  . LEU A 1 351 ? 33.60947 -29.08979 106.99664 1.000 24.10762 ? 351 LEU A CB  1 
ATOM   3129 C  CG  . LEU A 1 351 ? 33.38640 -27.81295 106.18477 1.000 27.35531 ? 351 LEU A CG  1 
ATOM   3130 C  CD1 . LEU A 1 351 ? 34.57376 -27.56017 105.26692 1.000 29.03724 ? 351 LEU A CD1 1 
ATOM   3131 C  CD2 . LEU A 1 351 ? 32.09932 -27.90781 105.38284 1.000 30.42335 ? 351 LEU A CD2 1 
ATOM   3132 N  N   . ASP A 1 352 ? 33.66530 -30.97571 109.62557 1.000 24.90442 ? 352 ASP A N   1 
ATOM   3133 C  CA  . ASP A 1 352 ? 33.99305 -32.28720 110.16851 1.000 27.13816 ? 352 ASP A CA  1 
ATOM   3134 C  C   . ASP A 1 352 ? 33.05310 -32.71807 111.28629 1.000 27.46174 ? 352 ASP A C   1 
ATOM   3135 O  O   . ASP A 1 352 ? 33.18695 -33.83675 111.79125 1.000 30.49462 ? 352 ASP A O   1 
ATOM   3136 C  CB  . ASP A 1 352 ? 35.42968 -32.28866 110.70868 1.000 31.00861 ? 352 ASP A CB  1 
ATOM   3137 C  CG  . ASP A 1 352 ? 36.46987 -32.21101 109.61086 1.000 39.07438 ? 352 ASP A CG  1 
ATOM   3138 O  OD1 . ASP A 1 352 ? 36.15098 -32.56635 108.45627 1.000 41.92064 ? 352 ASP A OD1 1 
ATOM   3139 O  OD2 . ASP A 1 352 ? 37.60807 -31.78570 109.90712 1.000 45.25398 ? 352 ASP A OD2 1 
ATOM   3140 N  N   . ASP A 1 353 ? 32.11443 -31.86673 111.68500 1.000 25.20183 ? 353 ASP A N   1 
ATOM   3141 C  CA  . ASP A 1 353 ? 31.25541 -32.12428 112.83910 1.000 24.05799 ? 353 ASP A CA  1 
ATOM   3142 C  C   . ASP A 1 353 ? 30.02478 -32.89293 112.37185 1.000 24.04983 ? 353 ASP A C   1 
ATOM   3143 O  O   . ASP A 1 353 ? 29.08846 -32.31358 111.81627 1.000 23.63792 ? 353 ASP A O   1 
ATOM   3144 C  CB  . ASP A 1 353 ? 30.88041 -30.80287 113.50005 1.000 24.51959 ? 353 ASP A CB  1 
ATOM   3145 C  CG  . ASP A 1 353 ? 30.04696 -30.98041 114.75464 1.000 25.33841 ? 353 ASP A CG  1 
ATOM   3146 O  OD1 . ASP A 1 353 ? 29.82597 -32.13305 115.18102 1.000 26.06815 ? 353 ASP A OD1 1 
ATOM   3147 O  OD2 . ASP A 1 353 ? 29.60696 -29.95289 115.31236 1.000 26.64028 ? 353 ASP A OD2 1 
ATOM   3148 N  N   . ARG A 1 354 ? 30.01360 -34.20623 112.61707 1.000 25.92877 ? 354 ARG A N   1 
ATOM   3149 C  CA  . ARG A 1 354 ? 28.86800 -35.01676 112.21664 1.000 28.31335 ? 354 ARG A CA  1 
ATOM   3150 C  C   . ARG A 1 354 ? 27.59420 -34.63799 112.96384 1.000 27.02102 ? 354 ARG A C   1 
ATOM   3151 O  O   . ARG A 1 354 ? 26.49817 -34.84586 112.43464 1.000 27.63264 ? 354 ARG A O   1 
ATOM   3152 C  CB  . ARG A 1 354 ? 29.17935 -36.50790 112.37142 1.000 33.36179 ? 354 ARG A CB  1 
ATOM   3153 C  CG  . ARG A 1 354 ? 30.23854 -37.01141 111.39965 1.000 38.16233 ? 354 ARG A CG  1 
ATOM   3154 C  CD  . ARG A 1 354 ? 30.52303 -38.49669 111.58708 1.000 44.08975 ? 354 ARG A CD  1 
ATOM   3155 N  NE  . ARG A 1 354 ? 29.34804 -39.32799 111.33721 1.000 48.40130 ? 354 ARG A NE  1 
ATOM   3156 C  CZ  . ARG A 1 354 ? 28.94471 -39.70239 110.12724 1.000 51.23113 ? 354 ARG A CZ  1 
ATOM   3157 N  NH1 . ARG A 1 354 ? 29.62135 -39.31646 109.05364 1.000 54.19165 ? 354 ARG A NH1 1 
ATOM   3158 N  NH2 . ARG A 1 354 ? 27.86538 -40.46095 109.98843 1.000 53.97315 ? 354 ARG A NH2 1 
ATOM   3159 N  N   . SER A 1 355 ? 27.70958 -34.07791 114.17072 1.000 26.57589 ? 355 SER A N   1 
ATOM   3160 C  CA  . SER A 1 355 ? 26.52950 -33.63404 114.90499 1.000 27.15336 ? 355 SER A CA  1 
ATOM   3161 C  C   . SER A 1 355 ? 25.84222 -32.44235 114.25434 1.000 25.28759 ? 355 SER A C   1 
ATOM   3162 O  O   . SER A 1 355 ? 24.70078 -32.13409 114.61539 1.000 26.59520 ? 355 SER A O   1 
ATOM   3163 C  CB  . SER A 1 355 ? 26.89539 -33.30082 116.35457 1.000 29.88977 ? 355 SER A CB  1 
ATOM   3164 O  OG  . SER A 1 355 ? 27.41755 -31.98728 116.46949 1.000 30.21945 ? 355 SER A OG  1 
ATOM   3165 N  N   . ALA A 1 356 ? 26.50216 -31.76940 113.31333 1.000 23.11056 ? 356 ALA A N   1 
ATOM   3166 C  CA  . ALA A 1 356 ? 25.90933 -30.63823 112.61886 1.000 22.37211 ? 356 ALA A CA  1 
ATOM   3167 C  C   . ALA A 1 356 ? 25.15411 -31.03529 111.35974 1.000 22.34369 ? 356 ALA A C   1 
ATOM   3168 O  O   . ALA A 1 356 ? 24.48072 -30.18570 110.77487 1.000 24.45796 ? 356 ALA A O   1 
ATOM   3169 C  CB  . ALA A 1 356 ? 26.97753 -29.59544 112.26719 1.000 22.82173 ? 356 ALA A CB  1 
ATOM   3170 N  N   . PHE A 1 357 ? 25.24361 -32.28824 110.91864 1.000 21.79819 ? 357 PHE A N   1 
ATOM   3171 C  CA  . PHE A 1 357 ? 24.52709 -32.66793 109.70651 1.000 22.31044 ? 357 PHE A CA  1 
ATOM   3172 C  C   . PHE A 1 357 ? 24.20413 -34.15452 109.65527 1.000 24.15169 ? 357 PHE A C   1 
ATOM   3173 O  O   . PHE A 1 357 ? 23.03701 -34.54451 109.75419 1.000 25.65727 ? 357 PHE A O   1 
ATOM   3174 C  CB  . PHE A 1 357 ? 25.30665 -32.25287 108.45627 1.000 23.32471 ? 357 PHE A CB  1 
ATOM   3175 C  CG  . PHE A 1 357 ? 24.50453 -32.34552 107.19241 1.000 25.46511 ? 357 PHE A CG  1 
ATOM   3176 C  CD1 . PHE A 1 357 ? 23.54045 -31.39505 106.89539 1.000 25.78445 ? 357 PHE A CD1 1 
ATOM   3177 C  CD2 . PHE A 1 357 ? 24.70192 -33.39487 106.31080 1.000 30.29168 ? 357 PHE A CD2 1 
ATOM   3178 C  CE1 . PHE A 1 357 ? 22.79861 -31.48069 105.73357 1.000 29.14410 ? 357 PHE A CE1 1 
ATOM   3179 C  CE2 . PHE A 1 357 ? 23.96153 -33.48827 105.14848 1.000 34.43570 ? 357 PHE A CE2 1 
ATOM   3180 C  CZ  . PHE A 1 357 ? 23.00925 -32.52919 104.85932 1.000 34.23571 ? 357 PHE A CZ  1 
ATOM   3181 N  N   . GLU A 1 358 ? 25.23676 -34.98609 109.49408 1.000 25.58448 ? 358 GLU A N   1 
ATOM   3182 C  CA  . GLU A 1 358 ? 25.02563 -36.41515 109.28048 1.000 28.48763 ? 358 GLU A CA  1 
ATOM   3183 C  C   . GLU A 1 358 ? 24.25385 -37.05116 110.43093 1.000 29.21287 ? 358 GLU A C   1 
ATOM   3184 O  O   . GLU A 1 358 ? 23.42858 -37.94576 110.21279 1.000 33.05661 ? 358 GLU A O   1 
ATOM   3185 C  CB  . GLU A 1 358 ? 26.36819 -37.11989 109.06684 1.000 32.74455 ? 358 GLU A CB  1 
ATOM   3186 C  CG  . GLU A 1 358 ? 27.09759 -36.74318 107.77632 1.000 35.25398 ? 358 GLU A CG  1 
ATOM   3187 C  CD  . GLU A 1 358 ? 28.00022 -35.52501 107.91853 1.000 36.27988 ? 358 GLU A CD  1 
ATOM   3188 O  OE1 . GLU A 1 358 ? 27.81697 -34.73489 108.86825 1.000 32.55690 ? 358 GLU A OE1 1 
ATOM   3189 O  OE2 . GLU A 1 358 ? 28.90392 -35.35773 107.07182 1.000 43.52524 ? 358 GLU A OE2 1 
ATOM   3190 N  N   . GLU A 1 359 ? 24.49779 -36.59800 111.66157 1.000 28.07326 ? 359 GLU A N   1 
ATOM   3191 C  CA  . GLU A 1 359 ? 23.88170 -37.18897 112.84449 1.000 29.40018 ? 359 GLU A CA  1 
ATOM   3192 C  C   . GLU A 1 359 ? 22.99209 -36.19916 113.58903 1.000 29.34351 ? 359 GLU A C   1 
ATOM   3193 O  O   . GLU A 1 359 ? 22.65332 -36.42280 114.75490 1.000 32.63243 ? 359 GLU A O   1 
ATOM   3194 C  CB  . GLU A 1 359 ? 24.95283 -37.77679 113.76323 1.000 33.01628 ? 359 GLU A CB  1 
ATOM   3195 C  CG  . GLU A 1 359 ? 25.71395 -38.93540 113.12438 1.000 38.86926 ? 359 GLU A CG  1 
ATOM   3196 C  CD  . GLU A 1 359 ? 26.87746 -39.42229 113.96658 1.000 46.66538 ? 359 GLU A CD  1 
ATOM   3197 O  OE1 . GLU A 1 359 ? 26.90460 -39.13052 115.18031 1.000 51.19662 ? 359 GLU A OE1 1 
ATOM   3198 O  OE2 . GLU A 1 359 ? 27.76998 -40.09403 113.40905 1.000 50.31573 ? 359 GLU A OE2 1 
ATOM   3199 N  N   . PHE A 1 360 ? 22.60732 -35.10733 112.93699 1.000 25.98660 ? 360 PHE A N   1 
ATOM   3200 C  CA  . PHE A 1 360 ? 21.72648 -34.12540 113.55021 1.000 25.09955 ? 360 PHE A CA  1 
ATOM   3201 C  C   . PHE A 1 360 ? 20.29029 -34.62909 113.50200 1.000 26.50543 ? 360 PHE A C   1 
ATOM   3202 O  O   . PHE A 1 360 ? 19.78755 -35.00099 112.43692 1.000 27.69610 ? 360 PHE A O   1 
ATOM   3203 C  CB  . PHE A 1 360 ? 21.83686 -32.79509 112.80842 1.000 24.32709 ? 360 PHE A CB  1 
ATOM   3204 C  CG  . PHE A 1 360 ? 21.00278 -31.70141 113.40540 1.000 24.69104 ? 360 PHE A CG  1 
ATOM   3205 C  CD1 . PHE A 1 360 ? 21.17078 -31.32916 114.72817 1.000 27.47011 ? 360 PHE A CD1 1 
ATOM   3206 C  CD2 . PHE A 1 360 ? 20.05136 -31.04439 112.64577 1.000 24.65201 ? 360 PHE A CD2 1 
ATOM   3207 C  CE1 . PHE A 1 360 ? 20.40236 -30.32284 115.28335 1.000 28.18176 ? 360 PHE A CE1 1 
ATOM   3208 C  CE2 . PHE A 1 360 ? 19.27921 -30.03618 113.19716 1.000 25.80623 ? 360 PHE A CE2 1 
ATOM   3209 C  CZ  . PHE A 1 360 ? 19.45843 -29.67445 114.51595 1.000 26.80472 ? 360 PHE A CZ  1 
ATOM   3210 N  N   . ASP A 1 361 ? 19.63103 -34.64093 114.65845 1.000 27.55526 ? 361 ASP A N   1 
ATOM   3211 C  CA  . ASP A 1 361 ? 18.25213 -35.11641 114.76747 1.000 29.31409 ? 361 ASP A CA  1 
ATOM   3212 C  C   . ASP A 1 361 ? 17.34142 -33.93447 114.46043 1.000 25.96369 ? 361 ASP A C   1 
ATOM   3213 O  O   . ASP A 1 361 ? 16.97129 -33.16134 115.34533 1.000 25.53656 ? 361 ASP A O   1 
ATOM   3214 C  CB  . ASP A 1 361 ? 18.00613 -35.69903 116.15452 1.000 34.36266 ? 361 ASP A CB  1 
ATOM   3215 C  CG  . ASP A 1 361 ? 16.66357 -36.39655 116.27220 1.000 39.81341 ? 361 ASP A CG  1 
ATOM   3216 O  OD1 . ASP A 1 361 ? 15.76869 -36.14058 115.43808 1.000 39.49935 ? 361 ASP A OD1 1 
ATOM   3217 O  OD2 . ASP A 1 361 ? 16.50883 -37.21755 117.20021 1.000 46.83979 ? 361 ASP A OD2 1 
ATOM   3218 N  N   . VAL A 1 362 ? 16.96708 -33.80555 113.18284 1.000 24.57192 ? 362 VAL A N   1 
ATOM   3219 C  CA  A VAL A 1 362 ? 16.16026 -32.67613 112.72613 0.404 25.11027 ? 362 VAL A CA  1 
ATOM   3220 C  CA  B VAL A 1 362 ? 16.17875 -32.64273 112.78033 0.596 24.36198 ? 362 VAL A CA  1 
ATOM   3221 C  C   . VAL A 1 362 ? 14.79942 -32.66730 113.41463 1.000 24.08791 ? 362 VAL A C   1 
ATOM   3222 O  O   . VAL A 1 362 ? 14.25797 -31.60918 113.75344 1.000 24.27225 ? 362 VAL A O   1 
ATOM   3223 C  CB  A VAL A 1 362 ? 16.02623 -32.74403 111.19335 0.404 28.55576 ? 362 VAL A CB  1 
ATOM   3224 C  CB  B VAL A 1 362 ? 16.09825 -32.44872 111.25074 0.596 27.76924 ? 362 VAL A CB  1 
ATOM   3225 C  CG1 A VAL A 1 362 ? 15.56111 -31.42453 110.62814 0.404 29.36385 ? 362 VAL A CG1 1 
ATOM   3226 C  CG1 B VAL A 1 362 ? 17.46415 -32.13957 110.66187 0.596 28.74797 ? 362 VAL A CG1 1 
ATOM   3227 C  CG2 A VAL A 1 362 ? 17.35042 -33.16422 110.57247 0.404 29.40842 ? 362 VAL A CG2 1 
ATOM   3228 C  CG2 B VAL A 1 362 ? 15.45112 -33.64696 110.57673 0.596 29.65507 ? 362 VAL A CG2 1 
ATOM   3229 N  N   . ASP A 1 363 ? 14.21388 -33.85116 113.60719 1.000 24.30087 ? 363 ASP A N   1 
ATOM   3230 C  CA  . ASP A 1 363 ? 12.86289 -33.91893 114.15542 1.000 25.05086 ? 363 ASP A CA  1 
ATOM   3231 C  C   . ASP A 1 363 ? 12.83166 -33.52828 115.62825 1.000 23.73330 ? 363 ASP A C   1 
ATOM   3232 O  O   . ASP A 1 363 ? 11.89790 -32.85033 116.07439 1.000 24.14074 ? 363 ASP A O   1 
ATOM   3233 C  CB  . ASP A 1 363 ? 12.26058 -35.30283 113.92287 1.000 29.47872 ? 363 ASP A CB  1 
ATOM   3234 C  CG  . ASP A 1 363 ? 12.00274 -35.58236 112.45639 1.000 37.14857 ? 363 ASP A CG  1 
ATOM   3235 O  OD1 . ASP A 1 363 ? 11.70086 -34.62553 111.71159 1.000 38.34862 ? 363 ASP A OD1 1 
ATOM   3236 O  OD2 . ASP A 1 363 ? 12.10250 -36.75440 112.04660 1.000 43.93336 ? 363 ASP A OD2 1 
ATOM   3237 N  N   . ALA A 1 364 ? 13.84426 -33.93693 116.39770 1.000 24.52548 ? 364 ALA A N   1 
ATOM   3238 C  CA  . ALA A 1 364 ? 13.90683 -33.53168 117.79923 1.000 25.55611 ? 364 ALA A CA  1 
ATOM   3239 C  C   . ALA A 1 364 ? 14.08272 -32.02306 117.92518 1.000 23.53350 ? 364 ALA A C   1 
ATOM   3240 O  O   . ALA A 1 364 ? 13.43726 -31.38004 118.76109 1.000 25.08545 ? 364 ALA A O   1 
ATOM   3241 C  CB  . ALA A 1 364 ? 15.03259 -34.27608 118.51712 1.000 29.81426 ? 364 ALA A CB  1 
ATOM   3242 N  N   . ALA A 1 365 ? 14.94240 -31.43766 117.09062 1.000 21.93817 ? 365 ALA A N   1 
ATOM   3243 C  CA  . ALA A 1 365 ? 15.11783 -29.99059 117.11318 1.000 21.23049 ? 365 ALA A CA  1 
ATOM   3244 C  C   . ALA A 1 365 ? 13.83901 -29.27752 116.69543 1.000 20.38747 ? 365 ALA A C   1 
ATOM   3245 O  O   . ALA A 1 365 ? 13.45259 -28.27300 117.30448 1.000 21.76919 ? 365 ALA A O   1 
ATOM   3246 C  CB  . ALA A 1 365 ? 16.28596 -29.59173 116.21542 1.000 22.26197 ? 365 ALA A CB  1 
ATOM   3247 N  N   . ALA A 1 366 ? 13.15156 -29.79986 115.67779 1.000 19.48185 ? 366 ALA A N   1 
ATOM   3248 C  CA  . ALA A 1 366 ? 11.93636 -29.14996 115.20113 1.000 19.72582 ? 366 ALA A CA  1 
ATOM   3249 C  C   . ALA A 1 366 ? 10.83663 -29.16033 116.25351 1.000 19.79371 ? 366 ALA A C   1 
ATOM   3250 O  O   . ALA A 1 366 ? 9.99091  -28.25885 116.27760 1.000 20.98222 ? 366 ALA A O   1 
ATOM   3251 C  CB  . ALA A 1 366 ? 11.44561 -29.82164 113.92258 1.000 20.92676 ? 366 ALA A CB  1 
ATOM   3252 N  N   . ALA A 1 367 ? 10.82503 -30.16942 117.12537 1.000 20.34150 ? 367 ALA A N   1 
ATOM   3253 C  CA  . ALA A 1 367 ? 9.75771  -30.29325 118.10893 1.000 21.28250 ? 367 ALA A CA  1 
ATOM   3254 C  C   . ALA A 1 367 ? 9.89223  -29.30960 119.26715 1.000 20.40964 ? 367 ALA A C   1 
ATOM   3255 O  O   . ALA A 1 367 ? 8.92167  -29.12394 120.00854 1.000 22.42988 ? 367 ALA A O   1 
ATOM   3256 C  CB  . ALA A 1 367 ? 9.70407  -31.72545 118.64024 1.000 23.52569 ? 367 ALA A CB  1 
ATOM   3257 N  N   . ARG A 1 368 ? 11.05686 -28.68488 119.44635 1.000 19.03802 ? 368 ARG A N   1 
ATOM   3258 C  CA  A ARG A 1 368 ? 11.26435 -27.75678 120.55602 0.740 19.63747 ? 368 ARG A CA  1 
ATOM   3259 C  CA  B ARG A 1 368 ? 11.25920 -27.76512 120.55839 0.260 19.64893 ? 368 ARG A CA  1 
ATOM   3260 C  C   . ARG A 1 368 ? 10.45041 -26.49522 120.32730 1.000 18.91987 ? 368 ARG A C   1 
ATOM   3261 O  O   . ARG A 1 368 ? 10.65934 -25.79973 119.34012 1.000 22.03064 ? 368 ARG A O   1 
ATOM   3262 C  CB  A ARG A 1 368 ? 12.72921 -27.33573 120.60771 0.740 22.43621 ? 368 ARG A CB  1 
ATOM   3263 C  CB  B ARG A 1 368 ? 12.73735 -27.39215 120.65424 0.260 22.42721 ? 368 ARG A CB  1 
ATOM   3264 C  CG  A ARG A 1 368 ? 13.75093 -28.39364 120.87302 0.740 24.45593 ? 368 ARG A CG  1 
ATOM   3265 C  CG  B ARG A 1 368 ? 13.70283 -28.52756 120.93427 0.260 26.01842 ? 368 ARG A CG  1 
ATOM   3266 C  CD  A ARG A 1 368 ? 15.11800 -27.72491 120.86216 0.740 27.88266 ? 368 ARG A CD  1 
ATOM   3267 C  CD  B ARG A 1 368 ? 15.11892 -27.97256 121.05565 0.260 29.42798 ? 368 ARG A CD  1 
ATOM   3268 N  NE  A ARG A 1 368 ? 16.20925 -28.67006 120.68097 0.740 29.34748 ? 368 ARG A NE  1 
ATOM   3269 N  NE  B ARG A 1 368 ? 15.35118 -27.36225 122.36303 0.260 33.95447 ? 368 ARG A NE  1 
ATOM   3270 C  CZ  A ARG A 1 368 ? 17.27223 -28.44578 119.91586 0.740 28.30707 ? 368 ARG A CZ  1 
ATOM   3271 C  CZ  B ARG A 1 368 ? 16.46864 -26.72951 122.70404 0.260 35.44424 ? 368 ARG A CZ  1 
ATOM   3272 N  NH1 A ARG A 1 368 ? 17.39063 -27.30419 119.24762 0.740 27.03320 ? 368 ARG A NH1 1 
ATOM   3273 N  NH1 B ARG A 1 368 ? 17.45448 -26.61358 121.82712 0.260 36.15756 ? 368 ARG A NH1 1 
ATOM   3274 N  NH2 A ARG A 1 368 ? 18.21814 -29.36831 119.81796 0.740 31.10544 ? 368 ARG A NH2 1 
ATOM   3275 N  NH2 B ARG A 1 368 ? 16.59825 -26.20557 123.91563 0.260 34.84897 ? 368 ARG A NH2 1 
ATOM   3276 N  N   . GLY A 1 369 ? 9.55498  -26.16408 121.24695 1.000 16.36282 ? 369 GLY A N   1 
ATOM   3277 C  CA  . GLY A 1 369 ? 8.87225  -24.88807 121.15493 1.000 15.46013 ? 369 GLY A CA  1 
ATOM   3278 C  C   . GLY A 1 369 ? 9.81093  -23.74242 121.48359 1.000 14.43466 ? 369 GLY A C   1 
ATOM   3279 O  O   . GLY A 1 369 ? 10.76401 -23.88748 122.25076 1.000 15.67102 ? 369 GLY A O   1 
ATOM   3280 N  N   . MET A 1 370 ? 9.54471  -22.57981 120.89519 1.000 13.00810 ? 370 MET A N   1 
ATOM   3281 C  CA  . MET A 1 370 ? 10.37635 -21.41318 121.16779 1.000 12.70926 ? 370 MET A CA  1 
ATOM   3282 C  C   . MET A 1 370 ? 9.94743  -20.63938 122.40483 1.000 12.66599 ? 370 MET A C   1 
ATOM   3283 O  O   . MET A 1 370 ? 10.72241 -19.80372 122.88326 1.000 13.34598 ? 370 MET A O   1 
ATOM   3284 C  CB  . MET A 1 370 ? 10.37774 -20.45869 119.97381 1.000 13.11046 ? 370 MET A CB  1 
ATOM   3285 C  CG  . MET A 1 370 ? 10.90770 -21.06688 118.68126 1.000 14.50387 ? 370 MET A CG  1 
ATOM   3286 S  SD  . MET A 1 370 ? 12.48065 -21.94333 118.82797 1.000 16.26483 ? 370 MET A SD  1 
ATOM   3287 C  CE  . MET A 1 370 ? 13.54969 -20.66571 119.48018 1.000 18.40933 ? 370 MET A CE  1 
ATOM   3288 N  N   . ALA A 1 371 ? 8.72918  -20.87058 122.90472 1.000 12.50168 ? 371 ALA A N   1 
ATOM   3289 C  CA  . ALA A 1 371 ? 8.20051  -20.19831 124.09936 1.000 13.10833 ? 371 ALA A CA  1 
ATOM   3290 C  C   . ALA A 1 371 ? 8.10159  -18.68227 123.91561 1.000 12.35994 ? 371 ALA A C   1 
ATOM   3291 O  O   . ALA A 1 371 ? 8.17026  -17.91695 124.87611 1.000 12.93521 ? 371 ALA A O   1 
ATOM   3292 C  CB  . ALA A 1 371 ? 8.97451  -20.57714 125.36884 1.000 14.76548 ? 371 ALA A CB  1 
ATOM   3293 N  N   . PHE A 1 372 ? 7.91937  -18.22882 122.67405 1.000 11.61196 ? 372 PHE A N   1 
ATOM   3294 C  CA  . PHE A 1 372 ? 7.87892  -16.79374 122.41978 1.000 11.21675 ? 372 PHE A CA  1 
ATOM   3295 C  C   . PHE A 1 372 ? 6.58518  -16.14145 122.88905 1.000 11.10936 ? 372 PHE A C   1 
ATOM   3296 O  O   . PHE A 1 372 ? 6.59109  -14.95194 123.22456 1.000 12.00958 ? 372 PHE A O   1 
ATOM   3297 C  CB  . PHE A 1 372 ? 8.05055  -16.50262 120.92960 1.000 11.61469 ? 372 PHE A CB  1 
ATOM   3298 C  CG  . PHE A 1 372 ? 9.42537  -16.80601 120.35618 1.000 11.49715 ? 372 PHE A CG  1 
ATOM   3299 C  CD1 . PHE A 1 372 ? 10.58665 -16.69103 121.10848 1.000 12.48763 ? 372 PHE A CD1 1 
ATOM   3300 C  CD2 . PHE A 1 372 ? 9.54800  -17.13614 119.02519 1.000 11.79294 ? 372 PHE A CD2 1 
ATOM   3301 C  CE1 . PHE A 1 372 ? 11.83044 -16.92007 120.52989 1.000 12.95351 ? 372 PHE A CE1 1 
ATOM   3302 C  CE2 . PHE A 1 372 ? 10.77853 -17.34529 118.43838 1.000 12.61580 ? 372 PHE A CE2 1 
ATOM   3303 C  CZ  . PHE A 1 372 ? 11.92570 -17.24612 119.18750 1.000 12.94179 ? 372 PHE A CZ  1 
ATOM   3304 N  N   . GLU A 1 373 ? 5.46866  -16.87482 122.89842 1.000 11.46695 ? 373 GLU A N   1 
ATOM   3305 C  CA  . GLU A 1 373 ? 4.20783  -16.24409 123.28898 1.000 11.69466 ? 373 GLU A CA  1 
ATOM   3306 C  C   . GLU A 1 373 ? 4.18153  -15.93827 124.78223 1.000 12.12312 ? 373 GLU A C   1 
ATOM   3307 O  O   . GLU A 1 373 ? 3.70444  -14.87622 125.19252 1.000 12.80433 ? 373 GLU A O   1 
ATOM   3308 C  CB  . GLU A 1 373 ? 3.01867  -17.08781 122.83135 1.000 12.13687 ? 373 GLU A CB  1 
ATOM   3309 C  CG  . GLU A 1 373 ? 2.81810  -17.01990 121.31294 1.000 12.56933 ? 373 GLU A CG  1 
ATOM   3310 C  CD  . GLU A 1 373 ? 2.37349  -15.64561 120.86344 1.000 13.04653 ? 373 GLU A CD  1 
ATOM   3311 O  OE1 . GLU A 1 373 ? 1.17270  -15.34783 120.99862 1.000 14.20040 ? 373 GLU A OE1 1 
ATOM   3312 O  OE2 . GLU A 1 373 ? 3.21230  -14.85408 120.40278 1.000 14.03580 ? 373 GLU A OE2 1 
ATOM   3313 N  N   A ARG A 1 374 ? 4.70032  -16.84948 125.60812 0.706 12.26311 ? 374 ARG A N   1 
ATOM   3314 N  N   B ARG A 1 374 ? 4.70909  -16.85319 125.60182 0.294 12.43535 ? 374 ARG A N   1 
ATOM   3315 C  CA  A ARG A 1 374 ? 4.79810  -16.56393 127.03483 0.706 13.14181 ? 374 ARG A CA  1 
ATOM   3316 C  CA  B ARG A 1 374 ? 4.82967  -16.60994 127.03732 0.294 13.58088 ? 374 ARG A CA  1 
ATOM   3317 C  C   A ARG A 1 374 ? 5.69228  -15.35675 127.27933 0.706 12.43790 ? 374 ARG A C   1 
ATOM   3318 C  C   B ARG A 1 374 ? 5.71529  -15.39982 127.30886 0.294 12.66179 ? 374 ARG A C   1 
ATOM   3319 O  O   A ARG A 1 374 ? 5.35137  -14.46393 128.06301 0.706 13.17544 ? 374 ARG A O   1 
ATOM   3320 O  O   B ARG A 1 374 ? 5.39396  -14.55229 128.14917 0.294 13.23107 ? 374 ARG A O   1 
ATOM   3321 C  CB  A ARG A 1 374 ? 5.31908  -17.78454 127.79177 0.706 16.03975 ? 374 ARG A CB  1 
ATOM   3322 C  CB  B ARG A 1 374 ? 5.40036  -17.86158 127.71076 0.294 16.71182 ? 374 ARG A CB  1 
ATOM   3323 C  CG  A ARG A 1 374 ? 5.44173  -17.53132 129.27742 0.706 21.03861 ? 374 ARG A CG  1 
ATOM   3324 C  CG  B ARG A 1 374 ? 5.67380  -17.75179 129.21031 0.294 21.48488 ? 374 ARG A CG  1 
ATOM   3325 C  CD  A ARG A 1 374 ? 5.49213  -18.79503 130.09799 0.706 26.30138 ? 374 ARG A CD  1 
ATOM   3326 C  CD  B ARG A 1 374 ? 4.42050  -17.97968 130.03933 0.294 27.09017 ? 374 ARG A CD  1 
ATOM   3327 N  NE  A ARG A 1 374 ? 5.50826  -18.44360 131.51385 0.706 33.09645 ? 374 ARG A NE  1 
ATOM   3328 N  NE  B ARG A 1 374 ? 4.01139  -19.38235 130.08005 0.294 32.06907 ? 374 ARG A NE  1 
ATOM   3329 C  CZ  A ARG A 1 374 ? 6.60171  -18.07613 132.17406 0.706 33.57367 ? 374 ARG A CZ  1 
ATOM   3330 C  CZ  B ARG A 1 374 ? 2.79458  -19.79205 130.42756 0.294 34.95038 ? 374 ARG A CZ  1 
ATOM   3331 N  NH1 A ARG A 1 374 ? 7.76862  -18.02631 131.54759 0.706 32.94770 ? 374 ARG A NH1 1 
ATOM   3332 N  NH1 B ARG A 1 374 ? 1.86685  -18.90552 130.76121 0.294 36.53078 ? 374 ARG A NH1 1 
ATOM   3333 N  NH2 A ARG A 1 374 ? 6.53255  -17.76162 133.46030 0.706 35.36905 ? 374 ARG A NH2 1 
ATOM   3334 N  NH2 B ARG A 1 374 ? 2.50118  -21.08570 130.43786 0.294 36.54732 ? 374 ARG A NH2 1 
ATOM   3335 N  N   . LEU A 1 375 ? 6.83968  -15.30487 126.59676 1.000 12.41564 ? 375 LEU A N   1 
ATOM   3336 C  CA  . LEU A 1 375 ? 7.72710  -14.15805 126.73785 1.000 12.36062 ? 375 LEU A CA  1 
ATOM   3337 C  C   . LEU A 1 375 ? 7.02542  -12.86211 126.34621 1.000 11.73232 ? 375 LEU A C   1 
ATOM   3338 O  O   . LEU A 1 375 ? 7.12882  -11.84608 127.04984 1.000 12.54208 ? 375 LEU A O   1 
ATOM   3339 C  CB  . LEU A 1 375 ? 8.97301  -14.38699 125.88078 1.000 13.28979 ? 375 LEU A CB  1 
ATOM   3340 C  CG  . LEU A 1 375 ? 9.99619  -13.25948 125.81150 1.000 14.32860 ? 375 LEU A CG  1 
ATOM   3341 C  CD1 . LEU A 1 375 ? 10.55304 -12.92349 127.19384 1.000 16.03555 ? 375 LEU A CD1 1 
ATOM   3342 C  CD2 . LEU A 1 375 ? 11.11630 -13.62919 124.84315 1.000 16.02340 ? 375 LEU A CD2 1 
ATOM   3343 N  N   . ASP A 1 376 ? 6.28364  -12.88303 125.23462 1.000 11.23037 ? 376 ASP A N   1 
ATOM   3344 C  CA  . ASP A 1 376 ? 5.62697  -11.66305 124.78530 1.000 10.87889 ? 376 ASP A CA  1 
ATOM   3345 C  C   . ASP A 1 376 ? 4.50269  -11.24908 125.71832 1.000 11.09373 ? 376 ASP A C   1 
ATOM   3346 O  O   . ASP A 1 376 ? 4.21972  -10.05580 125.85998 1.000 12.34633 ? 376 ASP A O   1 
ATOM   3347 C  CB  . ASP A 1 376 ? 5.08977  -11.80894 123.36695 1.000 11.01574 ? 376 ASP A CB  1 
ATOM   3348 C  CG  . ASP A 1 376 ? 4.67712  -10.48178 122.79161 1.000 11.13553 ? 376 ASP A CG  1 
ATOM   3349 O  OD1 . ASP A 1 376 ? 5.54191  -9.58197  122.74016 1.000 11.95647 ? 376 ASP A OD1 1 
ATOM   3350 O  OD2 . ASP A 1 376 ? 3.49652  -10.32619 122.41114 1.000 12.47823 ? 376 ASP A OD2 1 
ATOM   3351 N  N   . GLN A 1 377 ? 3.83862  -12.21411 126.35772 1.000 11.35167 ? 377 GLN A N   1 
ATOM   3352 C  CA  . GLN A 1 377 ? 2.80497  -11.83575 127.31591 1.000 11.75265 ? 377 GLN A CA  1 
ATOM   3353 C  C   . GLN A 1 377 ? 3.40574  -11.25258 128.59413 1.000 11.83579 ? 377 GLN A C   1 
ATOM   3354 O  O   . GLN A 1 377 ? 2.81591  -10.34493 129.19032 1.000 12.63237 ? 377 GLN A O   1 
ATOM   3355 C  CB  . GLN A 1 377 ? 1.83775  -12.98780 127.58405 1.000 13.25917 ? 377 GLN A CB  1 
ATOM   3356 C  CG  . GLN A 1 377 ? 0.61972  -12.57262 128.39913 1.000 13.81337 ? 377 GLN A CG  1 
ATOM   3357 C  CD  . GLN A 1 377 ? -0.22342 -11.51187 127.71486 1.000 13.55679 ? 377 GLN A CD  1 
ATOM   3358 O  OE1 . GLN A 1 377 ? -0.47118 -11.56684 126.50582 1.000 14.25796 ? 377 GLN A OE1 1 
ATOM   3359 N  NE2 . GLN A 1 377 ? -0.67229 -10.53269 128.48563 1.000 13.95696 ? 377 GLN A NE2 1 
ATOM   3360 N  N   . LEU A 1 378 ? 4.58325  -11.72342 129.01115 1.000 12.10614 ? 378 LEU A N   1 
ATOM   3361 C  CA  . LEU A 1 378 ? 5.28475  -11.03879 130.09547 1.000 12.72904 ? 378 LEU A CA  1 
ATOM   3362 C  C   . LEU A 1 378 ? 5.61554  -9.60612  129.71054 1.000 12.12649 ? 378 LEU A C   1 
ATOM   3363 O  O   . LEU A 1 378 ? 5.50460  -8.69333  130.53579 1.000 13.27842 ? 378 LEU A O   1 
ATOM   3364 C  CB  . LEU A 1 378 ? 6.55591  -11.78752 130.48944 1.000 14.44758 ? 378 LEU A CB  1 
ATOM   3365 C  CG  . LEU A 1 378 ? 6.34830  -13.10716 131.22745 1.000 17.39065 ? 378 LEU A CG  1 
ATOM   3366 C  CD1 . LEU A 1 378 ? 7.64831  -13.89633 131.30709 1.000 19.07117 ? 378 LEU A CD1 1 
ATOM   3367 C  CD2 . LEU A 1 378 ? 5.79055  -12.84636 132.62679 1.000 21.48116 ? 378 LEU A CD2 1 
ATOM   3368 N  N   . ALA A 1 379 ? 6.02503  -9.38778  128.45540 1.000 11.87122 ? 379 ALA A N   1 
ATOM   3369 C  CA  . ALA A 1 379 ? 6.30924  -8.03027  127.99827 1.000 12.32230 ? 379 ALA A CA  1 
ATOM   3370 C  C   . ALA A 1 379 ? 5.05104  -7.17002  128.00311 1.000 11.80926 ? 379 ALA A C   1 
ATOM   3371 O  O   . ALA A 1 379 ? 5.10266  -5.98898  128.36623 1.000 13.04551 ? 379 ALA A O   1 
ATOM   3372 C  CB  . ALA A 1 379 ? 6.92787  -8.06421  126.59748 1.000 13.57946 ? 379 ALA A CB  1 
ATOM   3373 N  N   . MET A 1 380 ? 3.91999  -7.73987  127.57241 1.000 11.72907 ? 380 MET A N   1 
ATOM   3374 C  CA  A MET A 1 380 ? 2.65841  -7.00989  127.61363 0.804 11.95598 ? 380 MET A CA  1 
ATOM   3375 C  CA  B MET A 1 380 ? 2.64887  -7.02254  127.61677 0.196 12.05597 ? 380 MET A CA  1 
ATOM   3376 C  C   . MET A 1 380 ? 2.27965  -6.65083  129.04119 1.000 12.06552 ? 380 MET A C   1 
ATOM   3377 O  O   . MET A 1 380 ? 1.88131  -5.51220  129.32145 1.000 12.97342 ? 380 MET A O   1 
ATOM   3378 C  CB  A MET A 1 380 ? 1.56205  -7.85146  126.96942 0.804 13.14871 ? 380 MET A CB  1 
ATOM   3379 C  CB  B MET A 1 380 ? 1.54402  -7.90019  127.03490 0.196 12.82048 ? 380 MET A CB  1 
ATOM   3380 C  CG  A MET A 1 380 ? 0.22611  -7.15851  126.87318 0.804 15.54295 ? 380 MET A CG  1 
ATOM   3381 C  CG  B MET A 1 380 ? 1.53089  -7.97409  125.53635 0.196 13.99733 ? 380 MET A CG  1 
ATOM   3382 S  SD  A MET A 1 380 ? 0.20447  -5.94995  125.56365 0.804 19.68552 ? 380 MET A SD  1 
ATOM   3383 S  SD  B MET A 1 380 ? 0.86649  -6.50019  124.73185 0.196 15.79918 ? 380 MET A SD  1 
ATOM   3384 C  CE  A MET A 1 380 ? 0.06480  -7.07410  124.17502 0.804 23.55778 ? 380 MET A CE  1 
ATOM   3385 C  CE  B MET A 1 380 ? -0.02884 -5.64650  126.02919 0.196 16.42446 ? 380 MET A CE  1 
ATOM   3386 N  N   . ASP A 1 381 ? 2.37519  -7.62422  129.94756 1.000 12.21178 ? 381 ASP A N   1 
ATOM   3387 C  CA  . ASP A 1 381 ? 2.02730  -7.38033  131.33989 1.000 12.78810 ? 381 ASP A CA  1 
ATOM   3388 C  C   . ASP A 1 381 ? 2.88125  -6.26253  131.92229 1.000 13.21328 ? 381 ASP A C   1 
ATOM   3389 O  O   . ASP A 1 381 ? 2.38190  -5.40944  132.66342 1.000 14.56033 ? 381 ASP A O   1 
ATOM   3390 C  CB  . ASP A 1 381 ? 2.22441  -8.65107  132.16888 1.000 13.96230 ? 381 ASP A CB  1 
ATOM   3391 C  CG  . ASP A 1 381 ? 1.18091  -9.72907  131.91165 1.000 15.49129 ? 381 ASP A CG  1 
ATOM   3392 O  OD1 . ASP A 1 381 ? 0.17808  -9.51386  131.20060 1.000 15.82141 ? 381 ASP A OD1 1 
ATOM   3393 O  OD2 . ASP A 1 381 ? 1.37553  -10.82473 132.48256 1.000 18.70721 ? 381 ASP A OD2 1 
ATOM   3394 N  N   . HIS A 1 382 ? 4.17729  -6.24895  131.59647 1.000 12.76784 ? 382 HIS A N   1 
ATOM   3395 C  CA  . HIS A 1 382 ? 5.04433  -5.19451  132.11124 1.000 13.62959 ? 382 HIS A CA  1 
ATOM   3396 C  C   . HIS A 1 382 ? 4.68909  -3.83767  131.52560 1.000 14.08845 ? 382 HIS A C   1 
ATOM   3397 O  O   . HIS A 1 382 ? 4.66719  -2.83186  132.24231 1.000 15.52249 ? 382 HIS A O   1 
ATOM   3398 C  CB  . HIS A 1 382 ? 6.50520  -5.52876  131.84083 1.000 14.36120 ? 382 HIS A CB  1 
ATOM   3399 C  CG  . HIS A 1 382 ? 7.14165  -6.27897  132.95655 1.000 15.13611 ? 382 HIS A CG  1 
ATOM   3400 N  ND1 . HIS A 1 382 ? 7.49769  -5.66730  134.13940 1.000 16.90442 ? 382 HIS A ND1 1 
ATOM   3401 C  CD2 . HIS A 1 382 ? 7.46278  -7.58513  133.08690 1.000 16.45947 ? 382 HIS A CD2 1 
ATOM   3402 C  CE1 . HIS A 1 382 ? 8.02330  -6.56545  134.94963 1.000 17.89055 ? 382 HIS A CE1 1 
ATOM   3403 N  NE2 . HIS A 1 382 ? 8.01133  -7.73786  134.33730 1.000 18.30114 ? 382 HIS A NE2 1 
ATOM   3404 N  N   . LEU A 1 383 ? 4.42841  -3.78296  130.21989 1.000 13.54262 ? 383 LEU A N   1 
ATOM   3405 C  CA  . LEU A 1 383 ? 4.05522  -2.51881  129.60090 1.000 13.39167 ? 383 LEU A CA  1 
ATOM   3406 C  C   . LEU A 1 383 ? 2.80709  -1.94089  130.25229 1.000 13.84492 ? 383 LEU A C   1 
ATOM   3407 O  O   . LEU A 1 383 ? 2.74177  -0.73680  130.53279 1.000 15.33633 ? 383 LEU A O   1 
ATOM   3408 C  CB  . LEU A 1 383 ? 3.84511  -2.72531  128.09714 1.000 13.25859 ? 383 LEU A CB  1 
ATOM   3409 C  CG  . LEU A 1 383 ? 3.24792  -1.55924  127.31432 1.000 14.46179 ? 383 LEU A CG  1 
ATOM   3410 C  CD1 . LEU A 1 383 ? 4.10920  -0.32490  127.43039 1.000 15.62815 ? 383 LEU A CD1 1 
ATOM   3411 C  CD2 . LEU A 1 383 ? 3.07475  -1.94871  125.84801 1.000 16.50770 ? 383 LEU A CD2 1 
ATOM   3412 N  N   . LEU A 1 384 ? 1.81389  -2.78822  130.50912 1.000 14.26473 ? 384 LEU A N   1 
ATOM   3413 C  CA  . LEU A 1 384 ? 0.54940  -2.33762  131.06429 1.000 15.18460 ? 384 LEU A CA  1 
ATOM   3414 C  C   . LEU A 1 384 ? 0.56944  -2.20624  132.58056 1.000 17.04463 ? 384 LEU A C   1 
ATOM   3415 O  O   . LEU A 1 384 ? -0.43895 -1.79250  133.15738 1.000 20.59723 ? 384 LEU A O   1 
ATOM   3416 C  CB  . LEU A 1 384 ? -0.58110 -3.27506  130.63177 1.000 15.85441 ? 384 LEU A CB  1 
ATOM   3417 C  CG  . LEU A 1 384 ? -0.82759 -3.33081  129.12481 1.000 18.64304 ? 384 LEU A CG  1 
ATOM   3418 C  CD1 . LEU A 1 384 ? -1.87781 -4.38099  128.79319 1.000 21.16125 ? 384 LEU A CD1 1 
ATOM   3419 C  CD2 . LEU A 1 384 ? -1.24074 -1.95507  128.61894 1.000 22.23926 ? 384 LEU A CD2 1 
ATOM   3420 N  N   . GLY A 1 385 ? 1.67523  -2.53752  133.23701 1.000 17.40018 ? 385 GLY A N   1 
ATOM   3421 C  CA  . GLY A 1 385 ? 1.70576  -2.46642  134.69229 1.000 19.98239 ? 385 GLY A CA  1 
ATOM   3422 C  C   . GLY A 1 385 ? 0.77668  -3.46925  135.33541 1.000 21.52360 ? 385 GLY A C   1 
ATOM   3423 O  O   . GLY A 1 385 ? 0.14651  -3.16387  136.35688 1.000 26.67466 ? 385 GLY A O   1 
ATOM   3424 N  N   . ALA A 1 386 ? 0.68027  -4.66372  134.75868 1.000 20.08838 ? 386 ALA A N   1 
ATOM   3425 C  CA  . ALA A 1 386 ? -0.18878 -5.73237  135.22616 1.000 23.50400 ? 386 ALA A CA  1 
ATOM   3426 C  C   . ALA A 1 386 ? 0.61086  -6.90283  135.79052 1.000 29.74372 ? 386 ALA A C   1 
ATOM   3427 O  O   . ALA A 1 386 ? 0.17598  -8.05363  135.71816 1.000 38.50549 ? 386 ALA A O   1 
ATOM   3428 C  CB  . ALA A 1 386 ? -1.11706 -6.19817  134.10663 1.000 24.40635 ? 386 ALA A CB  1 
ATOM   3429 N  N   . ARG A 1 387 ? 1.78116  -6.62146  136.35400 1.000 30.80408 ? 387 ARG A N   1 
ATOM   3430 C  CA  . ARG A 1 387 ? 2.55516  -7.62977  137.06773 1.000 31.04507 ? 387 ARG A CA  1 
ATOM   3431 C  C   . ARG A 1 387 ? 2.33714  -7.46754  138.57134 1.000 31.11517 ? 387 ARG A C   1 
ATOM   3432 O  O   . ARG A 1 387 ? 2.05402  -6.36842  139.05235 1.000 32.17997 ? 387 ARG A O   1 
ATOM   3433 C  CB  . ARG A 1 387 ? 4.04328  -7.50301  136.73680 1.000 30.99567 ? 387 ARG A CB  1 
ATOM   3434 C  CG  . ARG A 1 387 ? 4.39114  -7.81092  135.28678 1.000 30.37513 ? 387 ARG A CG  1 
ATOM   3435 C  CD  . ARG A 1 387 ? 4.47441  -9.30847  135.02760 1.000 30.61005 ? 387 ARG A CD  1 
ATOM   3436 N  NE  . ARG A 1 387 ? 5.64382  -9.93040  135.64410 1.000 30.33006 ? 387 ARG A NE  1 
ATOM   3437 C  CZ  . ARG A 1 387 ? 5.68065  -11.18911 136.07126 1.000 30.55068 ? 387 ARG A CZ  1 
ATOM   3438 N  NH1 . ARG A 1 387 ? 6.78931  -11.66957 136.61857 1.000 30.24394 ? 387 ARG A NH1 1 
ATOM   3439 N  NH2 . ARG A 1 387 ? 4.61441  -11.97153 135.94563 1.000 30.46208 ? 387 ARG A NH2 1 
HETATM 3440 MG MG  . MG  B 2 .   ? 12.25590 14.34388  111.18838 1.000 13.01509 ? 401 MG  A MG  1 
HETATM 3441 MG MG  . MG  C 2 .   ? 7.70396  13.07501  109.87792 1.000 6.97105  ? 402 MG  A MG  1 
HETATM 3442 NA NA  . NA  D 3 .   ? 32.79614 12.40631  102.26839 1.000 25.94096 ? 403 NA  A NA  1 
HETATM 3443 O  O   . HOH E 4 .   ? -0.60533 23.13561  128.72036 1.000 34.02419 ? 501 HOH A O   1 
HETATM 3444 O  O   . HOH E 4 .   ? 21.91135 -25.58490 120.32844 1.000 31.01019 ? 502 HOH A O   1 
HETATM 3445 O  O   . HOH E 4 .   ? 19.13394 -25.20837 122.30458 1.000 28.31959 ? 503 HOH A O   1 
HETATM 3446 O  O   . HOH E 4 .   ? -4.48686 7.71005   111.66068 1.000 32.03579 ? 504 HOH A O   1 
HETATM 3447 O  O   . HOH E 4 .   ? -9.092   30.367    105.834   1.000 31.40324 ? 505 HOH A O   1 
HETATM 3448 O  O   . HOH E 4 .   ? 12.56867 28.49901  103.54830 1.000 36.21579 ? 506 HOH A O   1 
HETATM 3449 O  O   . HOH E 4 .   ? 19.05635 18.75419  99.17366  1.000 28.43474 ? 507 HOH A O   1 
HETATM 3450 O  O   . HOH E 4 .   ? 5.65756  34.13429  120.65579 1.000 34.19251 ? 508 HOH A O   1 
HETATM 3451 O  O   . HOH E 4 .   ? 13.55741 16.18586  110.71563 1.000 32.17857 ? 509 HOH A O   1 
HETATM 3452 O  O   . HOH E 4 .   ? 19.61204 5.43900   86.40335  1.000 33.07222 ? 510 HOH A O   1 
HETATM 3453 O  O   . HOH E 4 .   ? 19.10550 8.36333   81.68410  1.000 48.06452 ? 511 HOH A O   1 
HETATM 3454 O  O   . HOH E 4 .   ? 14.76704 -20.97116 131.69257 1.000 36.99214 ? 512 HOH A O   1 
HETATM 3455 O  O   . HOH E 4 .   ? 11.63455 15.26757  109.19478 1.000 27.98195 ? 513 HOH A O   1 
HETATM 3456 O  O   . HOH E 4 .   ? -8.90491 28.14270  123.25384 1.000 45.49553 ? 514 HOH A O   1 
HETATM 3457 O  O   . HOH E 4 .   ? -0.01012 4.78730   120.96688 1.000 22.04010 ? 515 HOH A O   1 
HETATM 3458 O  O   . HOH E 4 .   ? -1.49757 2.62036   115.11046 1.000 31.49408 ? 516 HOH A O   1 
HETATM 3459 O  O   . HOH E 4 .   ? 17.13570 -9.93053  125.51094 1.000 42.48426 ? 517 HOH A O   1 
HETATM 3460 O  O   . HOH E 4 .   ? 20.13393 -23.41850 125.86157 1.000 43.21839 ? 518 HOH A O   1 
HETATM 3461 O  O   . HOH E 4 .   ? 2.18796  15.35021  106.40752 1.000 19.11595 ? 519 HOH A O   1 
HETATM 3462 O  O   . HOH E 4 .   ? 30.30101 21.76804  116.86387 1.000 43.57021 ? 520 HOH A O   1 
HETATM 3463 O  O   . HOH E 4 .   ? 17.47215 31.76106  106.76081 1.000 38.68908 ? 521 HOH A O   1 
HETATM 3464 O  O   . HOH E 4 .   ? 9.09499  27.79417  117.88992 1.000 25.01796 ? 522 HOH A O   1 
HETATM 3465 O  O   . HOH E 4 .   ? 1.70289  -16.82127 129.25189 1.000 38.04610 ? 523 HOH A O   1 
HETATM 3466 O  O   . HOH E 4 .   ? 22.81281 10.01238  82.18674  1.000 38.28900 ? 524 HOH A O   1 
HETATM 3467 O  O   . HOH E 4 .   ? 5.37818  6.39532   93.08492  1.000 30.48408 ? 525 HOH A O   1 
HETATM 3468 O  O   . HOH E 4 .   ? 12.75652 -23.90501 126.43958 1.000 48.98066 ? 526 HOH A O   1 
HETATM 3469 O  O   . HOH E 4 .   ? 25.33614 9.95548   83.28112  1.000 38.36294 ? 527 HOH A O   1 
HETATM 3470 O  O   . HOH E 4 .   ? -4.94345 20.68717  98.46958  1.000 48.25618 ? 528 HOH A O   1 
HETATM 3471 O  O   . HOH E 4 .   ? 31.02437 3.65761   107.58482 1.000 39.96723 ? 529 HOH A O   1 
HETATM 3472 O  O   . HOH E 4 .   ? 18.81048 3.49223   131.06676 1.000 40.58773 ? 530 HOH A O   1 
HETATM 3473 O  O   . HOH E 4 .   ? -3.48596 15.02349  110.95024 1.000 26.78077 ? 531 HOH A O   1 
HETATM 3474 O  O   . HOH E 4 .   ? 25.02012 25.93331  85.92082  1.000 40.38060 ? 532 HOH A O   1 
HETATM 3475 O  O   . HOH E 4 .   ? -6.46498 23.66231  125.09190 1.000 24.89680 ? 533 HOH A O   1 
HETATM 3476 O  O   . HOH E 4 .   ? 34.66534 14.48502  101.92927 1.000 29.72846 ? 534 HOH A O   1 
HETATM 3477 O  O   . HOH E 4 .   ? 9.15581  -11.72100 139.27529 1.000 40.50614 ? 535 HOH A O   1 
HETATM 3478 O  O   . HOH E 4 .   ? 8.58408  29.60477  115.79199 1.000 31.95663 ? 536 HOH A O   1 
HETATM 3479 O  O   . HOH E 4 .   ? 29.78475 -29.27703 117.88390 1.000 52.66607 ? 537 HOH A O   1 
HETATM 3480 O  O   . HOH E 4 .   ? 6.11190  4.18416   95.87577  1.000 16.82779 ? 538 HOH A O   1 
HETATM 3481 O  O   . HOH E 4 .   ? 14.14632 34.68158  115.08053 1.000 32.72284 ? 539 HOH A O   1 
HETATM 3482 O  O   . HOH E 4 .   ? 15.46392 35.73454  126.78464 1.000 51.88762 ? 540 HOH A O   1 
HETATM 3483 O  O   . HOH E 4 .   ? 14.84187 25.83687  88.49097  1.000 33.31816 ? 541 HOH A O   1 
HETATM 3484 O  O   . HOH E 4 .   ? -6.87497 27.13900  126.41244 1.000 42.45614 ? 542 HOH A O   1 
HETATM 3485 O  O   . HOH E 4 .   ? 9.96090  23.80874  97.29253  1.000 16.28013 ? 543 HOH A O   1 
HETATM 3486 O  O   . HOH E 4 .   ? 9.28149  5.35715   98.12012  1.000 12.66552 ? 544 HOH A O   1 
HETATM 3487 O  O   . HOH E 4 .   ? 2.78699  28.46822  115.94601 1.000 28.84298 ? 545 HOH A O   1 
HETATM 3488 O  O   . HOH E 4 .   ? 15.07077 9.73126   133.90137 1.000 52.59402 ? 546 HOH A O   1 
HETATM 3489 O  O   . HOH E 4 .   ? 17.10343 -4.54308  124.27388 1.000 37.56062 ? 547 HOH A O   1 
HETATM 3490 O  O   . HOH E 4 .   ? 13.38680 12.34172  134.83694 1.000 37.67631 ? 548 HOH A O   1 
HETATM 3491 O  O   . HOH E 4 .   ? 19.06408 33.58568  99.19007  1.000 49.18421 ? 549 HOH A O   1 
HETATM 3492 O  O   . HOH E 4 .   ? 7.97828  8.53184   91.79886  1.000 25.28427 ? 550 HOH A O   1 
HETATM 3493 O  O   . HOH E 4 .   ? 18.65161 -14.42344 135.90043 1.000 42.09182 ? 551 HOH A O   1 
HETATM 3494 O  O   . HOH E 4 .   ? 0.97869  -13.42127 131.84768 1.000 38.18828 ? 552 HOH A O   1 
HETATM 3495 O  O   . HOH E 4 .   ? 23.71926 18.65515  124.56974 1.000 41.67736 ? 553 HOH A O   1 
HETATM 3496 O  O   . HOH E 4 .   ? -3.45125 18.53310  109.84570 1.000 23.39383 ? 554 HOH A O   1 
HETATM 3497 O  O   . HOH E 4 .   ? 4.12938  5.08074   115.94480 1.000 10.68939 ? 555 HOH A O   1 
HETATM 3498 O  O   . HOH E 4 .   ? 24.24159 25.20941  122.65386 1.000 30.34742 ? 556 HOH A O   1 
HETATM 3499 O  O   . HOH E 4 .   ? 11.70286 14.98551  89.81569  1.000 15.14819 ? 557 HOH A O   1 
HETATM 3500 O  O   . HOH E 4 .   ? 8.02968  19.71545  94.81771  1.000 15.51197 ? 558 HOH A O   1 
HETATM 3501 O  O   . HOH E 4 .   ? 5.12457  14.07153  133.10789 1.000 29.51777 ? 559 HOH A O   1 
HETATM 3502 O  O   . HOH E 4 .   ? 24.96554 -18.06336 112.03979 1.000 15.08197 ? 560 HOH A O   1 
HETATM 3503 O  O   . HOH E 4 .   ? 33.76976 4.87028   100.57011 1.000 39.91034 ? 561 HOH A O   1 
HETATM 3504 O  O   . HOH E 4 .   ? 22.20656 -20.16784 129.73871 1.000 26.60114 ? 562 HOH A O   1 
HETATM 3505 O  O   . HOH E 4 .   ? 12.64784 -32.29561 121.20147 1.000 41.57834 ? 563 HOH A O   1 
HETATM 3506 O  O   . HOH E 4 .   ? 0.20505  15.64084  114.43844 1.000 20.48056 ? 564 HOH A O   1 
HETATM 3507 O  O   . HOH E 4 .   ? 12.09371 6.38884   106.09390 1.000 14.81223 ? 565 HOH A O   1 
HETATM 3508 O  O   . HOH E 4 .   ? 8.32193  33.06553  114.27827 1.000 53.60500 ? 566 HOH A O   1 
HETATM 3509 O  O   . HOH E 4 .   ? 7.24277  18.41950  112.98516 1.000 29.49658 ? 567 HOH A O   1 
HETATM 3510 O  O   . HOH E 4 .   ? 15.11370 10.19115  102.39838 1.000 19.38088 ? 568 HOH A O   1 
HETATM 3511 O  O   . HOH E 4 .   ? -3.33410 3.49208   106.58180 1.000 20.75339 ? 569 HOH A O   1 
HETATM 3512 O  O   . HOH E 4 .   ? 29.61475 8.93736   92.17300  1.000 36.63642 ? 570 HOH A O   1 
HETATM 3513 O  O   . HOH E 4 .   ? 32.46585 13.26792  95.14471  1.000 38.26658 ? 571 HOH A O   1 
HETATM 3514 O  O   . HOH E 4 .   ? 21.52377 29.13495  105.56606 1.000 17.76834 ? 572 HOH A O   1 
HETATM 3515 O  O   . HOH E 4 .   ? 13.96750 -3.83677  122.15984 1.000 19.53754 ? 573 HOH A O   1 
HETATM 3516 O  O   . HOH E 4 .   ? 34.60135 -30.91769 114.40133 1.000 37.79742 ? 574 HOH A O   1 
HETATM 3517 O  O   . HOH E 4 .   ? 5.86662  29.56935  114.57653 1.000 24.24267 ? 575 HOH A O   1 
HETATM 3518 O  O   . HOH E 4 .   ? -5.35240 31.40017  109.27848 1.000 37.77550 ? 576 HOH A O   1 
HETATM 3519 O  O   . HOH E 4 .   ? 4.66069  16.27576  108.75867 1.000 41.33422 ? 577 HOH A O   1 
HETATM 3520 O  O   . HOH E 4 .   ? 14.09880 18.70699  108.29875 1.000 29.98354 ? 578 HOH A O   1 
HETATM 3521 O  O   . HOH E 4 .   ? 20.14076 12.32552  83.52989  1.000 22.00583 ? 579 HOH A O   1 
HETATM 3522 O  O   . HOH E 4 .   ? 36.89085 20.43663  96.17409  1.000 37.72650 ? 580 HOH A O   1 
HETATM 3523 O  O   . HOH E 4 .   ? 6.64860  16.18840  88.97162  1.000 12.53829 ? 581 HOH A O   1 
HETATM 3524 O  O   . HOH E 4 .   ? 15.32796 16.92435  129.10184 1.000 18.55765 ? 582 HOH A O   1 
HETATM 3525 O  O   . HOH E 4 .   ? 9.73062  -17.53028 133.41394 1.000 29.69910 ? 583 HOH A O   1 
HETATM 3526 O  O   . HOH E 4 .   ? 14.89357 22.77449  131.34821 1.000 33.08060 ? 584 HOH A O   1 
HETATM 3527 O  O   A HOH E 4 .   ? 26.59393 1.94267   106.90027 0.501 17.41222 ? 585 HOH A O   1 
HETATM 3528 O  O   B HOH E 4 .   ? 26.79193 2.85101   106.86761 0.499 23.64184 ? 585 HOH A O   1 
HETATM 3529 O  O   . HOH E 4 .   ? 26.34531 11.52206  86.84725  1.000 21.80416 ? 586 HOH A O   1 
HETATM 3530 O  O   . HOH E 4 .   ? 28.45741 6.43195   89.39138  1.000 41.06609 ? 587 HOH A O   1 
HETATM 3531 O  O   . HOH E 4 .   ? 8.49492  12.96409  83.69188  1.000 13.59531 ? 588 HOH A O   1 
HETATM 3532 O  O   . HOH E 4 .   ? 28.03415 29.62559  101.58595 1.000 26.22991 ? 589 HOH A O   1 
HETATM 3533 O  O   . HOH E 4 .   ? 34.08889 -28.76990 116.68990 1.000 45.68519 ? 590 HOH A O   1 
HETATM 3534 O  O   . HOH E 4 .   ? -4.88549 19.54854  124.74228 1.000 15.06887 ? 591 HOH A O   1 
HETATM 3535 O  O   . HOH E 4 .   ? 5.73813  14.40322  86.96073  1.000 15.14541 ? 592 HOH A O   1 
HETATM 3536 O  O   . HOH E 4 .   ? 17.08901 12.45575  103.16428 1.000 21.53314 ? 593 HOH A O   1 
HETATM 3537 O  O   A HOH E 4 .   ? 2.39268  9.04587   102.59602 0.497 10.83613 ? 594 HOH A O   1 
HETATM 3538 O  O   B HOH E 4 .   ? 2.49184  9.75408   102.51155 0.503 15.61683 ? 594 HOH A O   1 
HETATM 3539 O  O   . HOH E 4 .   ? 0.20609  -13.90351 118.85363 1.000 20.63325 ? 595 HOH A O   1 
HETATM 3540 O  O   . HOH E 4 .   ? 23.76990 36.48192  125.38133 1.000 43.24407 ? 596 HOH A O   1 
HETATM 3541 O  O   . HOH E 4 .   ? 4.98435  10.51572  111.45937 1.000 12.18379 ? 597 HOH A O   1 
HETATM 3542 O  O   . HOH E 4 .   ? 30.06568 -20.15937 122.95904 1.000 47.92871 ? 598 HOH A O   1 
HETATM 3543 O  O   . HOH E 4 .   ? 10.36248 29.56685  113.76901 1.000 41.72677 ? 599 HOH A O   1 
HETATM 3544 O  O   . HOH E 4 .   ? 25.212   35.740    128.588   1.000 31.59872 ? 600 HOH A O   1 
HETATM 3545 O  O   . HOH E 4 .   ? 9.34030  -33.20850 115.08653 1.000 42.37174 ? 601 HOH A O   1 
HETATM 3546 O  O   . HOH E 4 .   ? 14.43994 0.34743   108.73951 1.000 13.62794 ? 602 HOH A O   1 
HETATM 3547 O  O   . HOH E 4 .   ? 11.24933 -5.91793  137.66736 1.000 29.12984 ? 603 HOH A O   1 
HETATM 3548 O  O   . HOH E 4 .   ? 9.45592  27.59286  111.68712 1.000 49.85636 ? 604 HOH A O   1 
HETATM 3549 O  O   . HOH E 4 .   ? 1.95637  26.50079  117.57657 1.000 20.40935 ? 605 HOH A O   1 
HETATM 3550 O  O   . HOH E 4 .   ? 17.33610 33.40381  133.89492 1.000 49.74499 ? 606 HOH A O   1 
HETATM 3551 O  O   . HOH E 4 .   ? 16.45917 19.04672  106.72131 1.000 23.74295 ? 607 HOH A O   1 
HETATM 3552 O  O   . HOH E 4 .   ? 32.74013 18.01213  93.02600  1.000 42.84473 ? 608 HOH A O   1 
HETATM 3553 O  O   . HOH E 4 .   ? 6.55336  24.18461  111.41609 1.000 37.12904 ? 609 HOH A O   1 
HETATM 3554 O  O   . HOH E 4 .   ? 0.96728  -1.19909  119.38119 1.000 15.68898 ? 610 HOH A O   1 
HETATM 3555 O  O   . HOH E 4 .   ? 18.95284 -21.36718 127.19651 1.000 23.96169 ? 611 HOH A O   1 
HETATM 3556 O  O   . HOH E 4 .   ? 20.80592 20.06230  105.86259 1.000 20.49062 ? 612 HOH A O   1 
HETATM 3557 O  O   . HOH E 4 .   ? 24.87731 -15.52634 125.73181 1.000 29.00765 ? 613 HOH A O   1 
HETATM 3558 O  O   . HOH E 4 .   ? 25.51959 7.92480   86.82739  1.000 32.63362 ? 614 HOH A O   1 
HETATM 3559 O  O   . HOH E 4 .   ? 7.17409  24.74997  104.85949 1.000 31.67515 ? 615 HOH A O   1 
HETATM 3560 O  O   . HOH E 4 .   ? 5.27794  6.67968   119.17037 1.000 12.92777 ? 616 HOH A O   1 
HETATM 3561 O  O   . HOH E 4 .   ? 2.35259  2.60766   112.82901 1.000 23.08395 ? 617 HOH A O   1 
HETATM 3562 O  O   . HOH E 4 .   ? 0.44583  16.27483  128.71575 1.000 37.63385 ? 618 HOH A O   1 
HETATM 3563 O  O   . HOH E 4 .   ? 30.20327 15.86593  116.72001 1.000 38.47562 ? 619 HOH A O   1 
HETATM 3564 O  O   . HOH E 4 .   ? 32.43047 5.52825   96.22247  1.000 49.52658 ? 620 HOH A O   1 
HETATM 3565 O  O   . HOH E 4 .   ? -7.74247 28.95071  114.70995 1.000 28.14087 ? 621 HOH A O   1 
HETATM 3566 O  O   . HOH E 4 .   ? 12.15675 26.38522  108.04346 1.000 31.74140 ? 622 HOH A O   1 
HETATM 3567 O  O   . HOH E 4 .   ? 15.45275 -1.70156  128.75004 1.000 31.14754 ? 623 HOH A O   1 
HETATM 3568 O  O   . HOH E 4 .   ? 15.38137 15.55080  93.02585  1.000 12.96275 ? 624 HOH A O   1 
HETATM 3569 O  O   . HOH E 4 .   ? 6.92957  18.48975  131.33207 1.000 27.61904 ? 625 HOH A O   1 
HETATM 3570 O  O   . HOH E 4 .   ? 13.31627 25.25309  90.70732  1.000 27.81172 ? 626 HOH A O   1 
HETATM 3571 O  O   . HOH E 4 .   ? 8.56635  15.05498  110.02822 1.000 14.63437 ? 627 HOH A O   1 
HETATM 3572 O  O   . HOH E 4 .   ? 23.91365 29.02749  91.38573  1.000 28.67071 ? 628 HOH A O   1 
HETATM 3573 O  O   . HOH E 4 .   ? 26.52034 1.77519   117.93968 1.000 28.69783 ? 629 HOH A O   1 
HETATM 3574 O  O   . HOH E 4 .   ? 6.06451  -7.71496  120.71879 1.000 14.45646 ? 630 HOH A O   1 
HETATM 3575 O  O   . HOH E 4 .   ? 38.21111 -25.17249 112.08126 1.000 31.24203 ? 631 HOH A O   1 
HETATM 3576 O  O   . HOH E 4 .   ? 13.19669 -1.98413  109.67180 1.000 12.51150 ? 632 HOH A O   1 
HETATM 3577 O  O   . HOH E 4 .   ? 30.84832 6.28666   111.82191 1.000 43.36864 ? 633 HOH A O   1 
HETATM 3578 O  O   . HOH E 4 .   ? 18.69746 17.25769  119.34530 1.000 15.49299 ? 634 HOH A O   1 
HETATM 3579 O  O   . HOH E 4 .   ? 3.22519  0.91889   109.57235 1.000 28.26836 ? 635 HOH A O   1 
HETATM 3580 O  O   . HOH E 4 .   ? 16.49974 12.31421  100.04921 1.000 16.24029 ? 636 HOH A O   1 
HETATM 3581 O  O   . HOH E 4 .   ? 14.63319 22.51100  92.48114  1.000 15.00511 ? 637 HOH A O   1 
HETATM 3582 O  O   . HOH E 4 .   ? 2.80494  -12.44863 119.01107 1.000 27.72450 ? 638 HOH A O   1 
HETATM 3583 O  O   . HOH E 4 .   ? 8.26571  10.28433  82.94841  1.000 13.85387 ? 639 HOH A O   1 
HETATM 3584 O  O   . HOH E 4 .   ? 26.85186 31.80019  109.01373 1.000 41.86877 ? 640 HOH A O   1 
HETATM 3585 O  O   . HOH E 4 .   ? 23.23861 15.94200  118.50046 1.000 28.42196 ? 641 HOH A O   1 
HETATM 3586 O  O   . HOH E 4 .   ? 29.86275 2.02400   93.76356  1.000 47.43744 ? 642 HOH A O   1 
HETATM 3587 O  O   . HOH E 4 .   ? 3.93328  0.46137   113.09788 1.000 25.13400 ? 643 HOH A O   1 
HETATM 3588 O  O   . HOH E 4 .   ? 31.50622 29.00112  112.83749 1.000 40.57392 ? 644 HOH A O   1 
HETATM 3589 O  O   . HOH E 4 .   ? 11.49080 6.72065   134.01484 1.000 31.37151 ? 645 HOH A O   1 
HETATM 3590 O  O   . HOH E 4 .   ? 16.22258 20.01283  103.95402 1.000 18.84609 ? 646 HOH A O   1 
HETATM 3591 O  O   . HOH E 4 .   ? 5.98707  4.11221   117.93078 1.000 13.88708 ? 647 HOH A O   1 
HETATM 3592 O  O   . HOH E 4 .   ? 17.49618 -9.06530  131.17098 1.000 38.62605 ? 648 HOH A O   1 
HETATM 3593 O  O   . HOH E 4 .   ? 29.74373 11.71599  92.80301  1.000 29.64330 ? 649 HOH A O   1 
HETATM 3594 O  O   . HOH E 4 .   ? 13.65218 7.48419   108.99371 1.000 13.24509 ? 650 HOH A O   1 
HETATM 3595 O  O   . HOH E 4 .   ? 20.06467 22.06824  129.12734 1.000 30.14158 ? 651 HOH A O   1 
HETATM 3596 O  O   . HOH E 4 .   ? 11.98550 29.54149  131.18259 1.000 40.07412 ? 652 HOH A O   1 
HETATM 3597 O  O   . HOH E 4 .   ? 6.80702  5.09838   99.56720  1.000 17.63101 ? 653 HOH A O   1 
HETATM 3598 O  O   . HOH E 4 .   ? 15.22337 18.66706  99.74945  1.000 17.65228 ? 654 HOH A O   1 
HETATM 3599 O  O   . HOH E 4 .   ? -6.36323 22.65581  122.52596 1.000 15.43805 ? 655 HOH A O   1 
HETATM 3600 O  O   . HOH E 4 .   ? 16.68247 -3.20790  133.86625 1.000 30.45735 ? 656 HOH A O   1 
HETATM 3601 O  O   . HOH E 4 .   ? 12.04884 34.67202  97.13716  1.000 39.95745 ? 657 HOH A O   1 
HETATM 3602 O  O   . HOH E 4 .   ? 15.76091 22.09136  89.31823  1.000 24.03963 ? 658 HOH A O   1 
HETATM 3603 O  O   . HOH E 4 .   ? 30.87420 -21.56695 118.40469 1.000 27.34791 ? 659 HOH A O   1 
HETATM 3604 O  O   . HOH E 4 .   ? 6.36693  -3.08430  134.58858 1.000 24.54878 ? 660 HOH A O   1 
HETATM 3605 O  O   . HOH E 4 .   ? 5.29584  -0.41117  110.86181 1.000 22.37929 ? 661 HOH A O   1 
HETATM 3606 O  O   . HOH E 4 .   ? 16.17502 37.15827  124.11419 1.000 33.82526 ? 662 HOH A O   1 
HETATM 3607 O  O   . HOH E 4 .   ? 23.66956 26.98029  124.60806 1.000 36.03097 ? 663 HOH A O   1 
HETATM 3608 O  O   . HOH E 4 .   ? 8.94158  14.29672  89.03472  1.000 13.34334 ? 664 HOH A O   1 
HETATM 3609 O  O   . HOH E 4 .   ? 9.80331  -17.76106 127.22294 1.000 15.50392 ? 665 HOH A O   1 
HETATM 3610 O  O   . HOH E 4 .   ? 11.64733 0.30427   136.51511 1.000 29.02425 ? 666 HOH A O   1 
HETATM 3611 O  O   . HOH E 4 .   ? 6.34665  15.82677  130.87227 1.000 23.39826 ? 667 HOH A O   1 
HETATM 3612 O  O   . HOH E 4 .   ? 13.05346 6.10316   96.03092  1.000 13.13193 ? 668 HOH A O   1 
HETATM 3613 O  O   . HOH E 4 .   ? 31.75726 -32.15065 105.29068 1.000 42.78913 ? 669 HOH A O   1 
HETATM 3614 O  O   . HOH E 4 .   ? -6.18897 26.31832  117.15157 1.000 30.44307 ? 670 HOH A O   1 
HETATM 3615 O  O   . HOH E 4 .   ? 20.83740 -34.04976 117.20232 1.000 42.28585 ? 671 HOH A O   1 
HETATM 3616 O  O   . HOH E 4 .   ? 15.21091 10.00429  82.12542  1.000 21.11884 ? 672 HOH A O   1 
HETATM 3617 O  O   . HOH E 4 .   ? 6.27774  18.03419  93.06690  1.000 19.72495 ? 673 HOH A O   1 
HETATM 3618 O  O   . HOH E 4 .   ? -2.70151 4.56661   118.05951 1.000 35.00805 ? 674 HOH A O   1 
HETATM 3619 O  O   . HOH E 4 .   ? 22.16281 30.21672  108.18427 1.000 21.72675 ? 675 HOH A O   1 
HETATM 3620 O  O   . HOH E 4 .   ? 18.26384 -14.10884 130.56395 1.000 24.96812 ? 676 HOH A O   1 
HETATM 3621 O  O   . HOH E 4 .   ? 7.60204  -0.06588  113.81787 1.000 15.03513 ? 677 HOH A O   1 
HETATM 3622 O  O   . HOH E 4 .   ? 16.82467 5.93783   87.04181  1.000 23.88060 ? 678 HOH A O   1 
HETATM 3623 O  O   . HOH E 4 .   ? 15.43015 35.01269  117.58811 1.000 31.79886 ? 679 HOH A O   1 
HETATM 3624 O  O   . HOH E 4 .   ? 23.27492 37.44190  122.95085 1.000 38.52542 ? 680 HOH A O   1 
HETATM 3625 O  O   . HOH E 4 .   ? 17.54694 -5.61533  109.13323 1.000 16.65230 ? 681 HOH A O   1 
HETATM 3626 O  O   . HOH E 4 .   ? 30.51890 14.31236  90.68854  1.000 36.93505 ? 682 HOH A O   1 
HETATM 3627 O  O   . HOH E 4 .   ? 32.33714 4.78139   108.81912 1.000 42.66144 ? 683 HOH A O   1 
HETATM 3628 O  O   A HOH E 4 .   ? 0.95028  15.82021  110.00713 0.499 26.09854 ? 684 HOH A O   1 
HETATM 3629 O  O   B HOH E 4 .   ? -0.31714 15.64048  111.03105 0.501 33.71144 ? 684 HOH A O   1 
HETATM 3630 O  O   . HOH E 4 .   ? -3.38492 18.41898  112.56778 1.000 16.86285 ? 685 HOH A O   1 
HETATM 3631 O  O   . HOH E 4 .   ? 31.14295 26.68059  87.76743  1.000 40.52063 ? 686 HOH A O   1 
HETATM 3632 O  O   . HOH E 4 .   ? 34.77844 16.93567  97.72212  1.000 40.57132 ? 687 HOH A O   1 
HETATM 3633 O  O   . HOH E 4 .   ? 23.00926 27.36832  127.61340 1.000 32.95169 ? 688 HOH A O   1 
HETATM 3634 O  O   . HOH E 4 .   ? 3.51893  9.81886   87.36659  1.000 29.43628 ? 689 HOH A O   1 
HETATM 3635 O  O   . HOH E 4 .   ? 5.23428  -5.02081  125.53753 1.000 17.22323 ? 690 HOH A O   1 
HETATM 3636 O  O   . HOH E 4 .   ? 3.99969  -3.11602  117.08785 1.000 40.41261 ? 691 HOH A O   1 
HETATM 3637 O  O   . HOH E 4 .   ? 16.08785 -15.69405 136.65665 1.000 42.04168 ? 692 HOH A O   1 
HETATM 3638 O  O   . HOH E 4 .   ? 8.91301  15.14169  106.99098 1.000 25.77265 ? 693 HOH A O   1 
HETATM 3639 O  O   . HOH E 4 .   ? 5.58199  -3.10275  104.70799 1.000 18.33554 ? 694 HOH A O   1 
HETATM 3640 O  O   . HOH E 4 .   ? 6.29110  -28.80907 118.77083 1.000 34.91057 ? 695 HOH A O   1 
HETATM 3641 O  O   . HOH E 4 .   ? 26.69736 29.01663  90.25971  1.000 30.07023 ? 696 HOH A O   1 
HETATM 3642 O  O   . HOH E 4 .   ? 14.69151 1.19890   130.08657 1.000 24.36787 ? 697 HOH A O   1 
HETATM 3643 O  O   . HOH E 4 .   ? 8.92735  -19.43489 129.24813 1.000 25.46903 ? 698 HOH A O   1 
HETATM 3644 O  O   . HOH E 4 .   ? 26.16575 0.74235   98.89536  1.000 22.63328 ? 699 HOH A O   1 
HETATM 3645 O  O   . HOH E 4 .   ? 28.93540 -13.33605 119.80619 1.000 58.16682 ? 700 HOH A O   1 
HETATM 3646 O  O   . HOH E 4 .   ? 1.21720  34.79993  113.08156 1.000 41.36558 ? 701 HOH A O   1 
HETATM 3647 O  O   . HOH E 4 .   ? 25.21745 7.02013   121.45454 1.000 37.38782 ? 702 HOH A O   1 
HETATM 3648 O  O   . HOH E 4 .   ? 3.38649  -14.99251 130.26404 1.000 29.22493 ? 703 HOH A O   1 
HETATM 3649 O  O   . HOH E 4 .   ? -2.87399 31.39567  118.09790 1.000 36.81559 ? 704 HOH A O   1 
HETATM 3650 O  O   . HOH E 4 .   ? -1.94899 1.58974   107.97175 1.000 32.53650 ? 705 HOH A O   1 
HETATM 3651 O  O   . HOH E 4 .   ? 13.57483 26.76070  101.55035 1.000 19.19433 ? 706 HOH A O   1 
HETATM 3652 O  O   . HOH E 4 .   ? 3.38274  5.80152   102.66741 1.000 17.96508 ? 707 HOH A O   1 
HETATM 3653 O  O   . HOH E 4 .   ? 34.12016 22.70336  116.09623 1.000 48.28800 ? 708 HOH A O   1 
HETATM 3654 O  O   . HOH E 4 .   ? 32.67696 16.67706  90.95902  1.000 47.63660 ? 709 HOH A O   1 
HETATM 3655 O  O   . HOH E 4 .   ? -2.44466 7.05073   118.92069 1.000 21.99157 ? 710 HOH A O   1 
HETATM 3656 O  O   . HOH E 4 .   ? -2.66025 23.14238  98.86340  1.000 33.75984 ? 711 HOH A O   1 
HETATM 3657 O  O   . HOH E 4 .   ? 11.79580 31.85367  106.76216 1.000 34.94112 ? 712 HOH A O   1 
HETATM 3658 O  O   . HOH E 4 .   ? 11.39952 -4.07211  109.11276 1.000 11.89002 ? 713 HOH A O   1 
HETATM 3659 O  O   . HOH E 4 .   ? 38.92027 -23.74577 109.41603 1.000 47.85294 ? 714 HOH A O   1 
HETATM 3660 O  O   . HOH E 4 .   ? 24.22494 -2.20725  108.32167 1.000 20.21334 ? 715 HOH A O   1 
HETATM 3661 O  O   . HOH E 4 .   ? 25.54379 4.14472   116.82612 1.000 21.30790 ? 716 HOH A O   1 
HETATM 3662 O  O   . HOH E 4 .   ? 4.37312  26.60291  110.70685 1.000 26.91306 ? 717 HOH A O   1 
HETATM 3663 O  O   . HOH E 4 .   ? 15.05594 16.51738  112.91794 1.000 27.66100 ? 718 HOH A O   1 
HETATM 3664 O  O   . HOH E 4 .   ? 21.26050 31.60874  104.26256 1.000 39.75041 ? 719 HOH A O   1 
HETATM 3665 O  O   . HOH E 4 .   ? -5.58948 30.92252  117.18622 1.000 45.66177 ? 720 HOH A O   1 
HETATM 3666 O  O   . HOH E 4 .   ? 2.04051  28.59031  108.09320 1.000 48.31411 ? 721 HOH A O   1 
HETATM 3667 O  O   . HOH E 4 .   ? 32.00692 -35.46471 114.48049 1.000 46.07765 ? 722 HOH A O   1 
HETATM 3668 O  O   . HOH E 4 .   ? 4.50429  9.34172   92.19759  1.000 18.94386 ? 723 HOH A O   1 
HETATM 3669 O  O   . HOH E 4 .   ? 17.82707 -9.06424  128.41401 1.000 30.87367 ? 724 HOH A O   1 
HETATM 3670 O  O   . HOH E 4 .   ? 14.73081 7.99722   83.96511  1.000 27.51046 ? 725 HOH A O   1 
HETATM 3671 O  O   . HOH E 4 .   ? 15.09343 -4.28755  117.60346 1.000 23.72931 ? 726 HOH A O   1 
HETATM 3672 O  O   . HOH E 4 .   ? 13.67967 -3.66820  120.23117 1.000 31.03187 ? 727 HOH A O   1 
HETATM 3673 O  O   . HOH E 4 .   ? 19.68839 13.97897  102.97887 1.000 35.81582 ? 728 HOH A O   1 
HETATM 3674 O  O   . HOH E 4 .   ? 10.04706 -5.25107  117.37298 1.000 27.19496 ? 729 HOH A O   1 
HETATM 3675 O  O   . HOH E 4 .   ? 22.85828 7.20435   84.41001  1.000 36.06560 ? 730 HOH A O   1 
HETATM 3676 O  O   . HOH E 4 .   ? 1.99018  25.69809  109.22416 1.000 26.72290 ? 731 HOH A O   1 
HETATM 3677 O  O   . HOH E 4 .   ? -4.20682 28.61955  124.75448 1.000 31.39467 ? 732 HOH A O   1 
HETATM 3678 O  O   . HOH E 4 .   ? 10.38866 -19.65385 131.57302 1.000 37.27957 ? 733 HOH A O   1 
