data_6YOV
# 
_entry.id   6YOV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6YOV         
WWPDB D_1292106458 
EMDB  EMD-10864    
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
EMDB .                                    EMD-10406 'other EM volume'      
EMDB .                                    EMD-10408 'other EM volume'      
EMDB 'OCT4-SOX2-bound nucleosome - SHL+6' EMD-10864 'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6YOV 
_pdbx_database_status.recvd_initial_deposition_date   2020-04-15 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Michael, A.K.' 1 0000-0002-6080-839X 
'Kempf, G.'     2 ?                   
'Cavadini, S.'  3 0000-0003-2777-7584 
'Bunker, R.D.'  4 ?                   
'Thoma, N.H.'   5 ?                   
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Science 
_citation.journal_id_ASTM           SCIEAS 
_citation.journal_id_CSD            0038 
_citation.journal_id_ISSN           1095-9203 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            368 
_citation.language                  ? 
_citation.page_first                1460 
_citation.page_last                 1465 
_citation.title                     'Mechanisms of OCT4-SOX2 motif readout on nucleosomes.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1126/science.abb0074 
_citation.pdbx_database_id_PubMed   32327602 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Michael, A.K.'   1  ? 
primary 'Grand, R.S.'     2  ? 
primary 'Isbel, L.'       3  ? 
primary 'Cavadini, S.'    4  ? 
primary 'Kozicka, Z.'     5  ? 
primary 'Kempf, G.'       6  ? 
primary 'Bunker, R.D.'    7  ? 
primary 'Schenk, A.D.'    8  ? 
primary 'Graff-Meyer, A.' 9  ? 
primary 'Pathare, G.R.'   10 ? 
primary 'Weiss, J.'       11 ? 
primary 'Matsumoto, S.'   12 ? 
primary 'Burger, L.'      13 ? 
primary 'Schubeler, D.'   14 ? 
primary 'Thoma, N.H.'     15 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6YOV 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.00 
_cell.length_a_esd                 ? 
_cell.length_b                     1.00 
_cell.length_b_esd                 ? 
_cell.length_c                     1.00 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        ? 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6YOV 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'Histone H3.1'                                                          15719.445 1 ? ? ? ? 
2  polymer     man 'Histone H4'                                                            11547.523 1 ? ? ? ? 
3  polymer     man 'Histone H2A type 1-B/E'                                                14447.825 2 ? ? ? ? 
4  polymer     man 'Histone H2B type 1-J'                                                  14088.336 2 ? ? ? ? 
5  polymer     man 'Histone H3.1'                                                          15491.173 1 ? ? ? ? 
6  polymer     man 'Histone H4'                                                            11676.703 1 ? ? ? ? 
7  polymer     syn 'DNA (142-MER)'                                                         92645.859 2 ? ? ? ? 
8  polymer     man 'Green fluorescent protein,POU domain, class 5, transcription factor 1' 69137.789 1 ? ? ? ? 
9  polymer     man 'Transcription factor SOX-2'                                            12718.679 1 ? ? ? ? 
10 non-polymer syn PENTANEDIAL                                                             100.116   8 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
'Histone H3/a,Histone H3/b,Histone H3/c,Histone H3/d,Histone H3/f,Histone H3/h,Histone H3/i,Histone H3/j,Histone H3/k,Histone H3/l' 
3 'Histone H2A.2,Histone H2A/a,Histone H2A/m' 
4 'Histone H2B.1,Histone H2B.r,H2B/r' 
5 
'Histone H3/a,Histone H3/b,Histone H3/c,Histone H3/d,Histone H3/f,Histone H3/h,Histone H3/i,Histone H3/j,Histone H3/k,Histone H3/l' 
8 'Octamer-binding protein 3,Oct-3,Octamer-binding protein 4,Oct-4,Octamer-binding transcription factor 3,OTF-3' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GSHMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQ
DFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;GSHMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQ
DFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A   ? 
2 'polypeptide(L)'        no no 
;GSHMSGRGKGGKGLGKGGAKRHRVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAK
RKTVTAMDVVYALKRQGRTLYGFGG
;
;GSHMSGRGKGGKGLGKGGAKRHRVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAK
RKTVTAMDVVYALKRQGRTLYGFGG
;
B   ? 
3 'polypeptide(L)'        no no 
;GSHMSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKT
RIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
;
;GSHMSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKT
RIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
;
C,G ? 
4 'polypeptide(L)'        no no 
;GSHMPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGE
ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
;
;GSHMPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGE
ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
;
D,H ? 
5 'polypeptide(L)'        no no 
;GSHMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQ
DFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
;
;GSHMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQ
DFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
;
E   ? 
6 'polypeptide(L)'        no no 
;GSHMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHA
KRKTVTAMDVVYALKRQGRTLYGFGG
;
;GSHMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHA
KRKTVTAMDVVYALKRQGRTLYGFGG
;
F   ? 
7 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DC)(DT)(DG)(DG)(DA)(DG)(DA)(DA)(DT)(DC)(DC)(DC)(DG)(DG)(DT)(DC)(DT)
(DG)(DC)(DA)(DG)(DG)(DC)(DC)(DG)(DC)(DT)(DC)(DA)(DA)(DT)(DT)(DG)(DG)(DT)(DC)(DG)
(DT)(DA)(DG)(DA)(DC)(DA)(DG)(DC)(DT)(DC)(DT)(DA)(DG)(DC)(DA)(DC)(DC)(DG)(DC)(DT)
(DT)(DA)(DA)(DA)(DC)(DG)(DC)(DA)(DC)(DG)(DT)(DA)(DC)(DG)(DC)(DG)(DC)(DT)(DG)(DT)
(DC)(DC)(DC)(DC)(DC)(DG)(DC)(DG)(DT)(DT)(DT)(DT)(DA)(DA)(DC)(DC)(DG)(DC)(DC)(DA)
(DA)(DG)(DG)(DG)(DG)(DA)(DT)(DT)(DA)(DC)(DT)(DC)(DC)(DC)(DT)(DA)(DG)(DT)(DC)(DT)
(DC)(DC)(DA)(DG)(DG)(DC)(DC)(DT)(DT)(DT)(DG)(DT)(DT)(DA)(DT)(DG)(DC)(DA)(DA)(DA)
(DT)(DA)(DC)(DA)(DT)(DC)(DC)(DT)(DG)(DT)(DA)(DC)(DA)(DG)(DG)(DA)(DT)(DG)(DT)(DA)
(DT)(DT)(DT)(DG)(DC)(DA)(DT)(DA)(DA)(DC)(DA)(DA)(DA)(DG)(DG)(DC)(DC)(DT)(DG)(DG)
(DA)(DG)(DA)(DC)(DT)(DA)(DG)(DG)(DG)(DA)(DG)(DT)(DA)(DA)(DT)(DC)(DC)(DC)(DC)(DT)
(DT)(DG)(DG)(DC)(DG)(DG)(DT)(DT)(DA)(DA)(DA)(DA)(DC)(DG)(DC)(DG)(DG)(DG)(DG)(DG)
(DA)(DC)(DA)(DG)(DC)(DG)(DC)(DG)(DT)(DA)(DC)(DG)(DT)(DG)(DC)(DG)(DT)(DT)(DT)(DA)
(DA)(DG)(DC)(DG)(DG)(DT)(DG)(DC)(DT)(DA)(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DT)(DA)
(DC)(DG)(DA)(DC)(DC)(DA)(DA)(DT)(DT)(DG)(DA)(DG)(DC)(DG)(DG)(DC)(DC)(DT)(DG)(DC)
(DA)(DG)(DA)(DC)(DC)(DG)(DG)(DG)(DA)(DT)(DT)(DC)(DT)(DC)(DC)(DA)(DG)(DG)(DA)(DT)
;
;ATCCTGGAGAATCCCGGTCTGCAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGT
CCCCCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCCTTTGTTATGCAAATACATCCTGTACAGGATGTA
TTTGCATAACAAAGGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTACGTGCGTTTA
AGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTGCAGACCGGGATTCTCCAGGAT
;
I,J ? 
8 'polypeptide(L)'        no no 
;MDWSHPQFEKSAVDENLYFQGGMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPW
PTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNIL
GHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDH
MVLLEFVTAAGITLGMDELYKEAAAKEAAAKMAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGP
GVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKL
EQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVE
EADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSS
SDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN
;
;MDWSHPQFEKSAVDENLYFQGGMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPW
PTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNIL
GHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDH
MVLLEFVTAAGITLGMDELYKEAAAKEAAAKMAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGP
GVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKL
EQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVE
EADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSS
SDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN
;
K   ? 
9 'polypeptide(L)'        no no 
;MDWSHPQFEKSAVDENLYFQGGMSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDE
AKRLRALHMKEHPDYKYRPRRKTKT
;
;MDWSHPQFEKSAVDENLYFQGGMSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDE
AKRLRALHMKEHPDYKYRPRRKTKT
;
L   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   ARG n 
1 7   THR n 
1 8   LYS n 
1 9   GLN n 
1 10  THR n 
1 11  ALA n 
1 12  ARG n 
1 13  LYS n 
1 14  SER n 
1 15  THR n 
1 16  GLY n 
1 17  GLY n 
1 18  LYS n 
1 19  ALA n 
1 20  PRO n 
1 21  ARG n 
1 22  LYS n 
1 23  GLN n 
1 24  LEU n 
1 25  ALA n 
1 26  THR n 
1 27  LYS n 
1 28  ALA n 
1 29  ALA n 
1 30  ARG n 
1 31  LYS n 
1 32  SER n 
1 33  ALA n 
1 34  PRO n 
1 35  ALA n 
1 36  THR n 
1 37  GLY n 
1 38  GLY n 
1 39  VAL n 
1 40  LYS n 
1 41  LYS n 
1 42  PRO n 
1 43  HIS n 
1 44  ARG n 
1 45  TYR n 
1 46  ARG n 
1 47  PRO n 
1 48  GLY n 
1 49  THR n 
1 50  VAL n 
1 51  ALA n 
1 52  LEU n 
1 53  ARG n 
1 54  GLU n 
1 55  ILE n 
1 56  ARG n 
1 57  ARG n 
1 58  TYR n 
1 59  GLN n 
1 60  LYS n 
1 61  SER n 
1 62  THR n 
1 63  GLU n 
1 64  LEU n 
1 65  LEU n 
1 66  ILE n 
1 67  ARG n 
1 68  LYS n 
1 69  LEU n 
1 70  PRO n 
1 71  PHE n 
1 72  GLN n 
1 73  ARG n 
1 74  LEU n 
1 75  VAL n 
1 76  ARG n 
1 77  GLU n 
1 78  ILE n 
1 79  ALA n 
1 80  GLN n 
1 81  ASP n 
1 82  PHE n 
1 83  LYS n 
1 84  THR n 
1 85  ASP n 
1 86  LEU n 
1 87  ARG n 
1 88  PHE n 
1 89  GLN n 
1 90  SER n 
1 91  SER n 
1 92  ALA n 
1 93  VAL n 
1 94  MET n 
1 95  ALA n 
1 96  LEU n 
1 97  GLN n 
1 98  GLU n 
1 99  ALA n 
1 100 CYS n 
1 101 GLU n 
1 102 ALA n 
1 103 TYR n 
1 104 LEU n 
1 105 VAL n 
1 106 GLY n 
1 107 LEU n 
1 108 PHE n 
1 109 GLU n 
1 110 ASP n 
1 111 THR n 
1 112 ASN n 
1 113 LEU n 
1 114 CYS n 
1 115 ALA n 
1 116 ILE n 
1 117 HIS n 
1 118 ALA n 
1 119 LYS n 
1 120 ARG n 
1 121 VAL n 
1 122 THR n 
1 123 ILE n 
1 124 MET n 
1 125 PRO n 
1 126 LYS n 
1 127 ASP n 
1 128 ILE n 
1 129 GLN n 
1 130 LEU n 
1 131 ALA n 
1 132 ARG n 
1 133 ARG n 
1 134 ILE n 
1 135 ARG n 
1 136 GLY n 
1 137 GLU n 
1 138 ARG n 
1 139 ALA n 
2 1   GLY n 
2 2   SER n 
2 3   HIS n 
2 4   MET n 
2 5   SER n 
2 6   GLY n 
2 7   ARG n 
2 8   GLY n 
2 9   LYS n 
2 10  GLY n 
2 11  GLY n 
2 12  LYS n 
2 13  GLY n 
2 14  LEU n 
2 15  GLY n 
2 16  LYS n 
2 17  GLY n 
2 18  GLY n 
2 19  ALA n 
2 20  LYS n 
2 21  ARG n 
2 22  HIS n 
2 23  ARG n 
2 24  VAL n 
2 25  LEU n 
2 26  ARG n 
2 27  ASP n 
2 28  ASN n 
2 29  ILE n 
2 30  GLN n 
2 31  GLY n 
2 32  ILE n 
2 33  THR n 
2 34  LYS n 
2 35  PRO n 
2 36  ALA n 
2 37  ILE n 
2 38  ARG n 
2 39  ARG n 
2 40  LEU n 
2 41  ALA n 
2 42  ARG n 
2 43  ARG n 
2 44  GLY n 
2 45  GLY n 
2 46  VAL n 
2 47  LYS n 
2 48  ARG n 
2 49  ILE n 
2 50  SER n 
2 51  GLY n 
2 52  LEU n 
2 53  ILE n 
2 54  TYR n 
2 55  GLU n 
2 56  GLU n 
2 57  THR n 
2 58  ARG n 
2 59  GLY n 
2 60  VAL n 
2 61  LEU n 
2 62  LYS n 
2 63  VAL n 
2 64  PHE n 
2 65  LEU n 
2 66  GLU n 
2 67  ASN n 
2 68  VAL n 
2 69  ILE n 
2 70  ARG n 
2 71  ASP n 
2 72  ALA n 
2 73  VAL n 
2 74  THR n 
2 75  TYR n 
2 76  THR n 
2 77  GLU n 
2 78  HIS n 
2 79  ALA n 
2 80  LYS n 
2 81  ARG n 
2 82  LYS n 
2 83  THR n 
2 84  VAL n 
2 85  THR n 
2 86  ALA n 
2 87  MET n 
2 88  ASP n 
2 89  VAL n 
2 90  VAL n 
2 91  TYR n 
2 92  ALA n 
2 93  LEU n 
2 94  LYS n 
2 95  ARG n 
2 96  GLN n 
2 97  GLY n 
2 98  ARG n 
2 99  THR n 
2 100 LEU n 
2 101 TYR n 
2 102 GLY n 
2 103 PHE n 
2 104 GLY n 
2 105 GLY n 
3 1   GLY n 
3 2   SER n 
3 3   HIS n 
3 4   MET n 
3 5   SER n 
3 6   GLY n 
3 7   ARG n 
3 8   GLY n 
3 9   LYS n 
3 10  GLN n 
3 11  GLY n 
3 12  GLY n 
3 13  LYS n 
3 14  ALA n 
3 15  ARG n 
3 16  ALA n 
3 17  LYS n 
3 18  ALA n 
3 19  LYS n 
3 20  THR n 
3 21  ARG n 
3 22  SER n 
3 23  SER n 
3 24  ARG n 
3 25  ALA n 
3 26  GLY n 
3 27  LEU n 
3 28  GLN n 
3 29  PHE n 
3 30  PRO n 
3 31  VAL n 
3 32  GLY n 
3 33  ARG n 
3 34  VAL n 
3 35  HIS n 
3 36  ARG n 
3 37  LEU n 
3 38  LEU n 
3 39  ARG n 
3 40  LYS n 
3 41  GLY n 
3 42  ASN n 
3 43  TYR n 
3 44  SER n 
3 45  GLU n 
3 46  ARG n 
3 47  VAL n 
3 48  GLY n 
3 49  ALA n 
3 50  GLY n 
3 51  ALA n 
3 52  PRO n 
3 53  VAL n 
3 54  TYR n 
3 55  LEU n 
3 56  ALA n 
3 57  ALA n 
3 58  VAL n 
3 59  LEU n 
3 60  GLU n 
3 61  TYR n 
3 62  LEU n 
3 63  THR n 
3 64  ALA n 
3 65  GLU n 
3 66  ILE n 
3 67  LEU n 
3 68  GLU n 
3 69  LEU n 
3 70  ALA n 
3 71  GLY n 
3 72  ASN n 
3 73  ALA n 
3 74  ALA n 
3 75  ARG n 
3 76  ASP n 
3 77  ASN n 
3 78  LYS n 
3 79  LYS n 
3 80  THR n 
3 81  ARG n 
3 82  ILE n 
3 83  ILE n 
3 84  PRO n 
3 85  ARG n 
3 86  HIS n 
3 87  LEU n 
3 88  GLN n 
3 89  LEU n 
3 90  ALA n 
3 91  ILE n 
3 92  ARG n 
3 93  ASN n 
3 94  ASP n 
3 95  GLU n 
3 96  GLU n 
3 97  LEU n 
3 98  ASN n 
3 99  LYS n 
3 100 LEU n 
3 101 LEU n 
3 102 GLY n 
3 103 ARG n 
3 104 VAL n 
3 105 THR n 
3 106 ILE n 
3 107 ALA n 
3 108 GLN n 
3 109 GLY n 
3 110 GLY n 
3 111 VAL n 
3 112 LEU n 
3 113 PRO n 
3 114 ASN n 
3 115 ILE n 
3 116 GLN n 
3 117 ALA n 
3 118 VAL n 
3 119 LEU n 
3 120 LEU n 
3 121 PRO n 
3 122 LYS n 
3 123 LYS n 
3 124 THR n 
3 125 GLU n 
3 126 SER n 
3 127 HIS n 
3 128 HIS n 
3 129 LYS n 
3 130 ALA n 
3 131 LYS n 
3 132 GLY n 
3 133 LYS n 
4 1   GLY n 
4 2   SER n 
4 3   HIS n 
4 4   MET n 
4 5   PRO n 
4 6   GLU n 
4 7   PRO n 
4 8   ALA n 
4 9   LYS n 
4 10  SER n 
4 11  ALA n 
4 12  PRO n 
4 13  ALA n 
4 14  PRO n 
4 15  LYS n 
4 16  LYS n 
4 17  GLY n 
4 18  SER n 
4 19  LYS n 
4 20  LYS n 
4 21  ALA n 
4 22  VAL n 
4 23  THR n 
4 24  LYS n 
4 25  ALA n 
4 26  GLN n 
4 27  LYS n 
4 28  LYS n 
4 29  ASP n 
4 30  GLY n 
4 31  LYS n 
4 32  LYS n 
4 33  ARG n 
4 34  LYS n 
4 35  ARG n 
4 36  SER n 
4 37  ARG n 
4 38  LYS n 
4 39  GLU n 
4 40  SER n 
4 41  TYR n 
4 42  SER n 
4 43  ILE n 
4 44  TYR n 
4 45  VAL n 
4 46  TYR n 
4 47  LYS n 
4 48  VAL n 
4 49  LEU n 
4 50  LYS n 
4 51  GLN n 
4 52  VAL n 
4 53  HIS n 
4 54  PRO n 
4 55  ASP n 
4 56  THR n 
4 57  GLY n 
4 58  ILE n 
4 59  SER n 
4 60  SER n 
4 61  LYS n 
4 62  ALA n 
4 63  MET n 
4 64  GLY n 
4 65  ILE n 
4 66  MET n 
4 67  ASN n 
4 68  SER n 
4 69  PHE n 
4 70  VAL n 
4 71  ASN n 
4 72  ASP n 
4 73  ILE n 
4 74  PHE n 
4 75  GLU n 
4 76  ARG n 
4 77  ILE n 
4 78  ALA n 
4 79  GLY n 
4 80  GLU n 
4 81  ALA n 
4 82  SER n 
4 83  ARG n 
4 84  LEU n 
4 85  ALA n 
4 86  HIS n 
4 87  TYR n 
4 88  ASN n 
4 89  LYS n 
4 90  ARG n 
4 91  SER n 
4 92  THR n 
4 93  ILE n 
4 94  THR n 
4 95  SER n 
4 96  ARG n 
4 97  GLU n 
4 98  ILE n 
4 99  GLN n 
4 100 THR n 
4 101 ALA n 
4 102 VAL n 
4 103 ARG n 
4 104 LEU n 
4 105 LEU n 
4 106 LEU n 
4 107 PRO n 
4 108 GLY n 
4 109 GLU n 
4 110 LEU n 
4 111 ALA n 
4 112 LYS n 
4 113 HIS n 
4 114 ALA n 
4 115 VAL n 
4 116 SER n 
4 117 GLU n 
4 118 GLY n 
4 119 THR n 
4 120 LYS n 
4 121 ALA n 
4 122 VAL n 
4 123 THR n 
4 124 LYS n 
4 125 TYR n 
4 126 THR n 
4 127 SER n 
4 128 ALA n 
5 1   GLY n 
5 2   SER n 
5 3   HIS n 
5 4   MET n 
5 5   ALA n 
5 6   ARG n 
5 7   THR n 
5 8   LYS n 
5 9   GLN n 
5 10  THR n 
5 11  ALA n 
5 12  ARG n 
5 13  LYS n 
5 14  SER n 
5 15  THR n 
5 16  GLY n 
5 17  GLY n 
5 18  LYS n 
5 19  ALA n 
5 20  PRO n 
5 21  ARG n 
5 22  LYS n 
5 23  GLN n 
5 24  LEU n 
5 25  ALA n 
5 26  THR n 
5 27  LYS n 
5 28  ALA n 
5 29  ALA n 
5 30  ARG n 
5 31  LYS n 
5 32  SER n 
5 33  ALA n 
5 34  PRO n 
5 35  ALA n 
5 36  THR n 
5 37  GLY n 
5 38  GLY n 
5 39  VAL n 
5 40  LYS n 
5 41  LYS n 
5 42  PRO n 
5 43  HIS n 
5 44  ARG n 
5 45  TYR n 
5 46  ARG n 
5 47  PRO n 
5 48  GLY n 
5 49  THR n 
5 50  VAL n 
5 51  ALA n 
5 52  LEU n 
5 53  ARG n 
5 54  GLU n 
5 55  ILE n 
5 56  ARG n 
5 57  ARG n 
5 58  TYR n 
5 59  GLN n 
5 60  LYS n 
5 61  SER n 
5 62  THR n 
5 63  GLU n 
5 64  LEU n 
5 65  LEU n 
5 66  ILE n 
5 67  ARG n 
5 68  LYS n 
5 69  LEU n 
5 70  PRO n 
5 71  PHE n 
5 72  GLN n 
5 73  ARG n 
5 74  LEU n 
5 75  VAL n 
5 76  ARG n 
5 77  GLU n 
5 78  ILE n 
5 79  ALA n 
5 80  GLN n 
5 81  ASP n 
5 82  PHE n 
5 83  LYS n 
5 84  THR n 
5 85  ASP n 
5 86  LEU n 
5 87  ARG n 
5 88  PHE n 
5 89  GLN n 
5 90  SER n 
5 91  SER n 
5 92  ALA n 
5 93  VAL n 
5 94  MET n 
5 95  ALA n 
5 96  LEU n 
5 97  GLN n 
5 98  GLU n 
5 99  ALA n 
5 100 CYS n 
5 101 GLU n 
5 102 ALA n 
5 103 TYR n 
5 104 LEU n 
5 105 VAL n 
5 106 GLY n 
5 107 LEU n 
5 108 PHE n 
5 109 GLU n 
5 110 ASP n 
5 111 THR n 
5 112 ASN n 
5 113 LEU n 
5 114 CYS n 
5 115 ALA n 
5 116 ILE n 
5 117 HIS n 
5 118 ALA n 
5 119 LYS n 
5 120 ARG n 
5 121 VAL n 
5 122 THR n 
5 123 ILE n 
5 124 MET n 
5 125 PRO n 
5 126 LYS n 
5 127 ASP n 
5 128 ILE n 
5 129 GLN n 
5 130 LEU n 
5 131 ALA n 
5 132 ARG n 
5 133 ARG n 
5 134 ILE n 
5 135 ARG n 
5 136 GLY n 
5 137 GLU n 
6 1   GLY n 
6 2   SER n 
6 3   HIS n 
6 4   MET n 
6 5   SER n 
6 6   GLY n 
6 7   ARG n 
6 8   GLY n 
6 9   LYS n 
6 10  GLY n 
6 11  GLY n 
6 12  LYS n 
6 13  GLY n 
6 14  LEU n 
6 15  GLY n 
6 16  LYS n 
6 17  GLY n 
6 18  GLY n 
6 19  ALA n 
6 20  LYS n 
6 21  ARG n 
6 22  HIS n 
6 23  ARG n 
6 24  LYS n 
6 25  VAL n 
6 26  LEU n 
6 27  ARG n 
6 28  ASP n 
6 29  ASN n 
6 30  ILE n 
6 31  GLN n 
6 32  GLY n 
6 33  ILE n 
6 34  THR n 
6 35  LYS n 
6 36  PRO n 
6 37  ALA n 
6 38  ILE n 
6 39  ARG n 
6 40  ARG n 
6 41  LEU n 
6 42  ALA n 
6 43  ARG n 
6 44  ARG n 
6 45  GLY n 
6 46  GLY n 
6 47  VAL n 
6 48  LYS n 
6 49  ARG n 
6 50  ILE n 
6 51  SER n 
6 52  GLY n 
6 53  LEU n 
6 54  ILE n 
6 55  TYR n 
6 56  GLU n 
6 57  GLU n 
6 58  THR n 
6 59  ARG n 
6 60  GLY n 
6 61  VAL n 
6 62  LEU n 
6 63  LYS n 
6 64  VAL n 
6 65  PHE n 
6 66  LEU n 
6 67  GLU n 
6 68  ASN n 
6 69  VAL n 
6 70  ILE n 
6 71  ARG n 
6 72  ASP n 
6 73  ALA n 
6 74  VAL n 
6 75  THR n 
6 76  TYR n 
6 77  THR n 
6 78  GLU n 
6 79  HIS n 
6 80  ALA n 
6 81  LYS n 
6 82  ARG n 
6 83  LYS n 
6 84  THR n 
6 85  VAL n 
6 86  THR n 
6 87  ALA n 
6 88  MET n 
6 89  ASP n 
6 90  VAL n 
6 91  VAL n 
6 92  TYR n 
6 93  ALA n 
6 94  LEU n 
6 95  LYS n 
6 96  ARG n 
6 97  GLN n 
6 98  GLY n 
6 99  ARG n 
6 100 THR n 
6 101 LEU n 
6 102 TYR n 
6 103 GLY n 
6 104 PHE n 
6 105 GLY n 
6 106 GLY n 
7 1   DA  n 
7 2   DT  n 
7 3   DC  n 
7 4   DC  n 
7 5   DT  n 
7 6   DG  n 
7 7   DG  n 
7 8   DA  n 
7 9   DG  n 
7 10  DA  n 
7 11  DA  n 
7 12  DT  n 
7 13  DC  n 
7 14  DC  n 
7 15  DC  n 
7 16  DG  n 
7 17  DG  n 
7 18  DT  n 
7 19  DC  n 
7 20  DT  n 
7 21  DG  n 
7 22  DC  n 
7 23  DA  n 
7 24  DG  n 
7 25  DG  n 
7 26  DC  n 
7 27  DC  n 
7 28  DG  n 
7 29  DC  n 
7 30  DT  n 
7 31  DC  n 
7 32  DA  n 
7 33  DA  n 
7 34  DT  n 
7 35  DT  n 
7 36  DG  n 
7 37  DG  n 
7 38  DT  n 
7 39  DC  n 
7 40  DG  n 
7 41  DT  n 
7 42  DA  n 
7 43  DG  n 
7 44  DA  n 
7 45  DC  n 
7 46  DA  n 
7 47  DG  n 
7 48  DC  n 
7 49  DT  n 
7 50  DC  n 
7 51  DT  n 
7 52  DA  n 
7 53  DG  n 
7 54  DC  n 
7 55  DA  n 
7 56  DC  n 
7 57  DC  n 
7 58  DG  n 
7 59  DC  n 
7 60  DT  n 
7 61  DT  n 
7 62  DA  n 
7 63  DA  n 
7 64  DA  n 
7 65  DC  n 
7 66  DG  n 
7 67  DC  n 
7 68  DA  n 
7 69  DC  n 
7 70  DG  n 
7 71  DT  n 
7 72  DA  n 
7 73  DC  n 
7 74  DG  n 
7 75  DC  n 
7 76  DG  n 
7 77  DC  n 
7 78  DT  n 
7 79  DG  n 
7 80  DT  n 
7 81  DC  n 
7 82  DC  n 
7 83  DC  n 
7 84  DC  n 
7 85  DC  n 
7 86  DG  n 
7 87  DC  n 
7 88  DG  n 
7 89  DT  n 
7 90  DT  n 
7 91  DT  n 
7 92  DT  n 
7 93  DA  n 
7 94  DA  n 
7 95  DC  n 
7 96  DC  n 
7 97  DG  n 
7 98  DC  n 
7 99  DC  n 
7 100 DA  n 
7 101 DA  n 
7 102 DG  n 
7 103 DG  n 
7 104 DG  n 
7 105 DG  n 
7 106 DA  n 
7 107 DT  n 
7 108 DT  n 
7 109 DA  n 
7 110 DC  n 
7 111 DT  n 
7 112 DC  n 
7 113 DC  n 
7 114 DC  n 
7 115 DT  n 
7 116 DA  n 
7 117 DG  n 
7 118 DT  n 
7 119 DC  n 
7 120 DT  n 
7 121 DC  n 
7 122 DC  n 
7 123 DA  n 
7 124 DG  n 
7 125 DG  n 
7 126 DC  n 
7 127 DC  n 
7 128 DT  n 
7 129 DT  n 
7 130 DT  n 
7 131 DG  n 
7 132 DT  n 
7 133 DT  n 
7 134 DA  n 
7 135 DT  n 
7 136 DG  n 
7 137 DC  n 
7 138 DA  n 
7 139 DA  n 
7 140 DA  n 
7 141 DT  n 
7 142 DA  n 
7 143 DC  n 
7 144 DA  n 
7 145 DT  n 
7 146 DC  n 
7 147 DC  n 
7 148 DT  n 
7 149 DG  n 
7 150 DT  n 
7 151 DA  n 
7 152 DC  n 
7 153 DA  n 
7 154 DG  n 
7 155 DG  n 
7 156 DA  n 
7 157 DT  n 
7 158 DG  n 
7 159 DT  n 
7 160 DA  n 
7 161 DT  n 
7 162 DT  n 
7 163 DT  n 
7 164 DG  n 
7 165 DC  n 
7 166 DA  n 
7 167 DT  n 
7 168 DA  n 
7 169 DA  n 
7 170 DC  n 
7 171 DA  n 
7 172 DA  n 
7 173 DA  n 
7 174 DG  n 
7 175 DG  n 
7 176 DC  n 
7 177 DC  n 
7 178 DT  n 
7 179 DG  n 
7 180 DG  n 
7 181 DA  n 
7 182 DG  n 
7 183 DA  n 
7 184 DC  n 
7 185 DT  n 
7 186 DA  n 
7 187 DG  n 
7 188 DG  n 
7 189 DG  n 
7 190 DA  n 
7 191 DG  n 
7 192 DT  n 
7 193 DA  n 
7 194 DA  n 
7 195 DT  n 
7 196 DC  n 
7 197 DC  n 
7 198 DC  n 
7 199 DC  n 
7 200 DT  n 
7 201 DT  n 
7 202 DG  n 
7 203 DG  n 
7 204 DC  n 
7 205 DG  n 
7 206 DG  n 
7 207 DT  n 
7 208 DT  n 
7 209 DA  n 
7 210 DA  n 
7 211 DA  n 
7 212 DA  n 
7 213 DC  n 
7 214 DG  n 
7 215 DC  n 
7 216 DG  n 
7 217 DG  n 
7 218 DG  n 
7 219 DG  n 
7 220 DG  n 
7 221 DA  n 
7 222 DC  n 
7 223 DA  n 
7 224 DG  n 
7 225 DC  n 
7 226 DG  n 
7 227 DC  n 
7 228 DG  n 
7 229 DT  n 
7 230 DA  n 
7 231 DC  n 
7 232 DG  n 
7 233 DT  n 
7 234 DG  n 
7 235 DC  n 
7 236 DG  n 
7 237 DT  n 
7 238 DT  n 
7 239 DT  n 
7 240 DA  n 
7 241 DA  n 
7 242 DG  n 
7 243 DC  n 
7 244 DG  n 
7 245 DG  n 
7 246 DT  n 
7 247 DG  n 
7 248 DC  n 
7 249 DT  n 
7 250 DA  n 
7 251 DG  n 
7 252 DA  n 
7 253 DG  n 
7 254 DC  n 
7 255 DT  n 
7 256 DG  n 
7 257 DT  n 
7 258 DC  n 
7 259 DT  n 
7 260 DA  n 
7 261 DC  n 
7 262 DG  n 
7 263 DA  n 
7 264 DC  n 
7 265 DC  n 
7 266 DA  n 
7 267 DA  n 
7 268 DT  n 
7 269 DT  n 
7 270 DG  n 
7 271 DA  n 
7 272 DG  n 
7 273 DC  n 
7 274 DG  n 
7 275 DG  n 
7 276 DC  n 
7 277 DC  n 
7 278 DT  n 
7 279 DG  n 
7 280 DC  n 
7 281 DA  n 
7 282 DG  n 
7 283 DA  n 
7 284 DC  n 
7 285 DC  n 
7 286 DG  n 
7 287 DG  n 
7 288 DG  n 
7 289 DA  n 
7 290 DT  n 
7 291 DT  n 
7 292 DC  n 
7 293 DT  n 
7 294 DC  n 
7 295 DC  n 
7 296 DA  n 
7 297 DG  n 
7 298 DG  n 
7 299 DA  n 
7 300 DT  n 
8 1   MET n 
8 2   ASP n 
8 3   TRP n 
8 4   SER n 
8 5   HIS n 
8 6   PRO n 
8 7   GLN n 
8 8   PHE n 
8 9   GLU n 
8 10  LYS n 
8 11  SER n 
8 12  ALA n 
8 13  VAL n 
8 14  ASP n 
8 15  GLU n 
8 16  ASN n 
8 17  LEU n 
8 18  TYR n 
8 19  PHE n 
8 20  GLN n 
8 21  GLY n 
8 22  GLY n 
8 23  MET n 
8 24  VAL n 
8 25  SER n 
8 26  LYS n 
8 27  GLY n 
8 28  GLU n 
8 29  GLU n 
8 30  LEU n 
8 31  PHE n 
8 32  THR n 
8 33  GLY n 
8 34  VAL n 
8 35  VAL n 
8 36  PRO n 
8 37  ILE n 
8 38  LEU n 
8 39  VAL n 
8 40  GLU n 
8 41  LEU n 
8 42  ASP n 
8 43  GLY n 
8 44  ASP n 
8 45  VAL n 
8 46  ASN n 
8 47  GLY n 
8 48  HIS n 
8 49  LYS n 
8 50  PHE n 
8 51  SER n 
8 52  VAL n 
8 53  SER n 
8 54  GLY n 
8 55  GLU n 
8 56  GLY n 
8 57  GLU n 
8 58  GLY n 
8 59  ASP n 
8 60  ALA n 
8 61  THR n 
8 62  TYR n 
8 63  GLY n 
8 64  LYS n 
8 65  LEU n 
8 66  THR n 
8 67  LEU n 
8 68  LYS n 
8 69  PHE n 
8 70  ILE n 
8 71  CYS n 
8 72  THR n 
8 73  THR n 
8 74  GLY n 
8 75  LYS n 
8 76  LEU n 
8 77  PRO n 
8 78  VAL n 
8 79  PRO n 
8 80  TRP n 
8 81  PRO n 
8 82  THR n 
8 83  LEU n 
8 84  VAL n 
8 85  THR n 
8 86  THR n 
8 87  LEU n 
8 88  THR n 
8 89  TYR n 
8 90  GLY n 
8 91  VAL n 
8 92  GLN n 
8 93  CYS n 
8 94  PHE n 
8 95  SER n 
8 96  ARG n 
8 97  TYR n 
8 98  PRO n 
8 99  ASP n 
8 100 HIS n 
8 101 MET n 
8 102 LYS n 
8 103 GLN n 
8 104 HIS n 
8 105 ASP n 
8 106 PHE n 
8 107 PHE n 
8 108 LYS n 
8 109 SER n 
8 110 ALA n 
8 111 MET n 
8 112 PRO n 
8 113 GLU n 
8 114 GLY n 
8 115 TYR n 
8 116 VAL n 
8 117 GLN n 
8 118 GLU n 
8 119 ARG n 
8 120 THR n 
8 121 ILE n 
8 122 PHE n 
8 123 PHE n 
8 124 LYS n 
8 125 ASP n 
8 126 ASP n 
8 127 GLY n 
8 128 ASN n 
8 129 TYR n 
8 130 LYS n 
8 131 THR n 
8 132 ARG n 
8 133 ALA n 
8 134 GLU n 
8 135 VAL n 
8 136 LYS n 
8 137 PHE n 
8 138 GLU n 
8 139 GLY n 
8 140 ASP n 
8 141 THR n 
8 142 LEU n 
8 143 VAL n 
8 144 ASN n 
8 145 ARG n 
8 146 ILE n 
8 147 GLU n 
8 148 LEU n 
8 149 LYS n 
8 150 GLY n 
8 151 ILE n 
8 152 ASP n 
8 153 PHE n 
8 154 LYS n 
8 155 GLU n 
8 156 ASP n 
8 157 GLY n 
8 158 ASN n 
8 159 ILE n 
8 160 LEU n 
8 161 GLY n 
8 162 HIS n 
8 163 LYS n 
8 164 LEU n 
8 165 GLU n 
8 166 TYR n 
8 167 ASN n 
8 168 TYR n 
8 169 ASN n 
8 170 SER n 
8 171 HIS n 
8 172 ASN n 
8 173 VAL n 
8 174 TYR n 
8 175 ILE n 
8 176 MET n 
8 177 ALA n 
8 178 ASP n 
8 179 LYS n 
8 180 GLN n 
8 181 LYS n 
8 182 ASN n 
8 183 GLY n 
8 184 ILE n 
8 185 LYS n 
8 186 VAL n 
8 187 ASN n 
8 188 PHE n 
8 189 LYS n 
8 190 ILE n 
8 191 ARG n 
8 192 HIS n 
8 193 ASN n 
8 194 ILE n 
8 195 GLU n 
8 196 ASP n 
8 197 GLY n 
8 198 SER n 
8 199 VAL n 
8 200 GLN n 
8 201 LEU n 
8 202 ALA n 
8 203 ASP n 
8 204 HIS n 
8 205 TYR n 
8 206 GLN n 
8 207 GLN n 
8 208 ASN n 
8 209 THR n 
8 210 PRO n 
8 211 ILE n 
8 212 GLY n 
8 213 ASP n 
8 214 GLY n 
8 215 PRO n 
8 216 VAL n 
8 217 LEU n 
8 218 LEU n 
8 219 PRO n 
8 220 ASP n 
8 221 ASN n 
8 222 HIS n 
8 223 TYR n 
8 224 LEU n 
8 225 SER n 
8 226 THR n 
8 227 GLN n 
8 228 SER n 
8 229 LYS n 
8 230 LEU n 
8 231 SER n 
8 232 LYS n 
8 233 ASP n 
8 234 PRO n 
8 235 ASN n 
8 236 GLU n 
8 237 LYS n 
8 238 ARG n 
8 239 ASP n 
8 240 HIS n 
8 241 MET n 
8 242 VAL n 
8 243 LEU n 
8 244 LEU n 
8 245 GLU n 
8 246 PHE n 
8 247 VAL n 
8 248 THR n 
8 249 ALA n 
8 250 ALA n 
8 251 GLY n 
8 252 ILE n 
8 253 THR n 
8 254 LEU n 
8 255 GLY n 
8 256 MET n 
8 257 ASP n 
8 258 GLU n 
8 259 LEU n 
8 260 TYR n 
8 261 LYS n 
8 262 GLU n 
8 263 ALA n 
8 264 ALA n 
8 265 ALA n 
8 266 LYS n 
8 267 GLU n 
8 268 ALA n 
8 269 ALA n 
8 270 ALA n 
8 271 LYS n 
8 272 MET n 
8 273 ALA n 
8 274 GLY n 
8 275 HIS n 
8 276 LEU n 
8 277 ALA n 
8 278 SER n 
8 279 ASP n 
8 280 PHE n 
8 281 ALA n 
8 282 PHE n 
8 283 SER n 
8 284 PRO n 
8 285 PRO n 
8 286 PRO n 
8 287 GLY n 
8 288 GLY n 
8 289 GLY n 
8 290 GLY n 
8 291 ASP n 
8 292 GLY n 
8 293 PRO n 
8 294 GLY n 
8 295 GLY n 
8 296 PRO n 
8 297 GLU n 
8 298 PRO n 
8 299 GLY n 
8 300 TRP n 
8 301 VAL n 
8 302 ASP n 
8 303 PRO n 
8 304 ARG n 
8 305 THR n 
8 306 TRP n 
8 307 LEU n 
8 308 SER n 
8 309 PHE n 
8 310 GLN n 
8 311 GLY n 
8 312 PRO n 
8 313 PRO n 
8 314 GLY n 
8 315 GLY n 
8 316 PRO n 
8 317 GLY n 
8 318 ILE n 
8 319 GLY n 
8 320 PRO n 
8 321 GLY n 
8 322 VAL n 
8 323 GLY n 
8 324 PRO n 
8 325 GLY n 
8 326 SER n 
8 327 GLU n 
8 328 VAL n 
8 329 TRP n 
8 330 GLY n 
8 331 ILE n 
8 332 PRO n 
8 333 PRO n 
8 334 CYS n 
8 335 PRO n 
8 336 PRO n 
8 337 PRO n 
8 338 TYR n 
8 339 GLU n 
8 340 PHE n 
8 341 CYS n 
8 342 GLY n 
8 343 GLY n 
8 344 MET n 
8 345 ALA n 
8 346 TYR n 
8 347 CYS n 
8 348 GLY n 
8 349 PRO n 
8 350 GLN n 
8 351 VAL n 
8 352 GLY n 
8 353 VAL n 
8 354 GLY n 
8 355 LEU n 
8 356 VAL n 
8 357 PRO n 
8 358 GLN n 
8 359 GLY n 
8 360 GLY n 
8 361 LEU n 
8 362 GLU n 
8 363 THR n 
8 364 SER n 
8 365 GLN n 
8 366 PRO n 
8 367 GLU n 
8 368 GLY n 
8 369 GLU n 
8 370 ALA n 
8 371 GLY n 
8 372 VAL n 
8 373 GLY n 
8 374 VAL n 
8 375 GLU n 
8 376 SER n 
8 377 ASN n 
8 378 SER n 
8 379 ASP n 
8 380 GLY n 
8 381 ALA n 
8 382 SER n 
8 383 PRO n 
8 384 GLU n 
8 385 PRO n 
8 386 CYS n 
8 387 THR n 
8 388 VAL n 
8 389 THR n 
8 390 PRO n 
8 391 GLY n 
8 392 ALA n 
8 393 VAL n 
8 394 LYS n 
8 395 LEU n 
8 396 GLU n 
8 397 LYS n 
8 398 GLU n 
8 399 LYS n 
8 400 LEU n 
8 401 GLU n 
8 402 GLN n 
8 403 ASN n 
8 404 PRO n 
8 405 GLU n 
8 406 GLU n 
8 407 SER n 
8 408 GLN n 
8 409 ASP n 
8 410 ILE n 
8 411 LYS n 
8 412 ALA n 
8 413 LEU n 
8 414 GLN n 
8 415 LYS n 
8 416 GLU n 
8 417 LEU n 
8 418 GLU n 
8 419 GLN n 
8 420 PHE n 
8 421 ALA n 
8 422 LYS n 
8 423 LEU n 
8 424 LEU n 
8 425 LYS n 
8 426 GLN n 
8 427 LYS n 
8 428 ARG n 
8 429 ILE n 
8 430 THR n 
8 431 LEU n 
8 432 GLY n 
8 433 TYR n 
8 434 THR n 
8 435 GLN n 
8 436 ALA n 
8 437 ASP n 
8 438 VAL n 
8 439 GLY n 
8 440 LEU n 
8 441 THR n 
8 442 LEU n 
8 443 GLY n 
8 444 VAL n 
8 445 LEU n 
8 446 PHE n 
8 447 GLY n 
8 448 LYS n 
8 449 VAL n 
8 450 PHE n 
8 451 SER n 
8 452 GLN n 
8 453 THR n 
8 454 THR n 
8 455 ILE n 
8 456 CYS n 
8 457 ARG n 
8 458 PHE n 
8 459 GLU n 
8 460 ALA n 
8 461 LEU n 
8 462 GLN n 
8 463 LEU n 
8 464 SER n 
8 465 PHE n 
8 466 LYS n 
8 467 ASN n 
8 468 MET n 
8 469 CYS n 
8 470 LYS n 
8 471 LEU n 
8 472 ARG n 
8 473 PRO n 
8 474 LEU n 
8 475 LEU n 
8 476 GLN n 
8 477 LYS n 
8 478 TRP n 
8 479 VAL n 
8 480 GLU n 
8 481 GLU n 
8 482 ALA n 
8 483 ASP n 
8 484 ASN n 
8 485 ASN n 
8 486 GLU n 
8 487 ASN n 
8 488 LEU n 
8 489 GLN n 
8 490 GLU n 
8 491 ILE n 
8 492 CYS n 
8 493 LYS n 
8 494 ALA n 
8 495 GLU n 
8 496 THR n 
8 497 LEU n 
8 498 VAL n 
8 499 GLN n 
8 500 ALA n 
8 501 ARG n 
8 502 LYS n 
8 503 ARG n 
8 504 LYS n 
8 505 ARG n 
8 506 THR n 
8 507 SER n 
8 508 ILE n 
8 509 GLU n 
8 510 ASN n 
8 511 ARG n 
8 512 VAL n 
8 513 ARG n 
8 514 GLY n 
8 515 ASN n 
8 516 LEU n 
8 517 GLU n 
8 518 ASN n 
8 519 LEU n 
8 520 PHE n 
8 521 LEU n 
8 522 GLN n 
8 523 CYS n 
8 524 PRO n 
8 525 LYS n 
8 526 PRO n 
8 527 THR n 
8 528 LEU n 
8 529 GLN n 
8 530 GLN n 
8 531 ILE n 
8 532 SER n 
8 533 HIS n 
8 534 ILE n 
8 535 ALA n 
8 536 GLN n 
8 537 GLN n 
8 538 LEU n 
8 539 GLY n 
8 540 LEU n 
8 541 GLU n 
8 542 LYS n 
8 543 ASP n 
8 544 VAL n 
8 545 VAL n 
8 546 ARG n 
8 547 VAL n 
8 548 TRP n 
8 549 PHE n 
8 550 CYS n 
8 551 ASN n 
8 552 ARG n 
8 553 ARG n 
8 554 GLN n 
8 555 LYS n 
8 556 GLY n 
8 557 LYS n 
8 558 ARG n 
8 559 SER n 
8 560 SER n 
8 561 SER n 
8 562 ASP n 
8 563 TYR n 
8 564 ALA n 
8 565 GLN n 
8 566 ARG n 
8 567 GLU n 
8 568 ASP n 
8 569 PHE n 
8 570 GLU n 
8 571 ALA n 
8 572 ALA n 
8 573 GLY n 
8 574 SER n 
8 575 PRO n 
8 576 PHE n 
8 577 SER n 
8 578 GLY n 
8 579 GLY n 
8 580 PRO n 
8 581 VAL n 
8 582 SER n 
8 583 PHE n 
8 584 PRO n 
8 585 LEU n 
8 586 ALA n 
8 587 PRO n 
8 588 GLY n 
8 589 PRO n 
8 590 HIS n 
8 591 PHE n 
8 592 GLY n 
8 593 THR n 
8 594 PRO n 
8 595 GLY n 
8 596 TYR n 
8 597 GLY n 
8 598 SER n 
8 599 PRO n 
8 600 HIS n 
8 601 PHE n 
8 602 THR n 
8 603 ALA n 
8 604 LEU n 
8 605 TYR n 
8 606 SER n 
8 607 SER n 
8 608 VAL n 
8 609 PRO n 
8 610 PHE n 
8 611 PRO n 
8 612 GLU n 
8 613 GLY n 
8 614 GLU n 
8 615 ALA n 
8 616 PHE n 
8 617 PRO n 
8 618 PRO n 
8 619 VAL n 
8 620 SER n 
8 621 VAL n 
8 622 THR n 
8 623 THR n 
8 624 LEU n 
8 625 GLY n 
8 626 SER n 
8 627 PRO n 
8 628 MET n 
8 629 HIS n 
8 630 SER n 
8 631 ASN n 
9 1   MET n 
9 2   ASP n 
9 3   TRP n 
9 4   SER n 
9 5   HIS n 
9 6   PRO n 
9 7   GLN n 
9 8   PHE n 
9 9   GLU n 
9 10  LYS n 
9 11  SER n 
9 12  ALA n 
9 13  VAL n 
9 14  ASP n 
9 15  GLU n 
9 16  ASN n 
9 17  LEU n 
9 18  TYR n 
9 19  PHE n 
9 20  GLN n 
9 21  GLY n 
9 22  GLY n 
9 23  MET n 
9 24  SER n 
9 25  PRO n 
9 26  ASP n 
9 27  ARG n 
9 28  VAL n 
9 29  LYS n 
9 30  ARG n 
9 31  PRO n 
9 32  MET n 
9 33  ASN n 
9 34  ALA n 
9 35  PHE n 
9 36  MET n 
9 37  VAL n 
9 38  TRP n 
9 39  SER n 
9 40  ARG n 
9 41  GLY n 
9 42  GLN n 
9 43  ARG n 
9 44  ARG n 
9 45  LYS n 
9 46  MET n 
9 47  ALA n 
9 48  GLN n 
9 49  GLU n 
9 50  ASN n 
9 51  PRO n 
9 52  LYS n 
9 53  MET n 
9 54  HIS n 
9 55  ASN n 
9 56  SER n 
9 57  GLU n 
9 58  ILE n 
9 59  SER n 
9 60  LYS n 
9 61  ARG n 
9 62  LEU n 
9 63  GLY n 
9 64  ALA n 
9 65  GLU n 
9 66  TRP n 
9 67  LYS n 
9 68  LEU n 
9 69  LEU n 
9 70  SER n 
9 71  GLU n 
9 72  THR n 
9 73  GLU n 
9 74  LYS n 
9 75  ARG n 
9 76  PRO n 
9 77  PHE n 
9 78  ILE n 
9 79  ASP n 
9 80  GLU n 
9 81  ALA n 
9 82  LYS n 
9 83  ARG n 
9 84  LEU n 
9 85  ARG n 
9 86  ALA n 
9 87  LEU n 
9 88  HIS n 
9 89  MET n 
9 90  LYS n 
9 91  GLU n 
9 92  HIS n 
9 93  PRO n 
9 94  ASP n 
9 95  TYR n 
9 96  LYS n 
9 97  TYR n 
9 98  ARG n 
9 99  PRO n 
9 100 ARG n 
9 101 ARG n 
9 102 LYS n 
9 103 THR n 
9 104 LYS n 
9 105 THR n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1   139 Human     ? 
;HIST1H3A, H3FA, HIST1H3B, H3FL, HIST1H3C, H3FC, HIST1H3D, H3FB, HIST1H3E, H3FD, HIST1H3F, H3FI, HIST1H3G, H3FH, HIST1H3H, H3FK, HIST1H3I, H3FF, HIST1H3J, H3FJ
;
? ? ? ? ? ? 'Homo sapiens'      9606 ? ? ? ? ? ? ? ?                
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1   105 Human     ? 
;H4C1, H4/A, H4FA, HIST1H4A, H4C2, H4/I, H4FI, HIST1H4B, H4C3, H4/G, H4FG, HIST1H4C, H4C4, H4/B, H4FB, HIST1H4D, H4C5, H4/J, H4FJ, HIST1H4E, H4C6, H4/C, H4FC, HIST1H4F, H4C8, H4/H, H4FH, HIST1H4H, H4C9, H4/M, H4FM, HIST1H4I, H4C11, H4/E, H4FE, HIST1H4J, H4C12, H4/D, H4FD, HIST1H4K, H4C13, H4/K, H4FK, HIST1H4L, H4C14, H4/N, H4F2, H4FN, HIST2H4, HIST2H4A, H4C15, H4/O, H4FO, HIST2H4B, H4-16, HIST4H4
;
? ? ? ? ? ? 'Homo sapiens'      9606 ? ? ? ? ? ? ? ?                
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1   133 Human     ? 'HIST1H2AB, H2AFM, HIST1H2AE, H2AFA' ? ? ? ? ? ? 'Homo sapiens'      9606 ? ? 
? ? ? ? ? ?                
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1   128 Human     ? 'HIST1H2BJ, H2BFR' ? ? ? ? ? ? 'Homo sapiens'      9606 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample 'Biological sequence' 1   137 Human     ? 
;H3C1, H3FA, HIST1H3A, H3C2, H3FL, HIST1H3B, H3C3, H3FC HIST1H3C, H3C4, H3FB, HIST1H3D, H3C6, H3FD, HIST1H3E, H3C7, H3FI, HIST1H3F, H3C8, H3FH, HIST1H3G, H3C10, H3FK, HIST1H3H, H3C11, H3FF, HIST1H3I, H3C12, H3FJ, HIST1H3J
;
? ? ? ? ? ? 'Homo sapiens'      9606 ? ? ? ? ? ? ? ?                
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6 1 sample 'Biological sequence' 1   106 Human     ? 
;HIST1H4A, H4/A, H4FA, HIST1H4B, H4/I, H4FI, HIST1H4C, H4/G, H4FG, HIST1H4D, H4/B, H4FB, HIST1H4E, H4/J, H4FJ, HIST1H4F, H4/C, H4FC, HIST1H4H, H4/H, H4FH, HIST1H4I, H4/M, H4FM, HIST1H4J, H4/E, H4FE, HIST1H4K, H4/D, H4FD, HIST1H4L, H4/K, H4FK, HIST2H4A, H4/N, H4F2, H4FN, HIST2H4, HIST2H4B, H4/O, H4FO, HIST4H4
;
? ? ? ? ? ? 'Homo sapiens'      9606 ? ? ? ? ? ? ? ?                
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8 1 sample 'Biological sequence' 1   271 Jellyfish ? GFP ? ? ? ? ? ? 'Aequorea victoria' 6100 ? ? ? ? ? ? ? 'cabbage looper' 
'Trichoplusia ni'                           7111   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8 2 sample 'Biological sequence' 272 631 Human     ? 'POU5F1, OCT3, OCT4, OTF3' ? ? ? ? ? ? 'Homo sapiens'      9606 ? ? ? ? ? ? ? 
'cabbage looper' 'Trichoplusia ni'                           7111   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9 1 sample 'Biological sequence' 1   105 Human     ? SOX2 ? ? ? ? ? ? 'Homo sapiens'      9606 ? ? ? ? ? ? ? 'cabbage looper' 
'Trichoplusia ni'                           7111   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
_pdbx_entity_src_syn.entity_id              7 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       300 
_pdbx_entity_src_syn.organism_scientific    'synthetic construct' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       32630 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1  UNP H31_HUMAN   P68431 ? 1 
;MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
1  
2  UNP H4_HUMAN    P62805 ? 2 
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
1  
3  UNP H2A1B_HUMAN P04908 ? 3 
;MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
;
1  
4  UNP H2B1J_HUMAN P06899 ? 4 
;MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASR
LAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
;
1  
5  UNP H31_HUMAN   P68431 ? 5 
;MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
;
1  
6  UNP H4_HUMAN    P62805 ? 6 
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
1  
7  PDB 6YOV        6YOV   ? 7 ? 1  
8  UNP GFP_AEQVI   P42212 ? 8 
;MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQ
HDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNG
IKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
;
1  
9  UNP PO5F1_HUMAN Q01860 ? 8 
;MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQV
GVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITL
GYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENR
VRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHF
GTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN
;
1  
10 UNP SOX2_HUMAN  P48431 ? 9 
;SPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKT
KT
;
37 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  6YOV A 4   ? 139 ? P68431 1    ? 136 ? 1    136 
2  2  6YOV B 4   ? 105 ? P62805 1    ? 103 ? 2    103 
3  3  6YOV C 4   ? 133 ? P04908 1    ? 130 ? 1    130 
4  4  6YOV D 4   ? 128 ? P06899 1    ? 125 ? 1    125 
5  5  6YOV E 4   ? 137 ? P68431 1    ? 134 ? 1    134 
6  6  6YOV F 4   ? 106 ? P62805 1    ? 103 ? 1    103 
7  3  6YOV G 4   ? 133 ? P04908 1    ? 130 ? 1    130 
8  4  6YOV H 4   ? 128 ? P06899 1    ? 125 ? 1    125 
9  7  6YOV I 1   ? 300 ? 6YOV   -2   ? 297 ? -2   297 
10 7  6YOV J 1   ? 300 ? 6YOV   -148 ? 151 ? -148 151 
11 8  6YOV K 23  ? 261 ? P42212 1    ? 238 ? -248 -10 
12 9  6YOV K 272 ? 631 ? Q01860 1    ? 360 ? 1    360 
13 10 6YOV L 24  ? 105 ? P48431 37   ? 118 ? 37   118 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  6YOV GLY A 1   ? UNP P68431 ?   ?   'expression tag'        -2   1  
1  6YOV SER A 2   ? UNP P68431 ?   ?   'expression tag'        -1   2  
1  6YOV HIS A 3   ? UNP P68431 ?   ?   'expression tag'        0    3  
2  6YOV GLY B 1   ? UNP P62805 ?   ?   'expression tag'        -1   4  
2  6YOV SER B 2   ? UNP P62805 ?   ?   'expression tag'        0    5  
2  6YOV HIS B 3   ? UNP P62805 ?   ?   'expression tag'        1    6  
2  6YOV ?   B ?   ? UNP P62805 LYS 21  deletion                ?    7  
3  6YOV GLY C 1   ? UNP P04908 ?   ?   'expression tag'        -2   8  
3  6YOV SER C 2   ? UNP P04908 ?   ?   'expression tag'        -1   9  
3  6YOV HIS C 3   ? UNP P04908 ?   ?   'expression tag'        0    10 
4  6YOV GLY D 1   ? UNP P06899 ?   ?   'expression tag'        -2   11 
4  6YOV SER D 2   ? UNP P06899 ?   ?   'expression tag'        -1   12 
4  6YOV HIS D 3   ? UNP P06899 ?   ?   'expression tag'        0    13 
5  6YOV GLY E 1   ? UNP P68431 ?   ?   'expression tag'        -2   14 
5  6YOV SER E 2   ? UNP P68431 ?   ?   'expression tag'        -1   15 
5  6YOV HIS E 3   ? UNP P68431 ?   ?   'expression tag'        0    16 
6  6YOV GLY F 1   ? UNP P62805 ?   ?   'expression tag'        -2   17 
6  6YOV SER F 2   ? UNP P62805 ?   ?   'expression tag'        -1   18 
6  6YOV HIS F 3   ? UNP P62805 ?   ?   'expression tag'        0    19 
7  6YOV GLY G 1   ? UNP P04908 ?   ?   'expression tag'        -2   20 
7  6YOV SER G 2   ? UNP P04908 ?   ?   'expression tag'        -1   21 
7  6YOV HIS G 3   ? UNP P04908 ?   ?   'expression tag'        0    22 
8  6YOV GLY H 1   ? UNP P06899 ?   ?   'expression tag'        -2   23 
8  6YOV SER H 2   ? UNP P06899 ?   ?   'expression tag'        -1   24 
8  6YOV HIS H 3   ? UNP P06899 ?   ?   'expression tag'        0    25 
11 6YOV MET K 1   ? UNP P42212 ?   ?   'initiating methionine' -270 26 
11 6YOV ASP K 2   ? UNP P42212 ?   ?   'expression tag'        -269 27 
11 6YOV TRP K 3   ? UNP P42212 ?   ?   'expression tag'        -268 28 
11 6YOV SER K 4   ? UNP P42212 ?   ?   'expression tag'        -267 29 
11 6YOV HIS K 5   ? UNP P42212 ?   ?   'expression tag'        -266 30 
11 6YOV PRO K 6   ? UNP P42212 ?   ?   'expression tag'        -265 31 
11 6YOV GLN K 7   ? UNP P42212 ?   ?   'expression tag'        -264 32 
11 6YOV PHE K 8   ? UNP P42212 ?   ?   'expression tag'        -263 33 
11 6YOV GLU K 9   ? UNP P42212 ?   ?   'expression tag'        -262 34 
11 6YOV LYS K 10  ? UNP P42212 ?   ?   'expression tag'        -261 35 
11 6YOV SER K 11  ? UNP P42212 ?   ?   'expression tag'        -260 36 
11 6YOV ALA K 12  ? UNP P42212 ?   ?   'expression tag'        -259 37 
11 6YOV VAL K 13  ? UNP P42212 ?   ?   'expression tag'        -258 38 
11 6YOV ASP K 14  ? UNP P42212 ?   ?   'expression tag'        -257 39 
11 6YOV GLU K 15  ? UNP P42212 ?   ?   'expression tag'        -256 40 
11 6YOV ASN K 16  ? UNP P42212 ?   ?   'expression tag'        -255 41 
11 6YOV LEU K 17  ? UNP P42212 ?   ?   'expression tag'        -254 42 
11 6YOV TYR K 18  ? UNP P42212 ?   ?   'expression tag'        -253 43 
11 6YOV PHE K 19  ? UNP P42212 ?   ?   'expression tag'        -252 44 
11 6YOV GLN K 20  ? UNP P42212 ?   ?   'expression tag'        -251 45 
11 6YOV GLY K 21  ? UNP P42212 ?   ?   'expression tag'        -250 46 
11 6YOV GLY K 22  ? UNP P42212 ?   ?   'expression tag'        -249 47 
11 6YOV VAL K 24  ? UNP P42212 ?   ?   insertion               -247 48 
11 6YOV LEU K 87  ? UNP P42212 PHE 64  conflict                -184 49 
11 6YOV THR K 88  ? UNP P42212 SER 65  conflict                -183 50 
11 6YOV LYS K 229 ? UNP P42212 ALA 206 conflict                -42  51 
11 6YOV LEU K 254 ? UNP P42212 HIS 231 conflict                -17  52 
11 6YOV GLU K 262 ? UNP P42212 ?   ?   linker                  -9   53 
11 6YOV ALA K 263 ? UNP P42212 ?   ?   linker                  -8   54 
11 6YOV ALA K 264 ? UNP P42212 ?   ?   linker                  -7   55 
11 6YOV ALA K 265 ? UNP P42212 ?   ?   linker                  -6   56 
11 6YOV LYS K 266 ? UNP P42212 ?   ?   linker                  -5   57 
11 6YOV GLU K 267 ? UNP P42212 ?   ?   linker                  -4   58 
11 6YOV ALA K 268 ? UNP P42212 ?   ?   linker                  -3   59 
11 6YOV ALA K 269 ? UNP P42212 ?   ?   linker                  -2   60 
11 6YOV ALA K 270 ? UNP P42212 ?   ?   linker                  -1   61 
11 6YOV LYS K 271 ? UNP P42212 ?   ?   linker                  0    62 
13 6YOV MET L 1   ? UNP P48431 ?   ?   'initiating methionine' 14   63 
13 6YOV ASP L 2   ? UNP P48431 ?   ?   'expression tag'        15   64 
13 6YOV TRP L 3   ? UNP P48431 ?   ?   'expression tag'        16   65 
13 6YOV SER L 4   ? UNP P48431 ?   ?   'expression tag'        17   66 
13 6YOV HIS L 5   ? UNP P48431 ?   ?   'expression tag'        18   67 
13 6YOV PRO L 6   ? UNP P48431 ?   ?   'expression tag'        19   68 
13 6YOV GLN L 7   ? UNP P48431 ?   ?   'expression tag'        20   69 
13 6YOV PHE L 8   ? UNP P48431 ?   ?   'expression tag'        21   70 
13 6YOV GLU L 9   ? UNP P48431 ?   ?   'expression tag'        22   71 
13 6YOV LYS L 10  ? UNP P48431 ?   ?   'expression tag'        23   72 
13 6YOV SER L 11  ? UNP P48431 ?   ?   'expression tag'        24   73 
13 6YOV ALA L 12  ? UNP P48431 ?   ?   'expression tag'        25   74 
13 6YOV VAL L 13  ? UNP P48431 ?   ?   'expression tag'        26   75 
13 6YOV ASP L 14  ? UNP P48431 ?   ?   'expression tag'        27   76 
13 6YOV GLU L 15  ? UNP P48431 ?   ?   'expression tag'        28   77 
13 6YOV ASN L 16  ? UNP P48431 ?   ?   'expression tag'        29   78 
13 6YOV LEU L 17  ? UNP P48431 ?   ?   'expression tag'        30   79 
13 6YOV TYR L 18  ? UNP P48431 ?   ?   'expression tag'        31   80 
13 6YOV PHE L 19  ? UNP P48431 ?   ?   'expression tag'        32   81 
13 6YOV GLN L 20  ? UNP P48431 ?   ?   'expression tag'        33   82 
13 6YOV GLY L 21  ? UNP P48431 ?   ?   'expression tag'        34   83 
13 6YOV GLY L 22  ? UNP P48431 ?   ?   'expression tag'        35   84 
13 6YOV MET L 23  ? UNP P48431 ?   ?   'expression tag'        36   85 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
PTD non-polymer         . PENTANEDIAL                          ? 'C5 H8 O2'        100.116 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6YOV 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_struct.entry_id                     6YOV 
_struct.title                        'OCT4-SOX2-bound nucleosome - SHL+6' 
_struct.pdbx_descriptor              'Histone H3.1, Histone H4, Histone H2A type 1-B/E, Histone H2B type 1-J/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6YOV 
_struct_keywords.text            'nucleosome, OCT4, SOX2, transcription factor, TRANSCRIPTION' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 6  ? 
G N N 3  ? 
H N N 4  ? 
I N N 7  ? 
J N N 7  ? 
K N N 8  ? 
L N N 9  ? 
M N N 10 ? 
N N N 10 ? 
O N N 10 ? 
P N N 10 ? 
Q N N 10 ? 
R N N 10 ? 
S N N 10 ? 
T N N 10 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 48  ? SER A 61  ? GLY A 45  SER A 58  1 ? 14 
HELX_P HELX_P2  AA2 ARG A 67  ? GLN A 80  ? ARG A 64  GLN A 77  1 ? 14 
HELX_P HELX_P3  AA3 GLN A 89  ? ALA A 118 ? GLN A 86  ALA A 115 1 ? 30 
HELX_P HELX_P4  AA4 MET A 124 ? ARG A 135 ? MET A 121 ARG A 132 1 ? 12 
HELX_P HELX_P5  AA5 ASP B 27  ? ILE B 32  ? ASP B 25  ILE B 30  5 ? 6  
HELX_P HELX_P6  AA6 THR B 33  ? GLY B 44  ? THR B 31  GLY B 42  1 ? 12 
HELX_P HELX_P7  AA7 LEU B 52  ? ALA B 79  ? LEU B 50  ALA B 77  1 ? 28 
HELX_P HELX_P8  AA8 THR B 85  ? ARG B 95  ? THR B 83  ARG B 93  1 ? 11 
HELX_P HELX_P9  AA9 THR C 20  ? ALA C 25  ? THR C 17  ALA C 22  1 ? 6  
HELX_P HELX_P10 AB1 PRO C 30  ? LYS C 40  ? PRO C 27  LYS C 37  1 ? 11 
HELX_P HELX_P11 AB2 GLY C 50  ? ASN C 77  ? GLY C 47  ASN C 74  1 ? 28 
HELX_P HELX_P12 AB3 ILE C 83  ? ASP C 94  ? ILE C 80  ASP C 91  1 ? 12 
HELX_P HELX_P13 AB4 ASP C 94  ? LEU C 101 ? ASP C 91  LEU C 98  1 ? 8  
HELX_P HELX_P14 AB5 GLN C 116 ? LEU C 120 ? GLN C 113 LEU C 117 5 ? 5  
HELX_P HELX_P15 AB6 TYR D 41  ? GLN D 51  ? TYR D 38  GLN D 48  1 ? 11 
HELX_P HELX_P16 AB7 SER D 59  ? ASN D 88  ? SER D 56  ASN D 85  1 ? 30 
HELX_P HELX_P17 AB8 THR D 94  ? LEU D 106 ? THR D 91  LEU D 103 1 ? 13 
HELX_P HELX_P18 AB9 PRO D 107 ? THR D 126 ? PRO D 104 THR D 123 1 ? 20 
HELX_P HELX_P19 AC1 GLY E 48  ? GLN E 59  ? GLY E 45  GLN E 56  1 ? 12 
HELX_P HELX_P20 AC2 ARG E 67  ? GLN E 80  ? ARG E 64  GLN E 77  1 ? 14 
HELX_P HELX_P21 AC3 GLN E 89  ? ALA E 118 ? GLN E 86  ALA E 115 1 ? 30 
HELX_P HELX_P22 AC4 MET E 124 ? GLY E 136 ? MET E 121 GLY E 133 1 ? 13 
HELX_P HELX_P23 AC5 THR F 34  ? GLY F 45  ? THR F 31  GLY F 42  1 ? 12 
HELX_P HELX_P24 AC6 LEU F 53  ? ALA F 80  ? LEU F 50  ALA F 77  1 ? 28 
HELX_P HELX_P25 AC7 THR F 86  ? ARG F 96  ? THR F 83  ARG F 93  1 ? 11 
HELX_P HELX_P26 AC8 THR G 20  ? GLY G 26  ? THR G 17  GLY G 23  1 ? 7  
HELX_P HELX_P27 AC9 PRO G 30  ? LEU G 38  ? PRO G 27  LEU G 35  1 ? 9  
HELX_P HELX_P28 AD1 ALA G 49  ? ASN G 77  ? ALA G 46  ASN G 74  1 ? 29 
HELX_P HELX_P29 AD2 ILE G 83  ? ASP G 94  ? ILE G 80  ASP G 91  1 ? 12 
HELX_P HELX_P30 AD3 GLU G 96  ? LEU G 101 ? GLU G 93  LEU G 98  1 ? 6  
HELX_P HELX_P31 AD4 GLN G 116 ? LEU G 120 ? GLN G 113 LEU G 117 5 ? 5  
HELX_P HELX_P32 AD5 TYR H 41  ? GLN H 51  ? TYR H 38  GLN H 48  1 ? 11 
HELX_P HELX_P33 AD6 SER H 59  ? ASN H 88  ? SER H 56  ASN H 85  1 ? 30 
HELX_P HELX_P34 AD7 THR H 94  ? LEU H 106 ? THR H 91  LEU H 103 1 ? 13 
HELX_P HELX_P35 AD8 PRO H 107 ? SER H 127 ? PRO H 104 SER H 124 1 ? 21 
HELX_P HELX_P36 AD9 LEU K 413 ? LEU K 431 ? LEU K 142 LEU K 160 1 ? 19 
HELX_P HELX_P37 AE1 THR K 434 ? GLY K 447 ? THR K 163 GLY K 176 1 ? 14 
HELX_P HELX_P38 AE2 SER K 451 ? ALA K 460 ? SER K 180 ALA K 189 1 ? 10 
HELX_P HELX_P39 AE3 SER K 464 ? VAL K 479 ? SER K 193 VAL K 208 1 ? 16 
HELX_P HELX_P40 AE4 ASN L 33  ? GLN L 48  ? ASN L 46  GLN L 61  1 ? 16 
HELX_P HELX_P41 AE5 HIS L 54  ? LEU L 68  ? HIS L 67  LEU L 81  1 ? 15 
HELX_P HELX_P42 AE6 SER L 70  ? HIS L 92  ? SER L 83  HIS L 105 1 ? 23 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1   covale none ? A LYS 83  NZ ? ? ? 1_555 O PTD .   C5 ? ? A LYS 80  B PTD 201 1_555 ? ? ? ? ? ? ?            1.263 ? 
covale2   covale none ? A LYS 119 NZ ? ? ? 1_555 M PTD .   C1 ? ? A LYS 116 A PTD 201 1_555 ? ? ? ? ? ? ?            1.268 ? 
covale3   covale none ? A LYS 126 NZ ? ? ? 1_555 N PTD .   C1 ? ? A LYS 123 A PTD 202 1_555 ? ? ? ? ? ? ?            1.270 ? 
covale4   covale none ? B LYS 82  NZ ? ? ? 1_555 O PTD .   C1 ? ? B LYS 80  B PTD 201 1_555 ? ? ? ? ? ? ?            1.261 ? 
covale5   covale none ? C LYS 40  NZ ? ? ? 1_555 P PTD .   C1 ? ? C LYS 37  C PTD 301 1_555 ? ? ? ? ? ? ?            1.269 ? 
covale6   covale none ? D LYS 47  NZ ? ? ? 1_555 Q PTD .   C5 ? ? D LYS 44  D PTD 201 1_555 ? ? ? ? ? ? ?            1.262 ? 
covale7   covale none ? D LYS 50  NZ ? ? ? 1_555 Q PTD .   C1 ? ? D LYS 47  D PTD 201 1_555 ? ? ? ? ? ? ?            1.271 ? 
covale8   covale none ? D LYS 89  NZ ? ? ? 1_555 R PTD .   C5 ? ? D LYS 86  D PTD 202 1_555 ? ? ? ? ? ? ?            1.269 ? 
covale9   covale none ? E LYS 83  NZ ? ? ? 1_555 S PTD .   C1 ? ? E LYS 80  F PTD 201 1_555 ? ? ? ? ? ? ?            1.274 ? 
covale10  covale none ? E LYS 119 NZ ? ? ? 1_555 N PTD .   C5 ? ? E LYS 116 A PTD 202 1_555 ? ? ? ? ? ? ?            1.270 ? 
covale11  covale none ? E LYS 126 NZ ? ? ? 1_555 M PTD .   C5 ? ? E LYS 123 A PTD 201 1_555 ? ? ? ? ? ? ?            1.268 ? 
covale12  covale none ? F LYS 83  NZ ? ? ? 1_555 S PTD .   C5 ? ? F LYS 80  F PTD 201 1_555 ? ? ? ? ? ? ?            1.259 ? 
covale13  covale none ? G LYS 40  NZ ? ? ? 1_555 R PTD .   C1 ? ? G LYS 37  D PTD 202 1_555 ? ? ? ? ? ? ?            1.270 ? 
covale14  covale none ? H LYS 47  NZ ? ? ? 1_555 T PTD .   C5 ? ? H LYS 44  H PTD 201 1_555 ? ? ? ? ? ? ?            1.265 ? 
covale15  covale none ? H LYS 50  NZ ? ? ? 1_555 T PTD .   C1 ? ? H LYS 47  H PTD 201 1_555 ? ? ? ? ? ? ?            1.262 ? 
covale16  covale none ? H LYS 89  NZ ? ? ? 1_555 P PTD .   C5 ? ? H LYS 86  C PTD 301 1_555 ? ? ? ? ? ? ?            1.269 ? 
hydrog1   hydrog ?    ? I DC  19  N3 ? ? ? 1_555 J DG  282 N1 ? ? I DC  16  J DG  133 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2   hydrog ?    ? I DC  19  N4 ? ? ? 1_555 J DG  282 O6 ? ? I DC  16  J DG  133 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3   hydrog ?    ? I DC  19  O2 ? ? ? 1_555 J DG  282 N2 ? ? I DC  16  J DG  133 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4   hydrog ?    ? I DT  20  N3 ? ? ? 1_555 J DA  281 N1 ? ? I DT  17  J DA  132 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5   hydrog ?    ? I DT  20  O4 ? ? ? 1_555 J DA  281 N6 ? ? I DT  17  J DA  132 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6   hydrog ?    ? I DG  21  N1 ? ? ? 1_555 J DC  280 N3 ? ? I DG  18  J DC  131 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7   hydrog ?    ? I DG  21  N2 ? ? ? 1_555 J DC  280 O2 ? ? I DG  18  J DC  131 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8   hydrog ?    ? I DG  21  O6 ? ? ? 1_555 J DC  280 N4 ? ? I DG  18  J DC  131 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9   hydrog ?    ? I DC  22  N3 ? ? ? 1_555 J DG  279 N1 ? ? I DC  19  J DG  130 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10  hydrog ?    ? I DC  22  N4 ? ? ? 1_555 J DG  279 O6 ? ? I DC  19  J DG  130 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11  hydrog ?    ? I DC  22  O2 ? ? ? 1_555 J DG  279 N2 ? ? I DC  19  J DG  130 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12  hydrog ?    ? I DA  23  N1 ? ? ? 1_555 J DT  278 N3 ? ? I DA  20  J DT  129 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13  hydrog ?    ? I DA  23  N6 ? ? ? 1_555 J DT  278 O4 ? ? I DA  20  J DT  129 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14  hydrog ?    ? I DG  24  N1 ? ? ? 1_555 J DC  277 N3 ? ? I DG  21  J DC  128 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15  hydrog ?    ? I DG  24  N2 ? ? ? 1_555 J DC  277 O2 ? ? I DG  21  J DC  128 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16  hydrog ?    ? I DG  24  O6 ? ? ? 1_555 J DC  277 N4 ? ? I DG  21  J DC  128 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17  hydrog ?    ? I DG  25  N1 ? ? ? 1_555 J DC  276 N3 ? ? I DG  22  J DC  127 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18  hydrog ?    ? I DG  25  N2 ? ? ? 1_555 J DC  276 O2 ? ? I DG  22  J DC  127 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19  hydrog ?    ? I DG  25  O6 ? ? ? 1_555 J DC  276 N4 ? ? I DG  22  J DC  127 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20  hydrog ?    ? I DC  26  N3 ? ? ? 1_555 J DG  275 N1 ? ? I DC  23  J DG  126 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21  hydrog ?    ? I DC  26  N4 ? ? ? 1_555 J DG  275 O6 ? ? I DC  23  J DG  126 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22  hydrog ?    ? I DC  26  O2 ? ? ? 1_555 J DG  275 N2 ? ? I DC  23  J DG  126 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23  hydrog ?    ? I DC  27  N3 ? ? ? 1_555 J DG  274 N1 ? ? I DC  24  J DG  125 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24  hydrog ?    ? I DC  27  N4 ? ? ? 1_555 J DG  274 O6 ? ? I DC  24  J DG  125 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25  hydrog ?    ? I DC  27  O2 ? ? ? 1_555 J DG  274 N2 ? ? I DC  24  J DG  125 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26  hydrog ?    ? I DG  28  N1 ? ? ? 1_555 J DC  273 N3 ? ? I DG  25  J DC  124 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27  hydrog ?    ? I DG  28  N2 ? ? ? 1_555 J DC  273 O2 ? ? I DG  25  J DC  124 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28  hydrog ?    ? I DG  28  O6 ? ? ? 1_555 J DC  273 N4 ? ? I DG  25  J DC  124 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29  hydrog ?    ? I DC  29  N3 ? ? ? 1_555 J DG  272 N1 ? ? I DC  26  J DG  123 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30  hydrog ?    ? I DC  29  N4 ? ? ? 1_555 J DG  272 O6 ? ? I DC  26  J DG  123 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31  hydrog ?    ? I DC  29  O2 ? ? ? 1_555 J DG  272 N2 ? ? I DC  26  J DG  123 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32  hydrog ?    ? I DT  30  N3 ? ? ? 1_555 J DA  271 N1 ? ? I DT  27  J DA  122 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33  hydrog ?    ? I DT  30  O4 ? ? ? 1_555 J DA  271 N6 ? ? I DT  27  J DA  122 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34  hydrog ?    ? I DC  31  N3 ? ? ? 1_555 J DG  270 N1 ? ? I DC  28  J DG  121 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35  hydrog ?    ? I DC  31  N4 ? ? ? 1_555 J DG  270 O6 ? ? I DC  28  J DG  121 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36  hydrog ?    ? I DC  31  O2 ? ? ? 1_555 J DG  270 N2 ? ? I DC  28  J DG  121 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37  hydrog ?    ? I DA  32  N1 ? ? ? 1_555 J DT  269 N3 ? ? I DA  29  J DT  120 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38  hydrog ?    ? I DA  32  N6 ? ? ? 1_555 J DT  269 O4 ? ? I DA  29  J DT  120 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39  hydrog ?    ? I DA  33  N1 ? ? ? 1_555 J DT  268 N3 ? ? I DA  30  J DT  119 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40  hydrog ?    ? I DA  33  N6 ? ? ? 1_555 J DT  268 O4 ? ? I DA  30  J DT  119 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41  hydrog ?    ? I DT  34  N3 ? ? ? 1_555 J DA  267 N1 ? ? I DT  31  J DA  118 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42  hydrog ?    ? I DT  34  O4 ? ? ? 1_555 J DA  267 N6 ? ? I DT  31  J DA  118 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43  hydrog ?    ? I DT  35  N3 ? ? ? 1_555 J DA  266 N1 ? ? I DT  32  J DA  117 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44  hydrog ?    ? I DT  35  O4 ? ? ? 1_555 J DA  266 N6 ? ? I DT  32  J DA  117 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45  hydrog ?    ? I DG  36  N1 ? ? ? 1_555 J DC  265 N3 ? ? I DG  33  J DC  116 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46  hydrog ?    ? I DG  36  N2 ? ? ? 1_555 J DC  265 O2 ? ? I DG  33  J DC  116 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47  hydrog ?    ? I DG  36  O6 ? ? ? 1_555 J DC  265 N4 ? ? I DG  33  J DC  116 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48  hydrog ?    ? I DG  37  N1 ? ? ? 1_555 J DC  264 N3 ? ? I DG  34  J DC  115 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49  hydrog ?    ? I DG  37  N2 ? ? ? 1_555 J DC  264 O2 ? ? I DG  34  J DC  115 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50  hydrog ?    ? I DG  37  O6 ? ? ? 1_555 J DC  264 N4 ? ? I DG  34  J DC  115 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51  hydrog ?    ? I DT  38  N3 ? ? ? 1_555 J DA  263 N1 ? ? I DT  35  J DA  114 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52  hydrog ?    ? I DT  38  O4 ? ? ? 1_555 J DA  263 N6 ? ? I DT  35  J DA  114 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53  hydrog ?    ? I DC  39  N3 ? ? ? 1_555 J DG  262 N1 ? ? I DC  36  J DG  113 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54  hydrog ?    ? I DC  39  N4 ? ? ? 1_555 J DG  262 O6 ? ? I DC  36  J DG  113 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55  hydrog ?    ? I DC  39  O2 ? ? ? 1_555 J DG  262 N2 ? ? I DC  36  J DG  113 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56  hydrog ?    ? I DG  40  N1 ? ? ? 1_555 J DC  261 N3 ? ? I DG  37  J DC  112 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57  hydrog ?    ? I DG  40  N2 ? ? ? 1_555 J DC  261 O2 ? ? I DG  37  J DC  112 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58  hydrog ?    ? I DG  40  O6 ? ? ? 1_555 J DC  261 N4 ? ? I DG  37  J DC  112 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59  hydrog ?    ? I DT  41  N3 ? ? ? 1_555 J DA  260 N1 ? ? I DT  38  J DA  111 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60  hydrog ?    ? I DT  41  O4 ? ? ? 1_555 J DA  260 N6 ? ? I DT  38  J DA  111 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61  hydrog ?    ? I DA  42  N1 ? ? ? 1_555 J DT  259 N3 ? ? I DA  39  J DT  110 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62  hydrog ?    ? I DA  42  N6 ? ? ? 1_555 J DT  259 O4 ? ? I DA  39  J DT  110 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63  hydrog ?    ? I DG  43  N1 ? ? ? 1_555 J DC  258 N3 ? ? I DG  40  J DC  109 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64  hydrog ?    ? I DG  43  N2 ? ? ? 1_555 J DC  258 O2 ? ? I DG  40  J DC  109 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65  hydrog ?    ? I DG  43  O6 ? ? ? 1_555 J DC  258 N4 ? ? I DG  40  J DC  109 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog66  hydrog ?    ? I DA  44  N1 ? ? ? 1_555 J DT  257 N3 ? ? I DA  41  J DT  108 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog67  hydrog ?    ? I DA  44  N6 ? ? ? 1_555 J DT  257 O4 ? ? I DA  41  J DT  108 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog68  hydrog ?    ? I DC  45  N3 ? ? ? 1_555 J DG  256 N1 ? ? I DC  42  J DG  107 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog69  hydrog ?    ? I DC  45  N4 ? ? ? 1_555 J DG  256 O6 ? ? I DC  42  J DG  107 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog70  hydrog ?    ? I DC  45  O2 ? ? ? 1_555 J DG  256 N2 ? ? I DC  42  J DG  107 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog71  hydrog ?    ? I DA  46  N1 ? ? ? 1_555 J DT  255 N3 ? ? I DA  43  J DT  106 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog72  hydrog ?    ? I DA  46  N6 ? ? ? 1_555 J DT  255 O4 ? ? I DA  43  J DT  106 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog73  hydrog ?    ? I DG  47  N1 ? ? ? 1_555 J DC  254 N3 ? ? I DG  44  J DC  105 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog74  hydrog ?    ? I DG  47  N2 ? ? ? 1_555 J DC  254 O2 ? ? I DG  44  J DC  105 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog75  hydrog ?    ? I DG  47  O6 ? ? ? 1_555 J DC  254 N4 ? ? I DG  44  J DC  105 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog76  hydrog ?    ? I DC  48  N3 ? ? ? 1_555 J DG  253 N1 ? ? I DC  45  J DG  104 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog77  hydrog ?    ? I DC  48  N4 ? ? ? 1_555 J DG  253 O6 ? ? I DC  45  J DG  104 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog78  hydrog ?    ? I DC  48  O2 ? ? ? 1_555 J DG  253 N2 ? ? I DC  45  J DG  104 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog79  hydrog ?    ? I DT  49  N3 ? ? ? 1_555 J DA  252 N1 ? ? I DT  46  J DA  103 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog80  hydrog ?    ? I DT  49  O4 ? ? ? 1_555 J DA  252 N6 ? ? I DT  46  J DA  103 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog81  hydrog ?    ? I DC  50  N3 ? ? ? 1_555 J DG  251 N1 ? ? I DC  47  J DG  102 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog82  hydrog ?    ? I DC  50  N4 ? ? ? 1_555 J DG  251 O6 ? ? I DC  47  J DG  102 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog83  hydrog ?    ? I DC  50  O2 ? ? ? 1_555 J DG  251 N2 ? ? I DC  47  J DG  102 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog84  hydrog ?    ? I DT  51  N3 ? ? ? 1_555 J DA  250 N1 ? ? I DT  48  J DA  101 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog85  hydrog ?    ? I DT  51  O4 ? ? ? 1_555 J DA  250 N6 ? ? I DT  48  J DA  101 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog86  hydrog ?    ? I DA  52  N1 ? ? ? 1_555 J DT  249 N3 ? ? I DA  49  J DT  100 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog87  hydrog ?    ? I DA  52  N6 ? ? ? 1_555 J DT  249 O4 ? ? I DA  49  J DT  100 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog88  hydrog ?    ? I DG  53  N1 ? ? ? 1_555 J DC  248 N3 ? ? I DG  50  J DC  99  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog89  hydrog ?    ? I DG  53  N2 ? ? ? 1_555 J DC  248 O2 ? ? I DG  50  J DC  99  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog90  hydrog ?    ? I DG  53  O6 ? ? ? 1_555 J DC  248 N4 ? ? I DG  50  J DC  99  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog91  hydrog ?    ? I DC  54  N3 ? ? ? 1_555 J DG  247 N1 ? ? I DC  51  J DG  98  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog92  hydrog ?    ? I DC  54  N4 ? ? ? 1_555 J DG  247 O6 ? ? I DC  51  J DG  98  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog93  hydrog ?    ? I DC  54  O2 ? ? ? 1_555 J DG  247 N2 ? ? I DC  51  J DG  98  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog94  hydrog ?    ? I DA  55  N1 ? ? ? 1_555 J DT  246 N3 ? ? I DA  52  J DT  97  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog95  hydrog ?    ? I DA  55  N6 ? ? ? 1_555 J DT  246 O4 ? ? I DA  52  J DT  97  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog96  hydrog ?    ? I DC  56  N3 ? ? ? 1_555 J DG  245 N1 ? ? I DC  53  J DG  96  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog97  hydrog ?    ? I DC  56  N4 ? ? ? 1_555 J DG  245 O6 ? ? I DC  53  J DG  96  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog98  hydrog ?    ? I DC  56  O2 ? ? ? 1_555 J DG  245 N2 ? ? I DC  53  J DG  96  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog99  hydrog ?    ? I DC  57  N3 ? ? ? 1_555 J DG  244 N1 ? ? I DC  54  J DG  95  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog100 hydrog ?    ? I DC  57  N4 ? ? ? 1_555 J DG  244 O6 ? ? I DC  54  J DG  95  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog101 hydrog ?    ? I DC  57  O2 ? ? ? 1_555 J DG  244 N2 ? ? I DC  54  J DG  95  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog102 hydrog ?    ? I DG  58  N1 ? ? ? 1_555 J DC  243 N3 ? ? I DG  55  J DC  94  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog103 hydrog ?    ? I DG  58  N2 ? ? ? 1_555 J DC  243 O2 ? ? I DG  55  J DC  94  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog104 hydrog ?    ? I DG  58  O6 ? ? ? 1_555 J DC  243 N4 ? ? I DG  55  J DC  94  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog105 hydrog ?    ? I DC  59  N3 ? ? ? 1_555 J DG  242 N1 ? ? I DC  56  J DG  93  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog106 hydrog ?    ? I DC  59  N4 ? ? ? 1_555 J DG  242 O6 ? ? I DC  56  J DG  93  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog107 hydrog ?    ? I DC  59  O2 ? ? ? 1_555 J DG  242 N2 ? ? I DC  56  J DG  93  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog108 hydrog ?    ? I DT  60  N3 ? ? ? 1_555 J DA  241 N1 ? ? I DT  57  J DA  92  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog109 hydrog ?    ? I DT  60  O4 ? ? ? 1_555 J DA  241 N6 ? ? I DT  57  J DA  92  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog110 hydrog ?    ? I DT  61  N3 ? ? ? 1_555 J DA  240 N1 ? ? I DT  58  J DA  91  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog111 hydrog ?    ? I DT  61  O4 ? ? ? 1_555 J DA  240 N6 ? ? I DT  58  J DA  91  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog112 hydrog ?    ? I DA  62  N1 ? ? ? 1_555 J DT  239 N3 ? ? I DA  59  J DT  90  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog113 hydrog ?    ? I DA  62  N6 ? ? ? 1_555 J DT  239 O4 ? ? I DA  59  J DT  90  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog114 hydrog ?    ? I DA  63  N1 ? ? ? 1_555 J DT  238 N3 ? ? I DA  60  J DT  89  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog115 hydrog ?    ? I DA  63  N6 ? ? ? 1_555 J DT  238 O4 ? ? I DA  60  J DT  89  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog116 hydrog ?    ? I DA  64  N1 ? ? ? 1_555 J DT  237 N3 ? ? I DA  61  J DT  88  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog117 hydrog ?    ? I DA  64  N6 ? ? ? 1_555 J DT  237 O4 ? ? I DA  61  J DT  88  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog118 hydrog ?    ? I DC  65  N3 ? ? ? 1_555 J DG  236 N1 ? ? I DC  62  J DG  87  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog119 hydrog ?    ? I DC  65  N4 ? ? ? 1_555 J DG  236 O6 ? ? I DC  62  J DG  87  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog120 hydrog ?    ? I DC  65  O2 ? ? ? 1_555 J DG  236 N2 ? ? I DC  62  J DG  87  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog121 hydrog ?    ? I DG  66  N1 ? ? ? 1_555 J DC  235 N3 ? ? I DG  63  J DC  86  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog122 hydrog ?    ? I DG  66  N2 ? ? ? 1_555 J DC  235 O2 ? ? I DG  63  J DC  86  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog123 hydrog ?    ? I DG  66  O6 ? ? ? 1_555 J DC  235 N4 ? ? I DG  63  J DC  86  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog124 hydrog ?    ? I DC  67  N3 ? ? ? 1_555 J DG  234 N1 ? ? I DC  64  J DG  85  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog125 hydrog ?    ? I DC  67  N4 ? ? ? 1_555 J DG  234 O6 ? ? I DC  64  J DG  85  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog126 hydrog ?    ? I DC  67  O2 ? ? ? 1_555 J DG  234 N2 ? ? I DC  64  J DG  85  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog127 hydrog ?    ? I DA  68  N1 ? ? ? 1_555 J DT  233 N3 ? ? I DA  65  J DT  84  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog128 hydrog ?    ? I DA  68  N6 ? ? ? 1_555 J DT  233 O4 ? ? I DA  65  J DT  84  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog129 hydrog ?    ? I DC  69  N3 ? ? ? 1_555 J DG  232 N1 ? ? I DC  66  J DG  83  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog130 hydrog ?    ? I DC  69  N4 ? ? ? 1_555 J DG  232 O6 ? ? I DC  66  J DG  83  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog131 hydrog ?    ? I DC  69  O2 ? ? ? 1_555 J DG  232 N2 ? ? I DC  66  J DG  83  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog132 hydrog ?    ? I DG  70  N1 ? ? ? 1_555 J DC  231 N3 ? ? I DG  67  J DC  82  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog133 hydrog ?    ? I DG  70  N2 ? ? ? 1_555 J DC  231 O2 ? ? I DG  67  J DC  82  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog134 hydrog ?    ? I DG  70  O6 ? ? ? 1_555 J DC  231 N4 ? ? I DG  67  J DC  82  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog135 hydrog ?    ? I DT  71  N3 ? ? ? 1_555 J DA  230 N1 ? ? I DT  68  J DA  81  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog136 hydrog ?    ? I DT  71  O4 ? ? ? 1_555 J DA  230 N6 ? ? I DT  68  J DA  81  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog137 hydrog ?    ? I DA  72  N1 ? ? ? 1_555 J DT  229 N3 ? ? I DA  69  J DT  80  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog138 hydrog ?    ? I DA  72  N6 ? ? ? 1_555 J DT  229 O4 ? ? I DA  69  J DT  80  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog139 hydrog ?    ? I DC  73  N3 ? ? ? 1_555 J DG  228 N1 ? ? I DC  70  J DG  79  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog140 hydrog ?    ? I DC  73  N4 ? ? ? 1_555 J DG  228 O6 ? ? I DC  70  J DG  79  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog141 hydrog ?    ? I DC  73  O2 ? ? ? 1_555 J DG  228 N2 ? ? I DC  70  J DG  79  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog142 hydrog ?    ? I DG  74  N1 ? ? ? 1_555 J DC  227 N3 ? ? I DG  71  J DC  78  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog143 hydrog ?    ? I DG  74  N2 ? ? ? 1_555 J DC  227 O2 ? ? I DG  71  J DC  78  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog144 hydrog ?    ? I DG  74  O6 ? ? ? 1_555 J DC  227 N4 ? ? I DG  71  J DC  78  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog145 hydrog ?    ? I DC  75  N3 ? ? ? 1_555 J DG  226 N1 ? ? I DC  72  J DG  77  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog146 hydrog ?    ? I DC  75  N4 ? ? ? 1_555 J DG  226 O6 ? ? I DC  72  J DG  77  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog147 hydrog ?    ? I DC  75  O2 ? ? ? 1_555 J DG  226 N2 ? ? I DC  72  J DG  77  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog148 hydrog ?    ? I DG  76  N1 ? ? ? 1_555 J DC  225 N3 ? ? I DG  73  J DC  76  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog149 hydrog ?    ? I DG  76  N2 ? ? ? 1_555 J DC  225 O2 ? ? I DG  73  J DC  76  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog150 hydrog ?    ? I DG  76  O6 ? ? ? 1_555 J DC  225 N4 ? ? I DG  73  J DC  76  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog151 hydrog ?    ? I DC  77  N3 ? ? ? 1_555 J DG  224 N1 ? ? I DC  74  J DG  75  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog152 hydrog ?    ? I DC  77  N4 ? ? ? 1_555 J DG  224 O6 ? ? I DC  74  J DG  75  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog153 hydrog ?    ? I DC  77  O2 ? ? ? 1_555 J DG  224 N2 ? ? I DC  74  J DG  75  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog154 hydrog ?    ? I DT  78  N3 ? ? ? 1_555 J DA  223 N1 ? ? I DT  75  J DA  74  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog155 hydrog ?    ? I DT  78  O4 ? ? ? 1_555 J DA  223 N6 ? ? I DT  75  J DA  74  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog156 hydrog ?    ? I DG  79  N1 ? ? ? 1_555 J DC  222 N3 ? ? I DG  76  J DC  73  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog157 hydrog ?    ? I DG  79  N2 ? ? ? 1_555 J DC  222 O2 ? ? I DG  76  J DC  73  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog158 hydrog ?    ? I DG  79  O6 ? ? ? 1_555 J DC  222 N4 ? ? I DG  76  J DC  73  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog159 hydrog ?    ? I DT  80  N3 ? ? ? 1_555 J DA  221 N1 ? ? I DT  77  J DA  72  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog160 hydrog ?    ? I DT  80  O4 ? ? ? 1_555 J DA  221 N6 ? ? I DT  77  J DA  72  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog161 hydrog ?    ? I DC  81  N3 ? ? ? 1_555 J DG  220 N1 ? ? I DC  78  J DG  71  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog162 hydrog ?    ? I DC  81  N4 ? ? ? 1_555 J DG  220 O6 ? ? I DC  78  J DG  71  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog163 hydrog ?    ? I DC  81  O2 ? ? ? 1_555 J DG  220 N2 ? ? I DC  78  J DG  71  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog164 hydrog ?    ? I DC  82  N3 ? ? ? 1_555 J DG  219 N1 ? ? I DC  79  J DG  70  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog165 hydrog ?    ? I DC  82  N4 ? ? ? 1_555 J DG  219 O6 ? ? I DC  79  J DG  70  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog166 hydrog ?    ? I DC  82  O2 ? ? ? 1_555 J DG  219 N2 ? ? I DC  79  J DG  70  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog167 hydrog ?    ? I DC  83  N3 ? ? ? 1_555 J DG  218 N1 ? ? I DC  80  J DG  69  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog168 hydrog ?    ? I DC  83  N4 ? ? ? 1_555 J DG  218 O6 ? ? I DC  80  J DG  69  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog169 hydrog ?    ? I DC  83  O2 ? ? ? 1_555 J DG  218 N2 ? ? I DC  80  J DG  69  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog170 hydrog ?    ? I DC  84  N3 ? ? ? 1_555 J DG  217 N1 ? ? I DC  81  J DG  68  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog171 hydrog ?    ? I DC  84  N4 ? ? ? 1_555 J DG  217 O6 ? ? I DC  81  J DG  68  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog172 hydrog ?    ? I DC  84  O2 ? ? ? 1_555 J DG  217 N2 ? ? I DC  81  J DG  68  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog173 hydrog ?    ? I DC  85  N3 ? ? ? 1_555 J DG  216 N1 ? ? I DC  82  J DG  67  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog174 hydrog ?    ? I DC  85  N4 ? ? ? 1_555 J DG  216 O6 ? ? I DC  82  J DG  67  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog175 hydrog ?    ? I DC  85  O2 ? ? ? 1_555 J DG  216 N2 ? ? I DC  82  J DG  67  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog176 hydrog ?    ? I DG  86  N1 ? ? ? 1_555 J DC  215 N3 ? ? I DG  83  J DC  66  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog177 hydrog ?    ? I DG  86  N2 ? ? ? 1_555 J DC  215 O2 ? ? I DG  83  J DC  66  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog178 hydrog ?    ? I DG  86  O6 ? ? ? 1_555 J DC  215 N4 ? ? I DG  83  J DC  66  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog179 hydrog ?    ? I DC  87  N3 ? ? ? 1_555 J DG  214 N1 ? ? I DC  84  J DG  65  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog180 hydrog ?    ? I DC  87  N4 ? ? ? 1_555 J DG  214 O6 ? ? I DC  84  J DG  65  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog181 hydrog ?    ? I DC  87  O2 ? ? ? 1_555 J DG  214 N2 ? ? I DC  84  J DG  65  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog182 hydrog ?    ? I DG  88  N1 ? ? ? 1_555 J DC  213 N3 ? ? I DG  85  J DC  64  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog183 hydrog ?    ? I DG  88  N2 ? ? ? 1_555 J DC  213 O2 ? ? I DG  85  J DC  64  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog184 hydrog ?    ? I DG  88  O6 ? ? ? 1_555 J DC  213 N4 ? ? I DG  85  J DC  64  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog185 hydrog ?    ? I DT  89  N3 ? ? ? 1_555 J DA  212 N1 ? ? I DT  86  J DA  63  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog186 hydrog ?    ? I DT  89  O4 ? ? ? 1_555 J DA  212 N6 ? ? I DT  86  J DA  63  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog187 hydrog ?    ? I DT  90  N3 ? ? ? 1_555 J DA  211 N1 ? ? I DT  87  J DA  62  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog188 hydrog ?    ? I DT  90  O4 ? ? ? 1_555 J DA  211 N6 ? ? I DT  87  J DA  62  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog189 hydrog ?    ? I DT  91  N3 ? ? ? 1_555 J DA  210 N1 ? ? I DT  88  J DA  61  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog190 hydrog ?    ? I DT  91  O4 ? ? ? 1_555 J DA  210 N6 ? ? I DT  88  J DA  61  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog191 hydrog ?    ? I DT  92  N3 ? ? ? 1_555 J DA  209 N1 ? ? I DT  89  J DA  60  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog192 hydrog ?    ? I DT  92  O4 ? ? ? 1_555 J DA  209 N6 ? ? I DT  89  J DA  60  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog193 hydrog ?    ? I DA  93  N1 ? ? ? 1_555 J DT  208 N3 ? ? I DA  90  J DT  59  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog194 hydrog ?    ? I DA  93  N6 ? ? ? 1_555 J DT  208 O4 ? ? I DA  90  J DT  59  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog195 hydrog ?    ? I DA  94  N1 ? ? ? 1_555 J DT  207 N3 ? ? I DA  91  J DT  58  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog196 hydrog ?    ? I DA  94  N6 ? ? ? 1_555 J DT  207 O4 ? ? I DA  91  J DT  58  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog197 hydrog ?    ? I DC  95  N3 ? ? ? 1_555 J DG  206 N1 ? ? I DC  92  J DG  57  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog198 hydrog ?    ? I DC  95  N4 ? ? ? 1_555 J DG  206 O6 ? ? I DC  92  J DG  57  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog199 hydrog ?    ? I DC  95  O2 ? ? ? 1_555 J DG  206 N2 ? ? I DC  92  J DG  57  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog200 hydrog ?    ? I DC  96  N3 ? ? ? 1_555 J DG  205 N1 ? ? I DC  93  J DG  56  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog201 hydrog ?    ? I DC  96  N4 ? ? ? 1_555 J DG  205 O6 ? ? I DC  93  J DG  56  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog202 hydrog ?    ? I DC  96  O2 ? ? ? 1_555 J DG  205 N2 ? ? I DC  93  J DG  56  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog203 hydrog ?    ? I DG  97  N1 ? ? ? 1_555 J DC  204 N3 ? ? I DG  94  J DC  55  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog204 hydrog ?    ? I DG  97  N2 ? ? ? 1_555 J DC  204 O2 ? ? I DG  94  J DC  55  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog205 hydrog ?    ? I DG  97  O6 ? ? ? 1_555 J DC  204 N4 ? ? I DG  94  J DC  55  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog206 hydrog ?    ? I DC  98  N3 ? ? ? 1_555 J DG  203 N1 ? ? I DC  95  J DG  54  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog207 hydrog ?    ? I DC  98  N4 ? ? ? 1_555 J DG  203 O6 ? ? I DC  95  J DG  54  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog208 hydrog ?    ? I DC  98  O2 ? ? ? 1_555 J DG  203 N2 ? ? I DC  95  J DG  54  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog209 hydrog ?    ? I DC  99  N3 ? ? ? 1_555 J DG  202 N1 ? ? I DC  96  J DG  53  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog210 hydrog ?    ? I DC  99  N4 ? ? ? 1_555 J DG  202 O6 ? ? I DC  96  J DG  53  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog211 hydrog ?    ? I DC  99  O2 ? ? ? 1_555 J DG  202 N2 ? ? I DC  96  J DG  53  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog212 hydrog ?    ? I DA  100 N1 ? ? ? 1_555 J DT  201 N3 ? ? I DA  97  J DT  52  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog213 hydrog ?    ? I DA  100 N6 ? ? ? 1_555 J DT  201 O4 ? ? I DA  97  J DT  52  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog214 hydrog ?    ? I DA  101 N1 ? ? ? 1_555 J DT  200 N3 ? ? I DA  98  J DT  51  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog215 hydrog ?    ? I DA  101 N6 ? ? ? 1_555 J DT  200 O4 ? ? I DA  98  J DT  51  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog216 hydrog ?    ? I DG  102 N1 ? ? ? 1_555 J DC  199 N3 ? ? I DG  99  J DC  50  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog217 hydrog ?    ? I DG  102 N2 ? ? ? 1_555 J DC  199 O2 ? ? I DG  99  J DC  50  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog218 hydrog ?    ? I DG  102 O6 ? ? ? 1_555 J DC  199 N4 ? ? I DG  99  J DC  50  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog219 hydrog ?    ? I DG  103 N1 ? ? ? 1_555 J DC  198 N3 ? ? I DG  100 J DC  49  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog220 hydrog ?    ? I DG  103 N2 ? ? ? 1_555 J DC  198 O2 ? ? I DG  100 J DC  49  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog221 hydrog ?    ? I DG  103 O6 ? ? ? 1_555 J DC  198 N4 ? ? I DG  100 J DC  49  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog222 hydrog ?    ? I DG  104 N1 ? ? ? 1_555 J DC  197 N3 ? ? I DG  101 J DC  48  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog223 hydrog ?    ? I DG  104 N2 ? ? ? 1_555 J DC  197 O2 ? ? I DG  101 J DC  48  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog224 hydrog ?    ? I DG  104 O6 ? ? ? 1_555 J DC  197 N4 ? ? I DG  101 J DC  48  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog225 hydrog ?    ? I DG  105 N1 ? ? ? 1_555 J DC  196 N3 ? ? I DG  102 J DC  47  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog226 hydrog ?    ? I DG  105 N2 ? ? ? 1_555 J DC  196 O2 ? ? I DG  102 J DC  47  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog227 hydrog ?    ? I DG  105 O6 ? ? ? 1_555 J DC  196 N4 ? ? I DG  102 J DC  47  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog228 hydrog ?    ? I DA  106 N1 ? ? ? 1_555 J DT  195 N3 ? ? I DA  103 J DT  46  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog229 hydrog ?    ? I DA  106 N6 ? ? ? 1_555 J DT  195 O4 ? ? I DA  103 J DT  46  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog230 hydrog ?    ? I DT  107 N3 ? ? ? 1_555 J DA  194 N1 ? ? I DT  104 J DA  45  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog231 hydrog ?    ? I DT  107 O4 ? ? ? 1_555 J DA  194 N6 ? ? I DT  104 J DA  45  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog232 hydrog ?    ? I DT  108 N3 ? ? ? 1_555 J DA  193 N1 ? ? I DT  105 J DA  44  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog233 hydrog ?    ? I DT  108 O4 ? ? ? 1_555 J DA  193 N6 ? ? I DT  105 J DA  44  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog234 hydrog ?    ? I DA  109 N1 ? ? ? 1_555 J DT  192 N3 ? ? I DA  106 J DT  43  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog235 hydrog ?    ? I DA  109 N6 ? ? ? 1_555 J DT  192 O4 ? ? I DA  106 J DT  43  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog236 hydrog ?    ? I DC  110 N3 ? ? ? 1_555 J DG  191 N1 ? ? I DC  107 J DG  42  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog237 hydrog ?    ? I DC  110 N4 ? ? ? 1_555 J DG  191 O6 ? ? I DC  107 J DG  42  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog238 hydrog ?    ? I DC  110 O2 ? ? ? 1_555 J DG  191 N2 ? ? I DC  107 J DG  42  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog239 hydrog ?    ? I DT  111 N3 ? ? ? 1_555 J DA  190 N1 ? ? I DT  108 J DA  41  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog240 hydrog ?    ? I DT  111 O4 ? ? ? 1_555 J DA  190 N6 ? ? I DT  108 J DA  41  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog241 hydrog ?    ? I DC  112 N3 ? ? ? 1_555 J DG  189 N1 ? ? I DC  109 J DG  40  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog242 hydrog ?    ? I DC  112 N4 ? ? ? 1_555 J DG  189 O6 ? ? I DC  109 J DG  40  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog243 hydrog ?    ? I DC  112 O2 ? ? ? 1_555 J DG  189 N2 ? ? I DC  109 J DG  40  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog244 hydrog ?    ? I DC  113 N3 ? ? ? 1_555 J DG  188 N1 ? ? I DC  110 J DG  39  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog245 hydrog ?    ? I DC  113 N4 ? ? ? 1_555 J DG  188 O6 ? ? I DC  110 J DG  39  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog246 hydrog ?    ? I DC  113 O2 ? ? ? 1_555 J DG  188 N2 ? ? I DC  110 J DG  39  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog247 hydrog ?    ? I DC  114 N3 ? ? ? 1_555 J DG  187 N1 ? ? I DC  111 J DG  38  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog248 hydrog ?    ? I DC  114 N4 ? ? ? 1_555 J DG  187 O6 ? ? I DC  111 J DG  38  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog249 hydrog ?    ? I DC  114 O2 ? ? ? 1_555 J DG  187 N2 ? ? I DC  111 J DG  38  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog250 hydrog ?    ? I DT  115 N3 ? ? ? 1_555 J DA  186 N1 ? ? I DT  112 J DA  37  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog251 hydrog ?    ? I DT  115 O4 ? ? ? 1_555 J DA  186 N6 ? ? I DT  112 J DA  37  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog252 hydrog ?    ? I DA  116 N1 ? ? ? 1_555 J DT  185 N3 ? ? I DA  113 J DT  36  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog253 hydrog ?    ? I DA  116 N6 ? ? ? 1_555 J DT  185 O4 ? ? I DA  113 J DT  36  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog254 hydrog ?    ? I DG  117 N1 ? ? ? 1_555 J DC  184 N3 ? ? I DG  114 J DC  35  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog255 hydrog ?    ? I DG  117 N2 ? ? ? 1_555 J DC  184 O2 ? ? I DG  114 J DC  35  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog256 hydrog ?    ? I DG  117 O6 ? ? ? 1_555 J DC  184 N4 ? ? I DG  114 J DC  35  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog257 hydrog ?    ? I DT  118 N3 ? ? ? 1_555 J DA  183 N1 ? ? I DT  115 J DA  34  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog258 hydrog ?    ? I DT  118 O4 ? ? ? 1_555 J DA  183 N6 ? ? I DT  115 J DA  34  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog259 hydrog ?    ? I DC  119 N3 ? ? ? 1_555 J DG  182 N1 ? ? I DC  116 J DG  33  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog260 hydrog ?    ? I DC  119 N4 ? ? ? 1_555 J DG  182 O6 ? ? I DC  116 J DG  33  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog261 hydrog ?    ? I DC  119 O2 ? ? ? 1_555 J DG  182 N2 ? ? I DC  116 J DG  33  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog262 hydrog ?    ? I DT  120 N3 ? ? ? 1_555 J DA  181 N1 ? ? I DT  117 J DA  32  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog263 hydrog ?    ? I DT  120 O4 ? ? ? 1_555 J DA  181 N6 ? ? I DT  117 J DA  32  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog264 hydrog ?    ? I DC  121 N3 ? ? ? 1_555 J DG  180 N1 ? ? I DC  118 J DG  31  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog265 hydrog ?    ? I DC  121 N4 ? ? ? 1_555 J DG  180 O6 ? ? I DC  118 J DG  31  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog266 hydrog ?    ? I DC  121 O2 ? ? ? 1_555 J DG  180 N2 ? ? I DC  118 J DG  31  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog267 hydrog ?    ? I DC  122 N3 ? ? ? 1_555 J DG  179 N1 ? ? I DC  119 J DG  30  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog268 hydrog ?    ? I DC  122 N4 ? ? ? 1_555 J DG  179 O6 ? ? I DC  119 J DG  30  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog269 hydrog ?    ? I DC  122 O2 ? ? ? 1_555 J DG  179 N2 ? ? I DC  119 J DG  30  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog270 hydrog ?    ? I DA  123 N1 ? ? ? 1_555 J DT  178 N3 ? ? I DA  120 J DT  29  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog271 hydrog ?    ? I DA  123 N6 ? ? ? 1_555 J DT  178 O4 ? ? I DA  120 J DT  29  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog272 hydrog ?    ? I DG  124 N1 ? ? ? 1_555 J DC  177 N3 ? ? I DG  121 J DC  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog273 hydrog ?    ? I DG  124 N2 ? ? ? 1_555 J DC  177 O2 ? ? I DG  121 J DC  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog274 hydrog ?    ? I DG  124 O6 ? ? ? 1_555 J DC  177 N4 ? ? I DG  121 J DC  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog275 hydrog ?    ? I DG  125 N1 ? ? ? 1_555 J DC  176 N3 ? ? I DG  122 J DC  27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog276 hydrog ?    ? I DG  125 N2 ? ? ? 1_555 J DC  176 O2 ? ? I DG  122 J DC  27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog277 hydrog ?    ? I DG  125 O6 ? ? ? 1_555 J DC  176 N4 ? ? I DG  122 J DC  27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog278 hydrog ?    ? I DC  126 N3 ? ? ? 1_555 J DG  175 N1 ? ? I DC  123 J DG  26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog279 hydrog ?    ? I DC  126 N4 ? ? ? 1_555 J DG  175 O6 ? ? I DC  123 J DG  26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog280 hydrog ?    ? I DC  126 O2 ? ? ? 1_555 J DG  175 N2 ? ? I DC  123 J DG  26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog281 hydrog ?    ? I DC  127 N3 ? ? ? 1_555 J DG  174 N1 ? ? I DC  124 J DG  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog282 hydrog ?    ? I DC  127 N4 ? ? ? 1_555 J DG  174 O6 ? ? I DC  124 J DG  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog283 hydrog ?    ? I DC  127 O2 ? ? ? 1_555 J DG  174 N2 ? ? I DC  124 J DG  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog284 hydrog ?    ? I DT  128 N3 ? ? ? 1_555 J DA  173 N1 ? ? I DT  125 J DA  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog285 hydrog ?    ? I DT  128 O4 ? ? ? 1_555 J DA  173 N6 ? ? I DT  125 J DA  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog286 hydrog ?    ? I DT  129 N3 ? ? ? 1_555 J DA  172 N1 ? ? I DT  126 J DA  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog287 hydrog ?    ? I DT  129 O4 ? ? ? 1_555 J DA  172 N6 ? ? I DT  126 J DA  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog288 hydrog ?    ? I DT  130 N3 ? ? ? 1_555 J DA  171 N1 ? ? I DT  127 J DA  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog289 hydrog ?    ? I DT  130 O4 ? ? ? 1_555 J DA  171 N6 ? ? I DT  127 J DA  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog290 hydrog ?    ? I DG  131 N1 ? ? ? 1_555 J DC  170 N3 ? ? I DG  128 J DC  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog291 hydrog ?    ? I DG  131 N2 ? ? ? 1_555 J DC  170 O2 ? ? I DG  128 J DC  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog292 hydrog ?    ? I DG  131 O6 ? ? ? 1_555 J DC  170 N4 ? ? I DG  128 J DC  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog293 hydrog ?    ? I DT  132 N3 ? ? ? 1_555 J DA  169 N1 ? ? I DT  129 J DA  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog294 hydrog ?    ? I DT  132 O4 ? ? ? 1_555 J DA  169 N6 ? ? I DT  129 J DA  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog295 hydrog ?    ? I DT  133 N3 ? ? ? 1_555 J DA  168 N1 ? ? I DT  130 J DA  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog296 hydrog ?    ? I DT  133 O4 ? ? ? 1_555 J DA  168 N6 ? ? I DT  130 J DA  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog297 hydrog ?    ? I DA  134 N1 ? ? ? 1_555 J DT  167 N3 ? ? I DA  131 J DT  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog298 hydrog ?    ? I DA  134 N6 ? ? ? 1_555 J DT  167 O4 ? ? I DA  131 J DT  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog299 hydrog ?    ? I DT  135 N3 ? ? ? 1_555 J DA  166 N1 ? ? I DT  132 J DA  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog300 hydrog ?    ? I DT  135 O4 ? ? ? 1_555 J DA  166 N6 ? ? I DT  132 J DA  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog301 hydrog ?    ? I DG  136 N1 ? ? ? 1_555 J DC  165 N3 ? ? I DG  133 J DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog302 hydrog ?    ? I DG  136 N2 ? ? ? 1_555 J DC  165 O2 ? ? I DG  133 J DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog303 hydrog ?    ? I DG  136 O6 ? ? ? 1_555 J DC  165 N4 ? ? I DG  133 J DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog304 hydrog ?    ? I DC  137 N3 ? ? ? 1_555 J DG  164 N1 ? ? I DC  134 J DG  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog305 hydrog ?    ? I DC  137 N4 ? ? ? 1_555 J DG  164 O6 ? ? I DC  134 J DG  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog306 hydrog ?    ? I DC  137 O2 ? ? ? 1_555 J DG  164 N2 ? ? I DC  134 J DG  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog307 hydrog ?    ? I DA  138 N1 ? ? ? 1_555 J DT  163 N3 ? ? I DA  135 J DT  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog308 hydrog ?    ? I DA  138 N6 ? ? ? 1_555 J DT  163 O4 ? ? I DA  135 J DT  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog309 hydrog ?    ? I DA  139 N1 ? ? ? 1_555 J DT  162 N3 ? ? I DA  136 J DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog310 hydrog ?    ? I DA  139 N6 ? ? ? 1_555 J DT  162 O4 ? ? I DA  136 J DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog311 hydrog ?    ? I DA  140 N1 ? ? ? 1_555 J DT  161 N3 ? ? I DA  137 J DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog312 hydrog ?    ? I DA  140 N6 ? ? ? 1_555 J DT  161 O4 ? ? I DA  137 J DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog313 hydrog ?    ? I DT  141 N3 ? ? ? 1_555 J DA  160 N1 ? ? I DT  138 J DA  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog314 hydrog ?    ? I DT  141 O4 ? ? ? 1_555 J DA  160 N6 ? ? I DT  138 J DA  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog315 hydrog ?    ? I DA  142 N1 ? ? ? 1_555 J DT  159 N3 ? ? I DA  139 J DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog316 hydrog ?    ? I DA  142 N6 ? ? ? 1_555 J DT  159 O4 ? ? I DA  139 J DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog317 hydrog ?    ? I DC  143 N3 ? ? ? 1_555 J DG  158 N1 ? ? I DC  140 J DG  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog318 hydrog ?    ? I DC  143 N4 ? ? ? 1_555 J DG  158 O6 ? ? I DC  140 J DG  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog319 hydrog ?    ? I DC  143 O2 ? ? ? 1_555 J DG  158 N2 ? ? I DC  140 J DG  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog320 hydrog ?    ? I DA  144 N1 ? ? ? 1_555 J DT  157 N3 ? ? I DA  141 J DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog321 hydrog ?    ? I DA  144 N6 ? ? ? 1_555 J DT  157 O4 ? ? I DA  141 J DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog322 hydrog ?    ? I DT  145 N3 ? ? ? 1_555 J DA  156 N1 ? ? I DT  142 J DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog323 hydrog ?    ? I DT  145 O4 ? ? ? 1_555 J DA  156 N6 ? ? I DT  142 J DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog324 hydrog ?    ? I DC  146 N3 ? ? ? 1_555 J DG  155 N1 ? ? I DC  143 J DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog325 hydrog ?    ? I DC  146 N4 ? ? ? 1_555 J DG  155 O6 ? ? I DC  143 J DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog326 hydrog ?    ? I DC  146 O2 ? ? ? 1_555 J DG  155 N2 ? ? I DC  143 J DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog327 hydrog ?    ? I DC  147 N3 ? ? ? 1_555 J DG  154 N1 ? ? I DC  144 J DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog328 hydrog ?    ? I DC  147 N4 ? ? ? 1_555 J DG  154 O6 ? ? I DC  144 J DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog329 hydrog ?    ? I DC  147 O2 ? ? ? 1_555 J DG  154 N2 ? ? I DC  144 J DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog330 hydrog ?    ? I DT  148 N3 ? ? ? 1_555 J DA  153 N1 ? ? I DT  145 J DA  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog331 hydrog ?    ? I DT  148 O4 ? ? ? 1_555 J DA  153 N6 ? ? I DT  145 J DA  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog332 hydrog ?    ? I DG  149 N1 ? ? ? 1_555 J DC  152 N3 ? ? I DG  146 J DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog333 hydrog ?    ? I DG  149 N2 ? ? ? 1_555 J DC  152 O2 ? ? I DG  146 J DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog334 hydrog ?    ? I DG  149 O6 ? ? ? 1_555 J DC  152 N4 ? ? I DG  146 J DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel 
AA2 1 2 ? parallel 
AA3 1 2 ? parallel 
AA4 1 2 ? parallel 
AA5 1 2 ? parallel 
AA6 1 2 ? parallel 
AA7 1 2 ? parallel 
AA8 1 2 ? parallel 
AA9 1 2 ? parallel 
AB1 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 87  ? PHE A 88  ? ARG A 84  PHE A 85  
AA1 2 THR B 83  ? VAL B 84  ? THR B 81  VAL B 82  
AA2 1 THR A 122 ? ILE A 123 ? THR A 119 ILE A 120 
AA2 2 ARG B 48  ? ILE B 49  ? ARG B 46  ILE B 47  
AA3 1 THR B 99  ? TYR B 101 ? THR B 97  TYR B 99  
AA3 2 VAL G 104 ? ILE G 106 ? VAL G 101 ILE G 103 
AA4 1 ARG C 46  ? VAL C 47  ? ARG C 43  VAL C 44  
AA4 2 THR D 92  ? ILE D 93  ? THR D 89  ILE D 90  
AA5 1 ARG C 81  ? ILE C 82  ? ARG C 78  ILE C 79  
AA5 2 GLY D 57  ? ILE D 58  ? GLY D 54  ILE D 55  
AA6 1 VAL C 104 ? ILE C 106 ? VAL C 101 ILE C 103 
AA6 2 THR F 100 ? TYR F 102 ? THR F 97  TYR F 99  
AA7 1 ARG E 87  ? PHE E 88  ? ARG E 84  PHE E 85  
AA7 2 THR F 84  ? VAL F 85  ? THR F 81  VAL F 82  
AA8 1 THR E 122 ? ILE E 123 ? THR E 119 ILE E 120 
AA8 2 ARG F 49  ? ILE F 50  ? ARG F 46  ILE F 47  
AA9 1 ARG G 46  ? VAL G 47  ? ARG G 43  VAL G 44  
AA9 2 THR H 92  ? ILE H 93  ? THR H 89  ILE H 90  
AB1 1 ARG G 81  ? ILE G 82  ? ARG G 78  ILE G 79  
AB1 2 GLY H 57  ? ILE H 58  ? GLY H 54  ILE H 55  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 87  ? N ARG A 84  O VAL B 84  ? O VAL B 82  
AA2 1 2 N ILE A 123 ? N ILE A 120 O ARG B 48  ? O ARG B 46  
AA3 1 2 N TYR B 101 ? N TYR B 99  O THR G 105 ? O THR G 102 
AA4 1 2 N ARG C 46  ? N ARG C 43  O ILE D 93  ? O ILE D 90  
AA5 1 2 N ILE C 82  ? N ILE C 79  O GLY D 57  ? O GLY D 54  
AA6 1 2 N THR C 105 ? N THR C 102 O TYR F 102 ? O TYR F 99  
AA7 1 2 N ARG E 87  ? N ARG E 84  O VAL F 85  ? O VAL F 82  
AA8 1 2 N ILE E 123 ? N ILE E 120 O ARG F 49  ? O ARG F 46  
AA9 1 2 N ARG G 46  ? N ARG G 43  O ILE H 93  ? O ILE H 90  
AB1 1 2 N ILE G 82  ? N ILE G 79  O GLY H 57  ? O GLY H 54  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A PTD 201 ? 2 'binding site for residue PTD A 201' 
AC2 Software A PTD 202 ? 2 'binding site for residue PTD A 202' 
AC3 Software B PTD 201 ? 2 'binding site for residue PTD B 201' 
AC4 Software C PTD 301 ? 2 'binding site for residue PTD C 301' 
AC5 Software D PTD 201 ? 2 'binding site for residue PTD D 201' 
AC6 Software D PTD 202 ? 2 'binding site for residue PTD D 202' 
AC7 Software F PTD 201 ? 2 'binding site for residue PTD F 201' 
AC8 Software H PTD 201 ? 2 'binding site for residue PTD H 201' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2 LYS A 119 ? LYS A 116 . ? 1_555 ? 
2  AC1 2 LYS E 126 ? LYS E 123 . ? 1_555 ? 
3  AC2 2 LYS A 126 ? LYS A 123 . ? 1_555 ? 
4  AC2 2 LYS E 119 ? LYS E 116 . ? 1_555 ? 
5  AC3 2 LYS A 83  ? LYS A 80  . ? 1_555 ? 
6  AC3 2 LYS B 82  ? LYS B 80  . ? 1_555 ? 
7  AC4 2 LYS C 40  ? LYS C 37  . ? 1_555 ? 
8  AC4 2 LYS H 89  ? LYS H 86  . ? 1_555 ? 
9  AC5 2 LYS D 47  ? LYS D 44  . ? 1_555 ? 
10 AC5 2 LYS D 50  ? LYS D 47  . ? 1_555 ? 
11 AC6 2 LYS D 89  ? LYS D 86  . ? 1_555 ? 
12 AC6 2 LYS G 40  ? LYS G 37  . ? 1_555 ? 
13 AC7 2 LYS E 83  ? LYS E 80  . ? 1_555 ? 
14 AC7 2 LYS F 83  ? LYS F 80  . ? 1_555 ? 
15 AC8 2 LYS H 47  ? LYS H 44  . ? 1_555 ? 
16 AC8 2 LYS H 50  ? LYS H 47  . ? 1_555 ? 
# 
_atom_sites.entry_id                    6YOV 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . HIS A 1  43  ? 123.562 146.775 143.759 1.00 302.57 ? 40  HIS A N     1 
ATOM   2     C CA    . HIS A 1  43  ? 124.038 146.611 142.359 1.00 311.63 ? 40  HIS A CA    1 
ATOM   3     C C     . HIS A 1  43  ? 123.070 145.707 141.588 1.00 291.93 ? 40  HIS A C     1 
ATOM   4     O O     . HIS A 1  43  ? 123.236 144.473 141.661 1.00 289.46 ? 40  HIS A O     1 
ATOM   5     C CB    . HIS A 1  43  ? 125.468 146.055 142.340 1.00 322.66 ? 40  HIS A CB    1 
ATOM   6     C CG    . HIS A 1  43  ? 126.457 146.911 143.058 1.00 341.28 ? 40  HIS A CG    1 
ATOM   7     N ND1   . HIS A 1  43  ? 126.229 148.250 143.310 1.00 342.83 ? 40  HIS A ND1   1 
ATOM   8     C CD2   . HIS A 1  43  ? 127.672 146.628 143.575 1.00 365.60 ? 40  HIS A CD2   1 
ATOM   9     C CE1   . HIS A 1  43  ? 127.262 148.755 143.954 1.00 347.26 ? 40  HIS A CE1   1 
ATOM   10    N NE2   . HIS A 1  43  ? 128.162 147.781 144.127 1.00 361.63 ? 40  HIS A NE2   1 
ATOM   11    N N     . ARG A 1  44  ? 122.106 146.299 140.874 1.00 270.53 ? 41  ARG A N     1 
ATOM   12    C CA    . ARG A 1  44  ? 121.150 145.504 140.058 1.00 245.01 ? 41  ARG A CA    1 
ATOM   13    C C     . ARG A 1  44  ? 121.788 145.183 138.704 1.00 248.32 ? 41  ARG A C     1 
ATOM   14    O O     . ARG A 1  44  ? 122.318 146.114 138.070 1.00 268.29 ? 41  ARG A O     1 
ATOM   15    C CB    . ARG A 1  44  ? 119.861 146.301 139.836 0.00 222.71 ? 41  ARG A CB    1 
ATOM   16    C CG    . ARG A 1  44  ? 118.877 146.238 140.995 0.00 200.39 ? 41  ARG A CG    1 
ATOM   17    C CD    . ARG A 1  44  ? 117.447 146.397 140.513 0.00 170.45 ? 41  ARG A CD    1 
ATOM   18    N NE    . ARG A 1  44  ? 116.529 146.743 141.588 0.00 159.94 ? 41  ARG A NE    1 
ATOM   19    C CZ    . ARG A 1  44  ? 115.206 146.703 141.486 0.00 150.48 ? 41  ARG A CZ    1 
ATOM   20    N NH1   . ARG A 1  44  ? 114.641 146.327 140.352 0.00 141.85 ? 41  ARG A NH1   1 
ATOM   21    N NH2   . ARG A 1  44  ? 114.452 147.035 142.519 0.00 143.48 ? 41  ARG A NH2   1 
ATOM   22    N N     . TYR A 1  45  ? 121.748 143.918 138.281 1.00 244.45 ? 42  TYR A N     1 
ATOM   23    C CA    . TYR A 1  45  ? 122.263 143.567 136.933 1.00 244.84 ? 42  TYR A CA    1 
ATOM   24    C C     . TYR A 1  45  ? 121.309 144.155 135.889 1.00 225.67 ? 42  TYR A C     1 
ATOM   25    O O     . TYR A 1  45  ? 120.082 144.002 136.057 1.00 212.67 ? 42  TYR A O     1 
ATOM   26    C CB    . TYR A 1  45  ? 122.460 142.054 136.813 0.00 234.31 ? 42  TYR A CB    1 
ATOM   27    C CG    . TYR A 1  45  ? 123.578 141.511 137.666 0.00 254.28 ? 42  TYR A CG    1 
ATOM   28    C CD1   . TYR A 1  45  ? 123.962 140.182 137.587 0.00 246.70 ? 42  TYR A CD1   1 
ATOM   29    C CD2   . TYR A 1  45  ? 124.256 142.328 138.556 0.00 281.23 ? 42  TYR A CD2   1 
ATOM   30    C CE1   . TYR A 1  45  ? 124.989 139.679 138.368 0.00 256.36 ? 42  TYR A CE1   1 
ATOM   31    C CE2   . TYR A 1  45  ? 125.284 141.841 139.346 0.00 290.92 ? 42  TYR A CE2   1 
ATOM   32    C CZ    . TYR A 1  45  ? 125.653 140.511 139.251 0.00 276.54 ? 42  TYR A CZ    1 
ATOM   33    O OH    . TYR A 1  45  ? 126.667 140.024 140.025 1.00 272.75 ? 42  TYR A OH    1 
ATOM   34    N N     . ARG A 1  46  ? 121.846 144.800 134.847 1.00 225.65 ? 43  ARG A N     1 
ATOM   35    C CA    . ARG A 1  46  ? 121.000 145.475 133.828 1.00 208.20 ? 43  ARG A CA    1 
ATOM   36    C C     . ARG A 1  46  ? 120.158 144.462 133.046 1.00 189.29 ? 43  ARG A C     1 
ATOM   37    O O     . ARG A 1  46  ? 120.613 143.315 132.885 1.00 184.95 ? 43  ARG A O     1 
ATOM   38    C CB    . ARG A 1  46  ? 121.886 146.271 132.865 0.00 213.88 ? 43  ARG A CB    1 
ATOM   39    C CG    . ARG A 1  46  ? 122.631 147.429 133.512 0.00 229.38 ? 43  ARG A CG    1 
ATOM   40    C CD    . ARG A 1  46  ? 123.562 148.110 132.526 0.00 240.27 ? 43  ARG A CD    1 
ATOM   41    N NE    . ARG A 1  46  ? 122.834 148.730 131.428 0.00 260.00 ? 43  ARG A NE    1 
ATOM   42    C CZ    . ARG A 1  46  ? 123.402 149.293 130.368 0.00 268.98 ? 43  ARG A CZ    1 
ATOM   43    N NH1   . ARG A 1  46  ? 124.719 149.315 130.255 0.00 260.41 ? 43  ARG A NH1   1 
ATOM   44    N NH2   . ARG A 1  46  ? 122.652 149.831 129.424 0.00 272.05 ? 43  ARG A NH2   1 
ATOM   45    N N     . PRO A 1  47  ? 118.955 144.837 132.547 1.00 178.81 ? 44  PRO A N     1 
ATOM   46    C CA    . PRO A 1  47  ? 118.136 143.965 131.736 1.00 167.07 ? 44  PRO A CA    1 
ATOM   47    C C     . PRO A 1  47  ? 118.955 143.275 130.666 1.00 165.07 ? 44  PRO A C     1 
ATOM   48    O O     . PRO A 1  47  ? 119.732 143.907 129.950 1.00 168.97 ? 44  PRO A O     1 
ATOM   49    C CB    . PRO A 1  47  ? 117.140 144.954 131.121 1.00 159.40 ? 44  PRO A CB    1 
ATOM   50    C CG    . PRO A 1  47  ? 116.998 146.033 132.163 1.00 167.68 ? 44  PRO A CG    1 
ATOM   51    C CD    . PRO A 1  47  ? 118.375 146.182 132.758 1.00 177.96 ? 44  PRO A CD    1 
ATOM   52    N N     . GLY A 1  48  ? 118.744 141.972 130.550 1.00 159.19 ? 45  GLY A N     1 
ATOM   53    C CA    . GLY A 1  48  ? 119.441 141.142 129.581 1.00 157.31 ? 45  GLY A CA    1 
ATOM   54    C C     . GLY A 1  48  ? 120.552 140.336 130.239 1.00 151.53 ? 45  GLY A C     1 
ATOM   55    O O     . GLY A 1  48  ? 120.926 139.268 129.748 1.00 146.15 ? 45  GLY A O     1 
ATOM   56    N N     . THR A 1  49  ? 121.132 140.839 131.334 1.00 157.73 ? 46  THR A N     1 
ATOM   57    C CA    . THR A 1  49  ? 122.166 140.038 132.043 1.00 155.84 ? 46  THR A CA    1 
ATOM   58    C C     . THR A 1  49  ? 121.548 138.726 132.527 1.00 145.81 ? 46  THR A C     1 
ATOM   59    O O     . THR A 1  49  ? 122.155 137.669 132.271 1.00 141.51 ? 46  THR A O     1 
ATOM   60    C CB    . THR A 1  49  ? 122.770 140.803 133.225 1.00 178.67 ? 46  THR A CB    1 
ATOM   61    O OG1   . THR A 1  49  ? 123.204 142.081 132.760 1.00 195.63 ? 46  THR A OG1   1 
ATOM   62    C CG2   . THR A 1  49  ? 123.924 140.061 133.862 1.00 207.83 ? 46  THR A CG2   1 
ATOM   63    N N     . VAL A 1  50  ? 120.382 138.786 133.177 1.00 143.90 ? 47  VAL A N     1 
ATOM   64    C CA    . VAL A 1  50  ? 119.742 137.602 133.694 1.00 136.53 ? 47  VAL A CA    1 
ATOM   65    C C     . VAL A 1  50  ? 119.243 136.734 132.565 1.00 130.98 ? 47  VAL A C     1 
ATOM   66    O O     . VAL A 1  50  ? 119.325 135.511 132.637 1.00 127.88 ? 47  VAL A O     1 
ATOM   67    C CB    . VAL A 1  50  ? 118.593 137.983 134.629 1.00 133.11 ? 47  VAL A CB    1 
ATOM   68    C CG1   . VAL A 1  50  ? 117.807 136.747 135.045 1.00 135.48 ? 47  VAL A CG1   1 
ATOM   69    C CG2   . VAL A 1  50  ? 119.163 138.698 135.840 1.00 141.05 ? 47  VAL A CG2   1 
ATOM   70    N N     . ALA A 1  51  ? 118.687 137.358 131.535 1.00 130.36 ? 48  ALA A N     1 
ATOM   71    C CA    . ALA A 1  51  ? 118.126 136.590 130.440 1.00 127.26 ? 48  ALA A CA    1 
ATOM   72    C C     . ALA A 1  51  ? 119.180 135.694 129.820 1.00 127.06 ? 48  ALA A C     1 
ATOM   73    O O     . ALA A 1  51  ? 118.929 134.516 129.573 1.00 118.93 ? 48  ALA A O     1 
ATOM   74    C CB    . ALA A 1  51  ? 117.547 137.513 129.385 1.00 124.94 ? 48  ALA A CB    1 
ATOM   75    N N     . LEU A 1  52  ? 120.387 136.216 129.645 1.00 127.47 ? 49  LEU A N     1 
ATOM   76    C CA    . LEU A 1  52  ? 121.437 135.400 129.065 1.00 126.15 ? 49  LEU A CA    1 
ATOM   77    C C     . LEU A 1  52  ? 121.838 134.285 130.011 1.00 124.09 ? 49  LEU A C     1 
ATOM   78    O O     . LEU A 1  52  ? 122.077 133.156 129.579 1.00 121.05 ? 49  LEU A O     1 
ATOM   79    C CB    . LEU A 1  52  ? 122.637 136.262 128.678 1.00 126.06 ? 49  LEU A CB    1 
ATOM   80    C CG    . LEU A 1  52  ? 122.409 137.215 127.483 1.00 131.70 ? 49  LEU A CG    1 
ATOM   81    C CD1   . LEU A 1  52  ? 123.605 138.132 127.334 1.00 137.05 ? 49  LEU A CD1   1 
ATOM   82    C CD2   . LEU A 1  52  ? 122.191 136.410 126.195 1.00 130.00 ? 49  LEU A CD2   1 
ATOM   83    N N     . ARG A 1  53  ? 121.881 134.583 131.317 1.00 124.78 ? 50  ARG A N     1 
ATOM   84    C CA    . ARG A 1  53  ? 122.208 133.550 132.335 1.00 122.34 ? 50  ARG A CA    1 
ATOM   85    C C     . ARG A 1  53  ? 121.139 132.454 132.318 1.00 115.60 ? 50  ARG A C     1 
ATOM   86    O O     . ARG A 1  53  ? 121.519 131.280 132.437 1.00 112.63 ? 50  ARG A O     1 
ATOM   87    C CB    . ARG A 1  53  ? 122.282 134.182 133.729 1.00 124.66 ? 50  ARG A CB    1 
ATOM   88    C CG    . ARG A 1  53  ? 123.542 134.998 133.981 1.00 140.63 ? 50  ARG A CG    1 
ATOM   89    C CD    . ARG A 1  53  ? 123.342 136.024 135.080 1.00 165.11 ? 50  ARG A CD    1 
ATOM   90    N NE    . ARG A 1  53  ? 124.543 136.232 135.877 1.00 177.46 ? 50  ARG A NE    1 
ATOM   91    C CZ    . ARG A 1  53  ? 124.706 135.795 137.121 1.00 214.66 ? 50  ARG A CZ    1 
ATOM   92    N NH1   . ARG A 1  53  ? 123.739 135.119 137.717 1.00 237.41 ? 50  ARG A NH1   1 
ATOM   93    N NH2   . ARG A 1  53  ? 125.835 136.034 137.764 1.00 235.69 ? 50  ARG A NH2   1 
ATOM   94    N N     . GLU A 1  54  ? 119.860 132.817 132.165 1.00 117.68 ? 51  GLU A N     1 
ATOM   95    C CA    . GLU A 1  54  ? 118.785 131.853 132.186 1.00 114.67 ? 51  GLU A CA    1 
ATOM   96    C C     . GLU A 1  54  ? 118.772 131.036 130.905 1.00 112.05 ? 51  GLU A C     1 
ATOM   97    O O     . GLU A 1  54  ? 118.551 129.826 130.941 1.00 106.72 ? 51  GLU A O     1 
ATOM   98    C CB    . GLU A 1  54  ? 117.465 132.566 132.432 1.00 116.43 ? 51  GLU A CB    1 
ATOM   99    C CG    . GLU A 1  54  ? 117.341 133.150 133.836 1.00 122.19 ? 51  GLU A CG    1 
ATOM   100   C CD    . GLU A 1  54  ? 117.448 132.124 134.917 0.00 127.61 ? 51  GLU A CD    1 
ATOM   101   O OE1   . GLU A 1  54  ? 116.515 131.385 135.114 0.00 126.43 ? 51  GLU A OE1   1 
ATOM   102   O OE2   . GLU A 1  54  ? 118.491 132.048 135.524 0.00 125.69 ? 51  GLU A OE2   1 
ATOM   103   N N     . ILE A 1  55  ? 119.106 131.662 129.780 1.00 108.07 ? 52  ILE A N     1 
ATOM   104   C CA    . ILE A 1  55  ? 119.208 130.896 128.549 1.00 109.79 ? 52  ILE A CA    1 
ATOM   105   C C     . ILE A 1  55  ? 120.326 129.890 128.711 1.00 112.07 ? 52  ILE A C     1 
ATOM   106   O O     . ILE A 1  55  ? 120.141 128.692 128.503 1.00 106.63 ? 52  ILE A O     1 
ATOM   107   C CB    . ILE A 1  55  ? 119.502 131.792 127.329 1.00 113.00 ? 52  ILE A CB    1 
ATOM   108   C CG1   . ILE A 1  55  ? 118.295 132.689 127.027 1.00 105.59 ? 52  ILE A CG1   1 
ATOM   109   C CG2   . ILE A 1  55  ? 119.849 130.924 126.127 1.00 114.20 ? 52  ILE A CG2   1 
ATOM   110   C CD1   . ILE A 1  55  ? 118.564 133.808 126.048 1.00 109.61 ? 52  ILE A CD1   1 
ATOM   111   N N     . ARG A 1  56  ? 121.460 130.370 129.183 1.00 109.14 ? 53  ARG A N     1 
ATOM   112   C CA    . ARG A 1  56  ? 122.608 129.523 129.412 1.00 112.72 ? 53  ARG A CA    1 
ATOM   113   C C     . ARG A 1  56  ? 122.298 128.370 130.340 1.00 109.09 ? 53  ARG A C     1 
ATOM   114   O O     . ARG A 1  56  ? 122.681 127.226 130.087 1.00 108.36 ? 53  ARG A O     1 
ATOM   115   C CB    . ARG A 1  56  ? 123.702 130.343 130.050 1.00 114.91 ? 53  ARG A CB    1 
ATOM   116   C CG    . ARG A 1  56  ? 124.945 129.592 130.353 1.00 117.92 ? 53  ARG A CG    1 
ATOM   117   C CD    . ARG A 1  56  ? 125.993 130.472 130.883 1.00 122.14 ? 53  ARG A CD    1 
ATOM   118   N NE    . ARG A 1  56  ? 126.368 131.503 129.922 1.00 128.17 ? 53  ARG A NE    1 
ATOM   119   C CZ    . ARG A 1  56  ? 126.107 132.824 130.040 1.00 128.81 ? 53  ARG A CZ    1 
ATOM   120   N NH1   . ARG A 1  56  ? 125.496 133.298 131.098 1.00 128.61 ? 53  ARG A NH1   1 
ATOM   121   N NH2   . ARG A 1  56  ? 126.486 133.650 129.084 1.00 127.88 ? 53  ARG A NH2   1 
ATOM   122   N N     . ARG A 1  57  ? 121.661 128.694 131.449 1.00 107.56 ? 54  ARG A N     1 
ATOM   123   C CA    . ARG A 1  57  ? 121.449 127.750 132.517 1.00 105.78 ? 54  ARG A CA    1 
ATOM   124   C C     . ARG A 1  57  ? 120.474 126.655 132.151 1.00 103.55 ? 54  ARG A C     1 
ATOM   125   O O     . ARG A 1  57  ? 120.703 125.487 132.467 1.00 105.68 ? 54  ARG A O     1 
ATOM   126   C CB    . ARG A 1  57  ? 120.946 128.480 133.730 1.00 108.65 ? 54  ARG A CB    1 
ATOM   127   C CG    . ARG A 1  57  ? 120.839 127.650 134.945 1.00 110.66 ? 54  ARG A CG    1 
ATOM   128   C CD    . ARG A 1  57  ? 120.646 128.484 136.144 1.00 114.93 ? 54  ARG A CD    1 
ATOM   129   N NE    . ARG A 1  57  ? 119.326 129.058 136.202 1.00 116.09 ? 54  ARG A NE    1 
ATOM   130   C CZ    . ARG A 1  57  ? 118.251 128.402 136.645 1.00 118.10 ? 54  ARG A CZ    1 
ATOM   131   N NH1   . ARG A 1  57  ? 118.354 127.153 137.028 1.00 120.23 ? 54  ARG A NH1   1 
ATOM   132   N NH2   . ARG A 1  57  ? 117.091 129.006 136.714 1.00 118.56 ? 54  ARG A NH2   1 
ATOM   133   N N     . TYR A 1  58  ? 119.389 127.014 131.484 1.00 105.15 ? 55  TYR A N     1 
ATOM   134   C CA    . TYR A 1  58  ? 118.408 126.005 131.151 1.00 103.08 ? 55  TYR A CA    1 
ATOM   135   C C     . TYR A 1  58  ? 118.901 125.138 130.019 1.00 103.46 ? 55  TYR A C     1 
ATOM   136   O O     . TYR A 1  58  ? 118.550 123.963 129.942 1.00 103.96 ? 55  TYR A O     1 
ATOM   137   C CB    . TYR A 1  58  ? 117.059 126.625 130.823 1.00 103.94 ? 55  TYR A CB    1 
ATOM   138   C CG    . TYR A 1  58  ? 116.437 127.274 132.005 1.00 108.77 ? 55  TYR A CG    1 
ATOM   139   C CD1   . TYR A 1  58  ? 116.115 128.599 131.949 1.00 109.00 ? 55  TYR A CD1   1 
ATOM   140   C CD2   . TYR A 1  58  ? 116.260 126.562 133.175 1.00 109.48 ? 55  TYR A CD2   1 
ATOM   141   C CE1   . TYR A 1  58  ? 115.636 129.231 133.056 1.00 113.56 ? 55  TYR A CE1   1 
ATOM   142   C CE2   . TYR A 1  58  ? 115.772 127.194 134.285 1.00 106.20 ? 55  TYR A CE2   1 
ATOM   143   C CZ    . TYR A 1  58  ? 115.479 128.531 134.228 1.00 112.82 ? 55  TYR A CZ    1 
ATOM   144   O OH    . TYR A 1  58  ? 115.050 129.191 135.350 1.00 113.55 ? 55  TYR A OH    1 
ATOM   145   N N     . GLN A 1  59  ? 119.733 125.695 129.147 1.00 103.88 ? 56  GLN A N     1 
ATOM   146   C CA    . GLN A 1  59  ? 120.295 124.888 128.080 1.00 105.84 ? 56  GLN A CA    1 
ATOM   147   C C     . GLN A 1  59  ? 121.216 123.833 128.662 1.00 107.70 ? 56  GLN A C     1 
ATOM   148   O O     . GLN A 1  59  ? 121.178 122.664 128.264 1.00 106.37 ? 56  GLN A O     1 
ATOM   149   C CB    . GLN A 1  59  ? 121.051 125.761 127.084 1.00 108.14 ? 56  GLN A CB    1 
ATOM   150   C CG    . GLN A 1  59  ? 120.155 126.645 126.260 1.00 106.18 ? 56  GLN A CG    1 
ATOM   151   C CD    . GLN A 1  59  ? 120.908 127.598 125.380 1.00 109.88 ? 56  GLN A CD    1 
ATOM   152   O OE1   . GLN A 1  59  ? 122.060 127.958 125.644 1.00 111.04 ? 56  GLN A OE1   1 
ATOM   153   N NE2   . GLN A 1  59  ? 120.258 127.982 124.295 1.00 108.44 ? 56  GLN A NE2   1 
ATOM   154   N N     . LYS A 1  60  ? 121.962 124.232 129.684 1.00 107.26 ? 57  LYS A N     1 
ATOM   155   C CA    . LYS A 1  60  ? 122.889 123.350 130.369 1.00 106.11 ? 57  LYS A CA    1 
ATOM   156   C C     . LYS A 1  60  ? 122.195 122.264 131.171 1.00 107.72 ? 57  LYS A C     1 
ATOM   157   O O     . LYS A 1  60  ? 122.724 121.160 131.321 1.00 109.08 ? 57  LYS A O     1 
ATOM   158   C CB    . LYS A 1  60  ? 123.760 124.154 131.307 1.00 116.85 ? 57  LYS A CB    1 
ATOM   159   C CG    . LYS A 1  60  ? 124.822 123.345 131.985 1.00 130.84 ? 57  LYS A CG    1 
ATOM   160   C CD    . LYS A 1  60  ? 125.732 124.224 132.796 1.00 165.09 ? 57  LYS A CD    1 
ATOM   161   C CE    . LYS A 1  60  ? 126.856 123.427 133.416 1.00 202.26 ? 57  LYS A CE    1 
ATOM   162   N NZ    . LYS A 1  60  ? 127.696 124.263 134.298 1.00 285.45 ? 57  LYS A NZ    1 
ATOM   163   N N     . SER A 1  61  ? 121.094 122.626 131.814 1.00 105.86 ? 58  SER A N     1 
ATOM   164   C CA    . SER A 1  61  ? 120.398 121.702 132.690 1.00 106.31 ? 58  SER A CA    1 
ATOM   165   C C     . SER A 1  61  ? 119.677 120.629 131.893 1.00 104.80 ? 58  SER A C     1 
ATOM   166   O O     . SER A 1  61  ? 119.502 120.742 130.680 1.00 103.33 ? 58  SER A O     1 
ATOM   167   C CB    . SER A 1  61  ? 119.417 122.445 133.568 1.00 106.62 ? 58  SER A CB    1 
ATOM   168   O OG    . SER A 1  61  ? 118.314 122.906 132.839 1.00 107.52 ? 58  SER A OG    1 
ATOM   169   N N     . THR A 1  62  ? 119.302 119.554 132.569 1.00 101.86 ? 59  THR A N     1 
ATOM   170   C CA    . THR A 1  62  ? 118.612 118.461 131.907 1.00 104.55 ? 59  THR A CA    1 
ATOM   171   C C     . THR A 1  62  ? 117.241 118.169 132.494 1.00 104.68 ? 59  THR A C     1 
ATOM   172   O O     . THR A 1  62  ? 116.440 117.458 131.885 1.00 104.81 ? 59  THR A O     1 
ATOM   173   C CB    . THR A 1  62  ? 119.460 117.190 131.955 1.00 106.77 ? 59  THR A CB    1 
ATOM   174   O OG1   . THR A 1  62  ? 119.718 116.841 133.320 1.00 104.80 ? 59  THR A OG1   1 
ATOM   175   C CG2   . THR A 1  62  ? 120.767 117.406 131.227 1.00 105.99 ? 59  THR A CG2   1 
ATOM   176   N N     . GLU A 1  63  ? 116.952 118.737 133.655 1.00 102.38 ? 60  GLU A N     1 
ATOM   177   C CA    . GLU A 1  63  ? 115.710 118.429 134.337 1.00 100.88 ? 60  GLU A CA    1 
ATOM   178   C C     . GLU A 1  63  ? 114.517 119.149 133.738 1.00 98.49  ? 60  GLU A C     1 
ATOM   179   O O     . GLU A 1  63  ? 114.643 119.940 132.799 1.00 99.44  ? 60  GLU A O     1 
ATOM   180   C CB    . GLU A 1  63  ? 115.814 118.755 135.823 1.00 102.91 ? 60  GLU A CB    1 
ATOM   181   C CG    . GLU A 1  63  ? 115.949 120.228 136.137 1.00 105.91 ? 60  GLU A CG    1 
ATOM   182   C CD    . GLU A 1  63  ? 117.367 120.687 136.086 1.00 112.03 ? 60  GLU A CD    1 
ATOM   183   O OE1   . GLU A 1  63  ? 118.201 119.922 135.650 1.00 108.57 ? 60  GLU A OE1   1 
ATOM   184   O OE2   . GLU A 1  63  ? 117.630 121.796 136.487 1.00 114.07 ? 60  GLU A OE2   1 
ATOM   185   N N     . LEU A 1  64  ? 113.355 118.871 134.312 1.00 97.13  ? 61  LEU A N     1 
ATOM   186   C CA    . LEU A 1  64  ? 112.093 119.417 133.849 1.00 97.39  ? 61  LEU A CA    1 
ATOM   187   C C     . LEU A 1  64  ? 111.906 120.849 134.317 1.00 95.56  ? 61  LEU A C     1 
ATOM   188   O O     . LEU A 1  64  ? 112.427 121.250 135.358 1.00 95.72  ? 61  LEU A O     1 
ATOM   189   C CB    . LEU A 1  64  ? 110.949 118.537 134.359 1.00 99.78  ? 61  LEU A CB    1 
ATOM   190   C CG    . LEU A 1  64  ? 110.954 117.068 133.860 1.00 101.56 ? 61  LEU A CG    1 
ATOM   191   C CD1   . LEU A 1  64  ? 109.906 116.270 134.623 1.00 105.22 ? 61  LEU A CD1   1 
ATOM   192   C CD2   . LEU A 1  64  ? 110.659 117.028 132.362 1.00 98.05  ? 61  LEU A CD2   1 
ATOM   193   N N     . LEU A 1  65  ? 111.217 121.635 133.502 1.00 92.62  ? 62  LEU A N     1 
ATOM   194   C CA    . LEU A 1  65  ? 110.971 123.036 133.798 1.00 91.63  ? 62  LEU A CA    1 
ATOM   195   C C     . LEU A 1  65  ? 109.519 123.262 134.211 1.00 92.08  ? 62  LEU A C     1 
ATOM   196   O O     . LEU A 1  65  ? 109.202 124.236 134.898 1.00 94.13  ? 62  LEU A O     1 
ATOM   197   C CB    . LEU A 1  65  ? 111.355 123.879 132.579 1.00 93.62  ? 62  LEU A CB    1 
ATOM   198   C CG    . LEU A 1  65  ? 112.828 123.683 132.091 1.00 97.97  ? 62  LEU A CG    1 
ATOM   199   C CD1   . LEU A 1  65  ? 113.077 124.510 130.850 1.00 99.57  ? 62  LEU A CD1   1 
ATOM   200   C CD2   . LEU A 1  65  ? 113.810 124.062 133.184 1.00 103.71 ? 62  LEU A CD2   1 
ATOM   201   N N     . ILE A 1  66  ? 108.642 122.363 133.767 1.00 88.70  ? 63  ILE A N     1 
ATOM   202   C CA    . ILE A 1  66  ? 107.230 122.393 134.130 1.00 86.74  ? 63  ILE A CA    1 
ATOM   203   C C     . ILE A 1  66  ? 106.982 121.589 135.400 1.00 87.95  ? 63  ILE A C     1 
ATOM   204   O O     . ILE A 1  66  ? 107.520 120.495 135.576 1.00 92.94  ? 63  ILE A O     1 
ATOM   205   C CB    . ILE A 1  66  ? 106.325 121.872 132.991 1.00 89.58  ? 63  ILE A CB    1 
ATOM   206   C CG1   . ILE A 1  66  ? 106.351 122.822 131.789 1.00 93.04  ? 63  ILE A CG1   1 
ATOM   207   C CG2   . ILE A 1  66  ? 104.902 121.663 133.492 1.00 90.81  ? 63  ILE A CG2   1 
ATOM   208   C CD1   . ILE A 1  66  ? 105.672 122.258 130.543 1.00 99.27  ? 63  ILE A CD1   1 
ATOM   209   N N     . ARG A 1  67  ? 106.166 122.138 136.285 1.00 87.69  ? 64  ARG A N     1 
ATOM   210   C CA    . ARG A 1  67  ? 105.822 121.487 137.541 1.00 89.97  ? 64  ARG A CA    1 
ATOM   211   C C     . ARG A 1  67  ? 105.040 120.205 137.327 1.00 91.56  ? 64  ARG A C     1 
ATOM   212   O O     . ARG A 1  67  ? 104.141 120.145 136.487 1.00 87.67  ? 64  ARG A O     1 
ATOM   213   C CB    . ARG A 1  67  ? 104.999 122.421 138.374 1.00 93.49  ? 64  ARG A CB    1 
ATOM   214   C CG    . ARG A 1  67  ? 105.704 123.648 138.824 1.00 95.93  ? 64  ARG A CG    1 
ATOM   215   C CD    . ARG A 1  67  ? 106.314 123.444 140.132 1.00 98.80  ? 64  ARG A CD    1 
ATOM   216   N NE    . ARG A 1  67  ? 107.469 122.617 140.066 1.00 100.03 ? 64  ARG A NE    1 
ATOM   217   C CZ    . ARG A 1  67  ? 108.688 123.052 139.743 1.00 105.93 ? 64  ARG A CZ    1 
ATOM   218   N NH1   . ARG A 1  67  ? 108.879 124.317 139.453 1.00 105.40 ? 64  ARG A NH1   1 
ATOM   219   N NH2   . ARG A 1  67  ? 109.698 122.208 139.722 1.00 108.68 ? 64  ARG A NH2   1 
ATOM   220   N N     . LYS A 1  68  ? 105.364 119.187 138.116 1.00 93.61  ? 65  LYS A N     1 
ATOM   221   C CA    . LYS A 1  68  ? 104.809 117.864 137.886 1.00 92.48  ? 65  LYS A CA    1 
ATOM   222   C C     . LYS A 1  68  ? 103.322 117.745 138.157 1.00 90.07  ? 65  LYS A C     1 
ATOM   223   O O     . LYS A 1  68  ? 102.578 117.262 137.305 1.00 86.82  ? 65  LYS A O     1 
ATOM   224   C CB    . LYS A 1  68  ? 105.549 116.841 138.728 1.00 95.05  ? 65  LYS A CB    1 
ATOM   225   C CG    . LYS A 1  68  ? 106.962 116.563 138.259 1.00 101.00 ? 65  LYS A CG    1 
ATOM   226   C CD    . LYS A 1  68  ? 107.642 115.519 139.138 1.00 110.69 ? 65  LYS A CD    1 
ATOM   227   C CE    . LYS A 1  68  ? 109.069 115.229 138.673 1.00 115.58 ? 65  LYS A CE    1 
ATOM   228   N NZ    . LYS A 1  68  ? 109.755 114.233 139.554 1.00 108.05 ? 65  LYS A NZ    1 
ATOM   229   N N     . LEU A 1  69  ? 102.870 118.181 139.325 1.00 86.80  ? 66  LEU A N     1 
ATOM   230   C CA    . LEU A 1  69  ? 101.464 117.980 139.619 1.00 88.00  ? 66  LEU A CA    1 
ATOM   231   C C     . LEU A 1  69  ? 100.535 118.741 138.675 1.00 89.34  ? 66  LEU A C     1 
ATOM   232   O O     . LEU A 1  69  ? 99.550  118.164 138.215 1.00 86.49  ? 66  LEU A O     1 
ATOM   233   C CB    . LEU A 1  69  ? 101.157 118.228 141.102 1.00 89.60  ? 66  LEU A CB    1 
ATOM   234   C CG    . LEU A 1  69  ? 101.627 117.134 142.070 0.00 94.59  ? 66  LEU A CG    1 
ATOM   235   C CD1   . LEU A 1  69  ? 101.457 117.636 143.489 0.00 105.12 ? 66  LEU A CD1   1 
ATOM   236   C CD2   . LEU A 1  69  ? 100.819 115.851 141.860 0.00 100.30 ? 66  LEU A CD2   1 
ATOM   237   N N     . PRO A 1  70  ? 100.768 120.030 138.402 1.00 89.37  ? 67  PRO A N     1 
ATOM   238   C CA    . PRO A 1  70  ? 100.044 120.814 137.425 1.00 87.83  ? 67  PRO A CA    1 
ATOM   239   C C     . PRO A 1  70  ? 100.032 120.150 136.059 1.00 86.14  ? 67  PRO A C     1 
ATOM   240   O O     . PRO A 1  70  ? 98.984  120.061 135.419 1.00 87.64  ? 67  PRO A O     1 
ATOM   241   C CB    . PRO A 1  70  ? 100.831 122.118 137.427 1.00 89.18  ? 67  PRO A CB    1 
ATOM   242   C CG    . PRO A 1  70  ? 101.348 122.223 138.829 1.00 92.88  ? 67  PRO A CG    1 
ATOM   243   C CD    . PRO A 1  70  ? 101.707 120.813 139.210 1.00 91.20  ? 67  PRO A CD    1 
ATOM   244   N N     . PHE A 1  71  ? 101.172 119.598 135.650 1.00 85.47  ? 68  PHE A N     1 
ATOM   245   C CA    . PHE A 1  71  ? 101.226 118.934 134.363 1.00 84.57  ? 68  PHE A CA    1 
ATOM   246   C C     . PHE A 1  71  ? 100.358 117.698 134.370 1.00 85.33  ? 68  PHE A C     1 
ATOM   247   O O     . PHE A 1  71  ? 99.571  117.472 133.451 1.00 83.42  ? 68  PHE A O     1 
ATOM   248   C CB    . PHE A 1  71  ? 102.645 118.541 133.988 1.00 84.34  ? 68  PHE A CB    1 
ATOM   249   C CG    . PHE A 1  71  ? 102.699 117.902 132.657 1.00 81.97  ? 68  PHE A CG    1 
ATOM   250   C CD1   . PHE A 1  71  ? 102.642 118.668 131.510 1.00 84.31  ? 68  PHE A CD1   1 
ATOM   251   C CD2   . PHE A 1  71  ? 102.737 116.533 132.538 1.00 87.10  ? 68  PHE A CD2   1 
ATOM   252   C CE1   . PHE A 1  71  ? 102.628 118.073 130.272 1.00 88.68  ? 68  PHE A CE1   1 
ATOM   253   C CE2   . PHE A 1  71  ? 102.718 115.935 131.303 1.00 89.08  ? 68  PHE A CE2   1 
ATOM   254   C CZ    . PHE A 1  71  ? 102.660 116.706 130.170 1.00 89.77  ? 68  PHE A CZ    1 
ATOM   255   N N     . GLN A 1  72  ? 100.493 116.898 135.417 1.00 84.98  ? 69  GLN A N     1 
ATOM   256   C CA    . GLN A 1  72  ? 99.747  115.663 135.515 1.00 86.55  ? 69  GLN A CA    1 
ATOM   257   C C     . GLN A 1  72  ? 98.261  115.936 135.443 1.00 85.38  ? 69  GLN A C     1 
ATOM   258   O O     . GLN A 1  72  ? 97.513  115.205 134.791 1.00 83.36  ? 69  GLN A O     1 
ATOM   259   C CB    . GLN A 1  72  ? 100.076 114.954 136.821 1.00 84.71  ? 69  GLN A CB    1 
ATOM   260   C CG    . GLN A 1  72  ? 99.396  113.629 136.984 1.00 88.02  ? 69  GLN A CG    1 
ATOM   261   C CD    . GLN A 1  72  ? 99.858  112.917 138.211 1.00 92.48  ? 69  GLN A CD    1 
ATOM   262   O OE1   . GLN A 1  72  ? 100.162 113.540 139.227 1.00 94.54  ? 69  GLN A OE1   1 
ATOM   263   N NE2   . GLN A 1  72  ? 99.926  111.599 138.137 1.00 93.96  ? 69  GLN A NE2   1 
ATOM   264   N N     . ARG A 1  73  ? 97.828  116.998 136.103 1.00 83.93  ? 70  ARG A N     1 
ATOM   265   C CA    . ARG A 1  73  ? 96.425  117.344 136.071 1.00 87.21  ? 70  ARG A CA    1 
ATOM   266   C C     . ARG A 1  73  ? 95.994  117.773 134.682 1.00 86.50  ? 70  ARG A C     1 
ATOM   267   O O     . ARG A 1  73  ? 94.952  117.340 134.198 1.00 86.38  ? 70  ARG A O     1 
ATOM   268   C CB    . ARG A 1  73  ? 96.116  118.432 137.058 1.00 89.39  ? 70  ARG A CB    1 
ATOM   269   C CG    . ARG A 1  73  ? 96.196  117.999 138.484 1.00 91.94  ? 70  ARG A CG    1 
ATOM   270   C CD    . ARG A 1  73  ? 95.546  118.964 139.366 1.00 95.87  ? 70  ARG A CD    1 
ATOM   271   N NE    . ARG A 1  73  ? 96.189  120.246 139.335 1.00 95.72  ? 70  ARG A NE    1 
ATOM   272   C CZ    . ARG A 1  73  ? 97.178  120.642 140.159 1.00 97.14  ? 70  ARG A CZ    1 
ATOM   273   N NH1   . ARG A 1  73  ? 97.639  119.849 141.097 1.00 95.86  ? 70  ARG A NH1   1 
ATOM   274   N NH2   . ARG A 1  73  ? 97.672  121.852 140.042 1.00 96.89  ? 70  ARG A NH2   1 
ATOM   275   N N     . LEU A 1  74  ? 96.837  118.538 133.996 1.00 84.56  ? 71  LEU A N     1 
ATOM   276   C CA    . LEU A 1  74  ? 96.507  118.956 132.643 1.00 86.13  ? 71  LEU A CA    1 
ATOM   277   C C     . LEU A 1  74  ? 96.318  117.741 131.752 1.00 84.71  ? 71  LEU A C     1 
ATOM   278   O O     . LEU A 1  74  ? 95.370  117.677 130.967 1.00 83.37  ? 71  LEU A O     1 
ATOM   279   C CB    . LEU A 1  74  ? 97.596  119.874 132.079 1.00 84.65  ? 71  LEU A CB    1 
ATOM   280   C CG    . LEU A 1  74  ? 97.398  120.362 130.629 1.00 88.38  ? 71  LEU A CG    1 
ATOM   281   C CD1   . LEU A 1  74  ? 96.092  121.138 130.504 1.00 92.32  ? 71  LEU A CD1   1 
ATOM   282   C CD2   . LEU A 1  74  ? 98.586  121.239 130.237 1.00 92.78  ? 71  LEU A CD2   1 
ATOM   283   N N     . VAL A 1  75  ? 97.175  116.742 131.923 1.00 82.49  ? 72  VAL A N     1 
ATOM   284   C CA    . VAL A 1  75  ? 97.052  115.531 131.133 1.00 82.65  ? 72  VAL A CA    1 
ATOM   285   C C     . VAL A 1  75  ? 95.700  114.900 131.358 1.00 82.36  ? 72  VAL A C     1 
ATOM   286   O O     . VAL A 1  75  ? 94.995  114.559 130.409 1.00 82.65  ? 72  VAL A O     1 
ATOM   287   C CB    . VAL A 1  75  ? 98.131  114.506 131.534 1.00 82.55  ? 72  VAL A CB    1 
ATOM   288   C CG1   . VAL A 1  75  ? 97.847  113.144 130.903 1.00 87.00  ? 72  VAL A CG1   1 
ATOM   289   C CG2   . VAL A 1  75  ? 99.485  115.002 131.107 1.00 88.65  ? 72  VAL A CG2   1 
ATOM   290   N N     . ARG A 1  76  ? 95.318  114.793 132.615 1.00 80.19  ? 73  ARG A N     1 
ATOM   291   C CA    . ARG A 1  76  ? 94.070  114.155 132.952 1.00 81.86  ? 73  ARG A CA    1 
ATOM   292   C C     . ARG A 1  76  ? 92.851  114.951 132.526 1.00 85.22  ? 73  ARG A C     1 
ATOM   293   O O     . ARG A 1  76  ? 91.893  114.383 132.008 1.00 84.29  ? 73  ARG A O     1 
ATOM   294   C CB    . ARG A 1  76  ? 94.029  113.893 134.422 1.00 82.26  ? 73  ARG A CB    1 
ATOM   295   C CG    . ARG A 1  76  ? 94.942  112.821 134.846 1.00 85.35  ? 73  ARG A CG    1 
ATOM   296   C CD    . ARG A 1  76  ? 94.946  112.659 136.274 1.00 83.57  ? 73  ARG A CD    1 
ATOM   297   N NE    . ARG A 1  76  ? 95.790  111.582 136.662 1.00 84.41  ? 73  ARG A NE    1 
ATOM   298   C CZ    . ARG A 1  76  ? 96.159  111.337 137.910 1.00 89.97  ? 73  ARG A CZ    1 
ATOM   299   N NH1   . ARG A 1  76  ? 95.756  112.123 138.871 1.00 94.39  ? 73  ARG A NH1   1 
ATOM   300   N NH2   . ARG A 1  76  ? 96.921  110.304 138.179 1.00 91.62  ? 73  ARG A NH2   1 
ATOM   301   N N     . GLU A 1  77  ? 92.904  116.268 132.666 1.00 88.09  ? 74  GLU A N     1 
ATOM   302   C CA    . GLU A 1  77  ? 91.767  117.080 132.266 1.00 91.33  ? 74  GLU A CA    1 
ATOM   303   C C     . GLU A 1  77  ? 91.450  116.826 130.811 1.00 86.82  ? 74  GLU A C     1 
ATOM   304   O O     . GLU A 1  77  ? 90.290  116.674 130.433 1.00 88.45  ? 74  GLU A O     1 
ATOM   305   C CB    . GLU A 1  77  ? 92.053  118.561 132.471 1.00 98.08  ? 74  GLU A CB    1 
ATOM   306   C CG    . GLU A 1  77  ? 90.907  119.480 132.061 0.00 106.41 ? 74  GLU A CG    1 
ATOM   307   C CD    . GLU A 1  77  ? 91.202  120.922 132.331 0.00 112.17 ? 74  GLU A CD    1 
ATOM   308   O OE1   . GLU A 1  77  ? 92.215  121.188 132.934 0.00 108.35 ? 74  GLU A OE1   1 
ATOM   309   O OE2   . GLU A 1  77  ? 90.409  121.764 131.960 0.00 116.71 ? 74  GLU A OE2   1 
ATOM   310   N N     . ILE A 1  78  ? 92.492  116.736 130.001 1.00 83.27  ? 75  ILE A N     1 
ATOM   311   C CA    . ILE A 1  78  ? 92.320  116.434 128.597 1.00 83.00  ? 75  ILE A CA    1 
ATOM   312   C C     . ILE A 1  78  ? 91.823  115.008 128.413 1.00 86.84  ? 75  ILE A C     1 
ATOM   313   O O     . ILE A 1  78  ? 90.903  114.753 127.641 1.00 88.01  ? 75  ILE A O     1 
ATOM   314   C CB    . ILE A 1  78  ? 93.634  116.618 127.835 1.00 83.00  ? 75  ILE A CB    1 
ATOM   315   C CG1   . ILE A 1  78  ? 94.033  118.102 127.823 1.00 85.52  ? 75  ILE A CG1   1 
ATOM   316   C CG2   . ILE A 1  78  ? 93.483  116.083 126.427 1.00 88.71  ? 75  ILE A CG2   1 
ATOM   317   C CD1   . ILE A 1  78  ? 95.463  118.358 127.368 1.00 89.57  ? 75  ILE A CD1   1 
ATOM   318   N N     . ALA A 1  79  ? 92.429  114.073 129.130 1.00 83.24  ? 76  ALA A N     1 
ATOM   319   C CA    . ALA A 1  79  ? 92.070  112.671 128.997 1.00 83.95  ? 76  ALA A CA    1 
ATOM   320   C C     . ALA A 1  79  ? 90.598  112.431 129.311 1.00 86.35  ? 76  ALA A C     1 
ATOM   321   O O     . ALA A 1  79  ? 89.935  111.644 128.633 1.00 89.12  ? 76  ALA A O     1 
ATOM   322   C CB    . ALA A 1  79  ? 92.941  111.827 129.904 1.00 84.75  ? 76  ALA A CB    1 
ATOM   323   N N     . GLN A 1  80  ? 90.062  113.202 130.252 1.00 85.00  ? 77  GLN A N     1 
ATOM   324   C CA    . GLN A 1  80  ? 88.675  113.066 130.677 1.00 86.37  ? 77  GLN A CA    1 
ATOM   325   C C     . GLN A 1  80  ? 87.687  113.374 129.562 1.00 89.41  ? 77  GLN A C     1 
ATOM   326   O O     . GLN A 1  80  ? 86.512  113.022 129.658 1.00 92.47  ? 77  GLN A O     1 
ATOM   327   C CB    . GLN A 1  80  ? 88.383  113.949 131.891 1.00 86.61  ? 77  GLN A CB    1 
ATOM   328   C CG    . GLN A 1  80  ? 89.016  113.449 133.176 1.00 92.94  ? 77  GLN A CG    1 
ATOM   329   C CD    . GLN A 1  80  ? 88.797  114.378 134.375 1.00 107.62 ? 77  GLN A CD    1 
ATOM   330   O OE1   . GLN A 1  80  ? 88.429  115.553 134.249 1.00 107.66 ? 77  GLN A OE1   1 
ATOM   331   N NE2   . GLN A 1  80  ? 89.023  113.833 135.565 1.00 110.94 ? 77  GLN A NE2   1 
ATOM   332   N N     . ASP A 1  81  ? 88.145  114.047 128.514 1.00 88.97  ? 78  ASP A N     1 
ATOM   333   C CA    . ASP A 1  81  ? 87.271  114.367 127.399 1.00 93.27  ? 78  ASP A CA    1 
ATOM   334   C C     . ASP A 1  81  ? 87.223  113.234 126.385 1.00 91.26  ? 78  ASP A C     1 
ATOM   335   O O     . ASP A 1  81  ? 86.459  113.289 125.421 1.00 96.08  ? 78  ASP A O     1 
ATOM   336   C CB    . ASP A 1  81  ? 87.706  115.659 126.713 1.00 101.66 ? 78  ASP A CB    1 
ATOM   337   C CG    . ASP A 1  81  ? 87.420  116.903 127.546 0.00 109.81 ? 78  ASP A CG    1 
ATOM   338   O OD1   . ASP A 1  81  ? 86.472  116.894 128.300 0.00 109.04 ? 78  ASP A OD1   1 
ATOM   339   O OD2   . ASP A 1  81  ? 88.143  117.860 127.406 0.00 109.37 ? 78  ASP A OD2   1 
ATOM   340   N N     . PHE A 1  82  ? 88.026  112.200 126.600 1.00 88.30  ? 79  PHE A N     1 
ATOM   341   C CA    . PHE A 1  82  ? 87.999  111.055 125.709 1.00 88.07  ? 79  PHE A CA    1 
ATOM   342   C C     . PHE A 1  82  ? 87.223  109.945 126.377 1.00 91.85  ? 79  PHE A C     1 
ATOM   343   O O     . PHE A 1  82  ? 86.458  109.227 125.733 1.00 96.42  ? 79  PHE A O     1 
ATOM   344   C CB    . PHE A 1  82  ? 89.411  110.566 125.397 1.00 88.68  ? 79  PHE A CB    1 
ATOM   345   C CG    . PHE A 1  82  ? 90.273  111.590 124.753 1.00 92.05  ? 79  PHE A CG    1 
ATOM   346   C CD1   . PHE A 1  82  ? 91.550  111.808 125.223 1.00 91.89  ? 79  PHE A CD1   1 
ATOM   347   C CD2   . PHE A 1  82  ? 89.810  112.367 123.706 1.00 91.63  ? 79  PHE A CD2   1 
ATOM   348   C CE1   . PHE A 1  82  ? 92.351  112.769 124.662 1.00 93.39  ? 79  PHE A CE1   1 
ATOM   349   C CE2   . PHE A 1  82  ? 90.609  113.332 123.148 1.00 95.19  ? 79  PHE A CE2   1 
ATOM   350   C CZ    . PHE A 1  82  ? 91.880  113.530 123.628 1.00 96.60  ? 79  PHE A CZ    1 
ATOM   351   N N     . LYS A 1  83  ? 87.474  109.760 127.665 1.00 91.77  ? 80  LYS A N     1 
ATOM   352   C CA    . LYS A 1  83  ? 86.740  108.762 128.428 1.00 95.76  ? 80  LYS A CA    1 
ATOM   353   C C     . LYS A 1  83  ? 86.868  109.016 129.923 1.00 98.89  ? 80  LYS A C     1 
ATOM   354   O O     . LYS A 1  83  ? 87.844  109.613 130.372 1.00 95.64  ? 80  LYS A O     1 
ATOM   355   C CB    . LYS A 1  83  ? 87.248  107.369 128.069 1.00 94.57  ? 80  LYS A CB    1 
ATOM   356   C CG    . LYS A 1  83  ? 86.257  106.246 128.311 1.00 102.95 ? 80  LYS A CG    1 
ATOM   357   C CD    . LYS A 1  83  ? 86.629  105.026 127.488 1.00 109.40 ? 80  LYS A CD    1 
ATOM   358   C CE    . LYS A 1  83  ? 85.471  104.050 127.376 1.00 116.29 ? 80  LYS A CE    1 
ATOM   359   N NZ    . LYS A 1  83  ? 85.430  103.093 128.511 1.00 113.55 ? 80  LYS A NZ    1 
ATOM   360   N N     . THR A 1  84  ? 85.881  108.588 130.695 1.00 100.47 ? 81  THR A N     1 
ATOM   361   C CA    . THR A 1  84  ? 85.949  108.722 132.135 1.00 104.83 ? 81  THR A CA    1 
ATOM   362   C C     . THR A 1  84  ? 86.793  107.612 132.724 1.00 101.56 ? 81  THR A C     1 
ATOM   363   O O     . THR A 1  84  ? 87.090  106.618 132.063 1.00 100.21 ? 81  THR A O     1 
ATOM   364   C CB    . THR A 1  84  ? 84.544  108.692 132.768 1.00 109.39 ? 81  THR A CB    1 
ATOM   365   O OG1   . THR A 1  84  ? 83.943  107.406 132.559 1.00 107.98 ? 81  THR A OG1   1 
ATOM   366   C CG2   . THR A 1  84  ? 83.670  109.758 132.134 1.00 109.13 ? 81  THR A CG2   1 
ATOM   367   N N     . ASP A 1  85  ? 87.179  107.783 133.977 1.00 101.12 ? 82  ASP A N     1 
ATOM   368   C CA    . ASP A 1  85  ? 87.824  106.723 134.729 1.00 101.41 ? 82  ASP A CA    1 
ATOM   369   C C     . ASP A 1  85  ? 89.089  106.200 134.057 1.00 97.05  ? 82  ASP A C     1 
ATOM   370   O O     . ASP A 1  85  ? 89.391  105.009 134.136 1.00 99.22  ? 82  ASP A O     1 
ATOM   371   C CB    . ASP A 1  85  ? 86.833  105.576 134.896 1.00 109.12 ? 82  ASP A CB    1 
ATOM   372   C CG    . ASP A 1  85  ? 85.516  106.057 135.473 1.00 115.88 ? 82  ASP A CG    1 
ATOM   373   O OD1   . ASP A 1  85  ? 85.536  106.719 136.485 1.00 115.51 ? 82  ASP A OD1   1 
ATOM   374   O OD2   . ASP A 1  85  ? 84.503  105.838 134.843 1.00 115.75 ? 82  ASP A OD2   1 
ATOM   375   N N     . LEU A 1  86  ? 89.851  107.090 133.440 1.00 93.33  ? 83  LEU A N     1 
ATOM   376   C CA    . LEU A 1  86  ? 91.113  106.694 132.836 1.00 91.07  ? 83  LEU A CA    1 
ATOM   377   C C     . LEU A 1  86  ? 92.239  106.836 133.831 1.00 91.77  ? 83  LEU A C     1 
ATOM   378   O O     . LEU A 1  86  ? 92.197  107.695 134.710 1.00 94.58  ? 83  LEU A O     1 
ATOM   379   C CB    . LEU A 1  86  ? 91.420  107.538 131.597 1.00 93.82  ? 83  LEU A CB    1 
ATOM   380   C CG    . LEU A 1  86  ? 90.441  107.407 130.433 1.00 102.00 ? 83  LEU A CG    1 
ATOM   381   C CD1   . LEU A 1  86  ? 90.797  108.436 129.365 1.00 103.30 ? 83  LEU A CD1   1 
ATOM   382   C CD2   . LEU A 1  86  ? 90.513  105.988 129.858 1.00 97.50  ? 83  LEU A CD2   1 
ATOM   383   N N     . ARG A 1  87  ? 93.259  106.007 133.677 1.00 91.55  ? 84  ARG A N     1 
ATOM   384   C CA    . ARG A 1  87  ? 94.427  106.088 134.536 1.00 91.25  ? 84  ARG A CA    1 
ATOM   385   C C     . ARG A 1  87  ? 95.710  106.104 133.752 1.00 89.92  ? 84  ARG A C     1 
ATOM   386   O O     . ARG A 1  87  ? 95.735  105.750 132.574 1.00 85.98  ? 84  ARG A O     1 
ATOM   387   C CB    . ARG A 1  87  ? 94.487  104.920 135.471 1.00 88.54  ? 84  ARG A CB    1 
ATOM   388   C CG    . ARG A 1  87  ? 93.371  104.819 136.401 1.00 92.37  ? 84  ARG A CG    1 
ATOM   389   C CD    . ARG A 1  87  ? 93.627  103.753 137.337 1.00 99.37  ? 84  ARG A CD    1 
ATOM   390   N NE    . ARG A 1  87  ? 92.494  103.466 138.158 1.00 105.66 ? 84  ARG A NE    1 
ATOM   391   C CZ    . ARG A 1  87  ? 92.472  102.498 139.075 1.00 109.80 ? 84  ARG A CZ    1 
ATOM   392   N NH1   . ARG A 1  87  ? 93.547  101.779 139.283 1.00 106.24 ? 84  ARG A NH1   1 
ATOM   393   N NH2   . ARG A 1  87  ? 91.373  102.255 139.756 1.00 110.65 ? 84  ARG A NH2   1 
ATOM   394   N N     . PHE A 1  88  ? 96.770  106.543 134.409 1.00 87.28  ? 85  PHE A N     1 
ATOM   395   C CA    . PHE A 1  88  ? 98.086  106.566 133.799 1.00 86.72  ? 85  PHE A CA    1 
ATOM   396   C C     . PHE A 1  88  ? 99.132  105.995 134.729 1.00 88.62  ? 85  PHE A C     1 
ATOM   397   O O     . PHE A 1  88  ? 99.151  106.317 135.915 1.00 89.92  ? 85  PHE A O     1 
ATOM   398   C CB    . PHE A 1  88  ? 98.477  107.999 133.453 1.00 86.21  ? 85  PHE A CB    1 
ATOM   399   C CG    . PHE A 1  88  ? 97.612  108.631 132.427 1.00 85.38  ? 85  PHE A CG    1 
ATOM   400   C CD1   . PHE A 1  88  ? 96.414  109.230 132.775 1.00 84.87  ? 85  PHE A CD1   1 
ATOM   401   C CD2   . PHE A 1  88  ? 98.004  108.646 131.108 1.00 88.48  ? 85  PHE A CD2   1 
ATOM   402   C CE1   . PHE A 1  88  ? 95.617  109.808 131.814 1.00 89.08  ? 85  PHE A CE1   1 
ATOM   403   C CE2   . PHE A 1  88  ? 97.212  109.224 130.146 1.00 92.40  ? 85  PHE A CE2   1 
ATOM   404   C CZ    . PHE A 1  88  ? 96.016  109.802 130.497 1.00 93.42  ? 85  PHE A CZ    1 
ATOM   405   N N     . GLN A 1  89  ? 100.103 105.305 134.157 1.00 89.27  ? 86  GLN A N     1 
ATOM   406   C CA    . GLN A 1  89  ? 101.277 104.918 134.919 1.00 88.15  ? 86  GLN A CA    1 
ATOM   407   C C     . GLN A 1  89  ? 102.060 106.175 135.233 1.00 89.04  ? 86  GLN A C     1 
ATOM   408   O O     . GLN A 1  89  ? 102.107 107.093 134.412 1.00 87.58  ? 86  GLN A O     1 
ATOM   409   C CB    . GLN A 1  89  ? 102.159 103.962 134.120 1.00 89.81  ? 86  GLN A CB    1 
ATOM   410   C CG    . GLN A 1  89  ? 101.549 102.615 133.859 1.00 92.49  ? 86  GLN A CG    1 
ATOM   411   C CD    . GLN A 1  89  ? 102.479 101.714 133.063 1.00 95.25  ? 86  GLN A CD    1 
ATOM   412   O OE1   . GLN A 1  89  ? 103.174 102.157 132.135 1.00 92.52  ? 86  GLN A OE1   1 
ATOM   413   N NE2   . GLN A 1  89  ? 102.499 100.439 133.419 1.00 99.35  ? 86  GLN A NE2   1 
ATOM   414   N N     . SER A 1  90  ? 102.756 106.200 136.362 1.00 89.89  ? 87  SER A N     1 
ATOM   415   C CA    . SER A 1  90  ? 103.513 107.399 136.693 1.00 90.80  ? 87  SER A CA    1 
ATOM   416   C C     . SER A 1  90  ? 104.558 107.679 135.625 1.00 88.07  ? 87  SER A C     1 
ATOM   417   O O     . SER A 1  90  ? 104.833 108.835 135.295 1.00 89.35  ? 87  SER A O     1 
ATOM   418   C CB    . SER A 1  90  ? 104.193 107.233 138.033 1.00 95.49  ? 87  SER A CB    1 
ATOM   419   O OG    . SER A 1  90  ? 105.197 106.261 137.962 1.00 96.07  ? 87  SER A OG    1 
ATOM   420   N N     . SER A 1  91  ? 105.044 106.616 135.000 1.00 85.31  ? 88  SER A N     1 
ATOM   421   C CA    . SER A 1  91  ? 106.029 106.728 133.944 1.00 86.53  ? 88  SER A CA    1 
ATOM   422   C C     . SER A 1  91  ? 105.419 107.256 132.653 1.00 86.43  ? 88  SER A C     1 
ATOM   423   O O     . SER A 1  91  ? 106.131 107.781 131.796 1.00 87.81  ? 88  SER A O     1 
ATOM   424   C CB    . SER A 1  91  ? 106.667 105.378 133.708 1.00 88.92  ? 88  SER A CB    1 
ATOM   425   O OG    . SER A 1  91  ? 105.724 104.457 133.238 1.00 90.78  ? 88  SER A OG    1 
ATOM   426   N N     . ALA A 1  92  ? 104.107 107.100 132.497 1.00 84.30  ? 89  ALA A N     1 
ATOM   427   C CA    . ALA A 1  92  ? 103.436 107.580 131.301 1.00 85.94  ? 89  ALA A CA    1 
ATOM   428   C C     . ALA A 1  92  ? 103.318 109.083 131.368 1.00 85.09  ? 89  ALA A C     1 
ATOM   429   O O     . ALA A 1  92  ? 103.485 109.779 130.367 1.00 83.90  ? 89  ALA A O     1 
ATOM   430   C CB    . ALA A 1  92  ? 102.062 106.950 131.159 1.00 88.03  ? 89  ALA A CB    1 
ATOM   431   N N     . VAL A 1  93  ? 103.083 109.584 132.568 1.00 81.65  ? 90  VAL A N     1 
ATOM   432   C CA    . VAL A 1  93  ? 102.957 111.013 132.752 1.00 80.83  ? 90  VAL A CA    1 
ATOM   433   C C     . VAL A 1  93  ? 104.301 111.659 132.496 1.00 84.57  ? 90  VAL A C     1 
ATOM   434   O O     . VAL A 1  93  ? 104.387 112.694 131.833 1.00 84.38  ? 90  VAL A O     1 
ATOM   435   C CB    . VAL A 1  93  ? 102.455 111.341 134.163 1.00 84.15  ? 90  VAL A CB    1 
ATOM   436   C CG1   . VAL A 1  93  ? 102.461 112.852 134.391 1.00 89.50  ? 90  VAL A CG1   1 
ATOM   437   C CG2   . VAL A 1  93  ? 101.058 110.770 134.338 1.00 88.88  ? 90  VAL A CG2   1 
ATOM   438   N N     . MET A 1  94  ? 105.356 111.035 133.010 1.00 85.01  ? 91  MET A N     1 
ATOM   439   C CA    . MET A 1  94  ? 106.701 111.537 132.792 1.00 87.71  ? 91  MET A CA    1 
ATOM   440   C C     . MET A 1  94  ? 107.035 111.539 131.310 1.00 84.95  ? 91  MET A C     1 
ATOM   441   O O     . MET A 1  94  ? 107.636 112.489 130.806 1.00 85.93  ? 91  MET A O     1 
ATOM   442   C CB    . MET A 1  94  ? 107.707 110.685 133.554 1.00 88.67  ? 91  MET A CB    1 
ATOM   443   C CG    . MET A 1  94  ? 107.628 110.822 135.065 1.00 96.52  ? 91  MET A CG    1 
ATOM   444   S SD    . MET A 1  94  ? 107.992 112.487 135.654 1.00 118.27 ? 91  MET A SD    1 
ATOM   445   C CE    . MET A 1  94  ? 109.766 112.565 135.418 1.00 121.37 ? 91  MET A CE    1 
ATOM   446   N N     . ALA A 1  95  ? 106.627 110.489 130.603 1.00 82.01  ? 92  ALA A N     1 
ATOM   447   C CA    . ALA A 1  95  ? 106.884 110.413 129.176 1.00 84.71  ? 92  ALA A CA    1 
ATOM   448   C C     . ALA A 1  95  ? 106.186 111.545 128.440 1.00 83.44  ? 92  ALA A C     1 
ATOM   449   O O     . ALA A 1  95  ? 106.784 112.199 127.582 1.00 84.99  ? 92  ALA A O     1 
ATOM   450   C CB    . ALA A 1  95  ? 106.418 109.073 128.633 1.00 88.13  ? 92  ALA A CB    1 
ATOM   451   N N     . LEU A 1  96  ? 104.956 111.843 128.843 1.00 79.70  ? 93  LEU A N     1 
ATOM   452   C CA    . LEU A 1  96  ? 104.215 112.918 128.208 1.00 79.69  ? 93  LEU A CA    1 
ATOM   453   C C     . LEU A 1  96  ? 104.873 114.258 128.454 1.00 84.13  ? 93  LEU A C     1 
ATOM   454   O O     . LEU A 1  96  ? 105.000 115.069 127.535 1.00 84.25  ? 93  LEU A O     1 
ATOM   455   C CB    . LEU A 1  96  ? 102.780 112.966 128.739 1.00 78.46  ? 93  LEU A CB    1 
ATOM   456   C CG    . LEU A 1  96  ? 101.850 111.842 128.297 1.00 82.75  ? 93  LEU A CG    1 
ATOM   457   C CD1   . LEU A 1  96  ? 100.591 111.887 129.128 1.00 87.96  ? 93  LEU A CD1   1 
ATOM   458   C CD2   . LEU A 1  96  ? 101.504 112.013 126.837 1.00 83.66  ? 93  LEU A CD2   1 
ATOM   459   N N     . GLN A 1  97  ? 105.343 114.480 129.675 1.00 83.50  ? 94  GLN A N     1 
ATOM   460   C CA    . GLN A 1  97  ? 105.938 115.767 129.975 1.00 84.90  ? 94  GLN A CA    1 
ATOM   461   C C     . GLN A 1  97  ? 107.244 115.940 129.235 1.00 85.45  ? 94  GLN A C     1 
ATOM   462   O O     . GLN A 1  97  ? 107.543 117.027 128.741 1.00 84.82  ? 94  GLN A O     1 
ATOM   463   C CB    . GLN A 1  97  ? 106.164 115.962 131.467 1.00 83.60  ? 94  GLN A CB    1 
ATOM   464   C CG    . GLN A 1  97  ? 106.548 117.379 131.792 1.00 90.52  ? 94  GLN A CG    1 
ATOM   465   C CD    . GLN A 1  97  ? 106.607 117.670 133.253 1.00 95.98  ? 94  GLN A CD    1 
ATOM   466   O OE1   . GLN A 1  97  ? 105.954 117.021 134.076 1.00 92.92  ? 94  GLN A OE1   1 
ATOM   467   N NE2   . GLN A 1  97  ? 107.405 118.672 133.596 1.00 98.24  ? 94  GLN A NE2   1 
ATOM   468   N N     . GLU A 1  98  ? 108.007 114.864 129.120 1.00 81.51  ? 95  GLU A N     1 
ATOM   469   C CA    . GLU A 1  98  ? 109.289 114.947 128.448 1.00 84.14  ? 95  GLU A CA    1 
ATOM   470   C C     . GLU A 1  98  ? 109.070 115.327 126.995 1.00 84.82  ? 95  GLU A C     1 
ATOM   471   O O     . GLU A 1  98  ? 109.756 116.200 126.456 1.00 85.44  ? 95  GLU A O     1 
ATOM   472   C CB    . GLU A 1  98  ? 110.001 113.598 128.523 1.00 88.60  ? 95  GLU A CB    1 
ATOM   473   C CG    . GLU A 1  98  ? 111.456 113.612 128.094 1.00 96.98  ? 95  GLU A CG    1 
ATOM   474   C CD    . GLU A 1  98  ? 112.342 114.303 129.085 0.00 102.44 ? 95  GLU A CD    1 
ATOM   475   O OE1   . GLU A 1  98  ? 111.898 114.548 130.178 0.00 99.30  ? 95  GLU A OE1   1 
ATOM   476   O OE2   . GLU A 1  98  ? 113.472 114.584 128.755 0.00 100.59 ? 95  GLU A OE2   1 
ATOM   477   N N     . ALA A 1  99  ? 108.060 114.716 126.378 1.00 81.32  ? 96  ALA A N     1 
ATOM   478   C CA    . ALA A 1  99  ? 107.732 115.007 124.993 1.00 83.43  ? 96  ALA A CA    1 
ATOM   479   C C     . ALA A 1  99  ? 107.279 116.446 124.828 1.00 84.49  ? 96  ALA A C     1 
ATOM   480   O O     . ALA A 1  99  ? 107.616 117.104 123.843 1.00 84.98  ? 96  ALA A O     1 
ATOM   481   C CB    . ALA A 1  99  ? 106.637 114.071 124.509 1.00 85.02  ? 96  ALA A CB    1 
ATOM   482   N N     . CYS A 1  100 ? 106.504 116.930 125.791 1.00 82.25  ? 97  CYS A N     1 
ATOM   483   C CA    . CYS A 1  100 ? 105.945 118.269 125.708 1.00 83.62  ? 97  CYS A CA    1 
ATOM   484   C C     . CYS A 1  100 ? 106.998 119.342 125.827 1.00 84.19  ? 97  CYS A C     1 
ATOM   485   O O     . CYS A 1  100 ? 106.987 120.314 125.071 1.00 82.41  ? 97  CYS A O     1 
ATOM   486   C CB    . CYS A 1  100 ? 104.907 118.484 126.794 1.00 84.42  ? 97  CYS A CB    1 
ATOM   487   S SG    . CYS A 1  100 ? 103.426 117.534 126.547 1.00 97.75  ? 97  CYS A SG    1 
ATOM   488   N N     . GLU A 1  101 ? 107.912 119.182 126.771 1.00 82.89  ? 98  GLU A N     1 
ATOM   489   C CA    . GLU A 1  101 ? 108.927 120.199 126.929 1.00 84.85  ? 98  GLU A CA    1 
ATOM   490   C C     . GLU A 1  101 ? 109.835 120.206 125.721 1.00 85.14  ? 98  GLU A C     1 
ATOM   491   O O     . GLU A 1  101 ? 110.042 121.245 125.095 1.00 82.80  ? 98  GLU A O     1 
ATOM   492   C CB    . GLU A 1  101 ? 109.746 119.962 128.188 1.00 88.63  ? 98  GLU A CB    1 
ATOM   493   C CG    . GLU A 1  101 ? 108.985 120.174 129.477 1.00 97.21  ? 98  GLU A CG    1 
ATOM   494   C CD    . GLU A 1  101 ? 109.887 120.169 130.662 0.00 101.90 ? 98  GLU A CD    1 
ATOM   495   O OE1   . GLU A 1  101 ? 111.037 119.848 130.493 0.00 103.44 ? 98  GLU A OE1   1 
ATOM   496   O OE2   . GLU A 1  101 ? 109.455 120.544 131.732 0.00 98.84  ? 98  GLU A OE2   1 
ATOM   497   N N     . ALA A 1  102 ? 110.212 119.021 125.261 1.00 82.21  ? 99  ALA A N     1 
ATOM   498   C CA    . ALA A 1  102 ? 111.084 118.946 124.105 1.00 85.05  ? 99  ALA A CA    1 
ATOM   499   C C     . ALA A 1  102 ? 110.425 119.624 122.918 1.00 83.74  ? 99  ALA A C     1 
ATOM   500   O O     . ALA A 1  102 ? 111.075 120.356 122.166 1.00 84.13  ? 99  ALA A O     1 
ATOM   501   C CB    . ALA A 1  102 ? 111.401 117.497 123.780 1.00 90.08  ? 99  ALA A CB    1 
ATOM   502   N N     . TYR A 1  103 ? 109.120 119.424 122.786 1.00 81.73  ? 100 TYR A N     1 
ATOM   503   C CA    . TYR A 1  103 ? 108.367 120.034 121.710 1.00 82.83  ? 100 TYR A CA    1 
ATOM   504   C C     . TYR A 1  103 ? 108.380 121.548 121.807 1.00 83.21  ? 100 TYR A C     1 
ATOM   505   O O     . TYR A 1  103 ? 108.712 122.236 120.839 1.00 83.22  ? 100 TYR A O     1 
ATOM   506   C CB    . TYR A 1  103 ? 106.933 119.525 121.714 1.00 84.10  ? 100 TYR A CB    1 
ATOM   507   C CG    . TYR A 1  103 ? 106.097 120.166 120.681 1.00 83.97  ? 100 TYR A CG    1 
ATOM   508   C CD1   . TYR A 1  103 ? 106.213 119.761 119.377 1.00 87.86  ? 100 TYR A CD1   1 
ATOM   509   C CD2   . TYR A 1  103 ? 105.224 121.174 121.023 1.00 83.08  ? 100 TYR A CD2   1 
ATOM   510   C CE1   . TYR A 1  103 ? 105.461 120.360 118.407 1.00 90.44  ? 100 TYR A CE1   1 
ATOM   511   C CE2   . TYR A 1  103 ? 104.470 121.776 120.052 1.00 85.90  ? 100 TYR A CE2   1 
ATOM   512   C CZ    . TYR A 1  103 ? 104.589 121.373 118.745 1.00 89.02  ? 100 TYR A CZ    1 
ATOM   513   O OH    . TYR A 1  103 ? 103.846 121.975 117.763 1.00 91.41  ? 100 TYR A OH    1 
ATOM   514   N N     . LEU A 1  104 ? 108.039 122.071 122.978 1.00 80.31  ? 101 LEU A N     1 
ATOM   515   C CA    . LEU A 1  104 ? 107.947 123.511 123.136 1.00 80.02  ? 101 LEU A CA    1 
ATOM   516   C C     . LEU A 1  104 ? 109.292 124.187 122.992 1.00 81.80  ? 101 LEU A C     1 
ATOM   517   O O     . LEU A 1  104 ? 109.378 125.273 122.423 1.00 79.10  ? 101 LEU A O     1 
ATOM   518   C CB    . LEU A 1  104 ? 107.332 123.879 124.485 1.00 80.31  ? 101 LEU A CB    1 
ATOM   519   C CG    . LEU A 1  104 ? 105.836 123.573 124.660 1.00 83.03  ? 101 LEU A CG    1 
ATOM   520   C CD1   . LEU A 1  104 ? 105.453 123.857 126.096 1.00 87.24  ? 101 LEU A CD1   1 
ATOM   521   C CD2   . LEU A 1  104 ? 104.997 124.429 123.700 1.00 85.33  ? 101 LEU A CD2   1 
ATOM   522   N N     . VAL A 1  105 ? 110.349 123.549 123.472 1.00 79.54  ? 102 VAL A N     1 
ATOM   523   C CA    . VAL A 1  105 ? 111.660 124.163 123.365 1.00 79.42  ? 102 VAL A CA    1 
ATOM   524   C C     . VAL A 1  105 ? 112.045 124.291 121.906 1.00 81.05  ? 102 VAL A C     1 
ATOM   525   O O     . VAL A 1  105 ? 112.534 125.338 121.480 1.00 83.11  ? 102 VAL A O     1 
ATOM   526   C CB    . VAL A 1  105 ? 112.723 123.354 124.125 1.00 82.57  ? 102 VAL A CB    1 
ATOM   527   C CG1   . VAL A 1  105 ? 114.122 123.898 123.830 1.00 87.21  ? 102 VAL A CG1   1 
ATOM   528   C CG2   . VAL A 1  105 ? 112.443 123.434 125.612 1.00 88.87  ? 102 VAL A CG2   1 
ATOM   529   N N     . GLY A 1  106 ? 111.815 123.232 121.135 1.00 81.35  ? 103 GLY A N     1 
ATOM   530   C CA    . GLY A 1  106 ? 112.118 123.265 119.713 1.00 86.33  ? 103 GLY A CA    1 
ATOM   531   C C     . GLY A 1  106 ? 111.305 124.345 119.014 1.00 84.49  ? 103 GLY A C     1 
ATOM   532   O O     . GLY A 1  106 ? 111.825 125.085 118.178 1.00 87.50  ? 103 GLY A O     1 
ATOM   533   N N     . LEU A 1  107 ? 110.047 124.487 119.412 1.00 79.69  ? 104 LEU A N     1 
ATOM   534   C CA    . LEU A 1  107 ? 109.204 125.508 118.823 1.00 79.96  ? 104 LEU A CA    1 
ATOM   535   C C     . LEU A 1  107 ? 109.706 126.892 119.180 1.00 82.41  ? 104 LEU A C     1 
ATOM   536   O O     . LEU A 1  107 ? 109.749 127.781 118.329 1.00 82.26  ? 104 LEU A O     1 
ATOM   537   C CB    . LEU A 1  107 ? 107.758 125.345 119.283 1.00 80.60  ? 104 LEU A CB    1 
ATOM   538   C CG    . LEU A 1  107 ? 106.761 126.390 118.760 1.00 82.94  ? 104 LEU A CG    1 
ATOM   539   C CD1   . LEU A 1  107 ? 106.723 126.382 117.228 1.00 90.36  ? 104 LEU A CD1   1 
ATOM   540   C CD2   . LEU A 1  107 ? 105.406 126.073 119.322 1.00 86.95  ? 104 LEU A CD2   1 
ATOM   541   N N     . PHE A 1  108 ? 110.104 127.080 120.431 1.00 80.15  ? 105 PHE A N     1 
ATOM   542   C CA    . PHE A 1  108 ? 110.609 128.372 120.847 1.00 80.37  ? 105 PHE A CA    1 
ATOM   543   C C     . PHE A 1  108 ? 111.880 128.727 120.108 1.00 83.77  ? 105 PHE A C     1 
ATOM   544   O O     . PHE A 1  108 ? 112.089 129.889 119.766 1.00 82.04  ? 105 PHE A O     1 
ATOM   545   C CB    . PHE A 1  108 ? 110.828 128.444 122.353 1.00 81.97  ? 105 PHE A CB    1 
ATOM   546   C CG    . PHE A 1  108 ? 109.596 128.837 123.100 1.00 81.02  ? 105 PHE A CG    1 
ATOM   547   C CD1   . PHE A 1  108 ? 108.995 127.978 124.002 1.00 84.86  ? 105 PHE A CD1   1 
ATOM   548   C CD2   . PHE A 1  108 ? 109.027 130.084 122.889 1.00 80.56  ? 105 PHE A CD2   1 
ATOM   549   C CE1   . PHE A 1  108 ? 107.855 128.359 124.676 1.00 87.27  ? 105 PHE A CE1   1 
ATOM   550   C CE2   . PHE A 1  108 ? 107.889 130.462 123.555 1.00 82.92  ? 105 PHE A CE2   1 
ATOM   551   C CZ    . PHE A 1  108 ? 107.301 129.600 124.449 1.00 86.17  ? 105 PHE A CZ    1 
ATOM   552   N N     . GLU A 1  109 ? 112.738 127.745 119.865 1.00 83.64  ? 106 GLU A N     1 
ATOM   553   C CA    . GLU A 1  109 ? 113.956 128.019 119.121 1.00 87.36  ? 106 GLU A CA    1 
ATOM   554   C C     . GLU A 1  109 ? 113.639 128.516 117.714 1.00 87.40  ? 106 GLU A C     1 
ATOM   555   O O     . GLU A 1  109 ? 114.224 129.498 117.252 1.00 86.90  ? 106 GLU A O     1 
ATOM   556   C CB    . GLU A 1  109 ? 114.843 126.785 119.042 1.00 88.95  ? 106 GLU A CB    1 
ATOM   557   C CG    . GLU A 1  109 ? 116.157 127.036 118.330 1.00 98.97  ? 106 GLU A CG    1 
ATOM   558   C CD    . GLU A 1  109 ? 117.051 125.843 118.299 0.00 112.93 ? 106 GLU A CD    1 
ATOM   559   O OE1   . GLU A 1  109 ? 116.668 124.818 118.807 0.00 109.69 ? 106 GLU A OE1   1 
ATOM   560   O OE2   . GLU A 1  109 ? 118.127 125.952 117.761 0.00 118.89 ? 106 GLU A OE2   1 
ATOM   561   N N     . ASP A 1  110 ? 112.685 127.867 117.046 1.00 86.40  ? 107 ASP A N     1 
ATOM   562   C CA    . ASP A 1  110 ? 112.297 128.297 115.705 1.00 88.82  ? 107 ASP A CA    1 
ATOM   563   C C     . ASP A 1  110 ? 111.633 129.658 115.767 1.00 87.80  ? 107 ASP A C     1 
ATOM   564   O O     . ASP A 1  110 ? 111.820 130.504 114.888 1.00 86.60  ? 107 ASP A O     1 
ATOM   565   C CB    . ASP A 1  110 ? 111.323 127.307 115.066 1.00 94.08  ? 107 ASP A CB    1 
ATOM   566   C CG    . ASP A 1  110 ? 111.963 126.003 114.628 1.00 100.20 ? 107 ASP A CG    1 
ATOM   567   O OD1   . ASP A 1  110 ? 113.168 125.927 114.581 1.00 98.22  ? 107 ASP A OD1   1 
ATOM   568   O OD2   . ASP A 1  110 ? 111.228 125.096 114.301 1.00 96.65  ? 107 ASP A OD2   1 
ATOM   569   N N     . THR A 1  111 ? 110.879 129.873 116.831 1.00 83.83  ? 108 THR A N     1 
ATOM   570   C CA    . THR A 1  111 ? 110.194 131.128 117.053 1.00 84.93  ? 108 THR A CA    1 
ATOM   571   C C     . THR A 1  111 ? 111.211 132.242 117.222 1.00 86.14  ? 108 THR A C     1 
ATOM   572   O O     . THR A 1  111 ? 111.050 133.340 116.687 1.00 86.21  ? 108 THR A O     1 
ATOM   573   C CB    . THR A 1  111 ? 109.321 131.038 118.307 1.00 83.99  ? 108 THR A CB    1 
ATOM   574   O OG1   . THR A 1  111 ? 108.341 130.008 118.139 1.00 84.59  ? 108 THR A OG1   1 
ATOM   575   C CG2   . THR A 1  111 ? 108.643 132.322 118.553 1.00 87.63  ? 108 THR A CG2   1 
ATOM   576   N N     . ASN A 1  112 ? 112.260 131.953 117.980 1.00 83.53  ? 109 ASN A N     1 
ATOM   577   C CA    . ASN A 1  112 ? 113.314 132.914 118.230 1.00 83.49  ? 109 ASN A CA    1 
ATOM   578   C C     . ASN A 1  112 ? 113.993 133.302 116.927 1.00 86.42  ? 109 ASN A C     1 
ATOM   579   O O     . ASN A 1  112 ? 114.247 134.481 116.683 1.00 84.83  ? 109 ASN A O     1 
ATOM   580   C CB    . ASN A 1  112 ? 114.311 132.340 119.215 1.00 86.78  ? 109 ASN A CB    1 
ATOM   581   C CG    . ASN A 1  112 ? 115.263 133.347 119.746 1.00 91.28  ? 109 ASN A CG    1 
ATOM   582   O OD1   . ASN A 1  112 ? 114.852 134.340 120.356 1.00 91.90  ? 109 ASN A OD1   1 
ATOM   583   N ND2   . ASN A 1  112 ? 116.526 133.106 119.543 1.00 94.93  ? 109 ASN A ND2   1 
ATOM   584   N N     . LEU A 1  113 ? 114.205 132.325 116.052 1.00 84.90  ? 110 LEU A N     1 
ATOM   585   C CA    . LEU A 1  113 ? 114.825 132.609 114.768 1.00 84.34  ? 110 LEU A CA    1 
ATOM   586   C C     . LEU A 1  113 ? 113.939 133.512 113.931 1.00 85.00  ? 110 LEU A C     1 
ATOM   587   O O     . LEU A 1  113 ? 114.432 134.392 113.223 1.00 84.25  ? 110 LEU A O     1 
ATOM   588   C CB    . LEU A 1  113 ? 115.098 131.316 113.999 1.00 85.19  ? 110 LEU A CB    1 
ATOM   589   C CG    . LEU A 1  113 ? 116.171 130.391 114.581 1.00 93.56  ? 110 LEU A CG    1 
ATOM   590   C CD1   . LEU A 1  113 ? 116.172 129.095 113.796 1.00 97.07  ? 110 LEU A CD1   1 
ATOM   591   C CD2   . LEU A 1  113 ? 117.538 131.062 114.513 1.00 100.80 ? 110 LEU A CD2   1 
ATOM   592   N N     . CYS A 1  114 ? 112.631 133.304 114.019 1.00 82.60  ? 111 CYS A N     1 
ATOM   593   C CA    . CYS A 1  114 ? 111.697 134.129 113.272 1.00 83.87  ? 111 CYS A CA    1 
ATOM   594   C C     . CYS A 1  114 ? 111.801 135.575 113.731 1.00 85.30  ? 111 CYS A C     1 
ATOM   595   O O     . CYS A 1  114 ? 111.855 136.495 112.913 1.00 85.41  ? 111 CYS A O     1 
ATOM   596   C CB    . CYS A 1  114 ? 110.262 133.649 113.481 1.00 86.89  ? 111 CYS A CB    1 
ATOM   597   S SG    . CYS A 1  114 ? 109.910 132.037 112.763 1.00 97.66  ? 111 CYS A SG    1 
ATOM   598   N N     . ALA A 1  115 ? 111.857 135.770 115.045 1.00 85.79  ? 112 ALA A N     1 
ATOM   599   C CA    . ALA A 1  115 ? 111.968 137.111 115.599 1.00 89.34  ? 112 ALA A CA    1 
ATOM   600   C C     . ALA A 1  115 ? 113.280 137.762 115.190 1.00 86.43  ? 112 ALA A C     1 
ATOM   601   O O     . ALA A 1  115 ? 113.313 138.945 114.854 1.00 84.99  ? 112 ALA A O     1 
ATOM   602   C CB    . ALA A 1  115 ? 111.848 137.073 117.111 1.00 91.44  ? 112 ALA A CB    1 
ATOM   603   N N     . ILE A 1  116 ? 114.344 136.968 115.140 1.00 83.80  ? 113 ILE A N     1 
ATOM   604   C CA    . ILE A 1  116 ? 115.643 137.475 114.728 1.00 84.52  ? 113 ILE A CA    1 
ATOM   605   C C     . ILE A 1  116 ? 115.596 137.926 113.282 1.00 83.77  ? 113 ILE A C     1 
ATOM   606   O O     . ILE A 1  116 ? 116.094 138.996 112.938 1.00 86.85  ? 113 ILE A O     1 
ATOM   607   C CB    . ILE A 1  116 ? 116.748 136.424 114.932 1.00 88.30  ? 113 ILE A CB    1 
ATOM   608   C CG1   . ILE A 1  116 ? 116.976 136.203 116.443 1.00 95.09  ? 113 ILE A CG1   1 
ATOM   609   C CG2   . ILE A 1  116 ? 118.034 136.867 114.237 1.00 92.60  ? 113 ILE A CG2   1 
ATOM   610   C CD1   . ILE A 1  116 ? 117.812 134.980 116.789 1.00 108.12 ? 113 ILE A CD1   1 
ATOM   611   N N     . HIS A 1  117 ? 114.965 137.127 112.434 1.00 83.37  ? 114 HIS A N     1 
ATOM   612   C CA    . HIS A 1  117 ? 114.803 137.480 111.032 1.00 84.05  ? 114 HIS A CA    1 
ATOM   613   C C     . HIS A 1  117 ? 114.049 138.794 110.899 1.00 83.15  ? 114 HIS A C     1 
ATOM   614   O O     . HIS A 1  117 ? 114.351 139.622 110.039 1.00 87.26  ? 114 HIS A O     1 
ATOM   615   C CB    . HIS A 1  117 ? 114.046 136.385 110.292 1.00 85.32  ? 114 HIS A CB    1 
ATOM   616   C CG    . HIS A 1  117 ? 113.941 136.621 108.839 1.00 85.30  ? 114 HIS A CG    1 
ATOM   617   N ND1   . HIS A 1  117 ? 115.017 136.502 107.992 1.00 90.80  ? 114 HIS A ND1   1 
ATOM   618   C CD2   . HIS A 1  117 ? 112.888 136.961 108.066 1.00 85.42  ? 114 HIS A CD2   1 
ATOM   619   C CE1   . HIS A 1  117 ? 114.629 136.758 106.759 1.00 92.27  ? 114 HIS A CE1   1 
ATOM   620   N NE2   . HIS A 1  117 ? 113.346 137.039 106.779 1.00 89.28  ? 114 HIS A NE2   1 
ATOM   621   N N     . ALA A 1  118 ? 113.093 138.998 111.794 1.00 82.61  ? 115 ALA A N     1 
ATOM   622   C CA    . ALA A 1  118 ? 112.280 140.203 111.822 1.00 86.74  ? 115 ALA A CA    1 
ATOM   623   C C     . ALA A 1  118 ? 113.014 141.352 112.505 1.00 85.39  ? 115 ALA A C     1 
ATOM   624   O O     . ALA A 1  118 ? 112.450 142.433 112.679 1.00 87.24  ? 115 ALA A O     1 
ATOM   625   C CB    . ALA A 1  118 ? 110.966 139.932 112.528 1.00 92.16  ? 115 ALA A CB    1 
ATOM   626   N N     . LYS A 1  119 ? 114.290 141.137 112.834 1.00 84.66  ? 116 LYS A N     1 
ATOM   627   C CA    . LYS A 1  119 ? 115.096 142.119 113.547 1.00 87.44  ? 116 LYS A CA    1 
ATOM   628   C C     . LYS A 1  119 ? 114.515 142.515 114.888 1.00 86.58  ? 116 LYS A C     1 
ATOM   629   O O     . LYS A 1  119 ? 114.520 143.690 115.248 1.00 88.08  ? 116 LYS A O     1 
ATOM   630   C CB    . LYS A 1  119 ? 115.342 143.362 112.704 1.00 88.56  ? 116 LYS A CB    1 
ATOM   631   C CG    . LYS A 1  119 ? 116.352 143.170 111.587 1.00 99.55  ? 116 LYS A CG    1 
ATOM   632   C CD    . LYS A 1  119 ? 116.376 144.392 110.679 1.00 109.42 ? 116 LYS A CD    1 
ATOM   633   C CE    . LYS A 1  119 ? 117.763 145.010 110.613 1.00 121.94 ? 116 LYS A CE    1 
ATOM   634   N NZ    . LYS A 1  119 ? 118.825 144.018 110.284 1.00 121.00 ? 116 LYS A NZ    1 
ATOM   635   N N     . ARG A 1  120 ? 114.079 141.530 115.653 1.00 87.91  ? 117 ARG A N     1 
ATOM   636   C CA    . ARG A 1  120 ? 113.583 141.777 116.993 1.00 89.89  ? 117 ARG A CA    1 
ATOM   637   C C     . ARG A 1  120 ? 114.127 140.785 118.001 1.00 91.27  ? 117 ARG A C     1 
ATOM   638   O O     . ARG A 1  120 ? 114.614 139.712 117.646 1.00 91.24  ? 117 ARG A O     1 
ATOM   639   C CB    . ARG A 1  120 ? 112.078 141.733 117.015 1.00 92.11  ? 117 ARG A CB    1 
ATOM   640   C CG    . ARG A 1  120 ? 111.412 142.885 116.335 1.00 94.33  ? 117 ARG A CG    1 
ATOM   641   C CD    . ARG A 1  120 ? 109.941 142.790 116.419 1.00 95.10  ? 117 ARG A CD    1 
ATOM   642   N NE    . ARG A 1  120 ? 109.413 141.819 115.494 1.00 92.43  ? 117 ARG A NE    1 
ATOM   643   C CZ    . ARG A 1  120 ? 108.992 140.583 115.815 1.00 92.29  ? 117 ARG A CZ    1 
ATOM   644   N NH1   . ARG A 1  120 ? 109.058 140.150 117.046 1.00 91.56  ? 117 ARG A NH1   1 
ATOM   645   N NH2   . ARG A 1  120 ? 108.524 139.791 114.877 1.00 93.20  ? 117 ARG A NH2   1 
ATOM   646   N N     . VAL A 1  121 ? 114.064 141.167 119.267 1.00 86.17  ? 118 VAL A N     1 
ATOM   647   C CA    . VAL A 1  121 ? 114.456 140.291 120.354 1.00 84.78  ? 118 VAL A CA    1 
ATOM   648   C C     . VAL A 1  121 ? 113.226 139.747 121.058 1.00 87.67  ? 118 VAL A C     1 
ATOM   649   O O     . VAL A 1  121 ? 113.237 138.628 121.570 1.00 91.58  ? 118 VAL A O     1 
ATOM   650   C CB    . VAL A 1  121 ? 115.345 141.041 121.352 1.00 89.94  ? 118 VAL A CB    1 
ATOM   651   C CG1   . VAL A 1  121 ? 115.677 140.148 122.540 1.00 102.18 ? 118 VAL A CG1   1 
ATOM   652   C CG2   . VAL A 1  121 ? 116.607 141.492 120.650 1.00 89.43  ? 118 VAL A CG2   1 
ATOM   653   N N     . THR A 1  122 ? 112.211 140.590 121.187 1.00 85.12  ? 119 THR A N     1 
ATOM   654   C CA    . THR A 1  122 ? 110.994 140.203 121.881 1.00 87.19  ? 119 THR A CA    1 
ATOM   655   C C     . THR A 1  122 ? 110.155 139.289 121.008 1.00 86.74  ? 119 THR A C     1 
ATOM   656   O O     . THR A 1  122 ? 109.946 139.563 119.826 1.00 89.47  ? 119 THR A O     1 
ATOM   657   C CB    . THR A 1  122 ? 110.172 141.435 122.290 1.00 97.33  ? 119 THR A CB    1 
ATOM   658   O OG1   . THR A 1  122 ? 110.992 142.308 123.082 1.00 96.59  ? 119 THR A OG1   1 
ATOM   659   C CG2   . THR A 1  122 ? 108.954 141.007 123.120 1.00 101.17 ? 119 THR A CG2   1 
ATOM   660   N N     . ILE A 1  123 ? 109.667 138.211 121.599 1.00 83.47  ? 120 ILE A N     1 
ATOM   661   C CA    . ILE A 1  123 ? 108.849 137.254 120.878 1.00 82.87  ? 120 ILE A CA    1 
ATOM   662   C C     . ILE A 1  123 ? 107.387 137.651 120.884 1.00 86.94  ? 120 ILE A C     1 
ATOM   663   O O     . ILE A 1  123 ? 106.821 137.967 121.933 1.00 87.97  ? 120 ILE A O     1 
ATOM   664   C CB    . ILE A 1  123 ? 108.981 135.859 121.497 1.00 82.72  ? 120 ILE A CB    1 
ATOM   665   C CG1   . ILE A 1  123 ? 110.441 135.442 121.555 1.00 84.56  ? 120 ILE A CG1   1 
ATOM   666   C CG2   . ILE A 1  123 ? 108.166 134.857 120.718 1.00 89.47  ? 120 ILE A CG2   1 
ATOM   667   C CD1   . ILE A 1  123 ? 111.163 135.400 120.230 1.00 89.70  ? 120 ILE A CD1   1 
ATOM   668   N N     . MET A 1  124 ? 106.781 137.620 119.702 1.00 84.00  ? 121 MET A N     1 
ATOM   669   C CA    . MET A 1  124 ? 105.364 137.896 119.536 1.00 85.39  ? 121 MET A CA    1 
ATOM   670   C C     . MET A 1  124 ? 104.628 136.610 119.152 1.00 86.14  ? 121 MET A C     1 
ATOM   671   O O     . MET A 1  124 ? 105.219 135.731 118.525 1.00 84.88  ? 121 MET A O     1 
ATOM   672   C CB    . MET A 1  124 ? 105.178 138.971 118.478 1.00 90.04  ? 121 MET A CB    1 
ATOM   673   C CG    . MET A 1  124 ? 105.880 140.263 118.800 1.00 90.86  ? 121 MET A CG    1 
ATOM   674   S SD    . MET A 1  124 ? 105.261 141.035 120.297 1.00 104.01 ? 121 MET A SD    1 
ATOM   675   C CE    . MET A 1  124 ? 103.634 141.598 119.794 1.00 113.86 ? 121 MET A CE    1 
ATOM   676   N N     . PRO A 1  125 ? 103.333 136.493 119.455 1.00 83.89  ? 122 PRO A N     1 
ATOM   677   C CA    . PRO A 1  125 ? 102.480 135.365 119.125 1.00 89.38  ? 122 PRO A CA    1 
ATOM   678   C C     . PRO A 1  125 ? 102.587 134.984 117.659 1.00 87.50  ? 122 PRO A C     1 
ATOM   679   O O     . PRO A 1  125 ? 102.522 133.806 117.308 1.00 86.28  ? 122 PRO A O     1 
ATOM   680   C CB    . PRO A 1  125 ? 101.094 135.921 119.451 1.00 94.41  ? 122 PRO A CB    1 
ATOM   681   C CG    . PRO A 1  125 ? 101.344 136.899 120.566 1.00 93.49  ? 122 PRO A CG    1 
ATOM   682   C CD    . PRO A 1  125 ? 102.664 137.546 120.233 1.00 88.07  ? 122 PRO A CD    1 
ATOM   683   N N     . LYS A 1  126 ? 102.753 135.992 116.813 1.00 85.86  ? 123 LYS A N     1 
ATOM   684   C CA    . LYS A 1  126 ? 102.882 135.760 115.388 1.00 87.90  ? 123 LYS A CA    1 
ATOM   685   C C     . LYS A 1  126 ? 104.162 135.022 115.042 1.00 88.56  ? 123 LYS A C     1 
ATOM   686   O O     . LYS A 1  126 ? 104.231 134.373 113.999 1.00 86.82  ? 123 LYS A O     1 
ATOM   687   C CB    . LYS A 1  126 ? 102.837 137.082 114.624 1.00 92.45  ? 123 LYS A CB    1 
ATOM   688   C CG    . LYS A 1  126 ? 101.491 137.780 114.677 1.00 104.64 ? 123 LYS A CG    1 
ATOM   689   C CD    . LYS A 1  126 ? 101.472 138.983 113.749 1.00 118.88 ? 123 LYS A CD    1 
ATOM   690   C CE    . LYS A 1  126 ? 100.151 139.728 113.843 1.00 130.18 ? 123 LYS A CE    1 
ATOM   691   N NZ    . LYS A 1  126 ? 99.996  140.739 112.763 1.00 123.08 ? 123 LYS A NZ    1 
ATOM   692   N N     . ASP A 1  127 ? 105.206 135.187 115.842 1.00 85.97  ? 124 ASP A N     1 
ATOM   693   C CA    . ASP A 1  127 ? 106.477 134.567 115.521 1.00 88.44  ? 124 ASP A CA    1 
ATOM   694   C C     . ASP A 1  127 ? 106.305 133.077 115.732 1.00 86.64  ? 124 ASP A C     1 
ATOM   695   O O     . ASP A 1  127 ? 106.867 132.258 115.002 1.00 85.40  ? 124 ASP A O     1 
ATOM   696   C CB    . ASP A 1  127 ? 107.593 135.083 116.440 1.00 91.09  ? 124 ASP A CB    1 
ATOM   697   C CG    . ASP A 1  127 ? 107.943 136.566 116.255 1.00 91.60  ? 124 ASP A CG    1 
ATOM   698   O OD1   . ASP A 1  127 ? 108.136 137.002 115.143 1.00 94.18  ? 124 ASP A OD1   1 
ATOM   699   O OD2   . ASP A 1  127 ? 108.010 137.259 117.248 1.00 91.67  ? 124 ASP A OD2   1 
ATOM   700   N N     . ILE A 1  128 ? 105.488 132.731 116.721 1.00 83.74  ? 125 ILE A N     1 
ATOM   701   C CA    . ILE A 1  128 ? 105.198 131.334 116.994 1.00 82.34  ? 125 ILE A CA    1 
ATOM   702   C C     . ILE A 1  128 ? 104.379 130.766 115.860 1.00 83.54  ? 125 ILE A C     1 
ATOM   703   O O     . ILE A 1  128 ? 104.657 129.677 115.355 1.00 82.65  ? 125 ILE A O     1 
ATOM   704   C CB    . ILE A 1  128 ? 104.414 131.154 118.305 1.00 81.34  ? 125 ILE A CB    1 
ATOM   705   C CG1   . ILE A 1  128 ? 105.284 131.548 119.492 1.00 86.66  ? 125 ILE A CG1   1 
ATOM   706   C CG2   . ILE A 1  128 ? 103.943 129.705 118.428 1.00 82.74  ? 125 ILE A CG2   1 
ATOM   707   C CD1   . ILE A 1  128 ? 104.537 131.669 120.799 1.00 91.59  ? 125 ILE A CD1   1 
ATOM   708   N N     . GLN A 1  129 ? 103.371 131.521 115.452 1.00 81.33  ? 126 GLN A N     1 
ATOM   709   C CA    . GLN A 1  129 ? 102.469 131.074 114.412 1.00 83.68  ? 126 GLN A CA    1 
ATOM   710   C C     . GLN A 1  129 ? 103.191 130.859 113.097 1.00 84.02  ? 126 GLN A C     1 
ATOM   711   O O     . GLN A 1  129 ? 102.919 129.884 112.398 1.00 84.03  ? 126 GLN A O     1 
ATOM   712   C CB    . GLN A 1  129 ? 101.356 132.089 114.230 1.00 84.84  ? 126 GLN A CB    1 
ATOM   713   C CG    . GLN A 1  129 ? 100.410 132.144 115.394 1.00 90.39  ? 126 GLN A CG    1 
ATOM   714   C CD    . GLN A 1  129 ? 99.496  133.320 115.325 1.00 96.59  ? 126 GLN A CD    1 
ATOM   715   O OE1   . GLN A 1  129 ? 99.629  134.163 114.433 1.00 94.05  ? 126 GLN A OE1   1 
ATOM   716   N NE2   . GLN A 1  129 ? 98.576  133.407 116.273 1.00 99.54  ? 126 GLN A NE2   1 
ATOM   717   N N     . LEU A 1  130 ? 104.141 131.731 112.775 1.00 82.36  ? 127 LEU A N     1 
ATOM   718   C CA    . LEU A 1  130 ? 104.872 131.563 111.533 1.00 81.99  ? 127 LEU A CA    1 
ATOM   719   C C     . LEU A 1  130 ? 105.635 130.260 111.542 1.00 84.34  ? 127 LEU A C     1 
ATOM   720   O O     . LEU A 1  130 ? 105.611 129.513 110.562 1.00 82.45  ? 127 LEU A O     1 
ATOM   721   C CB    . LEU A 1  130 ? 105.864 132.703 111.304 1.00 83.19  ? 127 LEU A CB    1 
ATOM   722   C CG    . LEU A 1  130 ? 106.748 132.560 110.036 1.00 87.58  ? 127 LEU A CG    1 
ATOM   723   C CD1   . LEU A 1  130 ? 105.879 132.573 108.776 1.00 90.24  ? 127 LEU A CD1   1 
ATOM   724   C CD2   . LEU A 1  130 ? 107.752 133.672 109.996 1.00 92.95  ? 127 LEU A CD2   1 
ATOM   725   N N     . ALA A 1  131 ? 106.324 129.982 112.641 1.00 80.70  ? 128 ALA A N     1 
ATOM   726   C CA    . ALA A 1  131 ? 107.101 128.762 112.704 1.00 86.33  ? 128 ALA A CA    1 
ATOM   727   C C     . ALA A 1  131 ? 106.199 127.549 112.551 1.00 83.66  ? 128 ALA A C     1 
ATOM   728   O O     . ALA A 1  131 ? 106.493 126.641 111.772 1.00 83.24  ? 128 ALA A O     1 
ATOM   729   C CB    . ALA A 1  131 ? 107.861 128.691 114.018 1.00 89.95  ? 128 ALA A CB    1 
ATOM   730   N N     . ARG A 1  132 ? 105.052 127.575 113.217 1.00 81.62  ? 129 ARG A N     1 
ATOM   731   C CA    . ARG A 1  132 ? 104.141 126.443 113.158 1.00 87.19  ? 129 ARG A CA    1 
ATOM   732   C C     . ARG A 1  132 ? 103.597 126.249 111.768 1.00 86.15  ? 129 ARG A C     1 
ATOM   733   O O     . ARG A 1  132 ? 103.451 125.124 111.288 1.00 86.35  ? 129 ARG A O     1 
ATOM   734   C CB    . ARG A 1  132 ? 102.980 126.645 114.087 1.00 85.83  ? 129 ARG A CB    1 
ATOM   735   C CG    . ARG A 1  132 ? 103.339 126.573 115.515 1.00 88.79  ? 129 ARG A CG    1 
ATOM   736   C CD    . ARG A 1  132 ? 102.173 126.629 116.375 1.00 89.78  ? 129 ARG A CD    1 
ATOM   737   N NE    . ARG A 1  132 ? 101.514 125.354 116.449 1.00 89.95  ? 129 ARG A NE    1 
ATOM   738   C CZ    . ARG A 1  132 ? 100.378 125.036 115.824 1.00 94.40  ? 129 ARG A CZ    1 
ATOM   739   N NH1   . ARG A 1  132 ? 99.764  125.908 115.065 1.00 96.97  ? 129 ARG A NH1   1 
ATOM   740   N NH2   . ARG A 1  132 ? 99.882  123.830 115.961 1.00 96.76  ? 129 ARG A NH2   1 
ATOM   741   N N     . ARG A 1  133 ? 103.295 127.353 111.119 1.00 82.54  ? 130 ARG A N     1 
ATOM   742   C CA    . ARG A 1  133 ? 102.743 127.308 109.789 1.00 84.53  ? 130 ARG A CA    1 
ATOM   743   C C     . ARG A 1  133 ? 103.698 126.656 108.823 1.00 83.37  ? 130 ARG A C     1 
ATOM   744   O O     . ARG A 1  133 ? 103.335 125.728 108.102 1.00 85.81  ? 130 ARG A O     1 
ATOM   745   C CB    . ARG A 1  133 ? 102.481 128.711 109.333 1.00 87.66  ? 130 ARG A CB    1 
ATOM   746   C CG    . ARG A 1  133 ? 102.090 128.858 107.929 1.00 91.90  ? 130 ARG A CG    1 
ATOM   747   C CD    . ARG A 1  133 ? 100.781 128.319 107.663 1.00 96.21  ? 130 ARG A CD    1 
ATOM   748   N NE    . ARG A 1  133 ? 100.384 128.632 106.330 1.00 102.69 ? 130 ARG A NE    1 
ATOM   749   C CZ    . ARG A 1  133 ? 99.891  129.821 105.951 1.00 109.80 ? 130 ARG A CZ    1 
ATOM   750   N NH1   . ARG A 1  133 ? 99.732  130.785 106.831 1.00 105.03 ? 130 ARG A NH1   1 
ATOM   751   N NH2   . ARG A 1  133 ? 99.578  130.028 104.690 1.00 111.36 ? 130 ARG A NH2   1 
ATOM   752   N N     . ILE A 1  134 ? 104.950 127.066 108.891 1.00 81.27  ? 131 ILE A N     1 
ATOM   753   C CA    . ILE A 1  134 ? 105.971 126.531 108.015 1.00 83.34  ? 131 ILE A CA    1 
ATOM   754   C C     . ILE A 1  134 ? 106.156 125.044 108.270 1.00 86.31  ? 131 ILE A C     1 
ATOM   755   O O     . ILE A 1  134 ? 106.363 124.259 107.346 1.00 89.93  ? 131 ILE A O     1 
ATOM   756   C CB    . ILE A 1  134 ? 107.279 127.308 108.187 1.00 83.26  ? 131 ILE A CB    1 
ATOM   757   C CG1   . ILE A 1  134 ? 107.094 128.728 107.641 1.00 86.81  ? 131 ILE A CG1   1 
ATOM   758   C CG2   . ILE A 1  134 ? 108.411 126.593 107.492 1.00 87.40  ? 131 ILE A CG2   1 
ATOM   759   C CD1   . ILE A 1  134 ? 108.208 129.676 107.993 1.00 90.41  ? 131 ILE A CD1   1 
ATOM   760   N N     . ARG A 1  135 ? 106.062 124.660 109.533 1.00 82.85  ? 132 ARG A N     1 
ATOM   761   C CA    . ARG A 1  135 ? 106.192 123.273 109.952 1.00 83.94  ? 132 ARG A CA    1 
ATOM   762   C C     . ARG A 1  135 ? 104.991 122.411 109.564 1.00 85.72  ? 132 ARG A C     1 
ATOM   763   O O     . ARG A 1  135 ? 105.019 121.193 109.744 1.00 87.30  ? 132 ARG A O     1 
ATOM   764   C CB    . ARG A 1  135 ? 106.373 123.222 111.450 1.00 87.22  ? 132 ARG A CB    1 
ATOM   765   C CG    . ARG A 1  135 ? 107.688 123.770 111.906 1.00 88.61  ? 132 ARG A CG    1 
ATOM   766   C CD    . ARG A 1  135 ? 107.680 124.181 113.323 1.00 90.95  ? 132 ARG A CD    1 
ATOM   767   N NE    . ARG A 1  135 ? 107.430 123.099 114.204 1.00 93.89  ? 132 ARG A NE    1 
ATOM   768   C CZ    . ARG A 1  135 ? 108.359 122.372 114.833 1.00 93.63  ? 132 ARG A CZ    1 
ATOM   769   N NH1   . ARG A 1  135 ? 109.640 122.641 114.715 1.00 88.22  ? 132 ARG A NH1   1 
ATOM   770   N NH2   . ARG A 1  135 ? 107.968 121.378 115.597 1.00 98.18  ? 132 ARG A NH2   1 
ATOM   771   N N     . GLY A 1  136 ? 103.916 123.041 109.092 1.00 87.72  ? 133 GLY A N     1 
ATOM   772   C CA    . GLY A 1  136 ? 102.714 122.314 108.706 1.00 93.69  ? 133 GLY A CA    1 
ATOM   773   C C     . GLY A 1  136 ? 101.873 121.884 109.905 1.00 95.32  ? 133 GLY A C     1 
ATOM   774   O O     . GLY A 1  136 ? 101.194 120.858 109.853 1.00 96.71  ? 133 GLY A O     1 
ATOM   775   N N     . GLU A 1  137 ? 101.942 122.648 110.988 1.00 93.26  ? 134 GLU A N     1 
ATOM   776   C CA    . GLU A 1  137 ? 101.214 122.314 112.205 1.00 98.31  ? 134 GLU A CA    1 
ATOM   777   C C     . GLU A 1  137 ? 99.941  123.139 112.358 1.00 95.96  ? 134 GLU A C     1 
ATOM   778   O O     . GLU A 1  137 ? 99.626  123.972 111.509 1.00 94.99  ? 134 GLU A O     1 
ATOM   779   C CB    . GLU A 1  137 ? 102.117 122.522 113.417 0.00 99.51  ? 134 GLU A CB    1 
ATOM   780   C CG    . GLU A 1  137 ? 103.312 121.593 113.464 0.00 103.27 ? 134 GLU A CG    1 
ATOM   781   C CD    . GLU A 1  137 ? 104.253 121.904 114.593 0.00 104.75 ? 134 GLU A CD    1 
ATOM   782   O OE1   . GLU A 1  137 ? 104.574 123.049 114.770 0.00 99.25  ? 134 GLU A OE1   1 
ATOM   783   O OE2   . GLU A 1  137 ? 104.657 120.998 115.282 0.00 103.57 ? 134 GLU A OE2   1 
ATOM   784   N N     . VAL B 2  24  ? 86.446  115.532 138.547 1.00 122.35 ? 22  VAL B N     1 
ATOM   785   C CA    . VAL B 2  24  ? 86.430  116.387 137.367 1.00 127.63 ? 22  VAL B CA    1 
ATOM   786   C C     . VAL B 2  24  ? 87.479  117.480 137.471 1.00 124.38 ? 22  VAL B C     1 
ATOM   787   O O     . VAL B 2  24  ? 87.497  118.250 138.431 1.00 122.68 ? 22  VAL B O     1 
ATOM   788   C CB    . VAL B 2  24  ? 85.039  117.025 137.184 0.00 133.50 ? 22  VAL B CB    1 
ATOM   789   C CG1   . VAL B 2  24  ? 85.038  117.974 135.985 0.00 127.98 ? 22  VAL B CG1   1 
ATOM   790   C CG2   . VAL B 2  24  ? 84.003  115.930 137.000 0.00 134.57 ? 22  VAL B CG2   1 
ATOM   791   N N     . LEU B 2  25  ? 88.351  117.543 136.478 1.00 123.22 ? 23  LEU B N     1 
ATOM   792   C CA    . LEU B 2  25  ? 89.394  118.554 136.443 1.00 121.79 ? 23  LEU B CA    1 
ATOM   793   C C     . LEU B 2  25  ? 89.022  119.704 135.526 1.00 119.88 ? 23  LEU B C     1 
ATOM   794   O O     . LEU B 2  25  ? 88.308  119.519 134.541 1.00 119.65 ? 23  LEU B O     1 
ATOM   795   C CB    . LEU B 2  25  ? 90.702  117.918 135.986 0.00 118.01 ? 23  LEU B CB    1 
ATOM   796   C CG    . LEU B 2  25  ? 91.274  116.837 136.902 0.00 119.57 ? 23  LEU B CG    1 
ATOM   797   C CD1   . LEU B 2  25  ? 92.416  116.180 136.201 0.00 103.74 ? 23  LEU B CD1   1 
ATOM   798   C CD2   . LEU B 2  25  ? 91.753  117.463 138.209 0.00 119.34 ? 23  LEU B CD2   1 
ATOM   799   N N     . ARG B 2  26  ? 89.526  120.892 135.842 1.00 118.71 ? 24  ARG B N     1 
ATOM   800   C CA    . ARG B 2  26  ? 89.277  122.054 135.002 1.00 119.89 ? 24  ARG B CA    1 
ATOM   801   C C     . ARG B 2  26  ? 90.428  123.058 135.017 1.00 115.92 ? 24  ARG B C     1 
ATOM   802   O O     . ARG B 2  26  ? 91.046  123.299 136.056 1.00 112.04 ? 24  ARG B O     1 
ATOM   803   C CB    . ARG B 2  26  ? 88.012  122.764 135.466 1.00 121.26 ? 24  ARG B CB    1 
ATOM   804   C CG    . ARG B 2  26  ? 86.707  121.979 135.266 1.00 125.43 ? 24  ARG B CG    1 
ATOM   805   C CD    . ARG B 2  26  ? 85.495  122.741 135.694 0.00 131.72 ? 24  ARG B CD    1 
ATOM   806   N NE    . ARG B 2  26  ? 84.274  121.941 135.558 0.00 137.32 ? 24  ARG B NE    1 
ATOM   807   C CZ    . ARG B 2  26  ? 83.037  122.323 135.976 0.00 141.04 ? 24  ARG B CZ    1 