HETATM 3679 O  O   . HOH E 4 .   ? 24.97403 23.42523  122.10352 1.000 31.74352 ? 734 HOH A O   1 
HETATM 3680 O  O   . HOH E 4 .   ? 12.18321 8.83769   88.76327  1.000 22.56344 ? 735 HOH A O   1 
HETATM 3681 O  O   . HOH E 4 .   ? 25.04351 21.27486  122.36610 1.000 31.76918 ? 736 HOH A O   1 
HETATM 3682 O  O   . HOH E 4 .   ? 8.90263  2.92609   117.54534 1.000 23.29363 ? 737 HOH A O   1 
HETATM 3683 O  O   . HOH E 4 .   ? 4.06341  -4.42934  136.38568 1.000 31.73644 ? 738 HOH A O   1 
HETATM 3684 O  O   . HOH E 4 .   ? 32.62810 16.27539  95.68138  1.000 34.54968 ? 739 HOH A O   1 
HETATM 3685 O  O   . HOH E 4 .   ? -3.93369 29.40637  120.23673 1.000 34.20452 ? 740 HOH A O   1 
HETATM 3686 O  O   . HOH E 4 .   ? 2.04102  21.39730  129.59032 1.000 40.71327 ? 741 HOH A O   1 
HETATM 3687 O  O   . HOH E 4 .   ? 0.58055  18.77977  107.28283 1.000 44.78163 ? 742 HOH A O   1 
HETATM 3688 O  O   . HOH E 4 .   ? 8.40916  7.52384   89.36775  1.000 31.37951 ? 743 HOH A O   1 
HETATM 3689 O  O   . HOH E 4 .   ? 18.98254 18.97486  104.07763 1.000 23.69458 ? 744 HOH A O   1 
HETATM 3690 O  O   . HOH E 4 .   ? 23.53805 36.16077  130.71025 1.000 31.71686 ? 745 HOH A O   1 
HETATM 3691 O  O   . HOH E 4 .   ? 0.00000  -0.00000  116.35534 0.50  30.37956 ? 746 HOH A O   1 
HETATM 3692 O  O   . HOH E 4 .   ? 6.05417  6.83787   89.87017  1.000 40.48343 ? 747 HOH A O   1 
HETATM 3693 O  O   . HOH E 4 .   ? -0.29796 16.36939  105.54723 1.000 50.03683 ? 748 HOH A O   1 
HETATM 3694 O  O   . HOH E 4 .   ? 19.16200 -14.50571 127.96278 1.000 31.35649 ? 749 HOH A O   1 
HETATM 3695 O  O   . HOH E 4 .   ? 13.39904 -7.48135  118.38419 1.000 38.59669 ? 750 HOH A O   1 
HETATM 3696 O  O   . HOH E 4 .   ? 0.24512  1.71329   113.99820 1.000 46.48940 ? 751 HOH A O   1 
HETATM 3697 O  O   . HOH E 4 .   ? -5.12959 21.64741  126.48705 1.000 30.34549 ? 752 HOH A O   1 
HETATM 3698 O  O   . HOH E 4 .   ? 13.58421 -1.73193  137.27498 1.000 43.52332 ? 753 HOH A O   1 
HETATM 3699 O  O   . HOH E 4 .   ? 11.08505 29.18152  104.90216 1.000 47.63882 ? 754 HOH A O   1 
HETATM 3700 O  O   . HOH E 4 .   ? 6.81150  -2.38347  115.05905 1.000 35.22644 ? 755 HOH A O   1 
HETATM 3701 O  O   . HOH E 4 .   ? 18.80709 12.69702  101.32896 1.000 42.01747 ? 756 HOH A O   1 
HETATM 3702 O  O   . HOH E 4 .   ? 5.77537  -4.29308  118.55748 1.000 39.65742 ? 757 HOH A O   1 
HETATM 3703 O  O   . HOH E 4 .   ? 6.99091  -0.96282  136.36630 1.000 38.23009 ? 758 HOH A O   1 
HETATM 3704 O  O   . HOH E 4 .   ? 8.05487  -3.30189  117.48876 1.000 29.68734 ? 759 HOH A O   1 
HETATM 3705 O  O   . HOH E 4 .   ? 19.88608 15.16146  101.18013 1.000 35.74748 ? 760 HOH A O   1 
HETATM 3706 O  O   . HOH E 4 .   ? 18.33309 10.95157  82.01112  1.000 30.01802 ? 761 HOH A O   1 
HETATM 3707 O  O   . HOH E 4 .   ? 16.74872 2.19205   131.64996 1.000 37.64327 ? 762 HOH A O   1 
HETATM 3708 O  O   . HOH E 4 .   ? 17.33097 -2.27325  130.80323 1.000 47.35066 ? 763 HOH A O   1 
HETATM 3709 O  O   . HOH E 4 .   ? 19.64371 17.34172  101.92476 1.000 37.10163 ? 764 HOH A O   1 
HETATM 3710 O  O   . HOH E 4 .   ? 26.14145 4.40424   88.11982  1.000 41.23363 ? 765 HOH A O   1 
HETATM 3711 O  O   . HOH E 4 .   ? 12.49109 -5.33894  118.63150 1.000 35.63035 ? 766 HOH A O   1 
HETATM 3712 O  O   . HOH E 4 .   ? 16.31822 -5.68647  121.60552 1.000 34.76025 ? 767 HOH A O   1 
HETATM 3713 O  O   . HOH E 4 .   ? 1.46313  14.90837  130.36921 1.000 36.70587 ? 768 HOH A O   1 
HETATM 3714 O  O   . HOH E 4 .   ? 11.25582 30.49248  101.96870 1.000 42.08371 ? 769 HOH A O   1 
HETATM 3715 O  O   . HOH E 4 .   ? 24.61680 9.30325   81.38286  1.000 44.79040 ? 770 HOH A O   1 
HETATM 3716 O  O   . HOH E 4 .   ? 9.33708  -0.28854  138.06552 1.000 31.75033 ? 771 HOH A O   1 
HETATM 3717 O  O   . HOH E 4 .   ? 18.61021 -11.60487 131.36883 1.000 44.56855 ? 772 HOH A O   1 
HETATM 3718 O  O   . HOH E 4 .   ? 15.58614 3.04237   134.19439 1.000 46.67719 ? 773 HOH A O   1 
HETATM 3719 O  O   . HOH E 4 .   ? -2.86332 16.11729  106.84660 1.000 34.79794 ? 774 HOH A O   1 
HETATM 3720 O  O   . HOH E 4 .   ? 15.17819 4.20847   96.31041  1.000 16.90632 ? 775 HOH A O   1 
HETATM 3721 O  O   . HOH E 4 .   ? 7.49802  -21.62706 128.62901 1.000 46.54658 ? 776 HOH A O   1 
HETATM 3722 O  O   . HOH E 4 .   ? -2.32718 16.00211  113.42576 1.000 26.81168 ? 777 HOH A O   1 
HETATM 3723 O  O   . HOH E 4 .   ? 4.88385  3.34306   93.53762  1.000 47.89594 ? 778 HOH A O   1 
HETATM 3724 O  O   . HOH E 4 .   ? 10.76660 8.85718   135.50432 1.000 48.19024 ? 779 HOH A O   1 
HETATM 3725 O  O   . HOH E 4 .   ? -1.07705 17.27975  108.91852 1.000 36.09772 ? 780 HOH A O   1 
HETATM 3726 O  O   . HOH E 4 .   ? 18.78509 -11.69508 126.81730 1.000 31.58793 ? 781 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . TYR A 3   ? 0.54680 0.46171 0.21453 -0.15696 -0.07320 0.04150  3   TYR A N   
2    C  CA  . TYR A 3   ? 0.38444 0.42582 0.22848 -0.07281 -0.03412 0.04779  3   TYR A CA  
3    C  C   . TYR A 3   ? 0.37326 0.42883 0.23581 -0.05202 -0.02296 0.04898  3   TYR A C   
4    O  O   . TYR A 3   ? 0.42296 0.45769 0.26234 -0.04518 -0.04274 0.07026  3   TYR A O   
5    C  CB  . TYR A 3   ? 0.32916 0.38432 0.19432 -0.01051 0.00359  0.01606  3   TYR A CB  
6    C  CG  . TYR A 3   ? 0.33082 0.37021 0.16562 0.01210  0.01591  -0.00238 3   TYR A CG  
7    C  CD1 . TYR A 3   ? 0.33628 0.37549 0.17215 0.02039  0.02234  0.00029  3   TYR A CD1 
8    C  CD2 . TYR A 3   ? 0.32875 0.37118 0.16884 0.01629  0.01603  -0.01218 3   TYR A CD2 
9    C  CE1 . TYR A 3   ? 0.35507 0.37781 0.17515 0.03051  0.03494  0.00387  3   TYR A CE1 
10   C  CE2 . TYR A 3   ? 0.33834 0.37833 0.18946 0.01242  0.02517  -0.00479 3   TYR A CE2 
11   C  CZ  . TYR A 3   ? 0.36951 0.38210 0.19728 0.01143  0.04252  0.00415  3   TYR A CZ  
12   O  OH  . TYR A 3   ? 0.40706 0.40424 0.23699 -0.02099 0.04091  0.00851  3   TYR A OH  
13   N  N   . GLN A 4   ? 0.38783 0.40050 0.20572 -0.04020 0.00406  0.01902  4   GLN A N   
14   C  CA  A GLN A 4   ? 0.40490 0.38852 0.18258 -0.03778 0.01233  -0.01003 4   GLN A CA  
15   C  CA  B GLN A 4   ? 0.41049 0.41245 0.22800 -0.04889 0.00905  0.01901  4   GLN A CA  
16   C  C   . GLN A 4   ? 0.36870 0.38505 0.17838 -0.04576 -0.01494 0.00690  4   GLN A C   
17   O  O   . GLN A 4   ? 0.37624 0.44791 0.16005 -0.04909 -0.04495 0.02856  4   GLN A O   
18   C  CB  A GLN A 4   ? 0.49152 0.41851 0.21849 -0.03787 0.04432  -0.05377 4   GLN A CB  
19   C  CB  B GLN A 4   ? 0.53834 0.49993 0.30494 -0.06066 0.02105  0.01655  4   GLN A CB  
20   C  CG  A GLN A 4   ? 0.55759 0.43878 0.28994 -0.01710 0.06280  -0.08094 4   GLN A CG  
21   C  CG  B GLN A 4   ? 0.65033 0.61944 0.39305 -0.03910 0.00001  0.05602  4   GLN A CG  
22   C  CD  A GLN A 4   ? 0.59902 0.50107 0.41097 0.04184  0.07728  -0.07495 4   GLN A CD  
23   C  CD  B GLN A 4   ? 0.76629 0.75433 0.48341 -0.00991 0.01488  0.07381  4   GLN A CD  
24   O  OE1 A GLN A 4   ? 0.62400 0.54247 0.59694 0.11498  0.11519  -0.07103 4   GLN A OE1 
25   O  OE1 B GLN A 4   ? 0.78233 0.81704 0.74864 0.04358  0.03598  0.05314  4   GLN A OE1 
26   N  NE2 A GLN A 4   ? 0.58965 0.50823 0.35582 0.02620  0.06557  -0.08890 4   GLN A NE2 
27   N  NE2 B GLN A 4   ? 0.91445 0.80823 0.34555 -0.04107 -0.01074 0.08176  4   GLN A NE2 
28   N  N   . PRO A 5   ? 0.33656 0.33516 0.15838 -0.03966 -0.01948 -0.02239 5   PRO A N   
29   C  CA  . PRO A 5   ? 0.34201 0.31547 0.16144 -0.05582 -0.02665 -0.02954 5   PRO A CA  
30   C  C   . PRO A 5   ? 0.35814 0.33769 0.17405 -0.07376 -0.03838 -0.05122 5   PRO A C   
31   O  O   . PRO A 5   ? 0.38065 0.34896 0.20366 -0.06910 -0.01565 -0.07456 5   PRO A O   
32   C  CB  . PRO A 5   ? 0.37633 0.33743 0.15977 -0.01702 -0.01742 -0.01447 5   PRO A CB  
33   C  CG  . PRO A 5   ? 0.39237 0.38623 0.16750 0.01277  -0.00791 -0.01518 5   PRO A CG  
34   C  CD  . PRO A 5   ? 0.35561 0.36821 0.17162 0.00436  -0.01127 -0.02245 5   PRO A CD  
35   N  N   . THR A 6   ? 0.33851 0.36368 0.17607 -0.08741 -0.06133 -0.04160 6   THR A N   
36   C  CA  . THR A 6   ? 0.36145 0.39394 0.16963 -0.10720 -0.06204 -0.02172 6   THR A CA  
37   C  C   . THR A 6   ? 0.35335 0.35625 0.15681 -0.08698 -0.06705 -0.01300 6   THR A C   
38   O  O   . THR A 6   ? 0.33771 0.33987 0.14213 -0.07691 -0.07405 -0.01285 6   THR A O   
39   C  CB  . THR A 6   ? 0.40896 0.50780 0.19125 -0.11501 -0.06338 0.01307  6   THR A CB  
40   O  OG1 . THR A 6   ? 0.40757 0.56452 0.22743 -0.05470 -0.06164 0.04572  6   THR A OG1 
41   C  CG2 . THR A 6   ? 0.43391 0.59711 0.19343 -0.14262 -0.05211 0.01743  6   THR A CG2 
42   N  N   . PRO A 7   ? 0.37149 0.36080 0.18457 -0.09703 -0.06014 -0.02837 7   PRO A N   
43   C  CA  . PRO A 7   ? 0.35647 0.40510 0.18724 -0.11766 -0.06804 -0.01178 7   PRO A CA  
44   C  C   . PRO A 7   ? 0.31420 0.42487 0.19829 -0.11271 -0.07774 0.01348  7   PRO A C   
45   O  O   . PRO A 7   ? 0.33960 0.42861 0.19841 -0.12895 -0.05982 0.01220  7   PRO A O   
46   C  CB  . PRO A 7   ? 0.41161 0.41121 0.23834 -0.12921 -0.06827 -0.03487 7   PRO A CB  
47   C  CG  . PRO A 7   ? 0.42544 0.38455 0.28538 -0.11649 -0.06321 -0.04079 7   PRO A CG  
48   C  CD  . PRO A 7   ? 0.38053 0.36150 0.25775 -0.09504 -0.05733 -0.04810 7   PRO A CD  
49   N  N   . GLU A 8   ? 0.31405 0.44665 0.22303 -0.09953 -0.11455 0.00811  8   GLU A N   
50   C  CA  A GLU A 8   ? 0.32017 0.48602 0.23895 -0.06351 -0.12528 0.01465  8   GLU A CA  
51   C  CA  B GLU A 8   ? 0.34191 0.46951 0.25822 -0.07821 -0.06354 0.02218  8   GLU A CA  
52   C  C   . GLU A 8   ? 0.29205 0.46534 0.24441 -0.05983 -0.08712 0.03573  8   GLU A C   
53   O  O   . GLU A 8   ? 0.26890 0.49084 0.29040 0.00111  -0.10317 0.04662  8   GLU A O   
54   C  CB  A GLU A 8   ? 0.43058 0.56715 0.26513 -0.02909 -0.15231 -0.00157 8   GLU A CB  
55   C  CB  B GLU A 8   ? 0.44356 0.53084 0.32412 -0.03360 -0.01908 0.04568  8   GLU A CB  
56   C  CG  A GLU A 8   ? 0.49327 0.64922 0.30609 -0.02794 -0.17013 -0.05585 8   GLU A CG  
57   C  CG  B GLU A 8   ? 0.49603 0.59327 0.42138 0.01356  0.01494  0.06703  8   GLU A CG  
58   C  CD  A GLU A 8   ? 0.51318 0.66585 0.36862 -0.04453 -0.15670 -0.09568 8   GLU A CD  
59   C  CD  B GLU A 8   ? 0.56347 0.63584 0.48156 0.04504  0.00322  0.12331  8   GLU A CD  
60   O  OE1 A GLU A 8   ? 0.51257 0.58506 0.27970 -0.03054 -0.13353 -0.07274 8   GLU A OE1 
61   O  OE1 B GLU A 8   ? 0.67436 0.70524 0.39994 0.04655  0.02941  0.19680  8   GLU A OE1 
62   O  OE2 A GLU A 8   ? 0.53613 0.76566 0.46589 -0.08836 -0.13354 -0.16819 8   GLU A OE2 
63   O  OE2 B GLU A 8   ? 0.58558 0.60735 0.60463 0.08108  -0.04175 0.15510  8   GLU A OE2 
64   N  N   . ASP A 9   ? 0.28262 0.42399 0.19504 -0.08235 -0.08901 0.06371  9   ASP A N   
65   C  CA  . ASP A 9   ? 0.27628 0.34486 0.20181 -0.05358 -0.08549 0.05677  9   ASP A CA  
66   C  C   . ASP A 9   ? 0.26226 0.29700 0.19932 -0.04643 -0.08632 0.03575  9   ASP A C   
67   O  O   . ASP A 9   ? 0.30893 0.28129 0.22586 -0.04663 -0.08624 0.02987  9   ASP A O   
68   C  CB  . ASP A 9   ? 0.27964 0.33031 0.21085 -0.04528 -0.08092 0.05122  9   ASP A CB  
69   C  CG  . ASP A 9   ? 0.30094 0.36717 0.24519 -0.04268 -0.05807 0.07238  9   ASP A CG  
70   O  OD1 . ASP A 9   ? 0.34435 0.40491 0.30421 -0.00664 -0.02772 0.12269  9   ASP A OD1 
71   O  OD2 . ASP A 9   ? 0.32480 0.38504 0.23749 -0.06329 -0.04031 0.05891  9   ASP A OD2 
72   N  N   . ARG A 10  ? 0.23077 0.28622 0.16587 -0.03839 -0.06911 0.01683  10  ARG A N   
73   C  CA  . ARG A 10  ? 0.22413 0.28331 0.16055 -0.01964 -0.06130 -0.01024 10  ARG A CA  
74   C  C   . ARG A 10  ? 0.20760 0.24490 0.14126 -0.02427 -0.05032 -0.01949 10  ARG A C   
75   O  O   . ARG A 10  ? 0.20353 0.26673 0.14683 -0.01452 -0.03894 -0.02466 10  ARG A O   
76   C  CB  . ARG A 10  ? 0.27558 0.36927 0.21251 0.03153  -0.07066 -0.01771 10  ARG A CB  
77   C  CG  . ARG A 10  ? 0.34502 0.52540 0.31617 0.07890  -0.10166 -0.03551 10  ARG A CG  
78   C  CD  . ARG A 10  ? 0.43125 0.63443 0.46192 0.08161  -0.08244 -0.06018 10  ARG A CD  
79   N  NE  . ARG A 10  ? 0.61974 0.65795 0.55925 0.04671  -0.09325 -0.03114 10  ARG A NE  
80   C  CZ  . ARG A 10  ? 0.60859 0.56601 0.58034 0.00184  -0.16644 -0.03579 10  ARG A CZ  
81   N  NH1 . ARG A 10  ? 0.51745 0.47827 0.67182 -0.04604 -0.14140 -0.09619 10  ARG A NH1 
82   N  NH2 . ARG A 10  ? 0.72747 0.59404 0.52464 -0.02082 -0.24515 -0.00083 10  ARG A NH2 
83   N  N   . PHE A 11  ? 0.20245 0.22249 0.11920 -0.02443 -0.04422 -0.00555 11  PHE A N   
84   C  CA  . PHE A 11  ? 0.18875 0.21123 0.11353 -0.02140 -0.03920 -0.00843 11  PHE A CA  
85   C  C   . PHE A 11  ? 0.19495 0.19945 0.10562 -0.03666 -0.04212 -0.01794 11  PHE A C   
86   O  O   . PHE A 11  ? 0.24342 0.21205 0.10724 -0.04067 -0.03623 -0.02132 11  PHE A O   
87   C  CB  . PHE A 11  ? 0.19534 0.22178 0.11861 -0.02482 -0.02698 -0.00673 11  PHE A CB  
88   C  CG  . PHE A 11  ? 0.19792 0.22630 0.11372 -0.02726 -0.03232 -0.00489 11  PHE A CG  
89   C  CD1 . PHE A 11  ? 0.20505 0.22400 0.12622 -0.03120 -0.02427 -0.00384 11  PHE A CD1 
90   C  CD2 . PHE A 11  ? 0.21537 0.24037 0.12050 -0.02998 -0.02298 0.00257  11  PHE A CD2 
91   C  CE1 . PHE A 11  ? 0.22228 0.23078 0.14208 -0.03081 -0.02121 0.00648  11  PHE A CE1 
92   C  CE2 . PHE A 11  ? 0.23687 0.24883 0.13381 -0.04219 -0.02225 0.00900  11  PHE A CE2 
93   C  CZ  . PHE A 11  ? 0.22743 0.24389 0.13898 -0.03780 -0.02069 0.01378  11  PHE A CZ  
94   N  N   . THR A 12  ? 0.17859 0.18787 0.10600 -0.02859 -0.03693 -0.01486 12  THR A N   
95   C  CA  . THR A 12  ? 0.17627 0.19315 0.10540 -0.02930 -0.03545 -0.01651 12  THR A CA  
96   C  C   . THR A 12  ? 0.17063 0.17880 0.10283 -0.02775 -0.02681 -0.02202 12  THR A C   
97   O  O   . THR A 12  ? 0.17031 0.18321 0.11412 -0.02246 -0.03553 -0.02512 12  THR A O   
98   C  CB  . THR A 12  ? 0.16981 0.22201 0.12105 -0.03165 -0.03332 -0.03532 12  THR A CB  
99   O  OG1 . THR A 12  ? 0.19347 0.22434 0.12788 -0.03171 -0.02025 -0.03907 12  THR A OG1 
100  C  CG2 . THR A 12  ? 0.16371 0.25554 0.14706 -0.03103 -0.03860 -0.03311 12  THR A CG2 
101  N  N   . PHE A 13  ? 0.17135 0.17887 0.10101 -0.02433 -0.03312 -0.01457 13  PHE A N   
102  C  CA  . PHE A 13  ? 0.16197 0.18267 0.10726 -0.01836 -0.02950 -0.00692 13  PHE A CA  
103  C  C   . PHE A 13  ? 0.17165 0.19189 0.10949 -0.02617 -0.02866 -0.01553 13  PHE A C   
104  O  O   . PHE A 13  ? 0.18617 0.21144 0.12355 -0.05536 -0.02459 -0.01040 13  PHE A O   
105  C  CB  . PHE A 13  ? 0.18036 0.19026 0.12530 -0.00999 -0.01295 -0.01002 13  PHE A CB  
106  C  CG  . PHE A 13  ? 0.18678 0.19556 0.12356 -0.01450 -0.01144 -0.01267 13  PHE A CG  
107  C  CD1 . PHE A 13  ? 0.20796 0.21309 0.11977 -0.01475 -0.00512 -0.01233 13  PHE A CD1 
108  C  CD2 . PHE A 13  ? 0.19108 0.21072 0.14707 -0.01681 -0.00249 -0.01442 13  PHE A CD2 
109  C  CE1 . PHE A 13  ? 0.22916 0.22895 0.13030 -0.01393 0.00334  -0.00215 13  PHE A CE1 
110  C  CE2 . PHE A 13  ? 0.19341 0.22827 0.16541 -0.01774 0.00480  -0.00917 13  PHE A CE2 
111  C  CZ  . PHE A 13  ? 0.21753 0.22702 0.15661 -0.01623 0.01868  0.00017  13  PHE A CZ  
112  N  N   . GLY A 14  ? 0.17079 0.19503 0.10517 -0.01754 -0.02656 -0.01168 14  GLY A N   
113  C  CA  . GLY A 14  ? 0.16879 0.20279 0.10994 -0.01821 -0.02101 -0.00333 14  GLY A CA  
114  C  C   . GLY A 14  ? 0.16026 0.19524 0.11884 -0.03243 -0.03111 -0.00947 14  GLY A C   
115  O  O   . GLY A 14  ? 0.15772 0.19757 0.13246 -0.03028 -0.01751 -0.01138 14  GLY A O   
116  N  N   . LEU A 15  ? 0.17374 0.19135 0.13112 -0.02846 -0.02057 -0.01670 15  LEU A N   
117  C  CA  . LEU A 15  ? 0.18501 0.18571 0.15122 -0.03245 -0.02143 -0.02737 15  LEU A CA  
118  C  C   . LEU A 15  ? 0.18577 0.17198 0.14679 -0.02338 -0.02203 -0.01991 15  LEU A C   
119  O  O   . LEU A 15  ? 0.19867 0.18756 0.18374 -0.01097 -0.02158 -0.03157 15  LEU A O   
120  C  CB  . LEU A 15  ? 0.20449 0.19505 0.18864 -0.05193 -0.01141 -0.03791 15  LEU A CB  
121  C  CG  . LEU A 15  ? 0.23052 0.23700 0.23642 -0.06637 -0.01243 -0.06273 15  LEU A CG  
122  C  CD1 . LEU A 15  ? 0.24042 0.24082 0.28720 -0.07615 0.00607  -0.06262 15  LEU A CD1 
123  C  CD2 . LEU A 15  ? 0.27513 0.28468 0.22342 -0.07775 -0.02128 -0.06954 15  LEU A CD2 
124  N  N   . TRP A 16  ? 0.18158 0.17227 0.13490 -0.02038 -0.02921 -0.01265 16  TRP A N   
125  C  CA  . TRP A 16  ? 0.17561 0.18018 0.12997 -0.02034 -0.03175 -0.00519 16  TRP A CA  
126  C  C   . TRP A 16  ? 0.17075 0.18625 0.13570 -0.01736 -0.03135 -0.00245 16  TRP A C   
127  O  O   . TRP A 16  ? 0.18581 0.22530 0.14051 -0.02220 -0.03813 0.01325  16  TRP A O   
128  C  CB  . TRP A 16  ? 0.18732 0.19323 0.13546 -0.01084 -0.02265 -0.00307 16  TRP A CB  
129  C  CG  . TRP A 16  ? 0.17938 0.18774 0.12829 -0.01801 -0.02357 -0.00634 16  TRP A CG  
130  C  CD1 . TRP A 16  ? 0.18675 0.19197 0.15269 -0.02528 -0.02921 -0.02054 16  TRP A CD1 
131  C  CD2 . TRP A 16  ? 0.18864 0.19061 0.12332 -0.02121 -0.02098 -0.00736 16  TRP A CD2 
132  N  NE1 . TRP A 16  ? 0.19403 0.19791 0.15795 -0.02031 -0.03021 -0.01444 16  TRP A NE1 
133  C  CE2 . TRP A 16  ? 0.19130 0.19279 0.13927 -0.02084 -0.02631 -0.01191 16  TRP A CE2 
134  C  CE3 . TRP A 16  ? 0.19325 0.19666 0.13036 -0.02236 -0.02578 -0.00344 16  TRP A CE3 
135  C  CZ2 . TRP A 16  ? 0.19799 0.20092 0.14605 -0.00623 -0.02603 -0.00642 16  TRP A CZ2 
136  C  CZ3 . TRP A 16  ? 0.19900 0.20802 0.13545 -0.02314 -0.02439 -0.00310 16  TRP A CZ3 
137  C  CH2 . TRP A 16  ? 0.19739 0.20969 0.14728 -0.01003 -0.02840 0.00064  16  TRP A CH2 
138  N  N   . THR A 17  ? 0.16957 0.17056 0.12617 -0.02010 -0.02443 -0.00141 17  THR A N   
139  C  CA  . THR A 17  ? 0.16932 0.17036 0.12872 -0.02072 -0.02945 -0.00561 17  THR A CA  
140  C  C   . THR A 17  ? 0.17165 0.18484 0.12826 -0.01738 -0.03291 -0.01131 17  THR A C   
141  O  O   . THR A 17  ? 0.17148 0.19793 0.14351 -0.01958 -0.02700 -0.01206 17  THR A O   
142  C  CB  . THR A 17  ? 0.17397 0.17577 0.13882 -0.01796 -0.04606 -0.01331 17  THR A CB  
143  O  OG1 . THR A 17  ? 0.17786 0.18482 0.13502 -0.02311 -0.04814 -0.00066 17  THR A OG1 
144  C  CG2 . THR A 17  ? 0.18484 0.17307 0.16314 -0.00532 -0.04519 -0.01123 17  THR A CG2 
145  N  N   . VAL A 18  ? 0.18312 0.19453 0.12862 -0.00865 -0.02247 -0.02142 18  VAL A N   
146  C  CA  . VAL A 18  ? 0.19368 0.20454 0.14183 -0.00381 -0.02288 -0.02246 18  VAL A CA  
147  C  C   . VAL A 18  ? 0.17601 0.21210 0.15749 -0.00551 -0.02257 -0.01021 18  VAL A C   
148  O  O   . VAL A 18  ? 0.19455 0.25104 0.18035 0.02170  -0.00849 -0.00543 18  VAL A O   
149  C  CB  . VAL A 18  ? 0.22298 0.22657 0.14092 -0.01278 -0.03593 -0.01902 18  VAL A CB  
150  C  CG1 . VAL A 18  ? 0.27435 0.24174 0.13356 -0.01993 -0.04077 -0.00420 18  VAL A CG1 
151  C  CG2 . VAL A 18  ? 0.22971 0.24471 0.16400 -0.01819 -0.04192 -0.02469 18  VAL A CG2 
152  N  N   . GLY A 19  ? 0.18342 0.18946 0.14717 -0.01950 -0.02856 -0.00494 19  GLY A N   
153  C  CA  . GLY A 19  ? 0.19652 0.19719 0.15812 -0.01605 -0.03168 -0.00373 19  GLY A CA  
154  C  C   . GLY A 19  ? 0.20339 0.19913 0.16686 -0.01719 -0.03885 -0.00087 19  GLY A C   
155  O  O   . GLY A 19  ? 0.25006 0.21167 0.19191 -0.02525 -0.06418 0.01610  19  GLY A O   
156  N  N   . TRP A 20  ? 0.18590 0.20061 0.14842 -0.01240 -0.03229 -0.00802 20  TRP A N   
157  C  CA  . TRP A 20  ? 0.17952 0.20692 0.14367 -0.01081 -0.03179 -0.00329 20  TRP A CA  
158  C  C   . TRP A 20  ? 0.18469 0.21376 0.14224 -0.01053 -0.02284 0.01409  20  TRP A C   
159  O  O   . TRP A 20  ? 0.19519 0.22065 0.15095 -0.00106 -0.00491 0.02075  20  TRP A O   
160  C  CB  . TRP A 20  ? 0.18856 0.21167 0.14520 -0.01581 -0.03646 -0.00552 20  TRP A CB  
161  C  CG  . TRP A 20  ? 0.19570 0.22546 0.13992 -0.03410 -0.02541 0.00275  20  TRP A CG  
162  C  CD1 . TRP A 20  ? 0.22952 0.28102 0.13825 -0.06767 -0.02040 0.00877  20  TRP A CD1 
163  C  CD2 . TRP A 20  ? 0.18722 0.21394 0.13224 -0.02174 -0.02073 -0.00629 20  TRP A CD2 
164  N  NE1 . TRP A 20  ? 0.25179 0.29693 0.13530 -0.07971 -0.02256 0.00391  20  TRP A NE1 
165  C  CE2 . TRP A 20  ? 0.22104 0.24489 0.13657 -0.04820 -0.02756 -0.00033 20  TRP A CE2 
166  C  CE3 . TRP A 20  ? 0.18271 0.20898 0.14630 -0.00865 -0.00850 -0.00786 20  TRP A CE3 
167  C  CZ2 . TRP A 20  ? 0.21735 0.24222 0.16166 -0.04380 -0.03634 0.00020  20  TRP A CZ2 
168  C  CZ3 . TRP A 20  ? 0.18297 0.21674 0.16446 -0.00951 -0.01672 -0.01137 20  TRP A CZ3 
169  C  CH2 . TRP A 20  ? 0.19366 0.23137 0.17948 -0.02556 -0.03066 -0.00418 20  TRP A CH2 
170  N  N   . GLN A 21  ? 0.18151 0.21667 0.15561 -0.00533 -0.03060 0.02292  21  GLN A N   
171  C  CA  . GLN A 21  ? 0.19385 0.21714 0.18355 -0.00737 -0.04203 0.02635  21  GLN A CA  
172  C  C   . GLN A 21  ? 0.18530 0.21247 0.19069 -0.00406 -0.03656 0.02143  21  GLN A C   
173  O  O   . GLN A 21  ? 0.18791 0.22380 0.22314 0.00149  -0.03805 0.00685  21  GLN A O   
174  C  CB  . GLN A 21  ? 0.22602 0.23052 0.21553 -0.02639 -0.05833 0.03184  21  GLN A CB  
175  C  CG  . GLN A 21  ? 0.26454 0.26253 0.24609 -0.04950 -0.04989 0.03413  21  GLN A CG  
176  C  CD  . GLN A 21  ? 0.37039 0.30192 0.31413 -0.07297 -0.01266 0.04367  21  GLN A CD  
177  O  OE1 . GLN A 21  ? 0.42617 0.37209 0.39320 -0.09869 0.05715  0.06407  21  GLN A OE1 
178  N  NE2 . GLN A 21  ? 0.41707 0.28355 0.32849 -0.05734 -0.03018 0.03421  21  GLN A NE2 
179  N  N   . GLY A 22  ? 0.17742 0.21419 0.19346 -0.01627 -0.03419 0.02223  22  GLY A N   
180  C  CA  . GLY A 22  ? 0.17575 0.23163 0.20038 -0.02445 -0.04158 0.02888  22  GLY A CA  
181  C  C   . GLY A 22  ? 0.17656 0.29089 0.20384 -0.03870 -0.03523 0.04407  22  GLY A C   
182  O  O   . GLY A 22  ? 0.17715 0.30924 0.19825 -0.05379 -0.02538 0.04020  22  GLY A O   
183  N  N   A ARG A 23  ? 0.17357 0.33541 0.21046 -0.05201 -0.05634 0.05264  23  ARG A N   
184  N  N   B ARG A 23  ? 0.19178 0.33623 0.19340 -0.03726 -0.03365 0.06198  23  ARG A N   
185  C  CA  A ARG A 23  ? 0.18314 0.40907 0.24330 -0.04226 -0.05738 0.06686  23  ARG A CA  
186  C  CA  B ARG A 23  ? 0.20233 0.40450 0.19064 -0.01815 -0.01319 0.09422  23  ARG A CA  
187  C  C   A ARG A 23  ? 0.18823 0.44115 0.24409 0.00550  -0.03431 0.03131  23  ARG A C   
188  C  C   B ARG A 23  ? 0.20519 0.42209 0.16277 0.00966  -0.01369 0.06688  23  ARG A C   
189  O  O   A ARG A 23  ? 0.18714 0.48978 0.33838 0.01866  -0.03650 -0.00232 23  ARG A O   
190  O  O   B ARG A 23  ? 0.22872 0.44557 0.16824 0.01780  -0.04288 0.07481  23  ARG A O   
191  C  CB  A ARG A 23  ? 0.24916 0.49330 0.32245 -0.04451 -0.06085 0.12253  23  ARG A CB  
192  C  CB  B ARG A 23  ? 0.21088 0.48362 0.24705 -0.02011 -0.00827 0.15278  23  ARG A CB  
193  C  CG  A ARG A 23  ? 0.37245 0.58882 0.40282 -0.02674 -0.07860 0.12550  23  ARG A CG  
194  C  CG  B ARG A 23  ? 0.26989 0.53650 0.27169 -0.00811 0.00751  0.18670  23  ARG A CG  
195  C  CD  A ARG A 23  ? 0.50533 0.61856 0.52394 -0.02948 -0.06535 0.10656  23  ARG A CD  
196  C  CD  B ARG A 23  ? 0.33733 0.54295 0.30459 0.01665  0.03002  0.18064  23  ARG A CD  
197  N  NE  A ARG A 23  ? 0.58870 0.66236 0.58150 -0.07917 -0.06315 0.09863  23  ARG A NE  
198  N  NE  B ARG A 23  ? 0.36539 0.59039 0.33918 0.05468  0.01076  0.10764  23  ARG A NE  
199  C  CZ  A ARG A 23  ? 0.50352 0.66534 0.57477 -0.11374 -0.07674 0.12680  23  ARG A CZ  
200  C  CZ  B ARG A 23  ? 0.35567 0.65271 0.31550 0.09517  -0.03506 0.02424  23  ARG A CZ  
201  N  NH1 A ARG A 23  ? 0.40362 0.55965 0.44173 -0.17444 -0.12474 0.18719  23  ARG A NH1 
202  N  NH1 B ARG A 23  ? 0.35055 0.71610 0.38138 0.08386  -0.03714 -0.00002 23  ARG A NH1 
203  N  NH2 A ARG A 23  ? 0.56702 0.72259 0.63803 -0.14388 -0.05043 0.11704  23  ARG A NH2 
204  N  NH2 B ARG A 23  ? 0.36768 0.61645 0.23880 0.12299  -0.03532 -0.05099 23  ARG A NH2 
205  N  N   . ASP A 24  ? 0.18787 0.43371 0.18235 0.03152  -0.01078 0.02714  24  ASP A N   
206  C  CA  . ASP A 24  ? 0.18737 0.47301 0.18674 0.07191  -0.00924 -0.03133 24  ASP A CA  
207  C  C   . ASP A 24  ? 0.22482 0.60079 0.20450 0.08964  -0.00729 -0.04141 24  ASP A C   
208  O  O   . ASP A 24  ? 0.20292 0.62949 0.18318 -0.00723 -0.00372 0.03971  24  ASP A O   
209  C  CB  . ASP A 24  ? 0.18748 0.40191 0.17984 0.05966  -0.01410 -0.06163 24  ASP A CB  
210  C  CG  . ASP A 24  ? 0.18280 0.36281 0.14209 0.05458  -0.01857 -0.05172 24  ASP A CG  
211  O  OD1 . ASP A 24  ? 0.18506 0.39026 0.14795 0.05965  -0.02202 -0.00988 24  ASP A OD1 
212  O  OD2 . ASP A 24  ? 0.19987 0.34110 0.13695 0.05453  -0.02798 -0.04972 24  ASP A OD2 
213  N  N   A PRO A 25  ? 0.33502 0.74770 0.27163 0.14499  -0.00798 -0.08941 25  PRO A N   
214  N  N   B PRO A 25  ? 0.24261 0.57970 0.19666 0.11754  -0.02943 -0.07391 25  PRO A N   
215  C  CA  A PRO A 25  ? 0.29661 0.81963 0.30154 0.12579  -0.01893 -0.05254 25  PRO A CA  
216  C  CA  B PRO A 25  ? 0.26255 0.62551 0.19427 0.11525  -0.01836 -0.07201 25  PRO A CA  
217  C  C   A PRO A 25  ? 0.22604 0.69115 0.20446 0.05518  -0.01181 -0.00056 25  PRO A C   
218  C  C   B PRO A 25  ? 0.24165 0.60334 0.16678 0.07189  -0.00555 -0.04598 25  PRO A C   
219  O  O   A PRO A 25  ? 0.21943 0.62943 0.16414 -0.00838 -0.00232 0.01643  25  PRO A O   
220  O  O   B PRO A 25  ? 0.27481 0.62959 0.16482 0.00649  0.00946  -0.03477 25  PRO A O   
221  C  CB  A PRO A 25  ? 0.37450 0.89115 0.34639 0.22438  -0.00594 -0.09481 25  PRO A CB  
222  C  CB  B PRO A 25  ? 0.30793 0.61084 0.25400 0.14035  -0.02136 -0.09590 25  PRO A CB  
223  C  CG  A PRO A 25  ? 0.38031 0.89065 0.31540 0.24815  -0.01831 -0.11497 25  PRO A CG  
224  C  CG  B PRO A 25  ? 0.25693 0.45591 0.30033 0.10021  -0.04592 -0.11898 25  PRO A CG  
225  C  CD  A PRO A 25  ? 0.38934 0.82960 0.29026 0.22882  -0.01909 -0.11663 25  PRO A CD  
226  C  CD  B PRO A 25  ? 0.22938 0.50897 0.24258 0.08169  -0.04911 -0.11550 25  PRO A CD  
227  N  N   . PHE A 26  ? 0.21558 0.52564 0.15653 0.07901  -0.00743 -0.01846 26  PHE A N   
228  C  CA  . PHE A 26  ? 0.21627 0.35494 0.15769 0.04550  0.00183  -0.00060 26  PHE A CA  
229  C  C   . PHE A 26  ? 0.18594 0.35676 0.15692 0.02606  -0.02870 -0.03889 26  PHE A C   
230  O  O   . PHE A 26  ? 0.18239 0.40693 0.22039 0.04074  -0.03486 -0.10252 26  PHE A O   
231  C  CB  . PHE A 26  ? 0.27635 0.32043 0.24281 0.03919  0.08907  0.04145  26  PHE A CB  
232  C  CG  . PHE A 26  ? 0.37598 0.31933 0.36953 0.03773  0.18792  0.05050  26  PHE A CG  
233  C  CD1 . PHE A 26  ? 0.43586 0.31249 0.43731 -0.04096 0.19363  -0.03141 26  PHE A CD1 
234  C  CD2 . PHE A 26  ? 0.50221 0.34911 0.44716 0.09012  0.24737  0.09606  26  PHE A CD2 
235  C  CE1 . PHE A 26  ? 0.49818 0.33333 0.50490 -0.04901 0.23490  -0.06112 26  PHE A CE1 
236  C  CE2 . PHE A 26  ? 0.57106 0.31606 0.51124 0.02938  0.28429  0.06692  26  PHE A CE2 
237  C  CZ  . PHE A 26  ? 0.52452 0.31194 0.54569 -0.04055 0.27193  -0.01534 26  PHE A CZ  
238  N  N   . GLY A 27  ? 0.18808 0.36041 0.14569 -0.00108 -0.01652 -0.02958 27  GLY A N   
239  C  CA  . GLY A 27  ? 0.19970 0.36900 0.18218 -0.02516 0.00266  -0.04509 27  GLY A CA  
240  C  C   . GLY A 27  ? 0.19611 0.35370 0.17521 -0.02505 -0.01983 -0.00142 27  GLY A C   
241  O  O   . GLY A 27  ? 0.20275 0.36083 0.21268 -0.01972 -0.02799 -0.00199 27  GLY A O   
242  N  N   . ASP A 28  ? 0.19737 0.32021 0.17006 -0.02811 -0.02927 0.03726  28  ASP A N   
243  C  CA  . ASP A 28  ? 0.22169 0.29863 0.19656 -0.03696 -0.04804 0.05255  28  ASP A CA  
244  C  C   . ASP A 28  ? 0.22232 0.27509 0.17977 -0.04048 -0.04258 0.04671  28  ASP A C   
245  O  O   . ASP A 28  ? 0.23334 0.26154 0.17637 -0.05180 -0.04547 0.03973  28  ASP A O   
246  C  CB  . ASP A 28  ? 0.27831 0.32395 0.27316 -0.03599 -0.09286 0.08261  28  ASP A CB  
247  C  CG  . ASP A 28  ? 0.40786 0.41269 0.34602 -0.04783 -0.12347 0.12471  28  ASP A CG  
248  O  OD1 . ASP A 28  ? 0.52131 0.49302 0.29493 -0.06986 -0.09746 0.14702  28  ASP A OD1 
249  O  OD2 . ASP A 28  ? 0.47737 0.43009 0.46097 -0.02517 -0.19250 0.15438  28  ASP A OD2 
250  N  N   . ALA A 29  ? 0.21996 0.27493 0.18619 -0.04216 -0.05162 0.05270  29  ALA A N   
251  C  CA  . ALA A 29  ? 0.21682 0.24559 0.19394 -0.03604 -0.05532 0.04142  29  ALA A CA  
252  C  C   . ALA A 29  ? 0.21173 0.21516 0.19982 -0.00904 -0.04784 0.03318  29  ALA A C   
253  O  O   . ALA A 29  ? 0.24718 0.24160 0.22810 0.01700  -0.05099 0.04795  29  ALA A O   
254  C  CB  . ALA A 29  ? 0.24387 0.26800 0.21534 -0.06023 -0.06402 0.05002  29  ALA A CB  
255  N  N   . THR A 30  ? 0.19956 0.20098 0.18070 0.00104  -0.04159 0.01020  30  THR A N   
256  C  CA  . THR A 30  ? 0.19474 0.20004 0.18948 0.01043  -0.03849 -0.00971 30  THR A CA  
257  C  C   . THR A 30  ? 0.20783 0.20699 0.20312 0.01017  -0.04520 -0.02364 30  THR A C   
258  O  O   . THR A 30  ? 0.22771 0.23870 0.21933 0.01392  -0.04330 -0.04554 30  THR A O   
259  C  CB  . THR A 30  ? 0.20142 0.20638 0.18645 0.00718  -0.04316 -0.00761 30  THR A CB  
260  O  OG1 . THR A 30  ? 0.20834 0.20111 0.18331 0.01545  -0.03895 0.00158  30  THR A OG1 
261  C  CG2 . THR A 30  ? 0.21811 0.22052 0.20718 -0.00285 -0.05503 -0.01583 30  THR A CG2 
262  N  N   . ARG A 31  ? 0.21381 0.19787 0.18659 -0.00468 -0.05413 -0.01581 31  ARG A N   
263  C  CA  . ARG A 31  ? 0.22030 0.19748 0.18960 -0.00342 -0.05566 -0.00868 31  ARG A CA  
264  C  C   . ARG A 31  ? 0.24660 0.20489 0.22703 -0.01410 -0.05988 -0.00158 31  ARG A C   
265  O  O   . ARG A 31  ? 0.27904 0.22046 0.22310 -0.03365 -0.05544 0.01546  31  ARG A O   
266  C  CB  . ARG A 31  ? 0.21600 0.19660 0.18247 -0.00353 -0.04240 -0.00398 31  ARG A CB  
267  C  CG  . ARG A 31  ? 0.21288 0.19553 0.17446 -0.00203 -0.02995 -0.01034 31  ARG A CG  
268  C  CD  . ARG A 31  ? 0.20930 0.18661 0.17213 0.00877  -0.01998 -0.01297 31  ARG A CD  
269  N  NE  . ARG A 31  ? 0.19729 0.17662 0.17128 -0.00156 -0.01668 -0.00342 31  ARG A NE  
270  C  CZ  . ARG A 31  ? 0.20291 0.18066 0.16698 -0.01265 -0.00287 -0.00802 31  ARG A CZ  
271  N  NH1 . ARG A 31  ? 0.21173 0.19073 0.15317 -0.02470 0.00052  -0.01506 31  ARG A NH1 
272  N  NH2 . ARG A 31  ? 0.22570 0.20185 0.19515 0.00105  0.02650  -0.01669 31  ARG A NH2 
273  N  N   . ARG A 32  ? 0.26195 0.19579 0.28574 -0.01916 -0.06744 -0.00777 32  ARG A N   
274  C  CA  A ARG A 32  ? 0.28835 0.19750 0.33818 -0.02174 -0.07286 -0.01050 32  ARG A CA  
275  C  CA  B ARG A 32  ? 0.27745 0.22071 0.32346 -0.02874 -0.07741 -0.00412 32  ARG A CA  
276  C  C   . ARG A 32  ? 0.27276 0.21551 0.30303 -0.03344 -0.08224 0.01084  32  ARG A C   
277  O  O   . ARG A 32  ? 0.27463 0.21919 0.27674 -0.01544 -0.06340 0.01694  32  ARG A O   
278  C  CB  A ARG A 32  ? 0.34528 0.22160 0.42098 -0.01796 -0.06248 -0.04332 32  ARG A CB  
279  C  CB  B ARG A 32  ? 0.30949 0.25875 0.39219 -0.02835 -0.08820 -0.02248 32  ARG A CB  
280  C  CG  A ARG A 32  ? 0.39518 0.30240 0.43522 -0.01278 -0.04853 -0.07798 32  ARG A CG  
281  C  CG  B ARG A 32  ? 0.33672 0.31841 0.43262 -0.02440 -0.11118 -0.03380 32  ARG A CG  
282  C  CD  A ARG A 32  ? 0.42545 0.38403 0.46361 -0.00775 -0.06014 -0.12055 32  ARG A CD  
283  C  CD  B ARG A 32  ? 0.42934 0.38458 0.49457 -0.01162 -0.09768 -0.05483 32  ARG A CD  
284  N  NE  A ARG A 32  ? 0.40700 0.48116 0.45159 0.03084  -0.07084 -0.16271 32  ARG A NE  
285  N  NE  B ARG A 32  ? 0.50102 0.51917 0.53039 -0.00284 -0.09040 -0.06626 32  ARG A NE  
286  C  CZ  A ARG A 32  ? 0.39938 0.49906 0.41342 0.05952  -0.04702 -0.15218 32  ARG A CZ  
287  C  CZ  B ARG A 32  ? 0.53880 0.61452 0.57550 0.01236  -0.08998 -0.05570 32  ARG A CZ  
288  N  NH1 A ARG A 32  ? 0.37090 0.47590 0.36243 0.06118  -0.05827 -0.12542 32  ARG A NH1 
289  N  NH1 B ARG A 32  ? 0.53230 0.65084 0.63045 0.00136  -0.10776 -0.03234 32  ARG A NH1 
290  N  NH2 A ARG A 32  ? 0.44566 0.54008 0.42362 0.07142  -0.02820 -0.14727 32  ARG A NH2 
291  N  NH2 B ARG A 32  ? 0.60301 0.63181 0.56543 0.02541  -0.08811 -0.04783 32  ARG A NH2 
292  N  N   . ALA A 33  ? 0.27191 0.24429 0.30547 -0.06000 -0.09054 0.02991  33  ALA A N   
293  C  CA  . ALA A 33  ? 0.28321 0.28056 0.29096 -0.06352 -0.07637 0.02909  33  ALA A CA  
294  C  C   . ALA A 33  ? 0.28591 0.25043 0.29130 -0.03121 -0.08297 -0.01726 33  ALA A C   
295  O  O   . ALA A 33  ? 0.34976 0.26728 0.33927 -0.00095 -0.10469 -0.05500 33  ALA A O   
296  C  CB  . ALA A 33  ? 0.30756 0.34755 0.29923 -0.09043 -0.05640 0.05081  33  ALA A CB  
297  N  N   . LEU A 34  ? 0.25825 0.23812 0.26515 -0.02690 -0.07054 -0.02568 34  LEU A N   
298  C  CA  . LEU A 34  ? 0.27984 0.25200 0.25775 -0.01336 -0.05533 -0.03617 34  LEU A CA  
299  C  C   . LEU A 34  ? 0.26415 0.26733 0.25119 -0.00996 -0.05481 -0.04879 34  LEU A C   
300  O  O   . LEU A 34  ? 0.27200 0.31209 0.26685 -0.01844 -0.03532 -0.06758 34  LEU A O   
301  C  CB  . LEU A 34  ? 0.34942 0.27144 0.28964 -0.01689 -0.01257 -0.02359 34  LEU A CB  
302  C  CG  . LEU A 34  ? 0.43007 0.30315 0.33256 -0.04648 0.03042  -0.02706 34  LEU A CG  
303  C  CD1 . LEU A 34  ? 0.45793 0.28050 0.30049 -0.08109 0.00686  -0.01947 34  LEU A CD1 
304  C  CD2 . LEU A 34  ? 0.51765 0.35295 0.39045 -0.02275 0.11163  -0.03689 34  LEU A CD2 
305  N  N   . ASP A 35  ? 0.26690 0.25869 0.26421 -0.01527 -0.06680 -0.04019 35  ASP A N   
306  C  CA  A ASP A 35  ? 0.28121 0.24909 0.29012 -0.02008 -0.07408 -0.04063 35  ASP A CA  
307  C  CA  B ASP A 35  ? 0.27545 0.24827 0.28504 -0.01313 -0.06296 -0.03104 35  ASP A CA  
308  C  C   . ASP A 35  ? 0.27074 0.24197 0.26660 -0.02347 -0.06334 -0.03108 35  ASP A C   
309  O  O   . ASP A 35  ? 0.26157 0.24808 0.26427 -0.02399 -0.05849 -0.02610 35  ASP A O   
310  C  CB  A ASP A 35  ? 0.32428 0.25257 0.36290 -0.01199 -0.08867 -0.05701 35  ASP A CB  
311  C  CB  B ASP A 35  ? 0.30254 0.24630 0.34149 -0.00208 -0.07039 -0.02317 35  ASP A CB  
312  C  CG  A ASP A 35  ? 0.35881 0.25606 0.45820 -0.01969 -0.08513 -0.08276 35  ASP A CG  
313  C  CG  B ASP A 35  ? 0.31683 0.27865 0.40269 -0.01575 -0.08885 -0.01344 35  ASP A CG  
314  O  OD1 A ASP A 35  ? 0.33826 0.24718 0.36275 -0.02881 -0.10016 -0.05266 35  ASP A OD1 
315  O  OD1 B ASP A 35  ? 0.26884 0.32861 0.42762 -0.05171 -0.07457 0.01749  35  ASP A OD1 
316  O  OD2 A ASP A 35  ? 0.41880 0.28094 0.63334 -0.01580 -0.05997 -0.14339 35  ASP A OD2 
317  O  OD2 B ASP A 35  ? 0.37071 0.28398 0.43672 -0.00393 -0.13131 -0.03518 35  ASP A OD2 
318  N  N   . PRO A 36  ? 0.28651 0.24336 0.24909 -0.01202 -0.05602 -0.01757 36  PRO A N   
319  C  CA  . PRO A 36  ? 0.28698 0.24527 0.24646 -0.00083 -0.03960 -0.02080 36  PRO A CA  
320  C  C   . PRO A 36  ? 0.26788 0.23825 0.25237 -0.00929 -0.04595 -0.01171 36  PRO A C   
321  O  O   . PRO A 36  ? 0.27878 0.24417 0.25734 -0.00152 -0.03990 -0.00401 36  PRO A O   
322  C  CB  . PRO A 36  ? 0.32456 0.28882 0.25374 0.01398  -0.01981 -0.02079 36  PRO A CB  
323  C  CG  . PRO A 36  ? 0.33668 0.31228 0.27148 -0.00165 -0.03286 0.00752  36  PRO A CG  
324  C  CD  . PRO A 36  ? 0.31795 0.27943 0.26313 -0.01209 -0.04810 0.00472  36  PRO A CD  
325  N  N   . VAL A 37  ? 0.26223 0.24283 0.25573 -0.02854 -0.05918 -0.01448 37  VAL A N   
326  C  CA  . VAL A 37  ? 0.28356 0.26991 0.26927 -0.04140 -0.07703 -0.02283 37  VAL A CA  
327  C  C   . VAL A 37  ? 0.27838 0.26059 0.24993 -0.00747 -0.06214 -0.03399 37  VAL A C   
328  O  O   . VAL A 37  ? 0.29763 0.26677 0.25339 -0.00889 -0.06477 -0.03240 37  VAL A O   
329  C  CB  . VAL A 37  ? 0.33271 0.30691 0.30638 -0.07721 -0.10516 -0.03021 37  VAL A CB  
330  C  CG1 . VAL A 37  ? 0.36637 0.32248 0.33365 -0.05202 -0.09777 -0.04949 37  VAL A CG1 
331  C  CG2 . VAL A 37  ? 0.34564 0.32644 0.32531 -0.08843 -0.11716 -0.01250 37  VAL A CG2 
332  N  N   A GLU A 38  ? 0.27406 0.25409 0.25286 0.00943  -0.04248 -0.03549 38  GLU A N   
333  N  N   B GLU A 38  ? 0.27609 0.26929 0.22866 -0.00584 -0.04572 -0.04286 38  GLU A N   
334  C  CA  A GLU A 38  ? 0.27838 0.28839 0.26136 0.02373  -0.02309 -0.02998 38  GLU A CA  
335  C  CA  B GLU A 38  ? 0.28779 0.29999 0.23764 -0.00639 -0.02855 -0.03910 38  GLU A CA  
336  C  C   A GLU A 38  ? 0.26242 0.27245 0.21836 0.00065  -0.02905 -0.04551 38  GLU A C   
337  C  C   B GLU A 38  ? 0.26823 0.28242 0.19425 -0.01375 -0.03683 -0.03801 38  GLU A C   
338  O  O   A GLU A 38  ? 0.26845 0.27050 0.22570 0.00873  -0.01046 -0.04673 38  GLU A O   
339  O  O   B GLU A 38  ? 0.25925 0.28474 0.17535 -0.01621 -0.04730 -0.04046 38  GLU A O   
340  C  CB  A GLU A 38  ? 0.31400 0.34739 0.33199 0.06276  -0.00542 -0.00157 38  GLU A CB  
341  C  CB  B GLU A 38  ? 0.31692 0.35221 0.32394 0.01254  -0.01060 -0.03134 38  GLU A CB  
342  C  CG  A GLU A 38  ? 0.36116 0.40819 0.37375 0.06672  0.01925  -0.00432 38  GLU A CG  
343  C  CG  B GLU A 38  ? 0.38326 0.38068 0.41668 0.02940  0.02108  -0.02630 38  GLU A CG  
344  C  CD  A GLU A 38  ? 0.39252 0.50337 0.46285 0.05421  0.02115  -0.00892 38  GLU A CD  
345  C  CD  B GLU A 38  ? 0.46668 0.44137 0.48746 0.01488  0.04734  -0.06978 38  GLU A CD  
346  O  OE1 A GLU A 38  ? 0.40316 0.53017 0.45603 0.06898  -0.08889 -0.01707 38  GLU A OE1 
347  O  OE1 B GLU A 38  ? 0.49419 0.51285 0.51458 0.06138  0.10443  -0.01084 38  GLU A OE1 
348  O  OE2 A GLU A 38  ? 0.45010 0.56098 0.57382 0.01226  0.11162  -0.00173 38  GLU A OE2 
349  O  OE2 B GLU A 38  ? 0.52162 0.43497 0.52927 -0.01165 0.02867  -0.17966 38  GLU A OE2 
350  N  N   . SER A 39  ? 0.25105 0.26905 0.19294 -0.01778 -0.04113 -0.03940 39  SER A N   
351  C  CA  . SER A 39  ? 0.24618 0.26967 0.18386 -0.02356 -0.04199 -0.04569 39  SER A CA  
352  C  C   . SER A 39  ? 0.23792 0.23202 0.18039 -0.03430 -0.03923 -0.05604 39  SER A C   
353  O  O   . SER A 39  ? 0.25978 0.24225 0.18708 -0.03820 -0.03958 -0.04748 39  SER A O   
354  C  CB  . SER A 39  ? 0.27338 0.34215 0.19511 -0.00520 -0.06167 -0.05511 39  SER A CB  
355  O  OG  . SER A 39  ? 0.30257 0.38361 0.23983 0.01037  -0.08446 -0.06073 39  SER A OG  
356  N  N   . VAL A 40  ? 0.23084 0.22241 0.17899 -0.02800 -0.04486 -0.05241 40  VAL A N   
357  C  CA  . VAL A 40  ? 0.23190 0.23285 0.17861 -0.02489 -0.03897 -0.04153 40  VAL A CA  
358  C  C   . VAL A 40  ? 0.25120 0.23007 0.17274 -0.02770 -0.03959 -0.04831 40  VAL A C   
359  O  O   . VAL A 40  ? 0.25381 0.23809 0.17697 -0.02844 -0.02913 -0.03184 40  VAL A O   
360  C  CB  . VAL A 40  ? 0.23192 0.26589 0.19576 -0.02948 -0.03200 -0.03189 40  VAL A CB  
361  C  CG1 . VAL A 40  ? 0.24310 0.29063 0.21139 -0.04114 -0.05488 -0.00893 40  VAL A CG1 
362  C  CG2 . VAL A 40  ? 0.24275 0.28885 0.20745 -0.02023 -0.02114 -0.03832 40  VAL A CG2 
363  N  N   A ARG A 41  ? 0.26596 0.23531 0.16274 -0.02922 -0.03069 -0.06534 41  ARG A N   
364  N  N   B ARG A 41  ? 0.26066 0.24356 0.18583 -0.02465 -0.03598 -0.04997 41  ARG A N   
365  C  CA  A ARG A 41  ? 0.28127 0.24514 0.17375 -0.03331 -0.01574 -0.08530 41  ARG A CA  
366  C  CA  B ARG A 41  ? 0.27762 0.28239 0.20407 -0.02657 -0.02972 -0.05365 41  ARG A CA  
367  C  C   A ARG A 41  ? 0.26359 0.25560 0.17260 -0.03177 -0.01652 -0.07909 41  ARG A C   
368  C  C   B ARG A 41  ? 0.26696 0.29169 0.17978 -0.02079 -0.02800 -0.04505 41  ARG A C   
369  O  O   A ARG A 41  ? 0.29071 0.26499 0.17608 -0.03919 -0.02278 -0.07613 41  ARG A O   
370  O  O   B ARG A 41  ? 0.29974 0.32672 0.16483 -0.02289 -0.02935 -0.04068 41  ARG A O   
371  C  CB  A ARG A 41  ? 0.33643 0.24682 0.20053 -0.03830 -0.00739 -0.10655 41  ARG A CB  
372  C  CB  B ARG A 41  ? 0.34154 0.31362 0.26091 -0.02725 -0.02126 -0.08020 41  ARG A CB  
373  C  CG  A ARG A 41  ? 0.40801 0.24719 0.26445 -0.04681 -0.00917 -0.10508 41  ARG A CG  
374  C  CG  B ARG A 41  ? 0.43029 0.36929 0.30383 -0.01421 -0.00382 -0.11415 41  ARG A CG  
375  C  CD  A ARG A 41  ? 0.47069 0.27878 0.37927 -0.03585 -0.00932 -0.08371 41  ARG A CD  
376  C  CD  B ARG A 41  ? 0.50516 0.43205 0.34490 0.00738  0.01123  -0.12384 41  ARG A CD  
377  N  NE  A ARG A 41  ? 0.50887 0.34000 0.47083 -0.04112 0.00845  -0.04683 41  ARG A NE  
378  N  NE  B ARG A 41  ? 0.52712 0.54768 0.41202 -0.01256 0.04150  -0.09381 41  ARG A NE  
379  C  CZ  A ARG A 41  ? 0.53891 0.41241 0.56391 -0.03579 0.01301  0.00089  41  ARG A CZ  
380  C  CZ  B ARG A 41  ? 0.55043 0.63015 0.45675 -0.02282 0.05840  -0.06897 41  ARG A CZ  
381  N  NH1 A ARG A 41  ? 0.60780 0.42650 0.60976 -0.08283 0.00449  0.00388  41  ARG A NH1 
382  N  NH1 B ARG A 41  ? 0.56644 0.67806 0.40276 0.00827  0.08199  -0.09901 41  ARG A NH1 
383  N  NH2 A ARG A 41  ? 0.53284 0.48309 0.61319 -0.00226 0.00851  0.02493  41  ARG A NH2 
384  N  NH2 B ARG A 41  ? 0.57132 0.65238 0.51631 -0.03827 0.07633  -0.01210 41  ARG A NH2 
385  N  N   A ARG A 42  ? 0.24182 0.24174 0.17806 -0.02233 -0.01003 -0.07560 42  ARG A N   
386  N  N   B ARG A 42  ? 0.25012 0.26347 0.18809 -0.01744 -0.02227 -0.05617 42  ARG A N   
387  C  CA  A ARG A 42  ? 0.23000 0.24403 0.19762 -0.02116 0.00090  -0.06938 42  ARG A CA  
388  C  CA  B ARG A 42  ? 0.25796 0.26478 0.21125 -0.01937 -0.02285 -0.06838 42  ARG A CA  
389  C  C   A ARG A 42  ? 0.24053 0.24326 0.18104 -0.02301 0.00234  -0.06121 42  ARG A C   
390  C  C   B ARG A 42  ? 0.24094 0.25552 0.19525 -0.02731 -0.01287 -0.06022 42  ARG A C   
391  O  O   A ARG A 42  ? 0.27979 0.24912 0.17303 -0.03185 0.01171  -0.06064 42  ARG A O   
392  O  O   B ARG A 42  ? 0.24955 0.28074 0.23570 -0.03068 -0.00599 -0.02604 42  ARG A O   
393  C  CB  A ARG A 42  ? 0.22887 0.25075 0.25008 -0.01796 0.00065  -0.06130 42  ARG A CB  
394  C  CB  B ARG A 42  ? 0.30351 0.29771 0.29399 -0.01437 -0.04206 -0.06918 42  ARG A CB  
395  C  CG  A ARG A 42  ? 0.28850 0.28328 0.33357 0.01119  0.00645  -0.05350 42  ARG A CG  
396  C  CG  B ARG A 42  ? 0.36874 0.35889 0.40542 -0.02686 -0.02498 -0.06792 42  ARG A CG  
397  C  CD  A ARG A 42  ? 0.36910 0.36156 0.42673 0.04030  0.04868  -0.03532 42  ARG A CD  
398  C  CD  B ARG A 42  ? 0.44415 0.44339 0.44031 0.00500  -0.01402 -0.10053 42  ARG A CD  
399  N  NE  A ARG A 42  ? 0.44498 0.43520 0.52496 0.01607  0.04266  -0.02405 42  ARG A NE  
400  N  NE  B ARG A 42  ? 0.55486 0.49575 0.46503 0.03454  0.00247  -0.14727 42  ARG A NE  
401  C  CZ  A ARG A 42  ? 0.49490 0.53937 0.50718 0.01227  0.00099  -0.02671 42  ARG A CZ  
402  C  CZ  B ARG A 42  ? 0.57095 0.49654 0.50360 0.03724  -0.03061 -0.16608 42  ARG A CZ  
403  N  NH1 A ARG A 42  ? 0.56089 0.60983 0.58502 0.08799  -0.00257 0.00252  42  ARG A NH1 
404  N  NH1 B ARG A 42  ? 0.53436 0.45885 0.45471 0.06803  -0.13365 -0.19815 42  ARG A NH1 
405  N  NH2 A ARG A 42  ? 0.51847 0.53783 0.38161 -0.05166 -0.03753 -0.08218 42  ARG A NH2 
406  N  NH2 B ARG A 42  ? 0.63589 0.53793 0.55099 0.04266  0.01995  -0.16109 42  ARG A NH2 
407  N  N   . LEU A 43  ? 0.22871 0.23221 0.17281 -0.02221 -0.01690 -0.06137 43  LEU A N   
408  C  CA  . LEU A 43  ? 0.22573 0.23311 0.16267 -0.01451 -0.02006 -0.05129 43  LEU A CA  
409  C  C   . LEU A 43  ? 0.23404 0.23214 0.16035 -0.02881 -0.02425 -0.04833 43  LEU A C   
410  O  O   . LEU A 43  ? 0.25286 0.23807 0.15938 -0.03038 -0.03119 -0.04173 43  LEU A O   
411  C  CB  . LEU A 43  ? 0.23321 0.24682 0.15928 -0.00065 -0.04161 -0.05608 43  LEU A CB  
412  C  CG  . LEU A 43  ? 0.28273 0.25291 0.19141 0.01323  -0.07583 -0.07083 43  LEU A CG  
413  C  CD1 . LEU A 43  ? 0.32370 0.29094 0.17709 0.04416  -0.05812 -0.06923 43  LEU A CD1 
414  C  CD2 . LEU A 43  ? 0.32257 0.25023 0.25082 -0.00056 -0.11767 -0.07606 43  LEU A CD2 
415  N  N   . ALA A 44  ? 0.23290 0.24911 0.14330 -0.03635 -0.02968 -0.04782 44  ALA A N   
416  C  CA  . ALA A 44  ? 0.24601 0.26927 0.15697 -0.04689 -0.03332 -0.04526 44  ALA A CA  
417  C  C   . ALA A 44  ? 0.25891 0.27400 0.15402 -0.03643 -0.02045 -0.05099 44  ALA A C   
418  O  O   . ALA A 44  ? 0.27596 0.29944 0.15588 -0.03499 -0.03411 -0.04186 44  ALA A O   
419  C  CB  . ALA A 44  ? 0.25922 0.29398 0.16936 -0.06714 -0.04125 -0.04321 44  ALA A CB  
420  N  N   A GLU A 45  ? 0.27534 0.27276 0.15612 -0.03046 -0.00632 -0.07228 45  GLU A N   
421  N  N   B GLU A 45  ? 0.26842 0.27801 0.15949 -0.03605 -0.00414 -0.04926 45  GLU A N   
422  C  CA  A GLU A 45  ? 0.30201 0.28703 0.18034 -0.02400 0.01847  -0.08863 45  GLU A CA  
423  C  CA  B GLU A 45  ? 0.28829 0.29376 0.18000 -0.03769 0.01757  -0.04156 45  GLU A CA  
424  C  C   A GLU A 45  ? 0.28492 0.28700 0.17519 -0.03603 0.01088  -0.07412 45  GLU A C   
425  C  C   B GLU A 45  ? 0.27532 0.30016 0.15725 -0.03827 0.01902  -0.04337 45  GLU A C   
426  O  O   A GLU A 45  ? 0.32591 0.31210 0.18208 -0.04964 0.00840  -0.07163 45  GLU A O   
427  O  O   B GLU A 45  ? 0.30917 0.34398 0.15630 -0.03951 0.03177  -0.02820 45  GLU A O   
428  C  CB  A GLU A 45  ? 0.34943 0.31174 0.22586 -0.00016 0.04638  -0.11420 45  GLU A CB  
429  C  CB  B GLU A 45  ? 0.31357 0.31480 0.24102 -0.02987 0.04127  -0.02274 45  GLU A CB  
430  C  CG  A GLU A 45  ? 0.43075 0.35273 0.26892 0.00409  0.03962  -0.12894 45  GLU A CG  
431  C  CG  B GLU A 45  ? 0.35267 0.37484 0.29699 -0.01166 0.06276  -0.00305 45  GLU A CG  
432  C  CD  A GLU A 45  ? 0.52369 0.42370 0.37920 0.03526  0.02464  -0.13608 45  GLU A CD  
433  C  CD  B GLU A 45  ? 0.43685 0.46079 0.39443 0.05306  0.08878  0.00161  45  GLU A CD  
434  O  OE1 A GLU A 45  ? 0.51855 0.46993 0.37363 0.03193  0.00710  -0.11384 45  GLU A OE1 
435  O  OE1 B GLU A 45  ? 0.47846 0.47026 0.41013 0.12041  0.12570  0.01425  45  GLU A OE1 
436  O  OE2 A GLU A 45  ? 0.63379 0.43297 0.51943 0.03994  0.03223  -0.16767 45  GLU A OE2 
437  O  OE2 B GLU A 45  ? 0.48875 0.54257 0.45816 0.05989  0.11142  -0.02339 45  GLU A OE2 
438  N  N   . LEU A 46  ? 0.25720 0.27049 0.16919 -0.02867 -0.00116 -0.05485 46  LEU A N   
439  C  CA  . LEU A 46  ? 0.25221 0.26340 0.17932 -0.03267 -0.01788 -0.04573 46  LEU A CA  
440  C  C   . LEU A 46  ? 0.25327 0.25663 0.17495 -0.03917 -0.01597 -0.03288 46  LEU A C   
441  O  O   . LEU A 46  ? 0.28247 0.26833 0.21310 -0.05185 -0.03095 -0.02012 46  LEU A O   
442  C  CB  . LEU A 46  ? 0.26241 0.29575 0.22236 -0.03802 -0.04069 -0.04701 46  LEU A CB  
443  C  CG  . LEU A 46  ? 0.27812 0.38678 0.30095 -0.03997 -0.05219 -0.01635 46  LEU A CG  
444  C  CD1 . LEU A 46  ? 0.30703 0.47151 0.29144 -0.04710 -0.08711 0.03169  46  LEU A CD1 
445  C  CD2 . LEU A 46  ? 0.27184 0.42175 0.37207 -0.02294 -0.02131 -0.05576 46  LEU A CD2 
446  N  N   . GLY A 47  ? 0.25259 0.25408 0.16077 -0.02966 -0.01092 -0.02469 47  GLY A N   
447  C  CA  . GLY A 47  ? 0.25676 0.26466 0.15669 -0.02207 -0.01442 -0.02129 47  GLY A CA  
448  C  C   . GLY A 47  ? 0.24096 0.25803 0.15384 -0.01935 -0.02989 -0.02177 47  GLY A C   
449  O  O   . GLY A 47  ? 0.25762 0.27852 0.16263 0.00066  -0.03596 -0.01960 47  GLY A O   
450  N  N   . ALA A 48  ? 0.22511 0.24207 0.14270 -0.02498 -0.03029 -0.02830 48  ALA A N   
451  C  CA  . ALA A 48  ? 0.22428 0.24837 0.13085 -0.02324 -0.03420 -0.02891 48  ALA A CA  
452  C  C   . ALA A 48  ? 0.22691 0.23956 0.12611 -0.03866 -0.03753 -0.04096 48  ALA A C   
453  O  O   . ALA A 48  ? 0.25292 0.26163 0.16021 -0.04823 -0.02970 -0.06953 48  ALA A O   
454  C  CB  . ALA A 48  ? 0.24541 0.27678 0.13812 -0.01120 -0.04601 -0.02301 48  ALA A CB  
455  N  N   . HIS A 49  ? 0.21276 0.23454 0.11395 -0.04217 -0.03537 -0.02461 49  HIS A N   
456  C  CA  . HIS A 49  ? 0.21244 0.22991 0.12478 -0.04166 -0.03718 -0.01572 49  HIS A CA  
457  C  C   . HIS A 49  ? 0.20588 0.23165 0.11597 -0.05430 -0.04500 -0.01899 49  HIS A C   
458  O  O   . HIS A 49  ? 0.22390 0.24055 0.12993 -0.05372 -0.04049 -0.01940 49  HIS A O   
459  C  CB  . HIS A 49  ? 0.22300 0.24974 0.16352 -0.03094 -0.04112 0.00203  49  HIS A CB  
460  C  CG  . HIS A 49  ? 0.22821 0.31036 0.20693 -0.02951 -0.04937 0.00691  49  HIS A CG  
461  N  ND1 . HIS A 49  ? 0.23526 0.38915 0.24895 -0.02663 -0.07432 0.00968  49  HIS A ND1 
462  C  CD2 . HIS A 49  ? 0.23133 0.35250 0.23338 -0.02475 -0.03987 0.01181  49  HIS A CD2 
463  C  CE1 . HIS A 49  ? 0.22788 0.41504 0.28900 -0.02181 -0.06627 0.01110  49  HIS A CE1 
464  N  NE2 . HIS A 49  ? 0.23202 0.39482 0.28190 -0.02679 -0.04543 0.02025  49  HIS A NE2 
465  N  N   . GLY A 50  ? 0.21715 0.23907 0.10334 -0.05474 -0.03767 -0.01748 50  GLY A N   
466  C  CA  . GLY A 50  ? 0.21525 0.24019 0.11879 -0.06018 -0.03874 -0.01416 50  GLY A CA  
467  C  C   . GLY A 50  ? 0.19600 0.21967 0.11364 -0.05366 -0.02849 -0.02156 50  GLY A C   
468  O  O   . GLY A 50  ? 0.20484 0.21815 0.11810 -0.04437 -0.02966 -0.01375 50  GLY A O   
469  N  N   . VAL A 51  ? 0.19454 0.22013 0.11424 -0.04086 -0.02866 -0.02004 51  VAL A N   
470  C  CA  A VAL A 51  ? 0.19276 0.21872 0.12196 -0.03109 -0.02173 -0.01914 51  VAL A CA  
471  C  CA  B VAL A 51  ? 0.19652 0.22289 0.12524 -0.02970 -0.02300 -0.01574 51  VAL A CA  
472  C  C   . VAL A 51  ? 0.17756 0.23343 0.11660 -0.03286 -0.02771 -0.01593 51  VAL A C   
473  O  O   . VAL A 51  ? 0.18304 0.30704 0.12326 -0.03217 -0.03569 -0.02122 51  VAL A O   
474  C  CB  A VAL A 51  ? 0.22017 0.22247 0.17453 -0.02573 -0.00290 -0.02559 51  VAL A CB  
475  C  CB  B VAL A 51  ? 0.22933 0.23795 0.18086 -0.02287 -0.02058 -0.01592 51  VAL A CB  
476  C  CG1 A VAL A 51  ? 0.23588 0.24039 0.16753 -0.01879 0.00382  -0.02975 51  VAL A CG1 
477  C  CG1 B VAL A 51  ? 0.25230 0.24431 0.24283 -0.03356 -0.01419 -0.00446 51  VAL A CG1 
478  C  CG2 A VAL A 51  ? 0.23746 0.21613 0.25190 -0.03247 0.02419  -0.03751 51  VAL A CG2 
479  C  CG2 B VAL A 51  ? 0.23163 0.27149 0.19202 -0.01181 -0.02837 -0.01249 51  VAL A CG2 
480  N  N   . THR A 52  ? 0.16916 0.20712 0.11048 -0.03154 -0.02343 -0.01583 52  THR A N   
481  C  CA  . THR A 52  ? 0.17366 0.20155 0.11139 -0.02756 -0.02012 -0.01256 52  THR A CA  
482  C  C   . THR A 52  ? 0.16178 0.19287 0.11083 -0.03793 -0.02562 -0.01717 52  THR A C   
483  O  O   . THR A 52  ? 0.16838 0.20673 0.12560 -0.02439 -0.01980 -0.00993 52  THR A O   
484  C  CB  . THR A 52  ? 0.16931 0.20488 0.12654 -0.02775 -0.03096 -0.00838 52  THR A CB  
485  O  OG1 . THR A 52  ? 0.17622 0.20800 0.14286 -0.02636 -0.04029 -0.01221 52  THR A OG1 
486  C  CG2 . THR A 52  ? 0.18591 0.21821 0.13464 -0.01367 -0.02889 0.00085  52  THR A CG2 
487  N  N   . PHE A 53  ? 0.18353 0.19488 0.10722 -0.02921 -0.02649 -0.00497 53  PHE A N   
488  C  CA  . PHE A 53  ? 0.20628 0.19040 0.11205 -0.02565 -0.02116 -0.01105 53  PHE A CA  
489  C  C   . PHE A 53  ? 0.18372 0.18912 0.11721 -0.02600 -0.02014 -0.00483 53  PHE A C   
490  O  O   . PHE A 53  ? 0.19706 0.20734 0.12264 -0.01967 -0.02440 -0.00923 53  PHE A O   
491  C  CB  . PHE A 53  ? 0.25100 0.20159 0.13337 -0.03645 -0.01761 -0.01249 53  PHE A CB  
492  C  CG  . PHE A 53  ? 0.26344 0.21355 0.14362 -0.06495 -0.04574 -0.00173 53  PHE A CG  
493  C  CD1 . PHE A 53  ? 0.27108 0.27254 0.17809 -0.09098 -0.06936 0.01953  53  PHE A CD1 
494  C  CD2 . PHE A 53  ? 0.26682 0.21928 0.16542 -0.08014 -0.03633 -0.00179 53  PHE A CD2 
495  C  CE1 . PHE A 53  ? 0.27665 0.30245 0.22554 -0.09691 -0.07148 0.03613  53  PHE A CE1 
496  C  CE2 . PHE A 53  ? 0.26703 0.25015 0.18592 -0.08561 -0.04155 0.00042  53  PHE A CE2 
497  C  CZ  . PHE A 53  ? 0.26418 0.28307 0.22627 -0.08745 -0.05474 0.01388  53  PHE A CZ  
498  N  N   . HIS A 54  ? 0.18414 0.20011 0.11308 -0.02535 -0.01990 0.00586  54  HIS A N   
499  C  CA  . HIS A 54  ? 0.19571 0.19956 0.10768 -0.03025 -0.02422 0.00746  54  HIS A CA  
500  C  C   . HIS A 54  ? 0.21073 0.19531 0.11598 -0.02152 -0.01907 0.00490  54  HIS A C   
501  O  O   . HIS A 54  ? 0.22194 0.19603 0.12895 -0.01622 -0.01736 0.00107  54  HIS A O   
502  C  CB  . HIS A 54  ? 0.20500 0.21034 0.11638 -0.02913 -0.03075 0.00425  54  HIS A CB  
503  C  CG  . HIS A 54  ? 0.20382 0.22031 0.11835 -0.03263 -0.02183 -0.00199 54  HIS A CG  
504  N  ND1 . HIS A 54  ? 0.21933 0.22559 0.13062 -0.04534 -0.00365 -0.00405 54  HIS A ND1 
505  C  CD2 . HIS A 54  ? 0.20837 0.22848 0.12823 -0.04325 -0.02187 -0.01041 54  HIS A CD2 
506  C  CE1 . HIS A 54  ? 0.23480 0.23317 0.14275 -0.05242 -0.00467 -0.00781 54  HIS A CE1 
507  N  NE2 . HIS A 54  ? 0.22824 0.23030 0.14023 -0.04754 -0.01471 -0.01198 54  HIS A NE2 
508  N  N   . ASP A 55  ? 0.20826 0.19712 0.12563 -0.04057 -0.01802 0.01171  55  ASP A N   
509  C  CA  . ASP A 55  ? 0.21292 0.19933 0.13382 -0.03558 -0.02269 0.00665  55  ASP A CA  
510  C  C   . ASP A 55  ? 0.22095 0.18577 0.13728 -0.03314 -0.02236 -0.00571 55  ASP A C   
511  O  O   . ASP A 55  ? 0.25171 0.19777 0.15391 -0.03036 -0.01700 -0.01156 55  ASP A O   
512  C  CB  . ASP A 55  ? 0.19963 0.21200 0.14002 -0.04656 -0.02854 -0.00089 55  ASP A CB  
513  C  CG  . ASP A 55  ? 0.19398 0.21159 0.14002 -0.04305 -0.01729 0.00183  55  ASP A CG  
514  O  OD1 . ASP A 55  ? 0.20293 0.20296 0.14114 -0.04793 -0.02112 -0.00670 55  ASP A OD1 
515  O  OD2 . ASP A 55  ? 0.21421 0.24638 0.14676 -0.05311 -0.01498 0.00259  55  ASP A OD2 
516  N  N   . ASP A 56  ? 0.21150 0.19112 0.13955 -0.02001 -0.02483 0.00382  56  ASP A N   
517  C  CA  . ASP A 56  ? 0.22364 0.20820 0.14719 -0.00463 -0.02180 0.00062  56  ASP A CA  
518  C  C   . ASP A 56  ? 0.22818 0.19903 0.15758 -0.00757 -0.01271 0.00260  56  ASP A C   
519  O  O   . ASP A 56  ? 0.26220 0.22533 0.18331 0.02698  0.00488  0.02366  56  ASP A O   
520  C  CB  . ASP A 56  ? 0.25790 0.24607 0.15519 0.01065  -0.02587 0.00151  56  ASP A CB  
521  C  CG  . ASP A 56  ? 0.34833 0.28233 0.16939 0.02164  -0.01490 0.02216  56  ASP A CG  
522  O  OD1 . ASP A 56  ? 0.32952 0.38587 0.19182 0.01636  0.02070  0.05909  56  ASP A OD1 
523  O  OD2 . ASP A 56  ? 0.48777 0.27317 0.16521 0.04562  -0.01420 0.00841  56  ASP A OD2 
524  N  N   . ASP A 57  ? 0.22123 0.19472 0.14094 -0.01798 -0.00897 -0.00813 57  ASP A N   
525  C  CA  . ASP A 57  ? 0.23644 0.19954 0.14395 -0.00803 -0.00121 -0.01321 57  ASP A CA  
526  C  C   . ASP A 57  ? 0.25837 0.21444 0.16838 -0.00666 0.00219  -0.02616 57  ASP A C   
527  O  O   . ASP A 57  ? 0.28255 0.23934 0.21358 0.00073  0.00820  -0.05072 57  ASP A O   
528  C  CB  . ASP A 57  ? 0.22577 0.20087 0.14541 -0.01360 -0.00464 -0.00625 57  ASP A CB  
529  C  CG  . ASP A 57  ? 0.22200 0.20597 0.16980 -0.01827 -0.00565 -0.00128 57  ASP A CG  
530  O  OD1 . ASP A 57  ? 0.24565 0.23085 0.19752 -0.01620 -0.03482 -0.00638 57  ASP A OD1 
531  O  OD2 . ASP A 57  ? 0.21911 0.20094 0.17876 -0.01742 0.00622  -0.00367 57  ASP A OD2 
532  N  N   . LEU A 58  ? 0.27109 0.22122 0.16429 -0.03407 -0.00726 -0.03181 58  LEU A N   
533  C  CA  . LEU A 58  ? 0.30446 0.23344 0.17801 -0.04688 -0.02245 -0.03310 58  LEU A CA  
534  C  C   . LEU A 58  ? 0.33784 0.22508 0.20962 -0.05099 -0.01967 -0.03512 58  LEU A C   
535  O  O   . LEU A 58  ? 0.39649 0.23384 0.25376 -0.04199 -0.01988 -0.05414 58  LEU A O   