ATOM   808   N NH1   . ARG B 2  26  ? 82.851  123.498 136.545 0.00 137.94 ? 24  ARG B NH1   1 
ATOM   809   N NH2   . ARG B 2  26  ? 82.009  121.508 135.811 0.00 132.76 ? 24  ARG B NH2   1 
ATOM   810   N N     . ASP B 2  27  ? 90.630  123.722 133.884 1.00 114.81 ? 25  ASP B N     1 
ATOM   811   C CA    . ASP B 2  27  ? 91.514  124.879 133.781 1.00 112.33 ? 25  ASP B CA    1 
ATOM   812   C C     . ASP B 2  27  ? 92.906  124.613 134.329 1.00 105.19 ? 25  ASP B C     1 
ATOM   813   O O     . ASP B 2  27  ? 93.553  125.514 134.864 1.00 101.68 ? 25  ASP B O     1 
ATOM   814   C CB    . ASP B 2  27  ? 90.904  126.085 134.500 1.00 117.32 ? 25  ASP B CB    1 
ATOM   815   C CG    . ASP B 2  27  ? 89.594  126.541 133.870 1.00 123.01 ? 25  ASP B CG    1 
ATOM   816   O OD1   . ASP B 2  27  ? 89.497  126.522 132.664 1.00 120.59 ? 25  ASP B OD1   1 
ATOM   817   O OD2   . ASP B 2  27  ? 88.697  126.894 134.599 1.00 122.38 ? 25  ASP B OD2   1 
ATOM   818   N N     . ASN B 2  28  ? 93.448  123.440 134.033 1.00 103.73 ? 26  ASN B N     1 
ATOM   819   C CA    . ASN B 2  28  ? 94.784  123.121 134.506 1.00 100.57 ? 26  ASN B CA    1 
ATOM   820   C C     . ASN B 2  28  ? 95.805  123.616 133.515 1.00 97.68  ? 26  ASN B C     1 
ATOM   821   O O     . ASN B 2  28  ? 97.006  123.580 133.769 1.00 96.07  ? 26  ASN B O     1 
ATOM   822   C CB    . ASN B 2  28  ? 94.936  121.644 134.759 1.00 98.24  ? 26  ASN B CB    1 
ATOM   823   C CG    . ASN B 2  28  ? 94.212  121.224 135.970 1.00 100.67 ? 26  ASN B CG    1 
ATOM   824   O OD1   . ASN B 2  28  ? 94.671  121.440 137.103 1.00 99.67  ? 26  ASN B OD1   1 
ATOM   825   N ND2   . ASN B 2  28  ? 93.066  120.657 135.774 1.00 104.81 ? 26  ASN B ND2   1 
ATOM   826   N N     . ILE B 2  29  ? 95.311  124.254 132.470 1.00 96.70  ? 27  ILE B N     1 
ATOM   827   C CA    . ILE B 2  29  ? 96.165  124.918 131.512 1.00 94.22  ? 27  ILE B CA    1 
ATOM   828   C C     . ILE B 2  29  ? 96.860  126.074 132.213 1.00 95.20  ? 27  ILE B C     1 
ATOM   829   O O     . ILE B 2  29  ? 97.994  126.423 131.893 1.00 92.93  ? 27  ILE B O     1 
ATOM   830   C CB    . ILE B 2  29  ? 95.345  125.414 130.307 1.00 97.59  ? 27  ILE B CB    1 
ATOM   831   C CG1   . ILE B 2  29  ? 96.254  125.777 129.124 1.00 98.46  ? 27  ILE B CG1   1 
ATOM   832   C CG2   . ILE B 2  29  ? 94.487  126.611 130.696 1.00 98.22  ? 27  ILE B CG2   1 
ATOM   833   C CD1   . ILE B 2  29  ? 96.982  124.602 128.493 1.00 96.89  ? 27  ILE B CD1   1 
ATOM   834   N N     . GLN B 2  30  ? 96.209  126.601 133.247 1.00 95.65  ? 28  GLN B N     1 
ATOM   835   C CA    . GLN B 2  30  ? 96.761  127.697 134.019 1.00 97.31  ? 28  GLN B CA    1 
ATOM   836   C C     . GLN B 2  30  ? 97.704  127.171 135.084 1.00 95.39  ? 28  GLN B C     1 
ATOM   837   O O     . GLN B 2  30  ? 98.298  127.938 135.840 1.00 93.96  ? 28  GLN B O     1 
ATOM   838   C CB    . GLN B 2  30  ? 95.646  128.513 134.655 1.00 99.56  ? 28  GLN B CB    1 
ATOM   839   C CG    . GLN B 2  30  ? 94.785  129.233 133.655 1.00 103.98 ? 28  GLN B CG    1 
ATOM   840   C CD    . GLN B 2  30  ? 93.670  129.992 134.305 1.00 116.75 ? 28  GLN B CD    1 
ATOM   841   O OE1   . GLN B 2  30  ? 93.153  129.589 135.350 1.00 115.29 ? 28  GLN B OE1   1 
ATOM   842   N NE2   . GLN B 2  30  ? 93.286  131.107 133.699 1.00 118.16 ? 28  GLN B NE2   1 
ATOM   843   N N     . GLY B 2  31  ? 97.835  125.850 135.141 1.00 93.88  ? 29  GLY B N     1 
ATOM   844   C CA    . GLY B 2  31  ? 98.756  125.205 136.056 1.00 94.06  ? 29  GLY B CA    1 
ATOM   845   C C     . GLY B 2  31  ? 100.160 125.313 135.492 1.00 92.25  ? 29  GLY B C     1 
ATOM   846   O O     . GLY B 2  31  ? 101.145 125.038 136.179 1.00 92.23  ? 29  GLY B O     1 
ATOM   847   N N     . ILE B 2  32  ? 100.249 125.732 134.237 1.00 88.70  ? 30  ILE B N     1 
ATOM   848   C CA    . ILE B 2  32  ? 101.535 125.973 133.632 1.00 84.34  ? 30  ILE B CA    1 
ATOM   849   C C     . ILE B 2  32  ? 101.839 127.437 133.856 1.00 85.93  ? 30  ILE B C     1 
ATOM   850   O O     . ILE B 2  32  ? 101.246 128.313 133.223 1.00 86.76  ? 30  ILE B O     1 
ATOM   851   C CB    . ILE B 2  32  ? 101.513 125.665 132.129 1.00 86.20  ? 30  ILE B CB    1 
ATOM   852   C CG1   . ILE B 2  32  ? 100.960 124.244 131.859 1.00 88.28  ? 30  ILE B CG1   1 
ATOM   853   C CG2   . ILE B 2  32  ? 102.907 125.828 131.555 1.00 90.02  ? 30  ILE B CG2   1 
ATOM   854   C CD1   . ILE B 2  32  ? 101.734 123.114 132.511 1.00 91.82  ? 30  ILE B CD1   1 
ATOM   855   N N     . THR B 2  33  ? 102.734 127.697 134.788 1.00 86.52  ? 31  THR B N     1 
ATOM   856   C CA    . THR B 2  33  ? 102.963 129.043 135.266 1.00 88.69  ? 31  THR B CA    1 
ATOM   857   C C     . THR B 2  33  ? 103.737 129.853 134.253 1.00 88.64  ? 31  THR B C     1 
ATOM   858   O O     . THR B 2  33  ? 104.339 129.303 133.329 1.00 87.63  ? 31  THR B O     1 
ATOM   859   C CB    . THR B 2  33  ? 103.737 129.004 136.596 1.00 92.97  ? 31  THR B CB    1 
ATOM   860   O OG1   . THR B 2  33  ? 105.036 128.418 136.377 1.00 96.77  ? 31  THR B OG1   1 
ATOM   861   C CG2   . THR B 2  33  ? 102.980 128.167 137.610 1.00 99.62  ? 31  THR B CG2   1 
ATOM   862   N N     . LYS B 2  34  ? 103.730 131.165 134.426 1.00 83.36  ? 32  LYS B N     1 
ATOM   863   C CA    . LYS B 2  34  ? 104.499 132.010 133.543 1.00 87.23  ? 32  LYS B CA    1 
ATOM   864   C C     . LYS B 2  34  ? 105.971 131.640 133.528 1.00 87.66  ? 32  LYS B C     1 
ATOM   865   O O     . LYS B 2  34  ? 106.555 131.552 132.451 1.00 83.50  ? 32  LYS B O     1 
ATOM   866   C CB    . LYS B 2  34  ? 104.274 133.484 133.833 1.00 89.16  ? 32  LYS B CB    1 
ATOM   867   C CG    . LYS B 2  34  ? 102.977 133.999 133.332 1.00 94.95  ? 32  LYS B CG    1 
ATOM   868   C CD    . LYS B 2  34  ? 102.865 135.487 133.550 1.00 101.43 ? 32  LYS B CD    1 
ATOM   869   C CE    . LYS B 2  34  ? 101.583 136.026 132.952 1.00 104.35 ? 32  LYS B CE    1 
ATOM   870   N NZ    . LYS B 2  34  ? 101.466 137.499 133.110 1.00 106.34 ? 32  LYS B NZ    1 
ATOM   871   N N     . PRO B 2  35  ? 106.611 131.486 134.693 1.00 83.64  ? 33  PRO B N     1 
ATOM   872   C CA    . PRO B 2  35  ? 107.946 130.962 134.832 1.00 89.96  ? 33  PRO B CA    1 
ATOM   873   C C     . PRO B 2  35  ? 108.134 129.648 134.091 1.00 88.54  ? 33  PRO B C     1 
ATOM   874   O O     . PRO B 2  35  ? 109.070 129.510 133.314 1.00 86.05  ? 33  PRO B O     1 
ATOM   875   C CB    . PRO B 2  35  ? 108.056 130.816 136.344 1.00 89.94  ? 33  PRO B CB    1 
ATOM   876   C CG    . PRO B 2  35  ? 107.235 131.954 136.876 1.00 88.21  ? 33  PRO B CG    1 
ATOM   877   C CD    . PRO B 2  35  ? 106.079 132.087 135.928 1.00 81.17  ? 33  PRO B CD    1 
ATOM   878   N N     . ALA B 2  36  ? 107.164 128.744 134.174 1.00 90.08  ? 34  ALA B N     1 
ATOM   879   C CA    . ALA B 2  36  ? 107.329 127.476 133.473 1.00 93.37  ? 34  ALA B CA    1 
ATOM   880   C C     . ALA B 2  36  ? 107.466 127.689 131.971 1.00 88.48  ? 34  ALA B C     1 
ATOM   881   O O     . ALA B 2  36  ? 108.340 127.104 131.326 1.00 88.46  ? 34  ALA B O     1 
ATOM   882   C CB    . ALA B 2  36  ? 106.157 126.556 133.762 1.00 99.24  ? 34  ALA B CB    1 
ATOM   883   N N     . ILE B 2  37  ? 106.650 128.583 131.430 1.00 85.53  ? 35  ILE B N     1 
ATOM   884   C CA    . ILE B 2  37  ? 106.714 128.896 130.014 1.00 82.78  ? 35  ILE B CA    1 
ATOM   885   C C     . ILE B 2  37  ? 107.999 129.626 129.703 1.00 85.26  ? 35  ILE B C     1 
ATOM   886   O O     . ILE B 2  37  ? 108.670 129.338 128.711 1.00 84.89  ? 35  ILE B O     1 
ATOM   887   C CB    . ILE B 2  37  ? 105.501 129.729 129.582 1.00 83.88  ? 35  ILE B CB    1 
ATOM   888   C CG1   . ILE B 2  37  ? 104.249 128.851 129.677 1.00 89.06  ? 35  ILE B CG1   1 
ATOM   889   C CG2   . ILE B 2  37  ? 105.708 130.283 128.168 1.00 87.39  ? 35  ILE B CG2   1 
ATOM   890   C CD1   . ILE B 2  37  ? 102.930 129.589 129.589 1.00 97.01  ? 35  ILE B CD1   1 
ATOM   891   N N     . ARG B 2  38  ? 108.326 130.581 130.551 1.00 84.56  ? 36  ARG B N     1 
ATOM   892   C CA    . ARG B 2  38  ? 109.515 131.384 130.396 1.00 85.35  ? 36  ARG B CA    1 
ATOM   893   C C     . ARG B 2  38  ? 110.771 130.547 130.352 1.00 86.36  ? 36  ARG B C     1 
ATOM   894   O O     . ARG B 2  38  ? 111.658 130.779 129.532 1.00 85.47  ? 36  ARG B O     1 
ATOM   895   C CB    . ARG B 2  38  ? 109.619 132.335 131.557 1.00 87.48  ? 36  ARG B CB    1 
ATOM   896   C CG    . ARG B 2  38  ? 110.821 133.196 131.554 1.00 94.79  ? 36  ARG B CG    1 
ATOM   897   C CD    . ARG B 2  38  ? 110.815 134.124 132.692 1.00 95.93  ? 36  ARG B CD    1 
ATOM   898   N NE    . ARG B 2  38  ? 109.708 135.050 132.631 1.00 96.04  ? 36  ARG B NE    1 
ATOM   899   C CZ    . ARG B 2  38  ? 109.682 136.161 131.877 1.00 99.15  ? 36  ARG B CZ    1 
ATOM   900   N NH1   . ARG B 2  38  ? 110.695 136.447 131.094 1.00 100.43 ? 36  ARG B NH1   1 
ATOM   901   N NH2   . ARG B 2  38  ? 108.641 136.966 131.928 1.00 100.30 ? 36  ARG B NH2   1 
ATOM   902   N N     . ARG B 2  39  ? 110.856 129.588 131.252 1.00 85.43  ? 37  ARG B N     1 
ATOM   903   C CA    . ARG B 2  39  ? 112.026 128.747 131.353 1.00 89.08  ? 37  ARG B CA    1 
ATOM   904   C C     . ARG B 2  39  ? 112.223 127.938 130.085 1.00 89.56  ? 37  ARG B C     1 
ATOM   905   O O     . ARG B 2  39  ? 113.341 127.822 129.582 1.00 88.53  ? 37  ARG B O     1 
ATOM   906   C CB    . ARG B 2  39  ? 111.889 127.839 132.550 1.00 92.66  ? 37  ARG B CB    1 
ATOM   907   C CG    . ARG B 2  39  ? 112.042 128.529 133.878 1.00 94.35  ? 37  ARG B CG    1 
ATOM   908   C CD    . ARG B 2  39  ? 112.178 127.563 134.992 1.00 95.14  ? 37  ARG B CD    1 
ATOM   909   N NE    . ARG B 2  39  ? 110.913 126.947 135.349 1.00 94.46  ? 37  ARG B NE    1 
ATOM   910   C CZ    . ARG B 2  39  ? 110.071 127.434 136.269 1.00 92.90  ? 37  ARG B CZ    1 
ATOM   911   N NH1   . ARG B 2  39  ? 110.371 128.531 136.921 1.00 93.85  ? 37  ARG B NH1   1 
ATOM   912   N NH2   . ARG B 2  39  ? 108.961 126.786 136.532 1.00 94.11  ? 37  ARG B NH2   1 
ATOM   913   N N     . LEU B 2  40  ? 111.132 127.424 129.534 1.00 86.23  ? 38  LEU B N     1 
ATOM   914   C CA    . LEU B 2  40  ? 111.213 126.689 128.283 1.00 87.35  ? 38  LEU B CA    1 
ATOM   915   C C     . LEU B 2  40  ? 111.658 127.601 127.160 1.00 86.77  ? 38  LEU B C     1 
ATOM   916   O O     . LEU B 2  40  ? 112.519 127.243 126.353 1.00 86.82  ? 38  LEU B O     1 
ATOM   917   C CB    . LEU B 2  40  ? 109.842 126.112 127.939 1.00 88.93  ? 38  LEU B CB    1 
ATOM   918   C CG    . LEU B 2  40  ? 109.378 124.968 128.808 1.00 90.85  ? 38  LEU B CG    1 
ATOM   919   C CD1   . LEU B 2  40  ? 107.911 124.797 128.638 1.00 91.65  ? 38  LEU B CD1   1 
ATOM   920   C CD2   . LEU B 2  40  ? 110.071 123.694 128.380 1.00 94.32  ? 38  LEU B CD2   1 
ATOM   921   N N     . ALA B 2  41  ? 111.100 128.801 127.133 1.00 85.48  ? 39  ALA B N     1 
ATOM   922   C CA    . ALA B 2  41  ? 111.447 129.747 126.095 1.00 88.46  ? 39  ALA B CA    1 
ATOM   923   C C     . ALA B 2  41  ? 112.917 130.111 126.189 1.00 88.80  ? 39  ALA B C     1 
ATOM   924   O O     . ALA B 2  41  ? 113.613 130.202 125.174 1.00 87.74  ? 39  ALA B O     1 
ATOM   925   C CB    . ALA B 2  41  ? 110.569 130.978 126.206 1.00 90.92  ? 39  ALA B CB    1 
ATOM   926   N N     . ARG B 2  42  ? 113.405 130.238 127.415 1.00 86.58  ? 40  ARG B N     1 
ATOM   927   C CA    . ARG B 2  42  ? 114.795 130.574 127.652 1.00 91.03  ? 40  ARG B CA    1 
ATOM   928   C C     . ARG B 2  42  ? 115.724 129.494 127.173 1.00 87.12  ? 40  ARG B C     1 
ATOM   929   O O     . ARG B 2  42  ? 116.720 129.768 126.509 1.00 93.51  ? 40  ARG B O     1 
ATOM   930   C CB    . ARG B 2  42  ? 115.027 130.803 129.123 1.00 94.95  ? 40  ARG B CB    1 
ATOM   931   C CG    . ARG B 2  42  ? 114.503 132.090 129.607 1.00 95.89  ? 40  ARG B CG    1 
ATOM   932   C CD    . ARG B 2  42  ? 115.459 133.132 129.322 1.00 103.51 ? 40  ARG B CD    1 
ATOM   933   N NE    . ARG B 2  42  ? 114.897 134.427 129.380 1.00 100.65 ? 40  ARG B NE    1 
ATOM   934   C CZ    . ARG B 2  42  ? 114.688 135.136 130.488 1.00 102.02 ? 40  ARG B CZ    1 
ATOM   935   N NH1   . ARG B 2  42  ? 114.936 134.625 131.667 1.00 107.57 ? 40  ARG B NH1   1 
ATOM   936   N NH2   . ARG B 2  42  ? 114.239 136.362 130.383 1.00 102.48 ? 40  ARG B NH2   1 
ATOM   937   N N     . ARG B 2  43  ? 115.358 128.255 127.417 1.00 86.57  ? 41  ARG B N     1 
ATOM   938   C CA    . ARG B 2  43  ? 116.177 127.158 126.956 1.00 87.20  ? 41  ARG B CA    1 
ATOM   939   C C     . ARG B 2  43  ? 116.317 127.221 125.437 1.00 86.32  ? 41  ARG B C     1 
ATOM   940   O O     . ARG B 2  43  ? 117.390 126.973 124.884 1.00 91.05  ? 41  ARG B O     1 
ATOM   941   C CB    . ARG B 2  43  ? 115.566 125.849 127.391 1.00 90.04  ? 41  ARG B CB    1 
ATOM   942   C CG    . ARG B 2  43  ? 116.354 124.643 127.039 1.00 92.66  ? 41  ARG B CG    1 
ATOM   943   C CD    . ARG B 2  43  ? 115.796 123.406 127.644 1.00 93.64  ? 41  ARG B CD    1 
ATOM   944   N NE    . ARG B 2  43  ? 116.296 123.164 128.979 1.00 95.96  ? 41  ARG B NE    1 
ATOM   945   C CZ    . ARG B 2  43  ? 115.805 122.254 129.835 1.00 96.40  ? 41  ARG B CZ    1 
ATOM   946   N NH1   . ARG B 2  43  ? 114.759 121.535 129.518 1.00 95.54  ? 41  ARG B NH1   1 
ATOM   947   N NH2   . ARG B 2  43  ? 116.385 122.077 131.001 1.00 100.63 ? 41  ARG B NH2   1 
ATOM   948   N N     . GLY B 2  44  ? 115.252 127.665 124.774 1.00 89.20  ? 42  GLY B N     1 
ATOM   949   C CA    . GLY B 2  44  ? 115.227 127.790 123.320 1.00 92.67  ? 42  GLY B CA    1 
ATOM   950   C C     . GLY B 2  44  ? 115.988 129.020 122.810 1.00 92.20  ? 42  GLY B C     1 
ATOM   951   O O     . GLY B 2  44  ? 116.123 129.211 121.601 1.00 93.97  ? 42  GLY B O     1 
ATOM   952   N N     . GLY B 2  45  ? 116.480 129.857 123.722 1.00 88.70  ? 43  GLY B N     1 
ATOM   953   C CA    . GLY B 2  45  ? 117.240 131.043 123.336 1.00 90.82  ? 43  GLY B CA    1 
ATOM   954   C C     . GLY B 2  45  ? 116.445 132.346 123.381 1.00 89.89  ? 43  GLY B C     1 
ATOM   955   O O     . GLY B 2  45  ? 116.914 133.375 122.897 1.00 94.79  ? 43  GLY B O     1 
ATOM   956   N N     . VAL B 2  46  ? 115.252 132.318 123.957 1.00 87.42  ? 44  VAL B N     1 
ATOM   957   C CA    . VAL B 2  46  ? 114.440 133.524 124.035 1.00 86.43  ? 44  VAL B CA    1 
ATOM   958   C C     . VAL B 2  46  ? 114.797 134.411 125.217 1.00 90.74  ? 44  VAL B C     1 
ATOM   959   O O     . VAL B 2  46  ? 114.758 133.976 126.367 1.00 92.74  ? 44  VAL B O     1 
ATOM   960   C CB    . VAL B 2  46  ? 112.958 133.149 124.130 1.00 91.30  ? 44  VAL B CB    1 
ATOM   961   C CG1   . VAL B 2  46  ? 112.116 134.387 124.356 1.00 95.42  ? 44  VAL B CG1   1 
ATOM   962   C CG2   . VAL B 2  46  ? 112.539 132.430 122.852 1.00 91.99  ? 44  VAL B CG2   1 
ATOM   963   N N     . LYS B 2  47  ? 115.132 135.673 124.924 1.00 87.98  ? 45  LYS B N     1 
ATOM   964   C CA    . LYS B 2  47  ? 115.488 136.641 125.997 1.00 89.58  ? 45  LYS B CA    1 
ATOM   965   C C     . LYS B 2  47  ? 114.254 137.455 126.393 1.00 93.65  ? 45  LYS B C     1 
ATOM   966   O O     . LYS B 2  47  ? 113.993 137.564 127.605 1.00 99.89  ? 45  LYS B O     1 
ATOM   967   C CB    . LYS B 2  47  ? 116.539 137.633 125.493 1.00 89.22  ? 45  LYS B CB    1 
ATOM   968   C CG    . LYS B 2  47  ? 117.922 137.058 125.235 1.00 100.59 ? 45  LYS B CG    1 
ATOM   969   C CD    . LYS B 2  47  ? 118.857 138.063 124.606 1.00 109.60 ? 45  LYS B CD    1 
ATOM   970   C CE    . LYS B 2  47  ? 119.165 139.236 125.511 1.00 117.46 ? 45  LYS B CE    1 
ATOM   971   N NZ    . LYS B 2  47  ? 120.175 140.140 124.911 1.00 118.73 ? 45  LYS B NZ    1 
ATOM   972   N N     . ARG B 2  48  ? 113.531 138.005 125.413 1.00 90.49  ? 46  ARG B N     1 
ATOM   973   C CA    . ARG B 2  48  ? 112.382 138.895 125.735 1.00 90.99  ? 46  ARG B CA    1 
ATOM   974   C C     . ARG B 2  48  ? 111.055 138.245 125.335 1.00 91.96  ? 46  ARG B C     1 
ATOM   975   O O     . ARG B 2  48  ? 110.976 137.714 124.212 1.00 88.49  ? 46  ARG B O     1 
ATOM   976   C CB    . ARG B 2  48  ? 112.600 140.299 125.168 1.00 90.65  ? 46  ARG B CB    1 
ATOM   977   C CG    . ARG B 2  48  ? 113.314 141.237 126.128 1.00 90.76  ? 46  ARG B CG    1 
ATOM   978   C CD    . ARG B 2  48  ? 113.700 142.546 125.474 1.00 96.33  ? 46  ARG B CD    1 
ATOM   979   N NE    . ARG B 2  48  ? 112.539 143.290 125.011 1.00 95.61  ? 46  ARG B NE    1 
ATOM   980   C CZ    . ARG B 2  48  ? 111.855 144.155 125.750 1.00 95.83  ? 46  ARG B CZ    1 
ATOM   981   N NH1   . ARG B 2  48  ? 112.214 144.389 127.000 1.00 97.24  ? 46  ARG B NH1   1 
ATOM   982   N NH2   . ARG B 2  48  ? 110.815 144.785 125.235 1.00 95.92  ? 46  ARG B NH2   1 
ATOM   983   N N     . ILE B 2  49  ? 110.056 138.286 126.223 1.00 86.83  ? 47  ILE B N     1 
ATOM   984   C CA    . ILE B 2  49  ? 108.758 137.593 125.958 1.00 89.57  ? 47  ILE B CA    1 
ATOM   985   C C     . ILE B 2  49  ? 107.600 138.594 126.038 1.00 93.73  ? 47  ILE B C     1 
ATOM   986   O O     . ILE B 2  49  ? 107.556 139.350 127.026 1.00 95.19  ? 47  ILE B O     1 
ATOM   987   C CB    . ILE B 2  49  ? 108.576 136.454 126.983 1.00 94.03  ? 47  ILE B CB    1 
ATOM   988   C CG1   . ILE B 2  49  ? 109.558 135.304 126.751 1.00 93.18  ? 47  ILE B CG1   1 
ATOM   989   C CG2   . ILE B 2  49  ? 107.137 135.966 127.027 1.00 99.06  ? 47  ILE B CG2   1 
ATOM   990   C CD1   . ILE B 2  49  ? 110.635 135.196 127.805 1.00 100.07 ? 47  ILE B CD1   1 
ATOM   991   N N     . SER B 2  50  ? 106.693 138.596 125.051 1.00 90.00  ? 48  SER B N     1 
ATOM   992   C CA    . SER B 2  50  ? 105.509 139.442 125.094 1.00 89.70  ? 48  SER B CA    1 
ATOM   993   C C     . SER B 2  50  ? 104.464 138.832 126.008 1.00 91.93  ? 48  SER B C     1 
ATOM   994   O O     . SER B 2  50  ? 104.303 137.613 126.055 1.00 91.09  ? 48  SER B O     1 
ATOM   995   C CB    . SER B 2  50  ? 104.926 139.642 123.714 1.00 95.48  ? 48  SER B CB    1 
ATOM   996   O OG    . SER B 2  50  ? 103.663 140.250 123.790 1.00 98.11  ? 48  SER B OG    1 
ATOM   997   N N     . GLY B 2  51  ? 103.698 139.675 126.687 1.00 91.65  ? 49  GLY B N     1 
ATOM   998   C CA    . GLY B 2  51  ? 102.682 139.198 127.617 1.00 94.86  ? 49  GLY B CA    1 
ATOM   999   C C     . GLY B 2  51  ? 101.609 138.365 126.926 1.00 94.17  ? 49  GLY B C     1 
ATOM   1000  O O     . GLY B 2  51  ? 100.824 137.681 127.581 1.00 96.16  ? 49  GLY B O     1 
ATOM   1001  N N     . LEU B 2  52  ? 101.566 138.430 125.603 1.00 88.80  ? 50  LEU B N     1 
ATOM   1002  C CA    . LEU B 2  52  ? 100.583 137.689 124.831 1.00 89.60  ? 50  LEU B CA    1 
ATOM   1003  C C     . LEU B 2  52  ? 101.038 136.260 124.546 1.00 90.36  ? 50  LEU B C     1 
ATOM   1004  O O     . LEU B 2  52  ? 100.246 135.422 124.105 1.00 91.82  ? 50  LEU B O     1 
ATOM   1005  C CB    . LEU B 2  52  ? 100.345 138.412 123.509 1.00 93.99  ? 50  LEU B CB    1 
ATOM   1006  C CG    . LEU B 2  52  ? 99.826  139.853 123.609 1.00 99.90  ? 50  LEU B CG    1 
ATOM   1007  C CD1   . LEU B 2  52  ? 99.800  140.460 122.215 1.00 110.74 ? 50  LEU B CD1   1 
ATOM   1008  C CD2   . LEU B 2  52  ? 98.436  139.869 124.232 1.00 103.32 ? 50  LEU B CD2   1 
ATOM   1009  N N     . ILE B 2  53  ? 102.317 135.993 124.772 1.00 86.58  ? 51  ILE B N     1 
ATOM   1010  C CA    . ILE B 2  53  ? 102.903 134.698 124.466 1.00 85.44  ? 51  ILE B CA    1 
ATOM   1011  C C     . ILE B 2  53  ? 102.357 133.610 125.338 1.00 87.91  ? 51  ILE B C     1 
ATOM   1012  O O     . ILE B 2  53  ? 102.187 132.477 124.894 1.00 86.36  ? 51  ILE B O     1 
ATOM   1013  C CB    . ILE B 2  53  ? 104.424 134.722 124.636 1.00 87.27  ? 51  ILE B CB    1 
ATOM   1014  C CG1   . ILE B 2  53  ? 105.055 135.645 123.623 1.00 88.76  ? 51  ILE B CG1   1 
ATOM   1015  C CG2   . ILE B 2  53  ? 105.018 133.312 124.564 1.00 88.22  ? 51  ILE B CG2   1 
ATOM   1016  C CD1   . ILE B 2  53  ? 104.813 135.279 122.198 1.00 89.71  ? 51  ILE B CD1   1 
ATOM   1017  N N     . TYR B 2  54  ? 102.163 133.917 126.600 1.00 87.05  ? 52  TYR B N     1 
ATOM   1018  C CA    . TYR B 2  54  ? 101.774 132.891 127.535 1.00 89.31  ? 52  TYR B CA    1 
ATOM   1019  C C     . TYR B 2  54  ? 100.504 132.198 127.070 1.00 89.03  ? 52  TYR B C     1 
ATOM   1020  O O     . TYR B 2  54  ? 100.422 130.970 127.082 1.00 87.55  ? 52  TYR B O     1 
ATOM   1021  C CB    . TYR B 2  54  ? 101.609 133.509 128.913 1.00 89.95  ? 52  TYR B CB    1 
ATOM   1022  C CG    . TYR B 2  54  ? 102.902 134.082 129.428 1.00 90.09  ? 52  TYR B CG    1 
ATOM   1023  C CD1   . TYR B 2  54  ? 103.055 135.447 129.561 1.00 91.88  ? 52  TYR B CD1   1 
ATOM   1024  C CD2   . TYR B 2  54  ? 103.945 133.241 129.737 1.00 94.08  ? 52  TYR B CD2   1 
ATOM   1025  C CE1   . TYR B 2  54  ? 104.243 135.961 130.038 1.00 94.60  ? 52  TYR B CE1   1 
ATOM   1026  C CE2   . TYR B 2  54  ? 105.129 133.750 130.205 1.00 95.97  ? 52  TYR B CE2   1 
ATOM   1027  C CZ    . TYR B 2  54  ? 105.276 135.101 130.369 1.00 96.16  ? 52  TYR B CZ    1 
ATOM   1028  O OH    . TYR B 2  54  ? 106.452 135.596 130.865 1.00 95.13  ? 52  TYR B OH    1 
ATOM   1029  N N     . GLU B 2  55  ? 99.552  132.974 126.571 1.00 89.92  ? 53  GLU B N     1 
ATOM   1030  C CA    . GLU B 2  55  ? 98.303  132.395 126.112 1.00 92.22  ? 53  GLU B CA    1 
ATOM   1031  C C     . GLU B 2  55  ? 98.465  131.638 124.806 1.00 90.82  ? 53  GLU B C     1 
ATOM   1032  O O     . GLU B 2  55  ? 97.906  130.551 124.637 1.00 90.52  ? 53  GLU B O     1 
ATOM   1033  C CB    . GLU B 2  55  ? 97.252  133.482 125.957 1.00 96.31  ? 53  GLU B CB    1 
ATOM   1034  C CG    . GLU B 2  55  ? 96.826  134.080 127.266 1.00 104.13 ? 53  GLU B CG    1 
ATOM   1035  C CD    . GLU B 2  55  ? 96.318  133.040 128.203 1.00 108.59 ? 53  GLU B CD    1 
ATOM   1036  O OE1   . GLU B 2  55  ? 95.456  132.292 127.817 1.00 109.16 ? 53  GLU B OE1   1 
ATOM   1037  O OE2   . GLU B 2  55  ? 96.822  132.958 129.295 1.00 104.53 ? 53  GLU B OE2   1 
ATOM   1038  N N     . GLU B 2  56  ? 99.289  132.165 123.910 1.00 88.68  ? 54  GLU B N     1 
ATOM   1039  C CA    . GLU B 2  56  ? 99.488  131.509 122.628 1.00 91.01  ? 54  GLU B CA    1 
ATOM   1040  C C     . GLU B 2  56  ? 100.214 130.188 122.832 1.00 88.78  ? 54  GLU B C     1 
ATOM   1041  O O     . GLU B 2  56  ? 99.889  129.179 122.202 1.00 87.84  ? 54  GLU B O     1 
ATOM   1042  C CB    . GLU B 2  56  ? 100.295 132.406 121.692 1.00 94.05  ? 54  GLU B CB    1 
ATOM   1043  C CG    . GLU B 2  56  ? 100.350 131.932 120.245 1.00 99.48  ? 54  GLU B CG    1 
ATOM   1044  C CD    . GLU B 2  56  ? 99.001  131.981 119.566 1.00 105.80 ? 54  GLU B CD    1 
ATOM   1045  O OE1   . GLU B 2  56  ? 98.128  132.636 120.078 1.00 102.76 ? 54  GLU B OE1   1 
ATOM   1046  O OE2   . GLU B 2  56  ? 98.858  131.397 118.517 1.00 106.13 ? 54  GLU B OE2   1 
ATOM   1047  N N     . THR B 2  57  ? 101.163 130.189 123.759 1.00 84.65  ? 55  THR B N     1 
ATOM   1048  C CA    . THR B 2  57  ? 101.954 129.009 124.052 1.00 83.42  ? 55  THR B CA    1 
ATOM   1049  C C     . THR B 2  57  ? 101.062 127.911 124.578 1.00 83.12  ? 55  THR B C     1 
ATOM   1050  O O     . THR B 2  57  ? 101.192 126.750 124.189 1.00 80.53  ? 55  THR B O     1 
ATOM   1051  C CB    . THR B 2  57  ? 103.034 129.311 125.100 1.00 85.19  ? 55  THR B CB    1 
ATOM   1052  O OG1   . THR B 2  57  ? 103.903 130.334 124.607 1.00 89.25  ? 55  THR B OG1   1 
ATOM   1053  C CG2   . THR B 2  57  ? 103.845 128.056 125.383 1.00 87.20  ? 55  THR B CG2   1 
ATOM   1054  N N     . ARG B 2  58  ? 100.158 128.284 125.469 1.00 81.37  ? 56  ARG B N     1 
ATOM   1055  C CA    . ARG B 2  58  ? 99.232  127.341 126.056 1.00 80.27  ? 56  ARG B CA    1 
ATOM   1056  C C     . ARG B 2  58  ? 98.357  126.680 125.016 1.00 80.81  ? 56  ARG B C     1 
ATOM   1057  O O     . ARG B 2  58  ? 98.231  125.455 124.992 1.00 79.47  ? 56  ARG B O     1 
ATOM   1058  C CB    . ARG B 2  58  ? 98.363  128.057 127.052 1.00 81.15  ? 56  ARG B CB    1 
ATOM   1059  C CG    . ARG B 2  58  ? 99.065  128.392 128.313 1.00 85.92  ? 56  ARG B CG    1 
ATOM   1060  C CD    . ARG B 2  58  ? 98.289  129.289 129.170 1.00 90.75  ? 56  ARG B CD    1 
ATOM   1061  N NE    . ARG B 2  58  ? 98.923  129.434 130.451 1.00 91.31  ? 56  ARG B NE    1 
ATOM   1062  C CZ    . ARG B 2  58  ? 98.656  130.387 131.347 1.00 93.05  ? 56  ARG B CZ    1 
ATOM   1063  N NH1   . ARG B 2  58  ? 97.774  131.322 131.097 1.00 93.89  ? 56  ARG B NH1   1 
ATOM   1064  N NH2   . ARG B 2  58  ? 99.289  130.376 132.499 1.00 93.76  ? 56  ARG B NH2   1 
ATOM   1065  N N     . GLY B 2  59  ? 97.859  127.466 124.074 1.00 81.04  ? 57  GLY B N     1 
ATOM   1066  C CA    . GLY B 2  59  ? 97.029  126.898 123.028 1.00 82.40  ? 57  GLY B CA    1 
ATOM   1067  C C     . GLY B 2  59  ? 97.800  125.827 122.275 1.00 81.54  ? 57  GLY B C     1 
ATOM   1068  O O     . GLY B 2  59  ? 97.284  124.737 122.021 1.00 82.34  ? 57  GLY B O     1 
ATOM   1069  N N     . VAL B 2  60  ? 99.056  126.119 121.970 1.00 78.09  ? 58  VAL B N     1 
ATOM   1070  C CA    . VAL B 2  60  ? 99.878  125.180 121.231 1.00 78.85  ? 58  VAL B CA    1 
ATOM   1071  C C     . VAL B 2  60  ? 100.206 123.943 122.051 1.00 80.15  ? 58  VAL B C     1 
ATOM   1072  O O     . VAL B 2  60  ? 100.123 122.820 121.548 1.00 81.91  ? 58  VAL B O     1 
ATOM   1073  C CB    . VAL B 2  60  ? 101.177 125.847 120.779 1.00 82.87  ? 58  VAL B CB    1 
ATOM   1074  C CG1   . VAL B 2  60  ? 102.085 124.819 120.159 1.00 88.47  ? 58  VAL B CG1   1 
ATOM   1075  C CG2   . VAL B 2  60  ? 100.864 126.954 119.794 1.00 88.47  ? 58  VAL B CG2   1 
ATOM   1076  N N     . LEU B 2  61  ? 100.589 124.139 123.308 1.00 78.64  ? 59  LEU B N     1 
ATOM   1077  C CA    . LEU B 2  61  ? 100.908 123.010 124.164 1.00 79.54  ? 59  LEU B CA    1 
ATOM   1078  C C     . LEU B 2  61  ? 99.730  122.084 124.270 1.00 78.51  ? 59  LEU B C     1 
ATOM   1079  O O     . LEU B 2  61  ? 99.869  120.865 124.173 1.00 78.60  ? 59  LEU B O     1 
ATOM   1080  C CB    . LEU B 2  61  ? 101.286 123.474 125.572 1.00 77.71  ? 59  LEU B CB    1 
ATOM   1081  C CG    . LEU B 2  61  ? 101.395 122.350 126.648 1.00 78.12  ? 59  LEU B CG    1 
ATOM   1082  C CD1   . LEU B 2  61  ? 102.437 121.305 126.246 1.00 84.11  ? 59  LEU B CD1   1 
ATOM   1083  C CD2   . LEU B 2  61  ? 101.744 122.979 127.993 1.00 85.03  ? 59  LEU B CD2   1 
ATOM   1084  N N     . LYS B 2  62  ? 98.568  122.660 124.494 1.00 77.02  ? 60  LYS B N     1 
ATOM   1085  C CA    . LYS B 2  62  ? 97.385  121.868 124.694 1.00 77.24  ? 60  LYS B CA    1 
ATOM   1086  C C     . LYS B 2  62  ? 97.100  120.982 123.502 1.00 80.20  ? 60  LYS B C     1 
ATOM   1087  O O     . LYS B 2  62  ? 96.774  119.809 123.665 1.00 80.63  ? 60  LYS B O     1 
ATOM   1088  C CB    . LYS B 2  62  ? 96.209  122.770 124.958 1.00 77.76  ? 60  LYS B CB    1 
ATOM   1089  C CG    . LYS B 2  62  ? 94.969  122.045 125.300 1.00 80.88  ? 60  LYS B CG    1 
ATOM   1090  C CD    . LYS B 2  62  ? 93.910  122.997 125.744 1.00 87.82  ? 60  LYS B CD    1 
ATOM   1091  C CE    . LYS B 2  62  ? 92.665  122.267 126.158 1.00 94.82  ? 60  LYS B CE    1 
ATOM   1092  N NZ    . LYS B 2  62  ? 91.624  123.195 126.659 1.00 99.42  ? 60  LYS B NZ    1 
ATOM   1093  N N     . VAL B 2  63  ? 97.240  121.529 122.302 1.00 77.56  ? 61  VAL B N     1 
ATOM   1094  C CA    . VAL B 2  63  ? 96.978  120.741 121.111 1.00 79.69  ? 61  VAL B CA    1 
ATOM   1095  C C     . VAL B 2  63  ? 97.993  119.623 120.955 1.00 81.88  ? 61  VAL B C     1 
ATOM   1096  O O     . VAL B 2  63  ? 97.636  118.495 120.611 1.00 83.93  ? 61  VAL B O     1 
ATOM   1097  C CB    . VAL B 2  63  ? 96.980  121.629 119.860 1.00 82.78  ? 61  VAL B CB    1 
ATOM   1098  C CG1   . VAL B 2  63  ? 96.911  120.769 118.600 1.00 90.46  ? 61  VAL B CG1   1 
ATOM   1099  C CG2   . VAL B 2  63  ? 95.793  122.568 119.918 1.00 83.51  ? 61  VAL B CG2   1 
ATOM   1100  N N     . PHE B 2  64  ? 99.267  119.940 121.155 1.00 79.67  ? 62  PHE B N     1 
ATOM   1101  C CA    . PHE B 2  64  ? 100.299 118.925 121.034 1.00 81.66  ? 62  PHE B CA    1 
ATOM   1102  C C     . PHE B 2  64  ? 100.051 117.799 122.018 1.00 83.35  ? 62  PHE B C     1 
ATOM   1103  O O     . PHE B 2  64  ? 100.009 116.624 121.644 1.00 83.76  ? 62  PHE B O     1 
ATOM   1104  C CB    . PHE B 2  64  ? 101.679 119.516 121.292 1.00 83.75  ? 62  PHE B CB    1 
ATOM   1105  C CG    . PHE B 2  64  ? 102.748 118.481 121.339 1.00 84.70  ? 62  PHE B CG    1 
ATOM   1106  C CD1   . PHE B 2  64  ? 103.280 117.967 120.175 1.00 88.62  ? 62  PHE B CD1   1 
ATOM   1107  C CD2   . PHE B 2  64  ? 103.205 117.993 122.551 1.00 86.00  ? 62  PHE B CD2   1 
ATOM   1108  C CE1   . PHE B 2  64  ? 104.251 116.992 120.217 1.00 94.68  ? 62  PHE B CE1   1 
ATOM   1109  C CE2   . PHE B 2  64  ? 104.170 117.015 122.595 1.00 90.09  ? 62  PHE B CE2   1 
ATOM   1110  C CZ    . PHE B 2  64  ? 104.696 116.516 121.428 1.00 95.26  ? 62  PHE B CZ    1 
ATOM   1111  N N     . LEU B 2  65  ? 99.837  118.167 123.273 1.00 81.78  ? 63  LEU B N     1 
ATOM   1112  C CA    . LEU B 2  65  ? 99.611  117.194 124.320 1.00 82.90  ? 63  LEU B CA    1 
ATOM   1113  C C     . LEU B 2  65  ? 98.343  116.403 124.064 1.00 83.69  ? 63  LEU B C     1 
ATOM   1114  O O     . LEU B 2  65  ? 98.327  115.180 124.207 1.00 81.46  ? 63  LEU B O     1 
ATOM   1115  C CB    . LEU B 2  65  ? 99.545  117.902 125.677 1.00 78.59  ? 63  LEU B CB    1 
ATOM   1116  C CG    . LEU B 2  65  ? 99.180  117.035 126.887 1.00 84.24  ? 63  LEU B CG    1 
ATOM   1117  C CD1   . LEU B 2  65  ? 100.158 115.874 127.036 1.00 89.63  ? 63  LEU B CD1   1 
ATOM   1118  C CD2   . LEU B 2  65  ? 99.195  117.909 128.132 1.00 88.93  ? 63  LEU B CD2   1 
ATOM   1119  N N     . GLU B 2  66  ? 97.286  117.088 123.658 1.00 83.73  ? 64  GLU B N     1 
ATOM   1120  C CA    . GLU B 2  66  ? 96.022  116.426 123.422 1.00 84.35  ? 64  GLU B CA    1 
ATOM   1121  C C     . GLU B 2  66  ? 96.126  115.351 122.362 1.00 84.92  ? 64  GLU B C     1 
ATOM   1122  O O     . GLU B 2  66  ? 95.605  114.249 122.540 1.00 82.96  ? 64  GLU B O     1 
ATOM   1123  C CB    . GLU B 2  66  ? 94.964  117.437 123.010 1.00 85.07  ? 64  GLU B CB    1 
ATOM   1124  C CG    . GLU B 2  66  ? 93.628  116.824 122.711 1.00 94.28  ? 64  GLU B CG    1 
ATOM   1125  C CD    . GLU B 2  66  ? 92.593  117.831 122.374 1.00 105.43 ? 64  GLU B CD    1 
ATOM   1126  O OE1   . GLU B 2  66  ? 92.821  118.991 122.602 1.00 101.52 ? 64  GLU B OE1   1 
ATOM   1127  O OE2   . GLU B 2  66  ? 91.565  117.445 121.873 1.00 113.56 ? 64  GLU B OE2   1 
ATOM   1128  N N     . ASN B 2  67  ? 96.815  115.650 121.271 1.00 84.64  ? 65  ASN B N     1 
ATOM   1129  C CA    . ASN B 2  67  ? 96.931  114.677 120.203 1.00 84.79  ? 65  ASN B CA    1 
ATOM   1130  C C     . ASN B 2  67  ? 97.683  113.444 120.672 1.00 85.06  ? 65  ASN B C     1 
ATOM   1131  O O     . ASN B 2  67  ? 97.261  112.316 120.412 1.00 84.29  ? 65  ASN B O     1 
ATOM   1132  C CB    . ASN B 2  67  ? 97.608  115.295 119.001 1.00 87.05  ? 65  ASN B CB    1 
ATOM   1133  C CG    . ASN B 2  67  ? 96.714  116.253 118.259 1.00 93.10  ? 65  ASN B CG    1 
ATOM   1134  O OD1   . ASN B 2  67  ? 95.477  116.202 118.350 1.00 93.18  ? 65  ASN B OD1   1 
ATOM   1135  N ND2   . ASN B 2  67  ? 97.321  117.126 117.500 1.00 93.97  ? 65  ASN B ND2   1 
ATOM   1136  N N     . VAL B 2  68  ? 98.719  113.651 121.472 1.00 78.74  ? 66  VAL B N     1 
ATOM   1137  C CA    . VAL B 2  68  ? 99.487  112.526 121.976 1.00 79.43  ? 66  VAL B CA    1 
ATOM   1138  C C     . VAL B 2  68  ? 98.660  111.669 122.917 1.00 81.96  ? 66  VAL B C     1 
ATOM   1139  O O     . VAL B 2  68  ? 98.678  110.439 122.823 1.00 83.79  ? 66  VAL B O     1 
ATOM   1140  C CB    . VAL B 2  68  ? 100.749 113.003 122.707 1.00 83.02  ? 66  VAL B CB    1 
ATOM   1141  C CG1   . VAL B 2  68  ? 101.422 111.825 123.393 1.00 88.51  ? 66  VAL B CG1   1 
ATOM   1142  C CG2   . VAL B 2  68  ? 101.702 113.652 121.715 1.00 89.86  ? 66  VAL B CG2   1 
ATOM   1143  N N     . ILE B 2  69  ? 97.930  112.311 123.821 1.00 79.17  ? 67  ILE B N     1 
ATOM   1144  C CA    . ILE B 2  69  ? 97.136  111.562 124.779 1.00 79.30  ? 67  ILE B CA    1 
ATOM   1145  C C     . ILE B 2  69  ? 96.098  110.745 124.059 1.00 82.00  ? 67  ILE B C     1 
ATOM   1146  O O     . ILE B 2  69  ? 95.937  109.556 124.323 1.00 79.90  ? 67  ILE B O     1 
ATOM   1147  C CB    . ILE B 2  69  ? 96.414  112.485 125.770 1.00 79.37  ? 67  ILE B CB    1 
ATOM   1148  C CG1   . ILE B 2  69  ? 97.414  113.169 126.681 1.00 85.78  ? 67  ILE B CG1   1 
ATOM   1149  C CG2   . ILE B 2  69  ? 95.395  111.681 126.594 1.00 81.94  ? 67  ILE B CG2   1 
ATOM   1150  C CD1   . ILE B 2  69  ? 96.827  114.318 127.458 1.00 92.18  ? 67  ILE B CD1   1 
ATOM   1151  N N     . ARG B 2  70  ? 95.411  111.365 123.121 1.00 79.50  ? 68  ARG B N     1 
ATOM   1152  C CA    . ARG B 2  70  ? 94.332  110.687 122.444 1.00 84.65  ? 68  ARG B CA    1 
ATOM   1153  C C     . ARG B 2  70  ? 94.790  109.395 121.801 1.00 82.41  ? 68  ARG B C     1 
ATOM   1154  O O     . ARG B 2  70  ? 94.109  108.374 121.902 1.00 80.69  ? 68  ARG B O     1 
ATOM   1155  C CB    . ARG B 2  70  ? 93.745  111.566 121.384 1.00 85.85  ? 68  ARG B CB    1 
ATOM   1156  C CG    . ARG B 2  70  ? 92.509  111.012 120.757 1.00 90.05  ? 68  ARG B CG    1 
ATOM   1157  C CD    . ARG B 2  70  ? 91.859  111.994 119.883 1.00 96.47  ? 68  ARG B CD    1 
ATOM   1158  N NE    . ARG B 2  70  ? 92.710  112.357 118.776 1.00 101.69 ? 68  ARG B NE    1 
ATOM   1159  C CZ    . ARG B 2  70  ? 93.356  113.535 118.635 1.00 104.60 ? 68  ARG B CZ    1 
ATOM   1160  N NH1   . ARG B 2  70  ? 93.241  114.495 119.524 1.00 100.21 ? 68  ARG B NH1   1 
ATOM   1161  N NH2   . ARG B 2  70  ? 94.134  113.729 117.595 1.00 104.03 ? 68  ARG B NH2   1 
ATOM   1162  N N     . ASP B 2  71  ? 95.947  109.423 121.152 1.00 81.75  ? 69  ASP B N     1 
ATOM   1163  C CA    . ASP B 2  71  ? 96.441  108.215 120.518 1.00 83.11  ? 69  ASP B CA    1 
ATOM   1164  C C     . ASP B 2  71  ? 96.809  107.176 121.567 1.00 82.86  ? 69  ASP B C     1 
ATOM   1165  O O     . ASP B 2  71  ? 96.459  106.003 121.437 1.00 79.33  ? 69  ASP B O     1 
ATOM   1166  C CB    . ASP B 2  71  ? 97.649  108.527 119.641 1.00 89.70  ? 69  ASP B CB    1 
ATOM   1167  C CG    . ASP B 2  71  ? 97.288  109.285 118.367 0.00 97.57  ? 69  ASP B CG    1 
ATOM   1168  O OD1   . ASP B 2  71  ? 96.141  109.287 117.987 0.00 93.07  ? 69  ASP B OD1   1 
ATOM   1169  O OD2   . ASP B 2  71  ? 98.170  109.872 117.790 0.00 98.91  ? 69  ASP B OD2   1 
ATOM   1170  N N     . ALA B 2  72  ? 97.420  107.619 122.663 1.00 80.07  ? 70  ALA B N     1 
ATOM   1171  C CA    . ALA B 2  72  ? 97.781  106.693 123.728 1.00 84.51  ? 70  ALA B CA    1 
ATOM   1172  C C     . ALA B 2  72  ? 96.533  106.046 124.321 1.00 81.42  ? 70  ALA B C     1 
ATOM   1173  O O     . ALA B 2  72  ? 96.509  104.840 124.586 1.00 80.83  ? 70  ALA B O     1 
ATOM   1174  C CB    . ALA B 2  72  ? 98.575  107.410 124.805 1.00 84.48  ? 70  ALA B CB    1 
ATOM   1175  N N     . VAL B 2  73  ? 95.473  106.834 124.455 1.00 77.21  ? 71  VAL B N     1 
ATOM   1176  C CA    . VAL B 2  73  ? 94.207  106.327 124.951 1.00 77.14  ? 71  VAL B CA    1 
ATOM   1177  C C     . VAL B 2  73  ? 93.603  105.366 123.949 1.00 80.15  ? 71  VAL B C     1 
ATOM   1178  O O     . VAL B 2  73  ? 93.060  104.331 124.328 1.00 80.31  ? 71  VAL B O     1 
ATOM   1179  C CB    . VAL B 2  73  ? 93.227  107.473 125.258 1.00 79.00  ? 71  VAL B CB    1 
ATOM   1180  C CG1   . VAL B 2  73  ? 91.838  106.922 125.561 1.00 82.63  ? 71  VAL B CG1   1 
ATOM   1181  C CG2   . VAL B 2  73  ? 93.738  108.260 126.459 1.00 85.13  ? 71  VAL B CG2   1 
ATOM   1182  N N     . THR B 2  74  ? 93.684  105.716 122.674 1.00 78.22  ? 72  THR B N     1 
ATOM   1183  C CA    . THR B 2  74  ? 93.150  104.881 121.612 1.00 76.83  ? 72  THR B CA    1 
ATOM   1184  C C     . THR B 2  74  ? 93.800  103.506 121.624 1.00 78.27  ? 72  THR B C     1 
ATOM   1185  O O     . THR B 2  74  ? 93.113  102.489 121.519 1.00 80.13  ? 72  THR B O     1 
ATOM   1186  C CB    . THR B 2  74  ? 93.360  105.548 120.245 1.00 80.37  ? 72  THR B CB    1 
ATOM   1187  O OG1   . THR B 2  74  ? 92.672  106.804 120.224 1.00 84.86  ? 72  THR B OG1   1 
ATOM   1188  C CG2   . THR B 2  74  ? 92.833  104.666 119.129 1.00 83.90  ? 72  THR B CG2   1 
ATOM   1189  N N     . TYR B 2  75  ? 95.120  103.469 121.781 1.00 76.21  ? 73  TYR B N     1 
ATOM   1190  C CA    . TYR B 2  75  ? 95.822  102.195 121.853 1.00 77.39  ? 73  TYR B CA    1 
ATOM   1191  C C     . TYR B 2  75  ? 95.377  101.411 123.078 1.00 81.26  ? 73  TYR B C     1 
ATOM   1192  O O     . TYR B 2  75  ? 95.122  100.205 123.002 1.00 81.98  ? 73  TYR B O     1 
ATOM   1193  C CB    . TYR B 2  75  ? 97.337  102.410 121.909 1.00 76.05  ? 73  TYR B CB    1 
ATOM   1194  C CG    . TYR B 2  75  ? 97.981  102.750 120.585 1.00 78.68  ? 73  TYR B CG    1 
ATOM   1195  C CD1   . TYR B 2  75  ? 98.610  103.971 120.405 1.00 84.56  ? 73  TYR B CD1   1 
ATOM   1196  C CD2   . TYR B 2  75  ? 97.966  101.829 119.561 1.00 83.13  ? 73  TYR B CD2   1 
ATOM   1197  C CE1   . TYR B 2  75  ? 99.219  104.263 119.204 1.00 86.79  ? 73  TYR B CE1   1 
ATOM   1198  C CE2   . TYR B 2  75  ? 98.573  102.121 118.362 1.00 86.38  ? 73  TYR B CE2   1 
ATOM   1199  C CZ    . TYR B 2  75  ? 99.199  103.328 118.182 1.00 87.49  ? 73  TYR B CZ    1 
ATOM   1200  O OH    . TYR B 2  75  ? 99.808  103.611 116.983 1.00 90.82  ? 73  TYR B OH    1 
ATOM   1201  N N     . THR B 2  76  ? 95.219  102.118 124.190 1.00 79.55  ? 74  THR B N     1 
ATOM   1202  C CA    . THR B 2  76  ? 94.815  101.504 125.442 1.00 82.60  ? 74  THR B CA    1 
ATOM   1203  C C     . THR B 2  76  ? 93.426  100.902 125.299 1.00 83.31  ? 74  THR B C     1 
ATOM   1204  O O     . THR B 2  76  ? 93.174  99.774  125.731 1.00 84.73  ? 74  THR B O     1 
ATOM   1205  C CB    . THR B 2  76  ? 94.815  102.545 126.579 1.00 84.44  ? 74  THR B CB    1 
ATOM   1206  O OG1   . THR B 2  76  ? 96.125  103.120 126.710 1.00 85.54  ? 74  THR B OG1   1 
ATOM   1207  C CG2   . THR B 2  76  ? 94.426  101.897 127.898 1.00 89.69  ? 74  THR B CG2   1 
ATOM   1208  N N     . GLU B 2  77  ? 92.541  101.642 124.638 1.00 82.33  ? 75  GLU B N     1 
ATOM   1209  C CA    . GLU B 2  77  ? 91.168  101.215 124.433 1.00 86.46  ? 75  GLU B CA    1 
ATOM   1210  C C     . GLU B 2  77  ? 91.097  99.988  123.542 1.00 86.49  ? 75  GLU B C     1 
ATOM   1211  O O     . GLU B 2  77  ? 90.371  99.040  123.835 1.00 89.36  ? 75  GLU B O     1 
ATOM   1212  C CB    . GLU B 2  77  ? 90.362  102.347 123.800 1.00 91.27  ? 75  GLU B CB    1 
ATOM   1213  C CG    . GLU B 2  77  ? 88.903  102.021 123.534 1.00 101.87 ? 75  GLU B CG    1 
ATOM   1214  C CD    . GLU B 2  77  ? 88.114  101.811 124.782 0.00 110.50 ? 75  GLU B CD    1 
ATOM   1215  O OE1   . GLU B 2  77  ? 88.542  102.266 125.812 0.00 108.11 ? 75  GLU B OE1   1 
ATOM   1216  O OE2   . GLU B 2  77  ? 87.074  101.203 124.709 0.00 114.01 ? 75  GLU B OE2   1 
ATOM   1217  N N     . HIS B 2  78  ? 91.909  99.964  122.495 1.00 83.88  ? 76  HIS B N     1 
ATOM   1218  C CA    . HIS B 2  78  ? 91.934  98.825  121.589 1.00 87.26  ? 76  HIS B CA    1 
ATOM   1219  C C     . HIS B 2  78  ? 92.220  97.542  122.344 1.00 86.55  ? 76  HIS B C     1 
ATOM   1220  O O     . HIS B 2  78  ? 91.535  96.528  122.170 1.00 89.31  ? 76  HIS B O     1 
ATOM   1221  C CB    . HIS B 2  78  ? 92.996  99.012  120.514 1.00 86.34  ? 76  HIS B CB    1 
ATOM   1222  C CG    . HIS B 2  78  ? 93.167  97.814  119.668 1.00 86.87  ? 76  HIS B CG    1 
ATOM   1223  N ND1   . HIS B 2  78  ? 92.246  97.434  118.724 1.00 89.19  ? 76  HIS B ND1   1 
ATOM   1224  C CD2   . HIS B 2  78  ? 94.129  96.870  119.661 1.00 87.71  ? 76  HIS B CD2   1 
ATOM   1225  C CE1   . HIS B 2  78  ? 92.638  96.303  118.166 1.00 91.24  ? 76  HIS B CE1   1 
ATOM   1226  N NE2   . HIS B 2  78  ? 93.780  95.943  118.718 1.00 90.12  ? 76  HIS B NE2   1 
ATOM   1227  N N     . ALA B 2  79  ? 93.170  97.633  123.269 1.00 83.69  ? 77  ALA B N     1 
ATOM   1228  C CA    . ALA B 2  79  ? 93.605  96.506  124.080 1.00 87.20  ? 77  ALA B CA    1 
ATOM   1229  C C     . ALA B 2  79  ? 92.612  96.184  125.190 1.00 87.42  ? 77  ALA B C     1 
ATOM   1230  O O     . ALA B 2  79  ? 92.833  95.267  125.981 1.00 87.91  ? 77  ALA B O     1 
ATOM   1231  C CB    . ALA B 2  79  ? 94.963  96.802  124.688 1.00 88.78  ? 77  ALA B CB    1 
ATOM   1232  N N     . LYS B 2  80  ? 91.544  96.968  125.275 1.00 88.88  ? 78  LYS B N     1 
ATOM   1233  C CA    . LYS B 2  80  ? 90.517  96.797  126.289 1.00 92.76  ? 78  LYS B CA    1 
ATOM   1234  C C     . LYS B 2  80  ? 91.081  96.926  127.685 1.00 91.56  ? 78  LYS B C     1 
ATOM   1235  O O     . LYS B 2  80  ? 90.698  96.193  128.596 1.00 91.66  ? 78  LYS B O     1 
ATOM   1236  C CB    . LYS B 2  80  ? 89.802  95.461  126.120 1.00 92.72  ? 78  LYS B CB    1 
ATOM   1237  C CG    . LYS B 2  80  ? 89.070  95.329  124.801 1.00 96.54  ? 78  LYS B CG    1 
ATOM   1238  C CD    . LYS B 2  80  ? 88.234  94.070  124.744 1.00 98.44  ? 78  LYS B CD    1 
ATOM   1239  C CE    . LYS B 2  80  ? 87.528  93.938  123.410 1.00 95.36  ? 78  LYS B CE    1 
ATOM   1240  N NZ    . LYS B 2  80  ? 86.740  92.695  123.324 1.00 98.16  ? 78  LYS B NZ    1 
ATOM   1241  N N     . ARG B 2  81  ? 91.976  97.883  127.851 1.00 91.48  ? 79  ARG B N     1 
ATOM   1242  C CA    . ARG B 2  81  ? 92.553  98.177  129.144 1.00 91.40  ? 79  ARG B CA    1 
ATOM   1243  C C     . ARG B 2  81  ? 92.104  99.537  129.625 1.00 93.33  ? 79  ARG B C     1 
ATOM   1244  O O     . ARG B 2  81  ? 91.439  100.273 128.897 1.00 96.92  ? 79  ARG B O     1 
ATOM   1245  C CB    . ARG B 2  81  ? 94.050  98.109  129.087 1.00 92.06  ? 79  ARG B CB    1 
ATOM   1246  C CG    . ARG B 2  81  ? 94.581  96.733  128.848 1.00 95.68  ? 79  ARG B CG    1 
ATOM   1247  C CD    . ARG B 2  81  ? 96.044  96.678  129.006 1.00 100.23 ? 79  ARG B CD    1 
ATOM   1248  N NE    . ARG B 2  81  ? 96.737  97.352  127.937 1.00 98.18  ? 79  ARG B NE    1 
ATOM   1249  C CZ    . ARG B 2  81  ? 97.246  98.587  128.024 1.00 95.78  ? 79  ARG B CZ    1 
ATOM   1250  N NH1   . ARG B 2  81  ? 97.058  99.298  129.109 1.00 94.53  ? 79  ARG B NH1   1 
ATOM   1251  N NH2   . ARG B 2  81  ? 97.905  99.097  127.011 1.00 93.36  ? 79  ARG B NH2   1 
ATOM   1252  N N     . LYS B 2  82  ? 92.402  99.815  130.891 1.00 89.13  ? 80  LYS B N     1 
ATOM   1253  C CA    . LYS B 2  82  ? 91.917  101.000 131.584 1.00 92.53  ? 80  LYS B CA    1 
ATOM   1254  C C     . LYS B 2  82  ? 93.063  101.967 131.855 1.00 94.22  ? 80  LYS B C     1 
ATOM   1255  O O     . LYS B 2  82  ? 92.871  103.186 131.865 1.00 95.70  ? 80  LYS B O     1 
ATOM   1256  C CB    . LYS B 2  82  ? 91.275  100.595 132.909 1.00 97.55  ? 80  LYS B CB    1 
ATOM   1257  C CG    . LYS B 2  82  ? 90.171  99.552  132.795 1.00 102.98 ? 80  LYS B CG    1 
ATOM   1258  C CD    . LYS B 2  82  ? 88.927  100.102 132.116 1.00 110.45 ? 80  LYS B CD    1 
ATOM   1259  C CE    . LYS B 2  82  ? 87.808  99.073  132.116 1.00 114.57 ? 80  LYS B CE    1 
ATOM   1260  N NZ    . LYS B 2  82  ? 86.486  99.663  131.776 1.00 114.80 ? 80  LYS B NZ    1 
ATOM   1261  N N     . THR B 2  83  ? 94.249  101.410 132.083 1.00 90.69  ? 81  THR B N     1 
ATOM   1262  C CA    . THR B 2  83  ? 95.412  102.219 132.413 1.00 89.58  ? 81  THR B CA    1 
ATOM   1263  C C     . THR B 2  83  ? 96.279  102.433 131.185 1.00 88.11  ? 81  THR B C     1 
ATOM   1264  O O     . THR B 2  83  ? 96.640  101.483 130.488 1.00 89.94  ? 81  THR B O     1 
ATOM   1265  C CB    . THR B 2  83  ? 96.251  101.573 133.529 1.00 92.87  ? 81  THR B CB    1 
ATOM   1266  O OG1   . THR B 2  83  ? 95.448  101.427 134.707 1.00 97.79  ? 81  THR B OG1   1 
ATOM   1267  C CG2   . THR B 2  83  ? 97.465  102.451 133.857 1.00 94.48  ? 81  THR B CG2   1 
ATOM   1268  N N     . VAL B 2  84  ? 96.636  103.682 130.936 1.00 85.44  ? 82  VAL B N     1 
ATOM   1269  C CA    . VAL B 2  84  ? 97.524  104.010 129.841 1.00 83.36  ? 82  VAL B CA    1 
ATOM   1270  C C     . VAL B 2  84  ? 98.951  103.772 130.286 1.00 87.16  ? 82  VAL B C     1 
ATOM   1271  O O     . VAL B 2  84  ? 99.366  104.250 131.344 1.00 85.17  ? 82  VAL B O     1 
ATOM   1272  C CB    . VAL B 2  84  ? 97.349  105.483 129.443 1.00 85.34  ? 82  VAL B CB    1 
ATOM   1273  C CG1   . VAL B 2  84  ? 98.327  105.856 128.339 1.00 88.86  ? 82  VAL B CG1   1 
ATOM   1274  C CG2   . VAL B 2  84  ? 95.915  105.729 129.003 1.00 89.73  ? 82  VAL B CG2   1 
ATOM   1275  N N     . THR B 2  85  ? 99.702  103.013 129.504 1.00 84.91  ? 83  THR B N     1 
ATOM   1276  C CA    . THR B 2  85  ? 101.068 102.735 129.893 1.00 83.90  ? 83  THR B CA    1 
ATOM   1277  C C     . THR B 2  85  ? 102.021 103.688 129.214 1.00 85.45  ? 83  THR B C     1 
ATOM   1278  O O     . THR B 2  85  ? 101.690 104.299 128.197 1.00 82.43  ? 83  THR B O     1 
ATOM   1279  C CB    . THR B 2  85  ? 101.467 101.288 129.571 1.00 87.84  ? 83  THR B CB    1 
ATOM   1280  O OG1   . THR B 2  85  ? 101.459 101.089 128.156 1.00 88.04  ? 83  THR B OG1   1 
ATOM   1281  C CG2   . THR B 2  85  ? 100.511 100.315 130.228 1.00 92.17  ? 83  THR B CG2   1 
ATOM   1282  N N     . ALA B 2  86  ? 103.240 103.752 129.717 1.00 85.17  ? 84  ALA B N     1 
ATOM   1283  C CA    . ALA B 2  86  ? 104.234 104.606 129.092 1.00 87.15  ? 84  ALA B CA    1 
ATOM   1284  C C     . ALA B 2  86  ? 104.464 104.173 127.659 1.00 83.43  ? 84  ALA B C     1 
ATOM   1285  O O     . ALA B 2  86  ? 104.632 105.006 126.771 1.00 82.59  ? 84  ALA B O     1 
ATOM   1286  C CB    . ALA B 2  86  ? 105.531 104.583 129.874 1.00 91.80  ? 84  ALA B CB    1 
ATOM   1287  N N     . MET B 2  87  ? 104.364 102.875 127.416 1.00 82.44  ? 85  MET B N     1 
ATOM   1288  C CA    . MET B 2  87  ? 104.592 102.349 126.086 1.00 85.27  ? 85  MET B CA    1 
ATOM   1289  C C     . MET B 2  87  ? 103.543 102.838 125.101 1.00 86.05  ? 85  MET B C     1 
ATOM   1290  O O     . MET B 2  87  ? 103.816 102.949 123.905 1.00 83.41  ? 85  MET B O     1 
ATOM   1291  C CB    . MET B 2  87  ? 104.623 100.829 126.114 1.00 88.60  ? 85  MET B CB    1 
ATOM   1292  C CG    . MET B 2  87  ? 105.187 100.226 124.858 1.00 97.29  ? 85  MET B CG    1 
ATOM   1293  S SD    . MET B 2  87  ? 106.910 100.669 124.639 1.00 114.86 ? 85  MET B SD    1 
ATOM   1294  C CE    . MET B 2  87  ? 106.959 100.980 122.887 1.00 106.61 ? 85  MET B CE    1 
ATOM   1295  N N     . ASP B 2  88  ? 102.367 103.192 125.605 1.00 81.71  ? 86  ASP B N     1 
ATOM   1296  C CA    . ASP B 2  88  ? 101.294 103.651 124.745 1.00 83.81  ? 86  ASP B CA    1 
ATOM   1297  C C     . ASP B 2  88  ? 101.560 105.092 124.366 1.00 81.71  ? 86  ASP B C     1 
ATOM   1298  O O     . ASP B 2  88  ? 101.267 105.522 123.249 1.00 80.78  ? 86  ASP B O     1 
ATOM   1299  C CB    . ASP B 2  88  ? 99.952  103.517 125.457 1.00 86.31  ? 86  ASP B CB    1 
ATOM   1300  C CG    . ASP B 2  88  ? 99.575  102.062 125.713 0.00 90.65  ? 86  ASP B CG    1 
ATOM   1301  O OD1   . ASP B 2  88  ? 99.695  101.270 124.805 0.00 93.17  ? 86  ASP B OD1   1 
ATOM   1302  O OD2   . ASP B 2  88  ? 99.204  101.742 126.830 0.00 91.03  ? 86  ASP B OD2   1 
ATOM   1303  N N     . VAL B 2  89  ? 102.206 105.809 125.273 1.00 76.54  ? 87  VAL B N     1 
ATOM   1304  C CA    . VAL B 2  89  ? 102.638 107.161 124.984 1.00 73.31  ? 87  VAL B CA    1 
ATOM   1305  C C     . VAL B 2  89  ? 103.734 107.105 123.936 1.00 78.03  ? 87  VAL B C     1 
ATOM   1306  O O     . VAL B 2  89  ? 103.776 107.926 123.021 1.00 77.89  ? 87  VAL B O     1 
ATOM   1307  C CB    . VAL B 2  89  ? 103.143 107.867 126.249 1.00 77.27  ? 87  VAL B CB    1 
ATOM   1308  C CG1   . VAL B 2  89  ? 103.728 109.223 125.891 1.00 82.22  ? 87  VAL B CG1   1 
ATOM   1309  C CG2   . VAL B 2  89  ? 101.999 108.013 127.236 1.00 81.81  ? 87  VAL B CG2   1 
ATOM   1310  N N     . VAL B 2  90  ? 104.627 106.133 124.074 1.00 76.52  ? 88  VAL B N     1 
ATOM   1311  C CA    . VAL B 2  90  ? 105.708 105.984 123.117 1.00 78.17  ? 88  VAL B CA    1 
ATOM   1312  C C     . VAL B 2  90  ? 105.160 105.723 121.726 1.00 79.40  ? 88  VAL B C     1 
ATOM   1313  O O     . VAL B 2  90  ? 105.619 106.329 120.759 1.00 81.90  ? 88  VAL B O     1 
ATOM   1314  C CB    . VAL B 2  90  ? 106.656 104.842 123.525 1.00 83.40  ? 88  VAL B CB    1 
ATOM   1315  C CG1   . VAL B 2  90  ? 107.643 104.546 122.404 1.00 90.99  ? 88  VAL B CG1   1 
ATOM   1316  C CG2   . VAL B 2  90  ? 107.407 105.230 124.790 1.00 90.07  ? 88  VAL B CG2   1 
ATOM   1317  N N     . TYR B 2  91  ? 104.166 104.850 121.621 1.00 79.78  ? 89  TYR B N     1 
ATOM   1318  C CA    . TYR B 2  91  ? 103.569 104.572 120.323 1.00 81.60  ? 89  TYR B CA    1 
ATOM   1319  C C     . TYR B 2  91  ? 102.922 105.827 119.760 1.00 81.90  ? 89  TYR B C     1 
ATOM   1320  O O     . TYR B 2  91  ? 103.015 106.109 118.561 1.00 82.83  ? 89  TYR B O     1 
ATOM   1321  C CB    . TYR B 2  91  ? 102.529 103.459 120.434 1.00 85.85  ? 89  TYR B CB    1 
ATOM   1322  C CG    . TYR B 2  91  ? 103.092 102.084 120.736 1.00 94.12  ? 89  TYR B CG    1 
ATOM   1323  C CD1   . TYR B 2  91  ? 102.397 101.239 121.583 1.00 96.63  ? 89  TYR B CD1   1 
ATOM   1324  C CD2   . TYR B 2  91  ? 104.276 101.653 120.155 1.00 95.47  ? 89  TYR B CD2   1 
ATOM   1325  C CE1   . TYR B 2  91  ? 102.882 99.979  121.855 1.00 99.78  ? 89  TYR B CE1   1 
ATOM   1326  C CE2   . TYR B 2  91  ? 104.754 100.393 120.428 1.00 98.91  ? 89  TYR B CE2   1 
ATOM   1327  C CZ    . TYR B 2  91  ? 104.064 99.560  121.276 1.00 101.81 ? 89  TYR B CZ    1 
ATOM   1328  O OH    . TYR B 2  91  ? 104.548 98.302  121.546 1.00 103.78 ? 89  TYR B OH    1 
ATOM   1329  N N     . ALA B 2  92  ? 102.281 106.594 120.633 1.00 78.38  ? 90  ALA B N     1 
ATOM   1330  C CA    . ALA B 2  92  ? 101.634 107.827 120.221 1.00 83.75  ? 90  ALA B CA    1 
ATOM   1331  C C     . ALA B 2  92  ? 102.639 108.791 119.609 1.00 82.67  ? 90  ALA B C     1 
ATOM   1332  O O     . ALA B 2  92  ? 102.317 109.521 118.675 1.00 84.66  ? 90  ALA B O     1 
ATOM   1333  C CB    . ALA B 2  92  ? 100.941 108.476 121.405 1.00 85.01  ? 90  ALA B CB    1 
ATOM   1334  N N     . LEU B 2  93  ? 103.853 108.807 120.147 1.00 79.64  ? 91  LEU B N     1 
ATOM   1335  C CA    . LEU B 2  93  ? 104.898 109.672 119.618 1.00 83.93  ? 91  LEU B CA    1 
ATOM   1336  C C     . LEU B 2  93  ? 105.539 109.101 118.356 1.00 85.63  ? 91  LEU B C     1 
ATOM   1337  O O     . LEU B 2  93  ? 105.809 109.835 117.402 1.00 86.18  ? 91  LEU B O     1 
ATOM   1338  C CB    . LEU B 2  93  ? 105.991 109.890 120.674 1.00 86.74  ? 91  LEU B CB    1 
ATOM   1339  C CG    . LEU B 2  93  ? 105.854 111.127 121.599 1.00 86.20  ? 91  LEU B CG    1 
ATOM   1340  C CD1   . LEU B 2  93  ? 106.037 112.405 120.802 1.00 91.89  ? 91  LEU B CD1   1 
ATOM   1341  C CD2   . LEU B 2  93  ? 104.519 111.115 122.287 1.00 81.28  ? 91  LEU B CD2   1 
ATOM   1342  N N     . LYS B 2  94  ? 105.676 107.779 118.305 1.00 83.86  ? 92  LYS B N     1 
ATOM   1343  C CA    . LYS B 2  94  ? 106.351 107.126 117.189 1.00 87.25  ? 92  LYS B CA    1 
ATOM   1344  C C     . LYS B 2  94  ? 105.757 107.533 115.856 1.00 87.70  ? 92  LYS B C     1 
ATOM   1345  O O     . LYS B 2  94  ? 106.475 107.863 114.910 1.00 91.67  ? 92  LYS B O     1 
ATOM   1346  C CB    . LYS B 2  94  ? 106.289 105.609 117.341 0.00 88.45  ? 92  LYS B CB    1 
ATOM   1347  C CG    . LYS B 2  94  ? 107.086 104.841 116.280 0.00 93.30  ? 92  LYS B CG    1 
ATOM   1348  C CD    . LYS B 2  94  ? 107.100 103.320 116.532 0.00 96.50  ? 92  LYS B CD    1 
ATOM   1349  C CE    . LYS B 2  94  ? 108.073 102.939 117.655 0.00 99.79  ? 92  LYS B CE    1 
ATOM   1350  N NZ    . LYS B 2  94  ? 108.254 101.460 117.779 0.00 98.32  ? 92  LYS B NZ    1 
ATOM   1351  N N     . ARG B 2  95  ? 104.444 107.601 115.807 1.00 83.67  ? 93  ARG B N     1 
ATOM   1352  C CA    . ARG B 2  95  ? 103.748 107.911 114.570 1.00 87.25  ? 93  ARG B CA    1 
ATOM   1353  C C     . ARG B 2  95  ? 103.844 109.377 114.187 1.00 88.05  ? 93  ARG B C     1 
ATOM   1354  O O     . ARG B 2  95  ? 103.437 109.767 113.095 1.00 91.10  ? 93  ARG B O     1 
ATOM   1355  C CB    . ARG B 2  95  ? 102.309 107.556 114.700 1.00 85.81  ? 93  ARG B CB    1 
ATOM   1356  C CG    . ARG B 2  95  ? 101.613 108.349 115.701 1.00 85.73  ? 93  ARG B CG    1 
ATOM   1357  C CD    . ARG B 2  95  ? 100.297 107.818 115.954 1.00 92.35  ? 93  ARG B CD    1 
ATOM   1358  N NE    . ARG B 2  95  ? 99.470  107.841 114.768 1.00 93.57  ? 93  ARG B NE    1 
ATOM   1359  C CZ    . ARG B 2  95  ? 99.154  106.768 114.029 1.00 94.44  ? 93  ARG B CZ    1 
ATOM   1360  N NH1   . ARG B 2  95  ? 99.631  105.585 114.343 1.00 93.85  ? 93  ARG B NH1   1 
ATOM   1361  N NH2   . ARG B 2  95  ? 98.366  106.909 112.985 1.00 92.64  ? 93  ARG B NH2   1 
ATOM   1362  N N     . GLN B 2  96  ? 104.315 110.200 115.107 1.00 87.32  ? 94  GLN B N     1 
ATOM   1363  C CA    . GLN B 2  96  ? 104.421 111.627 114.865 1.00 88.34  ? 94  GLN B CA    1 
ATOM   1364  C C     . GLN B 2  96  ? 105.779 111.943 114.269 1.00 93.02  ? 94  GLN B C     1 
ATOM   1365  O O     . GLN B 2  96  ? 106.107 113.105 114.028 1.00 94.42  ? 94  GLN B O     1 
ATOM   1366  C CB    . GLN B 2  96  ? 104.271 112.409 116.164 1.00 90.38  ? 94  GLN B CB    1 
ATOM   1367  C CG    . GLN B 2  96  ? 103.003 112.151 116.905 1.00 88.78  ? 94  GLN B CG    1 
ATOM   1368  C CD    . GLN B 2  96  ? 101.792 112.533 116.143 1.00 89.84  ? 94  GLN B CD    1 
ATOM   1369  O OE1   . GLN B 2  96  ? 101.778 113.533 115.421 1.00 91.66  ? 94  GLN B OE1   1 
ATOM   1370  N NE2   . GLN B 2  96  ? 100.728 111.772 116.335 1.00 90.97  ? 94  GLN B NE2   1 
ATOM   1371  N N     . GLY B 2  97  ? 106.587 110.906 114.068 1.00 94.63  ? 95  GLY B N     1 
ATOM   1372  C CA    . GLY B 2  97  ? 107.939 111.092 113.575 1.00 101.44 ? 95  GLY B CA    1 
ATOM   1373  C C     . GLY B 2  97  ? 108.877 111.424 114.721 1.00 101.55 ? 95  GLY B C     1 
ATOM   1374  O O     . GLY B 2  97  ? 109.850 112.158 114.547 1.00 103.38 ? 95  GLY B O     1 
ATOM   1375  N N     . ARG B 2  98  ? 108.524 110.960 115.916 1.00 94.97  ? 96  ARG B N     1 
ATOM   1376  C CA    . ARG B 2  98  ? 109.320 111.207 117.103 1.00 92.37  ? 96  ARG B CA    1 
ATOM   1377  C C     . ARG B 2  98  ? 109.487 109.942 117.910 1.00 91.09  ? 96  ARG B C     1 
ATOM   1378  O O     . ARG B 2  98  ? 108.609 109.090 117.920 1.00 91.88  ? 96  ARG B O     1 
ATOM   1379  C CB    . ARG B 2  98  ? 108.628 112.208 117.980 1.00 88.36  ? 96  ARG B CB    1 
ATOM   1380  C CG    . ARG B 2  98  ? 108.470 113.553 117.390 1.00 92.33  ? 96  ARG B CG    1 
ATOM   1381  C CD    . ARG B 2  98  ? 107.865 114.466 118.358 1.00 93.65  ? 96  ARG B CD    1 
ATOM   1382  N NE    . ARG B 2  98  ? 107.846 115.814 117.883 1.00 95.02  ? 96  ARG B NE    1 
ATOM   1383  C CZ    . ARG B 2  98  ? 106.908 116.312 117.082 1.00 97.68  ? 96  ARG B CZ    1 
ATOM   1384  N NH1   . ARG B 2  98  ? 105.929 115.549 116.672 1.00 96.13  ? 96  ARG B NH1   1 
ATOM   1385  N NH2   . ARG B 2  98  ? 106.971 117.566 116.700 1.00 96.95  ? 96  ARG B NH2   1 
ATOM   1386  N N     . THR B 2  99  ? 110.577 109.837 118.643 1.00 86.58  ? 97  THR B N     1 
ATOM   1387  C CA    . THR B 2  99  ? 110.721 108.719 119.559 1.00 88.39  ? 97  THR B CA    1 
ATOM   1388  C C     . THR B 2  99  ? 111.142 109.204 120.931 1.00 87.26  ? 97  THR B C     1 
ATOM   1389  O O     . THR B 2  99  ? 111.779 110.250 121.063 1.00 88.99  ? 97  THR B O     1 
ATOM   1390  C CB    . THR B 2  99  ? 111.733 107.697 119.025 1.00 95.95  ? 97  THR B CB    1 
ATOM   1391  O OG1   . THR B 2  99  ? 112.998 108.329 118.871 1.00 95.16  ? 97  THR B OG1   1 
ATOM   1392  C CG2   . THR B 2  99  ? 111.284 107.150 117.681 1.00 96.05  ? 97  THR B CG2   1 
ATOM   1393  N N     . LEU B 2  100 ? 110.785 108.440 121.956 1.00 84.09  ? 98  LEU B N     1 
ATOM   1394  C CA    . LEU B 2  100 ? 111.216 108.759 123.306 1.00 83.22  ? 98  LEU B CA    1 
ATOM   1395  C C     . LEU B 2  100 ? 112.143 107.678 123.823 1.00 86.69  ? 98  LEU B C     1 
ATOM   1396  O O     . LEU B 2  100 ? 111.698 106.602 124.231 1.00 90.75  ? 98  LEU B O     1 
ATOM   1397  C CB    . LEU B 2  100 ? 110.007 108.869 124.240 1.00 86.85  ? 98  LEU B CB    1 
ATOM   1398  C CG    . LEU B 2  100 ? 108.885 109.815 123.807 1.00 90.58  ? 98  LEU B CG    1 
ATOM   1399  C CD1   . LEU B 2  100 ? 107.746 109.724 124.821 1.00 93.90  ? 98  LEU B CD1   1 
ATOM   1400  C CD2   . LEU B 2  100 ? 109.413 111.237 123.699 1.00 91.22  ? 98  LEU B CD2   1 
ATOM   1401  N N     . TYR B 2  101 ? 113.434 107.935 123.772 1.00 86.62  ? 99  TYR B N     1 
ATOM   1402  C CA    . TYR B 2  101 ? 114.376 106.910 124.172 1.00 87.16  ? 99  TYR B CA    1 
ATOM   1403  C C     . TYR B 2  101 ? 114.441 106.836 125.682 1.00 91.96  ? 99  TYR B C     1 
ATOM   1404  O O     . TYR B 2  101 ? 114.376 107.856 126.367 1.00 91.38  ? 99  TYR B O     1 
ATOM   1405  C CB    . TYR B 2  101 ? 115.755 107.148 123.564 1.00 92.01  ? 99  TYR B CB    1 
ATOM   1406  C CG    . TYR B 2  101 ? 115.902 106.741 122.095 1.00 93.45  ? 99  TYR B CG    1 
ATOM   1407  C CD1   . TYR B 2  101 ? 114.794 106.488 121.287 1.00 89.75  ? 99  TYR B CD1   1 
ATOM   1408  C CD2   . TYR B 2  101 ? 117.174 106.590 121.569 1.00 93.42  ? 99  TYR B CD2   1 
ATOM   1409  C CE1   . TYR B 2  101 ? 114.980 106.093 119.973 1.00 89.83  ? 99  TYR B CE1   1 
ATOM   1410  C CE2   . TYR B 2  101 ? 117.347 106.212 120.260 1.00 90.24  ? 99  TYR B CE2   1 
ATOM   1411  C CZ    . TYR B 2  101 ? 116.262 105.964 119.464 1.00 89.13  ? 99  TYR B CZ    1 
ATOM   1412  O OH    . TYR B 2  101 ? 116.455 105.571 118.159 1.00 92.51  ? 99  TYR B OH    1 
ATOM   1413  N N     . GLY B 2  102 ? 114.548 105.620 126.200 1.00 92.50  ? 100 GLY B N     1 
ATOM   1414  C CA    . GLY B 2  102 ? 114.621 105.403 127.637 1.00 94.70  ? 100 GLY B CA    1 
ATOM   1415  C C     . GLY B 2  102 ? 113.265 105.022 128.216 1.00 94.39  ? 100 GLY B C     1 
ATOM   1416  O O     . GLY B 2  102 ? 113.174 104.596 129.367 1.00 96.75  ? 100 GLY B O     1 
ATOM   1417  N N     . PHE B 2  103 ? 112.213 105.144 127.411 1.00 90.48  ? 101 PHE B N     1 
ATOM   1418  C CA    . PHE B 2  103 ? 110.877 104.800 127.877 1.00 90.15  ? 101 PHE B CA    1 
ATOM   1419  C C     . PHE B 2  103 ? 110.351 103.510 127.260 1.00 95.62  ? 101 PHE B C     1 
ATOM   1420  O O     . PHE B 2  103 ? 109.359 102.955 127.732 1.00 96.68  ? 101 PHE B O     1 
ATOM   1421  C CB    . PHE B 2  103 ? 109.903 105.929 127.566 1.00 90.95  ? 101 PHE B CB    1 
ATOM   1422  C CG    . PHE B 2  103 ? 110.174 107.191 128.301 1.00 90.29  ? 101 PHE B CG    1 
ATOM   1423  C CD1   . PHE B 2  103 ? 110.930 108.184 127.723 1.00 94.70  ? 101 PHE B CD1   1 
ATOM   1424  C CD2   . PHE B 2  103 ? 109.634 107.411 129.555 1.00 89.68  ? 101 PHE B CD2   1 
ATOM   1425  C CE1   . PHE B 2  103 ? 111.137 109.379 128.370 1.00 100.61 ? 101 PHE B CE1   1 
ATOM   1426  C CE2   . PHE B 2  103 ? 109.845 108.604 130.215 1.00 91.75  ? 101 PHE B CE2   1 
ATOM   1427  C CZ    . PHE B 2  103 ? 110.595 109.592 129.617 1.00 98.19  ? 101 PHE B CZ    1 
ATOM   1428  N N     . GLY B 2  104 ? 110.993 103.040 126.196 1.00 98.74  ? 102 GLY B N     1 
ATOM   1429  C CA    . GLY B 2  104 ? 110.493 101.867 125.485 1.00 104.15 ? 102 GLY B CA    1 
ATOM   1430  C C     . GLY B 2  104 ? 111.133 101.707 124.109 1.00 109.11 ? 102 GLY B C     1 
ATOM   1431  O O     . GLY B 2  104 ? 112.194 102.266 123.832 1.00 105.77 ? 102 GLY B O     1 
ATOM   1432  N N     . GLY B 2  105 ? 110.528 100.864 123.277 1.00 112.84 ? 103 GLY B N     1 
ATOM   1433  C CA    . GLY B 2  105 ? 111.053 100.582 121.945 1.00 114.67 ? 103 GLY B CA    1 
ATOM   1434  C C     . GLY B 2  105 ? 110.226 101.267 120.861 1.00 110.99 ? 103 GLY B C     1 
ATOM   1435  O O     . GLY B 2  105 ? 110.127 102.494 120.830 1.00 107.40 ? 103 GLY B O     1 
ATOM   1436  O OXT   . GLY B 2  105 ? 109.726 100.594 119.960 1.00 106.62 ? 103 GLY B OXT   1 
ATOM   1437  N N     . GLY C 3  12  ? 71.029  99.298  104.656 1.00 145.23 ? 9   GLY C N     1 
ATOM   1438  C CA    . GLY C 3  12  ? 70.607  98.074  105.324 1.00 154.46 ? 9   GLY C CA    1 
ATOM   1439  C C     . GLY C 3  12  ? 69.731  97.232  104.410 1.00 165.13 ? 9   GLY C C     1 
ATOM   1440  O O     . GLY C 3  12  ? 68.513  97.405  104.364 1.00 167.63 ? 9   GLY C O     1 
ATOM   1441  N N     . LYS C 3  13  ? 70.359  96.321  103.681 1.00 168.60 ? 10  LYS C N     1 
ATOM   1442  C CA    . LYS C 3  13  ? 69.649  95.456  102.746 1.00 175.43 ? 10  LYS C CA    1 
ATOM   1443  C C     . LYS C 3  13  ? 69.123  94.196  103.413 1.00 177.66 ? 10  LYS C C     1 
ATOM   1444  O O     . LYS C 3  13  ? 69.634  93.760  104.447 1.00 172.72 ? 10  LYS C O     1 
ATOM   1445  C CB    . LYS C 3  13  ? 70.557  95.058  101.582 0.00 178.88 ? 10  LYS C CB    1 
ATOM   1446  C CG    . LYS C 3  13  ? 70.957  96.203  100.652 0.00 179.93 ? 10  LYS C CG    1 
ATOM   1447  C CD    . LYS C 3  13  ? 71.863  95.732  99.556  0.00 178.90 ? 10  LYS C CD    1 
ATOM   1448  C CE    . LYS C 3  13  ? 72.226  96.858  98.640  0.00 177.36 ? 10  LYS C CE    1 
ATOM   1449  N NZ    . LYS C 3  13  ? 73.124  96.416  97.587  0.00 164.18 ? 10  LYS C NZ    1 
ATOM   1450  N N     . ALA C 3  14  ? 68.133  93.577  102.781 1.00 181.92 ? 11  ALA C N     1 
ATOM   1451  C CA    . ALA C 3  14  ? 67.640  92.277  103.217 1.00 186.66 ? 11  ALA C CA    1 
ATOM   1452  C C     . ALA C 3  14  ? 68.368  91.141  102.502 1.00 190.51 ? 11  ALA C C     1 
ATOM   1453  O O     . ALA C 3  14  ? 68.088  89.966  102.742 1.00 188.50 ? 11  ALA C O     1 
ATOM   1454  C CB    . ALA C 3  14  ? 66.144  92.171  102.969 1.00 190.80 ? 11  ALA C CB    1 
ATOM   1455  N N     . ARG C 3  15  ? 69.270  91.495  101.591 1.00 185.59 ? 12  ARG C N     1 
ATOM   1456  C CA    . ARG C 3  15  ? 69.954  90.502  100.774 1.00 189.88 ? 12  ARG C CA    1 
ATOM   1457  C C     . ARG C 3  15  ? 71.343  90.145  101.294 1.00 190.98 ? 12  ARG C C     1 
ATOM   1458  O O     . ARG C 3  15  ? 72.341  90.732  100.877 1.00 179.73 ? 12  ARG C O     1 
ATOM   1459  C CB    . ARG C 3  15  ? 70.101  90.994  99.342  0.00 190.99 ? 12  ARG C CB    1 
ATOM   1460  C CG    . ARG C 3  15  ? 70.698  89.961  98.402  0.00 186.52 ? 12  ARG C CG    1 
ATOM   1461  C CD    . ARG C 3  15  ? 70.896  90.462  97.032  0.00 187.48 ? 12  ARG C CD    1 
ATOM   1462  N NE    . ARG C 3  15  ? 71.524  89.445  96.192  0.00 186.88 ? 12  ARG C NE    1 
ATOM   1463  C CZ    . ARG C 3  15  ? 71.809  89.591  94.885  0.00 188.15 ? 12  ARG C CZ    1 
ATOM   1464  N NH1   . ARG C 3  15  ? 71.512  90.712  94.267  0.00 186.02 ? 12  ARG C NH1   1 
ATOM   1465  N NH2   . ARG C 3  15  ? 72.387  88.602  94.220  0.00 180.66 ? 12  ARG C NH2   1 
ATOM   1466  N N     . ALA C 3  16  ? 71.417  89.097  102.108 1.00 189.85 ? 13  ALA C N     1 
ATOM   1467  C CA    . ALA C 3  16  ? 72.693  88.606  102.628 1.00 186.52 ? 13  ALA C CA    1 
ATOM   1468  C C     . ALA C 3  16  ? 73.095  87.313  101.920 1.00 182.36 ? 13  ALA C C     1 
ATOM   1469  O O     . ALA C 3  16  ? 74.012  86.613  102.347 1.00 181.41 ? 13  ALA C O     1 
ATOM   1470  C CB    . ALA C 3  16  ? 72.601  88.376  104.127 1.00 177.19 ? 13  ALA C CB    1 
ATOM   1471  N N     . LYS C 3  17  ? 72.344  86.967  100.878 1.00 186.32 ? 14  LYS C N     1 
ATOM   1472  C CA    . LYS C 3  17  ? 72.517  85.708  100.157 1.00 183.61 ? 14  LYS C CA    1 
ATOM   1473  C C     . LYS C 3  17  ? 73.536  85.797  99.031  1.00 183.09 ? 14  LYS C C     1 
ATOM   1474  O O     . LYS C 3  17  ? 73.828  84.798  98.375  1.00 183.40 ? 14  LYS C O     1 
ATOM   1475  C CB    . LYS C 3  17  ? 71.193  85.265  99.541  0.00 187.00 ? 14  LYS C CB    1 
ATOM   1476  C CG    . LYS C 3  17  ? 70.781  86.098  98.334  0.00 186.09 ? 14  LYS C CG    1 
ATOM   1477  C CD    . LYS C 3  17  ? 69.451  85.656  97.762  0.00 183.98 ? 14  LYS C CD    1 
ATOM   1478  C CE    . LYS C 3  17  ? 69.101  86.453  96.509  0.00 180.65 ? 14  LYS C CE    1 
ATOM   1479  N NZ    . LYS C 3  17  ? 67.811  86.017  95.916  0.00 170.47 ? 14  LYS C NZ    1 
ATOM   1480  N N     . ALA C 3  18  ? 73.968  87.007  98.709  1.00 184.31 ? 15  ALA C N     1 
ATOM   1481  C CA    . ALA C 3  18  ? 74.801  87.203  97.531  1.00 174.54 ? 15  ALA C CA    1 
ATOM   1482  C C     . ALA C 3  18  ? 76.084  86.395  97.626  1.00 170.51 ? 15  ALA C C     1 
ATOM   1483  O O     . ALA C 3  18  ? 76.733  86.367  98.673  1.00 167.64 ? 15  ALA C O     1 
ATOM   1484  C CB    . ALA C 3  18  ? 75.126  88.676  97.353  1.00 166.70 ? 15  ALA C CB    1 
ATOM   1485  N N     . LYS C 3  19  ? 76.460  85.761  96.518  1.00 170.89 ? 16  LYS C N     1 
ATOM   1486  C CA    . LYS C 3  19  ? 77.712  85.019  96.471  1.00 169.14 ? 16  LYS C CA    1 
ATOM   1487  C C     . LYS C 3  19  ? 78.875  85.982  96.423  1.00 163.93 ? 16  LYS C C     1 
ATOM   1488  O O     . LYS C 3  19  ? 79.840  85.857  97.178  1.00 162.61 ? 16  LYS C O     1 
ATOM   1489  C CB    . LYS C 3  19  ? 77.750  84.104  95.253  1.00 172.49 ? 16  LYS C CB    1 
ATOM   1490  C CG    . LYS C 3  19  ? 76.793  82.936  95.336  1.00 175.75 ? 16  LYS C CG    1 
ATOM   1491  C CD    . LYS C 3  19  ? 76.841  82.077  94.084  1.00 176.64 ? 16  LYS C CD    1 
ATOM   1492  C CE    . LYS C 3  19  ? 75.874  80.904  94.189  1.00 180.20 ? 16  LYS C CE    1 
ATOM   1493  N NZ    . LYS C 3  19  ? 75.835  80.100  92.940  1.00 179.02 ? 16  LYS C NZ    1 
ATOM   1494  N N     . THR C 3  20  ? 78.741  87.007  95.594  1.00 160.04 ? 17  THR C N     1 
ATOM   1495  C CA    . THR C 3  20  ? 79.792  87.993  95.511  1.00 154.77 ? 17  THR C CA    1 
ATOM   1496  C C     . THR C 3  20  ? 79.884  88.657  96.865  1.00 148.05 ? 17  THR C C     1 
ATOM   1497  O O     . THR C 3  20  ? 78.889  89.172  97.380  1.00 153.11 ? 17  THR C O     1 
ATOM   1498  C CB    . THR C 3  20  ? 79.504  89.029  94.411  1.00 152.35 ? 17  THR C CB    1 
ATOM   1499  O OG1   . THR C 3  20  ? 79.355  88.364  93.150  1.00 187.48 ? 17  THR C OG1   1 
ATOM   1500  C CG2   . THR C 3  20  ? 80.644  90.015  94.315  1.00 147.20 ? 17  THR C CG2   1 
ATOM   1501  N N     . ARG C 3  21  ? 81.072  88.567  97.473  1.00 148.24 ? 18  ARG C N     1 
ATOM   1502  C CA    . ARG C 3  21  ? 81.273  89.117  98.839  1.00 139.77 ? 18  ARG C CA    1 
ATOM   1503  C C     . ARG C 3  21  ? 80.991  90.619  98.843  1.00 136.79 ? 18  ARG C C     1 
ATOM   1504  O O     . ARG C 3  21  ? 80.393  91.088  99.829  1.00 136.08 ? 18  ARG C O     1 
ATOM   1505  C CB    . ARG C 3  21  ? 82.696  88.831  99.326  1.00 133.32 ? 18  ARG C CB    1 
ATOM   1506  C CG    . ARG C 3  21  ? 82.866  87.476  99.996  1.00 138.46 ? 18  ARG C CG    1 
ATOM   1507  C CD    . ARG C 3  21  ? 84.105  87.441  100.869 1.00 131.65 ? 18  ARG C CD    1 
ATOM   1508  N NE    . ARG C 3  21  ? 85.202  86.691  100.275 1.00 137.19 ? 18  ARG C NE    1 
ATOM   1509  C CZ    . ARG C 3  21  ? 86.420  86.602  100.799 1.00 131.61 ? 18  ARG C CZ    1 
ATOM   1510  N NH1   . ARG C 3  21  ? 86.700  87.222  101.933 1.00 120.93 ? 18  ARG C NH1   1 
ATOM   1511  N NH2   . ARG C 3  21  ? 87.354  85.897  100.186 1.00 132.69 ? 18  ARG C NH2   1 
ATOM   1512  N N     . SER C 3  22  ? 81.391  91.347  97.790  1.00 136.86 ? 19  SER C N     1 
ATOM   1513  C CA    . SER C 3  22  ? 81.196  92.783  97.794  1.00 133.40 ? 19  SER C CA    1 
ATOM   1514  C C     . SER C 3  22  ? 79.711  93.085  97.839  1.00 136.52 ? 19  SER C C     1 
ATOM   1515  O O     . SER C 3  22  ? 79.258  93.882  98.663  1.00 130.81 ? 19  SER C O     1 
ATOM   1516  C CB    . SER C 3  22  ? 81.801  93.400  96.552  1.00 125.67 ? 19  SER C CB    1 
ATOM   1517  O OG    . SER C 3  22  ? 81.123  92.980  95.403  1.00 140.23 ? 19  SER C OG    1 
ATOM   1518  N N     . SER C 3  23  ? 78.932  92.298  97.106  1.00 137.35 ? 20  SER C N     1 
ATOM   1519  C CA    . SER C 3  23  ? 77.493  92.490  97.095  1.00 137.01 ? 20  SER C CA    1 
ATOM   1520  C C     . SER C 3  23  ? 76.901  92.132  98.445  1.00 134.97 ? 20  SER C C     1 
ATOM   1521  O O     . SER C 3  23  ? 76.113  92.890  99.009  1.00 134.03 ? 20  SER C O     1 
ATOM   1522  C CB    . SER C 3  23  ? 76.851  91.638  96.018  1.00 143.70 ? 20  SER C CB    1 
ATOM   1523  O OG    . SER C 3  23  ? 77.247  92.048  94.738  1.00 147.11 ? 20  SER C OG    1 
ATOM   1524  N N     . ARG C 3  24  ? 77.335  91.005  99.003  1.00 137.67 ? 21  ARG C N     1 
ATOM   1525  C CA    . ARG C 3  24  ? 76.806  90.601  100.329 1.00 140.67 ? 21  ARG C CA    1 
ATOM   1526  C C     . ARG C 3  24  ? 77.129  91.693  101.359 1.00 134.24 ? 21  ARG C C     1 
ATOM   1527  O O     . ARG C 3  24  ? 76.252  91.987  102.187 1.00 134.69 ? 21  ARG C O     1 
ATOM   1528  C CB    . ARG C 3  24  ? 77.382  89.241  100.732 1.00 147.53 ? 21  ARG C CB    1 
ATOM   1529  C CG    . ARG C 3  24  ? 76.451  88.422  101.614 1.00 159.37 ? 21  ARG C CG    1 
ATOM   1530  C CD    . ARG C 3  24  ? 77.161  87.325  102.388 1.00 154.81 ? 21  ARG C CD    1 
ATOM   1531  N NE    . ARG C 3  24  ? 77.460  86.134  101.605 1.00 162.83 ? 21  ARG C NE    1 
ATOM   1532  C CZ    . ARG C 3  24  ? 78.318  85.193  101.980 1.00 153.10 ? 21  ARG C CZ    1 
ATOM   1533  N NH1   . ARG C 3  24  ? 78.968  85.314  103.124 1.00 140.20 ? 21  ARG C NH1   1 
ATOM   1534  N NH2   . ARG C 3  24  ? 78.531  84.141  101.211 1.00 157.45 ? 21  ARG C NH2   1 
ATOM   1535  N N     . ALA C 3  25  ? 78.299  92.334  101.248 1.00 132.51 ? 22  ALA C N     1 
ATOM   1536  C CA    . ALA C 3  25  ? 78.705  93.354  102.202 1.00 129.52 ? 22  ALA C CA    1 
ATOM   1537  C C     . ALA C 3  25  ? 78.018  94.686  101.913 1.00 126.96 ? 22  ALA C C     1 
ATOM   1538  O O     . ALA C 3  25  ? 78.153  95.639  102.680 1.00 125.32 ? 22  ALA C O     1 
ATOM   1539  C CB    . ALA C 3  25  ? 80.214  93.524  102.174 1.00 130.91 ? 22  ALA C CB    1 
ATOM   1540  N N     . GLY C 3  26  ? 77.285  94.755  100.802 1.00 126.62 ? 23  GLY C N     1 
ATOM   1541  C CA    . GLY C 3  26  ? 76.618  95.983  100.386 1.00 129.70 ? 23  GLY C CA    1 
ATOM   1542  C C     . GLY C 3  26  ? 77.599  96.930  99.718  1.00 123.11 ? 23  GLY C C     1 
ATOM   1543  O O     . GLY C 3  26  ? 77.306  98.109  99.520  1.00 126.42 ? 23  GLY C O     1 
ATOM   1544  N N     . LEU C 3  27  ? 78.772  96.411  99.406  1.00 120.34 ? 24  LEU C N     1 
ATOM   1545  C CA    . LEU C 3  27  ? 79.862  97.194  98.859  1.00 117.48 ? 24  LEU C CA    1 
ATOM   1546  C C     . LEU C 3  27  ? 80.056  96.949  97.379  1.00 116.76 ? 24  LEU C C     1 
ATOM   1547  O O     . LEU C 3  27  ? 79.530  95.990  96.818  1.00 120.05 ? 24  LEU C O     1 
ATOM   1548  C CB    . LEU C 3  27  ? 81.149  96.857  99.608  1.00 117.31 ? 24  LEU C CB    1 
ATOM   1549  C CG    . LEU C 3  27  ? 81.089  97.029  101.132 1.00 113.28 ? 24  LEU C CG    1 
ATOM   1550  C CD1   . LEU C 3  27  ? 82.399  96.585  101.726 1.00 105.02 ? 24  LEU C CD1   1 
ATOM   1551  C CD2   . LEU C 3  27  ? 80.797  98.477  101.481 1.00 113.48 ? 24  LEU C CD2   1 
ATOM   1552  N N     . GLN C 3  28  ? 80.774  97.853  96.735  1.00 110.93 ? 25  GLN C N     1 
ATOM   1553  C CA    . GLN C 3  28  ? 81.141  97.667  95.345  1.00 107.19 ? 25  GLN C CA    1 
ATOM   1554  C C     . GLN C 3  28  ? 82.569  97.164  95.257  1.00 110.73 ? 25  GLN C C     1 
ATOM   1555  O O     . GLN C 3  28  ? 82.913  96.390  94.366  1.00 116.14 ? 25  GLN C O     1 
ATOM   1556  C CB    . GLN C 3  28  ? 81.013  98.981  94.589  1.00 113.83 ? 25  GLN C CB    1 
ATOM   1557  C CG    . GLN C 3  28  ? 79.660  99.610  94.716  1.00 119.20 ? 25  GLN C CG    1 
ATOM   1558  C CD    . GLN C 3  28  ? 78.568  98.694  94.277  1.00 120.48 ? 25  GLN C CD    1 
ATOM   1559  O OE1   . GLN C 3  28  ? 78.568  98.194  93.152  1.00 122.24 ? 25  GLN C OE1   1 
ATOM   1560  N NE2   . GLN C 3  28  ? 77.625  98.447  95.171  1.00 121.76 ? 25  GLN C NE2   1 
ATOM   1561  N N     . PHE C 3  29  ? 83.381  97.543  96.236  1.00 107.05 ? 26  PHE C N     1 
ATOM   1562  C CA    . PHE C 3  29  ? 84.784  97.162  96.243  1.00 109.19 ? 26  PHE C CA    1 
ATOM   1563  C C     . PHE C 3  29  ? 84.947  95.658  96.414  1.00 111.84 ? 26  PHE C C     1 
ATOM   1564  O O     . PHE C 3  29  ? 84.204  95.031  97.168  1.00 113.89 ? 26  PHE C O     1 
ATOM   1565  C CB    . PHE C 3  29  ? 85.542  97.921  97.333  1.00 106.92 ? 26  PHE C CB    1 
ATOM   1566  C CG    . PHE C 3  29  ? 86.025  99.282  96.900  1.00 105.45 ? 26  PHE C CG    1 
ATOM   1567  C CD1   . PHE C 3  29  ? 85.341  100.030 95.947  1.00 108.47 ? 26  PHE C CD1   1 
ATOM   1568  C CD2   . PHE C 3  29  ? 87.206  99.795  97.411  1.00 103.11 ? 26  PHE C CD2   1 
ATOM   1569  C CE1   . PHE C 3  29  ? 85.825  101.246 95.531  1.00 110.75 ? 26  PHE C CE1   1 
ATOM   1570  C CE2   . PHE C 3  29  ? 87.684  101.017 96.990  1.00 102.94 ? 26  PHE C CE2   1 
ATOM   1571  C CZ    . PHE C 3  29  ? 86.992  101.738 96.053  1.00 106.86 ? 26  PHE C CZ    1 
ATOM   1572  N N     . PRO C 3  30  ? 85.974  95.077  95.794  1.00 114.89 ? 27  PRO C N     1 
ATOM   1573  C CA    . PRO C 3  30  ? 86.243  93.659  95.702  1.00 115.34 ? 27  PRO C CA    1 
ATOM   1574  C C     . PRO C 3  30  ? 86.710  93.073  97.023  1.00 110.56 ? 27  PRO C C     1 
ATOM   1575  O O     . PRO C 3  30  ? 87.878  92.718  97.173  1.00 107.75 ? 27  PRO C O     1 
ATOM   1576  C CB    . PRO C 3  30  ? 87.347  93.620  94.644  1.00 123.50 ? 27  PRO C CB    1 
ATOM   1577  C CG    . PRO C 3  30  ? 88.093  94.917  94.842  1.00 123.94 ? 27  PRO C CG    1 
ATOM   1578  C CD    . PRO C 3  30  ? 87.021  95.924  95.196  1.00 116.70 ? 27  PRO C CD    1 
ATOM   1579  N N     . VAL C 3  31  ? 85.767  92.864  97.930  1.00 111.06 ? 28  VAL C N     1 
ATOM   1580  C CA    . VAL C 3  31  ? 86.071  92.364  99.266  1.00 105.01 ? 28  VAL C CA    1 
ATOM   1581  C C     . VAL C 3  31  ? 86.948  91.127  99.214  1.00 103.97 ? 28  VAL C C     1 
ATOM   1582  O O     . VAL C 3  31  ? 87.862  90.974  100.025 1.00 104.32 ? 28  VAL C O     1 
ATOM   1583  C CB    . VAL C 3  31  ? 84.768  92.005  100.003 1.00 114.12 ? 28  VAL C CB    1 
ATOM   1584  C CG1   . VAL C 3  31  ? 85.066  91.246  101.288 1.00 110.64 ? 28  VAL C CG1   1 
ATOM   1585  C CG2   . VAL C 3  31  ? 84.000  93.263  100.321 1.00 120.32 ? 28  VAL C CG2   1 
ATOM   1586  N N     . GLY C 3  32  ? 86.649  90.224  98.289  1.00 111.46 ? 29  GLY C N     1 
ATOM   1587  C CA    . GLY C 3  32  ? 87.423  88.998  98.167  1.00 119.29 ? 29  GLY C CA    1 
ATOM   1588  C C     . GLY C 3  32  ? 88.888  89.305  97.881  1.00 111.77 ? 29  GLY C C     1 
ATOM   1589  O O     . GLY C 3  32  ? 89.786  88.601  98.352  1.00 114.27 ? 29  GLY C O     1 
ATOM   1590  N N     . ARG C 3  33  ? 89.136  90.368  97.128  1.00 110.38 ? 30  ARG C N     1 
ATOM   1591  C CA    . ARG C 3  33  ? 90.495  90.738  96.799  1.00 109.88 ? 30  ARG C CA    1 
ATOM   1592  C C     . ARG C 3  33  ? 91.153  91.414  97.973  1.00 104.12 ? 30  ARG C C     1 
ATOM   1593  O O     . ARG C 3  33  ? 92.335  91.214  98.234  1.00 104.74 ? 30  ARG C O     1 
ATOM   1594  C CB    . ARG C 3  33  ? 90.544  91.681  95.634  1.00 113.78 ? 30  ARG C CB    1 
ATOM   1595  C CG    . ARG C 3  33  ? 91.929  91.949  95.141  1.00 114.10 ? 30  ARG C CG    1 
ATOM   1596  C CD    . ARG C 3  33  ? 91.964  93.036  94.175  1.00 119.98 ? 30  ARG C CD    1 
ATOM   1597  N NE    . ARG C 3  33  ? 91.140  92.764  93.031  1.00 128.63 ? 30  ARG C NE    1 
ATOM   1598  C CZ    . ARG C 3  33  ? 90.887  93.648  92.059  1.00 132.22 ? 30  ARG C CZ    1 
ATOM   1599  N NH1   . ARG C 3  33  ? 91.432  94.843  92.107  1.00 133.77 ? 30  ARG C NH1   1 
ATOM   1600  N NH2   . ARG C 3  33  ? 90.101  93.315  91.055  1.00 141.63 ? 30  ARG C NH2   1 
ATOM   1601  N N     . VAL C 3  34  ? 90.383  92.209  98.694  1.00 103.56 ? 31  VAL C N     1 
ATOM   1602  C CA    . VAL C 3  34  ? 90.934  92.921  99.829  1.00 101.25 ? 31  VAL C CA    1 
ATOM   1603  C C     . VAL C 3  34  ? 91.460  91.895  100.817 1.00 101.19 ? 31  VAL C C     1 
ATOM   1604  O O     . VAL C 3  34  ? 92.517  92.081  101.419 1.00 99.48  ? 31  VAL C O     1 
ATOM   1605  C CB    . VAL C 3  34  ? 89.877  93.827  100.478 1.00 104.38 ? 31  VAL C CB    1 
ATOM   1606  C CG1   . VAL C 3  34  ? 90.418  94.448  101.761 1.00 102.73 ? 31  VAL C CG1   1 
ATOM   1607  C CG2   . VAL C 3  34  ? 89.467  94.907  99.490  1.00 105.91 ? 31  VAL C CG2   1 
ATOM   1608  N N     . HIS C 3  35  ? 90.714  90.806  100.971 1.00 101.86 ? 32  HIS C N     1 
ATOM   1609  C CA    . HIS C 3  35  ? 91.131  89.685  101.799 1.00 101.35 ? 32  HIS C CA    1 
ATOM   1610  C C     . HIS C 3  35  ? 92.496  89.200  101.351 1.00 101.01 ? 32  HIS C C     1 
ATOM   1611  O O     . HIS C 3  35  ? 93.426  89.074  102.150 1.00 101.23 ? 32  HIS C O     1 
ATOM   1612  C CB    . HIS C 3  35  ? 90.123  88.545  101.664 1.00 104.39 ? 32  HIS C CB    1 
ATOM   1613  C CG    . HIS C 3  35  ? 90.469  87.347  102.428 1.00 103.00 ? 32  HIS C CG    1 
ATOM   1614  N ND1   . HIS C 3  35  ? 90.190  87.209  103.767 1.00 103.90 ? 32  HIS C ND1   1 
ATOM   1615  C CD2   . HIS C 3  35  ? 91.078  86.210  102.048 1.00 105.01 ? 32  HIS C CD2   1 
ATOM   1616  C CE1   . HIS C 3  35  ? 90.609  86.034  104.176 1.00 107.84 ? 32  HIS C CE1   1 
ATOM   1617  N NE2   . HIS C 3  35  ? 91.155  85.407  103.150 1.00 106.43 ? 32  HIS C NE2   1 
ATOM   1618  N N     . ARG C 3  36  ? 92.616  88.967  100.056 1.00 102.32 ? 33  ARG C N     1 
ATOM   1619  C CA    . ARG C 3  36  ? 93.854  88.519  99.450  1.00 103.95 ? 33  ARG C CA    1 
ATOM   1620  C C     . ARG C 3  36  ? 94.996  89.503  99.662  1.00 101.23 ? 33  ARG C C     1 
ATOM   1621  O O     . ARG C 3  36  ? 96.127  89.105  99.941  1.00 100.58 ? 33  ARG C O     1 
ATOM   1622  C CB    . ARG C 3  36  ? 93.614  88.337  97.973  1.00 114.38 ? 33  ARG C CB    1 
ATOM   1623  C CG    . ARG C 3  36  ? 94.751  87.834  97.168  1.00 124.77 ? 33  ARG C CG    1 