536  C  CB  . LEU A 58  ? 0.32176 0.26861 0.18717 -0.05111 -0.03406 -0.03286 58  LEU A CB  
537  C  CG  . LEU A 58  ? 0.37256 0.34989 0.20162 -0.05600 -0.04945 -0.04382 58  LEU A CG  
538  C  CD1 . LEU A 58  ? 0.44359 0.43354 0.19698 -0.02563 -0.05509 -0.07992 58  LEU A CD1 
539  C  CD2 . LEU A 58  ? 0.35987 0.39323 0.22003 -0.06377 -0.06691 -0.01899 58  LEU A CD2 
540  N  N   . ILE A 59  ? 0.33257 0.21797 0.21823 -0.04868 -0.02599 -0.01049 59  ILE A N   
541  C  CA  . ILE A 59  ? 0.33826 0.24019 0.25271 -0.05329 -0.04021 0.01878  59  ILE A CA  
542  C  C   . ILE A 59  ? 0.36273 0.25635 0.26820 -0.05351 -0.05575 0.02014  59  ILE A C   
543  O  O   . ILE A 59  ? 0.37356 0.25074 0.26220 -0.05221 -0.06579 0.02142  59  ILE A O   
544  C  CB  . ILE A 59  ? 0.34433 0.29486 0.29417 -0.06915 -0.04695 0.05621  59  ILE A CB  
545  C  CG1 . ILE A 59  ? 0.37773 0.35609 0.31447 -0.07390 -0.04669 0.06009  59  ILE A CG1 
546  C  CG2 . ILE A 59  ? 0.36788 0.32706 0.33042 -0.07922 -0.06817 0.08612  59  ILE A CG2 
547  C  CD1 . ILE A 59  ? 0.45200 0.42377 0.31932 -0.01752 -0.06271 0.03143  59  ILE A CD1 
548  N  N   . PRO A 60  ? 0.40178 0.31874 0.31116 -0.02401 -0.06187 0.01231  60  PRO A N   
549  C  CA  . PRO A 60  ? 0.42138 0.35343 0.32436 -0.00683 -0.07421 0.02897  60  PRO A CA  
550  C  C   . PRO A 60  ? 0.39774 0.33477 0.29855 -0.03462 -0.07158 0.05312  60  PRO A C   
551  O  O   . PRO A 60  ? 0.40438 0.33144 0.30466 -0.05498 -0.06602 0.07132  60  PRO A O   
552  C  CB  . PRO A 60  ? 0.48712 0.42848 0.38910 0.05664  -0.08434 0.01471  60  PRO A CB  
553  C  CG  . PRO A 60  ? 0.50339 0.46819 0.40333 0.07617  -0.06028 -0.01415 60  PRO A CG  
554  C  CD  . PRO A 60  ? 0.46361 0.39045 0.35358 0.03651  -0.05118 -0.00763 60  PRO A CD  
555  N  N   . PHE A 61  ? 0.39088 0.34478 0.29540 -0.03404 -0.06775 0.04308  61  PHE A N   
556  C  CA  . PHE A 61  ? 0.39592 0.35715 0.29258 -0.03794 -0.06166 0.03371  61  PHE A CA  
557  C  C   . PHE A 61  ? 0.47502 0.38605 0.29413 -0.05142 -0.06368 0.04276  61  PHE A C   
558  O  O   . PHE A 61  ? 0.51251 0.41387 0.32287 0.00563  -0.06093 0.06037  61  PHE A O   
559  C  CB  . PHE A 61  ? 0.36516 0.36154 0.29372 -0.03621 -0.04377 0.02689  61  PHE A CB  
560  C  CG  . PHE A 61  ? 0.37514 0.37506 0.30114 -0.02090 -0.03641 0.04364  61  PHE A CG  
561  C  CD1 . PHE A 61  ? 0.42347 0.47989 0.31595 0.05725  0.00577  0.08895  61  PHE A CD1 
562  C  CD2 . PHE A 61  ? 0.39871 0.35593 0.29965 -0.05462 -0.07334 0.02985  61  PHE A CD2 
563  C  CE1 . PHE A 61  ? 0.43315 0.53257 0.30509 0.05423  -0.00807 0.09845  61  PHE A CE1 
564  C  CE2 . PHE A 61  ? 0.41377 0.40561 0.30649 -0.05293 -0.06766 0.03734  61  PHE A CE2 
565  C  CZ  . PHE A 61  ? 0.40137 0.48506 0.31074 -0.01178 -0.04759 0.08037  61  PHE A CZ  
566  N  N   . GLY A 62  ? 0.54964 0.42281 0.27969 -0.11731 -0.05114 0.05963  62  GLY A N   
567  C  CA  . GLY A 62  ? 0.65416 0.44978 0.28091 -0.13188 -0.07719 0.10028  62  GLY A CA  
568  C  C   . GLY A 62  ? 0.72662 0.43539 0.34128 -0.14501 -0.12662 0.12690  62  GLY A C   
569  O  O   . GLY A 62  ? 0.83354 0.46148 0.42887 -0.17764 -0.15712 0.18328  62  GLY A O   
570  N  N   . SER A 63  ? 0.68285 0.38493 0.33412 -0.13150 -0.13299 0.09653  63  SER A N   
571  C  CA  . SER A 63  ? 0.66524 0.38279 0.35163 -0.12380 -0.11678 0.07713  63  SER A CA  
572  C  C   . SER A 63  ? 0.71211 0.41515 0.38321 -0.16130 -0.09712 0.09687  63  SER A C   
573  O  O   . SER A 63  ? 0.67633 0.45094 0.40830 -0.19225 -0.05011 0.10846  63  SER A O   
574  C  CB  . SER A 63  ? 0.63496 0.36471 0.34730 -0.10104 -0.08887 0.05804  63  SER A CB  
575  O  OG  . SER A 63  ? 0.62708 0.37204 0.37378 -0.06787 -0.06529 0.03688  63  SER A OG  
576  N  N   . SER A 64  ? 0.76310 0.41163 0.39282 -0.17582 -0.13482 0.12458  64  SER A N   
577  C  CA  . SER A 64  ? 0.77979 0.42478 0.41150 -0.20732 -0.12093 0.14156  64  SER A CA  
578  C  C   . SER A 64  ? 0.70978 0.45412 0.39525 -0.23222 -0.08436 0.13982  64  SER A C   
579  O  O   . SER A 64  ? 0.68835 0.39708 0.37873 -0.20839 -0.07753 0.11860  64  SER A O   
580  C  CB  . SER A 64  ? 0.87139 0.40825 0.45838 -0.21052 -0.12361 0.14324  64  SER A CB  
581  O  OG  . SER A 64  ? 0.92919 0.39458 0.48402 -0.17656 -0.14425 0.12839  64  SER A OG  
582  N  N   . ASP A 65  ? 0.71052 0.54359 0.39994 -0.25748 -0.04068 0.14104  65  ASP A N   
583  C  CA  A ASP A 65  ? 0.71461 0.57520 0.43246 -0.26551 -0.03741 0.11451  65  ASP A CA  
584  C  CA  B ASP A 65  ? 0.72556 0.56988 0.42318 -0.25348 -0.04101 0.12315  65  ASP A CA  
585  C  C   . ASP A 65  ? 0.73130 0.52273 0.43366 -0.26387 -0.05562 0.10376  65  ASP A C   
586  O  O   . ASP A 65  ? 0.67159 0.55119 0.45523 -0.28212 -0.04365 0.11882  65  ASP A O   
587  C  CB  A ASP A 65  ? 0.69509 0.67493 0.49833 -0.27696 -0.01109 0.09501  65  ASP A CB  
588  C  CB  B ASP A 65  ? 0.71493 0.65902 0.46137 -0.24360 -0.02273 0.12783  65  ASP A CB  
589  C  CG  A ASP A 65  ? 0.66919 0.77810 0.53940 -0.27305 0.01921  0.07549  65  ASP A CG  
590  C  CG  B ASP A 65  ? 0.70320 0.73278 0.48765 -0.21174 -0.00383 0.13392  65  ASP A CG  
591  O  OD1 A ASP A 65  ? 0.67698 0.82981 0.55959 -0.23995 -0.03365 0.00556  65  ASP A OD1 
592  O  OD1 B ASP A 65  ? 0.66943 0.73063 0.54005 -0.20981 -0.03055 0.11174  65  ASP A OD1 
593  O  OD2 A ASP A 65  ? 0.67593 0.87204 0.51402 -0.29544 0.08053  0.12572  65  ASP A OD2 
594  O  OD2 B ASP A 65  ? 0.75331 0.79754 0.45760 -0.15626 0.02466  0.16461  65  ASP A OD2 
595  N  N   . SER A 66  ? 0.78522 0.43945 0.45021 -0.26517 -0.07851 0.06710  66  SER A N   
596  C  CA  A SER A 66  ? 0.80207 0.40465 0.47790 -0.25762 -0.08793 0.04145  66  SER A CA  
597  C  CA  B SER A 66  ? 0.78663 0.40101 0.45119 -0.25571 -0.11785 0.05018  66  SER A CA  
598  C  C   . SER A 66  ? 0.78280 0.37410 0.43719 -0.23053 -0.12729 0.04779  66  SER A C   
599  O  O   . SER A 66  ? 0.88195 0.37783 0.42938 -0.22783 -0.15960 0.05921  66  SER A O   
600  C  CB  A SER A 66  ? 0.87081 0.40520 0.55525 -0.24749 -0.06947 0.02152  66  SER A CB  
601  C  CB  B SER A 66  ? 0.83362 0.40689 0.47598 -0.23333 -0.15343 0.05466  66  SER A CB  
602  O  OG  A SER A 66  ? 0.94674 0.42495 0.59332 -0.21263 -0.04370 0.01239  66  SER A OG  
603  O  OG  B SER A 66  ? 0.91109 0.43241 0.47226 -0.19230 -0.17472 0.09125  66  SER A OG  
604  N  N   . GLU A 67  ? 0.69732 0.33454 0.40154 -0.15737 -0.12291 0.06229  67  GLU A N   
605  C  CA  A GLU A 67  ? 0.65801 0.33480 0.38628 -0.11075 -0.12637 0.06884  67  GLU A CA  
606  C  CA  B GLU A 67  ? 0.67493 0.34368 0.39737 -0.13151 -0.10789 0.06840  67  GLU A CA  
607  C  C   . GLU A 67  ? 0.61915 0.31928 0.34510 -0.12189 -0.08633 0.06053  67  GLU A C   
608  O  O   . GLU A 67  ? 0.60336 0.32042 0.32661 -0.10245 -0.06661 0.05036  67  GLU A O   
609  C  CB  A GLU A 67  ? 0.69940 0.37476 0.43381 -0.06168 -0.15862 0.09478  67  GLU A CB  
610  C  CB  B GLU A 67  ? 0.71456 0.42263 0.45459 -0.12647 -0.11504 0.07950  67  GLU A CB  
611  C  CG  A GLU A 67  ? 0.76279 0.38522 0.48237 -0.02044 -0.16191 0.10236  67  GLU A CG  
612  C  CG  B GLU A 67  ? 0.76988 0.48200 0.51166 -0.11030 -0.09904 0.09120  67  GLU A CG  
613  C  CD  A GLU A 67  ? 0.77850 0.40475 0.56262 0.04843  -0.19655 0.06681  67  GLU A CD  
614  C  CD  B GLU A 67  ? 0.81649 0.58043 0.55236 -0.10324 -0.07647 0.08625  67  GLU A CD  
615  O  OE1 A GLU A 67  ? 0.68655 0.37370 0.55167 0.01030  -0.21630 0.04822  67  GLU A OE1 
616  O  OE1 B GLU A 67  ? 0.83014 0.66311 0.56161 -0.11315 -0.08838 0.07622  67  GLU A OE1 
617  O  OE2 A GLU A 67  ? 0.80533 0.49485 0.66811 0.11523  -0.19051 0.04026  67  GLU A OE2 
618  O  OE2 B GLU A 67  ? 0.84538 0.58741 0.56749 -0.11417 -0.03349 0.11628  67  GLU A OE2 
619  N  N   . ARG A 68  ? 0.57965 0.31550 0.30772 -0.14315 -0.05442 0.06287  68  ARG A N   
620  C  CA  . ARG A 68  ? 0.53989 0.32206 0.31778 -0.14265 -0.04018 0.05284  68  ARG A CA  
621  C  C   . ARG A 68  ? 0.48939 0.32308 0.30241 -0.14583 -0.03592 0.04921  68  ARG A C   
622  O  O   . ARG A 68  ? 0.46266 0.31415 0.29625 -0.11649 -0.00931 0.04645  68  ARG A O   
623  C  CB  . ARG A 68  ? 0.57324 0.35388 0.36654 -0.12484 -0.00543 0.03976  68  ARG A CB  
624  C  CG  . ARG A 68  ? 0.60897 0.38954 0.39791 -0.11485 0.03875  0.01218  68  ARG A CG  
625  C  CD  . ARG A 68  ? 0.68851 0.44394 0.46685 -0.12199 0.11163  -0.03229 68  ARG A CD  
626  N  NE  . ARG A 68  ? 0.72574 0.43827 0.48485 -0.16755 0.14335  -0.07710 68  ARG A NE  
627  C  CZ  . ARG A 68  ? 0.58444 0.48434 0.43057 -0.20404 0.11247  -0.08988 68  ARG A CZ  
628  N  NH1 . ARG A 68  ? 0.55126 0.51607 0.49086 -0.14978 0.10594  -0.08869 68  ARG A NH1 
629  N  NH2 . ARG A 68  ? 0.58726 0.47391 0.38641 -0.24682 0.03557  -0.07556 68  ARG A NH2 
630  N  N   . GLU A 69  ? 0.49636 0.36930 0.32458 -0.17185 -0.05541 0.04739  69  GLU A N   
631  C  CA  A GLU A 69  ? 0.48989 0.39100 0.36841 -0.17846 -0.06864 0.03405  69  GLU A CA  
632  C  CA  B GLU A 69  ? 0.49640 0.41146 0.34434 -0.17235 -0.07258 0.04110  69  GLU A CA  
633  C  C   . GLU A 69  ? 0.47903 0.34973 0.32623 -0.14449 -0.07962 0.03792  69  GLU A C   
634  O  O   . GLU A 69  ? 0.46857 0.33226 0.32048 -0.12112 -0.08363 0.03933  69  GLU A O   
635  C  CB  A GLU A 69  ? 0.52515 0.46785 0.48325 -0.22151 -0.06963 0.00548  69  GLU A CB  
636  C  CB  B GLU A 69  ? 0.52596 0.53399 0.41248 -0.20115 -0.07721 0.02853  69  GLU A CB  
637  C  CG  A GLU A 69  ? 0.56359 0.52828 0.56144 -0.22921 -0.06503 -0.04546 69  GLU A CG  
638  C  CG  B GLU A 69  ? 0.56260 0.66757 0.46743 -0.16487 -0.04647 0.02522  69  GLU A CG  
639  C  CD  A GLU A 69  ? 0.56797 0.58993 0.69779 -0.23328 -0.01962 -0.08574 69  GLU A CD  
640  C  CD  B GLU A 69  ? 0.58103 0.77360 0.49983 -0.18353 -0.05317 0.03226  69  GLU A CD  
641  O  OE1 A GLU A 69  ? 0.59080 0.70008 0.72759 -0.25272 0.03851  -0.04838 69  GLU A OE1 
642  O  OE1 B GLU A 69  ? 0.57506 0.75828 0.62256 -0.24235 -0.01115 -0.00326 69  GLU A OE1 
643  O  OE2 A GLU A 69  ? 0.59442 0.53449 0.82403 -0.19659 -0.01168 -0.12070 69  GLU A OE2 
644  O  OE2 B GLU A 69  ? 0.57707 0.84704 0.49178 -0.17815 -0.08587 0.05188  69  GLU A OE2 
645  N  N   . GLU A 70  ? 0.50813 0.29613 0.31888 -0.11781 -0.08059 0.02299  70  GLU A N   
646  C  CA  A GLU A 70  ? 0.52915 0.28466 0.33987 -0.08778 -0.07473 0.01561  70  GLU A CA  
647  C  CA  B GLU A 70  ? 0.55053 0.26407 0.32524 -0.08867 -0.08080 0.00622  70  GLU A CA  
648  C  C   . GLU A 70  ? 0.49372 0.26386 0.30043 -0.06624 -0.07065 0.00320  70  GLU A C   
649  O  O   . GLU A 70  ? 0.47387 0.27746 0.28315 -0.04568 -0.06495 -0.01050 70  GLU A O   
650  C  CB  A GLU A 70  ? 0.60931 0.30970 0.42311 -0.06964 -0.05871 0.01439  70  GLU A CB  
651  C  CB  B GLU A 70  ? 0.67236 0.25912 0.37860 -0.06301 -0.07249 -0.00169 70  GLU A CB  
652  C  CG  A GLU A 70  ? 0.65638 0.35495 0.51048 -0.10168 -0.04058 -0.01056 70  GLU A CG  
653  C  CG  B GLU A 70  ? 0.76526 0.32353 0.41566 -0.06013 -0.03945 0.01387  70  GLU A CG  
654  C  CD  A GLU A 70  ? 0.71009 0.46997 0.57425 -0.15145 -0.03448 -0.06717 70  GLU A CD  
655  C  CD  B GLU A 70  ? 0.88283 0.40303 0.45065 -0.13386 -0.03024 -0.00598 70  GLU A CD  
656  O  OE1 A GLU A 70  ? 0.83416 0.56078 0.60715 -0.15856 -0.03160 -0.12375 70  GLU A OE1 
657  O  OE1 B GLU A 70  ? 0.97169 0.35073 0.58418 -0.18326 -0.07265 -0.03053 70  GLU A OE1 
658  O  OE2 A GLU A 70  ? 0.68191 0.55279 0.56999 -0.15368 -0.01278 -0.08607 70  GLU A OE2 
659  O  OE2 B GLU A 70  ? 0.91805 0.54492 0.37555 -0.16995 0.02973  -0.06686 70  GLU A OE2 
660  N  N   . HIS A 71  ? 0.44083 0.25226 0.27271 -0.03994 -0.05288 0.00183  71  HIS A N   
661  C  CA  . HIS A 71  ? 0.38757 0.24956 0.26056 -0.02799 -0.03617 -0.00461 71  HIS A CA  
662  C  C   . HIS A 71  ? 0.35517 0.23819 0.25611 -0.04579 -0.03215 0.00368  71  HIS A C   
663  O  O   . HIS A 71  ? 0.35276 0.25053 0.26237 -0.04740 -0.03694 0.01167  71  HIS A O   
664  C  CB  . HIS A 71  ? 0.39434 0.26657 0.27734 -0.01512 -0.04501 -0.00794 71  HIS A CB  
665  C  CG  . HIS A 71  ? 0.42890 0.31288 0.32790 -0.00311 -0.06309 0.02116  71  HIS A CG  
666  N  ND1 . HIS A 71  ? 0.43091 0.38368 0.35201 0.03313  -0.07995 0.01496  71  HIS A ND1 
667  C  CD2 . HIS A 71  ? 0.46683 0.36308 0.36860 0.00138  -0.06236 0.05989  71  HIS A CD2 
668  C  CE1 . HIS A 71  ? 0.45167 0.41513 0.39144 0.04027  -0.09542 0.02057  71  HIS A CE1 
669  N  NE2 . HIS A 71  ? 0.47062 0.40727 0.41143 0.02355  -0.07733 0.04235  71  HIS A NE2 
670  N  N   . VAL A 72  ? 0.34591 0.24456 0.24080 -0.05973 -0.03910 0.00544  72  VAL A N   
671  C  CA  . VAL A 72  ? 0.35051 0.26039 0.24453 -0.05514 -0.02870 0.00571  72  VAL A CA  
672  C  C   . VAL A 72  ? 0.34228 0.26004 0.25052 -0.06028 -0.03256 0.00573  72  VAL A C   
673  O  O   . VAL A 72  ? 0.32778 0.26805 0.24625 -0.04840 -0.02837 0.01575  72  VAL A O   
674  C  CB  . VAL A 72  ? 0.36590 0.30137 0.26357 -0.04186 -0.01859 -0.00350 72  VAL A CB  
675  C  CG1 . VAL A 72  ? 0.35891 0.34537 0.28124 -0.02569 -0.01850 0.00015  72  VAL A CG1 
676  C  CG2 . VAL A 72  ? 0.40668 0.31556 0.27166 -0.02828 -0.02314 -0.01598 72  VAL A CG2 
677  N  N   . LYS A 73  ? 0.36895 0.26455 0.26283 -0.07570 -0.04663 -0.00427 73  LYS A N   
678  C  CA  A LYS A 73  ? 0.39622 0.26383 0.26951 -0.08962 -0.05799 -0.00622 73  LYS A CA  
679  C  CA  B LYS A 73  ? 0.38391 0.27302 0.29147 -0.08699 -0.05868 -0.01493 73  LYS A CA  
680  C  C   . LYS A 73  ? 0.37145 0.25818 0.26535 -0.07212 -0.07009 -0.02000 73  LYS A C   
681  O  O   . LYS A 73  ? 0.36964 0.27467 0.24776 -0.06334 -0.08280 -0.02351 73  LYS A O   
682  C  CB  A LYS A 73  ? 0.44379 0.29442 0.30075 -0.13032 -0.06306 -0.00348 73  LYS A CB  
683  C  CB  B LYS A 73  ? 0.41382 0.31824 0.38120 -0.12511 -0.06151 -0.01900 73  LYS A CB  
684  C  CG  A LYS A 73  ? 0.46755 0.33874 0.36066 -0.16190 -0.07950 -0.03012 73  LYS A CG  
685  C  CG  B LYS A 73  ? 0.43095 0.38335 0.49670 -0.15119 -0.06550 -0.03940 73  LYS A CG  
686  C  CD  A LYS A 73  ? 0.55839 0.36854 0.44211 -0.16579 -0.06567 -0.05060 73  LYS A CD  
687  C  CD  B LYS A 73  ? 0.51358 0.42138 0.60745 -0.14597 -0.04571 -0.03818 73  LYS A CD  
688  C  CE  A LYS A 73  ? 0.63454 0.42310 0.49602 -0.15199 -0.03844 -0.04611 73  LYS A CE  
689  C  CE  B LYS A 73  ? 0.55164 0.48762 0.67026 -0.12578 -0.01751 -0.01456 73  LYS A CE  
690  N  NZ  A LYS A 73  ? 0.69521 0.43708 0.55650 -0.13626 -0.03295 -0.03734 73  LYS A NZ  
691  N  NZ  B LYS A 73  ? 0.59161 0.50241 0.71357 -0.10178 -0.01343 -0.00158 73  LYS A NZ  
692  N  N   . ARG A 74  ? 0.35055 0.24505 0.28186 -0.05564 -0.06554 -0.02311 74  ARG A N   
693  C  CA  A ARG A 74  ? 0.35223 0.25948 0.31118 -0.03731 -0.05419 -0.01995 74  ARG A CA  
694  C  CA  B ARG A 74  ? 0.34928 0.24040 0.28801 -0.03369 -0.06582 -0.01985 74  ARG A CA  
695  C  C   . ARG A 74  ? 0.32207 0.24590 0.26250 -0.03501 -0.06022 -0.02993 74  ARG A C   
696  O  O   . ARG A 74  ? 0.31075 0.25971 0.25207 -0.02422 -0.05492 -0.03718 74  ARG A O   
697  C  CB  A ARG A 74  ? 0.39599 0.30502 0.40033 0.01291  -0.03847 0.01545  74  ARG A CB  
698  C  CB  B ARG A 74  ? 0.38568 0.24299 0.32645 -0.00970 -0.06985 -0.00443 74  ARG A CB  
699  C  CG  A ARG A 74  ? 0.46343 0.33424 0.45717 -0.00461 -0.05258 0.02116  74  ARG A CG  
700  C  CG  B ARG A 74  ? 0.39876 0.29025 0.33603 -0.03005 -0.07720 -0.01888 74  ARG A CG  
701  C  CD  A ARG A 74  ? 0.47443 0.39878 0.55547 -0.00088 -0.05864 0.06955  74  ARG A CD  
702  C  CD  B ARG A 74  ? 0.41020 0.31193 0.34871 -0.05660 -0.09827 -0.03236 74  ARG A CD  
703  N  NE  A ARG A 74  ? 0.48662 0.42079 0.64401 -0.02845 -0.05467 0.06951  74  ARG A NE  
704  N  NE  B ARG A 74  ? 0.42988 0.31621 0.32904 -0.07337 -0.12745 -0.05458 74  ARG A NE  
705  C  CZ  A ARG A 74  ? 0.42709 0.44054 0.62301 -0.04482 -0.08630 0.05029  74  ARG A CZ  
706  C  CZ  B ARG A 74  ? 0.43733 0.34271 0.29978 -0.08249 -0.12905 -0.06463 74  ARG A CZ  
707  N  NH1 A ARG A 74  ? 0.37681 0.49986 0.52204 -0.06330 -0.07128 0.09003  74  ARG A NH1 
708  N  NH1 B ARG A 74  ? 0.40811 0.30718 0.34386 -0.09051 -0.13348 -0.09035 74  ARG A NH1 
709  N  NH2 A ARG A 74  ? 0.38915 0.39354 0.65270 -0.06347 -0.11641 -0.00180 74  ARG A NH2 
710  N  NH2 B ARG A 74  ? 0.45974 0.42130 0.25302 -0.07728 -0.10954 -0.07788 74  ARG A NH2 
711  N  N   . PHE A 75  ? 0.29830 0.23136 0.22870 -0.03865 -0.06120 -0.02017 75  PHE A N   
712  C  CA  . PHE A 75  ? 0.27968 0.23318 0.20943 -0.04399 -0.06680 -0.01825 75  PHE A CA  
713  C  C   . PHE A 75  ? 0.27325 0.23932 0.20605 -0.04918 -0.06803 -0.02148 75  PHE A C   
714  O  O   . PHE A 75  ? 0.28850 0.23216 0.19597 -0.05133 -0.07761 -0.02489 75  PHE A O   
715  C  CB  . PHE A 75  ? 0.28419 0.24692 0.20078 -0.05748 -0.05832 -0.02419 75  PHE A CB  
716  C  CG  . PHE A 75  ? 0.29285 0.26441 0.19601 -0.06863 -0.05740 -0.02111 75  PHE A CG  
717  C  CD1 . PHE A 75  ? 0.32726 0.28651 0.19719 -0.08553 -0.03873 -0.03599 75  PHE A CD1 
718  C  CD2 . PHE A 75  ? 0.30879 0.26263 0.24262 -0.05520 -0.06219 -0.00628 75  PHE A CD2 
719  C  CE1 . PHE A 75  ? 0.37383 0.29048 0.20847 -0.10178 -0.03403 -0.03551 75  PHE A CE1 
720  C  CE2 . PHE A 75  ? 0.37378 0.25865 0.26124 -0.04082 -0.06214 -0.00409 75  PHE A CE2 
721  C  CZ  . PHE A 75  ? 0.40178 0.26833 0.22297 -0.07821 -0.05228 -0.01473 75  PHE A CZ  
722  N  N   A ARG A 76  ? 0.27174 0.25063 0.22274 -0.05137 -0.07189 -0.02423 76  ARG A N   
723  N  N   B ARG A 76  ? 0.27788 0.26297 0.19935 -0.04934 -0.05830 -0.01502 76  ARG A N   
724  C  CA  A ARG A 76  ? 0.27182 0.27343 0.24722 -0.05332 -0.07944 -0.03656 76  ARG A CA  
725  C  CA  B ARG A 76  ? 0.28450 0.30167 0.20755 -0.05209 -0.06245 -0.01099 76  ARG A CA  
726  C  C   A ARG A 76  ? 0.26694 0.25790 0.24148 -0.06026 -0.08194 -0.03357 76  ARG A C   
727  C  C   B ARG A 76  ? 0.29014 0.28204 0.18851 -0.04277 -0.05650 -0.00157 76  ARG A C   
728  O  O   A ARG A 76  ? 0.26402 0.26716 0.24122 -0.05661 -0.07962 -0.03068 76  ARG A O   
729  O  O   B ARG A 76  ? 0.30846 0.30223 0.16506 -0.02207 -0.04955 0.00910  76  ARG A O   
730  C  CB  A ARG A 76  ? 0.27539 0.34413 0.27820 -0.04236 -0.08585 -0.05343 76  ARG A CB  
731  C  CB  B ARG A 76  ? 0.28347 0.38633 0.25073 -0.05918 -0.07133 -0.02025 76  ARG A CB  
732  C  CG  A ARG A 76  ? 0.34081 0.39637 0.29035 -0.03512 -0.07703 -0.06349 76  ARG A CG  
733  C  CG  B ARG A 76  ? 0.30602 0.44788 0.26991 -0.05256 -0.07308 -0.04877 76  ARG A CG  
734  C  CD  A ARG A 76  ? 0.36166 0.40169 0.34319 -0.03211 -0.05138 -0.08487 76  ARG A CD  
735  C  CD  B ARG A 76  ? 0.31077 0.45827 0.23952 -0.05502 -0.07346 -0.08167 76  ARG A CD  
736  N  NE  A ARG A 76  ? 0.36129 0.39070 0.35422 -0.03333 -0.06785 -0.10714 76  ARG A NE  
737  N  NE  B ARG A 76  ? 0.28718 0.43096 0.20964 -0.01099 -0.06894 -0.10582 76  ARG A NE  
738  C  CZ  A ARG A 76  ? 0.39652 0.43566 0.30491 0.00991  -0.08070 -0.09607 76  ARG A CZ  
739  C  CZ  B ARG A 76  ? 0.30715 0.39332 0.23975 -0.05321 -0.06665 -0.11128 76  ARG A CZ  
740  N  NH1 A ARG A 76  ? 0.46288 0.48772 0.30594 0.02506  -0.10500 -0.07009 76  ARG A NH1 
741  N  NH1 B ARG A 76  ? 0.31828 0.40267 0.28089 -0.05308 -0.06519 -0.09786 76  ARG A NH1 
742  N  NH2 A ARG A 76  ? 0.39105 0.49254 0.27926 0.05940  -0.04515 -0.07674 76  ARG A NH2 
743  N  NH2 B ARG A 76  ? 0.29019 0.37826 0.24838 -0.08806 -0.02951 -0.13447 76  ARG A NH2 
744  N  N   A GLN A 77  ? 0.28107 0.25063 0.23874 -0.06375 -0.08540 -0.04161 77  GLN A N   
745  N  N   B GLN A 77  ? 0.29231 0.27365 0.20996 -0.05003 -0.04342 -0.01896 77  GLN A N   
746  C  CA  A GLN A 77  ? 0.29064 0.25455 0.24284 -0.05138 -0.08080 -0.04632 77  GLN A CA  
747  C  CA  B GLN A 77  ? 0.29841 0.28807 0.23703 -0.04126 -0.04327 -0.04069 77  GLN A CA  
748  C  C   A GLN A 77  ? 0.29037 0.25706 0.22128 -0.04471 -0.07172 -0.05663 77  GLN A C   
749  C  C   B GLN A 77  ? 0.28971 0.27559 0.21155 -0.04074 -0.05019 -0.05114 77  GLN A C   
750  O  O   A GLN A 77  ? 0.31886 0.26936 0.21984 -0.05011 -0.07987 -0.05830 77  GLN A O   
751  O  O   B GLN A 77  ? 0.31951 0.28971 0.20881 -0.04180 -0.04670 -0.04559 77  GLN A O   
752  C  CB  A GLN A 77  ? 0.33308 0.26372 0.26412 -0.05350 -0.08543 -0.04556 77  GLN A CB  
753  C  CB  B GLN A 77  ? 0.32254 0.31264 0.29760 -0.02955 -0.04640 -0.05350 77  GLN A CB  
754  C  CG  A GLN A 77  ? 0.44075 0.28253 0.28785 -0.07522 -0.09838 -0.06789 77  GLN A CG  
755  C  CG  B GLN A 77  ? 0.35585 0.35278 0.36133 -0.01828 -0.04759 -0.07818 77  GLN A CG  
756  C  CD  A GLN A 77  ? 0.49233 0.33125 0.31136 -0.11686 -0.10098 -0.06038 77  GLN A CD  
757  C  CD  B GLN A 77  ? 0.45593 0.38618 0.46923 -0.02166 -0.04629 -0.09451 77  GLN A CD  
758  O  OE1 A GLN A 77  ? 0.53002 0.39262 0.41729 -0.16032 -0.08587 -0.07169 77  GLN A OE1 
759  O  OE1 B GLN A 77  ? 0.59277 0.33506 0.50894 -0.00663 -0.08767 -0.11914 77  GLN A OE1 
760  N  NE2 A GLN A 77  ? 0.47319 0.36408 0.26271 -0.11533 -0.08254 -0.04110 77  GLN A NE2 
761  N  NE2 B GLN A 77  ? 0.48879 0.48338 0.51430 -0.07625 -0.05199 -0.09391 77  GLN A NE2 
762  N  N   . ALA A 78  ? 0.27222 0.25798 0.21200 -0.03811 -0.05579 -0.05384 78  ALA A N   
763  C  CA  . ALA A 78  ? 0.26429 0.26786 0.21777 -0.03247 -0.05928 -0.04554 78  ALA A CA  
764  C  C   . ALA A 78  ? 0.25009 0.25320 0.17897 -0.04282 -0.05950 -0.04894 78  ALA A C   
765  O  O   . ALA A 78  ? 0.25848 0.25374 0.17658 -0.04115 -0.04478 -0.04669 78  ALA A O   
766  C  CB  . ALA A 78  ? 0.27098 0.28949 0.26155 -0.02231 -0.07945 -0.04312 78  ALA A CB  
767  N  N   . LEU A 79  ? 0.25070 0.24044 0.16979 -0.04266 -0.05600 -0.04957 79  LEU A N   
768  C  CA  . LEU A 79  ? 0.26341 0.24285 0.15373 -0.03797 -0.04773 -0.05029 79  LEU A CA  
769  C  C   . LEU A 79  ? 0.26282 0.24846 0.16021 -0.03973 -0.04957 -0.04894 79  LEU A C   
770  O  O   . LEU A 79  ? 0.28152 0.26231 0.16387 -0.03568 -0.05057 -0.04558 79  LEU A O   
771  C  CB  . LEU A 79  ? 0.28228 0.24646 0.14686 -0.04843 -0.03987 -0.04639 79  LEU A CB  
772  C  CG  . LEU A 79  ? 0.30932 0.26062 0.15424 -0.04328 -0.03523 -0.04750 79  LEU A CG  
773  C  CD1 . LEU A 79  ? 0.35981 0.27105 0.15559 -0.06217 -0.02016 -0.04820 79  LEU A CD1 
774  C  CD2 . LEU A 79  ? 0.30133 0.28568 0.15893 -0.05386 -0.04433 -0.04608 79  LEU A CD2 
775  N  N   . ASP A 80  ? 0.24853 0.26661 0.15955 -0.04717 -0.05737 -0.05150 80  ASP A N   
776  C  CA  . ASP A 80  ? 0.24505 0.29847 0.16499 -0.05561 -0.06020 -0.05498 80  ASP A CA  
777  C  C   . ASP A 80  ? 0.26405 0.31440 0.16382 -0.05576 -0.05378 -0.07081 80  ASP A C   
778  O  O   . ASP A 80  ? 0.29221 0.36187 0.16723 -0.05261 -0.05520 -0.06924 80  ASP A O   
779  C  CB  . ASP A 80  ? 0.25981 0.31178 0.19684 -0.06606 -0.07226 -0.04786 80  ASP A CB  
780  C  CG  . ASP A 80  ? 0.28038 0.33270 0.23932 -0.07852 -0.06344 -0.02769 80  ASP A CG  
781  O  OD1 . ASP A 80  ? 0.27025 0.35326 0.22856 -0.04599 -0.03764 -0.02845 80  ASP A OD1 
782  O  OD2 . ASP A 80  ? 0.31088 0.35548 0.30933 -0.10713 -0.07182 0.00416  80  ASP A OD2 
783  N  N   . ASP A 81  ? 0.26978 0.29338 0.18376 -0.05854 -0.04214 -0.08387 81  ASP A N   
784  C  CA  . ASP A 81  ? 0.28409 0.31933 0.20970 -0.05205 -0.02941 -0.10125 81  ASP A CA  
785  C  C   . ASP A 81  ? 0.28119 0.32620 0.18801 -0.05385 -0.02209 -0.10406 81  ASP A C   
786  O  O   . ASP A 81  ? 0.32736 0.35278 0.19178 -0.07197 -0.00993 -0.11169 81  ASP A O   
787  C  CB  . ASP A 81  ? 0.33834 0.32737 0.29172 -0.02869 -0.00162 -0.09348 81  ASP A CB  
788  C  CG  . ASP A 81  ? 0.48610 0.34842 0.40597 -0.00617 0.01376  -0.09768 81  ASP A CG  
789  O  OD1 . ASP A 81  ? 0.59316 0.35929 0.43980 -0.10023 0.01059  -0.16420 81  ASP A OD1 
790  O  OD2 . ASP A 81  ? 0.55882 0.38044 0.49181 0.07068  -0.00403 -0.08677 81  ASP A OD2 
791  N  N   . THR A 82  ? 0.26717 0.29925 0.17306 -0.06518 -0.02648 -0.09440 82  THR A N   
792  C  CA  . THR A 82  ? 0.26943 0.29495 0.16761 -0.07140 -0.02676 -0.07930 82  THR A CA  
793  C  C   . THR A 82  ? 0.28184 0.30260 0.16374 -0.07510 -0.03721 -0.06739 82  THR A C   
794  O  O   . THR A 82  ? 0.33175 0.32790 0.18855 -0.07692 -0.01490 -0.03209 82  THR A O   
795  C  CB  . THR A 82  ? 0.26072 0.30336 0.19398 -0.06417 -0.02925 -0.07522 82  THR A CB  
796  O  OG1 . THR A 82  ? 0.26622 0.28731 0.16594 -0.06288 -0.04270 -0.07494 82  THR A OG1 
797  C  CG2 . THR A 82  ? 0.26131 0.33881 0.25028 -0.05055 -0.03178 -0.07453 82  THR A CG2 
798  N  N   . GLY A 83  ? 0.25803 0.30239 0.16237 -0.06305 -0.05649 -0.07419 83  GLY A N   
799  C  CA  . GLY A 83  ? 0.26049 0.29850 0.15948 -0.05089 -0.05571 -0.06068 83  GLY A CA  
800  C  C   . GLY A 83  ? 0.25458 0.27817 0.16154 -0.04849 -0.06862 -0.04815 83  GLY A C   
801  O  O   . GLY A 83  ? 0.29471 0.28438 0.19074 -0.03393 -0.09304 -0.03921 83  GLY A O   
802  N  N   . MET A 84  ? 0.23990 0.25352 0.14218 -0.05424 -0.05435 -0.05060 84  MET A N   
803  C  CA  . MET A 84  ? 0.23632 0.25129 0.13375 -0.05292 -0.04326 -0.04360 84  MET A CA  
804  C  C   . MET A 84  ? 0.23331 0.25750 0.13742 -0.05969 -0.03790 -0.03588 84  MET A C   
805  O  O   . MET A 84  ? 0.25299 0.25832 0.17545 -0.06258 -0.01926 -0.03515 84  MET A O   
806  C  CB  . MET A 84  ? 0.23165 0.26847 0.14420 -0.05756 -0.03759 -0.04540 84  MET A CB  
807  C  CG  . MET A 84  ? 0.23478 0.28651 0.18352 -0.05966 -0.03083 -0.05356 84  MET A CG  
808  S  SD  . MET A 84  ? 0.27408 0.29782 0.23044 -0.05056 -0.00398 -0.04855 84  MET A SD  
809  C  CE  . MET A 84  ? 0.28878 0.37519 0.24072 -0.03690 -0.04044 -0.09964 84  MET A CE  
810  N  N   A LYS A 85  ? 0.22002 0.26550 0.12857 -0.05924 -0.03864 -0.04782 85  LYS A N   
811  N  N   B LYS A 85  ? 0.23257 0.26365 0.12629 -0.05134 -0.02299 -0.03128 85  LYS A N   
812  C  CA  A LYS A 85  ? 0.21051 0.27103 0.12980 -0.05110 -0.04732 -0.04676 85  LYS A CA  
813  C  CA  B LYS A 85  ? 0.22782 0.27507 0.15502 -0.04012 -0.01372 -0.01971 85  LYS A CA  
814  C  C   A LYS A 85  ? 0.18975 0.24948 0.12493 -0.06238 -0.04370 -0.04223 85  LYS A C   
815  C  C   B LYS A 85  ? 0.21408 0.26846 0.13762 -0.04593 -0.01619 -0.02517 85  LYS A C   
816  O  O   A LYS A 85  ? 0.19193 0.26356 0.12622 -0.06729 -0.04362 -0.03335 85  LYS A O   
817  O  O   B LYS A 85  ? 0.21985 0.29231 0.13099 -0.04852 -0.00652 -0.01780 85  LYS A O   
818  C  CB  A LYS A 85  ? 0.24696 0.31399 0.13370 -0.02126 -0.06217 -0.04864 85  LYS A CB  
819  C  CB  B LYS A 85  ? 0.24939 0.31506 0.21639 -0.02166 -0.01140 -0.00425 85  LYS A CB  
820  C  CG  A LYS A 85  ? 0.29928 0.37775 0.16850 -0.00469 -0.08839 -0.03452 85  LYS A CG  
821  C  CG  B LYS A 85  ? 0.30555 0.36755 0.27382 -0.02797 -0.03525 0.00239  85  LYS A CG  
822  C  CD  A LYS A 85  ? 0.34615 0.44735 0.24852 -0.03247 -0.13356 -0.02606 85  LYS A CD  
823  C  CD  B LYS A 85  ? 0.36737 0.42901 0.34326 -0.00477 -0.06426 0.01863  85  LYS A CD  
824  C  CE  A LYS A 85  ? 0.43878 0.51240 0.31771 -0.06477 -0.18597 -0.02414 85  LYS A CE  
825  C  CE  B LYS A 85  ? 0.39944 0.48439 0.38786 0.00729  -0.09600 0.02603  85  LYS A CE  
826  N  NZ  A LYS A 85  ? 0.52395 0.54529 0.38862 -0.05488 -0.21356 -0.04155 85  LYS A NZ  
827  N  NZ  B LYS A 85  ? 0.41797 0.50675 0.40762 -0.00099 -0.09559 0.03588  85  LYS A NZ  
828  N  N   . VAL A 86  ? 0.19702 0.25510 0.13048 -0.05303 -0.02614 -0.03871 86  VAL A N   
829  C  CA  . VAL A 86  ? 0.20767 0.24990 0.13218 -0.04968 -0.01770 -0.02658 86  VAL A CA  
830  C  C   . VAL A 86  ? 0.20355 0.24772 0.14327 -0.04992 -0.01059 -0.02588 86  VAL A C   
831  O  O   . VAL A 86  ? 0.22196 0.25995 0.19202 -0.05234 0.02146  -0.03568 86  VAL A O   
832  C  CB  . VAL A 86  ? 0.24870 0.26159 0.16460 -0.05168 -0.02263 -0.01123 86  VAL A CB  
833  C  CG1 . VAL A 86  ? 0.27978 0.29915 0.15875 -0.06088 -0.03809 0.00641  86  VAL A CG1 
834  C  CG2 . VAL A 86  ? 0.27336 0.26346 0.22896 -0.03048 -0.00737 -0.01048 86  VAL A CG2 
835  N  N   . PRO A 87  ? 0.18594 0.23959 0.13178 -0.04514 -0.02698 -0.02411 87  PRO A N   
836  C  CA  . PRO A 87  ? 0.19797 0.23789 0.13099 -0.02817 -0.02832 -0.01949 87  PRO A CA  
837  C  C   . PRO A 87  ? 0.17810 0.22524 0.12617 -0.02052 -0.03060 -0.01853 87  PRO A C   
838  O  O   . PRO A 87  ? 0.18651 0.24627 0.13774 -0.00877 -0.02867 -0.01910 87  PRO A O   
839  C  CB  . PRO A 87  ? 0.23038 0.25620 0.16074 -0.02769 -0.01473 0.00285  87  PRO A CB  
840  C  CG  . PRO A 87  ? 0.22554 0.27686 0.19116 -0.02935 -0.00325 0.00705  87  PRO A CG  
841  C  CD  . PRO A 87  ? 0.19201 0.25529 0.15845 -0.04065 -0.01688 -0.00607 87  PRO A CD  
842  N  N   . MET A 88  ? 0.17498 0.22308 0.11101 -0.02513 -0.02729 -0.01427 88  MET A N   
843  C  CA  . MET A 88  ? 0.18339 0.21309 0.11254 -0.03056 -0.02424 -0.01924 88  MET A CA  
844  C  C   . MET A 88  ? 0.17021 0.20691 0.12391 -0.03260 -0.01292 -0.01792 88  MET A C   
845  O  O   . MET A 88  ? 0.18580 0.21204 0.13214 -0.02523 -0.01433 -0.02124 88  MET A O   
846  C  CB  . MET A 88  ? 0.18426 0.21448 0.11363 -0.02659 -0.02799 -0.01368 88  MET A CB  
847  C  CG  . MET A 88  ? 0.18038 0.22154 0.12975 -0.02317 -0.03709 -0.01475 88  MET A CG  
848  S  SD  . MET A 88  ? 0.17948 0.23368 0.13900 -0.02475 -0.03019 -0.01225 88  MET A SD  
849  C  CE  . MET A 88  ? 0.19834 0.26532 0.18011 -0.02950 -0.01604 -0.01147 88  MET A CE  
850  N  N   . ALA A 89  ? 0.16845 0.21404 0.11551 -0.03039 -0.03055 -0.00510 89  ALA A N   
851  C  CA  . ALA A 89  ? 0.19400 0.21240 0.12774 -0.02943 -0.03546 -0.00623 89  ALA A CA  
852  C  C   . ALA A 89  ? 0.16430 0.19837 0.11993 -0.01652 -0.01849 -0.00666 89  ALA A C   
853  O  O   . ALA A 89  ? 0.17193 0.20881 0.12762 -0.01680 -0.02413 -0.00709 89  ALA A O   
854  C  CB  . ALA A 89  ? 0.26553 0.23093 0.16080 -0.05349 -0.05288 -0.00317 89  ALA A CB  
855  N  N   . THR A 90  ? 0.17597 0.19989 0.12006 -0.01604 -0.02295 -0.00667 90  THR A N   
856  C  CA  . THR A 90  ? 0.18472 0.19331 0.12283 -0.02295 -0.02837 -0.00648 90  THR A CA  
857  C  C   . THR A 90  ? 0.18649 0.19199 0.12812 -0.02944 -0.02763 -0.01194 90  THR A C   
858  O  O   . THR A 90  ? 0.20567 0.19964 0.12456 -0.01401 -0.01900 -0.00486 90  THR A O   
859  C  CB  . THR A 90  ? 0.19467 0.19856 0.14193 -0.02380 -0.02829 -0.01227 90  THR A CB  
860  O  OG1 . THR A 90  ? 0.21748 0.20472 0.14420 -0.02361 -0.04915 -0.01277 90  THR A OG1 
861  C  CG2 . THR A 90  ? 0.18822 0.21475 0.18678 -0.02828 -0.01346 -0.00997 90  THR A CG2 
862  N  N   . THR A 91  ? 0.19882 0.19942 0.12473 -0.02004 -0.02986 -0.00097 91  THR A N   
863  C  CA  . THR A 91  ? 0.18718 0.20313 0.12084 -0.02199 -0.02240 0.00863  91  THR A CA  
864  C  C   . THR A 91  ? 0.18872 0.18767 0.12070 -0.02706 -0.02965 -0.00291 91  THR A C   
865  O  O   . THR A 91  ? 0.20386 0.18882 0.16591 -0.02737 -0.03647 -0.01297 91  THR A O   
866  C  CB  . THR A 91  ? 0.19400 0.23595 0.13548 -0.02143 -0.01326 0.01361  91  THR A CB  
867  O  OG1 . THR A 91  ? 0.19298 0.26116 0.15298 -0.01352 -0.02532 0.00246  91  THR A OG1 
868  C  CG2 . THR A 91  ? 0.20005 0.24934 0.15383 -0.02712 0.00107  0.02484  91  THR A CG2 
869  N  N   . ASN A 92  ? 0.17350 0.18779 0.11063 -0.03412 -0.02981 -0.00349 92  ASN A N   
870  C  CA  . ASN A 92  ? 0.17412 0.19776 0.11089 -0.02596 -0.02459 -0.00657 92  ASN A CA  
871  C  C   . ASN A 92  ? 0.18680 0.18819 0.11139 -0.03595 -0.01383 0.00059  92  ASN A C   
872  O  O   . ASN A 92  ? 0.20762 0.19183 0.12349 -0.03842 -0.01521 0.00328  92  ASN A O   
873  C  CB  . ASN A 92  ? 0.18325 0.21180 0.12753 -0.02168 -0.02269 -0.01410 92  ASN A CB  
874  C  CG  . ASN A 92  ? 0.18315 0.23184 0.12824 -0.02101 -0.02922 -0.02327 92  ASN A CG  
875  O  OD1 . ASN A 92  ? 0.19345 0.23765 0.12610 -0.02306 -0.03094 -0.02451 92  ASN A OD1 
876  N  ND2 . ASN A 92  ? 0.18316 0.27137 0.14197 -0.00865 -0.01752 -0.02678 92  ASN A ND2 
877  N  N   . LEU A 93  ? 0.18779 0.19089 0.10629 -0.03596 -0.01473 -0.00588 93  LEU A N   
878  C  CA  . LEU A 93  ? 0.18643 0.20169 0.11412 -0.03340 -0.01295 -0.01116 93  LEU A CA  
879  C  C   . LEU A 93  ? 0.18479 0.19988 0.11328 -0.03264 -0.01608 -0.01274 93  LEU A C   
880  O  O   . LEU A 93  ? 0.19443 0.22221 0.12479 -0.03005 -0.02233 -0.01788 93  LEU A O   
881  C  CB  . LEU A 93  ? 0.18767 0.22085 0.13000 -0.03233 -0.01073 -0.00942 93  LEU A CB  
882  C  CG  . LEU A 93  ? 0.18514 0.22898 0.16819 -0.03992 -0.01353 -0.00083 93  LEU A CG  
883  C  CD1 . LEU A 93  ? 0.19326 0.25051 0.20701 -0.02656 -0.02556 0.00698  93  LEU A CD1 
884  C  CD2 . LEU A 93  ? 0.20375 0.23578 0.19590 -0.04971 -0.00760 0.00847  93  LEU A CD2 
885  N  N   . PHE A 94  ? 0.16844 0.20983 0.12535 -0.03342 -0.01915 -0.00310 94  PHE A N   
886  C  CA  . PHE A 94  ? 0.17572 0.20535 0.12499 -0.04142 -0.03138 0.00044  94  PHE A CA  
887  C  C   . PHE A 94  ? 0.17829 0.21288 0.11909 -0.02686 -0.01931 0.00048  94  PHE A C   
888  O  O   . PHE A 94  ? 0.18386 0.22897 0.12570 -0.02540 -0.02963 -0.00541 94  PHE A O   
889  C  CB  . PHE A 94  ? 0.19876 0.21419 0.13831 -0.03414 -0.03995 0.00845  94  PHE A CB  
890  C  CG  . PHE A 94  ? 0.19282 0.22669 0.14940 -0.03382 -0.03723 0.02069  94  PHE A CG  
891  C  CD1 . PHE A 94  ? 0.20538 0.26232 0.15664 -0.02033 -0.03101 0.01816  94  PHE A CD1 
892  C  CD2 . PHE A 94  ? 0.20022 0.23869 0.15398 -0.04606 -0.04467 0.02958  94  PHE A CD2 
893  C  CE1 . PHE A 94  ? 0.23863 0.29536 0.16314 -0.00993 -0.01591 0.01221  94  PHE A CE1 
894  C  CE2 . PHE A 94  ? 0.22096 0.25865 0.15582 -0.04919 -0.04391 0.02947  94  PHE A CE2 
895  C  CZ  . PHE A 94  ? 0.24731 0.28545 0.16098 -0.02600 -0.02772 0.02000  94  PHE A CZ  
896  N  N   . THR A 95  ? 0.17469 0.21915 0.12508 -0.01778 -0.02286 -0.00217 95  THR A N   
897  C  CA  . THR A 95  ? 0.19367 0.23693 0.12977 -0.00385 -0.02573 -0.00842 95  THR A CA  
898  C  C   . THR A 95  ? 0.19434 0.23633 0.13677 -0.00579 -0.02975 -0.00774 95  THR A C   
899  O  O   . THR A 95  ? 0.20248 0.25543 0.14609 0.00401  -0.02840 -0.00313 95  THR A O   
900  C  CB  . THR A 95  ? 0.21783 0.27397 0.13537 0.01042  -0.01394 -0.01467 95  THR A CB  
901  O  OG1 . THR A 95  ? 0.21622 0.29174 0.12637 -0.00668 -0.01600 -0.00735 95  THR A OG1 
902  C  CG2 . THR A 95  ? 0.24952 0.31214 0.16303 0.04555  -0.01069 -0.03762 95  THR A CG2 
903  N  N   . HIS A 96  ? 0.20814 0.21854 0.14324 -0.01214 -0.01965 -0.00405 96  HIS A N   
904  C  CA  . HIS A 96  ? 0.22339 0.20848 0.15243 -0.01783 -0.02282 -0.00114 96  HIS A CA  
905  C  C   . HIS A 96  ? 0.20460 0.19918 0.14709 -0.01154 -0.01657 0.00816  96  HIS A C   
906  O  O   . HIS A 96  ? 0.20053 0.18924 0.14880 -0.02293 -0.01520 0.01136  96  HIS A O   
907  C  CB  . HIS A 96  ? 0.24684 0.21947 0.16927 -0.02851 -0.03024 -0.00008 96  HIS A CB  
908  C  CG  . HIS A 96  ? 0.27559 0.21773 0.18208 -0.02973 -0.03475 -0.00484 96  HIS A CG  
909  N  ND1 . HIS A 96  ? 0.26590 0.20766 0.19439 -0.02706 -0.02857 0.00199  96  HIS A ND1 
910  C  CD2 . HIS A 96  ? 0.34555 0.23073 0.20244 -0.03154 -0.03473 -0.01667 96  HIS A CD2 
911  C  CE1 . HIS A 96  ? 0.29763 0.21092 0.21637 -0.02913 -0.03504 0.00864  96  HIS A CE1 
912  N  NE2 . HIS A 96  ? 0.34765 0.22752 0.22152 -0.02993 -0.03758 -0.00202 96  HIS A NE2 
913  N  N   . PRO A 97  ? 0.20881 0.21381 0.15440 0.00279  -0.02197 0.00206  97  PRO A N   
914  C  CA  . PRO A 97  ? 0.21103 0.21413 0.14953 0.00176  -0.02874 0.01251  97  PRO A CA  
915  C  C   . PRO A 97  ? 0.20544 0.18717 0.14478 -0.01810 -0.02810 0.01631  97  PRO A C   
916  O  O   . PRO A 97  ? 0.22222 0.19893 0.14612 -0.02054 -0.03228 0.00907  97  PRO A O   
917  C  CB  . PRO A 97  ? 0.25311 0.24598 0.18340 0.03003  -0.04321 0.01294  97  PRO A CB  
918  C  CG  . PRO A 97  ? 0.28667 0.26918 0.21676 0.05130  -0.06375 -0.01034 97  PRO A CG  
919  C  CD  . PRO A 97  ? 0.24359 0.23956 0.18218 0.03185  -0.03509 -0.00223 97  PRO A CD  
920  N  N   . VAL A 98  ? 0.20411 0.18850 0.14449 -0.01929 -0.01466 0.02379  98  VAL A N   
921  C  CA  . VAL A 98  ? 0.21107 0.19446 0.15721 -0.02401 -0.00984 0.02322  98  VAL A CA  
922  C  C   . VAL A 98  ? 0.20778 0.18637 0.13623 -0.02295 -0.00586 0.02005  98  VAL A C   
923  O  O   . VAL A 98  ? 0.22134 0.19468 0.13375 -0.02399 0.00590  0.02853  98  VAL A O   
924  C  CB  . VAL A 98  ? 0.22622 0.20473 0.20042 -0.04022 -0.01359 0.02577  98  VAL A CB  
925  C  CG1 . VAL A 98  ? 0.22289 0.21203 0.21651 -0.04019 -0.04569 0.01607  98  VAL A CG1 
926  C  CG2 . VAL A 98  ? 0.24707 0.23654 0.25441 -0.05513 0.02041  0.02841  98  VAL A CG2 
927  N  N   . PHE A 99  ? 0.18836 0.17618 0.12793 -0.02127 -0.01739 0.01975  99  PHE A N   
928  C  CA  . PHE A 99  ? 0.18977 0.17835 0.11858 -0.02241 -0.01632 0.01765  99  PHE A CA  
929  C  C   . PHE A 99  ? 0.17918 0.18382 0.10828 -0.01976 -0.00483 0.01548  99  PHE A C   
930  O  O   . PHE A 99  ? 0.18906 0.18354 0.11156 -0.02545 -0.01005 0.01386  99  PHE A O   
931  C  CB  . PHE A 99  ? 0.19791 0.18992 0.12983 -0.02674 -0.02330 0.01411  99  PHE A CB  
932  C  CG  . PHE A 99  ? 0.21486 0.19600 0.14068 -0.02777 -0.02775 0.01200  99  PHE A CG  
933  C  CD1 . PHE A 99  ? 0.20939 0.21719 0.17675 -0.02926 -0.03865 0.00980  99  PHE A CD1 
934  C  CD2 . PHE A 99  ? 0.24618 0.21356 0.13780 -0.03757 -0.04113 0.00511  99  PHE A CD2 
935  C  CE1 . PHE A 99  ? 0.21530 0.23840 0.20606 -0.03100 -0.05442 0.00709  99  PHE A CE1 
936  C  CE2 . PHE A 99  ? 0.26655 0.22833 0.16318 -0.04204 -0.05628 0.00197  99  PHE A CE2 
937  C  CZ  . PHE A 99  ? 0.24496 0.23728 0.18874 -0.04441 -0.06080 0.00797  99  PHE A CZ  
938  N  N   . LYS A 100 ? 0.16808 0.18584 0.11416 -0.01927 -0.01163 0.01335  100 LYS A N   
939  C  CA  . LYS A 100 ? 0.15983 0.18422 0.12702 -0.01621 -0.00731 0.00942  100 LYS A CA  
940  C  C   . LYS A 100 ? 0.15698 0.18757 0.12229 -0.02699 0.00257  0.00740  100 LYS A C   
941  O  O   . LYS A 100 ? 0.15829 0.20181 0.16127 -0.03908 0.01213  -0.00424 100 LYS A O   
942  C  CB  . LYS A 100 ? 0.17995 0.19126 0.14303 -0.00806 -0.00693 0.01982  100 LYS A CB  
943  C  CG  . LYS A 100 ? 0.19879 0.19892 0.14444 -0.01438 -0.02870 0.02974  100 LYS A CG  
944  C  CD  . LYS A 100 ? 0.24055 0.20743 0.17093 -0.01936 -0.04275 0.03629  100 LYS A CD  
945  C  CE  . LYS A 100 ? 0.27722 0.22030 0.19131 -0.02654 -0.04422 0.04029  100 LYS A CE  
946  N  NZ  . LYS A 100 ? 0.30142 0.24804 0.20729 -0.03971 -0.04709 0.05922  100 LYS A NZ  
947  N  N   . ASP A 101 ? 0.15097 0.18263 0.11042 -0.01957 -0.00373 0.01537  101 ASP A N   
948  C  CA  . ASP A 101 ? 0.16287 0.19005 0.11518 -0.01515 0.00592  0.02149  101 ASP A CA  
949  C  C   . ASP A 101 ? 0.16268 0.18509 0.12378 -0.01661 0.01012  0.02289  101 ASP A C   
950  O  O   . ASP A 101 ? 0.18311 0.21643 0.13101 0.01328  0.00700  0.02130  101 ASP A O   
951  C  CB  . ASP A 101 ? 0.18073 0.21081 0.12200 -0.00939 0.00268  0.01990  101 ASP A CB  
952  C  CG  . ASP A 101 ? 0.18479 0.23466 0.13941 -0.00572 -0.00363 0.01484  101 ASP A CG  
953  O  OD1 . ASP A 101 ? 0.21055 0.22255 0.15633 -0.01565 -0.01755 -0.00653 101 ASP A OD1 
954  O  OD2 . ASP A 101 ? 0.20182 0.29974 0.13701 0.01354  -0.00188 -0.00288 101 ASP A OD2 
955  N  N   . GLY A 102 ? 0.16163 0.18108 0.13711 -0.02658 -0.01300 0.02344  102 GLY A N   
956  C  CA  . GLY A 102 ? 0.15825 0.19417 0.14457 -0.02851 -0.01472 0.03048  102 GLY A CA  
957  C  C   . GLY A 102 ? 0.16819 0.18874 0.12250 -0.02808 -0.00531 0.02941  102 GLY A C   
958  O  O   . GLY A 102 ? 0.18853 0.19196 0.13639 -0.02895 -0.01744 0.02817  102 GLY A O   
959  N  N   . GLY A 103 ? 0.15751 0.20176 0.13482 -0.03412 -0.01612 0.02587  103 GLY A N   
960  C  CA  . GLY A 103 ? 0.16514 0.20502 0.14060 -0.03588 -0.00488 0.00873  103 GLY A CA  
961  C  C   . GLY A 103 ? 0.16370 0.20092 0.13030 -0.04153 0.00288  0.01677  103 GLY A C   
962  O  O   . GLY A 103 ? 0.18974 0.22524 0.15235 -0.02996 0.01302  0.04197  103 GLY A O   
963  N  N   . PHE A 104 ? 0.15320 0.20652 0.11995 -0.03638 -0.00672 0.01788  104 PHE A N   
964  C  CA  . PHE A 104 ? 0.15783 0.21556 0.12765 -0.02967 -0.00598 0.01810  104 PHE A CA  
965  C  C   . PHE A 104 ? 0.14130 0.21542 0.11923 -0.03706 0.00463  0.02056  104 PHE A C   
966  O  O   . PHE A 104 ? 0.14818 0.24679 0.12893 -0.03756 0.00967  0.01378  104 PHE A O   
967  C  CB  . PHE A 104 ? 0.18069 0.22763 0.13518 -0.02402 -0.02265 0.00911  104 PHE A CB  
968  C  CG  . PHE A 104 ? 0.19834 0.25048 0.14300 -0.02001 -0.02743 0.00200  104 PHE A CG  
969  C  CD1 . PHE A 104 ? 0.21436 0.26250 0.16705 -0.01203 -0.04214 -0.01900 104 PHE A CD1 
970  C  CD2 . PHE A 104 ? 0.27057 0.29493 0.13717 -0.04285 -0.02861 0.01478  104 PHE A CD2 
971  C  CE1 . PHE A 104 ? 0.23557 0.29535 0.18368 -0.02071 -0.04839 -0.03283 104 PHE A CE1 
972  C  CE2 . PHE A 104 ? 0.30706 0.33773 0.15008 -0.06007 -0.05282 0.00346  104 PHE A CE2 
973  C  CZ  . PHE A 104 ? 0.27135 0.33667 0.16941 -0.05556 -0.04825 -0.02461 104 PHE A CZ  
974  N  N   . THR A 105 ? 0.15007 0.19454 0.10788 -0.03492 0.00085  0.01552  105 THR A N   
975  C  CA  . THR A 105 ? 0.15803 0.19602 0.10702 -0.03193 0.00767  0.01501  105 THR A CA  
976  C  C   . THR A 105 ? 0.16001 0.19951 0.09687 -0.03847 0.01366  0.02014  105 THR A C   
977  O  O   . THR A 105 ? 0.17194 0.20712 0.10136 -0.03676 0.00235  0.01153  105 THR A O   
978  C  CB  . THR A 105 ? 0.16730 0.19904 0.11508 -0.02782 0.00811  0.01930  105 THR A CB  
979  O  OG1 . THR A 105 ? 0.16905 0.20050 0.11331 -0.04009 0.00181  0.02484  105 THR A OG1 
980  C  CG2 . THR A 105 ? 0.19058 0.21243 0.13705 -0.01065 -0.00264 0.01676  105 THR A CG2 
981  N  N   . ALA A 106 ? 0.15926 0.19831 0.10723 -0.03377 0.00878  0.02364  106 ALA A N   
982  C  CA  . ALA A 106 ? 0.17412 0.20120 0.10684 -0.02907 0.00777  0.01834  106 ALA A CA  
983  C  C   . ALA A 106 ? 0.15333 0.20013 0.10390 -0.03344 0.00575  0.02086  106 ALA A C   
984  O  O   . ALA A 106 ? 0.14916 0.23088 0.10994 -0.03891 0.00732  0.02082  106 ALA A O   
985  C  CB  . ALA A 106 ? 0.19569 0.20897 0.12694 -0.02491 0.00510  0.00978  106 ALA A CB  
986  N  N   . ASN A 107 ? 0.16785 0.19912 0.10032 -0.03237 0.00064  0.01846  107 ASN A N   
987  C  CA  . ASN A 107 ? 0.17951 0.20211 0.10281 -0.03209 0.00401  0.02427  107 ASN A CA  
988  C  C   . ASN A 107 ? 0.18320 0.21049 0.10128 -0.03403 0.00598  0.02564  107 ASN A C   
989  O  O   . ASN A 107 ? 0.19398 0.22946 0.11852 -0.04560 0.01760  0.01631  107 ASN A O   
990  C  CB  . ASN A 107 ? 0.17757 0.20415 0.10853 -0.03192 -0.00370 0.02696  107 ASN A CB  
991  C  CG  . ASN A 107 ? 0.17340 0.20917 0.10313 -0.02593 0.00380  0.02485  107 ASN A CG  
992  O  OD1 . ASN A 107 ? 0.17722 0.20560 0.11007 -0.03181 -0.00254 0.03130  107 ASN A OD1 
993  N  ND2 . ASN A 107 ? 0.17277 0.21900 0.11283 -0.02623 -0.00730 0.01933  107 ASN A ND2 
994  N  N   . ASP A 108 ? 0.19534 0.19763 0.11155 -0.03875 0.00200  0.02561  108 ASP A N   
995  C  CA  . ASP A 108 ? 0.19811 0.21331 0.12116 -0.04848 0.00058  0.02713  108 ASP A CA  
996  C  C   . ASP A 108 ? 0.19349 0.22221 0.11944 -0.04994 0.00310  0.03254  108 ASP A C   
997  O  O   . ASP A 108 ? 0.19549 0.23474 0.12022 -0.04772 0.00818  0.03140  108 ASP A O   
998  C  CB  . ASP A 108 ? 0.21738 0.21559 0.13792 -0.04341 -0.00698 0.01731  108 ASP A CB  
999  C  CG  . ASP A 108 ? 0.23064 0.28347 0.16045 -0.04001 -0.01386 0.03206  108 ASP A CG  
1000 O  OD1 . ASP A 108 ? 0.25579 0.32463 0.16486 -0.06371 -0.01777 0.05501  108 ASP A OD1 
1001 O  OD2 . ASP A 108 ? 0.23222 0.35499 0.18652 -0.01197 -0.01299 0.02103  108 ASP A OD2 
1002 N  N   . ARG A 109 ? 0.19088 0.23516 0.12999 -0.04474 0.00838  0.04005  109 ARG A N   
1003 C  CA  . ARG A 109 ? 0.19230 0.24703 0.13533 -0.04811 0.01424  0.04228  109 ARG A CA  
1004 C  C   . ARG A 109 ? 0.20250 0.24041 0.13436 -0.05209 0.01184  0.04760  109 ARG A C   
1005 O  O   . ARG A 109 ? 0.20269 0.25961 0.14042 -0.04773 0.00564  0.04584  109 ARG A O   
1006 C  CB  . ARG A 109 ? 0.19999 0.27853 0.14862 -0.04963 0.01948  0.04926  109 ARG A CB  
1007 C  CG  . ARG A 109 ? 0.20326 0.30929 0.15837 -0.05056 0.03140  0.05636  109 ARG A CG  
1008 C  CD  . ARG A 109 ? 0.21070 0.33628 0.19094 -0.04750 0.03594  0.06115  109 ARG A CD  
1009 N  NE  . ARG A 109 ? 0.21594 0.36912 0.20717 -0.06253 0.04141  0.07464  109 ARG A NE  
1010 C  CZ  . ARG A 109 ? 0.25470 0.38086 0.22814 -0.07660 0.04720  0.07223  109 ARG A CZ  
1011 N  NH1 . ARG A 109 ? 0.29502 0.36509 0.26397 -0.07538 0.04042  0.08172  109 ARG A NH1 
1012 N  NH2 . ARG A 109 ? 0.26132 0.40485 0.24540 -0.10679 0.03371  0.06425  109 ARG A NH2 
1013 N  N   A ASP A 110 ? 0.21147 0.22308 0.15500 -0.06262 0.00834  0.04329  110 ASP A N   
1014 N  N   B ASP A 110 ? 0.22140 0.23098 0.13172 -0.05548 0.01464  0.04729  110 ASP A N   
1015 C  CA  A ASP A 110 ? 0.22883 0.22910 0.17205 -0.06228 -0.00135 0.03831  110 ASP A CA  
1016 C  CA  B ASP A 110 ? 0.24207 0.22688 0.14314 -0.06132 0.00909  0.04457  110 ASP A CA  
1017 C  C   A ASP A 110 ? 0.21853 0.22193 0.15943 -0.06654 -0.00528 0.02990  110 ASP A C   
1018 C  C   B ASP A 110 ? 0.22527 0.22874 0.13996 -0.06084 0.00122  0.03090  110 ASP A C   
1019 O  O   A ASP A 110 ? 0.23955 0.23083 0.17347 -0.08821 -0.00568 0.02675  110 ASP A O   
1020 O  O   B ASP A 110 ? 0.24549 0.24607 0.14601 -0.06243 -0.00150 0.01835  110 ASP A O   
1021 C  CB  A ASP A 110 ? 0.26351 0.24212 0.20373 -0.06477 -0.00208 0.04876  110 ASP A CB  
1022 C  CB  B ASP A 110 ? 0.28138 0.22658 0.16849 -0.06870 0.01723  0.05602  110 ASP A CB  
1023 C  CG  A ASP A 110 ? 0.31200 0.26577 0.23813 -0.06445 -0.02805 0.07838  110 ASP A CG  
1024 C  CG  B ASP A 110 ? 0.34327 0.26203 0.21353 -0.06362 0.05280  0.07531  110 ASP A CG  
1025 O  OD1 A ASP A 110 ? 0.27367 0.27519 0.24338 -0.06030 -0.03313 0.06446  110 ASP A OD1 
1026 O  OD1 B ASP A 110 ? 0.32212 0.29585 0.24611 -0.07528 0.10671  0.06165  110 ASP A OD1 
1027 O  OD2 A ASP A 110 ? 0.40503 0.29215 0.29218 -0.05878 -0.06897 0.10416  110 ASP A OD2 
1028 O  OD2 B ASP A 110 ? 0.44565 0.26783 0.22634 -0.04374 0.04266  0.10339  110 ASP A OD2 
1029 N  N   . VAL A 111 ? 0.20423 0.21588 0.14014 -0.05506 0.00313  0.03159  111 VAL A N   
1030 C  CA  . VAL A 111 ? 0.19059 0.21287 0.13945 -0.04732 0.00237  0.01962  111 VAL A CA  
1031 C  C   . VAL A 111 ? 0.18703 0.20325 0.13167 -0.04880 0.01038  0.01514  111 VAL A C   
1032 O  O   . VAL A 111 ? 0.19892 0.21885 0.13151 -0.04686 0.00345  0.00477  111 VAL A O   
1033 C  CB  . VAL A 111 ? 0.19179 0.22663 0.14732 -0.04010 -0.00420 0.02271  111 VAL A CB  
1034 C  CG1 . VAL A 111 ? 0.20439 0.24236 0.15720 -0.04375 0.00367  0.03302  111 VAL A CG1 
1035 C  CG2 . VAL A 111 ? 0.20592 0.25266 0.15465 -0.02165 -0.00642 0.02137  111 VAL A CG2 
1036 N  N   . ARG A 112 ? 0.17776 0.20125 0.13154 -0.05198 0.00453  0.01654  112 ARG A N   
1037 C  CA  . ARG A 112 ? 0.17816 0.20035 0.12491 -0.04660 0.00015  0.01822  112 ARG A CA  
1038 C  C   . ARG A 112 ? 0.17746 0.21712 0.13212 -0.05784 0.00146  0.02393  112 ARG A C   
1039 O  O   . ARG A 112 ? 0.18964 0.23477 0.13318 -0.06081 -0.00639 0.02570  112 ARG A O   
1040 C  CB  . ARG A 112 ? 0.17932 0.20465 0.12666 -0.04890 0.00261  0.01384  112 ARG A CB  
1041 C  CG  . ARG A 112 ? 0.16818 0.21274 0.12691 -0.04508 0.00186  0.01059  112 ARG A CG  
1042 C  CD  . ARG A 112 ? 0.16900 0.22200 0.11671 -0.04410 0.01701  0.02225  112 ARG A CD  
1043 N  NE  . ARG A 112 ? 0.17078 0.23734 0.12397 -0.03571 0.01024  0.01616  112 ARG A NE  
1044 C  CZ  . ARG A 112 ? 0.16520 0.23743 0.12405 -0.03549 0.01716  0.01412  112 ARG A CZ  
1045 N  NH1 . ARG A 112 ? 0.16806 0.23975 0.13033 -0.04050 0.00913  0.01545  112 ARG A NH1 
1046 N  NH2 . ARG A 112 ? 0.16471 0.26016 0.14098 -0.04249 0.03164  0.01818  112 ARG A NH2 
1047 N  N   . ARG A 113 ? 0.17770 0.22485 0.13903 -0.07382 0.00738  0.02045  113 ARG A N   
1048 C  CA  . ARG A 113 ? 0.18251 0.23320 0.14237 -0.07843 0.00531  0.01913  113 ARG A CA  
1049 C  C   . ARG A 113 ? 0.18787 0.22677 0.14424 -0.07249 0.00057  0.01912  113 ARG A C   
1050 O  O   . ARG A 113 ? 0.20106 0.24498 0.14987 -0.07055 -0.00845 0.01622  113 ARG A O   
1051 C  CB  . ARG A 113 ? 0.19695 0.24430 0.15953 -0.07093 0.01483  0.02700  113 ARG A CB  
1052 C  CG  . ARG A 113 ? 0.20392 0.25511 0.16624 -0.07212 0.03073  0.02844  113 ARG A CG  
1053 C  CD  . ARG A 113 ? 0.21381 0.27236 0.18360 -0.07569 0.03825  0.03756  113 ARG A CD  
1054 N  NE  . ARG A 113 ? 0.22385 0.27546 0.20861 -0.08882 0.04510  0.04212  113 ARG A NE  
1055 C  CZ  . ARG A 113 ? 0.22842 0.29825 0.23426 -0.09627 0.03447  0.03437  113 ARG A CZ  
1056 N  NH1 . ARG A 113 ? 0.21567 0.32262 0.24051 -0.09421 0.02261  0.03591  113 ARG A NH1 
1057 N  NH2 . ARG A 113 ? 0.25111 0.29062 0.26534 -0.10569 0.01991  0.03710  113 ARG A NH2 
1058 N  N   . TYR A 114 ? 0.20511 0.21455 0.15181 -0.05475 0.00769  0.02148  114 TYR A N   
1059 C  CA  . TYR A 114 ? 0.20535 0.21007 0.14548 -0.04551 -0.00409 0.02025  114 TYR A CA  
1060 C  C   . TYR A 114 ? 0.19568 0.21213 0.14263 -0.05295 -0.00485 0.01229  114 TYR A C   
1061 O  O   . TYR A 114 ? 0.21256 0.21739 0.15110 -0.05297 -0.01047 0.00121  114 TYR A O   
1062 C  CB  . TYR A 114 ? 0.22472 0.21711 0.16778 -0.03693 -0.00307 0.01750  114 TYR A CB  
1063 C  CG  . TYR A 114 ? 0.23300 0.22210 0.19110 -0.03760 -0.00376 0.01083  114 TYR A CG  
1064 C  CD1 . TYR A 114 ? 0.27116 0.23263 0.24160 -0.04868 0.00280  -0.01820 114 TYR A CD1 
1065 C  CD2 . TYR A 114 ? 0.23765 0.23891 0.19961 -0.02176 0.00386  0.02180  114 TYR A CD2 
1066 C  CE1 . TYR A 114 ? 0.30432 0.25796 0.24292 -0.04899 0.00852  -0.03175 114 TYR A CE1 
1067 C  CE2 . TYR A 114 ? 0.26289 0.27060 0.22214 -0.01253 0.01553  0.00769  114 TYR A CE2 
1068 C  CZ  . TYR A 114 ? 0.29322 0.30082 0.22406 -0.01024 0.01752  -0.02187 114 TYR A CZ  
1069 O  OH  . TYR A 114 ? 0.32646 0.38193 0.24774 0.02553  0.03480  -0.05216 114 TYR A OH  
1070 N  N   . ALA A 115 ? 0.19255 0.21162 0.13367 -0.05572 -0.00387 0.01623  115 ALA A N   
1071 C  CA  . ALA A 115 ? 0.18245 0.21107 0.13145 -0.05620 -0.00916 0.01666  115 ALA A CA  
1072 C  C   . ALA A 115 ? 0.18035 0.21644 0.12562 -0.05074 0.00004  0.01304  115 ALA A C   
1073 O  O   . ALA A 115 ? 0.19385 0.23181 0.12537 -0.06015 -0.00181 0.01266  115 ALA A O   
1074 C  CB  . ALA A 115 ? 0.18197 0.21970 0.14196 -0.05475 -0.00813 0.00889  115 ALA A CB  
1075 N  N   . LEU A 116 ? 0.16983 0.21830 0.13390 -0.05175 -0.00193 0.00977  116 LEU A N   
1076 C  CA  . LEU A 116 ? 0.17718 0.23008 0.14432 -0.05238 -0.00887 0.00814  116 LEU A CA  
1077 C  C   . LEU A 116 ? 0.18301 0.22926 0.14581 -0.05858 -0.00720 0.01213  116 LEU A C   
1078 O  O   . LEU A 116 ? 0.20002 0.24215 0.14595 -0.05627 -0.01517 0.01332  116 LEU A O   
1079 C  CB  . LEU A 116 ? 0.19163 0.24754 0.17611 -0.04053 0.00688  0.00751  116 LEU A CB  
1080 C  CG  . LEU A 116 ? 0.24648 0.27189 0.20710 -0.03236 0.01694  0.00189  116 LEU A CG  
1081 C  CD1 . LEU A 116 ? 0.29643 0.30469 0.22137 -0.02589 0.03457  -0.00355 116 LEU A CD1 
1082 C  CD2 . LEU A 116 ? 0.30029 0.27552 0.22639 -0.00818 0.02459  0.01005  116 LEU A CD2 
1083 N  N   . ARG A 117 ? 0.19209 0.22659 0.15034 -0.06701 -0.00125 0.00868  117 ARG A N   
1084 C  CA  . ARG A 117 ? 0.20622 0.22693 0.15713 -0.07756 -0.00526 0.01130  117 ARG A CA  
1085 C  C   . ARG A 117 ? 0.20441 0.22499 0.15738 -0.08030 -0.00982 0.00531  117 ARG A C   
1086 O  O   . ARG A 117 ? 0.21911 0.24007 0.16416 -0.07914 -0.01305 0.00052  117 ARG A O   
1087 C  CB  . ARG A 117 ? 0.23027 0.23907 0.17652 -0.08689 0.00426  0.02534  117 ARG A CB  
1088 C  CG  . ARG A 117 ? 0.24681 0.26984 0.20152 -0.09927 0.01992  0.02336  117 ARG A CG  
1089 C  CD  . ARG A 117 ? 0.24932 0.29419 0.22858 -0.09896 0.01822  0.01927  117 ARG A CD  
1090 N  NE  . ARG A 117 ? 0.25210 0.31093 0.25366 -0.11799 -0.00507 0.01183  117 ARG A NE  
1091 C  CZ  . ARG A 117 ? 0.27024 0.32783 0.29124 -0.13304 -0.00987 0.01265  117 ARG A CZ  
1092 N  NH1 . ARG A 117 ? 0.30243 0.33882 0.29117 -0.14704 0.00109  0.03779  117 ARG A NH1 
1093 N  NH2 . ARG A 117 ? 0.32402 0.32510 0.33423 -0.13088 -0.01898 -0.01714 117 ARG A NH2 
1094 N  N   . LYS A 118 ? 0.19810 0.21807 0.14945 -0.06722 -0.00445 0.00718  118 LYS A N   
1095 C  CA  . LYS A 118 ? 0.20429 0.21108 0.14569 -0.05277 -0.01385 0.00061  118 LYS A CA  
1096 C  C   . LYS A 118 ? 0.20057 0.20953 0.14278 -0.05532 -0.01324 -0.00453 118 LYS A C   
1097 O  O   . LYS A 118 ? 0.22140 0.21363 0.15046 -0.05180 -0.01269 -0.00551 118 LYS A O   
1098 C  CB  . LYS A 118 ? 0.20896 0.21317 0.15095 -0.04428 -0.01885 -0.00149 118 LYS A CB  
1099 C  CG  . LYS A 118 ? 0.20772 0.21855 0.15622 -0.03989 -0.01220 0.00455  118 LYS A CG  
1100 C  CD  . LYS A 118 ? 0.20934 0.23390 0.16162 -0.03112 -0.01138 0.02314  118 LYS A CD  
1101 C  CE  . LYS A 118 ? 0.21542 0.23531 0.16705 -0.03230 -0.00881 0.02729  118 LYS A CE  
1102 N  NZ  . LYS A 118 ? 0.22030 0.21393 0.15850 -0.04015 -0.01088 0.02231  118 LYS A NZ  
1103 N  N   . THR A 119 ? 0.19382 0.20472 0.14176 -0.05308 -0.00683 0.00545  119 THR A N   
1104 C  CA  . THR A 119 ? 0.18779 0.21258 0.14238 -0.05450 -0.01253 0.00563  119 THR A CA  
1105 C  C   . THR A 119 ? 0.19279 0.23048 0.13864 -0.06711 -0.00629 0.00731  119 THR A C   
1106 O  O   . THR A 119 ? 0.20897 0.23930 0.14234 -0.06684 -0.01709 0.00012  119 THR A O   
1107 C  CB  . THR A 119 ? 0.18985 0.21265 0.15161 -0.06110 -0.01328 0.00203  119 THR A CB  
1108 O  OG1 . THR A 119 ? 0.19740 0.21911 0.15999 -0.06949 -0.01744 -0.00218 119 THR A OG1 
1109 C  CG2 . THR A 119 ? 0.20634 0.22210 0.16283 -0.05232 -0.00987 0.01396  119 THR A CG2 
1110 N  N   . ILE A 120 ? 0.18637 0.24049 0.14870 -0.06949 -0.01548 0.00663  120 ILE A N   
1111 C  CA  . ILE A 120 ? 0.18200 0.24938 0.16424 -0.07353 -0.01904 0.00293  120 ILE A CA  
1112 C  C   . ILE A 120 ? 0.18664 0.24670 0.17440 -0.07380 -0.01995 0.00258  120 ILE A C   
1113 O  O   . ILE A 120 ? 0.19733 0.27873 0.17680 -0.08065 -0.03196 -0.00195 120 ILE A O   
1114 C  CB  . ILE A 120 ? 0.18893 0.28648 0.19286 -0.07536 -0.01312 0.00421  120 ILE A CB  
1115 C  CG1 . ILE A 120 ? 0.22136 0.31592 0.22494 -0.06400 0.00639  -0.00392 120 ILE A CG1 
1116 C  CG2 . ILE A 120 ? 0.19353 0.31389 0.21650 -0.09097 -0.00612 -0.00240 120 ILE A CG2 
1117 C  CD1 . ILE A 120 ? 0.27210 0.36215 0.25585 -0.06246 0.03557  -0.02223 120 ILE A CD1 
1118 N  N   . ARG A 121 ? 0.21149 0.23204 0.18499 -0.08166 -0.01421 0.00903  121 ARG A N   
1119 C  CA  . ARG A 121 ? 0.25226 0.23370 0.19977 -0.08344 -0.01869 0.00770  121 ARG A CA  
1120 C  C   . ARG A 121 ? 0.23745 0.23026 0.19045 -0.08744 -0.02796 -0.00521 121 ARG A C   
1121 O  O   . ARG A 121 ? 0.25651 0.25655 0.20252 -0.09447 -0.04075 -0.01134 121 ARG A O   