ATOM   1624  C CD    . ARG C 3  36  ? 94.296  87.572  95.774  1.00 136.78 ? 33  ARG C CD    1 
ATOM   1625  N NE    . ARG C 3  36  ? 95.358  87.078  94.930  1.00 146.88 ? 33  ARG C NE    1 
ATOM   1626  C CZ    . ARG C 3  36  ? 96.198  87.848  94.214  1.00 150.92 ? 33  ARG C CZ    1 
ATOM   1627  N NH1   . ARG C 3  36  ? 96.087  89.156  94.239  1.00 149.88 ? 33  ARG C NH1   1 
ATOM   1628  N NH2   . ARG C 3  36  ? 97.141  87.284  93.482  1.00 153.29 ? 33  ARG C NH2   1 
ATOM   1629  N N     . LEU C 3  37  ? 94.704  90.784  99.517  1.00 100.08 ? 34  LEU C N     1 
ATOM   1630  C CA    . LEU C 3  37  ? 95.723  91.808  99.662  1.00 101.67 ? 34  LEU C CA    1 
ATOM   1631  C C     . LEU C 3  37  ? 96.191  91.922  101.101 1.00 101.38 ? 34  LEU C C     1 
ATOM   1632  O O     . LEU C 3  37  ? 97.367  92.177  101.351 1.00 101.34 ? 34  LEU C O     1 
ATOM   1633  C CB    . LEU C 3  37  ? 95.187  93.157  99.184  1.00 105.53 ? 34  LEU C CB    1 
ATOM   1634  C CG    . LEU C 3  37  ? 94.909  93.279  97.683  1.00 110.72 ? 34  LEU C CG    1 
ATOM   1635  C CD1   . LEU C 3  37  ? 94.141  94.572  97.428  1.00 113.48 ? 34  LEU C CD1   1 
ATOM   1636  C CD2   . LEU C 3  37  ? 96.221  93.275  96.908  1.00 110.47 ? 34  LEU C CD2   1 
ATOM   1637  N N     . LEU C 3  38  ? 95.268  91.773  102.049 1.00 100.81 ? 35  LEU C N     1 
ATOM   1638  C CA    . LEU C 3  38  ? 95.637  91.785  103.459 1.00 99.96  ? 35  LEU C CA    1 
ATOM   1639  C C     . LEU C 3  38  ? 96.463  90.566  103.799 1.00 101.95 ? 35  LEU C C     1 
ATOM   1640  O O     . LEU C 3  38  ? 97.384  90.635  104.610 1.00 103.71 ? 35  LEU C O     1 
ATOM   1641  C CB    . LEU C 3  38  ? 94.398  91.816  104.361 1.00 96.96  ? 35  LEU C CB    1 
ATOM   1642  C CG    . LEU C 3  38  ? 93.622  93.132  104.423 1.00 100.00 ? 35  LEU C CG    1 
ATOM   1643  C CD1   . LEU C 3  38  ? 92.311  92.900  105.168 1.00 98.90  ? 35  LEU C CD1   1 
ATOM   1644  C CD2   . LEU C 3  38  ? 94.464  94.184  105.142 1.00 98.30  ? 35  LEU C CD2   1 
ATOM   1645  N N     . ARG C 3  39  ? 96.120  89.442  103.186 1.00 101.83 ? 36  ARG C N     1 
ATOM   1646  C CA    . ARG C 3  39  ? 96.839  88.201  103.397 1.00 105.69 ? 36  ARG C CA    1 
ATOM   1647  C C     . ARG C 3  39  ? 98.285  88.342  102.997 1.00 104.99 ? 36  ARG C C     1 
ATOM   1648  O O     . ARG C 3  39  ? 99.184  87.774  103.616 1.00 105.07 ? 36  ARG C O     1 
ATOM   1649  C CB    . ARG C 3  39  ? 96.221  87.097  102.582 1.00 106.73 ? 36  ARG C CB    1 
ATOM   1650  C CG    . ARG C 3  39  ? 96.880  85.774  102.737 1.00 110.96 ? 36  ARG C CG    1 
ATOM   1651  C CD    . ARG C 3  39  ? 96.144  84.734  102.017 1.00 116.06 ? 36  ARG C CD    1 
ATOM   1652  N NE    . ARG C 3  39  ? 94.804  84.575  102.544 1.00 120.25 ? 36  ARG C NE    1 
ATOM   1653  C CZ    . ARG C 3  39  ? 94.490  83.879  103.656 1.00 120.62 ? 36  ARG C CZ    1 
ATOM   1654  N NH1   . ARG C 3  39  ? 95.431  83.281  104.351 1.00 119.33 ? 36  ARG C NH1   1 
ATOM   1655  N NH2   . ARG C 3  39  ? 93.230  83.806  104.051 1.00 116.15 ? 36  ARG C NH2   1 
ATOM   1656  N N     . LYS C 3  40  ? 98.490  89.021  101.873 1.00 102.25 ? 37  LYS C N     1 
ATOM   1657  C CA    . LYS C 3  40  ? 99.805  89.286  101.303 1.00 103.65 ? 37  LYS C CA    1 
ATOM   1658  C C     . LYS C 3  40  ? 100.403 90.576  101.862 1.00 105.92 ? 37  LYS C C     1 
ATOM   1659  O O     . LYS C 3  40  ? 99.717  91.348  102.522 1.00 102.33 ? 37  LYS C O     1 
ATOM   1660  C CB    . LYS C 3  40  ? 99.715  89.326  99.777  1.00 107.61 ? 37  LYS C CB    1 
ATOM   1661  C CG    . LYS C 3  40  ? 101.055 89.419  99.063  1.00 115.73 ? 37  LYS C CG    1 
ATOM   1662  C CD    . LYS C 3  40  ? 100.978 88.839  97.657  1.00 124.82 ? 37  LYS C CD    1 
ATOM   1663  C CE    . LYS C 3  40  ? 100.238 89.760  96.701  1.00 135.04 ? 37  LYS C CE    1 
ATOM   1664  N NZ    . LYS C 3  40  ? 101.003 91.004  96.419  1.00 131.12 ? 37  LYS C NZ    1 
ATOM   1665  N N     . GLY C 3  41  ? 101.715 90.773  101.714 1.00 106.15 ? 38  GLY C N     1 
ATOM   1666  C CA    . GLY C 3  41  ? 102.372 91.963  102.231 1.00 107.66 ? 38  GLY C CA    1 
ATOM   1667  C C     . GLY C 3  41  ? 102.883 91.702  103.633 1.00 103.79 ? 38  GLY C C     1 
ATOM   1668  O O     . GLY C 3  41  ? 103.429 92.590  104.286 1.00 104.13 ? 38  GLY C O     1 
ATOM   1669  N N     . ASN C 3  42  ? 102.658 90.483  104.106 1.00 99.96  ? 39  ASN C N     1 
ATOM   1670  C CA    . ASN C 3  42  ? 103.086 90.060  105.425 1.00 100.16 ? 39  ASN C CA    1 
ATOM   1671  C C     . ASN C 3  42  ? 102.636 91.015  106.522 1.00 98.94  ? 39  ASN C C     1 
ATOM   1672  O O     . ASN C 3  42  ? 103.382 91.289  107.457 1.00 100.66 ? 39  ASN C O     1 
ATOM   1673  C CB    . ASN C 3  42  ? 104.587 89.869  105.448 1.00 106.20 ? 39  ASN C CB    1 
ATOM   1674  C CG    . ASN C 3  42  ? 105.040 88.778  104.529 1.00 110.06 ? 39  ASN C CG    1 
ATOM   1675  O OD1   . ASN C 3  42  ? 104.312 87.804  104.306 1.00 113.27 ? 39  ASN C OD1   1 
ATOM   1676  N ND2   . ASN C 3  42  ? 106.237 88.904  104.016 1.00 107.45 ? 39  ASN C ND2   1 
ATOM   1677  N N     . TYR C 3  43  ? 101.395 91.475  106.453 1.00 93.15  ? 40  TYR C N     1 
ATOM   1678  C CA    . TYR C 3  43  ? 100.886 92.351  107.497 1.00 91.04  ? 40  TYR C CA    1 
ATOM   1679  C C     . TYR C 3  43  ? 100.602 91.537  108.745 1.00 89.95  ? 40  TYR C C     1 
ATOM   1680  O O     . TYR C 3  43  ? 100.782 91.997  109.873 1.00 92.62  ? 40  TYR C O     1 
ATOM   1681  C CB    . TYR C 3  43  ? 99.612  93.048  107.035 1.00 93.95  ? 40  TYR C CB    1 
ATOM   1682  C CG    . TYR C 3  43  ? 99.828  93.986  105.894 1.00 96.22  ? 40  TYR C CG    1 
ATOM   1683  C CD1   . TYR C 3  43  ? 99.351  93.658  104.641 1.00 97.90  ? 40  TYR C CD1   1 
ATOM   1684  C CD2   . TYR C 3  43  ? 100.508 95.169  106.090 1.00 96.13  ? 40  TYR C CD2   1 
ATOM   1685  C CE1   . TYR C 3  43  ? 99.547  94.512  103.584 1.00 99.87  ? 40  TYR C CE1   1 
ATOM   1686  C CE2   . TYR C 3  43  ? 100.708 96.028  105.032 1.00 98.29  ? 40  TYR C CE2   1 
ATOM   1687  C CZ    . TYR C 3  43  ? 100.230 95.701  103.781 1.00 99.67  ? 40  TYR C CZ    1 
ATOM   1688  O OH    . TYR C 3  43  ? 100.431 96.556  102.725 1.00 99.01  ? 40  TYR C OH    1 
ATOM   1689  N N     . SER C 3  44  ? 100.200 90.301  108.529 1.00 90.28  ? 41  SER C N     1 
ATOM   1690  C CA    . SER C 3  44  ? 99.864  89.387  109.599 1.00 92.56  ? 41  SER C CA    1 
ATOM   1691  C C     . SER C 3  44  ? 99.967  87.978  109.081 1.00 95.33  ? 41  SER C C     1 
ATOM   1692  O O     . SER C 3  44  ? 100.142 87.766  107.881 1.00 97.41  ? 41  SER C O     1 
ATOM   1693  C CB    . SER C 3  44  ? 98.462  89.634  110.083 1.00 96.45  ? 41  SER C CB    1 
ATOM   1694  O OG    . SER C 3  44  ? 97.530  89.273  109.099 1.00 97.99  ? 41  SER C OG    1 
ATOM   1695  N N     . GLU C 3  45  ? 99.888  87.010  109.997 1.00 96.62  ? 42  GLU C N     1 
ATOM   1696  C CA    . GLU C 3  45  ? 99.963  85.580  109.600 1.00 97.07  ? 42  GLU C CA    1 
ATOM   1697  C C     . GLU C 3  45  ? 98.548  85.086  109.295 1.00 96.76  ? 42  GLU C C     1 
ATOM   1698  O O     . GLU C 3  45  ? 98.396  84.262  108.374 1.00 99.22  ? 42  GLU C O     1 
ATOM   1699  C CB    . GLU C 3  45  ? 100.589 84.755  110.725 1.00 101.76 ? 42  GLU C CB    1 
ATOM   1700  C CG    . GLU C 3  45  ? 101.767 85.442  111.390 1.00 110.33 ? 42  GLU C CG    1 
ATOM   1701  C CD    . GLU C 3  45  ? 102.616 84.535  112.263 1.00 120.34 ? 42  GLU C CD    1 
ATOM   1702  O OE1   . GLU C 3  45  ? 102.071 83.545  112.790 1.00 119.99 ? 42  GLU C OE1   1 
ATOM   1703  O OE2   . GLU C 3  45  ? 103.820 84.821  112.414 1.00 126.24 ? 42  GLU C OE2   1 
ATOM   1704  N N     . ARG C 3  46  ? 97.560  85.577  110.047 1.00 94.91  ? 43  ARG C N     1 
ATOM   1705  C CA    . ARG C 3  46  ? 96.151  85.158  109.831 1.00 97.44  ? 43  ARG C CA    1 
ATOM   1706  C C     . ARG C 3  46  ? 95.280  86.391  109.569 1.00 95.95  ? 43  ARG C C     1 
ATOM   1707  O O     . ARG C 3  46  ? 95.519  87.428  110.212 1.00 93.05  ? 43  ARG C O     1 
ATOM   1708  C CB    . ARG C 3  46  ? 95.628  84.346  111.019 1.00 96.38  ? 43  ARG C CB    1 
ATOM   1709  C CG    . ARG C 3  46  ? 96.485  83.145  111.391 1.00 100.06 ? 43  ARG C CG    1 
ATOM   1710  C CD    . ARG C 3  46  ? 95.845  82.313  112.486 1.00 101.92 ? 43  ARG C CD    1 
ATOM   1711  N NE    . ARG C 3  46  ? 94.780  81.457  111.984 1.00 108.02 ? 43  ARG C NE    1 
ATOM   1712  C CZ    . ARG C 3  46  ? 94.718  80.145  112.180 1.00 108.76 ? 43  ARG C CZ    1 
ATOM   1713  N NH1   . ARG C 3  46  ? 95.665  79.534  112.871 1.00 107.19 ? 43  ARG C NH1   1 
ATOM   1714  N NH2   . ARG C 3  46  ? 93.712  79.447  111.685 1.00 113.31 ? 43  ARG C NH2   1 
ATOM   1715  N N     . VAL C 3  47  ? 94.328  86.283  108.638 1.00 91.23  ? 44  VAL C N     1 
ATOM   1716  C CA    . VAL C 3  47  ? 93.397  87.413  108.345 1.00 89.64  ? 44  VAL C CA    1 
ATOM   1717  C C     . VAL C 3  47  ? 91.972  86.949  108.660 1.00 92.34  ? 44  VAL C C     1 
ATOM   1718  O O     . VAL C 3  47  ? 91.586  85.873  108.166 1.00 96.63  ? 44  VAL C O     1 
ATOM   1719  C CB    . VAL C 3  47  ? 93.533  87.878  106.883 1.00 100.86 ? 44  VAL C CB    1 
ATOM   1720  C CG1   . VAL C 3  47  ? 92.424  88.839  106.481 1.00 104.32 ? 44  VAL C CG1   1 
ATOM   1721  C CG2   . VAL C 3  47  ? 94.895  88.499  106.620 1.00 104.85 ? 44  VAL C CG2   1 
ATOM   1722  N N     . GLY C 3  48  ? 91.223  87.734  109.440 1.00 93.51  ? 45  GLY C N     1 
ATOM   1723  C CA    . GLY C 3  48  ? 89.857  87.341  109.841 1.00 95.79  ? 45  GLY C CA    1 
ATOM   1724  C C     . GLY C 3  48  ? 88.846  87.515  108.721 1.00 93.96  ? 45  GLY C C     1 
ATOM   1725  O O     . GLY C 3  48  ? 89.223  88.050  107.662 1.00 93.91  ? 45  GLY C O     1 
ATOM   1726  N N     . ALA C 3  49  ? 87.597  87.089  108.945 1.00 92.62  ? 46  ALA C N     1 
ATOM   1727  C CA    . ALA C 3  49  ? 86.559  87.215  107.930 1.00 93.63  ? 46  ALA C CA    1 
ATOM   1728  C C     . ALA C 3  49  ? 86.050  88.637  107.796 1.00 91.33  ? 46  ALA C C     1 
ATOM   1729  O O     . ALA C 3  49  ? 85.727  89.087  106.698 1.00 95.42  ? 46  ALA C O     1 
ATOM   1730  C CB    . ALA C 3  49  ? 85.395  86.299  108.256 1.00 100.81 ? 46  ALA C CB    1 
ATOM   1731  N N     . GLY C 3  50  ? 85.977  89.350  108.908 1.00 89.32  ? 47  GLY C N     1 
ATOM   1732  C CA    . GLY C 3  50  ? 85.439  90.698  108.881 1.00 90.95  ? 47  GLY C CA    1 
ATOM   1733  C C     . GLY C 3  50  ? 86.505  91.737  108.574 1.00 89.70  ? 47  GLY C C     1 
ATOM   1734  O O     . GLY C 3  50  ? 86.203  92.919  108.420 1.00 86.61  ? 47  GLY C O     1 
ATOM   1735  N N     . ALA C 3  51  ? 87.762  91.321  108.498 1.00 87.18  ? 48  ALA C N     1 
ATOM   1736  C CA    . ALA C 3  51  ? 88.821  92.290  108.287 1.00 89.09  ? 48  ALA C CA    1 
ATOM   1737  C C     . ALA C 3  51  ? 88.715  92.988  106.926 1.00 86.74  ? 48  ALA C C     1 
ATOM   1738  O O     . ALA C 3  51  ? 88.645  94.216  106.891 1.00 87.26  ? 48  ALA C O     1 
ATOM   1739  C CB    . ALA C 3  51  ? 90.195  91.671  108.502 1.00 94.77  ? 48  ALA C CB    1 
ATOM   1740  N N     . PRO C 3  52  ? 88.660  92.261  105.794 1.00 82.86  ? 49  PRO C N     1 
ATOM   1741  C CA    . PRO C 3  52  ? 88.630  92.835  104.469 1.00 90.19  ? 49  PRO C CA    1 
ATOM   1742  C C     . PRO C 3  52  ? 87.305  93.497  104.197 1.00 88.54  ? 49  PRO C C     1 
ATOM   1743  O O     . PRO C 3  52  ? 87.219  94.433  103.406 1.00 87.74  ? 49  PRO C O     1 
ATOM   1744  C CB    . PRO C 3  52  ? 88.831  91.619  103.584 1.00 94.96  ? 49  PRO C CB    1 
ATOM   1745  C CG    . PRO C 3  52  ? 88.267  90.472  104.375 1.00 91.62  ? 49  PRO C CG    1 
ATOM   1746  C CD    . PRO C 3  52  ? 88.544  90.793  105.809 1.00 82.79  ? 49  PRO C CD    1 
ATOM   1747  N N     . VAL C 3  53  ? 86.291  93.073  104.925 1.00 84.66  ? 50  VAL C N     1 
ATOM   1748  C CA    . VAL C 3  53  ? 84.981  93.656  104.775 1.00 83.94  ? 50  VAL C CA    1 
ATOM   1749  C C     . VAL C 3  53  ? 84.986  95.046  105.365 1.00 86.97  ? 50  VAL C C     1 
ATOM   1750  O O     . VAL C 3  53  ? 84.539  96.005  104.732 1.00 88.61  ? 50  VAL C O     1 
ATOM   1751  C CB    . VAL C 3  53  ? 83.954  92.802  105.511 1.00 90.27  ? 50  VAL C CB    1 
ATOM   1752  C CG1   . VAL C 3  53  ? 82.612  93.472  105.495 1.00 93.00  ? 50  VAL C CG1   1 
ATOM   1753  C CG2   . VAL C 3  53  ? 83.887  91.442  104.889 1.00 96.73  ? 50  VAL C CG2   1 
ATOM   1754  N N     . TYR C 3  54  ? 85.534  95.156  106.570 1.00 85.14  ? 51  TYR C N     1 
ATOM   1755  C CA    . TYR C 3  54  ? 85.596  96.432  107.249 1.00 86.64  ? 51  TYR C CA    1 
ATOM   1756  C C     . TYR C 3  54  ? 86.399  97.389  106.396 1.00 85.50  ? 51  TYR C C     1 
ATOM   1757  O O     . TYR C 3  54  ? 85.967  98.507  106.116 1.00 84.39  ? 51  TYR C O     1 
ATOM   1758  C CB    . TYR C 3  54  ? 86.292  96.276  108.600 1.00 87.09  ? 51  TYR C CB    1 
ATOM   1759  C CG    . TYR C 3  54  ? 86.072  97.412  109.543 1.00 83.78  ? 51  TYR C CG    1 
ATOM   1760  C CD1   . TYR C 3  54  ? 85.215  97.242  110.605 1.00 87.48  ? 51  TYR C CD1   1 
ATOM   1761  C CD2   . TYR C 3  54  ? 86.684  98.624  109.344 1.00 84.42  ? 51  TYR C CD2   1 
ATOM   1762  C CE1   . TYR C 3  54  ? 84.990  98.269  111.472 1.00 90.34  ? 51  TYR C CE1   1 
ATOM   1763  C CE2   . TYR C 3  54  ? 86.459  99.654  110.218 1.00 90.10  ? 51  TYR C CE2   1 
ATOM   1764  C CZ    . TYR C 3  54  ? 85.609  99.474  111.273 1.00 91.37  ? 51  TYR C CZ    1 
ATOM   1765  O OH    . TYR C 3  54  ? 85.375  100.490 112.143 1.00 90.62  ? 51  TYR C OH    1 
ATOM   1766  N N     . LEU C 3  55  ? 87.545  96.913  105.926 1.00 84.36  ? 52  LEU C N     1 
ATOM   1767  C CA    . LEU C 3  55  ? 88.448  97.745  105.158 1.00 85.19  ? 52  LEU C CA    1 
ATOM   1768  C C     . LEU C 3  55  ? 87.872  98.135  103.813 1.00 87.07  ? 52  LEU C C     1 
ATOM   1769  O O     . LEU C 3  55  ? 88.031  99.274  103.376 1.00 85.61  ? 52  LEU C O     1 
ATOM   1770  C CB    . LEU C 3  55  ? 89.791  97.038  104.990 1.00 84.20  ? 52  LEU C CB    1 
ATOM   1771  C CG    . LEU C 3  55  ? 90.853  97.780  104.179 1.00 86.18  ? 52  LEU C CG    1 
ATOM   1772  C CD1   . LEU C 3  55  ? 91.094  99.156  104.754 1.00 90.78  ? 52  LEU C CD1   1 
ATOM   1773  C CD2   . LEU C 3  55  ? 92.125  96.992  104.246 1.00 88.04  ? 52  LEU C CD2   1 
ATOM   1774  N N     . ALA C 3  56  ? 87.214  97.205  103.138 1.00 86.17  ? 53  ALA C N     1 
ATOM   1775  C CA    . ALA C 3  56  ? 86.638  97.534  101.851 1.00 88.94  ? 53  ALA C CA    1 
ATOM   1776  C C     . ALA C 3  56  ? 85.629  98.657  102.006 1.00 88.92  ? 53  ALA C C     1 
ATOM   1777  O O     . ALA C 3  56  ? 85.609  99.592  101.207 1.00 88.96  ? 53  ALA C O     1 
ATOM   1778  C CB    . ALA C 3  56  ? 85.982  96.315  101.235 1.00 97.96  ? 53  ALA C CB    1 
ATOM   1779  N N     . ALA C 3  57  ? 84.847  98.613  103.083 1.00 84.09  ? 54  ALA C N     1 
ATOM   1780  C CA    . ALA C 3  57  ? 83.867  99.659  103.326 1.00 85.64  ? 54  ALA C CA    1 
ATOM   1781  C C     . ALA C 3  57  ? 84.547  101.001 103.509 1.00 85.19  ? 54  ALA C C     1 
ATOM   1782  O O     . ALA C 3  57  ? 84.078  102.021 103.001 1.00 88.42  ? 54  ALA C O     1 
ATOM   1783  C CB    . ALA C 3  57  ? 83.039  99.333  104.552 1.00 91.88  ? 54  ALA C CB    1 
ATOM   1784  N N     . VAL C 3  58  ? 85.679  100.993 104.198 1.00 81.93  ? 55  VAL C N     1 
ATOM   1785  C CA    . VAL C 3  58  ? 86.422  102.218 104.439 1.00 83.00  ? 55  VAL C CA    1 
ATOM   1786  C C     . VAL C 3  58  ? 86.985  102.781 103.153 1.00 86.36  ? 55  VAL C C     1 
ATOM   1787  O O     . VAL C 3  58  ? 86.871  103.979 102.887 1.00 87.00  ? 55  VAL C O     1 
ATOM   1788  C CB    . VAL C 3  58  ? 87.577  101.953 105.412 1.00 85.87  ? 55  VAL C CB    1 
ATOM   1789  C CG1   . VAL C 3  58  ? 88.499  103.175 105.507 1.00 90.04  ? 55  VAL C CG1   1 
ATOM   1790  C CG2   . VAL C 3  58  ? 87.011  101.589 106.768 1.00 90.74  ? 55  VAL C CG2   1 
ATOM   1791  N N     . LEU C 3  59  ? 87.587  101.916 102.354 1.00 85.23  ? 56  LEU C N     1 
ATOM   1792  C CA    . LEU C 3  59  ? 88.207  102.357 101.124 1.00 88.68  ? 56  LEU C CA    1 
ATOM   1793  C C     . LEU C 3  59  ? 87.161  102.914 100.179 1.00 90.06  ? 56  LEU C C     1 
ATOM   1794  O O     . LEU C 3  59  ? 87.377  103.944 99.538  1.00 90.97  ? 56  LEU C O     1 
ATOM   1795  C CB    . LEU C 3  59  ? 88.924  101.181 100.459 1.00 89.09  ? 56  LEU C CB    1 
ATOM   1796  C CG    . LEU C 3  59  ? 90.142  100.623 101.201 1.00 91.01  ? 56  LEU C CG    1 
ATOM   1797  C CD1   . LEU C 3  59  ? 90.546  99.310  100.564 1.00 95.02  ? 56  LEU C CD1   1 
ATOM   1798  C CD2   . LEU C 3  59  ? 91.292  101.615 101.150 1.00 90.13  ? 56  LEU C CD2   1 
ATOM   1799  N N     . GLU C 3  60  ? 86.009  102.261 100.127 1.00 91.38  ? 57  GLU C N     1 
ATOM   1800  C CA    . GLU C 3  60  ? 84.943  102.700 99.251  1.00 93.93  ? 57  GLU C CA    1 
ATOM   1801  C C     . GLU C 3  60  ? 84.356  104.018 99.720  1.00 90.30  ? 57  GLU C C     1 
ATOM   1802  O O     . GLU C 3  60  ? 84.081  104.902 98.910  1.00 91.53  ? 57  GLU C O     1 
ATOM   1803  C CB    . GLU C 3  60  ? 83.853  101.650 99.164  1.00 96.25  ? 57  GLU C CB    1 
ATOM   1804  C CG    . GLU C 3  60  ? 82.765  101.991 98.185  1.00 102.98 ? 57  GLU C CG    1 
ATOM   1805  C CD    . GLU C 3  60  ? 81.799  100.888 97.999  0.00 114.15 ? 57  GLU C CD    1 
ATOM   1806  O OE1   . GLU C 3  60  ? 82.221  99.767  97.818  0.00 113.92 ? 57  GLU C OE1   1 
ATOM   1807  O OE2   . GLU C 3  60  ? 80.625  101.151 98.038  0.00 115.05 ? 57  GLU C OE2   1 
ATOM   1808  N N     . TYR C 3  61  ? 84.162  104.154 101.027 1.00 86.40  ? 58  TYR C N     1 
ATOM   1809  C CA    . TYR C 3  61  ? 83.624  105.386 101.572 1.00 88.05  ? 58  TYR C CA    1 
ATOM   1810  C C     . TYR C 3  61  ? 84.490  106.573 101.207 1.00 90.62  ? 58  TYR C C     1 
ATOM   1811  O O     . TYR C 3  61  ? 83.990  107.593 100.732 1.00 89.62  ? 58  TYR C O     1 
ATOM   1812  C CB    . TYR C 3  61  ? 83.480  105.303 103.087 1.00 90.29  ? 58  TYR C CB    1 
ATOM   1813  C CG    . TYR C 3  61  ? 83.210  106.639 103.702 1.00 89.90  ? 58  TYR C CG    1 
ATOM   1814  C CD1   . TYR C 3  61  ? 81.966  107.217 103.576 1.00 92.17  ? 58  TYR C CD1   1 
ATOM   1815  C CD2   . TYR C 3  61  ? 84.225  107.306 104.362 1.00 91.26  ? 58  TYR C CD2   1 
ATOM   1816  C CE1   . TYR C 3  61  ? 81.743  108.474 104.084 1.00 97.29  ? 58  TYR C CE1   1 
ATOM   1817  C CE2   . TYR C 3  61  ? 84.001  108.557 104.878 1.00 96.34  ? 58  TYR C CE2   1 
ATOM   1818  C CZ    . TYR C 3  61  ? 82.768  109.147 104.727 1.00 99.85  ? 58  TYR C CZ    1 
ATOM   1819  O OH    . TYR C 3  61  ? 82.544  110.406 105.225 1.00 102.13 ? 58  TYR C OH    1 
ATOM   1820  N N     . LEU C 3  62  ? 85.790  106.451 101.439 1.00 88.78  ? 59  LEU C N     1 
ATOM   1821  C CA    . LEU C 3  62  ? 86.688  107.555 101.160 1.00 90.18  ? 59  LEU C CA    1 
ATOM   1822  C C     . LEU C 3  62  ? 86.739  107.838 99.673  1.00 91.62  ? 59  LEU C C     1 
ATOM   1823  O O     . LEU C 3  62  ? 86.805  108.995 99.252  1.00 91.87  ? 59  LEU C O     1 
ATOM   1824  C CB    . LEU C 3  62  ? 88.088  107.233 101.659 1.00 86.01  ? 59  LEU C CB    1 
ATOM   1825  C CG    . LEU C 3  62  ? 88.264  107.131 103.162 1.00 87.91  ? 59  LEU C CG    1 
ATOM   1826  C CD1   . LEU C 3  62  ? 89.643  106.560 103.432 1.00 89.44  ? 59  LEU C CD1   1 
ATOM   1827  C CD2   . LEU C 3  62  ? 88.093  108.516 103.803 1.00 92.75  ? 59  LEU C CD2   1 
ATOM   1828  N N     . THR C 3  63  ? 86.691  106.779 98.875  1.00 89.72  ? 60  THR C N     1 
ATOM   1829  C CA    . THR C 3  63  ? 86.709  106.922 97.435  1.00 90.17  ? 60  THR C CA    1 
ATOM   1830  C C     . THR C 3  63  ? 85.515  107.750 97.002  1.00 93.18  ? 60  THR C C     1 
ATOM   1831  O O     . THR C 3  63  ? 85.649  108.697 96.225  1.00 91.78  ? 60  THR C O     1 
ATOM   1832  C CB    . THR C 3  63  ? 86.674  105.538 96.756  1.00 93.16  ? 60  THR C CB    1 
ATOM   1833  O OG1   . THR C 3  63  ? 87.851  104.802 97.110  1.00 97.04  ? 60  THR C OG1   1 
ATOM   1834  C CG2   . THR C 3  63  ? 86.599  105.663 95.252  1.00 101.47 ? 60  THR C CG2   1 
ATOM   1835  N N     . ALA C 3  64  ? 84.353  107.434 97.561  1.00 88.74  ? 61  ALA C N     1 
ATOM   1836  C CA    . ALA C 3  64  ? 83.141  108.158 97.229  1.00 92.28  ? 61  ALA C CA    1 
ATOM   1837  C C     . ALA C 3  64  ? 83.240  109.627 97.601  1.00 94.40  ? 61  ALA C C     1 
ATOM   1838  O O     . ALA C 3  64  ? 82.862  110.489 96.810  1.00 96.63  ? 61  ALA C O     1 
ATOM   1839  C CB    . ALA C 3  64  ? 81.951  107.533 97.933  1.00 93.44  ? 61  ALA C CB    1 
ATOM   1840  N N     . GLU C 3  65  ? 83.830  109.924 98.756  1.00 92.66  ? 62  GLU C N     1 
ATOM   1841  C CA    . GLU C 3  65  ? 83.902  111.309 99.202  1.00 94.40  ? 62  GLU C CA    1 
ATOM   1842  C C     . GLU C 3  65  ? 84.770  112.150 98.288  1.00 95.57  ? 62  GLU C C     1 
ATOM   1843  O O     . GLU C 3  65  ? 84.396  113.265 97.919  1.00 95.86  ? 62  GLU C O     1 
ATOM   1844  C CB    . GLU C 3  65  ? 84.456  111.389 100.620 1.00 94.84  ? 62  GLU C CB    1 
ATOM   1845  C CG    . GLU C 3  65  ? 83.530  110.853 101.676 1.00 101.59 ? 62  GLU C CG    1 
ATOM   1846  C CD    . GLU C 3  65  ? 82.270  111.639 101.793 1.00 108.59 ? 62  GLU C CD    1 
ATOM   1847  O OE1   . GLU C 3  65  ? 82.346  112.819 102.030 1.00 109.24 ? 62  GLU C OE1   1 
ATOM   1848  O OE2   . GLU C 3  65  ? 81.226  111.073 101.586 1.00 108.70 ? 62  GLU C OE2   1 
ATOM   1849  N N     . ILE C 3  66  ? 85.878  111.584 97.835  1.00 91.00  ? 63  ILE C N     1 
ATOM   1850  C CA    . ILE C 3  66  ? 86.746  112.329 96.944  1.00 89.61  ? 63  ILE C CA    1 
ATOM   1851  C C     . ILE C 3  66  ? 86.032  112.601 95.644  1.00 95.01  ? 63  ILE C C     1 
ATOM   1852  O O     . ILE C 3  66  ? 86.055  113.721 95.134  1.00 96.28  ? 63  ILE C O     1 
ATOM   1853  C CB    . ILE C 3  66  ? 88.043  111.569 96.642  1.00 90.06  ? 63  ILE C CB    1 
ATOM   1854  C CG1   . ILE C 3  66  ? 88.892  111.477 97.889  1.00 93.61  ? 63  ILE C CG1   1 
ATOM   1855  C CG2   . ILE C 3  66  ? 88.806  112.279 95.527  1.00 94.88  ? 63  ILE C CG2   1 
ATOM   1856  C CD1   . ILE C 3  66  ? 90.013  110.498 97.790  1.00 95.85  ? 63  ILE C CD1   1 
ATOM   1857  N N     . LEU C 3  67  ? 85.397  111.572 95.111  1.00 93.38  ? 64  LEU C N     1 
ATOM   1858  C CA    . LEU C 3  67  ? 84.717  111.671 93.838  1.00 95.89  ? 64  LEU C CA    1 
ATOM   1859  C C     . LEU C 3  67  ? 83.531  112.614 93.909  1.00 101.84 ? 64  LEU C C     1 
ATOM   1860  O O     . LEU C 3  67  ? 83.244  113.329 92.949  1.00 103.36 ? 64  LEU C O     1 
ATOM   1861  C CB    . LEU C 3  67  ? 84.278  110.281 93.405  1.00 96.43  ? 64  LEU C CB    1 
ATOM   1862  C CG    . LEU C 3  67  ? 85.422  109.322 93.058  1.00 103.77 ? 64  LEU C CG    1 
ATOM   1863  C CD1   . LEU C 3  67  ? 84.870  107.927 92.947  1.00 112.41 ? 64  LEU C CD1   1 
ATOM   1864  C CD2   . LEU C 3  67  ? 86.101  109.746 91.751  1.00 106.19 ? 64  LEU C CD2   1 
ATOM   1865  N N     . GLU C 3  68  ? 82.830  112.617 95.035  1.00 99.26  ? 65  GLU C N     1 
ATOM   1866  C CA    . GLU C 3  68  ? 81.705  113.520 95.197  1.00 105.30 ? 65  GLU C CA    1 
ATOM   1867  C C     . GLU C 3  68  ? 82.166  114.959 95.145  1.00 105.48 ? 65  GLU C C     1 
ATOM   1868  O O     . GLU C 3  68  ? 81.603  115.782 94.419  1.00 107.36 ? 65  GLU C O     1 
ATOM   1869  C CB    . GLU C 3  68  ? 81.001  113.282 96.528  1.00 109.32 ? 65  GLU C CB    1 
ATOM   1870  C CG    . GLU C 3  68  ? 79.843  114.238 96.790  1.00 117.40 ? 65  GLU C CG    1 
ATOM   1871  C CD    . GLU C 3  68  ? 79.040  113.872 97.998  0.00 129.20 ? 65  GLU C CD    1 
ATOM   1872  O OE1   . GLU C 3  68  ? 79.216  112.794 98.503  0.00 123.97 ? 65  GLU C OE1   1 
ATOM   1873  O OE2   . GLU C 3  68  ? 78.241  114.675 98.417  0.00 138.47 ? 65  GLU C OE2   1 
ATOM   1874  N N     . LEU C 3  69  ? 83.220  115.247 95.887  1.00 100.68 ? 66  LEU C N     1 
ATOM   1875  C CA    . LEU C 3  69  ? 83.749  116.590 95.959  1.00 104.02 ? 66  LEU C CA    1 
ATOM   1876  C C     . LEU C 3  69  ? 84.390  116.996 94.641  1.00 104.37 ? 66  LEU C C     1 
ATOM   1877  O O     . LEU C 3  69  ? 84.288  118.150 94.226  1.00 106.39 ? 66  LEU C O     1 
ATOM   1878  C CB    . LEU C 3  69  ? 84.752  116.663 97.103  1.00 99.93  ? 66  LEU C CB    1 
ATOM   1879  C CG    . LEU C 3  69  ? 84.177  116.543 98.514  1.00 103.02 ? 66  LEU C CG    1 
ATOM   1880  C CD1   . LEU C 3  69  ? 85.323  116.323 99.482  1.00 107.12 ? 66  LEU C CD1   1 
ATOM   1881  C CD2   . LEU C 3  69  ? 83.409  117.807 98.875  1.00 104.53 ? 66  LEU C CD2   1 
ATOM   1882  N N     . ALA C 3  70  ? 85.050  116.050 93.981  1.00 100.92 ? 67  ALA C N     1 
ATOM   1883  C CA    . ALA C 3  70  ? 85.670  116.320 92.695  1.00 104.18 ? 67  ALA C CA    1 
ATOM   1884  C C     . ALA C 3  70  ? 84.617  116.592 91.641  1.00 107.28 ? 67  ALA C C     1 
ATOM   1885  O O     . ALA C 3  70  ? 84.787  117.474 90.800  1.00 111.72 ? 67  ALA C O     1 
ATOM   1886  C CB    . ALA C 3  70  ? 86.550  115.164 92.287  1.00 104.98 ? 67  ALA C CB    1 
ATOM   1887  N N     . GLY C 3  71  ? 83.501  115.876 91.713  1.00 104.60 ? 68  GLY C N     1 
ATOM   1888  C CA    . GLY C 3  71  ? 82.412  116.123 90.787  1.00 109.67 ? 68  GLY C CA    1 
ATOM   1889  C C     . GLY C 3  71  ? 81.910  117.543 90.972  1.00 113.15 ? 68  GLY C C     1 
ATOM   1890  O O     . GLY C 3  71  ? 81.639  118.249 89.999  1.00 115.67 ? 68  GLY C O     1 
ATOM   1891  N N     . ASN C 3  72  ? 81.869  117.992 92.221  1.00 111.20 ? 69  ASN C N     1 
ATOM   1892  C CA    . ASN C 3  72  ? 81.469  119.358 92.497  1.00 114.16 ? 69  ASN C CA    1 
ATOM   1893  C C     . ASN C 3  72  ? 82.520  120.335 91.986  1.00 118.48 ? 69  ASN C C     1 
ATOM   1894  O O     . ASN C 3  72  ? 82.181  121.380 91.432  1.00 121.78 ? 69  ASN C O     1 
ATOM   1895  C CB    . ASN C 3  72  ? 81.211  119.551 93.974  1.00 115.07 ? 69  ASN C CB    1 
ATOM   1896  C CG    . ASN C 3  72  ? 79.935  118.901 94.422  1.00 117.35 ? 69  ASN C CG    1 
ATOM   1897  O OD1   . ASN C 3  72  ? 79.027  118.648 93.621  1.00 117.39 ? 69  ASN C OD1   1 
ATOM   1898  N ND2   . ASN C 3  72  ? 79.843  118.624 95.696  1.00 115.83 ? 69  ASN C ND2   1 
ATOM   1899  N N     . ALA C 3  73  ? 83.795  119.970 92.112  1.00 115.03 ? 70  ALA C N     1 
ATOM   1900  C CA    . ALA C 3  73  ? 84.864  120.818 91.600  1.00 118.81 ? 70  ALA C CA    1 
ATOM   1901  C C     . ALA C 3  73  ? 84.748  120.959 90.090  1.00 120.99 ? 70  ALA C C     1 
ATOM   1902  O O     . ALA C 3  73  ? 84.992  122.031 89.533  1.00 126.44 ? 70  ALA C O     1 
ATOM   1903  C CB    . ALA C 3  73  ? 86.227  120.252 91.969  1.00 116.38 ? 70  ALA C CB    1 
ATOM   1904  N N     . ALA C 3  74  ? 84.367  119.874 89.425  1.00 118.38 ? 71  ALA C N     1 
ATOM   1905  C CA    . ALA C 3  74  ? 84.207  119.909 87.985  1.00 123.25 ? 71  ALA C CA    1 
ATOM   1906  C C     . ALA C 3  74  ? 83.121  120.887 87.604  1.00 126.57 ? 71  ALA C C     1 
ATOM   1907  O O     . ALA C 3  74  ? 83.284  121.684 86.680  1.00 133.09 ? 71  ALA C O     1 
ATOM   1908  C CB    . ALA C 3  74  ? 83.873  118.526 87.451  1.00 126.59 ? 71  ALA C CB    1 
ATOM   1909  N N     . ARG C 3  75  ? 82.056  120.898 88.388  1.00 123.17 ? 72  ARG C N     1 
ATOM   1910  C CA    . ARG C 3  75  ? 80.947  121.801 88.151  1.00 126.61 ? 72  ARG C CA    1 
ATOM   1911  C C     . ARG C 3  75  ? 81.344  123.245 88.398  1.00 127.98 ? 72  ARG C C     1 
ATOM   1912  O O     . ARG C 3  75  ? 80.963  124.138 87.644  1.00 127.47 ? 72  ARG C O     1 
ATOM   1913  C CB    . ARG C 3  75  ? 79.795  121.430 89.039  1.00 125.95 ? 72  ARG C CB    1 
ATOM   1914  C CG    . ARG C 3  75  ? 79.158  120.132 88.677  1.00 127.56 ? 72  ARG C CG    1 
ATOM   1915  C CD    . ARG C 3  75  ? 78.185  119.720 89.687  1.00 128.53 ? 72  ARG C CD    1 
ATOM   1916  N NE    . ARG C 3  75  ? 77.100  120.656 89.787  1.00 134.20 ? 72  ARG C NE    1 
ATOM   1917  C CZ    . ARG C 3  75  ? 76.025  120.661 88.989  1.00 137.67 ? 72  ARG C CZ    1 
ATOM   1918  N NH1   . ARG C 3  75  ? 75.914  119.777 88.025  1.00 135.55 ? 72  ARG C NH1   1 
ATOM   1919  N NH2   . ARG C 3  75  ? 75.077  121.556 89.175  1.00 137.31 ? 72  ARG C NH2   1 
ATOM   1920  N N     . ASP C 3  76  ? 82.193  123.466 89.394  1.00 127.92 ? 73  ASP C N     1 
ATOM   1921  C CA    . ASP C 3  76  ? 82.672  124.811 89.681  1.00 130.27 ? 73  ASP C CA    1 
ATOM   1922  C C     . ASP C 3  76  ? 83.406  125.374 88.473  1.00 132.23 ? 73  ASP C C     1 
ATOM   1923  O O     . ASP C 3  76  ? 83.320  126.566 88.178  1.00 134.64 ? 73  ASP C O     1 
ATOM   1924  C CB    . ASP C 3  76  ? 83.609  124.812 90.887  1.00 133.59 ? 73  ASP C CB    1 
ATOM   1925  C CG    . ASP C 3  76  ? 82.895  124.577 92.204  1.00 139.19 ? 73  ASP C CG    1 
ATOM   1926  O OD1   . ASP C 3  76  ? 81.695  124.723 92.253  1.00 138.56 ? 73  ASP C OD1   1 
ATOM   1927  O OD2   . ASP C 3  76  ? 83.561  124.249 93.157  1.00 136.08 ? 73  ASP C OD2   1 
ATOM   1928  N N     . ASN C 3  77  ? 84.075  124.494 87.733  1.00 132.41 ? 74  ASN C N     1 
ATOM   1929  C CA    . ASN C 3  77  ? 84.798  124.895 86.535  1.00 133.56 ? 74  ASN C CA    1 
ATOM   1930  C C     . ASN C 3  77  ? 83.933  124.779 85.287  1.00 134.00 ? 74  ASN C C     1 
ATOM   1931  O O     . ASN C 3  77  ? 84.408  125.022 84.177  1.00 135.19 ? 74  ASN C O     1 
ATOM   1932  C CB    . ASN C 3  77  ? 86.069  124.090 86.375  1.00 135.32 ? 74  ASN C CB    1 
ATOM   1933  C CG    . ASN C 3  77  ? 87.110  124.467 87.376  1.00 136.95 ? 74  ASN C CG    1 
ATOM   1934  O OD1   . ASN C 3  77  ? 87.159  125.612 87.843  1.00 136.26 ? 74  ASN C OD1   1 
ATOM   1935  N ND2   . ASN C 3  77  ? 87.969  123.541 87.698  1.00 132.63 ? 74  ASN C ND2   1 
ATOM   1936  N N     . LYS C 3  78  ? 82.645  124.508 85.492  1.00 132.51 ? 75  LYS C N     1 
ATOM   1937  C CA    . LYS C 3  78  ? 81.660  124.398 84.424  1.00 134.91 ? 75  LYS C CA    1 
ATOM   1938  C C     . LYS C 3  78  ? 81.902  123.196 83.523  1.00 135.47 ? 75  LYS C C     1 
ATOM   1939  O O     . LYS C 3  78  ? 81.687  123.261 82.312  1.00 135.81 ? 75  LYS C O     1 
ATOM   1940  C CB    . LYS C 3  78  ? 81.683  125.672 83.596  1.00 140.67 ? 75  LYS C CB    1 
ATOM   1941  C CG    . LYS C 3  78  ? 81.579  126.931 84.431  1.00 143.57 ? 75  LYS C CG    1 
ATOM   1942  C CD    . LYS C 3  78  ? 81.686  128.165 83.579  1.00 149.50 ? 75  LYS C CD    1 
ATOM   1943  C CE    . LYS C 3  78  ? 81.774  129.412 84.437  1.00 152.73 ? 75  LYS C CE    1 
ATOM   1944  N NZ    . LYS C 3  78  ? 81.968  130.629 83.616  1.00 151.34 ? 75  LYS C NZ    1 
ATOM   1945  N N     . LYS C 3  79  ? 82.321  122.090 84.122  1.00 136.61 ? 76  LYS C N     1 
ATOM   1946  C CA    . LYS C 3  79  ? 82.586  120.865 83.387  1.00 144.00 ? 76  LYS C CA    1 
ATOM   1947  C C     . LYS C 3  79  ? 81.741  119.693 83.851  1.00 148.26 ? 76  LYS C C     1 
ATOM   1948  O O     . LYS C 3  79  ? 81.163  119.708 84.938  1.00 147.05 ? 76  LYS C O     1 
ATOM   1949  C CB    . LYS C 3  79  ? 84.051  120.495 83.484  1.00 139.33 ? 76  LYS C CB    1 
ATOM   1950  C CG    . LYS C 3  79  ? 84.918  121.116 82.433  1.00 143.18 ? 76  LYS C CG    1 
ATOM   1951  C CD    . LYS C 3  79  ? 85.258  122.537 82.768  1.00 136.89 ? 76  LYS C CD    1 
ATOM   1952  C CE    . LYS C 3  79  ? 86.382  123.069 81.899  1.00 138.40 ? 76  LYS C CE    1 
ATOM   1953  N NZ    . LYS C 3  79  ? 85.952  123.281 80.494  1.00 138.84 ? 76  LYS C NZ    1 
ATOM   1954  N N     . THR C 3  80  ? 81.690  118.669 83.008  1.00 155.65 ? 77  THR C N     1 
ATOM   1955  C CA    . THR C 3  80  ? 80.948  117.443 83.266  1.00 162.72 ? 77  THR C CA    1 
ATOM   1956  C C     . THR C 3  80  ? 81.882  116.254 83.459  1.00 154.31 ? 77  THR C C     1 
ATOM   1957  O O     . THR C 3  80  ? 81.485  115.102 83.263  1.00 152.88 ? 77  THR C O     1 
ATOM   1958  C CB    . THR C 3  80  ? 80.005  117.154 82.094  1.00 193.55 ? 77  THR C CB    1 
ATOM   1959  O OG1   . THR C 3  80  ? 80.782  117.069 80.893  1.00 242.65 ? 77  THR C OG1   1 
ATOM   1960  C CG2   . THR C 3  80  ? 78.985  118.266 81.955  1.00 187.05 ? 77  THR C CG2   1 
ATOM   1961  N N     . ARG C 3  81  ? 83.151  116.542 83.721  1.00 153.44 ? 78  ARG C N     1 
ATOM   1962  C CA    . ARG C 3  81  ? 84.150  115.499 83.889  1.00 149.75 ? 78  ARG C CA    1 
ATOM   1963  C C     . ARG C 3  81  ? 85.133  115.770 85.019  1.00 139.58 ? 78  ARG C C     1 
ATOM   1964  O O     . ARG C 3  81  ? 85.524  116.913 85.261  1.00 137.25 ? 78  ARG C O     1 
ATOM   1965  C CB    . ARG C 3  81  ? 84.926  115.322 82.610  1.00 158.44 ? 78  ARG C CB    1 
ATOM   1966  C CG    . ARG C 3  81  ? 86.064  114.366 82.712  1.00 160.22 ? 78  ARG C CG    1 
ATOM   1967  C CD    . ARG C 3  81  ? 86.678  114.148 81.436  1.00 175.52 ? 78  ARG C CD    1 
ATOM   1968  N NE    . ARG C 3  81  ? 85.794  113.466 80.540  1.00 219.09 ? 78  ARG C NE    1 
ATOM   1969  C CZ    . ARG C 3  81  ? 85.989  113.358 79.221  1.00 288.07 ? 78  ARG C CZ    1 
ATOM   1970  N NH1   . ARG C 3  81  ? 87.051  113.892 78.665  1.00 286.68 ? 78  ARG C NH1   1 
ATOM   1971  N NH2   . ARG C 3  81  ? 85.104  112.722 78.477  1.00 312.46 ? 78  ARG C NH2   1 
ATOM   1972  N N     . ILE C 3  82  ? 85.613  114.698 85.638  1.00 135.48 ? 79  ILE C N     1 
ATOM   1973  C CA    . ILE C 3  82  ? 86.695  114.798 86.601  1.00 126.32 ? 79  ILE C CA    1 
ATOM   1974  C C     . ILE C 3  82  ? 88.058  114.573 85.964  1.00 127.45 ? 79  ILE C C     1 
ATOM   1975  O O     . ILE C 3  82  ? 88.280  113.601 85.241  1.00 134.07 ? 79  ILE C O     1 
ATOM   1976  C CB    . ILE C 3  82  ? 86.492  113.827 87.772  1.00 127.03 ? 79  ILE C CB    1 
ATOM   1977  C CG1   . ILE C 3  82  ? 85.243  114.232 88.550  1.00 122.23 ? 79  ILE C CG1   1 
ATOM   1978  C CG2   . ILE C 3  82  ? 87.734  113.794 88.674  1.00 125.07 ? 79  ILE C CG2   1 
ATOM   1979  C CD1   . ILE C 3  82  ? 84.798  113.215 89.558  1.00 123.17 ? 79  ILE C CD1   1 
ATOM   1980  N N     . ILE C 3  83  ? 88.958  115.504 86.232  1.00 119.55 ? 80  ILE C N     1 
ATOM   1981  C CA    . ILE C 3  83  ? 90.343  115.440 85.800  1.00 114.76 ? 80  ILE C CA    1 
ATOM   1982  C C     . ILE C 3  83  ? 91.182  115.580 87.073  1.00 109.79 ? 80  ILE C C     1 
ATOM   1983  O O     . ILE C 3  83  ? 90.655  116.061 88.076  1.00 107.74 ? 80  ILE C O     1 
ATOM   1984  C CB    . ILE C 3  83  ? 90.622  116.555 84.776  1.00 110.53 ? 80  ILE C CB    1 
ATOM   1985  C CG1   . ILE C 3  83  ? 90.467  117.917 85.432  1.00 110.51 ? 80  ILE C CG1   1 
ATOM   1986  C CG2   . ILE C 3  83  ? 89.644  116.408 83.617  1.00 124.92 ? 80  ILE C CG2   1 
ATOM   1987  C CD1   . ILE C 3  83  ? 90.937  119.074 84.585  1.00 118.19 ? 80  ILE C CD1   1 
ATOM   1988  N N     . PRO C 3  84  ? 92.482  115.255 87.055  1.00 109.11 ? 81  PRO C N     1 
ATOM   1989  C CA    . PRO C 3  84  ? 93.383  115.291 88.196  1.00 106.09 ? 81  PRO C CA    1 
ATOM   1990  C C     . PRO C 3  84  ? 93.271  116.593 88.974  1.00 102.73 ? 81  PRO C C     1 
ATOM   1991  O O     . PRO C 3  84  ? 93.320  116.596 90.206  1.00 102.23 ? 81  PRO C O     1 
ATOM   1992  C CB    . PRO C 3  84  ? 94.746  115.144 87.522  1.00 105.22 ? 81  PRO C CB    1 
ATOM   1993  C CG    . PRO C 3  84  ? 94.456  114.326 86.293  1.00 114.63 ? 81  PRO C CG    1 
ATOM   1994  C CD    . PRO C 3  84  ? 93.125  114.835 85.805  1.00 110.39 ? 81  PRO C CD    1 
ATOM   1995  N N     . ARG C 3  85  ? 93.023  117.686 88.269  1.00 101.21 ? 82  ARG C N     1 
ATOM   1996  C CA    . ARG C 3  85  ? 92.868  118.968 88.925  1.00 102.49 ? 82  ARG C CA    1 
ATOM   1997  C C     . ARG C 3  85  ? 91.647  119.021 89.824  1.00 101.23 ? 82  ARG C C     1 
ATOM   1998  O O     . ARG C 3  85  ? 91.665  119.653 90.879  1.00 99.05  ? 82  ARG C O     1 
ATOM   1999  C CB    . ARG C 3  85  ? 92.730  120.062 87.903  1.00 104.08 ? 82  ARG C CB    1 
ATOM   2000  C CG    . ARG C 3  85  ? 92.442  121.411 88.474  1.00 105.66 ? 82  ARG C CG    1 
ATOM   2001  C CD    . ARG C 3  85  ? 93.514  121.858 89.353  1.00 106.99 ? 82  ARG C CD    1 
ATOM   2002  N NE    . ARG C 3  85  ? 93.235  123.134 89.932  1.00 108.93 ? 82  ARG C NE    1 
ATOM   2003  C CZ    . ARG C 3  85  ? 93.436  124.300 89.325  1.00 109.33 ? 82  ARG C CZ    1 
ATOM   2004  N NH1   . ARG C 3  85  ? 93.877  124.328 88.095  1.00 112.55 ? 82  ARG C NH1   1 
ATOM   2005  N NH2   . ARG C 3  85  ? 93.194  125.420 89.966  1.00 109.95 ? 82  ARG C NH2   1 
ATOM   2006  N N     . HIS C 3  86  ? 90.565  118.408 89.379  1.00 104.06 ? 83  HIS C N     1 
ATOM   2007  C CA    . HIS C 3  86  ? 89.318  118.478 90.110  1.00 104.79 ? 83  HIS C CA    1 
ATOM   2008  C C     . HIS C 3  86  ? 89.442  117.644 91.366  1.00 101.97 ? 83  HIS C C     1 
ATOM   2009  O O     . HIS C 3  86  ? 88.906  117.999 92.418  1.00 101.96 ? 83  HIS C O     1 
ATOM   2010  C CB    . HIS C 3  86  ? 88.164  118.029 89.211  1.00 112.50 ? 83  HIS C CB    1 
ATOM   2011  C CG    . HIS C 3  86  ? 87.949  118.992 88.090  1.00 114.89 ? 83  HIS C CG    1 
ATOM   2012  N ND1   . HIS C 3  86  ? 87.252  118.681 86.935  1.00 120.58 ? 83  HIS C ND1   1 
ATOM   2013  C CD2   . HIS C 3  86  ? 88.379  120.262 87.940  1.00 115.20 ? 83  HIS C CD2   1 
ATOM   2014  C CE1   . HIS C 3  86  ? 87.265  119.729 86.130  1.00 125.60 ? 83  HIS C CE1   1 
ATOM   2015  N NE2   . HIS C 3  86  ? 87.932  120.703 86.726  1.00 122.20 ? 83  HIS C NE2   1 
ATOM   2016  N N     . LEU C 3  87  ? 90.250  116.595 91.280  1.00 101.56 ? 84  LEU C N     1 
ATOM   2017  C CA    . LEU C 3  87  ? 90.542  115.792 92.453  1.00 97.19  ? 84  LEU C CA    1 
ATOM   2018  C C     . LEU C 3  87  ? 91.354  116.624 93.437  1.00 98.54  ? 84  LEU C C     1 
ATOM   2019  O O     . LEU C 3  87  ? 91.071  116.629 94.635  1.00 97.87  ? 84  LEU C O     1 
ATOM   2020  C CB    . LEU C 3  87  ? 91.324  114.531 92.064  1.00 94.07  ? 84  LEU C CB    1 
ATOM   2021  C CG    . LEU C 3  87  ? 90.567  113.493 91.205  0.00 103.50 ? 84  LEU C CG    1 
ATOM   2022  C CD1   . LEU C 3  87  ? 91.528  112.434 90.735  0.00 109.85 ? 84  LEU C CD1   1 
ATOM   2023  C CD2   . LEU C 3  87  ? 89.467  112.848 92.013  0.00 106.68 ? 84  LEU C CD2   1 
ATOM   2024  N N     . GLN C 3  88  ? 92.297  117.410 92.920  1.00 96.32  ? 85  GLN C N     1 
ATOM   2025  C CA    . GLN C 3  88  ? 93.129  118.234 93.789  1.00 96.08  ? 85  GLN C CA    1 
ATOM   2026  C C     . GLN C 3  88  ? 92.312  119.269 94.543  1.00 96.59  ? 85  GLN C C     1 
ATOM   2027  O O     . GLN C 3  88  ? 92.516  119.481 95.742  1.00 95.81  ? 85  GLN C O     1 
ATOM   2028  C CB    . GLN C 3  88  ? 94.205  118.965 92.982  1.00 97.29  ? 85  GLN C CB    1 
ATOM   2029  C CG    . GLN C 3  88  ? 95.121  119.851 93.824  1.00 97.57  ? 85  GLN C CG    1 
ATOM   2030  C CD    . GLN C 3  88  ? 96.001  119.065 94.749  1.00 103.55 ? 85  GLN C CD    1 
ATOM   2031  O OE1   . GLN C 3  88  ? 97.131  118.713 94.402  1.00 101.82 ? 85  GLN C OE1   1 
ATOM   2032  N NE2   . GLN C 3  88  ? 95.483  118.737 95.921  1.00 105.43 ? 85  GLN C NE2   1 
ATOM   2033  N N     . LEU C 3  89  ? 91.370  119.892 93.850  1.00 96.52  ? 86  LEU C N     1 
ATOM   2034  C CA    . LEU C 3  89  ? 90.549  120.915 94.471  1.00 97.87  ? 86  LEU C CA    1 
ATOM   2035  C C     . LEU C 3  89  ? 89.674  120.301 95.546  1.00 101.21 ? 86  LEU C C     1 
ATOM   2036  O O     . LEU C 3  89  ? 89.537  120.850 96.640  1.00 100.26 ? 86  LEU C O     1 
ATOM   2037  C CB    . LEU C 3  89  ? 89.674  121.589 93.410  1.00 100.26 ? 86  LEU C CB    1 
ATOM   2038  C CG    . LEU C 3  89  ? 90.418  122.439 92.360  1.00 104.44 ? 86  LEU C CG    1 
ATOM   2039  C CD1   . LEU C 3  89  ? 89.450  122.819 91.244  1.00 112.36 ? 86  LEU C CD1   1 
ATOM   2040  C CD2   . LEU C 3  89  ? 90.997  123.685 93.015  1.00 105.59 ? 86  LEU C CD2   1 
ATOM   2041  N N     . ALA C 3  90  ? 89.150  119.118 95.257  1.00 100.04 ? 87  ALA C N     1 
ATOM   2042  C CA    . ALA C 3  90  ? 88.299  118.404 96.191  1.00 101.62 ? 87  ALA C CA    1 
ATOM   2043  C C     . ALA C 3  90  ? 89.023  118.090 97.484  1.00 101.03 ? 87  ALA C C     1 
ATOM   2044  O O     . ALA C 3  90  ? 88.496  118.317 98.577  1.00 103.92 ? 87  ALA C O     1 
ATOM   2045  C CB    . ALA C 3  90  ? 87.854  117.109 95.552  1.00 105.10 ? 87  ALA C CB    1 
ATOM   2046  N N     . ILE C 3  91  ? 90.276  117.684 97.360  1.00 96.02  ? 88  ILE C N     1 
ATOM   2047  C CA    . ILE C 3  91  ? 91.057  117.316 98.523  1.00 97.10  ? 88  ILE C CA    1 
ATOM   2048  C C     . ILE C 3  91  ? 91.213  118.496 99.453  1.00 98.99  ? 88  ILE C C     1 
ATOM   2049  O O     . ILE C 3  91  ? 91.053  118.368 100.662 1.00 99.79  ? 88  ILE C O     1 
ATOM   2050  C CB    . ILE C 3  91  ? 92.426  116.759 98.110  1.00 97.42  ? 88  ILE C CB    1 
ATOM   2051  C CG1   . ILE C 3  91  ? 92.228  115.400 97.425  1.00 100.59 ? 88  ILE C CG1   1 
ATOM   2052  C CG2   . ILE C 3  91  ? 93.340  116.640 99.330  1.00 99.41  ? 88  ILE C CG2   1 
ATOM   2053  C CD1   . ILE C 3  91  ? 93.447  114.886 96.688  1.00 104.38 ? 88  ILE C CD1   1 
ATOM   2054  N N     . ARG C 3  92  ? 91.508  119.651 98.887  1.00 98.55  ? 89  ARG C N     1 
ATOM   2055  C CA    . ARG C 3  92  ? 91.696  120.850 99.684  1.00 100.41 ? 89  ARG C CA    1 
ATOM   2056  C C     . ARG C 3  92  ? 90.422  121.397 100.301 1.00 103.02 ? 89  ARG C C     1 
ATOM   2057  O O     . ARG C 3  92  ? 90.439  121.911 101.419 1.00 103.29 ? 89  ARG C O     1 
ATOM   2058  C CB    . ARG C 3  92  ? 92.290  121.921 98.828  1.00 101.42 ? 89  ARG C CB    1 
ATOM   2059  C CG    . ARG C 3  92  ? 93.643  121.596 98.315  1.00 104.49 ? 89  ARG C CG    1 
ATOM   2060  C CD    . ARG C 3  92  ? 94.661  121.727 99.351  1.00 103.12 ? 89  ARG C CD    1 
ATOM   2061  N NE    . ARG C 3  92  ? 95.962  121.393 98.836  1.00 106.44 ? 89  ARG C NE    1 
ATOM   2062  C CZ    . ARG C 3  92  ? 96.516  120.172 98.878  1.00 105.03 ? 89  ARG C CZ    1 
ATOM   2063  N NH1   . ARG C 3  92  ? 95.905  119.184 99.485  1.00 100.93 ? 89  ARG C NH1   1 
ATOM   2064  N NH2   . ARG C 3  92  ? 97.685  119.966 98.307  1.00 101.61 ? 89  ARG C NH2   1 
ATOM   2065  N N     . ASN C 3  93  ? 89.321  121.319 99.570  1.00 104.69 ? 90  ASN C N     1 
ATOM   2066  C CA    . ASN C 3  93  ? 88.080  121.911 100.044 1.00 109.71 ? 90  ASN C CA    1 
ATOM   2067  C C     . ASN C 3  93  ? 87.628  121.284 101.359 1.00 112.40 ? 90  ASN C C     1 
ATOM   2068  O O     . ASN C 3  93  ? 87.071  121.963 102.220 1.00 111.60 ? 90  ASN C O     1 
ATOM   2069  C CB    . ASN C 3  93  ? 87.005  121.771 98.990  1.00 116.63 ? 90  ASN C CB    1 
ATOM   2070  C CG    . ASN C 3  93  ? 87.242  122.669 97.813  1.00 118.87 ? 90  ASN C CG    1 
ATOM   2071  O OD1   . ASN C 3  93  ? 87.956  123.674 97.908  1.00 112.73 ? 90  ASN C OD1   1 
ATOM   2072  N ND2   . ASN C 3  93  ? 86.657  122.323 96.695  1.00 117.77 ? 90  ASN C ND2   1 
ATOM   2073  N N     . ASP C 3  94  ? 87.861  119.986 101.504 1.00 110.85 ? 91  ASP C N     1 
ATOM   2074  C CA    . ASP C 3  94  ? 87.545  119.269 102.736 1.00 109.58 ? 91  ASP C CA    1 
ATOM   2075  C C     . ASP C 3  94  ? 88.771  119.175 103.643 1.00 104.60 ? 91  ASP C C     1 
ATOM   2076  O O     . ASP C 3  94  ? 89.757  118.531 103.294 1.00 102.93 ? 91  ASP C O     1 
ATOM   2077  C CB    . ASP C 3  94  ? 86.967  117.887 102.416 1.00 112.97 ? 91  ASP C CB    1 
ATOM   2078  C CG    . ASP C 3  94  ? 86.677  117.046 103.653 1.00 109.33 ? 91  ASP C CG    1 
ATOM   2079  O OD1   . ASP C 3  94  ? 87.393  117.190 104.618 1.00 104.29 ? 91  ASP C OD1   1 
ATOM   2080  O OD2   . ASP C 3  94  ? 85.756  116.267 103.624 1.00 107.89 ? 91  ASP C OD2   1 
ATOM   2081  N N     . GLU C 3  95  ? 88.741  119.884 104.767 1.00 105.52 ? 92  GLU C N     1 
ATOM   2082  C CA    . GLU C 3  95  ? 89.916  120.008 105.623 1.00 104.56 ? 92  GLU C CA    1 
ATOM   2083  C C     . GLU C 3  95  ? 90.426  118.670 106.136 1.00 101.39 ? 92  GLU C C     1 
ATOM   2084  O O     . GLU C 3  95  ? 91.633  118.483 106.306 1.00 98.89  ? 92  GLU C O     1 
ATOM   2085  C CB    . GLU C 3  95  ? 89.595  120.893 106.822 1.00 106.84 ? 92  GLU C CB    1 
ATOM   2086  C CG    . GLU C 3  95  ? 89.276  122.321 106.468 1.00 114.87 ? 92  GLU C CG    1 
ATOM   2087  C CD    . GLU C 3  95  ? 87.854  122.503 106.043 0.00 120.11 ? 92  GLU C CD    1 
ATOM   2088  O OE1   . GLU C 3  95  ? 87.132  121.532 106.013 0.00 113.68 ? 92  GLU C OE1   1 
ATOM   2089  O OE2   . GLU C 3  95  ? 87.481  123.613 105.754 0.00 122.38 ? 92  GLU C OE2   1 
ATOM   2090  N N     . GLU C 3  96  ? 89.511  117.768 106.458 1.00 101.62 ? 93  GLU C N     1 
ATOM   2091  C CA    . GLU C 3  96  ? 89.904  116.476 106.990 1.00 101.34 ? 93  GLU C CA    1 
ATOM   2092  C C     . GLU C 3  96  ? 90.508  115.629 105.889 1.00 99.18  ? 93  GLU C C     1 
ATOM   2093  O O     . GLU C 3  96  ? 91.506  114.931 106.092 1.00 95.24  ? 93  GLU C O     1 
ATOM   2094  C CB    . GLU C 3  96  ? 88.702  115.768 107.596 1.00 104.38 ? 93  GLU C CB    1 
ATOM   2095  C CG    . GLU C 3  96  ? 88.169  116.399 108.860 0.00 108.51 ? 93  GLU C CG    1 
ATOM   2096  C CD    . GLU C 3  96  ? 87.075  115.581 109.447 0.00 108.33 ? 93  GLU C CD    1 
ATOM   2097  O OE1   . GLU C 3  96  ? 86.770  114.570 108.868 0.00 104.22 ? 93  GLU C OE1   1 
ATOM   2098  O OE2   . GLU C 3  96  ? 86.545  115.942 110.472 0.00 107.84 ? 93  GLU C OE2   1 
ATOM   2099  N N     . LEU C 3  97  ? 89.931  115.744 104.703 1.00 98.87  ? 94  LEU C N     1 
ATOM   2100  C CA    . LEU C 3  97  ? 90.434  115.027 103.549 1.00 98.00  ? 94  LEU C CA    1 
ATOM   2101  C C     . LEU C 3  97  ? 91.800  115.571 103.187 1.00 94.08  ? 94  LEU C C     1 
ATOM   2102  O O     . LEU C 3  97  ? 92.708  114.815 102.837 1.00 92.84  ? 94  LEU C O     1 
ATOM   2103  C CB    . LEU C 3  97  ? 89.468  115.179 102.375 1.00 97.02  ? 94  LEU C CB    1 
ATOM   2104  C CG    . LEU C 3  97  ? 89.815  114.443 101.075 1.00 101.73 ? 94  LEU C CG    1 
ATOM   2105  C CD1   . LEU C 3  97  ? 89.954  112.940 101.324 1.00 102.73 ? 94  LEU C CD1   1 
ATOM   2106  C CD2   . LEU C 3  97  ? 88.705  114.725 100.059 1.00 104.49 ? 94  LEU C CD2   1 
ATOM   2107  N N     . ASN C 3  98  ? 91.948  116.887 103.305 1.00 94.28  ? 95  ASN C N     1 
ATOM   2108  C CA    . ASN C 3  98  ? 93.206  117.541 103.020 1.00 96.16  ? 95  ASN C CA    1 
ATOM   2109  C C     . ASN C 3  98  ? 94.306  116.972 103.880 1.00 92.73  ? 95  ASN C C     1 
ATOM   2110  O O     . ASN C 3  98  ? 95.371  116.629 103.385 1.00 92.44  ? 95  ASN C O     1 
ATOM   2111  C CB    . ASN C 3  98  ? 93.097  119.035 103.227 1.00 98.25  ? 95  ASN C CB    1 
ATOM   2112  C CG    . ASN C 3  98  ? 94.381  119.735 102.962 1.00 101.17 ? 95  ASN C CG    1 
ATOM   2113  O OD1   . ASN C 3  98  ? 94.972  119.607 101.889 1.00 101.44 ? 95  ASN C OD1   1 
ATOM   2114  N ND2   . ASN C 3  98  ? 94.836  120.489 103.928 1.00 96.71  ? 95  ASN C ND2   1 
ATOM   2115  N N     . LYS C 3  99  ? 94.046  116.830 105.168 1.00 92.13  ? 96  LYS C N     1 
ATOM   2116  C CA    . LYS C 3  99  ? 95.066  116.287 106.045 1.00 90.28  ? 96  LYS C CA    1 
ATOM   2117  C C     . LYS C 3  99  ? 95.460  114.882 105.643 1.00 88.95  ? 96  LYS C C     1 
ATOM   2118  O O     . LYS C 3  99  ? 96.645  114.575 105.503 1.00 88.99  ? 96  LYS C O     1 
ATOM   2119  C CB    . LYS C 3  99  ? 94.568  116.247 107.469 1.00 92.57  ? 96  LYS C CB    1 
ATOM   2120  C CG    . LYS C 3  99  ? 94.444  117.579 108.112 1.00 99.69  ? 96  LYS C CG    1 
ATOM   2121  C CD    . LYS C 3  99  ? 93.932  117.441 109.531 1.00 110.24 ? 96  LYS C CD    1 
ATOM   2122  C CE    . LYS C 3  99  ? 93.781  118.794 110.205 1.00 123.72 ? 96  LYS C CE    1 
ATOM   2123  N NZ    . LYS C 3  99  ? 93.273  118.671 111.603 1.00 114.23 ? 96  LYS C NZ    1 
ATOM   2124  N N     . LEU C 3  100 ? 94.467  114.060 105.342 1.00 88.89  ? 97  LEU C N     1 
ATOM   2125  C CA    . LEU C 3  100 ? 94.727  112.673 105.007 1.00 87.03  ? 97  LEU C CA    1 
ATOM   2126  C C     . LEU C 3  100 ? 95.669  112.589 103.818 1.00 88.92  ? 97  LEU C C     1 
ATOM   2127  O O     . LEU C 3  100 ? 96.570  111.746 103.776 1.00 91.14  ? 97  LEU C O     1 
ATOM   2128  C CB    . LEU C 3  100 ? 93.405  111.966 104.677 1.00 88.10  ? 97  LEU C CB    1 
ATOM   2129  C CG    . LEU C 3  100 ? 93.479  110.468 104.342 1.00 91.03  ? 97  LEU C CG    1 
ATOM   2130  C CD1   . LEU C 3  100 ? 94.005  109.686 105.546 1.00 91.92  ? 97  LEU C CD1   1 
ATOM   2131  C CD2   . LEU C 3  100 ? 92.086  109.982 103.938 1.00 95.83  ? 97  LEU C CD2   1 
ATOM   2132  N N     . LEU C 3  101 ? 95.445  113.467 102.848 1.00 87.78  ? 98  LEU C N     1 
ATOM   2133  C CA    . LEU C 3  101 ? 96.237  113.504 101.630 1.00 88.09  ? 98  LEU C CA    1 
ATOM   2134  C C     . LEU C 3  101 ? 97.026  114.805 101.497 1.00 92.92  ? 98  LEU C C     1 
ATOM   2135  O O     . LEU C 3  101 ? 97.307  115.259 100.385 1.00 95.46  ? 98  LEU C O     1 
ATOM   2136  C CB    . LEU C 3  101 ? 95.305  113.341 100.433 1.00 91.67  ? 98  LEU C CB    1 
ATOM   2137  C CG    . LEU C 3  101 ? 94.446  112.068 100.440 1.00 97.22  ? 98  LEU C CG    1 
ATOM   2138  C CD1   . LEU C 3  101 ? 93.475  112.124 99.281  1.00 102.87 ? 98  LEU C CD1   1 
ATOM   2139  C CD2   . LEU C 3  101 ? 95.330  110.825 100.367 1.00 99.83  ? 98  LEU C CD2   1 
ATOM   2140  N N     . GLY C 3  102 ? 97.403  115.398 102.624 1.00 90.33  ? 99  GLY C N     1 
ATOM   2141  C CA    . GLY C 3  102 ? 98.026  116.722 102.625 1.00 93.20  ? 99  GLY C CA    1 
ATOM   2142  C C     . GLY C 3  102 ? 99.467  116.705 102.153 1.00 94.04  ? 99  GLY C C     1 
ATOM   2143  O O     . GLY C 3  102 ? 100.084 117.754 101.971 1.00 96.98  ? 99  GLY C O     1 
ATOM   2144  N N     . ARG C 3  103 ? 100.013 115.516 101.985 1.00 91.03  ? 100 ARG C N     1 
ATOM   2145  C CA    . ARG C 3  103 ? 101.391 115.362 101.562 1.00 92.57  ? 100 ARG C CA    1 
ATOM   2146  C C     . ARG C 3  103 ? 101.481 114.695 100.216 1.00 91.45  ? 100 ARG C C     1 
ATOM   2147  O O     . ARG C 3  103 ? 102.533 114.167 99.847  1.00 91.76  ? 100 ARG C O     1 
ATOM   2148  C CB    . ARG C 3  103 ? 102.146 114.530 102.556 1.00 96.71  ? 100 ARG C CB    1 
ATOM   2149  C CG    . ARG C 3  103 ? 102.139 115.060 103.934 1.00 100.54 ? 100 ARG C CG    1 
ATOM   2150  C CD    . ARG C 3  103 ? 102.749 116.384 103.990 1.00 105.81 ? 100 ARG C CD    1 
ATOM   2151  N NE    . ARG C 3  103 ? 103.002 116.789 105.344 1.00 116.95 ? 100 ARG C NE    1 
ATOM   2152  C CZ    . ARG C 3  103 ? 104.078 116.409 106.057 1.00 125.34 ? 100 ARG C CZ    1 
ATOM   2153  N NH1   . ARG C 3  103 ? 104.966 115.597 105.526 1.00 118.09 ? 100 ARG C NH1   1 
ATOM   2154  N NH2   . ARG C 3  103 ? 104.243 116.851 107.291 1.00 126.65 ? 100 ARG C NH2   1 
ATOM   2155  N N     . VAL C 3  104 ? 100.367 114.669 99.514  1.00 90.00  ? 101 VAL C N     1 
ATOM   2156  C CA    . VAL C 3  104 ? 100.326 114.023 98.227  1.00 94.26  ? 101 VAL C CA    1 
ATOM   2157  C C     . VAL C 3  104 ? 100.532 115.014 97.106  1.00 92.67  ? 101 VAL C C     1 
ATOM   2158  O O     . VAL C 3  104 ? 99.859  116.041 97.037  1.00 93.29  ? 101 VAL C O     1 
ATOM   2159  C CB    . VAL C 3  104 ? 98.972  113.337 98.040  1.00 97.97  ? 101 VAL C CB    1 
ATOM   2160  C CG1   . VAL C 3  104 ? 98.897  112.710 96.681  1.00 98.52  ? 101 VAL C CG1   1 
ATOM   2161  C CG2   . VAL C 3  104 ? 98.769  112.306 99.123  1.00 97.04  ? 101 VAL C CG2   1 
ATOM   2162  N N     . THR C 3  105 ? 101.462 114.703 96.221  1.00 91.46  ? 102 THR C N     1 
ATOM   2163  C CA    . THR C 3  105 ? 101.646 115.500 95.031  1.00 88.51  ? 102 THR C CA    1 
ATOM   2164  C C     . THR C 3  105 ? 100.770 114.908 93.945  1.00 91.80  ? 102 THR C C     1 
ATOM   2165  O O     . THR C 3  105 ? 100.807 113.703 93.689  1.00 89.11  ? 102 THR C O     1 
ATOM   2166  C CB    . THR C 3  105 ? 103.120 115.519 94.590  1.00 93.34  ? 102 THR C CB    1 
ATOM   2167  O OG1   . THR C 3  105 ? 103.917 116.078 95.638  1.00 93.88  ? 102 THR C OG1   1 
ATOM   2168  C CG2   . THR C 3  105 ? 103.293 116.358 93.325  1.00 97.76  ? 102 THR C CG2   1 
ATOM   2169  N N     . ILE C 3  106 ? 99.934  115.737 93.357  1.00 88.31  ? 103 ILE C N     1 
ATOM   2170  C CA    . ILE C 3  106 ? 99.026  115.282 92.324  1.00 90.72  ? 103 ILE C CA    1 
ATOM   2171  C C     . ILE C 3  106 ? 99.575  115.634 90.964  1.00 92.11  ? 103 ILE C C     1 
ATOM   2172  O O     . ILE C 3  106 ? 99.888  116.796 90.698  1.00 94.50  ? 103 ILE C O     1 
ATOM   2173  C CB    . ILE C 3  106 ? 97.641  115.926 92.515  1.00 95.14  ? 103 ILE C CB    1 
ATOM   2174  C CG1   . ILE C 3  106 ? 97.052  115.568 93.897  1.00 92.55  ? 103 ILE C CG1   1 
ATOM   2175  C CG2   . ILE C 3  106 ? 96.693  115.554 91.383  1.00 102.66 ? 103 ILE C CG2   1 
ATOM   2176  C CD1   . ILE C 3  106 ? 96.826  114.091 94.135  1.00 95.40  ? 103 ILE C CD1   1 
ATOM   2177  N N     . ALA C 3  107 ? 99.699  114.639 90.095  1.00 91.77  ? 104 ALA C N     1 
ATOM   2178  C CA    . ALA C 3  107 ? 100.174 114.925 88.759  1.00 93.55  ? 104 ALA C CA    1 
ATOM   2179  C C     . ALA C 3  107 ? 99.263  115.966 88.139  1.00 96.23  ? 104 ALA C C     1 
ATOM   2180  O O     . ALA C 3  107 ? 98.056  115.756 88.029  1.00 99.59  ? 104 ALA C O     1 
ATOM   2181  C CB    . ALA C 3  107 ? 100.179 113.659 87.921  1.00 97.31  ? 104 ALA C CB    1 
ATOM   2182  N N     . GLN C 3  108 ? 99.845  117.079 87.717  1.00 97.98  ? 105 GLN C N     1 
ATOM   2183  C CA    . GLN C 3  108 ? 99.086  118.175 87.127  1.00 101.72 ? 105 GLN C CA    1 
ATOM   2184  C C     . GLN C 3  108 ? 97.946  118.648 88.026  1.00 100.96 ? 105 GLN C C     1 
ATOM   2185  O O     . GLN C 3  108 ? 96.878  119.012 87.534  1.00 104.44 ? 105 GLN C O     1 
ATOM   2186  C CB    . GLN C 3  108 ? 98.517  117.774 85.765  1.00 102.97 ? 105 GLN C CB    1 
ATOM   2187  C CG    . GLN C 3  108 ? 99.563  117.433 84.736  1.00 105.37 ? 105 GLN C CG    1 
ATOM   2188  C CD    . GLN C 3  108 ? 100.034 116.007 84.837  1.00 107.42 ? 105 GLN C CD    1 
ATOM   2189  O OE1   . GLN C 3  108 ? 99.243  115.067 84.748  1.00 109.45 ? 105 GLN C OE1   1 
ATOM   2190  N NE2   . GLN C 3  108 ? 101.329 115.823 85.040  1.00 110.04 ? 105 GLN C NE2   1 
ATOM   2191  N N     . GLY C 3  109 ? 98.169  118.658 89.339  1.00 99.59  ? 106 GLY C N     1 
ATOM   2192  C CA    . GLY C 3  109 ? 97.143  119.112 90.270  1.00 103.30 ? 106 GLY C CA    1 
ATOM   2193  C C     . GLY C 3  109 ? 97.063  120.632 90.364  1.00 105.60 ? 106 GLY C C     1 
ATOM   2194  O O     . GLY C 3  109 ? 96.003  121.188 90.646  1.00 106.24 ? 106 GLY C O     1 
ATOM   2195  N N     . GLY C 3  110 ? 98.189  121.306 90.174  1.00 101.59 ? 107 GLY C N     1 
ATOM   2196  C CA    . GLY C 3  110 ? 98.231  122.754 90.340  1.00 102.92 ? 107 GLY C CA    1 
ATOM   2197  C C     . GLY C 3  110 ? 98.130  123.123 91.816  1.00 103.15 ? 107 GLY C C     1 
ATOM   2198  O O     . GLY C 3  110 ? 98.371  122.291 92.690  1.00 103.96 ? 107 GLY C O     1 
ATOM   2199  N N     . VAL C 3  111 ? 97.828  124.388 92.088  1.00 103.93 ? 108 VAL C N     1 
ATOM   2200  C CA    . VAL C 3  111 ? 97.714  124.885 93.456  1.00 105.66 ? 108 VAL C CA    1 
ATOM   2201  C C     . VAL C 3  111 ? 96.436  125.695 93.627  1.00 109.94 ? 108 VAL C C     1 
ATOM   2202  O O     . VAL C 3  111 ? 95.763  126.002 92.647  1.00 111.76 ? 108 VAL C O     1 
ATOM   2203  C CB    . VAL C 3  111 ? 98.927  125.749 93.830  1.00 105.48 ? 108 VAL C CB    1 
ATOM   2204  C CG1   . VAL C 3  111 ? 100.205 124.941 93.716  1.00 105.15 ? 108 VAL C CG1   1 
ATOM   2205  C CG2   . VAL C 3  111 ? 98.982  126.972 92.945  1.00 109.87 ? 108 VAL C CG2   1 
ATOM   2206  N N     . LEU C 3  112 ? 96.094  126.026 94.867  1.00 109.92 ? 109 LEU C N     1 
ATOM   2207  C CA    . LEU C 3  112 ? 94.949  126.894 95.117  1.00 113.74 ? 109 LEU C CA    1 
ATOM   2208  C C     . LEU C 3  112 ? 95.290  128.342 94.784  1.00 118.72 ? 109 LEU C C     1 
ATOM   2209  O O     . LEU C 3  112 ? 96.407  128.785 95.055  1.00 120.45 ? 109 LEU C O     1 
ATOM   2210  C CB    . LEU C 3  112 ? 94.542  126.826 96.594  1.00 116.15 ? 109 LEU C CB    1 
ATOM   2211  C CG    . LEU C 3  112 ? 94.048  125.482 97.118  1.00 119.38 ? 109 LEU C CG    1 
ATOM   2212  C CD1   . LEU C 3  112 ? 93.794  125.623 98.607  1.00 121.11 ? 109 LEU C CD1   1 
ATOM   2213  C CD2   . LEU C 3  112 ? 92.774  125.063 96.385  1.00 120.21 ? 109 LEU C CD2   1 
ATOM   2214  N N     . PRO C 3  113 ? 94.298  129.139 94.368  1.00 121.10 ? 110 PRO C N     1 
ATOM   2215  C CA    . PRO C 3  113 ? 94.394  130.552 94.041  1.00 124.02 ? 110 PRO C CA    1 
ATOM   2216  C C     . PRO C 3  113 ? 94.468  131.413 95.292  1.00 129.45 ? 110 PRO C C     1 
ATOM   2217  O O     . PRO C 3  113 ? 93.585  132.229 95.558  1.00 129.32 ? 110 PRO C O     1 
ATOM   2218  C CB    . PRO C 3  113 ? 93.101  130.781 93.254  1.00 126.80 ? 110 PRO C CB    1 
ATOM   2219  C CG    . PRO C 3  113 ? 92.126  129.795 93.851  1.00 126.90 ? 110 PRO C CG    1 
ATOM   2220  C CD    . PRO C 3  113 ? 92.963  128.563 94.139  1.00 118.87 ? 110 PRO C CD    1 
ATOM   2221  N N     . ASN C 3  114 ? 95.526  131.211 96.063  1.00 131.67 ? 111 ASN C N     1 
ATOM   2222  C CA    . ASN C 3  114 ? 95.723  131.924 97.314  1.00 139.30 ? 111 ASN C CA    1 
ATOM   2223  C C     . ASN C 3  114 ? 96.466  133.242 97.119  1.00 142.90 ? 111 ASN C C     1 
ATOM   2224  O O     . ASN C 3  114 ? 97.669  133.264 96.846  1.00 142.01 ? 111 ASN C O     1 
ATOM   2225  C CB    . ASN C 3  114 ? 96.448  131.033 98.308  1.00 141.35 ? 111 ASN C CB    1 
ATOM   2226  C CG    . ASN C 3  114 ? 96.617  131.665 99.670  1.00 153.43 ? 111 ASN C CG    1 
ATOM   2227  O OD1   . ASN C 3  114 ? 96.890  132.867 99.792  1.00 154.75 ? 111 ASN C OD1   1 
ATOM   2228  N ND2   . ASN C 3  114 ? 96.450  130.867 100.697 1.00 148.76 ? 111 ASN C ND2   1 
ATOM   2229  N N     . ILE C 3  115 ? 95.732  134.343 97.226  1.00 146.14 ? 112 ILE C N     1 
ATOM   2230  C CA    . ILE C 3  115 ? 96.318  135.669 97.087  1.00 149.99 ? 112 ILE C CA    1 
ATOM   2231  C C     . ILE C 3  115 ? 96.294  136.378 98.432  1.00 156.90 ? 112 ILE C C     1 
ATOM   2232  O O     . ILE C 3  115 ? 95.240  136.500 99.057  1.00 157.88 ? 112 ILE C O     1 
ATOM   2233  C CB    . ILE C 3  115 ? 95.556  136.516 96.052  1.00 149.90 ? 112 ILE C CB    1 
ATOM   2234  C CG1   . ILE C 3  115 ? 95.461  135.779 94.694  1.00 144.95 ? 112 ILE C CG1   1 
ATOM   2235  C CG2   . ILE C 3  115 ? 96.228  137.882 95.890  1.00 152.26 ? 112 ILE C CG2   1 
ATOM   2236  C CD1   . ILE C 3  115 ? 96.792  135.473 94.030  1.00 136.65 ? 112 ILE C CD1   1 
ATOM   2237  N N     . GLN C 3  116 ? 97.452  136.849 98.872  1.00 156.58 ? 113 GLN C N     1 
ATOM   2238  C CA    . GLN C 3  116 ? 97.555  137.521 100.159 1.00 160.72 ? 113 GLN C CA    1 
ATOM   2239  C C     . GLN C 3  116 ? 97.272  139.013 100.050 1.00 160.48 ? 113 GLN C C     1 
ATOM   2240  O O     . GLN C 3  116 ? 97.734  139.680 99.126  1.00 162.16 ? 113 GLN C O     1 
ATOM   2241  C CB    . GLN C 3  116 ? 98.930  137.273 100.778 1.00 157.69 ? 113 GLN C CB    1 
ATOM   2242  C CG    . GLN C 3  116 ? 99.166  135.834 101.176 1.00 154.71 ? 113 GLN C CG    1 
ATOM   2243  C CD    . GLN C 3  116 ? 98.293  135.438 102.347 1.00 161.10 ? 113 GLN C CD    1 
ATOM   2244  O OE1   . GLN C 3  116 ? 98.355  136.072 103.405 1.00 157.23 ? 113 GLN C OE1   1 
ATOM   2245  N NE2   . GLN C 3  116 ? 97.462  134.417 102.170 1.00 159.20 ? 113 GLN C NE2   1 
ATOM   2246  N N     . ALA C 3  117 ? 96.582  139.545 101.056 1.00 166.22 ? 114 ALA C N     1 
ATOM   2247  C CA    . ALA C 3  117 ? 96.176  140.949 101.079 1.00 170.35 ? 114 ALA C CA    1 
ATOM   2248  C C     . ALA C 3  117 ? 97.357  141.903 100.998 1.00 164.02 ? 114 ALA C C     1 
ATOM   2249  O O     . ALA C 3  117 ? 97.263  142.972 100.398 1.00 165.79 ? 114 ALA C O     1 
ATOM   2250  C CB    . ALA C 3  117 ? 95.384  141.239 102.342 1.00 170.29 ? 114 ALA C CB    1 
ATOM   2251  N N     . VAL C 3  118 ? 98.479  141.503 101.577 1.00 163.09 ? 115 VAL C N     1 
ATOM   2252  C CA    . VAL C 3  118 ? 99.658  142.356 101.627 1.00 160.42 ? 115 VAL C CA    1 
ATOM   2253  C C     . VAL C 3  118 ? 100.284 142.549 100.251 1.00 158.23 ? 115 VAL C C     1 
ATOM   2254  O O     . VAL C 3  118 ? 101.157 143.399 100.074 1.00 154.88 ? 115 VAL C O     1 
ATOM   2255  C CB    . VAL C 3  118 ? 100.700 141.763 102.591 1.00 156.35 ? 115 VAL C CB    1 
ATOM   2256  C CG1   . VAL C 3  118 ? 100.117 141.652 103.992 1.00 156.67 ? 115 VAL C CG1   1 
ATOM   2257  C CG2   . VAL C 3  118 ? 101.144 140.405 102.095 1.00 150.04 ? 115 VAL C CG2   1 
ATOM   2258  N N     . LEU C 3  119 ? 99.887  141.719 99.292  1.00 161.08 ? 116 LEU C N     1 
ATOM   2259  C CA    . LEU C 3  119 ? 100.439 141.792 97.950  1.00 154.84 ? 116 LEU C CA    1 
ATOM   2260  C C     . LEU C 3  119 ? 99.558  142.644 97.044  1.00 158.15 ? 116 LEU C C     1 
ATOM   2261  O O     . LEU C 3  119 ? 99.906  142.904 95.889  1.00 152.57 ? 116 LEU C O     1 
ATOM   2262  C CB    . LEU C 3  119 ? 100.558 140.381 97.363  1.00 148.40 ? 116 LEU C CB    1 
ATOM   2263  C CG    . LEU C 3  119 ? 101.396 139.378 98.181  1.00 146.77 ? 116 LEU C CG    1 
ATOM   2264  C CD1   . LEU C 3  119 ? 101.335 138.020 97.503  1.00 140.95 ? 116 LEU C CD1   1 
ATOM   2265  C CD2   . LEU C 3  119 ? 102.843 139.859 98.321  1.00 134.07 ? 116 LEU C CD2   1 
ATOM   2266  N N     . LEU C 3  120 ? 98.428  143.098 97.573  1.00 164.47 ? 117 LEU C N     1 
ATOM   2267  C CA    . LEU C 3  120 ? 97.483  143.870 96.786  1.00 171.22 ? 117 LEU C CA    1 
ATOM   2268  C C     . LEU C 3  120 ? 97.845  145.353 96.839  1.00 181.16 ? 117 LEU C C     1 
ATOM   2269  O O     . LEU C 3  120 ? 98.486  145.799 97.790  1.00 174.02 ? 117 LEU C O     1 
ATOM   2270  C CB    . LEU C 3  120 ? 96.065  143.671 97.332  1.00 171.45 ? 117 LEU C CB    1 
ATOM   2271  C CG    . LEU C 3  120 ? 95.554  142.224 97.388  1.00 167.75 ? 117 LEU C CG    1 
ATOM   2272  C CD1   . LEU C 3  120 ? 94.168  142.218 97.996  1.00 170.43 ? 117 LEU C CD1   1 
ATOM   2273  C CD2   . LEU C 3  120 ? 95.543  141.610 96.005  1.00 164.97 ? 117 LEU C CD2   1 
ATOM   2274  N N     . PRO C 3  121 ? 97.468  146.130 95.818  1.00 190.55 ? 118 PRO C N     1 
ATOM   2275  C CA    . PRO C 3  121 ? 97.564  147.577 95.759  1.00 189.41 ? 118 PRO C CA    1 
ATOM   2276  C C     . PRO C 3  121 ? 97.006  148.216 97.024  1.00 191.27 ? 118 PRO C C     1 
ATOM   2277  O O     . PRO C 3  121 ? 95.862  147.961 97.401  1.00 188.21 ? 118 PRO C O     1 
ATOM   2278  C CB    . PRO C 3  121 ? 96.706  147.894 94.529  1.00 191.70 ? 118 PRO C CB    1 
ATOM   2279  C CG    . PRO C 3  121 ? 96.885  146.688 93.639  1.00 188.80 ? 118 PRO C CG    1 
ATOM   2280  C CD    . PRO C 3  121 ? 96.939  145.512 94.591  1.00 181.62 ? 118 PRO C CD    1 
ATOM   2281  N N     . SER D 4  36  ? 99.117  89.368  83.411  1.00 218.66 ? 33  SER D N     1 
ATOM   2282  C CA    . SER D 4  36  ? 100.449 89.933  83.230  1.00 217.54 ? 33  SER D CA    1 
ATOM   2283  C C     . SER D 4  36  ? 100.499 91.363  83.743  1.00 221.91 ? 33  SER D C     1 
ATOM   2284  O O     . SER D 4  36  ? 101.464 92.092  83.513  1.00 220.17 ? 33  SER D O     1 
ATOM   2285  C CB    . SER D 4  36  ? 100.828 89.899  81.764  1.00 219.68 ? 33  SER D CB    1 
ATOM   2286  O OG    . SER D 4  36  ? 99.964  90.701  81.004  1.00 221.86 ? 33  SER D OG    1 
ATOM   2287  N N     . ARG D 4  37  ? 99.451  91.758  84.452  1.00 221.53 ? 34  ARG D N     1 
ATOM   2288  C CA    . ARG D 4  37  ? 99.352  93.105  84.992  1.00 218.34 ? 34  ARG D CA    1 
ATOM   2289  C C     . ARG D 4  37  ? 98.769  93.096  86.394  1.00 210.85 ? 34  ARG D C     1 
ATOM   2290  O O     . ARG D 4  37  ? 97.898  92.285  86.704  1.00 204.37 ? 34  ARG D O     1 
ATOM   2291  C CB    . ARG D 4  37  ? 98.491  93.974  84.093  1.00 221.03 ? 34  ARG D CB    1 
ATOM   2292  C CG    . ARG D 4  37  ? 98.408  95.433  84.496  1.00 220.47 ? 34  ARG D CG    1 
ATOM   2293  C CD    . ARG D 4  37  ? 97.655  96.221  83.509  0.00 228.36 ? 34  ARG D CD    1 
ATOM   2294  N NE    . ARG D 4  37  ? 98.323  96.244  82.223  0.00 229.51 ? 34  ARG D NE    1 
ATOM   2295  C CZ    . ARG D 4  37  ? 99.309  97.094  81.883  0.00 224.99 ? 34  ARG D CZ    1 
ATOM   2296  N NH1   . ARG D 4  37  ? 99.731  97.995  82.742  0.00 221.62 ? 34  ARG D NH1   1 
ATOM   2297  N NH2   . ARG D 4  37  ? 99.854  97.019  80.682  0.00 220.58 ? 34  ARG D NH2   1 
ATOM   2298  N N     . LYS D 4  38  ? 99.239  94.013  87.232  1.00 203.24 ? 35  LYS D N     1 
ATOM   2299  C CA    . LYS D 4  38  ? 98.685  94.182  88.569  1.00 196.05 ? 35  LYS D CA    1 
ATOM   2300  C C     . LYS D 4  38  ? 97.264  94.714  88.483  1.00 188.03 ? 35  LYS D C     1 
ATOM   2301  O O     . LYS D 4  38  ? 96.970  95.591  87.669  1.00 183.64 ? 35  LYS D O     1 
ATOM   2302  C CB    . LYS D 4  38  ? 99.557  95.128  89.392  0.00 186.47 ? 35  LYS D CB    1 
ATOM   2303  C CG    . LYS D 4  38  ? 99.091  95.304  90.825  0.00 179.58 ? 35  LYS D CG    1 
ATOM   2304  C CD    . LYS D 4  38  ? 100.018 96.212  91.604  0.00 174.64 ? 35  LYS D CD    1 
ATOM   2305  C CE    . LYS D 4  38  ? 99.526  96.398  93.028  0.00 160.79 ? 35  LYS D CE    1 
ATOM   2306  N NZ    . LYS D 4  38  ? 100.420 97.285  93.812  0.00 150.94 ? 35  LYS D NZ    1 
ATOM   2307  N N     . GLU D 4  39  ? 96.383  94.186  89.318  1.00 179.98 ? 36  GLU D N     1 
ATOM   2308  C CA    . GLU D 4  39  ? 94.992  94.602  89.295  1.00 169.63 ? 36  GLU D CA    1 
ATOM   2309  C C     . GLU D 4  39  ? 94.833  96.052  89.714  1.00 156.07 ? 36  GLU D C     1 
ATOM   2310  O O     . GLU D 4  39  ? 95.455  96.507  90.675  1.00 152.89 ? 36  GLU D O     1 
ATOM   2311  C CB    . GLU D 4  39  ? 94.161  93.714  90.217  0.00 163.16 ? 36  GLU D CB    1 
ATOM   2312  C CG    . GLU D 4  39  ? 94.182  92.241  89.854  0.00 172.39 ? 36  GLU D CG    1 
ATOM   2313  C CD    . GLU D 4  39  ? 95.354  91.504  90.451  0.00 184.09 ? 36  GLU D CD    1 
ATOM   2314  O OE1   . GLU D 4  39  ? 96.203  92.140  91.034  0.00 179.62 ? 36  GLU D OE1   1 
ATOM   2315  O OE2   . GLU D 4  39  ? 95.398  90.305  90.329  0.00 181.54 ? 36  GLU D OE2   1 
ATOM   2316  N N     . SER D 4  40  ? 93.966  96.763  89.008  1.00 144.77 ? 37  SER D N     1 
ATOM   2317  C CA    . SER D 4  40  ? 93.615  98.125  89.369  1.00 130.60 ? 37  SER D CA    1 
ATOM   2318  C C     . SER D 4  40  ? 92.225  98.123  89.970  1.00 123.23 ? 37  SER D C     1 
ATOM   2319  O O     . SER D 4  40  ? 91.540  97.098  89.966  1.00 127.71 ? 37  SER D O     1 
ATOM   2320  C CB    . SER D 4  40  ? 93.640  99.032  88.159  1.00 128.84 ? 37  SER D CB    1 
ATOM   2321  O OG    . SER D 4  40  ? 92.492  98.852  87.380  1.00 124.79 ? 37  SER D OG    1 
ATOM   2322  N N     . TYR D 4  41  ? 91.794  99.272  90.453  1.00 116.95 ? 38  TYR D N     1 
ATOM   2323  C CA    . TYR D 4  41  ? 90.460  99.402  91.000  1.00 116.75 ? 38  TYR D CA    1 
ATOM   2324  C C     . TYR D 4  41  ? 89.623  100.277 90.093  1.00 115.80 ? 38  TYR D C     1 
ATOM   2325  O O     . TYR D 4  41  ? 88.546  100.730 90.475  1.00 116.66 ? 38  TYR D O     1 
ATOM   2326  C CB    . TYR D 4  41  ? 90.525  100.027 92.387  1.00 113.69 ? 38  TYR D CB    1 
ATOM   2327  C CG    . TYR D 4  41  ? 91.506  99.361  93.272  1.00 110.11 ? 38  TYR D CG    1 
ATOM   2328  C CD1   . TYR D 4  41  ? 92.731  99.951  93.450  1.00 112.77 ? 38  TYR D CD1   1 
ATOM   2329  C CD2   . TYR D 4  41  ? 91.211  98.159  93.886  1.00 111.82 ? 38  TYR D CD2   1 
ATOM   2330  C CE1   . TYR D 4  41  ? 93.667  99.357  94.238  1.00 110.15 ? 38  TYR D CE1   1 
ATOM   2331  C CE2   . TYR D 4  41  ? 92.159  97.555  94.683  1.00 112.01 ? 38  TYR D CE2   1 
ATOM   2332  C CZ    . TYR D 4  41  ? 93.387  98.155  94.857  1.00 112.20 ? 38  TYR D CZ    1 
ATOM   2333  O OH    . TYR D 4  41  ? 94.345  97.560  95.642  1.00 112.49 ? 38  TYR D OH    1 
ATOM   2334  N N     . SER D 4  42  ? 90.109  100.508 88.878  1.00 116.22 ? 39  SER D N     1 
ATOM   2335  C CA    . SER D 4  42  ? 89.491  101.495 88.007  1.00 116.97 ? 39  SER D CA    1 
ATOM   2336  C C     . SER D 4  42  ? 88.037  101.179 87.714  1.00 118.08 ? 39  SER D C     1 
ATOM   2337  O O     . SER D 4  42  ? 87.209  102.083 87.600  1.00 121.18 ? 39  SER D O     1 
ATOM   2338  C CB    . SER D 4  42  ? 90.250  101.576 86.701  1.00 121.41 ? 39  SER D CB    1 
ATOM   2339  O OG    . SER D 4  42  ? 90.120  100.385 85.976  1.00 125.00 ? 39  SER D OG    1 
ATOM   2340  N N     . ILE D 4  43  ? 87.700  99.901  87.698  1.00 116.51 ? 40  ILE D N     1 
ATOM   2341  C CA    . ILE D 4  43  ? 86.326  99.515  87.452  1.00 119.66 ? 40  ILE D CA    1 
ATOM   2342  C C     . ILE D 4  43  ? 85.442  99.877  88.637  1.00 120.73 ? 40  ILE D C     1 
ATOM   2343  O O     . ILE D 4  43  ? 84.278  100.242 88.465  1.00 123.32 ? 40  ILE D O     1 
ATOM   2344  C CB    . ILE D 4  43  ? 86.226  98.013  87.118  1.00 125.82 ? 40  ILE D CB    1 
ATOM   2345  C CG1   . ILE D 4  43  ? 84.831  97.647  86.579  1.00 126.25 ? 40  ILE D CG1   1 
ATOM   2346  C CG2   . ILE D 4  43  ? 86.559  97.164  88.323  1.00 129.29 ? 40  ILE D CG2   1 
ATOM   2347  C CD1   . ILE D 4  43  ? 84.479  98.273  85.241  1.00 131.17 ? 40  ILE D CD1   1 
ATOM   2348  N N     . TYR D 4  44  ? 85.995  99.785  89.840  1.00 120.01 ? 41  TYR D N     1 
ATOM   2349  C CA    . TYR D 4  44  ? 85.220  100.035 91.040  1.00 121.08 ? 41  TYR D CA    1 
ATOM   2350  C C     . TYR D 4  44  ? 85.142  101.523 91.314  1.00 118.34 ? 41  TYR D C     1 
ATOM   2351  O O     . TYR D 4  44  ? 84.109  102.032 91.749  1.00 116.68 ? 41  TYR D O     1 
ATOM   2352  C CB    . TYR D 4  44  ? 85.842  99.296  92.219  1.00 119.85 ? 41  TYR D CB    1 
ATOM   2353  C CG    . TYR D 4  44  ? 85.929  97.823  91.976  1.00 123.11 ? 41  TYR D CG    1 
ATOM   2354  C CD1   . TYR D 4  44  ? 87.156  97.241  91.743  1.00 126.60 ? 41  TYR D CD1   1 
ATOM   2355  C CD2   . TYR D 4  44  ? 84.780  97.065  91.906  1.00 132.17 ? 41  TYR D CD2   1 
ATOM   2356  C CE1   . TYR D 4  44  ? 87.239  95.900  91.437  1.00 128.18 ? 41  TYR D CE1   1 
ATOM   2357  C CE2   . TYR D 4  44  ? 84.858  95.724  91.596  1.00 140.63 ? 41  TYR D CE2   1 
ATOM   2358  C CZ    . TYR D 4  44  ? 86.079  95.141  91.356  1.00 134.57 ? 41  TYR D CZ    1 
ATOM   2359  O OH    . TYR D 4  44  ? 86.152  93.811  91.000  1.00 167.07 ? 41  TYR D OH    1 
ATOM   2360  N N     . VAL D 4  45  ? 86.221  102.228 91.007  1.00 117.05 ? 42  VAL D N     1 
ATOM   2361  C CA    . VAL D 4  45  ? 86.259  103.664 91.204  1.00 116.96 ? 42  VAL D CA    1 
ATOM   2362  C C     . VAL D 4  45  ? 85.254  104.316 90.279  1.00 117.59 ? 42  VAL D C     1 
ATOM   2363  O O     . VAL D 4  45  ? 84.512  105.214 90.681  1.00 115.46 ? 42  VAL D O     1 
ATOM   2364  C CB    . VAL D 4  45  ? 87.672  104.211 90.930  1.00 115.26 ? 42  VAL D CB    1 
ATOM   2365  C CG1   . VAL D 4  45  ? 87.667  105.732 90.908  1.00 116.13 ? 42  VAL D CG1   1 
ATOM   2366  C CG2   . VAL D 4  45  ? 88.626  103.713 92.004  1.00 120.19 ? 42  VAL D CG2   1 
ATOM   2367  N N     . TYR D 4  46  ? 85.224  103.850 89.039  1.00 121.84 ? 43  TYR D N     1 
ATOM   2368  C CA    . TYR D 4  46  ? 84.286  104.362 88.067  1.00 130.40 ? 43  TYR D CA    1 
ATOM   2369  C C     . TYR D 4  46  ? 82.860  104.204 88.565  1.00 128.60 ? 43  TYR D C     1 
ATOM   2370  O O     . TYR D 4  46  ? 82.061  105.140 88.501  1.00 129.56 ? 43  TYR D O     1 
ATOM   2371  C CB    . TYR D 4  46  ? 84.460  103.650 86.732  1.00 134.53 ? 43  TYR D CB    1 
ATOM   2372  C CG    . TYR D 4  46  ? 83.464  104.093 85.737  1.00 154.00 ? 43  TYR D CG    1 
ATOM   2373  C CD1   . TYR D 4  46  ? 83.641  105.297 85.096  1.00 174.33 ? 43  TYR D CD1   1 
ATOM   2374  C CD2   . TYR D 4  46  ? 82.340  103.327 85.495  1.00 167.18 ? 43  TYR D CD2   1 
ATOM   2375  C CE1   . TYR D 4  46  ? 82.688  105.751 84.218  1.00 211.83 ? 43  TYR D CE1   1 
ATOM   2376  C CE2   . TYR D 4  46  ? 81.385  103.774 84.609  1.00 205.22 ? 43  TYR D CE2   1 
ATOM   2377  C CZ    . TYR D 4  46  ? 81.552  104.989 83.980  1.00 225.82 ? 43  TYR D CZ    1 
ATOM   2378  O OH    . TYR D 4  46  ? 80.598  105.456 83.106  1.00 265.29 ? 43  TYR D OH    1 
ATOM   2379  N N     . LYS D 4  47  ? 82.543  103.013 89.054  1.00 123.03 ? 44  LYS D N     1 
ATOM   2380  C CA    . LYS D 4  47  ? 81.193  102.730 89.514  1.00 120.26 ? 44  LYS D CA    1 
ATOM   2381  C C     . LYS D 4  47  ? 80.824  103.610 90.704  1.00 118.23 ? 44  LYS D C     1 
ATOM   2382  O O     . LYS D 4  47  ? 79.703  104.103 90.798  1.00 120.30 ? 44  LYS D O     1 
ATOM   2383  C CB    . LYS D 4  47  ? 81.052  101.248 89.860  1.00 122.00 ? 44  LYS D CB    1 
ATOM   2384  C CG    . LYS D 4  47  ? 79.619  100.789 90.096  1.00 129.64 ? 44  LYS D CG    1 
ATOM   2385  C CD    . LYS D 4  47  ? 79.525  99.275  90.238  1.00 134.83 ? 44  LYS D CD    1 
ATOM   2386  C CE    . LYS D 4  47  ? 79.588  98.571  88.888  1.00 141.39 ? 44  LYS D CE    1 
ATOM   2387  N NZ    . LYS D 4  47  ? 78.376  98.846  88.070  1.00 152.13 ? 44  LYS D NZ    1 
ATOM   2388  N N     . VAL D 4  48  ? 81.744  103.828 91.626  1.00 111.24 ? 45  VAL D N     1 
ATOM   2389  C CA    . VAL D 4  48  ? 81.445  104.658 92.775  1.00 112.65 ? 45  VAL D CA    1 
ATOM   2390  C C     . VAL D 4  48  ? 81.120  106.075 92.342  1.00 117.17 ? 45  VAL D C     1 
ATOM   2391  O O     . VAL D 4  48  ? 80.191  106.690 92.866  1.00 119.32 ? 45  VAL D O     1 
ATOM   2392  C CB    . VAL D 4  48  ? 82.614  104.659 93.770  1.00 111.25 ? 45  VAL D CB    1 
ATOM   2393  C CG1   . VAL D 4  48  ? 82.399  105.706 94.840  1.00 110.27 ? 45  VAL D CG1   1 
ATOM   2394  C CG2   . VAL D 4  48  ? 82.722  103.300 94.422  1.00 113.12 ? 45  VAL D CG2   1 
ATOM   2395  N N     . LEU D 4  49  ? 81.881  106.603 91.388  1.00 116.72 ? 46  LEU D N     1 
ATOM   2396  C CA    . LEU D 4  49  ? 81.636  107.956 90.912  1.00 118.01 ? 46  LEU D CA    1 
ATOM   2397  C C     . LEU D 4  49  ? 80.219  108.113 90.417  1.00 120.01 ? 46  LEU D C     1 
ATOM   2398  O O     . LEU D 4  49  ? 79.525  109.061 90.789  1.00 122.06 ? 46  LEU D O     1 
ATOM   2399  C CB    . LEU D 4  49  ? 82.592  108.313 89.766  1.00 115.08 ? 46  LEU D CB    1 
ATOM   2400  C CG    . LEU D 4  49  ? 82.295  109.638 89.037  0.00 121.17 ? 46  LEU D CG    1 
ATOM   2401  C CD1   . LEU D 4  49  ? 82.360  110.807 90.014  0.00 128.22 ? 46  LEU D CD1   1 
ATOM   2402  C CD2   . LEU D 4  49  ? 83.298  109.819 87.914  0.00 134.66 ? 46  LEU D CD2   1 
ATOM   2403  N N     . LYS D 4  50  ? 79.769  107.163 89.597  1.00 120.41 ? 47  LYS D N     1 
ATOM   2404  C CA    . LYS D 4  50  ? 78.475  107.305 88.939  1.00 124.46 ? 47  LYS D CA    1 
ATOM   2405  C C     . LYS D 4  50  ? 77.325  107.183 89.931  1.00 124.47 ? 47  LYS D C     1 
ATOM   2406  O O     . LYS D 4  50  ? 76.213  107.613 89.640  1.00 126.41 ? 47  LYS D O     1 
ATOM   2407  C CB    . LYS D 4  50  ? 78.299  106.273 87.823  1.00 128.90 ? 47  LYS D CB    1 
ATOM   2408  C CG    . LYS D 4  50  ? 77.771  104.927 88.293  1.00 131.85 ? 47  LYS D CG    1 
ATOM   2409  C CD    . LYS D 4  50  ? 78.087  103.814 87.304  1.00 149.21 ? 47  LYS D CD    1 
ATOM   2410  C CE    . LYS D 4  50  ? 77.138  103.813 86.115  1.00 166.27 ? 47  LYS D CE    1 
ATOM   2411  N NZ    . LYS D 4  50  ? 77.305  102.578 85.298  1.00 178.17 ? 47  LYS D NZ    1 
ATOM   2412  N N     . GLN D 4  51  ? 77.545  106.591 91.106  1.00 123.67 ? 48  GLN D N     1 
ATOM   2413  C CA    . GLN D 4  51  ? 76.474  106.508 92.084  1.00 124.79 ? 48  GLN D CA    1 
ATOM   2414  C C     . GLN D 4  51  ? 76.235  107.847 92.757  1.00 123.31 ? 48  GLN D C     1 
ATOM   2415  O O     . GLN D 4  51  ? 75.259  108.018 93.488  1.00 124.17 ? 48  GLN D O     1 
ATOM   2416  C CB    . GLN D 4  51  ? 76.777  105.442 93.130  1.00 126.19 ? 48  GLN D CB    1 
ATOM   2417  C CG    . GLN D 4  51  ? 76.745  104.034 92.588  1.00 129.69 ? 48  GLN D CG    1 
ATOM   2418  C CD    . GLN D 4  51  ? 77.088  103.010 93.637  1.00 132.08 ? 48  GLN D CD    1 
ATOM   2419  O OE1   . GLN D 4  51  ? 77.713  103.333 94.649  1.00 131.08 ? 48  GLN D OE1   1 
ATOM   2420  N NE2   . GLN D 4  51  ? 76.680  101.768 93.411  1.00 133.79 ? 48  GLN D NE2   1 
ATOM   2421  N N     . VAL D 4  52  ? 77.159  108.775 92.562  1.00 122.61 ? 49  VAL D N     1 
ATOM   2422  C CA    . VAL D 4  52  ? 77.041  110.096 93.146  1.00 122.61 ? 49  VAL D CA    1 
ATOM   2423  C C     . VAL D 4  52  ? 76.737  111.110 92.052  1.00 123.68 ? 49  VAL D C     1 
ATOM   2424  O O     . VAL D 4  52  ? 75.863  111.964 92.201  1.00 127.52 ? 49  VAL D O     1 
ATOM   2425  C CB    . VAL D 4  52  ? 78.342  110.482 93.857  1.00 119.79 ? 49  VAL D CB    1 
ATOM   2426  C CG1   . VAL D 4  52  ? 78.210  111.864 94.446  1.00 121.17 ? 49  VAL D CG1   1 
ATOM   2427  C CG2   . VAL D 4  52  ? 78.679  109.453 94.925  1.00 119.79 ? 49  VAL D CG2   1 
ATOM   2428  N N     . HIS D 4  53  ? 77.475  111.004 90.954  1.00 123.94 ? 50  HIS D N     1 
ATOM   2429  C CA    . HIS D 4  53  ? 77.349  111.906 89.824  1.00 124.97 ? 50  HIS D CA    1 
ATOM   2430  C C     . HIS D 4  53  ? 77.225  111.119 88.522  1.00 128.33 ? 50  HIS D C     1 
ATOM   2431  O O     . HIS D 4  53  ? 78.177  111.061 87.748  1.00 130.60 ? 50  HIS D O     1 
ATOM   2432  C CB    . HIS D 4  53  ? 78.573  112.814 89.715  1.00 122.77 ? 50  HIS D CB    1 
ATOM   2433  C CG    . HIS D 4  53  ? 78.763  113.738 90.852  1.00 120.34 ? 50  HIS D CG    1 
ATOM   2434  N ND1   . HIS D 4  53  ? 77.983  114.856 91.033  1.00 122.01 ? 50  HIS D ND1   1 
ATOM   2435  C CD2   . HIS D 4  53  ? 79.686  113.760 91.834  1.00 118.67 ? 50  HIS D CD2   1 
ATOM   2436  C CE1   . HIS D 4  53  ? 78.413  115.522 92.088  1.00 122.66 ? 50  HIS D CE1   1 
ATOM   2437  N NE2   . HIS D 4  53  ? 79.448  114.882 92.587  1.00 117.71 ? 50  HIS D NE2   1 
ATOM   2438  N N     . PRO D 4  54  ? 76.055  110.537 88.245  1.00 129.51 ? 51  PRO D N     1 
ATOM   2439  C CA    . PRO D 4  54  ? 75.796  109.573 87.187  1.00 133.36 ? 51  PRO D CA    1 
ATOM   2440  C C     . PRO D 4  54  ? 76.005  110.154 85.791  1.00 136.20 ? 51  PRO D C     1 
ATOM   2441  O O     . PRO D 4  54  ? 76.116  109.414 84.814  1.00 138.27 ? 51  PRO D O     1 
ATOM   2442  C CB    . PRO D 4  54  ? 74.326  109.210 87.430  1.00 135.50 ? 51  PRO D CB    1 
ATOM   2443  C CG    . PRO D 4  54  ? 73.739  110.415 88.131  1.00 133.15 ? 51  PRO D CG    1 
ATOM   2444  C CD    . PRO D 4  54  ? 74.860  110.975 88.974  1.00 127.01 ? 51  PRO D CD    1 
ATOM   2445  N N     . ASP D 4  55  ? 76.006  111.477 85.691  1.00 136.52 ? 52  ASP D N     1 
ATOM   2446  C CA    . ASP D 4  55  ? 76.192  112.154 84.421  1.00 138.01 ? 52  ASP D CA    1 
ATOM   2447  C C     . ASP D 4  55  ? 77.593  112.740 84.278  1.00 138.38 ? 52  ASP D C     1 
ATOM   2448  O O     . ASP D 4  55  ? 77.865  113.487 83.338  1.00 144.18 ? 52  ASP D O     1 
ATOM   2449  C CB    . ASP D 4  55  ? 75.146  113.255 84.294  1.00 143.50 ? 52  ASP D CB    1 
ATOM   2450  C CG    . ASP D 4  55  ? 75.194  114.196 85.482  1.00 147.92 ? 52  ASP D CG    1 
ATOM   2451  O OD1   . ASP D 4  55  ? 75.868  113.864 86.440  1.00 141.85 ? 52  ASP D OD1   1 
ATOM   2452  O OD2   . ASP D 4  55  ? 74.547  115.215 85.447  1.00 150.15 ? 52  ASP D OD2   1 
ATOM   2453  N N     . THR D 4  56  ? 78.489  112.371 85.186  1.00 136.39 ? 53  THR D N     1 
ATOM   2454  C CA    . THR D 4  56  ? 79.848  112.894 85.171  1.00 136.91 ? 53  THR D CA    1 
ATOM   2455  C C     . THR D 4  56  ? 80.849  111.824 84.777  1.00 135.01 ? 53  THR D C     1 
ATOM   2456  O O     . THR D 4  56  ? 80.835  110.713 85.306  1.00 136.78 ? 53  THR D O     1 
ATOM   2457  C CB    . THR D 4  56  ? 80.220  113.494 86.541  1.00 138.78 ? 53  THR D CB    1 
ATOM   2458  O OG1   . THR D 4  56  ? 79.344  114.592 86.830  1.00 138.77 ? 53  THR D OG1   1 
ATOM   2459  C CG2   . THR D 4  56  ? 81.661  113.988 86.566  1.00 142.30 ? 53  THR D CG2   1 
ATOM   2460  N N     . GLY D 4  57  ? 81.707  112.157 83.823  1.00 145.63 ? 54  GLY D N     1 
ATOM   2461  C CA    . GLY D 4  57  ? 82.734  111.227 83.373  1.00 158.14 ? 54  GLY D CA    1 
ATOM   2462  C C     . GLY D 4  57  ? 84.037  111.466 84.117  1.00 149.11 ? 54  GLY D C     1 
ATOM   2463  O O     . GLY D 4  57  ? 84.106  112.314 85.009  1.00 146.19 ? 54  GLY D O     1 
ATOM   2464  N N     . ILE D 4  58  ? 85.075  110.733 83.740  1.00 160.00 ? 55  ILE D N     1 
ATOM   2465  C CA    . ILE D 4  58  ? 86.366  110.881 84.400  1.00 146.60 ? 55  ILE D CA    1 
ATOM   2466  C C     . ILE D 4  58  ? 87.512  110.451 83.492  1.00 156.53 ? 55  ILE D C     1 
ATOM   2467  O O     . ILE D 4  58  ? 87.424  109.431 82.812  1.00 182.49 ? 55  ILE D O     1 
ATOM   2468  C CB    . ILE D 4  58  ? 86.344  110.096 85.724  1.00 140.65 ? 55  ILE D CB    1 
ATOM   2469  C CG1   . ILE D 4  58  ? 87.630  110.305 86.505  1.00 136.53 ? 55  ILE D CG1   1 
ATOM   2470  C CG2   . ILE D 4  58  ? 86.083  108.620 85.456  1.00 158.36 ? 55  ILE D CG2   1 
ATOM   2471  C CD1   . ILE D 4  58  ? 87.531  109.936 87.978  1.00 131.46 ? 55  ILE D CD1   1 
ATOM   2472  N N     . SER D 4  59  ? 88.593  111.227 83.493  1.00 150.29 ? 56  SER D N     1 
ATOM   2473  C CA    . SER D 4  59  ? 89.728  110.953 82.612  1.00 154.25 ? 56  SER D CA    1 
ATOM   2474  C C     . SER D 4  59  ? 90.563  109.786 83.108  1.00 143.44 ? 56  SER D C     1 
ATOM   2475  O O     . SER D 4  59  ? 90.613  109.518 84.308  1.00 138.87 ? 56  SER D O     1 
ATOM   2476  C CB    . SER D 4  59  ? 90.616  112.176 82.496  1.00 147.33 ? 56  SER D CB    1 
ATOM   2477  O OG    . SER D 4  59  ? 91.307  112.419 83.692  1.00 135.29 ? 56  SER D OG    1 
ATOM   2478  N N     . SER D 4  60  ? 91.340  109.190 82.204  1.00 159.78 ? 57  SER D N     1 
ATOM   2479  C CA    . SER D 4  60  ? 92.205  108.077 82.572  1.00 150.19 ? 57  SER D CA    1 
ATOM   2480  C C     . SER D 4  60  ? 93.279  108.501 83.554  1.00 134.85 ? 57  SER D C     1 
ATOM   2481  O O     . SER D 4  60  ? 93.693  107.719 84.413  1.00 131.86 ? 57  SER D O     1 
ATOM   2482  C CB    . SER D 4  60  ? 92.868  107.511 81.338  1.00 176.08 ? 57  SER D CB    1 
ATOM   2483  O OG    . SER D 4  60  ? 93.810  108.411 80.823  1.00 174.92 ? 57  SER D OG    1 
ATOM   2484  N N     . LYS D 4  61  ? 93.682  109.758 83.482  1.00 131.72 ? 58  LYS D N     1 
ATOM   2485  C CA    . LYS D 4  61  ? 94.670  110.262 84.413  1.00 127.10 ? 58  LYS D CA    1 
ATOM   2486  C C     . LYS D 4  61  ? 94.077  110.385 85.798  1.00 121.32 ? 58  LYS D C     1 
ATOM   2487  O O     . LYS D 4  61  ? 94.700  109.998 86.787  1.00 116.50 ? 58  LYS D O     1 
ATOM   2488  C CB    . LYS D 4  61  ? 95.186  111.606 83.953  1.00 127.16 ? 58  LYS D CB    1 
ATOM   2489  C CG    . LYS D 4  61  ? 96.106  111.558 82.756  1.00 131.58 ? 58  LYS D CG    1 
ATOM   2490  C CD    . LYS D 4  61  ? 97.485  111.036 83.140  1.00 135.14 ? 58  LYS D CD    1 
ATOM   2491  C CE    . LYS D 4  61  ? 98.507  111.259 82.024  1.00 137.55 ? 58  LYS D CE    1 
ATOM   2492  N NZ    . LYS D 4  61  ? 99.873  110.796 82.415  1.00 127.76 ? 58  LYS D NZ    1 
ATOM   2493  N N     . ALA D 4  62  ? 92.843  110.864 85.866  1.00 124.56 ? 59  ALA D N     1 
ATOM   2494  C CA    . ALA D 4  62  ? 92.162  110.974 87.140  1.00 118.95 ? 59  ALA D CA    1 
ATOM   2495  C C     . ALA D 4  62  ? 92.000  109.595 87.756  1.00 117.73 ? 59  ALA D C     1 
ATOM   2496  O O     . ALA D 4  62  ? 92.095  109.433 88.973  1.00 111.99 ? 59  ALA D O     1 
ATOM   2497  C CB    . ALA D 4  62  ? 90.818  111.643 86.957  1.00 125.18 ? 59  ALA D CB    1 
ATOM   2498  N N     . MET D 4  63  ? 91.774  108.593 86.913  1.00 121.91 ? 60  MET D N     1 
ATOM   2499  C CA    . MET D 4  63  ? 91.649  107.234 87.410  1.00 117.12 ? 60  MET D CA    1 
ATOM   2500  C C     . MET D 4  63  ? 92.984  106.796 87.991  1.00 110.61 ? 60  MET D C     1 
ATOM   2501  O O     . MET D 4  63  ? 93.039  106.212 89.074  1.00 105.72 ? 60  MET D O     1 
ATOM   2502  C CB    . MET D 4  63  ? 91.219  106.288 86.294  1.00 121.18 ? 60  MET D CB    1 
ATOM   2503  C CG    . MET D 4  63  ? 89.836  106.573 85.729  1.00 134.14 ? 60  MET D CG    1 
ATOM   2504  S SD    . MET D 4  63  ? 88.543  106.560 86.957  1.00 146.49 ? 60  MET D SD    1 
ATOM   2505  C CE    . MET D 4  63  ? 88.349  104.832 87.228  1.00 128.92 ? 60  MET D CE    1 
ATOM   2506  N N     . GLY D 4  64  ? 94.069  107.180 87.324  1.00 110.60 ? 61  GLY D N     1 
ATOM   2507  C CA    . GLY D 4  64  ? 95.408  106.872 87.806  1.00 109.47 ? 61  GLY D CA    1 
ATOM   2508  C C     . GLY D 4  64  ? 95.646  107.482 89.181  1.00 103.12 ? 61  GLY D C     1 
ATOM   2509  O O     . GLY D 4  64  ? 96.270  106.861 90.045  1.00 101.61 ? 61  GLY D O     1 
ATOM   2510  N N     . ILE D 4  65  ? 95.112  108.679 89.398  1.00 101.94 ? 62  ILE D N     1 
ATOM   2511  C CA    . ILE D 4  65  ? 95.248  109.324 90.693  1.00 101.81 ? 62  ILE D CA    1 
ATOM   2512  C C     . ILE D 4  65  ? 94.480  108.532 91.735  1.00 99.87  ? 62  ILE D C     1 
ATOM   2513  O O     . ILE D 4  65  ? 94.982  108.274 92.831  1.00 96.51  ? 62  ILE D O     1 
ATOM   2514  C CB    . ILE D 4  65  ? 94.690  110.763 90.680  1.00 100.86 ? 62  ILE D CB    1 
ATOM   2515  C CG1   . ILE D 4  65  ? 95.447  111.676 89.698  1.00 103.94 ? 62  ILE D CG1   1 
ATOM   2516  C CG2   . ILE D 4  65  ? 94.716  111.354 92.085  1.00 100.73 ? 62  ILE D CG2   1 
ATOM   2517  C CD1   . ILE D 4  65  ? 96.909  111.862 89.987  1.00 101.20 ? 62  ILE D CD1   1 
ATOM   2518  N N     . MET D 4  66  ? 93.262  108.132 91.383  1.00 99.11  ? 63  MET D N     1 
ATOM   2519  C CA    . MET D 4  66  ? 92.411  107.399 92.305  1.00 96.42  ? 63  MET D CA    1 
ATOM   2520  C C     . MET D 4  66  ? 92.964  106.021 92.626  1.00 97.61  ? 63  MET D C     1 
ATOM   2521  O O     . MET D 4  66  ? 92.807  105.534 93.746  1.00 94.94  ? 63  MET D O     1 
ATOM   2522  C CB    . MET D 4  66  ? 91.001  107.284 91.746  1.00 99.48  ? 63  MET D CB    1 
ATOM   2523  C CG    . MET D 4  66  ? 90.237  108.596 91.697  1.00 101.58 ? 63  MET D CG    1 
ATOM   2524  S SD    . MET D 4  66  ? 90.154  109.421 93.291  1.00 102.52 ? 63  MET D SD    1 
ATOM   2525  C CE    . MET D 4  66  ? 89.151  108.295 94.244  1.00 104.24 ? 63  MET D CE    1 
ATOM   2526  N N     . ASN D 4  67  ? 93.656  105.409 91.675  1.00 97.63  ? 64  ASN D N     1 
ATOM   2527  C CA    . ASN D 4  67  ? 94.237  104.103 91.933  1.00 96.39  ? 64  ASN D CA    1 
ATOM   2528  C C     . ASN D 4  67  ? 95.418  104.215 92.878  1.00 96.62  ? 64  ASN D C     1 
ATOM   2529  O O     . ASN D 4  67  ? 95.563  103.405 93.797  1.00 95.03  ? 64  ASN D O     1 
ATOM   2530  C CB    . ASN D 4  67  ? 94.623  103.418 90.644  1.00 100.73 ? 64  ASN D CB    1 
ATOM   2531  C CG    . ASN D 4  67  ? 93.440  102.827 89.955  1.00 111.32 ? 64  ASN D CG    1 
ATOM   2532  O OD1   . ASN D 4  67  ? 92.999  101.731 90.322  1.00 112.53 ? 64  ASN D OD1   1 
ATOM   2533  N ND2   . ASN D 4  67  ? 92.904  103.522 88.990  1.00 114.59 ? 64  ASN D ND2   1 
ATOM   2534  N N     . SER D 4  68  ? 96.194  105.284 92.741  1.00 92.89  ? 65  SER D N     1 
ATOM   2535  C CA    . SER D 4  68  ? 97.287  105.503 93.670  1.00 95.88  ? 65  SER D CA    1 
ATOM   2536  C C     . SER D 4  68  ? 96.711  105.747 95.056  1.00 92.55  ? 65  SER D C     1 
ATOM   2537  O O     . SER D 4  68  ? 97.200  105.210 96.053  1.00 93.19  ? 65  SER D O     1 
ATOM   2538  C CB    . SER D 4  68  ? 98.128  106.690 93.243  1.00 98.97  ? 65  SER D CB    1 
ATOM   2539  O OG    . SER D 4  68  ? 98.794  106.445 92.024  1.00 103.44 ? 65  SER D OG    1 
ATOM   2540  N N     . PHE D 4  69  ? 95.606  106.480 95.103  1.00 92.69  ? 66  PHE D N     1 
ATOM   2541  C CA    . PHE D 4  69  ? 94.937  106.774 96.357  1.00 92.71  ? 66  PHE D CA    1 
ATOM   2542  C C     . PHE D 4  69  ? 94.494  105.524 97.094  1.00 91.09  ? 66  PHE D C     1 
ATOM   2543  O O     . PHE D 4  69  ? 94.820  105.340 98.267  1.00 88.08  ? 66  PHE D O     1 
ATOM   2544  C CB    . PHE D 4  69  ? 93.728  107.667 96.117  1.00 92.70  ? 66  PHE D CB    1 
ATOM   2545  C CG    . PHE D 4  69  ? 92.843  107.743 97.280  1.00 91.67  ? 66  PHE D CG    1 
ATOM   2546  C CD1   . PHE D 4  69  ? 93.193  108.472 98.383  1.00 91.27  ? 66  PHE D CD1   1 
ATOM   2547  C CD2   . PHE D 4  69  ? 91.651  107.047 97.288  1.00 96.06  ? 66  PHE D CD2   1 
ATOM   2548  C CE1   . PHE D 4  69  ? 92.377  108.500 99.485  1.00 94.67  ? 66  PHE D CE1   1 
ATOM   2549  C CE2   . PHE D 4  69  ? 90.834  107.072 98.387  1.00 99.67  ? 66  PHE D CE2   1 
ATOM   2550  C CZ    . PHE D 4  69  ? 91.204  107.798 99.489  1.00 96.64  ? 66  PHE D CZ    1 
ATOM   2551  N N     . VAL D 4  70  ? 93.804  104.631 96.397  1.00 88.32  ? 67  VAL D N     1 
ATOM   2552  C CA    . VAL D 4  70  ? 93.273  103.455 97.065  1.00 87.02  ? 67  VAL D CA    1 
ATOM   2553  C C     . VAL D 4  70  ? 94.392  102.613 97.644  1.00 89.51  ? 67  VAL D C     1 
ATOM   2554  O O     . VAL D 4  70  ? 94.285  102.126 98.771  1.00 88.02  ? 67  VAL D O     1 
ATOM   2555  C CB    . VAL D 4  70  ? 92.416  102.605 96.110  1.00 92.21  ? 67  VAL D CB    1 
ATOM   2556  C CG1   . VAL D 4  70  ? 92.049  101.272 96.768  1.00 98.96  ? 67  VAL D CG1   1 
ATOM   2557  C CG2   . VAL D 4  70  ? 91.151  103.366 95.751  1.00 95.37  ? 67  VAL D CG2   1 
ATOM   2558  N N     . ASN D 4  71  ? 95.469  102.441 96.888  1.00 89.04  ? 68  ASN D N     1 
ATOM   2559  C CA    . ASN D 4  71  ? 96.582  101.645 97.378  1.00 90.25  ? 68  ASN D CA    1 
ATOM   2560  C C     . ASN D 4  71  ? 97.284  102.299 98.555  1.00 89.53  ? 68  ASN D C     1 
ATOM   2561  O O     . ASN D 4  71  ? 97.776  101.609 99.448  1.00 89.90  ? 68  ASN D O     1 
ATOM   2562  C CB    . ASN D 4  71  ? 97.559  101.350 96.265  1.00 92.52  ? 68  ASN D CB    1 
ATOM   2563  C CG    . ASN D 4  71  ? 97.091  100.236 95.397  1.00 103.10 ? 68  ASN D CG    1 
ATOM   2564  O OD1   . ASN D 4  71  ? 96.417  99.312  95.877  1.00 105.31 ? 68  ASN D OD1   1 
ATOM   2565  N ND2   . ASN D 4  71  ? 97.415  100.297 94.134  1.00 111.56 ? 68  ASN D ND2   1 
ATOM   2566  N N     . ASP D 4  72  ? 97.287  103.624 98.596  1.00 88.42  ? 69  ASP D N     1 
ATOM   2567  C CA    . ASP D 4  72  ? 97.946  104.326 99.684  1.00 89.67  ? 69  ASP D CA    1 
ATOM   2568  C C     . ASP D 4  72  ? 97.179  104.108 100.980 1.00 88.17  ? 69  ASP D C     1 
ATOM   2569  O O     . ASP D 4  72  ? 97.752  103.711 101.997 1.00 87.67  ? 69  ASP D O     1 
ATOM   2570  C CB    . ASP D 4  72  ? 98.052  105.822 99.365  1.00 93.76  ? 69  ASP D CB    1 
ATOM   2571  C CG    . ASP D 4  72  ? 98.964  106.601 100.320 1.00 96.45  ? 69  ASP D CG    1 
ATOM   2572  O OD1   . ASP D 4  72  ? 99.599  105.986 101.140 1.00 96.33  ? 69  ASP D OD1   1 
ATOM   2573  O OD2   . ASP D 4  72  ? 99.042  107.806 100.191 1.00 97.06  ? 69  ASP D OD2   1 
ATOM   2574  N N     . ILE D 4  73  ? 95.864  104.272 100.922 1.00 84.49  ? 70  ILE D N     1 
ATOM   2575  C CA    . ILE D 4  73  ? 95.061  104.115 102.122 1.00 83.73  ? 70  ILE D CA    1 
ATOM   2576  C C     . ILE D 4  73  ? 95.072  102.671 102.585 1.00 85.48  ? 70  ILE D C     1 
ATOM   2577  O O     . ILE D 4  73  ? 95.208  102.395 103.778 1.00 83.77  ? 70  ILE D O     1 
ATOM   2578  C CB    . ILE D 4  73  ? 93.616  104.575 101.900 1.00 83.05  ? 70  ILE D CB    1 
ATOM   2579  C CG1   . ILE D 4  73  ? 93.563  106.070 101.539 1.00 87.50  ? 70  ILE D CG1   1 
ATOM   2580  C CG2   . ILE D 4  73  ? 92.774  104.281 103.133 1.00 84.13  ? 70  ILE D CG2   1 
ATOM   2581  C CD1   . ILE D 4  73  ? 94.195  107.015 102.547 1.00 90.42  ? 70  ILE D CD1   1 
ATOM   2582  N N     . PHE D 4  74  ? 94.939  101.746 101.642 1.00 85.58  ? 71  PHE D N     1 
ATOM   2583  C CA    . PHE D 4  74  ? 94.967  100.334 101.979 1.00 87.78  ? 71  PHE D CA    1 
ATOM   2584  C C     . PHE D 4  74  ? 96.236  99.995  102.731 1.00 87.51  ? 71  PHE D C     1 
ATOM   2585  O O     . PHE D 4  74  ? 96.198  99.360  103.787 1.00 84.75  ? 71  PHE D O     1 
ATOM   2586  C CB    . PHE D 4  74  ? 94.915  99.475  100.718 1.00 86.47  ? 71  PHE D CB    1 
ATOM   2587  C CG    . PHE D 4  74  ? 95.143  98.034  101.003 1.00 86.30  ? 71  PHE D CG    1 
ATOM   2588  C CD1   . PHE D 4  74  ? 94.097  97.206  101.326 1.00 89.76  ? 71  PHE D CD1   1 
ATOM   2589  C CD2   . PHE D 4  74  ? 96.429  97.519  101.036 1.00 91.51  ? 71  PHE D CD2   1 
ATOM   2590  C CE1   . PHE D 4  74  ? 94.325  95.900  101.684 1.00 99.11  ? 71  PHE D CE1   1 
ATOM   2591  C CE2   . PHE D 4  74  ? 96.654  96.221  101.403 1.00 98.49  ? 71  PHE D CE2   1 
ATOM   2592  C CZ    . PHE D 4  74  ? 95.602  95.416  101.734 1.00 103.07 ? 71  PHE D CZ    1 
ATOM   2593  N N     . GLU D 4  75  ? 97.367  100.415 102.181 1.00 87.38  ? 72  GLU D N     1 
ATOM   2594  C CA    . GLU D 4  75  ? 98.656  100.092 102.754 1.00 89.32  ? 72  GLU D CA    1 
ATOM   2595  C C     . GLU D 4  75  ? 98.795  100.623 104.166 1.00 87.31  ? 72  GLU D C     1 
ATOM   2596  O O     . GLU D 4  75  ? 99.305  99.931  105.048 1.00 88.04  ? 72  GLU D O     1 
ATOM   2597  C CB    . GLU D 4  75  ? 99.758  100.654 101.867 1.00 95.22  ? 72  GLU D CB    1 
ATOM   2598  C CG    . GLU D 4  75  ? 101.168 100.360 102.323 1.00 103.46 ? 72  GLU D CG    1 
ATOM   2599  C CD    . GLU D 4  75  ? 102.181 100.801 101.298 1.00 113.62 ? 72  GLU D CD    1 
ATOM   2600  O OE1   . GLU D 4  75  ? 101.917 100.628 100.133 1.00 114.56 ? 72  GLU D OE1   1 
ATOM   2601  O OE2   . GLU D 4  75  ? 103.204 101.332 101.669 1.00 110.87 ? 72  GLU D OE2   1 
ATOM   2602  N N     . ARG D 4  76  ? 98.338  101.847 104.392 1.00 83.57  ? 73  ARG D N     1 
ATOM   2603  C CA    . ARG D 4  76  ? 98.476  102.438 105.711 1.00 85.08  ? 73  ARG D CA    1 
ATOM   2604  C C     . ARG D 4  76  ? 97.654  101.715 106.754 1.00 84.82  ? 73  ARG D C     1 
ATOM   2605  O O     . ARG D 4  76  ? 98.139  101.448 107.854 1.00 84.58  ? 73  ARG D O     1 
ATOM   2606  C CB    . ARG D 4  76  ? 98.009  103.866 105.716 1.00 85.39  ? 73  ARG D CB    1 
ATOM   2607  C CG    . ARG D 4  76  ? 98.859  104.835 104.996 1.00 89.03  ? 73  ARG D CG    1 
ATOM   2608  C CD    . ARG D 4  76  ? 98.283  106.181 105.108 1.00 90.77  ? 73  ARG D CD    1 
ATOM   2609  N NE    . ARG D 4  76  ? 98.968  107.129 104.297 1.00 92.33  ? 73  ARG D NE    1 
ATOM   2610  C CZ    . ARG D 4  76  ? 98.623  108.418 104.178 1.00 92.54  ? 73  ARG D CZ    1 
ATOM   2611  N NH1   . ARG D 4  76  ? 97.621  108.913 104.871 1.00 88.09  ? 73  ARG D NH1   1 
ATOM   2612  N NH2   . ARG D 4  76  ? 99.283  109.186 103.349 1.00 95.33  ? 73  ARG D NH2   1 
ATOM   2613  N N     . ILE D 4  77  ? 96.409  101.403 106.419 1.00 81.16  ? 74  ILE D N     1 
ATOM   2614  C CA    . ILE D 4  77  ? 95.535  100.782 107.394 1.00 79.64  ? 74  ILE D CA    1 
ATOM   2615  C C     . ILE D 4  77  ? 96.035  99.397  107.716 1.00 82.32  ? 74  ILE D C     1 
ATOM   2616  O O     . ILE D 4  77  ? 96.084  99.001  108.880 1.00 82.75  ? 74  ILE D O     1 
ATOM   2617  C CB    . ILE D 4  77  ? 94.078  100.733 106.917 1.00 78.35  ? 74  ILE D CB    1 
ATOM   2618  C CG1   . ILE D 4  77  ? 93.524  102.157 106.817 1.00 79.06  ? 74  ILE D CG1   1 
ATOM   2619  C CG2   . ILE D 4  77  ? 93.253  99.916  107.902 1.00 82.16  ? 74  ILE D CG2   1 
ATOM   2620  C CD1   . ILE D 4  77  ? 92.205  102.260 106.105 1.00 85.20  ? 74  ILE D CD1   1 
ATOM   2621  N N     . ALA D 4  78  ? 96.401  98.656  106.683 1.00 82.12  ? 75  ALA D N     1 
ATOM   2622  C CA    . ALA D 4  78  ? 96.933  97.323  106.875 1.00 86.81  ? 75  ALA D CA    1 
ATOM   2623  C C     . ALA D 4  78  ? 98.206  97.382  107.710 1.00 87.09  ? 75  ALA D C     1 
ATOM   2624  O O     . ALA D 4  78  ? 98.422  96.545  108.587 1.00 87.53  ? 75  ALA D O     1 
ATOM   2625  C CB    . ALA D 4  78  ? 97.194  96.680  105.528 1.00 93.20  ? 75  ALA D CB    1 
ATOM   2626  N N     . GLY D 4  79  ? 99.011  98.418  107.483 1.00 85.28  ? 76  GLY D N     1 
ATOM   2627  C CA    . GLY D 4  79  ? 100.247 98.617  108.223 1.00 87.43  ? 76  GLY D CA    1 
ATOM   2628  C C     . GLY D 4  79  ? 99.986  98.814  109.709 1.00 85.96  ? 76  GLY D C     1 
ATOM   2629  O O     . GLY D 4  79  ? 100.627 98.185  110.553 1.00 87.59  ? 76  GLY D O     1 
ATOM   2630  N N     . GLU D 4  80  ? 99.047  99.690  110.035 1.00 82.54  ? 77  GLU D N     1 
ATOM   2631  C CA    . GLU D 4  80  ? 98.748  99.941  111.433 1.00 84.57  ? 77  GLU D CA    1 
ATOM   2632  C C     . GLU D 4  80  ? 98.091  98.735  112.072 1.00 86.83  ? 77  GLU D C     1 
ATOM   2633  O O     . GLU D 4  80  ? 98.338  98.430  113.239 1.00 84.56  ? 77  GLU D O     1 
ATOM   2634  C CB    . GLU D 4  80  ? 97.866  101.166 111.582 1.00 86.40  ? 77  GLU D CB    1 
ATOM   2635  C CG    . GLU D 4  80  ? 98.564  102.452 111.245 1.00 95.26  ? 77  GLU D CG    1 
ATOM   2636  C CD    . GLU D 4  80  ? 99.751  102.724 112.108 1.00 99.09  ? 77  GLU D CD    1 
ATOM   2637  O OE1   . GLU D 4  80  ? 99.600  102.771 113.303 1.00 97.28  ? 77  GLU D OE1   1 
ATOM   2638  O OE2   . GLU D 4  80  ? 100.820 102.870 111.572 1.00 97.49  ? 77  GLU D OE2   1 
ATOM   2639  N N     . ALA D 4  81  ? 97.261  98.034  111.309 1.00 82.62  ? 78  ALA D N     1 
ATOM   2640  C CA    . ALA D 4  81  ? 96.612  96.848  111.832 1.00 84.76  ? 78  ALA D CA    1 
ATOM   2641  C C     . ALA D 4  81  ? 97.664  95.818  112.210 1.00 85.31  ? 78  ALA D C     1 
ATOM   2642  O O     . ALA D 4  81  ? 97.547  95.144  113.236 1.00 85.87  ? 78  ALA D O     1 
ATOM   2643  C CB    . ALA D 4  81  ? 95.637  96.291  110.818 1.00 87.15  ? 78  ALA D CB    1 
ATOM   2644  N N     . SER D 4  82  ? 98.726  95.750  111.411 1.00 83.15  ? 79  SER D N     1 
ATOM   2645  C CA    . SER D 4  82  ? 99.840  94.865  111.695 1.00 85.74  ? 79  SER D CA    1 
ATOM   2646  C C     . SER D 4  82  ? 100.476 95.239  113.017 1.00 85.58  ? 79  SER D C     1 
ATOM   2647  O O     . SER D 4  82  ? 100.732 94.375  113.858 1.00 87.87  ? 79  SER D O     1 
ATOM   2648  C CB    . SER D 4  82  ? 100.875 94.959  110.598 1.00 90.83  ? 79  SER D CB    1 
ATOM   2649  O OG    . SER D 4  82  ? 101.957 94.119  110.860 1.00 94.37  ? 79  SER D OG    1 
ATOM   2650  N N     . ARG D 4  83  ? 100.696 96.534  113.218 1.00 82.92  ? 80  ARG D N     1 
ATOM   2651  C CA    . ARG D 4  83  ? 101.266 97.002  114.469 1.00 90.43  ? 80  ARG D CA    1 
ATOM   2652  C C     . ARG D 4  83  ? 100.393 96.677  115.659 1.00 89.67  ? 80  ARG D C     1 
ATOM   2653  O O     . ARG D 4  83  ? 100.894 96.252  116.697 1.00 90.28  ? 80  ARG D O     1 
ATOM   2654  C CB    . ARG D 4  83  ? 101.496 98.494  114.448 1.00 92.91  ? 80  ARG D CB    1 
ATOM   2655  C CG    . ARG D 4  83  ? 102.716 98.945  113.709 1.00 95.09  ? 80  ARG D CG    1 
ATOM   2656  C CD    . ARG D 4  83  ? 102.897 100.415 113.821 1.00 97.56  ? 80  ARG D CD    1 
ATOM   2657  N NE    . ARG D 4  83  ? 104.178 100.838 113.310 1.00 101.08 ? 80  ARG D NE    1 
ATOM   2658  C CZ    . ARG D 4  83  ? 105.336 100.784 114.000 1.00 100.62 ? 80  ARG D CZ    1 
ATOM   2659  N NH1   . ARG D 4  83  ? 105.353 100.357 115.238 1.00 98.53  ? 80  ARG D NH1   1 
ATOM   2660  N NH2   . ARG D 4  83  ? 106.458 101.135 113.413 1.00 99.61  ? 80  ARG D NH2   1 
ATOM   2661  N N     . LEU D 4  84  ? 99.089  96.837  115.512 1.00 85.87  ? 81  LEU D N     1 
ATOM   2662  C CA    . LEU D 4  84  ? 98.211  96.562  116.632 1.00 87.07  ? 81  LEU D CA    1 
ATOM   2663  C C     . LEU D 4  84  ? 98.291  95.095  117.007 1.00 88.35  ? 81  LEU D C     1 
ATOM   2664  O O     . LEU D 4  84  ? 98.363  94.748  118.189 1.00 87.90  ? 81  LEU D O     1 
ATOM   2665  C CB    . LEU D 4  84  ? 96.773  96.929  116.271 1.00 86.71  ? 81  LEU D CB    1 
ATOM   2666  C CG    . LEU D 4  84  ? 96.488  98.421  116.095 1.00 87.66  ? 81  LEU D CG    1 
ATOM   2667  C CD1   . LEU D 4  84  ? 95.119  98.582  115.494 1.00 90.07  ? 81  LEU D CD1   1 
ATOM   2668  C CD2   . LEU D 4  84  ? 96.562  99.131  117.439 1.00 88.81  ? 81  LEU D CD2   1 
ATOM   2669  N N     . ALA D 4  85  ? 98.331  94.233  115.998 1.00 84.89  ? 82  ALA D N     1 
ATOM   2670  C CA    . ALA D 4  85  ? 98.466  92.811  116.249 1.00 90.12  ? 82  ALA D CA    1 
ATOM   2671  C C     . ALA D 4  85  ? 99.800  92.530  116.919 1.00 90.13  ? 82  ALA D C     1 
ATOM   2672  O O     . ALA D 4  85  ? 99.879  91.745  117.861 1.00 90.04  ? 82  ALA D O     1 
ATOM   2673  C CB    . ALA D 4  85  ? 98.348  92.029  114.951 1.00 96.27  ? 82  ALA D CB    1 
ATOM   2674  N N     . HIS D 4  86  ? 100.835 93.233  116.482 1.00 89.32  ? 83  HIS D N     1 
ATOM   2675  C CA    . HIS D 4  86  ? 102.165 93.049  117.037 1.00 93.23  ? 83  HIS D CA    1 
ATOM   2676  C C     . HIS D 4  86  ? 102.207 93.478  118.496 1.00 93.01  ? 83  HIS D C     1 
ATOM   2677  O O     . HIS D 4  86  ? 102.736 92.768  119.350 1.00 95.32  ? 83  HIS D O     1 
ATOM   2678  C CB    . HIS D 4  86  ? 103.195 93.843  116.237 1.00 94.76  ? 83  HIS D CB    1 
ATOM   2679  C CG    . HIS D 4  86  ? 104.602 93.561  116.625 1.00 104.30 ? 83  HIS D CG    1 
ATOM   2680  N ND1   . HIS D 4  86  ? 105.257 92.403  116.258 1.00 107.22 ? 83  HIS D ND1   1 
ATOM   2681  C CD2   . HIS D 4  86  ? 105.485 94.280  117.353 1.00 109.66 ? 83  HIS D CD2   1 
ATOM   2682  C CE1   . HIS D 4  86  ? 106.487 92.427  116.741 1.00 112.47 ? 83  HIS D CE1   1 
ATOM   2683  N NE2   . HIS D 4  86  ? 106.650 93.556  117.406 1.00 111.13 ? 83  HIS D NE2   1 
ATOM   2684  N N     . TYR D 4  87  ? 101.595 94.616  118.794 1.00 91.65  ? 84  TYR D N     1 
ATOM   2685  C CA    . TYR D 4  87  ? 101.635 95.182  120.135 1.00 92.77  ? 84  TYR D CA    1 
ATOM   2686  C C     . TYR D 4  87  ? 100.945 94.274  121.131 1.00 90.45  ? 84  TYR D C     1 
ATOM   2687  O O     . TYR D 4  87  ? 101.358 94.179  122.287 1.00 93.78  ? 84  TYR D O     1 
ATOM   2688  C CB    . TYR D 4  87  ? 100.958 96.551  120.162 1.00 93.32  ? 84  TYR D CB    1 
ATOM   2689  C CG    . TYR D 4  87  ? 101.634 97.619  119.326 0.00 99.66  ? 84  TYR D CG    1 
ATOM   2690  C CD1   . TYR D 4  87  ? 102.905 97.421  118.789 0.00 105.12 ? 84  TYR D CD1   1 
ATOM   2691  C CD2   . TYR D 4  87  ? 100.977 98.820  119.109 0.00 102.35 ? 84  TYR D CD2   1 
ATOM   2692  C CE1   . TYR D 4  87  ? 103.494 98.414  118.044 0.00 107.12 ? 84  TYR D CE1   1 
ATOM   2693  C CE2   . TYR D 4  87  ? 101.579 99.814  118.372 0.00 102.16 ? 84  TYR D CE2   1 
ATOM   2694  C CZ    . TYR D 4  87  ? 102.830 99.613  117.843 0.00 107.45 ? 84  TYR D CZ    1 
ATOM   2695  O OH    . TYR D 4  87  ? 103.439 100.609 117.127 1.00 100.89 ? 84  TYR D OH    1 
ATOM   2696  N N     . ASN D 4  88  ? 99.918  93.577  120.675 1.00 88.71  ? 85  ASN D N     1 
ATOM   2697  C CA    . ASN D 4  88  ? 99.159  92.704  121.550 1.00 88.99  ? 85  ASN D CA    1 
ATOM   2698  C C     . ASN D 4  88  ? 99.628  91.264  121.444 1.00 90.96  ? 85  ASN D C     1 
ATOM   2699  O O     . ASN D 4  88  ? 99.016  90.364  122.022 1.00 89.57  ? 85  ASN D O     1 
ATOM   2700  C CB    . ASN D 4  88  ? 97.687  92.829  121.243 1.00 94.38  ? 85  ASN D CB    1 
ATOM   2701  C CG    . ASN D 4  88  ? 97.161  94.168  121.636 1.00 93.74  ? 85  ASN D CG    1 
ATOM   2702  O OD1   . ASN D 4  88  ? 96.823  94.403  122.803 1.00 94.06  ? 85  ASN D OD1   1 
ATOM   2703  N ND2   . ASN D 4  88  ? 97.127  95.073  120.696 1.00 93.51  ? 85  ASN D ND2   1 
ATOM   2704  N N     . LYS D 4  89  ? 100.770 91.083  120.786 1.00 91.79  ? 86  LYS D N     1 
ATOM   2705  C CA    . LYS D 4  89  ? 101.395 89.783  120.611 1.00 96.52  ? 86  LYS D CA    1 
ATOM   2706  C C     . LYS D 4  89  ? 100.442 88.788  119.975 1.00 95.32  ? 86  LYS D C     1 
ATOM   2707  O O     . LYS D 4  89  ? 100.150 87.733  120.534 1.00 96.46  ? 86  LYS D O     1 
ATOM   2708  C CB    . LYS D 4  89  ? 101.957 89.268  121.933 1.00 100.45 ? 86  LYS D CB    1 
ATOM   2709  C CG    . LYS D 4  89  ? 103.017 90.191  122.515 1.00 106.05 ? 86  LYS D CG    1 
ATOM   2710  C CD    . LYS D 4  89  ? 103.755 89.563  123.689 1.00 116.53 ? 86  LYS D CD    1 
ATOM   2711  C CE    . LYS D 4  89  ? 104.822 90.500  124.237 1.00 120.46 ? 86  LYS D CE    1 
ATOM   2712  N NZ    . LYS D 4  89  ? 105.884 90.793  123.229 1.00 117.59 ? 86  LYS D NZ    1 
ATOM   2713  N N     . ARG D 4  90  ? 99.948  89.177  118.806 1.00 94.27  ? 87  ARG D N     1 
ATOM   2714  C CA    . ARG D 4  90  ? 98.999  88.376  118.055 1.00 94.73  ? 87  ARG D CA    1 
ATOM   2715  C C     . ARG D 4  90  ? 99.487  88.065  116.657 1.00 98.63  ? 87  ARG D C     1 
ATOM   2716  O O     . ARG D 4  90  ? 100.482 88.621  116.190 1.00 101.52 ? 87  ARG D O     1 
ATOM   2717  C CB    . ARG D 4  90  ? 97.704  89.117  117.924 1.00 94.50  ? 87  ARG D CB    1 
ATOM   2718  C CG    . ARG D 4  90  ? 97.151  89.600  119.191 1.00 94.98  ? 87  ARG D CG    1 
ATOM   2719  C CD    . ARG D 4  90  ? 96.737  88.509  120.038 1.00 97.15  ? 87  ARG D CD    1 
ATOM   2720  N NE    . ARG D 4  90  ? 96.060  88.988  121.196 1.00 103.48 ? 87  ARG D NE    1 
ATOM   2721  C CZ    . ARG D 4  90  ? 94.766  89.362  121.222 1.00 109.47 ? 87  ARG D CZ    1 
ATOM   2722  N NH1   . ARG D 4  90  ? 94.042  89.333  120.126 1.00 107.03 ? 87  ARG D NH1   1 
ATOM   2723  N NH2   . ARG D 4  90  ? 94.226  89.769  122.353 1.00 108.81 ? 87  ARG D NH2   1 
ATOM   2724  N N     . SER D 4  91  ? 98.801  87.135  116.002 1.00 95.26  ? 88  SER D N     1 
ATOM   2725  C CA    . SER D 4  91  ? 99.125  86.780  114.633 1.00 104.64 ? 88  SER D CA    1 
ATOM   2726  C C     . SER D 4  91  ? 97.985  87.129  113.682 1.00 100.28 ? 88  SER D C     1 
ATOM   2727  O O     . SER D 4  91  ? 98.193  87.255  112.469 1.00 99.82  ? 88  SER D O     1 
ATOM   2728  C CB    . SER D 4  91  ? 99.423  85.300  114.555 1.00 112.20 ? 88  SER D CB    1 
ATOM   2729  O OG    . SER D 4  91  ? 98.293  84.546  114.888 1.00 111.03 ? 88  SER D OG    1 
ATOM   2730  N N     . THR D 4  92  ? 96.798  87.368  114.243 1.00 96.11  ? 89  THR D N     1 
ATOM   2731  C CA    . THR D 4  92  ? 95.616  87.617  113.426 1.00 95.91  ? 89  THR D CA    1 
ATOM   2732  C C     . THR D 4  92  ? 95.168  89.073  113.450 1.00 90.98  ? 89  THR D C     1 
ATOM   2733  O O     . THR D 4  92  ? 95.100  89.700  114.506 1.00 92.73  ? 89  THR D O     1 
ATOM   2734  C CB    . THR D 4  92  ? 94.436  86.746  113.903 1.00 100.50 ? 89  THR D CB    1 
ATOM   2735  O OG1   . THR D 4  92  ? 94.819  85.372  113.878 1.00 104.56 ? 89  THR D OG1   1 
ATOM   2736  C CG2   . THR D 4  92  ? 93.224  86.935  112.986 1.00 99.25  ? 89  THR D CG2   1 
ATOM   2737  N N     . ILE D 4  93  ? 94.793  89.576  112.279 1.00 88.59  ? 90  ILE D N     1 
ATOM   2738  C CA    . ILE D 4  93  ? 94.100  90.853  112.146 1.00 84.38  ? 90  ILE D CA    1 
ATOM   2739  C C     . ILE D 4  93  ? 92.619  90.615  111.923 1.00 88.45  ? 90  ILE D C     1 
ATOM   2740  O O     . ILE D 4  93  ? 92.240  89.819  111.064 1.00 90.48  ? 90  ILE D O     1 
ATOM   2741  C CB    . ILE D 4  93  ? 94.659  91.689  110.979 1.00 82.62  ? 90  ILE D CB    1 
ATOM   2742  C CG1   . ILE D 4  93  ? 96.081  92.155  111.295 1.00 86.59  ? 90  ILE D CG1   1 
ATOM   2743  C CG2   . ILE D 4  93  ? 93.734  92.863  110.655 1.00 87.27  ? 90  ILE D CG2   1 
ATOM   2744  C CD1   . ILE D 4  93  ? 96.810  92.777  110.110 1.00 90.26  ? 90  ILE D CD1   1 
ATOM   2745  N N     . THR D 4  94  ? 91.785  91.291  112.700 1.00 87.38  ? 91  THR D N     1 
ATOM   2746  C CA    . THR D 4  94  ? 90.342  91.169  112.571 1.00 87.16  ? 91  THR D CA    1 
ATOM   2747  C C     . THR D 4  94  ? 89.743  92.533  112.287 1.00 88.31  ? 91  THR D C     1 
ATOM   2748  O O     . THR D 4  94  ? 90.465  93.516  112.100 1.00 84.64  ? 91  THR D O     1 
ATOM   2749  C CB    . THR D 4  94  ? 89.692  90.602  113.842 1.00 90.31  ? 91  THR D CB    1 
ATOM   2750  O OG1   . THR D 4  94  ? 89.693  91.601  114.868 1.00 89.65  ? 91  THR D OG1   1 
ATOM   2751  C CG2   . THR D 4  94  ? 90.449  89.380  114.328 1.00 95.19  ? 91  THR D CG2   1 
ATOM   2752  N N     . SER D 4  95  ? 88.421  92.590  112.239 1.00 86.53  ? 92  SER D N     1 
ATOM   2753  C CA    . SER D 4  95  ? 87.723  93.835  111.976 1.00 87.88  ? 92  SER D CA    1 
ATOM   2754  C C     . SER D 4  95  ? 88.014  94.868  113.052 1.00 85.36  ? 92  SER D C     1 
ATOM   2755  O O     . SER D 4  95  ? 87.881  96.071  112.821 1.00 84.21  ? 92  SER D O     1 
ATOM   2756  C CB    . SER D 4  95  ? 86.238  93.581  111.945 1.00 89.87  ? 92  SER D CB    1 
ATOM   2757  O OG    . SER D 4  95  ? 85.780  93.175  113.205 1.00 89.28  ? 92  SER D OG    1 
ATOM   2758  N N     . ARG D 4  96  ? 88.398  94.402  114.232 1.00 84.60  ? 93  ARG D N     1 
ATOM   2759  C CA    . ARG D 4  96  ? 88.639  95.301  115.343 1.00 87.16  ? 93  ARG D CA    1 
ATOM   2760  C C     . ARG D 4  96  ? 89.909  96.106  115.139 1.00 86.31  ? 93  ARG D C     1 
ATOM   2761  O O     . ARG D 4  96  ? 89.947  97.305  115.417 1.00 84.17  ? 93  ARG D O     1 
ATOM   2762  C CB    . ARG D 4  96  ? 88.741  94.526  116.631 1.00 87.74  ? 93  ARG D CB    1 
ATOM   2763  C CG    . ARG D 4  96  ? 88.816  95.383  117.852 1.00 88.68  ? 93  ARG D CG    1 
ATOM   2764  C CD    . ARG D 4  96  ? 88.829  94.586  119.080 1.00 90.95  ? 93  ARG D CD    1 
ATOM   2765  N NE    . ARG D 4  96  ? 88.967  95.424  120.246 1.00 94.26  ? 93  ARG D NE    1 
ATOM   2766  C CZ    . ARG D 4  96  ? 87.965  96.057  120.859 1.00 93.55  ? 93  ARG D CZ    1 
ATOM   2767  N NH1   . ARG D 4  96  ? 86.731  95.936  120.440 1.00 89.25  ? 93  ARG D NH1   1 
ATOM   2768  N NH2   . ARG D 4  96  ? 88.250  96.806  121.891 1.00 93.65  ? 93  ARG D NH2   1 
ATOM   2769  N N     . GLU D 4  97  ? 90.945  95.455  114.635 1.00 85.58  ? 94  GLU D N     1 
ATOM   2770  C CA    . GLU D 4  97  ? 92.204  96.128  114.382 1.00 85.50  ? 94  GLU D CA    1 
ATOM   2771  C C     . GLU D 4  97  ? 92.038  97.135  113.276 1.00 85.86  ? 94  GLU D C     1 
ATOM   2772  O O     . GLU D 4  97  ? 92.597  98.228  113.336 1.00 81.55  ? 94  GLU D O     1 
ATOM   2773  C CB    . GLU D 4  97  ? 93.286  95.123  114.027 1.00 87.83  ? 94  GLU D CB    1 
ATOM   2774  C CG    . GLU D 4  97  ? 93.743  94.287  115.188 1.00 94.36  ? 94  GLU D CG    1 
ATOM   2775  C CD    . GLU D 4  97  ? 92.741  93.258  115.568 1.00 97.25  ? 94  GLU D CD    1 
ATOM   2776  O OE1   . GLU D 4  97  ? 91.824  93.053  114.814 1.00 89.81  ? 94  GLU D OE1   1 
ATOM   2777  O OE2   . GLU D 4  97  ? 92.860  92.700  116.627 1.00 102.23 ? 94  GLU D OE2   1 
ATOM   2778  N N     . ILE D 4  98  ? 91.234  96.789  112.284 1.00 80.90  ? 95  ILE D N     1 
ATOM   2779  C CA    . ILE D 4  98  ? 91.013  97.716  111.197 1.00 78.97  ? 95  ILE D CA    1 
ATOM   2780  C C     . ILE D 4  98  ? 90.321  98.950  111.751 1.00 83.07  ? 95  ILE D C     1 
ATOM   2781  O O     . ILE D 4  98  ? 90.736  100.073 111.475 1.00 81.54  ? 95  ILE D O     1 
ATOM   2782  C CB    . ILE D 4  98  ? 90.155  97.098  110.083 1.00 82.00  ? 95  ILE D CB    1 
ATOM   2783  C CG1   . ILE D 4  98  ? 90.840  95.849  109.475 1.00 85.77  ? 95  ILE D CG1   1 
ATOM   2784  C CG2   . ILE D 4  98  ? 89.907  98.136  108.999 1.00 85.16  ? 95  ILE D CG2   1 
ATOM   2785  C CD1   . ILE D 4  98  ? 92.155  96.105  108.765 1.00 89.75  ? 95  ILE D CD1   1 
ATOM   2786  N N     . GLN D 4  99  ? 89.324  98.745  112.605 1.00 80.48  ? 96  GLN D N     1 
ATOM   2787  C CA    . GLN D 4  99  ? 88.611  99.868  113.194 1.00 81.56  ? 96  GLN D CA    1 
ATOM   2788  C C     . GLN D 4  99  ? 89.535  100.822 113.925 1.00 81.88  ? 96  GLN D C     1 
ATOM   2789  O O     . GLN D 4  99  ? 89.469  102.037 113.722 1.00 81.14  ? 96  GLN D O     1 
ATOM   2790  C CB    . GLN D 4  99  ? 87.552  99.372  114.168 1.00 81.41  ? 96  GLN D CB    1 
ATOM   2791  C CG    . GLN D 4  99  ? 86.810  100.474 114.866 1.00 83.84  ? 96  GLN D CG    1 
ATOM   2792  C CD    . GLN D 4  99  ? 85.647  99.959  115.637 1.00 85.53  ? 96  GLN D CD    1 
ATOM   2793  O OE1   . GLN D 4  99  ? 85.717  99.759  116.850 1.00 89.31  ? 96  GLN D OE1   1 
ATOM   2794  N NE2   . GLN D 4  99  ? 84.556  99.718  114.934 1.00 85.99  ? 96  GLN D NE2   1 
ATOM   2795  N N     . THR D 4  100 ? 90.401  100.276 114.764 1.00 77.37  ? 97  THR D N     1 
ATOM   2796  C CA    . THR D 4  100 ? 91.334  101.098 115.510 1.00 77.92  ? 97  THR D CA    1 
ATOM   2797  C C     . THR D 4  100 ? 92.293  101.800 114.566 1.00 81.69  ? 97  THR D C     1 
ATOM   2798  O O     . THR D 4  100 ? 92.601  102.981 114.742 1.00 81.27  ? 97  THR D O     1 
ATOM   2799  C CB    . THR D 4  100 ? 92.107  100.261 116.536 1.00 80.51  ? 97  THR D CB    1 
ATOM   2800  O OG1   . THR D 4  100 ? 91.193  99.718  117.498 1.00 83.83  ? 97  THR D OG1   1 
ATOM   2801  C CG2   . THR D 4  100 ? 93.147  101.114 117.246 1.00 85.02  ? 97  THR D CG2   1 
ATOM   2802  N N     . ALA D 4  101 ? 92.778  101.067 113.571 1.00 80.11  ? 98  ALA D N     1 
ATOM   2803  C CA    . ALA D 4  101 ? 93.715  101.613 112.606 1.00 84.86  ? 98  ALA D CA    1 
ATOM   2804  C C     . ALA D 4  101 ? 93.111  102.801 111.869 1.00 83.71  ? 98  ALA D C     1 
ATOM   2805  O O     . ALA D 4  101 ? 93.784  103.811 111.657 1.00 83.52  ? 98  ALA D O     1 
ATOM   2806  C CB    . ALA D 4  101 ? 94.127  100.534 111.622 1.00 87.58  ? 98  ALA D CB    1 
ATOM   2807  N N     . VAL D 4  102 ? 91.822  102.721 111.563 1.00 78.03  ? 99  VAL D N     1 
ATOM   2808  C CA    . VAL D 4  102 ? 91.154  103.816 110.879 1.00 76.43  ? 99  VAL D CA    1 
ATOM   2809  C C     . VAL D 4  102 ? 91.181  105.067 111.723 1.00 80.87  ? 99  VAL D C     1 
ATOM   2810  O O     . VAL D 4  102 ? 91.503  106.145 111.231 1.00 80.95  ? 99  VAL D O     1 
ATOM   2811  C CB    . VAL D 4  102 ? 89.695  103.453 110.564 1.00 76.61  ? 99  VAL D CB    1 
ATOM   2812  C CG1   . VAL D 4  102 ? 88.922  104.674 110.091 1.00 84.07  ? 99  VAL D CG1   1 
ATOM   2813  C CG2   . VAL D 4  102 ? 89.663  102.407 109.488 1.00 83.56  ? 99  VAL D CG2   1 
ATOM   2814  N N     . ARG D 4  103 ? 90.874  104.926 113.001 1.00 79.22  ? 100 ARG D N     1 
ATOM   2815  C CA    . ARG D 4  103 ? 90.866  106.077 113.888 1.00 80.52  ? 100 ARG D CA    1 
ATOM   2816  C C     . ARG D 4  103 ? 92.236  106.702 114.051 1.00 80.89  ? 100 ARG D C     1 
ATOM   2817  O O     . ARG D 4  103 ? 92.356  107.912 114.233 1.00 84.25  ? 100 ARG D O     1 
ATOM   2818  C CB    . ARG D 4  103 ? 90.371  105.688 115.248 1.00 80.40  ? 100 ARG D CB    1 
ATOM   2819  C CG    . ARG D 4  103 ? 88.926  105.390 115.313 1.00 86.28  ? 100 ARG D CG    1 
ATOM   2820  C CD    . ARG D 4  103 ? 88.523  105.092 116.692 1.00 96.72  ? 100 ARG D CD    1 
ATOM   2821  N NE    . ARG D 4  103 ? 87.130  104.730 116.785 1.00 103.56 ? 100 ARG D NE    1 
ATOM   2822  C CZ    . ARG D 4  103 ? 86.113  105.604 116.852 1.00 110.93 ? 100 ARG D CZ    1 
ATOM   2823  N NH1   . ARG D 4  103 ? 86.346  106.897 116.816 1.00 111.06 ? 100 ARG D NH1   1 
ATOM   2824  N NH2   . ARG D 4  103 ? 84.875  105.162 116.957 1.00 110.55 ? 100 ARG D NH2   1 
ATOM   2825  N N     . LEU D 4  104 ? 93.263  105.871 114.073 1.00 79.33  ? 101 LEU D N     1 
ATOM   2826  C CA    . LEU D 4  104 ? 94.617  106.368 114.234 1.00 82.87  ? 101 LEU D CA    1 
ATOM   2827  C C     . LEU D 4  104 ? 95.082  107.130 112.995 1.00 86.11  ? 101 LEU D C     1 
ATOM   2828  O O     . LEU D 4  104 ? 95.862  108.079 113.095 1.00 89.59  ? 101 LEU D O     1 
ATOM   2829  C CB    . LEU D 4  104 ? 95.563  105.198 114.518 1.00 86.79  ? 101 LEU D CB    1 
ATOM   2830  C CG    . LEU D 4  104 ? 95.399  104.498 115.884 1.00 88.12  ? 101 LEU D CG    1 
ATOM   2831  C CD1   . LEU D 4  104 ? 96.192  103.204 115.872 1.00 92.92  ? 101 LEU D CD1   1 
ATOM   2832  C CD2   . LEU D 4  104 ? 95.905  105.408 117.006 1.00 89.44  ? 101 LEU D CD2   1 
ATOM   2833  N N     . LEU D 4  105 ? 94.642  106.687 111.823 1.00 81.77  ? 102 LEU D N     1 
ATOM   2834  C CA    . LEU D 4  105 ? 95.082  107.280 110.566 1.00 82.01  ? 102 LEU D CA    1 
ATOM   2835  C C     . LEU D 4  105 ? 94.209  108.418 110.056 1.00 82.67  ? 102 LEU D C     1 
ATOM   2836  O O     . LEU D 4  105 ? 94.717  109.367 109.459 1.00 87.68  ? 102 LEU D O     1 
ATOM   2837  C CB    . LEU D 4  105 ? 95.154  106.190 109.507 1.00 84.49  ? 102 LEU D CB    1 
ATOM   2838  C CG    . LEU D 4  105 ? 96.210  105.125 109.742 1.00 92.92  ? 102 LEU D CG    1 
ATOM   2839  C CD1   . LEU D 4  105 ? 95.931  103.968 108.844 1.00 93.06  ? 102 LEU D CD1   1 
ATOM   2840  C CD2   . LEU D 4  105 ? 97.598  105.695 109.441 1.00 95.34  ? 102 LEU D CD2   1 
ATOM   2841  N N     . LEU D 4  106 ? 92.903  108.322 110.250 1.00 81.27  ? 103 LEU D N     1 
ATOM   2842  C CA    . LEU D 4  106 ? 92.008  109.328 109.704 1.00 83.01  ? 103 LEU D CA    1 
ATOM   2843  C C     . LEU D 4  106 ? 91.611  110.314 110.787 1.00 86.81  ? 103 LEU D C     1 
ATOM   2844  O O     . LEU D 4  106 ? 91.469  109.934 111.946 1.00 88.22  ? 103 LEU D O     1 
ATOM   2845  C CB    . LEU D 4  106 ? 90.733  108.683 109.160 1.00 84.17  ? 103 LEU D CB    1 
ATOM   2846  C CG    . LEU D 4  106 ? 90.773  108.094 107.764 1.00 89.88  ? 103 LEU D CG    1 
ATOM   2847  C CD1   . LEU D 4  106 ? 91.694  106.878 107.711 1.00 88.63  ? 103 LEU D CD1   1 
ATOM   2848  C CD2   . LEU D 4  106 ? 89.357  107.712 107.391 1.00 93.08  ? 103 LEU D CD2   1 
ATOM   2849  N N     . PRO D 4  107 ? 91.456  111.588 110.449 1.00 87.01  ? 104 PRO D N     1 
ATOM   2850  C CA    . PRO D 4  107 ? 90.964  112.636 111.311 1.00 88.44  ? 104 PRO D CA    1 
ATOM   2851  C C     . PRO D 4  107 ? 89.444  112.659 111.401 1.00 92.68  ? 104 PRO D C     1 
ATOM   2852  O O     . PRO D 4  107 ? 88.751  112.320 110.440 1.00 93.56  ? 104 PRO D O     1 
ATOM   2853  C CB    . PRO D 4  107 ? 91.497  113.883 110.604 1.00 94.92  ? 104 PRO D CB    1 
ATOM   2854  C CG    . PRO D 4  107 ? 91.510  113.498 109.143 1.00 96.68  ? 104 PRO D CG    1 
ATOM   2855  C CD    . PRO D 4  107 ? 91.892  112.036 109.127 1.00 89.13  ? 104 PRO D CD    1 
ATOM   2856  N N     . GLY D 4  108 ? 88.954  113.168 112.525 1.00 93.87  ? 105 GLY D N     1 
ATOM   2857  C CA    . GLY D 4  108 ? 87.617  113.737 112.657 1.00 97.04  ? 105 GLY D CA    1 
ATOM   2858  C C     . GLY D 4  108 ? 86.466  112.878 112.148 1.00 95.04  ? 105 GLY D C     1 
ATOM   2859  O O     . GLY D 4  108 ? 86.370  111.681 112.432 1.00 94.14  ? 105 GLY D O     1 
ATOM   2860  N N     . GLU D 4  109 ? 85.558  113.547 111.444 1.00 93.84  ? 106 GLU D N     1 
ATOM   2861  C CA    . GLU D 4  109 ? 84.345  112.953 110.913 1.00 97.35  ? 106 GLU D CA    1 
ATOM   2862  C C     . GLU D 4  109 ? 84.611  111.875 109.876 1.00 97.27  ? 106 GLU D C     1 
ATOM   2863  O O     . GLU D 4  109 ? 83.906  110.867 109.834 1.00 93.21  ? 106 GLU D O     1 
ATOM   2864  C CB    . GLU D 4  109 ? 83.445  114.035 110.328 1.00 105.87 ? 106 GLU D CB    1 
ATOM   2865  C CG    . GLU D 4  109 ? 82.150  113.511 109.771 1.00 111.74 ? 106 GLU D CG    1 
ATOM   2866  C CD    . GLU D 4  109 ? 81.174  114.590 109.373 0.00 121.06 ? 106 GLU D CD    1 
ATOM   2867  O OE1   . GLU D 4  109 ? 81.484  115.744 109.548 0.00 123.97 ? 106 GLU D OE1   1 
ATOM   2868  O OE2   . GLU D 4  109 ? 80.113  114.255 108.889 0.00 115.70 ? 106 GLU D OE2   1 
ATOM   2869  N N     . LEU D 4  110 ? 85.613  112.069 109.027 1.00 96.90  ? 107 LEU D N     1 
ATOM   2870  C CA    . LEU D 4  110 ? 85.874  111.053 108.019 1.00 98.21  ? 107 LEU D CA    1 
ATOM   2871  C C     . LEU D 4  110 ? 86.222  109.751 108.697 1.00 94.72  ? 107 LEU D C     1 
ATOM   2872  O O     . LEU D 4  110 ? 85.737  108.689 108.301 1.00 93.96  ? 107 LEU D O     1 
ATOM   2873  C CB    . LEU D 4  110 ? 87.025  111.445 107.088 1.00 95.71  ? 107 LEU D CB    1 
ATOM   2874  C CG    . LEU D 4  110 ? 86.758  112.578 106.091 1.00 104.15 ? 107 LEU D CG    1 
ATOM   2875  C CD1   . LEU D 4  110 ? 88.054  112.908 105.364 1.00 106.27 ? 107 LEU D CD1   1 
ATOM   2876  C CD2   . LEU D 4  110 ? 85.677  112.162 105.090 1.00 107.06 ? 107 LEU D CD2   1 
ATOM   2877  N N     . ALA D 4  111 ? 87.005  109.832 109.767 1.00 93.06  ? 108 ALA D N     1 
ATOM   2878  C CA    . ALA D 4  111 ? 87.336  108.632 110.510 1.00 93.75  ? 108 ALA D CA    1 
ATOM   2879  C C     . ALA D 4  111 ? 86.070  108.007 111.058 1.00 93.18  ? 108 ALA D C     1 
ATOM   2880  O O     . ALA D 4  111 ? 85.871  106.799 110.960 1.00 93.73  ? 108 ALA D O     1 
ATOM   2881  C CB    . ALA D 4  111 ? 88.282  108.952 111.653 1.00 93.51  ? 108 ALA D CB    1 
ATOM   2882  N N     . LYS D 4  112 ? 85.177  108.847 111.556 1.00 87.18  ? 109 LYS D N     1 
ATOM   2883  C CA    . LYS D 4  112 ? 83.937  108.367 112.132 1.00 86.38  ? 109 LYS D CA    1 
ATOM   2884  C C     . LYS D 4  112 ? 83.064  107.626 111.144 1.00 89.12  ? 109 LYS D C     1 
ATOM   2885  O O     . LYS D 4  112 ? 82.540  106.556 111.455 1.00 87.85  ? 109 LYS D O     1 
ATOM   2886  C CB    . LYS D 4  112 ? 83.141  109.518 112.681 1.00 87.15  ? 109 LYS D CB    1 
ATOM   2887  C CG    . LYS D 4  112 ? 81.840  109.119 113.272 1.00 89.38  ? 109 LYS D CG    1 
ATOM   2888  C CD    . LYS D 4  112 ? 81.132  110.321 113.820 1.00 103.39 ? 109 LYS D CD    1 
ATOM   2889  C CE    . LYS D 4  112 ? 79.764  109.972 114.361 0.00 115.23 ? 109 LYS D CE    1 
ATOM   2890  N NZ    . LYS D 4  112 ? 79.056  111.175 114.884 0.00 112.24 ? 109 LYS D NZ    1 
ATOM   2891  N N     . HIS D 4  113 ? 82.860  108.209 109.972 1.00 89.22  ? 110 HIS D N     1 
ATOM   2892  C CA    . HIS D 4  113 ? 81.984  107.575 109.004 1.00 89.87  ? 110 HIS D CA    1 
ATOM   2893  C C     . HIS D 4  113 ? 82.624  106.308 108.496 1.00 90.40  ? 110 HIS D C     1 
ATOM   2894  O O     . HIS D 4  113 ? 81.968  105.275 108.378 1.00 88.68  ? 110 HIS D O     1 
ATOM   2895  C CB    . HIS D 4  113 ? 81.662  108.498 107.838 1.00 94.50  ? 110 HIS D CB    1 
ATOM   2896  C CG    . HIS D 4  113 ? 80.734  109.592 108.186 1.00 97.57  ? 110 HIS D CG    1 
ATOM   2897  N ND1   . HIS D 4  113 ? 79.493  109.372 108.749 1.00 95.67  ? 110 HIS D ND1   1 
ATOM   2898  C CD2   . HIS D 4  113 ? 80.841  110.917 108.015 1.00 99.79  ? 110 HIS D CD2   1 
ATOM   2899  C CE1   . HIS D 4  113 ? 78.895  110.533 108.941 1.00 97.08  ? 110 HIS D CE1   1 
ATOM   2900  N NE2   . HIS D 4  113 ? 79.695  111.486 108.507 1.00 100.14 ? 110 HIS D NE2   1 
ATOM   2901  N N     . ALA D 4  114 ? 83.935  106.347 108.310 1.00 89.13  ? 111 ALA D N     1 
ATOM   2902  C CA    . ALA D 4  114 ? 84.645  105.159 107.892 1.00 90.85  ? 111 ALA D CA    1 
ATOM   2903  C C     . ALA D 4  114 ? 84.420  104.049 108.910 1.00 91.50  ? 111 ALA D C     1 
ATOM   2904  O O     . ALA D 4  114 ? 84.125  102.912 108.542 1.00 91.03  ? 111 ALA D O     1 
ATOM   2905  C CB    . ALA D 4  114 ? 86.121  105.469 107.753 1.00 94.77  ? 111 ALA D CB    1 
ATOM   2906  N N     . VAL D 4  115 ? 84.439  104.411 110.190 1.00 87.99  ? 112 VAL D N     1 
ATOM   2907  C CA    . VAL D 4  115 ? 84.160  103.456 111.247 1.00 89.75  ? 112 VAL D CA    1 
ATOM   2908  C C     . VAL D 4  115 ? 82.723  102.978 111.204 1.00 90.82  ? 112 VAL D C     1 
ATOM   2909  O O     . VAL D 4  115 ? 82.465  101.784 111.346 1.00 90.33  ? 112 VAL D O     1 
ATOM   2910  C CB    . VAL D 4  115 ? 84.483  104.047 112.631 1.00 91.52  ? 112 VAL D CB    1 
ATOM   2911  C CG1   . VAL D 4  115 ? 83.933  103.153 113.737 1.00 92.22  ? 112 VAL D CG1   1 
ATOM   2912  C CG2   . VAL D 4  115 ? 85.998  104.163 112.784 1.00 96.51  ? 112 VAL D CG2   1 
ATOM   2913  N N     . SER D 4  116 ? 81.788  103.894 111.003 1.00 85.64  ? 113 SER D N     1 
ATOM   2914  C CA    . SER D 4  116 ? 80.384  103.521 110.957 1.00 86.43  ? 113 SER D CA    1 
ATOM   2915  C C     . SER D 4  116 ? 80.114  102.531 109.836 1.00 91.97  ? 113 SER D C     1 
ATOM   2916  O O     . SER D 4  116 ? 79.463  101.506 110.046 1.00 91.14  ? 113 SER D O     1 
ATOM   2917  C CB    . SER D 4  116 ? 79.527  104.749 110.757 1.00 88.73  ? 113 SER D CB    1 
ATOM   2918  O OG    . SER D 4  116 ? 78.171  104.411 110.710 1.00 92.97  ? 113 SER D OG    1 
ATOM   2919  N N     . GLU D 4  117 ? 80.651  102.814 108.655 1.00 89.74  ? 114 GLU D N     1 
ATOM   2920  C CA    . GLU D 4  117 ? 80.423  101.963 107.498 1.00 93.43  ? 114 GLU D CA    1 
ATOM   2921  C C     . GLU D 4  117 ? 81.124  100.625 107.645 1.00 93.57  ? 114 GLU D C     1 
ATOM   2922  O O     . GLU D 4  117 ? 80.556  99.580  107.327 1.00 93.48  ? 114 GLU D O     1 
ATOM   2923  C CB    . GLU D 4  117 ? 80.911  102.658 106.230 1.00 96.60  ? 114 GLU D CB    1 
ATOM   2924  C CG    . GLU D 4  117 ? 80.068  103.841 105.798 1.00 103.06 ? 114 GLU D CG    1 
ATOM   2925  C CD    . GLU D 4  117 ? 78.687  103.443 105.391 1.00 111.52 ? 114 GLU D CD    1 
ATOM   2926  O OE1   . GLU D 4  117 ? 78.563  102.535 104.607 1.00 110.91 ? 114 GLU D OE1   1 
ATOM   2927  O OE2   . GLU D 4  117 ? 77.751  104.038 105.866 1.00 115.40 ? 114 GLU D OE2   1 
ATOM   2928  N N     . GLY D 4  118 ? 82.340  100.649 108.174 1.00 92.71  ? 115 GLY D N     1 
ATOM   2929  C CA    . GLY D 4  118 ? 83.095  99.428  108.398 1.00 92.19  ? 115 GLY D CA    1 
ATOM   2930  C C     . GLY D 4  118 ? 82.397  98.560  109.426 1.00 91.58  ? 115 GLY D C     1 
ATOM   2931  O O     . GLY D 4  118 ? 82.190  97.364  109.211 1.00 92.42  ? 115 GLY D O     1 
ATOM   2932  N N     . THR D 4  119 ? 82.003  99.172  110.536 1.00 92.20  ? 116 THR D N     1 
ATOM   2933  C CA    . THR D 4  119 ? 81.348  98.449  111.608 1.00 96.63  ? 116 THR D CA    1 
ATOM   2934  C C     . THR D 4  119 ? 80.097  97.799  111.072 1.00 97.49  ? 116 THR D C     1 
ATOM   2935  O O     . THR D 4  119 ? 79.843  96.618  111.317 1.00 100.17 ? 116 THR D O     1 
ATOM   2936  C CB    . THR D 4  119 ? 80.982  99.384  112.775 1.00 99.44  ? 116 THR D CB    1 
ATOM   2937  O OG1   . THR D 4  119 ? 82.173  99.974  113.307 1.00 97.53  ? 116 THR D OG1   1 
ATOM   2938  C CG2   . THR D 4  119 ? 80.275  98.606  113.875 1.00 102.55 ? 116 THR D CG2   1 
ATOM   2939  N N     . LYS D 4  120 ? 79.335  98.560  110.302 1.00 93.79  ? 117 LYS D N     1 
ATOM   2940  C CA    . LYS D 4  120 ? 78.137  98.038  109.689 1.00 92.75  ? 117 LYS D CA    1 
ATOM   2941  C C     . LYS D 4  120 ? 78.421  96.881  108.767 1.00 96.32  ? 117 LYS D C     1 
ATOM   2942  O O     . LYS D 4  120 ? 77.765  95.846  108.840 1.00 97.61  ? 117 LYS D O     1 
ATOM   2943  C CB    . LYS D 4  120 ? 77.456  99.110  108.874 1.00 95.15  ? 117 LYS D CB    1 
ATOM   2944  C CG    . LYS D 4  120 ? 76.258  98.613  108.120 1.00 100.88 ? 117 LYS D CG    1 
ATOM   2945  C CD    . LYS D 4  120 ? 75.593  99.730  107.353 1.00 110.71 ? 117 LYS D CD    1 
ATOM   2946  C CE    . LYS D 4  120 ? 74.416  99.218  106.536 1.00 124.27 ? 117 LYS D CE    1 
ATOM   2947  N NZ    . LYS D 4  120 ? 73.753  100.305 105.773 1.00 123.17 ? 117 LYS D NZ    1 
ATOM   2948  N N     . ALA D 4  121 ? 79.378  97.062  107.870 1.00 92.99  ? 118 ALA D N     1 
ATOM   2949  C CA    . ALA D 4  121 ? 79.622  96.060  106.853 1.00 95.27  ? 118 ALA D CA    1 
ATOM   2950  C C     . ALA D 4  121 ? 79.960  94.725  107.487 1.00 98.56  ? 118 ALA D C     1 
ATOM   2951  O O     . ALA D 4  121 ? 79.491  93.685  107.032 1.00 102.84 ? 118 ALA D O     1 
ATOM   2952  C CB    . ALA D 4  121 ? 80.735  96.516  105.926 1.00 102.46 ? 118 ALA D CB    1 
ATOM   2953  N N     . VAL D 4  122 ? 80.722  94.756  108.574 1.00 99.19  ? 119 VAL D N     1 
ATOM   2954  C CA    . VAL D 4  122 ? 81.106  93.526  109.255 1.00 102.52 ? 119 VAL D CA    1 
ATOM   2955  C C     . VAL D 4  122 ? 79.985  92.975  110.107 1.00 104.36 ? 119 VAL D C     1 
ATOM   2956  O O     . VAL D 4  122 ? 79.700  91.777  110.077 1.00 110.34 ? 119 VAL D O     1 
ATOM   2957  C CB    . VAL D 4  122 ? 82.337  93.745  110.130 1.00 103.92 ? 119 VAL D CB    1 
ATOM   2958  C CG1   . VAL D 4  122 ? 82.623  92.490  110.952 1.00 105.67 ? 119 VAL D CG1   1 
ATOM   2959  C CG2   . VAL D 4  122 ? 83.497  94.068  109.248 1.00 99.50  ? 119 VAL D CG2   1 
ATOM   2960  N N     . THR D 4  123 ? 79.342  93.846  110.870 1.00 103.43 ? 120 THR D N     1 
ATOM   2961  C CA    . THR D 4  123 ? 78.240  93.423  111.712 1.00 110.16 ? 120 THR D CA    1 
ATOM   2962  C C     . THR D 4  123 ? 77.229  92.729  110.829 1.00 108.67 ? 120 THR D C     1 
ATOM   2963  O O     . THR D 4  123 ? 76.652  91.701  111.191 1.00 113.94 ? 120 THR D O     1 
ATOM   2964  C CB    . THR D 4  123 ? 77.581  94.627  112.411 1.00 116.43 ? 120 THR D CB    1 
ATOM   2965  O OG1   . THR D 4  123 ? 78.551  95.301  113.222 1.00 116.22 ? 120 THR D OG1   1 
ATOM   2966  C CG2   . THR D 4  123 ? 76.430  94.165  113.290 1.00 117.26 ? 120 THR D CG2   1 
ATOM   2967  N N     . LYS D 4  124 ? 77.025  93.315  109.664 1.00 103.83 ? 121 LYS D N     1 
ATOM   2968  C CA    . LYS D 4  124 ? 76.135  92.789  108.668 1.00 105.66 ? 121 LYS D CA    1 
ATOM   2969  C C     . LYS D 4  124 ? 76.698  91.536  108.019 1.00 107.49 ? 121 LYS D C     1 
ATOM   2970  O O     . LYS D 4  124 ? 75.982  90.560  107.824 1.00 107.99 ? 121 LYS D O     1 
ATOM   2971  C CB    . LYS D 4  124 ? 75.925  93.845  107.612 1.00 100.61 ? 121 LYS D CB    1 
ATOM   2972  C CG    . LYS D 4  124 ? 74.917  93.512  106.595 1.00 109.65 ? 121 LYS D CG    1 
ATOM   2973  C CD    . LYS D 4  124 ? 73.548  93.496  107.196 1.00 118.17 ? 121 LYS D CD    1 
ATOM   2974  C CE    . LYS D 4  124 ? 72.490  93.517  106.125 1.00 135.99 ? 121 LYS D CE    1 
ATOM   2975  N NZ    . LYS D 4  124 ? 71.129  93.540  106.693 1.00 146.79 ? 121 LYS D NZ    1 
ATOM   2976  N N     . TYR D 4  125 ? 77.994  91.542  107.727 1.00 106.98 ? 122 TYR D N     1 
ATOM   2977  C CA    . TYR D 4  125 ? 78.634  90.440  107.022 1.00 111.57 ? 122 TYR D CA    1 
ATOM   2978  C C     . TYR D 4  125 ? 78.402  89.097  107.689 1.00 114.86 ? 122 TYR D C     1 
ATOM   2979  O O     . TYR D 4  125 ? 78.147  88.093  107.018 1.00 114.73 ? 122 TYR D O     1 
ATOM   2980  C CB    . TYR D 4  125 ? 80.122  90.672  106.882 1.00 111.08 ? 122 TYR D CB    1 
ATOM   2981  C CG    . TYR D 4  125 ? 80.789  89.626  106.082 1.00 118.01 ? 122 TYR D CG    1 
ATOM   2982  C CD1   . TYR D 4  125 ? 80.740  89.708  104.713 1.00 114.68 ? 122 TYR D CD1   1 
ATOM   2983  C CD2   . TYR D 4  125 ? 81.447  88.583  106.700 1.00 121.35 ? 122 TYR D CD2   1 
ATOM   2984  C CE1   . TYR D 4  125 ? 81.348  88.755  103.954 1.00 117.27 ? 122 TYR D CE1   1 
ATOM   2985  C CE2   . TYR D 4  125 ? 82.055  87.619  105.941 1.00 116.08 ? 122 TYR D CE2   1 
ATOM   2986  C CZ    . TYR D 4  125 ? 82.008  87.702  104.569 1.00 116.13 ? 122 TYR D CZ    1 
ATOM   2987  O OH    . TYR D 4  125 ? 82.613  86.738  103.802 1.00 122.48 ? 122 TYR D OH    1 
ATOM   2988  N N     . THR D 4  126 ? 78.517  89.072  109.010 1.00 118.67 ? 123 THR D N     1 
ATOM   2989  C CA    . THR D 4  126 ? 78.403  87.828  109.758 1.00 123.82 ? 123 THR D CA    1 
ATOM   2990  C C     . THR D 4  126 ? 76.953  87.519  110.123 1.00 124.47 ? 123 THR D C     1 
ATOM   2991  O O     . THR D 4  126 ? 76.669  86.510  110.771 1.00 127.00 ? 123 THR D O     1 
ATOM   2992  C CB    . THR D 4  126 ? 79.259  87.877  111.035 1.00 129.61 ? 123 THR D CB    1 
ATOM   2993  O OG1   . THR D 4  126 ? 78.748  88.881  111.918 1.00 123.86 ? 123 THR D OG1   1 
ATOM   2994  C CG2   . THR D 4  126 ? 80.701  88.222  110.673 1.00 123.26 ? 123 THR D CG2   1 
ATOM   2995  N N     . SER D 4  127 ? 76.045  88.408  109.745 1.00 120.09 ? 124 SER D N     1 
ATOM   2996  C CA    . SER D 4  127 ? 74.628  88.232  110.020 1.00 122.74 ? 124 SER D CA    1 
ATOM   2997  C C     . SER D 4  127 ? 73.962  87.410  108.926 1.00 123.62 ? 124 SER D C     1 
ATOM   2998  O O     . SER D 4  127 ? 74.552  87.153  107.875 1.00 122.45 ? 124 SER D O     1 
ATOM   2999  C CB    . SER D 4  127 ? 73.939  89.577  110.159 1.00 122.20 ? 124 SER D CB    1 
ATOM   3000  O OG    . SER D 4  127 ? 74.406  90.271  111.289 1.00 122.00 ? 124 SER D OG    1 
ATOM   3001  N N     . ALA D 4  128 ? 72.738  86.971  109.185 1.00 128.95 ? 125 ALA D N     1 
ATOM   3002  C CA    . ALA D 4  128 ? 71.978  86.232  108.188 1.00 137.52 ? 125 ALA D CA    1 
ATOM   3003  C C     . ALA D 4  128 ? 71.287  87.181  107.217 1.00 134.22 ? 125 ALA D C     1 
ATOM   3004  O O     . ALA D 4  128 ? 71.212  88.384  107.465 1.00 129.52 ? 125 ALA D O     1 
ATOM   3005  C CB    . ALA D 4  128 ? 70.957  85.336  108.865 1.00 142.73 ? 125 ALA D CB    1 
ATOM   3006  N N     . HIS E 5  43  ? 103.260 153.284 78.296  1.00 194.19 ? 40  HIS E N     1 
ATOM   3007  C CA    . HIS E 5  43  ? 101.922 152.800 78.611  1.00 193.01 ? 40  HIS E CA    1 
ATOM   3008  C C     . HIS E 5  43  ? 102.050 151.431 79.260  1.00 185.94 ? 40  HIS E C     1 
ATOM   3009  O O     . HIS E 5  43  ? 101.174 150.580 79.114  1.00 183.07 ? 40  HIS E O     1 
ATOM   3010  C CB    . HIS E 5  43  ? 101.036 152.829 77.364  0.00 197.88 ? 40  HIS E CB    1 
ATOM   3011  C CG    . HIS E 5  43  ? 100.795 154.205 76.844  0.00 205.15 ? 40  HIS E CG    1 
ATOM   3012  N ND1   . HIS E 5  43  ? 101.715 154.876 76.066  0.00 205.44 ? 40  HIS E ND1   1 
ATOM   3013  C CD2   . HIS E 5  43  ? 99.741  155.041 76.989  0.00 205.67 ? 40  HIS E CD2   1 
ATOM   3014  C CE1   . HIS E 5  43  ? 101.233 156.067 75.753  0.00 207.15 ? 40  HIS E CE1   1 
ATOM   3015  N NE2   . HIS E 5  43  ? 100.038 156.191 76.301  0.00 207.27 ? 40  HIS E NE2   1 
ATOM   3016  N N     . ARG E 5  44  ? 103.038 151.442 80.155  1.00 176.11 ? 41  ARG E N     1 
ATOM   3017  C CA    . ARG E 5  44  ? 103.352 150.220 80.893  1.00 173.07 ? 41  ARG E CA    1 
ATOM   3018  C C     . ARG E 5  44  ? 102.450 149.919 82.062  1.00 169.89 ? 41  ARG E C     1 
ATOM   3019  O O     . ARG E 5  44  ? 101.995 150.885 82.705  1.00 172.11 ? 41  ARG E O     1 
ATOM   3020  C CB    . ARG E 5  44  ? 104.751 150.422 81.488  0.00 159.43 ? 41  ARG E CB    1 
ATOM   3021  C CG    . ARG E 5  44  ? 105.872 150.473 80.460  0.00 155.81 ? 41  ARG E CG    1 
ATOM   3022  C CD    . ARG E 5  44  ? 107.208 150.842 81.077  0.00 142.89 ? 41  ARG E CD    1 
ATOM   3023  N NE    . ARG E 5  44  ? 107.200 152.186 81.635  0.00 137.55 ? 41  ARG E NE    1 
ATOM   3024  C CZ    . ARG E 5  44  ? 108.237 152.761 82.234  0.00 138.11 ? 41  ARG E CZ    1 
ATOM   3025  N NH1   . ARG E 5  44  ? 109.379 152.107 82.360  0.00 150.76 ? 41  ARG E NH1   1 
ATOM   3026  N NH2   . ARG E 5  44  ? 108.128 153.990 82.705  0.00 133.48 ? 41  ARG E NH2   1 
ATOM   3027  N N     . TYR E 5  45  ? 102.174 148.635 82.325  1.00 168.52 ? 42  TYR E N     1 
ATOM   3028  C CA    . TYR E 5  45  ? 101.431 148.414 83.551  1.00 167.17 ? 42  TYR E CA    1 
ATOM   3029  C C     . TYR E 5  45  ? 102.423 148.730 84.659  1.00 159.55 ? 42  TYR E C     1 
ATOM   3030  O O     . TYR E 5  45  ? 103.586 148.332 84.601  1.00 158.30 ? 42  TYR E O     1 
ATOM   3031  C CB    . TYR E 5  45  ? 100.854 147.013 83.729  1.00 163.24 ? 42  TYR E CB    1 
ATOM   3032  C CG    . TYR E 5  45  ? 99.610  146.758 82.927  1.00 165.66 ? 42  TYR E CG    1 
ATOM   3033  C CD1   . TYR E 5  45  ? 99.665  145.977 81.786  1.00 163.03 ? 42  TYR E CD1   1 
ATOM   3034  C CD2   . TYR E 5  45  ? 98.407  147.311 83.335  1.00 170.30 ? 42  TYR E CD2   1 
ATOM   3035  C CE1   . TYR E 5  45  ? 98.517  145.753 81.052  1.00 166.41 ? 42  TYR E CE1   1 
ATOM   3036  C CE2   . TYR E 5  45  ? 97.262  147.086 82.605  1.00 171.43 ? 42  TYR E CE2   1 
ATOM   3037  C CZ    . TYR E 5  45  ? 97.313  146.313 81.466  1.00 172.94 ? 42  TYR E CZ    1 
ATOM   3038  O OH    . TYR E 5  45  ? 96.172  146.106 80.727  1.00 172.74 ? 42  TYR E OH    1 
ATOM   3039  N N     . ARG E 5  46  ? 101.952 149.427 85.683  1.00 163.88 ? 43  ARG E N     1 
ATOM   3040  C CA    . ARG E 5  46  ? 102.795 149.799 86.807  1.00 160.97 ? 43  ARG E CA    1 
ATOM   3041  C C     . ARG E 5  46  ? 103.366 148.544 87.466  1.00 154.69 ? 43  ARG E C     1 
ATOM   3042  O O     . ARG E 5  46  ? 102.620 147.594 87.705  1.00 155.33 ? 43  ARG E O     1 
ATOM   3043  C CB    . ARG E 5  46  ? 101.977 150.581 87.820  1.00 161.74 ? 43  ARG E CB    1 
ATOM   3044  C CG    . ARG E 5  46  ? 102.773 151.260 88.908  1.00 157.87 ? 43  ARG E CG    1 
ATOM   3045  C CD    . ARG E 5  46  ? 101.923 152.134 89.732  1.00 161.99 ? 43  ARG E CD    1 
ATOM   3046  N NE    . ARG E 5  46  ? 100.933 151.374 90.463  1.00 166.47 ? 43  ARG E NE    1 
ATOM   3047  C CZ    . ARG E 5  46  ? 99.951  151.907 91.208  1.00 172.65 ? 43  ARG E CZ    1 
ATOM   3048  N NH1   . ARG E 5  46  ? 99.844  153.212 91.327  1.00 171.68 ? 43  ARG E NH1   1 
ATOM   3049  N NH2   . ARG E 5  46  ? 99.094  151.113 91.823  1.00 170.81 ? 43  ARG E NH2   1 
ATOM   3050  N N     . PRO E 5  47  ? 104.656 148.532 87.834  1.00 152.18 ? 44  PRO E N     1 
ATOM   3051  C CA    . PRO E 5  47  ? 105.338 147.420 88.467  1.00 144.61 ? 44  PRO E CA    1 
ATOM   3052  C C     . PRO E 5  47  ? 104.547 146.898 89.648  1.00 147.49 ? 44  PRO E C     1 
ATOM   3053  O O     . PRO E 5  47  ? 104.108 147.666 90.505  1.00 150.45 ? 44  PRO E O     1 
ATOM   3054  C CB    . PRO E 5  47  ? 106.659 148.068 88.894  1.00 142.04 ? 44  PRO E CB    1 
ATOM   3055  C CG    . PRO E 5  47  ? 106.908 149.121 87.835  1.00 146.83 ? 44  PRO E CG    1 
ATOM   3056  C CD    . PRO E 5  47  ? 105.536 149.667 87.496  1.00 154.41 ? 44  PRO E CD    1 
ATOM   3057  N N     . GLY E 5  48  ? 104.383 145.579 89.691  1.00 141.27 ? 45  GLY E N     1 
ATOM   3058  C CA    . GLY E 5  48  ? 103.606 144.916 90.725  1.00 141.53 ? 45  GLY E CA    1 
ATOM   3059  C C     . GLY E 5  48  ? 102.233 144.519 90.193  1.00 139.20 ? 45  GLY E C     1 
ATOM   3060  O O     . GLY E 5  48  ? 101.611 143.584 90.700  1.00 135.63 ? 45  GLY E O     1 
ATOM   3061  N N     . THR E 5  49  ? 101.804 145.165 89.109  1.00 141.02 ? 46  THR E N     1 
ATOM   3062  C CA    . THR E 5  49  ? 100.516 144.855 88.502  1.00 138.80 ? 46  THR E CA    1 
ATOM   3063  C C     . THR E 5  49  ? 100.573 143.524 87.784  1.00 132.53 ? 46  THR E C     1 
ATOM   3064  O O     . THR E 5  49  ? 99.691  142.677 87.938  1.00 132.66 ? 46  THR E O     1 
ATOM   3065  C CB    . THR E 5  49  ? 100.118 145.931 87.481  1.00 146.98 ? 46  THR E CB    1 
ATOM   3066  O OG1   . THR E 5  49  ? 100.028 147.198 88.128  1.00 150.58 ? 46  THR E OG1   1 
ATOM   3067  C CG2   . THR E 5  49  ? 98.779  145.591 86.843  1.00 145.22 ? 46  THR E CG2   1 
ATOM   3068  N N     . VAL E 5  50  ? 101.606 143.357 86.973  1.00 133.53 ? 47  VAL E N     1 
ATOM   3069  C CA    . VAL E 5  50  ? 101.754 142.148 86.193  1.00 129.19 ? 47  VAL E CA    1 
ATOM   3070  C C     . VAL E 5  50  ? 102.153 141.014 87.109  1.00 127.10 ? 47  VAL E C     1 
ATOM   3071  O O     . VAL E 5  50  ? 101.581 139.931 87.049  1.00 123.03 ? 47  VAL E O     1 
ATOM   3072  C CB    . VAL E 5  50  ? 102.797 142.339 85.088  1.00 126.70 ? 47  VAL E CB    1 
ATOM   3073  C CG1   . VAL E 5  50  ? 103.015 141.034 84.336  1.00 132.72 ? 47  VAL E CG1   1 
ATOM   3074  C CG2   . VAL E 5  50  ? 102.348 143.452 84.163  1.00 133.54 ? 47  VAL E CG2   1 
ATOM   3075  N N     . ALA E 5  51  ? 103.090 141.284 88.010  1.00 127.78 ? 48  ALA E N     1 
ATOM   3076  C CA    . ALA E 5  51  ? 103.531 140.258 88.941  1.00 124.73 ? 48  ALA E CA    1 
ATOM   3077  C C     . ALA E 5  51  ? 102.360 139.686 89.728  1.00 123.48 ? 48  ALA E C     1 
ATOM   3078  O O     . ALA E 5  51  ? 102.247 138.469 89.882  1.00 120.24 ? 48  ALA E O     1 
ATOM   3079  C CB    . ALA E 5  51  ? 104.557 140.830 89.903  1.00 121.29 ? 48  ALA E CB    1 
ATOM   3080  N N     . LEU E 5  52  ? 101.437 140.545 90.148  1.00 132.67 ? 49  LEU E N     1 
ATOM   3081  C CA    . LEU E 5  52  ? 100.282 140.066 90.889  1.00 126.02 ? 49  LEU E CA    1 
ATOM   3082  C C     . LEU E 5  52  ? 99.387  139.232 89.984  1.00 123.85 ? 49  LEU E C     1 
ATOM   3083  O O     . LEU E 5  52  ? 98.860  138.192 90.392  1.00 123.32 ? 49  LEU E O     1 
ATOM   3084  C CB    . LEU E 5  52  ? 99.504  141.245 91.478  1.00 131.82 ? 49  LEU E CB    1 
ATOM   3085  C CG    . LEU E 5  52  ? 98.276  140.902 92.350  1.00 137.16 ? 49  LEU E CG    1 
ATOM   3086  C CD1   . LEU E 5  52  ? 98.697  140.053 93.562  1.00 138.89 ? 49  LEU E CD1   1 
ATOM   3087  C CD2   . LEU E 5  52  ? 97.630  142.194 92.804  1.00 148.26 ? 49  LEU E CD2   1 
ATOM   3088  N N     . ARG E 5  53  ? 99.213  139.687 88.749  1.00 123.77 ? 50  ARG E N     1 
ATOM   3089  C CA    . ARG E 5  53  ? 98.402  138.957 87.791  1.00 123.39 ? 50  ARG E CA    1 
ATOM   3090  C C     . ARG E 5  53  ? 99.011  137.604 87.455  1.00 120.88 ? 50  ARG E C     1 
ATOM   3091  O O     . ARG E 5  53  ? 98.292  136.623 87.258  1.00 119.56 ? 50  ARG E O     1 
ATOM   3092  C CB    . ARG E 5  53  ? 98.220  139.753 86.521  1.00 124.77 ? 50  ARG E CB    1 
ATOM   3093  C CG    . ARG E 5  53  ? 97.267  139.118 85.552  1.00 131.30 ? 50  ARG E CG    1 
ATOM   3094  C CD    . ARG E 5  53  ? 96.822  140.048 84.503  1.00 134.56 ? 50  ARG E CD    1 
ATOM   3095  N NE    . ARG E 5  53  ? 97.884  140.392 83.587  1.00 134.32 ? 50  ARG E NE    1 
ATOM   3096  C CZ    . ARG E 5  53  ? 98.503  141.580 83.526  1.00 139.06 ? 50  ARG E CZ    1 
ATOM   3097  N NH1   . ARG E 5  53  ? 98.192  142.546 84.364  1.00 141.95 ? 50  ARG E NH1   1 
ATOM   3098  N NH2   . ARG E 5  53  ? 99.424  141.774 82.607  1.00 141.15 ? 50  ARG E NH2   1 
ATOM   3099  N N     . GLU E 5  54  ? 100.330 137.560 87.351  1.00 120.05 ? 51  GLU E N     1 
ATOM   3100  C CA    . GLU E 5  54  ? 101.015 136.323 87.032  1.00 117.67 ? 51  GLU E CA    1 
ATOM   3101  C C     . GLU E 5  54  ? 100.885 135.320 88.163  1.00 126.11 ? 51  GLU E C     1 
ATOM   3102  O O     . GLU E 5  54  ? 100.588 134.152 87.916  1.00 117.51 ? 51  GLU E O     1 
ATOM   3103  C CB    . GLU E 5  54  ? 102.470 136.592 86.674  1.00 117.61 ? 51  GLU E CB    1 
ATOM   3104  C CG    . GLU E 5  54  ? 102.642 137.229 85.303  1.00 125.79 ? 51  GLU E CG    1 
ATOM   3105  C CD    . GLU E 5  54  ? 102.196 136.324 84.181  1.00 128.23 ? 51  GLU E CD    1 
ATOM   3106  O OE1   . GLU E 5  54  ? 101.072 136.453 83.759  1.00 127.75 ? 51  GLU E OE1   1 
ATOM   3107  O OE2   . GLU E 5  54  ? 103.001 135.565 83.689  1.00 128.46 ? 51  GLU E OE2   1 
ATOM   3108  N N     . ILE E 5  55  ? 100.893 135.801 89.406  1.00 118.58 ? 52  ILE E N     1 
ATOM   3109  C CA    . ILE E 5  55  ? 100.642 134.893 90.514  1.00 113.08 ? 52  ILE E CA    1 
ATOM   3110  C C     . ILE E 5  55  ? 99.286  134.252 90.309  1.00 118.44 ? 52  ILE E C     1 
ATOM   3111  O O     . ILE E 5  55  ? 99.140  133.034 90.397  1.00 117.63 ? 52  ILE E O     1 
ATOM   3112  C CB    . ILE E 5  55  ? 100.625 135.617 91.877  1.00 115.36 ? 52  ILE E CB    1 
ATOM   3113  C CG1   . ILE E 5  55  ? 102.027 136.107 92.254  1.00 109.24 ? 52  ILE E CG1   1 
ATOM   3114  C CG2   . ILE E 5  55  ? 100.054 134.691 92.950  1.00 118.25 ? 52  ILE E CG2   1 
ATOM   3115  C CD1   . ILE E 5  55  ? 102.058 137.063 93.424  1.00 111.65 ? 52  ILE E CD1   1 
ATOM   3116  N N     . ARG E 5  56  ? 98.301  135.075 89.983  1.00 118.26 ? 53  ARG E N     1 
ATOM   3117  C CA    . ARG E 5  56  ? 96.962  134.575 89.756  1.00 119.38 ? 53  ARG E CA    1 
ATOM   3118  C C     . ARG E 5  56  ? 96.920  133.532 88.653  1.00 116.06 ? 53  ARG E C     1 
ATOM   3119  O O     . ARG E 5  56  ? 96.233  132.519 88.777  1.00 116.44 ? 53  ARG E O     1 
ATOM   3120  C CB    . ARG E 5  56  ? 96.036  135.714 89.388  1.00 124.86 ? 53  ARG E CB    1 
ATOM   3121  C CG    . ARG E 5  56  ? 94.621  135.317 89.123  1.00 131.67 ? 53  ARG E CG    1 
ATOM   3122  C CD    . ARG E 5  56  ? 93.780  136.495 88.876  1.00 135.34 ? 53  ARG E CD    1 
ATOM   3123  N NE    . ARG E 5  56  ? 92.420  136.123 88.577  1.00 145.44 ? 53  ARG E NE    1 
ATOM   3124  C CZ    . ARG E 5  56  ? 91.970  135.801 87.352  1.00 151.92 ? 53  ARG E CZ    1 
ATOM   3125  N NH1   . ARG E 5  56  ? 92.788  135.812 86.324  1.00 150.02 ? 53  ARG E NH1   1 
ATOM   3126  N NH2   . ARG E 5  56  ? 90.703  135.477 87.181  1.00 153.53 ? 53  ARG E NH2   1 
ATOM   3127  N N     . ARG E 5  57  ? 97.631  133.788 87.563  1.00 114.87 ? 54  ARG E N     1 
ATOM   3128  C CA    . ARG E 5  57  ? 97.604  132.879 86.428  1.00 114.56 ? 54  ARG E CA    1 
ATOM   3129  C C     . ARG E 5  57  ? 98.319  131.565 86.706  1.00 112.99 ? 54  ARG E C     1 
ATOM   3130  O O     . ARG E 5  57  ? 97.830  130.496 86.338  1.00 113.44 ? 54  ARG E O     1 
ATOM   3131  C CB    . ARG E 5  57  ? 98.214  133.527 85.212  1.00 116.76 ? 54  ARG E CB    1 
ATOM   3132  C CG    . ARG E 5  57  ? 98.038  132.734 83.939  1.00 122.52 ? 54  ARG E CG    1 
ATOM   3133  C CD    . ARG E 5  57  ? 98.369  133.538 82.741  1.00 127.25 ? 54  ARG E CD    1 
ATOM   3134  N NE    . ARG E 5  57  ? 99.791  133.790 82.630  1.00 129.06 ? 54  ARG E NE    1 
ATOM   3135  C CZ    . ARG E 5  57  ? 100.672 132.937 82.081  1.00 128.21 ? 54  ARG E CZ    1 
ATOM   3136  N NH1   . ARG E 5  57  ? 100.260 131.791 81.586  1.00 128.77 ? 54  ARG E NH1   1 
ATOM   3137  N NH2   . ARG E 5  57  ? 101.950 133.251 82.031  1.00 126.82 ? 54  ARG E NH2   1 
ATOM   3138  N N     . TYR E 5  58  ? 99.452  131.630 87.386  1.00 111.35 ? 55  TYR E N     1 
ATOM   3139  C CA    . TYR E 5  58  ? 100.212 130.420 87.649  1.00 110.01 ? 55  TYR E CA    1 
ATOM   3140  C C     . TYR E 5  58  ? 99.533  129.575 88.708  1.00 110.11 ? 55  TYR E C     1 
ATOM   3141  O O     . TYR E 5  58  ? 99.703  128.358 88.744  1.00 109.05 ? 55  TYR E O     1 
ATOM   3142  C CB    . TYR E 5  58  ? 101.658 130.736 88.000  1.00 108.55 ? 55  TYR E CB    1 
ATOM   3143  C CG    . TYR E 5  58  ? 102.418 131.242 86.817  1.00 112.38 ? 55  TYR E CG    1 
ATOM   3144  C CD1   . TYR E 5  58  ? 102.928 132.519 86.816  1.00 114.02 ? 55  TYR E CD1   1 
ATOM   3145  C CD2   . TYR E 5  58  ? 102.527 130.450 85.690  1.00 116.31 ? 55  TYR E CD2   1 
ATOM   3146  C CE1   . TYR E 5  58  ? 103.542 133.006 85.688  1.00 118.29 ? 55  TYR E CE1   1 
ATOM   3147  C CE2   . TYR E 5  58  ? 103.136 130.940 84.565  1.00 113.97 ? 55  TYR E CE2   1 
ATOM   3148  C CZ    . TYR E 5  58  ? 103.632 132.216 84.560  1.00 119.03 ? 55  TYR E CZ    1 
ATOM   3149  O OH    . TYR E 5  58  ? 104.219 132.721 83.426  1.00 117.40 ? 55  TYR E OH    1 
ATOM   3150  N N     . GLN E 5  59  ? 98.678  130.197 89.505  1.00 111.54 ? 56  GLN E N     1 
ATOM   3151  C CA    . GLN E 5  59  ? 97.884  129.455 90.468  1.00 113.52 ? 56  GLN E CA    1 
ATOM   3152  C C     . GLN E 5  59  ? 96.648  128.851 89.815  1.00 113.96 ? 56  GLN E C     1 
ATOM   3153  O O     . GLN E 5  59  ? 95.828  128.226 90.484  1.00 114.33 ? 56  GLN E O     1 
ATOM   3154  C CB    . GLN E 5  59  ? 97.454  130.344 91.623  1.00 116.57 ? 56  GLN E CB    1 
ATOM   3155  C CG    . GLN E 5  59  ? 98.574  130.819 92.505  1.00 113.93 ? 56  GLN E CG    1 
ATOM   3156  C CD    . GLN E 5  59  ? 98.089  131.787 93.545  1.00 121.01 ? 56  GLN E CD    1 
ATOM   3157  O OE1   . GLN E 5  59  ? 97.049  132.427 93.369  1.00 125.25 ? 56  GLN E OE1   1 
ATOM   3158  N NE2   . GLN E 5  59  ? 98.807  131.867 94.656  1.00 119.63 ? 56  GLN E NE2   1 
ATOM   3159  N N     . LYS E 5  60  ? 96.481  129.090 88.520  1.00 112.77 ? 57  LYS E N     1 
ATOM   3160  C CA    . LYS E 5  60  ? 95.347  128.563 87.782  1.00 111.79 ? 57  LYS E CA    1 
ATOM   3161  C C     . LYS E 5  60  ? 95.771  127.406 86.890  1.00 112.00 ? 57  LYS E C     1 
ATOM   3162  O O     . LYS E 5  60  ? 95.043  126.423 86.741  1.00 116.11 ? 57  LYS E O     1 
ATOM   3163  C CB    . LYS E 5  60  ? 94.724  129.661 86.934  1.00 113.59 ? 57  LYS E CB    1 
ATOM   3164  C CG    . LYS E 5  60  ? 93.478  129.254 86.200  1.00 118.97 ? 57  LYS E CG    1 
ATOM   3165  C CD    . LYS E 5  60  ? 92.875  130.433 85.455  1.00 128.28 ? 57  LYS E CD    1 
ATOM   3166  C CE    . LYS E 5  60  ? 91.605  130.031 84.723  1.00 139.88 ? 57  LYS E CE    1 
ATOM   3167  N NZ    . LYS E 5  60  ? 91.053  131.145 83.901  1.00 135.53 ? 57  LYS E NZ    1 
ATOM   3168  N N     . SER E 5  61  ? 96.951  127.533 86.298  1.00 110.51 ? 58  SER E N     1 
ATOM   3169  C CA    . SER E 5  61  ? 97.467  126.524 85.385  1.00 111.36 ? 58  SER E CA    1 
ATOM   3170  C C     . SER E 5  61  ? 97.973  125.290 86.128  1.00 112.00 ? 58  SER E C     1 
ATOM   3171  O O     . SER E 5  61  ? 98.109  125.291 87.353  1.00 110.10 ? 58  SER E O     1 
ATOM   3172  C CB    . SER E 5  61  ? 98.571  127.121 84.531  1.00 115.94 ? 58  SER E CB    1 
ATOM   3173  O OG    . SER E 5  61  ? 99.706  127.428 85.294  1.00 114.31 ? 58  SER E OG    1 
ATOM   3174  N N     . THR E 5  62  ? 98.163  124.202 85.387  1.00 113.72 ? 59  THR E N     1 
ATOM   3175  C CA    . THR E 5  62  ? 98.692  122.962 85.943  1.00 111.53 ? 59  THR E CA    1 
ATOM   3176  C C     . THR E 5  62  ? 99.931  122.547 85.175  1.00 112.41 ? 59  THR E C     1 
ATOM   3177  O O     . THR E 5  62  ? 100.619 121.591 85.534  1.00 110.64 ? 59  THR E O     1 
ATOM   3178  C CB    . THR E 5  62  ? 97.654  121.831 85.890  1.00 111.40 ? 59  THR E CB    1 
ATOM   3179  O OG1   . THR E 5  62  ? 97.282  121.588 84.529  1.00 112.40 ? 59  THR E OG1   1 
ATOM   3180  C CG2   . THR E 5  62  ? 96.423  122.199 86.694  1.00 113.30 ? 59  THR E CG2   1 
ATOM   3181  N N     . GLU E 5  63  ? 100.208 123.293 84.119  1.00 113.47 ? 60  GLU E N     1 
ATOM   3182  C CA    . GLU E 5  63  ? 101.312 123.019 83.218  1.00 111.02 ? 60  GLU E CA    1 
ATOM   3183  C C     . GLU E 5  63  ? 102.656 123.118 83.916  1.00 107.82 ? 60  GLU E C     1 
ATOM   3184  O O     . GLU E 5  63  ? 102.819 123.864 84.884  1.00 107.20 ? 60  GLU E O     1 
ATOM   3185  C CB    . GLU E 5  63  ? 101.280 123.985 82.036  1.00 115.17 ? 60  GLU E CB    1 
ATOM   3186  C CG    . GLU E 5  63  ? 100.126 123.767 81.061  1.00 122.91 ? 60  GLU E CG    1 
ATOM   3187  C CD    . GLU E 5  63  ? 98.856  124.474 81.455  1.00 127.36 ? 60  GLU E CD    1 
ATOM   3188  O OE1   . GLU E 5  63  ? 98.517  124.468 82.620  1.00 120.35 ? 60  GLU E OE1   1 
ATOM   3189  O OE2   . GLU E 5  63  ? 98.232  125.043 80.591  1.00 132.23 ? 60  GLU E OE2   1 
ATOM   3190  N N     . LEU E 5  64  ? 103.616 122.347 83.419  1.00 105.53 ? 61  LEU E N     1 
ATOM   3191  C CA    . LEU E 5  64  ? 104.982 122.404 83.915  1.00 102.78 ? 61  LEU E CA    1 
ATOM   3192  C C     . LEU E 5  64  ? 105.613 123.731 83.531  1.00 101.18 ? 61  LEU E C     1 
ATOM   3193  O O     . LEU E 5  64  ? 105.273 124.315 82.501  1.00 102.82 ? 61  LEU E O     1 
ATOM   3194  C CB    . LEU E 5  64  ? 105.798 121.244 83.336  1.00 103.29 ? 61  LEU E CB    1 
ATOM   3195  C CG    . LEU E 5  64  ? 105.367 119.822 83.768  1.00 104.68 ? 61  LEU E CG    1 
ATOM   3196  C CD1   . LEU E 5  64  ? 106.131 118.793 82.941  1.00 108.89 ? 61  LEU E CD1   1 
ATOM   3197  C CD2   . LEU E 5  64  ? 105.649 119.624 85.256  1.00 100.59 ? 61  LEU E CD2   1 
ATOM   3198  N N     . LEU E 5  65  ? 106.459 124.250 84.408  1.00 95.83  ? 62  LEU E N     1 
ATOM   3199  C CA    . LEU E 5  65  ? 107.074 125.550 84.197  1.00 91.99  ? 62  LEU E CA    1 
ATOM   3200  C C     . LEU E 5  65  ? 108.534 125.412 83.780  1.00 91.86  ? 62  LEU E C     1 
ATOM   3201  O O     . LEU E 5  65  ? 109.065 126.246 83.044  1.00 96.79  ? 62  LEU E O     1 
ATOM   3202  C CB    . LEU E 5  65  ? 106.925 126.375 85.475  1.00 95.63  ? 62  LEU E CB    1 
ATOM   3203  C CG    . LEU E 5  65  ? 105.453 126.564 85.960  1.00 99.90  ? 62  LEU E CG    1 
ATOM   3204  C CD1   . LEU E 5  65  ? 105.446 127.302 87.277  1.00 104.00 ? 62  LEU E CD1   1 
ATOM   3205  C CD2   . LEU E 5  65  ? 104.640 127.324 84.920  1.00 104.09 ? 62  LEU E CD2   1 
ATOM   3206  N N     . ILE E 5  66  ? 109.174 124.344 84.239  1.00 89.91  ? 63  ILE E N     1 
ATOM   3207  C CA    . ILE E 5  66  ? 110.558 124.073 83.877  1.00 88.22  ? 63  ILE E CA    1 
ATOM   3208  C C     . ILE E 5  66  ? 110.609 123.339 82.543  1.00 91.03  ? 63  ILE E C     1 
ATOM   3209  O O     . ILE E 5  66  ? 109.903 122.351 82.340  1.00 95.98  ? 63  ILE E O     1 
ATOM   3210  C CB    . ILE E 5  66  ? 111.281 123.245 84.958  1.00 89.44  ? 63  ILE E CB    1 
ATOM   3211  C CG1   . ILE E 5  66  ? 111.368 124.028 86.274  1.00 91.37  ? 63  ILE E CG1   1 
ATOM   3212  C CG2   . ILE E 5  66  ? 112.666 122.852 84.473  1.00 91.07  ? 63  ILE E CG2   1 
ATOM   3213  C CD1   . ILE E 5  66  ? 111.833 123.194 87.460  1.00 96.55  ? 63  ILE E CD1   1 
ATOM   3214  N N     . ARG E 5  67  ? 111.463 123.806 81.640  1.00 91.37  ? 64  ARG E N     1 
ATOM   3215  C CA    . ARG E 5  67  ? 111.581 123.189 80.326  1.00 97.01  ? 64  ARG E CA    1 
ATOM   3216  C C     . ARG E 5  67  ? 112.020 121.745 80.455  1.00 94.57  ? 64  ARG E C     1 
ATOM   3217  O O     . ARG E 5  67  ? 112.890 121.420 81.265  1.00 91.12  ? 64  ARG E O     1 
ATOM   3218  C CB    . ARG E 5  67  ? 112.587 123.935 79.489  1.00 98.85  ? 64  ARG E CB    1 
ATOM   3219  C CG    . ARG E 5  67  ? 112.257 125.369 79.217  1.00 100.24 ? 64  ARG E CG    1 
ATOM   3220  C CD    . ARG E 5  67  ? 111.169 125.497 78.265  1.00 102.28 ? 64  ARG E CD    1 
ATOM   3221  N NE    . ARG E 5  67  ? 109.903 125.438 78.916  1.00 104.22 ? 64  ARG E NE    1 
ATOM   3222  C CZ    . ARG E 5  67  ? 108.742 125.253 78.290  1.00 111.63 ? 64  ARG E CZ    1 
ATOM   3223  N NH1   . ARG E 5  67  ? 108.716 125.111 76.988  1.00 111.68 ? 64  ARG E NH1   1 
ATOM   3224  N NH2   . ARG E 5  67  ? 107.622 125.216 78.985  1.00 110.91 ? 64  ARG E NH2   1 
ATOM   3225  N N     . LYS E 5  68  ? 111.437 120.883 79.632  1.00 94.69  ? 65  LYS E N     1 
ATOM   3226  C CA    . LYS E 5  68  ? 111.638 119.457 79.807  1.00 93.75  ? 65  LYS E CA    1 
ATOM   3227  C C     . LYS E 5  68  ? 113.040 118.974 79.483  1.00 92.40  ? 65  LYS E C     1 
ATOM   3228  O O     . LYS E 5  68  ? 113.636 118.239 80.270  1.00 88.15  ? 65  LYS E O     1 
ATOM   3229  C CB    . LYS E 5  68  ? 110.633 118.692 78.968  1.00 95.00  ? 65  LYS E CB    1 
ATOM   3230  C CG    . LYS E 5  68  ? 109.208 118.800 79.460  1.00 99.07  ? 65  LYS E CG    1 
ATOM   3231  C CD    . LYS E 5  68  ? 108.274 117.944 78.612  1.00 108.88 ? 65  LYS E CD    1 
ATOM   3232  C CE    . LYS E 5  68  ? 106.825 118.048 79.073  1.00 113.89 ? 65  LYS E CE    1 
ATOM   3233  N NZ    . LYS E 5  68  ? 105.905 117.236 78.219  1.00 108.92 ? 65  LYS E NZ    1 
ATOM   3234  N N     . LEU E 5  69  ? 113.581 119.374 78.340  1.00 91.61  ? 66  LEU E N     1 
ATOM   3235  C CA    . LEU E 5  69  ? 114.894 118.864 77.990  1.00 89.40  ? 66  LEU E CA    1 
ATOM   3236  C C     . LEU E 5  69  ? 115.990 119.298 78.959  1.00 89.97  ? 66  LEU E C     1 
ATOM   3237  O O     . LEU E 5  69  ? 116.783 118.455 79.378  1.00 86.38  ? 66  LEU E O     1 
ATOM   3238  C CB    . LEU E 5  69  ? 115.235 119.147 76.521  1.00 92.25  ? 66  LEU E CB    1 
ATOM   3239  C CG    . LEU E 5  69  ? 114.552 118.238 75.492  1.00 99.24  ? 66  LEU E CG    1 
ATOM   3240  C CD1   . LEU E 5  69  ? 114.788 118.806 74.107  1.00 111.14 ? 66  LEU E CD1   1 
ATOM   3241  C CD2   . LEU E 5  69  ? 115.116 116.813 75.586  1.00 106.47 ? 66  LEU E CD2   1 
ATOM   3242  N N     . PRO E 5  70  ? 116.099 120.586 79.306  1.00 89.99  ? 67  PRO E N     1 
ATOM   3243  C CA    . PRO E 5  70  ? 116.994 121.101 80.318  1.00 86.97  ? 67  PRO E CA    1 
ATOM   3244  C C     . PRO E 5  70  ? 116.842 120.367 81.637  1.00 85.62  ? 67  PRO E C     1 
ATOM   3245  O O     . PRO E 5  70  ? 117.836 119.986 82.257  1.00 87.48  ? 67  PRO E O     1 
ATOM   3246  C CB    . PRO E 5  70  ? 116.549 122.556 80.411  1.00 89.44  ? 67  PRO E CB    1 
ATOM   3247  C CG    . PRO E 5  70  ? 116.096 122.876 79.022  1.00 94.16  ? 67  PRO E CG    1 
ATOM   3248  C CD    . PRO E 5  70  ? 115.408 121.628 78.545  1.00 93.69  ? 67  PRO E CD    1 
ATOM   3249  N N     . PHE E 5  71  ? 115.601 120.077 82.021  1.00 85.05  ? 68  PHE E N     1 
ATOM   3250  C CA    . PHE E 5  71  ? 115.377 119.358 83.259  1.00 85.10  ? 68  PHE E CA    1 
ATOM   3251  C C     . PHE E 5  71  ? 115.966 117.969 83.172  1.00 84.80  ? 68  PHE E C     1 
ATOM   3252  O O     . PHE E 5  71  ? 116.682 117.529 84.071  1.00 82.70  ? 68  PHE E O     1 
ATOM   3253  C CB    . PHE E 5  71  ? 113.895 119.252 83.582  1.00 85.73  ? 68  PHE E CB    1 