1122 C  CB  . ARG A 121 ? 0.32915 0.25456 0.25028 -0.06682 -0.01201 0.01505  121 ARG A CB  
1123 C  CG  . ARG A 121 ? 0.45885 0.31697 0.34896 -0.02161 -0.00716 0.00085  121 ARG A CG  
1124 C  CD  . ARG A 121 ? 0.54505 0.37648 0.48200 0.03663  -0.00080 0.01021  121 ARG A CD  
1125 N  NE  . ARG A 121 ? 0.63773 0.39900 0.55877 0.06511  0.02917  0.02887  121 ARG A NE  
1126 C  CZ  . ARG A 121 ? 0.76764 0.44527 0.58375 0.07972  -0.00477 0.06175  121 ARG A CZ  
1127 N  NH1 . ARG A 121 ? 0.81066 0.52198 0.60399 0.13752  -0.05942 0.03483  121 ARG A NH1 
1128 N  NH2 . ARG A 121 ? 0.85634 0.45942 0.62312 -0.03100 -0.00743 0.07382  121 ARG A NH2 
1129 N  N   . ASN A 122 ? 0.22241 0.21846 0.17004 -0.07684 -0.01989 0.00028  122 ASN A N   
1130 C  CA  . ASN A 122 ? 0.20128 0.22596 0.16145 -0.05909 -0.02401 0.00203  122 ASN A CA  
1131 C  C   . ASN A 122 ? 0.19706 0.24104 0.15330 -0.05935 -0.02349 -0.00347 122 ASN A C   
1132 O  O   . ASN A 122 ? 0.20992 0.27106 0.14798 -0.04726 -0.02439 -0.00365 122 ASN A O   
1133 C  CB  . ASN A 122 ? 0.19840 0.22432 0.16620 -0.05156 -0.03518 0.00243  122 ASN A CB  
1134 C  CG  . ASN A 122 ? 0.20955 0.22275 0.17391 -0.05292 -0.03214 0.00947  122 ASN A CG  
1135 O  OD1 . ASN A 122 ? 0.22527 0.23242 0.17496 -0.05035 -0.02030 -0.00276 122 ASN A OD1 
1136 N  ND2 . ASN A 122 ? 0.22490 0.22857 0.19930 -0.05835 -0.02984 0.02456  122 ASN A ND2 
1137 N  N   . ILE A 123 ? 0.19742 0.23817 0.14795 -0.05344 -0.02028 0.00046  123 ILE A N   
1138 C  CA  . ILE A 123 ? 0.20015 0.24193 0.15240 -0.04886 -0.02552 -0.00624 123 ILE A CA  
1139 C  C   . ILE A 123 ? 0.20007 0.25138 0.15850 -0.06835 -0.02284 -0.00118 123 ILE A C   
1140 O  O   . ILE A 123 ? 0.21371 0.26721 0.15620 -0.06235 -0.03205 -0.00340 123 ILE A O   
1141 C  CB  . ILE A 123 ? 0.21093 0.25184 0.17498 -0.03978 -0.02758 -0.01190 123 ILE A CB  
1142 C  CG1 . ILE A 123 ? 0.23480 0.24583 0.17655 -0.04708 -0.02861 -0.00836 123 ILE A CG1 
1143 C  CG2 . ILE A 123 ? 0.22104 0.28995 0.20772 -0.02160 -0.03755 -0.02824 123 ILE A CG2 
1144 C  CD1 . ILE A 123 ? 0.28673 0.25339 0.18291 -0.04066 -0.02155 -0.01089 123 ILE A CD1 
1145 N  N   . ASP A 124 ? 0.20855 0.26211 0.17709 -0.08208 -0.02579 -0.00878 124 ASP A N   
1146 C  CA  . ASP A 124 ? 0.21730 0.26303 0.20153 -0.08758 -0.02237 -0.01664 124 ASP A CA  
1147 C  C   . ASP A 124 ? 0.22057 0.26932 0.20322 -0.07543 -0.02886 -0.02148 124 ASP A C   
1148 O  O   . ASP A 124 ? 0.23642 0.29316 0.21427 -0.07707 -0.04167 -0.02279 124 ASP A O   
1149 C  CB  . ASP A 124 ? 0.24496 0.26849 0.23619 -0.10163 -0.01059 -0.00110 124 ASP A CB  
1150 C  CG  . ASP A 124 ? 0.29351 0.28184 0.27328 -0.10310 0.01767  0.00644  124 ASP A CG  
1151 O  OD1 . ASP A 124 ? 0.28002 0.30624 0.26812 -0.08656 0.01194  -0.01402 124 ASP A OD1 
1152 O  OD2 . ASP A 124 ? 0.40143 0.30749 0.30967 -0.07279 0.06204  0.03623  124 ASP A OD2 
1153 N  N   . LEU A 125 ? 0.22697 0.25726 0.19656 -0.06591 -0.02243 -0.02125 125 LEU A N   
1154 C  CA  . LEU A 125 ? 0.23480 0.25953 0.19170 -0.06850 -0.02148 -0.02386 125 LEU A CA  
1155 C  C   . LEU A 125 ? 0.23603 0.26728 0.17821 -0.07368 -0.03021 -0.03050 125 LEU A C   
1156 O  O   . LEU A 125 ? 0.26618 0.28122 0.17700 -0.06620 -0.03238 -0.04016 125 LEU A O   
1157 C  CB  . LEU A 125 ? 0.25390 0.26228 0.20891 -0.05450 -0.01262 -0.02090 125 LEU A CB  
1158 C  CG  . LEU A 125 ? 0.28300 0.28595 0.24309 -0.03665 -0.00355 -0.03968 125 LEU A CG  
1159 C  CD1 . LEU A 125 ? 0.30914 0.30025 0.28020 -0.03184 0.00708  -0.07446 125 LEU A CD1 
1160 C  CD2 . LEU A 125 ? 0.28131 0.30266 0.26785 -0.02914 -0.00585 -0.03704 125 LEU A CD2 
1161 N  N   . ALA A 126 ? 0.23389 0.26469 0.16511 -0.08062 -0.03039 -0.01738 126 ALA A N   
1162 C  CA  . ALA A 126 ? 0.24245 0.27528 0.15284 -0.09203 -0.04031 -0.01727 126 ALA A CA  
1163 C  C   . ALA A 126 ? 0.23849 0.28021 0.15377 -0.07714 -0.03101 -0.01903 126 ALA A C   
1164 O  O   . ALA A 126 ? 0.24853 0.29495 0.15531 -0.08462 -0.03149 -0.01264 126 ALA A O   
1165 C  CB  . ALA A 126 ? 0.26977 0.27986 0.15944 -0.10748 -0.05064 -0.00833 126 ALA A CB  
1166 N  N   . VAL A 127 ? 0.23455 0.28323 0.17058 -0.07040 -0.04198 -0.01406 127 VAL A N   
1167 C  CA  . VAL A 127 ? 0.24253 0.31174 0.19326 -0.07344 -0.04747 -0.01847 127 VAL A CA  
1168 C  C   . VAL A 127 ? 0.24986 0.33596 0.19676 -0.08599 -0.05772 -0.03241 127 VAL A C   
1169 O  O   . VAL A 127 ? 0.26834 0.36688 0.19757 -0.07334 -0.05423 -0.04419 127 VAL A O   
1170 C  CB  . VAL A 127 ? 0.25052 0.35814 0.22365 -0.04880 -0.04039 -0.02271 127 VAL A CB  
1171 C  CG1 . VAL A 127 ? 0.25414 0.42626 0.26568 -0.04272 -0.05176 -0.02682 127 VAL A CG1 
1172 C  CG2 . VAL A 127 ? 0.26752 0.36656 0.22200 -0.01212 -0.04177 -0.01947 127 VAL A CG2 
1173 N  N   A GLU A 128 ? 0.25151 0.32631 0.19933 -0.10764 -0.04236 -0.04085 128 GLU A N   
1174 N  N   B GLU A 128 ? 0.25832 0.34843 0.20561 -0.07977 -0.06075 -0.03657 128 GLU A N   
1175 C  CA  A GLU A 128 ? 0.28393 0.32349 0.21823 -0.11550 -0.02770 -0.04904 128 GLU A CA  
1176 C  CA  B GLU A 128 ? 0.28790 0.36104 0.22326 -0.07842 -0.05409 -0.04088 128 GLU A CA  
1177 C  C   A GLU A 128 ? 0.30627 0.31659 0.19914 -0.11644 -0.04267 -0.06158 128 GLU A C   
1178 C  C   B GLU A 128 ? 0.29086 0.34271 0.21569 -0.09868 -0.04455 -0.04455 128 GLU A C   
1179 O  O   A GLU A 128 ? 0.35078 0.35452 0.20693 -0.12292 -0.04816 -0.08199 128 GLU A O   
1180 O  O   B GLU A 128 ? 0.32883 0.37230 0.22595 -0.10533 -0.04410 -0.04590 128 GLU A O   
1181 C  CB  A GLU A 128 ? 0.34226 0.32319 0.27201 -0.13468 -0.00012 -0.04050 128 GLU A CB  
1182 C  CB  B GLU A 128 ? 0.35377 0.39156 0.25987 -0.06303 -0.05840 -0.04040 128 GLU A CB  
1183 C  CG  A GLU A 128 ? 0.42804 0.33120 0.34651 -0.13512 0.00917  -0.04827 128 GLU A CG  
1184 C  CG  B GLU A 128 ? 0.41744 0.44707 0.31368 -0.07551 -0.05750 -0.04868 128 GLU A CG  
1185 C  CD  A GLU A 128 ? 0.57200 0.36076 0.43698 -0.10332 0.04388  -0.03714 128 GLU A CD  
1186 C  CD  B GLU A 128 ? 0.46095 0.53938 0.39777 -0.08907 -0.05085 -0.03664 128 GLU A CD  
1187 O  OE1 A GLU A 128 ? 0.66464 0.40660 0.42121 -0.10887 0.07659  0.02096  128 GLU A OE1 
1188 O  OE1 B GLU A 128 ? 0.43180 0.60892 0.41279 -0.11691 -0.05868 -0.05082 128 GLU A OE1 
1189 O  OE2 A GLU A 128 ? 0.62749 0.41381 0.56614 -0.02444 0.06315  -0.05607 128 GLU A OE2 
1190 O  OE2 B GLU A 128 ? 0.57549 0.57657 0.41735 -0.05897 -0.05203 -0.01919 128 GLU A OE2 
1191 N  N   . LEU A 129 ? 0.28827 0.30559 0.18895 -0.10347 -0.03379 -0.04855 129 LEU A N   
1192 C  CA  . LEU A 129 ? 0.29831 0.31831 0.17942 -0.09566 -0.01542 -0.04433 129 LEU A CA  
1193 C  C   . LEU A 129 ? 0.30533 0.34382 0.18389 -0.09257 -0.00650 -0.02882 129 LEU A C   
1194 O  O   . LEU A 129 ? 0.36044 0.39518 0.20967 -0.08621 0.02815  -0.01078 129 LEU A O   
1195 C  CB  . LEU A 129 ? 0.29418 0.34476 0.19102 -0.09132 -0.01430 -0.04878 129 LEU A CB  
1196 C  CG  . LEU A 129 ? 0.32895 0.38353 0.23930 -0.07399 -0.04857 -0.04433 129 LEU A CG  
1197 C  CD1 . LEU A 129 ? 0.31952 0.44848 0.25624 -0.07739 -0.05936 -0.01624 129 LEU A CD1 
1198 C  CD2 . LEU A 129 ? 0.41556 0.37609 0.29329 -0.03044 -0.07805 -0.07283 129 LEU A CD2 
1199 N  N   . GLY A 130 ? 0.30455 0.33243 0.18663 -0.09131 -0.03700 -0.03703 130 GLY A N   
1200 C  CA  . GLY A 130 ? 0.32131 0.33897 0.18755 -0.09676 -0.05579 -0.02540 130 GLY A CA  
1201 C  C   . GLY A 130 ? 0.28734 0.32007 0.17728 -0.07601 -0.04340 -0.01610 130 GLY A C   
1202 O  O   . GLY A 130 ? 0.32207 0.32890 0.18605 -0.07356 -0.05951 -0.00526 130 GLY A O   
1203 N  N   . ALA A 131 ? 0.24112 0.29038 0.16713 -0.06873 -0.02399 -0.01514 131 ALA A N   
1204 C  CA  . ALA A 131 ? 0.21595 0.28285 0.17616 -0.05477 -0.02501 -0.01780 131 ALA A CA  
1205 C  C   . ALA A 131 ? 0.20120 0.30264 0.19326 -0.04824 -0.02362 -0.03406 131 ALA A C   
1206 O  O   . ALA A 131 ? 0.21335 0.34509 0.27349 -0.06158 0.00718  -0.03898 131 ALA A O   
1207 C  CB  . ALA A 131 ? 0.21885 0.27872 0.18885 -0.05786 -0.03788 -0.00527 131 ALA A CB  
1208 N  N   A GLU A 132 ? 0.20981 0.29853 0.17543 -0.02205 -0.03689 -0.03543 132 GLU A N   
1209 N  N   B GLU A 132 ? 0.20683 0.30001 0.16949 -0.03426 -0.04362 -0.03609 132 GLU A N   
1210 C  CA  A GLU A 132 ? 0.24021 0.32092 0.17703 0.01063  -0.06589 -0.03124 132 GLU A CA  
1211 C  CA  B GLU A 132 ? 0.23293 0.31725 0.17115 -0.01436 -0.05419 -0.03332 132 GLU A CA  
1212 C  C   A GLU A 132 ? 0.19014 0.28935 0.15294 -0.00113 -0.04521 -0.01467 132 GLU A C   
1213 C  C   B GLU A 132 ? 0.18566 0.28371 0.16686 -0.01398 -0.04240 -0.02661 132 GLU A C   
1214 O  O   A GLU A 132 ? 0.18585 0.29141 0.15407 -0.00372 -0.03662 -0.00075 132 GLU A O   
1215 O  O   B GLU A 132 ? 0.16637 0.28755 0.20190 -0.02521 -0.04168 -0.03994 132 GLU A O   
1216 C  CB  A GLU A 132 ? 0.37412 0.37577 0.19249 0.03843  -0.10125 -0.02904 132 GLU A CB  
1217 C  CB  B GLU A 132 ? 0.32235 0.36851 0.18405 -0.01495 -0.06384 -0.02033 132 GLU A CB  
1218 C  CG  A GLU A 132 ? 0.49364 0.45299 0.19896 0.05026  -0.12006 -0.01894 132 GLU A CG  
1219 C  CG  B GLU A 132 ? 0.38543 0.41518 0.24057 -0.04041 -0.03652 0.03012  132 GLU A CG  
1220 C  CD  A GLU A 132 ? 0.64454 0.53858 0.23863 0.05070  -0.12440 0.01516  132 GLU A CD  
1221 C  CD  B GLU A 132 ? 0.39985 0.51220 0.35142 -0.06240 -0.07238 0.11487  132 GLU A CD  
1222 O  OE1 A GLU A 132 ? 0.79304 0.52705 0.26409 0.04815  -0.12055 0.07447  132 GLU A OE1 
1223 O  OE1 B GLU A 132 ? 0.46276 0.58014 0.40756 -0.04581 -0.12632 0.08367  132 GLU A OE1 
1224 O  OE2 A GLU A 132 ? 0.71588 0.63778 0.26866 0.03711  -0.12255 -0.02697 132 GLU A OE2 
1225 O  OE2 B GLU A 132 ? 0.35360 0.58084 0.39535 -0.06375 -0.08512 0.21796  132 GLU A OE2 
1226 N  N   . THR A 133 ? 0.18182 0.26271 0.13806 -0.01717 -0.04187 -0.01027 133 THR A N   
1227 C  CA  . THR A 133 ? 0.17706 0.23986 0.13867 -0.02964 -0.03539 0.00300  133 THR A CA  
1228 C  C   . THR A 133 ? 0.16514 0.22565 0.12672 -0.01946 -0.02203 -0.01189 133 THR A C   
1229 O  O   . THR A 133 ? 0.19105 0.25353 0.13237 -0.00306 -0.02050 -0.00938 133 THR A O   
1230 C  CB  . THR A 133 ? 0.22296 0.26784 0.17285 -0.04588 -0.04755 0.03319  133 THR A CB  
1231 O  OG1 . THR A 133 ? 0.26594 0.29369 0.20360 -0.03368 -0.05131 0.06098  133 THR A OG1 
1232 C  CG2 . THR A 133 ? 0.25586 0.27476 0.19973 -0.08000 -0.05819 0.03274  133 THR A CG2 
1233 N  N   . TYR A 134 ? 0.16131 0.21413 0.12357 -0.02705 -0.02919 -0.00990 134 TYR A N   
1234 C  CA  . TYR A 134 ? 0.14957 0.20109 0.12619 -0.03517 -0.02604 -0.00404 134 TYR A CA  
1235 C  C   . TYR A 134 ? 0.15195 0.19621 0.13826 -0.02621 -0.03025 -0.01249 134 TYR A C   
1236 O  O   . TYR A 134 ? 0.16632 0.21006 0.16318 -0.02461 -0.02570 -0.03153 134 TYR A O   
1237 C  CB  . TYR A 134 ? 0.15789 0.21743 0.13903 -0.04331 -0.01884 0.00466  134 TYR A CB  
1238 C  CG  . TYR A 134 ? 0.17281 0.21768 0.13730 -0.04909 -0.02339 0.00212  134 TYR A CG  
1239 C  CD1 . TYR A 134 ? 0.20051 0.21163 0.15379 -0.05458 -0.03856 -0.00151 134 TYR A CD1 
1240 C  CD2 . TYR A 134 ? 0.18490 0.22381 0.14605 -0.04505 -0.03047 0.00539  134 TYR A CD2 
1241 C  CE1 . TYR A 134 ? 0.19872 0.20962 0.16228 -0.05762 -0.03674 0.00009  134 TYR A CE1 
1242 C  CE2 . TYR A 134 ? 0.19947 0.21786 0.14841 -0.04041 -0.03227 0.01271  134 TYR A CE2 
1243 C  CZ  . TYR A 134 ? 0.19438 0.20587 0.15788 -0.04942 -0.03239 0.01233  134 TYR A CZ  
1244 O  OH  . TYR A 134 ? 0.21816 0.21069 0.18134 -0.03517 -0.03376 0.00721  134 TYR A OH  
1245 N  N   . VAL A 135 ? 0.15094 0.19321 0.13450 -0.03159 -0.03511 -0.00699 135 VAL A N   
1246 C  CA  . VAL A 135 ? 0.15186 0.19436 0.13582 -0.02713 -0.04087 -0.00692 135 VAL A CA  
1247 C  C   . VAL A 135 ? 0.16425 0.18061 0.13711 -0.02491 -0.03736 -0.00236 135 VAL A C   
1248 O  O   . VAL A 135 ? 0.20180 0.18350 0.13806 -0.02664 -0.03695 -0.00325 135 VAL A O   
1249 C  CB  . VAL A 135 ? 0.17087 0.21329 0.14625 -0.03897 -0.03044 -0.00719 135 VAL A CB  
1250 C  CG1 . VAL A 135 ? 0.17533 0.26107 0.16744 -0.05903 -0.02614 0.00239  135 VAL A CG1 
1251 C  CG2 . VAL A 135 ? 0.21454 0.20949 0.14937 -0.03431 -0.02312 0.00541  135 VAL A CG2 
1252 N  N   . ALA A 136 ? 0.17120 0.18933 0.13045 -0.02790 -0.02972 -0.00368 136 ALA A N   
1253 C  CA  . ALA A 136 ? 0.17781 0.20930 0.12097 -0.03898 -0.02096 0.00027  136 ALA A CA  
1254 C  C   . ALA A 136 ? 0.17827 0.18813 0.11792 -0.02477 -0.03153 0.00652  136 ALA A C   
1255 O  O   . ALA A 136 ? 0.18379 0.18979 0.14959 -0.01934 -0.03631 0.01214  136 ALA A O   
1256 C  CB  . ALA A 136 ? 0.20279 0.25218 0.15009 -0.05067 0.00215  0.00903  136 ALA A CB  
1257 N  N   . TRP A 137 ? 0.17640 0.19654 0.11728 -0.01781 -0.04091 0.00632  137 TRP A N   
1258 C  CA  . TRP A 137 ? 0.16903 0.19913 0.11502 -0.01857 -0.03153 0.00290  137 TRP A CA  
1259 C  C   . TRP A 137 ? 0.17035 0.18696 0.11425 -0.01460 -0.03357 0.00846  137 TRP A C   
1260 O  O   . TRP A 137 ? 0.20946 0.18745 0.12869 -0.01384 -0.04342 0.00738  137 TRP A O   
1261 C  CB  . TRP A 137 ? 0.18243 0.20256 0.12279 -0.01730 -0.02669 -0.00254 137 TRP A CB  
1262 C  CG  . TRP A 137 ? 0.18093 0.19403 0.12956 -0.02284 -0.02459 0.00824  137 TRP A CG  
1263 C  CD1 . TRP A 137 ? 0.19485 0.19366 0.17868 -0.03062 -0.03364 0.01795  137 TRP A CD1 
1264 C  CD2 . TRP A 137 ? 0.17304 0.19431 0.13407 -0.02260 -0.01584 0.00499  137 TRP A CD2 
1265 N  NE1 . TRP A 137 ? 0.19572 0.19314 0.18633 -0.03201 -0.03103 0.02417  137 TRP A NE1 
1266 C  CE2 . TRP A 137 ? 0.17311 0.19383 0.14258 -0.02422 -0.00848 0.02100  137 TRP A CE2 
1267 C  CE3 . TRP A 137 ? 0.18106 0.20308 0.18496 -0.00413 -0.02918 -0.00837 137 TRP A CE3 
1268 C  CZ2 . TRP A 137 ? 0.16604 0.19930 0.13743 -0.02339 -0.00112 0.02030  137 TRP A CZ2 
1269 C  CZ3 . TRP A 137 ? 0.19276 0.20721 0.19285 -0.00011 -0.03201 -0.01687 137 TRP A CZ3 
1270 C  CH2 . TRP A 137 ? 0.17824 0.20561 0.15574 -0.00882 -0.00945 0.00068  137 TRP A CH2 
1271 N  N   . GLY A 138 ? 0.16830 0.20321 0.10350 -0.01640 -0.02017 0.00828  138 GLY A N   
1272 C  CA  . GLY A 138 ? 0.17304 0.21927 0.10025 -0.00988 -0.02199 0.01345  138 GLY A CA  
1273 C  C   . GLY A 138 ? 0.17606 0.19969 0.09510 -0.01999 -0.01323 0.01153  138 GLY A C   
1274 O  O   . GLY A 138 ? 0.18958 0.19342 0.10535 -0.01793 -0.00798 0.01356  138 GLY A O   
1275 N  N   . GLY A 139 ? 0.17492 0.21736 0.09486 -0.01694 -0.00755 0.00476  139 GLY A N   
1276 C  CA  . GLY A 139 ? 0.16730 0.23458 0.09776 -0.01899 -0.01132 0.01191  139 GLY A CA  
1277 C  C   . GLY A 139 ? 0.15146 0.21932 0.09509 -0.02713 -0.00693 0.01827  139 GLY A C   
1278 O  O   . GLY A 139 ? 0.16394 0.26036 0.11415 -0.04225 -0.00399 0.02417  139 GLY A O   
1279 N  N   . ARG A 140 ? 0.16179 0.19531 0.09390 -0.02334 -0.00732 0.01756  140 ARG A N   
1280 C  CA  . ARG A 140 ? 0.17672 0.18012 0.09722 -0.02341 -0.01142 0.01473  140 ARG A CA  
1281 C  C   . ARG A 140 ? 0.15593 0.17410 0.09581 -0.02438 -0.01617 0.02030  140 ARG A C   
1282 O  O   . ARG A 140 ? 0.16818 0.18919 0.09967 -0.01991 -0.01585 0.02734  140 ARG A O   
1283 C  CB  . ARG A 140 ? 0.19270 0.18156 0.11623 -0.02002 -0.00914 0.00538  140 ARG A CB  
1284 C  CG  . ARG A 140 ? 0.19787 0.18929 0.13054 -0.01329 -0.01305 0.00359  140 ARG A CG  
1285 C  CD  . ARG A 140 ? 0.18425 0.21267 0.13138 -0.01265 -0.00621 -0.00189 140 ARG A CD  
1286 N  NE  . ARG A 140 ? 0.17350 0.21036 0.12678 -0.01435 -0.00522 0.01055  140 ARG A NE  
1287 C  CZ  . ARG A 140 ? 0.17439 0.22743 0.12237 -0.02863 -0.00855 0.02087  140 ARG A CZ  
1288 N  NH1 . ARG A 140 ? 0.18899 0.21492 0.12405 -0.04130 -0.01529 0.03812  140 ARG A NH1 
1289 N  NH2 . ARG A 140 ? 0.18492 0.30400 0.11941 -0.01883 0.01028  0.00044  140 ARG A NH2 
1290 N  N   . GLU A 141 ? 0.15099 0.17394 0.09776 -0.02833 -0.00596 0.01569  141 GLU A N   
1291 C  CA  . GLU A 141 ? 0.15013 0.17615 0.09730 -0.02224 -0.00573 0.01821  141 GLU A CA  
1292 C  C   . GLU A 141 ? 0.14937 0.17942 0.09256 -0.03174 -0.00368 0.02310  141 GLU A C   
1293 O  O   . GLU A 141 ? 0.17957 0.18034 0.09655 -0.03925 0.00000  0.02802  141 GLU A O   
1294 C  CB  . GLU A 141 ? 0.15614 0.19197 0.11074 -0.02901 -0.01675 0.02341  141 GLU A CB  
1295 C  CG  . GLU A 141 ? 0.18186 0.20651 0.11169 -0.04783 -0.01579 0.02624  141 GLU A CG  
1296 C  CD  . GLU A 141 ? 0.24799 0.21019 0.11797 -0.06369 0.00840  0.01754  141 GLU A CD  
1297 O  OE1 . GLU A 141 ? 0.18334 0.20887 0.12047 -0.05216 0.02285  0.01438  141 GLU A OE1 
1298 O  OE2 . GLU A 141 ? 0.46301 0.21604 0.14241 -0.07459 0.05817  0.00859  141 GLU A OE2 
1299 N  N   . GLY A 142 ? 0.14664 0.18347 0.09214 -0.03745 -0.01130 0.02235  142 GLY A N   
1300 C  CA  . GLY A 142 ? 0.15782 0.18820 0.09699 -0.03818 -0.02152 0.02249  142 GLY A CA  
1301 C  C   . GLY A 142 ? 0.14473 0.18436 0.09380 -0.02987 -0.00801 0.02523  142 GLY A C   
1302 O  O   . GLY A 142 ? 0.15365 0.20359 0.10848 -0.04071 -0.01045 0.04694  142 GLY A O   
1303 N  N   . ALA A 143 ? 0.13879 0.18222 0.08126 -0.01813 -0.00994 0.02232  143 ALA A N   
1304 C  CA  . ALA A 143 ? 0.13991 0.19653 0.08030 -0.01146 -0.00212 0.01400  143 ALA A CA  
1305 C  C   . ALA A 143 ? 0.13440 0.17297 0.07059 -0.01737 0.00397  0.01701  143 ALA A C   
1306 O  O   . ALA A 143 ? 0.14629 0.19194 0.08113 -0.02419 -0.00117 0.02671  143 ALA A O   
1307 C  CB  . ALA A 143 ? 0.15463 0.23668 0.09788 -0.00719 0.00431  -0.00563 143 ALA A CB  
1308 N  N   . GLU A 144 ? 0.13545 0.17802 0.07439 -0.01612 -0.00724 0.01401  144 GLU A N   
1309 C  CA  . GLU A 144 ? 0.13595 0.17760 0.08936 -0.01155 -0.00578 0.00734  144 GLU A CA  
1310 C  C   . GLU A 144 ? 0.14359 0.19935 0.09972 -0.02253 0.00211  -0.00485 144 GLU A C   
1311 O  O   . GLU A 144 ? 0.17526 0.25175 0.13657 -0.05517 0.02515  -0.03376 144 GLU A O   
1312 C  CB  . GLU A 144 ? 0.15408 0.18498 0.09521 -0.00032 0.00187  0.00249  144 GLU A CB  
1313 C  CG  . GLU A 144 ? 0.16594 0.19456 0.09842 -0.00675 0.00127  -0.00375 144 GLU A CG  
1314 C  CD  . GLU A 144 ? 0.18366 0.18126 0.08521 -0.00966 -0.00789 0.01580  144 GLU A CD  
1315 O  OE1 . GLU A 144 ? 0.18911 0.18355 0.08943 -0.01188 -0.00985 0.02212  144 GLU A OE1 
1316 O  OE2 . GLU A 144 ? 0.20738 0.18970 0.09500 -0.03169 -0.02042 0.02380  144 GLU A OE2 
1317 N  N   . SER A 145 ? 0.15448 0.19673 0.08183 -0.01342 0.00992  0.00734  145 SER A N   
1318 C  CA  . SER A 145 ? 0.16047 0.19596 0.08683 -0.00264 -0.00376 -0.00168 145 SER A CA  
1319 C  C   . SER A 145 ? 0.16201 0.19016 0.08600 -0.01297 -0.00393 0.00138  145 SER A C   
1320 O  O   . SER A 145 ? 0.16971 0.20483 0.11021 -0.01898 -0.00337 -0.01368 145 SER A O   
1321 C  CB  . SER A 145 ? 0.17834 0.20770 0.09561 -0.00912 0.00246  0.01370  145 SER A CB  
1322 O  OG  . SER A 145 ? 0.20249 0.22103 0.10576 -0.01099 0.00414  0.02982  145 SER A OG  
1323 N  N   . GLY A 146 ? 0.16502 0.19244 0.09579 -0.00077 -0.00275 -0.00585 146 GLY A N   
1324 C  CA  . GLY A 146 ? 0.16301 0.20308 0.12307 0.00896  -0.00638 -0.00734 146 GLY A CA  
1325 C  C   . GLY A 146 ? 0.15906 0.23005 0.13411 0.01332  -0.01305 -0.00760 146 GLY A C   
1326 O  O   . GLY A 146 ? 0.16413 0.30786 0.15826 0.03242  -0.00846 -0.00293 146 GLY A O   
1327 N  N   . GLY A 147 ? 0.15818 0.21229 0.11987 -0.00119 0.00348  -0.00564 147 GLY A N   
1328 C  CA  . GLY A 147 ? 0.15977 0.23118 0.12773 -0.01148 0.01227  -0.00845 147 GLY A CA  
1329 C  C   . GLY A 147 ? 0.15132 0.21877 0.11761 -0.00635 0.00675  0.00691  147 GLY A C   
1330 O  O   . GLY A 147 ? 0.18364 0.23671 0.12501 -0.01883 0.02051  0.00581  147 GLY A O   
1331 N  N   . ALA A 148 ? 0.15248 0.20014 0.11979 -0.00900 -0.00038 0.00297  148 ALA A N   
1332 C  CA  . ALA A 148 ? 0.16221 0.19732 0.12086 -0.01545 0.00733  0.00991  148 ALA A CA  
1333 C  C   . ALA A 148 ? 0.16937 0.18733 0.12008 -0.02396 0.00236  0.01837  148 ALA A C   
1334 O  O   . ALA A 148 ? 0.17854 0.19571 0.14567 -0.02830 0.00209  0.02097  148 ALA A O   
1335 C  CB  . ALA A 148 ? 0.16337 0.21487 0.13596 -0.01545 0.01898  0.00277  148 ALA A CB  
1336 N  N   . LYS A 149 ? 0.15826 0.19583 0.13844 -0.02181 -0.01449 0.02406  149 LYS A N   
1337 C  CA  . LYS A 149 ? 0.18322 0.21466 0.16582 -0.03914 -0.02988 0.04520  149 LYS A CA  
1338 C  C   . LYS A 149 ? 0.17933 0.20467 0.22408 -0.03654 -0.03209 0.03378  149 LYS A C   
1339 O  O   . LYS A 149 ? 0.18126 0.21158 0.33849 -0.02791 -0.00653 0.03439  149 LYS A O   
1340 C  CB  . LYS A 149 ? 0.22977 0.26379 0.15540 -0.05531 -0.01658 0.05224  149 LYS A CB  
1341 C  CG  . LYS A 149 ? 0.23930 0.25545 0.15775 -0.04343 0.00276  0.01509  149 LYS A CG  
1342 C  CD  . LYS A 149 ? 0.20330 0.23611 0.15055 -0.03907 0.01274  0.00510  149 LYS A CD  
1343 C  CE  . LYS A 149 ? 0.17052 0.23462 0.13310 -0.04394 0.00880  0.01743  149 LYS A CE  
1344 N  NZ  . LYS A 149 ? 0.17848 0.22793 0.12060 -0.03364 0.00685  0.01702  149 LYS A NZ  
1345 N  N   . ASP A 150 ? 0.18987 0.20411 0.16509 -0.02720 -0.03567 0.04146  150 ASP A N   
1346 C  CA  . ASP A 150 ? 0.19019 0.21590 0.14478 -0.03133 -0.02172 0.03915  150 ASP A CA  
1347 C  C   . ASP A 150 ? 0.16877 0.19299 0.13105 -0.02527 -0.01125 0.03118  150 ASP A C   
1348 O  O   . ASP A 150 ? 0.17337 0.19468 0.14447 -0.03514 -0.02057 0.03154  150 ASP A O   
1349 C  CB  . ASP A 150 ? 0.21256 0.25742 0.14258 -0.02831 -0.00810 0.02939  150 ASP A CB  
1350 C  CG  . ASP A 150 ? 0.27279 0.31219 0.14732 0.00646  -0.00246 0.00128  150 ASP A CG  
1351 O  OD1 . ASP A 150 ? 0.25526 0.30234 0.15630 0.02498  -0.00009 0.00562  150 ASP A OD1 
1352 O  OD2 . ASP A 150 ? 0.43002 0.39479 0.17043 0.03826  -0.03205 -0.04578 150 ASP A OD2 
1353 N  N   . VAL A 151 ? 0.16096 0.18589 0.12514 -0.01805 -0.00848 0.02174  151 VAL A N   
1354 C  CA  . VAL A 151 ? 0.16500 0.19032 0.12086 -0.02622 0.00564  0.02520  151 VAL A CA  
1355 C  C   . VAL A 151 ? 0.16267 0.19308 0.11327 -0.02234 0.01040  0.02075  151 VAL A C   
1356 O  O   . VAL A 151 ? 0.16249 0.21304 0.11394 -0.03437 0.00794  0.00905  151 VAL A O   
1357 C  CB  . VAL A 151 ? 0.16014 0.21377 0.13546 -0.03137 0.01290  0.03503  151 VAL A CB  
1358 C  CG1 . VAL A 151 ? 0.20015 0.22624 0.12977 -0.04914 0.00859  0.03922  151 VAL A CG1 
1359 C  CG2 . VAL A 151 ? 0.16698 0.26567 0.17422 -0.02939 0.02330  0.03073  151 VAL A CG2 
1360 N  N   A ARG A 152 ? 0.15608 0.19539 0.12071 -0.01523 0.00631  0.01679  152 ARG A N   
1361 N  N   B ARG A 152 ? 0.15875 0.20161 0.11383 -0.01784 0.00780  0.01714  152 ARG A N   
1362 C  CA  A ARG A 152 ? 0.15683 0.20637 0.12451 -0.01541 0.01255  0.01353  152 ARG A CA  
1363 C  CA  B ARG A 152 ? 0.15983 0.21183 0.12120 -0.01541 0.01756  0.01313  152 ARG A CA  
1364 C  C   A ARG A 152 ? 0.14408 0.21250 0.11263 -0.02080 0.01362  0.01876  152 ARG A C   
1365 C  C   B ARG A 152 ? 0.14955 0.21169 0.11027 -0.01209 0.02133  0.01790  152 ARG A C   
1366 O  O   A ARG A 152 ? 0.14983 0.22527 0.13686 -0.02996 -0.00563 0.01719  152 ARG A O   
1367 O  O   B ARG A 152 ? 0.15563 0.21749 0.11527 -0.00126 0.01629  0.00934  152 ARG A O   
1368 C  CB  A ARG A 152 ? 0.18796 0.20548 0.15269 -0.00865 0.02456  0.02094  152 ARG A CB  
1369 C  CB  B ARG A 152 ? 0.18631 0.21887 0.15027 -0.01643 0.03998  0.00688  152 ARG A CB  
1370 C  CG  A ARG A 152 ? 0.24371 0.20756 0.19719 0.00070  0.04187  0.02192  152 ARG A CG  
1371 C  CG  B ARG A 152 ? 0.23569 0.23097 0.18761 -0.02554 0.07050  -0.01267 152 ARG A CG  
1372 C  CD  A ARG A 152 ? 0.31448 0.22693 0.22778 0.01297  0.04462  0.00541  152 ARG A CD  
1373 C  CD  B ARG A 152 ? 0.30604 0.27118 0.21822 -0.04218 0.07995  -0.04451 152 ARG A CD  
1374 N  NE  A ARG A 152 ? 0.35425 0.26602 0.23716 0.01161  0.04114  -0.00672 152 ARG A NE  
1375 N  NE  B ARG A 152 ? 0.36808 0.33284 0.23136 -0.06293 0.07612  -0.07202 152 ARG A NE  
1376 C  CZ  A ARG A 152 ? 0.42189 0.35985 0.26164 0.01135  0.04457  -0.04097 152 ARG A CZ  
1377 C  CZ  B ARG A 152 ? 0.47542 0.38046 0.24648 -0.07612 0.11531  -0.06234 152 ARG A CZ  
1378 N  NH1 A ARG A 152 ? 0.34661 0.43699 0.29574 0.00264  0.08772  -0.07472 152 ARG A NH1 
1379 N  NH1 B ARG A 152 ? 0.53875 0.39982 0.22652 -0.04739 0.14041  -0.05578 152 ARG A NH1 
1380 N  NH2 A ARG A 152 ? 0.55697 0.38418 0.26995 0.03395  0.01028  -0.02749 152 ARG A NH2 
1381 N  NH2 B ARG A 152 ? 0.51036 0.42021 0.28057 -0.08344 0.11903  -0.05356 152 ARG A NH2 
1382 N  N   . ASP A 153 ? 0.15877 0.20329 0.11143 -0.01860 0.02280  0.01863  153 ASP A N   
1383 C  CA  . ASP A 153 ? 0.16493 0.20142 0.10991 -0.02269 0.01551  0.01912  153 ASP A CA  
1384 C  C   . ASP A 153 ? 0.14031 0.19913 0.11500 -0.03561 0.01157  0.02393  153 ASP A C   
1385 O  O   . ASP A 153 ? 0.15589 0.21809 0.11588 -0.04386 0.01608  0.01389  153 ASP A O   
1386 C  CB  . ASP A 153 ? 0.18602 0.21154 0.10955 -0.01540 0.02552  0.02479  153 ASP A CB  
1387 C  CG  . ASP A 153 ? 0.21385 0.25642 0.12257 -0.00074 0.02467  0.01789  153 ASP A CG  
1388 O  OD1 . ASP A 153 ? 0.23025 0.34904 0.12338 0.02932  0.04282  0.01554  153 ASP A OD1 
1389 O  OD2 . ASP A 153 ? 0.24091 0.26479 0.12009 0.00466  0.01076  0.01515  153 ASP A OD2 
1390 N  N   . ALA A 154 ? 0.14267 0.19228 0.10816 -0.02029 0.01637  0.02304  154 ALA A N   
1391 C  CA  . ALA A 154 ? 0.14506 0.19975 0.10606 -0.01724 0.01476  0.01362  154 ALA A CA  
1392 C  C   . ALA A 154 ? 0.14810 0.18871 0.10944 -0.02086 0.01629  0.01504  154 ALA A C   
1393 O  O   . ALA A 154 ? 0.16215 0.20640 0.11618 -0.02505 -0.00014 0.00364  154 ALA A O   
1394 C  CB  . ALA A 154 ? 0.14771 0.21716 0.11646 -0.01835 0.01341  0.01346  154 ALA A CB  
1395 N  N   . LEU A 155 ? 0.14636 0.19210 0.10686 -0.01720 0.00724  0.02445  155 LEU A N   
1396 C  CA  . LEU A 155 ? 0.14993 0.19830 0.11681 -0.02175 0.00309  0.02227  155 LEU A CA  
1397 C  C   . LEU A 155 ? 0.14791 0.20007 0.11823 -0.03045 0.00745  0.01897  155 LEU A C   
1398 O  O   . LEU A 155 ? 0.16734 0.22387 0.12041 -0.03749 -0.00695 0.01598  155 LEU A O   
1399 C  CB  . LEU A 155 ? 0.16253 0.20990 0.13969 -0.02865 0.01095  0.03610  155 LEU A CB  
1400 C  CG  . LEU A 155 ? 0.18314 0.24469 0.16587 -0.04319 0.01545  0.05179  155 LEU A CG  
1401 C  CD1 . LEU A 155 ? 0.19794 0.23535 0.23478 -0.03929 0.00198  0.05694  155 LEU A CD1 
1402 C  CD2 . LEU A 155 ? 0.22950 0.34061 0.15873 -0.07923 0.03579  0.04669  155 LEU A CD2 
1403 N  N   . ASP A 156 ? 0.14038 0.20466 0.12237 -0.02370 0.01780  0.01615  156 ASP A N   
1404 C  CA  . ASP A 156 ? 0.14816 0.21470 0.12633 -0.02259 0.01752  0.01594  156 ASP A CA  
1405 C  C   . ASP A 156 ? 0.14754 0.21355 0.11653 -0.02881 0.00973  0.02537  156 ASP A C   
1406 O  O   . ASP A 156 ? 0.14883 0.23044 0.14012 -0.03152 0.00038  0.01376  156 ASP A O   
1407 C  CB  . ASP A 156 ? 0.16377 0.23218 0.14254 -0.01796 0.03400  0.01106  156 ASP A CB  
1408 C  CG  . ASP A 156 ? 0.19571 0.24498 0.16469 -0.01671 0.04551  0.00888  156 ASP A CG  
1409 O  OD1 . ASP A 156 ? 0.20824 0.22990 0.18813 -0.00075 0.05361  0.01622  156 ASP A OD1 
1410 O  OD2 . ASP A 156 ? 0.25320 0.27983 0.16167 -0.00287 0.04887  0.00108  156 ASP A OD2 
1411 N  N   . ARG A 157 ? 0.15200 0.20800 0.11661 -0.03647 0.01341  0.02198  157 ARG A N   
1412 C  CA  . ARG A 157 ? 0.15501 0.20419 0.11494 -0.02929 0.00179  0.02124  157 ARG A CA  
1413 C  C   . ARG A 157 ? 0.15182 0.20510 0.11673 -0.03874 0.00371  0.02119  157 ARG A C   
1414 O  O   . ARG A 157 ? 0.16296 0.21536 0.12159 -0.04081 -0.00661 0.01894  157 ARG A O   
1415 C  CB  . ARG A 157 ? 0.16338 0.21325 0.11472 -0.02703 0.00726  0.03024  157 ARG A CB  
1416 C  CG  . ARG A 157 ? 0.17910 0.22426 0.11660 -0.03577 0.01481  0.03683  157 ARG A CG  
1417 C  CD  . ARG A 157 ? 0.18935 0.24028 0.13355 -0.03874 0.02375  0.04124  157 ARG A CD  
1418 N  NE  . ARG A 157 ? 0.18900 0.26375 0.14943 -0.04201 0.02915  0.05579  157 ARG A NE  
1419 C  CZ  . ARG A 157 ? 0.19150 0.27494 0.17024 -0.02309 0.03405  0.06193  157 ARG A CZ  
1420 N  NH1 . ARG A 157 ? 0.20395 0.27436 0.15558 -0.01708 0.03560  0.04531  157 ARG A NH1 
1421 N  NH2 . ARG A 157 ? 0.18873 0.30123 0.22681 -0.01696 0.03591  0.07400  157 ARG A NH2 
1422 N  N   . MET A 158 ? 0.15777 0.20798 0.10797 -0.03260 0.00723  0.02966  158 MET A N   
1423 C  CA  A MET A 158 ? 0.15117 0.21111 0.11689 -0.03407 0.00911  0.02376  158 MET A CA  
1424 C  CA  B MET A 158 ? 0.15681 0.22364 0.11327 -0.03896 0.00445  0.03360  158 MET A CA  
1425 C  C   . MET A 158 ? 0.15410 0.21509 0.11169 -0.03654 0.00321  0.02571  158 MET A C   
1426 O  O   . MET A 158 ? 0.16891 0.22818 0.12185 -0.03838 0.00277  0.01459  158 MET A O   
1427 C  CB  A MET A 158 ? 0.16264 0.22583 0.12053 -0.03164 0.01595  0.02634  158 MET A CB  
1428 C  CB  B MET A 158 ? 0.16528 0.25713 0.12030 -0.04175 0.00716  0.05446  158 MET A CB  
1429 C  CG  A MET A 158 ? 0.17774 0.25357 0.13029 -0.02418 0.01008  0.02387  158 MET A CG  
1430 C  CG  B MET A 158 ? 0.17162 0.29989 0.15063 -0.04403 0.01611  0.06215  158 MET A CG  
1431 S  SD  A MET A 158 ? 0.20001 0.27853 0.15261 -0.00626 0.01078  0.01307  158 MET A SD  
1432 S  SD  B MET A 158 ? 0.20917 0.34026 0.20204 -0.05785 0.02442  0.08601  158 MET A SD  
1433 C  CE  A MET A 158 ? 0.20632 0.31795 0.17871 -0.02788 0.01962  0.02839  158 MET A CE  
1434 C  CE  B MET A 158 ? 0.26328 0.34343 0.21269 -0.06265 0.00967  0.08303  158 MET A CE  
1435 N  N   . LYS A 159 ? 0.15040 0.21574 0.11760 -0.02858 -0.00579 0.02839  159 LYS A N   
1436 C  CA  . LYS A 159 ? 0.15227 0.21901 0.13059 -0.02677 -0.00048 0.02099  159 LYS A CA  
1437 C  C   . LYS A 159 ? 0.15485 0.22542 0.12791 -0.03065 -0.00729 0.02172  159 LYS A C   
1438 O  O   . LYS A 159 ? 0.16691 0.24287 0.13293 -0.03226 -0.01963 0.01973  159 LYS A O   
1439 C  CB  . LYS A 159 ? 0.16846 0.22727 0.14773 -0.02019 -0.00059 0.00970  159 LYS A CB  
1440 C  CG  . LYS A 159 ? 0.17736 0.24364 0.16939 -0.01160 0.00078  0.01404  159 LYS A CG  
1441 C  CD  . LYS A 159 ? 0.19018 0.26682 0.19085 -0.00307 0.00413  -0.00112 159 LYS A CD  
1442 C  CE  . LYS A 159 ? 0.19486 0.28656 0.19160 -0.00521 0.01677  -0.01259 159 LYS A CE  
1443 N  NZ  . LYS A 159 ? 0.17364 0.28554 0.20275 -0.01172 0.01922  -0.00903 159 LYS A NZ  
1444 N  N   . GLU A 160 ? 0.15988 0.22961 0.13719 -0.04106 0.00408  0.02515  160 GLU A N   
1445 C  CA  . GLU A 160 ? 0.16570 0.23325 0.14034 -0.03779 0.00011  0.02465  160 GLU A CA  
1446 C  C   . GLU A 160 ? 0.16498 0.22885 0.14092 -0.04693 -0.00285 0.01744  160 GLU A C   
1447 O  O   . GLU A 160 ? 0.17846 0.24252 0.15557 -0.05989 -0.00890 0.01641  160 GLU A O   
1448 C  CB  . GLU A 160 ? 0.17545 0.25193 0.14633 -0.04071 0.01203  0.03645  160 GLU A CB  
1449 C  CG  . GLU A 160 ? 0.18806 0.27287 0.17534 -0.05845 0.00171  0.04903  160 GLU A CG  
1450 C  CD  . GLU A 160 ? 0.19686 0.29311 0.18310 -0.06354 0.00021  0.05511  160 GLU A CD  
1451 O  OE1 . GLU A 160 ? 0.20279 0.30877 0.16212 -0.06194 -0.00307 0.05457  160 GLU A OE1 
1452 O  OE2 . GLU A 160 ? 0.22316 0.31405 0.20863 -0.07890 0.00904  0.07483  160 GLU A OE2 
1453 N  N   . ALA A 161 ? 0.16959 0.22407 0.13802 -0.03630 0.00281  0.01982  161 ALA A N   
1454 C  CA  . ALA A 161 ? 0.17121 0.22424 0.14613 -0.02894 -0.01037 0.01248  161 ALA A CA  
1455 C  C   . ALA A 161 ? 0.15979 0.21821 0.14264 -0.04484 -0.00091 0.01092  161 ALA A C   
1456 O  O   . ALA A 161 ? 0.17427 0.22728 0.15215 -0.05025 -0.01234 0.01115  161 ALA A O   
1457 C  CB  . ALA A 161 ? 0.17460 0.23774 0.15819 -0.02282 -0.01573 0.02035  161 ALA A CB  
1458 N  N   . PHE A 162 ? 0.15934 0.22170 0.12852 -0.04056 -0.00050 0.01613  162 PHE A N   
1459 C  CA  . PHE A 162 ? 0.15589 0.22792 0.13157 -0.04436 -0.00826 0.01684  162 PHE A CA  
1460 C  C   . PHE A 162 ? 0.15494 0.23908 0.13695 -0.05357 -0.00653 0.01782  162 PHE A C   
1461 O  O   . PHE A 162 ? 0.16798 0.25384 0.14057 -0.05929 -0.01192 0.01155  162 PHE A O   
1462 C  CB  . PHE A 162 ? 0.14943 0.23835 0.14101 -0.03913 -0.00145 0.01575  162 PHE A CB  
1463 C  CG  . PHE A 162 ? 0.15239 0.26719 0.13769 -0.04186 0.00710  0.00530  162 PHE A CG  
1464 C  CD1 . PHE A 162 ? 0.17433 0.32090 0.15793 -0.03491 0.01077  -0.02301 162 PHE A CD1 
1465 C  CD2 . PHE A 162 ? 0.16081 0.29920 0.14689 -0.04795 0.00759  0.00614  162 PHE A CD2 
1466 C  CE1 . PHE A 162 ? 0.18506 0.35726 0.17080 -0.02983 0.01285  -0.02863 162 PHE A CE1 
1467 C  CE2 . PHE A 162 ? 0.16762 0.33903 0.15728 -0.03990 0.00646  0.00326  162 PHE A CE2 
1468 C  CZ  . PHE A 162 ? 0.17784 0.35338 0.16834 -0.02725 0.00662  -0.00420 162 PHE A CZ  
1469 N  N   . ASP A 163 ? 0.14804 0.24303 0.15087 -0.04684 -0.00682 0.01601  163 ASP A N   
1470 C  CA  . ASP A 163 ? 0.15165 0.25914 0.16495 -0.05060 -0.00479 0.00355  163 ASP A CA  
1471 C  C   . ASP A 163 ? 0.15362 0.26494 0.16888 -0.05244 -0.01692 0.00415  163 ASP A C   
1472 O  O   . ASP A 163 ? 0.16418 0.27595 0.19129 -0.05047 -0.02669 -0.00273 163 ASP A O   
1473 C  CB  . ASP A 163 ? 0.16406 0.25701 0.17429 -0.04264 0.00933  0.00282  163 ASP A CB  
1474 C  CG  . ASP A 163 ? 0.16446 0.26016 0.18416 -0.03592 0.01032  0.00164  163 ASP A CG  
1475 O  OD1 . ASP A 163 ? 0.19150 0.26179 0.18252 -0.03639 0.00881  0.01057  163 ASP A OD1 
1476 O  OD2 . ASP A 163 ? 0.19039 0.26966 0.19613 -0.02815 0.02252  -0.01019 163 ASP A OD2 
1477 N  N   . LEU A 164 ? 0.16063 0.26066 0.16691 -0.05464 -0.00606 0.01055  164 LEU A N   
1478 C  CA  . LEU A 164 ? 0.17408 0.25771 0.17668 -0.06789 -0.00968 0.01334  164 LEU A CA  
1479 C  C   . LEU A 164 ? 0.18048 0.25559 0.17577 -0.07778 -0.01118 0.00590  164 LEU A C   
1480 O  O   . LEU A 164 ? 0.19205 0.27746 0.18504 -0.08584 -0.01123 0.00241  164 LEU A O   
1481 C  CB  . LEU A 164 ? 0.20474 0.26668 0.19980 -0.06544 0.00233  0.02571  164 LEU A CB  
1482 C  CG  . LEU A 164 ? 0.26225 0.32803 0.23829 -0.07682 0.02075  0.03563  164 LEU A CG  
1483 C  CD1 . LEU A 164 ? 0.30179 0.35642 0.24013 -0.06031 0.00782  0.05777  164 LEU A CD1 
1484 C  CD2 . LEU A 164 ? 0.29399 0.38415 0.27552 -0.11450 0.04968  0.02685  164 LEU A CD2 
1485 N  N   . LEU A 165 ? 0.17359 0.24932 0.16838 -0.06474 -0.00688 0.00231  165 LEU A N   
1486 C  CA  . LEU A 165 ? 0.17196 0.26439 0.16862 -0.05333 -0.00909 -0.00419 165 LEU A CA  
1487 C  C   . LEU A 165 ? 0.17316 0.27553 0.16572 -0.06311 -0.01293 -0.00086 165 LEU A C   
1488 O  O   . LEU A 165 ? 0.19726 0.29216 0.17759 -0.07806 -0.02535 -0.00673 165 LEU A O   
1489 C  CB  . LEU A 165 ? 0.18155 0.27786 0.17552 -0.04774 -0.01455 -0.01657 165 LEU A CB  
1490 C  CG  . LEU A 165 ? 0.19741 0.30690 0.21368 -0.03277 -0.02156 -0.04364 165 LEU A CG  
1491 C  CD1 . LEU A 165 ? 0.18802 0.33288 0.28712 -0.03290 -0.01125 -0.05597 165 LEU A CD1 
1492 C  CD2 . LEU A 165 ? 0.23552 0.31465 0.21130 -0.01652 -0.02253 -0.03168 165 LEU A CD2 
1493 N  N   . GLY A 166 ? 0.17505 0.27375 0.17304 -0.05941 -0.01688 0.00654  166 GLY A N   
1494 C  CA  . GLY A 166 ? 0.17942 0.28910 0.17853 -0.05607 -0.03248 0.00532  166 GLY A CA  
1495 C  C   . GLY A 166 ? 0.18155 0.30456 0.18870 -0.06071 -0.03309 -0.00455 166 GLY A C   
1496 O  O   . GLY A 166 ? 0.19169 0.33091 0.19737 -0.06734 -0.04763 0.00121  166 GLY A O   
1497 N  N   . GLU A 167 ? 0.17053 0.30876 0.19972 -0.05861 -0.01054 -0.00533 167 GLU A N   
1498 C  CA  . GLU A 167 ? 0.18233 0.33491 0.21411 -0.07433 -0.00713 -0.00271 167 GLU A CA  
1499 C  C   . GLU A 167 ? 0.17836 0.33311 0.21700 -0.08664 -0.01819 -0.01024 167 GLU A C   
1500 O  O   . GLU A 167 ? 0.17825 0.36026 0.23580 -0.09558 -0.02615 -0.01724 167 GLU A O   
1501 C  CB  . GLU A 167 ? 0.22178 0.37655 0.23865 -0.07491 0.00317  0.01692  167 GLU A CB  
1502 C  CG  . GLU A 167 ? 0.25776 0.44449 0.29818 -0.08245 0.02900  0.02620  167 GLU A CG  
1503 C  CD  . GLU A 167 ? 0.34364 0.57057 0.36522 -0.09785 0.06368  0.04022  167 GLU A CD  
1504 O  OE1 . GLU A 167 ? 0.38464 0.63244 0.30973 -0.07683 0.03125  0.02208  167 GLU A OE1 
1505 O  OE2 . GLU A 167 ? 0.41987 0.64347 0.50999 -0.14421 0.14303  0.05259  167 GLU A OE2 
1506 N  N   . TYR A 168 ? 0.18751 0.31012 0.20749 -0.08478 -0.00942 -0.00361 168 TYR A N   
1507 C  CA  . TYR A 168 ? 0.18789 0.30417 0.20623 -0.08292 -0.01646 -0.00143 168 TYR A CA  
1508 C  C   . TYR A 168 ? 0.18509 0.31488 0.20892 -0.09076 -0.01798 -0.01141 168 TYR A C   
1509 O  O   . TYR A 168 ? 0.19397 0.33571 0.22195 -0.10034 -0.02347 -0.01874 168 TYR A O   
1510 C  CB  . TYR A 168 ? 0.19453 0.30212 0.21356 -0.07740 -0.02000 0.00345  168 TYR A CB  
1511 C  CG  . TYR A 168 ? 0.20792 0.29942 0.21866 -0.08033 -0.00915 0.00383  168 TYR A CG  
1512 C  CD1 . TYR A 168 ? 0.23140 0.30029 0.22032 -0.08644 0.00369  0.00450  168 TYR A CD1 
1513 C  CD2 . TYR A 168 ? 0.21026 0.29084 0.23329 -0.07995 -0.00715 0.00749  168 TYR A CD2 
1514 C  CE1 . TYR A 168 ? 0.24105 0.30378 0.22749 -0.09111 0.01368  -0.00074 168 TYR A CE1 
1515 C  CE2 . TYR A 168 ? 0.22133 0.28766 0.23528 -0.07874 -0.00073 0.00632  168 TYR A CE2 
1516 C  CZ  . TYR A 168 ? 0.24170 0.29348 0.24035 -0.08908 0.01209  -0.00252 168 TYR A CZ  
1517 O  OH  . TYR A 168 ? 0.28125 0.29809 0.27638 -0.09238 0.02697  -0.01879 168 TYR A OH  
1518 N  N   . VAL A 169 ? 0.18872 0.32651 0.20212 -0.08486 -0.01704 -0.00886 169 VAL A N   
1519 C  CA  A VAL A 169 ? 0.19586 0.34407 0.19801 -0.08922 -0.02890 -0.00777 169 VAL A CA  
1520 C  CA  B VAL A 169 ? 0.20049 0.34344 0.20036 -0.08579 -0.01939 -0.00320 169 VAL A CA  
1521 C  C   . VAL A 169 ? 0.19998 0.35985 0.21303 -0.08614 -0.03728 -0.00818 169 VAL A C   
1522 O  O   . VAL A 169 ? 0.22285 0.40009 0.21807 -0.08465 -0.04557 -0.02588 169 VAL A O   
1523 C  CB  A VAL A 169 ? 0.20111 0.36215 0.19670 -0.09359 -0.03146 0.00005  169 VAL A CB  
1524 C  CB  B VAL A 169 ? 0.22070 0.36565 0.19616 -0.08154 -0.00665 0.00878  169 VAL A CB  
1525 C  CG1 A VAL A 169 ? 0.18083 0.38158 0.21510 -0.09501 -0.03003 -0.00162 169 VAL A CG1 
1526 C  CG1 B VAL A 169 ? 0.23219 0.37949 0.18385 -0.07491 -0.01285 0.00365  169 VAL A CG1 
1527 C  CG2 A VAL A 169 ? 0.23053 0.35402 0.19846 -0.10565 -0.03731 0.00550  169 VAL A CG2 
1528 C  CG2 B VAL A 169 ? 0.22753 0.38479 0.20882 -0.07619 -0.00219 0.01656  169 VAL A CG2 
1529 N  N   . THR A 170 ? 0.19204 0.37150 0.24577 -0.07029 -0.04764 0.00894  170 THR A N   
1530 C  CA  A THR A 170 ? 0.20420 0.40044 0.29666 -0.05672 -0.06019 0.00465  170 THR A CA  
1531 C  CA  B THR A 170 ? 0.19759 0.39872 0.26907 -0.06451 -0.05119 0.01749  170 THR A CA  
1532 C  C   . THR A 170 ? 0.19708 0.43498 0.29458 -0.08356 -0.05054 0.00290  170 THR A C   
1533 O  O   . THR A 170 ? 0.20328 0.49218 0.33018 -0.09291 -0.06703 -0.02191 170 THR A O   
1534 C  CB  A THR A 170 ? 0.23025 0.42258 0.37055 -0.02427 -0.07303 -0.01445 170 THR A CB  
1535 C  CB  B THR A 170 ? 0.21237 0.40131 0.29231 -0.05501 -0.04808 0.03182  170 THR A CB  
1536 O  OG1 A THR A 170 ? 0.25541 0.41848 0.39556 -0.01825 -0.09298 -0.01967 170 THR A OG1 
1537 O  OG1 B THR A 170 ? 0.22955 0.41378 0.29021 -0.06834 -0.03240 0.04096  170 THR A OG1 
1538 C  CG2 A THR A 170 ? 0.22808 0.44008 0.41230 -0.01577 -0.06737 -0.03110 170 THR A CG2 
1539 C  CG2 B THR A 170 ? 0.21263 0.39540 0.31049 -0.05160 -0.05959 0.03185  170 THR A CG2 
1540 N  N   . SER A 171 ? 0.19922 0.44287 0.29786 -0.11331 -0.02350 -0.00285 171 SER A N   
1541 C  CA  . SER A 171 ? 0.23276 0.45675 0.34589 -0.14217 -0.00887 -0.00275 171 SER A CA  
1542 C  C   . SER A 171 ? 0.21908 0.46655 0.34593 -0.14493 -0.01490 -0.03454 171 SER A C   
1543 O  O   . SER A 171 ? 0.23160 0.51411 0.36215 -0.16142 -0.01543 -0.05385 171 SER A O   
1544 C  CB  . SER A 171 ? 0.31009 0.48824 0.38155 -0.18475 0.00328  0.04183  171 SER A CB  
1545 O  OG  . SER A 171 ? 0.34734 0.56435 0.39587 -0.19520 -0.02657 0.04802  171 SER A OG  
1546 N  N   . GLN A 172 ? 0.22079 0.41506 0.32011 -0.12454 -0.02260 -0.03242 172 GLN A N   
1547 C  CA  . GLN A 172 ? 0.23742 0.39664 0.31834 -0.12515 -0.03078 -0.02775 172 GLN A CA  
1548 C  C   . GLN A 172 ? 0.24407 0.41860 0.31686 -0.12015 -0.04760 -0.04279 172 GLN A C   
1549 O  O   . GLN A 172 ? 0.31478 0.43307 0.35160 -0.11893 -0.06965 -0.06516 172 GLN A O   
1550 C  CB  . GLN A 172 ? 0.26320 0.39288 0.33152 -0.11261 -0.02973 -0.01152 172 GLN A CB  
1551 C  CG  . GLN A 172 ? 0.34787 0.38833 0.37028 -0.11216 -0.03968 -0.00060 172 GLN A CG  
1552 C  CD  . GLN A 172 ? 0.55191 0.45104 0.46539 -0.15464 -0.00703 0.00682  172 GLN A CD  
1553 O  OE1 . GLN A 172 ? 0.78944 0.42874 0.51273 -0.18550 0.04842  -0.03001 172 GLN A OE1 
1554 N  NE2 . GLN A 172 ? 0.56019 0.59508 0.51716 -0.17987 0.02277  0.05188  172 GLN A NE2 
1555 N  N   . GLY A 173 ? 0.20560 0.45109 0.29092 -0.09986 -0.05038 -0.03261 173 GLY A N   
1556 C  CA  . GLY A 173 ? 0.21403 0.49782 0.27860 -0.07773 -0.05557 -0.02758 173 GLY A CA  
1557 C  C   . GLY A 173 ? 0.22727 0.51438 0.26609 -0.09441 -0.06095 -0.02034 173 GLY A C   
1558 O  O   . GLY A 173 ? 0.26140 0.58786 0.27478 -0.10236 -0.08082 -0.02167 173 GLY A O   
1559 N  N   . TYR A 174 ? 0.21455 0.44744 0.23995 -0.09246 -0.04675 -0.02204 174 TYR A N   
1560 C  CA  . TYR A 174 ? 0.22909 0.41342 0.24768 -0.08957 -0.04796 -0.02634 174 TYR A CA  
1561 C  C   . TYR A 174 ? 0.26494 0.42625 0.26876 -0.08814 -0.07024 -0.01033 174 TYR A C   
1562 O  O   . TYR A 174 ? 0.37339 0.39883 0.30967 -0.09907 -0.03478 -0.02421 174 TYR A O   
1563 C  CB  . TYR A 174 ? 0.22321 0.39170 0.26140 -0.08992 -0.04650 -0.03739 174 TYR A CB  
1564 C  CG  . TYR A 174 ? 0.22064 0.38571 0.25428 -0.09218 -0.04066 -0.05335 174 TYR A CG  
1565 C  CD1 . TYR A 174 ? 0.23881 0.38440 0.28762 -0.07676 -0.05001 -0.06317 174 TYR A CD1 
1566 C  CD2 . TYR A 174 ? 0.22121 0.40411 0.23826 -0.09081 -0.03070 -0.03943 174 TYR A CD2 
1567 C  CE1 . TYR A 174 ? 0.25015 0.39095 0.31412 -0.08269 -0.05427 -0.05784 174 TYR A CE1 
1568 C  CE2 . TYR A 174 ? 0.24369 0.40211 0.27539 -0.09541 -0.03210 -0.03026 174 TYR A CE2 
1569 C  CZ  . TYR A 174 ? 0.26564 0.38735 0.31826 -0.09099 -0.04004 -0.03116 174 TYR A CZ  
1570 O  OH  . TYR A 174 ? 0.31048 0.37813 0.36747 -0.08553 -0.04737 -0.01699 174 TYR A OH  
1571 N  N   A ASP A 175 ? 0.26249 0.47224 0.26571 -0.08028 -0.09087 0.00869  175 ASP A N   
1572 N  N   B ASP A 175 ? 0.22104 0.45158 0.27936 -0.09430 -0.09127 0.01706  175 ASP A N   
1573 C  CA  A ASP A 175 ? 0.28635 0.50428 0.29323 -0.07521 -0.08869 0.04784  175 ASP A CA  
1574 C  CA  B ASP A 175 ? 0.24496 0.47872 0.30662 -0.10056 -0.11106 0.04541  175 ASP A CA  
1575 C  C   A ASP A 175 ? 0.24438 0.45345 0.31549 -0.05919 -0.03492 0.05326  175 ASP A C   
1576 C  C   B ASP A 175 ? 0.23887 0.44580 0.27203 -0.08781 -0.07935 0.02058  175 ASP A C   
1577 O  O   A ASP A 175 ? 0.25148 0.44911 0.41222 -0.04120 -0.01728 0.07163  175 ASP A O   
1578 O  O   B ASP A 175 ? 0.27155 0.47219 0.26912 -0.08898 -0.08313 -0.02891 175 ASP A O   
1579 C  CB  A ASP A 175 ? 0.37771 0.54901 0.31656 -0.09968 -0.12920 0.06845  175 ASP A CB  
1580 C  CB  B ASP A 175 ? 0.30798 0.54211 0.36550 -0.09899 -0.13455 0.05076  175 ASP A CB  
1581 C  CG  A ASP A 175 ? 0.47840 0.56941 0.38679 -0.11131 -0.14234 0.07519  175 ASP A CG  
1582 C  CG  B ASP A 175 ? 0.36916 0.60863 0.51293 -0.06116 -0.13633 -0.00864 175 ASP A CG  
1583 O  OD1 A ASP A 175 ? 0.51379 0.52911 0.48474 -0.13949 -0.12792 0.06848  175 ASP A OD1 
1584 O  OD1 B ASP A 175 ? 0.35141 0.60587 0.61294 -0.01089 -0.12382 0.00355  175 ASP A OD1 
1585 O  OD2 A ASP A 175 ? 0.58615 0.64557 0.36826 -0.09217 -0.13817 0.07775  175 ASP A OD2 
1586 O  OD2 B ASP A 175 ? 0.51785 0.66926 0.58929 -0.07199 -0.13938 -0.09113 175 ASP A OD2 
1587 N  N   . ILE A 176 ? 0.21191 0.39149 0.25158 -0.08763 -0.04933 0.01366  176 ILE A N   
1588 C  CA  . ILE A 176 ? 0.19947 0.33441 0.21899 -0.07820 -0.03945 -0.01587 176 ILE A CA  
1589 C  C   . ILE A 176 ? 0.18169 0.33079 0.20414 -0.05129 -0.02140 -0.03900 176 ILE A C   
1590 O  O   . ILE A 176 ? 0.20669 0.40351 0.23847 -0.06778 0.01061  -0.06549 176 ILE A O   
1591 C  CB  . ILE A 176 ? 0.22424 0.34235 0.22100 -0.07532 -0.03395 0.00474  176 ILE A CB  
1592 C  CG1 . ILE A 176 ? 0.23403 0.32318 0.23739 -0.06068 -0.05218 0.00204  176 ILE A CG1 
1593 C  CG2 . ILE A 176 ? 0.25259 0.40706 0.22595 -0.08531 -0.03200 0.02555  176 ILE A CG2 
1594 C  CD1 . ILE A 176 ? 0.26615 0.32718 0.26583 -0.05069 -0.06191 -0.01579 176 ILE A CD1 
1595 N  N   A ARG A 177 ? 0.16765 0.29070 0.19368 -0.03484 -0.04409 -0.03149 177 ARG A N   
1596 N  N   B ARG A 177 ? 0.17458 0.30438 0.17612 -0.03035 -0.01861 -0.03239 177 ARG A N   
1597 C  CA  A ARG A 177 ? 0.17484 0.27218 0.19697 -0.01522 -0.05527 -0.02934 177 ARG A CA  
1598 C  CA  B ARG A 177 ? 0.17841 0.29192 0.17829 -0.01547 -0.01972 -0.02967 177 ARG A CA  
1599 C  C   A ARG A 177 ? 0.15751 0.26652 0.17080 -0.01412 -0.03701 -0.02471 177 ARG A C   
1600 C  C   B ARG A 177 ? 0.16699 0.27431 0.15949 -0.00758 -0.00829 -0.02792 177 ARG A C   
1601 O  O   A ARG A 177 ? 0.17821 0.30595 0.17340 0.01610  -0.05486 -0.04548 177 ARG A O   
1602 O  O   B ARG A 177 ? 0.19178 0.30485 0.15655 0.01552  -0.00691 -0.04597 177 ARG A O   
1603 C  CB  A ARG A 177 ? 0.24056 0.28372 0.24186 0.01412  -0.09382 -0.02336 177 ARG A CB  
1604 C  CB  B ARG A 177 ? 0.22291 0.30724 0.21368 -0.01067 -0.03217 -0.02721 177 ARG A CB  
1605 C  CG  A ARG A 177 ? 0.30130 0.34308 0.30447 0.02958  -0.12690 -0.01144 177 ARG A CG  
1606 C  CG  B ARG A 177 ? 0.31519 0.33412 0.24137 -0.01203 -0.02444 -0.03057 177 ARG A CG  
1607 C  CD  A ARG A 177 ? 0.37256 0.37797 0.34971 0.02035  -0.12853 0.00800  177 ARG A CD  
1608 C  CD  B ARG A 177 ? 0.40232 0.36396 0.29252 0.01827  -0.02757 -0.01498 177 ARG A CD  
1609 N  NE  A ARG A 177 ? 0.47097 0.38552 0.35536 -0.02141 -0.10713 0.01707  177 ARG A NE  
1610 N  NE  B ARG A 177 ? 0.46633 0.37579 0.31211 0.03877  -0.03125 -0.00306 177 ARG A NE  
1611 C  CZ  A ARG A 177 ? 0.50193 0.40224 0.35310 -0.00211 -0.12838 0.02959  177 ARG A CZ  
1612 C  CZ  B ARG A 177 ? 0.51973 0.37010 0.29487 0.07110  -0.06552 0.00503  177 ARG A CZ  
1613 N  NH1 A ARG A 177 ? 0.54075 0.43033 0.35094 0.04545  -0.15806 0.02920  177 ARG A NH1 
1614 N  NH1 B ARG A 177 ? 0.54839 0.36527 0.22701 0.11375  -0.07730 0.00386  177 ARG A NH1 
1615 N  NH2 A ARG A 177 ? 0.48544 0.39462 0.33542 -0.01243 -0.12704 0.02673  177 ARG A NH2 
1616 N  NH2 B ARG A 177 ? 0.57561 0.38454 0.32619 0.03369  -0.10250 0.02823  177 ARG A NH2 
1617 N  N   . PHE A 178 ? 0.14091 0.24164 0.15857 -0.02231 -0.01515 -0.01192 178 PHE A N   
1618 C  CA  . PHE A 178 ? 0.13840 0.22105 0.15049 -0.03428 -0.01504 -0.00126 178 PHE A CA  
1619 C  C   . PHE A 178 ? 0.13490 0.20075 0.16395 -0.02125 -0.01203 0.00246  178 PHE A C   
1620 O  O   . PHE A 178 ? 0.15050 0.21019 0.20642 -0.01462 -0.01171 0.00923  178 PHE A O   
1621 C  CB  . PHE A 178 ? 0.17065 0.24294 0.14958 -0.03699 0.00476  0.00078  178 PHE A CB  
1622 C  CG  . PHE A 178 ? 0.17883 0.26601 0.17464 -0.05043 0.00183  0.00834  178 PHE A CG  
1623 C  CD1 . PHE A 178 ? 0.21527 0.26644 0.19967 -0.05035 0.00240  0.03665  178 PHE A CD1 
1624 C  CD2 . PHE A 178 ? 0.18419 0.29686 0.20595 -0.06899 0.00496  0.00628  178 PHE A CD2 
1625 C  CE1 . PHE A 178 ? 0.25813 0.26683 0.22440 -0.06188 0.00310  0.04391  178 PHE A CE1 
1626 C  CE2 . PHE A 178 ? 0.21417 0.31725 0.21452 -0.08515 0.00916  0.01757  178 PHE A CE2 
1627 C  CZ  . PHE A 178 ? 0.25165 0.30005 0.21783 -0.08307 0.00486  0.03368  178 PHE A CZ  
1628 N  N   . ALA A 179 ? 0.14314 0.20112 0.15339 -0.02686 -0.02946 -0.00521 179 ALA A N   
1629 C  CA  . ALA A 179 ? 0.14873 0.20138 0.15823 -0.03159 -0.04104 -0.00308 179 ALA A CA  
1630 C  C   . ALA A 179 ? 0.16472 0.18649 0.16205 -0.01017 -0.05367 -0.00800 179 ALA A C   
1631 O  O   . ALA A 179 ? 0.22428 0.19394 0.20364 0.01046  -0.10099 -0.02784 179 ALA A O   
1632 C  CB  . ALA A 179 ? 0.15433 0.22642 0.16270 -0.03230 -0.04037 0.01694  179 ALA A CB  
1633 N  N   . ILE A 180 ? 0.13698 0.18485 0.12696 -0.02352 -0.01944 -0.00024 180 ILE A N   
1634 C  CA  . ILE A 180 ? 0.14864 0.19568 0.11273 -0.01675 -0.01735 -0.00199 180 ILE A CA  
1635 C  C   . ILE A 180 ? 0.13208 0.17356 0.11350 -0.02280 -0.02802 0.00654  180 ILE A C   
1636 O  O   . ILE A 180 ? 0.13527 0.19181 0.12596 -0.01584 -0.01968 0.01298  180 ILE A O   
1637 C  CB  . ILE A 180 ? 0.20129 0.24712 0.12375 0.00079  -0.00063 0.00025  180 ILE A CB  
1638 C  CG1 . ILE A 180 ? 0.22434 0.32064 0.17464 0.02802  0.05601  0.01900  180 ILE A CG1 
1639 C  CG2 . ILE A 180 ? 0.26664 0.27154 0.12329 0.00706  -0.03285 -0.01480 180 ILE A CG2 
1640 C  CD1 . ILE A 180 ? 0.29250 0.39423 0.20444 0.07830  0.07834  0.02425  180 ILE A CD1 
1641 N  N   . GLU A 181 ? 0.13179 0.17519 0.12618 -0.02407 -0.02880 0.01095  181 GLU A N   
1642 C  CA  A GLU A 181 ? 0.13034 0.17869 0.14263 -0.02830 -0.03218 0.01051  181 GLU A CA  
1643 C  CA  B GLU A 181 ? 0.13519 0.17234 0.13863 -0.02602 -0.03192 0.01399  181 GLU A CA  
1644 C  C   . GLU A 181 ? 0.13945 0.17812 0.13679 -0.02721 -0.04575 0.02233  181 GLU A C   
1645 O  O   . GLU A 181 ? 0.18410 0.18993 0.17627 -0.03577 -0.07196 0.03715  181 GLU A O   
1646 C  CB  A GLU A 181 ? 0.13580 0.19746 0.16295 -0.01569 -0.01941 0.01827  181 GLU A CB  
1647 C  CB  B GLU A 181 ? 0.14519 0.17653 0.15798 -0.01324 -0.02472 0.02418  181 GLU A CB  
1648 C  CG  A GLU A 181 ? 0.14238 0.22269 0.16447 -0.00380 -0.01168 0.03361  181 GLU A CG  
1649 C  CG  B GLU A 181 ? 0.14960 0.18241 0.17491 -0.00170 -0.01966 0.04214  181 GLU A CG  
1650 C  CD  A GLU A 181 ? 0.15663 0.25636 0.18314 0.02251  -0.00859 0.05744  181 GLU A CD  
1651 C  CD  B GLU A 181 ? 0.16788 0.19829 0.19112 0.01612  -0.00689 0.04753  181 GLU A CD  
1652 O  OE1 A GLU A 181 ? 0.24222 0.26786 0.19591 0.01114  0.03757  0.03046  181 GLU A OE1 
1653 O  OE1 B GLU A 181 ? 0.19670 0.21280 0.21124 0.01863  -0.02785 0.05264  181 GLU A OE1 
1654 O  OE2 A GLU A 181 ? 0.13975 0.29735 0.24709 0.02227  -0.01748 0.07757  181 GLU A OE2 
1655 O  OE2 B GLU A 181 ? 0.16603 0.20702 0.19745 0.01808  0.01542  0.02730  181 GLU A OE2 
1656 N  N   . PRO A 182 ? 0.12865 0.17816 0.12062 -0.02405 -0.03284 0.01410  182 PRO A N   
1657 C  CA  . PRO A 182 ? 0.12948 0.18151 0.12845 -0.01828 -0.02948 0.00004  182 PRO A CA  
1658 C  C   . PRO A 182 ? 0.13132 0.17943 0.10608 -0.01910 -0.01781 0.01371  182 PRO A C   
1659 O  O   . PRO A 182 ? 0.13618 0.19463 0.10546 -0.01189 -0.02923 0.00180  182 PRO A O   
1660 C  CB  . PRO A 182 ? 0.16021 0.19407 0.15428 -0.00160 -0.03893 -0.00649 182 PRO A CB  
1661 C  CG  . PRO A 182 ? 0.19040 0.18696 0.14466 0.00307  -0.03887 -0.00887 182 PRO A CG  
1662 C  CD  . PRO A 182 ? 0.16013 0.17880 0.12914 -0.01762 -0.03521 0.01042  182 PRO A CD  
1663 N  N   . LYS A 183 ? 0.12064 0.18346 0.09598 -0.01922 -0.02206 0.01794  183 LYS A N   
1664 C  CA  . LYS A 183 ? 0.12164 0.17431 0.08557 -0.01137 -0.01971 0.01110  183 LYS A CA  
1665 C  C   . LYS A 183 ? 0.11796 0.17127 0.07364 -0.00526 -0.00724 0.01457  183 LYS A C   
1666 O  O   . LYS A 183 ? 0.13433 0.18927 0.07862 -0.01247 0.00091  0.02382  183 LYS A O   
1667 C  CB  . LYS A 183 ? 0.13976 0.17503 0.08884 -0.01088 -0.01343 0.00428  183 LYS A CB  
1668 C  CG  . LYS A 183 ? 0.14586 0.17857 0.09802 -0.00118 -0.01811 0.00373  183 LYS A CG  
1669 C  CD  . LYS A 183 ? 0.17138 0.18078 0.09490 0.00291  -0.00973 0.00779  183 LYS A CD  
1670 C  CE  . LYS A 183 ? 0.19250 0.18593 0.10767 0.03098  0.01578  0.01781  183 LYS A CE  
1671 N  NZ  . LYS A 183 ? 0.26458 0.21599 0.14845 0.06040  0.07462  0.03911  183 LYS A NZ  
1672 N  N   . PRO A 184 ? 0.11719 0.16062 0.06790 -0.00753 -0.00106 0.00870  184 PRO A N   
1673 C  CA  A PRO A 184 ? 0.13374 0.15586 0.08010 -0.00604 -0.01338 -0.00079 184 PRO A CA  
1674 C  CA  B PRO A 184 ? 0.12669 0.16418 0.06770 -0.00719 -0.00594 0.00482  184 PRO A CA  
1675 C  C   . PRO A 184 ? 0.10982 0.16055 0.07201 -0.01119 0.00033  -0.00151 184 PRO A C   
1676 O  O   . PRO A 184 ? 0.12309 0.15915 0.07334 -0.00781 0.00631  0.00110  184 PRO A O   
1677 C  CB  A PRO A 184 ? 0.16332 0.15934 0.10516 -0.00876 -0.00294 0.01044  184 PRO A CB  
1678 C  CB  B PRO A 184 ? 0.13535 0.16566 0.06851 -0.00786 -0.00341 0.01387  184 PRO A CB  
1679 C  CG  A PRO A 184 ? 0.14314 0.17302 0.10705 -0.01392 -0.00493 0.00426  184 PRO A CG  
1680 C  CG  B PRO A 184 ? 0.11613 0.16115 0.06654 -0.01037 -0.00336 0.01726  184 PRO A CG  
1681 C  CD  A PRO A 184 ? 0.14019 0.17172 0.09482 -0.02034 0.00109  0.01232  184 PRO A CD  
1682 C  CD  B PRO A 184 ? 0.12212 0.16539 0.07351 -0.01345 -0.00256 0.01275  184 PRO A CD  
1683 N  N   . ASN A 185 ? 0.11133 0.15122 0.07174 -0.00109 -0.00741 0.00792  185 ASN A N   
1684 C  CA  . ASN A 185 ? 0.12182 0.15930 0.07276 -0.00467 -0.01253 0.01055  185 ASN A CA  
1685 C  C   . ASN A 185 ? 0.12547 0.15802 0.06843 -0.00493 -0.00448 0.01367  185 ASN A C   
1686 O  O   . ASN A 185 ? 0.14118 0.16558 0.06973 0.00647  -0.00013 0.00974  185 ASN A O   
1687 C  CB  . ASN A 185 ? 0.12494 0.16917 0.08214 -0.00919 0.00267  0.00318  185 ASN A CB  
1688 C  CG  . ASN A 185 ? 0.11854 0.16421 0.08977 -0.00394 -0.00789 0.00035  185 ASN A CG  
1689 O  OD1 . ASN A 185 ? 0.13859 0.17480 0.11986 -0.00092 0.01751  0.00356  185 ASN A OD1 
1690 N  ND2 . ASN A 185 ? 0.13825 0.16605 0.10491 -0.00958 -0.01263 0.00970  185 ASN A ND2 
1691 N  N   A GLU A 186 ? 0.12906 0.15063 0.08973 -0.00573 0.00320  0.01054  186 GLU A N   
1692 N  N   B GLU A 186 ? 0.14375 0.15994 0.06489 -0.00682 0.00615  0.01772  186 GLU A N   
1693 C  CA  A GLU A 186 ? 0.13258 0.15078 0.10282 -0.00492 0.01189  0.01190  186 GLU A CA  
1694 C  CA  B GLU A 186 ? 0.15365 0.16356 0.06871 -0.00677 0.00716  0.01838  186 GLU A CA  
1695 C  C   A GLU A 186 ? 0.14178 0.15222 0.09480 -0.00045 0.00928  0.00218  186 GLU A C   
1696 C  C   B GLU A 186 ? 0.15832 0.16837 0.07938 -0.00384 0.00427  0.01163  186 GLU A C   
1697 O  O   A GLU A 186 ? 0.13700 0.15782 0.10020 -0.00397 -0.00177 -0.00272 186 GLU A O   
1698 O  O   B GLU A 186 ? 0.14366 0.18496 0.08312 0.00728  0.00777  0.02149  186 GLU A O   
1699 C  CB  A GLU A 186 ? 0.12933 0.15599 0.10319 0.00113  0.00754  0.01217  186 GLU A CB  
1700 C  CB  B GLU A 186 ? 0.15527 0.17024 0.06255 -0.00462 0.00127  0.02326  186 GLU A CB  
1701 C  CG  A GLU A 186 ? 0.14745 0.17339 0.11167 0.00758  0.01166  0.00200  186 GLU A CG  
1702 C  CG  B GLU A 186 ? 0.16606 0.18444 0.07490 -0.00018 0.00997  0.02437  186 GLU A CG  
1703 C  CD  A GLU A 186 ? 0.17257 0.24486 0.12984 0.01473  0.00408  0.00424  186 GLU A CD  
1704 C  CD  B GLU A 186 ? 0.18233 0.21995 0.11303 -0.00770 0.02467  0.02329  186 GLU A CD  
1705 O  OE1 A GLU A 186 ? 0.21034 0.34476 0.11049 0.05112  0.00569  0.01841  186 GLU A OE1 
1706 O  OE1 B GLU A 186 ? 0.18057 0.25257 0.10622 -0.03147 0.01770  0.04891  186 GLU A OE1 
1707 O  OE2 A GLU A 186 ? 0.17201 0.29564 0.17762 -0.00856 0.02045  -0.03653 186 GLU A OE2 
1708 O  OE2 B GLU A 186 ? 0.19731 0.22811 0.14819 -0.00010 0.02922  -0.00952 186 GLU A OE2 
1709 N  N   . PRO A 187 ? 0.17074 0.15605 0.09236 -0.01091 0.00822  0.00887  187 PRO A N   
1710 C  CA  . PRO A 187 ? 0.19774 0.15694 0.10523 0.00525  0.00906  0.00966  187 PRO A CA  
1711 C  C   . PRO A 187 ? 0.20058 0.19324 0.10295 0.02354  -0.00866 0.01128  187 PRO A C   
1712 O  O   . PRO A 187 ? 0.23134 0.28732 0.12593 0.07079  -0.02914 -0.00616 187 PRO A O   
1713 C  CB  . PRO A 187 ? 0.23071 0.16019 0.14113 -0.00895 0.00919  0.00592  187 PRO A CB  
1714 C  CG  . PRO A 187 ? 0.23373 0.16984 0.13319 -0.02684 0.00508  0.01107  187 PRO A CG  
1715 C  CD  . PRO A 187 ? 0.20006 0.16526 0.11475 -0.03594 0.01140  0.00641  187 PRO A CD  
1716 N  N   . ARG A 188 ? 0.17818 0.16950 0.08865 -0.00888 -0.00278 0.00141  188 ARG A N   
1717 C  CA  . ARG A 188 ? 0.16270 0.16736 0.07951 -0.00890 -0.00726 -0.00022 188 ARG A CA  
1718 C  C   . ARG A 188 ? 0.14874 0.17037 0.07842 -0.00912 -0.00073 0.00495  188 ARG A C   
1719 O  O   . ARG A 188 ? 0.16989 0.16798 0.07620 -0.01595 0.00268  0.01149  188 ARG A O   
1720 C  CB  . ARG A 188 ? 0.16385 0.17149 0.09838 -0.03080 -0.00837 0.01288  188 ARG A CB  
1721 C  CG  . ARG A 188 ? 0.18623 0.17787 0.10291 -0.02873 -0.02460 0.01580  188 ARG A CG  
1722 C  CD  . ARG A 188 ? 0.20738 0.18314 0.10468 -0.02616 -0.02923 0.01368  188 ARG A CD  
1723 N  NE  . ARG A 188 ? 0.19554 0.18389 0.10128 -0.03183 -0.02236 0.02333  188 ARG A NE  
1724 C  CZ  . ARG A 188 ? 0.18525 0.18562 0.11214 -0.03015 -0.02578 0.02955  188 ARG A CZ  
1725 N  NH1 . ARG A 188 ? 0.19752 0.19393 0.12883 -0.02550 -0.02222 0.02359  188 ARG A NH1 
1726 N  NH2 . ARG A 188 ? 0.19167 0.20531 0.11169 -0.01819 -0.03364 0.02858  188 ARG A NH2 
1727 N  N   . GLY A 189 ? 0.12848 0.16607 0.08202 -0.00837 -0.00879 0.00009  189 GLY A N   
1728 C  CA  . GLY A 189 ? 0.13113 0.17187 0.08373 -0.00831 -0.01850 0.00506  189 GLY A CA  
1729 C  C   . GLY A 189 ? 0.12335 0.16638 0.07297 -0.01607 0.00010  0.00362  189 GLY A C   
1730 O  O   . GLY A 189 ? 0.13424 0.17532 0.09780 -0.02116 0.00390  0.01572  189 GLY A O   
1731 N  N   . ASP A 190 ? 0.11317 0.15982 0.07867 -0.00529 0.00367  0.01194  190 ASP A N   
1732 C  CA  . ASP A 190 ? 0.11601 0.15560 0.09228 -0.01091 -0.00281 0.00601  190 ASP A CA  
1733 C  C   . ASP A 190 ? 0.12264 0.16493 0.07965 -0.01973 -0.00025 0.02129  190 ASP A C   
1734 O  O   . ASP A 190 ? 0.15526 0.19918 0.08993 -0.05036 -0.01281 0.03832  190 ASP A O   
1735 C  CB  . ASP A 190 ? 0.13947 0.16848 0.10727 0.00035  -0.00646 -0.00663 190 ASP A CB  
1736 C  CG  . ASP A 190 ? 0.15673 0.16227 0.09834 -0.00450 -0.00678 -0.00142 190 ASP A CG  
1737 O  OD1 . ASP A 190 ? 0.17028 0.17082 0.11000 -0.01981 -0.01366 0.00989  190 ASP A OD1 
1738 O  OD2 . ASP A 190 ? 0.16008 0.17807 0.10780 -0.00295 -0.01778 0.00290  190 ASP A OD2 
1739 N  N   . ILE A 191 ? 0.12172 0.16374 0.07720 -0.01559 -0.00933 0.00941  191 ILE A N   
1740 C  CA  . ILE A 191 ? 0.12746 0.16250 0.07374 -0.01694 -0.00429 0.00650  191 ILE A CA  
1741 C  C   . ILE A 191 ? 0.13146 0.15733 0.06927 -0.02113 0.00013  0.00971  191 ILE A C   
1742 O  O   . ILE A 191 ? 0.14471 0.16651 0.10247 -0.01436 0.00641  0.01206  191 ILE A O   
1743 C  CB  . ILE A 191 ? 0.13145 0.17212 0.08161 -0.01484 -0.00235 0.00024  191 ILE A CB  
1744 C  CG1 . ILE A 191 ? 0.14141 0.18066 0.09928 -0.00501 0.01343  0.00625  191 ILE A CG1 
1745 C  CG2 . ILE A 191 ? 0.14800 0.20287 0.09785 -0.01594 -0.01726 -0.02289 191 ILE A CG2 
1746 C  CD1 . ILE A 191 ? 0.15603 0.20381 0.12021 -0.01262 0.01496  -0.00488 191 ILE A CD1 
1747 N  N   . LEU A 192 ? 0.12597 0.17974 0.07374 -0.01777 0.00701  0.01472  192 LEU A N   
1748 C  CA  . LEU A 192 ? 0.12786 0.19053 0.08926 -0.00803 0.01054  0.01956  192 LEU A CA  
1749 C  C   . LEU A 192 ? 0.12203 0.17949 0.08659 -0.00883 0.00171  0.01452  192 LEU A C   
1750 O  O   . LEU A 192 ? 0.15791 0.19882 0.09522 0.01121  -0.01345 0.00923  192 LEU A O   
1751 C  CB  . LEU A 192 ? 0.15689 0.22573 0.10172 -0.00740 0.02071  0.03581  192 LEU A CB  
1752 C  CG  . LEU A 192 ? 0.22307 0.28652 0.12376 -0.01285 0.03706  0.04065  192 LEU A CG  
1753 C  CD1 . LEU A 192 ? 0.23758 0.33082 0.16101 -0.01908 0.06077  0.07489  192 LEU A CD1 
1754 C  CD2 . LEU A 192 ? 0.32816 0.33149 0.12585 -0.01854 0.01739  0.00744  192 LEU A CD2 
1755 N  N   . LEU A 193 ? 0.12538 0.18270 0.10176 -0.01225 0.00172  0.02250  193 LEU A N   
1756 C  CA  . LEU A 193 ? 0.13457 0.19318 0.10386 -0.01803 -0.01249 0.02032  193 LEU A CA  
1757 C  C   . LEU A 193 ? 0.14141 0.17250 0.08494 -0.01521 -0.00448 0.01112  193 LEU A C   
1758 O  O   . LEU A 193 ? 0.17459 0.19173 0.09288 -0.03476 0.00352  0.00147  193 LEU A O   
1759 C  CB  . LEU A 193 ? 0.13580 0.21002 0.13104 -0.03207 -0.01494 0.03049  193 LEU A CB  
1760 C  CG  . LEU A 193 ? 0.13710 0.24148 0.18359 -0.04008 -0.01130 0.04132  193 LEU A CG  
1761 C  CD1 . LEU A 193 ? 0.15632 0.26810 0.24388 -0.06113 -0.03058 0.03535  193 LEU A CD1 
1762 C  CD2 . LEU A 193 ? 0.15008 0.26882 0.19150 -0.01876 0.00934  0.04809  193 LEU A CD2 
1763 N  N   . PRO A 194 ? 0.12195 0.16410 0.08010 -0.00871 -0.00016 0.00681  194 PRO A N   
1764 C  CA  . PRO A 194 ? 0.12031 0.17510 0.07960 -0.00847 -0.00030 0.00702  194 PRO A CA  
1765 C  C   . PRO A 194 ? 0.12597 0.18118 0.07690 0.00734  -0.00097 0.00749  194 PRO A C   
1766 O  O   . PRO A 194 ? 0.13872 0.22886 0.08389 0.03316  0.00484  0.01514  194 PRO A O   
1767 C  CB  . PRO A 194 ? 0.13272 0.17585 0.08292 -0.00798 -0.00478 -0.00377 194 PRO A CB  
1768 C  CG  . PRO A 194 ? 0.13706 0.17248 0.09565 -0.00839 0.00714  0.00164  194 PRO A CG  
1769 C  CD  . PRO A 194 ? 0.13993 0.17389 0.08389 -0.01481 -0.00366 -0.00704 194 PRO A CD  
1770 N  N   . THR A 195 ? 0.12859 0.16680 0.06779 0.00001  -0.00054 0.01759  195 THR A N   
1771 C  CA  . THR A 195 ? 0.12870 0.17856 0.07963 -0.01076 -0.00146 0.01992  195 THR A CA  
1772 C  C   . THR A 195 ? 0.12598 0.17358 0.07549 -0.00306 -0.00110 0.00410  195 THR A C   
1773 O  O   . THR A 195 ? 0.12385 0.18087 0.09212 -0.00373 -0.00615 0.00808  195 THR A O   
1774 C  CB  . THR A 195 ? 0.13377 0.18208 0.09910 -0.01135 -0.00819 0.01540  195 THR A CB  
1775 O  OG1 . THR A 195 ? 0.15634 0.17125 0.09052 0.00027  -0.00967 0.00757  195 THR A OG1 
1776 C  CG2 . THR A 195 ? 0.14615 0.20367 0.10833 -0.02669 -0.02240 0.01966  195 THR A CG2 
1777 N  N   . VAL A 196 ? 0.13106 0.18882 0.07338 -0.00915 -0.00829 0.00563  196 VAL A N   
1778 C  CA  A VAL A 196 ? 0.13108 0.19896 0.07944 -0.00118 -0.00635 0.00786  196 VAL A CA  
1779 C  CA  B VAL A 196 ? 0.13005 0.19662 0.07864 -0.00907 -0.00395 0.00390  196 VAL A CA  
1780 C  C   . VAL A 196 ? 0.12743 0.18182 0.07784 -0.00861 -0.00637 0.01712  196 VAL A C   
1781 O  O   . VAL A 196 ? 0.12239 0.19962 0.09704 -0.01240 -0.00631 0.01021  196 VAL A O   
1782 C  CB  A VAL A 196 ? 0.15419 0.23556 0.07464 0.00259  -0.00947 0.00487  196 VAL A CB  
1783 C  CB  B VAL A 196 ? 0.14928 0.21755 0.08652 -0.01324 -0.00391 -0.00188 196 VAL A CB  
1784 C  CG1 A VAL A 196 ? 0.17109 0.25346 0.09271 0.00947  -0.01390 0.03435  196 VAL A CG1 
1785 C  CG1 B VAL A 196 ? 0.17333 0.20905 0.10743 -0.00960 -0.01255 0.01148  196 VAL A CG1 
1786 C  CG2 A VAL A 196 ? 0.16911 0.26389 0.08255 0.01185  -0.01053 -0.01475 196 VAL A CG2 
1787 C  CG2 B VAL A 196 ? 0.14246 0.24556 0.09093 -0.01978 0.00030  -0.01379 196 VAL A CG2 
1788 N  N   . GLY A 197 ? 0.13581 0.17445 0.08169 -0.00237 0.00025  0.01253  197 GLY A N   
1789 C  CA  . GLY A 197 ? 0.14153 0.17011 0.09522 -0.00113 0.01340  0.01218  197 GLY A CA  
1790 C  C   . GLY A 197 ? 0.12204 0.16633 0.09771 -0.00178 -0.00743 -0.00073 197 GLY A C   
1791 O  O   . GLY A 197 ? 0.13136 0.18739 0.10476 0.00863  -0.00111 0.00950  197 GLY A O   
1792 N  N   . HIS A 198 ? 0.12172 0.17537 0.08290 0.00152  -0.00604 0.00783  198 HIS A N   
1793 C  CA  . HIS A 198 ? 0.12239 0.18414 0.08542 -0.00795 -0.00158 0.01617  198 HIS A CA  
1794 C  C   . HIS A 198 ? 0.12311 0.18135 0.08558 -0.00563 0.00257  0.00660  198 HIS A C   
1795 O  O   . HIS A 198 ? 0.12690 0.19967 0.09597 -0.01996 0.00355  0.00456  198 HIS A O   
1796 C  CB  . HIS A 198 ? 0.12633 0.17396 0.08936 -0.00515 -0.01172 0.01298  198 HIS A CB  
1797 C  CG  . HIS A 198 ? 0.12404 0.17774 0.08072 -0.00070 -0.00406 0.02179  198 HIS A CG  
1798 N  ND1 . HIS A 198 ? 0.12268 0.19133 0.10269 -0.00663 -0.00156 0.02663  198 HIS A ND1 
1799 C  CD2 . HIS A 198 ? 0.13660 0.18525 0.09182 -0.00076 -0.01019 0.01273  198 HIS A CD2 
1800 C  CE1 . HIS A 198 ? 0.12715 0.18168 0.10705 -0.00907 -0.01670 0.02197  198 HIS A CE1 
1801 N  NE2 . HIS A 198 ? 0.14305 0.17794 0.10470 -0.00778 -0.00665 0.01650  198 HIS A NE2 
1802 N  N   . ALA A 199 ? 0.12144 0.17299 0.09155 -0.00847 0.00096  -0.00025 199 ALA A N   
1803 C  CA  . ALA A 199 ? 0.12935 0.17349 0.10341 -0.00948 0.00139  -0.00589 199 ALA A CA  
1804 C  C   . ALA A 199 ? 0.13270 0.17939 0.09974 -0.01003 -0.00387 0.00396  199 ALA A C   
1805 O  O   . ALA A 199 ? 0.13831 0.19622 0.13067 -0.02376 -0.00238 0.00695  199 ALA A O   
1806 C  CB  . ALA A 199 ? 0.15790 0.18336 0.12951 -0.00365 -0.00412 -0.01344 199 ALA A CB  
1807 N  N   . LEU A 200 ? 0.12535 0.17899 0.10270 -0.00365 -0.00740 0.00325  200 LEU A N   
1808 C  CA  . LEU A 200 ? 0.13265 0.19357 0.10402 0.00444  -0.01294 0.01084  200 LEU A CA  
1809 C  C   . LEU A 200 ? 0.13225 0.20465 0.11696 -0.00283 -0.01106 0.00755  200 LEU A C   
1810 O  O   . LEU A 200 ? 0.13528 0.24007 0.14309 0.00150  -0.00695 -0.00354 200 LEU A O   
1811 C  CB  . LEU A 200 ? 0.15225 0.20759 0.10772 0.00340  -0.00547 0.00803  200 LEU A CB  
1812 C  CG  . LEU A 200 ? 0.16831 0.23563 0.10558 0.00297  -0.01053 0.01326  200 LEU A CG  
1813 C  CD1 . LEU A 200 ? 0.19592 0.26791 0.11738 0.00415  -0.00203 0.03687  200 LEU A CD1 
1814 C  CD2 . LEU A 200 ? 0.18695 0.26410 0.11992 0.00571  -0.01995 -0.01691 200 LEU A CD2 
1815 N  N   . ALA A 201 ? 0.13883 0.19309 0.10484 -0.00566 0.00005  0.00315  201 ALA A N   
1816 C  CA  . ALA A 201 ? 0.14569 0.19977 0.11538 -0.00742 0.01679  -0.00442 201 ALA A CA  
1817 C  C   . ALA A 201 ? 0.12862 0.20348 0.12300 0.00273  0.01141  0.00549  201 ALA A C   
1818 O  O   . ALA A 201 ? 0.14425 0.22394 0.15336 0.00283  0.02199  0.00346  201 ALA A O   
1819 C  CB  . ALA A 201 ? 0.17766 0.20170 0.12739 -0.02245 0.01907  -0.01044 201 ALA A CB  
1820 N  N   . PHE A 202 ? 0.12401 0.19387 0.11617 -0.01264 0.00621  0.00986  202 PHE A N   
1821 C  CA  . PHE A 202 ? 0.13073 0.20077 0.12753 -0.01615 0.00090  0.01717  202 PHE A CA  
1822 C  C   . PHE A 202 ? 0.13180 0.20916 0.12720 -0.01465 0.00928  0.01407  202 PHE A C   
1823 O  O   . PHE A 202 ? 0.13264 0.22319 0.13911 -0.01938 0.01524  0.02160  202 PHE A O   
1824 C  CB  . PHE A 202 ? 0.14062 0.20517 0.13536 -0.00896 0.00130  0.03313  202 PHE A CB  
1825 C  CG  . PHE A 202 ? 0.14664 0.21580 0.13489 -0.01599 0.00216  0.03754  202 PHE A CG  
1826 C  CD1 . PHE A 202 ? 0.18151 0.23559 0.13971 -0.01383 0.00510  0.04414  202 PHE A CD1 
1827 C  CD2 . PHE A 202 ? 0.15971 0.22448 0.15591 -0.02240 -0.00182 0.02885  202 PHE A CD2 
1828 C  CE1 . PHE A 202 ? 0.19480 0.24998 0.15844 -0.01601 0.01056  0.05346  202 PHE A CE1 
1829 C  CE2 . PHE A 202 ? 0.15766 0.23256 0.18267 -0.02869 0.00170  0.04090  202 PHE A CE2 
1830 C  CZ  . PHE A 202 ? 0.16858 0.24234 0.18063 -0.01926 0.00490  0.05712  202 PHE A CZ  
1831 N  N   . ILE A 203 ? 0.13143 0.21407 0.12485 -0.02093 -0.00092 0.01118  203 ILE A N   
1832 C  CA  . ILE A 203 ? 0.13940 0.22597 0.13753 -0.01891 -0.00483 0.00029  203 ILE A CA  
1833 C  C   . ILE A 203 ? 0.14241 0.22393 0.16657 -0.01479 -0.00944 0.01220  203 ILE A C   
1834 O  O   . ILE A 203 ? 0.13671 0.25038 0.18579 -0.02648 -0.01244 0.01278  203 ILE A O   
1835 C  CB  . ILE A 203 ? 0.16151 0.25898 0.14047 -0.01414 -0.00906 -0.01140 203 ILE A CB  
1836 C  CG1 . ILE A 203 ? 0.17379 0.26726 0.15500 -0.02662 0.01177  -0.03214 203 ILE A CG1 
1837 C  CG2 . ILE A 203 ? 0.18609 0.29317 0.14875 -0.01062 -0.02567 -0.00776 203 ILE A CG2 
1838 C  CD1 . ILE A 203 ? 0.20945 0.29591 0.16406 -0.02739 0.02129  -0.04187 203 ILE A CD1 
1839 N  N   . GLU A 204 ? 0.13856 0.22171 0.18289 0.00785  -0.01072 0.02038  204 GLU A N   
1840 C  CA  . GLU A 204 ? 0.15813 0.24022 0.22386 0.02258  0.01188  0.03096  204 GLU A CA  
1841 C  C   . GLU A 204 ? 0.16365 0.27084 0.25562 0.01658  0.02850  0.03656  204 GLU A C   
1842 O  O   . GLU A 204 ? 0.17772 0.34412 0.31888 0.05050  0.05678  0.07021  204 GLU A O   
1843 C  CB  . GLU A 204 ? 0.18797 0.24370 0.23107 0.02804  0.01435  0.03480  204 GLU A CB  
1844 C  CG  . GLU A 204 ? 0.21707 0.28760 0.24674 0.03831  0.00452  0.05530  204 GLU A CG  
1845 C  CD  . GLU A 204 ? 0.23727 0.43585 0.29120 0.07209  -0.01927 0.06882  204 GLU A CD  
1846 O  OE1 . GLU A 204 ? 0.24557 0.53821 0.33790 0.10291  -0.02985 0.08326  204 GLU A OE1 
1847 O  OE2 . GLU A 204 ? 0.24707 0.50780 0.28312 0.06791  -0.04010 0.04090  204 GLU A OE2 
1848 N  N   . ARG A 205 ? 0.15314 0.24811 0.21508 -0.00412 0.02617  0.00754  205 ARG A N   
1849 C  CA  . ARG A 205 ? 0.17362 0.26958 0.20450 -0.02285 0.02374  -0.00313 205 ARG A CA  
1850 C  C   . ARG A 205 ? 0.17025 0.26274 0.18756 -0.02146 0.02654  -0.00156 205 ARG A C   
1851 O  O   . ARG A 205 ? 0.20831 0.27618 0.18565 -0.02689 0.04444  -0.00721 205 ARG A O   
1852 C  CB  . ARG A 205 ? 0.22190 0.31196 0.23797 -0.05177 0.01391  -0.02045 205 ARG A CB  
1853 C  CG  . ARG A 205 ? 0.28116 0.35122 0.31861 -0.06616 0.01820  -0.02623 205 ARG A CG  
1854 C  CD  . ARG A 205 ? 0.35114 0.38990 0.41428 -0.05706 0.03951  -0.00754 205 ARG A CD  
1855 N  NE  . ARG A 205 ? 0.40295 0.41853 0.46825 -0.07681 -0.01065 0.01097  205 ARG A NE  
1856 C  CZ  . ARG A 205 ? 0.39252 0.39152 0.41137 -0.03910 0.01107  -0.00542 205 ARG A CZ  
1857 N  NH1 . ARG A 205 ? 0.44612 0.40594 0.39652 -0.00882 0.03062  -0.01144 205 ARG A NH1 
1858 N  NH2 . ARG A 205 ? 0.36013 0.37856 0.33737 -0.00995 0.01679  -0.01711 205 ARG A NH2 
1859 N  N   . LEU A 206 ? 0.15707 0.25427 0.17970 -0.02067 0.00738  0.00136  206 LEU A N   
1860 C  CA  . LEU A 206 ? 0.15717 0.25313 0.17801 -0.01951 0.00984  0.00447  206 LEU A CA  
1861 C  C   . LEU A 206 ? 0.15785 0.27717 0.20239 -0.02351 0.00975  0.01638  206 LEU A C   
1862 O  O   . LEU A 206 ? 0.16392 0.28823 0.23529 -0.00997 0.01022  0.01949  206 LEU A O   
1863 C  CB  . LEU A 206 ? 0.15106 0.24780 0.16854 -0.01468 0.00055  0.00443  206 LEU A CB  
1864 C  CG  . LEU A 206 ? 0.15435 0.25761 0.16195 -0.01321 -0.00014 0.01271  206 LEU A CG  
1865 C  CD1 . LEU A 206 ? 0.16450 0.25302 0.17767 -0.02100 0.00771  -0.00434 206 LEU A CD1 
1866 C  CD2 . LEU A 206 ? 0.16861 0.29746 0.17761 0.00106  0.00333  0.03610  206 LEU A CD2 
1867 N  N   A GLU A 207 ? 0.15117 0.29392 0.21446 -0.03053 0.01355  0.01856  207 GLU A N   
1868 N  N   B GLU A 207 ? 0.16024 0.29628 0.19246 -0.03343 0.01628  0.01632  207 GLU A N   
1869 C  CA  A GLU A 207 ? 0.16215 0.33924 0.23378 -0.03711 0.02046  0.03045  207 GLU A CA  
1870 C  CA  B GLU A 207 ? 0.16348 0.33647 0.20482 -0.04587 0.02073  0.02017  207 GLU A CA  
1871 C  C   A GLU A 207 ? 0.15537 0.35860 0.23215 -0.01017 0.02595  0.03213  207 GLU A C   
1872 C  C   B GLU A 207 ? 0.17590 0.35557 0.22292 -0.02407 0.02021  0.02513  207 GLU A C   
1873 O  O   A GLU A 207 ? 0.15567 0.39355 0.25468 0.00572  0.02870  0.04581  207 GLU A O   
1874 O  O   B GLU A 207 ? 0.20492 0.38312 0.27532 -0.00112 0.01918  0.03682  207 GLU A O   
1875 C  CB  A GLU A 207 ? 0.20465 0.38185 0.25760 -0.05213 0.02129  0.04505  207 GLU A CB  
1876 C  CB  B GLU A 207 ? 0.16016 0.36730 0.22095 -0.07307 0.01943  0.02176  207 GLU A CB  
1877 C  CG  A GLU A 207 ? 0.21741 0.45098 0.29199 -0.03287 0.03907  0.03666  207 GLU A CG  
1878 C  CG  B GLU A 207 ? 0.17497 0.41804 0.26404 -0.09527 -0.00075 0.02722  207 GLU A CG  
1879 C  CD  A GLU A 207 ? 0.21722 0.53869 0.38242 -0.01190 0.06362  0.00504  207 GLU A CD  
1880 C  CD  B GLU A 207 ? 0.25932 0.50212 0.35860 -0.11244 0.03111  0.07221  207 GLU A CD  
1881 O  OE1 A GLU A 207 ? 0.23594 0.63179 0.43891 0.01028  0.06935  -0.00838 207 GLU A OE1 
1882 O  OE1 B GLU A 207 ? 0.34164 0.56223 0.35476 -0.13533 0.03321  0.15559  207 GLU A OE1 
1883 O  OE2 A GLU A 207 ? 0.19106 0.57345 0.38512 0.02202  0.05257  -0.02328 207 GLU A OE2 
1884 O  OE2 B GLU A 207 ? 0.24986 0.56369 0.46058 -0.12601 0.07134  0.04952  207 GLU A OE2 
1885 N  N   . ARG A 208 ? 0.16928 0.35375 0.20825 -0.02581 0.01433  0.02762  208 ARG A N   
1886 C  CA  . ARG A 208 ? 0.18314 0.37327 0.21152 -0.04260 -0.00183 0.02814  208 ARG A CA  
1887 C  C   . ARG A 208 ? 0.16628 0.34409 0.20216 -0.01341 -0.00073 0.03032  208 ARG A C   
1888 O  O   . ARG A 208 ? 0.17426 0.32791 0.21265 -0.00622 -0.00067 0.02178  208 ARG A O   
1889 C  CB  . ARG A 208 ? 0.22164 0.42532 0.25636 -0.08780 0.00099  0.01796  208 ARG A CB  
1890 C  CG  . ARG A 208 ? 0.28734 0.47955 0.33198 -0.12885 0.02470  0.00787  208 ARG A CG  
1891 C  CD  . ARG A 208 ? 0.38846 0.52066 0.44552 -0.17229 0.05194  0.00156  208 ARG A CD  
1892 N  NE  . ARG A 208 ? 0.41908 0.60527 0.57035 -0.18581 0.05973  0.02036  208 ARG A NE  
1893 C  CZ  . ARG A 208 ? 0.36102 0.68954 0.71613 -0.15298 0.01915  0.04180  208 ARG A CZ  
1894 N  NH1 . ARG A 208 ? 0.32309 0.70156 0.85708 -0.10119 -0.08619 -0.01672 208 ARG A NH1 
1895 N  NH2 . ARG A 208 ? 0.37270 0.76140 0.76947 -0.19265 0.03601  0.06671  208 ARG A NH2 
1896 N  N   . PRO A 209 ? 0.16707 0.32892 0.20535 -0.00259 0.01632  0.02661  209 PRO A N   
1897 C  CA  . PRO A 209 ? 0.16584 0.30381 0.21408 -0.01141 0.01129  0.02264  209 PRO A CA  
1898 C  C   . PRO A 209 ? 0.15692 0.29355 0.20949 -0.00335 0.01060  0.02145  209 PRO A C   
1899 O  O   . PRO A 209 ? 0.15307 0.28652 0.21005 -0.01388 0.01123  0.01460  209 PRO A O   
1900 C  CB  . PRO A 209 ? 0.19876 0.31161 0.26044 -0.00829 0.02299  0.01371  209 PRO A CB  
1901 C  CG  . PRO A 209 ? 0.26903 0.32483 0.31688 0.00141  0.08153  0.02004  209 PRO A CG  
1902 C  CD  . PRO A 209 ? 0.20992 0.34171 0.25885 0.00909  0.04959  0.01908  209 PRO A CD  
1903 N  N   . GLU A 210 ? 0.15586 0.31915 0.20982 0.01696  -0.00092 0.03465  210 GLU A N   
1904 C  CA  . GLU A 210 ? 0.16273 0.36738 0.20825 0.02018  -0.02534 0.03574  210 GLU A CA  
1905 C  C   . GLU A 210 ? 0.16261 0.35188 0.18904 0.00165  -0.01675 0.02194  210 GLU A C   
1906 O  O   . GLU A 210 ? 0.20011 0.38775 0.18559 0.01208  -0.00769 0.03224  210 GLU A O   
1907 C  CB  . GLU A 210 ? 0.19293 0.45117 0.26451 0.02730  -0.05109 0.03984  210 GLU A CB  
1908 C  CG  . GLU A 210 ? 0.21234 0.52877 0.37982 -0.00548 -0.05916 0.03853  210 GLU A CG  
1909 C  CD  . GLU A 210 ? 0.23686 0.64832 0.45242 -0.07161 -0.05084 0.03123  210 GLU A CD  
1910 O  OE1 . GLU A 210 ? 0.19553 0.66990 0.37469 -0.03378 -0.02780 -0.00130 210 GLU A OE1 
1911 O  OE2 . GLU A 210 ? 0.33889 0.74020 0.59668 -0.17414 -0.06502 0.06686  210 GLU A OE2 
1912 N  N   . LEU A 211 ? 0.13864 0.31503 0.18594 -0.01606 -0.01615 0.01169  211 LEU A N   
1913 C  CA  . LEU A 211 ? 0.13103 0.29794 0.20041 -0.04009 -0.01243 0.00723  211 LEU A CA  
1914 C  C   . LEU A 211 ? 0.12826 0.26701 0.18659 -0.02984 -0.00680 -0.00517 211 LEU A C   
1915 O  O   . LEU A 211 ? 0.13743 0.27074 0.21817 -0.02383 -0.00439 -0.03378 211 LEU A O   
1916 C  CB  . LEU A 211 ? 0.16353 0.32874 0.24661 -0.06741 -0.01007 0.01539  211 LEU A CB  
1917 C  CG  . LEU A 211 ? 0.21739 0.40823 0.34277 -0.09655 -0.00496 0.01052  211 LEU A CG  
1918 C  CD1 . LEU A 211 ? 0.26856 0.39679 0.37820 -0.10231 0.03328  0.03093  211 LEU A CD1 
1919 C  CD2 . LEU A 211 ? 0.27947 0.49164 0.39467 -0.13133 -0.05490 -0.01746 211 LEU A CD2 
1920 N  N   . TYR A 212 ? 0.12085 0.24695 0.15672 -0.03058 -0.00822 0.01340  212 TYR A N   
1921 C  CA  . TYR A 212 ? 0.12837 0.23299 0.14778 -0.02732 -0.01618 0.01450  212 TYR A CA  
1922 C  C   . TYR A 212 ? 0.12064 0.21792 0.15655 -0.01141 -0.00650 0.01488  212 TYR A C   
1923 O  O   . TYR A 212 ? 0.13738 0.22909 0.17925 -0.00505 0.01057  0.01837  212 TYR A O   
1924 C  CB  . TYR A 212 ? 0.15858 0.24312 0.14000 -0.02702 -0.01049 0.01704  212 TYR A CB  
1925 C  CG  . TYR A 212 ? 0.17588 0.25759 0.13585 -0.03129 -0.00756 0.01173  212 TYR A CG  
1926 C  CD1 . TYR A 212 ? 0.16696 0.28484 0.15957 -0.03367 0.00597  0.01990  212 TYR A CD1 
1927 C  CD2 . TYR A 212 ? 0.19250 0.26843 0.13132 -0.03297 -0.01075 0.01158  212 TYR A CD2 
1928 C  CE1 . TYR A 212 ? 0.17175 0.28455 0.17556 -0.03136 -0.00260 0.03545  212 TYR A CE1 
1929 C  CE2 . TYR A 212 ? 0.20058 0.26884 0.13783 -0.03824 -0.01310 0.02018  212 TYR A CE2 
1930 C  CZ  . TYR A 212 ? 0.18458 0.27371 0.17082 -0.04423 -0.02528 0.03765  212 TYR A CZ  
1931 O  OH  . TYR A 212 ? 0.20139 0.29011 0.20378 -0.06921 -0.01488 0.04356  212 TYR A OH  
1932 N  N   . GLY A 213 ? 0.11625 0.21183 0.15555 -0.01965 -0.00174 0.01287  213 GLY A N   
1933 C  CA  . GLY A 213 ? 0.11928 0.21389 0.14940 -0.01699 -0.00957 0.01545  213 GLY A CA  
1934 C  C   . GLY A 213 ? 0.12259 0.19339 0.11274 -0.01495 -0.01817 0.01413  213 GLY A C   
1935 O  O   . GLY A 213 ? 0.12877 0.20376 0.12177 -0.01561 -0.01218 0.01822  213 GLY A O   
1936 N  N   . VAL A 214 ? 0.11696 0.20360 0.11182 -0.00773 -0.00859 0.01429  214 VAL A N   
1937 C  CA  . VAL A 214 ? 0.11739 0.19797 0.11912 -0.01580 -0.00790 0.00682  214 VAL A CA  
1938 C  C   . VAL A 214 ? 0.11864 0.20274 0.11083 -0.01942 -0.01383 0.00579  214 VAL A C   
1939 O  O   . VAL A 214 ? 0.12873 0.22937 0.12266 -0.00834 -0.01632 0.00238  214 VAL A O   
1940 C  CB  . VAL A 214 ? 0.14594 0.20332 0.12191 -0.01668 -0.01427 0.00640  214 VAL A CB  
1941 C  CG1 . VAL A 214 ? 0.22786 0.23552 0.13136 -0.00549 -0.00191 -0.00700 214 VAL A CG1 
1942 C  CG2 . VAL A 214 ? 0.15536 0.20176 0.14336 -0.01205 -0.00422 0.01574  214 VAL A CG2 
1943 N  N   . ASN A 215 ? 0.11138 0.19578 0.11653 -0.01374 -0.00099 0.00367  215 ASN A N   
1944 C  CA  . ASN A 215 ? 0.11602 0.18261 0.12524 -0.01898 -0.00391 -0.00448 215 ASN A CA  
1945 C  C   . ASN A 215 ? 0.11609 0.18325 0.11524 -0.01425 -0.01087 0.00469  215 ASN A C   
1946 O  O   . ASN A 215 ? 0.12732 0.20192 0.13829 -0.00929 -0.02385 0.01756  215 ASN A O   
1947 C  CB  . ASN A 215 ? 0.13287 0.19218 0.15218 -0.01127 -0.00719 -0.00220 215 ASN A CB  
1948 C  CG  . ASN A 215 ? 0.15638 0.20642 0.15881 -0.00151 -0.00860 -0.00771 215 ASN A CG  
1949 O  OD1 . ASN A 215 ? 0.21268 0.23894 0.14989 0.02821  -0.01255 -0.01442 215 ASN A OD1 
1950 N  ND2 . ASN A 215 ? 0.16219 0.21400 0.19039 0.00618  0.00446  0.00653  215 ASN A ND2 
1951 N  N   . PRO A 216 ? 0.11054 0.18624 0.10842 -0.01289 -0.00781 0.00476  216 PRO A N   
1952 C  CA  . PRO A 216 ? 0.11492 0.17962 0.10923 -0.01442 -0.00553 -0.00791 216 PRO A CA  
1953 C  C   . PRO A 216 ? 0.10873 0.17949 0.08893 -0.01571 -0.00837 -0.01297 216 PRO A C   
1954 O  O   . PRO A 216 ? 0.13483 0.22958 0.09944 -0.00380 -0.01580 -0.02983 216 PRO A O   
1955 C  CB  . PRO A 216 ? 0.12297 0.18502 0.14862 -0.00628 -0.01256 -0.00462 216 PRO A CB  
1956 C  CG  . PRO A 216 ? 0.13244 0.19379 0.16472 -0.02014 -0.01866 0.00877  216 PRO A CG  
1957 C  CD  . PRO A 216 ? 0.12129 0.19127 0.12929 -0.00684 -0.01699 0.01369  216 PRO A CD  
1958 N  N   . GLU A 217 ? 0.11031 0.17469 0.07833 -0.01039 -0.00304 -0.00695 217 GLU A N   
1959 C  CA  . GLU A 217 ? 0.11533 0.16256 0.08319 -0.00393 -0.00410 0.00084  217 GLU A CA  
1960 C  C   . GLU A 217 ? 0.11254 0.16495 0.07041 -0.00659 -0.00636 0.00060  217 GLU A C   
1961 O  O   . GLU A 217 ? 0.12376 0.17094 0.07026 -0.01575 -0.00673 -0.01088 217 GLU A O   
1962 C  CB  . GLU A 217 ? 0.12508 0.17175 0.08216 0.00325  -0.00885 -0.00539 217 GLU A CB  
1963 C  CG  . GLU A 217 ? 0.13424 0.17791 0.09639 0.01048  -0.00982 0.00085  217 GLU A CG  
1964 C  CD  . GLU A 217 ? 0.14201 0.18616 0.09419 0.01543  -0.01439 0.00273  217 GLU A CD  
1965 O  OE1 . GLU A 217 ? 0.16900 0.18727 0.14033 -0.01336 0.00023  0.00712  217 GLU A OE1 
1966 O  OE2 . GLU A 217 ? 0.13394 0.22339 0.08307 0.02719  -0.01803 0.00436  217 GLU A OE2 
1967 N  N   . VAL A 218 ? 0.11789 0.16555 0.06917 -0.01212 -0.00095 0.00497  218 VAL A N   
1968 C  CA  . VAL A 218 ? 0.12591 0.16301 0.06717 -0.01604 0.00407  -0.00184 218 VAL A CA  
1969 C  C   . VAL A 218 ? 0.11924 0.14630 0.06826 -0.00973 -0.01029 -0.00766 218 VAL A C   
1970 O  O   . VAL A 218 ? 0.13156 0.15689 0.08396 -0.01164 -0.00348 -0.01156 218 VAL A O   
1971 C  CB  . VAL A 218 ? 0.13638 0.17293 0.06741 -0.01804 -0.00039 0.00123  218 VAL A CB  
1972 C  CG1 . VAL A 218 ? 0.16109 0.19741 0.09117 -0.02865 0.00501  0.00246  218 VAL A CG1 
1973 C  CG2 . VAL A 218 ? 0.16303 0.18525 0.07911 0.00140  -0.01474 -0.00143 218 VAL A CG2 
1974 N  N   . GLY A 219 ? 0.11432 0.15726 0.07350 -0.00601 -0.00498 -0.00281 219 GLY A N   
1975 C  CA  . GLY A 219 ? 0.11545 0.18009 0.07735 -0.00454 -0.00734 -0.00550 219 GLY A CA  
1976 C  C   . GLY A 219 ? 0.11279 0.16457 0.07174 -0.00565 -0.00442 -0.00035 219 GLY A C   
1977 O  O   . GLY A 219 ? 0.12648 0.18506 0.07870 -0.01535 -0.01058 -0.01036 219 GLY A O   
1978 N  N   . HIS A 220 ? 0.11823 0.16454 0.06569 -0.01158 -0.00256 0.00182  220 HIS A N   
1979 C  CA  . HIS A 220 ? 0.12050 0.17383 0.06176 -0.00943 0.00896  -0.00084 220 HIS A CA  
1980 C  C   . HIS A 220 ? 0.12554 0.17011 0.06994 -0.00540 0.00161  0.00705  220 HIS A C   
1981 O  O   . HIS A 220 ? 0.14090 0.17127 0.06897 -0.01180 -0.00691 -0.00796 220 HIS A O   
1982 C  CB  . HIS A 220 ? 0.13321 0.17503 0.07725 -0.01781 0.00570  0.00494  220 HIS A CB  
1983 C  CG  . HIS A 220 ? 0.14677 0.16031 0.07474 -0.01677 -0.00714 0.00532  220 HIS A CG  
1984 N  ND1 . HIS A 220 ? 0.16620 0.16354 0.09547 -0.02889 -0.01566 0.00957  220 HIS A ND1 
1985 C  CD2 . HIS A 220 ? 0.16275 0.15990 0.09056 -0.00904 -0.00750 -0.00476 220 HIS A CD2 
1986 C  CE1 . HIS A 220 ? 0.16774 0.16296 0.09444 -0.03243 -0.01292 0.00556  220 HIS A CE1 
1987 N  NE2 . HIS A 220 ? 0.18677 0.16412 0.08490 -0.02805 -0.01631 -0.00266 220 HIS A NE2 
1988 N  N   . GLU A 221 ? 0.12478 0.15936 0.07083 -0.00771 -0.00605 0.00851  221 GLU A N   
1989 C  CA  . GLU A 221 ? 0.11853 0.16027 0.07573 -0.00059 -0.00722 0.01197  221 GLU A CA  
1990 C  C   . GLU A 221 ? 0.12460 0.15694 0.06951 0.00551  -0.00190 0.00744  221 GLU A C   
1991 O  O   . GLU A 221 ? 0.13187 0.16724 0.07852 -0.00203 -0.00538 -0.00462 221 GLU A O   
1992 C  CB  . GLU A 221 ? 0.11862 0.19122 0.08929 -0.00135 -0.01645 0.02154  221 GLU A CB  
1993 C  CG  . GLU A 221 ? 0.12853 0.21746 0.09456 -0.00086 0.00184  0.00563  221 GLU A CG  
1994 C  CD  . GLU A 221 ? 0.15655 0.23003 0.09297 0.00761  0.00123  0.00584  221 GLU A CD  
1995 O  OE1 . GLU A 221 ? 0.21512 0.22417 0.09644 0.02490  0.00328  0.01471  221 GLU A OE1 
1996 O  OE2 . GLU A 221 ? 0.20142 0.24773 0.11128 -0.01556 -0.00198 0.01340  221 GLU A OE2 
1997 N  N   . GLN A 222 ? 0.12470 0.15481 0.07267 -0.00546 0.00446  0.00770  222 GLN A N   
1998 C  CA  . GLN A 222 ? 0.12336 0.16286 0.08204 -0.01016 0.01031  -0.00151 222 GLN A CA  
1999 C  C   . GLN A 222 ? 0.13016 0.15729 0.08509 -0.01322 -0.00389 -0.00715 222 GLN A C   
2000 O  O   . GLN A 222 ? 0.13864 0.17403 0.09386 -0.02138 -0.00191 -0.00241 222 GLN A O   
2001 C  CB  . GLN A 222 ? 0.14500 0.16912 0.08308 -0.00038 0.01130  -0.00262 222 GLN A CB  
2002 C  CG  . GLN A 222 ? 0.16621 0.17979 0.08873 0.00774  0.01192  0.00461  222 GLN A CG  
2003 C  CD  . GLN A 222 ? 0.18018 0.19611 0.09226 0.00466  0.00959  0.00248  222 GLN A CD  
2004 O  OE1 . GLN A 222 ? 0.18840 0.22080 0.09953 0.03195  0.01079  -0.00868 222 GLN A OE1 
2005 N  NE2 . GLN A 222 ? 0.19701 0.20876 0.09899 0.01060  0.00171  0.01667  222 GLN A NE2 
2006 N  N   . MET A 223 ? 0.12685 0.15179 0.09228 -0.00323 -0.02165 0.00343  223 MET A N   
2007 C  CA  . MET A 223 ? 0.14147 0.15750 0.09960 -0.00350 -0.03179 0.00657  223 MET A CA  
2008 C  C   . MET A 223 ? 0.15277 0.15946 0.10211 -0.00142 -0.04043 0.00595  223 MET A C   
2009 O  O   . MET A 223 ? 0.19245 0.17829 0.11702 0.00819  -0.05942 -0.00347 223 MET A O   
2010 C  CB  . MET A 223 ? 0.14867 0.16606 0.10666 0.00970  -0.01255 0.00386  223 MET A CB  
2011 C  CG  . MET A 223 ? 0.16526 0.17771 0.10378 0.00905  -0.02026 0.00686  223 MET A CG  
2012 S  SD  . MET A 223 ? 0.19313 0.16438 0.13239 -0.01710 -0.05843 0.00515  223 MET A SD  
2013 C  CE  . MET A 223 ? 0.19005 0.17594 0.11797 -0.01001 -0.03379 0.02689  223 MET A CE  
2014 N  N   . ALA A 224 ? 0.15679 0.15691 0.08035 0.00204  -0.01988 0.00979  224 ALA A N   
2015 C  CA  . ALA A 224 ? 0.19014 0.16789 0.07954 -0.00014 -0.00373 0.00362  224 ALA A CA  
2016 C  C   . ALA A 224 ? 0.18599 0.16221 0.07646 0.00392  -0.01356 0.00600  224 ALA A C   
2017 O  O   . ALA A 224 ? 0.23053 0.17007 0.08411 -0.00759 -0.00280 -0.00086 224 ALA A O   
2018 C  CB  . ALA A 224 ? 0.21763 0.19633 0.11285 -0.01128 0.01683  0.01082  224 ALA A CB  
2019 N  N   . GLY A 225 ? 0.14569 0.15733 0.08142 -0.00229 -0.02132 0.00692  225 GLY A N   
2020 C  CA  . GLY A 225 ? 0.14756 0.15727 0.10035 -0.00207 -0.01881 0.01798  225 GLY A CA  
2021 C  C   . GLY A 225 ? 0.14370 0.15517 0.09079 -0.00419 -0.01390 0.00821  225 GLY A C   
2022 O  O   . GLY A 225 ? 0.16932 0.16405 0.12281 -0.01371 -0.00782 0.02315  225 GLY A O   
2023 N  N   . LEU A 226 ? 0.13481 0.16249 0.07212 0.00611  -0.01255 0.00380  226 LEU A N   
2024 C  CA  . LEU A 226 ? 0.13551 0.16945 0.07916 0.00690  -0.00551 0.01119  226 LEU A CA  
2025 C  C   . LEU A 226 ? 0.14341 0.15747 0.07753 0.00910  -0.00351 0.00374  226 LEU A C   
2026 O  O   . LEU A 226 ? 0.17092 0.18721 0.08497 0.03095  -0.00797 -0.00042 226 LEU A O   
2027 C  CB  . LEU A 226 ? 0.14023 0.19091 0.09194 0.00136  0.00432  0.02269  226 LEU A CB  
2028 C  CG  . LEU A 226 ? 0.17676 0.20660 0.10562 -0.00101 0.02615  0.02228  226 LEU A CG  
2029 C  CD1 . LEU A 226 ? 0.20028 0.24963 0.14113 -0.02465 0.03768  0.02044  226 LEU A CD1 
2030 C  CD2 . LEU A 226 ? 0.23606 0.21911 0.11028 0.01159  0.02890  -0.00121 226 LEU A CD2 
2031 N  N   . ASN A 227 ? 0.13355 0.16283 0.07278 0.00448  -0.01266 0.00490  227 ASN A N   
2032 C  CA  . ASN A 227 ? 0.13428 0.15730 0.07570 0.00201  -0.01514 0.00606  227 ASN A CA  
2033 C  C   . ASN A 227 ? 0.12283 0.16480 0.07308 0.00989  -0.00469 0.00012  227 ASN A C   
2034 O  O   . ASN A 227 ? 0.13236 0.17737 0.08583 -0.00105 -0.00700 -0.01059 227 ASN A O   
2035 C  CB  . ASN A 227 ? 0.15573 0.16379 0.08757 0.00571  -0.01561 0.01034  227 ASN A CB  
2036 C  CG  . ASN A 227 ? 0.15601 0.17679 0.09124 -0.00794 -0.01167 0.00627  227 ASN A CG  
2037 O  OD1 . ASN A 227 ? 0.16091 0.19407 0.09290 -0.00151 -0.01561 0.00471  227 ASN A OD1 
2038 N  ND2 . ASN A 227 ? 0.19208 0.18875 0.10126 -0.01539 0.00124  0.01641  227 ASN A ND2 
2039 N  N   . PHE A 228 ? 0.12056 0.16288 0.07514 0.00095  -0.00339 -0.00151 228 PHE A N   
2040 C  CA  . PHE A 228 ? 0.12462 0.16115 0.08877 0.00524  -0.00783 -0.00596 228 PHE A CA  
2041 C  C   . PHE A 228 ? 0.13034 0.16567 0.08820 -0.00203 -0.00104 -0.00986 228 PHE A C   
2042 O  O   . PHE A 228 ? 0.12942 0.18025 0.10179 -0.00434 -0.00641 -0.00149 228 PHE A O   
2043 C  CB  . PHE A 228 ? 0.13008 0.16527 0.10145 0.00597  -0.00058 -0.00676 228 PHE A CB  
2044 C  CG  . PHE A 228 ? 0.12726 0.16990 0.08289 0.00054  -0.00429 0.00025  228 PHE A CG  
2045 C  CD1 . PHE A 228 ? 0.13857 0.17613 0.09404 -0.00499 -0.00166 0.00603  228 PHE A CD1 
2046 C  CD2 . PHE A 228 ? 0.14606 0.18313 0.09028 -0.00918 -0.00805 -0.01022 228 PHE A CD2 
2047 C  CE1 . PHE A 228 ? 0.13888 0.17866 0.11088 -0.00471 -0.00945 0.00692  228 PHE A CE1 
2048 C  CE2 . PHE A 228 ? 0.14879 0.18471 0.10411 -0.00825 -0.01228 0.00317  228 PHE A CE2 
2049 C  CZ  . PHE A 228 ? 0.14193 0.17731 0.11747 -0.00111 -0.00288 -0.00170 228 PHE A CZ  
2050 N  N   . PRO A 229 ? 0.12640 0.18284 0.07640 0.00529  -0.00481 -0.00082 229 PRO A N   
2051 C  CA  . PRO A 229 ? 0.14165 0.20260 0.08247 0.01168  -0.00281 0.00441  229 PRO A CA  
2052 C  C   . PRO A 229 ? 0.13328 0.19217 0.07811 0.00468  -0.01457 0.00874  229 PRO A C   
2053 O  O   . PRO A 229 ? 0.13984 0.20647 0.09380 0.00841  -0.01732 -0.00266 229 PRO A O   
2054 C  CB  . PRO A 229 ? 0.17619 0.22480 0.08876 0.02006  0.01055  0.01212  229 PRO A CB  
2055 C  CG  . PRO A 229 ? 0.18327 0.22740 0.09124 0.01515  0.00796  0.01654  229 PRO A CG  
2056 C  CD  . PRO A 229 ? 0.15265 0.20809 0.07433 0.00348  0.01720  0.01041  229 PRO A CD  
2057 N  N   . HIS A 230 ? 0.13539 0.17856 0.08127 0.00488  -0.00872 -0.00028 230 HIS A N   
2058 C  CA  . HIS A 230 ? 0.13623 0.17470 0.09556 0.00728  -0.00834 0.00111  230 HIS A CA  
2059 C  C   . HIS A 230 ? 0.12857 0.18169 0.09092 0.00764  -0.01591 -0.00239 230 HIS A C   
2060 O  O   . HIS A 230 ? 0.13689 0.20244 0.12633 0.00976  -0.01146 -0.00167 230 HIS A O   
2061 C  CB  . HIS A 230 ? 0.14819 0.17543 0.09923 -0.00093 -0.01349 0.00039  230 HIS A CB  
2062 C  CG  . HIS A 230 ? 0.14080 0.17499 0.10632 0.00485  -0.01941 0.01178  230 HIS A CG  
2063 N  ND1 . HIS A 230 ? 0.16645 0.17802 0.12960 -0.00333 -0.01974 0.00710  230 HIS A ND1 
2064 C  CD2 . HIS A 230 ? 0.15782 0.18962 0.13153 0.00424  0.00020  0.02074  230 HIS A CD2 
2065 C  CE1 . HIS A 230 ? 0.18673 0.18133 0.15070 -0.01396 -0.01700 0.01964  230 HIS A CE1 
2066 N  NE2 . HIS A 230 ? 0.17042 0.19771 0.14911 -0.00040 -0.01091 0.01773  230 HIS A NE2 
2067 N  N   . GLY A 231 ? 0.13818 0.18902 0.08270 -0.00290 -0.01060 0.00762  231 GLY A N   
2068 C  CA  . GLY A 231 ? 0.14101 0.19702 0.08834 -0.01064 -0.00292 0.01557  231 GLY A CA  
2069 C  C   . GLY A 231 ? 0.13353 0.18879 0.09329 -0.00052 -0.00709 0.02043  231 GLY A C   
2070 O  O   . GLY A 231 ? 0.14046 0.21606 0.10337 0.00110  -0.00585 0.01816  231 GLY A O   
2071 N  N   . ILE A 232 ? 0.13426 0.18087 0.09914 -0.00412 -0.01272 0.00825  232 ILE A N   
2072 C  CA  . ILE A 232 ? 0.12820 0.18938 0.10611 0.01071  -0.00841 -0.00801 232 ILE A CA  
2073 C  C   . ILE A 232 ? 0.13413 0.18892 0.09811 0.00018  -0.01221 -0.00459 232 ILE A C   
2074 O  O   . ILE A 232 ? 0.13567 0.20531 0.11705 -0.00328 -0.01648 -0.00220 232 ILE A O   
2075 C  CB  . ILE A 232 ? 0.14238 0.19800 0.12734 0.01205  -0.01099 -0.01808 232 ILE A CB  
2076 C  CG1 . ILE A 232 ? 0.15480 0.19500 0.16311 0.00788  0.01008  0.00686  232 ILE A CG1 
2077 C  CG2 . ILE A 232 ? 0.17020 0.23519 0.13812 0.01200  -0.02073 -0.02976 232 ILE A CG2 
2078 C  CD1 . ILE A 232 ? 0.17428 0.21137 0.20967 0.02062  0.02084  0.02870  232 ILE A CD1 
2079 N  N   . ALA A 233 ? 0.13624 0.18850 0.08916 0.00744  -0.00798 0.00252  233 ALA A N   
2080 C  CA  . ALA A 233 ? 0.13365 0.18976 0.10508 0.00900  -0.00450 0.01312  233 ALA A CA  
2081 C  C   . ALA A 233 ? 0.13809 0.18629 0.09817 0.00564  -0.01445 0.01135  233 ALA A C   
2082 O  O   . ALA A 233 ? 0.13967 0.21511 0.10713 0.01397  -0.01070 0.01129  233 ALA A O   
2083 C  CB  . ALA A 233 ? 0.15405 0.20312 0.11455 0.00512  0.00016  0.02708  233 ALA A CB  
2084 N  N   . GLN A 234 ? 0.13393 0.19213 0.08917 0.00993  -0.00639 0.00646  234 GLN A N   
2085 C  CA  . GLN A 234 ? 0.12827 0.19696 0.09393 0.00152  -0.00659 0.00544  234 GLN A CA  
2086 C  C   . GLN A 234 ? 0.12748 0.20216 0.09481 0.00474  -0.00529 0.00251  234 GLN A C   
2087 O  O   . GLN A 234 ? 0.12553 0.21970 0.11934 0.00626  -0.00587 0.00455  234 GLN A O   
2088 C  CB  . GLN A 234 ? 0.14434 0.20602 0.09507 0.00640  -0.01284 -0.00415 234 GLN A CB  
2089 C  CG  . GLN A 234 ? 0.15652 0.21801 0.10503 0.00693  -0.00446 -0.00373 234 GLN A CG  
2090 C  CD  . GLN A 234 ? 0.14867 0.22425 0.10733 -0.00105 -0.00728 0.00603  234 GLN A CD  
2091 O  OE1 . GLN A 234 ? 0.15669 0.24299 0.11337 -0.00339 -0.00317 -0.00509 234 GLN A OE1 
2092 N  NE2 . GLN A 234 ? 0.16557 0.24705 0.09787 0.00127  0.00458  0.00321  234 GLN A NE2 
2093 N  N   . ALA A 235 ? 0.13931 0.19377 0.09659 -0.00256 -0.01479 0.00895  235 ALA A N   
2094 C  CA  . ALA A 235 ? 0.13305 0.19601 0.11889 -0.00142 -0.02221 0.00983  235 ALA A CA  
2095 C  C   . ALA A 235 ? 0.13397 0.20011 0.11464 -0.00790 -0.01177 0.01109  235 ALA A C   
2096 O  O   . ALA A 235 ? 0.14070 0.22718 0.13684 -0.02046 -0.01154 0.01849  235 ALA A O   
2097 C  CB  . ALA A 235 ? 0.15900 0.20466 0.13433 0.00817  -0.02298 0.01607  235 ALA A CB  
2098 N  N   . LEU A 236 ? 0.13750 0.20274 0.10531 -0.00378 -0.01674 0.00253  236 LEU A N   
2099 C  CA  . LEU A 236 ? 0.14123 0.22597 0.11174 -0.00073 -0.02431 0.00972  236 LEU A CA  
2100 C  C   . LEU A 236 ? 0.14471 0.23534 0.12461 0.00439  -0.03017 0.00587  236 LEU A C   
2101 O  O   . LEU A 236 ? 0.14475 0.24944 0.14891 -0.00156 -0.03822 -0.00152 236 LEU A O   
2102 C  CB  . LEU A 236 ? 0.16568 0.23156 0.11495 0.00007  -0.01764 0.01164  236 LEU A CB  
2103 C  CG  . LEU A 236 ? 0.18513 0.25766 0.11983 -0.00275 -0.01224 -0.00075 236 LEU A CG  
2104 C  CD1 . LEU A 236 ? 0.19746 0.30565 0.12528 -0.00956 0.00366  -0.00196 236 LEU A CD1 
2105 C  CD2 . LEU A 236 ? 0.21413 0.26140 0.14207 -0.01396 -0.01861 -0.01565 236 LEU A CD2 
2106 N  N   . TRP A 237 ? 0.14475 0.22535 0.12902 0.01155  -0.02307 0.00740  237 TRP A N   
2107 C  CA  . TRP A 237 ? 0.13747 0.22132 0.15903 0.01552  -0.02194 0.01267  237 TRP A CA  
2108 C  C   . TRP A 237 ? 0.13801 0.22871 0.18954 0.02190  -0.01570 0.01114  237 TRP A C   
2109 O  O   . TRP A 237 ? 0.13821 0.25987 0.24919 0.02519  -0.01440 0.01909  237 TRP A O   
2110 C  CB  . TRP A 237 ? 0.15028 0.21821 0.16131 0.01638  -0.01477 0.00918  237 TRP A CB  
2111 C  CG  . TRP A 237 ? 0.15127 0.21611 0.16111 0.01806  -0.01431 0.01343  237 TRP A CG  
2112 C  CD1 . TRP A 237 ? 0.17148 0.22783 0.17078 0.02325  -0.00426 0.01834  237 TRP A CD1 
2113 C  CD2 . TRP A 237 ? 0.16220 0.22501 0.16292 0.01230  -0.00803 0.01573  237 TRP A CD2 
2114 N  NE1 . TRP A 237 ? 0.17743 0.22758 0.19929 0.02699  -0.00102 0.01572  237 TRP A NE1 
2115 C  CE2 . TRP A 237 ? 0.16851 0.22747 0.18982 0.02059  0.00073  0.00668  237 TRP A CE2 
2116 C  CE3 . TRP A 237 ? 0.20428 0.25370 0.15849 0.01654  0.00023  0.01945  237 TRP A CE3 
2117 C  CZ2 . TRP A 237 ? 0.20151 0.25310 0.20568 0.02258  0.01921  -0.01079 237 TRP A CZ2 
2118 C  CZ3 . TRP A 237 ? 0.24242 0.28322 0.17804 0.01511  0.01004  0.00310  237 TRP A CZ3 
2119 C  CH2 . TRP A 237 ? 0.23881 0.27976 0.19524 0.01895  0.01817  -0.01593 237 TRP A CH2 
2120 N  N   . ALA A 238 ? 0.15257 0.22567 0.17397 0.01564  0.00965  0.01446  238 ALA A N   
2121 C  CA  . ALA A 238 ? 0.16933 0.24870 0.18286 -0.00294 0.01073  0.01239  238 ALA A CA  
2122 C  C   . ALA A 238 ? 0.14835 0.25957 0.20233 0.00063  0.00324  0.01716  238 ALA A C   
2123 O  O   . ALA A 238 ? 0.16762 0.30242 0.22637 -0.01702 0.01586  0.01936  238 ALA A O   
2124 C  CB  . ALA A 238 ? 0.21412 0.28049 0.17139 -0.02460 0.01307  0.00495  238 ALA A CB  
2125 N  N   . GLY A 239 ? 0.14444 0.23996 0.19286 0.00201  -0.02626 0.01585  239 GLY A N   
2126 C  CA  . GLY A 239 ? 0.14283 0.24291 0.19507 -0.01005 -0.03604 0.02472  239 GLY A CA  
2127 C  C   . GLY A 239 ? 0.14100 0.23683 0.18446 -0.01873 -0.03696 0.02812  239 GLY A C   
2128 O  O   . GLY A 239 ? 0.15805 0.25185 0.23856 -0.02618 -0.05603 0.03715  239 GLY A O   
2129 N  N   . LYS A 240 ? 0.13463 0.22354 0.13950 -0.01010 -0.02603 0.02937  240 LYS A N   
2130 C  CA  . LYS A 240 ? 0.14508 0.23304 0.13556 -0.00499 -0.02283 0.02921  240 LYS A CA  
2131 C  C   . LYS A 240 ? 0.13696 0.22776 0.12913 -0.01068 -0.03197 0.02465  240 LYS A C   
2132 O  O   . LYS A 240 ? 0.15868 0.24784 0.13828 0.00595  -0.02345 0.03596  240 LYS A O   
2133 C  CB  . LYS A 240 ? 0.17202 0.26571 0.14256 0.00026  -0.01031 0.02179  240 LYS A CB  
2134 C  CG  . LYS A 240 ? 0.19541 0.29617 0.18926 0.00708  0.01184  0.03406  240 LYS A CG  
2135 C  CD  . LYS A 240 ? 0.20103 0.30342 0.26626 0.01485  0.02354  0.04513  240 LYS A CD  
2136 C  CE  . LYS A 240 ? 0.20582 0.30080 0.27875 0.01074  0.02723  0.06147  240 LYS A CE  
2137 N  NZ  . LYS A 240 ? 0.18782 0.29818 0.26392 -0.00071 0.02810  0.06140  240 LYS A NZ  
2138 N  N   . LEU A 241 ? 0.14677 0.21965 0.12755 -0.00471 -0.02203 0.01501  241 LEU A N   
2139 C  CA  . LEU A 241 ? 0.14562 0.21819 0.13217 -0.00789 -0.02649 0.01077  241 LEU A CA  
2140 C  C   . LEU A 241 ? 0.15102 0.22610 0.14327 -0.01372 -0.03520 0.01151  241 LEU A C   
2141 O  O   . LEU A 241 ? 0.22653 0.25254 0.16353 -0.04540 -0.07282 0.01725  241 LEU A O   
2142 C  CB  . LEU A 241 ? 0.15783 0.22356 0.13707 -0.00545 -0.01567 0.01138  241 LEU A CB  
2143 C  CG  . LEU A 241 ? 0.16148 0.23298 0.14760 -0.01301 -0.01004 0.00885  241 LEU A CG  
2144 C  CD1 . LEU A 241 ? 0.16451 0.26879 0.17242 -0.00955 -0.02077 0.00654  241 LEU A CD1 
2145 C  CD2 . LEU A 241 ? 0.19261 0.26167 0.16139 -0.01807 -0.00015 0.01082  241 LEU A CD2 
2146 N  N   . PHE A 242 ? 0.13836 0.21040 0.14759 -0.00587 -0.02059 0.00469  242 PHE A N   
2147 C  CA  . PHE A 242 ? 0.14929 0.21808 0.17493 -0.01555 -0.01194 -0.00159 242 PHE A CA  
2148 C  C   . PHE A 242 ? 0.14540 0.22870 0.19180 -0.01837 -0.02354 -0.02560 242 PHE A C   
2149 O  O   . PHE A 242 ? 0.16390 0.25927 0.24112 -0.02036 -0.03650 -0.05385 242 PHE A O   
2150 C  CB  . PHE A 242 ? 0.15571 0.23401 0.19206 -0.02288 -0.00068 0.01480  242 PHE A CB  
2151 C  CG  . PHE A 242 ? 0.15530 0.24422 0.18635 -0.03318 -0.01829 0.01603  242 PHE A CG  
2152 C  CD1 . PHE A 242 ? 0.14530 0.26695 0.21013 -0.02058 -0.00840 0.00833  242 PHE A CD1 
2153 C  CD2 . PHE A 242 ? 0.18495 0.26088 0.17694 -0.05203 -0.01358 0.00571  242 PHE A CD2 
2154 C  CE1 . PHE A 242 ? 0.15504 0.28734 0.22841 -0.02227 -0.00036 -0.00694 242 PHE A CE1 
2155 C  CE2 . PHE A 242 ? 0.18629 0.30406 0.18196 -0.05508 -0.00486 -0.01361 242 PHE A CE2 
2156 C  CZ  . PHE A 242 ? 0.16564 0.31001 0.21496 -0.03048 -0.00527 -0.02334 242 PHE A CZ  
2157 N  N   . HIS A 243 ? 0.13242 0.21457 0.16506 -0.01450 -0.01026 -0.01208 243 HIS A N   
2158 C  CA  . HIS A 243 ? 0.13627 0.20224 0.14849 -0.02080 -0.00870 -0.01344 243 HIS A CA  
2159 C  C   . HIS A 243 ? 0.13529 0.20418 0.12385 -0.01432 -0.01243 -0.01101 243 HIS A C   
2160 O  O   . HIS A 243 ? 0.14020 0.21968 0.13751 -0.01803 -0.01661 -0.02975 243 HIS A O   
2161 C  CB  . HIS A 243 ? 0.15458 0.21281 0.16597 -0.01353 0.00160  -0.00468 243 HIS A CB  
2162 C  CG  . HIS A 243 ? 0.16229 0.21221 0.16153 -0.01390 0.00292  -0.00542 243 HIS A CG  
2163 N  ND1 . HIS A 243 ? 0.16813 0.21248 0.15738 -0.00588 0.01415  0.00039  243 HIS A ND1 
2164 C  CD2 . HIS A 243 ? 0.18564 0.21477 0.19049 -0.01501 -0.00095 -0.01462 243 HIS A CD2 
2165 C  CE1 . HIS A 243 ? 0.17840 0.22005 0.17635 -0.01185 0.01358  -0.00977 243 HIS A CE1 
2166 N  NE2 . HIS A 243 ? 0.20221 0.21581 0.19481 -0.02039 0.00610  -0.01355 243 HIS A NE2 
2167 N  N   . ILE A 244 ? 0.13055 0.20535 0.12858 -0.02952 -0.01320 -0.01111 244 ILE A N   
2168 C  CA  . ILE A 244 ? 0.13692 0.19813 0.11614 -0.02700 -0.01131 -0.01776 244 ILE A CA  
2169 C  C   . ILE A 244 ? 0.14008 0.19962 0.11565 -0.01436 -0.01768 -0.03120 244 ILE A C   
2170 O  O   . ILE A 244 ? 0.16241 0.22682 0.16198 -0.00174 -0.03298 -0.06304 244 ILE A O   
2171 C  CB  . ILE A 244 ? 0.15892 0.21798 0.10833 -0.03509 -0.01852 -0.00667 244 ILE A CB  
2172 C  CG1 . ILE A 244 ? 0.17507 0.22631 0.13860 -0.04088 -0.02358 0.00727  244 ILE A CG1 
2173 C  CG2 . ILE A 244 ? 0.19799 0.26639 0.11080 -0.04667 -0.02416 -0.00614 244 ILE A CG2 
2174 C  CD1 . ILE A 244 ? 0.20562 0.23364 0.15916 -0.02973 -0.01980 0.01724  244 ILE A CD1 
2175 N  N   . ASP A 245 ? 0.12773 0.19047 0.10184 -0.01677 -0.00681 -0.02090 245 ASP A N   
2176 C  CA  . ASP A 245 ? 0.13395 0.17966 0.10836 -0.01649 -0.01355 -0.00655 245 ASP A CA  
2177 C  C   . ASP A 245 ? 0.13427 0.17485 0.10182 -0.02009 -0.01258 -0.02185 245 ASP A C   
2178 O  O   . ASP A 245 ? 0.16391 0.19352 0.10594 -0.03203 0.00631  -0.03827 245 ASP A O   
2179 C  CB  . ASP A 245 ? 0.16459 0.19006 0.11066 -0.02173 -0.01991 -0.00329 245 ASP A CB  
2180 C  CG  . ASP A 245 ? 0.17592 0.20177 0.11148 -0.00945 -0.02281 -0.00597 245 ASP A CG  
2181 O  OD1 . ASP A 245 ? 0.19482 0.20539 0.12962 -0.04210 -0.01294 -0.01238 245 ASP A OD1 
2182 O  OD2 . ASP A 245 ? 0.21196 0.23378 0.14124 -0.02153 -0.02970 0.01800  245 ASP A OD2 
2183 N  N   . LEU A 246 ? 0.13868 0.17178 0.09270 -0.01146 -0.01103 -0.02058 246 LEU A N   
2184 C  CA  . LEU A 246 ? 0.13832 0.18204 0.09324 -0.00972 -0.00282 -0.00886 246 LEU A CA  
2185 C  C   . LEU A 246 ? 0.13901 0.16871 0.09858 -0.01407 -0.00908 -0.02561 246 LEU A C   
2186 O  O   . LEU A 246 ? 0.14516 0.17896 0.14261 -0.00778 -0.02601 -0.03612 246 LEU A O   
2187 C  CB  . LEU A 246 ? 0.15089 0.18868 0.10189 -0.00493 -0.01396 -0.00713 246 LEU A CB  
2188 C  CG  . LEU A 246 ? 0.18262 0.21492 0.12538 0.00399  -0.03057 -0.00342 246 LEU A CG  
2189 C  CD1 . LEU A 246 ? 0.23081 0.27107 0.12765 0.02400  -0.05296 -0.00915 246 LEU A CD1 
2190 C  CD2 . LEU A 246 ? 0.19445 0.22617 0.19387 0.00956  -0.03489 -0.00658 246 LEU A CD2 
2191 N  N   . ASN A 247 ? 0.12885 0.16986 0.08109 -0.01813 -0.01258 -0.01289 247 ASN A N   
2192 C  CA  . ASN A 247 ? 0.13085 0.15419 0.08235 -0.01328 -0.00676 -0.00470 247 ASN A CA  
2193 C  C   . ASN A 247 ? 0.13808 0.15637 0.07400 -0.01087 -0.00584 -0.01438 247 ASN A C   
2194 O  O   . ASN A 247 ? 0.14398 0.16596 0.09543 -0.01779 -0.00828 -0.00289 247 ASN A O   
2195 C  CB  . ASN A 247 ? 0.14085 0.15563 0.08433 -0.00617 -0.00020 -0.00997 247 ASN A CB  
2196 C  CG  . ASN A 247 ? 0.14639 0.15737 0.08101 0.00065  -0.00356 -0.00645 247 ASN A CG  
2197 O  OD1 . ASN A 247 ? 0.17033 0.16663 0.07130 0.00282  -0.00191 -0.01293 247 ASN A OD1 
2198 N  ND2 . ASN A 247 ? 0.17986 0.16962 0.09252 0.00400  0.00310  0.00064  247 ASN A ND2 
2199 N  N   . GLY A 248 ? 0.13350 0.16910 0.07754 -0.02303 -0.01665 -0.01083 248 GLY A N   
2200 C  CA  . GLY A 248 ? 0.14927 0.17463 0.08263 -0.03242 -0.02527 -0.00221 248 GLY A CA  
2201 C  C   . GLY A 248 ? 0.14320 0.16135 0.07984 -0.01242 -0.01448 -0.00234 248 GLY A C   
2202 O  O   . GLY A 248 ? 0.17781 0.15504 0.08680 -0.01138 -0.02050 -0.00474 248 GLY A O   
2203 N  N   . GLN A 249 ? 0.13146 0.15192 0.07270 -0.01420 -0.02150 -0.01205 249 GLN A N   
2204 C  CA  . GLN A 249 ? 0.12516 0.16112 0.06682 -0.01448 -0.01220 -0.00613 249 GLN A CA  
2205 C  C   . GLN A 249 ? 0.12788 0.16307 0.07667 -0.00283 -0.01248 0.00299  249 GLN A C   
2206 O  O   . GLN A 249 ? 0.14616 0.17007 0.11054 -0.01185 -0.02182 0.00633  249 GLN A O   
2207 C  CB  . GLN A 249 ? 0.13210 0.17188 0.07262 -0.00084 -0.00380 -0.00117 249 GLN A CB  
2208 C  CG  . GLN A 249 ? 0.14224 0.16526 0.07327 0.00708  -0.01425 -0.00199 249 GLN A CG  
2209 C  CD  . GLN A 249 ? 0.13149 0.16533 0.07484 -0.01021 -0.01303 -0.00533 249 GLN A CD  
2210 O  OE1 . GLN A 249 ? 0.15195 0.16103 0.09568 -0.00798 -0.02267 0.00450  249 GLN A OE1 
2211 N  NE2 . GLN A 249 ? 0.15886 0.20551 0.08899 -0.01183 -0.02785 -0.00026 249 GLN A NE2 
2212 N  N   . ASN A 250 ? 0.13195 0.17734 0.10515 -0.01678 -0.02657 0.00986  250 ASN A N   
2213 C  CA  . ASN A 250 ? 0.15678 0.19565 0.15964 -0.03657 -0.03693 0.01738  250 ASN A CA  
2214 C  C   . ASN A 250 ? 0.22808 0.22705 0.14542 -0.05655 -0.09075 0.02423  250 ASN A C   
2215 O  O   . ASN A 250 ? 0.28375 0.29515 0.20380 -0.06573 -0.13081 0.04390  250 ASN A O   
2216 C  CB  . ASN A 250 ? 0.15833 0.21748 0.25968 -0.02190 -0.03646 0.00679  250 ASN A CB  
2217 C  CG  . ASN A 250 ? 0.19909 0.22907 0.30451 0.00252  -0.02692 -0.03013 250 ASN A CG  
2218 O  OD1 . ASN A 250 ? 0.28554 0.23959 0.38846 0.02440  -0.04712 -0.05081 250 ASN A OD1 
2219 N  ND2 . ASN A 250 ? 0.24962 0.24675 0.27126 -0.00049 0.01206  -0.01766 250 ASN A ND2 
2220 N  N   . GLY A 251 ? 0.29691 0.21513 0.11909 -0.04562 -0.06433 -0.00736 251 GLY A N   
2221 C  CA  . GLY A 251 ? 0.36744 0.21171 0.11751 -0.05090 -0.04495 -0.01201 251 GLY A CA  
2222 C  C   . GLY A 251 ? 0.30513 0.19920 0.11613 -0.04854 -0.04848 -0.01228 251 GLY A C   
2223 O  O   . GLY A 251 ? 0.28134 0.18913 0.13820 -0.03756 -0.06097 -0.01606 251 GLY A O   
2224 N  N   . ILE A 252 ? 0.24985 0.20703 0.10712 -0.05467 -0.02766 -0.02083 252 ILE A N   
2225 C  CA  . ILE A 252 ? 0.18360 0.20737 0.11088 -0.03633 -0.01244 -0.01298 252 ILE A CA  
2226 C  C   . ILE A 252 ? 0.15560 0.22124 0.11419 -0.02476 -0.01554 -0.02823 252 ILE A C   
2227 O  O   . ILE A 252 ? 0.15197 0.24937 0.15292 -0.02556 -0.01965 -0.05212 252 ILE A O   
2228 C  CB  . ILE A 252 ? 0.18574 0.20526 0.11779 -0.02099 -0.02125 -0.00629 252 ILE A CB  
2229 C  CG1 . ILE A 252 ? 0.22404 0.20783 0.15935 -0.00760 -0.04561 -0.00658 252 ILE A CG1 
2230 C  CG2 . ILE A 252 ? 0.18404 0.23867 0.11740 0.00579  -0.00368 0.00933  252 ILE A CG2 
2231 C  CD1 . ILE A 252 ? 0.22366 0.23232 0.18746 0.01972  -0.05426 -0.01229 252 ILE A CD1 
2232 N  N   . LYS A 253 ? 0.14696 0.21442 0.10202 -0.01287 -0.01008 -0.00839 253 LYS A N   
2233 C  CA  A LYS A 253 ? 0.13148 0.22928 0.11040 -0.00637 -0.00263 -0.00938 253 LYS A CA  
2234 C  CA  B LYS A 253 ? 0.15064 0.22334 0.11214 -0.00889 0.00316  -0.00373 253 LYS A CA  
2235 C  C   . LYS A 253 ? 0.13252 0.21506 0.09347 -0.00837 -0.01271 -0.01141 253 LYS A C   
2236 O  O   . LYS A 253 ? 0.12993 0.21096 0.13638 -0.00603 -0.01703 -0.01145 253 LYS A O   
2237 C  CB  A LYS A 253 ? 0.13781 0.25596 0.12518 -0.00300 -0.00472 -0.00196 253 LYS A CB  
2238 C  CB  B LYS A 253 ? 0.18638 0.23955 0.11939 -0.00148 0.02711  0.00817  253 LYS A CB  
2239 C  CG  A LYS A 253 ? 0.14692 0.24794 0.13962 -0.03348 -0.02526 -0.01188 253 LYS A CG  
2240 C  CG  B LYS A 253 ? 0.23828 0.22844 0.11073 0.02480  0.04119  0.00718  253 LYS A CG  
2241 C  CD  A LYS A 253 ? 0.17862 0.27042 0.14217 -0.00911 -0.01587 -0.01771 253 LYS A CD  
2242 C  CD  B LYS A 253 ? 0.23515 0.22137 0.09069 0.04039  0.01789  -0.00046 253 LYS A CD  
2243 C  CE  A LYS A 253 ? 0.14973 0.28263 0.14381 0.01018  -0.01257 -0.02514 253 LYS A CE  
2244 C  CE  B LYS A 253 ? 0.20101 0.24693 0.09278 0.04980  -0.01757 -0.00685 253 LYS A CE  
2245 N  NZ  A LYS A 253 ? 0.17827 0.25388 0.15770 0.00356  0.00602  -0.00461 253 LYS A NZ  
2246 N  NZ  B LYS A 253 ? 0.16435 0.25336 0.10159 0.03466  -0.02496 0.00491  253 LYS A NZ  
2247 N  N   . TYR A 254 ? 0.14396 0.20893 0.07821 0.00506  -0.01066 -0.00638 254 TYR A N   
2248 C  CA  . TYR A 254 ? 0.13901 0.20668 0.08270 0.00926  -0.01700 0.00456  254 TYR A CA  
2249 C  C   . TYR A 254 ? 0.13596 0.18998 0.07209 0.00229  -0.00608 0.00728  254 TYR A C   
2250 O  O   . TYR A 254 ? 0.14595 0.19558 0.07706 -0.01602 -0.01340 0.00336  254 TYR A O   
2251 C  CB  . TYR A 254 ? 0.14599 0.21275 0.09749 0.00989  -0.01305 0.02139  254 TYR A CB  
2252 C  CG  . TYR A 254 ? 0.13932 0.19280 0.10567 -0.00189 -0.01225 0.01647  254 TYR A CG  
2253 C  CD1 . TYR A 254 ? 0.14175 0.19884 0.12793 -0.00583 -0.01062 0.00383  254 TYR A CD1 
2254 C  CD2 . TYR A 254 ? 0.14549 0.18875 0.12170 0.00553  -0.00625 0.00791  254 TYR A CD2 
2255 C  CE1 . TYR A 254 ? 0.14256 0.19867 0.13608 -0.00298 -0.00943 -0.00536 254 TYR A CE1 
2256 C  CE2 . TYR A 254 ? 0.14514 0.18933 0.13636 0.00314  -0.00076 0.00419  254 TYR A CE2 
2257 C  CZ  . TYR A 254 ? 0.14425 0.19257 0.13470 0.00367  0.00909  0.00449  254 TYR A CZ  
2258 O  OH  . TYR A 254 ? 0.17735 0.22080 0.15138 0.00064  0.03007  -0.00246 254 TYR A OH  
2259 N  N   . ASP A 255 ? 0.13379 0.18532 0.08025 0.00447  -0.00564 0.00361  255 ASP A N   
2260 C  CA  . ASP A 255 ? 0.13926 0.17776 0.09254 -0.00310 -0.00844 -0.00601 255 ASP A CA  
2261 C  C   . ASP A 255 ? 0.13810 0.16172 0.08926 -0.00190 -0.01501 0.00877  255 ASP A C   
2262 O  O   . ASP A 255 ? 0.17214 0.17246 0.10168 0.01038  0.01234  0.01358  255 ASP A O   
2263 C  CB  . ASP A 255 ? 0.13508 0.18121 0.11149 -0.00950 0.00022  0.00343  255 ASP A CB  
2264 C  CG  . ASP A 255 ? 0.14340 0.17381 0.14164 -0.00631 0.00423  0.00261  255 ASP A CG  
2265 O  OD1 . ASP A 255 ? 0.14056 0.18119 0.12295 -0.01328 -0.01344 0.00237  255 ASP A OD1 
2266 O  OD2 . ASP A 255 ? 0.15839 0.18513 0.17766 -0.02509 -0.00058 0.00767  255 ASP A OD2 
2267 N  N   . GLN A 256 ? 0.13194 0.16867 0.08835 -0.00086 -0.01116 -0.00053 256 GLN A N   
2268 C  CA  . GLN A 256 ? 0.14165 0.17426 0.08680 -0.00369 0.00113  -0.00394 256 GLN A CA  
2269 C  C   . GLN A 256 ? 0.14382 0.16633 0.09034 0.00648  -0.00511 -0.00369 256 GLN A C   
2270 O  O   . GLN A 256 ? 0.15987 0.18696 0.11523 0.01879  0.00529  -0.01303 256 GLN A O   
2271 C  CB  . GLN A 256 ? 0.14135 0.18588 0.08673 -0.01362 -0.00908 -0.00530 256 GLN A CB  
2272 C  CG  . GLN A 256 ? 0.13170 0.20540 0.11481 -0.01945 -0.01908 0.00481  256 GLN A CG  
2273 C  CD  . GLN A 256 ? 0.12781 0.20482 0.13655 -0.00191 -0.00982 0.01744  256 GLN A CD  
2274 O  OE1 . GLN A 256 ? 0.15895 0.20514 0.15322 0.01088  -0.00982 0.02930  256 GLN A OE1 
2275 N  NE2 . GLN A 256 ? 0.13618 0.23120 0.17714 0.00857  -0.00040 0.04012  256 GLN A NE2 
2276 N  N   . ASP A 257 ? 0.14516 0.15541 0.09208 -0.01528 -0.01366 -0.00518 257 ASP A N   
2277 C  CA  . ASP A 257 ? 0.14943 0.16307 0.10214 -0.02310 -0.00319 -0.01385 257 ASP A CA  
2278 C  C   . ASP A 257 ? 0.14887 0.16486 0.09420 -0.01395 -0.00100 -0.01423 257 ASP A C   
2279 O  O   . ASP A 257 ? 0.17470 0.17237 0.11262 -0.02012 0.00881  -0.03133 257 ASP A O   
2280 C  CB  . ASP A 257 ? 0.16863 0.17279 0.12342 -0.01806 0.01500  -0.00618 257 ASP A CB  
2281 C  CG  . ASP A 257 ? 0.17718 0.16826 0.13647 -0.01385 0.02177  -0.00011 257 ASP A CG  
2282 O  OD1 . ASP A 257 ? 0.15391 0.18731 0.12866 -0.01123 0.01940  0.00700  257 ASP A OD1 
2283 O  OD2 . ASP A 257 ? 0.24018 0.18210 0.18184 -0.00062 0.06332  0.00968  257 ASP A OD2 
2284 N  N   . LEU A 258 ? 0.14929 0.16868 0.08589 -0.01468 0.00137  -0.01082 258 LEU A N   
2285 C  CA  . LEU A 258 ? 0.14551 0.18833 0.08410 -0.02474 0.00136  -0.01872 258 LEU A CA  
2286 C  C   . LEU A 258 ? 0.13869 0.17579 0.08753 -0.00617 -0.00496 -0.01671 258 LEU A C   
2287 O  O   . LEU A 258 ? 0.14348 0.17925 0.10567 -0.00970 -0.00844 -0.02526 258 LEU A O   
2288 C  CB  . LEU A 258 ? 0.17463 0.23281 0.09563 -0.04913 -0.00429 -0.03284 258 LEU A CB  
2289 C  CG  . LEU A 258 ? 0.20200 0.30947 0.12536 -0.08316 -0.00794 -0.03198 258 LEU A CG  
2290 C  CD1 . LEU A 258 ? 0.25035 0.33724 0.16530 -0.11925 -0.00627 -0.04308 258 LEU A CD1 
2291 C  CD2 . LEU A 258 ? 0.20336 0.36153 0.17269 -0.05511 -0.03115 -0.00558 258 LEU A CD2 
2292 N  N   . ARG A 259 ? 0.15422 0.18060 0.08791 -0.00337 -0.01065 -0.01569 259 ARG A N   
2293 C  CA  . ARG A 259 ? 0.17093 0.18707 0.09680 0.00936  -0.01591 -0.01922 259 ARG A CA  
2294 C  C   . ARG A 259 ? 0.16571 0.17547 0.09185 -0.00923 -0.01656 -0.01223 259 ARG A C   