ATOM   3254  C CG    . PHE E 5  71  ? 113.644 118.528 84.848  1.00 81.97  ? 68  PHE E CG    1 
ATOM   3255  C CD1   . PHE E 5  71  ? 113.813 119.161 86.063  1.00 83.05  ? 68  PHE E CD1   1 
ATOM   3256  C CD2   . PHE E 5  71  ? 113.278 117.201 84.836  1.00 86.21  ? 68  PHE E CD2   1 
ATOM   3257  C CE1   . PHE E 5  71  ? 113.615 118.481 87.239  1.00 86.77  ? 68  PHE E CE1   1 
ATOM   3258  C CE2   . PHE E 5  71  ? 113.086 116.516 86.011  1.00 90.38  ? 68  PHE E CE2   1 
ATOM   3259  C CZ    . PHE E 5  71  ? 113.256 117.158 87.212  1.00 88.84  ? 68  PHE E CZ    1 
ATOM   3260  N N     . GLN E 5  72  ? 115.668 117.277 82.082  1.00 84.37  ? 69  GLN E N     1 
ATOM   3261  C CA    . GLN E 5  72  ? 116.139 115.919 81.921  1.00 85.98  ? 69  GLN E CA    1 
ATOM   3262  C C     . GLN E 5  72  ? 117.650 115.866 81.982  1.00 85.46  ? 69  GLN E C     1 
ATOM   3263  O O     . GLN E 5  72  ? 118.227 114.959 82.584  1.00 83.87  ? 69  GLN E O     1 
ATOM   3264  C CB    . GLN E 5  72  ? 115.683 115.342 80.590  1.00 84.67  ? 69  GLN E CB    1 
ATOM   3265  C CG    . GLN E 5  72  ? 116.047 113.892 80.423  1.00 90.53  ? 69  GLN E CG    1 
ATOM   3266  C CD    . GLN E 5  72  ? 115.734 113.361 79.064  1.00 94.49  ? 69  GLN E CD    1 
ATOM   3267  O OE1   . GLN E 5  72  ? 116.571 112.675 78.468  1.00 95.85  ? 69  GLN E OE1   1 
ATOM   3268  N NE2   . GLN E 5  72  ? 114.547 113.660 78.551  1.00 93.87  ? 69  GLN E NE2   1 
ATOM   3269  N N     . ARG E 5  73  ? 118.298 116.829 81.345  1.00 81.77  ? 70  ARG E N     1 
ATOM   3270  C CA    . ARG E 5  73  ? 119.744 116.832 81.328  1.00 85.69  ? 70  ARG E CA    1 
ATOM   3271  C C     . ARG E 5  73  ? 120.312 117.027 82.719  1.00 86.76  ? 70  ARG E C     1 
ATOM   3272  O O     . ARG E 5  73  ? 121.275 116.360 83.097  1.00 85.95  ? 70  ARG E O     1 
ATOM   3273  C CB    . ARG E 5  73  ? 120.277 117.900 80.413  1.00 87.60  ? 70  ARG E CB    1 
ATOM   3274  C CG    . ARG E 5  73  ? 120.046 117.642 78.959  1.00 90.87  ? 70  ARG E CG    1 
ATOM   3275  C CD    . ARG E 5  73  ? 120.921 118.472 78.122  1.00 94.95  ? 70  ARG E CD    1 
ATOM   3276  N NE    . ARG E 5  73  ? 120.670 119.885 78.278  1.00 96.51  ? 70  ARG E NE    1 
ATOM   3277  C CZ    . ARG E 5  73  ? 119.838 120.623 77.513  1.00 98.78  ? 70  ARG E CZ    1 
ATOM   3278  N NH1   . ARG E 5  73  ? 119.165 120.070 76.530  1.00 98.12  ? 70  ARG E NH1   1 
ATOM   3279  N NH2   . ARG E 5  73  ? 119.728 121.921 77.737  1.00 98.91  ? 70  ARG E NH2   1 
ATOM   3280  N N     . LEU E 5  74  ? 119.685 117.898 83.501  1.00 86.37  ? 71  LEU E N     1 
ATOM   3281  C CA    . LEU E 5  74  ? 120.127 118.125 84.866  1.00 86.77  ? 71  LEU E CA    1 
ATOM   3282  C C     . LEU E 5  74  ? 120.034 116.841 85.668  1.00 87.11  ? 71  LEU E C     1 
ATOM   3283  O O     . LEU E 5  74  ? 120.947 116.502 86.423  1.00 86.14  ? 71  LEU E O     1 
ATOM   3284  C CB    . LEU E 5  74  ? 119.286 119.227 85.519  1.00 86.05  ? 71  LEU E CB    1 
ATOM   3285  C CG    . LEU E 5  74  ? 119.594 119.550 86.991  1.00 89.95  ? 71  LEU E CG    1 
ATOM   3286  C CD1   . LEU E 5  74  ? 121.042 119.986 87.146  1.00 96.10  ? 71  LEU E CD1   1 
ATOM   3287  C CD2   . LEU E 5  74  ? 118.650 120.652 87.453  1.00 93.35  ? 71  LEU E CD2   1 
ATOM   3288  N N     . VAL E 5  75  ? 118.958 116.094 85.460  1.00 83.36  ? 72  VAL E N     1 
ATOM   3289  C CA    . VAL E 5  75  ? 118.784 114.837 86.164  1.00 85.57  ? 72  VAL E CA    1 
ATOM   3290  C C     . VAL E 5  75  ? 119.916 113.885 85.833  1.00 85.94  ? 72  VAL E C     1 
ATOM   3291  O O     . VAL E 5  75  ? 120.517 113.288 86.726  1.00 86.22  ? 72  VAL E O     1 
ATOM   3292  C CB    . VAL E 5  75  ? 117.444 114.186 85.772  1.00 83.43  ? 72  VAL E CB    1 
ATOM   3293  C CG1   . VAL E 5  75  ? 117.349 112.756 86.307  1.00 87.41  ? 72  VAL E CG1   1 
ATOM   3294  C CG2   . VAL E 5  75  ? 116.304 115.027 86.307  1.00 90.13  ? 72  VAL E CG2   1 
ATOM   3295  N N     . ARG E 5  76  ? 120.242 113.785 84.555  1.00 83.14  ? 73  ARG E N     1 
ATOM   3296  C CA    . ARG E 5  76  ? 121.294 112.885 84.127  1.00 86.28  ? 73  ARG E CA    1 
ATOM   3297  C C     . ARG E 5  76  ? 122.693 113.165 84.643  1.00 87.15  ? 73  ARG E C     1 
ATOM   3298  O O     . ARG E 5  76  ? 123.373 112.263 85.133  1.00 88.10  ? 73  ARG E O     1 
ATOM   3299  C CB    . ARG E 5  76  ? 121.349 112.843 82.625  1.00 85.95  ? 73  ARG E CB    1 
ATOM   3300  C CG    . ARG E 5  76  ? 120.172 112.179 81.989  1.00 89.91  ? 73  ARG E CG    1 
ATOM   3301  C CD    . ARG E 5  76  ? 120.275 112.191 80.518  1.00 94.56  ? 73  ARG E CD    1 
ATOM   3302  N NE    . ARG E 5  76  ? 119.075 111.690 79.888  1.00 95.28  ? 73  ARG E NE    1 
ATOM   3303  C CZ    . ARG E 5  76  ? 118.769 110.402 79.766  1.00 99.66  ? 73  ARG E CZ    1 
ATOM   3304  N NH1   . ARG E 5  76  ? 119.564 109.485 80.251  1.00 101.22 ? 73  ARG E NH1   1 
ATOM   3305  N NH2   . ARG E 5  76  ? 117.665 110.060 79.157  1.00 98.79  ? 73  ARG E NH2   1 
ATOM   3306  N N     . GLU E 5  77  ? 123.114 114.430 84.526  1.00 87.76  ? 74  GLU E N     1 
ATOM   3307  C CA    . GLU E 5  77  ? 124.448 114.872 85.024  1.00 93.13  ? 74  GLU E CA    1 
ATOM   3308  C C     . GLU E 5  77  ? 124.604 114.596 86.537  1.00 92.90  ? 74  GLU E C     1 
ATOM   3309  O O     . GLU E 5  77  ? 125.703 114.212 86.983  1.00 95.80  ? 74  GLU E O     1 
ATOM   3310  C CB    . GLU E 5  77  ? 124.599 116.382 84.831  1.00 100.83 ? 74  GLU E CB    1 
ATOM   3311  C CG    . GLU E 5  77  ? 125.960 116.910 85.246  1.00 115.05 ? 74  GLU E CG    1 
ATOM   3312  C CD    . GLU E 5  77  ? 126.132 117.117 86.741  0.00 115.95 ? 74  GLU E CD    1 
ATOM   3313  O OE1   . GLU E 5  77  ? 125.111 117.314 87.430  0.00 107.66 ? 74  GLU E OE1   1 
ATOM   3314  O OE2   . GLU E 5  77  ? 127.286 117.082 87.212  0.00 113.67 ? 74  GLU E OE2   1 
ATOM   3315  N N     . ILE E 5  78  ? 123.489 114.729 87.263  1.00 89.39  ? 75  ILE E N     1 
ATOM   3316  C CA    . ILE E 5  78  ? 123.449 114.441 88.685  1.00 92.11  ? 75  ILE E CA    1 
ATOM   3317  C C     . ILE E 5  78  ? 123.604 112.937 88.795  1.00 91.53  ? 75  ILE E C     1 
ATOM   3318  O O     . ILE E 5  78  ? 124.415 112.442 89.571  1.00 93.69  ? 75  ILE E O     1 
ATOM   3319  C CB    . ILE E 5  78  ? 122.200 114.899 89.453  1.00 89.12  ? 75  ILE E CB    1 
ATOM   3320  C CG1   . ILE E 5  78  ? 122.198 116.431 89.568  1.00 94.33  ? 75  ILE E CG1   1 
ATOM   3321  C CG2   . ILE E 5  78  ? 122.150 114.237 90.833  1.00 91.56  ? 75  ILE E CG2   1 
ATOM   3322  C CD1   . ILE E 5  78  ? 120.889 117.018 90.057  1.00 94.63  ? 75  ILE E CD1   1 
ATOM   3323  N N     . ALA E 5  79  ? 122.846 112.202 87.998  1.00 87.02  ? 76  ALA E N     1 
ATOM   3324  C CA    . ALA E 5  79  ? 122.885 110.752 88.061  1.00 88.91  ? 76  ALA E CA    1 
ATOM   3325  C C     . ALA E 5  79  ? 124.293 110.213 87.836  1.00 92.56  ? 76  ALA E C     1 
ATOM   3326  O O     . ALA E 5  79  ? 124.703 109.258 88.500  1.00 94.33  ? 76  ALA E O     1 
ATOM   3327  C CB    . ALA E 5  79  ? 121.933 110.163 87.044  1.00 90.25  ? 76  ALA E CB    1 
ATOM   3328  N N     . GLN E 5  80  ? 125.064 110.887 86.987  1.00 91.70  ? 77  GLN E N     1 
ATOM   3329  C CA    . GLN E 5  80  ? 126.420 110.454 86.667  1.00 95.80  ? 77  GLN E CA    1 
ATOM   3330  C C     . GLN E 5  80  ? 127.363 110.522 87.854  1.00 96.84  ? 77  GLN E C     1 
ATOM   3331  O O     . GLN E 5  80  ? 128.451 109.948 87.819  1.00 98.92  ? 77  GLN E O     1 
ATOM   3332  C CB    . GLN E 5  80  ? 127.005 111.252 85.510  1.00 94.69  ? 77  GLN E CB    1 
ATOM   3333  C CG    . GLN E 5  80  ? 126.381 110.939 84.184  1.00 101.23 ? 77  GLN E CG    1 
ATOM   3334  C CD    . GLN E 5  80  ? 127.039 111.682 83.063  1.00 109.43 ? 77  GLN E CD    1 
ATOM   3335  O OE1   . GLN E 5  80  ? 127.798 112.628 83.289  1.00 110.33 ? 77  GLN E OE1   1 
ATOM   3336  N NE2   . GLN E 5  80  ? 126.766 111.260 81.835  1.00 110.16 ? 77  GLN E NE2   1 
ATOM   3337  N N     . ASP E 5  81  ? 126.961 111.226 88.906  1.00 96.24  ? 78  ASP E N     1 
ATOM   3338  C CA    . ASP E 5  81  ? 127.779 111.312 90.104  1.00 100.84 ? 78  ASP E CA    1 
ATOM   3339  C C     . ASP E 5  81  ? 127.699 110.013 90.885  1.00 98.90  ? 78  ASP E C     1 
ATOM   3340  O O     . ASP E 5  81  ? 128.485 109.778 91.803  1.00 101.20 ? 78  ASP E O     1 
ATOM   3341  C CB    . ASP E 5  81  ? 127.339 112.474 90.994  1.00 106.64 ? 78  ASP E CB    1 
ATOM   3342  C CG    . ASP E 5  81  ? 127.700 113.843 90.423  1.00 116.07 ? 78  ASP E CG    1 
ATOM   3343  O OD1   . ASP E 5  81  ? 128.574 113.916 89.590  1.00 113.68 ? 78  ASP E OD1   1 
ATOM   3344  O OD2   . ASP E 5  81  ? 127.113 114.809 90.850  1.00 114.03 ? 78  ASP E OD2   1 
ATOM   3345  N N     . PHE E 5  82  ? 126.748 109.164 90.516  1.00 97.46  ? 79  PHE E N     1 
ATOM   3346  C CA    . PHE E 5  82  ? 126.592 107.884 91.175  1.00 96.05  ? 79  PHE E CA    1 
ATOM   3347  C C     . PHE E 5  82  ? 127.024 106.790 90.215  1.00 99.70  ? 79  PHE E C     1 
ATOM   3348  O O     . PHE E 5  82  ? 127.654 105.810 90.614  1.00 99.23  ? 79  PHE E O     1 
ATOM   3349  C CB    . PHE E 5  82  ? 125.133 107.676 91.570  1.00 95.13  ? 79  PHE E CB    1 
ATOM   3350  C CG    . PHE E 5  82  ? 124.568 108.833 92.324  1.00 97.75  ? 79  PHE E CG    1 
ATOM   3351  C CD1   . PHE E 5  82  ? 123.426 109.467 91.866  1.00 97.82  ? 79  PHE E CD1   1 
ATOM   3352  C CD2   . PHE E 5  82  ? 125.220 109.356 93.425  1.00 96.96  ? 79  PHE E CD2   1 
ATOM   3353  C CE1   . PHE E 5  82  ? 122.934 110.583 92.501  1.00 99.49  ? 79  PHE E CE1   1 
ATOM   3354  C CE2   . PHE E 5  82  ? 124.737 110.480 94.055  1.00 98.64  ? 79  PHE E CE2   1 
ATOM   3355  C CZ    . PHE E 5  82  ? 123.594 111.094 93.591  1.00 99.83  ? 79  PHE E CZ    1 
ATOM   3356  N N     . LYS E 5  83  ? 126.597 106.913 88.949  1.00 100.73 ? 80  LYS E N     1 
ATOM   3357  C CA    . LYS E 5  83  ? 126.931 105.944 87.904  1.00 105.28 ? 80  LYS E CA    1 
ATOM   3358  C C     . LYS E 5  83  ? 126.759 106.495 86.487  1.00 105.48 ? 80  LYS E C     1 
ATOM   3359  O O     . LYS E 5  83  ? 125.737 107.104 86.173  1.00 103.28 ? 80  LYS E O     1 
ATOM   3360  C CB    . LYS E 5  83  ? 126.075 104.687 88.059  1.00 102.34 ? 80  LYS E CB    1 
ATOM   3361  C CG    . LYS E 5  83  ? 126.060 103.805 86.821  1.00 105.73 ? 80  LYS E CG    1 
ATOM   3362  C CD    . LYS E 5  83  ? 125.355 102.480 87.052  1.00 114.90 ? 80  LYS E CD    1 
ATOM   3363  C CE    . LYS E 5  83  ? 126.251 101.502 87.807  1.00 127.08 ? 80  LYS E CE    1 
ATOM   3364  N NZ    . LYS E 5  83  ? 125.929 100.095 87.453  1.00 123.39 ? 80  LYS E NZ    1 
ATOM   3365  N N     . THR E 5  84  ? 127.685 106.166 85.575  1.00 109.56 ? 81  THR E N     1 
ATOM   3366  C CA    . THR E 5  84  ? 127.521 106.523 84.176  1.00 113.28 ? 81  THR E CA    1 
ATOM   3367  C C     . THR E 5  84  ? 126.735 105.469 83.408  1.00 108.87 ? 81  THR E C     1 
ATOM   3368  O O     . THR E 5  84  ? 126.501 104.369 83.901  1.00 103.90 ? 81  THR E O     1 
ATOM   3369  C CB    . THR E 5  84  ? 128.888 106.750 83.515  1.00 122.82 ? 81  THR E CB    1 
ATOM   3370  O OG1   . THR E 5  84  ? 129.659 105.541 83.579  1.00 115.65 ? 81  THR E OG1   1 
ATOM   3371  C CG2   . THR E 5  84  ? 129.624 107.867 84.237  1.00 119.13 ? 81  THR E CG2   1 
ATOM   3372  N N     . ASP E 5  85  ? 126.330 105.810 82.188  1.00 111.57 ? 82  ASP E N     1 
ATOM   3373  C CA    . ASP E 5  85  ? 125.602 104.886 81.323  1.00 109.88 ? 82  ASP E CA    1 
ATOM   3374  C C     . ASP E 5  85  ? 124.320 104.373 81.974  1.00 101.50 ? 82  ASP E C     1 
ATOM   3375  O O     . ASP E 5  85  ? 123.946 103.212 81.810  1.00 101.06 ? 82  ASP E O     1 
ATOM   3376  C CB    . ASP E 5  85  ? 126.503 103.709 80.954  1.00 113.94 ? 82  ASP E CB    1 
ATOM   3377  C CG    . ASP E 5  85  ? 127.759 104.156 80.229  1.00 122.11 ? 82  ASP E CG    1 
ATOM   3378  O OD1   . ASP E 5  85  ? 127.665 105.035 79.402  1.00 123.28 ? 82  ASP E OD1   1 
ATOM   3379  O OD2   . ASP E 5  85  ? 128.812 103.650 80.539  1.00 121.98 ? 82  ASP E OD2   1 
ATOM   3380  N N     . LEU E 5  86  ? 123.622 105.265 82.662  1.00 96.91  ? 83  LEU E N     1 
ATOM   3381  C CA    . LEU E 5  86  ? 122.367 104.943 83.322  1.00 91.79  ? 83  LEU E CA    1 
ATOM   3382  C C     . LEU E 5  86  ? 121.192 105.408 82.470  1.00 91.09  ? 83  LEU E C     1 
ATOM   3383  O O     . LEU E 5  86  ? 121.295 106.411 81.764  1.00 95.74  ? 83  LEU E O     1 
ATOM   3384  C CB    . LEU E 5  86  ? 122.316 105.633 84.686  1.00 97.20  ? 83  LEU E CB    1 
ATOM   3385  C CG    . LEU E 5  86  ? 121.142 105.262 85.592  1.00 98.20  ? 83  LEU E CG    1 
ATOM   3386  C CD1   . LEU E 5  86  ? 121.325 103.851 86.137  1.00 98.17  ? 83  LEU E CD1   1 
ATOM   3387  C CD2   . LEU E 5  86  ? 121.042 106.258 86.694  1.00 101.78 ? 83  LEU E CD2   1 
ATOM   3388  N N     . ARG E 5  87  ? 120.074 104.688 82.534  1.00 92.08  ? 84  ARG E N     1 
ATOM   3389  C CA    . ARG E 5  87  ? 118.885 105.078 81.780  1.00 93.19  ? 84  ARG E CA    1 
ATOM   3390  C C     . ARG E 5  87  ? 117.697 105.411 82.655  1.00 90.49  ? 84  ARG E C     1 
ATOM   3391  O O     . ARG E 5  87  ? 117.622 104.981 83.805  1.00 87.74  ? 84  ARG E O     1 
ATOM   3392  C CB    . ARG E 5  87  ? 118.439 103.974 80.867  1.00 95.07  ? 84  ARG E CB    1 
ATOM   3393  C CG    . ARG E 5  87  ? 119.358 103.636 79.791  1.00 100.90 ? 84  ARG E CG    1 
ATOM   3394  C CD    . ARG E 5  87  ? 118.736 102.659 78.916  1.00 105.79 ? 84  ARG E CD    1 
ATOM   3395  N NE    . ARG E 5  87  ? 119.600 102.262 77.860  1.00 113.38 ? 84  ARG E NE    1 
ATOM   3396  C CZ    . ARG E 5  87  ? 119.280 101.350 76.944  1.00 118.78 ? 84  ARG E CZ    1 
ATOM   3397  N NH1   . ARG E 5  87  ? 118.106 100.769 76.986  1.00 115.96 ? 84  ARG E NH1   1 
ATOM   3398  N NH2   . ARG E 5  87  ? 120.148 101.025 76.008  1.00 121.67 ? 84  ARG E NH2   1 
ATOM   3399  N N     . PHE E 5  88  ? 116.753 106.155 82.085  1.00 87.91  ? 85  PHE E N     1 
ATOM   3400  C CA    . PHE E 5  88  ? 115.510 106.472 82.770  1.00 86.26  ? 85  PHE E CA    1 
ATOM   3401  C C     . PHE E 5  88  ? 114.307 106.268 81.870  1.00 89.91  ? 85  PHE E C     1 
ATOM   3402  O O     . PHE E 5  88  ? 114.329 106.654 80.703  1.00 92.48  ? 85  PHE E O     1 
ATOM   3403  C CB    . PHE E 5  88  ? 115.516 107.930 83.216  1.00 87.64  ? 85  PHE E CB    1 
ATOM   3404  C CG    . PHE E 5  88  ? 116.576 108.264 84.191  1.00 85.08  ? 85  PHE E CG    1 
ATOM   3405  C CD1   . PHE E 5  88  ? 117.842 108.620 83.768  1.00 86.98  ? 85  PHE E CD1   1 
ATOM   3406  C CD2   . PHE E 5  88  ? 116.306 108.249 85.539  1.00 87.17  ? 85  PHE E CD2   1 
ATOM   3407  C CE1   . PHE E 5  88  ? 118.817 108.937 84.680  1.00 92.91  ? 85  PHE E CE1   1 
ATOM   3408  C CE2   . PHE E 5  88  ? 117.277 108.564 86.453  1.00 91.12  ? 85  PHE E CE2   1 
ATOM   3409  C CZ    . PHE E 5  88  ? 118.533 108.906 86.025  1.00 94.77  ? 85  PHE E CZ    1 
ATOM   3410  N N     . GLN E 5  89  ? 113.204 105.829 82.453  1.00 91.95  ? 86  GLN E N     1 
ATOM   3411  C CA    . GLN E 5  89  ? 111.950 105.806 81.718  1.00 91.86  ? 86  GLN E CA    1 
ATOM   3412  C C     . GLN E 5  89  ? 111.492 107.230 81.486  1.00 91.02  ? 86  GLN E C     1 
ATOM   3413  O O     . GLN E 5  89  ? 111.627 108.078 82.369  1.00 88.60  ? 86  GLN E O     1 
ATOM   3414  C CB    . GLN E 5  89  ? 110.873 105.040 82.482  1.00 92.61  ? 86  GLN E CB    1 
ATOM   3415  C CG    . GLN E 5  89  ? 111.118 103.564 82.583  1.00 97.09  ? 86  GLN E CG    1 
ATOM   3416  C CD    . GLN E 5  89  ? 109.998 102.844 83.310  1.00 99.46  ? 86  GLN E CD    1 
ATOM   3417  O OE1   . GLN E 5  89  ? 109.454 103.323 84.317  1.00 94.83  ? 86  GLN E OE1   1 
ATOM   3418  N NE2   . GLN E 5  89  ? 109.637 101.680 82.796  1.00 103.47 ? 86  GLN E NE2   1 
ATOM   3419  N N     . SER E 5  90  ? 110.861 107.484 80.349  1.00 90.29  ? 87  SER E N     1 
ATOM   3420  C CA    . SER E 5  90  ? 110.420 108.844 80.071  1.00 91.40  ? 87  SER E CA    1 
ATOM   3421  C C     . SER E 5  90  ? 109.435 109.324 81.126  1.00 88.77  ? 87  SER E C     1 
ATOM   3422  O O     . SER E 5  90  ? 109.448 110.495 81.515  1.00 90.44  ? 87  SER E O     1 
ATOM   3423  C CB    . SER E 5  90  ? 109.764 108.905 78.711  1.00 94.79  ? 87  SER E CB    1 
ATOM   3424  O OG    . SER E 5  90  ? 108.561 108.190 78.711  1.00 95.32  ? 87  SER E OG    1 
ATOM   3425  N N     . SER E 5  91  ? 108.666 108.393 81.671  1.00 85.64  ? 88  SER E N     1 
ATOM   3426  C CA    . SER E 5  91  ? 107.694 108.716 82.698  1.00 88.41  ? 88  SER E CA    1 
ATOM   3427  C C     . SER E 5  91  ? 108.362 108.960 84.041  1.00 88.66  ? 88  SER E C     1 
ATOM   3428  O O     . SER E 5  91  ? 107.782 109.597 84.920  1.00 88.79  ? 88  SER E O     1 
ATOM   3429  C CB    . SER E 5  91  ? 106.687 107.594 82.821  1.00 92.06  ? 88  SER E CB    1 
ATOM   3430  O OG    . SER E 5  91  ? 107.293 106.434 83.313  1.00 94.21  ? 88  SER E OG    1 
ATOM   3431  N N     . ALA E 5  92  ? 109.574 108.440 84.211  1.00 86.58  ? 89  ALA E N     1 
ATOM   3432  C CA    . ALA E 5  92  ? 110.298 108.608 85.458  1.00 87.12  ? 89  ALA E CA    1 
ATOM   3433  C C     . ALA E 5  92  ? 110.797 110.029 85.557  1.00 85.66  ? 89  ALA E C     1 
ATOM   3434  O O     . ALA E 5  92  ? 110.798 110.632 86.630  1.00 85.89  ? 89  ALA E O     1 
ATOM   3435  C CB    . ALA E 5  92  ? 111.463 107.634 85.544  1.00 88.94  ? 89  ALA E CB    1 
ATOM   3436  N N     . VAL E 5  93  ? 111.170 110.580 84.413  1.00 82.98  ? 90  VAL E N     1 
ATOM   3437  C CA    . VAL E 5  93  ? 111.679 111.934 84.378  1.00 83.81  ? 90  VAL E CA    1 
ATOM   3438  C C     . VAL E 5  93  ? 110.548 112.887 84.704  1.00 86.92  ? 90  VAL E C     1 
ATOM   3439  O O     . VAL E 5  93  ? 110.713 113.811 85.500  1.00 85.56  ? 90  VAL E O     1 
ATOM   3440  C CB    . VAL E 5  93  ? 112.273 112.255 82.998  1.00 86.15  ? 90  VAL E CB    1 
ATOM   3441  C CG1   . VAL E 5  93  ? 112.708 113.718 82.931  1.00 91.23  ? 90  VAL E CG1   1 
ATOM   3442  C CG2   . VAL E 5  93  ? 113.445 111.323 82.722  1.00 91.14  ? 90  VAL E CG2   1 
ATOM   3443  N N     . MET E 5  94  ? 109.386 112.638 84.111  1.00 86.76  ? 91  MET E N     1 
ATOM   3444  C CA    . MET E 5  94  ? 108.216 113.454 84.386  1.00 88.11  ? 91  MET E CA    1 
ATOM   3445  C C     . MET E 5  94  ? 107.761 113.306 85.827  1.00 88.20  ? 91  MET E C     1 
ATOM   3446  O O     . MET E 5  94  ? 107.358 114.285 86.456  1.00 89.04  ? 91  MET E O     1 
ATOM   3447  C CB    . MET E 5  94  ? 107.092 113.097 83.426  1.00 92.55  ? 91  MET E CB    1 
ATOM   3448  C CG    . MET E 5  94  ? 107.368 113.466 81.975  1.00 99.25  ? 91  MET E CG    1 
ATOM   3449  S SD    . MET E 5  94  ? 107.576 115.250 81.734  1.00 126.09 ? 91  MET E SD    1 
ATOM   3450  C CE    . MET E 5  94  ? 109.360 115.440 81.679  1.00 106.14 ? 91  MET E CE    1 
ATOM   3451  N N     . ALA E 5  95  ? 107.858 112.096 86.369  1.00 85.46  ? 92  ALA E N     1 
ATOM   3452  C CA    . ALA E 5  95  ? 107.470 111.882 87.753  1.00 88.19  ? 92  ALA E CA    1 
ATOM   3453  C C     . ALA E 5  95  ? 108.344 112.714 88.670  1.00 86.61  ? 92  ALA E C     1 
ATOM   3454  O O     . ALA E 5  95  ? 107.857 113.382 89.585  1.00 88.74  ? 92  ALA E O     1 
ATOM   3455  C CB    . ALA E 5  95  ? 107.597 110.411 88.113  1.00 91.32  ? 92  ALA E CB    1 
ATOM   3456  N N     . LEU E 5  96  ? 109.629 112.756 88.351  1.00 82.35  ? 93  LEU E N     1 
ATOM   3457  C CA    . LEU E 5  96  ? 110.569 113.500 89.156  1.00 82.93  ? 93  LEU E CA    1 
ATOM   3458  C C     . LEU E 5  96  ? 110.326 114.993 89.036  1.00 85.63  ? 93  LEU E C     1 
ATOM   3459  O O     . LEU E 5  96  ? 110.376 115.715 90.034  1.00 85.54  ? 93  LEU E O     1 
ATOM   3460  C CB    . LEU E 5  96  ? 111.998 113.140 88.742  1.00 80.54  ? 93  LEU E CB    1 
ATOM   3461  C CG    . LEU E 5  96  ? 113.136 113.794 89.531  1.00 86.23  ? 93  LEU E CG    1 
ATOM   3462  C CD1   . LEU E 5  96  ? 113.011 113.472 91.007  1.00 92.86  ? 93  LEU E CD1   1 
ATOM   3463  C CD2   . LEU E 5  96  ? 114.450 113.270 88.998  1.00 89.08  ? 93  LEU E CD2   1 
ATOM   3464  N N     . GLN E 5  97  ? 110.037 115.463 87.827  1.00 84.63  ? 94  GLN E N     1 
ATOM   3465  C CA    . GLN E 5  97  ? 109.817 116.885 87.644  1.00 85.55  ? 94  GLN E CA    1 
ATOM   3466  C C     . GLN E 5  97  ? 108.597 117.367 88.404  1.00 85.24  ? 94  GLN E C     1 
ATOM   3467  O O     . GLN E 5  97  ? 108.641 118.414 89.049  1.00 84.68  ? 94  GLN E O     1 
ATOM   3468  C CB    . GLN E 5  97  ? 109.665 117.255 86.175  1.00 86.10  ? 94  GLN E CB    1 
ATOM   3469  C CG    . GLN E 5  97  ? 109.592 118.748 85.972  1.00 90.47  ? 94  GLN E CG    1 
ATOM   3470  C CD    . GLN E 5  97  ? 109.619 119.165 84.537  1.00 94.39  ? 94  GLN E CD    1 
ATOM   3471  O OE1   . GLN E 5  97  ? 109.982 118.391 83.647  1.00 94.16  ? 94  GLN E OE1   1 
ATOM   3472  N NE2   . GLN E 5  97  ? 109.232 120.413 84.295  1.00 98.88  ? 94  GLN E NE2   1 
ATOM   3473  N N     . GLU E 5  98  ? 107.532 116.573 88.409  1.00 83.95  ? 95  GLU E N     1 
ATOM   3474  C CA    . GLU E 5  98  ? 106.326 116.990 89.109  1.00 85.31  ? 95  GLU E CA    1 
ATOM   3475  C C     . GLU E 5  98  ? 106.634 117.203 90.577  1.00 84.37  ? 95  GLU E C     1 
ATOM   3476  O O     . GLU E 5  98  ? 106.225 118.202 91.173  1.00 87.40  ? 95  GLU E O     1 
ATOM   3477  C CB    . GLU E 5  98  ? 105.238 115.921 88.991  1.00 91.03  ? 95  GLU E CB    1 
ATOM   3478  C CG    . GLU E 5  98  ? 104.597 115.777 87.618  1.00 99.80  ? 95  GLU E CG    1 
ATOM   3479  C CD    . GLU E 5  98  ? 103.511 116.781 87.336  1.00 105.02 ? 95  GLU E CD    1 
ATOM   3480  O OE1   . GLU E 5  98  ? 102.762 117.089 88.231  1.00 101.41 ? 95  GLU E OE1   1 
ATOM   3481  O OE2   . GLU E 5  98  ? 103.383 117.184 86.204  1.00 107.56 ? 95  GLU E OE2   1 
ATOM   3482  N N     . ALA E 5  99  ? 107.416 116.291 91.145  1.00 82.43  ? 96  ALA E N     1 
ATOM   3483  C CA    . ALA E 5  99  ? 107.802 116.401 92.540  1.00 86.50  ? 96  ALA E CA    1 
ATOM   3484  C C     . ALA E 5  99  ? 108.675 117.622 92.774  1.00 86.15  ? 96  ALA E C     1 
ATOM   3485  O O     . ALA E 5  99  ? 108.568 118.284 93.807  1.00 86.33  ? 96  ALA E O     1 
ATOM   3486  C CB    . ALA E 5  99  ? 108.537 115.150 92.975  1.00 87.68  ? 96  ALA E CB    1 
ATOM   3487  N N     . CYS E 5  100 ? 109.552 117.909 91.819  1.00 83.20  ? 97  CYS E N     1 
ATOM   3488  C CA    . CYS E 5  100 ? 110.490 119.008 91.965  1.00 83.38  ? 97  CYS E CA    1 
ATOM   3489  C C     . CYS E 5  100 ? 109.790 120.347 91.966  1.00 84.15  ? 97  CYS E C     1 
ATOM   3490  O O     . CYS E 5  100 ? 110.091 121.212 92.790  1.00 84.20  ? 97  CYS E O     1 
ATOM   3491  C CB    . CYS E 5  100 ? 111.507 118.994 90.838  1.00 84.85  ? 97  CYS E CB    1 
ATOM   3492  S SG    . CYS E 5  100 ? 112.620 117.609 90.908  1.00 100.36 ? 97  CYS E SG    1 
ATOM   3493  N N     . GLU E 5  101 ? 108.848 120.526 91.052  1.00 83.07  ? 98  GLU E N     1 
ATOM   3494  C CA    . GLU E 5  101 ? 108.153 121.795 90.998  1.00 84.58  ? 98  GLU E CA    1 
ATOM   3495  C C     . GLU E 5  101 ? 107.282 121.958 92.227  1.00 85.63  ? 98  GLU E C     1 
ATOM   3496  O O     . GLU E 5  101 ? 107.361 122.970 92.923  1.00 83.69  ? 98  GLU E O     1 
ATOM   3497  C CB    . GLU E 5  101 ? 107.307 121.898 89.736  1.00 88.63  ? 98  GLU E CB    1 
ATOM   3498  C CG    . GLU E 5  101 ? 108.114 122.003 88.450  1.00 97.45  ? 98  GLU E CG    1 
ATOM   3499  C CD    . GLU E 5  101 ? 107.262 122.331 87.261  0.00 102.95 ? 98  GLU E CD    1 
ATOM   3500  O OE1   . GLU E 5  101 ? 106.065 122.292 87.394  0.00 104.21 ? 98  GLU E OE1   1 
ATOM   3501  O OE2   . GLU E 5  101 ? 107.804 122.666 86.225  0.00 100.35 ? 98  GLU E OE2   1 
ATOM   3502  N N     . ALA E 5  102 ? 106.592 120.892 92.612  1.00 83.45  ? 99  ALA E N     1 
ATOM   3503  C CA    . ALA E 5  102 ? 105.737 120.972 93.783  1.00 86.05  ? 99  ALA E CA    1 
ATOM   3504  C C     . ALA E 5  102 ? 106.559 121.338 95.006  1.00 85.39  ? 99  ALA E C     1 
ATOM   3505  O O     . ALA E 5  102 ? 106.142 122.158 95.828  1.00 86.52  ? 99  ALA E O     1 
ATOM   3506  C CB    . ALA E 5  102 ? 105.026 119.650 94.002  1.00 89.88  ? 99  ALA E CB    1 
ATOM   3507  N N     . TYR E 5  103 ? 107.750 120.762 95.096  1.00 82.92  ? 100 TYR E N     1 
ATOM   3508  C CA    . TYR E 5  103 ? 108.660 121.046 96.185  1.00 82.78  ? 100 TYR E CA    1 
ATOM   3509  C C     . TYR E 5  103 ? 109.066 122.509 96.214  1.00 84.71  ? 100 TYR E C     1 
ATOM   3510  O O     . TYR E 5  103 ? 108.945 123.172 97.246  1.00 84.81  ? 100 TYR E O     1 
ATOM   3511  C CB    . TYR E 5  103 ? 109.882 120.142 96.083  1.00 83.99  ? 100 TYR E CB    1 
ATOM   3512  C CG    . TYR E 5  103 ? 110.985 120.520 96.991  1.00 83.53  ? 100 TYR E CG    1 
ATOM   3513  C CD1   . TYR E 5  103 ? 110.884 120.290 98.342  1.00 87.61  ? 100 TYR E CD1   1 
ATOM   3514  C CD2   . TYR E 5  103 ? 112.124 121.070 96.464  1.00 84.43  ? 100 TYR E CD2   1 
ATOM   3515  C CE1   . TYR E 5  103 ? 111.925 120.632 99.174  1.00 89.98  ? 100 TYR E CE1   1 
ATOM   3516  C CE2   . TYR E 5  103 ? 113.163 121.402 97.283  1.00 88.07  ? 100 TYR E CE2   1 
ATOM   3517  C CZ    . TYR E 5  103 ? 113.070 121.193 98.636  1.00 90.50  ? 100 TYR E CZ    1 
ATOM   3518  O OH    . TYR E 5  103 ? 114.114 121.547 99.460  1.00 92.32  ? 100 TYR E OH    1 
ATOM   3519  N N     . LEU E 5  104 ? 109.504 123.030 95.075  1.00 81.14  ? 101 LEU E N     1 
ATOM   3520  C CA    . LEU E 5  104 ? 109.959 124.409 95.033  1.00 81.31  ? 101 LEU E CA    1 
ATOM   3521  C C     . LEU E 5  104 ? 108.831 125.387 95.290  1.00 83.48  ? 101 LEU E C     1 
ATOM   3522  O O     . LEU E 5  104 ? 109.028 126.397 95.965  1.00 82.18  ? 101 LEU E O     1 
ATOM   3523  C CB    . LEU E 5  104 ? 110.619 124.727 93.692  1.00 79.47  ? 101 LEU E CB    1 
ATOM   3524  C CG    . LEU E 5  104 ? 111.973 124.053 93.422  1.00 82.81  ? 101 LEU E CG    1 
ATOM   3525  C CD1   . LEU E 5  104 ? 112.387 124.358 91.999  1.00 86.51  ? 101 LEU E CD1   1 
ATOM   3526  C CD2   . LEU E 5  104 ? 113.030 124.557 94.412  1.00 85.65  ? 101 LEU E CD2   1 
ATOM   3527  N N     . VAL E 5  105 ? 107.641 125.092 94.785  1.00 80.34  ? 102 VAL E N     1 
ATOM   3528  C CA    . VAL E 5  105 ? 106.536 126.010 94.992  1.00 81.84  ? 102 VAL E CA    1 
ATOM   3529  C C     . VAL E 5  105 ? 106.187 126.076 96.466  1.00 84.74  ? 102 VAL E C     1 
ATOM   3530  O O     . VAL E 5  105 ? 106.002 127.163 97.014  1.00 86.27  ? 102 VAL E O     1 
ATOM   3531  C CB    . VAL E 5  105 ? 105.301 125.609 94.171  1.00 82.64  ? 102 VAL E CB    1 
ATOM   3532  C CG1   . VAL E 5  105 ? 104.103 126.477 94.559  1.00 91.44  ? 102 VAL E CG1   1 
ATOM   3533  C CG2   . VAL E 5  105 ? 105.601 125.782 92.694  1.00 90.06  ? 102 VAL E CG2   1 
ATOM   3534  N N     . GLY E 5  106 ? 106.132 124.920 97.119  1.00 84.86  ? 103 GLY E N     1 
ATOM   3535  C CA    . GLY E 5  106 ? 105.827 124.885 98.540  1.00 89.93  ? 103 GLY E CA    1 
ATOM   3536  C C     . GLY E 5  106 ? 106.862 125.672 99.331  1.00 87.47  ? 103 GLY E C     1 
ATOM   3537  O O     . GLY E 5  106 ? 106.523 126.413 100.256 1.00 89.77  ? 103 GLY E O     1 
ATOM   3538  N N     . LEU E 5  107 ? 108.121 125.569 98.923  1.00 83.57  ? 104 LEU E N     1 
ATOM   3539  C CA    . LEU E 5  107 ? 109.167 126.320 99.589  1.00 84.29  ? 104 LEU E CA    1 
ATOM   3540  C C     . LEU E 5  107 ? 108.978 127.806 99.360  1.00 85.34  ? 104 LEU E C     1 
ATOM   3541  O O     . LEU E 5  107 ? 109.134 128.606 100.284 1.00 84.32  ? 104 LEU E O     1 
ATOM   3542  C CB    . LEU E 5  107 ? 110.546 125.879 99.104  1.00 82.30  ? 104 LEU E CB    1 
ATOM   3543  C CG    . LEU E 5  107 ? 111.750 126.604 99.732  1.00 83.79  ? 104 LEU E CG    1 
ATOM   3544  C CD1   . LEU E 5  107 ? 111.749 126.435 101.257 1.00 90.98  ? 104 LEU E CD1   1 
ATOM   3545  C CD2   . LEU E 5  107 ? 113.008 126.031 99.143  1.00 86.12  ? 104 LEU E CD2   1 
ATOM   3546  N N     . PHE E 5  108 ? 108.611 128.182 98.141  1.00 83.34  ? 105 PHE E N     1 
ATOM   3547  C CA    . PHE E 5  108 ? 108.391 129.585 97.847  1.00 83.94  ? 105 PHE E CA    1 
ATOM   3548  C C     . PHE E 5  108 ? 107.239 130.152 98.656  1.00 86.40  ? 105 PHE E C     1 
ATOM   3549  O O     . PHE E 5  108 ? 107.306 131.296 99.101  1.00 83.78  ? 105 PHE E O     1 
ATOM   3550  C CB    . PHE E 5  108 ? 108.178 129.832 96.356  1.00 84.90  ? 105 PHE E CB    1 
ATOM   3551  C CG    . PHE E 5  108 ? 109.465 129.972 95.599  1.00 85.00  ? 105 PHE E CG    1 
ATOM   3552  C CD1   . PHE E 5  108 ? 109.819 129.077 94.603  1.00 87.63  ? 105 PHE E CD1   1 
ATOM   3553  C CD2   . PHE E 5  108 ? 110.339 131.007 95.902  1.00 83.86  ? 105 PHE E CD2   1 
ATOM   3554  C CE1   . PHE E 5  108 ? 111.014 129.216 93.928  1.00 89.27  ? 105 PHE E CE1   1 
ATOM   3555  C CE2   . PHE E 5  108 ? 111.533 131.142 95.234  1.00 83.18  ? 105 PHE E CE2   1 
ATOM   3556  C CZ    . PHE E 5  108 ? 111.871 130.247 94.248  1.00 86.62  ? 105 PHE E CZ    1 
ATOM   3557  N N     . GLU E 5  109 ? 106.199 129.358 98.886  1.00 86.07  ? 106 GLU E N     1 
ATOM   3558  C CA    . GLU E 5  109 ? 105.087 129.841 99.696  1.00 88.20  ? 106 GLU E CA    1 
ATOM   3559  C C     . GLU E 5  109 ? 105.539 130.171 101.114 1.00 88.16  ? 106 GLU E C     1 
ATOM   3560  O O     . GLU E 5  109 ? 105.207 131.232 101.647 1.00 88.06  ? 106 GLU E O     1 
ATOM   3561  C CB    . GLU E 5  109 ? 103.977 128.799 99.770  1.00 92.27  ? 106 GLU E CB    1 
ATOM   3562  C CG    . GLU E 5  109 ? 103.193 128.614 98.499  1.00 98.22  ? 106 GLU E CG    1 
ATOM   3563  C CD    . GLU E 5  109 ? 102.157 127.538 98.617  0.00 108.28 ? 106 GLU E CD    1 
ATOM   3564  O OE1   . GLU E 5  109 ? 102.220 126.780 99.554  0.00 107.98 ? 106 GLU E OE1   1 
ATOM   3565  O OE2   . GLU E 5  109 ? 101.280 127.492 97.789  0.00 109.73 ? 106 GLU E OE2   1 
ATOM   3566  N N     . ASP E 5  110 ? 106.367 129.306 101.693 1.00 87.58  ? 107 ASP E N     1 
ATOM   3567  C CA    . ASP E 5  110 ? 106.859 129.543 103.046 1.00 89.95  ? 107 ASP E CA    1 
ATOM   3568  C C     . ASP E 5  110 ? 107.853 130.685 103.053 1.00 88.78  ? 107 ASP E C     1 
ATOM   3569  O O     . ASP E 5  110 ? 107.905 131.487 103.990 1.00 87.55  ? 107 ASP E O     1 
ATOM   3570  C CB    . ASP E 5  110 ? 107.510 128.286 103.610 1.00 92.87  ? 107 ASP E CB    1 
ATOM   3571  C CG    . ASP E 5  110 ? 106.505 127.212 103.959 1.00 100.59 ? 107 ASP E CG    1 
ATOM   3572  O OD1   . ASP E 5  110 ? 105.343 127.519 104.085 1.00 97.87  ? 107 ASP E OD1   1 
ATOM   3573  O OD2   . ASP E 5  110 ? 106.908 126.083 104.103 1.00 99.07  ? 107 ASP E OD2   1 
ATOM   3574  N N     . THR E 5  111 ? 108.611 130.781 101.978 1.00 85.09  ? 108 THR E N     1 
ATOM   3575  C CA    . THR E 5  111 ? 109.573 131.847 101.813 1.00 85.25  ? 108 THR E CA    1 
ATOM   3576  C C     . THR E 5  111 ? 108.844 133.178 101.763 1.00 86.87  ? 108 THR E C     1 
ATOM   3577  O O     . THR E 5  111 ? 109.273 134.162 102.368 1.00 87.37  ? 108 THR E O     1 
ATOM   3578  C CB    . THR E 5  111 ? 110.364 131.643 100.519 1.00 84.81  ? 108 THR E CB    1 
ATOM   3579  O OG1   . THR E 5  111 ? 111.074 130.402 100.581 1.00 86.05  ? 108 THR E OG1   1 
ATOM   3580  C CG2   . THR E 5  111 ? 111.318 132.748 100.320 1.00 87.54  ? 108 THR E CG2   1 
ATOM   3581  N N     . ASN E 5  112 ? 107.735 133.202 101.036 1.00 84.71  ? 109 ASN E N     1 
ATOM   3582  C CA    . ASN E 5  112 ? 106.939 134.404 100.894 1.00 83.55  ? 109 ASN E CA    1 
ATOM   3583  C C     . ASN E 5  112 ? 106.397 134.840 102.244 1.00 87.36  ? 109 ASN E C     1 
ATOM   3584  O O     . ASN E 5  112 ? 106.448 136.021 102.584 1.00 86.02  ? 109 ASN E O     1 
ATOM   3585  C CB    . ASN E 5  112 ? 105.816 134.170 99.905  1.00 86.96  ? 109 ASN E CB    1 
ATOM   3586  C CG    . ASN E 5  112 ? 105.162 135.427 99.448  1.00 91.31  ? 109 ASN E CG    1 
ATOM   3587  O OD1   . ASN E 5  112 ? 105.831 136.320 98.917  1.00 93.90  ? 109 ASN E OD1   1 
ATOM   3588  N ND2   . ASN E 5  112 ? 103.873 135.512 99.623  1.00 97.34  ? 109 ASN E ND2   1 
ATOM   3589  N N     . LEU E 5  113 ? 105.981 133.874 103.060 1.00 85.74  ? 110 LEU E N     1 
ATOM   3590  C CA    . LEU E 5  113 ? 105.474 134.198 104.385 1.00 86.44  ? 110 LEU E CA    1 
ATOM   3591  C C     . LEU E 5  113 ? 106.559 134.827 105.234 1.00 86.84  ? 110 LEU E C     1 
ATOM   3592  O O     . LEU E 5  113 ? 106.291 135.730 106.027 1.00 86.15  ? 110 LEU E O     1 
ATOM   3593  C CB    . LEU E 5  113 ? 104.962 132.945 105.098 1.00 87.53  ? 110 LEU E CB    1 
ATOM   3594  C CG    . LEU E 5  113 ? 103.694 132.300 104.540 1.00 94.08  ? 110 LEU E CG    1 
ATOM   3595  C CD1   . LEU E 5  113 ? 103.477 130.978 105.254 1.00 97.32  ? 110 LEU E CD1   1 
ATOM   3596  C CD2   . LEU E 5  113 ? 102.496 133.223 104.748 1.00 94.87  ? 110 LEU E CD2   1 
ATOM   3597  N N     . CYS E 5  114 ? 107.784 134.346 105.075 1.00 84.21  ? 111 CYS E N     1 
ATOM   3598  C CA    . CYS E 5  114 ? 108.897 134.880 105.841 1.00 86.01  ? 111 CYS E CA    1 
ATOM   3599  C C     . CYS E 5  114 ? 109.126 136.345 105.486 1.00 87.23  ? 111 CYS E C     1 
ATOM   3600  O O     . CYS E 5  114 ? 109.315 137.184 106.369 1.00 87.41  ? 111 CYS E O     1 
ATOM   3601  C CB    . CYS E 5  114 ? 110.165 134.080 105.564 1.00 88.83  ? 111 CYS E CB    1 
ATOM   3602  S SG    . CYS E 5  114 ? 110.108 132.385 106.189 1.00 96.97  ? 111 CYS E SG    1 
ATOM   3603  N N     . ALA E 5  115 ? 109.070 136.655 104.194 1.00 86.48  ? 112 ALA E N     1 
ATOM   3604  C CA    . ALA E 5  115 ? 109.237 138.031 103.742 1.00 91.25  ? 112 ALA E CA    1 
ATOM   3605  C C     . ALA E 5  115 ? 108.104 138.914 104.246 1.00 88.81  ? 112 ALA E C     1 
ATOM   3606  O O     . ALA E 5  115 ? 108.316 140.072 104.609 1.00 87.40  ? 112 ALA E O     1 
ATOM   3607  C CB    . ALA E 5  115 ? 109.308 138.085 102.231 1.00 92.93  ? 112 ALA E CB    1 
ATOM   3608  N N     . ILE E 5  116 ? 106.905 138.351 104.301 1.00 86.38  ? 113 ILE E N     1 
ATOM   3609  C CA    . ILE E 5  116 ? 105.755 139.075 104.812 1.00 87.16  ? 113 ILE E CA    1 
ATOM   3610  C C     . ILE E 5  116 ? 105.951 139.364 106.290 1.00 86.40  ? 113 ILE E C     1 
ATOM   3611  O O     . ILE E 5  116 ? 105.640 140.452 106.770 1.00 90.06  ? 113 ILE E O     1 
ATOM   3612  C CB    . ILE E 5  116 ? 104.453 138.297 104.571 1.00 91.74  ? 113 ILE E CB    1 
ATOM   3613  C CG1   . ILE E 5  116 ? 104.171 138.246 103.061 1.00 96.97  ? 113 ILE E CG1   1 
ATOM   3614  C CG2   . ILE E 5  116 ? 103.297 138.954 105.322 1.00 99.12  ? 113 ILE E CG2   1 
ATOM   3615  C CD1   . ILE E 5  116 ? 103.079 137.271 102.653 1.00 106.90 ? 113 ILE E CD1   1 
ATOM   3616  N N     . HIS E 5  117 ? 106.476 138.384 107.013 1.00 86.02  ? 114 HIS E N     1 
ATOM   3617  C CA    . HIS E 5  117 ? 106.765 138.533 108.432 1.00 86.59  ? 114 HIS E CA    1 
ATOM   3618  C C     . HIS E 5  117 ? 107.789 139.636 108.657 1.00 85.04  ? 114 HIS E C     1 
ATOM   3619  O O     . HIS E 5  117 ? 107.740 140.360 109.653 1.00 89.69  ? 114 HIS E O     1 
ATOM   3620  C CB    . HIS E 5  117 ? 107.308 137.227 108.989 1.00 88.12  ? 114 HIS E CB    1 
ATOM   3621  C CG    . HIS E 5  117 ? 107.285 137.156 110.453 1.00 90.22  ? 114 HIS E CG    1 
ATOM   3622  N ND1   . HIS E 5  117 ? 106.113 137.084 111.163 1.00 95.06  ? 114 HIS E ND1   1 
ATOM   3623  C CD2   . HIS E 5  117 ? 108.282 137.085 111.361 1.00 91.26  ? 114 HIS E CD2   1 
ATOM   3624  C CE1   . HIS E 5  117 ? 106.387 136.973 112.442 1.00 97.13  ? 114 HIS E CE1   1 
ATOM   3625  N NE2   . HIS E 5  117 ? 107.691 136.971 112.590 1.00 92.73  ? 114 HIS E NE2   1 
ATOM   3626  N N     . ALA E 5  118 ? 108.669 139.814 107.678 1.00 85.28  ? 115 ALA E N     1 
ATOM   3627  C CA    . ALA E 5  118 ? 109.681 140.858 107.708 1.00 88.99  ? 115 ALA E CA    1 
ATOM   3628  C C     . ALA E 5  118 ? 109.085 142.199 107.288 1.00 88.82  ? 115 ALA E C     1 
ATOM   3629  O O     . ALA E 5  118 ? 109.796 143.201 107.208 1.00 88.46  ? 115 ALA E O     1 
ATOM   3630  C CB    . ALA E 5  118 ? 110.849 140.493 106.807 1.00 92.95  ? 115 ALA E CB    1 
ATOM   3631  N N     . LYS E 5  119 ? 107.768 142.251 107.118 1.00 89.57  ? 116 LYS E N     1 
ATOM   3632  C CA    . LYS E 5  119 ? 107.083 143.470 106.694 1.00 92.34  ? 116 LYS E CA    1 
ATOM   3633  C C     . LYS E 5  119 ? 107.543 143.952 105.325 1.00 90.98  ? 116 LYS E C     1 
ATOM   3634  O O     . LYS E 5  119 ? 107.810 145.141 105.150 1.00 92.32  ? 116 LYS E O     1 
ATOM   3635  C CB    . LYS E 5  119 ? 107.286 144.599 107.705 1.00 95.23  ? 116 LYS E CB    1 
ATOM   3636  C CG    . LYS E 5  119 ? 106.916 144.258 109.139 1.00 101.94 ? 116 LYS E CG    1 
ATOM   3637  C CD    . LYS E 5  119 ? 105.411 144.127 109.307 1.00 107.12 ? 116 LYS E CD    1 
ATOM   3638  C CE    . LYS E 5  119 ? 105.031 143.984 110.774 1.00 104.77 ? 116 LYS E CE    1 
ATOM   3639  N NZ    . LYS E 5  119 ? 103.558 143.988 110.974 1.00 101.55 ? 116 LYS E NZ    1 
ATOM   3640  N N     . ARG E 5  120 ? 107.625 143.067 104.336 1.00 91.33  ? 117 ARG E N     1 
ATOM   3641  C CA    . ARG E 5  120 ? 108.024 143.490 103.007 1.00 91.20  ? 117 ARG E CA    1 
ATOM   3642  C C     . ARG E 5  120 ? 107.541 142.520 101.939 1.00 91.55  ? 117 ARG E C     1 
ATOM   3643  O O     . ARG E 5  120 ? 106.774 141.601 102.223 1.00 94.19  ? 117 ARG E O     1 
ATOM   3644  C CB    . ARG E 5  120 ? 109.513 143.595 102.940 1.00 88.56  ? 117 ARG E CB    1 
ATOM   3645  C CG    . ARG E 5  120 ? 110.194 142.317 103.088 1.00 91.01  ? 117 ARG E CG    1 
ATOM   3646  C CD    . ARG E 5  120 ? 111.613 142.487 103.082 1.00 92.82  ? 117 ARG E CD    1 
ATOM   3647  N NE    . ARG E 5  120 ? 112.278 141.230 103.121 1.00 92.73  ? 117 ARG E NE    1 
ATOM   3648  C CZ    . ARG E 5  120 ? 113.560 141.081 103.395 1.00 93.15  ? 117 ARG E CZ    1 
ATOM   3649  N NH1   . ARG E 5  120 ? 114.291 142.135 103.662 1.00 98.02  ? 117 ARG E NH1   1 
ATOM   3650  N NH2   . ARG E 5  120 ? 114.093 139.885 103.410 1.00 94.33  ? 117 ARG E NH2   1 
ATOM   3651  N N     . VAL E 5  121 ? 107.878 142.812 100.687 1.00 86.17  ? 118 VAL E N     1 
ATOM   3652  C CA    . VAL E 5  121 ? 107.458 141.974 99.575  1.00 85.88  ? 118 VAL E CA    1 
ATOM   3653  C C     . VAL E 5  121 ? 108.616 141.203 98.962  1.00 89.45  ? 118 VAL E C     1 
ATOM   3654  O O     . VAL E 5  121 ? 108.447 140.062 98.536  1.00 92.76  ? 118 VAL E O     1 
ATOM   3655  C CB    . VAL E 5  121 ? 106.789 142.829 98.495  1.00 91.87  ? 118 VAL E CB    1 
ATOM   3656  C CG1   . VAL E 5  121 ? 106.453 141.980 97.278  1.00 102.03 ? 118 VAL E CG1   1 
ATOM   3657  C CG2   . VAL E 5  121 ? 105.539 143.459 99.066  1.00 96.29  ? 118 VAL E CG2   1 
ATOM   3658  N N     . THR E 5  122 ? 109.746 141.875 98.797  1.00 88.62  ? 119 THR E N     1 
ATOM   3659  C CA    . THR E 5  122 ? 110.878 141.298 98.088  1.00 88.63  ? 119 THR E CA    1 
ATOM   3660  C C     . THR E 5  122 ? 111.453 140.110 98.837  1.00 88.87  ? 119 THR E C     1 
ATOM   3661  O O     . THR E 5  122 ? 111.645 140.163 100.052 1.00 91.01  ? 119 THR E O     1 
ATOM   3662  C CB    . THR E 5  122 ? 111.974 142.348 97.863  1.00 95.51  ? 119 THR E CB    1 
ATOM   3663  O OG1   . THR E 5  122 ? 111.402 143.492 97.211  1.00 95.85  ? 119 THR E OG1   1 
ATOM   3664  C CG2   . THR E 5  122 ? 113.086 141.773 96.977  1.00 100.24 ? 119 THR E CG2   1 
ATOM   3665  N N     . ILE E 5  123 ? 111.731 139.043 98.100  1.00 86.11  ? 120 ILE E N     1 
ATOM   3666  C CA    . ILE E 5  123 ? 112.293 137.834 98.676  1.00 85.44  ? 120 ILE E CA    1 
ATOM   3667  C C     . ILE E 5  123 ? 113.812 137.851 98.665  1.00 89.48  ? 120 ILE E C     1 
ATOM   3668  O O     . ILE E 5  123 ? 114.432 138.072 97.622  1.00 90.29  ? 120 ILE E O     1 
ATOM   3669  C CB    . ILE E 5  123 ? 111.836 136.602 97.887  1.00 86.95  ? 120 ILE E CB    1 
ATOM   3670  C CG1   . ILE E 5  123 ? 110.320 136.565 97.771  1.00 89.47  ? 120 ILE E CG1   1 
ATOM   3671  C CG2   . ILE E 5  123 ? 112.354 135.347 98.535  1.00 92.10  ? 120 ILE E CG2   1 
ATOM   3672  C CD1   . ILE E 5  123 ? 109.570 136.564 99.069  1.00 93.28  ? 120 ILE E CD1   1 
ATOM   3673  N N     . MET E 5  124 ? 114.403 137.561 99.823  1.00 88.18  ? 121 MET E N     1 
ATOM   3674  C CA    . MET E 5  124 ? 115.849 137.443 99.955  1.00 88.08  ? 121 MET E CA    1 
ATOM   3675  C C     . MET E 5  124 ? 116.227 135.988 100.254 1.00 88.14  ? 121 MET E C     1 
ATOM   3676  O O     . MET E 5  124 ? 115.419 135.251 100.816 1.00 86.40  ? 121 MET E O     1 
ATOM   3677  C CB    . MET E 5  124 ? 116.337 138.381 101.050 1.00 92.59  ? 121 MET E CB    1 
ATOM   3678  C CG    . MET E 5  124 ? 116.054 139.836 100.774 1.00 95.92  ? 121 MET E CG    1 
ATOM   3679  S SD    . MET E 5  124 ? 116.929 140.454 99.336  1.00 108.50 ? 121 MET E SD    1 
ATOM   3680  C CE    . MET E 5  124 ? 118.623 140.527 99.923  1.00 116.44 ? 121 MET E CE    1 
ATOM   3681  N N     . PRO E 5  125 ? 117.457 135.562 99.947  1.00 84.58  ? 122 PRO E N     1 
ATOM   3682  C CA    . PRO E 5  125 ? 117.980 134.229 100.185 1.00 87.57  ? 122 PRO E CA    1 
ATOM   3683  C C     . PRO E 5  125 ? 117.752 133.780 101.617 1.00 87.91  ? 122 PRO E C     1 
ATOM   3684  O O     . PRO E 5  125 ? 117.564 132.594 101.882 1.00 86.71  ? 122 PRO E O     1 
ATOM   3685  C CB    . PRO E 5  125 ? 119.468 134.421 99.899  1.00 89.17  ? 122 PRO E CB    1 
ATOM   3686  C CG    . PRO E 5  125 ? 119.508 135.515 98.874  1.00 89.64  ? 122 PRO E CG    1 
ATOM   3687  C CD    . PRO E 5  125 ? 118.397 136.460 99.260  1.00 87.85  ? 122 PRO E CD    1 
ATOM   3688  N N     . LYS E 5  126 ? 117.814 134.743 102.528 1.00 87.27  ? 123 LYS E N     1 
ATOM   3689  C CA    . LYS E 5  126 ? 117.557 134.526 103.935 1.00 89.23  ? 123 LYS E CA    1 
ATOM   3690  C C     . LYS E 5  126 ? 116.159 134.007 104.200 1.00 89.59  ? 123 LYS E C     1 
ATOM   3691  O O     . LYS E 5  126 ? 115.959 133.272 105.161 1.00 87.57  ? 123 LYS E O     1 
ATOM   3692  C CB    . LYS E 5  126 ? 117.653 135.847 104.679 1.00 92.39  ? 123 LYS E CB    1 
ATOM   3693  C CG    . LYS E 5  126 ? 119.029 136.446 104.841 1.00 100.07 ? 123 LYS E CG    1 
ATOM   3694  C CD    . LYS E 5  126 ? 118.874 137.789 105.531 1.00 105.70 ? 123 LYS E CD    1 
ATOM   3695  C CE    . LYS E 5  126 ? 120.212 138.406 105.920 1.00 113.87 ? 123 LYS E CE    1 
ATOM   3696  N NZ    . LYS E 5  126 ? 120.049 139.807 106.406 1.00 107.06 ? 123 LYS E NZ    1 
ATOM   3697  N N     . ASP E 5  127 ? 115.195 134.473 103.423 1.00 87.90  ? 124 ASP E N     1 
ATOM   3698  C CA    . ASP E 5  127 ? 113.810 134.123 103.668 1.00 92.02  ? 124 ASP E CA    1 
ATOM   3699  C C     . ASP E 5  127 ? 113.651 132.664 103.298 1.00 88.61  ? 124 ASP E C     1 
ATOM   3700  O O     . ASP E 5  127 ? 112.894 131.924 103.929 1.00 86.11  ? 124 ASP E O     1 
ATOM   3701  C CB    . ASP E 5  127 ? 112.866 134.990 102.822 1.00 91.60  ? 124 ASP E CB    1 
ATOM   3702  C CG    . ASP E 5  127 ? 112.822 136.456 103.255 1.00 92.22  ? 124 ASP E CG    1 
ATOM   3703  O OD1   . ASP E 5  127 ? 112.498 136.713 104.392 1.00 95.69  ? 124 ASP E OD1   1 
ATOM   3704  O OD2   . ASP E 5  127 ? 113.074 137.313 102.433 1.00 94.42  ? 124 ASP E OD2   1 
ATOM   3705  N N     . ILE E 5  128 ? 114.417 132.239 102.299 1.00 86.16  ? 125 ILE E N     1 
ATOM   3706  C CA    . ILE E 5  128 ? 114.407 130.840 101.907 1.00 84.43  ? 125 ILE E CA    1 
ATOM   3707  C C     . ILE E 5  128 ? 115.048 130.008 102.994 1.00 85.65  ? 125 ILE E C     1 
ATOM   3708  O O     . ILE E 5  128 ? 114.511 128.980 103.407 1.00 84.46  ? 125 ILE E O     1 
ATOM   3709  C CB    . ILE E 5  128 ? 115.166 130.599 100.592 1.00 80.13  ? 125 ILE E CB    1 
ATOM   3710  C CG1   . ILE E 5  128 ? 114.433 131.264 99.439  1.00 84.06  ? 125 ILE E CG1   1 
ATOM   3711  C CG2   . ILE E 5  128 ? 115.315 129.098 100.351 1.00 82.87  ? 125 ILE E CG2   1 
ATOM   3712  C CD1   . ILE E 5  128 ? 115.216 131.316 98.153  1.00 89.02  ? 125 ILE E CD1   1 
ATOM   3713  N N     . GLN E 5  129 ? 116.195 130.468 103.471 1.00 83.80  ? 126 GLN E N     1 
ATOM   3714  C CA    . GLN E 5  129 ? 116.943 129.731 104.470 1.00 85.61  ? 126 GLN E CA    1 
ATOM   3715  C C     . GLN E 5  129 ? 116.172 129.594 105.768 1.00 85.33  ? 126 GLN E C     1 
ATOM   3716  O O     . GLN E 5  129 ? 116.192 128.533 106.391 1.00 84.98  ? 126 GLN E O     1 
ATOM   3717  C CB    . GLN E 5  129 ? 118.274 130.414 104.715 1.00 85.86  ? 126 GLN E CB    1 
ATOM   3718  C CG    . GLN E 5  129 ? 119.210 130.307 103.544 1.00 92.01  ? 126 GLN E CG    1 
ATOM   3719  C CD    . GLN E 5  129 ? 120.385 131.215 103.668 1.00 99.61  ? 126 GLN E CD    1 
ATOM   3720  O OE1   . GLN E 5  129 ? 120.476 131.995 104.621 1.00 96.79  ? 126 GLN E OE1   1 
ATOM   3721  N NE2   . GLN E 5  129 ? 121.285 131.149 102.696 1.00 101.03 ? 126 GLN E NE2   1 
ATOM   3722  N N     . LEU E 5  130 ? 115.453 130.640 106.156 1.00 83.16  ? 127 LEU E N     1 
ATOM   3723  C CA    . LEU E 5  130 ? 114.666 130.565 107.372 1.00 82.65  ? 127 LEU E CA    1 
ATOM   3724  C C     . LEU E 5  130 ? 113.594 129.507 107.234 1.00 85.82  ? 127 LEU E C     1 
ATOM   3725  O O     . LEU E 5  130 ? 113.407 128.682 108.130 1.00 83.27  ? 127 LEU E O     1 
ATOM   3726  C CB    . LEU E 5  130 ? 114.009 131.912 107.683 1.00 86.09  ? 127 LEU E CB    1 
ATOM   3727  C CG    . LEU E 5  130 ? 113.081 131.943 108.923 1.00 89.76  ? 127 LEU E CG    1 
ATOM   3728  C CD1   . LEU E 5  130 ? 113.874 131.617 110.192 1.00 92.13  ? 127 LEU E CD1   1 
ATOM   3729  C CD2   . LEU E 5  130 ? 112.442 133.304 109.031 1.00 91.76  ? 127 LEU E CD2   1 
ATOM   3730  N N     . ALA E 5  131 ? 112.895 129.514 106.103 1.00 84.83  ? 128 ALA E N     1 
ATOM   3731  C CA    . ALA E 5  131 ? 111.841 128.541 105.895 1.00 88.20  ? 128 ALA E CA    1 
ATOM   3732  C C     . ALA E 5  131 ? 112.403 127.130 105.921 1.00 84.52  ? 128 ALA E C     1 
ATOM   3733  O O     . ALA E 5  131 ? 111.838 126.238 106.557 1.00 83.38  ? 128 ALA E O     1 
ATOM   3734  C CB    . ALA E 5  131 ? 111.140 128.800 104.572 1.00 89.93  ? 128 ALA E CB    1 
ATOM   3735  N N     . ARG E 5  132 ? 113.561 126.942 105.307 1.00 82.50  ? 129 ARG E N     1 
ATOM   3736  C CA    . ARG E 5  132 ? 114.157 125.620 105.258 1.00 87.36  ? 129 ARG E CA    1 
ATOM   3737  C C     . ARG E 5  132 ? 114.569 125.145 106.628 1.00 85.85  ? 129 ARG E C     1 
ATOM   3738  O O     . ARG E 5  132 ? 114.322 123.996 107.004 1.00 85.95  ? 129 ARG E O     1 
ATOM   3739  C CB    . ARG E 5  132 ? 115.367 125.620 104.373 1.00 86.44  ? 129 ARG E CB    1 
ATOM   3740  C CG    . ARG E 5  132 ? 115.062 125.722 102.932 1.00 87.67  ? 129 ARG E CG    1 
ATOM   3741  C CD    . ARG E 5  132 ? 116.249 125.543 102.150 1.00 87.39  ? 129 ARG E CD    1 
ATOM   3742  N NE    . ARG E 5  132 ? 116.762 124.219 102.309 1.00 89.51  ? 129 ARG E NE    1 
ATOM   3743  C CZ    . ARG E 5  132 ? 118.055 123.894 102.257 1.00 94.90  ? 129 ARG E CZ    1 
ATOM   3744  N NH1   . ARG E 5  132 ? 118.962 124.815 102.033 1.00 92.85  ? 129 ARG E NH1   1 
ATOM   3745  N NH2   . ARG E 5  132 ? 118.421 122.644 102.443 1.00 99.43  ? 129 ARG E NH2   1 
ATOM   3746  N N     . ARG E 5  133 ? 115.136 126.047 107.405 1.00 83.04  ? 130 ARG E N     1 
ATOM   3747  C CA    . ARG E 5  133 ? 115.576 125.684 108.727 1.00 84.17  ? 130 ARG E CA    1 
ATOM   3748  C C     . ARG E 5  133 ? 114.420 125.200 109.553 1.00 84.16  ? 130 ARG E C     1 
ATOM   3749  O O     . ARG E 5  133 ? 114.477 124.133 110.160 1.00 86.37  ? 130 ARG E O     1 
ATOM   3750  C CB    . ARG E 5  133 ? 116.149 126.883 109.420 1.00 87.59  ? 130 ARG E CB    1 
ATOM   3751  C CG    . ARG E 5  133 ? 116.468 126.670 110.865 1.00 91.82  ? 130 ARG E CG    1 
ATOM   3752  C CD    . ARG E 5  133 ? 117.538 125.708 111.045 1.00 96.17  ? 130 ARG E CD    1 
ATOM   3753  N NE    . ARG E 5  133 ? 118.709 126.121 110.335 1.00 103.41 ? 130 ARG E NE    1 
ATOM   3754  C CZ    . ARG E 5  133 ? 119.564 127.061 110.763 1.00 111.00 ? 130 ARG E CZ    1 
ATOM   3755  N NH1   . ARG E 5  133 ? 119.365 127.665 111.913 1.00 106.16 ? 130 ARG E NH1   1 
ATOM   3756  N NH2   . ARG E 5  133 ? 120.604 127.386 110.022 1.00 113.37 ? 130 ARG E NH2   1 
ATOM   3757  N N     . ILE E 5  134 ? 113.333 125.939 109.493 1.00 80.88  ? 131 ILE E N     1 
ATOM   3758  C CA    . ILE E 5  134 ? 112.158 125.613 110.265 1.00 81.63  ? 131 ILE E CA    1 
ATOM   3759  C C     . ILE E 5  134 ? 111.597 124.268 109.830 1.00 83.38  ? 131 ILE E C     1 
ATOM   3760  O O     . ILE E 5  134 ? 111.157 123.471 110.657 1.00 87.37  ? 131 ILE E O     1 
ATOM   3761  C CB    . ILE E 5  134 ? 111.134 126.741 110.158 1.00 84.84  ? 131 ILE E CB    1 
ATOM   3762  C CG1   . ILE E 5  134 ? 111.680 127.980 110.878 1.00 86.33  ? 131 ILE E CG1   1 
ATOM   3763  C CG2   . ILE E 5  134 ? 109.827 126.308 110.742 1.00 87.87  ? 131 ILE E CG2   1 
ATOM   3764  C CD1   . ILE E 5  134 ? 110.914 129.241 110.600 1.00 91.34  ? 131 ILE E CD1   1 
ATOM   3765  N N     . ARG E 5  135 ? 111.634 124.013 108.528 1.00 82.69  ? 132 ARG E N     1 
ATOM   3766  C CA    . ARG E 5  135 ? 111.186 122.746 107.963 1.00 86.54  ? 132 ARG E CA    1 
ATOM   3767  C C     . ARG E 5  135 ? 112.115 121.588 108.328 1.00 87.58  ? 132 ARG E C     1 
ATOM   3768  O O     . ARG E 5  135 ? 111.746 120.423 108.181 1.00 89.52  ? 132 ARG E O     1 
ATOM   3769  C CB    . ARG E 5  135 ? 111.102 122.861 106.456 1.00 88.43  ? 132 ARG E CB    1 
ATOM   3770  C CG    . ARG E 5  135 ? 110.003 123.770 105.982 1.00 89.63  ? 132 ARG E CG    1 
ATOM   3771  C CD    . ARG E 5  135 ? 110.223 124.269 104.607 1.00 91.47  ? 132 ARG E CD    1 
ATOM   3772  N NE    . ARG E 5  135 ? 110.054 123.265 103.609 1.00 93.25  ? 132 ARG E NE    1 
ATOM   3773  C CZ    . ARG E 5  135 ? 108.924 123.056 102.919 1.00 93.10  ? 132 ARG E CZ    1 
ATOM   3774  N NH1   . ARG E 5  135 ? 107.861 123.796 103.115 1.00 89.91  ? 132 ARG E NH1   1 
ATOM   3775  N NH2   . ARG E 5  135 ? 108.892 122.104 102.019 1.00 97.08  ? 132 ARG E NH2   1 
ATOM   3776  N N     . GLY E 5  136 ? 113.317 121.905 108.806 1.00 85.97  ? 133 GLY E N     1 
ATOM   3777  C CA    . GLY E 5  136 ? 114.273 120.886 109.215 1.00 90.01  ? 133 GLY E CA    1 
ATOM   3778  C C     . GLY E 5  136 ? 115.093 120.344 108.052 1.00 94.22  ? 133 GLY E C     1 
ATOM   3779  O O     . GLY E 5  136 ? 115.526 119.192 108.076 1.00 96.87  ? 133 GLY E O     1 
ATOM   3780  N N     . GLU E 5  137 ? 115.271 121.157 107.018 1.00 92.72  ? 134 GLU E N     1 
ATOM   3781  C CA    . GLU E 5  137 ? 116.030 120.739 105.848 1.00 98.04  ? 134 GLU E CA    1 
ATOM   3782  C C     . GLU E 5  137 ? 117.514 121.052 106.003 1.00 95.71  ? 134 GLU E C     1 
ATOM   3783  O O     . GLU E 5  137 ? 118.311 120.734 105.119 1.00 95.18  ? 134 GLU E O     1 
ATOM   3784  C CB    . GLU E 5  137 ? 115.487 121.421 104.597 1.00 100.26 ? 134 GLU E CB    1 
ATOM   3785  C CG    . GLU E 5  137 ? 114.058 121.050 104.253 1.00 101.16 ? 134 GLU E CG    1 
ATOM   3786  C CD    . GLU E 5  137 ? 113.560 121.741 103.015 1.00 103.57 ? 134 GLU E CD    1 
ATOM   3787  O OE1   . GLU E 5  137 ? 114.338 122.416 102.379 1.00 98.93  ? 134 GLU E OE1   1 
ATOM   3788  O OE2   . GLU E 5  137 ? 112.404 121.585 102.693 1.00 102.19 ? 134 GLU E OE2   1 
ATOM   3789  N N     . LEU F 6  26  ? 127.375 114.872 79.802  1.00 123.75 ? 23  LEU F N     1 
ATOM   3790  C CA    . LEU F 6  26  ? 127.374 116.354 79.678  1.00 128.74 ? 23  LEU F CA    1 
ATOM   3791  C C     . LEU F 6  26  ? 127.565 116.980 81.063  1.00 124.35 ? 23  LEU F C     1 
ATOM   3792  O O     . LEU F 6  26  ? 127.563 116.230 82.057  1.00 119.39 ? 23  LEU F O     1 
ATOM   3793  C CB    . LEU F 6  26  ? 126.054 116.808 79.048  1.00 131.64 ? 23  LEU F CB    1 
ATOM   3794  C CG    . LEU F 6  26  ? 125.901 116.512 77.557  1.00 139.63 ? 23  LEU F CG    1 
ATOM   3795  C CD1   . LEU F 6  26  ? 124.504 116.868 77.075  1.00 134.78 ? 23  LEU F CD1   1 
ATOM   3796  C CD2   . LEU F 6  26  ? 126.948 117.260 76.747  1.00 137.32 ? 23  LEU F CD2   1 
ATOM   3797  N N     . ARG F 6  27  ? 127.590 118.318 81.130  1.00 127.56 ? 24  ARG F N     1 
ATOM   3798  C CA    . ARG F 6  27  ? 127.728 119.056 82.419  1.00 125.95 ? 24  ARG F CA    1 
ATOM   3799  C C     . ARG F 6  27  ? 126.931 120.368 82.356  1.00 119.62 ? 24  ARG F C     1 
ATOM   3800  O O     . ARG F 6  27  ? 126.268 120.607 81.327  1.00 117.56 ? 24  ARG F O     1 
ATOM   3801  C CB    . ARG F 6  27  ? 129.205 119.335 82.720  1.00 132.84 ? 24  ARG F CB    1 
ATOM   3802  C CG    . ARG F 6  27  ? 129.998 118.109 83.149  0.00 137.71 ? 24  ARG F CG    1 
ATOM   3803  C CD    . ARG F 6  27  ? 131.455 118.432 83.427  0.00 150.35 ? 24  ARG F CD    1 
ATOM   3804  N NE    . ARG F 6  27  ? 131.611 119.443 84.463  0.00 153.60 ? 24  ARG F NE    1 
ATOM   3805  C CZ    . ARG F 6  27  ? 132.780 119.898 84.900  0.00 157.53 ? 24  ARG F CZ    1 
ATOM   3806  N NH1   . ARG F 6  27  ? 133.905 119.430 84.388  0.00 152.82 ? 24  ARG F NH1   1 
ATOM   3807  N NH2   . ARG F 6  27  ? 132.819 120.818 85.846  0.00 148.45 ? 24  ARG F NH2   1 
ATOM   3808  N N     . ASP F 6  28  ? 127.014 121.187 83.413  1.00 119.65 ? 25  ASP F N     1 
ATOM   3809  C CA    . ASP F 6  28  ? 126.328 122.509 83.488  1.00 114.52 ? 25  ASP F CA    1 
ATOM   3810  C C     . ASP F 6  28  ? 124.844 122.533 83.091  1.00 107.26 ? 25  ASP F C     1 
ATOM   3811  O O     . ASP F 6  28  ? 124.480 123.373 82.244  1.00 105.69 ? 25  ASP F O     1 
ATOM   3812  C CB    . ASP F 6  28  ? 126.969 123.523 82.537  1.00 117.83 ? 25  ASP F CB    1 
ATOM   3813  C CG    . ASP F 6  28  ? 128.432 123.796 82.844  1.00 122.67 ? 25  ASP F CG    1 
ATOM   3814  O OD1   . ASP F 6  28  ? 128.956 123.175 83.790  1.00 123.47 ? 25  ASP F OD1   1 
ATOM   3815  O OD2   . ASP F 6  28  ? 129.033 124.627 82.136  1.00 120.02 ? 25  ASP F OD2   1 
ATOM   3816  N N     . ASN F 6  29  ? 124.028 121.643 83.668  1.00 102.43 ? 26  ASN F N     1 
ATOM   3817  C CA    . ASN F 6  29  ? 122.562 121.623 83.394  1.00 101.55 ? 26  ASN F CA    1 
ATOM   3818  C C     . ASN F 6  29  ? 121.663 122.475 84.409  1.00 99.26  ? 26  ASN F C     1 
ATOM   3819  O O     . ASN F 6  29  ? 120.430 122.615 84.290  1.00 97.07  ? 26  ASN F O     1 
ATOM   3820  C CB    . ASN F 6  29  ? 122.059 120.193 83.175  1.00 100.06 ? 26  ASN F CB    1 
ATOM   3821  C CG    . ASN F 6  29  ? 122.654 119.540 81.946  1.00 102.94 ? 26  ASN F CG    1 
ATOM   3822  O OD1   . ASN F 6  29  ? 122.676 120.133 80.870  1.00 101.24 ? 26  ASN F OD1   1 
ATOM   3823  N ND2   . ASN F 6  29  ? 123.137 118.317 82.095  1.00 104.10 ? 26  ASN F ND2   1 
ATOM   3824  N N     . ILE F 6  30  ? 122.367 122.932 85.448  1.00 97.73  ? 27  ILE F N     1 
ATOM   3825  C CA    . ILE F 6  30  ? 121.827 123.828 86.508  1.00 95.59  ? 27  ILE F CA    1 
ATOM   3826  C C     . ILE F 6  30  ? 121.482 125.208 85.947  1.00 96.56  ? 27  ILE F C     1 
ATOM   3827  O O     . ILE F 6  30  ? 120.733 125.958 86.604  1.00 94.35  ? 27  ILE F O     1 
ATOM   3828  C CB    . ILE F 6  30  ? 122.856 123.912 87.652  1.00 99.17  ? 27  ILE F CB    1 
ATOM   3829  C CG1   . ILE F 6  30  ? 122.238 124.478 88.933  1.00 99.27  ? 27  ILE F CG1   1 
ATOM   3830  C CG2   . ILE F 6  30  ? 124.082 124.701 87.220  1.00 102.65 ? 27  ILE F CG2   1 
ATOM   3831  C CD1   . ILE F 6  30  ? 121.114 123.638 89.495  1.00 97.23  ? 27  ILE F CD1   1 
ATOM   3832  N N     . GLN F 6  31  ? 122.056 125.517 84.777  1.00 95.89  ? 28  GLN F N     1 
ATOM   3833  C CA    . GLN F 6  31  ? 121.760 126.759 84.088  1.00 96.32  ? 28  GLN F CA    1 
ATOM   3834  C C     . GLN F 6  31  ? 120.588 126.543 83.152  1.00 94.52  ? 28  GLN F C     1 
ATOM   3835  O O     . GLN F 6  31  ? 120.072 127.485 82.552  1.00 96.59  ? 28  GLN F O     1 
ATOM   3836  C CB    . GLN F 6  31  ? 122.955 127.217 83.259  1.00 98.95  ? 28  GLN F CB    1 
ATOM   3837  C CG    . GLN F 6  31  ? 124.237 127.378 84.028  1.00 106.23 ? 28  GLN F CG    1 
ATOM   3838  C CD    . GLN F 6  31  ? 124.129 128.300 85.196  1.00 108.11 ? 28  GLN F CD    1 
ATOM   3839  O OE1   . GLN F 6  31  ? 123.381 129.287 85.180  1.00 103.60 ? 28  GLN F OE1   1 
ATOM   3840  N NE2   . GLN F 6  31  ? 124.926 128.012 86.219  1.00 109.91 ? 28  GLN F NE2   1 
ATOM   3841  N N     . GLY F 6  32  ? 120.178 125.287 83.020  1.00 93.36  ? 29  GLY F N     1 
ATOM   3842  C CA    . GLY F 6  32  ? 119.056 124.917 82.183  1.00 94.83  ? 29  GLY F CA    1 
ATOM   3843  C C     . GLY F 6  32  ? 117.768 125.324 82.865  1.00 92.25  ? 29  GLY F C     1 
ATOM   3844  O O     . GLY F 6  32  ? 116.701 125.342 82.250  1.00 93.53  ? 29  GLY F O     1 
ATOM   3845  N N     . ILE F 6  33  ? 117.869 125.658 84.145  1.00 88.60  ? 30  ILE F N     1 
ATOM   3846  C CA    . ILE F 6  33  ? 116.725 126.158 84.864  1.00 87.65  ? 30  ILE F CA    1 
ATOM   3847  C C     . ILE F 6  33  ? 116.795 127.667 84.770  1.00 93.61  ? 30  ILE F C     1 
ATOM   3848  O O     . ILE F 6  33  ? 117.552 128.317 85.496  1.00 92.16  ? 30  ILE F O     1 
ATOM   3849  C CB    . ILE F 6  33  ? 116.753 125.715 86.332  1.00 89.34  ? 30  ILE F CB    1 
ATOM   3850  C CG1   . ILE F 6  33  ? 116.979 124.191 86.440  1.00 91.49  ? 30  ILE F CG1   1 
ATOM   3851  C CG2   . ILE F 6  33  ? 115.457 126.123 87.012  1.00 92.25  ? 30  ILE F CG2   1 
ATOM   3852  C CD1   . ILE F 6  33  ? 115.938 123.331 85.750  1.00 92.90  ? 30  ILE F CD1   1 
ATOM   3853  N N     . THR F 6  34  ? 116.030 128.210 83.843  1.00 93.03  ? 31  THR F N     1 
ATOM   3854  C CA    . THR F 6  34  ? 116.154 129.600 83.459  1.00 94.01  ? 31  THR F CA    1 
ATOM   3855  C C     . THR F 6  34  ? 115.539 130.501 84.504  1.00 93.41  ? 31  THR F C     1 
ATOM   3856  O O     . THR F 6  34  ? 114.805 130.044 85.381  1.00 91.44  ? 31  THR F O     1 
ATOM   3857  C CB    . THR F 6  34  ? 115.470 129.832 82.100  1.00 98.67  ? 31  THR F CB    1 
ATOM   3858  O OG1   . THR F 6  34  ? 114.055 129.556 82.228  1.00 99.52  ? 31  THR F OG1   1 
ATOM   3859  C CG2   . THR F 6  34  ? 116.077 128.901 81.057  1.00 101.08 ? 31  THR F CG2   1 
ATOM   3860  N N     . LYS F 6  35  ? 115.838 131.786 84.416  1.00 86.72  ? 32  LYS F N     1 
ATOM   3861  C CA    . LYS F 6  35  ? 115.269 132.728 85.350  1.00 87.43  ? 32  LYS F CA    1 
ATOM   3862  C C     . LYS F 6  35  ? 113.750 132.701 85.360  1.00 89.78  ? 32  LYS F C     1 
ATOM   3863  O O     . LYS F 6  35  ? 113.161 132.667 86.438  1.00 87.36  ? 32  LYS F O     1 
ATOM   3864  C CB    . LYS F 6  35  ? 115.820 134.121 85.118  1.00 89.44  ? 32  LYS F CB    1 
ATOM   3865  C CG    . LYS F 6  35  ? 117.168 134.338 85.721  1.00 97.58  ? 32  LYS F CG    1 
ATOM   3866  C CD    . LYS F 6  35  ? 117.738 135.693 85.346  1.00 103.94 ? 32  LYS F CD    1 
ATOM   3867  C CE    . LYS F 6  35  ? 117.056 136.823 86.091  1.00 102.25 ? 32  LYS F CE    1 
ATOM   3868  N NZ    . LYS F 6  35  ? 117.664 138.137 85.764  1.00 102.25 ? 32  LYS F NZ    1 
ATOM   3869  N N     . PRO F 6  36  ? 113.084 132.786 84.201  1.00 87.72  ? 33  PRO F N     1 
ATOM   3870  C CA    . PRO F 6  36  ? 111.658 132.615 84.058  1.00 92.48  ? 33  PRO F CA    1 
ATOM   3871  C C     . PRO F 6  36  ? 111.159 131.330 84.700  1.00 91.71  ? 33  PRO F C     1 
ATOM   3872  O O     . PRO F 6  36  ? 110.176 131.348 85.430  1.00 90.39  ? 33  PRO F O     1 
ATOM   3873  C CB    . PRO F 6  36  ? 111.501 132.616 82.544  1.00 97.44  ? 33  PRO F CB    1 
ATOM   3874  C CG    . PRO F 6  36  ? 112.584 133.537 82.067  1.00 93.07  ? 33  PRO F CG    1 
ATOM   3875  C CD    . PRO F 6  36  ? 113.745 133.286 82.985  1.00 84.81  ? 33  PRO F CD    1 
ATOM   3876  N N     . ALA F 6  37  ? 111.891 130.232 84.542  1.00 92.79  ? 34  ALA F N     1 
ATOM   3877  C CA    . ALA F 6  37  ? 111.426 128.995 85.154  1.00 95.59  ? 34  ALA F CA    1 
ATOM   3878  C C     . ALA F 6  37  ? 111.364 129.133 86.667  1.00 92.12  ? 34  ALA F C     1 
ATOM   3879  O O     . ALA F 6  37  ? 110.377 128.746 87.299  1.00 91.87  ? 34  ALA F O     1 
ATOM   3880  C CB    . ALA F 6  37  ? 112.333 127.839 84.779  1.00 100.43 ? 34  ALA F CB    1 
ATOM   3881  N N     . ILE F 6  38  ? 112.386 129.759 87.235  1.00 89.23  ? 35  ILE F N     1 
ATOM   3882  C CA    . ILE F 6  38  ? 112.442 129.966 88.672  1.00 86.53  ? 35  ILE F CA    1 
ATOM   3883  C C     . ILE F 6  38  ? 111.371 130.936 89.101  1.00 88.62  ? 35  ILE F C     1 
ATOM   3884  O O     . ILE F 6  38  ? 110.658 130.709 90.080  1.00 88.18  ? 35  ILE F O     1 
ATOM   3885  C CB    . ILE F 6  38  ? 113.824 130.484 89.091  1.00 87.05  ? 35  ILE F CB    1 
ATOM   3886  C CG1   . ILE F 6  38  ? 114.843 129.369 88.871  1.00 93.20  ? 35  ILE F CG1   1 
ATOM   3887  C CG2   . ILE F 6  38  ? 113.800 130.965 90.550  1.00 89.09  ? 35  ILE F CG2   1 
ATOM   3888  C CD1   . ILE F 6  38  ? 116.291 129.795 88.926  1.00 99.58  ? 35  ILE F CD1   1 
ATOM   3889  N N     . ARG F 6  39  ? 111.254 132.013 88.352  1.00 87.44  ? 36  ARG F N     1 
ATOM   3890  C CA    . ARG F 6  39  ? 110.295 133.047 88.643  1.00 88.30  ? 36  ARG F CA    1 
ATOM   3891  C C     . ARG F 6  39  ? 108.868 132.562 88.597  1.00 89.31  ? 36  ARG F C     1 
ATOM   3892  O O     . ARG F 6  39  ? 108.056 132.921 89.446  1.00 88.29  ? 36  ARG F O     1 
ATOM   3893  C CB    . ARG F 6  39  ? 110.441 134.148 87.638  1.00 89.00  ? 36  ARG F CB    1 
ATOM   3894  C CG    . ARG F 6  39  ? 109.364 135.158 87.681  1.00 96.17  ? 36  ARG F CG    1 
ATOM   3895  C CD    . ARG F 6  39  ? 109.677 136.283 86.828  1.00 96.47  ? 36  ARG F CD    1 
ATOM   3896  N NE    . ARG F 6  39  ? 110.710 137.083 87.393  1.00 96.00  ? 36  ARG F NE    1 
ATOM   3897  C CZ    . ARG F 6  39  ? 111.454 137.947 86.712  1.00 96.45  ? 36  ARG F CZ    1 
ATOM   3898  N NH1   . ARG F 6  39  ? 111.282 138.089 85.422  1.00 95.85  ? 36  ARG F NH1   1 
ATOM   3899  N NH2   . ARG F 6  39  ? 112.354 138.669 87.343  1.00 98.69  ? 36  ARG F NH2   1 
ATOM   3900  N N     . ARG F 6  40  ? 108.546 131.786 87.582  1.00 89.38  ? 37  ARG F N     1 
ATOM   3901  C CA    . ARG F 6  40  ? 107.191 131.316 87.410  1.00 93.45  ? 37  ARG F CA    1 
ATOM   3902  C C     . ARG F 6  40  ? 106.787 130.424 88.570  1.00 91.23  ? 37  ARG F C     1 
ATOM   3903  O O     . ARG F 6  40  ? 105.662 130.510 89.065  1.00 91.80  ? 37  ARG F O     1 
ATOM   3904  C CB    . ARG F 6  40  ? 107.058 130.595 86.093  1.00 96.69  ? 37  ARG F CB    1 
ATOM   3905  C CG    . ARG F 6  40  ? 107.081 131.487 84.879  1.00 97.85  ? 37  ARG F CG    1 
ATOM   3906  C CD    . ARG F 6  40  ? 106.677 130.746 83.674  1.00 99.54  ? 37  ARG F CD    1 
ATOM   3907  N NE    . ARG F 6  40  ? 107.683 129.800 83.253  1.00 96.34  ? 37  ARG F NE    1 
ATOM   3908  C CZ    . ARG F 6  40  ? 108.635 130.056 82.347  1.00 94.66  ? 37  ARG F CZ    1 
ATOM   3909  N NH1   . ARG F 6  40  ? 108.662 131.213 81.732  1.00 96.84  ? 37  ARG F NH1   1 
ATOM   3910  N NH2   . ARG F 6  40  ? 109.522 129.131 82.052  1.00 96.81  ? 37  ARG F NH2   1 
ATOM   3911  N N     . LEU F 6  41  ? 107.717 129.601 89.040  1.00 88.62  ? 38  LEU F N     1 
ATOM   3912  C CA    . LEU F 6  41  ? 107.453 128.778 90.208  1.00 88.58  ? 38  LEU F CA    1 
ATOM   3913  C C     . LEU F 6  41  ? 107.220 129.656 91.422  1.00 89.31  ? 38  LEU F C     1 
ATOM   3914  O O     . LEU F 6  41  ? 106.279 129.443 92.188  1.00 87.61  ? 38  LEU F O     1 
ATOM   3915  C CB    . LEU F 6  41  ? 108.651 127.867 90.473  1.00 90.52  ? 38  LEU F CB    1 
ATOM   3916  C CG    . LEU F 6  41  ? 108.846 126.733 89.486  1.00 92.89  ? 38  LEU F CG    1 
ATOM   3917  C CD1   . LEU F 6  41  ? 110.245 126.218 89.600  1.00 95.56  ? 38  LEU F CD1   1 
ATOM   3918  C CD2   . LEU F 6  41  ? 107.881 125.610 89.808  1.00 98.29  ? 38  LEU F CD2   1 
ATOM   3919  N N     . ALA F 6  42  ? 108.047 130.682 91.566  1.00 87.35  ? 39  ALA F N     1 
ATOM   3920  C CA    . ALA F 6  42  ? 107.915 131.584 92.691  1.00 89.31  ? 39  ALA F CA    1 
ATOM   3921  C C     . ALA F 6  42  ? 106.575 132.300 92.644  1.00 89.83  ? 39  ALA F C     1 
ATOM   3922  O O     . ALA F 6  42  ? 105.913 132.468 93.671  1.00 89.74  ? 39  ALA F O     1 
ATOM   3923  C CB    . ALA F 6  42  ? 109.064 132.573 92.694  1.00 90.80  ? 39  ALA F CB    1 
ATOM   3924  N N     . ARG F 6  43  ? 106.143 132.651 91.440  1.00 88.10  ? 40  ARG F N     1 
ATOM   3925  C CA    . ARG F 6  43  ? 104.871 133.324 91.243  1.00 91.63  ? 40  ARG F CA    1 
ATOM   3926  C C     . ARG F 6  43  ? 103.714 132.434 91.607  1.00 91.46  ? 40  ARG F C     1 
ATOM   3927  O O     . ARG F 6  43  ? 102.791 132.850 92.302  1.00 97.07  ? 40  ARG F O     1 
ATOM   3928  C CB    . ARG F 6  43  ? 104.725 133.742 89.804  1.00 96.80  ? 40  ARG F CB    1 
ATOM   3929  C CG    . ARG F 6  43  ? 105.605 134.861 89.422  1.00 98.30  ? 40  ARG F CG    1 
ATOM   3930  C CD    . ARG F 6  43  ? 104.986 136.125 89.768  1.00 103.62 ? 40  ARG F CD    1 
ATOM   3931  N NE    . ARG F 6  43  ? 105.928 137.194 89.818  1.00 101.46 ? 40  ARG F NE    1 
ATOM   3932  C CZ    . ARG F 6  43  ? 106.354 137.902 88.767  1.00 101.99 ? 40  ARG F CZ    1 
ATOM   3933  N NH1   . ARG F 6  43  ? 105.952 137.600 87.558  1.00 105.36 ? 40  ARG F NH1   1 
ATOM   3934  N NH2   . ARG F 6  43  ? 107.164 138.916 88.960  1.00 102.81 ? 40  ARG F NH2   1 
ATOM   3935  N N     . ARG F 6  44  ? 103.806 131.174 91.233  1.00 89.69  ? 41  ARG F N     1 
ATOM   3936  C CA    . ARG F 6  44  ? 102.764 130.235 91.580  1.00 91.11  ? 41  ARG F CA    1 
ATOM   3937  C C     . ARG F 6  44  ? 102.633 130.150 93.096  1.00 89.49  ? 41  ARG F C     1 
ATOM   3938  O O     . ARG F 6  44  ? 101.541 129.942 93.624  1.00 94.41  ? 41  ARG F O     1 
ATOM   3939  C CB    . ARG F 6  44  ? 103.064 128.879 90.990  1.00 92.20  ? 41  ARG F CB    1 
ATOM   3940  C CG    . ARG F 6  44  ? 101.986 127.867 91.178  1.00 97.20  ? 41  ARG F CG    1 
ATOM   3941  C CD    . ARG F 6  44  ? 102.242 126.617 90.419  1.00 95.58  ? 41  ARG F CD    1 
ATOM   3942  N NE    . ARG F 6  44  ? 101.803 126.688 89.032  1.00 98.26  ? 41  ARG F NE    1 
ATOM   3943  C CZ    . ARG F 6  44  ? 102.166 125.811 88.078  1.00 100.00 ? 41  ARG F CZ    1 
ATOM   3944  N NH1   . ARG F 6  44  ? 103.009 124.850 88.360  1.00 97.94  ? 41  ARG F NH1   1 
ATOM   3945  N NH2   . ARG F 6  44  ? 101.679 125.901 86.856  1.00 106.04 ? 41  ARG F NH2   1 
ATOM   3946  N N     . GLY F 6  45  ? 103.751 130.341 93.795  1.00 89.74  ? 42  GLY F N     1 
ATOM   3947  C CA    . GLY F 6  45  ? 103.787 130.307 95.253  1.00 93.56  ? 42  GLY F CA    1 
ATOM   3948  C C     . GLY F 6  45  ? 103.378 131.637 95.901  1.00 93.06  ? 42  GLY F C     1 
ATOM   3949  O O     . GLY F 6  45  ? 103.365 131.755 97.127  1.00 97.38  ? 42  GLY F O     1 
ATOM   3950  N N     . GLY F 6  46  ? 103.070 132.649 95.091  1.00 90.96  ? 43  GLY F N     1 
ATOM   3951  C CA    . GLY F 6  46  ? 102.638 133.939 95.625  1.00 93.18  ? 43  GLY F CA    1 
ATOM   3952  C C     . GLY F 6  46  ? 103.729 135.007 95.718  1.00 92.42  ? 43  GLY F C     1 
ATOM   3953  O O     . GLY F 6  46  ? 103.527 136.042 96.353  1.00 94.82  ? 43  GLY F O     1 
ATOM   3954  N N     . VAL F 6  47  ? 104.877 134.776 95.097  1.00 90.08  ? 44  VAL F N     1 
ATOM   3955  C CA    . VAL F 6  47  ? 105.955 135.757 95.141  1.00 87.94  ? 44  VAL F CA    1 
ATOM   3956  C C     . VAL F 6  47  ? 105.868 136.791 94.029  1.00 92.54  ? 44  VAL F C     1 
ATOM   3957  O O     . VAL F 6  47  ? 105.833 136.445 92.849  1.00 94.28  ? 44  VAL F O     1 
ATOM   3958  C CB    . VAL F 6  47  ? 107.308 135.045 95.039  1.00 93.70  ? 44  VAL F CB    1 
ATOM   3959  C CG1   . VAL F 6  47  ? 108.432 136.056 94.941  1.00 97.41  ? 44  VAL F CG1   1 
ATOM   3960  C CG2   . VAL F 6  47  ? 107.497 134.141 96.250  1.00 95.91  ? 44  VAL F CG2   1 
ATOM   3961  N N     . LYS F 6  48  ? 105.949 138.068 94.398  1.00 89.39  ? 45  LYS F N     1 
ATOM   3962  C CA    . LYS F 6  48  ? 105.925 139.127 93.397  1.00 92.56  ? 45  LYS F CA    1 
ATOM   3963  C C     . LYS F 6  48  ? 107.308 139.598 93.003  1.00 95.74  ? 45  LYS F C     1 
ATOM   3964  O O     . LYS F 6  48  ? 107.563 139.909 91.839  1.00 101.15 ? 45  LYS F O     1 
ATOM   3965  C CB    . LYS F 6  48  ? 105.180 140.344 93.903  1.00 91.78  ? 45  LYS F CB    1 
ATOM   3966  C CG    . LYS F 6  48  ? 103.731 140.138 94.096  1.00 110.42 ? 45  LYS F CG    1 
ATOM   3967  C CD    . LYS F 6  48  ? 102.963 141.463 94.084  1.00 124.20 ? 45  LYS F CD    1 
ATOM   3968  C CE    . LYS F 6  48  ? 103.319 142.366 95.242  1.00 120.50 ? 45  LYS F CE    1 
ATOM   3969  N NZ    . LYS F 6  48  ? 102.476 143.597 95.261  1.00 124.78 ? 45  LYS F NZ    1 
ATOM   3970  N N     . ARG F 6  49  ? 108.198 139.686 93.977  1.00 92.22  ? 46  ARG F N     1 
ATOM   3971  C CA    . ARG F 6  49  ? 109.493 140.295 93.735  1.00 90.82  ? 46  ARG F CA    1 
ATOM   3972  C C     . ARG F 6  49  ? 110.637 139.410 94.158  1.00 91.43  ? 46  ARG F C     1 
ATOM   3973  O O     . ARG F 6  49  ? 110.700 138.944 95.296  1.00 90.18  ? 46  ARG F O     1 
ATOM   3974  C CB    . ARG F 6  49  ? 109.583 141.610 94.456  1.00 92.26  ? 46  ARG F CB    1 
ATOM   3975  C CG    . ARG F 6  49  ? 108.691 142.668 93.924  1.00 94.59  ? 46  ARG F CG    1 
ATOM   3976  C CD    . ARG F 6  49  ? 108.756 143.871 94.760  1.00 98.22  ? 46  ARG F CD    1 
ATOM   3977  N NE    . ARG F 6  49  ? 110.062 144.489 94.731  1.00 99.00  ? 46  ARG F NE    1 
ATOM   3978  C CZ    . ARG F 6  49  ? 110.459 145.412 93.840  1.00 100.38 ? 46  ARG F CZ    1 
ATOM   3979  N NH1   . ARG F 6  49  ? 109.639 145.823 92.905  1.00 101.04 ? 46  ARG F NH1   1 
ATOM   3980  N NH2   . ARG F 6  49  ? 111.673 145.912 93.912  1.00 98.67  ? 46  ARG F NH2   1 
ATOM   3981  N N     . ILE F 6  50  ? 111.542 139.180 93.227  1.00 87.04  ? 47  ILE F N     1 
ATOM   3982  C CA    . ILE F 6  50  ? 112.624 138.245 93.447  1.00 87.99  ? 47  ILE F CA    1 
ATOM   3983  C C     . ILE F 6  50  ? 113.981 138.926 93.415  1.00 93.58  ? 47  ILE F C     1 
ATOM   3984  O O     . ILE F 6  50  ? 114.401 139.424 92.373  1.00 96.40  ? 47  ILE F O     1 
ATOM   3985  C CB    . ILE F 6  50  ? 112.571 137.173 92.349  1.00 92.97  ? 47  ILE F CB    1 
ATOM   3986  C CG1   . ILE F 6  50  ? 111.207 136.479 92.370  1.00 92.26  ? 47  ILE F CG1   1 
ATOM   3987  C CG2   . ILE F 6  50  ? 113.676 136.170 92.540  1.00 99.93  ? 47  ILE F CG2   1 
ATOM   3988  C CD1   . ILE F 6  50  ? 110.939 135.636 91.159  1.00 98.56  ? 47  ILE F CD1   1 
ATOM   3989  N N     . SER F 6  51  ? 114.717 138.857 94.518  1.00 93.55  ? 48  SER F N     1 
ATOM   3990  C CA    . SER F 6  51  ? 116.073 139.391 94.528  1.00 92.88  ? 48  SER F CA    1 
ATOM   3991  C C     . SER F 6  51  ? 116.954 138.616 93.569  1.00 94.24  ? 48  SER F C     1 
ATOM   3992  O O     . SER F 6  51  ? 116.784 137.412 93.382  1.00 91.85  ? 48  SER F O     1 
ATOM   3993  C CB    . SER F 6  51  ? 116.671 139.359 95.913  1.00 97.62  ? 48  SER F CB    1 
ATOM   3994  O OG    . SER F 6  51  ? 118.038 139.674 95.868  1.00 99.80  ? 48  SER F OG    1 
ATOM   3995  N N     . GLY F 6  52  ? 117.931 139.293 92.987  1.00 93.45  ? 49  GLY F N     1 
ATOM   3996  C CA    . GLY F 6  52  ? 118.813 138.664 92.011  1.00 96.72  ? 49  GLY F CA    1 
ATOM   3997  C C     . GLY F 6  52  ? 119.620 137.530 92.626  1.00 93.61  ? 49  GLY F C     1 
ATOM   3998  O O     . GLY F 6  52  ? 120.165 136.686 91.917  1.00 95.08  ? 49  GLY F O     1 
ATOM   3999  N N     . LEU F 6  53  ? 119.677 137.497 93.948  1.00 88.90  ? 50  LEU F N     1 
ATOM   4000  C CA    . LEU F 6  53  ? 120.427 136.477 94.658  1.00 90.97  ? 50  LEU F CA    1 
ATOM   4001  C C     . LEU F 6  53  ? 119.636 135.177 94.779  1.00 92.07  ? 50  LEU F C     1 
ATOM   4002  O O     . LEU F 6  53  ? 120.199 134.121 95.077  1.00 93.23  ? 50  LEU F O     1 
ATOM   4003  C CB    . LEU F 6  53  ? 120.762 136.992 96.054  1.00 94.39  ? 50  LEU F CB    1 
ATOM   4004  C CG    . LEU F 6  53  ? 121.617 138.261 96.120  1.00 96.83  ? 50  LEU F CG    1 
ATOM   4005  C CD1   . LEU F 6  53  ? 121.696 138.721 97.567  1.00 105.21 ? 50  LEU F CD1   1 
ATOM   4006  C CD2   . LEU F 6  53  ? 123.007 137.987 95.565  1.00 99.95  ? 50  LEU F CD2   1 
ATOM   4007  N N     . ILE F 6  54  ? 118.328 135.265 94.578  1.00 89.08  ? 51  ILE F N     1 
ATOM   4008  C CA    . ILE F 6  54  ? 117.437 134.132 94.759  1.00 88.88  ? 51  ILE F CA    1 
ATOM   4009  C C     . ILE F 6  54  ? 117.694 133.054 93.752  1.00 89.91  ? 51  ILE F C     1 
ATOM   4010  O O     . ILE F 6  54  ? 117.582 131.868 94.056  1.00 88.42  ? 51  ILE F O     1 
ATOM   4011  C CB    . ILE F 6  54  ? 115.972 134.555 94.625  1.00 89.06  ? 51  ILE F CB    1 
ATOM   4012  C CG1   . ILE F 6  54  ? 115.592 135.508 95.730  1.00 91.82  ? 51  ILE F CG1   1 
ATOM   4013  C CG2   . ILE F 6  54  ? 115.044 133.341 94.580  1.00 90.61  ? 51  ILE F CG2   1 
ATOM   4014  C CD1   . ILE F 6  54  ? 115.740 134.971 97.113  1.00 93.38  ? 51  ILE F CD1   1 
ATOM   4015  N N     . TYR F 6  55  ? 117.954 133.453 92.529  1.00 88.41  ? 52  TYR F N     1 
ATOM   4016  C CA    . TYR F 6  55  ? 118.069 132.492 91.461  1.00 89.78  ? 52  TYR F CA    1 
ATOM   4017  C C     . TYR F 6  55  ? 119.139 131.459 91.778  1.00 90.98  ? 52  TYR F C     1 
ATOM   4018  O O     . TYR F 6  55  ? 118.924 130.260 91.593  1.00 89.06  ? 52  TYR F O     1 
ATOM   4019  C CB    . TYR F 6  55  ? 118.337 133.230 90.159  1.00 91.09  ? 52  TYR F CB    1 
ATOM   4020  C CG    . TYR F 6  55  ? 117.175 134.116 89.788  1.00 91.31  ? 52  TYR F CG    1 
ATOM   4021  C CD1   . TYR F 6  55  ? 117.211 135.466 90.074  1.00 90.32  ? 52  TYR F CD1   1 
ATOM   4022  C CD2   . TYR F 6  55  ? 116.054 133.567 89.212  1.00 95.35  ? 52  TYR F CD2   1 
ATOM   4023  C CE1   . TYR F 6  55  ? 116.126 136.261 89.772  1.00 92.66  ? 52  TYR F CE1   1 
ATOM   4024  C CE2   . TYR F 6  55  ? 114.974 134.355 88.906  1.00 96.00  ? 52  TYR F CE2   1 
ATOM   4025  C CZ    . TYR F 6  55  ? 115.006 135.696 89.182  1.00 95.63  ? 52  TYR F CZ    1 
ATOM   4026  O OH    . TYR F 6  55  ? 113.922 136.475 88.878  1.00 95.72  ? 52  TYR F OH    1 
ATOM   4027  N N     . GLU F 6  56  ? 120.254 131.906 92.338  1.00 89.14  ? 53  GLU F N     1 
ATOM   4028  C CA    . GLU F 6  56  ? 121.325 130.985 92.676  1.00 90.57  ? 53  GLU F CA    1 
ATOM   4029  C C     . GLU F 6  56  ? 120.990 130.150 93.900  1.00 91.00  ? 53  GLU F C     1 
ATOM   4030  O O     . GLU F 6  56  ? 121.270 128.949 93.938  1.00 91.21  ? 53  GLU F O     1 
ATOM   4031  C CB    . GLU F 6  56  ? 122.614 131.749 92.919  1.00 93.38  ? 53  GLU F CB    1 
ATOM   4032  C CG    . GLU F 6  56  ? 123.150 132.426 91.691  1.00 103.81 ? 53  GLU F CG    1 
ATOM   4033  C CD    . GLU F 6  56  ? 123.368 131.472 90.569  1.00 106.70 ? 53  GLU F CD    1 
ATOM   4034  O OE1   . GLU F 6  56  ? 123.872 130.405 90.812  1.00 105.56 ? 53  GLU F OE1   1 
ATOM   4035  O OE2   . GLU F 6  56  ? 123.012 131.799 89.465  1.00 104.18 ? 53  GLU F OE2   1 
ATOM   4036  N N     . GLU F 6  57  ? 120.328 130.763 94.873  1.00 89.36  ? 54  GLU F N     1 
ATOM   4037  C CA    . GLU F 6  57  ? 119.986 130.051 96.094  1.00 92.09  ? 54  GLU F CA    1 
ATOM   4038  C C     . GLU F 6  57  ? 118.958 128.969 95.797  1.00 90.32  ? 54  GLU F C     1 
ATOM   4039  O O     . GLU F 6  57  ? 119.032 127.858 96.327  1.00 89.74  ? 54  GLU F O     1 
ATOM   4040  C CB    . GLU F 6  57  ? 119.427 131.025 97.129  1.00 95.65  ? 54  GLU F CB    1 
ATOM   4041  C CG    . GLU F 6  57  ? 119.251 130.445 98.526  1.00 101.27 ? 54  GLU F CG    1 
ATOM   4042  C CD    . GLU F 6  57  ? 120.564 130.100 99.180  0.00 107.34 ? 54  GLU F CD    1 
ATOM   4043  O OE1   . GLU F 6  57  ? 121.577 130.528 98.687  0.00 104.69 ? 54  GLU F OE1   1 
ATOM   4044  O OE2   . GLU F 6  57  ? 120.550 129.448 100.200 0.00 110.54 ? 54  GLU F OE2   1 
ATOM   4045  N N     . THR F 6  58  ? 118.025 129.289 94.907  1.00 86.97  ? 55  THR F N     1 
ATOM   4046  C CA    . THR F 6  58  ? 116.966 128.369 94.530  1.00 86.82  ? 55  THR F CA    1 
ATOM   4047  C C     . THR F 6  58  ? 117.563 127.146 93.875  1.00 85.30  ? 55  THR F C     1 
ATOM   4048  O O     . THR F 6  58  ? 117.157 126.016 94.152  1.00 83.24  ? 55  THR F O     1 
ATOM   4049  C CB    . THR F 6  58  ? 115.984 129.026 93.548  1.00 88.06  ? 55  THR F CB    1 
ATOM   4050  O OG1   . THR F 6  58  ? 115.393 130.175 94.160  1.00 92.75  ? 55  THR F OG1   1 
ATOM   4051  C CG2   . THR F 6  58  ? 114.888 128.039 93.171  1.00 88.62  ? 55  THR F CG2   1 
ATOM   4052  N N     . ARG F 6  59  ? 118.525 127.379 92.998  1.00 83.59  ? 56  ARG F N     1 
ATOM   4053  C CA    . ARG F 6  59  ? 119.196 126.303 92.304  1.00 82.67  ? 56  ARG F CA    1 
ATOM   4054  C C     . ARG F 6  59  ? 119.902 125.368 93.260  1.00 83.11  ? 56  ARG F C     1 
ATOM   4055  O O     . ARG F 6  59  ? 119.765 124.149 93.157  1.00 81.99  ? 56  ARG F O     1 
ATOM   4056  C CB    . ARG F 6  59  ? 120.201 126.878 91.349  1.00 84.85  ? 56  ARG F CB    1 
ATOM   4057  C CG    . ARG F 6  59  ? 119.602 127.502 90.146  1.00 88.44  ? 56  ARG F CG    1 
ATOM   4058  C CD    . ARG F 6  59  ? 120.593 128.229 89.364  1.00 92.22  ? 56  ARG F CD    1 
ATOM   4059  N NE    . ARG F 6  59  ? 120.048 128.673 88.121  1.00 94.20  ? 56  ARG F NE    1 
ATOM   4060  C CZ    . ARG F 6  59  ? 120.719 129.372 87.213  1.00 96.93  ? 56  ARG F CZ    1 
ATOM   4061  N NH1   . ARG F 6  59  ? 121.956 129.729 87.446  1.00 97.71  ? 56  ARG F NH1   1 
ATOM   4062  N NH2   . ARG F 6  59  ? 120.141 129.674 86.070  1.00 97.59  ? 56  ARG F NH2   1 
ATOM   4063  N N     . GLY F 6  60  ? 120.568 125.930 94.259  1.00 82.01  ? 57  GLY F N     1 
ATOM   4064  C CA    . GLY F 6  60  ? 121.246 125.096 95.235  1.00 82.48  ? 57  GLY F CA    1 
ATOM   4065  C C     . GLY F 6  60  ? 120.248 124.164 95.903  1.00 82.40  ? 57  GLY F C     1 
ATOM   4066  O O     . GLY F 6  60  ? 120.492 122.963 96.033  1.00 82.92  ? 57  GLY F O     1 
ATOM   4067  N N     . VAL F 6  61  ? 119.087 124.703 96.245  1.00 79.00  ? 58  VAL F N     1 
ATOM   4068  C CA    . VAL F 6  61  ? 118.050 123.911 96.882  1.00 80.85  ? 58  VAL F CA    1 