2295 O  O   . ARG A 259 ? 0.17115 0.17762 0.10528 -0.01195 -0.02110 -0.00405 259 ARG A O   
2296 C  CB  . ARG A 259 ? 0.19897 0.20179 0.11361 0.00310  0.00622  -0.01941 259 ARG A CB  
2297 C  CG  . ARG A 259 ? 0.18697 0.20794 0.14446 0.00044  0.02037  -0.02311 259 ARG A CG  
2298 C  CD  . ARG A 259 ? 0.19169 0.21035 0.12855 -0.00468 0.01313  -0.02094 259 ARG A CD  
2299 N  NE  . ARG A 259 ? 0.19579 0.22407 0.12069 -0.01352 0.00699  -0.01962 259 ARG A NE  
2300 C  CZ  . ARG A 259 ? 0.17337 0.23600 0.10183 -0.01359 0.00472  -0.03011 259 ARG A CZ  
2301 N  NH1 . ARG A 259 ? 0.19425 0.24549 0.10645 -0.00930 0.00791  -0.01090 259 ARG A NH1 
2302 N  NH2 . ARG A 259 ? 0.18270 0.24815 0.12245 0.00083  0.00847  -0.01457 259 ARG A NH2 
2303 N  N   . PHE A 260 ? 0.17154 0.18164 0.09368 -0.00121 -0.01826 -0.00199 260 PHE A N   
2304 C  CA  . PHE A 260 ? 0.16248 0.18216 0.09492 -0.01230 -0.01896 -0.01251 260 PHE A CA  
2305 C  C   . PHE A 260 ? 0.16597 0.18945 0.09133 -0.00079 -0.02000 -0.00832 260 PHE A C   
2306 O  O   . PHE A 260 ? 0.18569 0.21662 0.08927 -0.00265 -0.00811 -0.01588 260 PHE A O   
2307 C  CB  . PHE A 260 ? 0.15693 0.19514 0.10888 -0.01061 -0.02464 -0.01693 260 PHE A CB  
2308 C  CG  . PHE A 260 ? 0.15771 0.19484 0.09913 -0.01033 -0.02138 -0.00848 260 PHE A CG  
2309 C  CD1 . PHE A 260 ? 0.16176 0.20234 0.10938 -0.00429 -0.01334 -0.00768 260 PHE A CD1 
2310 C  CD2 . PHE A 260 ? 0.19736 0.22214 0.10159 -0.01177 -0.03659 0.00026  260 PHE A CD2 
2311 C  CE1 . PHE A 260 ? 0.17798 0.19870 0.13066 0.00244  -0.02217 0.00048  260 PHE A CE1 
2312 C  CE2 . PHE A 260 ? 0.21639 0.22402 0.12146 -0.01464 -0.05073 0.01290  260 PHE A CE2 
2313 C  CZ  . PHE A 260 ? 0.21016 0.20850 0.14599 -0.00596 -0.04395 0.01335  260 PHE A CZ  
2314 N  N   . GLY A 261 ? 0.17381 0.18828 0.10089 -0.01114 -0.01580 0.00536  261 GLY A N   
2315 C  CA  . GLY A 261 ? 0.18548 0.20221 0.10272 -0.02017 -0.00878 0.00905  261 GLY A CA  
2316 C  C   . GLY A 261 ? 0.17853 0.19770 0.10686 -0.01776 -0.00448 -0.00061 261 GLY A C   
2317 O  O   . GLY A 261 ? 0.19347 0.21428 0.13409 -0.02919 -0.01045 0.01305  261 GLY A O   
2318 N  N   . ALA A 262 ? 0.16752 0.20058 0.11345 -0.00619 -0.00845 -0.01121 262 ALA A N   
2319 C  CA  . ALA A 262 ? 0.17315 0.19943 0.13316 -0.00360 -0.01111 -0.01062 262 ALA A CA  
2320 C  C   . ALA A 262 ? 0.14738 0.19721 0.10681 0.00370  0.00457  0.00011  262 ALA A C   
2321 O  O   . ALA A 262 ? 0.14543 0.23594 0.11807 0.00238  0.00147  0.00166  262 ALA A O   
2322 C  CB  . ALA A 262 ? 0.18817 0.21421 0.17056 0.00363  -0.01586 -0.01311 262 ALA A CB  
2323 N  N   . GLY A 263 ? 0.16134 0.19457 0.10830 0.00696  -0.00018 -0.00678 263 GLY A N   
2324 C  CA  . GLY A 263 ? 0.16200 0.19432 0.11195 0.01195  -0.00018 0.00255  263 GLY A CA  
2325 C  C   . GLY A 263 ? 0.14683 0.18254 0.10089 0.00066  0.00631  0.00976  263 GLY A C   
2326 O  O   . GLY A 263 ? 0.16101 0.20317 0.13351 0.00311  0.02751  0.02324  263 GLY A O   
2327 N  N   . ASP A 264 ? 0.14254 0.17892 0.08183 0.00497  -0.00182 0.00263  264 ASP A N   
2328 C  CA  . ASP A 264 ? 0.14249 0.17096 0.07938 0.00339  -0.00683 0.00062  264 ASP A CA  
2329 C  C   . ASP A 264 ? 0.13462 0.17315 0.08094 -0.00763 -0.00170 0.00488  264 ASP A C   
2330 O  O   . ASP A 264 ? 0.13918 0.18031 0.08230 -0.01411 -0.00633 0.00747  264 ASP A O   
2331 C  CB  . ASP A 264 ? 0.16193 0.18623 0.09142 0.00392  0.00053  -0.00914 264 ASP A CB  
2332 C  CG  . ASP A 264 ? 0.17283 0.18444 0.09631 -0.00073 -0.01359 -0.02020 264 ASP A CG  
2333 O  OD1 . ASP A 264 ? 0.16211 0.18332 0.10802 -0.00917 -0.00360 0.00540  264 ASP A OD1 
2334 O  OD2 . ASP A 264 ? 0.21599 0.20275 0.11321 0.00382  -0.01352 -0.02553 264 ASP A OD2 
2335 N  N   . LEU A 265 ? 0.13944 0.19282 0.07715 0.00650  -0.00010 0.00599  265 LEU A N   
2336 C  CA  . LEU A 265 ? 0.13395 0.20317 0.07147 0.01127  -0.00406 -0.00148 265 LEU A CA  
2337 C  C   . LEU A 265 ? 0.14052 0.18941 0.07305 -0.00272 0.00013  -0.00254 265 LEU A C   
2338 O  O   . LEU A 265 ? 0.14642 0.20204 0.08831 0.00883  -0.01079 -0.01072 265 LEU A O   
2339 C  CB  . LEU A 265 ? 0.15940 0.23431 0.08319 0.02392  0.00324  -0.00475 265 LEU A CB  
2340 C  CG  . LEU A 265 ? 0.18054 0.28797 0.08658 0.02070  0.00566  -0.00894 265 LEU A CG  
2341 C  CD1 . LEU A 265 ? 0.19603 0.31207 0.08969 0.02299  -0.00418 -0.02831 265 LEU A CD1 
2342 C  CD2 . LEU A 265 ? 0.20677 0.33386 0.10715 0.01996  0.03138  -0.00274 265 LEU A CD2 
2343 N  N   A ARG A 266 ? 0.14446 0.18613 0.08128 -0.00290 -0.00290 0.00861  266 ARG A N   
2344 N  N   B ARG A 266 ? 0.14149 0.18408 0.08818 -0.00273 -0.00258 0.00717  266 ARG A N   
2345 C  CA  A ARG A 266 ? 0.15510 0.18865 0.08533 -0.00073 -0.00333 0.00897  266 ARG A CA  
2346 C  CA  B ARG A 266 ? 0.14897 0.18337 0.10223 0.00243  -0.00677 0.00243  266 ARG A CA  
2347 C  C   A ARG A 266 ? 0.14681 0.18075 0.07831 0.00736  -0.00779 0.00236  266 ARG A C   
2348 C  C   B ARG A 266 ? 0.14657 0.17882 0.08153 0.00950  -0.00852 -0.00072 266 ARG A C   
2349 O  O   A ARG A 266 ? 0.15468 0.19084 0.09026 0.01069  -0.01699 0.00425  266 ARG A O   
2350 O  O   B ARG A 266 ? 0.15336 0.19015 0.09204 0.01262  -0.01445 0.00142  266 ARG A O   
2351 C  CB  A ARG A 266 ? 0.17758 0.20984 0.10481 -0.02030 0.01657  0.01414  266 ARG A CB  
2352 C  CB  B ARG A 266 ? 0.15986 0.19394 0.15112 -0.00803 0.01085  0.00211  266 ARG A CB  
2353 C  CG  A ARG A 266 ? 0.20121 0.22473 0.12796 -0.00973 0.02557  0.02255  266 ARG A CG  
2354 C  CG  B ARG A 266 ? 0.18384 0.20257 0.18303 0.00368  0.03203  0.01995  266 ARG A CG  
2355 C  CD  A ARG A 266 ? 0.22011 0.22091 0.12161 -0.00613 -0.00707 0.01429  266 ARG A CD  
2356 C  CD  B ARG A 266 ? 0.20683 0.19821 0.18148 0.00330  0.04309  0.01908  266 ARG A CD  
2357 N  NE  A ARG A 266 ? 0.22662 0.21271 0.12320 0.00124  -0.01208 0.00663  266 ARG A NE  
2358 N  NE  B ARG A 266 ? 0.21423 0.18629 0.17835 0.01231  0.04472  0.01430  266 ARG A NE  
2359 C  CZ  A ARG A 266 ? 0.20238 0.20585 0.12877 0.01015  -0.01136 0.00336  266 ARG A CZ  
2360 C  CZ  B ARG A 266 ? 0.19858 0.18541 0.17290 0.02451  0.03254  0.01236  266 ARG A CZ  
2361 N  NH1 A ARG A 266 ? 0.18975 0.20425 0.14517 0.02004  0.00139  0.00526  266 ARG A NH1 
2362 N  NH1 B ARG A 266 ? 0.19448 0.19062 0.16557 0.03080  0.01099  0.04311  266 ARG A NH1 
2363 N  NH2 A ARG A 266 ? 0.20848 0.20231 0.13577 0.01810  -0.01897 -0.01381 266 ARG A NH2 
2364 N  NH2 B ARG A 266 ? 0.22140 0.19782 0.18352 0.03356  0.01140  -0.01470 266 ARG A NH2 
2365 N  N   . ALA A 267 ? 0.14101 0.17789 0.07792 0.00037  -0.00601 -0.00330 267 ALA A N   
2366 C  CA  . ALA A 267 ? 0.13976 0.19717 0.07402 -0.00432 -0.00739 -0.00105 267 ALA A CA  
2367 C  C   . ALA A 267 ? 0.13462 0.18834 0.07191 0.00611  -0.00548 0.00139  267 ALA A C   
2368 O  O   . ALA A 267 ? 0.13406 0.21144 0.09094 0.00504  -0.00711 -0.00456 267 ALA A O   
2369 C  CB  . ALA A 267 ? 0.15591 0.21850 0.07265 -0.00644 -0.00512 -0.00321 267 ALA A CB  
2370 N  N   . ALA A 268 ? 0.14152 0.17537 0.07107 0.00361  -0.00722 -0.00172 268 ALA A N   
2371 C  CA  . ALA A 268 ? 0.15084 0.18109 0.08588 0.00215  -0.02322 -0.00312 268 ALA A CA  
2372 C  C   . ALA A 268 ? 0.13936 0.18354 0.08444 -0.00170 -0.00807 -0.00438 268 ALA A C   
2373 O  O   . ALA A 268 ? 0.14857 0.19570 0.09648 -0.00803 -0.01629 0.00087  268 ALA A O   
2374 C  CB  . ALA A 268 ? 0.18026 0.18059 0.09975 0.00580  -0.02022 -0.00176 268 ALA A CB  
2375 N  N   . PHE A 269 ? 0.14789 0.18871 0.07498 0.00042  -0.01012 0.00265  269 PHE A N   
2376 C  CA  . PHE A 269 ? 0.14544 0.19172 0.07225 -0.00190 -0.00164 0.01119  269 PHE A CA  
2377 C  C   . PHE A 269 ? 0.15120 0.18678 0.06563 -0.00186 -0.00322 0.00932  269 PHE A C   
2378 O  O   . PHE A 269 ? 0.15078 0.20756 0.08214 0.00266  -0.01053 0.00864  269 PHE A O   
2379 C  CB  . PHE A 269 ? 0.15255 0.20268 0.08444 -0.00180 0.00123  0.01064  269 PHE A CB  
2380 C  CG  . PHE A 269 ? 0.16730 0.20460 0.07911 0.00152  -0.00106 0.01001  269 PHE A CG  
2381 C  CD1 . PHE A 269 ? 0.19967 0.22487 0.09048 0.01669  -0.01383 0.00781  269 PHE A CD1 
2382 C  CD2 . PHE A 269 ? 0.20492 0.19875 0.10553 0.00394  -0.00073 0.01525  269 PHE A CD2 
2383 C  CE1 . PHE A 269 ? 0.22263 0.24231 0.09966 0.02344  -0.01680 0.01624  269 PHE A CE1 
2384 C  CE2 . PHE A 269 ? 0.23042 0.20531 0.12809 0.01626  -0.00554 0.02064  269 PHE A CE2 
2385 C  CZ  . PHE A 269 ? 0.23475 0.22569 0.12384 0.01722  -0.02002 0.02238  269 PHE A CZ  
2386 N  N   . TRP A 270 ? 0.14555 0.17655 0.07548 0.00234  0.00300  0.00518  270 TRP A N   
2387 C  CA  . TRP A 270 ? 0.14730 0.17033 0.08284 0.00359  0.00321  0.00467  270 TRP A CA  
2388 C  C   . TRP A 270 ? 0.14213 0.17412 0.08292 0.00616  0.00130  0.00924  270 TRP A C   
2389 O  O   . TRP A 270 ? 0.14262 0.19236 0.10848 0.01057  -0.00590 0.01835  270 TRP A O   
2390 C  CB  . TRP A 270 ? 0.16559 0.17020 0.09184 -0.00548 0.00273  0.00539  270 TRP A CB  
2391 C  CG  . TRP A 270 ? 0.16617 0.17012 0.09297 -0.00247 0.00344  -0.00173 270 TRP A CG  
2392 C  CD1 . TRP A 270 ? 0.17077 0.18715 0.11523 -0.01397 0.00286  -0.00733 270 TRP A CD1 
2393 C  CD2 . TRP A 270 ? 0.17257 0.17750 0.09380 -0.00230 0.01046  0.00888  270 TRP A CD2 
2394 N  NE1 . TRP A 270 ? 0.17890 0.19610 0.12331 -0.00796 0.01242  -0.00062 270 TRP A NE1 
2395 C  CE2 . TRP A 270 ? 0.18314 0.18471 0.10825 -0.00458 0.02185  0.00734  270 TRP A CE2 
2396 C  CE3 . TRP A 270 ? 0.19508 0.20187 0.10719 0.00735  0.00930  0.01119  270 TRP A CE3 
2397 C  CZ2 . TRP A 270 ? 0.22073 0.19087 0.12510 -0.00717 0.03164  0.01006  270 TRP A CZ2 
2398 C  CZ3 . TRP A 270 ? 0.21871 0.21430 0.11917 0.00497  0.01334  0.01786  270 TRP A CZ3 
2399 C  CH2 . TRP A 270 ? 0.23472 0.19975 0.12927 0.00362  0.02402  0.02074  270 TRP A CH2 
2400 N  N   . LEU A 271 ? 0.14599 0.17285 0.07611 -0.00558 -0.00848 0.00794  271 LEU A N   
2401 C  CA  . LEU A 271 ? 0.14149 0.17924 0.08512 -0.00852 -0.02330 0.01526  271 LEU A CA  
2402 C  C   . LEU A 271 ? 0.13308 0.18819 0.08342 -0.00014 -0.01216 0.01693  271 LEU A C   
2403 O  O   . LEU A 271 ? 0.13284 0.21302 0.08664 -0.00163 -0.01431 0.01174  271 LEU A O   
2404 C  CB  . LEU A 271 ? 0.14880 0.18600 0.09396 -0.00629 -0.02797 0.01438  271 LEU A CB  
2405 C  CG  . LEU A 271 ? 0.16769 0.19720 0.10337 -0.01044 -0.01558 0.01682  271 LEU A CG  
2406 C  CD1 . LEU A 271 ? 0.16976 0.22119 0.11569 -0.01892 -0.00237 0.02280  271 LEU A CD1 
2407 C  CD2 . LEU A 271 ? 0.19801 0.20114 0.12571 0.00174  -0.01179 0.01506  271 LEU A CD2 
2408 N  N   . VAL A 272 ? 0.14919 0.19010 0.07495 -0.00127 -0.01668 0.00571  272 VAL A N   
2409 C  CA  . VAL A 272 ? 0.15310 0.20424 0.08207 0.00273  -0.02540 -0.00295 272 VAL A CA  
2410 C  C   . VAL A 272 ? 0.15519 0.21452 0.07472 -0.00472 -0.02149 0.00093  272 VAL A C   
2411 O  O   . VAL A 272 ? 0.15850 0.22600 0.09758 -0.00860 -0.03162 -0.00043 272 VAL A O   
2412 C  CB  . VAL A 272 ? 0.17143 0.22018 0.09277 0.01221  -0.01828 -0.00099 272 VAL A CB  
2413 C  CG1 . VAL A 272 ? 0.19756 0.27365 0.09590 0.02316  -0.02814 -0.02251 272 VAL A CG1 
2414 C  CG2 . VAL A 272 ? 0.17962 0.20480 0.12094 0.00978  -0.01747 -0.00317 272 VAL A CG2 
2415 N  N   . ASP A 273 ? 0.15068 0.21710 0.08157 0.00787  -0.01827 0.01091  273 ASP A N   
2416 C  CA  . ASP A 273 ? 0.15597 0.22344 0.08866 0.01204  -0.02053 0.01760  273 ASP A CA  
2417 C  C   . ASP A 273 ? 0.15895 0.22989 0.08365 0.01601  -0.01737 0.02046  273 ASP A C   
2418 O  O   . ASP A 273 ? 0.17161 0.25276 0.10340 0.02403  -0.02758 0.02294  273 ASP A O   
2419 C  CB  . ASP A 273 ? 0.18378 0.21783 0.10434 0.01089  -0.01652 0.02601  273 ASP A CB  
2420 C  CG  . ASP A 273 ? 0.22810 0.23188 0.12132 0.02878  -0.00141 0.02955  273 ASP A CG  
2421 O  OD1 . ASP A 273 ? 0.25779 0.25196 0.13045 0.04522  -0.01953 0.04182  273 ASP A OD1 
2422 O  OD2 . ASP A 273 ? 0.28814 0.23804 0.13816 0.05896  0.00385  0.02102  273 ASP A OD2 
2423 N  N   . LEU A 274 ? 0.15350 0.22131 0.08918 0.01427  -0.01154 0.01331  274 LEU A N   
2424 C  CA  . LEU A 274 ? 0.14861 0.22089 0.09783 0.00387  -0.01693 0.00643  274 LEU A CA  
2425 C  C   . LEU A 274 ? 0.14521 0.23119 0.10148 0.01231  -0.02215 0.00530  274 LEU A C   
2426 O  O   . LEU A 274 ? 0.14890 0.25151 0.12630 0.01169  -0.03055 0.00399  274 LEU A O   
2427 C  CB  . LEU A 274 ? 0.16531 0.22217 0.09891 0.00257  -0.00618 0.00020  274 LEU A CB  
2428 C  CG  . LEU A 274 ? 0.18860 0.24295 0.11931 0.01143  0.01417  -0.00420 274 LEU A CG  
2429 C  CD1 . LEU A 274 ? 0.21624 0.25204 0.17121 0.03188  0.03138  -0.00030 274 LEU A CD1 
2430 C  CD2 . LEU A 274 ? 0.23766 0.28822 0.11064 -0.00618 0.00562  -0.00930 274 LEU A CD2 
2431 N  N   . LEU A 275 ? 0.14678 0.22301 0.09876 -0.00035 -0.02212 0.00527  275 LEU A N   
2432 C  CA  . LEU A 275 ? 0.16066 0.22924 0.11425 -0.00386 -0.03674 0.00354  275 LEU A CA  
2433 C  C   . LEU A 275 ? 0.16367 0.24646 0.12555 -0.00802 -0.03774 0.00035  275 LEU A C   
2434 O  O   . LEU A 275 ? 0.17179 0.27813 0.14023 -0.02420 -0.04467 0.01272  275 LEU A O   
2435 C  CB  . LEU A 275 ? 0.17647 0.23273 0.11405 -0.00314 -0.03332 0.01273  275 LEU A CB  
2436 C  CG  . LEU A 275 ? 0.20008 0.24452 0.12144 -0.00589 -0.02350 0.01927  275 LEU A CG  
2437 C  CD1 . LEU A 275 ? 0.23561 0.24999 0.15080 0.01341  -0.03475 0.02550  275 LEU A CD1 
2438 C  CD2 . LEU A 275 ? 0.21142 0.28366 0.11632 -0.00506 -0.01044 0.02198  275 LEU A CD2 
2439 N  N   . GLU A 276 ? 0.16612 0.25231 0.11108 0.00131  -0.03667 0.00077  276 GLU A N   
2440 C  CA  . GLU A 276 ? 0.18997 0.27559 0.11162 0.00272  -0.05137 0.00010  276 GLU A CA  
2441 C  C   . GLU A 276 ? 0.20195 0.29302 0.14388 0.01307  -0.07410 0.00990  276 GLU A C   
2442 O  O   . GLU A 276 ? 0.22320 0.34337 0.18937 0.01768  -0.10897 -0.00174 276 GLU A O   
2443 C  CB  . GLU A 276 ? 0.20864 0.28528 0.11104 0.00921  -0.03653 0.00419  276 GLU A CB  
2444 C  CG  . GLU A 276 ? 0.20621 0.28974 0.13026 0.00082  -0.03916 -0.00429 276 GLU A CG  
2445 C  CD  . GLU A 276 ? 0.23714 0.30104 0.18686 0.00768  -0.07249 -0.00472 276 GLU A CD  
2446 O  OE1 . GLU A 276 ? 0.29837 0.32766 0.22995 0.00362  -0.13591 -0.02686 276 GLU A OE1 
2447 O  OE2 . GLU A 276 ? 0.21862 0.29524 0.23396 0.00968  -0.05877 0.01238  276 GLU A OE2 
2448 N  N   A SER A 277 ? 0.19887 0.27846 0.15500 0.01998  -0.06800 0.02711  277 SER A N   
2449 N  N   B SER A 277 ? 0.20171 0.28537 0.15433 0.01965  -0.06871 0.01828  277 SER A N   
2450 C  CA  A SER A 277 ? 0.19721 0.27422 0.18728 0.01961  -0.07101 0.04193  277 SER A CA  
2451 C  CA  B SER A 277 ? 0.21308 0.28997 0.20286 0.02337  -0.07084 0.02973  277 SER A CA  
2452 C  C   A SER A 277 ? 0.19295 0.27143 0.20442 0.02780  -0.07776 0.03275  277 SER A C   
2453 C  C   B SER A 277 ? 0.21432 0.29287 0.20189 0.02999  -0.06375 0.03521  277 SER A C   
2454 O  O   A SER A 277 ? 0.20428 0.29061 0.24504 0.04195  -0.09488 0.03576  277 SER A O   
2455 O  O   B SER A 277 ? 0.23420 0.31929 0.22747 0.04777  -0.05864 0.05125  277 SER A O   
2456 C  CB  A SER A 277 ? 0.20696 0.28839 0.21875 0.01592  -0.04765 0.06665  277 SER A CB  
2457 C  CB  B SER A 277 ? 0.23958 0.30116 0.27320 0.02402  -0.07726 0.03906  277 SER A CB  
2458 O  OG  A SER A 277 ? 0.22322 0.33082 0.24592 0.01457  -0.02945 0.08975  277 SER A OG  
2459 O  OG  B SER A 277 ? 0.29011 0.32302 0.30569 0.03859  -0.12017 0.03363  277 SER A OG  
2460 N  N   . ALA A 278 ? 0.18607 0.28774 0.19909 0.03062  -0.05949 0.02754  278 ALA A N   
2461 C  CA  . ALA A 278 ? 0.18656 0.32703 0.22682 0.03045  -0.03717 0.03829  278 ALA A CA  
2462 C  C   . ALA A 278 ? 0.19165 0.33149 0.28477 0.02003  -0.04180 0.03767  278 ALA A C   
2463 O  O   . ALA A 278 ? 0.20413 0.40830 0.35296 -0.00428 -0.01804 0.02726  278 ALA A O   
2464 C  CB  . ALA A 278 ? 0.19382 0.38516 0.21636 0.01800  -0.01861 0.05121  278 ALA A CB  
2465 N  N   . GLY A 279 ? 0.20845 0.29654 0.29742 0.00734  -0.07643 0.03906  279 GLY A N   
2466 C  CA  . GLY A 279 ? 0.22553 0.30375 0.34634 -0.01246 -0.10634 0.04428  279 GLY A CA  
2467 C  C   . GLY A 279 ? 0.22243 0.29535 0.37854 -0.01124 -0.10819 0.04942  279 GLY A C   
2468 O  O   . GLY A 279 ? 0.22461 0.32312 0.45037 -0.02523 -0.12740 0.07049  279 GLY A O   
2469 N  N   . TYR A 280 ? 0.20962 0.27014 0.32990 -0.00087 -0.08559 0.03278  280 TYR A N   
2470 C  CA  . TYR A 280 ? 0.20741 0.26152 0.30983 -0.00570 -0.07320 0.02886  280 TYR A CA  
2471 C  C   . TYR A 280 ? 0.21008 0.27360 0.31474 -0.00092 -0.07611 0.03160  280 TYR A C   
2472 O  O   . TYR A 280 ? 0.22190 0.30156 0.32588 0.00979  -0.05872 0.01529  280 TYR A O   
2473 C  CB  . TYR A 280 ? 0.21361 0.25701 0.27801 -0.01388 -0.07617 0.02445  280 TYR A CB  
2474 C  CG  . TYR A 280 ? 0.19603 0.26352 0.22568 -0.01349 -0.05026 0.01222  280 TYR A CG  
2475 C  CD1 . TYR A 280 ? 0.20426 0.27210 0.22169 -0.00671 -0.02637 -0.00463 280 TYR A CD1 
2476 C  CD2 . TYR A 280 ? 0.19860 0.26706 0.18578 -0.01480 -0.03937 0.01076  280 TYR A CD2 
2477 C  CE1 . TYR A 280 ? 0.21147 0.27305 0.18966 -0.00672 -0.01526 -0.01115 280 TYR A CE1 
2478 C  CE2 . TYR A 280 ? 0.19753 0.26519 0.17410 -0.00954 -0.02864 0.00920  280 TYR A CE2 
2479 C  CZ  . TYR A 280 ? 0.19878 0.26974 0.16635 -0.01362 -0.02421 0.00059  280 TYR A CZ  
2480 O  OH  . TYR A 280 ? 0.20891 0.28170 0.15603 -0.01408 -0.02030 0.00457  280 TYR A OH  
2481 N  N   . SER A 281 ? 0.23848 0.27360 0.31575 -0.01583 -0.10875 0.02642  281 SER A N   
2482 C  CA  A SER A 281 ? 0.25049 0.29053 0.35045 -0.02583 -0.13266 0.01998  281 SER A CA  
2483 C  CA  B SER A 281 ? 0.27195 0.29130 0.33325 -0.01887 -0.12477 0.01867  281 SER A CA  
2484 C  C   . SER A 281 ? 0.25232 0.27948 0.31828 -0.02490 -0.11775 0.00754  281 SER A C   
2485 O  O   . SER A 281 ? 0.30541 0.29918 0.33629 -0.02951 -0.13471 -0.00452 281 SER A O   
2486 C  CB  A SER A 281 ? 0.25331 0.35537 0.46903 -0.02534 -0.14994 0.02024  281 SER A CB  
2487 C  CB  B SER A 281 ? 0.32506 0.33976 0.38463 -0.01248 -0.16057 0.02686  281 SER A CB  
2488 O  OG  A SER A 281 ? 0.22517 0.44228 0.57614 0.00069  -0.10413 -0.01186 281 SER A OG  
2489 O  OG  B SER A 281 ? 0.40719 0.37185 0.39456 -0.00423 -0.17590 0.03718  281 SER A OG  
2490 N  N   . GLY A 282 ? 0.19886 0.25845 0.28847 -0.01082 -0.08159 0.01346  282 GLY A N   
2491 C  CA  . GLY A 282 ? 0.18432 0.24574 0.27118 -0.01571 -0.05077 0.01216  282 GLY A CA  
2492 C  C   . GLY A 282 ? 0.17841 0.24595 0.22032 -0.02321 -0.04907 0.00961  282 GLY A C   
2493 O  O   . GLY A 282 ? 0.19686 0.26448 0.20147 -0.01644 -0.03972 0.01987  282 GLY A O   
2494 N  N   . PRO A 283 ? 0.17719 0.24189 0.20621 -0.02329 -0.03112 0.01014  283 PRO A N   
2495 C  CA  . PRO A 283 ? 0.17957 0.22945 0.19771 -0.02151 -0.03048 0.00225  283 PRO A CA  
2496 C  C   . PRO A 283 ? 0.16902 0.22171 0.16309 -0.01143 -0.03302 -0.00886 283 PRO A C   
2497 O  O   . PRO A 283 ? 0.17701 0.23230 0.16057 -0.01215 -0.01991 -0.00761 283 PRO A O   
2498 C  CB  . PRO A 283 ? 0.21826 0.24262 0.23728 -0.03162 -0.02523 0.02095  283 PRO A CB  
2499 C  CG  . PRO A 283 ? 0.23075 0.26423 0.24576 -0.02834 -0.01891 0.03185  283 PRO A CG  
2500 C  CD  . PRO A 283 ? 0.19712 0.26533 0.22952 -0.02431 -0.01433 0.03287  283 PRO A CD  
2501 N  N   . ARG A 284 ? 0.16105 0.21706 0.15459 -0.01333 -0.04015 -0.00324 284 ARG A N   
2502 C  CA  A ARG A 284 ? 0.16416 0.21075 0.15638 -0.00759 -0.03116 0.00349  284 ARG A CA  
2503 C  CA  B ARG A 284 ? 0.17155 0.21051 0.14836 -0.01171 -0.03542 0.00336  284 ARG A CA  
2504 C  C   . ARG A 284 ? 0.15660 0.19085 0.13538 -0.01576 -0.02575 -0.01335 284 ARG A C   
2505 O  O   . ARG A 284 ? 0.18457 0.19667 0.12388 -0.00798 -0.02203 -0.01709 284 ARG A O   
2506 C  CB  A ARG A 284 ? 0.17804 0.22462 0.17951 -0.00264 -0.03028 0.02514  284 ARG A CB  
2507 C  CB  B ARG A 284 ? 0.20147 0.22503 0.16074 -0.01099 -0.03629 0.02651  284 ARG A CB  
2508 C  CG  A ARG A 284 ? 0.18015 0.23430 0.19698 -0.00692 -0.04093 0.03745  284 ARG A CG  
2509 C  CG  B ARG A 284 ? 0.22496 0.24119 0.17478 -0.01538 -0.03998 0.04883  284 ARG A CG  
2510 C  CD  A ARG A 284 ? 0.18746 0.25669 0.19290 -0.00622 -0.03579 0.05680  284 ARG A CD  
2511 C  CD  B ARG A 284 ? 0.27899 0.26416 0.18119 -0.02874 -0.04983 0.06474  284 ARG A CD  
2512 N  NE  A ARG A 284 ? 0.19340 0.27773 0.20987 0.00747  -0.02811 0.07595  284 ARG A NE  
2513 N  NE  B ARG A 284 ? 0.30366 0.27707 0.20965 -0.01604 -0.05389 0.06354  284 ARG A NE  
2514 C  CZ  A ARG A 284 ? 0.19457 0.30828 0.23785 0.01322  -0.02415 0.10408  284 ARG A CZ  
2515 C  CZ  B ARG A 284 ? 0.34418 0.23931 0.25979 0.00880  -0.05540 0.03183  284 ARG A CZ  
2516 N  NH1 A ARG A 284 ? 0.20084 0.31746 0.23572 0.01408  -0.02484 0.11168  284 ARG A NH1 
2517 N  NH1 B ARG A 284 ? 0.37688 0.20873 0.34673 -0.00025 0.00822  0.03130  284 ARG A NH1 
2518 N  NH2 A ARG A 284 ? 0.18681 0.32523 0.29483 0.01323  -0.01841 0.13029  284 ARG A NH2 
2519 N  NH2 B ARG A 284 ? 0.33523 0.20676 0.25552 0.01132  -0.10751 -0.00872 284 ARG A NH2 
2520 N  N   . HIS A 285 ? 0.15650 0.18749 0.13475 -0.01427 -0.02270 -0.01487 285 HIS A N   
2521 C  CA  . HIS A 285 ? 0.14972 0.17840 0.11894 -0.02265 -0.01689 -0.02096 285 HIS A CA  
2522 C  C   . HIS A 285 ? 0.15282 0.17506 0.11209 -0.02144 -0.02059 -0.03796 285 HIS A C   
2523 O  O   . HIS A 285 ? 0.15649 0.18867 0.16508 -0.02538 -0.01380 -0.06020 285 HIS A O   
2524 C  CB  . HIS A 285 ? 0.16606 0.18367 0.12957 -0.02260 -0.00159 -0.02026 285 HIS A CB  
2525 C  CG  . HIS A 285 ? 0.17992 0.19235 0.11255 -0.03154 -0.01846 -0.01963 285 HIS A CG  
2526 N  ND1 . HIS A 285 ? 0.19368 0.21028 0.11454 -0.04196 -0.02054 -0.01904 285 HIS A ND1 
2527 C  CD2 . HIS A 285 ? 0.21591 0.18965 0.12103 -0.03980 -0.01924 -0.00638 285 HIS A CD2 
2528 C  CE1 . HIS A 285 ? 0.21938 0.21324 0.11963 -0.04371 -0.02224 -0.00866 285 HIS A CE1 
2529 N  NE2 . HIS A 285 ? 0.23043 0.20442 0.12928 -0.04098 -0.01247 -0.00363 285 HIS A NE2 
2530 N  N   . PHE A 286 ? 0.15215 0.16887 0.10284 -0.01493 -0.02944 -0.01792 286 PHE A N   
2531 C  CA  . PHE A 286 ? 0.15457 0.17251 0.12185 -0.01009 -0.03148 -0.01722 286 PHE A CA  
2532 C  C   . PHE A 286 ? 0.18446 0.16921 0.13014 -0.00453 -0.04029 -0.01636 286 PHE A C   
2533 O  O   . PHE A 286 ? 0.25681 0.18420 0.14424 -0.01280 -0.06266 -0.01266 286 PHE A O   
2534 C  CB  . PHE A 286 ? 0.16881 0.19096 0.12874 -0.00769 -0.01208 -0.01999 286 PHE A CB  
2535 C  CG  . PHE A 286 ? 0.15652 0.20230 0.11847 -0.01385 -0.01764 -0.03115 286 PHE A CG  
2536 C  CD1 . PHE A 286 ? 0.16106 0.20578 0.12290 -0.01398 -0.00658 -0.02639 286 PHE A CD1 
2537 C  CD2 . PHE A 286 ? 0.18365 0.22801 0.12448 -0.01953 -0.02718 -0.02991 286 PHE A CD2 
2538 C  CE1 . PHE A 286 ? 0.17696 0.22041 0.12314 -0.00406 -0.01707 -0.02256 286 PHE A CE1 
2539 C  CE2 . PHE A 286 ? 0.20175 0.23927 0.12116 -0.01872 -0.02943 -0.02916 286 PHE A CE2 
2540 C  CZ  . PHE A 286 ? 0.18568 0.23693 0.12209 -0.01386 -0.01721 -0.02306 286 PHE A CZ  
2541 N  N   . ASP A 287 ? 0.15946 0.17486 0.11580 -0.00622 -0.03877 -0.01703 287 ASP A N   
2542 C  CA  . ASP A 287 ? 0.15509 0.17216 0.12009 0.00310  -0.02535 -0.01625 287 ASP A CA  
2543 C  C   . ASP A 287 ? 0.15648 0.15729 0.12797 -0.00621 -0.02217 -0.01721 287 ASP A C   
2544 O  O   . ASP A 287 ? 0.17369 0.17616 0.13969 -0.01684 -0.02307 -0.02902 287 ASP A O   
2545 C  CB  . ASP A 287 ? 0.16675 0.18114 0.12603 0.00291  -0.01289 -0.01375 287 ASP A CB  
2546 C  CG  . ASP A 287 ? 0.19673 0.17901 0.12405 0.01199  -0.00605 -0.01761 287 ASP A CG  
2547 O  OD1 . ASP A 287 ? 0.19435 0.17578 0.13220 0.00167  -0.00849 -0.01092 287 ASP A OD1 
2548 O  OD2 . ASP A 287 ? 0.25458 0.23773 0.13051 0.05275  0.00134  -0.02161 287 ASP A OD2 
2549 N  N   . PHE A 288 ? 0.14475 0.16722 0.15624 -0.00496 -0.02963 -0.02957 288 PHE A N   
2550 C  CA  . PHE A 288 ? 0.14839 0.16206 0.17580 -0.01269 -0.02636 -0.02469 288 PHE A CA  
2551 C  C   . PHE A 288 ? 0.14662 0.16206 0.17133 -0.01496 -0.01549 -0.02781 288 PHE A C   
2552 O  O   . PHE A 288 ? 0.16505 0.17412 0.18822 -0.01348 -0.02566 -0.02550 288 PHE A O   
2553 C  CB  . PHE A 288 ? 0.17316 0.17935 0.19082 -0.01409 -0.01922 -0.00863 288 PHE A CB  
2554 C  CG  . PHE A 288 ? 0.17281 0.19807 0.15965 -0.01730 -0.02575 0.00853  288 PHE A CG  
2555 C  CD1 . PHE A 288 ? 0.19141 0.22240 0.15102 -0.02007 -0.03611 -0.00588 288 PHE A CD1 
2556 C  CD2 . PHE A 288 ? 0.19284 0.23806 0.15269 -0.01442 -0.00679 0.00522  288 PHE A CD2 
2557 C  CE1 . PHE A 288 ? 0.22388 0.25549 0.13927 -0.01715 -0.03020 -0.00896 288 PHE A CE1 
2558 C  CE2 . PHE A 288 ? 0.21831 0.27408 0.14041 -0.01380 0.00439  -0.00970 288 PHE A CE2 
2559 C  CZ  . PHE A 288 ? 0.23972 0.27978 0.13185 -0.01325 -0.01668 -0.01192 288 PHE A CZ  
2560 N  N   . LYS A 289 ? 0.14815 0.17465 0.18382 0.00349  -0.00921 -0.02276 289 LYS A N   
2561 C  CA  A LYS A 289 ? 0.17166 0.18428 0.20664 0.02345  -0.01568 -0.02207 289 LYS A CA  
2562 C  CA  B LYS A 289 ? 0.17344 0.18400 0.20808 0.01801  -0.01041 -0.02059 289 LYS A CA  
2563 C  C   . LYS A 289 ? 0.16190 0.18010 0.21966 0.00917  -0.01020 -0.03939 289 LYS A C   
2564 O  O   . LYS A 289 ? 0.16969 0.19555 0.26417 -0.01445 0.01872  -0.07046 289 LYS A O   
2565 C  CB  A LYS A 289 ? 0.22236 0.22657 0.21454 0.05894  -0.02597 -0.00974 289 LYS A CB  
2566 C  CB  B LYS A 289 ? 0.21768 0.22635 0.22039 0.03745  -0.01402 0.00007  289 LYS A CB  
2567 C  CG  A LYS A 289 ? 0.29146 0.25699 0.20283 0.07152  -0.02327 -0.00645 289 LYS A CG  
2568 C  CG  B LYS A 289 ? 0.27416 0.26606 0.23004 0.04511  -0.00801 0.02751  289 LYS A CG  
2569 C  CD  A LYS A 289 ? 0.36279 0.27958 0.21683 0.08352  -0.03598 -0.01119 289 LYS A CD  
2570 C  CD  B LYS A 289 ? 0.32581 0.32745 0.23561 0.05298  -0.02426 0.03975  289 LYS A CD  
2571 C  CE  A LYS A 289 ? 0.37686 0.30641 0.24905 0.06690  -0.02510 0.00165  289 LYS A CE  
2572 C  CE  B LYS A 289 ? 0.39201 0.38550 0.21302 0.04378  -0.03930 0.04200  289 LYS A CE  
2573 N  NZ  A LYS A 289 ? 0.33728 0.29923 0.27239 0.02412  -0.01581 0.00969  289 LYS A NZ  
2574 N  NZ  B LYS A 289 ? 0.42088 0.39759 0.21191 0.05438  -0.06137 0.03252  289 LYS A NZ  
2575 N  N   . PRO A 290 ? 0.16191 0.18108 0.19383 0.00019  -0.03106 -0.04116 290 PRO A N   
2576 C  CA  . PRO A 290 ? 0.16861 0.19540 0.14472 0.00234  -0.02959 -0.03388 290 PRO A CA  
2577 C  C   . PRO A 290 ? 0.15899 0.18322 0.11734 0.00489  -0.01076 -0.01943 290 PRO A C   
2578 O  O   . PRO A 290 ? 0.16573 0.18466 0.12385 0.00252  -0.00563 -0.00406 290 PRO A O   
2579 C  CB  . PRO A 290 ? 0.20879 0.22835 0.16529 0.00095  -0.03710 -0.05594 290 PRO A CB  
2580 C  CG  . PRO A 290 ? 0.22642 0.24741 0.23934 -0.00548 -0.03030 -0.07689 290 PRO A CG  
2581 C  CD  . PRO A 290 ? 0.19708 0.21675 0.24163 -0.01378 -0.03428 -0.06513 290 PRO A CD  
2582 N  N   . PRO A 291 ? 0.16896 0.18002 0.11296 0.00139  -0.00793 -0.01096 291 PRO A N   
2583 C  CA  . PRO A 291 ? 0.15513 0.18232 0.12610 0.00345  -0.00125 -0.01632 291 PRO A CA  
2584 C  C   . PRO A 291 ? 0.15020 0.18292 0.10437 0.00699  0.00376  -0.01592 291 PRO A C   
2585 O  O   . PRO A 291 ? 0.16685 0.18142 0.11267 0.01175  -0.00587 -0.02182 291 PRO A O   
2586 C  CB  . PRO A 291 ? 0.17794 0.18841 0.16420 -0.00606 0.00079  -0.00469 291 PRO A CB  
2587 C  CG  . PRO A 291 ? 0.20200 0.20477 0.17482 -0.01556 -0.01255 0.01419  291 PRO A CG  
2588 C  CD  . PRO A 291 ? 0.19607 0.19578 0.14048 -0.01701 -0.01119 0.01286  291 PRO A CD  
2589 N  N   . ARG A 292 ? 0.16002 0.19233 0.10924 0.01037  0.00103  -0.00514 292 ARG A N   
2590 C  CA  . ARG A 292 ? 0.18290 0.21519 0.11569 0.02876  0.00099  0.00408  292 ARG A CA  
2591 C  C   . ARG A 292 ? 0.17386 0.19349 0.11079 0.01954  -0.00787 -0.00553 292 ARG A C   
2592 O  O   . ARG A 292 ? 0.19712 0.18796 0.14735 0.02072  -0.00537 0.00180  292 ARG A O   
2593 C  CB  . ARG A 292 ? 0.21885 0.25817 0.13520 0.01932  -0.00842 -0.00463 292 ARG A CB  
2594 C  CG  . ARG A 292 ? 0.21704 0.27782 0.13945 -0.00266 0.00199  -0.04113 292 ARG A CG  
2595 C  CD  . ARG A 292 ? 0.20375 0.27909 0.14092 0.00020  -0.01116 -0.05931 292 ARG A CD  
2596 N  NE  . ARG A 292 ? 0.18697 0.27239 0.14388 -0.02380 0.00247  -0.05566 292 ARG A NE  
2597 C  CZ  . ARG A 292 ? 0.19163 0.23909 0.14043 -0.01944 -0.00188 -0.02883 292 ARG A CZ  
2598 N  NH1 . ARG A 292 ? 0.17599 0.22274 0.12491 -0.01552 0.00084  -0.02363 292 ARG A NH1 
2599 N  NH2 . ARG A 292 ? 0.22546 0.24611 0.15907 -0.03202 -0.00186 -0.02254 292 ARG A NH2 
2600 N  N   . THR A 293 ? 0.15774 0.18621 0.10404 0.01153  -0.00252 -0.00830 293 THR A N   
2601 C  CA  . THR A 293 ? 0.16254 0.18473 0.10967 0.00956  0.00149  -0.01454 293 THR A CA  
2602 C  C   . THR A 293 ? 0.15909 0.18318 0.11274 0.01231  0.00039  -0.01746 293 THR A C   
2603 O  O   . THR A 293 ? 0.17217 0.19134 0.13358 0.01857  0.00272  -0.03019 293 THR A O   
2604 C  CB  . THR A 293 ? 0.16904 0.18917 0.11516 0.01065  -0.00880 -0.02231 293 THR A CB  
2605 O  OG1 . THR A 293 ? 0.17948 0.17147 0.11147 0.01497  -0.00334 -0.01974 293 THR A OG1 
2606 C  CG2 . THR A 293 ? 0.18432 0.20418 0.11906 -0.00683 -0.00735 -0.02761 293 THR A CG2 
2607 N  N   . GLU A 294 ? 0.16708 0.17797 0.10092 0.01041  -0.01315 -0.01960 294 GLU A N   
2608 C  CA  . GLU A 294 ? 0.17905 0.17032 0.11431 0.00891  -0.01588 -0.01662 294 GLU A CA  
2609 C  C   . GLU A 294 ? 0.17574 0.16840 0.13274 0.00575  -0.00580 -0.01976 294 GLU A C   
2610 O  O   . GLU A 294 ? 0.19578 0.17495 0.14936 -0.00014 0.00402  -0.00971 294 GLU A O   
2611 C  CB  . GLU A 294 ? 0.18287 0.17563 0.11573 0.01188  -0.01379 -0.01250 294 GLU A CB  
2612 C  CG  . GLU A 294 ? 0.19034 0.18376 0.10559 0.00650  -0.00314 -0.01022 294 GLU A CG  
2613 C  CD  . GLU A 294 ? 0.19566 0.18955 0.10148 0.00173  -0.00401 -0.02124 294 GLU A CD  
2614 O  OE1 . GLU A 294 ? 0.20779 0.22162 0.10265 0.00691  -0.00593 -0.01667 294 GLU A OE1 
2615 O  OE2 . GLU A 294 ? 0.20599 0.19675 0.10504 -0.00941 -0.00700 -0.01793 294 GLU A OE2 
2616 N  N   . ASP A 295 ? 0.19309 0.17425 0.14710 0.00794  -0.00802 -0.03913 295 ASP A N   
2617 C  CA  . ASP A 295 ? 0.21126 0.17556 0.18113 0.01217  -0.01195 -0.04734 295 ASP A CA  
2618 C  C   . ASP A 295 ? 0.21153 0.18372 0.17786 0.00436  -0.01452 -0.05191 295 ASP A C   
2619 O  O   . ASP A 295 ? 0.19551 0.18239 0.15953 0.01231  -0.02129 -0.04646 295 ASP A O   
2620 C  CB  . ASP A 295 ? 0.22644 0.19322 0.22376 0.02208  -0.00065 -0.06215 295 ASP A CB  
2621 C  CG  . ASP A 295 ? 0.24239 0.25620 0.23493 0.02738  0.02096  -0.08023 295 ASP A CG  
2622 O  OD1 . ASP A 295 ? 0.24001 0.26629 0.19779 0.01163  0.01769  -0.06241 295 ASP A OD1 
2623 O  OD2 . ASP A 295 ? 0.29213 0.33168 0.28882 0.05545  0.06150  -0.08658 295 ASP A OD2 
2624 N  N   A PHE A 296 ? 0.21714 0.20142 0.20230 -0.00437 -0.01334 -0.05922 296 PHE A N   
2625 N  N   B PHE A 296 ? 0.21730 0.20022 0.20214 -0.00294 -0.01227 -0.05997 296 PHE A N   
2626 C  CA  A PHE A 296 ? 0.23926 0.24252 0.21052 -0.02714 -0.02199 -0.07911 296 PHE A CA  
2627 C  CA  B PHE A 296 ? 0.24093 0.24608 0.21203 -0.02436 -0.02038 -0.07570 296 PHE A CA  
2628 C  C   A PHE A 296 ? 0.23123 0.25445 0.19285 0.00953  -0.01963 -0.09608 296 PHE A C   
2629 C  C   B PHE A 296 ? 0.23145 0.25898 0.19619 0.00264  -0.02065 -0.08830 296 PHE A C   
2630 O  O   A PHE A 296 ? 0.22623 0.27198 0.21134 0.00944  -0.02758 -0.09242 296 PHE A O   
2631 O  O   B PHE A 296 ? 0.22600 0.27342 0.21027 0.01001  -0.02813 -0.09434 296 PHE A O   
2632 C  CB  A PHE A 296 ? 0.32660 0.27680 0.24300 -0.07551 -0.03953 -0.06338 296 PHE A CB  
2633 C  CB  B PHE A 296 ? 0.32860 0.28132 0.24456 -0.07449 -0.03775 -0.06000 296 PHE A CB  
2634 C  CG  A PHE A 296 ? 0.40972 0.33036 0.32174 -0.08761 -0.02091 -0.01654 296 PHE A CG  
2635 C  CG  B PHE A 296 ? 0.41149 0.33399 0.32360 -0.08409 -0.01997 -0.01425 296 PHE A CG  
2636 C  CD1 A PHE A 296 ? 0.45028 0.34333 0.37061 -0.11876 0.02590  -0.04413 296 PHE A CD1 
2637 C  CD1 B PHE A 296 ? 0.45109 0.34445 0.37075 -0.11712 0.02545  -0.04375 296 PHE A CD1 
2638 C  CD2 A PHE A 296 ? 0.48884 0.43515 0.39484 -0.02274 -0.01100 0.07874  296 PHE A CD2 
2639 C  CD2 B PHE A 296 ? 0.48904 0.43567 0.39506 -0.02247 -0.01077 0.07832  296 PHE A CD2 
2640 C  CE1 A PHE A 296 ? 0.49562 0.40899 0.37134 -0.13663 0.02128  -0.04025 296 PHE A CE1 
2641 C  CE1 B PHE A 296 ? 0.49575 0.40951 0.37218 -0.13560 0.02143  -0.03910 296 PHE A CE1 
2642 C  CE2 A PHE A 296 ? 0.49511 0.53258 0.39641 -0.02342 0.00092  0.09425  296 PHE A CE2 
2643 C  CE2 B PHE A 296 ? 0.49502 0.53237 0.39670 -0.02330 0.00105  0.09355  296 PHE A CE2 
2644 C  CZ  A PHE A 296 ? 0.46063 0.52028 0.35190 -0.08714 -0.01293 0.02774  296 PHE A CZ  
2645 C  CZ  B PHE A 296 ? 0.46136 0.51977 0.35292 -0.08691 -0.01227 0.02796  296 PHE A CZ  
2646 N  N   A ASP A 297 ? 0.24667 0.25662 0.16870 0.03562  -0.01299 -0.09282 297 ASP A N   
2647 N  N   B ASP A 297 ? 0.24534 0.26250 0.18654 0.00714  -0.01839 -0.06858 297 ASP A N   
2648 C  CA  A ASP A 297 ? 0.24882 0.29160 0.15668 0.03913  -0.01243 -0.07671 297 ASP A CA  
2649 C  CA  B ASP A 297 ? 0.26558 0.27316 0.19143 0.00362  -0.01602 -0.05278 297 ASP A CA  
2650 C  C   A ASP A 297 ? 0.23017 0.27524 0.13808 0.03422  -0.01366 -0.05698 297 ASP A C   
2651 C  C   B ASP A 297 ? 0.24465 0.27169 0.15788 0.01649  -0.01969 -0.04072 297 ASP A C   
2652 O  O   A ASP A 297 ? 0.25047 0.27977 0.13160 0.04410  -0.02765 -0.05830 297 ASP A O   
2653 O  O   B ASP A 297 ? 0.27442 0.29171 0.15702 0.02853  -0.02304 -0.02834 297 ASP A O   
2654 C  CB  A ASP A 297 ? 0.29758 0.33617 0.18719 0.05104  0.00765  -0.10475 297 ASP A CB  
2655 C  CB  B ASP A 297 ? 0.30948 0.29356 0.23380 -0.00480 0.00554  -0.05066 297 ASP A CB  
2656 C  CG  A ASP A 297 ? 0.39516 0.39366 0.29387 0.04764  0.02370  -0.16160 297 ASP A CG  
2657 C  CG  B ASP A 297 ? 0.37510 0.34376 0.29832 -0.02444 0.02042  -0.03699 297 ASP A CG  
2658 O  OD1 A ASP A 297 ? 0.45766 0.40836 0.33039 0.01038  0.02998  -0.20021 297 ASP A OD1 
2659 O  OD1 B ASP A 297 ? 0.37342 0.31202 0.37904 -0.06021 0.00102  0.01843  297 ASP A OD1 
2660 O  OD2 A ASP A 297 ? 0.43990 0.45751 0.38831 0.09073  0.01814  -0.20190 297 ASP A OD2 
2661 O  OD2 B ASP A 297 ? 0.45065 0.42081 0.30715 -0.00912 0.04078  -0.10543 297 ASP A OD2 
2662 N  N   . GLY A 298 ? 0.20917 0.24700 0.13823 0.01895  -0.01418 -0.04133 298 GLY A N   
2663 C  CA  . GLY A 298 ? 0.19910 0.22009 0.13609 0.01207  -0.01614 -0.02997 298 GLY A CA  
2664 C  C   . GLY A 298 ? 0.19482 0.19711 0.13899 0.01126  -0.02305 -0.03682 298 GLY A C   
2665 O  O   . GLY A 298 ? 0.21360 0.20466 0.15652 0.01117  -0.02299 -0.02008 298 GLY A O   
2666 N  N   . VAL A 299 ? 0.19413 0.19799 0.12874 0.01465  -0.01554 -0.03362 299 VAL A N   
2667 C  CA  . VAL A 299 ? 0.19737 0.19546 0.12783 0.00979  -0.01664 -0.02490 299 VAL A CA  
2668 C  C   . VAL A 299 ? 0.19819 0.18960 0.12495 0.01095  -0.00949 -0.03594 299 VAL A C   
2669 O  O   . VAL A 299 ? 0.19438 0.20030 0.12493 0.01739  -0.01054 -0.03120 299 VAL A O   
2670 C  CB  . VAL A 299 ? 0.21226 0.20679 0.13699 0.01469  -0.01700 -0.01395 299 VAL A CB  
2671 C  CG1 . VAL A 299 ? 0.21983 0.23479 0.15495 0.00236  -0.00978 -0.00897 299 VAL A CG1 
2672 C  CG2 . VAL A 299 ? 0.22665 0.22112 0.14370 0.02252  -0.02169 -0.00608 299 VAL A CG2 
2673 N  N   . TRP A 300 ? 0.20021 0.19524 0.12028 0.00779  -0.02294 -0.03576 300 TRP A N   
2674 C  CA  . TRP A 300 ? 0.21338 0.20720 0.11762 0.01193  -0.03169 -0.03719 300 TRP A CA  
2675 C  C   . TRP A 300 ? 0.21156 0.21695 0.12010 0.01460  -0.02555 -0.03155 300 TRP A C   
2676 O  O   . TRP A 300 ? 0.22044 0.22385 0.13860 0.02506  -0.03428 -0.03072 300 TRP A O   
2677 C  CB  . TRP A 300 ? 0.23671 0.21133 0.13774 0.00193  -0.03534 -0.04123 300 TRP A CB  
2678 C  CG  . TRP A 300 ? 0.24006 0.21366 0.15859 -0.00299 -0.04511 -0.04376 300 TRP A CG  
2679 C  CD1 . TRP A 300 ? 0.26239 0.21978 0.21215 0.00100  -0.06560 -0.04122 300 TRP A CD1 
2680 C  CD2 . TRP A 300 ? 0.25840 0.22333 0.16485 -0.02310 -0.04027 -0.04791 300 TRP A CD2 
2681 N  NE1 . TRP A 300 ? 0.28132 0.21749 0.24558 -0.01099 -0.07705 -0.02556 300 TRP A NE1 
2682 C  CE2 . TRP A 300 ? 0.29004 0.22663 0.20524 -0.03382 -0.05917 -0.02831 300 TRP A CE2 
2683 C  CE3 . TRP A 300 ? 0.26240 0.25241 0.18885 -0.02988 -0.02417 -0.06847 300 TRP A CE3 
2684 C  CZ2 . TRP A 300 ? 0.32856 0.25531 0.21271 -0.06082 -0.04014 -0.03606 300 TRP A CZ2 
2685 C  CZ3 . TRP A 300 ? 0.30570 0.26997 0.21234 -0.04702 -0.01105 -0.06408 300 TRP A CZ3 
2686 C  CH2 . TRP A 300 ? 0.33144 0.26947 0.21531 -0.07068 -0.01983 -0.05334 300 TRP A CH2 
2687 N  N   . ALA A 301 ? 0.21531 0.21115 0.11871 0.01867  -0.00258 -0.02789 301 ALA A N   
2688 C  CA  . ALA A 301 ? 0.20959 0.21747 0.13412 0.01751  0.00830  -0.01111 301 ALA A CA  
2689 C  C   . ALA A 301 ? 0.20097 0.20630 0.12340 0.00946  0.00233  -0.00658 301 ALA A C   
2690 O  O   . ALA A 301 ? 0.21411 0.21651 0.13064 0.01442  0.00316  -0.00503 301 ALA A O   
2691 C  CB  . ALA A 301 ? 0.21759 0.23928 0.17121 0.01460  0.02498  -0.00734 301 ALA A CB  
2692 N  N   . SER A 302 ? 0.18921 0.19736 0.12354 0.00582  -0.00086 -0.01733 302 SER A N   
2693 C  CA  A SER A 302 ? 0.18707 0.19910 0.12596 -0.00033 -0.00561 -0.02712 302 SER A CA  
2694 C  CA  B SER A 302 ? 0.19149 0.19298 0.11436 0.00214  -0.01287 -0.01808 302 SER A CA  
2695 C  C   . SER A 302 ? 0.18195 0.18085 0.11637 -0.00163 -0.01389 -0.02508 302 SER A C   
2696 O  O   . SER A 302 ? 0.19531 0.18178 0.12663 -0.00322 -0.02490 -0.01708 302 SER A O   
2697 C  CB  A SER A 302 ? 0.20438 0.22086 0.13064 -0.00149 -0.02269 -0.04334 302 SER A CB  
2698 C  CB  B SER A 302 ? 0.20588 0.20058 0.11942 0.00144  -0.02524 -0.01152 302 SER A CB  
2699 O  OG  A SER A 302 ? 0.20939 0.23400 0.13359 0.00704  -0.01355 -0.04822 302 SER A OG  
2700 O  OG  B SER A 302 ? 0.21997 0.20446 0.13573 0.00466  -0.04080 0.00862  302 SER A OG  
2701 N  N   . ALA A 303 ? 0.17760 0.18753 0.12046 -0.01040 -0.01891 -0.02498 303 ALA A N   
2702 C  CA  . ALA A 303 ? 0.17835 0.18500 0.13416 -0.01080 -0.01784 -0.01469 303 ALA A CA  
2703 C  C   . ALA A 303 ? 0.17454 0.18577 0.13079 -0.00131 -0.01901 -0.02529 303 ALA A C   
2704 O  O   . ALA A 303 ? 0.18101 0.19691 0.13847 0.00018  -0.01465 -0.01763 303 ALA A O   
2705 C  CB  . ALA A 303 ? 0.18814 0.19396 0.14432 -0.01974 -0.01357 -0.00333 303 ALA A CB  
2706 N  N   . ALA A 304 ? 0.19110 0.19315 0.12137 -0.00040 -0.02023 -0.01679 304 ALA A N   
2707 C  CA  . ALA A 304 ? 0.20575 0.20539 0.11879 0.01385  -0.01915 -0.02389 304 ALA A CA  
2708 C  C   . ALA A 304 ? 0.18988 0.20500 0.11305 0.01179  -0.02206 -0.02435 304 ALA A C   
2709 O  O   . ALA A 304 ? 0.19580 0.20138 0.12151 0.01935  -0.02298 -0.02271 304 ALA A O   
2710 C  CB  . ALA A 304 ? 0.24342 0.21962 0.12716 0.01678  -0.00877 -0.03555 304 ALA A CB  
2711 N  N   . GLY A 305 ? 0.17694 0.19253 0.11358 0.00093  -0.00701 -0.02474 305 GLY A N   
2712 C  CA  . GLY A 305 ? 0.17079 0.19165 0.12507 0.00150  -0.01201 -0.01225 305 GLY A CA  
2713 C  C   . GLY A 305 ? 0.16743 0.18011 0.11037 0.00346  -0.02385 -0.00928 305 GLY A C   
2714 O  O   . GLY A 305 ? 0.18691 0.18481 0.12289 0.00165  -0.01766 0.00164  305 GLY A O   
2715 N  N   . CYS A 306 ? 0.17135 0.18190 0.10327 -0.00509 -0.01512 -0.01636 306 CYS A N   
2716 C  CA  . CYS A 306 ? 0.17574 0.17700 0.10961 0.00290  -0.01896 -0.01438 306 CYS A CA  
2717 C  C   . CYS A 306 ? 0.16754 0.18087 0.10189 -0.00112 -0.02109 -0.01939 306 CYS A C   
2718 O  O   . CYS A 306 ? 0.18433 0.19525 0.11047 -0.00079 -0.02531 -0.02046 306 CYS A O   
2719 C  CB  . CYS A 306 ? 0.18770 0.18832 0.10161 -0.01104 -0.02644 -0.01416 306 CYS A CB  
2720 S  SG  . CYS A 306 ? 0.20642 0.20756 0.11394 -0.00662 -0.01804 -0.00715 306 CYS A SG  
2721 N  N   . MET A 307 ? 0.16902 0.19129 0.10173 -0.01081 -0.02456 -0.02198 307 MET A N   
2722 C  CA  . MET A 307 ? 0.17705 0.20267 0.10132 -0.01415 -0.03413 -0.02057 307 MET A CA  
2723 C  C   . MET A 307 ? 0.17757 0.19766 0.10034 0.00427  -0.02600 -0.02433 307 MET A C   
2724 O  O   . MET A 307 ? 0.18533 0.20278 0.12038 0.00141  -0.02335 -0.01377 307 MET A O   
2725 C  CB  . MET A 307 ? 0.18515 0.21722 0.11149 -0.02625 -0.02312 -0.01715 307 MET A CB  
2726 C  CG  . MET A 307 ? 0.20800 0.22770 0.12027 -0.03541 -0.02066 -0.02504 307 MET A CG  
2727 S  SD  . MET A 307 ? 0.22207 0.23602 0.13588 -0.04207 -0.02780 -0.02020 307 MET A SD  
2728 C  CE  . MET A 307 ? 0.26459 0.24987 0.16567 -0.00694 -0.02997 -0.03830 307 MET A CE  
2729 N  N   . ARG A 308 ? 0.19479 0.19538 0.10556 -0.00154 -0.00502 -0.01681 308 ARG A N   
2730 C  CA  . ARG A 308 ? 0.19068 0.19381 0.10721 -0.00058 -0.00550 -0.01643 308 ARG A CA  
2731 C  C   . ARG A 308 ? 0.17131 0.19455 0.09694 -0.00092 -0.01206 -0.01582 308 ARG A C   
2732 O  O   . ARG A 308 ? 0.19841 0.20400 0.09620 0.00628  -0.01435 -0.01436 308 ARG A O   
2733 C  CB  . ARG A 308 ? 0.20519 0.20485 0.12082 -0.00012 0.00575  -0.02249 308 ARG A CB  
2734 C  CG  . ARG A 308 ? 0.21190 0.22716 0.12667 -0.00758 0.00803  -0.02893 308 ARG A CG  
2735 C  CD  . ARG A 308 ? 0.21936 0.26720 0.13682 -0.02007 0.02031  -0.04316 308 ARG A CD  
2736 N  NE  . ARG A 308 ? 0.23719 0.30859 0.13754 -0.02974 0.02714  -0.05409 308 ARG A NE  
2737 C  CZ  . ARG A 308 ? 0.25924 0.38875 0.15177 -0.04378 0.02728  -0.05790 308 ARG A CZ  
2738 N  NH1 . ARG A 308 ? 0.28822 0.42607 0.15689 -0.04004 0.00215  -0.08636 308 ARG A NH1 
2739 N  NH2 . ARG A 308 ? 0.29325 0.46202 0.17556 -0.06959 0.05205  -0.02213 308 ARG A NH2 
2740 N  N   . ASN A 309 ? 0.17520 0.18741 0.09765 -0.00048 -0.01328 -0.01795 309 ASN A N   
2741 C  CA  . ASN A 309 ? 0.17243 0.18691 0.09625 0.00137  -0.01892 -0.01419 309 ASN A CA  
2742 C  C   . ASN A 309 ? 0.16147 0.18175 0.09543 -0.00295 -0.02149 -0.00989 309 ASN A C   
2743 O  O   . ASN A 309 ? 0.17292 0.18215 0.10884 -0.00042 -0.01767 -0.00876 309 ASN A O   
2744 C  CB  . ASN A 309 ? 0.16101 0.20638 0.09378 0.00077  -0.01652 -0.00952 309 ASN A CB  
2745 C  CG  . ASN A 309 ? 0.15618 0.21733 0.10738 -0.00389 -0.00821 -0.00089 309 ASN A CG  
2746 O  OD1 . ASN A 309 ? 0.16962 0.25549 0.12455 0.01222  0.00502  0.02131  309 ASN A OD1 
2747 N  ND2 . ASN A 309 ? 0.16302 0.21672 0.10520 0.00169  -0.01570 -0.00262 309 ASN A ND2 
2748 N  N   . TYR A 310 ? 0.16001 0.19435 0.07974 -0.00146 -0.02148 -0.00634 310 TYR A N   
2749 C  CA  . TYR A 310 ? 0.16090 0.19408 0.08933 0.00064  -0.01804 0.00060  310 TYR A CA  
2750 C  C   . TYR A 310 ? 0.16110 0.19581 0.09338 -0.00547 -0.01856 0.00215  310 TYR A C   
2751 O  O   . TYR A 310 ? 0.17282 0.20140 0.09724 -0.00281 -0.01564 0.00689  310 TYR A O   
2752 C  CB  . TYR A 310 ? 0.16942 0.20240 0.10210 -0.00498 -0.00889 -0.00008 310 TYR A CB  
2753 C  CG  . TYR A 310 ? 0.17205 0.20459 0.10496 -0.00366 -0.01463 -0.00045 310 TYR A CG  
2754 C  CD1 . TYR A 310 ? 0.18944 0.22235 0.11437 0.00123  -0.01949 0.00084  310 TYR A CD1 
2755 C  CD2 . TYR A 310 ? 0.17021 0.21419 0.11223 -0.00905 -0.01191 -0.00598 310 TYR A CD2 
2756 C  CE1 . TYR A 310 ? 0.18453 0.23884 0.13722 0.00387  -0.01684 0.00045  310 TYR A CE1 
2757 C  CE2 . TYR A 310 ? 0.17666 0.23438 0.12614 -0.00304 -0.00988 -0.01015 310 TYR A CE2 
2758 C  CZ  . TYR A 310 ? 0.17899 0.24402 0.15205 0.01049  -0.00576 -0.00472 310 TYR A CZ  
2759 O  OH  . TYR A 310 ? 0.19326 0.27810 0.19471 0.03234  0.01194  -0.00518 310 TYR A OH  
2760 N  N   . LEU A 311 ? 0.18024 0.20598 0.08814 -0.01166 -0.02595 0.00069  311 LEU A N   
2761 C  CA  . LEU A 311 ? 0.19830 0.20858 0.08221 -0.01206 -0.02370 -0.00709 311 LEU A CA  
2762 C  C   . LEU A 311 ? 0.18976 0.21063 0.08349 -0.00135 -0.02403 -0.00528 311 LEU A C   
2763 O  O   . LEU A 311 ? 0.21299 0.22313 0.09876 0.00078  -0.03257 0.00109  311 LEU A O   
2764 C  CB  . LEU A 311 ? 0.22103 0.22426 0.10066 -0.02413 -0.02360 -0.01009 311 LEU A CB  
2765 C  CG  . LEU A 311 ? 0.24637 0.24961 0.13594 -0.04205 -0.03967 -0.00564 311 LEU A CG  
2766 C  CD1 . LEU A 311 ? 0.29620 0.25105 0.18048 -0.04638 -0.03380 -0.02997 311 LEU A CD1 
2767 C  CD2 . LEU A 311 ? 0.23457 0.29403 0.16614 -0.05622 -0.05598 0.00900  311 LEU A CD2 
2768 N  N   . ILE A 312 ? 0.19200 0.20723 0.08917 -0.00568 -0.01005 -0.01295 312 ILE A N   
2769 C  CA  . ILE A 312 ? 0.19377 0.20616 0.09708 -0.00343 -0.00460 0.00614  312 ILE A CA  
2770 C  C   . ILE A 312 ? 0.19436 0.20077 0.08142 -0.00294 -0.00962 0.00422  312 ILE A C   
2771 O  O   . ILE A 312 ? 0.21054 0.20422 0.09028 -0.00363 -0.00302 0.00505  312 ILE A O   
2772 C  CB  . ILE A 312 ? 0.19638 0.21066 0.14068 0.00079  0.01212  0.00120  312 ILE A CB  
2773 C  CG1 . ILE A 312 ? 0.21632 0.22725 0.16741 0.01493  0.02429  -0.00552 312 ILE A CG1 
2774 C  CG2 . ILE A 312 ? 0.21548 0.22589 0.19563 -0.01287 0.01035  0.00526  312 ILE A CG2 
2775 C  CD1 . ILE A 312 ? 0.22293 0.24457 0.21985 0.01561  0.02827  0.00555  312 ILE A CD1 
2776 N  N   . LEU A 313 ? 0.18710 0.19099 0.08138 -0.00110 -0.01566 -0.00758 313 LEU A N   
2777 C  CA  . LEU A 313 ? 0.19123 0.19331 0.08918 0.00956  -0.01920 0.00046  313 LEU A CA  
2778 C  C   . LEU A 313 ? 0.19573 0.19798 0.08919 0.00337  -0.02193 0.00684  313 LEU A C   
2779 O  O   . LEU A 313 ? 0.20803 0.19860 0.10238 0.00929  -0.02263 0.00674  313 LEU A O   
2780 C  CB  . LEU A 313 ? 0.19183 0.20660 0.08853 0.00430  -0.03150 -0.00300 313 LEU A CB  
2781 C  CG  . LEU A 313 ? 0.20607 0.23034 0.10858 -0.00881 -0.04194 -0.00880 313 LEU A CG  
2782 C  CD1 . LEU A 313 ? 0.24266 0.27004 0.10756 0.00717  -0.05188 0.00476  313 LEU A CD1 
2783 C  CD2 . LEU A 313 ? 0.22698 0.24133 0.16651 -0.01724 -0.05172 -0.00819 313 LEU A CD2 
2784 N  N   . LYS A 314 ? 0.18803 0.20606 0.08842 0.00433  -0.02675 0.01149  314 LYS A N   
2785 C  CA  . LYS A 314 ? 0.18727 0.21721 0.10131 0.00451  -0.03719 0.01974  314 LYS A CA  
2786 C  C   . LYS A 314 ? 0.19441 0.21820 0.09753 0.00961  -0.03609 0.01026  314 LYS A C   
2787 O  O   . LYS A 314 ? 0.20745 0.22866 0.11256 0.01761  -0.01810 0.01559  314 LYS A O   
2788 C  CB  . LYS A 314 ? 0.19892 0.24874 0.12390 -0.00624 -0.04241 0.01489  314 LYS A CB  
2789 C  CG  . LYS A 314 ? 0.21940 0.28207 0.16208 -0.01744 -0.04968 0.00552  314 LYS A CG  
2790 C  CD  . LYS A 314 ? 0.24204 0.33162 0.22251 -0.03466 -0.06706 0.01093  314 LYS A CD  
2791 C  CE  . LYS A 314 ? 0.27987 0.39453 0.32811 -0.04146 -0.09887 -0.00565 314 LYS A CE  
2792 N  NZ  . LYS A 314 ? 0.36431 0.44426 0.44975 -0.07310 -0.14027 -0.01355 314 LYS A NZ  
2793 N  N   . GLU A 315 ? 0.21517 0.21760 0.08276 -0.00074 -0.02605 0.00843  315 GLU A N   
2794 C  CA  . GLU A 315 ? 0.24131 0.22995 0.08338 0.00857  -0.01367 0.00457  315 GLU A CA  
2795 C  C   . GLU A 315 ? 0.22790 0.22588 0.07944 0.01013  -0.02623 0.01164  315 GLU A C   
2796 O  O   . GLU A 315 ? 0.24567 0.23465 0.09669 0.00845  -0.03498 0.01650  315 GLU A O   
2797 C  CB  . GLU A 315 ? 0.30201 0.26294 0.09451 0.01751  0.00314  0.00136  315 GLU A CB  
2798 C  CG  . GLU A 315 ? 0.36235 0.32559 0.12496 0.02692  0.02618  0.01188  315 GLU A CG  
2799 C  CD  . GLU A 315 ? 0.40040 0.44594 0.19793 0.03191  0.02303  -0.01450 315 GLU A CD  
2800 O  OE1 . GLU A 315 ? 0.37475 0.46630 0.26013 -0.00547 -0.00437 -0.05920 315 GLU A OE1 
2801 O  OE2 . GLU A 315 ? 0.52412 0.54927 0.23190 0.12220  0.00253  -0.07527 315 GLU A OE2 
2802 N  N   . ARG A 316 ? 0.21368 0.21853 0.08903 0.01408  -0.01106 0.00507  316 ARG A N   
2803 C  CA  . ARG A 316 ? 0.21256 0.21687 0.10200 0.00543  -0.01532 0.01227  316 ARG A CA  
2804 C  C   . ARG A 316 ? 0.20837 0.21428 0.10011 0.00657  -0.01517 0.01764  316 ARG A C   
2805 O  O   . ARG A 316 ? 0.22406 0.21328 0.11887 0.01297  -0.00917 0.02568  316 ARG A O   
2806 C  CB  . ARG A 316 ? 0.20496 0.23044 0.12582 0.01240  -0.00681 0.00605  316 ARG A CB  
2807 C  CG  . ARG A 316 ? 0.20646 0.23956 0.15073 0.01322  0.00859  0.00149  316 ARG A CG  
2808 C  CD  . ARG A 316 ? 0.23263 0.25866 0.16394 0.03161  0.02184  -0.00958 316 ARG A CD  
2809 N  NE  . ARG A 316 ? 0.26221 0.29316 0.16390 0.04156  0.00358  -0.02082 316 ARG A NE  
2810 C  CZ  . ARG A 316 ? 0.26265 0.30671 0.15622 0.05781  -0.00650 -0.03380 316 ARG A CZ  
2811 N  NH1 . ARG A 316 ? 0.26433 0.29595 0.15268 0.02795  0.00424  -0.02790 316 ARG A NH1 
2812 N  NH2 . ARG A 316 ? 0.27116 0.36260 0.16484 0.09284  -0.01330 -0.06692 316 ARG A NH2 
2813 N  N   . ALA A 317 ? 0.19639 0.21719 0.09421 0.01583  -0.01293 0.00971  317 ALA A N   
2814 C  CA  . ALA A 317 ? 0.20633 0.22675 0.10012 0.03280  -0.00774 0.01730  317 ALA A CA  
2815 C  C   . ALA A 317 ? 0.20821 0.22550 0.12310 0.02163  -0.01133 0.01653  317 ALA A C   
2816 O  O   . ALA A 317 ? 0.21603 0.23496 0.13427 0.03120  -0.01497 0.01939  317 ALA A O   
2817 C  CB  . ALA A 317 ? 0.22487 0.25092 0.10666 0.03233  -0.00101 0.01921  317 ALA A CB  
2818 N  N   . ALA A 318 ? 0.21231 0.22962 0.12733 0.01237  -0.02756 0.02159  318 ALA A N   
2819 C  CA  . ALA A 318 ? 0.22819 0.24138 0.14268 0.00688  -0.04553 0.02833  318 ALA A CA  
2820 C  C   . ALA A 318 ? 0.22969 0.24544 0.13526 0.01530  -0.04494 0.02113  318 ALA A C   
2821 O  O   . ALA A 318 ? 0.23499 0.25973 0.16539 0.02291  -0.05210 0.03014  318 ALA A O   
2822 C  CB  . ALA A 318 ? 0.25924 0.26325 0.16850 -0.01498 -0.06097 0.03325  318 ALA A CB  
2823 N  N   . ALA A 319 ? 0.23915 0.24112 0.11170 0.01367  -0.03169 0.02168  319 ALA A N   
2824 C  CA  . ALA A 319 ? 0.25041 0.24337 0.11197 0.01211  -0.02187 0.02664  319 ALA A CA  
2825 C  C   . ALA A 319 ? 0.24465 0.23704 0.10454 0.01753  -0.03155 0.03111  319 ALA A C   
2826 O  O   . ALA A 319 ? 0.28143 0.24086 0.10917 0.02222  -0.03183 0.02773  319 ALA A O   
2827 C  CB  . ALA A 319 ? 0.27429 0.25153 0.12871 0.00794  0.00070  0.01635  319 ALA A CB  
2828 N  N   . PHE A 320 ? 0.22360 0.22660 0.10670 0.01511  -0.02297 0.01725  320 PHE A N   
2829 C  CA  . PHE A 320 ? 0.21054 0.22320 0.10776 0.02128  -0.02921 0.02037  320 PHE A CA  
2830 C  C   . PHE A 320 ? 0.22040 0.22440 0.10452 0.01984  -0.03029 0.02543  320 PHE A C   
2831 O  O   . PHE A 320 ? 0.24041 0.22889 0.13332 0.01970  -0.03318 0.03193  320 PHE A O   
2832 C  CB  . PHE A 320 ? 0.20742 0.23196 0.11021 0.02171  -0.02978 0.03197  320 PHE A CB  
2833 C  CG  . PHE A 320 ? 0.20170 0.24261 0.10889 0.02531  -0.02180 0.03403  320 PHE A CG  
2834 C  CD1 . PHE A 320 ? 0.20455 0.23289 0.11331 0.02999  -0.03626 0.03286  320 PHE A CD1 
2835 C  CD2 . PHE A 320 ? 0.22246 0.28507 0.11993 0.00617  -0.00476 0.02546  320 PHE A CD2 
2836 C  CE1 . PHE A 320 ? 0.21570 0.25113 0.11950 0.03253  -0.04316 0.01485  320 PHE A CE1 
2837 C  CE2 . PHE A 320 ? 0.23874 0.30794 0.12323 0.02067  -0.01363 0.00829  320 PHE A CE2 
2838 C  CZ  . PHE A 320 ? 0.23849 0.28110 0.11780 0.04011  -0.03786 0.00363  320 PHE A CZ  
2839 N  N   . ARG A 321 ? 0.20479 0.24074 0.11379 0.01974  -0.03219 0.03227  321 ARG A N   
2840 C  CA  . ARG A 321 ? 0.21374 0.26073 0.14099 0.03167  -0.03463 0.04559  321 ARG A CA  
2841 C  C   . ARG A 321 ? 0.23609 0.27624 0.15254 0.03919  -0.04828 0.03589  321 ARG A C   
2842 O  O   . ARG A 321 ? 0.25513 0.29764 0.18669 0.07214  -0.04787 0.04249  321 ARG A O   
2843 C  CB  . ARG A 321 ? 0.21352 0.27392 0.15489 0.03114  -0.02434 0.04562  321 ARG A CB  
2844 C  CG  . ARG A 321 ? 0.24076 0.27380 0.15885 0.04688  -0.01107 0.04111  321 ARG A CG  
2845 C  CD  . ARG A 321 ? 0.28605 0.27159 0.16375 0.06939  -0.00072 0.04475  321 ARG A CD  
2846 N  NE  . ARG A 321 ? 0.28108 0.25281 0.15712 0.05491  0.00433  0.04373  321 ARG A NE  
2847 C  CZ  . ARG A 321 ? 0.29285 0.24173 0.17188 0.05193  0.00935  0.03812  321 ARG A CZ  
2848 N  NH1 . ARG A 321 ? 0.36090 0.24590 0.19653 0.05709  0.02321  0.03954  321 ARG A NH1 
2849 N  NH2 . ARG A 321 ? 0.31126 0.25112 0.16685 0.03847  0.00725  0.02566  321 ARG A NH2 
2850 N  N   . ALA A 322 ? 0.25897 0.26935 0.13442 0.02668  -0.06755 0.03201  322 ALA A N   
2851 C  CA  . ALA A 322 ? 0.28520 0.28923 0.13815 0.01407  -0.08061 0.03449  322 ALA A CA  
2852 C  C   . ALA A 322 ? 0.28542 0.29611 0.13753 0.01950  -0.06547 0.03833  322 ALA A C   
2853 O  O   . ALA A 322 ? 0.33106 0.32792 0.15608 0.01676  -0.09392 0.06378  322 ALA A O   
2854 C  CB  . ALA A 322 ? 0.33526 0.29367 0.16113 0.00668  -0.09979 0.03066  322 ALA A CB  
2855 N  N   . ASP A 323 ? 0.26740 0.27103 0.11382 0.02274  -0.04116 0.02784  323 ASP A N   
2856 C  CA  . ASP A 323 ? 0.27418 0.26028 0.10956 0.03449  -0.03318 0.02709  323 ASP A CA  
2857 C  C   . ASP A 323 ? 0.27648 0.26014 0.10091 0.03555  -0.03693 0.02763  323 ASP A C   
2858 O  O   . ASP A 323 ? 0.26330 0.25986 0.10181 0.04334  -0.03629 0.02320  323 ASP A O   
2859 C  CB  . ASP A 323 ? 0.27427 0.26448 0.11540 0.03332  -0.02598 0.03336  323 ASP A CB  
2860 C  CG  . ASP A 323 ? 0.27441 0.28649 0.13841 0.03748  -0.01168 0.04709  323 ASP A CG  
2861 O  OD1 . ASP A 323 ? 0.29723 0.29279 0.15814 0.03834  -0.00955 0.06398  323 ASP A OD1 
2862 O  OD2 . ASP A 323 ? 0.26314 0.31416 0.18329 0.03010  -0.01600 0.06216  323 ASP A OD2 
2863 N  N   . PRO A 324 ? 0.31937 0.27378 0.10515 0.04700  -0.04156 0.03019  324 PRO A N   
2864 C  CA  A PRO A 324 ? 0.32583 0.27268 0.12708 0.05753  -0.05159 0.04164  324 PRO A CA  
2865 C  CA  B PRO A 324 ? 0.31576 0.27724 0.10419 0.04227  -0.03189 0.02466  324 PRO A CA  
2866 C  C   . PRO A 324 ? 0.30212 0.26506 0.11332 0.04951  -0.02252 0.03228  324 PRO A C   
2867 O  O   . PRO A 324 ? 0.29618 0.26848 0.12581 0.05337  -0.02554 0.03115  324 PRO A O   
2868 C  CB  A PRO A 324 ? 0.36201 0.30207 0.14431 0.06312  -0.06289 0.05578  324 PRO A CB  
2869 C  CB  B PRO A 324 ? 0.32840 0.29922 0.10290 0.02339  -0.04199 0.02746  324 PRO A CB  
2870 C  CG  A PRO A 324 ? 0.37138 0.31575 0.14247 0.06709  -0.05486 0.04935  324 PRO A CG  
2871 C  CG  B PRO A 324 ? 0.32082 0.30322 0.10704 0.01872  -0.03411 0.04439  324 PRO A CG  
2872 C  CD  A PRO A 324 ? 0.35115 0.29061 0.11568 0.05767  -0.04853 0.02978  324 PRO A CD  
2873 C  CD  B PRO A 324 ? 0.33564 0.29090 0.10234 0.02845  -0.03247 0.03519  324 PRO A CD  
2874 N  N   A GLU A 325 ? 0.29186 0.25884 0.09751 0.03899  -0.00983 0.03721  325 GLU A N   
2875 N  N   B GLU A 325 ? 0.29749 0.25199 0.12747 0.04879  -0.00024 0.03080  325 GLU A N   
2876 C  CA  A GLU A 325 ? 0.28454 0.26664 0.11716 0.02181  -0.00191 0.03522  325 GLU A CA  
2877 C  CA  B GLU A 325 ? 0.29052 0.25831 0.13505 0.04256  0.00879  0.03290  325 GLU A CA  
2878 C  C   A GLU A 325 ? 0.24933 0.24566 0.11726 0.02484  -0.00992 0.03178  325 GLU A C   
2879 C  C   B GLU A 325 ? 0.25254 0.24155 0.12186 0.03218  -0.00552 0.02617  325 GLU A C   
2880 O  O   A GLU A 325 ? 0.26690 0.24407 0.12446 0.01326  -0.00279 0.03011  325 GLU A O   
2881 O  O   B GLU A 325 ? 0.26542 0.24545 0.12522 0.01922  -0.00335 0.01929  325 GLU A O   
2882 C  CB  A GLU A 325 ? 0.30436 0.31614 0.14489 -0.00825 0.01503  0.03957  325 GLU A CB  
2883 C  CB  B GLU A 325 ? 0.32528 0.29771 0.16478 0.04246  0.03697  0.04829  325 GLU A CB  
2884 C  CG  A GLU A 325 ? 0.33948 0.36613 0.20580 -0.04044 0.00855  0.03304  325 GLU A CG  
2885 C  CG  B GLU A 325 ? 0.38125 0.34825 0.21727 0.01775  0.05559  0.07538  325 GLU A CG  
2886 C  CD  A GLU A 325 ? 0.38526 0.48468 0.35005 -0.09396 0.05097  0.00715  325 GLU A CD  
2887 C  CD  B GLU A 325 ? 0.41127 0.42816 0.34622 0.01241  0.06162  0.10834  325 GLU A CD  
2888 O  OE1 A GLU A 325 ? 0.37046 0.60217 0.42232 -0.09383 0.13215  -0.07575 325 GLU A OE1 
2889 O  OE1 B GLU A 325 ? 0.40957 0.39127 0.50696 0.04926  0.04696  0.12171  325 GLU A OE1 
2890 O  OE2 A GLU A 325 ? 0.44250 0.51778 0.45750 -0.15517 0.01367  0.04087  325 GLU A OE2 
2891 O  OE2 B GLU A 325 ? 0.47635 0.52851 0.34548 -0.00232 0.10695  0.12916  325 GLU A OE2 
2892 N  N   . VAL A 326 ? 0.23075 0.23471 0.11352 0.03164  -0.01484 0.03293  326 VAL A N   
2893 C  CA  . VAL A 326 ? 0.21842 0.22886 0.10595 0.02922  -0.01766 0.02447  326 VAL A CA  
2894 C  C   . VAL A 326 ? 0.21485 0.23038 0.10331 0.03708  -0.02970 0.02508  326 VAL A C   
2895 O  O   . VAL A 326 ? 0.21973 0.23870 0.10324 0.04424  -0.02683 0.02560  326 VAL A O   
2896 C  CB  . VAL A 326 ? 0.22024 0.23252 0.11485 0.03789  -0.02558 0.02510  326 VAL A CB  
2897 C  CG1 . VAL A 326 ? 0.22929 0.23838 0.12078 0.03590  -0.01644 0.02852  326 VAL A CG1 
2898 C  CG2 . VAL A 326 ? 0.22938 0.23506 0.12744 0.03560  -0.02290 0.01866  326 VAL A CG2 
2899 N  N   . GLN A 327 ? 0.21336 0.24171 0.10939 0.03915  -0.03130 0.02583  327 GLN A N   
2900 C  CA  . GLN A 327 ? 0.21382 0.26062 0.12425 0.04326  -0.03443 0.02063  327 GLN A CA  
2901 C  C   . GLN A 327 ? 0.22938 0.25290 0.11498 0.05143  -0.03275 0.02880  327 GLN A C   
2902 O  O   . GLN A 327 ? 0.22695 0.26811 0.13766 0.05407  -0.02618 0.01825  327 GLN A O   
2903 C  CB  . GLN A 327 ? 0.23103 0.28918 0.15385 0.03244  -0.05535 0.02576  327 GLN A CB  
2904 C  CG  . GLN A 327 ? 0.28684 0.30108 0.20231 0.02088  -0.08356 0.02170  327 GLN A CG  
2905 C  CD  . GLN A 327 ? 0.38413 0.34609 0.27545 0.03171  -0.14422 0.01820  327 GLN A CD  
2906 O  OE1 . GLN A 327 ? 0.48175 0.38151 0.31377 0.04512  -0.20210 0.03351  327 GLN A OE1 
2907 N  NE2 . GLN A 327 ? 0.40584 0.35023 0.31835 0.02807  -0.15309 0.00482  327 GLN A NE2 
2908 N  N   A GLU A 328 ? 0.23639 0.23558 0.10203 0.04295  -0.03369 0.03229  328 GLU A N   
2909 N  N   B GLU A 328 ? 0.25208 0.24628 0.10545 0.05357  -0.03122 0.04066  328 GLU A N   
2910 N  N   C GLU A 328 ? 0.24497 0.26040 0.12606 0.04874  -0.01910 0.02014  328 GLU A N   
2911 C  CA  A GLU A 328 ? 0.23881 0.22397 0.09372 0.03421  -0.03013 0.03487  328 GLU A CA  
2912 C  CA  B GLU A 328 ? 0.28868 0.24602 0.11393 0.04697  -0.02430 0.05109  328 GLU A CA  
2913 C  CA  C GLU A 328 ? 0.27555 0.27036 0.15229 0.04413  -0.01208 0.00623  328 GLU A CA  
2914 C  C   A GLU A 328 ? 0.23603 0.23193 0.10110 0.03234  -0.02066 0.02255  328 GLU A C   
2915 C  C   B GLU A 328 ? 0.24590 0.22389 0.10941 0.04182  -0.01968 0.04984  328 GLU A C   
2916 C  C   C GLU A 328 ? 0.23651 0.24658 0.14224 0.04152  -0.00810 0.00757  328 GLU A C   
2917 O  O   A GLU A 328 ? 0.25302 0.24981 0.11662 0.02401  -0.01059 -0.00018 328 GLU A O   
2918 O  O   B GLU A 328 ? 0.25030 0.21348 0.11316 0.04912  -0.01782 0.06250  328 GLU A O   
2919 O  O   C GLU A 328 ? 0.24569 0.26301 0.15293 0.03489  0.00522  -0.01172 328 GLU A O   
2920 C  CB  A GLU A 328 ? 0.24547 0.21094 0.09140 0.02783  -0.03728 0.03948  328 GLU A CB  
2921 C  CB  B GLU A 328 ? 0.39178 0.28452 0.13664 0.04407  -0.02059 0.05867  328 GLU A CB  
2922 C  CB  C GLU A 328 ? 0.35284 0.31907 0.19191 0.04670  0.00357  -0.00013 328 GLU A CB  
2923 C  CG  A GLU A 328 ? 0.27297 0.21300 0.10139 0.02517  -0.03288 0.03662  328 GLU A CG  
2924 C  CG  B GLU A 328 ? 0.52690 0.37606 0.18659 0.04045  -0.04380 0.05313  328 GLU A CG  
2925 C  CG  C GLU A 328 ? 0.42642 0.38046 0.28130 0.07408  0.00071  0.00408  328 GLU A CG  
2926 C  CD  A GLU A 328 ? 0.32584 0.25872 0.13943 0.02330  -0.01954 0.04247  328 GLU A CD  
2927 C  CD  B GLU A 328 ? 0.67671 0.52357 0.26356 -0.03135 -0.00147 0.08583  328 GLU A CD  
2928 C  CD  C GLU A 328 ? 0.51497 0.45287 0.38220 0.04713  -0.00827 0.00861  328 GLU A CD  
2929 O  OE1 A GLU A 328 ? 0.37821 0.29787 0.14007 0.03472  -0.02634 0.04640  328 GLU A OE1 
2930 O  OE1 B GLU A 328 ? 0.74603 0.52257 0.33440 -0.11829 0.07381  0.13006  328 GLU A OE1 
2931 O  OE1 C GLU A 328 ? 0.59716 0.48108 0.36290 0.00073  -0.01097 0.10595  328 GLU A OE1 
2932 O  OE2 A GLU A 328 ? 0.32596 0.28852 0.19512 0.00860  -0.01837 0.06082  328 GLU A OE2 
2933 O  OE2 B GLU A 328 ? 0.79659 0.67296 0.27435 -0.06164 0.00235  0.05049  328 GLU A OE2 
2934 O  OE2 C GLU A 328 ? 0.49748 0.51688 0.47199 0.08615  -0.02536 -0.04218 328 GLU A OE2 
2935 N  N   . ALA A 329 ? 0.22314 0.22985 0.10801 0.03300  -0.01981 0.03340  329 ALA A N   
2936 C  CA  . ALA A 329 ? 0.20025 0.23307 0.10330 0.02573  -0.01120 0.03009  329 ALA A CA  
2937 C  C   . ALA A 329 ? 0.19502 0.22149 0.10264 0.01963  -0.01659 0.02559  329 ALA A C   
2938 O  O   . ALA A 329 ? 0.20061 0.23652 0.11043 0.01077  -0.01818 0.01031  329 ALA A O   
2939 C  CB  . ALA A 329 ? 0.20678 0.25232 0.12058 0.03253  -0.00227 0.01949  329 ALA A CB  
2940 N  N   . LEU A 330 ? 0.19404 0.22181 0.10276 0.02061  -0.01045 0.02799  330 LEU A N   
2941 C  CA  . LEU A 330 ? 0.19535 0.22400 0.10631 0.01732  -0.01103 0.02638  330 LEU A CA  
2942 C  C   . LEU A 330 ? 0.20244 0.22709 0.10350 0.03083  -0.01591 0.02907  330 LEU A C   
2943 O  O   . LEU A 330 ? 0.21826 0.24046 0.10939 0.04204  -0.01243 0.02938  330 LEU A O   
2944 C  CB  . LEU A 330 ? 0.19919 0.22399 0.12658 0.02350  -0.02078 0.02559  330 LEU A CB  
2945 C  CG  . LEU A 330 ? 0.22451 0.23228 0.14311 0.01659  -0.01668 0.03474  330 LEU A CG  
2946 C  CD1 . LEU A 330 ? 0.26386 0.24703 0.16816 -0.00468 -0.02075 0.02257  330 LEU A CD1 
2947 C  CD2 . LEU A 330 ? 0.23567 0.24305 0.14744 0.02747  -0.01823 0.04479  330 LEU A CD2 
2948 N  N   A ARG A 331 ? 0.20660 0.23044 0.10842 0.03960  -0.01829 0.03539  331 ARG A N   
2949 N  N   B ARG A 331 ? 0.20969 0.22942 0.11173 0.04021  -0.01733 0.03524  331 ARG A N   
2950 C  CA  A ARG A 331 ? 0.20480 0.24033 0.11446 0.04200  -0.02595 0.03866  331 ARG A CA  
2951 C  CA  B ARG A 331 ? 0.21157 0.24107 0.12340 0.04334  -0.02147 0.03842  331 ARG A CA  
2952 C  C   A ARG A 331 ? 0.20839 0.23135 0.12091 0.04464  -0.01767 0.03710  331 ARG A C   
2953 C  C   B ARG A 331 ? 0.21012 0.23112 0.12455 0.04543  -0.01590 0.03671  331 ARG A C   
2954 O  O   A ARG A 331 ? 0.21747 0.23948 0.13606 0.05090  -0.01286 0.03241  331 ARG A O   
2955 O  O   B ARG A 331 ? 0.21808 0.23891 0.13759 0.05133  -0.01227 0.03216  331 ARG A O   
2956 C  CB  A ARG A 331 ? 0.21285 0.26398 0.12518 0.03991  -0.03669 0.04342  331 ARG A CB  
2957 C  CB  B ARG A 331 ? 0.23104 0.27209 0.14708 0.04163  -0.02773 0.04567  331 ARG A CB  
2958 C  CG  A ARG A 331 ? 0.22105 0.29118 0.14115 0.03796  -0.05659 0.04531  331 ARG A CG  
2959 C  CG  B ARG A 331 ? 0.25364 0.31358 0.19381 0.03653  -0.04308 0.04982  331 ARG A CG  
2960 C  CD  A ARG A 331 ? 0.23419 0.32753 0.15776 0.03268  -0.06839 0.04140  331 ARG A CD  
2961 C  CD  B ARG A 331 ? 0.28567 0.38033 0.23853 0.04336  -0.05935 0.06965  331 ARG A CD  
2962 N  NE  A ARG A 331 ? 0.22834 0.34218 0.17514 0.05717  -0.07529 0.01657  331 ARG A NE  
2963 N  NE  B ARG A 331 ? 0.32789 0.45418 0.24446 0.04119  -0.05883 0.09080  331 ARG A NE  
2964 C  CZ  A ARG A 331 ? 0.27701 0.33973 0.20343 0.09744  -0.07660 0.01046  331 ARG A CZ  
2965 C  CZ  B ARG A 331 ? 0.37393 0.47879 0.23253 0.03893  -0.07695 0.09667  331 ARG A CZ  
2966 N  NH1 A ARG A 331 ? 0.29038 0.36189 0.20155 0.13590  -0.08473 -0.00146 331 ARG A NH1 
2967 N  NH1 B ARG A 331 ? 0.44529 0.47127 0.29225 0.04491  -0.13735 0.07616  331 ARG A NH1 
2968 N  NH2 A ARG A 331 ? 0.33172 0.33975 0.25164 0.07756  -0.05264 -0.00095 331 ARG A NH2 
2969 N  NH2 B ARG A 331 ? 0.38604 0.49421 0.19365 0.06346  -0.02930 0.11339  331 ARG A NH2 
2970 N  N   . ALA A 332 ? 0.21449 0.22354 0.11782 0.03442  -0.01579 0.04205  332 ALA A N   
2971 C  CA  . ALA A 332 ? 0.22011 0.22290 0.12403 0.01572  0.00401  0.03671  332 ALA A CA  
2972 C  C   . ALA A 332 ? 0.21256 0.20915 0.12246 0.01291  -0.00745 0.03259  332 ALA A C   
2973 O  O   . ALA A 332 ? 0.24532 0.20953 0.13810 0.00714  -0.00223 0.03378  332 ALA A O   
2974 C  CB  . ALA A 332 ? 0.24001 0.24197 0.13622 -0.00371 0.02075  0.03867  332 ALA A CB  
2975 N  N   . SER A 333 ? 0.19028 0.21010 0.10898 0.02026  -0.00833 0.03384  333 SER A N   
2976 C  CA  . SER A 333 ? 0.17465 0.20923 0.10775 0.03000  -0.00606 0.03128  333 SER A CA  
2977 C  C   . SER A 333 ? 0.17189 0.21476 0.11356 0.02360  -0.01201 0.03199  333 SER A C   
2978 O  O   . SER A 333 ? 0.17004 0.22996 0.11805 0.01852  -0.00497 0.03751  333 SER A O   
2979 C  CB  . SER A 333 ? 0.17024 0.21812 0.12006 0.03194  -0.00464 0.02839  333 SER A CB  
2980 O  OG  . SER A 333 ? 0.16912 0.22806 0.12857 0.03154  -0.00019 0.01806  333 SER A OG  
2981 N  N   . ARG A 334 ? 0.16570 0.21594 0.12434 0.02898  -0.00701 0.02994  334 ARG A N   
2982 C  CA  . ARG A 334 ? 0.16442 0.20821 0.13056 0.02702  -0.00785 0.02597  334 ARG A CA  
2983 C  C   . ARG A 334 ? 0.16620 0.20881 0.11143 0.02815  -0.01489 0.02939  334 ARG A C   
2984 O  O   . ARG A 334 ? 0.17243 0.22384 0.12476 0.02482  -0.00988 0.02144  334 ARG A O   
2985 C  CB  . ARG A 334 ? 0.18670 0.21166 0.15266 0.02516  -0.01314 0.02259  334 ARG A CB  
2986 C  CG  . ARG A 334 ? 0.20672 0.21463 0.16638 0.03010  -0.01117 0.02350  334 ARG A CG  
2987 C  CD  . ARG A 334 ? 0.22338 0.22336 0.15953 0.01873  -0.01447 0.02114  334 ARG A CD  
2988 N  NE  . ARG A 334 ? 0.21278 0.21256 0.15663 0.02005  -0.01829 0.02022  334 ARG A NE  
2989 C  CZ  . ARG A 334 ? 0.20798 0.21639 0.15145 0.02657  -0.01285 0.02331  334 ARG A CZ  
2990 N  NH1 . ARG A 334 ? 0.20715 0.23427 0.16163 0.03497  0.00077  0.01330  334 ARG A NH1 
2991 N  NH2 . ARG A 334 ? 0.22423 0.22574 0.15819 0.01735  -0.02179 0.01293  334 ARG A NH2 
2992 N  N   . LEU A 335 ? 0.17325 0.20958 0.12045 0.03056  -0.01364 0.03407  335 LEU A N   
2993 C  CA  . LEU A 335 ? 0.17372 0.21000 0.11654 0.02368  -0.00678 0.03358  335 LEU A CA  
2994 C  C   . LEU A 335 ? 0.17217 0.21132 0.11581 0.02453  -0.01683 0.03592  335 LEU A C   
2995 O  O   . LEU A 335 ? 0.18079 0.22401 0.14860 0.01911  -0.01239 0.05260  335 LEU A O   
2996 C  CB  . LEU A 335 ? 0.18092 0.21724 0.12466 0.03564  -0.01781 0.03120  335 LEU A CB  
2997 C  CG  . LEU A 335 ? 0.18376 0.22399 0.14109 0.02897  -0.00987 0.04831  335 LEU A CG  
2998 C  CD1 . LEU A 335 ? 0.20206 0.24662 0.15315 0.03559  -0.01343 0.06512  335 LEU A CD1 
2999 C  CD2 . LEU A 335 ? 0.17941 0.23386 0.14677 0.02443  -0.01153 0.04114  335 LEU A CD2 
3000 N  N   . ASP A 336 ? 0.17722 0.22810 0.11364 0.03480  -0.02438 0.03266  336 ASP A N   
3001 C  CA  . ASP A 336 ? 0.17873 0.25118 0.11939 0.03395  -0.03440 0.03677  336 ASP A CA  
3002 C  C   . ASP A 336 ? 0.17129 0.24055 0.13495 0.03161  -0.03287 0.04112  336 ASP A C   
3003 O  O   . ASP A 336 ? 0.18818 0.26752 0.15555 0.02457  -0.02739 0.02471  336 ASP A O   
3004 C  CB  . ASP A 336 ? 0.21183 0.29427 0.12945 0.04256  -0.04003 0.04539  336 ASP A CB  
3005 C  CG  . ASP A 336 ? 0.25715 0.32266 0.17069 0.02501  -0.05464 0.09649  336 ASP A CG  
3006 O  OD1 . ASP A 336 ? 0.24275 0.32679 0.22519 -0.00247 -0.04936 0.12543  336 ASP A OD1 
3007 O  OD2 . ASP A 336 ? 0.33920 0.34782 0.21828 0.04529  -0.08575 0.10496  336 ASP A OD2 
3008 N  N   A GLU A 337 ? 0.16692 0.23412 0.13512 0.03546  -0.02778 0.04460  337 GLU A N   
3009 N  N   B GLU A 337 ? 0.17221 0.22326 0.12164 0.03744  -0.02859 0.04777  337 GLU A N   
3010 C  CA  A GLU A 337 ? 0.18170 0.23458 0.15719 0.03799  -0.02180 0.03720  337 GLU A CA  
3011 C  CA  B GLU A 337 ? 0.18432 0.20910 0.13359 0.03713  -0.01656 0.04178  337 GLU A CA  
3012 C  C   A GLU A 337 ? 0.17867 0.21412 0.13071 0.04240  -0.02553 0.02730  337 GLU A C   
3013 C  C   B GLU A 337 ? 0.17837 0.20767 0.12087 0.04057  -0.02268 0.03063  337 GLU A C   
3014 O  O   A GLU A 337 ? 0.19369 0.23236 0.13644 0.05515  -0.01661 0.01982  337 GLU A O   
3015 O  O   B GLU A 337 ? 0.19088 0.23057 0.12906 0.05397  -0.01352 0.02274  337 GLU A O   
3016 C  CB  A GLU A 337 ? 0.20204 0.25901 0.19479 0.03188  -0.02494 0.03205  337 GLU A CB  
3017 C  CB  B GLU A 337 ? 0.20221 0.19731 0.14432 0.04053  -0.01602 0.04500  337 GLU A CB  
3018 C  CG  A GLU A 337 ? 0.24715 0.27636 0.18459 0.02980  -0.02909 0.02219  337 GLU A CG  
3019 C  CG  B GLU A 337 ? 0.22383 0.18937 0.12827 0.05033  -0.02258 0.03781  337 GLU A CG  
3020 C  CD  A GLU A 337 ? 0.33307 0.30037 0.18664 0.04186  -0.03119 0.04216  337 GLU A CD  
3021 C  CD  B GLU A 337 ? 0.27269 0.19560 0.13426 0.05095  -0.02010 0.04053  337 GLU A CD  
3022 O  OE1 A GLU A 337 ? 0.41132 0.33893 0.21393 0.08612  0.03218  0.01393  337 GLU A OE1 
3023 O  OE1 B GLU A 337 ? 0.27274 0.18538 0.13011 0.03793  -0.00168 0.04687  337 GLU A OE1 
3024 O  OE2 A GLU A 337 ? 0.36051 0.33118 0.17129 -0.00030 -0.05948 0.04436  337 GLU A OE2 
3025 O  OE2 B GLU A 337 ? 0.37430 0.20988 0.14730 0.04903  -0.02386 0.05659  337 GLU A OE2 
3026 N  N   . LEU A 338 ? 0.17709 0.20537 0.11333 0.03858  -0.02656 0.03147  338 LEU A N   
3027 C  CA  . LEU A 338 ? 0.17704 0.21358 0.10652 0.04077  -0.02545 0.03731  338 LEU A CA  
3028 C  C   . LEU A 338 ? 0.17195 0.23527 0.10988 0.03269  -0.01728 0.03790  338 LEU A C   
3029 O  O   . LEU A 338 ? 0.17961 0.27325 0.12149 0.02882  -0.01930 0.03842  338 LEU A O   
3030 C  CB  . LEU A 338 ? 0.18207 0.21100 0.11705 0.04071  -0.02805 0.03634  338 LEU A CB  
3031 C  CG  . LEU A 338 ? 0.17911 0.21549 0.13191 0.02946  -0.03485 0.04198  338 LEU A CG  
3032 C  CD1 . LEU A 338 ? 0.18835 0.24160 0.12959 0.03155  -0.02181 0.04070  338 LEU A CD1 
3033 C  CD2 . LEU A 338 ? 0.19159 0.21613 0.16285 0.02535  -0.03784 0.03829  338 LEU A CD2 
3034 N  N   . ALA A 339 ? 0.18119 0.22188 0.11958 0.02594  -0.03201 0.03189  339 ALA A N   
3035 C  CA  . ALA A 339 ? 0.19536 0.22616 0.14631 0.01784  -0.04232 0.03136  339 ALA A CA  
3036 C  C   . ALA A 339 ? 0.19380 0.24240 0.17474 0.01396  -0.05041 0.03472  339 ALA A C   
3037 O  O   . ALA A 339 ? 0.20607 0.26167 0.26867 0.00480  -0.05554 0.03394  339 ALA A O   
3038 C  CB  . ALA A 339 ? 0.21968 0.23622 0.16652 0.02736  -0.05002 0.00814  339 ALA A CB  
3039 N  N   . ARG A 340 ? 0.17890 0.24751 0.14137 0.04036  -0.03903 0.02935  340 ARG A N   
3040 C  CA  A ARG A 340 ? 0.18343 0.26238 0.15180 0.04470  -0.03696 0.02636  340 ARG A CA  
3041 C  CA  B ARG A 340 ? 0.17660 0.25999 0.13251 0.04916  -0.03920 0.03011  340 ARG A CA  
3042 C  C   . ARG A 340 ? 0.17783 0.27694 0.14101 0.04120  -0.03968 0.02698  340 ARG A C   
3043 O  O   . ARG A 340 ? 0.17544 0.28615 0.13205 0.03589  -0.03532 0.02512  340 ARG A O   
3044 C  CB  A ARG A 340 ? 0.22299 0.27419 0.19212 0.05025  -0.03076 0.02642  340 ARG A CB  
3045 C  CB  B ARG A 340 ? 0.18621 0.26172 0.12098 0.06838  -0.03198 0.03225  340 ARG A CB  
3046 C  CG  A ARG A 340 ? 0.28258 0.30644 0.22632 0.05676  -0.03728 0.02957  340 ARG A CG  
3047 C  CG  B ARG A 340 ? 0.21076 0.27235 0.11750 0.07726  -0.01595 0.04501  340 ARG A CG  
3048 C  CD  A ARG A 340 ? 0.34925 0.36385 0.26707 0.01488  -0.09333 0.06350  340 ARG A CD  
3049 C  CD  B ARG A 340 ? 0.28800 0.30886 0.14354 0.01647  0.01059  0.05450  340 ARG A CD  
3050 N  NE  A ARG A 340 ? 0.33954 0.42397 0.27212 -0.02785 -0.12377 0.10541  340 ARG A NE  
3051 N  NE  B ARG A 340 ? 0.32755 0.33604 0.20604 0.01893  -0.04553 0.06930  340 ARG A NE  
3052 C  CZ  A ARG A 340 ? 0.32948 0.37985 0.23865 0.01522  -0.13094 0.06604  340 ARG A CZ  
3053 C  CZ  B ARG A 340 ? 0.44832 0.37220 0.25795 -0.00776 -0.11237 0.10267  340 ARG A CZ  
3054 N  NH1 A ARG A 340 ? 0.27389 0.32135 0.26012 0.04436  -0.14161 0.02846  340 ARG A NH1 
3055 N  NH1 B ARG A 340 ? 0.51499 0.45658 0.29953 -0.11308 -0.12745 0.15917  340 ARG A NH1 
3056 N  NH2 A ARG A 340 ? 0.40525 0.37334 0.21748 -0.00945 -0.14775 0.05023  340 ARG A NH2 
3057 N  NH2 B ARG A 340 ? 0.55071 0.35006 0.27602 0.05039  -0.14150 0.06044  340 ARG A NH2 
3058 N  N   . PRO A 341 ? 0.17688 0.30693 0.14993 0.03743  -0.03445 0.01964  341 PRO A N   
3059 C  CA  . PRO A 341 ? 0.18869 0.29851 0.15867 0.04400  -0.01897 0.02705  341 PRO A CA  
3060 C  C   . PRO A 341 ? 0.19372 0.27916 0.14760 0.06270  -0.02764 0.03398  341 PRO A C   
3061 O  O   . PRO A 341 ? 0.21239 0.28797 0.15611 0.06206  -0.02498 0.04411  341 PRO A O   
3062 C  CB  . PRO A 341 ? 0.19023 0.36531 0.19948 0.03060  -0.01205 0.01445  341 PRO A CB  
3063 C  CG  . PRO A 341 ? 0.20043 0.44603 0.23497 0.01503  -0.00988 -0.02033 341 PRO A CG  
3064 C  CD  . PRO A 341 ? 0.18210 0.38737 0.19164 0.02487  -0.03099 -0.00792 341 PRO A CD  
3065 N  N   . THR A 342 ? 0.18871 0.27333 0.14246 0.06732  -0.01723 0.02988  342 THR A N   
3066 C  CA  . THR A 342 ? 0.18517 0.26717 0.14908 0.07098  -0.02151 0.03457  342 THR A CA  
3067 C  C   . THR A 342 ? 0.19463 0.27477 0.16525 0.07642  -0.02283 0.03740  342 THR A C   
3068 O  O   . THR A 342 ? 0.20082 0.28091 0.18606 0.07984  -0.03049 0.03906  342 THR A O   
3069 C  CB  . THR A 342 ? 0.17727 0.27012 0.14715 0.07244  -0.02088 0.02353  342 THR A CB  
3070 O  OG1 . THR A 342 ? 0.16024 0.26696 0.14496 0.06932  0.00004  0.03049  342 THR A OG1 
3071 C  CG2 . THR A 342 ? 0.19039 0.28639 0.16371 0.08213  -0.02564 0.00956  342 THR A CG2 
3072 N  N   . ALA A 343 ? 0.18848 0.28292 0.17801 0.08527  -0.02735 0.03087  343 ALA A N   
3073 C  CA  . ALA A 343 ? 0.19991 0.30200 0.21491 0.09151  -0.01414 0.02489  343 ALA A CA  
3074 C  C   . ALA A 343 ? 0.20072 0.33512 0.25493 0.07247  -0.01522 0.03801  343 ALA A C   
3075 O  O   . ALA A 343 ? 0.19665 0.37447 0.27091 0.07003  -0.01346 0.05785  343 ALA A O   
3076 C  CB  . ALA A 343 ? 0.22872 0.32929 0.22056 0.09531  -0.01563 0.00626  343 ALA A CB  
3077 N  N   . ALA A 344 ? 0.19061 0.37151 0.28005 0.07186  -0.03680 0.01563  344 ALA A N   
3078 C  CA  . ALA A 344 ? 0.19980 0.43028 0.30221 0.06456  -0.04541 -0.00573 344 ALA A CA  
3079 C  C   . ALA A 344 ? 0.20426 0.45449 0.29642 0.07225  -0.05689 0.01217  344 ALA A C   
3080 O  O   . ALA A 344 ? 0.21117 0.48722 0.35140 0.06245  -0.06409 0.00640  344 ALA A O   
3081 C  CB  . ALA A 344 ? 0.22036 0.46349 0.33447 0.07486  -0.04885 -0.04336 344 ALA A CB  
3082 N  N   . ASP A 345 ? 0.22543 0.44192 0.26612 0.11665  -0.04379 0.03212  345 ASP A N   
3083 C  CA  . ASP A 345 ? 0.24153 0.44947 0.27232 0.12928  -0.04770 0.02590  345 ASP A CA  
3084 C  C   . ASP A 345 ? 0.22591 0.46194 0.28860 0.13116  -0.03237 0.01675  345 ASP A C   
3085 O  O   . ASP A 345 ? 0.23849 0.49756 0.31875 0.15114  -0.02282 0.01624  345 ASP A O   
3086 C  CB  . ASP A 345 ? 0.25366 0.44222 0.28645 0.12640  -0.04040 0.04077  345 ASP A CB  
3087 C  CG  . ASP A 345 ? 0.25344 0.41785 0.34574 0.12094  -0.04095 0.05380  345 ASP A CG  
3088 O  OD1 . ASP A 345 ? 0.23772 0.39819 0.34667 0.10247  -0.05374 0.05979  345 ASP A OD1 
3089 O  OD2 . ASP A 345 ? 0.26755 0.41699 0.43334 0.12971  -0.04278 0.05264  345 ASP A OD2 
3090 N  N   . GLY A 346 ? 0.21957 0.44331 0.27752 0.09672  -0.01871 0.02376  346 GLY A N   
3091 C  CA  . GLY A 346 ? 0.23356 0.41589 0.27050 0.07528  -0.01168 0.02444  346 GLY A CA  
3092 C  C   . GLY A 346 ? 0.22837 0.39269 0.26030 0.07393  -0.01593 0.04171  346 GLY A C   
3093 O  O   . GLY A 346 ? 0.24708 0.39770 0.25986 0.07143  -0.01590 0.04513  346 GLY A O   
3094 N  N   . LEU A 347 ? 0.23348 0.37448 0.25767 0.06925  -0.02132 0.04995  347 LEU A N   
3095 C  CA  . LEU A 347 ? 0.23952 0.35931 0.25837 0.07236  -0.02756 0.05314  347 LEU A CA  
3096 C  C   . LEU A 347 ? 0.23788 0.36930 0.26629 0.09358  -0.02420 0.04761  347 LEU A C   
3097 O  O   . LEU A 347 ? 0.23408 0.36809 0.26964 0.09273  -0.01783 0.04460  347 LEU A O   
3098 C  CB  . LEU A 347 ? 0.25357 0.35442 0.26835 0.06041  -0.03021 0.05499  347 LEU A CB  
3099 C  CG  . LEU A 347 ? 0.29793 0.38245 0.28462 0.05889  -0.04252 0.05142  347 LEU A CG  
3100 C  CD1 . LEU A 347 ? 0.30392 0.39407 0.31490 0.06623  -0.06850 0.04598  347 LEU A CD1 
3101 C  CD2 . LEU A 347 ? 0.34741 0.40394 0.28551 0.05714  -0.02142 0.05316  347 LEU A CD2 
3102 N  N   . GLN A 348 ? 0.24365 0.38991 0.29286 0.10245  -0.02089 0.03072  348 GLN A N   
3103 C  CA  . GLN A 348 ? 0.24322 0.41459 0.32366 0.12206  -0.00177 0.03396  348 GLN A CA  
3104 C  C   . GLN A 348 ? 0.24297 0.38981 0.30859 0.11608  -0.01778 0.03881  348 GLN A C   
3105 O  O   . GLN A 348 ? 0.27294 0.38265 0.31599 0.12382  -0.01782 0.03356  348 GLN A O   
3106 C  CB  . GLN A 348 ? 0.26668 0.47902 0.38834 0.15084  0.01581  0.02848  348 GLN A CB  
3107 C  CG  . GLN A 348 ? 0.34220 0.53554 0.44432 0.17924  0.04862  0.01157  348 GLN A CG  
3108 C  CD  . GLN A 348 ? 0.48500 0.60012 0.45196 0.16749  0.09143  -0.00166 348 GLN A CD  
3109 O  OE1 . GLN A 348 ? 0.59068 0.70469 0.42950 0.11845  0.15135  0.01983  348 GLN A OE1 
3110 N  NE2 . GLN A 348 ? 0.53012 0.55590 0.49318 0.18506  0.04867  -0.02218 348 GLN A NE2 
3111 N  N   . ALA A 349 ? 0.23580 0.38134 0.29497 0.11397  -0.02874 0.04938  349 ALA A N   
3112 C  CA  . ALA A 349 ? 0.26346 0.38829 0.28478 0.10510  -0.03517 0.05580  349 ALA A CA  
3113 C  C   . ALA A 349 ? 0.25500 0.34542 0.28070 0.10438  -0.03226 0.06401  349 ALA A C   
3114 O  O   . ALA A 349 ? 0.26497 0.34965 0.30984 0.09446  -0.04374 0.08506  349 ALA A O   
3115 C  CB  . ALA A 349 ? 0.29279 0.44786 0.27510 0.10562  -0.06292 0.04699  349 ALA A CB  
3116 N  N   . LEU A 350 ? 0.23057 0.33241 0.24980 0.10452  -0.03066 0.04402  350 LEU A N   
3117 C  CA  . LEU A 350 ? 0.22783 0.31149 0.23652 0.10870  -0.02479 0.02609  350 LEU A CA  
3118 C  C   . LEU A 350 ? 0.23244 0.31200 0.23580 0.10959  -0.02058 0.03164  350 LEU A C   
3119 O  O   . LEU A 350 ? 0.24216 0.31705 0.25359 0.11426  -0.01430 0.02760  350 LEU A O   
3120 C  CB  . LEU A 350 ? 0.23781 0.30892 0.23552 0.10616  -0.03492 0.01569  350 LEU A CB  
3121 C  CG  . LEU A 350 ? 0.23899 0.33650 0.25456 0.10685  -0.02599 0.02452  350 LEU A CG  
3122 C  CD1 . LEU A 350 ? 0.24665 0.37967 0.26218 0.09610  -0.00309 0.02743  350 LEU A CD1 
3123 C  CD2 . LEU A 350 ? 0.26445 0.35287 0.29312 0.11515  -0.03537 0.04099  350 LEU A CD2 
3124 N  N   . LEU A 351 ? 0.24840 0.32139 0.24009 0.11411  -0.01342 0.02862  351 LEU A N   
3125 C  CA  . LEU A 351 ? 0.27029 0.32753 0.26519 0.11248  -0.00446 0.02325  351 LEU A CA  
3126 C  C   . LEU A 351 ? 0.29417 0.32244 0.30909 0.12751  0.00307  0.02513  351 LEU A C   
3127 O  O   . LEU A 351 ? 0.34963 0.32268 0.33517 0.12448  -0.01071 0.00805  351 LEU A O   
3128 C  CB  . LEU A 351 ? 0.30080 0.36264 0.25254 0.11905  -0.00685 0.02267  351 LEU A CB  
3129 C  CG  . LEU A 351 ? 0.34849 0.41373 0.27717 0.11613  -0.00576 0.04081  351 LEU A CG  
3130 C  CD1 . LEU A 351 ? 0.37949 0.42097 0.30282 0.09398  0.02710  0.06781  351 LEU A CD1 
3131 C  CD2 . LEU A 351 ? 0.36054 0.47599 0.31943 0.12376  -0.03529 0.05151  351 LEU A CD2 
3132 N  N   . ASP A 352 ? 0.28581 0.33392 0.32652 0.14731  0.01499  0.04175  352 ASP A N   
3133 C  CA  . ASP A 352 ? 0.30938 0.35150 0.37024 0.16273  0.02292  0.05879  352 ASP A CA  
3134 C  C   . ASP A 352 ? 0.33256 0.33888 0.37198 0.16242  0.02832  0.07848  352 ASP A C   
3135 O  O   . ASP A 352 ? 0.39270 0.35018 0.41577 0.18534  0.05366  0.09610  352 ASP A O   
3136 C  CB  . ASP A 352 ? 0.34767 0.40482 0.42569 0.18506  0.02272  0.06156  352 ASP A CB  
3137 C  CG  . ASP A 352 ? 0.44466 0.50896 0.53103 0.20750  0.06790  0.04655  352 ASP A CG  
3138 O  OD1 . ASP A 352 ? 0.45885 0.61808 0.51586 0.25215  0.06805  0.01945  352 ASP A OD1 
3139 O  OD2 . ASP A 352 ? 0.42713 0.60480 0.68752 0.20201  0.07987  0.05938  352 ASP A OD2 
3140 N  N   . ASP A 353 ? 0.30865 0.31611 0.33279 0.13441  0.00239  0.07331  353 ASP A N   
3141 C  CA  . ASP A 353 ? 0.30197 0.30426 0.30786 0.11983  -0.01257 0.06704  353 ASP A CA  
3142 C  C   . ASP A 353 ? 0.30801 0.29140 0.31438 0.11806  -0.00793 0.05510  353 ASP A C   
3143 O  O   . ASP A 353 ? 0.30875 0.29865 0.29073 0.11510  -0.00799 0.05910  353 ASP A O   
3144 C  CB  . ASP A 353 ? 0.31405 0.32026 0.29733 0.11495  -0.00933 0.06562  353 ASP A CB  
3145 C  CG  . ASP A 353 ? 0.32992 0.33072 0.30211 0.09925  -0.00056 0.05922  353 ASP A CG  
3146 O  OD1 . ASP A 353 ? 0.35161 0.33892 0.29994 0.08224  -0.01181 0.06983  353 ASP A OD1 
3147 O  OD2 . ASP A 353 ? 0.35588 0.33353 0.32280 0.08444  0.02289  0.04117  353 ASP A OD2 
3148 N  N   . ARG A 354 ? 0.32660 0.29370 0.36487 0.12312  -0.00189 0.06257  354 ARG A N   
3149 C  CA  . ARG A 354 ? 0.37140 0.30284 0.40153 0.11702  -0.01077 0.06196  354 ARG A CA  
3150 C  C   . ARG A 354 ? 0.36588 0.31072 0.35008 0.09703  -0.01345 0.06899  354 ARG A C   
3151 O  O   . ARG A 354 ? 0.38461 0.30697 0.35834 0.09068  -0.01722 0.04498  354 ARG A O   
3152 C  CB  . ARG A 354 ? 0.44983 0.31036 0.50741 0.14606  -0.00805 0.05078  354 ARG A CB  
3153 C  CG  . ARG A 354 ? 0.52627 0.32378 0.59995 0.17637  0.01122  0.03250  354 ARG A CG  
3154 C  CD  . ARG A 354 ? 0.61926 0.37334 0.68261 0.22336  -0.01441 0.00780  354 ARG A CD  
3155 N  NE  . ARG A 354 ? 0.66207 0.45977 0.71719 0.21348  -0.02305 -0.00523 354 ARG A NE  
3156 C  CZ  . ARG A 354 ? 0.74662 0.44925 0.75067 0.20864  -0.02084 -0.02106 354 ARG A CZ  
3157 N  NH1 . ARG A 354 ? 0.87549 0.47470 0.70885 0.19411  0.04099  -0.04900 354 ARG A NH1 
3158 N  NH2 . ARG A 354 ? 0.76289 0.44134 0.84651 0.17484  -0.04170 -0.03184 354 ARG A NH2 
3159 N  N   . SER A 355 ? 0.35492 0.33989 0.31495 0.09884  -0.01408 0.09456  355 SER A N   
3160 C  CA  . SER A 355 ? 0.36021 0.38311 0.28839 0.08995  -0.00938 0.09516  355 SER A CA  
3161 C  C   . SER A 355 ? 0.32964 0.35637 0.27480 0.08945  -0.00513 0.05864  355 SER A C   
3162 O  O   . SER A 355 ? 0.33719 0.37096 0.30235 0.07859  0.00858  0.06711  355 SER A O   
3163 C  CB  . SER A 355 ? 0.41750 0.44141 0.27677 0.07288  -0.00381 0.10594  355 SER A CB  
3164 O  OG  . SER A 355 ? 0.41826 0.45988 0.27006 0.08661  -0.01408 0.08161  355 SER A OG  
3165 N  N   . ALA A 356 ? 0.32266 0.30599 0.24944 0.10165  -0.00150 0.03478  356 ALA A N   
3166 C  CA  . ALA A 356 ? 0.31667 0.27772 0.25565 0.10344  -0.00547 0.01980  356 ALA A CA  
3167 C  C   . ALA A 356 ? 0.30256 0.25832 0.28808 0.10194  -0.01740 0.01808  356 ALA A C   
3168 O  O   . ALA A 356 ? 0.32441 0.25491 0.34997 0.10900  -0.05404 0.01832  356 ALA A O   
3169 C  CB  . ALA A 356 ? 0.33060 0.28921 0.24731 0.09200  -0.00904 0.01557  356 ALA A CB  
3170 N  N   . PHE A 357 ? 0.30000 0.25853 0.26971 0.09379  -0.00856 0.02398  357 PHE A N   
3171 C  CA  . PHE A 357 ? 0.31499 0.26501 0.26770 0.08361  0.00878  0.02035  357 PHE A CA  
3172 C  C   . PHE A 357 ? 0.34262 0.26845 0.30659 0.08852  0.01567  0.01731  357 PHE A C   
3173 O  O   . PHE A 357 ? 0.34368 0.29613 0.33505 0.08046  0.01211  0.02348  357 PHE A O   
3174 C  CB  . PHE A 357 ? 0.33374 0.29236 0.26013 0.06905  0.02005  0.02042  357 PHE A CB  
3175 C  CG  . PHE A 357 ? 0.37346 0.32122 0.27288 0.06204  0.00393  0.01664  357 PHE A CG  
3176 C  CD1 . PHE A 357 ? 0.36733 0.34316 0.26920 0.05392  -0.01824 0.04545  357 PHE A CD1 
3177 C  CD2 . PHE A 357 ? 0.45296 0.38140 0.31658 0.09963  -0.02313 -0.03028 357 PHE A CD2 
3178 C  CE1 . PHE A 357 ? 0.41308 0.39092 0.30334 0.08787  -0.05100 0.02996  357 PHE A CE1 
3179 C  CE2 . PHE A 357 ? 0.50511 0.45449 0.34880 0.12176  -0.06428 -0.05046 357 PHE A CE2 
3180 C  CZ  . PHE A 357 ? 0.50655 0.46372 0.33053 0.12104  -0.06961 -0.02023 357 PHE A CZ  
3181 N  N   . GLU A 358 ? 0.37852 0.26253 0.33104 0.09692  0.02719  0.00876  358 GLU A N   
3182 C  CA  . GLU A 358 ? 0.42704 0.26766 0.38771 0.09477  0.03428  0.01226  358 GLU A CA  
3183 C  C   . GLU A 358 ? 0.41447 0.26593 0.42956 0.05579  0.01077  0.02504  358 GLU A C   
3184 O  O   . GLU A 358 ? 0.45453 0.29476 0.50672 0.01829  -0.01846 0.01586  358 GLU A O   
3185 C  CB  . GLU A 358 ? 0.49299 0.30827 0.44288 0.14640  0.08567  0.01716  358 GLU A CB  
3186 C  CG  . GLU A 358 ? 0.48093 0.38336 0.47521 0.16677  0.10691  0.02670  358 GLU A CG  
3187 C  CD  . GLU A 358 ? 0.43705 0.45755 0.48388 0.16424  0.12345  0.01788  358 GLU A CD  
3188 O  OE1 . GLU A 358 ? 0.37993 0.40534 0.45174 0.12813  0.08202  0.04392  358 GLU A OE1 
3189 O  OE2 . GLU A 358 ? 0.50934 0.59558 0.54883 0.15447  0.20236  -0.01562 358 GLU A OE2 
3190 N  N   . GLU A 359 ? 0.39303 0.25851 0.41512 0.08133  0.03647  0.04828  359 GLU A N   
3191 C  CA  . GLU A 359 ? 0.40254 0.28799 0.42654 0.09900  0.04672  0.08736  359 GLU A CA  
3192 C  C   . GLU A 359 ? 0.41345 0.30223 0.39924 0.10724  0.06266  0.09294  359 GLU A C   
3193 O  O   . GLU A 359 ? 0.48392 0.35869 0.39727 0.13463  0.06371  0.11059  359 GLU A O   
3194 C  CB  . GLU A 359 ? 0.44720 0.32843 0.47885 0.12554  0.03224  0.11957  359 GLU A CB  
3195 C  CG  . GLU A 359 ? 0.51143 0.38323 0.58219 0.17319  0.03015  0.12686  359 GLU A CG  
3196 C  CD  . GLU A 359 ? 0.60500 0.51012 0.65795 0.21986  -0.00251 0.14465  359 GLU A CD  
3197 O  OE1 . GLU A 359 ? 0.67757 0.64307 0.62460 0.24213  -0.10110 0.14215  359 GLU A OE1 
3198 O  OE2 . GLU A 359 ? 0.59743 0.53672 0.77762 0.23376  0.07583  0.18449  359 GLU A OE2 
3199 N  N   . PHE A 360 ? 0.34871 0.28482 0.35384 0.08879  0.05054  0.07030  360 PHE A N   
3200 C  CA  . PHE A 360 ? 0.32709 0.28938 0.33720 0.07743  0.03447  0.05286  360 PHE A CA  
3201 C  C   . PHE A 360 ? 0.34395 0.29422 0.36891 0.06469  0.03302  0.04724  360 PHE A C   
3202 O  O   . PHE A 360 ? 0.34353 0.32359 0.38520 0.04617  0.03300  0.00759  360 PHE A O   
3203 C  CB  . PHE A 360 ? 0.30157 0.28884 0.33391 0.07378  0.03078  0.04177  360 PHE A CB  
3204 C  CG  . PHE A 360 ? 0.29625 0.30163 0.34026 0.07021  0.01618  0.02813  360 PHE A CG  
3205 C  CD1 . PHE A 360 ? 0.35858 0.31629 0.36887 0.06174  0.00314  -0.00735 360 PHE A CD1 
3206 C  CD2 . PHE A 360 ? 0.29819 0.30843 0.33005 0.07962  0.01774  0.04454  360 PHE A CD2 
3207 C  CE1 . PHE A 360 ? 0.37928 0.31083 0.38067 0.03913  0.02939  -0.01618 360 PHE A CE1 
3208 C  CE2 . PHE A 360 ? 0.31235 0.30204 0.36613 0.07766  0.04155  0.05018  360 PHE A CE2 
3209 C  CZ  . PHE A 360 ? 0.33197 0.29367 0.39282 0.03723  0.05960  0.01450  360 PHE A CZ  
3210 N  N   . ASP A 361 ? 0.36884 0.27688 0.40125 0.07048  0.05475  0.06995  361 ASP A N   
3211 C  CA  . ASP A 361 ? 0.40325 0.26847 0.44208 0.07598  0.08320  0.08452  361 ASP A CA  
3212 C  C   . ASP A 361 ? 0.37824 0.25430 0.35396 0.05234  0.08155  0.04989  361 ASP A C   
3213 O  O   . ASP A 361 ? 0.37821 0.26844 0.32362 0.06809  0.07355  0.05375  361 ASP A O   
3214 C  CB  . ASP A 361 ? 0.46736 0.29705 0.54121 0.11670  0.12082  0.13530  361 ASP A CB  
3215 C  CG  . ASP A 361 ? 0.51123 0.33271 0.66879 0.09795  0.18020  0.15762  361 ASP A CG  
3216 O  OD1 . ASP A 361 ? 0.44594 0.30967 0.74518 0.05437  0.16283  0.09906  361 ASP A OD1 
3217 O  OD2 . ASP A 361 ? 0.61751 0.40402 0.75817 0.09038  0.23207  0.24513  361 ASP A OD2 
3218 N  N   . VAL A 362 ? 0.37381 0.25738 0.30243 0.02576  0.08281  0.02140  362 VAL A N   
3219 C  CA  A VAL A 362 ? 0.38528 0.27921 0.28959 0.02564  0.08322  0.00239  362 VAL A CA  
3220 C  CA  B VAL A 362 ? 0.37837 0.28033 0.26694 0.00019  0.08547  0.00851  362 VAL A CA  
3221 C  C   . VAL A 362 ? 0.36272 0.26918 0.28333 0.01941  0.08122  0.00239  362 VAL A C   
3222 O  O   . VAL A 362 ? 0.35909 0.27095 0.29220 0.03054  0.08937  -0.00083 362 VAL A O   
3223 C  CB  A VAL A 362 ? 0.44548 0.33354 0.30596 0.03445  0.08668  -0.01453 362 VAL A CB  
3224 C  CB  B VAL A 362 ? 0.44292 0.35864 0.25355 -0.04957 0.10584  -0.00864 362 VAL A CB  
3225 C  CG1 A VAL A 362 ? 0.43576 0.37425 0.30568 0.06821  0.09403  -0.02292 362 VAL A CG1 
3226 C  CG1 B VAL A 362 ? 0.43981 0.39822 0.25427 -0.05332 0.11474  0.01239  362 VAL A CG1 
3227 C  CG2 A VAL A 362 ? 0.46206 0.32236 0.33297 0.03618  0.07742  -0.01208 362 VAL A CG2 
3228 C  CG2 B VAL A 362 ? 0.49204 0.37145 0.26327 -0.04872 0.10262  -0.04795 362 VAL A CG2 
3229 N  N   . ASP A 363 ? 0.35320 0.26647 0.30365 0.02135  0.08033  -0.00581 363 ASP A N   
3230 C  CA  . ASP A 363 ? 0.36414 0.27452 0.31316 0.00786  0.09135  -0.00532 363 ASP A CA  
3231 C  C   . ASP A 363 ? 0.35045 0.26116 0.29014 0.02344  0.08215  0.03684  363 ASP A C   
3232 O  O   . ASP A 363 ? 0.33721 0.28399 0.29603 0.03158  0.07449  0.03449  363 ASP A O   
3233 C  CB  . ASP A 363 ? 0.43584 0.31488 0.36934 -0.01183 0.09720  -0.03317 363 ASP A CB  
3234 C  CG  . ASP A 363 ? 0.55168 0.41855 0.44125 -0.00228 0.05906  -0.08391 363 ASP A CG  
3235 O  OD1 . ASP A 363 ? 0.49989 0.52312 0.43406 -0.00260 -0.00658 -0.08812 363 ASP A OD1 
3236 O  OD2 . ASP A 363 ? 0.71765 0.41665 0.53496 0.00761  0.05132  -0.11548 363 ASP A OD2 
3237 N  N   . ALA A 364 ? 0.37974 0.25606 0.29606 0.04002  0.06232  0.06822  364 ALA A N   
3238 C  CA  . ALA A 364 ? 0.38781 0.28662 0.29659 0.05000  0.05306  0.08519  364 ALA A CA  
3239 C  C   . ALA A 364 ? 0.35791 0.28176 0.25450 0.03942  0.05251  0.06583  364 ALA A C   
3240 O  O   . ALA A 364 ? 0.39028 0.29882 0.26403 0.03879  0.06601  0.05905  364 ALA A O   
3241 C  CB  . ALA A 364 ? 0.45965 0.33185 0.34130 0.07991  0.03008  0.12411  364 ALA A CB  
3242 N  N   . ALA A 365 ? 0.33330 0.27217 0.22809 0.03993  0.03465  0.05521  365 ALA A N   
3243 C  CA  . ALA A 365 ? 0.32135 0.26769 0.21762 0.03132  0.03103  0.04016  365 ALA A CA  
3244 C  C   . ALA A 365 ? 0.29743 0.24321 0.23399 0.01986  0.03677  0.02357  365 ALA A C   
3245 O  O   . ALA A 365 ? 0.30336 0.25001 0.27376 0.01338  0.04445  0.00313  365 ALA A O   
3246 C  CB  . ALA A 365 ? 0.32647 0.28715 0.23223 0.02033  0.02717  0.05732  365 ALA A CB  
3247 N  N   . ALA A 366 ? 0.28165 0.23071 0.22786 0.02348  0.04545  0.03452  366 ALA A N   
3248 C  CA  . ALA A 366 ? 0.28185 0.24119 0.22645 0.02868  0.04683  0.03922  366 ALA A CA  
3249 C  C   . ALA A 366 ? 0.27449 0.23458 0.24300 0.02437  0.04786  0.03979  366 ALA A C   
3250 O  O   . ALA A 366 ? 0.27529 0.25906 0.26288 0.04529  0.04229  0.04980  366 ALA A O   
3251 C  CB  . ALA A 366 ? 0.31260 0.27336 0.20916 0.02708  0.03355  0.04282  366 ALA A CB  
3252 N  N   . ALA A 367 ? 0.30136 0.22601 0.24551 0.00674  0.06586  0.02803  367 ALA A N   
3253 C  CA  . ALA A 367 ? 0.31671 0.23365 0.25828 -0.00881 0.07687  0.02410  367 ALA A CA  
3254 C  C   . ALA A 367 ? 0.29048 0.23558 0.24941 0.01011  0.05893  0.01928  367 ALA A C   
3255 O  O   . ALA A 367 ? 0.30709 0.27387 0.27127 -0.01503 0.08643  -0.00792 367 ALA A O   
3256 C  CB  . ALA A 367 ? 0.37765 0.23455 0.28167 -0.02637 0.10267  0.01510  367 ALA A CB  
3257 N  N   . ARG A 368 ? 0.28315 0.21815 0.22206 0.03493  0.03231  0.03099  368 ARG A N   
3258 C  CA  A ARG A 368 ? 0.29434 0.23490 0.21690 0.04386  0.03331  0.02955  368 ARG A CA  
3259 C  CA  B ARG A 368 ? 0.29726 0.21646 0.23285 0.05607  0.02787  0.02726  368 ARG A CA  
3260 C  C   . ARG A 368 ? 0.30205 0.21063 0.20618 0.04555  0.03470  0.04384  368 ARG A C   
3261 O  O   . ARG A 368 ? 0.39558 0.23558 0.20591 0.06281  0.06999  0.06862  368 ARG A O   
3262 C  CB  A ARG A 368 ? 0.30516 0.30407 0.24324 0.04936  0.02786  0.01289  368 ARG A CB  
3263 C  CB  B ARG A 368 ? 0.31844 0.23641 0.29729 0.09348  0.01824  0.00715  368 ARG A CB  
3264 C  CG  A ARG A 368 ? 0.30224 0.35465 0.27233 0.04804  0.01804  0.01839  368 ARG A CG  
3265 C  CG  B ARG A 368 ? 0.36505 0.27864 0.34489 0.12487  -0.00296 0.01407  368 ARG A CG  
3266 C  CD  A ARG A 368 ? 0.29808 0.39885 0.36248 0.04346  -0.00900 0.03355  368 ARG A CD  
3267 C  CD  B ARG A 368 ? 0.39211 0.32397 0.40205 0.13621  -0.03997 0.03436  368 ARG A CD  
3268 N  NE  A ARG A 368 ? 0.32489 0.40196 0.38822 0.04495  0.02829  0.06431  368 ARG A NE  
3269 N  NE  B ARG A 368 ? 0.46802 0.36005 0.46205 0.11212  -0.06460 0.03997  368 ARG A NE  
3270 C  CZ  A ARG A 368 ? 0.32139 0.37080 0.38334 0.03038  0.03359  0.07551  368 ARG A CZ  
3271 C  CZ  B ARG A 368 ? 0.51050 0.35640 0.47982 0.10013  -0.06520 0.07269  368 ARG A CZ  
3272 N  NH1 A ARG A 368 ? 0.31802 0.29451 0.41461 0.01976  0.06946  0.03391  368 ARG A NH1 
3273 N  NH1 B ARG A 368 ? 0.46525 0.42566 0.48291 0.14129  -0.11434 0.09687  368 ARG A NH1 
3274 N  NH2 A ARG A 368 ? 0.35824 0.43819 0.38544 0.06435  0.01483  0.11646  368 ARG A NH2 
3275 N  NH2 B ARG A 368 ? 0.58774 0.26156 0.47481 0.05236  -0.03601 0.10826  368 ARG A NH2 
3276 N  N   . GLY A 369 ? 0.24631 0.18591 0.18950 0.02254  0.01562  0.04060  369 GLY A N   
3277 C  CA  . GLY A 369 ? 0.20966 0.18491 0.19285 0.01027  0.00030  0.03231  369 GLY A CA  
3278 C  C   . GLY A 369 ? 0.19281 0.19011 0.16552 0.01479  -0.00679 0.03330  369 GLY A C   
3279 O  O   . GLY A 369 ? 0.21709 0.20041 0.17793 0.01526  -0.02575 0.05416  369 GLY A O   
3280 N  N   . MET A 370 ? 0.17895 0.18131 0.13400 0.01458  0.00144  0.02749  370 MET A N   
3281 C  CA  . MET A 370 ? 0.17142 0.18673 0.12474 0.00760  0.00009  0.03076  370 MET A CA  
3282 C  C   . MET A 370 ? 0.16916 0.18476 0.12733 0.01012  -0.01005 0.03135  370 MET A C   
3283 O  O   . MET A 370 ? 0.17269 0.19382 0.14057 0.00721  -0.01112 0.02466  370 MET A O   
3284 C  CB  . MET A 370 ? 0.17659 0.19801 0.12354 0.02029  0.00941  0.02922  370 MET A CB  
3285 C  CG  . MET A 370 ? 0.18950 0.21384 0.14774 0.02591  0.02085  0.02494  370 MET A CG  
3286 S  SD  . MET A 370 ? 0.19998 0.22824 0.18976 0.02889  0.02604  0.03122  370 MET A SD  
3287 C  CE  . MET A 370 ? 0.18940 0.24283 0.26723 0.02832  0.00767  0.05033  370 MET A CE  
3288 N  N   . ALA A 371 ? 0.17867 0.18182 0.11452 0.02225  0.00192  0.02712  371 ALA A N   
3289 C  CA  . ALA A 371 ? 0.20273 0.18780 0.10753 0.02087  -0.00302 0.03037  371 ALA A CA  
3290 C  C   . ALA A 371 ? 0.18387 0.18831 0.09745 0.01431  0.00003  0.02525  371 ALA A C   
3291 O  O   . ALA A 371 ? 0.20157 0.19478 0.09513 0.01794  -0.00985 0.01883  371 ALA A O   
3292 C  CB  . ALA A 371 ? 0.24553 0.19889 0.11659 0.02213  -0.01228 0.04098  371 ALA A CB  
3293 N  N   . PHE A 372 ? 0.16888 0.17722 0.09510 0.01654  0.00565  0.03337  372 PHE A N   
3294 C  CA  . PHE A 372 ? 0.16329 0.17452 0.08838 0.01723  0.01454  0.02281  372 PHE A CA  
3295 C  C   . PHE A 372 ? 0.16692 0.17320 0.08199 0.00873  0.00684  0.01741  372 PHE A C   
3296 O  O   . PHE A 372 ? 0.17434 0.17916 0.10281 0.00416  0.01389  0.01157  372 PHE A O   
3297 C  CB  . PHE A 372 ? 0.16180 0.18683 0.09267 0.02223  0.00978  0.02380  372 PHE A CB  
3298 C  CG  . PHE A 372 ? 0.16005 0.18442 0.09237 0.01299  0.00133  0.02658  372 PHE A CG  
3299 C  CD1 . PHE A 372 ? 0.16743 0.20301 0.10403 0.01372  0.00682  0.02849  372 PHE A CD1 
3300 C  CD2 . PHE A 372 ? 0.16784 0.18413 0.09612 0.01481  0.00850  0.02161  372 PHE A CD2 
3301 C  CE1 . PHE A 372 ? 0.16718 0.21509 0.10990 0.01724  0.00759  0.03095  372 PHE A CE1 
3302 C  CE2 . PHE A 372 ? 0.16993 0.19532 0.11409 0.02362  0.00584  0.03004  372 PHE A CE2 
3303 C  CZ  . PHE A 372 ? 0.16683 0.20809 0.11682 0.01922  0.00574  0.03257  372 PHE A CZ  
3304 N  N   . GLU A 373 ? 0.15856 0.18292 0.09421 0.01276  0.00777  0.01577  373 GLU A N   
3305 C  CA  . GLU A 373 ? 0.15918 0.18663 0.09854 0.00984  0.00050  0.00546  373 GLU A CA  
3306 C  C   . GLU A 373 ? 0.17105 0.19202 0.09756 0.01433  0.00665  0.01644  373 GLU A C   
3307 O  O   . GLU A 373 ? 0.17759 0.19767 0.11125 0.01643  0.00050  0.01104  373 GLU A O   
3308 C  CB  . GLU A 373 ? 0.16474 0.19664 0.09977 0.00379  0.00202  0.01127  373 GLU A CB  
3309 C  CG  . GLU A 373 ? 0.17208 0.19954 0.10595 0.00854  -0.00178 0.01894  373 GLU A CG  
3310 C  CD  . GLU A 373 ? 0.16708 0.21188 0.11675 0.00494  0.00850  0.02543  373 GLU A CD  
3311 O  OE1 . GLU A 373 ? 0.16925 0.23381 0.13649 0.01570  0.01718  0.04584  373 GLU A OE1 
3312 O  OE2 . GLU A 373 ? 0.17692 0.21774 0.13864 0.00698  0.00628  0.03027  373 GLU A OE2 
3313 N  N   A ARG A 374 ? 0.18487 0.19155 0.08952 0.00778  0.00688  0.02239  374 ARG A N   
3314 N  N   B ARG A 374 ? 0.18899 0.19531 0.08819 0.00944  0.01104  0.01452  374 ARG A N   
3315 C  CA  A ARG A 374 ? 0.20878 0.19677 0.09378 0.00695  0.00223  0.03473  374 ARG A CA  
3316 C  CA  B ARG A 374 ? 0.21098 0.20477 0.10027 0.00278  0.01415  0.01132  374 ARG A CA  
3317 C  C   A ARG A 374 ? 0.19356 0.19542 0.08360 0.01553  0.00028  0.02813  374 ARG A C   
3318 C  C   B ARG A 374 ? 0.20124 0.19844 0.08142 0.01145  0.00510  0.01340  374 ARG A C   
3319 O  O   A ARG A 374 ? 0.20105 0.20643 0.09313 0.01549  0.00850  0.01927  374 ARG A O   
3320 O  O   B ARG A 374 ? 0.21302 0.20800 0.08170 0.00906  0.00570  0.00310  374 ARG A O   
3321 C  CB  A ARG A 374 ? 0.27534 0.22078 0.11332 0.00013  -0.01050 0.05882  374 ARG A CB  
3322 C  CB  B ARG A 374 ? 0.25907 0.22830 0.14760 -0.00772 0.01335  0.01984  374 ARG A CB  
3323 C  CG  A ARG A 374 ? 0.35994 0.28956 0.14987 0.01294  -0.02718 0.07795  374 ARG A CG  
3324 C  CG  B ARG A 374 ? 0.31722 0.30509 0.19402 -0.00502 0.00629  0.02663  374 ARG A CG  
3325 C  CD  A ARG A 374 ? 0.42213 0.37466 0.20254 0.02230  -0.02603 0.12217  374 ARG A CD  
3326 C  CD  B ARG A 374 ? 0.35124 0.40622 0.27185 -0.02456 0.03001  0.05139  374 ARG A CD  
3327 N  NE  A ARG A 374 ? 0.54953 0.48238 0.22560 -0.01356 -0.02374 0.12435  374 ARG A NE  
3328 N  NE  B ARG A 374 ? 0.40839 0.48043 0.32966 -0.06241 0.08680  0.07619  374 ARG A NE  
3329 C  CZ  A ARG A 374 ? 0.57484 0.48519 0.21562 -0.03187 -0.00155 0.09921  374 ARG A CZ  
3330 C  CZ  B ARG A 374 ? 0.44363 0.56036 0.32396 -0.05735 0.15661  0.06124  374 ARG A CZ  
3331 N  NH1 A ARG A 374 ? 0.58577 0.45299 0.21311 -0.08899 0.04954  0.04308  374 ARG A NH1 
3332 N  NH1 B ARG A 374 ? 0.44530 0.58659 0.35611 -0.05447 0.18932  0.07506  374 ARG A NH1 
3333 N  NH2 A ARG A 374 ? 0.58522 0.55217 0.20647 0.00409  -0.01784 0.10931  374 ARG A NH2 
3334 N  NH2 B ARG A 374 ? 0.47571 0.59355 0.31937 -0.05240 0.15990  0.02676  374 ARG A NH2 
3335 N  N   . LEU A 375 ? 0.18984 0.19227 0.08962 0.01491  -0.00597 0.02524  375 LEU A N   
3336 C  CA  . LEU A 375 ? 0.17559 0.19595 0.09811 0.01770  -0.00744 0.02118  375 LEU A CA  
3337 C  C   . LEU A 375 ? 0.16903 0.19127 0.08548 0.01142  -0.00461 0.01715  375 LEU A C   
3338 O  O   . LEU A 375 ? 0.17976 0.20068 0.09610 0.02397  -0.01617 0.01163  375 LEU A O   
3339 C  CB  . LEU A 375 ? 0.17381 0.20926 0.12188 0.02221  -0.01262 0.02532  375 LEU A CB  
3340 C  CG  . LEU A 375 ? 0.17624 0.23704 0.13114 0.01330  -0.01564 0.02306  375 LEU A CG  
3341 C  CD1 . LEU A 375 ? 0.20111 0.26172 0.14645 0.00226  -0.02812 0.01232  375 LEU A CD1 
3342 C  CD2 . LEU A 375 ? 0.18430 0.27731 0.14721 0.02170  0.00046  0.02292  375 LEU A CD2 
3343 N  N   . ASP A 376 ? 0.15818 0.18611 0.08242 0.01672  -0.00709 0.02843  376 ASP A N   
3344 C  CA  . ASP A 376 ? 0.15772 0.17907 0.07656 0.01771  -0.00379 0.01867  376 ASP A CA  
3345 C  C   . ASP A 376 ? 0.15967 0.17990 0.08194 0.00939  -0.00688 0.01819  376 ASP A C   
3346 O  O   . ASP A 376 ? 0.18833 0.18357 0.09721 0.01476  0.01137  0.01397  376 ASP A O   
3347 C  CB  . ASP A 376 ? 0.15962 0.17876 0.08016 0.01768  -0.01033 0.02142  376 ASP A CB  
3348 C  CG  . ASP A 376 ? 0.15371 0.17919 0.09021 0.00463  -0.00303 0.02813  376 ASP A CG  
3349 O  OD1 . ASP A 376 ? 0.15907 0.18628 0.10894 0.00605  0.00517  0.03251  376 ASP A OD1 
3350 O  OD2 . ASP A 376 ? 0.15407 0.19355 0.12650 0.00529  -0.01058 0.03338  376 ASP A OD2 
3351 N  N   . GLN A 377 ? 0.15983 0.18450 0.08698 0.00801  0.00099  0.02117  377 GLN A N   
3352 C  CA  . GLN A 377 ? 0.16274 0.19092 0.09289 0.00994  0.01374  0.01103  377 GLN A CA  
3353 C  C   . GLN A 377 ? 0.16977 0.18863 0.09131 0.01176  0.01151  0.02307  377 GLN A C   
3354 O  O   . GLN A 377 ? 0.17742 0.20228 0.10027 0.00995  0.00831  0.01020  377 GLN A O   
3355 C  CB  . GLN A 377 ? 0.17905 0.20931 0.11543 -0.00036 0.01066  0.01194  377 GLN A CB  
3356 C  CG  . GLN A 377 ? 0.17954 0.22792 0.11739 0.00622  0.01037  0.01496  377 GLN A CG  
3357 C  CD  . GLN A 377 ? 0.17585 0.23912 0.10013 0.00602  0.00931  0.01157  377 GLN A CD  
3358 O  OE1 . GLN A 377 ? 0.18060 0.26391 0.09723 0.01180  -0.00127 0.00675  377 GLN A OE1 
3359 N  NE2 . GLN A 377 ? 0.18805 0.23685 0.10541 0.00208  0.01074  0.00752  377 GLN A NE2 
3360 N  N   . LEU A 378 ? 0.17658 0.20018 0.08322 0.00681  0.00204  0.02374  378 LEU A N   
3361 C  CA  . LEU A 378 ? 0.18206 0.21242 0.08917 0.01677  -0.01105 0.01408  378 LEU A CA  
3362 C  C   . LEU A 378 ? 0.17761 0.20488 0.07827 0.00905  -0.01123 0.01204  378 LEU A C   
3363 O  O   . LEU A 378 ? 0.20450 0.21354 0.08647 0.01065  -0.01365 0.01321  378 LEU A O   
3364 C  CB  . LEU A 378 ? 0.20525 0.23121 0.11248 0.02122  -0.01558 0.03640  378 LEU A CB  
3365 C  CG  . LEU A 378 ? 0.27028 0.26541 0.12508 0.03808  -0.01115 0.05614  378 LEU A CG  
3366 C  CD1 . LEU A 378 ? 0.29037 0.26406 0.17019 0.05198  -0.03929 0.04648  378 LEU A CD1 
3367 C  CD2 . LEU A 378 ? 0.34941 0.32722 0.13955 0.04988  0.02371  0.07039  378 LEU A CD2 
3368 N  N   . ALA A 379 ? 0.16814 0.19790 0.08501 0.00997  -0.00322 0.02008  379 ALA A N   
3369 C  CA  . ALA A 379 ? 0.17041 0.20650 0.09128 0.00663  0.00090  0.01854  379 ALA A CA  
3370 C  C   . ALA A 379 ? 0.16882 0.18950 0.09038 0.00197  -0.00288 0.01817  379 ALA A C   
3371 O  O   . ALA A 379 ? 0.18677 0.19307 0.11583 -0.00083 -0.00055 0.01197  379 ALA A O   
3372 C  CB  . ALA A 379 ? 0.17542 0.23157 0.10897 0.00561  0.00879  0.02368  379 ALA A CB  
3373 N  N   . MET A 380 ? 0.16546 0.19340 0.08679 0.01065  0.00229  0.01497  380 MET A N   
3374 C  CA  A MET A 380 ? 0.16673 0.19699 0.09056 0.01610  -0.00087 0.00377  380 MET A CA  
3375 C  CA  B MET A 380 ? 0.16530 0.20366 0.08911 0.01066  -0.00854 0.00165  380 MET A CA  
3376 C  C   . MET A 380 ? 0.16873 0.19740 0.09230 0.01362  -0.00726 0.00512  380 MET A C   
3377 O  O   . MET A 380 ? 0.18641 0.20640 0.10012 0.01616  -0.00986 0.00511  380 MET A O   
3378 C  CB  A MET A 380 ? 0.17879 0.22163 0.09917 0.01499  -0.02033 0.01335  380 MET A CB  
3379 C  CB  B MET A 380 ? 0.16773 0.23119 0.08821 0.00823  -0.02283 -0.00903 380 MET A CB  
3380 C  CG  A MET A 380 ? 0.19276 0.26357 0.13423 0.02119  -0.02156 0.03199  380 MET A CG  
3381 C  CG  B MET A 380 ? 0.17336 0.25925 0.09922 0.00392  -0.02604 -0.01273 380 MET A CG  
3382 S  SD  A MET A 380 ? 0.22097 0.32810 0.19889 0.01574  -0.02854 0.07162  380 MET A SD  
3383 S  SD  B MET A 380 ? 0.21010 0.27835 0.11185 -0.00482 -0.00079 0.00311  380 MET A SD  
3384 C  CE  A MET A 380 ? 0.20542 0.52092 0.16875 -0.04798 0.00174  0.00183  380 MET A CE  
3385 C  CE  B MET A 380 ? 0.22885 0.30218 0.09302 -0.01224 -0.00409 -0.00055 380 MET A CE  
3386 N  N   . ASP A 381 ? 0.17690 0.20377 0.08332 0.00574  -0.00168 0.00624  381 ASP A N   
3387 C  CA  . ASP A 381 ? 0.18938 0.21349 0.08302 0.00684  0.01048  0.00362  381 ASP A CA  
3388 C  C   . ASP A 381 ? 0.19556 0.22367 0.08282 0.00581  0.00434  0.00254  381 ASP A C   
3389 O  O   . ASP A 381 ? 0.20886 0.23996 0.10440 0.00249  0.01407  -0.01786 381 ASP A O   
3390 C  CB  . ASP A 381 ? 0.20897 0.22317 0.09837 -0.00243 0.00990  0.01284  381 ASP A CB  
3391 C  CG  . ASP A 381 ? 0.23864 0.23816 0.11180 -0.00640 0.00485  0.02759  381 ASP A CG  
3392 O  OD1 . ASP A 381 ? 0.21927 0.25677 0.12510 -0.01671 0.00364  0.00862  381 ASP A OD1 
3393 O  OD2 . ASP A 381 ? 0.29191 0.24882 0.17006 -0.02106 -0.01927 0.04956  381 ASP A OD2 
3394 N  N   . HIS A 382 ? 0.18618 0.21578 0.08316 0.00891  -0.01482 0.01339  382 HIS A N   
3395 C  CA  . HIS A 382 ? 0.19927 0.22089 0.09770 0.00763  -0.01914 0.00621  382 HIS A CA  
3396 C  C   . HIS A 382 ? 0.21397 0.21841 0.10291 0.00452  -0.03074 0.00075  382 HIS A C   
3397 O  O   . HIS A 382 ? 0.25830 0.22166 0.10982 0.00231  -0.03898 -0.00362 382 HIS A O   
3398 C  CB  . HIS A 382 ? 0.20431 0.23280 0.10854 0.01259  -0.01881 0.01774  382 HIS A CB  
3399 C  CG  . HIS A 382 ? 0.21420 0.25043 0.11047 0.00996  -0.02190 0.00589  382 HIS A CG  
3400 N  ND1 . HIS A 382 ? 0.24204 0.27117 0.12908 0.01534  -0.02955 0.01489  382 HIS A ND1 
3401 C  CD2 . HIS A 382 ? 0.22994 0.26443 0.13101 0.01466  -0.02575 0.02329  382 HIS A CD2 
3402 C  CE1 . HIS A 382 ? 0.24928 0.28363 0.14685 0.02451  -0.02842 0.04040  382 HIS A CE1 
3403 N  NE2 . HIS A 382 ? 0.24021 0.31377 0.14138 0.02509  -0.03681 0.05658  382 HIS A NE2 
3404 N  N   . LEU A 383 ? 0.20456 0.20616 0.10385 0.00247  -0.02265 0.01248  383 LEU A N   
3405 C  CA  . LEU A 383 ? 0.20730 0.20027 0.10126 0.00682  -0.01165 0.00332  383 LEU A CA  
3406 C  C   . LEU A 383 ? 0.22773 0.19602 0.10230 0.01155  0.00183  0.00592  383 LEU A C   
3407 O  O   . LEU A 383 ? 0.25234 0.20808 0.12229 0.00285  0.00896  -0.00952 383 LEU A O   
3408 C  CB  . LEU A 383 ? 0.19587 0.20930 0.09860 0.01153  -0.01112 0.01467  383 LEU A CB  
3409 C  CG  . LEU A 383 ? 0.20751 0.22602 0.11596 0.00781  -0.00557 0.01737  383 LEU A CG  
3410 C  CD1 . LEU A 383 ? 0.22276 0.22409 0.14694 0.00543  0.00983  0.01903  383 LEU A CD1 
3411 C  CD2 . LEU A 383 ? 0.23884 0.26372 0.12466 0.02214  -0.02265 0.01601  383 LEU A CD2 
3412 N  N   . LEU A 384 ? 0.22469 0.21117 0.10614 0.01739  0.00992  0.00472  384 LEU A N   
3413 C  CA  . LEU A 384 ? 0.23189 0.23207 0.11299 0.02536  0.02008  -0.00233 384 LEU A CA  
3414 C  C   . LEU A 384 ? 0.26316 0.26707 0.11740 0.03833  0.02591  -0.01053 384 LEU A C   
3415 O  O   . LEU A 384 ? 0.30587 0.33602 0.14071 0.07658  0.03672  -0.02602 384 LEU A O   
3416 C  CB  . LEU A 384 ? 0.22308 0.26044 0.11888 0.02834  0.01774  -0.00069 384 LEU A CB  
3417 C  CG  . LEU A 384 ? 0.25941 0.31131 0.13763 0.05494  -0.00566 -0.00403 384 LEU A CG  
3418 C  CD1 . LEU A 384 ? 0.26816 0.36375 0.17213 0.01936  -0.00600 -0.01227 384 LEU A CD1 
3419 C  CD2 . LEU A 384 ? 0.35715 0.33945 0.14839 0.09869  -0.03034 0.00754  384 LEU A CD2 
3420 N  N   . GLY A 385 ? 0.28424 0.26904 0.10785 0.01647  0.01199  -0.01460 385 GLY A N   
3421 C  CA  . GLY A 385 ? 0.33724 0.31247 0.10953 0.01037  0.00309  -0.01817 385 GLY A CA  
3422 C  C   . GLY A 385 ? 0.35569 0.34555 0.11656 0.03332  0.03111  -0.01026 385 GLY A C   
3423 O  O   . GLY A 385 ? 0.46746 0.39350 0.15255 0.03821  0.09060  -0.01902 385 GLY A O   
3424 N  N   . ALA A 386 ? 0.29904 0.33553 0.12869 0.02639  0.02890  0.01349  386 ALA A N   
3425 C  CA  . ALA A 386 ? 0.34050 0.37034 0.18221 0.00873  0.04791  0.05515  386 ALA A CA  
3426 C  C   . ALA A 386 ? 0.40272 0.39917 0.32823 0.00452  0.05548  0.11051  386 ALA A C   
3427 O  O   . ALA A 386 ? 0.47914 0.41276 0.57114 -0.01572 0.04124  0.13730  386 ALA A O   
3428 C  CB  . ALA A 386 ? 0.34598 0.37566 0.20569 -0.00233 0.03817  0.04818  386 ALA A CB  
3440 MG MG  . MG  B .   ? 0.16598 0.18588 0.14266 0.02139  -0.03798 -0.03538 401 MG  A MG  
3441 MG MG  . MG  C .   ? 0.09999 0.10867 0.05621 -0.02001 -0.00988 0.01962  402 MG  A MG  
3442 NA NA  . NA  D .   ? 0.32470 0.39242 0.26852 -0.02539 0.01083  0.03143  403 NA  A NA  
3443 O  O   . HOH E .   ? 0.53813 0.55065 0.20399 0.06129  -0.03700 -0.08123 501 HOH A O   
3444 O  O   . HOH E .   ? 0.57733 0.35089 0.25003 0.04837  0.08265  0.04735  502 HOH A O   
3445 O  O   . HOH E .   ? 0.38456 0.32764 0.36381 0.05274  -0.09601 0.07757  503 HOH A O   
3446 O  O   . HOH E .   ? 0.28030 0.51742 0.41949 0.02027  -0.05432 0.11003  504 HOH A O   
3448 O  O   . HOH E .   ? 0.49717 0.41873 0.46013 0.01137  -0.16383 -0.11871 506 HOH A O   
3449 O  O   . HOH E .   ? 0.32790 0.50107 0.25142 -0.10445 -0.00337 -0.02850 507 HOH A O   
3450 O  O   . HOH E .   ? 0.39229 0.46592 0.44094 -0.03547 0.01200  -0.16078 508 HOH A O   
3451 O  O   . HOH E .   ? 0.59223 0.29512 0.33529 0.04728  0.02446  0.02692  509 HOH A O   
3452 O  O   . HOH E .   ? 0.41742 0.28775 0.55142 -0.03630 -0.13142 0.05137  510 HOH A O   
3453 O  O   . HOH E .   ? 0.94196 0.60813 0.27614 0.17028  -0.08839 0.01279  511 HOH A O   
3454 O  O   . HOH E .   ? 0.54074 0.46073 0.40406 0.12199  0.02494  0.17638  512 HOH A O   
3455 O  O   . HOH E .   ? 0.37221 0.33695 0.35403 0.06249  0.02364  0.00161  513 HOH A O   
3456 O  O   . HOH E .   ? 0.55085 0.68025 0.49752 0.29498  -0.20274 -0.25679 514 HOH A O   
3457 O  O   . HOH E .   ? 0.29453 0.32291 0.21998 -0.03191 0.02242  0.00277  515 HOH A O   
3459 O  O   . HOH E .   ? 0.42627 0.63452 0.55341 0.00789  0.00725  -0.15049 517 HOH A O   
3460 O  O   . HOH E .   ? 0.68573 0.64365 0.31272 0.29450  0.00574  0.08758  518 HOH A O   
3461 O  O   . HOH E .   ? 0.33444 0.22608 0.16580 0.02356  0.05752  0.00679  519 HOH A O   
3462 O  O   . HOH E .   ? 0.30426 0.65835 0.69286 -0.12176 -0.03208 -0.01697 520 HOH A O   
3463 O  O   . HOH E .   ? 0.47331 0.49802 0.49868 -0.11026 0.11709  0.06460  521 HOH A O   
3464 O  O   . HOH E .   ? 0.35436 0.33604 0.26016 0.03056  -0.07339 -0.12333 522 HOH A O   
3465 O  O   . HOH E .   ? 0.41161 0.57677 0.45720 -0.08489 0.06460  -0.12333 523 HOH A O   
3466 O  O   . HOH E .   ? 0.63929 0.57724 0.23828 0.06098  0.09019  -0.11515 524 HOH A O   
3467 O  O   . HOH E .   ? 0.26417 0.49288 0.40121 -0.01985 -0.07444 0.10990  525 HOH A O   
3468 O  O   . HOH E .   ? 1.04424 0.41659 0.40021 -0.15599 0.02086  -0.03481 526 HOH A O   
3469 O  O   . HOH E .   ? 0.58087 0.53268 0.34406 0.03532  0.15959  0.01097  527 HOH A O   
3470 O  O   . HOH E .   ? 0.78449 0.66928 0.37974 -0.11804 -0.03353 -0.07569 528 HOH A O   
3471 O  O   . HOH E .   ? 0.39051 0.59523 0.53283 0.05737  0.00625  -0.02710 529 HOH A O   
3472 O  O   . HOH E .   ? 0.55269 0.63773 0.35174 -0.03171 -0.18004 0.03759  530 HOH A O   
3473 O  O   . HOH E .   ? 0.40404 0.31243 0.30108 0.01369  -0.03803 -0.10957 531 HOH A O   
3474 O  O   . HOH E .   ? 0.34567 0.46298 0.72563 -0.04936 0.02228  0.24977  532 HOH A O   
3475 O  O   . HOH E .   ? 0.43135 0.32375 0.19086 -0.05803 0.04470  -0.08492 533 HOH A O   
3476 O  O   . HOH E .   ? 0.34013 0.35523 0.43418 -0.05457 -0.10494 0.03036  534 HOH A O   
3477 O  O   . HOH E .   ? 0.51670 0.68304 0.33932 0.02504  -0.01298 -0.00353 535 HOH A O   
3478 O  O   . HOH E .   ? 0.48339 0.30820 0.42262 0.02856  0.09059  -0.01419 536 HOH A O   
3479 O  O   . HOH E .   ? 0.90165 0.74558 0.35384 -0.16456 -0.03572 0.06875  537 HOH A O   
3480 O  O   . HOH E .   ? 0.20625 0.24583 0.18730 -0.04446 -0.04240 0.05776  538 HOH A O   