ATOM   4069  C C     . VAL F 6  61  ? 117.489 122.844 95.949  1.00 82.60  ? 58  VAL F C     1 
ATOM   4070  O O     . VAL F 6  61  ? 117.293 121.696 96.354  1.00 83.14  ? 58  VAL F O     1 
ATOM   4071  C CB    . VAL F 6  61  ? 116.917 124.820 97.370  1.00 84.76  ? 58  VAL F CB    1 
ATOM   4072  C CG1   . VAL F 6  61  ? 115.762 123.989 97.843  1.00 87.98  ? 58  VAL F CG1   1 
ATOM   4073  C CG2   . VAL F 6  61  ? 117.424 125.706 98.489  1.00 88.64  ? 58  VAL F CG2   1 
ATOM   4074  N N     . LEU F 6  62  ? 117.205 123.219 94.707  1.00 80.56  ? 59  LEU F N     1 
ATOM   4075  C CA    . LEU F 6  62  ? 116.680 122.255 93.754  1.00 79.42  ? 59  LEU F CA    1 
ATOM   4076  C C     . LEU F 6  62  ? 117.653 121.122 93.550  1.00 81.13  ? 59  LEU F C     1 
ATOM   4077  O O     . LEU F 6  62  ? 117.261 119.956 93.476  1.00 79.61  ? 59  LEU F O     1 
ATOM   4078  C CB    . LEU F 6  62  ? 116.399 122.911 92.401  1.00 77.64  ? 59  LEU F CB    1 
ATOM   4079  C CG    . LEU F 6  62  ? 116.014 121.941 91.250  1.00 81.94  ? 59  LEU F CG    1 
ATOM   4080  C CD1   . LEU F 6  62  ? 114.757 121.136 91.608  1.00 87.72  ? 59  LEU F CD1   1 
ATOM   4081  C CD2   . LEU F 6  62  ? 115.805 122.743 89.975  1.00 88.11  ? 59  LEU F CD2   1 
ATOM   4082  N N     . LYS F 6  63  ? 118.920 121.466 93.421  1.00 81.18  ? 60  LYS F N     1 
ATOM   4083  C CA    . LYS F 6  63  ? 119.933 120.472 93.173  1.00 82.33  ? 60  LYS F CA    1 
ATOM   4084  C C     . LYS F 6  63  ? 119.979 119.449 94.288  1.00 84.48  ? 60  LYS F C     1 
ATOM   4085  O O     . LYS F 6  63  ? 119.995 118.249 94.026  1.00 82.42  ? 60  LYS F O     1 
ATOM   4086  C CB    . LYS F 6  63  ? 121.282 121.137 93.017  1.00 84.46  ? 60  LYS F CB    1 
ATOM   4087  C CG    . LYS F 6  63  ? 122.385 120.201 92.652  1.00 89.39  ? 60  LYS F CG    1 
ATOM   4088  C CD    . LYS F 6  63  ? 123.648 120.961 92.350  1.00 98.00  ? 60  LYS F CD    1 
ATOM   4089  C CE    . LYS F 6  63  ? 124.771 120.033 91.954  1.00 105.73 ? 60  LYS F CE    1 
ATOM   4090  N NZ    . LYS F 6  63  ? 126.022 120.773 91.651  1.00 105.02 ? 60  LYS F NZ    1 
ATOM   4091  N N     . VAL F 6  64  ? 119.918 119.915 95.529  1.00 81.29  ? 61  VAL F N     1 
ATOM   4092  C CA    . VAL F 6  64  ? 119.960 118.998 96.654  1.00 82.10  ? 61  VAL F CA    1 
ATOM   4093  C C     . VAL F 6  64  ? 118.763 118.068 96.639  1.00 83.10  ? 61  VAL F C     1 
ATOM   4094  O O     . VAL F 6  64  ? 118.897 116.871 96.900  1.00 83.60  ? 61  VAL F O     1 
ATOM   4095  C CB    . VAL F 6  64  ? 120.014 119.766 97.981  1.00 82.64  ? 61  VAL F CB    1 
ATOM   4096  C CG1   . VAL F 6  64  ? 119.824 118.810 99.155  1.00 88.03  ? 61  VAL F CG1   1 
ATOM   4097  C CG2   . VAL F 6  64  ? 121.352 120.466 98.088  1.00 83.17  ? 61  VAL F CG2   1 
ATOM   4098  N N     . PHE F 6  65  ? 117.589 118.619 96.359  1.00 79.14  ? 62  PHE F N     1 
ATOM   4099  C CA    . PHE F 6  65  ? 116.389 117.806 96.284  1.00 80.59  ? 62  PHE F CA    1 
ATOM   4100  C C     . PHE F 6  65  ? 116.575 116.705 95.250  1.00 81.87  ? 62  PHE F C     1 
ATOM   4101  O O     . PHE F 6  65  ? 116.347 115.527 95.532  1.00 82.02  ? 62  PHE F O     1 
ATOM   4102  C CB    . PHE F 6  65  ? 115.187 118.671 95.922  1.00 82.88  ? 62  PHE F CB    1 
ATOM   4103  C CG    . PHE F 6  65  ? 113.898 117.927 95.833  1.00 82.51  ? 62  PHE F CG    1 
ATOM   4104  C CD1   . PHE F 6  65  ? 113.170 117.647 96.973  1.00 82.82  ? 62  PHE F CD1   1 
ATOM   4105  C CD2   . PHE F 6  65  ? 113.401 117.514 94.610  1.00 85.63  ? 62  PHE F CD2   1 
ATOM   4106  C CE1   . PHE F 6  65  ? 111.970 116.978 96.894  1.00 90.42  ? 62  PHE F CE1   1 
ATOM   4107  C CE2   . PHE F 6  65  ? 112.204 116.840 94.530  1.00 89.00  ? 62  PHE F CE2   1 
ATOM   4108  C CZ    . PHE F 6  65  ? 111.487 116.576 95.671  1.00 92.93  ? 62  PHE F CZ    1 
ATOM   4109  N N     . LEU F 6  66  ? 117.057 117.080 94.069  1.00 79.63  ? 63  LEU F N     1 
ATOM   4110  C CA    . LEU F 6  66  ? 117.283 116.109 93.012  1.00 80.01  ? 63  LEU F CA    1 
ATOM   4111  C C     . LEU F 6  66  ? 118.318 115.073 93.406  1.00 82.67  ? 63  LEU F C     1 
ATOM   4112  O O     . LEU F 6  66  ? 118.132 113.884 93.163  1.00 80.16  ? 63  LEU F O     1 
ATOM   4113  C CB    . LEU F 6  66  ? 117.752 116.815 91.740  1.00 78.83  ? 63  LEU F CB    1 
ATOM   4114  C CG    . LEU F 6  66  ? 116.704 117.588 90.964  1.00 83.65  ? 63  LEU F CG    1 
ATOM   4115  C CD1   . LEU F 6  66  ? 117.389 118.481 89.959  1.00 91.62  ? 63  LEU F CD1   1 
ATOM   4116  C CD2   . LEU F 6  66  ? 115.812 116.609 90.234  1.00 85.28  ? 63  LEU F CD2   1 
ATOM   4117  N N     . GLU F 6  67  ? 119.388 115.500 94.059  1.00 82.87  ? 64  GLU F N     1 
ATOM   4118  C CA    . GLU F 6  67  ? 120.436 114.559 94.414  1.00 82.75  ? 64  GLU F CA    1 
ATOM   4119  C C     . GLU F 6  67  ? 119.924 113.471 95.332  1.00 84.14  ? 64  GLU F C     1 
ATOM   4120  O O     . GLU F 6  67  ? 120.172 112.288 95.102  1.00 82.04  ? 64  GLU F O     1 
ATOM   4121  C CB    . GLU F 6  67  ? 121.582 115.279 95.109  1.00 87.19  ? 64  GLU F CB    1 
ATOM   4122  C CG    . GLU F 6  67  ? 122.436 116.131 94.205  1.00 96.50  ? 64  GLU F CG    1 
ATOM   4123  C CD    . GLU F 6  67  ? 123.368 117.017 94.973  0.00 108.24 ? 64  GLU F CD    1 
ATOM   4124  O OE1   . GLU F 6  67  ? 123.228 117.091 96.170  0.00 101.33 ? 64  GLU F OE1   1 
ATOM   4125  O OE2   . GLU F 6  67  ? 124.224 117.616 94.368  0.00 109.63 ? 64  GLU F OE2   1 
ATOM   4126  N N     . ASN F 6  68  ? 119.124 113.855 96.315  1.00 81.22  ? 65  ASN F N     1 
ATOM   4127  C CA    . ASN F 6  68  ? 118.639 112.882 97.275  1.00 83.41  ? 65  ASN F CA    1 
ATOM   4128  C C     . ASN F 6  68  ? 117.631 111.932 96.651  1.00 83.55  ? 65  ASN F C     1 
ATOM   4129  O O     . ASN F 6  68  ? 117.690 110.720 96.868  1.00 83.25  ? 65  ASN F O     1 
ATOM   4130  C CB    . ASN F 6  68  ? 118.034 113.593 98.463  1.00 84.23  ? 65  ASN F CB    1 
ATOM   4131  C CG    . ASN F 6  68  ? 119.072 114.229 99.342  1.00 88.86  ? 65  ASN F CG    1 
ATOM   4132  O OD1   . ASN F 6  68  ? 120.218 113.767 99.440  1.00 90.38  ? 65  ASN F OD1   1 
ATOM   4133  N ND2   . ASN F 6  68  ? 118.696 115.300 99.986  1.00 93.22  ? 65  ASN F ND2   1 
ATOM   4134  N N     . VAL F 6  69  ? 116.755 112.462 95.809  1.00 78.81  ? 66  VAL F N     1 
ATOM   4135  C CA    . VAL F 6  69  ? 115.727 111.629 95.213  1.00 76.67  ? 66  VAL F CA    1 
ATOM   4136  C C     . VAL F 6  69  ? 116.315 110.722 94.147  1.00 79.20  ? 66  VAL F C     1 
ATOM   4137  O O     . VAL F 6  69  ? 115.974 109.541 94.072  1.00 81.78  ? 66  VAL F O     1 
ATOM   4138  C CB    . VAL F 6  69  ? 114.595 112.485 94.630  1.00 79.74  ? 66  VAL F CB    1 
ATOM   4139  C CG1   . VAL F 6  69  ? 113.584 111.603 93.901  1.00 85.87  ? 66  VAL F CG1   1 
ATOM   4140  C CG2   . VAL F 6  69  ? 113.916 113.250 95.753  1.00 86.82  ? 66  VAL F CG2   1 
ATOM   4141  N N     . ILE F 6  70  ? 117.186 111.271 93.310  1.00 78.16  ? 67  ILE F N     1 
ATOM   4142  C CA    . ILE F 6  70  ? 117.793 110.481 92.257  1.00 77.14  ? 67  ILE F CA    1 
ATOM   4143  C C     . ILE F 6  70  ? 118.635 109.380 92.856  1.00 81.56  ? 67  ILE F C     1 
ATOM   4144  O O     . ILE F 6  70  ? 118.493 108.215 92.495  1.00 80.40  ? 67  ILE F O     1 
ATOM   4145  C CB    . ILE F 6  70  ? 118.675 111.347 91.343  1.00 77.34  ? 67  ILE F CB    1 
ATOM   4146  C CG1   . ILE F 6  70  ? 117.801 112.314 90.544  1.00 83.53  ? 67  ILE F CG1   1 
ATOM   4147  C CG2   . ILE F 6  70  ? 119.510 110.459 90.409  1.00 80.59  ? 67  ILE F CG2   1 
ATOM   4148  C CD1   . ILE F 6  70  ? 118.576 113.422 89.863  1.00 91.34  ? 67  ILE F CD1   1 
ATOM   4149  N N     . ARG F 6  71  ? 119.462 109.722 93.830  1.00 80.88  ? 68  ARG F N     1 
ATOM   4150  C CA    . ARG F 6  71  ? 120.347 108.729 94.399  1.00 85.08  ? 68  ARG F CA    1 
ATOM   4151  C C     . ARG F 6  71  ? 119.586 107.529 94.928  1.00 82.96  ? 68  ARG F C     1 
ATOM   4152  O O     . ARG F 6  71  ? 120.000 106.387 94.715  1.00 81.99  ? 68  ARG F O     1 
ATOM   4153  C CB    . ARG F 6  71  ? 121.162 109.316 95.520  1.00 87.49  ? 68  ARG F CB    1 
ATOM   4154  C CG    . ARG F 6  71  ? 122.200 108.375 96.062  1.00 92.97  ? 68  ARG F CG    1 
ATOM   4155  C CD    . ARG F 6  71  ? 123.106 109.017 97.033  1.00 95.49  ? 68  ARG F CD    1 
ATOM   4156  N NE    . ARG F 6  71  ? 122.392 109.514 98.177  1.00 95.39  ? 68  ARG F NE    1 
ATOM   4157  C CZ    . ARG F 6  71  ? 122.187 110.807 98.451  1.00 96.71  ? 68  ARG F CZ    1 
ATOM   4158  N NH1   . ARG F 6  71  ? 122.681 111.745 97.678  1.00 96.28  ? 68  ARG F NH1   1 
ATOM   4159  N NH2   . ARG F 6  71  ? 121.467 111.135 99.499  1.00 96.38  ? 68  ARG F NH2   1 
ATOM   4160  N N     . ASP F 6  72  ? 118.468 107.766 95.602  1.00 81.22  ? 69  ASP F N     1 
ATOM   4161  C CA    . ASP F 6  72  ? 117.709 106.647 96.128  1.00 84.23  ? 69  ASP F CA    1 
ATOM   4162  C C     . ASP F 6  72  ? 117.058 105.863 94.997  1.00 83.22  ? 69  ASP F C     1 
ATOM   4163  O O     . ASP F 6  72  ? 117.113 104.633 94.976  1.00 79.83  ? 69  ASP F O     1 
ATOM   4164  C CB    . ASP F 6  72  ? 116.660 107.126 97.127  1.00 89.24  ? 69  ASP F CB    1 
ATOM   4165  C CG    . ASP F 6  72  ? 117.269 107.614 98.436  1.00 96.75  ? 69  ASP F CG    1 
ATOM   4166  O OD1   . ASP F 6  72  ? 118.428 107.355 98.666  1.00 93.13  ? 69  ASP F OD1   1 
ATOM   4167  O OD2   . ASP F 6  72  ? 116.556 108.191 99.222  1.00 97.76  ? 69  ASP F OD2   1 
ATOM   4168  N N     . ALA F 6  73  ? 116.558 106.564 93.983  1.00 80.22  ? 70  ALA F N     1 
ATOM   4169  C CA    . ALA F 6  73  ? 115.948 105.875 92.853  1.00 83.20  ? 70  ALA F CA    1 
ATOM   4170  C C     . ALA F 6  73  ? 116.971 104.976 92.174  1.00 82.36  ? 70  ALA F C     1 
ATOM   4171  O O     . ALA F 6  73  ? 116.666 103.844 91.787  1.00 82.09  ? 70  ALA F O     1 
ATOM   4172  C CB    . ALA F 6  73  ? 115.380 106.875 91.862  1.00 83.25  ? 70  ALA F CB    1 
ATOM   4173  N N     . VAL F 6  74  ? 118.205 105.455 92.100  1.00 78.56  ? 71  VAL F N     1 
ATOM   4174  C CA    . VAL F 6  74  ? 119.282 104.671 91.530  1.00 79.13  ? 71  VAL F CA    1 
ATOM   4175  C C     . VAL F 6  74  ? 119.594 103.492 92.428  1.00 83.84  ? 71  VAL F C     1 
ATOM   4176  O O     . VAL F 6  74  ? 119.735 102.367 91.956  1.00 82.94  ? 71  VAL F O     1 
ATOM   4177  C CB    . VAL F 6  74  ? 120.537 105.531 91.325  1.00 83.53  ? 71  VAL F CB    1 
ATOM   4178  C CG1   . VAL F 6  74  ? 121.711 104.660 90.896  1.00 93.54  ? 71  VAL F CG1   1 
ATOM   4179  C CG2   . VAL F 6  74  ? 120.249 106.578 90.274  1.00 88.74  ? 71  VAL F CG2   1 
ATOM   4180  N N     . THR F 6  75  ? 119.637 103.738 93.728  1.00 81.21  ? 72  THR F N     1 
ATOM   4181  C CA    . THR F 6  75  ? 119.924 102.688 94.691  1.00 82.05  ? 72  THR F CA    1 
ATOM   4182  C C     . THR F 6  75  ? 118.929 101.544 94.555  1.00 81.28  ? 72  THR F C     1 
ATOM   4183  O O     . THR F 6  75  ? 119.316 100.373 94.552  1.00 83.43  ? 72  THR F O     1 
ATOM   4184  C CB    . THR F 6  75  ? 119.896 103.244 96.124  1.00 83.88  ? 72  THR F CB    1 
ATOM   4185  O OG1   . THR F 6  75  ? 120.891 104.267 96.255  1.00 87.64  ? 72  THR F OG1   1 
ATOM   4186  C CG2   . THR F 6  75  ? 120.170 102.144 97.130  1.00 86.37  ? 72  THR F CG2   1 
ATOM   4187  N N     . TYR F 6  76  ? 117.650 101.877 94.415  1.00 76.58  ? 73  TYR F N     1 
ATOM   4188  C CA    . TYR F 6  76  ? 116.631 100.854 94.233  1.00 76.51  ? 73  TYR F CA    1 
ATOM   4189  C C     . TYR F 6  76  ? 116.854 100.107 92.925  1.00 81.37  ? 73  TYR F C     1 
ATOM   4190  O O     . TYR F 6  76  ? 116.747 98.879  92.872  1.00 82.36  ? 73  TYR F O     1 
ATOM   4191  C CB    . TYR F 6  76  ? 115.232 101.470 94.252  1.00 77.84  ? 73  TYR F CB    1 
ATOM   4192  C CG    . TYR F 6  76  ? 114.734 101.841 95.632  1.00 77.57  ? 73  TYR F CG    1 
ATOM   4193  C CD1   . TYR F 6  76  ? 114.550 103.170 95.976  1.00 82.66  ? 73  TYR F CD1   1 
ATOM   4194  C CD2   . TYR F 6  76  ? 114.450 100.851 96.549  1.00 78.82  ? 73  TYR F CD2   1 
ATOM   4195  C CE1   . TYR F 6  76  ? 114.094 103.501 97.231  1.00 84.26  ? 73  TYR F CE1   1 
ATOM   4196  C CE2   . TYR F 6  76  ? 113.991 101.184 97.805  1.00 82.22  ? 73  TYR F CE2   1 
ATOM   4197  C CZ    . TYR F 6  76  ? 113.812 102.500 98.145  1.00 83.30  ? 73  TYR F CZ    1 
ATOM   4198  O OH    . TYR F 6  76  ? 113.364 102.834 99.401  1.00 90.03  ? 73  TYR F OH    1 
ATOM   4199  N N     . THR F 6  77  ? 117.226 100.847 91.888  1.00 79.90  ? 74  THR F N     1 
ATOM   4200  C CA    . THR F 6  77  ? 117.475 100.267 90.580  1.00 83.08  ? 74  THR F CA    1 
ATOM   4201  C C     . THR F 6  77  ? 118.633 99.278  90.648  1.00 84.04  ? 74  THR F C     1 
ATOM   4202  O O     . THR F 6  77  ? 118.565 98.184  90.081  1.00 84.63  ? 74  THR F O     1 
ATOM   4203  C CB    . THR F 6  77  ? 117.785 101.370 89.551  1.00 85.94  ? 74  THR F CB    1 
ATOM   4204  O OG1   . THR F 6  77  ? 116.681 102.282 89.485  1.00 87.06  ? 74  THR F OG1   1 
ATOM   4205  C CG2   . THR F 6  77  ? 118.005 100.767 88.173  1.00 91.31  ? 74  THR F CG2   1 
ATOM   4206  N N     . GLU F 6  78  ? 119.686 99.657  91.365  1.00 82.63  ? 75  GLU F N     1 
ATOM   4207  C CA    . GLU F 6  78  ? 120.850 98.797  91.527  1.00 86.68  ? 75  GLU F CA    1 
ATOM   4208  C C     . GLU F 6  78  ? 120.514 97.543  92.311  1.00 85.92  ? 75  GLU F C     1 
ATOM   4209  O O     . GLU F 6  78  ? 120.950 96.448  91.961  1.00 88.75  ? 75  GLU F O     1 
ATOM   4210  C CB    . GLU F 6  78  ? 121.972 99.536  92.245  1.00 92.06  ? 75  GLU F CB    1 
ATOM   4211  C CG    . GLU F 6  78  ? 122.650 100.611 91.437  1.00 99.77  ? 75  GLU F CG    1 
ATOM   4212  C CD    . GLU F 6  78  ? 123.687 101.332 92.235  0.00 111.23 ? 75  GLU F CD    1 
ATOM   4213  O OE1   . GLU F 6  78  ? 123.775 101.085 93.414  0.00 105.30 ? 75  GLU F OE1   1 
ATOM   4214  O OE2   . GLU F 6  78  ? 124.401 102.123 91.672  0.00 119.24 ? 75  GLU F OE2   1 
ATOM   4215  N N     . HIS F 6  79  ? 119.689 97.686  93.340  1.00 83.35  ? 76  HIS F N     1 
ATOM   4216  C CA    . HIS F 6  79  ? 119.294 96.541  94.145  1.00 83.95  ? 76  HIS F CA    1 
ATOM   4217  C C     . HIS F 6  79  ? 118.602 95.501  93.285  1.00 83.56  ? 76  HIS F C     1 
ATOM   4218  O O     . HIS F 6  79  ? 118.791 94.297  93.462  1.00 87.87  ? 76  HIS F O     1 
ATOM   4219  C CB    . HIS F 6  79  ? 118.363 96.944  95.278  1.00 86.07  ? 76  HIS F CB    1 
ATOM   4220  C CG    . HIS F 6  79  ? 117.982 95.787  96.104  1.00 87.24  ? 76  HIS F CG    1 
ATOM   4221  N ND1   . HIS F 6  79  ? 118.848 95.189  96.989  1.00 89.64  ? 76  HIS F ND1   1 
ATOM   4222  C CD2   . HIS F 6  79  ? 116.859 95.044  96.113  1.00 88.83  ? 76  HIS F CD2   1 
ATOM   4223  C CE1   . HIS F 6  79  ? 118.267 94.126  97.511  1.00 92.62  ? 76  HIS F CE1   1 
ATOM   4224  N NE2   . HIS F 6  79  ? 117.059 94.017  96.993  1.00 91.14  ? 76  HIS F NE2   1 
ATOM   4225  N N     . ALA F 6  80  ? 117.838 95.983  92.314  1.00 82.41  ? 77  ALA F N     1 
ATOM   4226  C CA    . ALA F 6  80  ? 117.103 95.133  91.392  1.00 87.80  ? 77  ALA F CA    1 
ATOM   4227  C C     . ALA F 6  80  ? 118.022 94.546  90.324  1.00 86.08  ? 77  ALA F C     1 
ATOM   4228  O O     . ALA F 6  80  ? 117.574 93.801  89.451  1.00 85.55  ? 77  ALA F O     1 
ATOM   4229  C CB    . ALA F 6  80  ? 115.987 95.927  90.737  1.00 92.36  ? 77  ALA F CB    1 
ATOM   4230  N N     . LYS F 6  81  ? 119.300 94.907  90.378  1.00 86.95  ? 78  LYS F N     1 
ATOM   4231  C CA    . LYS F 6  81  ? 120.295 94.413  89.444  1.00 89.93  ? 78  LYS F CA    1 
ATOM   4232  C C     . LYS F 6  81  ? 119.938 94.735  88.015  1.00 88.16  ? 78  LYS F C     1 
ATOM   4233  O O     . LYS F 6  81  ? 120.069 93.895  87.124  1.00 89.20  ? 78  LYS F O     1 
ATOM   4234  C CB    . LYS F 6  81  ? 120.493 92.913  89.614  1.00 91.02  ? 78  LYS F CB    1 
ATOM   4235  C CG    . LYS F 6  81  ? 120.897 92.485  91.022  1.00 97.56  ? 78  LYS F CG    1 
ATOM   4236  C CD    . LYS F 6  81  ? 122.293 92.995  91.394  1.00 99.62  ? 78  LYS F CD    1 
ATOM   4237  C CE    . LYS F 6  81  ? 122.707 92.544  92.774  1.00 96.64  ? 78  LYS F CE    1 
ATOM   4238  N NZ    . LYS F 6  81  ? 123.945 93.224  93.236  1.00 91.94  ? 78  LYS F NZ    1 
ATOM   4239  N N     . ARG F 6  82  ? 119.538 95.972  87.785  1.00 88.76  ? 79  ARG F N     1 
ATOM   4240  C CA    . ARG F 6  82  ? 119.196 96.402  86.448  1.00 90.63  ? 79  ARG F CA    1 
ATOM   4241  C C     . ARG F 6  82  ? 119.723 97.794  86.181  1.00 92.45  ? 79  ARG F C     1 
ATOM   4242  O O     . ARG F 6  82  ? 120.393 98.381  87.030  1.00 95.75  ? 79  ARG F O     1 
ATOM   4243  C CB    . ARG F 6  82  ? 117.714 96.335  86.245  1.00 90.73  ? 79  ARG F CB    1 
ATOM   4244  C CG    . ARG F 6  82  ? 116.930 97.294  87.035  1.00 92.12  ? 79  ARG F CG    1 
ATOM   4245  C CD    . ARG F 6  82  ? 115.506 96.983  86.938  1.00 93.30  ? 79  ARG F CD    1 
ATOM   4246  N NE    . ARG F 6  82  ? 114.693 97.921  87.658  1.00 93.03  ? 79  ARG F NE    1 
ATOM   4247  C CZ    . ARG F 6  82  ? 113.412 97.718  87.969  1.00 92.88  ? 79  ARG F CZ    1 
ATOM   4248  N NH1   . ARG F 6  82  ? 112.825 96.598  87.630  1.00 94.24  ? 79  ARG F NH1   1 
ATOM   4249  N NH2   . ARG F 6  82  ? 112.738 98.644  88.610  1.00 94.61  ? 79  ARG F NH2   1 
ATOM   4250  N N     . LYS F 6  83  ? 119.500 98.262  84.953  1.00 89.91  ? 80  LYS F N     1 
ATOM   4251  C CA    . LYS F 6  83  ? 120.206 99.404  84.402  1.00 92.99  ? 80  LYS F CA    1 
ATOM   4252  C C     . LYS F 6  83  ? 119.280 100.602 84.228  1.00 97.00  ? 80  LYS F C     1 
ATOM   4253  O O     . LYS F 6  83  ? 119.736 101.746 84.257  1.00 97.61  ? 80  LYS F O     1 
ATOM   4254  C CB    . LYS F 6  83  ? 120.791 99.041  83.038  1.00 99.18  ? 80  LYS F CB    1 
ATOM   4255  C CG    . LYS F 6  83  ? 121.686 97.803  83.015  1.00 105.33 ? 80  LYS F CG    1 
ATOM   4256  C CD    . LYS F 6  83  ? 122.884 97.933  83.937  1.00 105.50 ? 80  LYS F CD    1 
ATOM   4257  C CE    . LYS F 6  83  ? 123.806 96.735  83.792  1.00 109.56 ? 80  LYS F CE    1 
ATOM   4258  N NZ    . LYS F 6  83  ? 124.903 96.775  84.794  1.00 111.30 ? 80  LYS F NZ    1 
ATOM   4259  N N     . THR F 6  84  ? 117.998 100.344 83.988  1.00 94.18  ? 81  THR F N     1 
ATOM   4260  C CA    . THR F 6  84  ? 117.049 101.426 83.754  1.00 92.88  ? 81  THR F CA    1 
ATOM   4261  C C     . THR F 6  84  ? 116.291 101.776 85.024  1.00 91.17  ? 81  THR F C     1 
ATOM   4262  O O     . THR F 6  84  ? 115.752 100.902 85.703  1.00 92.22  ? 81  THR F O     1 
ATOM   4263  C CB    . THR F 6  84  ? 116.056 101.073 82.634  1.00 94.32  ? 81  THR F CB    1 
ATOM   4264  O OG1   . THR F 6  84  ? 116.782 100.827 81.423  1.00 100.40 ? 81  THR F OG1   1 
ATOM   4265  C CG2   . THR F 6  84  ? 115.076 102.231 82.406  1.00 95.58  ? 81  THR F CG2   1 
ATOM   4266  N N     . VAL F 6  85  ? 116.232 103.066 85.329  1.00 86.31  ? 82  VAL F N     1 
ATOM   4267  C CA    . VAL F 6  85  ? 115.471 103.551 86.464  1.00 84.81  ? 82  VAL F CA    1 
ATOM   4268  C C     . VAL F 6  85  ? 114.019 103.694 86.060  1.00 88.23  ? 82  VAL F C     1 
ATOM   4269  O O     . VAL F 6  85  ? 113.709 104.343 85.057  1.00 86.70  ? 82  VAL F O     1 
ATOM   4270  C CB    . VAL F 6  85  ? 116.005 104.919 86.917  1.00 86.78  ? 82  VAL F CB    1 
ATOM   4271  C CG1   . VAL F 6  85  ? 115.172 105.465 88.072  1.00 90.10  ? 82  VAL F CG1   1 
ATOM   4272  C CG2   . VAL F 6  85  ? 117.465 104.799 87.309  1.00 91.94  ? 82  VAL F CG2   1 
ATOM   4273  N N     . THR F 6  86  ? 113.123 103.091 86.825  1.00 85.68  ? 83  THR F N     1 
ATOM   4274  C CA    . THR F 6  86  ? 111.719 103.161 86.470  1.00 86.84  ? 83  THR F CA    1 
ATOM   4275  C C     . THR F 6  86  ? 111.008 104.245 87.248  1.00 87.23  ? 83  THR F C     1 
ATOM   4276  O O     . THR F 6  86  ? 111.498 104.714 88.276  1.00 84.14  ? 83  THR F O     1 
ATOM   4277  C CB    . THR F 6  86  ? 111.017 101.815 86.690  1.00 91.44  ? 83  THR F CB    1 
ATOM   4278  O OG1   . THR F 6  86  ? 111.011 101.497 88.083  1.00 91.04  ? 83  THR F OG1   1 
ATOM   4279  C CG2   . THR F 6  86  ? 111.725 100.719 85.920  1.00 96.78  ? 83  THR F CG2   1 
ATOM   4280  N N     . ALA F 6  87  ? 109.809 104.592 86.806  1.00 85.46  ? 84  ALA F N     1 
ATOM   4281  C CA    . ALA F 6  87  ? 109.035 105.602 87.506  1.00 85.71  ? 84  ALA F CA    1 
ATOM   4282  C C     . ALA F 6  87  ? 108.784 105.173 88.939  1.00 83.97  ? 84  ALA F C     1 
ATOM   4283  O O     . ALA F 6  87  ? 108.870 105.983 89.861  1.00 83.00  ? 84  ALA F O     1 
ATOM   4284  C CB    . ALA F 6  87  ? 107.726 105.866 86.786  1.00 87.91  ? 84  ALA F CB    1 
ATOM   4285  N N     . MET F 6  88  ? 108.606 103.876 89.142  1.00 83.09  ? 85  MET F N     1 
ATOM   4286  C CA    . MET F 6  88  ? 108.357 103.365 90.479  1.00 86.94  ? 85  MET F CA    1 
ATOM   4287  C C     . MET F 6  88  ? 109.537 103.573 91.403  1.00 87.04  ? 85  MET F C     1 
ATOM   4288  O O     . MET F 6  88  ? 109.359 103.724 92.611  1.00 84.19  ? 85  MET F O     1 
ATOM   4289  C CB    . MET F 6  88  ? 107.988 101.889 90.439  1.00 91.38  ? 85  MET F CB    1 
ATOM   4290  C CG    . MET F 6  88  ? 106.596 101.608 89.929  1.00 96.69  ? 85  MET F CG    1 
ATOM   4291  S SD    . MET F 6  88  ? 105.334 102.539 90.831  1.00 109.18 ? 85  MET F SD    1 
ATOM   4292  C CE    . MET F 6  88  ? 105.575 101.987 92.525  1.00 104.36 ? 85  MET F CE    1 
ATOM   4293  N N     . ASP F 6  89  ? 110.734 103.647 90.842  1.00 83.95  ? 86  ASP F N     1 
ATOM   4294  C CA    . ASP F 6  89  ? 111.920 103.792 91.661  1.00 86.49  ? 86  ASP F CA    1 
ATOM   4295  C C     . ASP F 6  89  ? 112.018 105.235 92.115  1.00 83.94  ? 86  ASP F C     1 
ATOM   4296  O O     . ASP F 6  89  ? 112.439 105.522 93.238  1.00 81.95  ? 86  ASP F O     1 
ATOM   4297  C CB    . ASP F 6  89  ? 113.153 103.370 90.870  1.00 88.75  ? 86  ASP F CB    1 
ATOM   4298  C CG    . ASP F 6  89  ? 113.126 101.879 90.527  1.00 90.40  ? 86  ASP F CG    1 
ATOM   4299  O OD1   . ASP F 6  89  ? 112.770 101.098 91.384  1.00 94.26  ? 86  ASP F OD1   1 
ATOM   4300  O OD2   . ASP F 6  89  ? 113.374 101.538 89.384  1.00 92.21  ? 86  ASP F OD2   1 
ATOM   4301  N N     . VAL F 6  90  ? 111.519 106.134 91.277  1.00 80.24  ? 87  VAL F N     1 
ATOM   4302  C CA    . VAL F 6  90  ? 111.425 107.533 91.649  1.00 76.98  ? 87  VAL F CA    1 
ATOM   4303  C C     . VAL F 6  90  ? 110.401 107.677 92.760  1.00 80.02  ? 87  VAL F C     1 
ATOM   4304  O O     . VAL F 6  90  ? 110.605 108.428 93.714  1.00 79.93  ? 87  VAL F O     1 
ATOM   4305  C CB    . VAL F 6  90  ? 111.034 108.405 90.447  1.00 79.41  ? 87  VAL F CB    1 
ATOM   4306  C CG1   . VAL F 6  90  ? 110.765 109.839 90.893  1.00 84.68  ? 87  VAL F CG1   1 
ATOM   4307  C CG2   . VAL F 6  90  ? 112.147 108.367 89.422  1.00 83.81  ? 87  VAL F CG2   1 
ATOM   4308  N N     . VAL F 6  91  ? 109.299 106.948 92.634  1.00 77.01  ? 88  VAL F N     1 
ATOM   4309  C CA    . VAL F 6  91  ? 108.249 106.999 93.634  1.00 79.05  ? 88  VAL F CA    1 
ATOM   4310  C C     . VAL F 6  91  ? 108.751 106.553 94.995  1.00 81.06  ? 88  VAL F C     1 
ATOM   4311  O O     . VAL F 6  91  ? 108.470 107.204 96.000  1.00 80.96  ? 88  VAL F O     1 
ATOM   4312  C CB    . VAL F 6  91  ? 107.056 106.125 93.215  1.00 81.54  ? 88  VAL F CB    1 
ATOM   4313  C CG1   . VAL F 6  91  ? 106.072 105.979 94.365  1.00 86.97  ? 88  VAL F CG1   1 
ATOM   4314  C CG2   . VAL F 6  91  ? 106.371 106.754 92.014  1.00 86.28  ? 88  VAL F CG2   1 
ATOM   4315  N N     . TYR F 6  92  ? 109.504 105.462 95.038  1.00 80.78  ? 89  TYR F N     1 
ATOM   4316  C CA    . TYR F 6  92  ? 110.020 104.992 96.315  1.00 82.55  ? 89  TYR F CA    1 
ATOM   4317  C C     . TYR F 6  92  ? 111.006 105.989 96.896  1.00 82.74  ? 89  TYR F C     1 
ATOM   4318  O O     . TYR F 6  92  ? 111.038 106.216 98.108  1.00 83.39  ? 89  TYR F O     1 
ATOM   4319  C CB    . TYR F 6  92  ? 110.667 103.619 96.174  1.00 85.49  ? 89  TYR F CB    1 
ATOM   4320  C CG    . TYR F 6  92  ? 109.672 102.508 96.034  1.00 91.13  ? 89  TYR F CG    1 
ATOM   4321  C CD1   . TYR F 6  92  ? 109.554 101.838 94.840  1.00 94.75  ? 89  TYR F CD1   1 
ATOM   4322  C CD2   . TYR F 6  92  ? 108.854 102.175 97.098  1.00 95.72  ? 89  TYR F CD2   1 
ATOM   4323  C CE1   . TYR F 6  92  ? 108.610 100.855 94.697  1.00 96.93  ? 89  TYR F CE1   1 
ATOM   4324  C CE2   . TYR F 6  92  ? 107.919 101.173 96.958  1.00 97.90  ? 89  TYR F CE2   1 
ATOM   4325  C CZ    . TYR F 6  92  ? 107.795 100.519 95.759  1.00 99.45  ? 89  TYR F CZ    1 
ATOM   4326  O OH    . TYR F 6  92  ? 106.849 99.537  95.605  1.00 102.13 ? 89  TYR F OH    1 
ATOM   4327  N N     . ALA F 6  93  ? 111.805 106.598 96.032  1.00 78.88  ? 90  ALA F N     1 
ATOM   4328  C CA    . ALA F 6  93  ? 112.763 107.584 96.489  1.00 83.93  ? 90  ALA F CA    1 
ATOM   4329  C C     . ALA F 6  93  ? 112.055 108.757 97.150  1.00 84.03  ? 90  ALA F C     1 
ATOM   4330  O O     . ALA F 6  93  ? 112.484 109.242 98.197  1.00 86.47  ? 90  ALA F O     1 
ATOM   4331  C CB    . ALA F 6  93  ? 113.594 108.071 95.322  1.00 84.85  ? 90  ALA F CB    1 
ATOM   4332  N N     . LEU F 6  94  ? 110.932 109.165 96.568  1.00 79.60  ? 91  LEU F N     1 
ATOM   4333  C CA    . LEU F 6  94  ? 110.134 110.258 97.112  1.00 83.11  ? 91  LEU F CA    1 
ATOM   4334  C C     . LEU F 6  94  ? 109.395 109.829 98.370  1.00 85.44  ? 91  LEU F C     1 
ATOM   4335  O O     . LEU F 6  94  ? 109.277 110.591 99.333  1.00 85.08  ? 91  LEU F O     1 
ATOM   4336  C CB    . LEU F 6  94  ? 109.118 110.725 96.065  1.00 83.12  ? 91  LEU F CB    1 
ATOM   4337  C CG    . LEU F 6  94  ? 109.694 111.423 94.822  1.00 85.64  ? 91  LEU F CG    1 
ATOM   4338  C CD1   . LEU F 6  94  ? 108.601 111.558 93.772  1.00 90.29  ? 91  LEU F CD1   1 
ATOM   4339  C CD2   . LEU F 6  94  ? 110.237 112.795 95.205  1.00 87.66  ? 91  LEU F CD2   1 
ATOM   4340  N N     . LYS F 6  95  ? 108.989 108.571 98.397  1.00 83.44  ? 92  LYS F N     1 
ATOM   4341  C CA    . LYS F 6  95  ? 108.228 108.026 99.505  1.00 86.37  ? 92  LYS F CA    1 
ATOM   4342  C C     . LYS F 6  95  ? 108.976 108.159 100.817 1.00 86.96  ? 92  LYS F C     1 
ATOM   4343  O O     . LYS F 6  95  ? 108.397 108.502 101.848 1.00 89.22  ? 92  LYS F O     1 
ATOM   4344  C CB    . LYS F 6  95  ? 107.878 106.581 99.208  1.00 88.51  ? 92  LYS F CB    1 
ATOM   4345  C CG    . LYS F 6  95  ? 106.909 105.943 100.158 1.00 92.34  ? 92  LYS F CG    1 
ATOM   4346  C CD    . LYS F 6  95  ? 106.363 104.664 99.538  1.00 97.79  ? 92  LYS F CD    1 
ATOM   4347  C CE    . LYS F 6  95  ? 105.395 103.961 100.437 1.00 96.60  ? 92  LYS F CE    1 
ATOM   4348  N NZ    . LYS F 6  95  ? 104.710 102.849 99.734  1.00 93.35  ? 92  LYS F NZ    1 
ATOM   4349  N N     . ARG F 6  96  ? 110.287 108.016 100.760 1.00 84.98  ? 93  ARG F N     1 
ATOM   4350  C CA    . ARG F 6  96  ? 111.087 108.098 101.968 1.00 88.41  ? 93  ARG F CA    1 
ATOM   4351  C C     . ARG F 6  96  ? 111.429 109.520 102.360 1.00 88.71  ? 93  ARG F C     1 
ATOM   4352  O O     . ARG F 6  96  ? 112.091 109.752 103.370 1.00 89.68  ? 93  ARG F O     1 
ATOM   4353  C CB    . ARG F 6  96  ? 112.337 107.292 101.827 1.00 87.88  ? 93  ARG F CB    1 
ATOM   4354  C CG    . ARG F 6  96  ? 112.068 105.837 101.756 1.00 91.23  ? 93  ARG F CG    1 
ATOM   4355  C CD    . ARG F 6  96  ? 113.285 105.052 101.721 1.00 94.64  ? 93  ARG F CD    1 
ATOM   4356  N NE    . ARG F 6  96  ? 114.071 105.220 102.913 1.00 94.47  ? 93  ARG F NE    1 
ATOM   4357  C CZ    . ARG F 6  96  ? 115.220 105.902 102.981 1.00 95.32  ? 93  ARG F CZ    1 
ATOM   4358  N NH1   . ARG F 6  96  ? 115.692 106.520 101.923 1.00 94.80  ? 93  ARG F NH1   1 
ATOM   4359  N NH2   . ARG F 6  96  ? 115.887 105.936 104.111 1.00 94.41  ? 93  ARG F NH2   1 
ATOM   4360  N N     . GLN F 6  97  ? 110.964 110.476 101.574 1.00 88.38  ? 94  GLN F N     1 
ATOM   4361  C CA    . GLN F 6  97  ? 111.166 111.872 101.904 1.00 90.44  ? 94  GLN F CA    1 
ATOM   4362  C C     . GLN F 6  97  ? 109.943 112.363 102.655 1.00 91.09  ? 94  GLN F C     1 
ATOM   4363  O O     . GLN F 6  97  ? 109.834 113.543 102.984 1.00 93.63  ? 94  GLN F O     1 
ATOM   4364  C CB    . GLN F 6  97  ? 111.362 112.716 100.651 1.00 93.57  ? 94  GLN F CB    1 
ATOM   4365  C CG    . GLN F 6  97  ? 112.424 112.209 99.726  1.00 93.09  ? 94  GLN F CG    1 
ATOM   4366  C CD    . GLN F 6  97  ? 113.727 111.965 100.398 1.00 93.64  ? 94  GLN F CD    1 
ATOM   4367  O OE1   . GLN F 6  97  ? 114.247 112.812 101.127 1.00 94.34  ? 94  GLN F OE1   1 
ATOM   4368  N NE2   . GLN F 6  97  ? 114.283 110.787 100.148 1.00 94.15  ? 94  GLN F NE2   1 
ATOM   4369  N N     . GLY F 6  98  ? 108.996 111.452 102.883 1.00 90.04  ? 95  GLY F N     1 
ATOM   4370  C CA    . GLY F 6  98  ? 107.748 111.795 103.541 1.00 95.33  ? 95  GLY F CA    1 
ATOM   4371  C C     . GLY F 6  98  ? 106.727 112.323 102.548 1.00 96.02  ? 95  GLY F C     1 
ATOM   4372  O O     . GLY F 6  98  ? 105.839 113.095 102.910 1.00 98.65  ? 95  GLY F O     1 
ATOM   4373  N N     . ARG F 6  99  ? 106.864 111.931 101.286 1.00 89.96  ? 96  ARG F N     1 
ATOM   4374  C CA    . ARG F 6  99  ? 105.960 112.401 100.251 1.00 90.04  ? 96  ARG F CA    1 
ATOM   4375  C C     . ARG F 6  99  ? 105.420 111.278 99.408  1.00 89.81  ? 96  ARG F C     1 
ATOM   4376  O O     . ARG F 6  99  ? 106.107 110.297 99.161  1.00 91.10  ? 96  ARG F O     1 
ATOM   4377  C CB    . ARG F 6  99  ? 106.698 113.307 99.316  1.00 86.89  ? 96  ARG F CB    1 
ATOM   4378  C CG    . ARG F 6  99  ? 107.173 114.537 99.918  1.00 88.80  ? 96  ARG F CG    1 
ATOM   4379  C CD    . ARG F 6  99  ? 107.931 115.312 98.958  1.00 89.28  ? 96  ARG F CD    1 
ATOM   4380  N NE    . ARG F 6  99  ? 108.205 116.611 99.453  1.00 92.71  ? 96  ARG F NE    1 
ATOM   4381  C CZ    . ARG F 6  99  ? 109.139 116.879 100.357 1.00 98.78  ? 96  ARG F CZ    1 
ATOM   4382  N NH1   . ARG F 6  99  ? 109.864 115.909 100.853 1.00 96.21  ? 96  ARG F NH1   1 
ATOM   4383  N NH2   . ARG F 6  99  ? 109.318 118.115 100.766 1.00 100.09 ? 96  ARG F NH2   1 
ATOM   4384  N N     . THR F 6  100 ? 104.242 111.469 98.852  1.00 86.36  ? 97  THR F N     1 
ATOM   4385  C CA    . THR F 6  100 ? 103.796 110.539 97.835  1.00 88.41  ? 97  THR F CA    1 
ATOM   4386  C C     . THR F 6  100 ? 103.434 111.293 96.576  1.00 89.97  ? 97  THR F C     1 
ATOM   4387  O O     . THR F 6  100 ? 103.272 112.514 96.594  1.00 90.52  ? 97  THR F O     1 
ATOM   4388  C CB    . THR F 6  100 ? 102.625 109.674 98.318  1.00 96.02  ? 97  THR F CB    1 
ATOM   4389  O OG1   . THR F 6  100 ? 101.509 110.500 98.611  1.00 96.56  ? 97  THR F OG1   1 
ATOM   4390  C CG2   . THR F 6  100 ? 103.020 108.906 99.563  1.00 96.23  ? 97  THR F CG2   1 
ATOM   4391  N N     . LEU F 6  101 ? 103.422 110.576 95.468  1.00 86.99  ? 98  LEU F N     1 
ATOM   4392  C CA    . LEU F 6  101 ? 103.094 111.145 94.176  1.00 85.48  ? 98  LEU F CA    1 
ATOM   4393  C C     . LEU F 6  101 ? 102.068 110.267 93.492  1.00 86.90  ? 98  LEU F C     1 
ATOM   4394  O O     . LEU F 6  101 ? 102.302 109.077 93.290  1.00 91.37  ? 98  LEU F O     1 
ATOM   4395  C CB    . LEU F 6  101 ? 104.375 111.244 93.336  1.00 82.87  ? 98  LEU F CB    1 
ATOM   4396  C CG    . LEU F 6  101 ? 104.224 111.695 91.883  1.00 90.42  ? 98  LEU F CG    1 
ATOM   4397  C CD1   . LEU F 6  101 ? 103.720 113.123 91.816  1.00 95.82  ? 98  LEU F CD1   1 
ATOM   4398  C CD2   . LEU F 6  101 ? 105.569 111.568 91.186  1.00 90.66  ? 98  LEU F CD2   1 
ATOM   4399  N N     . TYR F 6  102 ? 100.918 110.836 93.169  1.00 87.71  ? 99  TYR F N     1 
ATOM   4400  C CA    . TYR F 6  102 ? 99.840  110.050 92.588  1.00 88.71  ? 99  TYR F CA    1 
ATOM   4401  C C     . TYR F 6  102 ? 99.782  110.196 91.077  1.00 94.28  ? 99  TYR F C     1 
ATOM   4402  O O     . TYR F 6  102 ? 99.967  111.288 90.534  1.00 96.24  ? 99  TYR F O     1 
ATOM   4403  C CB    . TYR F 6  102 ? 98.491  110.437 93.193  1.00 94.98  ? 99  TYR F CB    1 
ATOM   4404  C CG    . TYR F 6  102 ? 98.240  109.992 94.635  1.00 96.53  ? 99  TYR F CG    1 
ATOM   4405  C CD1   . TYR F 6  102 ? 99.226  109.384 95.412  1.00 92.71  ? 99  TYR F CD1   1 
ATOM   4406  C CD2   . TYR F 6  102 ? 96.978  110.180 95.169  1.00 98.96  ? 99  TYR F CD2   1 
ATOM   4407  C CE1   . TYR F 6  102 ? 98.935  108.991 96.705  1.00 93.23  ? 99  TYR F CE1   1 
ATOM   4408  C CE2   . TYR F 6  102 ? 96.701  109.792 96.454  1.00 96.23  ? 99  TYR F CE2   1 
ATOM   4409  C CZ    . TYR F 6  102 ? 97.667  109.205 97.220  1.00 93.91  ? 99  TYR F CZ    1 
ATOM   4410  O OH    . TYR F 6  102 ? 97.361  108.799 98.494  1.00 95.95  ? 99  TYR F OH    1 
ATOM   4411  N N     . GLY F 6  103 ? 99.402  109.107 90.409  1.00 95.19  ? 100 GLY F N     1 
ATOM   4412  C CA    . GLY F 6  103 ? 99.214  109.108 88.960  1.00 98.35  ? 100 GLY F CA    1 
ATOM   4413  C C     . GLY F 6  103 ? 100.366 108.444 88.215  1.00 95.61  ? 100 GLY F C     1 
ATOM   4414  O O     . GLY F 6  103 ? 100.355 108.364 86.988  1.00 97.18  ? 100 GLY F O     1 
ATOM   4415  N N     . PHE F 6  104 ? 101.361 107.977 88.955  1.00 90.89  ? 101 PHE F N     1 
ATOM   4416  C CA    . PHE F 6  104 ? 102.517 107.323 88.358  1.00 89.61  ? 101 PHE F CA    1 
ATOM   4417  C C     . PHE F 6  104 ? 102.687 105.890 88.835  1.00 94.50  ? 101 PHE F C     1 
ATOM   4418  O O     . PHE F 6  104 ? 103.796 105.359 88.838  1.00 97.42  ? 101 PHE F O     1 
ATOM   4419  C CB    . PHE F 6  104 ? 103.782 108.121 88.637  1.00 87.73  ? 101 PHE F CB    1 
ATOM   4420  C CG    . PHE F 6  104 ? 103.828 109.422 87.923  1.00 88.43  ? 101 PHE F CG    1 
ATOM   4421  C CD1   . PHE F 6  104 ? 103.342 110.565 88.510  1.00 89.85  ? 101 PHE F CD1   1 
ATOM   4422  C CD2   . PHE F 6  104 ? 104.395 109.512 86.666  1.00 93.01  ? 101 PHE F CD2   1 
ATOM   4423  C CE1   . PHE F 6  104 ? 103.430 111.776 87.866  1.00 95.79  ? 101 PHE F CE1   1 
ATOM   4424  C CE2   . PHE F 6  104 ? 104.478 110.720 86.015  1.00 96.88  ? 101 PHE F CE2   1 
ATOM   4425  C CZ    . PHE F 6  104 ? 103.999 111.855 86.619  1.00 98.06  ? 101 PHE F CZ    1 
ATOM   4426  N N     . GLY F 6  105 ? 101.593 105.268 89.254  1.00 98.17  ? 102 GLY F N     1 
ATOM   4427  C CA    . GLY F 6  105 ? 101.640 103.892 89.731  1.00 102.75 ? 102 GLY F CA    1 
ATOM   4428  C C     . GLY F 6  105 ? 100.853 103.714 91.024  1.00 110.53 ? 102 GLY F C     1 
ATOM   4429  O O     . GLY F 6  105 ? 100.739 104.636 91.834  1.00 107.18 ? 102 GLY F O     1 
ATOM   4430  N N     . GLY G 3  12  ? 140.039 90.984  111.372 1.00 180.56 ? 9   GLY G N     1 
ATOM   4431  C CA    . GLY G 3  12  ? 139.249 90.082  112.197 1.00 193.14 ? 9   GLY G CA    1 
ATOM   4432  C C     . GLY G 3  12  ? 140.091 88.909  112.669 1.00 201.43 ? 9   GLY G C     1 
ATOM   4433  O O     . GLY G 3  12  ? 141.319 88.942  112.593 1.00 203.86 ? 9   GLY G O     1 
ATOM   4434  N N     . LYS G 3  13  ? 139.431 87.881  113.186 1.00 200.60 ? 10  LYS G N     1 
ATOM   4435  C CA    . LYS G 3  13  ? 140.142 86.731  113.727 1.00 211.30 ? 10  LYS G CA    1 
ATOM   4436  C C     . LYS G 3  13  ? 140.858 85.949  112.632 1.00 207.66 ? 10  LYS G C     1 
ATOM   4437  O O     . LYS G 3  13  ? 140.381 85.849  111.500 1.00 199.01 ? 10  LYS G O     1 
ATOM   4438  C CB    . LYS G 3  13  ? 139.188 85.817  114.492 0.00 204.20 ? 10  LYS G CB    1 
ATOM   4439  C CG    . LYS G 3  13  ? 138.511 86.463  115.680 0.00 214.36 ? 10  LYS G CG    1 
ATOM   4440  C CD    . LYS G 3  13  ? 139.525 86.851  116.733 0.00 211.42 ? 10  LYS G CD    1 
ATOM   4441  C CE    . LYS G 3  13  ? 138.857 87.429  117.952 0.00 214.47 ? 10  LYS G CE    1 
ATOM   4442  N NZ    . LYS G 3  13  ? 139.831 87.830  118.971 0.00 213.98 ? 10  LYS G NZ    1 
ATOM   4443  N N     . ALA G 3  14  ? 141.991 85.357  112.996 1.00 212.55 ? 11  ALA G N     1 
ATOM   4444  C CA    . ALA G 3  14  ? 142.809 84.578  112.071 1.00 217.84 ? 11  ALA G CA    1 
ATOM   4445  C C     . ALA G 3  14  ? 142.459 83.096  112.098 1.00 221.86 ? 11  ALA G C     1 
ATOM   4446  O O     . ALA G 3  14  ? 143.166 82.275  111.514 1.00 217.33 ? 11  ALA G O     1 
ATOM   4447  C CB    . ALA G 3  14  ? 144.282 84.761  112.401 1.00 218.64 ? 11  ALA G CB    1 
ATOM   4448  N N     . ARG G 3  15  ? 141.405 82.747  112.823 1.00 221.10 ? 12  ARG G N     1 
ATOM   4449  C CA    . ARG G 3  15  ? 141.038 81.349  113.001 1.00 219.01 ? 12  ARG G CA    1 
ATOM   4450  C C     . ARG G 3  15  ? 139.640 81.068  112.471 1.00 209.24 ? 12  ARG G C     1 
ATOM   4451  O O     . ARG G 3  15  ? 138.782 81.944  112.467 1.00 200.81 ? 12  ARG G O     1 
ATOM   4452  C CB    . ARG G 3  15  ? 141.066 80.996  114.479 0.00 215.78 ? 12  ARG G CB    1 
ATOM   4453  C CG    . ARG G 3  15  ? 139.917 81.578  115.284 0.00 206.79 ? 12  ARG G CG    1 
ATOM   4454  C CD    . ARG G 3  15  ? 140.093 81.372  116.730 0.00 209.43 ? 12  ARG G CD    1 
ATOM   4455  N NE    . ARG G 3  15  ? 138.846 81.577  117.451 0.00 206.91 ? 12  ARG G NE    1 
ATOM   4456  C CZ    . ARG G 3  15  ? 138.747 81.845  118.772 0.00 203.20 ? 12  ARG G CZ    1 
ATOM   4457  N NH1   . ARG G 3  15  ? 139.833 81.992  119.504 0.00 202.97 ? 12  ARG G NH1   1 
ATOM   4458  N NH2   . ARG G 3  15  ? 137.556 81.963  119.335 0.00 198.94 ? 12  ARG G NH2   1 
ATOM   4459  N N     . ALA G 3  16  ? 139.397 79.820  112.076 1.00 213.12 ? 13  ALA G N     1 
ATOM   4460  C CA    . ALA G 3  16  ? 138.048 79.384  111.717 1.00 201.71 ? 13  ALA G CA    1 
ATOM   4461  C C     . ALA G 3  16  ? 137.239 79.018  112.960 1.00 201.82 ? 13  ALA G C     1 
ATOM   4462  O O     . ALA G 3  16  ? 136.009 79.071  112.953 1.00 191.64 ? 13  ALA G O     1 
ATOM   4463  C CB    . ALA G 3  16  ? 138.111 78.193  110.774 1.00 189.05 ? 13  ALA G CB    1 
ATOM   4464  N N     . LYS G 3  17  ? 137.943 78.683  114.037 1.00 208.50 ? 14  LYS G N     1 
ATOM   4465  C CA    . LYS G 3  17  ? 137.318 78.204  115.266 1.00 201.46 ? 14  LYS G CA    1 
ATOM   4466  C C     . LYS G 3  17  ? 136.317 79.186  115.856 1.00 198.01 ? 14  LYS G C     1 
ATOM   4467  O O     . LYS G 3  17  ? 136.575 80.391  115.957 1.00 192.97 ? 14  LYS G O     1 
ATOM   4468  C CB    . LYS G 3  17  ? 138.379 77.866  116.311 0.00 201.82 ? 14  LYS G CB    1 
ATOM   4469  C CG    . LYS G 3  17  ? 137.818 77.311  117.622 0.00 199.02 ? 14  LYS G CG    1 
ATOM   4470  C CD    . LYS G 3  17  ? 138.924 76.782  118.528 0.00 197.04 ? 14  LYS G CD    1 
ATOM   4471  C CE    . LYS G 3  17  ? 139.744 77.909  119.138 0.00 199.66 ? 14  LYS G CE    1 
ATOM   4472  N NZ    . LYS G 3  17  ? 140.741 77.400  120.117 0.00 195.26 ? 14  LYS G NZ    1 
ATOM   4473  N N     . ALA G 3  18  ? 135.197 78.635  116.319 1.00 194.08 ? 15  ALA G N     1 
ATOM   4474  C CA    . ALA G 3  18  ? 134.149 79.410  116.960 1.00 171.62 ? 15  ALA G CA    1 
ATOM   4475  C C     . ALA G 3  18  ? 133.463 78.592  118.039 1.00 174.47 ? 15  ALA G C     1 
ATOM   4476  O O     . ALA G 3  18  ? 133.449 77.363  117.986 1.00 177.42 ? 15  ALA G O     1 
ATOM   4477  C CB    . ALA G 3  18  ? 133.129 79.851  115.933 1.00 159.20 ? 15  ALA G CB    1 
ATOM   4478  N N     . LYS G 3  19  ? 132.893 79.282  119.017 1.00 166.88 ? 16  LYS G N     1 
ATOM   4479  C CA    . LYS G 3  19  ? 132.108 78.627  120.053 1.00 162.69 ? 16  LYS G CA    1 
ATOM   4480  C C     . LYS G 3  19  ? 130.640 78.974  119.900 1.00 155.62 ? 16  LYS G C     1 
ATOM   4481  O O     . LYS G 3  19  ? 129.761 78.176  120.225 1.00 152.88 ? 16  LYS G O     1 
ATOM   4482  C CB    . LYS G 3  19  ? 132.599 79.043  121.434 1.00 166.64 ? 16  LYS G CB    1 
ATOM   4483  C CG    . LYS G 3  19  ? 134.048 78.682  121.731 1.00 168.92 ? 16  LYS G CG    1 
ATOM   4484  C CD    . LYS G 3  19  ? 134.244 77.178  121.789 1.00 169.77 ? 16  LYS G CD    1 
ATOM   4485  C CE    . LYS G 3  19  ? 135.630 76.825  122.276 1.00 171.88 ? 16  LYS G CE    1 
ATOM   4486  N NZ    . LYS G 3  19  ? 135.828 75.358  122.353 1.00 166.94 ? 16  LYS G NZ    1 
ATOM   4487  N N     . THR G 3  20  ? 130.385 80.183  119.418 1.00 150.45 ? 17  THR G N     1 
ATOM   4488  C CA    . THR G 3  20  ? 129.032 80.672  119.225 1.00 145.17 ? 17  THR G CA    1 
ATOM   4489  C C     . THR G 3  20  ? 128.934 81.293  117.850 1.00 138.10 ? 17  THR G C     1 
ATOM   4490  O O     . THR G 3  20  ? 129.949 81.674  117.267 1.00 142.26 ? 17  THR G O     1 
ATOM   4491  C CB    . THR G 3  20  ? 128.654 81.729  120.279 1.00 142.88 ? 17  THR G CB    1 
ATOM   4492  O OG1   . THR G 3  20  ? 129.426 82.922  120.058 1.00 137.05 ? 17  THR G OG1   1 
ATOM   4493  C CG2   . THR G 3  20  ? 128.930 81.206  121.680 1.00 152.31 ? 17  THR G CG2   1 
ATOM   4494  N N     . ARG G 3  21  ? 127.714 81.493  117.380 1.00 138.14 ? 18  ARG G N     1 
ATOM   4495  C CA    . ARG G 3  21  ? 127.484 82.128  116.095 1.00 132.36 ? 18  ARG G CA    1 
ATOM   4496  C C     . ARG G 3  21  ? 128.119 83.509  116.031 1.00 128.18 ? 18  ARG G C     1 
ATOM   4497  O O     . ARG G 3  21  ? 128.674 83.901  115.003 1.00 126.32 ? 18  ARG G O     1 
ATOM   4498  C CB    . ARG G 3  21  ? 126.002 82.256  115.858 1.00 130.56 ? 18  ARG G CB    1 
ATOM   4499  C CG    . ARG G 3  21  ? 125.612 82.678  114.495 0.00 125.19 ? 18  ARG G CG    1 
ATOM   4500  C CD    . ARG G 3  21  ? 124.177 82.875  114.423 0.00 124.32 ? 18  ARG G CD    1 
ATOM   4501  N NE    . ARG G 3  21  ? 123.458 81.650  114.618 0.00 129.83 ? 18  ARG G NE    1 
ATOM   4502  C CZ    . ARG G 3  21  ? 123.161 80.788  113.643 0.00 131.65 ? 18  ARG G CZ    1 
ATOM   4503  N NH1   . ARG G 3  21  ? 123.501 81.051  112.405 0.00 129.53 ? 18  ARG G NH1   1 
ATOM   4504  N NH2   . ARG G 3  21  ? 122.515 79.678  113.928 0.00 138.52 ? 18  ARG G NH2   1 
ATOM   4505  N N     . SER G 3  22  ? 128.022 84.254  117.127 1.00 129.37 ? 19  SER G N     1 
ATOM   4506  C CA    . SER G 3  22  ? 128.602 85.585  117.175 1.00 124.08 ? 19  SER G CA    1 
ATOM   4507  C C     . SER G 3  22  ? 130.118 85.492  117.134 1.00 123.45 ? 19  SER G C     1 
ATOM   4508  O O     . SER G 3  22  ? 130.773 86.249  116.414 1.00 120.37 ? 19  SER G O     1 
ATOM   4509  C CB    . SER G 3  22  ? 128.157 86.316  118.425 1.00 121.99 ? 19  SER G CB    1 
ATOM   4510  O OG    . SER G 3  22  ? 126.778 86.573  118.398 1.00 112.49 ? 19  SER G OG    1 
ATOM   4511  N N     . SER G 3  23  ? 130.671 84.508  117.844 1.00 127.22 ? 20  SER G N     1 
ATOM   4512  C CA    . SER G 3  23  ? 132.114 84.316  117.850 1.00 128.14 ? 20  SER G CA    1 
ATOM   4513  C C     . SER G 3  23  ? 132.587 83.815  116.494 1.00 128.18 ? 20  SER G C     1 
ATOM   4514  O O     . SER G 3  23  ? 133.724 84.071  116.091 1.00 127.48 ? 20  SER G O     1 
ATOM   4515  C CB    . SER G 3  23  ? 132.522 83.339  118.938 1.00 139.67 ? 20  SER G CB    1 
ATOM   4516  O OG    . SER G 3  23  ? 132.155 82.022  118.610 1.00 144.50 ? 20  SER G OG    1 
ATOM   4517  N N     . ARG G 3  24  ? 131.680 83.177  115.756 1.00 129.11 ? 21  ARG G N     1 
ATOM   4518  C CA    . ARG G 3  24  ? 131.964 82.735  114.402 1.00 130.05 ? 21  ARG G CA    1 
ATOM   4519  C C     . ARG G 3  24  ? 132.058 83.927  113.467 1.00 124.47 ? 21  ARG G C     1 
ATOM   4520  O O     . ARG G 3  24  ? 132.990 84.028  112.670 1.00 122.10 ? 21  ARG G O     1 
ATOM   4521  C CB    . ARG G 3  24  ? 130.905 81.762  113.911 1.00 132.85 ? 21  ARG G CB    1 
ATOM   4522  C CG    . ARG G 3  24  ? 131.246 81.074  112.601 1.00 133.06 ? 21  ARG G CG    1 
ATOM   4523  C CD    . ARG G 3  24  ? 130.256 80.045  112.241 1.00 130.89 ? 21  ARG G CD    1 
ATOM   4524  N NE    . ARG G 3  24  ? 130.212 78.991  113.217 1.00 141.38 ? 21  ARG G NE    1 
ATOM   4525  C CZ    . ARG G 3  24  ? 131.074 77.965  113.277 1.00 148.46 ? 21  ARG G CZ    1 
ATOM   4526  N NH1   . ARG G 3  24  ? 132.053 77.871  112.410 1.00 149.74 ? 21  ARG G NH1   1 
ATOM   4527  N NH2   . ARG G 3  24  ? 130.935 77.050  114.216 1.00 155.41 ? 21  ARG G NH2   1 
ATOM   4528  N N     . ALA G 3  25  ? 131.121 84.855  113.610 1.00 123.24 ? 22  ALA G N     1 
ATOM   4529  C CA    . ALA G 3  25  ? 131.128 86.083  112.830 1.00 119.93 ? 22  ALA G CA    1 
ATOM   4530  C C     . ALA G 3  25  ? 132.271 86.997  113.257 1.00 117.42 ? 22  ALA G C     1 
ATOM   4531  O O     . ALA G 3  25  ? 132.837 87.725  112.441 1.00 118.04 ? 22  ALA G O     1 
ATOM   4532  C CB    . ALA G 3  25  ? 129.801 86.806  112.983 1.00 118.15 ? 22  ALA G CB    1 
ATOM   4533  N N     . GLY G 3  26  ? 132.628 86.931  114.538 1.00 114.44 ? 23  GLY G N     1 
ATOM   4534  C CA    . GLY G 3  26  ? 133.644 87.808  115.099 1.00 114.19 ? 23  GLY G CA    1 
ATOM   4535  C C     . GLY G 3  26  ? 132.995 89.045  115.703 1.00 109.56 ? 23  GLY G C     1 
ATOM   4536  O O     . GLY G 3  26  ? 133.629 90.091  115.840 1.00 109.28 ? 23  GLY G O     1 
ATOM   4537  N N     . LEU G 3  27  ? 131.704 88.936  115.990 1.00 108.98 ? 24  LEU G N     1 
ATOM   4538  C CA    . LEU G 3  27  ? 130.915 90.030  116.533 1.00 107.74 ? 24  LEU G CA    1 
ATOM   4539  C C     . LEU G 3  27  ? 130.609 89.814  118.003 1.00 108.79 ? 24  LEU G C     1 
ATOM   4540  O O     . LEU G 3  27  ? 130.787 88.715  118.527 1.00 111.10 ? 24  LEU G O     1 
ATOM   4541  C CB    . LEU G 3  27  ? 129.612 90.156  115.748 1.00 109.56 ? 24  LEU G CB    1 
ATOM   4542  C CG    . LEU G 3  27  ? 129.767 90.359  114.239 1.00 107.59 ? 24  LEU G CG    1 
ATOM   4543  C CD1   . LEU G 3  27  ? 128.397 90.338  113.602 1.00 101.53 ? 24  LEU G CD1   1 
ATOM   4544  C CD2   . LEU G 3  27  ? 130.473 91.677  113.965 1.00 106.93 ? 24  LEU G CD2   1 
ATOM   4545  N N     . GLN G 3  28  ? 130.194 90.877  118.680 1.00 103.40 ? 25  GLN G N     1 
ATOM   4546  C CA    . GLN G 3  28  ? 129.816 90.776  120.080 1.00 103.13 ? 25  GLN G CA    1 
ATOM   4547  C C     . GLN G 3  28  ? 128.310 90.633  120.218 1.00 104.29 ? 25  GLN G C     1 
ATOM   4548  O O     . GLN G 3  28  ? 127.820 89.941  121.109 1.00 107.58 ? 25  GLN G O     1 
ATOM   4549  C CB    . GLN G 3  28  ? 130.273 92.017  120.835 1.00 107.57 ? 25  GLN G CB    1 
ATOM   4550  C CG    . GLN G 3  28  ? 131.737 92.306  120.680 1.00 115.27 ? 25  GLN G CG    1 
ATOM   4551  C CD    . GLN G 3  28  ? 132.595 91.157  121.104 1.00 120.87 ? 25  GLN G CD    1 
ATOM   4552  O OE1   . GLN G 3  28  ? 132.489 90.661  122.226 1.00 122.70 ? 25  GLN G OE1   1 
ATOM   4553  N NE2   . GLN G 3  28  ? 133.457 90.713  120.201 1.00 118.75 ? 25  GLN G NE2   1 
ATOM   4554  N N     . PHE G 3  29  ? 127.579 91.242  119.293 1.00 101.11 ? 26  PHE G N     1 
ATOM   4555  C CA    . PHE G 3  29  ? 126.123 91.193  119.320 1.00 99.08  ? 26  PHE G CA    1 
ATOM   4556  C C     . PHE G 3  29  ? 125.612 89.765  119.168 1.00 101.73 ? 26  PHE G C     1 
ATOM   4557  O O     . PHE G 3  29  ? 126.282 88.918  118.579 1.00 103.80 ? 26  PHE G O     1 
ATOM   4558  C CB    . PHE G 3  29  ? 125.533 92.115  118.253 1.00 97.78  ? 26  PHE G CB    1 
ATOM   4559  C CG    . PHE G 3  29  ? 125.271 93.511  118.753 1.00 97.37  ? 26  PHE G CG    1 
ATOM   4560  C CD1   . PHE G 3  29  ? 126.181 94.174  119.563 1.00 96.90  ? 26  PHE G CD1   1 
ATOM   4561  C CD2   . PHE G 3  29  ? 124.069 94.140  118.464 1.00 96.99  ? 26  PHE G CD2   1 
ATOM   4562  C CE1   . PHE G 3  29  ? 125.899 95.430  120.053 1.00 98.74  ? 26  PHE G CE1   1 
ATOM   4563  C CE2   . PHE G 3  29  ? 123.791 95.394  118.956 1.00 96.04  ? 26  PHE G CE2   1 
ATOM   4564  C CZ    . PHE G 3  29  ? 124.706 96.040  119.748 1.00 96.88  ? 26  PHE G CZ    1 
ATOM   4565  N N     . PRO G 3  30  ? 124.424 89.470  119.700 1.00 100.86 ? 27  PRO G N     1 
ATOM   4566  C CA    . PRO G 3  30  ? 123.793 88.169  119.722 1.00 102.09 ? 27  PRO G CA    1 
ATOM   4567  C C     . PRO G 3  30  ? 123.254 87.808  118.354 1.00 99.19  ? 27  PRO G C     1 
ATOM   4568  O O     . PRO G 3  30  ? 122.045 87.831  118.132 1.00 97.88  ? 27  PRO G O     1 
ATOM   4569  C CB    . PRO G 3  30  ? 122.664 88.384  120.729 1.00 108.12 ? 27  PRO G CB    1 
ATOM   4570  C CG    . PRO G 3  30  ? 122.284 89.835  120.556 1.00 109.60 ? 27  PRO G CG    1 
ATOM   4571  C CD    . PRO G 3  30  ? 123.588 90.549  120.252 1.00 102.28 ? 27  PRO G CD    1 
ATOM   4572  N N     . VAL G 3  31  ? 124.147 87.422  117.455 1.00 99.51  ? 28  VAL G N     1 
ATOM   4573  C CA    . VAL G 3  31  ? 123.773 87.219  116.063 1.00 97.31  ? 28  VAL G CA    1 
ATOM   4574  C C     . VAL G 3  31  ? 122.610 86.250  115.960 1.00 99.12  ? 28  VAL G C     1 
ATOM   4575  O O     . VAL G 3  31  ? 121.716 86.429  115.130 1.00 97.63  ? 28  VAL G O     1 
ATOM   4576  C CB    . VAL G 3  31  ? 124.954 86.652  115.258 1.00 106.20 ? 28  VAL G CB    1 
ATOM   4577  C CG1   . VAL G 3  31  ? 124.503 86.285  113.856 1.00 104.51 ? 28  VAL G CG1   1 
ATOM   4578  C CG2   . VAL G 3  31  ? 126.078 87.658  115.189 1.00 113.20 ? 28  VAL G CG2   1 
ATOM   4579  N N     . GLY G 3  32  ? 122.641 85.198  116.769 1.00 100.01 ? 29  GLY G N     1 
ATOM   4580  C CA    . GLY G 3  32  ? 121.588 84.195  116.739 1.00 107.75 ? 29  GLY G CA    1 
ATOM   4581  C C     . GLY G 3  32  ? 120.236 84.813  117.057 1.00 100.08 ? 29  GLY G C     1 
ATOM   4582  O O     . GLY G 3  32  ? 119.209 84.393  116.519 1.00 102.33 ? 29  GLY G O     1 
ATOM   4583  N N     . ARG G 3  33  ? 120.231 85.806  117.936 1.00 97.62  ? 30  ARG G N     1 
ATOM   4584  C CA    . ARG G 3  33  ? 118.994 86.452  118.311 1.00 96.13  ? 30  ARG G CA    1 
ATOM   4585  C C     . ARG G 3  33  ? 118.530 87.368  117.213 1.00 96.68  ? 30  ARG G C     1 
ATOM   4586  O O     . ARG G 3  33  ? 117.340 87.464  116.936 1.00 96.47  ? 30  ARG G O     1 
ATOM   4587  C CB    . ARG G 3  33  ? 119.150 87.271  119.555 1.00 101.44 ? 30  ARG G CB    1 
ATOM   4588  C CG    . ARG G 3  33  ? 117.853 87.801  120.062 1.00 107.41 ? 30  ARG G CG    1 
ATOM   4589  C CD    . ARG G 3  33  ? 118.028 88.789  121.112 1.00 110.13 ? 30  ARG G CD    1 
ATOM   4590  N NE    . ARG G 3  33  ? 118.710 88.252  122.250 1.00 118.36 ? 30  ARG G NE    1 
ATOM   4591  C CZ    . ARG G 3  33  ? 119.139 88.990  123.280 1.00 120.11 ? 30  ARG G CZ    1 
ATOM   4592  N NH1   . ARG G 3  33  ? 118.906 90.285  123.293 1.00 119.34 ? 30  ARG G NH1   1 
ATOM   4593  N NH2   . ARG G 3  33  ? 119.788 88.419  124.276 1.00 116.50 ? 30  ARG G NH2   1 
ATOM   4594  N N     . VAL G 3  34  ? 119.474 88.034  116.576 1.00 96.11  ? 31  VAL G N     1 
ATOM   4595  C CA    . VAL G 3  34  ? 119.123 88.942  115.505 1.00 95.43  ? 31  VAL G CA    1 
ATOM   4596  C C     . VAL G 3  34  ? 118.397 88.150  114.433 1.00 95.70  ? 31  VAL G C     1 
ATOM   4597  O O     . VAL G 3  34  ? 117.380 88.595  113.899 1.00 94.35  ? 31  VAL G O     1 
ATOM   4598  C CB    . VAL G 3  34  ? 120.383 89.621  114.939 1.00 99.44  ? 31  VAL G CB    1 
ATOM   4599  C CG1   . VAL G 3  34  ? 120.054 90.420  113.688 1.00 99.09  ? 31  VAL G CG1   1 
ATOM   4600  C CG2   . VAL G 3  34  ? 120.982 90.528  116.004 1.00 100.91 ? 31  VAL G CG2   1 
ATOM   4601  N N     . HIS G 3  35  ? 118.894 86.948  114.160 1.00 97.04  ? 32  HIS G N     1 
ATOM   4602  C CA    . HIS G 3  35  ? 118.270 86.080  113.178 1.00 98.20  ? 32  HIS G CA    1 
ATOM   4603  C C     . HIS G 3  35  ? 116.857 85.771  113.622 1.00 97.28  ? 32  HIS G C     1 
ATOM   4604  O O     . HIS G 3  35  ? 115.911 85.851  112.842 1.00 96.96  ? 32  HIS G O     1 
ATOM   4605  C CB    . HIS G 3  35  ? 119.059 84.776  113.035 1.00 99.99  ? 32  HIS G CB    1 
ATOM   4606  C CG    . HIS G 3  35  ? 118.749 84.008  111.782 1.00 103.47 ? 32  HIS G CG    1 
ATOM   4607  N ND1   . HIS G 3  35  ? 119.400 82.838  111.448 1.00 107.60 ? 32  HIS G ND1   1 
ATOM   4608  C CD2   . HIS G 3  35  ? 117.936 84.296  110.738 1.00 106.07 ? 32  HIS G CD2   1 
ATOM   4609  C CE1   . HIS G 3  35  ? 119.013 82.452  110.243 1.00 109.83 ? 32  HIS G CE1   1 
ATOM   4610  N NE2   . HIS G 3  35  ? 118.124 83.316  109.794 1.00 106.61 ? 32  HIS G NE2   1 
ATOM   4611  N N     . ARG G 3  36  ? 116.712 85.459  114.899 1.00 96.41  ? 33  ARG G N     1 
ATOM   4612  C CA    . ARG G 3  36  ? 115.415 85.167  115.475 1.00 98.10  ? 33  ARG G CA    1 
ATOM   4613  C C     . ARG G 3  36  ? 114.455 86.341  115.383 1.00 96.62  ? 33  ARG G C     1 
ATOM   4614  O O     . ARG G 3  36  ? 113.293 86.178  115.016 1.00 95.82  ? 33  ARG G O     1 
ATOM   4615  C CB    . ARG G 3  36  ? 115.598 84.794  116.922 1.00 104.95 ? 33  ARG G CB    1 
ATOM   4616  C CG    . ARG G 3  36  ? 114.363 84.437  117.652 1.00 111.37 ? 33  ARG G CG    1 
ATOM   4617  C CD    . ARG G 3  36  ? 114.697 83.957  119.000 1.00 118.83 ? 33  ARG G CD    1 
ATOM   4618  N NE    . ARG G 3  36  ? 113.525 83.692  119.783 1.00 130.11 ? 33  ARG G NE    1 
ATOM   4619  C CZ    . ARG G 3  36  ? 112.868 84.615  120.503 1.00 134.99 ? 33  ARG G CZ    1 
ATOM   4620  N NH1   . ARG G 3  36  ? 113.280 85.861  120.514 1.00 131.38 ? 33  ARG G NH1   1 
ATOM   4621  N NH2   . ARG G 3  36  ? 111.807 84.268  121.206 1.00 137.28 ? 33  ARG G NH2   1 
ATOM   4622  N N     . LEU G 3  37  ? 114.943 87.532  115.678 1.00 94.09  ? 34  LEU G N     1 
ATOM   4623  C CA    . LEU G 3  37  ? 114.099 88.712  115.664 1.00 94.72  ? 34  LEU G CA    1 
ATOM   4624  C C     . LEU G 3  37  ? 113.617 89.015  114.261 1.00 96.94  ? 34  LEU G C     1 
ATOM   4625  O O     . LEU G 3  37  ? 112.489 89.462  114.070 1.00 98.31  ? 34  LEU G O     1 
ATOM   4626  C CB    . LEU G 3  37  ? 114.862 89.912  116.216 1.00 96.53  ? 34  LEU G CB    1 
ATOM   4627  C CG    . LEU G 3  37  ? 115.199 89.864  117.700 1.00 103.09 ? 34  LEU G CG    1 
ATOM   4628  C CD1   . LEU G 3  37  ? 116.184 90.975  118.013 1.00 108.98 ? 34  LEU G CD1   1 
ATOM   4629  C CD2   . LEU G 3  37  ? 113.933 90.024  118.531 1.00 103.34 ? 34  LEU G CD2   1 
ATOM   4630  N N     . LEU G 3  38  ? 114.447 88.712  113.271 1.00 94.82  ? 35  LEU G N     1 
ATOM   4631  C CA    . LEU G 3  38  ? 114.089 88.960  111.883 1.00 93.47  ? 35  LEU G CA    1 
ATOM   4632  C C     . LEU G 3  38  ? 113.004 88.011  111.394 1.00 96.14  ? 35  LEU G C     1 
ATOM   4633  O O     . LEU G 3  38  ? 112.437 88.219  110.323 1.00 98.76  ? 35  LEU G O     1 
ATOM   4634  C CB    . LEU G 3  38  ? 115.322 88.850  110.975 1.00 91.06  ? 35  LEU G CB    1 
ATOM   4635  C CG    . LEU G 3  38  ? 116.375 89.959  111.104 1.00 94.70  ? 35  LEU G CG    1 
ATOM   4636  C CD1   . LEU G 3  38  ? 117.630 89.562  110.317 1.00 95.22  ? 35  LEU G CD1   1 
ATOM   4637  C CD2   . LEU G 3  38  ? 115.803 91.264  110.556 1.00 94.36  ? 35  LEU G CD2   1 
ATOM   4638  N N     . ARG G 3  39  ? 112.732 86.950  112.152 1.00 95.53  ? 36  ARG G N     1 
ATOM   4639  C CA    . ARG G 3  39  ? 111.712 85.988  111.764 1.00 96.58  ? 36  ARG G CA    1 
ATOM   4640  C C     . ARG G 3  39  ? 110.358 86.438  112.253 1.00 96.35  ? 36  ARG G C     1 
ATOM   4641  O O     . ARG G 3  39  ? 109.336 85.814  111.966 1.00 95.94  ? 36  ARG G O     1 
ATOM   4642  C CB    . ARG G 3  39  ? 111.983 84.625  112.360 1.00 96.24  ? 36  ARG G CB    1 
ATOM   4643  C CG    . ARG G 3  39  ? 113.163 83.902  111.796 1.00 101.12 ? 36  ARG G CG    1 
ATOM   4644  C CD    . ARG G 3  39  ? 113.291 82.554  112.385 1.00 102.69 ? 36  ARG G CD    1 
ATOM   4645  N NE    . ARG G 3  39  ? 114.348 81.776  111.762 1.00 105.50 ? 36  ARG G NE    1 
ATOM   4646  C CZ    . ARG G 3  39  ? 115.644 81.817  112.109 1.00 104.97 ? 36  ARG G CZ    1 
ATOM   4647  N NH1   . ARG G 3  39  ? 116.037 82.618  113.058 1.00 103.53 ? 36  ARG G NH1   1 
ATOM   4648  N NH2   . ARG G 3  39  ? 116.511 81.041  111.498 1.00 104.46 ? 36  ARG G NH2   1 
ATOM   4649  N N     . LYS G 3  40  ? 110.370 87.457  113.101 1.00 98.70  ? 37  LYS G N     1 
ATOM   4650  C CA    . LYS G 3  40  ? 109.184 87.963  113.765 1.00 100.85 ? 37  LYS G CA    1 
ATOM   4651  C C     . LYS G 3  40  ? 108.913 89.382  113.282 1.00 105.13 ? 37  LYS G C     1 
ATOM   4652  O O     . LYS G 3  40  ? 109.762 89.981  112.635 1.00 100.20 ? 37  LYS G O     1 
ATOM   4653  C CB    . LYS G 3  40  ? 109.357 87.849  115.281 1.00 103.85 ? 37  LYS G CB    1 
ATOM   4654  C CG    . LYS G 3  40  ? 108.150 88.260  116.116 1.00 113.55 ? 37  LYS G CG    1 
ATOM   4655  C CD    . LYS G 3  40  ? 108.061 87.427  117.388 1.00 124.08 ? 37  LYS G CD    1 
ATOM   4656  C CE    . LYS G 3  40  ? 109.211 87.693  118.349 1.00 131.67 ? 37  LYS G CE    1 
ATOM   4657  N NZ    . LYS G 3  40  ? 109.053 88.944  119.145 1.00 128.64 ? 37  LYS G NZ    1 
ATOM   4658  N N     . GLY G 3  41  ? 107.689 89.866  113.436 1.00 105.94 ? 38  GLY G N     1 
ATOM   4659  C CA    . GLY G 3  41  ? 107.325 91.189  112.957 1.00 107.17 ? 38  GLY G CA    1 
ATOM   4660  C C     . GLY G 3  41  ? 106.875 91.080  111.515 1.00 102.25 ? 38  GLY G C     1 
ATOM   4661  O O     . GLY G 3  41  ? 106.596 92.079  110.854 1.00 102.17 ? 38  GLY G O     1 
ATOM   4662  N N     . ASN G 3  42  ? 106.850 89.847  111.027 1.00 98.74  ? 39  ASN G N     1 
ATOM   4663  C CA    . ASN G 3  42  ? 106.438 89.527  109.675 1.00 100.77 ? 39  ASN G CA    1 
ATOM   4664  C C     . ASN G 3  42  ? 107.187 90.333  108.621 1.00 99.13  ? 39  ASN G C     1 
ATOM   4665  O O     . ASN G 3  42  ? 106.595 90.788  107.647 1.00 100.55 ? 39  ASN G O     1 
ATOM   4666  C CB    . ASN G 3  42  ? 104.944 89.716  109.552 1.00 106.66 ? 39  ASN G CB    1 
ATOM   4667  C CG    . ASN G 3  42  ? 104.202 88.889  110.545 0.00 109.68 ? 39  ASN G CG    1 
ATOM   4668  O OD1   . ASN G 3  42  ? 104.607 87.764  110.860 0.00 111.54 ? 39  ASN G OD1   1 
ATOM   4669  N ND2   . ASN G 3  42  ? 103.125 89.420  111.059 0.00 107.06 ? 39  ASN G ND2   1 
ATOM   4670  N N     . TYR G 3  43  ? 108.496 90.468  108.775 1.00 93.35  ? 40  TYR G N     1 
ATOM   4671  C CA    . TYR G 3  43  ? 109.267 91.212  107.790 1.00 90.31  ? 40  TYR G CA    1 
ATOM   4672  C C     . TYR G 3  43  ? 109.344 90.433  106.489 1.00 89.77  ? 40  TYR G C     1 
ATOM   4673  O O     . TYR G 3  43  ? 109.322 91.007  105.399 1.00 92.29  ? 40  TYR G O     1 
ATOM   4674  C CB    . TYR G 3  43  ? 110.672 91.488  108.312 1.00 91.71  ? 40  TYR G CB    1 
ATOM   4675  C CG    . TYR G 3  43  ? 110.691 92.389  109.502 1.00 92.81  ? 40  TYR G CG    1 
ATOM   4676  C CD1   . TYR G 3  43  ? 111.091 91.894  110.726 1.00 94.26  ? 40  TYR G CD1   1 
ATOM   4677  C CD2   . TYR G 3  43  ? 110.286 93.703  109.382 1.00 94.43  ? 40  TYR G CD2   1 
ATOM   4678  C CE1   . TYR G 3  43  ? 111.091 92.710  111.831 1.00 97.75  ? 40  TYR G CE1   1 
ATOM   4679  C CE2   . TYR G 3  43  ? 110.285 94.523  110.487 1.00 97.18  ? 40  TYR G CE2   1 
ATOM   4680  C CZ    . TYR G 3  43  ? 110.683 94.029  111.710 1.00 99.20  ? 40  TYR G CZ    1 
ATOM   4681  O OH    . TYR G 3  43  ? 110.678 94.847  112.816 1.00 100.11 ? 40  TYR G OH    1 
ATOM   4682  N N     . SER G 3  44  ? 109.415 89.119  106.613 1.00 89.78  ? 41  SER G N     1 
ATOM   4683  C CA    . SER G 3  44  ? 109.486 88.229  105.471 1.00 92.78  ? 41  SER G CA    1 
ATOM   4684  C C     . SER G 3  44  ? 109.097 86.832  105.891 1.00 94.73  ? 41  SER G C     1 
ATOM   4685  O O     . SER G 3  44  ? 109.136 86.498  107.075 1.00 95.68  ? 41  SER G O     1 
ATOM   4686  C CB    . SER G 3  44  ? 110.886 88.198  104.918 1.00 94.26  ? 41  SER G CB    1 
ATOM   4687  O OG    . SER G 3  44  ? 111.760 87.611  105.842 1.00 95.22  ? 41  SER G OG    1 
ATOM   4688  N N     . GLU G 3  45  ? 108.767 85.997  104.903 1.00 95.65  ? 42  GLU G N     1 
ATOM   4689  C CA    . GLU G 3  45  ? 108.435 84.580  105.198 1.00 96.53  ? 42  GLU G CA    1 
ATOM   4690  C C     . GLU G 3  45  ? 109.739 83.818  105.447 1.00 96.17  ? 42  GLU G C     1 
ATOM   4691  O O     . GLU G 3  45  ? 109.724 82.878  106.264 1.00 101.43 ? 42  GLU G O     1 
ATOM   4692  C CB    . GLU G 3  45  ? 107.680 83.963  104.020 1.00 101.15 ? 42  GLU G CB    1 
ATOM   4693  C CG    . GLU G 3  45  ? 106.519 84.812  103.538 1.00 110.11 ? 42  GLU G CG    1 
ATOM   4694  C CD    . GLU G 3  45  ? 106.893 85.878  102.525 1.00 116.41 ? 42  GLU G CD    1 
ATOM   4695  O OE1   . GLU G 3  45  ? 107.811 86.670  102.813 1.00 108.22 ? 42  GLU G OE1   1 
ATOM   4696  O OE2   . GLU G 3  45  ? 106.265 85.915  101.449 1.00 119.70 ? 42  GLU G OE2   1 
ATOM   4697  N N     . ARG G 3  46  ? 110.819 84.211  104.766 1.00 94.36  ? 43  ARG G N     1 
ATOM   4698  C CA    . ARG G 3  46  ? 112.116 83.497  104.907 1.00 97.17  ? 43  ARG G CA    1 
ATOM   4699  C C     . ARG G 3  46  ? 113.236 84.495  105.222 1.00 95.68  ? 43  ARG G C     1 
ATOM   4700  O O     . ARG G 3  46  ? 113.190 85.617  104.688 1.00 92.45  ? 43  ARG G O     1 
ATOM   4701  C CB    . ARG G 3  46  ? 112.432 82.704  103.636 1.00 98.40  ? 43  ARG G CB    1 
ATOM   4702  C CG    . ARG G 3  46  ? 111.722 81.363  103.534 1.00 101.44 ? 43  ARG G CG    1 
ATOM   4703  C CD    . ARG G 3  46  ? 112.569 80.355  102.781 1.00 104.91 ? 43  ARG G CD    1 
ATOM   4704  N NE    . ARG G 3  46  ? 111.793 79.251  102.235 1.00 110.48 ? 43  ARG G NE    1 
ATOM   4705  C CZ    . ARG G 3  46  ? 112.233 78.417  101.300 1.00 114.25 ? 43  ARG G CZ    1 
ATOM   4706  N NH1   . ARG G 3  46  ? 113.450 78.561  100.804 1.00 111.85 ? 43  ARG G NH1   1 
ATOM   4707  N NH2   . ARG G 3  46  ? 111.456 77.442  100.864 1.00 118.30 ? 43  ARG G NH2   1 
ATOM   4708  N N     . VAL G 3  47  ? 114.188 84.107  106.075 1.00 90.59  ? 44  VAL G N     1 
ATOM   4709  C CA    . VAL G 3  47  ? 115.349 84.984  106.413 1.00 89.38  ? 44  VAL G CA    1 
ATOM   4710  C C     . VAL G 3  47  ? 116.638 84.213  106.114 1.00 91.52  ? 44  VAL G C     1 
ATOM   4711  O O     . VAL G 3  47  ? 116.724 83.040  106.517 1.00 97.09  ? 44  VAL G O     1 
ATOM   4712  C CB    . VAL G 3  47  ? 115.311 85.437  107.884 1.00 98.14  ? 44  VAL G CB    1 
ATOM   4713  C CG1   . VAL G 3  47  ? 116.304 86.556  108.153 1.00 100.68 ? 44  VAL G CG1   1 
ATOM   4714  C CG2   . VAL G 3  47  ? 113.913 85.844  108.322 1.00 101.18 ? 44  VAL G CG2   1 
ATOM   4715  N N     . GLY G 3  48  ? 117.605 84.852  105.450 1.00 91.37  ? 45  GLY G N     1 
ATOM   4716  C CA    . GLY G 3  48  ? 118.863 84.173  105.083 1.00 94.86  ? 45  GLY G CA    1 
ATOM   4717  C C     . GLY G 3  48  ? 119.823 84.027  106.252 1.00 95.04  ? 45  GLY G C     1 
ATOM   4718  O O     . GLY G 3  48  ? 119.574 84.657  107.296 1.00 93.47  ? 45  GLY G O     1 
ATOM   4719  N N     . ALA G 3  49  ? 120.891 83.233  106.086 1.00 94.70  ? 46  ALA G N     1 
ATOM   4720  C CA    . ALA G 3  49  ? 121.888 83.062  107.137 1.00 95.58  ? 46  ALA G CA    1 
ATOM   4721  C C     . ALA G 3  49  ? 122.814 84.260  107.273 1.00 93.72  ? 46  ALA G C     1 
ATOM   4722  O O     . ALA G 3  49  ? 123.294 84.557  108.365 1.00 96.27  ? 46  ALA G O     1 
ATOM   4723  C CB    . ALA G 3  49  ? 122.715 81.818  106.879 1.00 102.21 ? 46  ALA G CB    1 
ATOM   4724  N N     . GLY G 3  50  ? 123.113 84.918  106.161 1.00 90.98  ? 47  GLY G N     1 
ATOM   4725  C CA    . GLY G 3  50  ? 124.043 86.036  106.194 1.00 92.38  ? 47  GLY G CA    1 
ATOM   4726  C C     . GLY G 3  50  ? 123.362 87.319  106.644 1.00 89.74  ? 47  GLY G C     1 
ATOM   4727  O O     . GLY G 3  50  ? 124.024 88.314  106.935 1.00 87.35  ? 47  GLY G O     1 
ATOM   4728  N N     . ALA G 3  51  ? 122.037 87.317  106.672 1.00 86.61  ? 48  ALA G N     1 
ATOM   4729  C CA    . ALA G 3  51  ? 121.308 88.528  106.996 1.00 88.40  ? 48  ALA G CA    1 
ATOM   4730  C C     . ALA G 3  51  ? 121.598 89.034  108.412 1.00 85.28  ? 48  ALA G C     1 
ATOM   4731  O O     . ALA G 3  51  ? 122.003 90.186  108.556 1.00 83.83  ? 48  ALA G O     1 
ATOM   4732  C CB    . ALA G 3  51  ? 119.818 88.347  106.747 1.00 92.48  ? 48  ALA G CB    1 
ATOM   4733  N N     . PRO G 3  52  ? 121.438 88.219  109.472 1.00 83.46  ? 49  PRO G N     1 
ATOM   4734  C CA    . PRO G 3  52  ? 121.638 88.620  110.845 1.00 87.71  ? 49  PRO G CA    1 
ATOM   4735  C C     . PRO G 3  52  ? 123.094 88.855  111.152 1.00 86.41  ? 49  PRO G C     1 
ATOM   4736  O O     . PRO G 3  52  ? 123.430 89.649  112.026 1.00 84.62  ? 49  PRO G O     1 
ATOM   4737  C CB    . PRO G 3  52  ? 121.110 87.421  111.609 1.00 92.98  ? 49  PRO G CB    1 
ATOM   4738  C CG    . PRO G 3  52  ? 121.283 86.270  110.663 1.00 92.98  ? 49  PRO G CG    1 
ATOM   4739  C CD    . PRO G 3  52  ? 121.021 86.821  109.323 1.00 88.76  ? 49  PRO G CD    1 
ATOM   4740  N N     . VAL G 3  53  ? 123.965 88.234  110.381 1.00 82.04  ? 50  VAL G N     1 
ATOM   4741  C CA    . VAL G 3  53  ? 125.378 88.444  110.585 1.00 83.79  ? 50  VAL G CA    1 
ATOM   4742  C C     . VAL G 3  53  ? 125.723 89.841  110.116 1.00 86.55  ? 50  VAL G C     1 
ATOM   4743  O O     . VAL G 3  53  ? 126.398 90.598  110.817 1.00 87.98  ? 50  VAL G O     1 
ATOM   4744  C CB    . VAL G 3  53  ? 126.186 87.408  109.798 1.00 92.74  ? 50  VAL G CB    1 
ATOM   4745  C CG1   . VAL G 3  53  ? 127.652 87.705  109.906 1.00 96.69  ? 50  VAL G CG1   1 
ATOM   4746  C CG2   . VAL G 3  53  ? 125.884 86.026  110.311 1.00 98.36  ? 50  VAL G CG2   1 
ATOM   4747  N N     . TYR G 3  54  ? 125.228 90.185  108.933 1.00 84.51  ? 51  TYR G N     1 
ATOM   4748  C CA    . TYR G 3  54  ? 125.460 91.493  108.358 1.00 86.21  ? 51  TYR G CA    1 
ATOM   4749  C C     . TYR G 3  54  ? 124.849 92.547  109.264 1.00 84.85  ? 51  TYR G C     1 
ATOM   4750  O O     . TYR G 3  54  ? 125.507 93.516  109.646 1.00 84.72  ? 51  TYR G O     1 
ATOM   4751  C CB    . TYR G 3  54  ? 124.807 91.568  106.978 1.00 87.13  ? 51  TYR G CB    1 
ATOM   4752  C CG    . TYR G 3  54  ? 125.229 92.734  106.133 1.00 86.10  ? 51  TYR G CG    1 
ATOM   4753  C CD1   . TYR G 3  54  ? 126.086 92.517  105.077 1.00 87.23  ? 51  TYR G CD1   1 
ATOM   4754  C CD2   . TYR G 3  54  ? 124.787 94.008  106.407 1.00 84.82  ? 51  TYR G CD2   1 
ATOM   4755  C CE1   . TYR G 3  54  ? 126.487 93.562  104.292 1.00 87.96  ? 51  TYR G CE1   1 
ATOM   4756  C CE2   . TYR G 3  54  ? 125.189 95.057  105.617 1.00 88.14  ? 51  TYR G CE2   1 
ATOM   4757  C CZ    . TYR G 3  54  ? 126.039 94.830  104.569 1.00 89.71  ? 51  TYR G CZ    1 
ATOM   4758  O OH    . TYR G 3  54  ? 126.453 95.862  103.790 1.00 88.37  ? 51  TYR G OH    1 
ATOM   4759  N N     . LEU G 3  55  ? 123.604 92.313  109.663 1.00 81.96  ? 52  LEU G N     1 
ATOM   4760  C CA    . LEU G 3  55  ? 122.870 93.272  110.467 1.00 82.19  ? 52  LEU G CA    1 
ATOM   4761  C C     . LEU G 3  55  ? 123.461 93.446  111.849 1.00 84.97  ? 52  LEU G C     1 
ATOM   4762  O O     . LEU G 3  55  ? 123.519 94.563  112.364 1.00 82.27  ? 52  LEU G O     1 
ATOM   4763  C CB    . LEU G 3  55  ? 121.402 92.859  110.570 1.00 81.10  ? 52  LEU G CB    1 
ATOM   4764  C CG    . LEU G 3  55  ? 120.498 93.758  111.425 1.00 83.30  ? 52  LEU G CG    1 
ATOM   4765  C CD1   . LEU G 3  55  ? 120.559 95.180  110.933 1.00 87.22  ? 52  LEU G CD1   1 
ATOM   4766  C CD2   . LEU G 3  55  ? 119.081 93.251  111.322 1.00 86.89  ? 52  LEU G CD2   1 
ATOM   4767  N N     . ALA G 3  56  ? 123.867 92.354  112.478 1.00 84.02  ? 53  ALA G N     1 
ATOM   4768  C CA    . ALA G 3  56  ? 124.435 92.461  113.805 1.00 85.74  ? 53  ALA G CA    1 
ATOM   4769  C C     . ALA G 3  56  ? 125.680 93.326  113.769 1.00 86.00  ? 53  ALA G C     1 
ATOM   4770  O O     . ALA G 3  56  ? 125.876 94.170  114.642 1.00 86.08  ? 53  ALA G O     1 
ATOM   4771  C CB    . ALA G 3  56  ? 124.757 91.089  114.356 1.00 91.42  ? 53  ALA G CB    1 
ATOM   4772  N N     . ALA G 3  57  ? 126.484 93.179  112.718 1.00 84.87  ? 54  ALA G N     1 
ATOM   4773  C CA    . ALA G 3  57  ? 127.683 93.991  112.585 1.00 86.23  ? 54  ALA G CA    1 
ATOM   4774  C C     . ALA G 3  57  ? 127.327 95.461  112.481 1.00 84.08  ? 54  ALA G C     1 
ATOM   4775  O O     . ALA G 3  57  ? 128.011 96.317  113.042 1.00 85.24  ? 54  ALA G O     1 
ATOM   4776  C CB    . ALA G 3  57  ? 128.471 93.571  111.364 1.00 94.28  ? 54  ALA G CB    1 
ATOM   4777  N N     . VAL G 3  58  ? 126.243 95.752  111.773 1.00 81.50  ? 55  VAL G N     1 
ATOM   4778  C CA    . VAL G 3  58  ? 125.805 97.125  111.602 1.00 82.98  ? 55  VAL G CA    1 
ATOM   4779  C C     . VAL G 3  58  ? 125.346 97.713  112.917 1.00 84.70  ? 55  VAL G C     1 
ATOM   4780  O O     . VAL G 3  58  ? 125.728 98.827  113.275 1.00 83.89  ? 55  VAL G O     1 
ATOM   4781  C CB    . VAL G 3  58  ? 124.653 97.196  110.588 1.00 82.88  ? 55  VAL G CB    1 
ATOM   4782  C CG1   . VAL G 3  58  ? 124.037 98.596  110.565 1.00 86.79  ? 55  VAL G CG1   1 
ATOM   4783  C CG2   . VAL G 3  58  ? 125.173 96.814  109.218 1.00 86.92  ? 55  VAL G CG2   1 
ATOM   4784  N N     . LEU G 3  59  ? 124.544 96.954  113.646 1.00 83.13  ? 56  LEU G N     1 
ATOM   4785  C CA    . LEU G 3  59  ? 124.018 97.435  114.906 1.00 85.99  ? 56  LEU G CA    1 
ATOM   4786  C C     . LEU G 3  59  ? 125.153 97.658  115.887 1.00 87.83  ? 56  LEU G C     1 
ATOM   4787  O O     . LEU G 3  59  ? 125.190 98.672  116.587 1.00 86.71  ? 56  LEU G O     1 
ATOM   4788  C CB    . LEU G 3  59  ? 123.037 96.410  115.480 1.00 87.57  ? 56  LEU G CB    1 
ATOM   4789  C CG    . LEU G 3  59  ? 121.733 96.197  114.686 1.00 90.15  ? 56  LEU G CG    1 
ATOM   4790  C CD1   . LEU G 3  59  ? 121.023 94.967  115.222 1.00 92.12  ? 56  LEU G CD1   1 
ATOM   4791  C CD2   . LEU G 3  59  ? 120.834 97.424  114.798 1.00 88.94  ? 56  LEU G CD2   1 
ATOM   4792  N N     . GLU G 3  60  ? 126.112 96.741  115.891 1.00 88.27  ? 57  GLU G N     1 
ATOM   4793  C CA    . GLU G 3  60  ? 127.248 96.839  116.786 1.00 91.20  ? 57  GLU G CA    1 
ATOM   4794  C C     . GLU G 3  60  ? 128.117 98.030  116.434 1.00 87.93  ? 57  GLU G C     1 
ATOM   4795  O O     . GLU G 3  60  ? 128.552 98.773  117.314 1.00 89.24  ? 57  GLU G O     1 
ATOM   4796  C CB    . GLU G 3  60  ? 128.072 95.562  116.734 1.00 95.02  ? 57  GLU G CB    1 
ATOM   4797  C CG    . GLU G 3  60  ? 129.222 95.525  117.709 1.00 101.24 ? 57  GLU G CG    1 
ATOM   4798  C CD    . GLU G 3  60  ? 129.921 94.206  117.720 0.00 111.46 ? 57  GLU G CD    1 
ATOM   4799  O OE1   . GLU G 3  60  ? 129.260 93.193  117.801 0.00 109.41 ? 57  GLU G OE1   1 
ATOM   4800  O OE2   . GLU G 3  60  ? 131.123 94.199  117.641 0.00 113.20 ? 57  GLU G OE2   1 
ATOM   4801  N N     . TYR G 3  61  ? 128.356 98.226  115.145 1.00 83.26  ? 58  TYR G N     1 
ATOM   4802  C CA    . TYR G 3  61  ? 129.157 99.348  114.696 1.00 86.03  ? 58  TYR G CA    1 
ATOM   4803  C C     . TYR G 3  61  ? 128.560 100.672 115.126 1.00 87.53  ? 58  TYR G C     1 
ATOM   4804  O O     . TYR G 3  61  ? 129.259 101.530 115.668 1.00 86.57  ? 58  TYR G O     1 
ATOM   4805  C CB    . TYR G 3  61  ? 129.326 99.325  113.185 1.00 89.08  ? 58  TYR G CB    1 
ATOM   4806  C CG    . TYR G 3  61  ? 129.861 100.610 112.667 1.00 89.81  ? 58  TYR G CG    1 
ATOM   4807  C CD1   . TYR G 3  61  ? 131.174 100.955 112.897 1.00 91.00  ? 58  TYR G CD1   1 
ATOM   4808  C CD2   . TYR G 3  61  ? 129.024 101.467 111.985 1.00 91.38  ? 58  TYR G CD2   1 
ATOM   4809  C CE1   . TYR G 3  61  ? 131.643 102.172 112.471 1.00 95.65  ? 58  TYR G CE1   1 
ATOM   4810  C CE2   . TYR G 3  61  ? 129.493 102.674 111.547 1.00 94.59  ? 58  TYR G CE2   1 
ATOM   4811  C CZ    . TYR G 3  61  ? 130.794 103.037 111.804 1.00 97.31  ? 58  TYR G CZ    1 
ATOM   4812  O OH    . TYR G 3  61  ? 131.265 104.257 111.379 1.00 98.87  ? 58  TYR G OH    1 
ATOM   4813  N N     . LEU G 3  62  ? 127.275 100.856 114.858 1.00 84.95  ? 59  LEU G N     1 
ATOM   4814  C CA    . LEU G 3  62  ? 126.630 102.113 115.184 1.00 86.56  ? 59  LEU G CA    1 
ATOM   4815  C C     . LEU G 3  62  ? 126.616 102.323 116.686 1.00 88.37  ? 59  LEU G C     1 
ATOM   4816  O O     . LEU G 3  62  ? 126.808 103.441 117.171 1.00 87.94  ? 59  LEU G O     1 
ATOM   4817  C CB    . LEU G 3  62  ? 125.200 102.118 114.659 1.00 83.53  ? 59  LEU G CB    1 
ATOM   4818  C CG    . LEU G 3  62  ? 125.033 102.108 113.146 1.00 88.10  ? 59  LEU G CG    1 
ATOM   4819  C CD1   . LEU G 3  62  ? 123.574 101.866 112.823 1.00 91.29  ? 59  LEU G CD1   1 
ATOM   4820  C CD2   . LEU G 3  62  ? 125.498 103.429 112.567 1.00 91.53  ? 59  LEU G CD2   1 
ATOM   4821  N N     . THR G 3  63  ? 126.422 101.237 117.423 1.00 86.22  ? 60  THR G N     1 
ATOM   4822  C CA    . THR G 3  63  ? 126.410 101.292 118.870 1.00 87.83  ? 60  THR G CA    1 
ATOM   4823  C C     . THR G 3  63  ? 127.745 101.812 119.369 1.00 89.01  ? 60  THR G C     1 
ATOM   4824  O O     . THR G 3  63  ? 127.799 102.724 120.196 1.00 88.11  ? 60  THR G O     1 
ATOM   4825  C CB    . THR G 3  63  ? 126.133 99.891  119.457 1.00 89.32  ? 60  THR G CB    1 
ATOM   4826  O OG1   . THR G 3  63  ? 124.828 99.454  119.060 1.00 94.23  ? 60  THR G OG1   1 
ATOM   4827  C CG2   . THR G 3  63  ? 126.218 99.893  120.965 1.00 93.82  ? 60  THR G CG2   1 
ATOM   4828  N N     . ALA G 3  64  ? 128.824 101.280 118.809 1.00 86.22  ? 61  ALA G N     1 
ATOM   4829  C CA    . ALA G 3  64  ? 130.156 101.692 119.211 1.00 87.69  ? 61  ALA G CA    1 
ATOM   4830  C C     . ALA G 3  64  ? 130.401 103.169 118.949 1.00 89.49  ? 61  ALA G C     1 
ATOM   4831  O O     . ALA G 3  64  ? 130.937 103.868 119.806 1.00 90.83  ? 61  ALA G O     1 
ATOM   4832  C CB    . ALA G 3  64  ? 131.196 100.867 118.476 1.00 90.48  ? 61  ALA G CB    1 
ATOM   4833  N N     . GLU G 3  65  ? 129.932 103.670 117.811 1.00 87.02  ? 62  GLU G N     1 
ATOM   4834  C CA    . GLU G 3  65  ? 130.204 105.060 117.461 1.00 89.70  ? 62  GLU G CA    1 
ATOM   4835  C C     . GLU G 3  65  ? 129.549 106.024 118.428 1.00 91.07  ? 62  GLU G C     1 
ATOM   4836  O O     . GLU G 3  65  ? 130.174 106.983 118.888 1.00 90.01  ? 62  GLU G O     1 
ATOM   4837  C CB    . GLU G 3  65  ? 129.703 105.357 116.054 1.00 92.05  ? 62  GLU G CB    1 
ATOM   4838  C CG    . GLU G 3  65  ? 130.495 104.689 114.971 1.00 100.47 ? 62  GLU G CG    1 
ATOM   4839  C CD    . GLU G 3  65  ? 131.892 105.201 114.889 1.00 109.06 ? 62  GLU G CD    1 
ATOM   4840  O OE1   . GLU G 3  65  ? 132.062 106.377 114.681 1.00 108.36 ? 62  GLU G OE1   1 
ATOM   4841  O OE2   . GLU G 3  65  ? 132.796 104.425 115.079 1.00 109.10 ? 62  GLU G OE2   1 
ATOM   4842  N N     . ILE G 3  66  ? 128.326 105.717 118.823 1.00 86.72  ? 63  ILE G N     1 
ATOM   4843  C CA    . ILE G 3  66  ? 127.637 106.582 119.759 1.00 86.13  ? 63  ILE G CA    1 
ATOM   4844  C C     . ILE G 3  66  ? 128.352 106.567 121.091 1.00 88.34  ? 63  ILE G C     1 
ATOM   4845  O O     . ILE G 3  66  ? 128.571 107.613 121.701 1.00 89.41  ? 63  ILE G O     1 
ATOM   4846  C CB    . ILE G 3  66  ? 126.176 106.155 119.943 1.00 85.94  ? 63  ILE G CB    1 
ATOM   4847  C CG1   . ILE G 3  66  ? 125.411 106.405 118.651 1.00 89.51  ? 63  ILE G CG1   1 
ATOM   4848  C CG2   . ILE G 3  66  ? 125.550 106.921 121.109 1.00 89.03  ? 63  ILE G CG2   1 
ATOM   4849  C CD1   . ILE G 3  66  ? 124.073 105.741 118.593 1.00 93.45  ? 63  ILE G CD1   1 
ATOM   4850  N N     . LEU G 3  67  ? 128.720 105.378 121.538 1.00 87.51  ? 64  LEU G N     1 
ATOM   4851  C CA    . LEU G 3  67  ? 129.376 105.221 122.819 1.00 89.27  ? 64  LEU G CA    1 
ATOM   4852  C C     . LEU G 3  67  ? 130.743 105.884 122.848 1.00 93.29  ? 64  LEU G C     1 
ATOM   4853  O O     . LEU G 3  67  ? 131.144 106.435 123.873 1.00 93.27  ? 64  LEU G O     1 
ATOM   4854  C CB    . LEU G 3  67  ? 129.501 103.737 123.136 1.00 90.46  ? 64  LEU G CB    1 
ATOM   4855  C CG    . LEU G 3  67  ? 128.183 103.015 123.419 1.00 95.21  ? 64  LEU G CG    1 
ATOM   4856  C CD1   . LEU G 3  67  ? 128.436 101.526 123.414 1.00 103.21 ? 64  LEU G CD1   1 
ATOM   4857  C CD2   . LEU G 3  67  ? 127.606 103.466 124.765 1.00 95.08  ? 64  LEU G CD2   1 
ATOM   4858  N N     . GLU G 3  68  ? 131.474 105.819 121.741 1.00 90.58  ? 65  GLU G N     1 
ATOM   4859  C CA    . GLU G 3  68  ? 132.786 106.446 121.705 1.00 95.48  ? 65  GLU G CA    1 
ATOM   4860  C C     . GLU G 3  68  ? 132.670 107.938 121.899 1.00 96.01  ? 65  GLU G C     1 
ATOM   4861  O O     . GLU G 3  68  ? 133.378 108.532 122.716 1.00 95.56  ? 65  GLU G O     1 
ATOM   4862  C CB    . GLU G 3  68  ? 133.490 106.197 120.375 1.00 100.90 ? 65  GLU G CB    1 
ATOM   4863  C CG    . GLU G 3  68  ? 134.872 106.853 120.297 1.00 109.06 ? 65  GLU G CG    1 
ATOM   4864  C CD    . GLU G 3  68  ? 135.641 106.492 119.064 1.00 122.60 ? 65  GLU G CD    1 
ATOM   4865  O OE1   . GLU G 3  68  ? 135.171 105.685 118.306 1.00 122.15 ? 65  GLU G OE1   1 
ATOM   4866  O OE2   . GLU G 3  68  ? 136.707 107.028 118.881 1.00 127.62 ? 65  GLU G OE2   1 
ATOM   4867  N N     . LEU G 3  69  ? 131.751 108.536 121.166 1.00 92.81  ? 66  LEU G N     1 
ATOM   4868  C CA    . LEU G 3  69  ? 131.567 109.967 121.212 1.00 93.72  ? 66  LEU G CA    1 
ATOM   4869  C C     . LEU G 3  69  ? 130.978 110.400 122.543 1.00 94.67  ? 66  LEU G C     1 
ATOM   4870  O O     . LEU G 3  69  ? 131.299 111.475 123.048 1.00 94.23  ? 66  LEU G O     1 
ATOM   4871  C CB    . LEU G 3  69  ? 130.674 110.384 120.058 1.00 89.47  ? 66  LEU G CB    1 
ATOM   4872  C CG    . LEU G 3  69  ? 131.274 110.240 118.673 1.00 94.19  ? 66  LEU G CG    1 
ATOM   4873  C CD1   . LEU G 3  69  ? 130.167 110.400 117.671 1.00 100.22 ? 66  LEU G CD1   1 
ATOM   4874  C CD2   . LEU G 3  69  ? 132.352 111.295 118.459 1.00 93.71  ? 66  LEU G CD2   1 
ATOM   4875  N N     . ALA G 3  70  ? 130.106 109.572 123.104 1.00 92.77  ? 67  ALA G N     1 
ATOM   4876  C CA    . ALA G 3  70  ? 129.530 109.859 124.406 1.00 94.86  ? 67  ALA G CA    1 
ATOM   4877  C C     . ALA G 3  70  ? 130.599 109.797 125.479 1.00 96.19  ? 67  ALA G C     1 
ATOM   4878  O O     . ALA G 3  70  ? 130.612 110.617 126.396 1.00 98.45  ? 67  ALA G O     1 
ATOM   4879  C CB    . ALA G 3  70  ? 128.409 108.894 124.704 1.00 94.45  ? 67  ALA G CB    1 
ATOM   4880  N N     . GLY G 3  71  ? 131.533 108.862 125.338 1.00 94.68  ? 68  GLY G N     1 
ATOM   4881  C CA    . GLY G 3  71  ? 132.644 108.777 126.270 1.00 98.04  ? 68  GLY G CA    1 
ATOM   4882  C C     . GLY G 3  71  ? 133.462 110.055 126.205 1.00 98.89  ? 68  GLY G C     1 
ATOM   4883  O O     . GLY G 3  71  ? 133.908 110.574 127.231 1.00 101.54 ? 68  GLY G O     1 