3481 O  O   . HOH E .   ? 0.41879 0.45046 0.37407 -0.00181 -0.01881 -0.06737 539 HOH A O   
3482 O  O   . HOH E .   ? 0.50959 0.59167 0.87023 0.04490  -0.05746 -0.33322 540 HOH A O   
3483 O  O   . HOH E .   ? 0.49374 0.40992 0.36228 0.09090  0.06011  0.03677  541 HOH A O   
3484 O  O   . HOH E .   ? 0.52703 0.71237 0.37374 0.17391  0.03127  -0.17096 542 HOH A O   
3485 O  O   . HOH E .   ? 0.23545 0.23647 0.14666 -0.04477 -0.03673 0.00810  543 HOH A O   
3486 O  O   . HOH E .   ? 0.18623 0.18584 0.10916 0.00011  0.00679  -0.00826 544 HOH A O   
3487 O  O   . HOH E .   ? 0.44971 0.28851 0.35768 0.07057  0.07702  0.06197  545 HOH A O   
3488 O  O   . HOH E .   ? 0.56344 0.82141 0.61348 -0.06907 -0.13719 0.39003  546 HOH A O   
3489 O  O   . HOH E .   ? 0.34781 0.41994 0.65938 -0.03754 0.05385  -0.14066 547 HOH A O   
3490 O  O   . HOH E .   ? 0.47431 0.71974 0.23748 -0.04861 -0.05493 0.13033  548 HOH A O   
3491 O  O   . HOH E .   ? 0.50986 0.49635 0.86257 -0.09219 0.12994  -0.29691 549 HOH A O   
3492 O  O   . HOH E .   ? 0.57526 0.22271 0.16271 -0.03725 -0.06362 0.02617  550 HOH A O   
3493 O  O   . HOH E .   ? 0.70167 0.52006 0.37757 0.22690  -0.22148 -0.05367 551 HOH A O   
3494 O  O   . HOH E .   ? 0.91616 0.27908 0.25574 0.01641  -0.08995 0.01634  552 HOH A O   
3495 O  O   . HOH E .   ? 0.44062 0.74699 0.39594 0.02986  0.04975  -0.05471 553 HOH A O   
3496 O  O   . HOH E .   ? 0.36393 0.37264 0.15229 0.06622  -0.00243 0.00076  554 HOH A O   
3497 O  O   . HOH E .   ? 0.14876 0.17766 0.07973 -0.00376 0.00024  0.01039  555 HOH A O   
3499 O  O   . HOH E .   ? 0.18313 0.26071 0.13172 -0.03296 -0.00678 0.05775  557 HOH A O   
3500 O  O   . HOH E .   ? 0.18201 0.26933 0.13804 -0.01709 -0.00040 -0.01271 558 HOH A O   
3501 O  O   . HOH E .   ? 0.38005 0.44719 0.29430 -0.04448 -0.06583 -0.08384 559 HOH A O   
3502 O  O   . HOH E .   ? 0.17722 0.24541 0.15041 0.05159  -0.01039 0.04224  560 HOH A O   
3503 O  O   . HOH E .   ? 0.37778 0.44733 0.69130 0.00872  0.08489  -0.05728 561 HOH A O   
3504 O  O   . HOH E .   ? 0.39693 0.37680 0.23699 0.08055  -0.05889 0.08223  562 HOH A O   
3505 O  O   . HOH E .   ? 0.64262 0.63055 0.30662 0.01593  0.11210  0.14813  563 HOH A O   
3506 O  O   . HOH E .   ? 0.20007 0.28017 0.29793 0.00639  -0.00871 -0.12153 564 HOH A O   
3507 O  O   . HOH E .   ? 0.20045 0.23072 0.13162 0.01905  0.00720  -0.00535 565 HOH A O   
3508 O  O   . HOH E .   ? 0.60394 0.96883 0.46397 0.02744  -0.04530 0.24142  566 HOH A O   
3509 O  O   . HOH E .   ? 0.28061 0.42298 0.41715 0.03830  0.01537  0.09520  567 HOH A O   
3510 O  O   . HOH E .   ? 0.28303 0.30801 0.14534 0.00977  0.00868  0.00767  568 HOH A O   
3511 O  O   . HOH E .   ? 0.22447 0.28611 0.27795 -0.05563 0.00051  -0.02100 569 HOH A O   
3512 O  O   . HOH E .   ? 0.39230 0.60686 0.39286 0.04750  -0.09031 -0.04101 570 HOH A O   
3513 O  O   . HOH E .   ? 0.64930 0.48531 0.31935 0.09632  0.21009  0.08760  571 HOH A O   
3514 O  O   . HOH E .   ? 0.24749 0.23535 0.19227 -0.05788 -0.01774 -0.00990 572 HOH A O   
3515 O  O   . HOH E .   ? 0.26616 0.28034 0.19584 0.02005  0.01437  0.01668  573 HOH A O   
3516 O  O   . HOH E .   ? 0.43301 0.53818 0.46494 0.09771  -0.14335 0.19054  574 HOH A O   
3517 O  O   . HOH E .   ? 0.34436 0.26576 0.31099 -0.04466 -0.02753 -0.01332 575 HOH A O   
3518 O  O   . HOH E .   ? 0.53150 0.36864 0.53516 0.06758  -0.06579 0.14745  576 HOH A O   
3519 O  O   . HOH E .   ? 0.92543 0.29532 0.34975 0.07049  -0.21198 -0.03488 577 HOH A O   
3520 O  O   . HOH E .   ? 0.53801 0.30556 0.29566 0.04230  -0.07870 -0.07932 578 HOH A O   
3521 O  O   . HOH E .   ? 0.25998 0.25902 0.31713 -0.02602 -0.00980 0.07131  579 HOH A O   
3522 O  O   . HOH E .   ? 0.53072 0.53347 0.36924 0.11819  0.12485  0.06390  580 HOH A O   
3523 O  O   . HOH E .   ? 0.18018 0.19682 0.09940 -0.00403 -0.01119 0.01894  581 HOH A O   
3524 O  O   . HOH E .   ? 0.29405 0.27161 0.13944 -0.03305 -0.03951 -0.01263 582 HOH A O   
3525 O  O   . HOH E .   ? 0.42809 0.37356 0.32678 -0.06043 0.01915  0.07015  583 HOH A O   
3526 O  O   . HOH E .   ? 0.49279 0.49181 0.27231 0.07870  -0.10630 -0.14408 584 HOH A O   
3527 O  O   A HOH E .   ? 0.18099 0.29542 0.18518 0.01072  -0.00967 0.02538  585 HOH A O   
3528 O  O   B HOH E .   ? 0.27513 0.43764 0.18551 0.04513  -0.04260 -0.00673 585 HOH A O   
3529 O  O   . HOH E .   ? 0.28044 0.33883 0.20919 -0.00154 0.05626  0.02298  586 HOH A O   
3530 O  O   . HOH E .   ? 0.63394 0.34693 0.57945 0.07116  0.31573  0.00116  587 HOH A O   
3531 O  O   . HOH E .   ? 0.18049 0.20349 0.13258 -0.01049 0.00022  0.01618  588 HOH A O   
3532 O  O   . HOH E .   ? 0.33450 0.42309 0.23902 -0.17101 -0.02893 0.03481  589 HOH A O   
3533 O  O   . HOH E .   ? 0.55195 0.56261 0.62128 0.20880  0.02088  0.17277  590 HOH A O   
3534 O  O   . HOH E .   ? 0.23120 0.20163 0.13971 0.00308  -0.01765 -0.02408 591 HOH A O   
3535 O  O   . HOH E .   ? 0.20578 0.21197 0.15771 0.00624  -0.01430 -0.00273 592 HOH A O   
3536 O  O   . HOH E .   ? 0.37825 0.24414 0.19577 0.03535  -0.08307 -0.00652 593 HOH A O   
3537 O  O   A HOH E .   ? 0.11134 0.21759 0.08279 0.00554  -0.01048 0.01056  594 HOH A O   
3538 O  O   B HOH E .   ? 0.17978 0.30971 0.10389 0.01078  -0.01937 0.00343  594 HOH A O   
3539 O  O   . HOH E .   ? 0.19653 0.37150 0.21594 0.07199  0.00905  0.11561  595 HOH A O   
3540 O  O   . HOH E .   ? 0.53770 0.56618 0.53919 -0.13576 -0.17949 -0.00198 596 HOH A O   
3541 O  O   . HOH E .   ? 0.15760 0.17079 0.13454 0.00185  -0.01962 0.00284  597 HOH A O   
3542 O  O   . HOH E .   ? 0.55920 0.83334 0.42853 0.18697  -0.01837 0.17156  598 HOH A O   
3543 O  O   . HOH E .   ? 0.38690 0.63132 0.56721 -0.10592 0.12577  -0.23275 599 HOH A O   
3545 O  O   . HOH E .   ? 0.39901 0.54448 0.66645 -0.03859 0.01574  -0.05014 601 HOH A O   
3546 O  O   . HOH E .   ? 0.17996 0.21434 0.12350 0.01589  0.01353  -0.01033 602 HOH A O   
3547 O  O   . HOH E .   ? 0.55232 0.41189 0.14259 0.02642  -0.01151 0.01954  603 HOH A O   
3548 O  O   . HOH E .   ? 0.38199 0.63499 0.87734 0.13172  0.05513  -0.10419 604 HOH A O   
3549 O  O   . HOH E .   ? 0.22119 0.26225 0.29202 -0.01243 -0.05270 0.01655  605 HOH A O   
3550 O  O   . HOH E .   ? 0.81484 0.71606 0.35918 0.27638  -0.06045 -0.14009 606 HOH A O   
3551 O  O   . HOH E .   ? 0.36870 0.29587 0.23755 -0.08918 -0.10712 -0.02150 607 HOH A O   
3552 O  O   . HOH E .   ? 0.40953 0.61067 0.60770 -0.15002 -0.04730 0.20170  608 HOH A O   
3553 O  O   . HOH E .   ? 0.26774 0.82812 0.31487 0.03525  -0.01630 0.20504  609 HOH A O   
3554 O  O   . HOH E .   ? 0.17568 0.26309 0.15734 -0.03894 -0.02649 0.03920  610 HOH A O   
3555 O  O   . HOH E .   ? 0.27691 0.31459 0.31894 0.06361  -0.01302 0.03221  611 HOH A O   
3556 O  O   . HOH E .   ? 0.29938 0.25655 0.22263 -0.03773 -0.03187 0.01697  612 HOH A O   
3557 O  O   . HOH E .   ? 0.41236 0.36982 0.31998 -0.04053 -0.18147 0.12314  613 HOH A O   
3558 O  O   . HOH E .   ? 0.37797 0.47067 0.39129 -0.03860 0.03499  -0.06504 614 HOH A O   
3560 O  O   . HOH E .   ? 0.16931 0.20580 0.11608 -0.01257 -0.00994 0.01683  616 HOH A O   
3561 O  O   . HOH E .   ? 0.40070 0.24496 0.23143 -0.00185 -0.11938 -0.02623 617 HOH A O   
3562 O  O   . HOH E .   ? 0.53311 0.56747 0.32934 -0.02793 0.06603  0.17026  618 HOH A O   
3563 O  O   . HOH E .   ? 0.38040 0.70065 0.38085 0.08075  -0.05404 0.07367  619 HOH A O   
3564 O  O   . HOH E .   ? 0.66890 0.61106 0.60183 -0.08339 0.35052  -0.16471 620 HOH A O   
3565 O  O   . HOH E .   ? 0.26417 0.48333 0.32173 0.03606  -0.01770 -0.04388 621 HOH A O   
3566 O  O   . HOH E .   ? 0.42538 0.58797 0.19267 0.03898  -0.03819 -0.10900 622 HOH A O   
3567 O  O   . HOH E .   ? 0.43923 0.37424 0.37000 -0.04130 -0.22053 0.10614  623 HOH A O   
3568 O  O   . HOH E .   ? 0.17871 0.21111 0.10270 -0.04412 0.00266  0.02395  624 HOH A O   
3569 O  O   . HOH E .   ? 0.31968 0.32951 0.40021 -0.06071 0.02104  -0.04128 625 HOH A O   
3570 O  O   . HOH E .   ? 0.33595 0.51751 0.20326 -0.00304 -0.04111 0.05402  626 HOH A O   
3571 O  O   . HOH E .   ? 0.19108 0.17675 0.18820 -0.04194 -0.03161 0.01538  627 HOH A O   
3572 O  O   . HOH E .   ? 0.37363 0.29975 0.41598 -0.12034 -0.05312 0.02656  628 HOH A O   
3573 O  O   . HOH E .   ? 0.39164 0.36179 0.33695 -0.02185 -0.10598 -0.01231 629 HOH A O   
3574 O  O   . HOH E .   ? 0.17527 0.22233 0.15168 0.00412  0.01950  0.01422  630 HOH A O   
3575 O  O   . HOH E .   ? 0.28674 0.52538 0.37494 0.07122  0.00396  -0.02887 631 HOH A O   
3576 O  O   . HOH E .   ? 0.15188 0.21345 0.11004 -0.00040 0.00427  0.00549  632 HOH A O   
3577 O  O   . HOH E .   ? 0.49262 0.82669 0.32851 0.13360  -0.12167 -0.02594 633 HOH A O   
3578 O  O   . HOH E .   ? 0.20364 0.22986 0.15516 -0.01210 -0.00861 -0.00204 634 HOH A O   
3579 O  O   . HOH E .   ? 0.34881 0.39895 0.32631 -0.03396 0.11192  0.13404  635 HOH A O   
3580 O  O   . HOH E .   ? 0.18797 0.22179 0.20729 -0.02398 -0.02562 0.00844  636 HOH A O   
3581 O  O   . HOH E .   ? 0.19094 0.20758 0.17161 -0.03738 0.00031  0.02396  637 HOH A O   
3582 O  O   . HOH E .   ? 0.32344 0.34013 0.38984 -0.00914 -0.04844 0.13973  638 HOH A O   
3583 O  O   . HOH E .   ? 0.17028 0.21529 0.14082 0.00376  -0.01003 0.01671  639 HOH A O   
3584 O  O   . HOH E .   ? 0.52645 0.34564 0.71874 -0.05774 -0.15120 -0.09685 640 HOH A O   
3585 O  O   . HOH E .   ? 0.41145 0.35242 0.31604 -0.00114 0.02012  -0.00386 641 HOH A O   
3586 O  O   . HOH E .   ? 0.44718 0.77863 0.57660 -0.08014 0.03888  0.16893  642 HOH A O   
3587 O  O   . HOH E .   ? 0.40877 0.36086 0.18534 0.03156  0.05537  -0.02125 643 HOH A O   
3588 O  O   . HOH E .   ? 0.38875 0.68656 0.46631 -0.21575 -0.06320 -0.05075 644 HOH A O   
3589 O  O   . HOH E .   ? 0.44168 0.44967 0.30062 -0.06848 -0.20323 0.02397  645 HOH A O   
3590 O  O   . HOH E .   ? 0.28847 0.22573 0.20186 -0.03216 -0.03209 0.00388  646 HOH A O   
3591 O  O   . HOH E .   ? 0.17805 0.22388 0.12572 -0.03083 -0.02098 0.03938  647 HOH A O   
3592 O  O   . HOH E .   ? 0.47053 0.55198 0.44510 0.17420  0.06567  0.07537  648 HOH A O   
3593 O  O   . HOH E .   ? 0.23819 0.51808 0.37005 0.05269  0.05131  0.04639  649 HOH A O   
3594 O  O   . HOH E .   ? 0.15284 0.25636 0.09405 -0.01836 -0.00549 -0.00333 650 HOH A O   
3595 O  O   . HOH E .   ? 0.47815 0.41350 0.25359 -0.10157 -0.15526 -0.01706 651 HOH A O   
3596 O  O   . HOH E .   ? 0.58613 0.57104 0.36547 -0.04904 -0.09737 -0.18074 652 HOH A O   
3597 O  O   . HOH E .   ? 0.21583 0.20074 0.25333 -0.02531 0.04309  -0.05026 653 HOH A O   
3598 O  O   . HOH E .   ? 0.22107 0.23966 0.20998 -0.05219 -0.03234 0.00066  654 HOH A O   
3599 O  O   . HOH E .   ? 0.22811 0.21547 0.14300 -0.00267 0.00556  -0.02619 655 HOH A O   
3600 O  O   . HOH E .   ? 0.28140 0.42547 0.45038 0.00071  -0.09026 0.04184  656 HOH A O   
3601 O  O   . HOH E .   ? 0.81340 0.23931 0.46549 -0.00139 -0.06617 -0.00164 657 HOH A O   
3602 O  O   . HOH E .   ? 0.24705 0.37369 0.29266 -0.03720 0.00066  0.13173  658 HOH A O   
3603 O  O   . HOH E .   ? 0.29240 0.46038 0.28632 0.03178  -0.02494 0.06051  659 HOH A O   
3604 O  O   . HOH E .   ? 0.38842 0.33517 0.20915 0.05425  -0.09975 -0.04513 660 HOH A O   
3605 O  O   . HOH E .   ? 0.24846 0.31735 0.28450 0.00731  0.07124  -0.04190 661 HOH A O   
3606 O  O   . HOH E .   ? 0.40107 0.47508 0.40906 0.03667  -0.05765 -0.16317 662 HOH A O   
3607 O  O   . HOH E .   ? 0.46575 0.53244 0.37082 -0.07966 0.02697  -0.05382 663 HOH A O   
3608 O  O   . HOH E .   ? 0.19393 0.20593 0.10713 -0.02372 0.01837  0.04023  664 HOH A O   
3609 O  O   . HOH E .   ? 0.21418 0.26159 0.11330 0.01430  -0.01062 0.02356  665 HOH A O   
3610 O  O   . HOH E .   ? 0.49939 0.40958 0.19382 0.00411  -0.13208 -0.01388 666 HOH A O   
3611 O  O   . HOH E .   ? 0.38963 0.31821 0.18119 -0.01039 -0.08462 -0.03677 667 HOH A O   
3612 O  O   . HOH E .   ? 0.19247 0.17431 0.13218 -0.00756 0.02095  -0.00137 668 HOH A O   
3613 O  O   . HOH E .   ? 0.55082 0.68131 0.39366 0.00111  0.02179  -0.04371 669 HOH A O   
3614 O  O   . HOH E .   ? 0.34778 0.51550 0.29342 0.12523  -0.01722 0.10963  670 HOH A O   
3615 O  O   . HOH E .   ? 0.48738 0.73609 0.38320 0.08229  0.03190  0.09790  671 HOH A O   
3616 O  O   . HOH E .   ? 0.29702 0.30292 0.20248 0.02684  0.04099  0.01285  672 HOH A O   
3617 O  O   . HOH E .   ? 0.22608 0.21859 0.30479 -0.01525 0.04365  -0.04003 673 HOH A O   
3618 O  O   . HOH E .   ? 0.27411 0.64187 0.41416 0.10292  0.07265  0.07851  674 HOH A O   
3619 O  O   . HOH E .   ? 0.31821 0.24779 0.25951 -0.06790 -0.03527 -0.00331 675 HOH A O   
3620 O  O   . HOH E .   ? 0.28167 0.40095 0.26606 0.05307  -0.03380 0.03770  676 HOH A O   
3621 O  O   . HOH E .   ? 0.15933 0.21602 0.19592 0.01774  0.01939  -0.03521 677 HOH A O   
3622 O  O   . HOH E .   ? 0.40512 0.28829 0.21394 -0.14120 -0.02889 0.00585  678 HOH A O   
3623 O  O   . HOH E .   ? 0.43529 0.41219 0.36073 -0.02179 -0.02592 -0.02679 679 HOH A O   
3624 O  O   . HOH E .   ? 0.43757 0.52550 0.50072 -0.10065 -0.08538 -0.07875 680 HOH A O   
3625 O  O   . HOH E .   ? 0.19302 0.25342 0.18627 -0.00419 -0.01758 -0.04417 681 HOH A O   
3626 O  O   . HOH E .   ? 0.47597 0.59281 0.33458 -0.06330 0.01879  -0.00630 682 HOH A O   
3627 O  O   . HOH E .   ? 0.42984 0.54452 0.64659 0.12102  0.16262  0.05715  683 HOH A O   
3628 O  O   A HOH E .   ? 0.51111 0.24400 0.23652 0.10982  0.01981  -0.00452 684 HOH A O   
3629 O  O   B HOH E .   ? 0.49391 0.52453 0.26245 0.27292  -0.09461 -0.11268 684 HOH A O   
3630 O  O   . HOH E .   ? 0.24451 0.25201 0.14419 0.00241  -0.00588 -0.04275 685 HOH A O   
3631 O  O   . HOH E .   ? 0.61935 0.54468 0.37557 -0.23769 0.07042  0.04011  686 HOH A O   
3632 O  O   . HOH E .   ? 0.47305 0.61204 0.45644 -0.02769 0.03126  0.12110  687 HOH A O   
3633 O  O   . HOH E .   ? 0.36573 0.41106 0.47522 -0.11102 -0.13852 -0.03567 688 HOH A O   
3634 O  O   . HOH E .   ? 0.28312 0.37532 0.46000 -0.08952 -0.05220 0.03786  689 HOH A O   
3635 O  O   . HOH E .   ? 0.25126 0.24725 0.15589 -0.00016 0.00114  0.02330  690 HOH A O   
3636 O  O   . HOH E .   ? 0.73318 0.25452 0.54780 0.06514  -0.30158 -0.04518 691 HOH A O   
3637 O  O   . HOH E .   ? 0.54373 0.62343 0.43023 0.19331  -0.15308 0.07217  692 HOH A O   
3638 O  O   . HOH E .   ? 0.55143 0.26491 0.16290 -0.00918 0.07027  0.01775  693 HOH A O   
3639 O  O   . HOH E .   ? 0.33685 0.24004 0.11978 -0.04019 0.00999  -0.00804 694 HOH A O   
3640 O  O   . HOH E .   ? 0.42321 0.45810 0.44514 -0.01574 0.09238  -0.04845 695 HOH A O   
3641 O  O   . HOH E .   ? 0.44301 0.37459 0.32494 -0.02031 0.01879  0.04046  696 HOH A O   
3642 O  O   . HOH E .   ? 0.28537 0.36601 0.27449 -0.00288 0.02307  0.06260  697 HOH A O   
3643 O  O   . HOH E .   ? 0.34230 0.41630 0.20911 -0.03663 0.01784  0.08907  698 HOH A O   
3644 O  O   . HOH E .   ? 0.24373 0.40369 0.21254 0.04051  -0.00711 -0.02404 699 HOH A O   
3645 O  O   . HOH E .   ? 0.64828 0.74630 0.81549 0.20772  -0.11235 -0.26743 700 HOH A O   
3646 O  O   . HOH E .   ? 0.51447 0.42619 0.63104 -0.00469 -0.01617 0.22741  701 HOH A O   
3647 O  O   . HOH E .   ? 0.33507 0.68854 0.39695 -0.10204 0.02345  -0.03372 702 HOH A O   
3648 O  O   . HOH E .   ? 0.48451 0.38418 0.24173 -0.03506 -0.00764 0.05900  703 HOH A O   
3649 O  O   . HOH E .   ? 0.42375 0.51523 0.45985 -0.09581 0.05610  -0.19864 704 HOH A O   
3650 O  O   . HOH E .   ? 0.40863 0.48433 0.34328 -0.15684 -0.07467 -0.01016 705 HOH A O   
3651 O  O   . HOH E .   ? 0.24494 0.28170 0.20266 -0.01298 -0.02248 0.03434  706 HOH A O   
3652 O  O   . HOH E .   ? 0.19561 0.28191 0.20507 -0.03256 -0.01864 0.10224  707 HOH A O   
3653 O  O   . HOH E .   ? 0.79266 0.62921 0.41285 0.15528  0.00609  -0.04392 708 HOH A O   
3654 O  O   . HOH E .   ? 0.37026 0.88050 0.55922 -0.05793 0.02989  0.14808  709 HOH A O   
3655 O  O   . HOH E .   ? 0.24791 0.38657 0.20110 0.03085  0.02450  -0.04439 710 HOH A O   
3656 O  O   . HOH E .   ? 0.39747 0.64480 0.24045 -0.07683 0.01584  -0.00964 711 HOH A O   
3657 O  O   . HOH E .   ? 0.45722 0.38101 0.48937 -0.00122 0.07786  0.04803  712 HOH A O   
3658 O  O   . HOH E .   ? 0.16309 0.17874 0.10994 0.00600  0.01406  -0.01009 713 HOH A O   
3659 O  O   . HOH E .   ? 0.29674 0.70441 0.81704 -0.00277 0.00729  -0.03555 714 HOH A O   
3660 O  O   . HOH E .   ? 0.21507 0.35964 0.19330 -0.03839 -0.05580 0.02867  715 HOH A O   
3661 O  O   . HOH E .   ? 0.21972 0.38509 0.20480 0.01823  -0.03723 0.04087  716 HOH A O   
3662 O  O   . HOH E .   ? 0.31449 0.43792 0.27016 -0.05285 0.01262  0.08417  717 HOH A O   
3663 O  O   . HOH E .   ? 0.42784 0.30556 0.31760 -0.12039 -0.02789 0.00897  718 HOH A O   
3664 O  O   . HOH E .   ? 0.63195 0.35915 0.51923 -0.05330 -0.05440 0.09925  719 HOH A O   
3665 O  O   . HOH E .   ? 0.50427 0.67574 0.55493 -0.01936 -0.02410 -0.04777 720 HOH A O   
3666 O  O   . HOH E .   ? 0.63114 0.62368 0.58090 -0.12243 0.07496  0.13998  721 HOH A O   
3667 O  O   . HOH E .   ? 0.54175 0.59511 0.61389 0.15913  -0.12440 0.25523  722 HOH A O   
3668 O  O   . HOH E .   ? 0.21757 0.33090 0.17131 -0.02116 0.04401  -0.02650 723 HOH A O   
3669 O  O   . HOH E .   ? 0.33235 0.35495 0.48576 0.04716  -0.02015 0.06775  724 HOH A O   
3670 O  O   . HOH E .   ? 0.38565 0.35080 0.30882 0.01449  0.04481  0.03156  725 HOH A O   
3671 O  O   . HOH E .   ? 0.32032 0.32671 0.25458 0.03305  -0.03347 0.05149  726 HOH A O   
3673 O  O   . HOH E .   ? 0.32434 0.66864 0.36786 0.00248  0.00208  -0.13798 728 HOH A O   
3674 O  O   . HOH E .   ? 0.45474 0.42116 0.15738 0.03718  0.02629  0.04988  729 HOH A O   
3675 O  O   . HOH E .   ? 0.48002 0.40252 0.48779 0.06113  0.19456  0.05238  730 HOH A O   
3676 O  O   . HOH E .   ? 0.27964 0.45750 0.27821 -0.03534 -0.05642 0.03530  731 HOH A O   
3678 O  O   . HOH E .   ? 0.58354 0.55189 0.28102 -0.05594 -0.01400 0.03995  733 HOH A O   
3680 O  O   . HOH E .   ? 0.34183 0.31907 0.19641 -0.02795 -0.06597 0.03677  735 HOH A O   
3682 O  O   . HOH E .   ? 0.27770 0.39445 0.21289 -0.07916 -0.01254 0.09764  737 HOH A O   
3684 O  O   . HOH E .   ? 0.41505 0.49540 0.40228 -0.07551 -0.05560 0.05349  739 HOH A O   
3685 O  O   . HOH E .   ? 0.39063 0.34919 0.55979 -0.02384 -0.06413 0.09573  740 HOH A O   
3686 O  O   . HOH E .   ? 0.62164 0.63862 0.28665 -0.02444 -0.00106 -0.10483 741 HOH A O   
3687 O  O   . HOH E .   ? 0.48926 0.77139 0.44085 0.00491  0.11062  0.16796  742 HOH A O   
3688 O  O   . HOH E .   ? 0.60275 0.40261 0.18692 0.01286  0.05564  0.05060  743 HOH A O   
3689 O  O   . HOH E .   ? 0.28699 0.32389 0.28941 -0.03162 -0.08607 0.04053  744 HOH A O   
3692 O  O   . HOH E .   ? 0.65195 0.51500 0.37124 0.05528  -0.04474 0.02141  747 HOH A O   
3693 O  O   . HOH E .   ? 0.56758 0.65059 0.68300 0.22411  0.18602  0.33846  748 HOH A O   
3695 O  O   . HOH E .   ? 0.42678 0.52196 0.51776 0.11441  0.08753  0.12250  750 HOH A O   
3696 O  O   . HOH E .   ? 0.44773 0.59136 0.72729 -0.01707 -0.20881 0.16724  751 HOH A O   
3697 O  O   . HOH E .   ? 0.56940 0.29908 0.28451 -0.05737 0.11467  -0.12264 752 HOH A O   
3698 O  O   . HOH E .   ? 0.71910 0.55310 0.38149 0.08489  -0.22481 -0.00286 753 HOH A O   
3699 O  O   . HOH E .   ? 0.45718 0.71350 0.63938 0.06806  -0.20997 -0.18575 754 HOH A O   
3700 O  O   . HOH E .   ? 0.74287 0.33500 0.26058 -0.14208 0.09918  -0.04563 755 HOH A O   
3701 O  O   . HOH E .   ? 0.39735 0.59856 0.60056 0.12903  -0.06365 -0.09843 756 HOH A O   
3702 O  O   . HOH E .   ? 0.44662 0.73665 0.32353 0.19004  -0.06414 -0.11899 757 HOH A O   
3703 O  O   . HOH E .   ? 0.56959 0.52753 0.35545 0.05014  -0.03784 -0.17103 758 HOH A O   
3704 O  O   . HOH E .   ? 0.51187 0.35150 0.26461 0.03787  -0.01540 -0.06308 759 HOH A O   
3705 O  O   . HOH E .   ? 0.35615 0.59005 0.41204 -0.00209 -0.00983 -0.13067 760 HOH A O   
3706 O  O   . HOH E .   ? 0.39587 0.40927 0.33541 -0.01713 0.03694  -0.00853 761 HOH A O   
3707 O  O   . HOH E .   ? 0.34161 0.72362 0.36505 -0.00401 -0.08999 -0.08469 762 HOH A O   
3708 O  O   . HOH E .   ? 0.52706 0.61068 0.66136 -0.03288 -0.32455 0.03559  763 HOH A O   
3709 O  O   . HOH E .   ? 0.46064 0.68890 0.26015 0.00135  -0.03379 -0.04465 764 HOH A O   
3710 O  O   . HOH E .   ? 0.41034 0.76486 0.39150 0.03021  0.05192  -0.01441 765 HOH A O   
3711 O  O   . HOH E .   ? 0.38579 0.40780 0.56021 0.04004  -0.01782 0.06339  766 HOH A O   
3712 O  O   . HOH E .   ? 0.50473 0.54956 0.26644 -0.06209 0.03512  -0.04014 767 HOH A O   
3713 O  O   . HOH E .   ? 0.54181 0.43991 0.41294 0.02948  -0.10241 0.06431  768 HOH A O   
3714 O  O   . HOH E .   ? 0.70677 0.54623 0.34598 -0.00712 -0.08650 -0.00123 769 HOH A O   
3715 O  O   . HOH E .   ? 0.84467 0.56942 0.28774 0.01972  0.12066  -0.05718 770 HOH A O   
3717 O  O   . HOH E .   ? 0.62190 0.47258 0.59892 0.16805  -0.12122 -0.10637 772 HOH A O   
3718 O  O   . HOH E .   ? 0.80597 0.58352 0.38403 -0.15757 -0.00065 -0.00845 773 HOH A O   
3719 O  O   . HOH E .   ? 0.32924 0.44907 0.54385 -0.02224 -0.11958 0.13119  774 HOH A O   
3720 O  O   . HOH E .   ? 0.20675 0.29535 0.14026 -0.02439 -0.00623 -0.02074 775 HOH A O   
3721 O  O   . HOH E .   ? 0.85318 0.61502 0.30036 -0.28216 -0.03066 0.05444  776 HOH A O   
3722 O  O   . HOH E .   ? 0.32891 0.35888 0.33094 0.05193  -0.05289 -0.05079 777 HOH A O   
3723 O  O   . HOH E .   ? 0.71923 0.65494 0.44566 0.20419  -0.25477 -0.20830 778 HOH A O   
3724 O  O   . HOH E .   ? 0.78783 0.62422 0.41896 0.01831  -0.11237 -0.09008 779 HOH A O   
3725 O  O   . HOH E .   ? 0.48394 0.46688 0.42073 0.20186  0.00889  -0.03703 780 HOH A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ASN 2   2   ?   ?   ?   A . n 
A 1 3   TYR 3   3   3   TYR TYR A . n 
A 1 4   GLN 4   4   4   GLN GLN A . n 
A 1 5   PRO 5   5   5   PRO PRO A . n 
A 1 6   THR 6   6   6   THR THR A . n 
A 1 7   PRO 7   7   7   PRO PRO A . n 
A 1 8   GLU 8   8   8   GLU GLU A . n 
A 1 9   ASP 9   9   9   ASP ASP A . n 
A 1 10  ARG 10  10  10  ARG ARG A . n 
A 1 11  PHE 11  11  11  PHE PHE A . n 
A 1 12  THR 12  12  12  THR THR A . n 
A 1 13  PHE 13  13  13  PHE PHE A . n 
A 1 14  GLY 14  14  14  GLY GLY A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  TRP 16  16  16  TRP TRP A . n 
A 1 17  THR 17  17  17  THR THR A . n 
A 1 18  VAL 18  18  18  VAL VAL A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  TRP 20  20  20  TRP TRP A . n 
A 1 21  GLN 21  21  21  GLN GLN A . n 
A 1 22  GLY 22  22  22  GLY GLY A . n 
A 1 23  ARG 23  23  23  ARG ARG A . n 
A 1 24  ASP 24  24  24  ASP ASP A . n 
A 1 25  PRO 25  25  25  PRO PRO A . n 
A 1 26  PHE 26  26  26  PHE PHE A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  ASP 28  28  28  ASP ASP A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  THR 30  30  30  THR THR A . n 
A 1 31  ARG 31  31  31  ARG ARG A . n 
A 1 32  ARG 32  32  32  ARG ARG A . n 
A 1 33  ALA 33  33  33  ALA ALA A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  ASP 35  35  35  ASP ASP A . n 
A 1 36  PRO 36  36  36  PRO PRO A . n 
A 1 37  VAL 37  37  37  VAL VAL A . n 
A 1 38  GLU 38  38  38  GLU GLU A . n 
A 1 39  SER 39  39  39  SER SER A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  ARG 41  41  41  ARG ARG A . n 
A 1 42  ARG 42  42  42  ARG ARG A . n 
A 1 43  LEU 43  43  43  LEU LEU A . n 
A 1 44  ALA 44  44  44  ALA ALA A . n 
A 1 45  GLU 45  45  45  GLU GLU A . n 
A 1 46  LEU 46  46  46  LEU LEU A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  ALA 48  48  48  ALA ALA A . n 
A 1 49  HIS 49  49  49  HIS HIS A . n 
A 1 50  GLY 50  50  50  GLY GLY A . n 
A 1 51  VAL 51  51  51  VAL VAL A . n 
A 1 52  THR 52  52  52  THR THR A . n 
A 1 53  PHE 53  53  53  PHE PHE A . n 
A 1 54  HIS 54  54  54  HIS HIS A . n 
A 1 55  ASP 55  55  55  ASP ASP A . n 
A 1 56  ASP 56  56  56  ASP ASP A . n 
A 1 57  ASP 57  57  57  ASP ASP A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  ILE 59  59  59  ILE ILE A . n 
A 1 60  PRO 60  60  60  PRO PRO A . n 
A 1 61  PHE 61  61  61  PHE PHE A . n 
A 1 62  GLY 62  62  62  GLY GLY A . n 
A 1 63  SER 63  63  63  SER SER A . n 
A 1 64  SER 64  64  64  SER SER A . n 
A 1 65  ASP 65  65  65  ASP ASP A . n 
A 1 66  SER 66  66  66  SER SER A . n 
A 1 67  GLU 67  67  67  GLU GLU A . n 
A 1 68  ARG 68  68  68  ARG ARG A . n 
A 1 69  GLU 69  69  69  GLU GLU A . n 
A 1 70  GLU 70  70  70  GLU GLU A . n 
A 1 71  HIS 71  71  71  HIS HIS A . n 
A 1 72  VAL 72  72  72  VAL VAL A . n 
A 1 73  LYS 73  73  73  LYS LYS A . n 
A 1 74  ARG 74  74  74  ARG ARG A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  ARG 76  76  76  ARG ARG A . n 
A 1 77  GLN 77  77  77  GLN GLN A . n 
A 1 78  ALA 78  78  78  ALA ALA A . n 
A 1 79  LEU 79  79  79  LEU LEU A . n 
A 1 80  ASP 80  80  80  ASP ASP A . n 
A 1 81  ASP 81  81  81  ASP ASP A . n 
A 1 82  THR 82  82  82  THR THR A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  MET 84  84  84  MET MET A . n 
A 1 85  LYS 85  85  85  LYS LYS A . n 
A 1 86  VAL 86  86  86  VAL VAL A . n 
A 1 87  PRO 87  87  87  PRO PRO A . n 
A 1 88  MET 88  88  88  MET MET A . n 
A 1 89  ALA 89  89  89  ALA ALA A . n 
A 1 90  THR 90  90  90  THR THR A . n 
A 1 91  THR 91  91  91  THR THR A . n 
A 1 92  ASN 92  92  92  ASN ASN A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  PHE 94  94  94  PHE PHE A . n 
A 1 95  THR 95  95  95  THR THR A . n 
A 1 96  HIS 96  96  96  HIS HIS A . n 
A 1 97  PRO 97  97  97  PRO PRO A . n 
A 1 98  VAL 98  98  98  VAL VAL A . n 
A 1 99  PHE 99  99  99  PHE PHE A . n 
A 1 100 LYS 100 100 100 LYS LYS A . n 
A 1 101 ASP 101 101 101 ASP ASP A . n 
A 1 102 GLY 102 102 102 GLY GLY A . n 
A 1 103 GLY 103 103 103 GLY GLY A . n 
A 1 104 PHE 104 104 104 PHE PHE A . n 
A 1 105 THR 105 105 105 THR THR A . n 
A 1 106 ALA 106 106 106 ALA ALA A . n 
A 1 107 ASN 107 107 107 ASN ASN A . n 
A 1 108 ASP 108 108 108 ASP ASP A . n 
A 1 109 ARG 109 109 109 ARG ARG A . n 
A 1 110 ASP 110 110 110 ASP ASP A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 ARG 112 112 112 ARG ARG A . n 
A 1 113 ARG 113 113 113 ARG ARG A . n 
A 1 114 TYR 114 114 114 TYR TYR A . n 
A 1 115 ALA 115 115 115 ALA ALA A . n 
A 1 116 LEU 116 116 116 LEU LEU A . n 
A 1 117 ARG 117 117 117 ARG ARG A . n 
A 1 118 LYS 118 118 118 LYS LYS A . n 
A 1 119 THR 119 119 119 THR THR A . n 
A 1 120 ILE 120 120 120 ILE ILE A . n 
A 1 121 ARG 121 121 121 ARG ARG A . n 
A 1 122 ASN 122 122 122 ASN ASN A . n 
A 1 123 ILE 123 123 123 ILE ILE A . n 
A 1 124 ASP 124 124 124 ASP ASP A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 ALA 126 126 126 ALA ALA A . n 
A 1 127 VAL 127 127 127 VAL VAL A . n 
A 1 128 GLU 128 128 128 GLU GLU A . n 
A 1 129 LEU 129 129 129 LEU LEU A . n 
A 1 130 GLY 130 130 130 GLY GLY A . n 
A 1 131 ALA 131 131 131 ALA ALA A . n 
A 1 132 GLU 132 132 132 GLU GLU A . n 
A 1 133 THR 133 133 133 THR THR A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 VAL 135 135 135 VAL VAL A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TRP 137 137 137 TRP TRP A . n 
A 1 138 GLY 138 138 138 GLY GLY A . n 
A 1 139 GLY 139 139 139 GLY GLY A . n 
A 1 140 ARG 140 140 140 ARG ARG A . n 
A 1 141 GLU 141 141 141 GLU GLU A . n 
A 1 142 GLY 142 142 142 GLY GLY A . n 
A 1 143 ALA 143 143 143 ALA ALA A . n 
A 1 144 GLU 144 144 144 GLU GLU A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 GLY 146 146 146 GLY GLY A . n 
A 1 147 GLY 147 147 147 GLY GLY A . n 
A 1 148 ALA 148 148 148 ALA ALA A . n 
A 1 149 LYS 149 149 149 LYS LYS A . n 
A 1 150 ASP 150 150 150 ASP ASP A . n 
A 1 151 VAL 151 151 151 VAL VAL A . n 
A 1 152 ARG 152 152 152 ARG ARG A . n 
A 1 153 ASP 153 153 153 ASP ASP A . n 
A 1 154 ALA 154 154 154 ALA ALA A . n 
A 1 155 LEU 155 155 155 LEU LEU A . n 
A 1 156 ASP 156 156 156 ASP ASP A . n 
A 1 157 ARG 157 157 157 ARG ARG A . n 
A 1 158 MET 158 158 158 MET MET A . n 
A 1 159 LYS 159 159 159 LYS LYS A . n 
A 1 160 GLU 160 160 160 GLU GLU A . n 
A 1 161 ALA 161 161 161 ALA ALA A . n 
A 1 162 PHE 162 162 162 PHE PHE A . n 
A 1 163 ASP 163 163 163 ASP ASP A . n 
A 1 164 LEU 164 164 164 LEU LEU A . n 
A 1 165 LEU 165 165 165 LEU LEU A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 GLU 167 167 167 GLU GLU A . n 
A 1 168 TYR 168 168 168 TYR TYR A . n 
A 1 169 VAL 169 169 169 VAL VAL A . n 
A 1 170 THR 170 170 170 THR THR A . n 
A 1 171 SER 171 171 171 SER SER A . n 
A 1 172 GLN 172 172 172 GLN GLN A . n 
A 1 173 GLY 173 173 173 GLY GLY A . n 
A 1 174 TYR 174 174 174 TYR TYR A . n 
A 1 175 ASP 175 175 175 ASP ASP A . n 
A 1 176 ILE 176 176 176 ILE ILE A . n 
A 1 177 ARG 177 177 177 ARG ARG A . n 
A 1 178 PHE 178 178 178 PHE PHE A . n 
A 1 179 ALA 179 179 179 ALA ALA A . n 
A 1 180 ILE 180 180 180 ILE ILE A . n 
A 1 181 GLU 181 181 181 GLU GLU A . n 
A 1 182 PRO 182 182 182 PRO PRO A . n 
A 1 183 LYS 183 183 183 LYS LYS A . n 
A 1 184 PRO 184 184 184 PRO PRO A . n 
A 1 185 ASN 185 185 185 ASN ASN A . n 
A 1 186 GLU 186 186 186 GLU GLU A . n 
A 1 187 PRO 187 187 187 PRO PRO A . n 
A 1 188 ARG 188 188 188 ARG ARG A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 ILE 191 191 191 ILE ILE A . n 
A 1 192 LEU 192 192 192 LEU LEU A . n 
A 1 193 LEU 193 193 193 LEU LEU A . n 
A 1 194 PRO 194 194 194 PRO PRO A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 VAL 196 196 196 VAL VAL A . n 
A 1 197 GLY 197 197 197 GLY GLY A . n 
A 1 198 HIS 198 198 198 HIS HIS A . n 
A 1 199 ALA 199 199 199 ALA ALA A . n 
A 1 200 LEU 200 200 200 LEU LEU A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 PHE 202 202 202 PHE PHE A . n 
A 1 203 ILE 203 203 203 ILE ILE A . n 
A 1 204 GLU 204 204 204 GLU GLU A . n 
A 1 205 ARG 205 205 205 ARG ARG A . n 
A 1 206 LEU 206 206 206 LEU LEU A . n 
A 1 207 GLU 207 207 207 GLU GLU A . n 
A 1 208 ARG 208 208 208 ARG ARG A . n 
A 1 209 PRO 209 209 209 PRO PRO A . n 
A 1 210 GLU 210 210 210 GLU GLU A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 TYR 212 212 212 TYR TYR A . n 
A 1 213 GLY 213 213 213 GLY GLY A . n 
A 1 214 VAL 214 214 214 VAL VAL A . n 
A 1 215 ASN 215 215 215 ASN ASN A . n 
A 1 216 PRO 216 216 216 PRO PRO A . n 
A 1 217 GLU 217 217 217 GLU GLU A . n 
A 1 218 VAL 218 218 218 VAL VAL A . n 
A 1 219 GLY 219 219 219 GLY GLY A . n 
A 1 220 HIS 220 220 220 HIS HIS A . n 
A 1 221 GLU 221 221 221 GLU GLU A . n 
A 1 222 GLN 222 222 222 GLN GLN A . n 
A 1 223 MET 223 223 223 MET MET A . n 
A 1 224 ALA 224 224 224 ALA ALA A . n 
A 1 225 GLY 225 225 225 GLY GLY A . n 
A 1 226 LEU 226 226 226 LEU LEU A . n 
A 1 227 ASN 227 227 227 ASN ASN A . n 
A 1 228 PHE 228 228 228 PHE PHE A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 HIS 230 230 230 HIS HIS A . n 
A 1 231 GLY 231 231 231 GLY GLY A . n 
A 1 232 ILE 232 232 232 ILE ILE A . n 
A 1 233 ALA 233 233 233 ALA ALA A . n 
A 1 234 GLN 234 234 234 GLN GLN A . n 
A 1 235 ALA 235 235 235 ALA ALA A . n 
A 1 236 LEU 236 236 236 LEU LEU A . n 
A 1 237 TRP 237 237 237 TRP TRP A . n 
A 1 238 ALA 238 238 238 ALA ALA A . n 
A 1 239 GLY 239 239 239 GLY GLY A . n 
A 1 240 LYS 240 240 240 LYS LYS A . n 
A 1 241 LEU 241 241 241 LEU LEU A . n 
A 1 242 PHE 242 242 242 PHE PHE A . n 
A 1 243 HIS 243 243 243 HIS HIS A . n 
A 1 244 ILE 244 244 244 ILE ILE A . n 
A 1 245 ASP 245 245 245 ASP ASP A . n 
A 1 246 LEU 246 246 246 LEU LEU A . n 
A 1 247 ASN 247 247 247 ASN ASN A . n 
A 1 248 GLY 248 248 248 GLY GLY A . n 
A 1 249 GLN 249 249 249 GLN GLN A . n 
A 1 250 ASN 250 250 250 ASN ASN A . n 
A 1 251 GLY 251 251 251 GLY GLY A . n 
A 1 252 ILE 252 252 252 ILE ILE A . n 
A 1 253 LYS 253 253 253 LYS LYS A . n 
A 1 254 TYR 254 254 254 TYR TYR A . n 
A 1 255 ASP 255 255 255 ASP ASP A . n 
A 1 256 GLN 256 256 256 GLN GLN A . n 
A 1 257 ASP 257 257 257 ASP ASP A . n 
A 1 258 LEU 258 258 258 LEU LEU A . n 
A 1 259 ARG 259 259 259 ARG ARG A . n 
A 1 260 PHE 260 260 260 PHE PHE A . n 
A 1 261 GLY 261 261 261 GLY GLY A . n 
A 1 262 ALA 262 262 262 ALA ALA A . n 
A 1 263 GLY 263 263 263 GLY GLY A . n 
A 1 264 ASP 264 264 264 ASP ASP A . n 
A 1 265 LEU 265 265 265 LEU LEU A . n 
A 1 266 ARG 266 266 266 ARG ARG A . n 
A 1 267 ALA 267 267 267 ALA ALA A . n 
A 1 268 ALA 268 268 268 ALA ALA A . n 
A 1 269 PHE 269 269 269 PHE PHE A . n 
A 1 270 TRP 270 270 270 TRP TRP A . n 
A 1 271 LEU 271 271 271 LEU LEU A . n 
A 1 272 VAL 272 272 272 VAL VAL A . n 
A 1 273 ASP 273 273 273 ASP ASP A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 LEU 275 275 275 LEU LEU A . n 
A 1 276 GLU 276 276 276 GLU GLU A . n 
A 1 277 SER 277 277 277 SER SER A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 GLY 279 279 279 GLY GLY A . n 
A 1 280 TYR 280 280 280 TYR TYR A . n 
A 1 281 SER 281 281 281 SER SER A . n 
A 1 282 GLY 282 282 282 GLY GLY A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 ARG 284 284 284 ARG ARG A . n 
A 1 285 HIS 285 285 285 HIS HIS A . n 
A 1 286 PHE 286 286 286 PHE PHE A . n 
A 1 287 ASP 287 287 287 ASP ASP A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 LYS 289 289 289 LYS LYS A . n 
A 1 290 PRO 290 290 290 PRO PRO A . n 
A 1 291 PRO 291 291 291 PRO PRO A . n 
A 1 292 ARG 292 292 292 ARG ARG A . n 
A 1 293 THR 293 293 293 THR THR A . n 
A 1 294 GLU 294 294 294 GLU GLU A . n 
A 1 295 ASP 295 295 295 ASP ASP A . n 
A 1 296 PHE 296 296 296 PHE PHE A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 VAL 299 299 299 VAL VAL A . n 
A 1 300 TRP 300 300 300 TRP TRP A . n 
A 1 301 ALA 301 301 301 ALA ALA A . n 
A 1 302 SER 302 302 302 SER SER A . n 
A 1 303 ALA 303 303 303 ALA ALA A . n 
A 1 304 ALA 304 304 304 ALA ALA A . n 
A 1 305 GLY 305 305 305 GLY GLY A . n 
A 1 306 CYS 306 306 306 CYS CYS A . n 
A 1 307 MET 307 307 307 MET MET A . n 
A 1 308 ARG 308 308 308 ARG ARG A . n 
A 1 309 ASN 309 309 309 ASN ASN A . n 
A 1 310 TYR 310 310 310 TYR TYR A . n 
A 1 311 LEU 311 311 311 LEU LEU A . n 
A 1 312 ILE 312 312 312 ILE ILE A . n 
A 1 313 LEU 313 313 313 LEU LEU A . n 
A 1 314 LYS 314 314 314 LYS LYS A . n 
A 1 315 GLU 315 315 315 GLU GLU A . n 
A 1 316 ARG 316 316 316 ARG ARG A . n 
A 1 317 ALA 317 317 317 ALA ALA A . n 
A 1 318 ALA 318 318 318 ALA ALA A . n 
A 1 319 ALA 319 319 319 ALA ALA A . n 
A 1 320 PHE 320 320 320 PHE PHE A . n 
A 1 321 ARG 321 321 321 ARG ARG A . n 
A 1 322 ALA 322 322 322 ALA ALA A . n 
A 1 323 ASP 323 323 323 ASP ASP A . n 
A 1 324 PRO 324 324 324 PRO PRO A . n 
A 1 325 GLU 325 325 325 GLU GLU A . n 
A 1 326 VAL 326 326 326 VAL VAL A . n 
A 1 327 GLN 327 327 327 GLN GLN A . n 
A 1 328 GLU 328 328 328 GLU GLU A . n 
A 1 329 ALA 329 329 329 ALA ALA A . n 
A 1 330 LEU 330 330 330 LEU LEU A . n 
A 1 331 ARG 331 331 331 ARG ARG A . n 
A 1 332 ALA 332 332 332 ALA ALA A . n 
A 1 333 SER 333 333 333 SER SER A . n 
A 1 334 ARG 334 334 334 ARG ARG A . n 
A 1 335 LEU 335 335 335 LEU LEU A . n 
A 1 336 ASP 336 336 336 ASP ASP A . n 
A 1 337 GLU 337 337 337 GLU GLU A . n 
A 1 338 LEU 338 338 338 LEU LEU A . n 
A 1 339 ALA 339 339 339 ALA ALA A . n 
A 1 340 ARG 340 340 340 ARG ARG A . n 
A 1 341 PRO 341 341 341 PRO PRO A . n 
A 1 342 THR 342 342 342 THR THR A . n 
A 1 343 ALA 343 343 343 ALA ALA A . n 
A 1 344 ALA 344 344 344 ALA ALA A . n 
A 1 345 ASP 345 345 345 ASP ASP A . n 
A 1 346 GLY 346 346 346 GLY GLY A . n 
A 1 347 LEU 347 347 347 LEU LEU A . n 
A 1 348 GLN 348 348 348 GLN GLN A . n 
A 1 349 ALA 349 349 349 ALA ALA A . n 
A 1 350 LEU 350 350 350 LEU LEU A . n 
A 1 351 LEU 351 351 351 LEU LEU A . n 
A 1 352 ASP 352 352 352 ASP ASP A . n 
A 1 353 ASP 353 353 353 ASP ASP A . n 
A 1 354 ARG 354 354 354 ARG ARG A . n 
A 1 355 SER 355 355 355 SER SER A . n 
A 1 356 ALA 356 356 356 ALA ALA A . n 
A 1 357 PHE 357 357 357 PHE PHE A . n 
A 1 358 GLU 358 358 358 GLU GLU A . n 
A 1 359 GLU 359 359 359 GLU GLU A . n 
A 1 360 PHE 360 360 360 PHE PHE A . n 
A 1 361 ASP 361 361 361 ASP ASP A . n 
A 1 362 VAL 362 362 362 VAL VAL A . n 
A 1 363 ASP 363 363 363 ASP ASP A . n 
A 1 364 ALA 364 364 364 ALA ALA A . n 
A 1 365 ALA 365 365 365 ALA ALA A . n 
A 1 366 ALA 366 366 366 ALA ALA A . n 
A 1 367 ALA 367 367 367 ALA ALA A . n 
A 1 368 ARG 368 368 368 ARG ARG A . n 
A 1 369 GLY 369 369 369 GLY GLY A . n 
A 1 370 MET 370 370 370 MET MET A . n 
A 1 371 ALA 371 371 371 ALA ALA A . n 
A 1 372 PHE 372 372 372 PHE PHE A . n 
A 1 373 GLU 373 373 373 GLU GLU A . n 
A 1 374 ARG 374 374 374 ARG ARG A . n 
A 1 375 LEU 375 375 375 LEU LEU A . n 
A 1 376 ASP 376 376 376 ASP ASP A . n 
A 1 377 GLN 377 377 377 GLN GLN A . n 
A 1 378 LEU 378 378 378 LEU LEU A . n 
A 1 379 ALA 379 379 379 ALA ALA A . n 
A 1 380 MET 380 380 380 MET MET A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 HIS 382 382 382 HIS HIS A . n 
A 1 383 LEU 383 383 383 LEU LEU A . n 
A 1 384 LEU 384 384 384 LEU LEU A . n 
A 1 385 GLY 385 385 385 GLY GLY A . n 
A 1 386 ALA 386 386 386 ALA ALA A . n 
A 1 387 ARG 387 387 387 ARG ARG A . n 
A 1 388 GLY 388 388 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MG  1   401 2   MG  MG  A . 
C 2 MG  1   402 3   MG  MG  A . 
D 3 NA  1   403 1   NA  NA  A . 
E 4 HOH 1   501 113 HOH HOH A . 
E 4 HOH 2   502 117 HOH HOH A . 
E 4 HOH 3   503 82  HOH HOH A . 
E 4 HOH 4   504 278 HOH HOH A . 
E 4 HOH 5   505 350 HOH HOH A . 
E 4 HOH 6   506 142 HOH HOH A . 
E 4 HOH 7   507 114 HOH HOH A . 
E 4 HOH 8   508 147 HOH HOH A . 
E 4 HOH 9   509 148 HOH HOH A . 
E 4 HOH 10  510 123 HOH HOH A . 
E 4 HOH 11  511 282 HOH HOH A . 
E 4 HOH 12  512 192 HOH HOH A . 
E 4 HOH 13  513 111 HOH HOH A . 
E 4 HOH 14  514 248 HOH HOH A . 
E 4 HOH 15  515 276 HOH HOH A . 
E 4 HOH 16  516 357 HOH HOH A . 
E 4 HOH 17  517 335 HOH HOH A . 
E 4 HOH 18  518 268 HOH HOH A . 
E 4 HOH 19  519 49  HOH HOH A . 
E 4 HOH 20  520 190 HOH HOH A . 
E 4 HOH 21  521 134 HOH HOH A . 
E 4 HOH 22  522 66  HOH HOH A . 
E 4 HOH 23  523 194 HOH HOH A . 
E 4 HOH 24  524 279 HOH HOH A . 
E 4 HOH 25  525 124 HOH HOH A . 
E 4 HOH 26  526 337 HOH HOH A . 
E 4 HOH 27  527 145 HOH HOH A . 
E 4 HOH 28  528 227 HOH HOH A . 
E 4 HOH 29  529 301 HOH HOH A . 
E 4 HOH 30  530 202 HOH HOH A . 
E 4 HOH 31  531 93  HOH HOH A . 
E 4 HOH 32  532 168 HOH HOH A . 
E 4 HOH 33  533 65  HOH HOH A . 
E 4 HOH 34  534 108 HOH HOH A . 
E 4 HOH 35  535 165 HOH HOH A . 
E 4 HOH 36  536 126 HOH HOH A . 
E 4 HOH 37  537 304 HOH HOH A . 
E 4 HOH 38  538 31  HOH HOH A . 
E 4 HOH 39  539 120 HOH HOH A . 
E 4 HOH 40  540 249 HOH HOH A . 
E 4 HOH 41  541 153 HOH HOH A . 
E 4 HOH 42  542 221 HOH HOH A . 
E 4 HOH 43  543 22  HOH HOH A . 
E 4 HOH 44  544 295 HOH HOH A . 
E 4 HOH 45  545 127 HOH HOH A . 
E 4 HOH 46  546 315 HOH HOH A . 
E 4 HOH 47  547 154 HOH HOH A . 
E 4 HOH 48  548 158 HOH HOH A . 
E 4 HOH 49  549 204 HOH HOH A . 
E 4 HOH 50  550 55  HOH HOH A . 
E 4 HOH 51  551 151 HOH HOH A . 
E 4 HOH 52  552 132 HOH HOH A . 
E 4 HOH 53  553 181 HOH HOH A . 
E 4 HOH 54  554 78  HOH HOH A . 
E 4 HOH 55  555 273 HOH HOH A . 
E 4 HOH 56  556 346 HOH HOH A . 
E 4 HOH 57  557 16  HOH HOH A . 
E 4 HOH 58  558 20  HOH HOH A . 
E 4 HOH 59  559 95  HOH HOH A . 
E 4 HOH 60  560 18  HOH HOH A . 
E 4 HOH 61  561 173 HOH HOH A . 
E 4 HOH 62  562 83  HOH HOH A . 
E 4 HOH 63  563 174 HOH HOH A . 
E 4 HOH 64  564 48  HOH HOH A . 
E 4 HOH 65  565 19  HOH HOH A . 
E 4 HOH 66  566 311 HOH HOH A . 
E 4 HOH 67  567 122 HOH HOH A . 
E 4 HOH 68  568 52  HOH HOH A . 
E 4 HOH 69  569 51  HOH HOH A . 
E 4 HOH 70  570 196 HOH HOH A . 
E 4 HOH 71  571 137 HOH HOH A . 
E 4 HOH 72  572 38  HOH HOH A . 
E 4 HOH 73  573 296 HOH HOH A . 
E 4 HOH 74  574 150 HOH HOH A . 
E 4 HOH 75  575 72  HOH HOH A . 
E 4 HOH 76  576 146 HOH HOH A . 
E 4 HOH 77  577 143 HOH HOH A . 
E 4 HOH 78  578 110 HOH HOH A . 
E 4 HOH 79  579 58  HOH HOH A . 
E 4 HOH 80  580 267 HOH HOH A . 
E 4 HOH 81  581 2   HOH HOH A . 
E 4 HOH 82  582 34  HOH HOH A . 
E 4 HOH 83  583 102 HOH HOH A . 
E 4 HOH 84  584 133 HOH HOH A . 
E 4 HOH 85  585 64  HOH HOH A . 
E 4 HOH 86  586 50  HOH HOH A . 
E 4 HOH 87  587 144 HOH HOH A . 
E 4 HOH 88  588 10  HOH HOH A . 
E 4 HOH 89  589 68  HOH HOH A . 
E 4 HOH 90  590 177 HOH HOH A . 
E 4 HOH 91  591 24  HOH HOH A . 
E 4 HOH 92  592 27  HOH HOH A . 
E 4 HOH 93  593 45  HOH HOH A . 
E 4 HOH 94  594 14  HOH HOH A . 
E 4 HOH 95  595 39  HOH HOH A . 
E 4 HOH 96  596 219 HOH HOH A . 
E 4 HOH 97  597 294 HOH HOH A . 
E 4 HOH 98  598 303 HOH HOH A . 
E 4 HOH 99  599 172 HOH HOH A . 
E 4 HOH 100 600 355 HOH HOH A . 
E 4 HOH 101 601 234 HOH HOH A . 
E 4 HOH 102 602 1   HOH HOH A . 
E 4 HOH 103 603 85  HOH HOH A . 
E 4 HOH 104 604 245 HOH HOH A . 
E 4 HOH 105 605 43  HOH HOH A . 
E 4 HOH 106 606 184 HOH HOH A . 
E 4 HOH 107 607 74  HOH HOH A . 
E 4 HOH 108 608 214 HOH HOH A . 
E 4 HOH 109 609 316 HOH HOH A . 
E 4 HOH 110 610 23  HOH HOH A . 
E 4 HOH 111 611 80  HOH HOH A . 
E 4 HOH 112 612 54  HOH HOH A . 
E 4 HOH 113 613 90  HOH HOH A . 
E 4 HOH 114 614 328 HOH HOH A . 
E 4 HOH 115 615 358 HOH HOH A . 
E 4 HOH 116 616 7   HOH HOH A . 
E 4 HOH 117 617 56  HOH HOH A . 
E 4 HOH 118 618 176 HOH HOH A . 
E 4 HOH 119 619 166 HOH HOH A . 
E 4 HOH 120 620 213 HOH HOH A . 
E 4 HOH 121 621 125 HOH HOH A . 
E 4 HOH 122 622 109 HOH HOH A . 
E 4 HOH 123 623 261 HOH HOH A . 
E 4 HOH 124 624 3   HOH HOH A . 
E 4 HOH 125 625 79  HOH HOH A . 
E 4 HOH 126 626 88  HOH HOH A . 
E 4 HOH 127 627 9   HOH HOH A . 
E 4 HOH 128 628 101 HOH HOH A . 
E 4 HOH 129 629 121 HOH HOH A . 
E 4 HOH 130 630 12  HOH HOH A . 
E 4 HOH 131 631 97  HOH HOH A . 
E 4 HOH 132 632 8   HOH HOH A . 
E 4 HOH 133 633 228 HOH HOH A . 
E 4 HOH 134 634 28  HOH HOH A . 
E 4 HOH 135 635 96  HOH HOH A . 
E 4 HOH 136 636 32  HOH HOH A . 
E 4 HOH 137 637 17  HOH HOH A . 
E 4 HOH 138 638 100 HOH HOH A . 
E 4 HOH 139 639 13  HOH HOH A . 
E 4 HOH 140 640 197 HOH HOH A . 
E 4 HOH 141 641 175 HOH HOH A . 
E 4 HOH 142 642 251 HOH HOH A . 
E 4 HOH 143 643 87  HOH HOH A . 
E 4 HOH 144 644 193 HOH HOH A . 
E 4 HOH 145 645 104 HOH HOH A . 
E 4 HOH 146 646 42  HOH HOH A . 
E 4 HOH 147 647 11  HOH HOH A . 
E 4 HOH 148 648 157 HOH HOH A . 
E 4 HOH 149 649 106 HOH HOH A . 
E 4 HOH 150 650 4   HOH HOH A . 
E 4 HOH 151 651 98  HOH HOH A . 
E 4 HOH 152 652 217 HOH HOH A . 
E 4 HOH 153 653 29  HOH HOH A . 
E 4 HOH 154 654 36  HOH HOH A . 
E 4 HOH 155 655 21  HOH HOH A . 
E 4 HOH 156 656 128 HOH HOH A . 
E 4 HOH 157 657 155 HOH HOH A . 
E 4 HOH 158 658 67  HOH HOH A . 
E 4 HOH 159 659 81  HOH HOH A . 
E 4 HOH 160 660 71  HOH HOH A . 
E 4 HOH 161 661 60  HOH HOH A . 
E 4 HOH 162 662 188 HOH HOH A . 
E 4 HOH 163 663 139 HOH HOH A . 
E 4 HOH 164 664 6   HOH HOH A . 
E 4 HOH 165 665 25  HOH HOH A . 
E 4 HOH 166 666 103 HOH HOH A . 
E 4 HOH 167 667 77  HOH HOH A . 
E 4 HOH 168 668 5   HOH HOH A . 
E 4 HOH 169 669 178 HOH HOH A . 
E 4 HOH 170 670 94  HOH HOH A . 
E 4 HOH 171 671 199 HOH HOH A . 
E 4 HOH 172 672 59  HOH HOH A . 
E 4 HOH 173 673 53  HOH HOH A . 
E 4 HOH 174 674 149 HOH HOH A . 
E 4 HOH 175 675 62  HOH HOH A . 
E 4 HOH 176 676 73  HOH HOH A . 
E 4 HOH 177 677 15  HOH HOH A . 
E 4 HOH 178 678 69  HOH HOH A . 
E 4 HOH 179 679 161 HOH HOH A . 
E 4 HOH 180 680 179 HOH HOH A . 
E 4 HOH 181 681 33  HOH HOH A . 
E 4 HOH 182 682 159 HOH HOH A . 
E 4 HOH 183 683 345 HOH HOH A . 
E 4 HOH 184 684 320 HOH HOH A . 
E 4 HOH 185 685 26  HOH HOH A . 
E 4 HOH 186 686 171 HOH HOH A . 
E 4 HOH 187 687 189 HOH HOH A . 
E 4 HOH 188 688 131 HOH HOH A . 
E 4 HOH 189 689 135 HOH HOH A . 
E 4 HOH 190 690 35  HOH HOH A . 
E 4 HOH 191 691 180 HOH HOH A . 
E 4 HOH 192 692 200 HOH HOH A . 
E 4 HOH 193 693 63  HOH HOH A . 
E 4 HOH 194 694 37  HOH HOH A . 
E 4 HOH 195 695 167 HOH HOH A . 
E 4 HOH 196 696 105 HOH HOH A . 
E 4 HOH 197 697 76  HOH HOH A . 
E 4 HOH 198 698 61  HOH HOH A . 
E 4 HOH 199 699 57  HOH HOH A . 
E 4 HOH 200 700 252 HOH HOH A . 
E 4 HOH 201 701 187 HOH HOH A . 
E 4 HOH 202 702 162 HOH HOH A . 
E 4 HOH 203 703 118 HOH HOH A . 
E 4 HOH 204 704 119 HOH HOH A . 
E 4 HOH 205 705 300 HOH HOH A . 
E 4 HOH 206 706 44  HOH HOH A . 
E 4 HOH 207 707 30  HOH HOH A . 
E 4 HOH 208 708 240 HOH HOH A . 
E 4 HOH 209 709 229 HOH HOH A . 
E 4 HOH 210 710 70  HOH HOH A . 
E 4 HOH 211 711 326 HOH HOH A . 
E 4 HOH 212 712 129 HOH HOH A . 
E 4 HOH 213 713 321 HOH HOH A . 
E 4 HOH 214 714 231 HOH HOH A . 
E 4 HOH 215 715 41  HOH HOH A . 
E 4 HOH 216 716 47  HOH HOH A . 
E 4 HOH 217 717 86  HOH HOH A . 
E 4 HOH 218 718 112 HOH HOH A . 
E 4 HOH 219 719 195 HOH HOH A . 
E 4 HOH 220 720 246 HOH HOH A . 
E 4 HOH 221 721 242 HOH HOH A . 
E 4 HOH 222 722 186 HOH HOH A . 
E 4 HOH 223 723 46  HOH HOH A . 
E 4 HOH 224 724 89  HOH HOH A . 
E 4 HOH 225 725 107 HOH HOH A . 
E 4 HOH 226 726 84  HOH HOH A . 
E 4 HOH 227 727 349 HOH HOH A . 
E 4 HOH 228 728 280 HOH HOH A . 
E 4 HOH 229 729 99  HOH HOH A . 
E 4 HOH 230 730 130 HOH HOH A . 
E 4 HOH 231 731 75  HOH HOH A . 
E 4 HOH 232 732 361 HOH HOH A . 
E 4 HOH 233 733 163 HOH HOH A . 
E 4 HOH 234 734 347 HOH HOH A . 
E 4 HOH 235 735 277 HOH HOH A . 
E 4 HOH 236 736 348 HOH HOH A . 
E 4 HOH 237 737 297 HOH HOH A . 
E 4 HOH 238 738 352 HOH HOH A . 
E 4 HOH 239 739 156 HOH HOH A . 
E 4 HOH 240 740 141 HOH HOH A . 
E 4 HOH 241 741 338 HOH HOH A . 
E 4 HOH 242 742 212 HOH HOH A . 
E 4 HOH 243 743 298 HOH HOH A . 
E 4 HOH 244 744 91  HOH HOH A . 
E 4 HOH 245 745 359 HOH HOH A . 
E 4 HOH 246 746 356 HOH HOH A . 
E 4 HOH 247 747 283 HOH HOH A . 
E 4 HOH 248 748 206 HOH HOH A . 
E 4 HOH 249 749 354 HOH HOH A . 
E 4 HOH 250 750 275 HOH HOH A . 
E 4 HOH 251 751 211 HOH HOH A . 
E 4 HOH 252 752 92  HOH HOH A . 
E 4 HOH 253 753 247 HOH HOH A . 
E 4 HOH 254 754 342 HOH HOH A . 
E 4 HOH 255 755 170 HOH HOH A . 
E 4 HOH 256 756 215 HOH HOH A . 
E 4 HOH 257 757 237 HOH HOH A . 
E 4 HOH 258 758 182 HOH HOH A . 
E 4 HOH 259 759 262 HOH HOH A . 
E 4 HOH 260 760 284 HOH HOH A . 
E 4 HOH 261 761 235 HOH HOH A . 
E 4 HOH 262 762 152 HOH HOH A . 
E 4 HOH 263 763 341 HOH HOH A . 
E 4 HOH 264 764 183 HOH HOH A . 
E 4 HOH 265 765 281 HOH HOH A . 
E 4 HOH 266 766 274 HOH HOH A . 
E 4 HOH 267 767 136 HOH HOH A . 
E 4 HOH 268 768 140 HOH HOH A . 
E 4 HOH 269 769 210 HOH HOH A . 
E 4 HOH 270 770 285 HOH HOH A . 
E 4 HOH 271 771 360 HOH HOH A . 
E 4 HOH 272 772 191 HOH HOH A . 
E 4 HOH 273 773 185 HOH HOH A . 
E 4 HOH 274 774 236 HOH HOH A . 
E 4 HOH 275 775 40  HOH HOH A . 
E 4 HOH 276 776 253 HOH HOH A . 
E 4 HOH 277 777 115 HOH HOH A . 
E 4 HOH 278 778 331 HOH HOH A . 
E 4 HOH 279 779 314 HOH HOH A . 
E 4 HOH 280 780 138 HOH HOH A . 
E 4 HOH 281 781 353 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 340   ? 
1 MORE         -32   ? 
1 'SSA (A^2)'  19110 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     746 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   E 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASP 163 ? A ASP 163 ? 1_555 NA ? D NA . ? A NA 403 ? 1_555 OH  ? A TYR 212 ? A TYR 212 ? 1_555 110.0 ? 
2  OD1 ? A ASP 163 ? A ASP 163 ? 1_555 NA ? D NA . ? A NA 403 ? 1_555 O   ? E HOH .   ? A HOH 534 ? 1_555 101.9 ? 
3  OH  ? A TYR 212 ? A TYR 212 ? 1_555 NA ? D NA . ? A NA 403 ? 1_555 O   ? E HOH .   ? A HOH 534 ? 1_555 95.0  ? 
4  OE2 A A GLU 181 ? A GLU 181 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OE2 B A GLU 181 ? A GLU 181 ? 1_555 16.3  ? 
5  OE2 A A GLU 181 ? A GLU 181 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OE1 ? A GLU 217 ? A GLU 217 ? 1_555 91.3  ? 
6  OE2 B A GLU 181 ? A GLU 181 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OE1 ? A GLU 217 ? A GLU 217 ? 1_555 88.9  ? 
7  OE2 A A GLU 181 ? A GLU 181 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OD2 ? A ASP 245 ? A ASP 245 ? 1_555 102.9 ? 
8  OE2 B A GLU 181 ? A GLU 181 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OD2 ? A ASP 245 ? A ASP 245 ? 1_555 88.1  ? 
9  OE1 ? A GLU 217 ? A GLU 217 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OD2 ? A ASP 245 ? A ASP 245 ? 1_555 106.2 ? 
10 OE2 A A GLU 181 ? A GLU 181 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OD2 ? A ASP 287 ? A ASP 287 ? 1_555 155.7 ? 
11 OE2 B A GLU 181 ? A GLU 181 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OD2 ? A ASP 287 ? A ASP 287 ? 1_555 170.5 ? 
12 OE1 ? A GLU 217 ? A GLU 217 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OD2 ? A ASP 287 ? A ASP 287 ? 1_555 86.0  ? 
13 OD2 ? A ASP 245 ? A ASP 245 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OD2 ? A ASP 287 ? A ASP 287 ? 1_555 101.0 ? 
14 OE2 A A GLU 181 ? A GLU 181 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O   ? E HOH .   ? A HOH 509 ? 1_555 89.0  ? 
15 OE2 B A GLU 181 ? A GLU 181 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O   ? E HOH .   ? A HOH 509 ? 1_555 95.5  ? 
16 OE1 ? A GLU 217 ? A GLU 217 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O   ? E HOH .   ? A HOH 509 ? 1_555 164.8 ? 
17 OD2 ? A ASP 245 ? A ASP 245 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O   ? E HOH .   ? A HOH 509 ? 1_555 88.5  ? 
18 OD2 ? A ASP 287 ? A ASP 287 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O   ? E HOH .   ? A HOH 509 ? 1_555 87.5  ? 
19 OE2 A A GLU 181 ? A GLU 181 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O   ? E HOH .   ? A HOH 513 ? 1_555 71.5  ? 
20 OE2 B A GLU 181 ? A GLU 181 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O   ? E HOH .   ? A HOH 513 ? 1_555 87.8  ? 
21 OE1 ? A GLU 217 ? A GLU 217 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O   ? E HOH .   ? A HOH 513 ? 1_555 96.2  ? 
22 OD2 ? A ASP 245 ? A ASP 245 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O   ? E HOH .   ? A HOH 513 ? 1_555 157.2 ? 
23 OD2 ? A ASP 287 ? A ASP 287 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O   ? E HOH .   ? A HOH 513 ? 1_555 84.8  ? 
24 O   ? E HOH .   ? A HOH 509 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O   ? E HOH .   ? A HOH 513 ? 1_555 69.6  ? 
25 OE2 ? A GLU 217 ? A GLU 217 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 OD1 ? A ASP 255 ? A ASP 255 ? 1_555 107.1 ? 
26 OE2 ? A GLU 217 ? A GLU 217 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 OD2 ? A ASP 255 ? A ASP 255 ? 1_555 162.5 ? 
27 OD1 ? A ASP 255 ? A ASP 255 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 OD2 ? A ASP 255 ? A ASP 255 ? 1_555 57.4  ? 
28 OE2 ? A GLU 217 ? A GLU 217 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 OD1 ? A ASP 257 ? A ASP 257 ? 1_555 89.9  ? 
29 OD1 ? A ASP 255 ? A ASP 255 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 OD1 ? A ASP 257 ? A ASP 257 ? 1_555 82.7  ? 
30 OD2 ? A ASP 255 ? A ASP 255 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 OD1 ? A ASP 257 ? A ASP 257 ? 1_555 95.4  ? 
31 OE2 ? A GLU 217 ? A GLU 217 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O   ? E HOH .   ? A HOH 627 ? 1_555 104.7 ? 
32 OD1 ? A ASP 255 ? A ASP 255 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O   ? E HOH .   ? A HOH 627 ? 1_555 147.3 ? 
33 OD2 ? A ASP 255 ? A ASP 255 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O   ? E HOH .   ? A HOH 627 ? 1_555 92.0  ? 
34 OD1 ? A ASP 257 ? A ASP 257 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O   ? E HOH .   ? A HOH 627 ? 1_555 89.8  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2020-08-12 
2 'Structure model' 1 1 2020-08-19 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                 
2  2 'Structure model' '_citation.journal_abbrev'          
3  2 'Structure model' '_citation.journal_id_ASTM'         
4  2 'Structure model' '_citation.journal_id_ISSN'         
5  2 'Structure model' '_citation.journal_volume'          
6  2 'Structure model' '_citation.page_first'              
7  2 'Structure model' '_citation.page_last'               
8  2 'Structure model' '_citation.pdbx_database_id_PubMed' 
9  2 'Structure model' '_citation.title'                   
10 2 'Structure model' '_citation_author.identifier_ORCID' 
11 2 'Structure model' '_citation_author.name'             
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data collection' ? ? ? ? ? ? ? ? ? ? ? MxCuBE  ? ? ? .           1 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS     ? ? ? .           2 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER  ? ? ? .           3 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX  ? ? ? 1.15.2_3472 4 
? 'model building'  ? ? ? ? ? ? ? ? ? ? ? Coot    ? ? ? .           5 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? .           6 
# 
_pdbx_entry_details.entry_id                 6YBO 
_pdbx_entry_details.has_ligand_of_interest   N 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 O   A HOH 573 ? ? O A HOH 727 ? ? 1.96 
2  1 O   A HOH 556 ? ? O A HOH 734 ? ? 2.01 
3  1 OD1 A ASP 297 ? B O A HOH 501 ? ? 2.09 
4  1 O   A HOH 524 ? ? O A HOH 770 ? ? 2.10 
5  1 O   A HOH 506 ? ? O A HOH 754 ? ? 2.12 
6  1 O   A HOH 529 ? ? O A HOH 683 ? ? 2.12 
7  1 O   A HOH 527 ? ? O A HOH 770 ? ? 2.13 
8  1 O   A HOH 728 ? ? O A HOH 760 ? ? 2.16 
9  1 O   A HOH 734 ? ? O A HOH 736 ? ? 2.17 
10 1 OE2 A GLU 337 ? A O A HOH 502 ? ? 2.17 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O A HOH 504 ? ? 1_555 O A HOH 525 ? ? 3_557 2.07 
2 1 O A HOH 735 ? ? 1_555 O A HOH 750 ? ? 4_557 2.11 
3 1 O A HOH 517 ? ? 1_555 O A HOH 761 ? ? 4_557 2.13 
4 1 O A HOH 674 ? ? 1_555 O A HOH 691 ? ? 2_555 2.18 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 THR A 17  ? ? -83.77  -72.90  
2 1 GLU A 186 ? A 83.88   104.31  
3 1 GLU A 186 ? B 75.69   113.65  
4 1 ASN A 247 ? ? -168.67 -167.70 
5 1 LYS A 253 ? ? -170.19 -171.25 
6 1 ALA A 343 ? ? -151.13 60.50   
7 1 PHE A 357 ? ? -154.63 -69.36  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1   ? A MET 1   
2 1 Y 1 A ASN 2   ? A ASN 2   
3 1 Y 1 A GLY 388 ? A GLY 388 
# 
_pdbx_audit_support.funding_organization   'Ministry of Economy and Competitiveness (MINECO)' 
_pdbx_audit_support.country                Spain 
_pdbx_audit_support.grant_number           BIO2016-74875-P 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION' MG  
3 'SODIUM ION'    NA  
4 water           HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                none 
# 
_space_group.name_H-M_alt     'I 2 2 2' 
_space_group.name_Hall        'I 2 2' 
_space_group.IT_number        23 
_space_group.crystal_system   orthorhombic 
_space_group.id               1 
# 
loop_
_space_group_symop.id 
_space_group_symop.operation_xyz 
1 x,y,z               
2 x,-y,-z             
3 -x,y,-z             
4 -x,-y,z             
5 x+1/2,y+1/2,z+1/2   
6 x+1/2,-y+1/2,-z+1/2 
7 -x+1/2,y+1/2,-z+1/2 
8 -x+1/2,-y+1/2,z+1/2 
#