ATOM   4884  N N     . ASN G 3  72  ? 133.596 110.604 125.003 1.00 96.88  ? 69  ASN G N     1 
ATOM   4885  C CA    . ASN G 3  72  ? 134.301 111.861 124.839 1.00 96.23  ? 69  ASN G CA    1 
ATOM   4886  C C     . ASN G 3  72  ? 133.503 113.001 125.458 1.00 101.97 ? 69  ASN G C     1 
ATOM   4887  O O     . ASN G 3  72  ? 134.066 113.859 126.136 1.00 103.33 ? 69  ASN G O     1 
ATOM   4888  C CB    . ASN G 3  72  ? 134.581 112.125 123.377 1.00 97.55  ? 69  ASN G CB    1 
ATOM   4889  C CG    . ASN G 3  72  ? 135.637 111.220 122.826 1.00 100.89 ? 69  ASN G CG    1 
ATOM   4890  O OD1   . ASN G 3  72  ? 136.465 110.676 123.565 1.00 99.83  ? 69  ASN G OD1   1 
ATOM   4891  N ND2   . ASN G 3  72  ? 135.626 111.040 121.532 1.00 101.70 ? 69  ASN G ND2   1 
ATOM   4892  N N     . ALA G 3  73  ? 132.180 112.960 125.310 1.00 99.56  ? 70  ALA G N     1 
ATOM   4893  C CA    . ALA G 3  73  ? 131.334 113.970 125.935 1.00 103.64 ? 70  ALA G CA    1 
ATOM   4894  C C     . ALA G 3  73  ? 131.468 113.898 127.450 1.00 104.45 ? 70  ALA G C     1 
ATOM   4895  O O     . ALA G 3  73  ? 131.484 114.922 128.136 1.00 107.98 ? 70  ALA G O     1 
ATOM   4896  C CB    . ALA G 3  73  ? 129.880 113.784 125.526 1.00 102.87 ? 70  ALA G CB    1 
ATOM   4897  N N     . ALA G 3  74  ? 131.576 112.681 127.972 1.00 102.40 ? 71  ALA G N     1 
ATOM   4898  C CA    . ALA G 3  74  ? 131.749 112.499 129.399 1.00 104.72 ? 71  ALA G CA    1 
ATOM   4899  C C     . ALA G 3  74  ? 133.052 113.125 129.839 1.00 107.30 ? 71  ALA G C     1 
ATOM   4900  O O     . ALA G 3  74  ? 133.106 113.816 130.856 1.00 109.46 ? 71  ALA G O     1 
ATOM   4901  C CB    . ALA G 3  74  ? 131.718 111.022 129.760 1.00 105.66 ? 71  ALA G CB    1 
ATOM   4902  N N     . ARG G 3  75  ? 134.072 112.982 129.005 1.00 105.04 ? 72  ARG G N     1 
ATOM   4903  C CA    . ARG G 3  75  ? 135.364 113.573 129.287 1.00 107.39 ? 72  ARG G CA    1 
ATOM   4904  C C     . ARG G 3  75  ? 135.300 115.084 129.281 1.00 109.08 ? 72  ARG G C     1 
ATOM   4905  O O     . ARG G 3  75  ? 135.883 115.739 130.140 1.00 110.66 ? 72  ARG G O     1 
ATOM   4906  C CB    . ARG G 3  75  ? 136.382 113.138 128.267 1.00 107.33 ? 72  ARG G CB    1 
ATOM   4907  C CG    . ARG G 3  75  ? 137.789 113.587 128.555 1.00 114.15 ? 72  ARG G CG    1 
ATOM   4908  C CD    . ARG G 3  75  ? 138.384 112.861 129.683 1.00 113.83 ? 72  ARG G CD    1 
ATOM   4909  N NE    . ARG G 3  75  ? 138.570 111.467 129.372 1.00 117.20 ? 72  ARG G NE    1 
ATOM   4910  C CZ    . ARG G 3  75  ? 137.827 110.458 129.859 1.00 118.27 ? 72  ARG G CZ    1 
ATOM   4911  N NH1   . ARG G 3  75  ? 136.827 110.693 130.678 1.00 113.36 ? 72  ARG G NH1   1 
ATOM   4912  N NH2   . ARG G 3  75  ? 138.106 109.217 129.505 1.00 117.80 ? 72  ARG G NH2   1 
ATOM   4913  N N     . ASP G 3  76  ? 134.527 115.646 128.367 1.00 109.59 ? 73  ASP G N     1 
ATOM   4914  C CA    . ASP G 3  76  ? 134.400 117.093 128.303 1.00 113.18 ? 73  ASP G CA    1 
ATOM   4915  C C     . ASP G 3  76  ? 133.869 117.630 129.627 1.00 113.99 ? 73  ASP G C     1 
ATOM   4916  O O     . ASP G 3  76  ? 134.299 118.685 130.101 1.00 113.51 ? 73  ASP G O     1 
ATOM   4917  C CB    . ASP G 3  76  ? 133.465 117.502 127.165 1.00 119.82 ? 73  ASP G CB    1 
ATOM   4918  C CG    . ASP G 3  76  ? 134.069 117.288 125.783 1.00 121.72 ? 73  ASP G CG    1 
ATOM   4919  O OD1   . ASP G 3  76  ? 135.265 117.134 125.683 1.00 117.12 ? 73  ASP G OD1   1 
ATOM   4920  O OD2   . ASP G 3  76  ? 133.319 117.271 124.836 1.00 118.38 ? 73  ASP G OD2   1 
ATOM   4921  N N     . ASN G 3  77  ? 133.004 116.845 130.267 1.00 112.98 ? 74  ASN G N     1 
ATOM   4922  C CA    . ASN G 3  77  ? 132.425 117.206 131.555 1.00 113.89 ? 74  ASN G CA    1 
ATOM   4923  C C     . ASN G 3  77  ? 133.244 116.656 132.720 1.00 114.05 ? 74  ASN G C     1 
ATOM   4924  O O     . ASN G 3  77  ? 132.835 116.746 133.880 1.00 113.83 ? 74  ASN G O     1 
ATOM   4925  C CB    . ASN G 3  77  ? 130.989 116.733 131.644 1.00 112.84 ? 74  ASN G CB    1 
ATOM   4926  C CG    . ASN G 3  77  ? 130.076 117.520 130.760 1.00 115.91 ? 74  ASN G CG    1 
ATOM   4927  O OD1   . ASN G 3  77  ? 130.317 118.704 130.496 1.00 117.11 ? 74  ASN G OD1   1 
ATOM   4928  N ND2   . ASN G 3  77  ? 129.018 116.902 130.312 1.00 112.33 ? 74  ASN G ND2   1 
ATOM   4929  N N     . LYS G 3  78  ? 134.412 116.107 132.406 1.00 113.15 ? 75  LYS G N     1 
ATOM   4930  C CA    . LYS G 3  78  ? 135.345 115.556 133.383 1.00 114.21 ? 75  LYS G CA    1 
ATOM   4931  C C     . LYS G 3  78  ? 134.737 114.419 134.183 1.00 112.19 ? 75  LYS G C     1 
ATOM   4932  O O     . LYS G 3  78  ? 134.956 114.310 135.390 1.00 111.00 ? 75  LYS G O     1 
ATOM   4933  C CB    . LYS G 3  78  ? 135.801 116.639 134.351 1.00 118.04 ? 75  LYS G CB    1 
ATOM   4934  C CG    . LYS G 3  78  ? 136.134 117.963 133.704 1.00 121.39 ? 75  LYS G CG    1 
ATOM   4935  C CD    . LYS G 3  78  ? 137.150 117.821 132.600 1.00 122.05 ? 75  LYS G CD    1 
ATOM   4936  C CE    . LYS G 3  78  ? 137.506 119.171 132.021 1.00 126.76 ? 75  LYS G CE    1 
ATOM   4937  N NZ    . LYS G 3  78  ? 136.293 119.915 131.557 1.00 130.86 ? 75  LYS G NZ    1 
ATOM   4938  N N     . LYS G 3  79  ? 133.979 113.569 133.511 1.00 111.84 ? 76  LYS G N     1 
ATOM   4939  C CA    . LYS G 3  79  ? 133.336 112.447 134.165 1.00 111.70 ? 76  LYS G CA    1 
ATOM   4940  C C     . LYS G 3  79  ? 133.913 111.122 133.708 1.00 111.99 ? 76  LYS G C     1 
ATOM   4941  O O     . LYS G 3  79  ? 134.558 111.035 132.663 1.00 112.27 ? 76  LYS G O     1 
ATOM   4942  C CB    . LYS G 3  79  ? 131.845 112.482 133.898 1.00 111.51 ? 76  LYS G CB    1 
ATOM   4943  C CG    . LYS G 3  79  ? 131.186 113.794 134.263 1.00 114.01 ? 76  LYS G CG    1 
ATOM   4944  C CD    . LYS G 3  79  ? 131.187 114.042 135.752 1.00 115.36 ? 76  LYS G CD    1 
ATOM   4945  C CE    . LYS G 3  79  ? 130.377 115.284 136.096 1.00 114.40 ? 76  LYS G CE    1 
ATOM   4946  N NZ    . LYS G 3  79  ? 131.178 116.525 135.968 1.00 113.10 ? 76  LYS G NZ    1 
ATOM   4947  N N     . THR G 3  80  ? 133.649 110.084 134.490 1.00 109.06 ? 77  THR G N     1 
ATOM   4948  C CA    . THR G 3  80  ? 134.103 108.735 134.186 1.00 112.40 ? 77  THR G CA    1 
ATOM   4949  C C     . THR G 3  80  ? 132.870 107.928 133.815 1.00 111.44 ? 77  THR G C     1 
ATOM   4950  O O     . THR G 3  80  ? 132.895 106.697 133.846 1.00 110.82 ? 77  THR G O     1 
ATOM   4951  C CB    . THR G 3  80  ? 134.809 108.119 135.401 1.00 116.94 ? 77  THR G CB    1 
ATOM   4952  O OG1   . THR G 3  80  ? 133.888 108.048 136.496 1.00 114.42 ? 77  THR G OG1   1 
ATOM   4953  C CG2   . THR G 3  80  ? 135.995 108.977 135.801 1.00 118.05 ? 77  THR G CG2   1 
ATOM   4954  N N     . ARG G 3  81  ? 131.743 108.604 133.537 1.00 110.80 ? 78  ARG G N     1 
ATOM   4955  C CA    . ARG G 3  81  ? 130.477 107.853 133.345 1.00 110.93 ? 78  ARG G CA    1 
ATOM   4956  C C     . ARG G 3  81  ? 129.572 108.469 132.281 1.00 108.86 ? 78  ARG G C     1 
ATOM   4957  O O     . ARG G 3  81  ? 129.393 109.702 132.299 1.00 109.55 ? 78  ARG G O     1 
ATOM   4958  C CB    . ARG G 3  81  ? 129.759 107.708 134.691 1.00 112.08 ? 78  ARG G CB    1 
ATOM   4959  C CG    . ARG G 3  81  ? 128.501 106.852 134.652 1.00 120.88 ? 78  ARG G CG    1 
ATOM   4960  C CD    . ARG G 3  81  ? 127.805 106.781 135.996 0.00 137.05 ? 78  ARG G CD    1 
ATOM   4961  N NE    . ARG G 3  81  ? 128.602 106.109 137.012 0.00 150.16 ? 78  ARG G NE    1 
ATOM   4962  C CZ    . ARG G 3  81  ? 128.653 104.793 137.179 0.00 209.40 ? 78  ARG G CZ    1 
ATOM   4963  N NH1   . ARG G 3  81  ? 127.948 103.997 136.393 0.00 218.91 ? 78  ARG G NH1   1 
ATOM   4964  N NH2   . ARG G 3  81  ? 129.407 104.276 138.132 0.00 230.83 ? 78  ARG G NH2   1 
ATOM   4965  N N     . ILE G 3  82  ? 129.020 107.634 131.404 1.00 106.14 ? 79  ILE G N     1 
ATOM   4966  C CA    . ILE G 3  82  ? 128.078 108.025 130.369 1.00 100.08 ? 79  ILE G CA    1 
ATOM   4967  C C     . ILE G 3  82  ? 126.680 108.096 130.964 1.00 101.50 ? 79  ILE G C     1 
ATOM   4968  O O     . ILE G 3  82  ? 126.195 107.151 131.586 1.00 102.89 ? 79  ILE G O     1 
ATOM   4969  C CB    . ILE G 3  82  ? 128.072 107.156 129.102 1.00 98.99  ? 79  ILE G CB    1 
ATOM   4970  C CG1   . ILE G 3  82  ? 129.406 107.314 128.377 1.00 98.32  ? 79  ILE G CG1   1 
ATOM   4971  C CG2   . ILE G 3  82  ? 126.887 107.518 128.194 1.00 101.47 ? 79  ILE G CG2   1 
ATOM   4972  C CD1   . ILE G 3  82  ? 129.616 106.335 127.257 1.00 102.56 ? 79  ILE G CD1   1 
ATOM   4973  N N     . ILE G 3  83  ? 126.048 109.242 130.770 1.00 97.78  ? 80  ILE G N     1 
ATOM   4974  C CA    . ILE G 3  83  ? 124.674 109.484 131.176 1.00 94.80  ? 80  ILE G CA    1 
ATOM   4975  C C     . ILE G 3  83  ? 123.935 109.947 129.917 1.00 93.67  ? 80  ILE G C     1 
ATOM   4976  O O     . ILE G 3  83  ? 124.595 110.374 128.968 1.00 91.09  ? 80  ILE G O     1 
ATOM   4977  C CB    . ILE G 3  83  ? 124.639 110.528 132.306 1.00 91.04  ? 80  ILE G CB    1 
ATOM   4978  C CG1   . ILE G 3  83  ? 125.165 111.854 131.800 1.00 93.11  ? 80  ILE G CG1   1 
ATOM   4979  C CG2   . ILE G 3  83  ? 125.489 110.024 133.464 1.00 101.58 ? 80  ILE G CG2   1 
ATOM   4980  C CD1   . ILE G 3  83  ? 124.953 113.010 132.747 1.00 101.97 ? 80  ILE G CD1   1 
ATOM   4981  N N     . PRO G 3  84  ? 122.595 109.950 129.893 1.00 92.36  ? 81  PRO G N     1 
ATOM   4982  C CA    . PRO G 3  84  ? 121.764 110.315 128.757 1.00 93.38  ? 81  PRO G CA    1 
ATOM   4983  C C     . PRO G 3  84  ? 122.204 111.626 128.119 1.00 91.41  ? 81  PRO G C     1 
ATOM   4984  O O     . PRO G 3  84  ? 122.221 111.752 126.894 1.00 91.38  ? 81  PRO G O     1 
ATOM   4985  C CB    . PRO G 3  84  ? 120.382 110.426 129.405 1.00 93.23  ? 81  PRO G CB    1 
ATOM   4986  C CG    . PRO G 3  84  ? 120.433 109.437 130.542 1.00 95.22  ? 81  PRO G CG    1 
ATOM   4987  C CD    . PRO G 3  84  ? 121.830 109.565 131.089 1.00 91.32  ? 81  PRO G CD    1 
ATOM   4988  N N     . ARG G 3  85  ? 122.690 112.547 128.937 1.00 90.14  ? 82  ARG G N     1 
ATOM   4989  C CA    . ARG G 3  85  ? 123.172 113.822 128.439 1.00 91.75  ? 82  ARG G CA    1 
ATOM   4990  C C     . ARG G 3  85  ? 124.374 113.659 127.530 1.00 90.12  ? 82  ARG G C     1 
ATOM   4991  O O     . ARG G 3  85  ? 124.517 114.369 126.535 1.00 88.52  ? 82  ARG G O     1 
ATOM   4992  C CB    . ARG G 3  85  ? 123.585 114.680 129.604 1.00 94.01  ? 82  ARG G CB    1 
ATOM   4993  C CG    . ARG G 3  85  ? 124.238 115.978 129.265 1.00 96.04  ? 82  ARG G CG    1 
ATOM   4994  C CD    . ARG G 3  85  ? 123.354 116.865 128.549 1.00 97.45  ? 82  ARG G CD    1 
ATOM   4995  N NE    . ARG G 3  85  ? 123.845 118.218 128.573 1.00 99.46  ? 82  ARG G NE    1 
ATOM   4996  C CZ    . ARG G 3  85  ? 123.359 119.216 127.828 1.00 103.07 ? 82  ARG G CZ    1 
ATOM   4997  N NH1   . ARG G 3  85  ? 122.376 119.012 127.004 1.00 103.12 ? 82  ARG G NH1   1 
ATOM   4998  N NH2   . ARG G 3  85  ? 123.874 120.419 127.905 1.00 103.22 ? 82  ARG G NH2   1 
ATOM   4999  N N     . HIS G 3  86  ? 125.257 112.745 127.887 1.00 90.72  ? 83  HIS G N     1 
ATOM   5000  C CA    . HIS G 3  86  ? 126.487 112.566 127.147 1.00 92.47  ? 83  HIS G CA    1 
ATOM   5001  C C     . HIS G 3  86  ? 126.180 111.901 125.825 1.00 91.63  ? 83  HIS G C     1 
ATOM   5002  O O     . HIS G 3  86  ? 126.777 112.227 124.797 1.00 91.69  ? 83  HIS G O     1 
ATOM   5003  C CB    . HIS G 3  86  ? 127.479 111.763 127.988 1.00 95.65  ? 83  HIS G CB    1 
ATOM   5004  C CG    . HIS G 3  86  ? 127.898 112.528 129.196 1.00 98.31  ? 83  HIS G CG    1 
ATOM   5005  N ND1   . HIS G 3  86  ? 128.458 111.941 130.318 1.00 101.33 ? 83  HIS G ND1   1 
ATOM   5006  C CD2   . HIS G 3  86  ? 127.810 113.847 129.465 1.00 99.07  ? 83  HIS G CD2   1 
ATOM   5007  C CE1   . HIS G 3  86  ? 128.690 112.876 131.219 1.00 105.52 ? 83  HIS G CE1   1 
ATOM   5008  N NE2   . HIS G 3  86  ? 128.315 114.040 130.719 1.00 104.20 ? 83  HIS G NE2   1 
ATOM   5009  N N     . LEU G 3  87  ? 125.167 111.044 125.832 1.00 90.59  ? 84  LEU G N     1 
ATOM   5010  C CA    . LEU G 3  87  ? 124.722 110.427 124.597 1.00 88.25  ? 84  LEU G CA    1 
ATOM   5011  C C     . LEU G 3  87  ? 124.135 111.498 123.691 1.00 90.28  ? 84  LEU G C     1 
ATOM   5012  O O     . LEU G 3  87  ? 124.427 111.541 122.495 1.00 90.39  ? 84  LEU G O     1 
ATOM   5013  C CB    . LEU G 3  87  ? 123.664 109.354 124.881 1.00 86.27  ? 84  LEU G CB    1 
ATOM   5014  C CG    . LEU G 3  87  ? 124.146 108.094 125.636 0.00 91.51  ? 84  LEU G CG    1 
ATOM   5015  C CD1   . LEU G 3  87  ? 122.952 107.260 126.036 0.00 96.24  ? 84  LEU G CD1   1 
ATOM   5016  C CD2   . LEU G 3  87  ? 125.055 107.271 124.752 0.00 96.35  ? 84  LEU G CD2   1 
ATOM   5017  N N     . GLN G 3  88  ? 123.385 112.426 124.280 1.00 88.33  ? 85  GLN G N     1 
ATOM   5018  C CA    . GLN G 3  88  ? 122.755 113.472 123.491 1.00 88.78  ? 85  GLN G CA    1 
ATOM   5019  C C     . GLN G 3  88  ? 123.773 114.385 122.833 1.00 88.93  ? 85  GLN G C     1 
ATOM   5020  O O     . GLN G 3  88  ? 123.652 114.706 121.649 1.00 89.21  ? 85  GLN G O     1 
ATOM   5021  C CB    . GLN G 3  88  ? 121.827 114.323 124.360 1.00 90.87  ? 85  GLN G CB    1 
ATOM   5022  C CG    . GLN G 3  88  ? 121.114 115.438 123.602 1.00 93.22  ? 85  GLN G CG    1 
ATOM   5023  C CD    . GLN G 3  88  ? 120.127 114.920 122.594 1.00 98.86  ? 85  GLN G CD    1 
ATOM   5024  O OE1   . GLN G 3  88  ? 118.943 114.760 122.895 1.00 95.97  ? 85  GLN G OE1   1 
ATOM   5025  N NE2   . GLN G 3  88  ? 120.607 114.625 121.394 1.00 98.68  ? 85  GLN G NE2   1 
ATOM   5026  N N     . LEU G 3  89  ? 124.803 114.760 123.579 1.00 87.56  ? 86  LEU G N     1 
ATOM   5027  C CA    . LEU G 3  89  ? 125.808 115.663 123.049 1.00 89.61  ? 86  LEU G CA    1 
ATOM   5028  C C     . LEU G 3  89  ? 126.576 114.993 121.926 1.00 92.51  ? 86  LEU G C     1 
ATOM   5029  O O     . LEU G 3  89  ? 126.858 115.609 120.895 1.00 91.75  ? 86  LEU G O     1 
ATOM   5030  C CB    . LEU G 3  89  ? 126.770 116.080 124.165 1.00 91.36  ? 86  LEU G CB    1 
ATOM   5031  C CG    . LEU G 3  89  ? 126.173 116.964 125.281 1.00 95.23  ? 86  LEU G CG    1 
ATOM   5032  C CD1   . LEU G 3  89  ? 127.177 117.073 126.419 1.00 99.54  ? 86  LEU G CD1   1 
ATOM   5033  C CD2   . LEU G 3  89  ? 125.830 118.339 124.733 1.00 94.88  ? 86  LEU G CD2   1 
ATOM   5034  N N     . ALA G 3  90  ? 126.850 113.707 122.099 1.00 91.20  ? 87  ALA G N     1 
ATOM   5035  C CA    . ALA G 3  90  ? 127.574 112.935 121.106 1.00 93.81  ? 87  ALA G CA    1 
ATOM   5036  C C     . ALA G 3  90  ? 126.841 112.904 119.780 1.00 93.99  ? 87  ALA G C     1 
ATOM   5037  O O     . ALA G 3  90  ? 127.436 113.121 118.720 1.00 96.10  ? 87  ALA G O     1 
ATOM   5038  C CB    . ALA G 3  90  ? 127.735 111.521 121.616 1.00 99.27  ? 87  ALA G CB    1 
ATOM   5039  N N     . ILE G 3  91  ? 125.529 112.739 119.854 1.00 89.63  ? 88  ILE G N     1 
ATOM   5040  C CA    . ILE G 3  91  ? 124.701 112.662 118.666 1.00 93.46  ? 88  ILE G CA    1 
ATOM   5041  C C     . ILE G 3  91  ? 124.751 113.946 117.874 1.00 94.33  ? 88  ILE G C     1 
ATOM   5042  O O     . ILE G 3  91  ? 124.804 113.921 116.649 1.00 95.20  ? 88  ILE G O     1 
ATOM   5043  C CB    . ILE G 3  91  ? 123.245 112.328 119.028 1.00 94.02  ? 88  ILE G CB    1 
ATOM   5044  C CG1   . ILE G 3  91  ? 123.175 110.886 119.545 1.00 94.45  ? 88  ILE G CG1   1 
ATOM   5045  C CG2   . ILE G 3  91  ? 122.326 112.544 117.808 1.00 97.65  ? 88  ILE G CG2   1 
ATOM   5046  C CD1   . ILE G 3  91  ? 121.882 110.525 120.250 1.00 97.58  ? 88  ILE G CD1   1 
ATOM   5047  N N     . ARG G 3  92  ? 124.685 115.071 118.563 1.00 93.27  ? 89  ARG G N     1 
ATOM   5048  C CA    . ARG G 3  92  ? 124.655 116.345 117.868 1.00 94.43  ? 89  ARG G CA    1 
ATOM   5049  C C     . ARG G 3  92  ? 125.987 116.732 117.267 1.00 95.52  ? 89  ARG G C     1 
ATOM   5050  O O     . ARG G 3  92  ? 126.041 117.323 116.189 1.00 96.86  ? 89  ARG G O     1 
ATOM   5051  C CB    . ARG G 3  92  ? 124.261 117.436 118.812 1.00 94.97  ? 89  ARG G CB    1 
ATOM   5052  C CG    . ARG G 3  92  ? 122.952 117.236 119.472 1.00 97.11  ? 89  ARG G CG    1 
ATOM   5053  C CD    . ARG G 3  92  ? 121.893 116.981 118.519 1.00 97.88  ? 89  ARG G CD    1 
ATOM   5054  N NE    . ARG G 3  92  ? 120.620 116.955 119.167 1.00 99.48  ? 89  ARG G NE    1 
ATOM   5055  C CZ    . ARG G 3  92  ? 119.483 116.557 118.594 1.00 100.49 ? 89  ARG G CZ    1 
ATOM   5056  N NH1   . ARG G 3  92  ? 119.472 116.184 117.342 1.00 98.76  ? 89  ARG G NH1   1 
ATOM   5057  N NH2   . ARG G 3  92  ? 118.368 116.546 119.291 1.00 100.61 ? 89  ARG G NH2   1 
ATOM   5058  N N     . ASN G 3  93  ? 127.066 116.438 117.973 1.00 95.54  ? 90  ASN G N     1 
ATOM   5059  C CA    . ASN G 3  93  ? 128.372 116.856 117.501 1.00 98.59  ? 90  ASN G CA    1 
ATOM   5060  C C     . ASN G 3  93  ? 128.740 116.137 116.211 1.00 100.95 ? 90  ASN G C     1 
ATOM   5061  O O     . ASN G 3  93  ? 129.387 116.708 115.333 1.00 100.96 ? 90  ASN G O     1 
ATOM   5062  C CB    . ASN G 3  93  ? 129.408 116.633 118.576 1.00 103.36 ? 90  ASN G CB    1 
ATOM   5063  C CG    . ASN G 3  93  ? 129.264 117.615 119.702 1.00 105.79 ? 90  ASN G CG    1 
ATOM   5064  O OD1   . ASN G 3  93  ? 128.665 118.685 119.542 1.00 97.72  ? 90  ASN G OD1   1 
ATOM   5065  N ND2   . ASN G 3  93  ? 129.799 117.272 120.843 1.00 108.01 ? 90  ASN G ND2   1 
ATOM   5066  N N     . ASP G 3  94  ? 128.299 114.892 116.083 1.00 101.95 ? 91  ASP G N     1 
ATOM   5067  C CA    . ASP G 3  94  ? 128.521 114.125 114.867 1.00 105.66 ? 91  ASP G CA    1 
ATOM   5068  C C     . ASP G 3  94  ? 127.379 114.335 113.879 1.00 99.43  ? 91  ASP G C     1 
ATOM   5069  O O     . ASP G 3  94  ? 126.250 113.908 114.116 1.00 95.89  ? 91  ASP G O     1 
ATOM   5070  C CB    . ASP G 3  94  ? 128.703 112.646 115.197 1.00 107.88 ? 91  ASP G CB    1 
ATOM   5071  C CG    . ASP G 3  94  ? 128.992 111.789 113.980 1.00 109.09 ? 91  ASP G CG    1 
ATOM   5072  O OD1   . ASP G 3  94  ? 128.132 111.684 113.132 1.00 102.55 ? 91  ASP G OD1   1 
ATOM   5073  O OD2   . ASP G 3  94  ? 130.093 111.300 113.870 1.00 109.52 ? 91  ASP G OD2   1 
ATOM   5074  N N     . GLU G 3  95  ? 127.673 115.001 112.771 1.00 100.00 ? 92  GLU G N     1 
ATOM   5075  C CA    . GLU G 3  95  ? 126.640 115.367 111.810 1.00 99.33  ? 92  GLU G CA    1 
ATOM   5076  C C     . GLU G 3  95  ? 125.813 114.180 111.338 1.00 96.81  ? 92  GLU G C     1 
ATOM   5077  O O     . GLU G 3  95  ? 124.618 114.315 111.078 1.00 95.15  ? 92  GLU G O     1 
ATOM   5078  C CB    . GLU G 3  95  ? 127.265 116.033 110.591 1.00 103.95 ? 92  GLU G CB    1 
ATOM   5079  C CG    . GLU G 3  95  ? 126.258 116.422 109.523 1.00 114.18 ? 92  GLU G CG    1 
ATOM   5080  C CD    . GLU G 3  95  ? 126.883 117.101 108.350 0.00 122.99 ? 92  GLU G CD    1 
ATOM   5081  O OE1   . GLU G 3  95  ? 128.064 117.343 108.388 0.00 124.35 ? 92  GLU G OE1   1 
ATOM   5082  O OE2   . GLU G 3  95  ? 126.184 117.360 107.397 0.00 124.95 ? 92  GLU G OE2   1 
ATOM   5083  N N     . GLU G 3  96  ? 126.466 113.050 111.111 1.00 97.57  ? 93  GLU G N     1 
ATOM   5084  C CA    . GLU G 3  96  ? 125.773 111.892 110.577 1.00 96.34  ? 93  GLU G CA    1 
ATOM   5085  C C     . GLU G 3  96  ? 124.818 111.294 111.600 1.00 94.33  ? 93  GLU G C     1 
ATOM   5086  O O     . GLU G 3  96  ? 123.658 111.010 111.288 1.00 91.87  ? 93  GLU G O     1 
ATOM   5087  C CB    . GLU G 3  96  ? 126.792 110.866 110.102 1.00 99.86  ? 93  GLU G CB    1 
ATOM   5088  C CG    . GLU G 3  96  ? 127.550 111.310 108.860 1.00 103.42 ? 93  GLU G CG    1 
ATOM   5089  C CD    . GLU G 3  96  ? 128.650 110.383 108.472 0.00 106.82 ? 93  GLU G CD    1 
ATOM   5090  O OE1   . GLU G 3  96  ? 129.279 109.834 109.339 0.00 106.23 ? 93  GLU G OE1   1 
ATOM   5091  O OE2   . GLU G 3  96  ? 128.839 110.188 107.299 0.00 101.46 ? 93  GLU G OE2   1 
ATOM   5092  N N     . LEU G 3  97  ? 125.258 111.224 112.850 1.00 95.07  ? 94  LEU G N     1 
ATOM   5093  C CA    . LEU G 3  97  ? 124.385 110.719 113.900 1.00 94.01  ? 94  LEU G CA    1 
ATOM   5094  C C     . LEU G 3  97  ? 123.285 111.724 114.178 1.00 92.24  ? 94  LEU G C     1 
ATOM   5095  O O     . LEU G 3  97  ? 122.149 111.350 114.475 1.00 91.68  ? 94  LEU G O     1 
ATOM   5096  C CB    . LEU G 3  97  ? 125.161 110.430 115.188 1.00 94.66  ? 94  LEU G CB    1 
ATOM   5097  C CG    . LEU G 3  97  ? 126.158 109.254 115.143 1.00 96.77  ? 94  LEU G CG    1 
ATOM   5098  C CD1   . LEU G 3  97  ? 126.918 109.207 116.458 1.00 98.74  ? 94  LEU G CD1   1 
ATOM   5099  C CD2   . LEU G 3  97  ? 125.413 107.937 114.907 1.00 98.51  ? 94  LEU G CD2   1 
ATOM   5100  N N     . ASN G 3  98  ? 123.571 112.989 113.896 1.00 91.96  ? 95  ASN G N     1 
ATOM   5101  C CA    . ASN G 3  98  ? 122.616 114.060 114.112 1.00 94.11  ? 95  ASN G CA    1 
ATOM   5102  C C     . ASN G 3  98  ? 121.516 114.053 113.068 1.00 93.73  ? 95  ASN G C     1 
ATOM   5103  O O     . ASN G 3  98  ? 120.619 114.895 113.098 1.00 95.10  ? 95  ASN G O     1 
ATOM   5104  C CB    . ASN G 3  98  ? 123.307 115.403 114.114 1.00 96.42  ? 95  ASN G CB    1 
ATOM   5105  C CG    . ASN G 3  98  ? 122.442 116.474 114.672 1.00 100.56 ? 95  ASN G CG    1 
ATOM   5106  O OD1   . ASN G 3  98  ? 121.710 116.241 115.640 1.00 98.60  ? 95  ASN G OD1   1 
ATOM   5107  N ND2   . ASN G 3  98  ? 122.516 117.649 114.100 1.00 99.64  ? 95  ASN G ND2   1 
ATOM   5108  N N     . LYS G 3  99  ? 121.587 113.122 112.131 1.00 91.78  ? 96  LYS G N     1 
ATOM   5109  C CA    . LYS G 3  99  ? 120.506 112.934 111.188 1.00 91.74  ? 96  LYS G CA    1 
ATOM   5110  C C     . LYS G 3  99  ? 119.798 111.637 111.496 1.00 89.45  ? 96  LYS G C     1 
ATOM   5111  O O     . LYS G 3  99  ? 118.586 111.613 111.697 1.00 89.47  ? 96  LYS G O     1 
ATOM   5112  C CB    . LYS G 3  99  ? 121.033 112.911 109.767 1.00 92.31  ? 96  LYS G CB    1 
ATOM   5113  C CG    . LYS G 3  99  ? 121.564 114.231 109.300 1.00 97.93  ? 96  LYS G CG    1 
ATOM   5114  C CD    . LYS G 3  99  ? 122.101 114.147 107.882 1.00 104.39 ? 96  LYS G CD    1 
ATOM   5115  C CE    . LYS G 3  99  ? 122.653 115.496 107.426 1.00 114.81 ? 96  LYS G CE    1 
ATOM   5116  N NZ    . LYS G 3  99  ? 123.291 115.428 106.076 1.00 108.04 ? 96  LYS G NZ    1 
ATOM   5117  N N     . LEU G 3  100 ? 120.581 110.596 111.731 1.00 88.77  ? 97  LEU G N     1 
ATOM   5118  C CA    . LEU G 3  100 ? 120.015 109.288 111.999 1.00 87.72  ? 97  LEU G CA    1 
ATOM   5119  C C     . LEU G 3  100 ? 119.124 109.336 113.225 1.00 89.40  ? 97  LEU G C     1 
ATOM   5120  O O     . LEU G 3  100 ? 118.021 108.783 113.236 1.00 91.73  ? 97  LEU G O     1 
ATOM   5121  C CB    . LEU G 3  100 ? 121.142 108.284 112.242 1.00 90.86  ? 97  LEU G CB    1 
ATOM   5122  C CG    . LEU G 3  100 ? 120.715 106.861 112.584 1.00 95.73  ? 97  LEU G CG    1 
ATOM   5123  C CD1   . LEU G 3  100 ? 119.933 106.275 111.415 1.00 96.05  ? 97  LEU G CD1   1 
ATOM   5124  C CD2   . LEU G 3  100 ? 121.961 106.034 112.909 1.00 98.61  ? 97  LEU G CD2   1 
ATOM   5125  N N     . LEU G 3  101 ? 119.630 109.971 114.272 1.00 88.83  ? 98  LEU G N     1 
ATOM   5126  C CA    . LEU G 3  101 ? 118.909 110.126 115.519 1.00 92.01  ? 98  LEU G CA    1 
ATOM   5127  C C     . LEU G 3  101 ? 118.555 111.585 115.742 1.00 94.76  ? 98  LEU G C     1 
ATOM   5128  O O     . LEU G 3  101 ? 118.339 112.019 116.874 1.00 97.95  ? 98  LEU G O     1 
ATOM   5129  C CB    . LEU G 3  101 ? 119.768 109.623 116.673 1.00 94.94  ? 98  LEU G CB    1 
ATOM   5130  C CG    . LEU G 3  101 ? 120.240 108.173 116.560 0.00 97.93  ? 98  LEU G CG    1 
ATOM   5131  C CD1   . LEU G 3  101 ? 121.132 107.861 117.748 0.00 100.91 ? 98  LEU G CD1   1 
ATOM   5132  C CD2   . LEU G 3  101 ? 119.040 107.224 116.479 0.00 99.39  ? 98  LEU G CD2   1 
ATOM   5133  N N     . GLY G 3  102 ? 118.544 112.356 114.665 1.00 93.07  ? 99  GLY G N     1 
ATOM   5134  C CA    . GLY G 3  102 ? 118.394 113.800 114.758 1.00 96.14  ? 99  GLY G CA    1 
ATOM   5135  C C     . GLY G 3  102 ? 117.092 114.211 115.418 1.00 99.77  ? 99  GLY G C     1 
ATOM   5136  O O     . GLY G 3  102 ? 117.027 115.227 116.111 1.00 100.23 ? 99  GLY G O     1 
ATOM   5137  N N     . ARG G 3  103 ? 116.067 113.398 115.238 1.00 93.70  ? 100 ARG G N     1 
ATOM   5138  C CA    . ARG G 3  103 ? 114.739 113.719 115.714 1.00 94.60  ? 100 ARG G CA    1 
ATOM   5139  C C     . ARG G 3  103 ? 114.380 113.005 116.996 1.00 93.52  ? 100 ARG G C     1 
ATOM   5140  O O     . ARG G 3  103 ? 113.220 113.005 117.406 1.00 93.44  ? 100 ARG G O     1 
ATOM   5141  C CB    . ARG G 3  103 ? 113.755 113.303 114.671 1.00 94.76  ? 100 ARG G CB    1 
ATOM   5142  C CG    . ARG G 3  103 ? 113.974 113.939 113.362 1.00 98.60  ? 100 ARG G CG    1 
ATOM   5143  C CD    . ARG G 3  103 ? 113.081 113.373 112.377 1.00 108.76 ? 100 ARG G CD    1 
ATOM   5144  N NE    . ARG G 3  103 ? 111.716 113.576 112.753 1.00 113.15 ? 100 ARG G NE    1 
ATOM   5145  C CZ    . ARG G 3  103 ? 111.016 114.688 112.526 1.00 118.37 ? 100 ARG G CZ    1 
ATOM   5146  N NH1   . ARG G 3  103 ? 111.549 115.706 111.885 1.00 117.87 ? 100 ARG G NH1   1 
ATOM   5147  N NH2   . ARG G 3  103 ? 109.785 114.746 112.968 1.00 114.84 ? 100 ARG G NH2   1 
ATOM   5148  N N     . VAL G 3  104 ? 115.345 112.330 117.583 1.00 91.07  ? 101 VAL G N     1 
ATOM   5149  C CA    . VAL G 3  104 ? 115.079 111.540 118.765 1.00 91.65  ? 101 VAL G CA    1 
ATOM   5150  C C     . VAL G 3  104 ? 115.131 112.373 120.027 1.00 90.09  ? 101 VAL G C     1 
ATOM   5151  O O     . VAL G 3  104 ? 116.058 113.156 120.228 1.00 92.26  ? 101 VAL G O     1 
ATOM   5152  C CB    . VAL G 3  104 ? 116.093 110.401 118.859 1.00 97.33  ? 101 VAL G CB    1 
ATOM   5153  C CG1   . VAL G 3  104 ? 115.911 109.639 120.144 1.00 97.25  ? 101 VAL G CG1   1 
ATOM   5154  C CG2   . VAL G 3  104 ? 115.927 109.488 117.666 1.00 97.53  ? 101 VAL G CG2   1 
ATOM   5155  N N     . THR G 3  105 ? 114.133 112.201 120.882 1.00 88.03  ? 102 THR G N     1 
ATOM   5156  C CA    . THR G 3  105 ? 114.130 112.867 122.166 1.00 87.69  ? 102 THR G CA    1 
ATOM   5157  C C     . THR G 3  105 ? 114.817 111.982 123.188 1.00 89.45  ? 102 THR G C     1 
ATOM   5158  O O     . THR G 3  105 ? 114.492 110.802 123.332 1.00 87.38  ? 102 THR G O     1 
ATOM   5159  C CB    . THR G 3  105 ? 112.696 113.193 122.617 1.00 90.00  ? 102 THR G CB    1 
ATOM   5160  O OG1   . THR G 3  105 ? 112.096 114.082 121.672 1.00 89.26  ? 102 THR G OG1   1 
ATOM   5161  C CG2   . THR G 3  105 ? 112.688 113.840 123.999 1.00 93.87  ? 102 THR G CG2   1 
ATOM   5162  N N     . ILE G 3  106 ? 115.787 112.548 123.878 1.00 83.73  ? 103 ILE G N     1 
ATOM   5163  C CA    . ILE G 3  106 ? 116.524 111.818 124.887 1.00 84.43  ? 103 ILE G CA    1 
ATOM   5164  C C     . ILE G 3  106 ? 116.056 112.246 126.255 1.00 86.16  ? 103 ILE G C     1 
ATOM   5165  O O     . ILE G 3  106 ? 116.029 113.439 126.563 1.00 89.26  ? 103 ILE G O     1 
ATOM   5166  C CB    . ILE G 3  106 ? 118.029 112.082 124.740 1.00 89.57  ? 103 ILE G CB    1 
ATOM   5167  C CG1   . ILE G 3  106 ? 118.515 111.695 123.326 1.00 88.56  ? 103 ILE G CG1   1 
ATOM   5168  C CG2   . ILE G 3  106 ? 118.819 111.368 125.827 1.00 96.06  ? 103 ILE G CG2   1 
ATOM   5169  C CD1   . ILE G 3  106 ? 118.320 110.244 122.953 1.00 92.05  ? 103 ILE G CD1   1 
ATOM   5170  N N     . ALA G 3  107 ? 115.657 111.284 127.071 1.00 87.56  ? 104 ALA G N     1 
ATOM   5171  C CA    . ALA G 3  107 ? 115.196 111.627 128.398 1.00 89.67  ? 104 ALA G CA    1 
ATOM   5172  C C     . ALA G 3  107 ? 116.310 112.352 129.119 1.00 90.34  ? 104 ALA G C     1 
ATOM   5173  O O     . ALA G 3  107 ? 117.414 111.826 129.254 1.00 93.89  ? 104 ALA G O     1 
ATOM   5174  C CB    . ALA G 3  107 ? 114.794 110.377 129.159 1.00 96.11  ? 104 ALA G CB    1 
ATOM   5175  N N     . GLN G 3  108 ? 116.018 113.551 129.597 1.00 90.83  ? 105 GLN G N     1 
ATOM   5176  C CA    . GLN G 3  108 ? 117.016 114.360 130.278 1.00 95.71  ? 105 GLN G CA    1 
ATOM   5177  C C     . GLN G 3  108 ? 118.270 114.547 129.429 1.00 96.20  ? 105 GLN G C     1 
ATOM   5178  O O     . GLN G 3  108 ? 119.385 114.546 129.951 1.00 97.29  ? 105 GLN G O     1 
ATOM   5179  C CB    . GLN G 3  108 ? 117.391 113.740 131.627 1.00 98.70  ? 105 GLN G CB    1 
ATOM   5180  C CG    . GLN G 3  108 ? 116.270 113.739 132.632 1.00 98.92  ? 105 GLN G CG    1 
ATOM   5181  C CD    . GLN G 3  108 ? 115.313 112.598 132.428 1.00 100.80 ? 105 GLN G CD    1 
ATOM   5182  O OE1   . GLN G 3  108 ? 115.709 111.430 132.420 1.00 101.77 ? 105 GLN G OE1   1 
ATOM   5183  N NE2   . GLN G 3  108 ? 114.042 112.924 132.250 1.00 100.86 ? 105 GLN G NE2   1 
ATOM   5184  N N     . GLY G 3  109 ? 118.093 114.713 128.120 1.00 93.20  ? 106 GLY G N     1 
ATOM   5185  C CA    . GLY G 3  109 ? 119.226 114.945 127.237 1.00 95.37  ? 106 GLY G CA    1 
ATOM   5186  C C     . GLY G 3  109 ? 119.693 116.395 127.277 1.00 98.21  ? 106 GLY G C     1 
ATOM   5187  O O     . GLY G 3  109 ? 120.855 116.687 126.993 1.00 97.61  ? 106 GLY G O     1 
ATOM   5188  N N     . GLY G 3  110 ? 118.775 117.307 127.594 1.00 96.19  ? 107 GLY G N     1 
ATOM   5189  C CA    . GLY G 3  110 ? 119.068 118.738 127.580 1.00 97.77  ? 107 GLY G CA    1 
ATOM   5190  C C     . GLY G 3  110 ? 119.244 119.209 126.143 1.00 96.16  ? 107 GLY G C     1 
ATOM   5191  O O     . GLY G 3  110 ? 118.885 118.497 125.206 1.00 95.13  ? 107 GLY G O     1 
ATOM   5192  N N     . VAL G 3  111 ? 119.782 120.414 125.964 1.00 96.27  ? 108 VAL G N     1 
ATOM   5193  C CA    . VAL G 3  111 ? 120.024 120.940 124.624 1.00 95.17  ? 108 VAL G CA    1 
ATOM   5194  C C     . VAL G 3  111 ? 121.432 121.508 124.523 1.00 99.75  ? 108 VAL G C     1 
ATOM   5195  O O     . VAL G 3  111 ? 122.169 121.528 125.509 1.00 101.00 ? 108 VAL G O     1 
ATOM   5196  C CB    . VAL G 3  111 ? 118.984 122.005 124.244 1.00 96.34  ? 108 VAL G CB    1 
ATOM   5197  C CG1   . VAL G 3  111 ? 117.591 121.409 124.259 1.00 94.61  ? 108 VAL G CG1   1 
ATOM   5198  C CG2   . VAL G 3  111 ? 119.068 123.158 125.190 1.00 102.48 ? 108 VAL G CG2   1 
ATOM   5199  N N     . LEU G 3  112 ? 121.846 121.868 123.317 1.00 99.37  ? 109 LEU G N     1 
ATOM   5200  C CA    . LEU G 3  112 ? 123.145 122.499 123.152 1.00 102.90 ? 109 LEU G CA    1 
ATOM   5201  C C     . LEU G 3  112 ? 123.087 123.933 123.663 1.00 108.30 ? 109 LEU G C     1 
ATOM   5202  O O     . LEU G 3  112 ? 122.101 124.631 123.422 1.00 109.27 ? 109 LEU G O     1 
ATOM   5203  C CB    . LEU G 3  112 ? 123.538 122.516 121.674 1.00 106.95 ? 109 LEU G CB    1 
ATOM   5204  C CG    . LEU G 3  112 ? 123.735 121.161 121.005 1.00 109.50 ? 109 LEU G CG    1 
ATOM   5205  C CD1   . LEU G 3  112 ? 123.976 121.389 119.528 1.00 113.51 ? 109 LEU G CD1   1 
ATOM   5206  C CD2   . LEU G 3  112 ? 124.913 120.431 121.635 1.00 109.53 ? 109 LEU G CD2   1 
ATOM   5207  N N     . PRO G 3  113 ? 124.183 124.440 124.231 1.00 108.29 ? 110 PRO G N     1 
ATOM   5208  C CA    . PRO G 3  113 ? 124.341 125.781 124.763 1.00 111.58 ? 110 PRO G CA    1 
ATOM   5209  C C     . PRO G 3  113 ? 124.567 126.805 123.660 1.00 114.06 ? 110 PRO G C     1 
ATOM   5210  O O     . PRO G 3  113 ? 125.618 127.445 123.604 1.00 113.59 ? 110 PRO G O     1 
ATOM   5211  C CB    . PRO G 3  113 ? 125.580 125.617 125.645 1.00 110.37 ? 110 PRO G CB    1 
ATOM   5212  C CG    . PRO G 3  113 ? 126.393 124.557 124.941 1.00 108.33 ? 110 PRO G CG    1 
ATOM   5213  C CD    . PRO G 3  113 ? 125.363 123.583 124.401 1.00 104.66 ? 110 PRO G CD    1 
ATOM   5214  N N     . ASN G 3  114 ? 123.589 126.938 122.775 1.00 115.22 ? 111 ASN G N     1 
ATOM   5215  C CA    . ASN G 3  114 ? 123.709 127.839 121.639 1.00 118.70 ? 111 ASN G CA    1 
ATOM   5216  C C     . ASN G 3  114 ? 122.991 129.166 121.848 1.00 120.30 ? 111 ASN G C     1 
ATOM   5217  O O     . ASN G 3  114 ? 121.775 129.206 122.050 1.00 119.54 ? 111 ASN G O     1 
ATOM   5218  C CB    . ASN G 3  114 ? 123.197 127.175 120.379 1.00 120.08 ? 111 ASN G CB    1 
ATOM   5219  C CG    . ASN G 3  114 ? 124.016 125.990 119.974 1.00 125.25 ? 111 ASN G CG    1 
ATOM   5220  O OD1   . ASN G 3  114 ? 125.233 125.945 120.186 1.00 121.88 ? 111 ASN G OD1   1 
ATOM   5221  N ND2   . ASN G 3  114 ? 123.375 125.035 119.354 1.00 123.94 ? 111 ASN G ND2   1 
ATOM   5222  N N     . ILE G 3  115 ? 123.753 130.252 121.805 1.00 122.76 ? 112 ILE G N     1 
ATOM   5223  C CA    . ILE G 3  115 ? 123.188 131.591 121.888 1.00 127.31 ? 112 ILE G CA    1 
ATOM   5224  C C     . ILE G 3  115 ? 123.655 132.406 120.693 1.00 129.96 ? 112 ILE G C     1 
ATOM   5225  O O     . ILE G 3  115 ? 124.854 132.519 120.442 1.00 132.29 ? 112 ILE G O     1 
ATOM   5226  C CB    . ILE G 3  115 ? 123.579 132.300 123.201 1.00 127.55 ? 112 ILE G CB    1 
ATOM   5227  C CG1   . ILE G 3  115 ? 123.096 131.460 124.400 1.00 124.37 ? 112 ILE G CG1   1 
ATOM   5228  C CG2   . ILE G 3  115 ? 122.972 133.709 123.235 1.00 125.76 ? 112 ILE G CG2   1 
ATOM   5229  C CD1   . ILE G 3  115 ? 123.491 131.997 125.768 1.00 124.69 ? 112 ILE G CD1   1 
ATOM   5230  N N     . GLN G 3  116 ? 122.710 132.965 119.954 1.00 130.04 ? 113 GLN G N     1 
ATOM   5231  C CA    . GLN G 3  116 ? 123.029 133.730 118.760 1.00 132.75 ? 113 GLN G CA    1 
ATOM   5232  C C     . GLN G 3  116 ? 123.739 135.033 119.103 1.00 133.12 ? 113 GLN G C     1 
ATOM   5233  O O     . GLN G 3  116 ? 123.423 135.683 120.097 1.00 136.59 ? 113 GLN G O     1 
ATOM   5234  C CB    . GLN G 3  116 ? 121.762 134.008 117.950 1.00 132.57 ? 113 GLN G CB    1 
ATOM   5235  C CG    . GLN G 3  116 ? 121.121 132.765 117.352 1.00 129.15 ? 113 GLN G CG    1 
ATOM   5236  C CD    . GLN G 3  116 ? 120.183 132.069 118.319 0.00 129.25 ? 113 GLN G CD    1 
ATOM   5237  O OE1   . GLN G 3  116 ? 120.290 132.234 119.538 0.00 126.93 ? 113 GLN G OE1   1 
ATOM   5238  N NE2   . GLN G 3  116 ? 119.260 131.283 117.782 0.00 122.21 ? 113 GLN G NE2   1 
ATOM   5239  N N     . ALA G 3  117 ? 124.641 135.455 118.223 1.00 137.39 ? 114 ALA G N     1 
ATOM   5240  C CA    . ALA G 3  117 ? 125.433 136.663 118.435 1.00 139.02 ? 114 ALA G CA    1 
ATOM   5241  C C     . ALA G 3  117 ? 124.574 137.905 118.620 1.00 136.93 ? 114 ALA G C     1 
ATOM   5242  O O     . ALA G 3  117 ? 124.948 138.822 119.348 1.00 137.20 ? 114 ALA G O     1 
ATOM   5243  C CB    . ALA G 3  117 ? 126.380 136.873 117.268 1.00 144.06 ? 114 ALA G CB    1 
ATOM   5244  N N     . VAL G 3  118 ? 123.422 137.937 117.965 1.00 136.82 ? 115 VAL G N     1 
ATOM   5245  C CA    . VAL G 3  118 ? 122.547 139.104 118.009 1.00 136.64 ? 115 VAL G CA    1 
ATOM   5246  C C     . VAL G 3  118 ? 121.920 139.293 119.385 1.00 133.76 ? 115 VAL G C     1 
ATOM   5247  O O     . VAL G 3  118 ? 121.289 140.314 119.655 1.00 130.67 ? 115 VAL G O     1 
ATOM   5248  C CB    . VAL G 3  118 ? 121.428 138.973 116.959 1.00 137.47 ? 115 VAL G CB    1 
ATOM   5249  C CG1   . VAL G 3  118 ? 122.025 138.848 115.566 1.00 136.92 ? 115 VAL G CG1   1 
ATOM   5250  C CG2   . VAL G 3  118 ? 120.547 137.772 117.281 1.00 130.22 ? 115 VAL G CG2   1 
ATOM   5251  N N     . LEU G 3  119 ? 122.023 138.270 120.221 1.00 133.05 ? 116 LEU G N     1 
ATOM   5252  C CA    . LEU G 3  119 ? 121.447 138.294 121.551 1.00 128.98 ? 116 LEU G CA    1 
ATOM   5253  C C     . LEU G 3  119 ? 122.462 138.768 122.582 1.00 130.56 ? 116 LEU G C     1 
ATOM   5254  O O     . LEU G 3  119 ? 122.120 139.023 123.741 1.00 128.58 ? 116 LEU G O     1 
ATOM   5255  C CB    . LEU G 3  119 ? 120.965 136.883 121.896 1.00 126.87 ? 116 LEU G CB    1 
ATOM   5256  C CG    . LEU G 3  119 ? 119.896 136.294 120.954 1.00 125.57 ? 116 LEU G CG    1 
ATOM   5257  C CD1   . LEU G 3  119 ? 119.598 134.870 121.376 1.00 121.10 ? 116 LEU G CD1   1 
ATOM   5258  C CD2   . LEU G 3  119 ? 118.623 137.153 120.968 1.00 119.18 ? 116 LEU G CD2   1 
ATOM   5259  N N     . LEU G 3  120 ? 123.708 138.917 122.150 1.00 133.98 ? 117 LEU G N     1 
ATOM   5260  C CA    . LEU G 3  120 ? 124.796 139.254 123.050 1.00 137.65 ? 117 LEU G CA    1 
ATOM   5261  C C     . LEU G 3  120 ? 125.142 140.738 122.954 1.00 142.06 ? 117 LEU G C     1 
ATOM   5262  O O     . LEU G 3  120 ? 124.830 141.387 121.956 1.00 140.12 ? 117 LEU G O     1 
ATOM   5263  C CB    . LEU G 3  120 ? 126.025 138.412 122.689 1.00 138.45 ? 117 LEU G CB    1 
ATOM   5264  C CG    . LEU G 3  120 ? 125.817 136.889 122.687 1.00 135.88 ? 117 LEU G CG    1 
ATOM   5265  C CD1   . LEU G 3  120 ? 127.086 136.218 122.209 1.00 136.19 ? 117 LEU G CD1   1 
ATOM   5266  C CD2   . LEU G 3  120 ? 125.445 136.409 124.081 1.00 136.13 ? 117 LEU G CD2   1 
ATOM   5267  N N     . PRO G 3  121 ? 125.746 141.307 124.001 1.00 145.71 ? 118 PRO G N     1 
ATOM   5268  C CA    . PRO G 3  121 ? 126.327 142.636 124.043 1.00 153.61 ? 118 PRO G CA    1 
ATOM   5269  C C     . PRO G 3  121 ? 127.261 142.863 122.860 1.00 149.20 ? 118 PRO G C     1 
ATOM   5270  O O     . PRO G 3  121 ? 128.152 142.054 122.605 1.00 145.62 ? 118 PRO G O     1 
ATOM   5271  C CB    . PRO G 3  121 ? 127.080 142.603 125.376 1.00 152.43 ? 118 PRO G CB    1 
ATOM   5272  C CG    . PRO G 3  121 ? 126.256 141.675 126.235 1.00 149.13 ? 118 PRO G CG    1 
ATOM   5273  C CD    . PRO G 3  121 ? 125.776 140.599 125.289 1.00 144.93 ? 118 PRO G CD    1 
ATOM   5274  N N     . ARG H 4  37  ? 109.865 89.727  131.053 1.00 178.83 ? 34  ARG H N     1 
ATOM   5275  C CA    . ARG H 4  37  ? 110.461 90.950  130.533 1.00 178.97 ? 34  ARG H CA    1 
ATOM   5276  C C     . ARG H 4  37  ? 110.624 90.886  129.022 1.00 176.39 ? 34  ARG H C     1 
ATOM   5277  O O     . ARG H 4  37  ? 110.070 90.005  128.363 1.00 174.28 ? 34  ARG H O     1 
ATOM   5278  C CB    . ARG H 4  37  ? 111.819 91.196  131.177 0.00 183.22 ? 34  ARG H CB    1 
ATOM   5279  C CG    . ARG H 4  37  ? 111.777 91.467  132.664 0.00 190.43 ? 34  ARG H CG    1 
ATOM   5280  C CD    . ARG H 4  37  ? 113.125 91.773  133.200 0.00 192.66 ? 34  ARG H CD    1 
ATOM   5281  N NE    . ARG H 4  37  ? 113.079 92.143  134.607 0.00 199.23 ? 34  ARG H NE    1 
ATOM   5282  C CZ    . ARG H 4  37  ? 113.100 91.273  135.638 0.00 198.14 ? 34  ARG H CZ    1 
ATOM   5283  N NH1   . ARG H 4  37  ? 113.159 89.978  135.413 0.00 198.48 ? 34  ARG H NH1   1 
ATOM   5284  N NH2   . ARG H 4  37  ? 113.056 91.724  136.880 0.00 199.22 ? 34  ARG H NH2   1 
ATOM   5285  N N     . LYS H 4  38  ? 111.391 91.824  128.480 1.00 171.89 ? 35  LYS H N     1 
ATOM   5286  C CA    . LYS H 4  38  ? 111.664 91.883  127.052 1.00 167.87 ? 35  LYS H CA    1 
ATOM   5287  C C     . LYS H 4  38  ? 113.155 91.738  126.803 1.00 162.40 ? 35  LYS H C     1 
ATOM   5288  O O     . LYS H 4  38  ? 113.968 92.016  127.686 1.00 155.76 ? 35  LYS H O     1 
ATOM   5289  C CB    . LYS H 4  38  ? 111.157 93.204  126.466 1.00 162.71 ? 35  LYS H CB    1 
ATOM   5290  C CG    . LYS H 4  38  ? 111.328 93.343  124.951 0.00 157.56 ? 35  LYS H CG    1 
ATOM   5291  C CD    . LYS H 4  38  ? 110.754 94.666  124.440 0.00 152.19 ? 35  LYS H CD    1 
ATOM   5292  C CE    . LYS H 4  38  ? 110.940 94.826  122.937 0.00 139.50 ? 35  LYS H CE    1 
ATOM   5293  N NZ    . LYS H 4  38  ? 110.383 96.111  122.435 0.00 133.43 ? 35  LYS H NZ    1 
ATOM   5294  N N     . GLU H 4  39  ? 113.515 91.298  125.605 1.00 156.93 ? 36  GLU H N     1 
ATOM   5295  C CA    . GLU H 4  39  ? 114.915 91.204  125.231 1.00 147.69 ? 36  GLU H CA    1 
ATOM   5296  C C     . GLU H 4  39  ? 115.550 92.582  125.202 1.00 138.45 ? 36  GLU H C     1 
ATOM   5297  O O     . GLU H 4  39  ? 114.952 93.540  124.713 1.00 135.93 ? 36  GLU H O     1 
ATOM   5298  C CB    . GLU H 4  39  ? 115.055 90.540  123.860 1.00 146.30 ? 36  GLU H CB    1 
ATOM   5299  C CG    . GLU H 4  39  ? 114.584 89.099  123.819 0.00 147.93 ? 36  GLU H CG    1 
ATOM   5300  C CD    . GLU H 4  39  ? 113.105 88.980  123.600 0.00 158.98 ? 36  GLU H CD    1 
ATOM   5301  O OE1   . GLU H 4  39  ? 112.448 89.995  123.546 0.00 155.42 ? 36  GLU H OE1   1 
ATOM   5302  O OE2   . GLU H 4  39  ? 112.626 87.874  123.510 0.00 153.47 ? 36  GLU H OE2   1 
ATOM   5303  N N     . SER H 4  40  ? 116.789 92.662  125.662 1.00 127.24 ? 37  SER H N     1 
ATOM   5304  C CA    . SER H 4  40  ? 117.531 93.910  125.629 1.00 116.76 ? 37  SER H CA    1 
ATOM   5305  C C     . SER H 4  40  ? 118.959 93.617  125.241 1.00 108.79 ? 37  SER H C     1 
ATOM   5306  O O     . SER H 4  40  ? 119.344 92.458  125.068 1.00 112.04 ? 37  SER H O     1 
ATOM   5307  C CB    . SER H 4  40  ? 117.523 94.585  126.981 1.00 114.77 ? 37  SER H CB    1 
ATOM   5308  O OG    . SER H 4  40  ? 118.398 93.940  127.861 1.00 111.81 ? 37  SER H OG    1 
ATOM   5309  N N     . TYR H 4  41  ? 119.740 94.663  125.063 1.00 104.44 ? 38  TYR H N     1 
ATOM   5310  C CA    . TYR H 4  41  ? 121.113 94.491  124.646 1.00 104.58 ? 38  TYR H CA    1 
ATOM   5311  C C     . TYR H 4  41  ? 122.042 95.068  125.683 1.00 103.20 ? 38  TYR H C     1 
ATOM   5312  O O     . TYR H 4  41  ? 123.188 95.400  125.388 1.00 102.05 ? 38  TYR H O     1 
ATOM   5313  C CB    . TYR H 4  41  ? 121.311 95.160  123.294 1.00 104.75 ? 38  TYR H CB    1 
ATOM   5314  C CG    . TYR H 4  41  ? 120.321 94.674  122.293 1.00 101.76 ? 38  TYR H CG    1 
ATOM   5315  C CD1   . TYR H 4  41  ? 119.126 95.345  122.155 1.00 102.75 ? 38  TYR H CD1   1 
ATOM   5316  C CD2   . TYR H 4  41  ? 120.576 93.542  121.544 1.00 103.93 ? 38  TYR H CD2   1 
ATOM   5317  C CE1   . TYR H 4  41  ? 118.186 94.890  121.276 1.00 100.68 ? 38  TYR H CE1   1 
ATOM   5318  C CE2   . TYR H 4  41  ? 119.630 93.088  120.655 1.00 103.51 ? 38  TYR H CE2   1 
ATOM   5319  C CZ    . TYR H 4  41  ? 118.437 93.761  120.525 1.00 100.63 ? 38  TYR H CZ    1 
ATOM   5320  O OH    . TYR H 4  41  ? 117.485 93.308  119.653 1.00 103.16 ? 38  TYR H OH    1 
ATOM   5321  N N     . SER H 4  42  ? 121.568 95.146  126.917 1.00 101.99 ? 39  SER H N     1 
ATOM   5322  C CA    . SER H 4  42  ? 122.326 95.828  127.950 1.00 103.27 ? 39  SER H CA    1 
ATOM   5323  C C     . SER H 4  42  ? 123.689 95.200  128.177 1.00 104.66 ? 39  SER H C     1 
ATOM   5324  O O     . SER H 4  42  ? 124.673 95.904  128.407 1.00 107.64 ? 39  SER H O     1 
ATOM   5325  C CB    . SER H 4  42  ? 121.550 95.805  129.245 1.00 108.87 ? 39  SER H CB    1 
ATOM   5326  O OG    . SER H 4  42  ? 121.437 94.495  129.730 1.00 110.44 ? 39  SER H OG    1 
ATOM   5327  N N     . ILE H 4  43  ? 123.781 93.893  128.001 1.00 102.65 ? 40  ILE H N     1 
ATOM   5328  C CA    . ILE H 4  43  ? 125.056 93.227  128.186 1.00 106.49 ? 40  ILE H CA    1 
ATOM   5329  C C     . ILE H 4  43  ? 126.003 93.548  127.042 1.00 106.28 ? 40  ILE H C     1 
ATOM   5330  O O     . ILE H 4  43  ? 127.212 93.674  127.240 1.00 109.88 ? 40  ILE H O     1 
ATOM   5331  C CB    . ILE H 4  43  ? 124.874 91.704  128.354 1.00 110.67 ? 40  ILE H CB    1 
ATOM   5332  C CG1   . ILE H 4  43  ? 126.184 91.032  128.821 1.00 119.05 ? 40  ILE H CG1   1 
ATOM   5333  C CG2   . ILE H 4  43  ? 124.386 91.067  127.072 1.00 107.06 ? 40  ILE H CG2   1 
ATOM   5334  C CD1   . ILE H 4  43  ? 126.655 91.438  130.209 1.00 123.21 ? 40  ILE H CD1   1 
ATOM   5335  N N     . TYR H 4  44  ? 125.454 93.679  125.843 1.00 104.36 ? 41  TYR H N     1 
ATOM   5336  C CA    . TYR H 4  44  ? 126.269 93.907  124.667 1.00 105.36 ? 41  TYR H CA    1 
ATOM   5337  C C     . TYR H 4  44  ? 126.699 95.357  124.589 1.00 102.91 ? 41  TYR H C     1 
ATOM   5338  O O     . TYR H 4  44  ? 127.836 95.656  124.230 1.00 103.10 ? 41  TYR H O     1 
ATOM   5339  C CB    . TYR H 4  44  ? 125.494 93.499  123.421 1.00 105.73 ? 41  TYR H CB    1 
ATOM   5340  C CG    . TYR H 4  44  ? 125.090 92.067  123.478 1.00 106.68 ? 41  TYR H CG    1 
ATOM   5341  C CD1   . TYR H 4  44  ? 123.781 91.739  123.752 1.00 109.28 ? 41  TYR H CD1   1 
ATOM   5342  C CD2   . TYR H 4  44  ? 126.038 91.078  123.348 1.00 111.63 ? 41  TYR H CD2   1 
ATOM   5343  C CE1   . TYR H 4  44  ? 123.416 90.423  123.913 1.00 109.56 ? 41  TYR H CE1   1 
ATOM   5344  C CE2   . TYR H 4  44  ? 125.678 89.759  123.504 1.00 114.22 ? 41  TYR H CE2   1 
ATOM   5345  C CZ    . TYR H 4  44  ? 124.375 89.431  123.800 1.00 111.55 ? 41  TYR H CZ    1 
ATOM   5346  O OH    . TYR H 4  44  ? 124.024 88.115  123.996 1.00 112.73 ? 41  TYR H OH    1 
ATOM   5347  N N     . VAL H 4  45  ? 125.810 96.254  124.986 1.00 101.19 ? 42  VAL H N     1 
ATOM   5348  C CA    . VAL H 4  45  ? 126.124 97.668  124.975 1.00 102.63 ? 42  VAL H CA    1 
ATOM   5349  C C     . VAL H 4  45  ? 127.240 97.938  125.960 1.00 104.79 ? 42  VAL H C     1 
ATOM   5350  O O     . VAL H 4  45  ? 128.185 98.670  125.662 1.00 103.27 ? 42  VAL H O     1 
ATOM   5351  C CB    . VAL H 4  45  ? 124.878 98.501  125.330 1.00 102.54 ? 42  VAL H CB    1 
ATOM   5352  C CG1   . VAL H 4  45  ? 125.250 99.959  125.571 1.00 102.89 ? 42  VAL H CG1   1 
ATOM   5353  C CG2   . VAL H 4  45  ? 123.871 98.413  124.193 1.00 105.08 ? 42  VAL H CG2   1 
ATOM   5354  N N     . TYR H 4  46  ? 127.135 97.328  127.131 1.00 108.57 ? 43  TYR H N     1 
ATOM   5355  C CA    . TYR H 4  46  ? 128.135 97.486  128.164 1.00 115.57 ? 43  TYR H CA    1 
ATOM   5356  C C     . TYR H 4  46  ? 129.504 97.070  127.648 1.00 112.86 ? 43  TYR H C     1 
ATOM   5357  O O     . TYR H 4  46  ? 130.487 97.795  127.814 1.00 115.08 ? 43  TYR H O     1 
ATOM   5358  C CB    . TYR H 4  46  ? 127.744 96.660  129.386 1.00 126.51 ? 43  TYR H CB    1 
ATOM   5359  C CG    . TYR H 4  46  ? 128.712 96.758  130.514 1.00 146.54 ? 43  TYR H CG    1 
ATOM   5360  C CD1   . TYR H 4  46  ? 128.647 97.833  131.380 1.00 153.68 ? 43  TYR H CD1   1 
ATOM   5361  C CD2   . TYR H 4  46  ? 129.672 95.779  130.688 1.00 166.27 ? 43  TYR H CD2   1 
ATOM   5362  C CE1   . TYR H 4  46  ? 129.544 97.932  132.418 1.00 184.39 ? 43  TYR H CE1   1 
ATOM   5363  C CE2   . TYR H 4  46  ? 130.571 95.877  131.725 1.00 192.78 ? 43  TYR H CE2   1 
ATOM   5364  C CZ    . TYR H 4  46  ? 130.511 96.950  132.587 1.00 219.21 ? 43  TYR H CZ    1 
ATOM   5365  O OH    . TYR H 4  46  ? 131.412 97.053  133.617 1.00 257.67 ? 43  TYR H OH    1 
ATOM   5366  N N     . LYS H 4  47  ? 129.560 95.893  127.012 1.00 110.11 ? 44  LYS H N     1 
ATOM   5367  C CA    . LYS H 4  47  ? 130.816 95.353  126.502 1.00 110.70 ? 44  LYS H CA    1 
ATOM   5368  C C     . LYS H 4  47  ? 131.386 96.228  125.393 1.00 105.70 ? 44  LYS H C     1 
ATOM   5369  O O     . LYS H 4  47  ? 132.594 96.469  125.341 1.00 106.46 ? 44  LYS H O     1 
ATOM   5370  C CB    . LYS H 4  47  ? 130.619 93.940  125.943 1.00 108.47 ? 44  LYS H CB    1 
ATOM   5371  C CG    . LYS H 4  47  ? 130.220 92.868  126.950 1.00 116.52 ? 44  LYS H CG    1 
ATOM   5372  C CD    . LYS H 4  47  ? 131.379 92.422  127.826 1.00 129.19 ? 44  LYS H CD    1 
ATOM   5373  C CE    . LYS H 4  47  ? 131.020 91.150  128.575 1.00 133.04 ? 44  LYS H CE    1 
ATOM   5374  N NZ    . LYS H 4  47  ? 131.993 90.840  129.657 1.00 136.25 ? 44  LYS H NZ    1 
ATOM   5375  N N     . VAL H 4  48  ? 130.538 96.694  124.490 1.00 101.60 ? 45  VAL H N     1 
ATOM   5376  C CA    . VAL H 4  48  ? 131.023 97.512  123.395 1.00 103.95 ? 45  VAL H CA    1 
ATOM   5377  C C     . VAL H 4  48  ? 131.651 98.783  123.928 1.00 103.50 ? 45  VAL H C     1 
ATOM   5378  O O     . VAL H 4  48  ? 132.689 99.220  123.432 1.00 103.09 ? 45  VAL H O     1 
ATOM   5379  C CB    . VAL H 4  48  ? 129.895 97.841  122.404 1.00 104.14 ? 45  VAL H CB    1 
ATOM   5380  C CG1   . VAL H 4  48  ? 130.346 98.898  121.414 1.00 102.98 ? 45  VAL H CG1   1 
ATOM   5381  C CG2   . VAL H 4  48  ? 129.515 96.586  121.643 1.00 106.14 ? 45  VAL H CG2   1 
ATOM   5382  N N     . LEU H 4  49  ? 131.025 99.389  124.932 1.00 103.40 ? 46  LEU H N     1 
ATOM   5383  C CA    . LEU H 4  49  ? 131.581 100.596 125.520 1.00 103.77 ? 46  LEU H CA    1 
ATOM   5384  C C     . LEU H 4  49  ? 132.969 100.335 126.055 1.00 102.67 ? 46  LEU H C     1 
ATOM   5385  O O     . LEU H 4  49  ? 133.892 101.109 125.806 1.00 102.08 ? 46  LEU H O     1 
ATOM   5386  C CB    . LEU H 4  49  ? 130.699 101.110 126.665 1.00 102.27 ? 46  LEU H CB    1 
ATOM   5387  C CG    . LEU H 4  49  ? 131.272 102.298 127.473 1.00 106.78 ? 46  LEU H CG    1 
ATOM   5388  C CD1   . LEU H 4  49  ? 131.518 103.496 126.559 1.00 110.21 ? 46  LEU H CD1   1 
ATOM   5389  C CD2   . LEU H 4  49  ? 130.296 102.661 128.576 1.00 110.72 ? 46  LEU H CD2   1 
ATOM   5390  N N     . LYS H 4  50  ? 133.154 99.225  126.770 1.00 102.86 ? 47  LYS H N     1 
ATOM   5391  C CA    . LYS H 4  50  ? 134.459 99.032  127.389 1.00 104.06 ? 47  LYS H CA    1 
ATOM   5392  C C     . LYS H 4  50  ? 135.525 98.709  126.349 1.00 103.42 ? 47  LYS H C     1 
ATOM   5393  O O     . LYS H 4  50  ? 136.713 98.869  126.620 1.00 103.19 ? 47  LYS H O     1 
ATOM   5394  C CB    . LYS H 4  50  ? 134.449 97.977  128.496 1.00 108.82 ? 47  LYS H CB    1 
ATOM   5395  C CG    . LYS H 4  50  ? 134.485 96.522  128.046 1.00 113.41 ? 47  LYS H CG    1 
ATOM   5396  C CD    . LYS H 4  50  ? 134.566 95.595  129.252 1.00 125.89 ? 47  LYS H CD    1 
ATOM   5397  C CE    . LYS H 4  50  ? 134.752 94.128  128.841 1.00 137.04 ? 47  LYS H CE    1 
ATOM   5398  N NZ    . LYS H 4  50  ? 134.848 93.236  130.032 1.00 135.15 ? 47  LYS H NZ    1 
ATOM   5399  N N     . GLN H 4  51  ? 135.157 98.272  125.141 1.00 103.35 ? 48  GLN H N     1 
ATOM   5400  C CA    . GLN H 4  51  ? 136.173 98.060  124.124 1.00 103.65 ? 48  GLN H CA    1 
ATOM   5401  C C     . GLN H 4  51  ? 136.701 99.372  123.573 1.00 102.37 ? 48  GLN H C     1 
ATOM   5402  O O     . GLN H 4  51  ? 137.672 99.388  122.814 1.00 103.48 ? 48  GLN H O     1 
ATOM   5403  C CB    . GLN H 4  51  ? 135.627 97.212  122.984 1.00 108.45 ? 48  GLN H CB    1 
ATOM   5404  C CG    . GLN H 4  51  ? 135.341 95.781  123.361 1.00 115.40 ? 48  GLN H CG    1 
ATOM   5405  C CD    . GLN H 4  51  ? 134.790 94.991  122.200 1.00 122.34 ? 48  GLN H CD    1 
ATOM   5406  O OE1   . GLN H 4  51  ? 134.213 95.565  121.274 1.00 119.21 ? 48  GLN H OE1   1 
ATOM   5407  N NE2   . GLN H 4  51  ? 134.975 93.678  122.229 1.00 126.34 ? 48  GLN H NE2   1 
ATOM   5408  N N     . VAL H 4  52  ? 136.020 100.462 123.888 1.00 99.79  ? 49  VAL H N     1 
ATOM   5409  C CA    . VAL H 4  52  ? 136.409 101.768 123.395 1.00 99.53  ? 49  VAL H CA    1 
ATOM   5410  C C     . VAL H 4  52  ? 136.966 102.608 124.534 1.00 99.81  ? 49  VAL H C     1 
ATOM   5411  O O     . VAL H 4  52  ? 138.017 103.235 124.409 1.00 101.58 ? 49  VAL H O     1 
ATOM   5412  C CB    . VAL H 4  52  ? 135.199 102.479 122.782 1.00 99.74  ? 49  VAL H CB    1 
ATOM   5413  C CG1   . VAL H 4  52  ? 135.600 103.846 122.298 1.00 104.02 ? 49  VAL H CG1   1 
ATOM   5414  C CG2   . VAL H 4  52  ? 134.620 101.643 121.650 1.00 100.60 ? 49  VAL H CG2   1 
ATOM   5415  N N     . HIS H 4  53  ? 136.238 102.617 125.641 1.00 100.44 ? 50  HIS H N     1 
ATOM   5416  C CA    . HIS H 4  53  ? 136.590 103.387 126.819 1.00 102.34 ? 50  HIS H CA    1 
ATOM   5417  C C     . HIS H 4  53  ? 136.526 102.503 128.059 1.00 104.60 ? 50  HIS H C     1 
ATOM   5418  O O     . HIS H 4  53  ? 135.583 102.610 128.840 1.00 105.26 ? 50  HIS H O     1 
ATOM   5419  C CB    . HIS H 4  53  ? 135.626 104.557 127.020 1.00 103.75 ? 50  HIS H CB    1 
ATOM   5420  C CG    . HIS H 4  53  ? 135.659 105.591 125.959 1.00 100.82 ? 50  HIS H CG    1 
ATOM   5421  N ND1   . HIS H 4  53  ? 136.693 106.489 125.835 1.00 101.33 ? 50  HIS H ND1   1 
ATOM   5422  C CD2   . HIS H 4  53  ? 134.748 105.934 125.026 1.00 100.70 ? 50  HIS H CD2   1 
ATOM   5423  C CE1   . HIS H 4  53  ? 136.422 107.333 124.857 1.00 103.51 ? 50  HIS H CE1   1 
ATOM   5424  N NE2   . HIS H 4  53  ? 135.246 107.022 124.356 1.00 100.75 ? 50  HIS H NE2   1 
ATOM   5425  N N     . PRO H 4  54  ? 137.532 101.656 128.282 1.00 104.04 ? 51  PRO H N     1 
ATOM   5426  C CA    . PRO H 4  54  ? 137.558 100.585 129.263 1.00 107.12 ? 51  PRO H CA    1 
ATOM   5427  C C     . PRO H 4  54  ? 137.462 101.099 130.696 1.00 108.09 ? 51  PRO H C     1 
ATOM   5428  O O     . PRO H 4  54  ? 137.178 100.336 131.618 1.00 110.52 ? 51  PRO H O     1 
ATOM   5429  C CB    . PRO H 4  54  ? 138.915 99.927  128.992 1.00 107.33 ? 51  PRO H CB    1 
ATOM   5430  C CG    . PRO H 4  54  ? 139.762 101.022 128.384 1.00 105.62 ? 51  PRO H CG    1 
ATOM   5431  C CD    . PRO H 4  54  ? 138.804 101.875 127.589 1.00 100.08 ? 51  PRO H CD    1 
ATOM   5432  N N     . ASP H 4  55  ? 137.747 102.380 130.889 1.00 108.24 ? 52  ASP H N     1 
ATOM   5433  C CA    . ASP H 4  55  ? 137.697 102.992 132.203 1.00 110.89 ? 52  ASP H CA    1 
ATOM   5434  C C     . ASP H 4  55  ? 136.455 103.857 132.396 1.00 110.44 ? 52  ASP H C     1 
ATOM   5435  O O     . ASP H 4  55  ? 136.346 104.584 133.384 1.00 114.04 ? 52  ASP H O     1 
ATOM   5436  C CB    . ASP H 4  55  ? 138.954 103.826 132.405 1.00 118.77 ? 52  ASP H CB    1 
ATOM   5437  C CG    . ASP H 4  55  ? 139.129 104.836 131.289 1.00 120.94 ? 52  ASP H CG    1 
ATOM   5438  O OD1   . ASP H 4  55  ? 138.407 104.737 130.314 1.00 115.67 ? 52  ASP H OD1   1 
ATOM   5439  O OD2   . ASP H 4  55  ? 139.995 105.671 131.390 1.00 123.60 ? 52  ASP H OD2   1 
ATOM   5440  N N     . THR H 4  56  ? 135.505 103.754 131.474 1.00 107.50 ? 53  THR H N     1 
ATOM   5441  C CA    . THR H 4  56  ? 134.292 104.558 131.544 1.00 107.70 ? 53  THR H CA    1 
ATOM   5442  C C     . THR H 4  56  ? 133.072 103.695 131.817 1.00 107.04 ? 53  THR H C     1 
ATOM   5443  O O     . THR H 4  56  ? 132.867 102.664 131.178 1.00 109.06 ? 53  THR H O     1 
ATOM   5444  C CB    . THR H 4  56  ? 134.095 105.366 130.248 1.00 110.79 ? 53  THR H CB    1 
ATOM   5445  O OG1   . THR H 4  56  ? 135.209 106.252 130.067 1.00 111.37 ? 53  THR H OG1   1 
ATOM   5446  C CG2   . THR H 4  56  ? 132.813 106.188 130.297 1.00 111.40 ? 53  THR H CG2   1 
ATOM   5447  N N     . GLY H 4  57  ? 132.273 104.108 132.792 1.00 109.39 ? 54  GLY H N     1 
ATOM   5448  C CA    . GLY H 4  57  ? 131.055 103.388 133.132 1.00 111.24 ? 54  GLY H CA    1 
ATOM   5449  C C     . GLY H 4  57  ? 129.857 103.987 132.415 1.00 109.81 ? 54  GLY H C     1 
ATOM   5450  O O     . GLY H 4  57  ? 130.001 104.892 131.593 1.00 108.64 ? 54  GLY H O     1 
ATOM   5451  N N     . ILE H 4  58  ? 128.672 103.506 132.750 1.00 113.13 ? 55  ILE H N     1 
ATOM   5452  C CA    . ILE H 4  58  ? 127.458 103.991 132.117 1.00 107.25 ? 55  ILE H CA    1 
ATOM   5453  C C     . ILE H 4  58  ? 126.261 103.792 133.038 1.00 114.12 ? 55  ILE H C     1 
ATOM   5454  O O     . ILE H 4  58  ? 126.144 102.758 133.695 1.00 119.90 ? 55  ILE H O     1 
ATOM   5455  C CB    . ILE H 4  58  ? 127.283 103.290 130.760 1.00 102.20 ? 55  ILE H CB    1 
ATOM   5456  C CG1   . ILE H 4  58  ? 126.082 103.844 130.013 1.00 101.85 ? 55  ILE H CG1   1 
ATOM   5457  C CG2   . ILE H 4  58  ? 127.187 101.782 130.953 1.00 111.14 ? 55  ILE H CG2   1 
ATOM   5458  C CD1   . ILE H 4  58  ? 126.080 103.545 128.523 1.00 105.13 ? 55  ILE H CD1   1 
ATOM   5459  N N     . SER H 4  59  ? 125.387 104.793 133.099 1.00 113.37 ? 56  SER H N     1 
ATOM   5460  C CA    . SER H 4  59  ? 124.230 104.740 133.986 1.00 110.83 ? 56  SER H CA    1 
ATOM   5461  C C     . SER H 4  59  ? 123.157 103.817 133.447 1.00 102.51 ? 56  SER H C     1 
ATOM   5462  O O     . SER H 4  59  ? 123.072 103.591 132.241 1.00 102.44 ? 56  SER H O     1 
ATOM   5463  C CB    . SER H 4  59  ? 123.638 106.121 134.174 1.00 110.68 ? 56  SER H CB    1 
ATOM   5464  O OG    . SER H 4  59  ? 123.006 106.567 133.005 1.00 102.62 ? 56  SER H OG    1 
ATOM   5465  N N     . SER H 4  60  ? 122.259 103.384 134.328 1.00 100.96 ? 57  SER H N     1 
ATOM   5466  C CA    . SER H 4  60  ? 121.165 102.512 133.924 1.00 104.65 ? 57  SER H CA    1 
ATOM   5467  C C     . SER H 4  60  ? 120.214 103.214 132.972 1.00 99.70  ? 57  SER H C     1 
ATOM   5468  O O     . SER H 4  60  ? 119.641 102.589 132.077 1.00 102.01 ? 57  SER H O     1 
ATOM   5469  C CB    . SER H 4  60  ? 120.401 102.051 135.145 1.00 108.23 ? 57  SER H CB    1 
ATOM   5470  O OG    . SER H 4  60  ? 119.773 103.132 135.776 1.00 108.85 ? 57  SER H OG    1 
ATOM   5471  N N     . LYS H 4  61  ? 120.107 104.524 133.110 1.00 94.93  ? 58  LYS H N     1 
ATOM   5472  C CA    . LYS H 4  61  ? 119.257 105.288 132.221 1.00 96.51  ? 58  LYS H CA    1 
ATOM   5473  C C     . LYS H 4  61  ? 119.867 105.362 130.839 1.00 95.27  ? 58  LYS H C     1 
ATOM   5474  O O     . LYS H 4  61  ? 119.179 105.168 129.836 1.00 93.67  ? 58  LYS H O     1 
ATOM   5475  C CB    . LYS H 4  61  ? 119.052 106.681 132.773 1.00 97.60  ? 58  LYS H CB    1 
ATOM   5476  C CG    . LYS H 4  61  ? 118.176 106.748 134.006 1.00 103.61 ? 58  LYS H CG    1 
ATOM   5477  C CD    . LYS H 4  61  ? 116.700 106.563 133.660 1.00 108.90 ? 58  LYS H CD    1 
ATOM   5478  C CE    . LYS H 4  61  ? 115.802 106.851 134.863 1.00 115.56 ? 58  LYS H CE    1 
ATOM   5479  N NZ    . LYS H 4  61  ? 114.354 106.717 134.529 1.00 110.94 ? 58  LYS H NZ    1 
ATOM   5480  N N     . ALA H 4  62  ? 121.175 105.567 130.788 1.00 95.73  ? 59  ALA H N     1 
ATOM   5481  C CA    . ALA H 4  62  ? 121.872 105.607 129.517 1.00 95.30  ? 59  ALA H CA    1 
ATOM   5482  C C     . ALA H 4  62  ? 121.736 104.269 128.813 1.00 95.90  ? 59  ALA H C     1 
ATOM   5483  O O     . ALA H 4  62  ? 121.635 104.211 127.587 1.00 92.46  ? 59  ALA H O     1 
ATOM   5484  C CB    . ALA H 4  62  ? 123.326 105.954 129.730 1.00 98.17  ? 59  ALA H CB    1 
ATOM   5485  N N     . MET H 4  63  ? 121.730 103.188 129.587 1.00 96.23  ? 60  MET H N     1 
ATOM   5486  C CA    . MET H 4  63  ? 121.558 101.870 129.002 1.00 95.02  ? 60  MET H CA    1 
ATOM   5487  C C     . MET H 4  63  ? 120.175 101.777 128.381 1.00 92.16  ? 60  MET H C     1 
ATOM   5488  O O     . MET H 4  63  ? 120.018 101.291 127.261 1.00 90.04  ? 60  MET H O     1 
ATOM   5489  C CB    . MET H 4  63  ? 121.740 100.784 130.057 1.00 99.09  ? 60  MET H CB    1 
ATOM   5490  C CG    . MET H 4  63  ? 123.143 100.704 130.632 1.00 107.58 ? 60  MET H CG    1 
ATOM   5491  S SD    . MET H 4  63  ? 124.397 100.423 129.404 1.00 122.64 ? 60  MET H SD    1 
ATOM   5492  C CE    . MET H 4  63  ? 124.188 98.705  129.118 1.00 111.62 ? 60  MET H CE    1 
ATOM   5493  N N     . GLY H 4  64  ? 119.187 102.344 129.070 1.00 91.51  ? 61  GLY H N     1 
ATOM   5494  C CA    . GLY H 4  64  ? 117.826 102.388 128.558 1.00 94.63  ? 61  GLY H CA    1 
ATOM   5495  C C     . GLY H 4  64  ? 117.763 103.154 127.244 1.00 91.36  ? 61  GLY H C     1 
ATOM   5496  O O     . GLY H 4  64  ? 117.057 102.752 126.315 1.00 90.94  ? 61  GLY H O     1 
ATOM   5497  N N     . ILE H 4  65  ? 118.552 104.217 127.140 1.00 88.30  ? 62  ILE H N     1 
ATOM   5498  C CA    . ILE H 4  65  ? 118.593 104.986 125.908 1.00 91.26  ? 62  ILE H CA    1 
ATOM   5499  C C     . ILE H 4  65  ? 119.171 104.124 124.800 1.00 89.68  ? 62  ILE H C     1 
ATOM   5500  O O     . ILE H 4  65  ? 118.651 104.098 123.683 1.00 87.78  ? 62  ILE H O     1 
ATOM   5501  C CB    . ILE H 4  65  ? 119.471 106.250 126.046 1.00 90.94  ? 62  ILE H CB    1 
ATOM   5502  C CG1   . ILE H 4  65  ? 118.929 107.227 127.112 1.00 93.00  ? 62  ILE H CG1   1 
ATOM   5503  C CG2   . ILE H 4  65  ? 119.609 106.952 124.701 1.00 92.40  ? 62  ILE H CG2   1 
ATOM   5504  C CD1   . ILE H 4  65  ? 117.547 107.760 126.860 1.00 91.84  ? 62  ILE H CD1   1 
ATOM   5505  N N     . MET H 4  66  ? 120.244 103.407 125.116 1.00 86.90  ? 63  MET H N     1 
ATOM   5506  C CA    . MET H 4  66  ? 120.901 102.566 124.131 1.00 84.99  ? 63  MET H CA    1 
ATOM   5507  C C     . MET H 4  66  ? 120.037 101.380 123.724 1.00 87.35  ? 63  MET H C     1 
ATOM   5508  O O     . MET H 4  66  ? 120.092 100.938 122.577 1.00 86.57  ? 63  MET H O     1 
ATOM   5509  C CB    . MET H 4  66  ? 122.254 102.100 124.648 1.00 86.25  ? 63  MET H CB    1 
ATOM   5510  C CG    . MET H 4  66  ? 123.287 103.214 124.784 1.00 89.03  ? 63  MET H CG    1 
ATOM   5511  S SD    . MET H 4  66  ? 123.516 104.161 123.268 1.00 92.65  ? 63  MET H SD    1 
ATOM   5512  C CE    . MET H 4  66  ? 124.268 102.963 122.179 1.00 95.12  ? 63  MET H CE    1 
ATOM   5513  N N     . ASN H 4  67  ? 119.196 100.900 124.633 1.00 86.74  ? 64  ASN H N     1 
ATOM   5514  C CA    . ASN H 4  67  ? 118.297 99.810  124.286 1.00 87.12  ? 64  ASN H CA    1 
ATOM   5515  C C     . ASN H 4  67  ? 117.242 100.293 123.309 1.00 89.89  ? 64  ASN H C     1 
ATOM   5516  O O     . ASN H 4  67  ? 116.947 99.618  122.319 1.00 88.56  ? 64  ASN H O     1 
ATOM   5517  C CB    . ASN H 4  67  ? 117.646 99.233  125.523 1.00 90.08  ? 64  ASN H CB    1 
ATOM   5518  C CG    . ASN H 4  67  ? 118.554 98.329  126.296 1.00 99.82  ? 64  ASN H CG    1 
ATOM   5519  O OD1   . ASN H 4  67  ? 119.285 97.504  125.724 1.00 100.83 ? 64  ASN H OD1   1 
ATOM   5520  N ND2   . ASN H 4  67  ? 118.534 98.474  127.594 1.00 101.15 ? 64  ASN H ND2   1 
ATOM   5521  N N     . SER H 4  68  ? 116.763 101.515 123.512 1.00 87.88  ? 65  SER H N     1 
ATOM   5522  C CA    . SER H 4  68  ? 115.792 102.082 122.593 1.00 90.71  ? 65  SER H CA    1 
ATOM   5523  C C     . SER H 4  68  ? 116.439 102.263 121.233 1.00 87.83  ? 65  SER H C     1 
ATOM   5524  O O     . SER H 4  68  ? 115.848 101.944 120.199 1.00 87.75  ? 65  SER H O     1 
ATOM   5525  C CB    . SER H 4  68  ? 115.301 103.422 123.096 1.00 93.22  ? 65  SER H CB    1 
ATOM   5526  O OG    . SER H 4  68  ? 114.584 103.294 124.294 1.00 96.53  ? 65  SER H OG    1 
ATOM   5527  N N     . PHE H 4  69  ? 117.693 102.694 121.247 1.00 86.15  ? 66  PHE H N     1 
ATOM   5528  C CA    . PHE H 4  69  ? 118.439 102.909 120.023 1.00 86.99  ? 66  PHE H CA    1 
ATOM   5529  C C     . PHE H 4  69  ? 118.567 101.652 119.187 1.00 86.20  ? 66  PHE H C     1 
ATOM   5530  O O     . PHE H 4  69  ? 118.268 101.662 117.991 1.00 83.89  ? 66  PHE H O     1 
ATOM   5531  C CB    . PHE H 4  69  ? 119.827 103.442 120.339 1.00 86.56  ? 66  PHE H CB    1 
ATOM   5532  C CG    . PHE H 4  69  ? 120.720 103.394 119.184 1.00 87.20  ? 66  PHE H CG    1 
ATOM   5533  C CD1   . PHE H 4  69  ? 120.546 104.254 118.139 1.00 86.08  ? 66  PHE H CD1   1 
ATOM   5534  C CD2   . PHE H 4  69  ? 121.735 102.462 119.126 1.00 92.09  ? 66  PHE H CD2   1 
ATOM   5535  C CE1   . PHE H 4  69  ? 121.359 104.186 117.038 1.00 89.11  ? 66  PHE H CE1   1 
ATOM   5536  C CE2   . PHE H 4  69  ? 122.551 102.389 118.029 1.00 95.83  ? 66  PHE H CE2   1 
ATOM   5537  C CZ    . PHE H 4  69  ? 122.356 103.252 116.980 1.00 93.78  ? 66  PHE H CZ    1 
ATOM   5538  N N     . VAL H 4  70  ? 118.993 100.561 119.806 1.00 82.94  ? 67  VAL H N     1 
ATOM   5539  C CA    . VAL H 4  70  ? 119.211 99.352  119.036 1.00 82.63  ? 67  VAL H CA    1 
ATOM   5540  C C     . VAL H 4  70  ? 117.906 98.852  118.451 1.00 84.60  ? 67  VAL H C     1 
ATOM   5541  O O     . VAL H 4  70  ? 117.863 98.425  117.296 1.00 83.84  ? 67  VAL H O     1 
ATOM   5542  C CB    . VAL H 4  70  ? 119.866 98.249  119.884 1.00 87.71  ? 67  VAL H CB    1 
ATOM   5543  C CG1   . VAL H 4  70  ? 119.921 96.940  119.091 1.00 94.71  ? 67  VAL H CG1   1 
ATOM   5544  C CG2   . VAL H 4  70  ? 121.266 98.677  120.282 1.00 90.33  ? 67  VAL H CG2   1 
ATOM   5545  N N     . ASN H 4  71  ? 116.840 98.892  119.241 1.00 84.79  ? 68  ASN H N     1 
ATOM   5546  C CA    . ASN H 4  71  ? 115.554 98.419  118.760 1.00 86.75  ? 68  ASN H CA    1 
ATOM   5547  C C     . ASN H 4  71  ? 115.048 99.263  117.604 1.00 87.64  ? 68  ASN H C     1 
ATOM   5548  O O     . ASN H 4  71  ? 114.526 98.731  116.624 1.00 89.49  ? 68  ASN H O     1 
ATOM   5549  C CB    . ASN H 4  71  ? 114.542 98.412  119.883 1.00 89.31  ? 68  ASN H CB    1 
ATOM   5550  C CG    . ASN H 4  71  ? 114.745 97.277  120.816 1.00 97.61  ? 68  ASN H CG    1 
ATOM   5551  O OD1   . ASN H 4  71  ? 115.203 96.204  120.412 1.00 95.24  ? 68  ASN H OD1   1 
ATOM   5552  N ND2   . ASN H 4  71  ? 114.441 97.490  122.066 1.00 104.18 ? 68  ASN H ND2   1 
ATOM   5553  N N     . ASP H 4  72  ? 115.295 100.565 117.667 1.00 85.80  ? 69  ASP H N     1 
ATOM   5554  C CA    . ASP H 4  72  ? 114.837 101.464 116.621 1.00 87.65  ? 69  ASP H CA    1 
ATOM   5555  C C     . ASP H 4  72  ? 115.550 101.172 115.310 1.00 87.75  ? 69  ASP H C     1 
ATOM   5556  O O     . ASP H 4  72  ? 114.912 100.981 114.273 1.00 87.27  ? 69  ASP H O     1 
ATOM   5557  C CB    . ASP H 4  72  ? 115.061 102.920 117.044 1.00 92.14  ? 69  ASP H CB    1 
ATOM   5558  C CG    . ASP H 4  72  ? 114.427 103.949 116.100 1.00 97.79  ? 69  ASP H CG    1 
ATOM   5559  O OD1   . ASP H 4  72  ? 113.768 103.557 115.171 1.00 97.33  ? 69  ASP H OD1   1 
ATOM   5560  O OD2   . ASP H 4  72  ? 114.589 105.127 116.341 1.00 97.61  ? 69  ASP H OD2   1 
ATOM   5561  N N     . ILE H 4  73  ? 116.871 101.066 115.361 1.00 83.37  ? 70  ILE H N     1 
ATOM   5562  C CA    . ILE H 4  73  ? 117.622 100.832 114.140 1.00 82.84  ? 70  ILE H CA    1 
ATOM   5563  C C     . ILE H 4  73  ? 117.288 99.471  113.567 1.00 84.18  ? 70  ILE H C     1 
ATOM   5564  O O     . ILE H 4  73  ? 117.135 99.322  112.353 1.00 81.78  ? 70  ILE H O     1 
ATOM   5565  C CB    . ILE H 4  73  ? 119.133 100.943 114.372 1.00 82.01  ? 70  ILE H CB    1 
ATOM   5566  C CG1   . ILE H 4  73  ? 119.515 102.359 114.834 1.00 85.29  ? 70  ILE H CG1   1 
ATOM   5567  C CG2   . ILE H 4  73  ? 119.893 100.556 113.111 1.00 82.95  ? 70  ILE H CG2   1 
ATOM   5568  C CD1   . ILE H 4  73  ? 119.108 103.483 113.902 1.00 90.53  ? 70  ILE H CD1   1 
ATOM   5569  N N     . PHE H 4  74  ? 117.183 98.471  114.433 1.00 82.73  ? 71  PHE H N     1 
ATOM   5570  C CA    . PHE H 4  74  ? 116.840 97.138  113.981 1.00 84.21  ? 71  PHE H CA    1 
ATOM   5571  C C     . PHE H 4  74  ? 115.543 97.166  113.197 1.00 86.76  ? 71  PHE H C     1 
ATOM   5572  O O     . PHE H 4  74  ? 115.470 96.642  112.084 1.00 84.75  ? 71  PHE H O     1 
ATOM   5573  C CB    . PHE H 4  74  ? 116.683 96.189  115.164 1.00 84.46  ? 71  PHE H CB    1 
ATOM   5574  C CG    . PHE H 4  74  ? 116.171 94.851  114.765 1.00 85.54  ? 71  PHE H CG    1 
ATOM   5575  C CD1   . PHE H 4  74  ? 117.031 93.866  114.338 1.00 87.76  ? 71  PHE H CD1   1 
ATOM   5576  C CD2   . PHE H 4  74  ? 114.812 94.591  114.762 1.00 90.09  ? 71  PHE H CD2   1 
ATOM   5577  C CE1   . PHE H 4  74  ? 116.548 92.649  113.920 1.00 95.05  ? 71  PHE H CE1   1 
ATOM   5578  C CE2   . PHE H 4  74  ? 114.331 93.380  114.336 1.00 96.62  ? 71  PHE H CE2   1 
ATOM   5579  C CZ    . PHE H 4  74  ? 115.201 92.412  113.913 1.00 99.66  ? 71  PHE H CZ    1 
ATOM   5580  N N     . GLU H 4  75  ? 114.519 97.793  113.769 1.00 86.18  ? 72  GLU H N     1 
ATOM   5581  C CA    . GLU H 4  75  ? 113.225 97.845  113.115 1.00 90.11  ? 72  GLU H CA    1 
ATOM   5582  C C     . GLU H 4  75  ? 113.305 98.520  111.762 1.00 88.15  ? 72  GLU H C     1 
ATOM   5583  O O     . GLU H 4  75  ? 112.683 98.068  110.800 1.00 88.90  ? 72  GLU H O     1 
ATOM   5584  C CB    . GLU H 4  75  ? 112.208 98.588  113.977 1.00 96.31  ? 72  GLU H CB    1 
ATOM   5585  C CG    . GLU H 4  75  ? 110.824 98.696  113.336 1.00 107.68 ? 72  GLU H CG    1 
ATOM   5586  C CD    . GLU H 4  75  ? 109.804 99.415  114.192 1.00 120.63 ? 72  GLU H CD    1 
ATOM   5587  O OE1   . GLU H 4  75  ? 109.861 99.307  115.391 1.00 118.35 ? 72  GLU H OE1   1 
ATOM   5588  O OE2   . GLU H 4  75  ? 108.975 100.096 113.633 1.00 116.60 ? 72  GLU H OE2   1 
ATOM   5589  N N     . ARG H 4  76  ? 114.042 99.620  111.684 1.00 84.33  ? 73  ARG H N     1 
ATOM   5590  C CA    . ARG H 4  76  ? 114.099 100.368 110.441 1.00 86.43  ? 73  ARG H CA    1 
ATOM   5591  C C     . ARG H 4  76  ? 114.739 99.565  109.334 1.00 85.14  ? 73  ARG H C     1 
ATOM   5592  O O     . ARG H 4  76  ? 114.236 99.533  108.210 1.00 84.26  ? 73  ARG H O     1 
ATOM   5593  C CB    . ARG H 4  76  ? 114.923 101.616 110.600 1.00 87.39  ? 73  ARG H CB    1 
ATOM   5594  C CG    . ARG H 4  76  ? 114.342 102.677 111.466 1.00 90.82  ? 73  ARG H CG    1 
ATOM   5595  C CD    . ARG H 4  76  ? 115.243 103.836 111.521 1.00 92.53  ? 73  ARG H CD    1 
ATOM   5596  N NE    . ARG H 4  76  ? 114.939 104.715 112.610 1.00 93.34  ? 73  ARG H NE    1 
ATOM   5597  C CZ    . ARG H 4  76  ? 115.537 105.898 112.817 1.00 94.45  ? 73  ARG H CZ    1 
ATOM   5598  N NH1   . ARG H 4  76  ? 116.407 106.372 111.953 1.00 91.09  ? 73  ARG H NH1   1 
ATOM   5599  N NH2   . ARG H 4  76  ? 115.273 106.581 113.905 1.00 96.71  ? 73  ARG H NH2   1 
ATOM   5600  N N     . ILE H 4  77  ? 115.843 98.903  109.648 1.00 80.41  ? 74  ILE H N     1 
ATOM   5601  C CA    . ILE H 4  77  ? 116.548 98.164  108.623 1.00 79.26  ? 74  ILE H CA    1 
ATOM   5602  C C     . ILE H 4  77  ? 115.715 96.987  108.183 1.00 84.05  ? 74  ILE H C     1 
ATOM   5603  O O     . ILE H 4  77  ? 115.572 96.731  106.988 1.00 83.45  ? 74  ILE H O     1 
ATOM   5604  C CB    . ILE H 4  77  ? 117.927 97.693  109.098 1.00 78.56  ? 74  ILE H CB    1 
ATOM   5605  C CG1   . ILE H 4  77  ? 118.830 98.905  109.344 1.00 79.62  ? 74  ILE H CG1   1 
ATOM   5606  C CG2   . ILE H 4  77  ? 118.537 96.792  108.037 1.00 86.42  ? 74  ILE H CG2   1 
ATOM   5607  C CD1   . ILE H 4  77  ? 120.112 98.586  110.071 1.00 87.30  ? 74  ILE H CD1   1 
ATOM   5608  N N     . ALA H 4  78  ? 115.164 96.266  109.148 1.00 81.73  ? 75  ALA H N     1 
ATOM   5609  C CA    . ALA H 4  78  ? 114.320 95.129  108.842 1.00 86.40  ? 75  ALA H CA    1 
ATOM   5610  C C     . ALA H 4  78  ? 113.097 95.573  108.049 1.00 87.07  ? 75  ALA H C     1 
ATOM   5611  O O     . ALA H 4  78  ? 112.639 94.868  107.148 1.00 87.77  ? 75  ALA H O     1 
ATOM   5612  C CB    . ALA H 4  78  ? 113.910 94.439  110.127 1.00 91.96  ? 75  ALA H CB    1 
ATOM   5613  N N     . GLY H 4  79  ? 112.571 96.745  108.389 1.00 85.23  ? 76  GLY H N     1 
ATOM   5614  C CA    . GLY H 4  79  ? 111.409 97.301  107.715 1.00 88.32  ? 76  GLY H CA    1 
ATOM   5615  C C     . GLY H 4  79  ? 111.707 97.606  106.256 1.00 86.97  ? 76  GLY H C     1 
ATOM   5616  O O     . GLY H 4  79  ? 110.939 97.243  105.362 1.00 89.11  ? 76  GLY H O     1 
ATOM   5617  N N     . GLU H 4  80  ? 112.821 98.278  106.011 1.00 84.00  ? 77  GLU H N     1 
ATOM   5618  C CA    . GLU H 4  80  ? 113.175 98.625  104.649 1.00 86.58  ? 77  GLU H CA    1 
ATOM   5619  C C     . GLU H 4  80  ? 113.535 97.371  103.870 1.00 88.62  ? 77  GLU H C     1 
ATOM   5620  O O     . GLU H 4  80  ? 113.156 97.219  102.707 1.00 86.21  ? 77  GLU H O     1 
ATOM   5621  C CB    . GLU H 4  80  ? 114.332 99.612  104.633 1.00 88.94  ? 77  GLU H CB    1 
ATOM   5622  C CG    . GLU H 4  80  ? 114.681 100.138 103.255 1.00 95.57  ? 77  GLU H CG    1 
ATOM   5623  C CD    . GLU H 4  80  ? 113.571 100.954 102.644 1.00 102.01 ? 77  GLU H CD    1 
ATOM   5624  O OE1   . GLU H 4  80  ? 112.768 101.476 103.381 1.00 98.01  ? 77  GLU H OE1   1 
ATOM   5625  O OE2   . GLU H 4  80  ? 113.528 101.058 101.439 1.00 100.09 ? 77  GLU H OE2   1 
ATOM   5626  N N     . ALA H 4  81  ? 114.220 96.444  104.528 1.00 85.33  ? 78  ALA H N     1 
ATOM   5627  C CA    . ALA H 4  81  ? 114.585 95.196  103.885 1.00 87.40  ? 78  ALA H CA    1 
ATOM   5628  C C     . ALA H 4  81  ? 113.330 94.447  103.465 1.00 86.47  ? 78  ALA H C     1 
ATOM   5629  O O     . ALA H 4  81  ? 113.296 93.824  102.401 1.00 86.29  ? 78  ALA H O     1 
ATOM   5630  C CB    . ALA H 4  81  ? 115.438 94.356  104.813 1.00 87.95  ? 78  ALA H CB    1 
ATOM   5631  N N     . SER H 4  82  ? 112.285 94.548  104.281 1.00 83.87  ? 79  SER H N     1 
ATOM   5632  C CA    . SER H 4  82  ? 111.010 93.936  103.958 1.00 86.22  ? 79  SER H CA    1 
ATOM   5633  C C     . SER H 4  82  ? 110.458 94.529  102.677 1.00 87.03  ? 79  SER H C     1 
ATOM   5634  O O     . SER H 4  82  ? 110.007 93.797  101.794 1.00 87.90  ? 79  SER H O     1 
ATOM   5635  C CB    . SER H 4  82  ? 110.023 94.136  105.085 1.00 89.77  ? 79  SER H CB    1 
ATOM   5636  O OG    . SER H 4  82  ? 108.798 93.537  104.786 1.00 92.90  ? 79  SER H OG    1 
ATOM   5637  N N     . ARG H 4  83  ? 110.530 95.854  102.551 1.00 83.96  ? 80  ARG H N     1 
ATOM   5638  C CA    . ARG H 4  83  ? 110.069 96.489  101.326 1.00 86.61  ? 80  ARG H CA    1 
ATOM   5639  C C     . ARG H 4  83  ? 110.851 96.034  100.120 1.00 85.68  ? 80  ARG H C     1 
ATOM   5640  O O     . ARG H 4  83  ? 110.279 95.834  99.052  1.00 87.04  ? 80  ARG H O     1 
ATOM   5641  C CB    . ARG H 4  83  ? 110.174 97.995  101.372 1.00 90.95  ? 80  ARG H CB    1 
ATOM   5642  C CG    . ARG H 4  83  ? 109.124 98.697  102.158 1.00 94.43  ? 80  ARG H CG    1 
ATOM   5643  C CD    . ARG H 4  83  ? 109.152 100.163 101.878 1.00 97.01  ? 80  ARG H CD    1 
ATOM   5644  N NE    . ARG H 4  83  ? 108.094 100.860 102.563 1.00 98.00  ? 80  ARG H NE    1 
ATOM   5645  C CZ    . ARG H 4  83  ? 106.819 100.895 102.152 1.00 95.90  ? 80  ARG H CZ    1 
ATOM   5646  N NH1   . ARG H 4  83  ? 106.466 100.279 101.052 1.00 96.24  ? 80  ARG H NH1   1 
ATOM   5647  N NH2   . ARG H 4  83  ? 105.915 101.515 102.876 1.00 95.91  ? 80  ARG H NH2   1 
ATOM   5648  N N     . LEU H 4  84  ? 112.156 95.890  100.270 1.00 82.91  ? 81  LEU H N     1 
ATOM   5649  C CA    . LEU H 4  84  ? 112.961 95.496  99.131  1.00 83.77  ? 81  LEU H CA    1 
ATOM   5650  C C     . LEU H 4  84  ? 112.556 94.113  98.669  1.00 87.53  ? 81  LEU H C     1 
ATOM   5651  O O     . LEU H 4  84  ? 112.416 93.863  97.468  1.00 87.19  ? 81  LEU H O     1 
ATOM   5652  C CB    . LEU H 4  84  ? 114.441 95.496  99.508  1.00 86.95  ? 81  LEU H CB    1 
ATOM   5653  C CG    . LEU H 4  84  ? 115.060 96.861  99.807  1.00 88.81  ? 81  LEU H CG    1 
ATOM   5654  C CD1   . LEU H 4  84  ? 116.439 96.653  100.378 1.00 91.39  ? 81  LEU H CD1   1 
ATOM   5655  C CD2   . LEU H 4  84  ? 115.134 97.696  98.537  1.00 88.51  ? 81  LEU H CD2   1 
ATOM   5656  N N     . ALA H 4  85  ? 112.324 93.220  99.624  1.00 83.52  ? 82  ALA H N     1 
ATOM   5657  C CA    . ALA H 4  85  ? 111.894 91.877  99.287  1.00 89.79  ? 82  ALA H CA    1 
ATOM   5658  C C     . ALA H 4  85  ? 110.515 91.905  98.651  1.00 90.41  ? 82  ALA H C     1 
ATOM   5659  O O     . ALA H 4  85  ? 110.269 91.228  97.656  1.00 91.13  ? 82  ALA H O     1 
ATOM   5660  C CB    . ALA H 4  85  ? 111.888 90.997  100.526 1.00 96.35  ? 82  ALA H CB    1 
ATOM   5661  N N     . HIS H 4  86  ? 109.634 92.745  99.174  1.00 90.35  ? 83  HIS H N     1 
ATOM   5662  C CA    . HIS H 4  86  ? 108.283 92.825  98.647  1.00 93.99  ? 83  HIS H CA    1 
ATOM   5663  C C     . HIS H 4  86  ? 108.293 93.381  97.234  1.00 93.03  ? 83  HIS H C     1 
ATOM   5664  O O     . HIS H 4  86  ? 107.705 92.810  96.317  1.00 95.58  ? 83  HIS H O     1 
ATOM   5665  C CB    . HIS H 4  86  ? 107.408 93.703  99.538  1.00 94.40  ? 83  HIS H CB    1 
ATOM   5666  C CG    . HIS H 4  86  ? 105.987 93.746  99.108  1.00 103.93 ? 83  HIS H CG    1 
ATOM   5667  N ND1   . HIS H 4  86  ? 105.117 92.697  99.317  1.00 107.81 ? 83  HIS H ND1   1 
ATOM   5668  C CD2   . HIS H 4  86  ? 105.283 94.696  98.456  1.00 108.53 ? 83  HIS H CD2   1 
ATOM   5669  C CE1   . HIS H 4  86  ? 103.936 93.005  98.813  1.00 115.62 ? 83  HIS H CE1   1 
ATOM   5670  N NE2   . HIS H 4  86  ? 104.010 94.213  98.288  1.00 114.45 ? 83  HIS H NE2   1 
ATOM   5671  N N     . TYR H 4  87  ? 109.006 94.479  97.052  1.00 89.97  ? 84  TYR H N     1 
ATOM   5672  C CA    . TYR H 4  87  ? 109.068 95.179  95.782  1.00 92.48  ? 84  TYR H CA    1 
ATOM   5673  C C     . TYR H 4  87  ? 109.592 94.295  94.666  1.00 91.71  ? 84  TYR H C     1 
ATOM   5674  O O     . TYR H 4  87  ? 109.070 94.312  93.552  1.00 94.40  ? 84  TYR H O     1 
ATOM   5675  C CB    . TYR H 4  87  ? 109.905 96.448  95.924  1.00 93.83  ? 84  TYR H CB    1 
ATOM   5676  C CG    . TYR H 4  87  ? 110.128 97.191  94.640  1.00 98.44  ? 84  TYR H CG    1 
ATOM   5677  C CD1   . TYR H 4  87  ? 109.064 97.479  93.805  1.00 101.97 ? 84  TYR H CD1   1 
ATOM   5678  C CD2   . TYR H 4  87  ? 111.392 97.652  94.330  1.00 99.66  ? 84  TYR H CD2   1 
ATOM   5679  C CE1   . TYR H 4  87  ? 109.272 98.192  92.648  1.00 103.74 ? 84  TYR H CE1   1 
ATOM   5680  C CE2   . TYR H 4  87  ? 111.595 98.387  93.184  1.00 102.21 ? 84  TYR H CE2   1 
ATOM   5681  C CZ    . TYR H 4  87  ? 110.541 98.650  92.342  1.00 105.37 ? 84  TYR H CZ    1 
ATOM   5682  O OH    . TYR H 4  87  ? 110.733 99.400  91.208  1.00 100.30 ? 84  TYR H OH    1 
ATOM   5683  N N     . ASN H 4  88  ? 110.597 93.489  94.972  1.00 90.13  ? 85  ASN H N     1 
ATOM   5684  C CA    . ASN H 4  88  ? 111.201 92.636  93.966  1.00 89.31  ? 85  ASN H CA    1 
ATOM   5685  C C     . ASN H 4  88  ? 110.558 91.258  93.940  1.00 92.24  ? 85  ASN H C     1 
ATOM   5686  O O     . ASN H 4  88  ? 111.017 90.368  93.222  1.00 93.08  ? 85  ASN H O     1 
ATOM   5687  C CB    . ASN H 4  88  ? 112.689 92.543  94.197  1.00 92.39  ? 85  ASN H CB    1 
ATOM   5688  C CG    . ASN H 4  88  ? 113.367 93.838  93.899  1.00 92.86  ? 85  ASN H CG    1 
ATOM   5689  O OD1   . ASN H 4  88  ? 113.718 94.129  92.750  1.00 94.78  ? 85  ASN H OD1   1 
ATOM   5690  N ND2   . ASN H 4  88  ? 113.515 94.650  94.907  1.00 93.95  ? 85  ASN H ND2   1 
ATOM   5691  N N     . LYS H 4  89  ? 109.418 91.112  94.607  1.00 92.11  ? 86  LYS H N     1 
ATOM   5692  C CA    . LYS H 4  89  ? 108.646 89.871  94.571  1.00 94.67  ? 86  LYS H CA    1 
ATOM   5693  C C     . LYS H 4  89  ? 109.418 88.691  95.145  1.00 96.56  ? 86  LYS H C     1 
ATOM   5694  O O     . LYS H 4  89  ? 109.494 87.639  94.513  1.00 97.23  ? 86  LYS H O     1 
ATOM   5695  C CB    . LYS H 4  89  ? 108.220 89.533  93.141  1.00 95.11  ? 86  LYS H CB    1 
ATOM   5696  C CG    . LYS H 4  89  ? 107.595 90.687  92.373  1.00 101.59 ? 86  LYS H CG    1 
ATOM   5697  C CD    . LYS H 4  89  ? 106.307 91.166  93.025  1.00 109.19 ? 86  LYS H CD    1 
ATOM   5698  C CE    . LYS H 4  89  ? 105.654 92.264  92.205  1.00 114.45 ? 86  LYS H CE    1 
ATOM   5699  N NZ    . LYS H 4  89  ? 104.436 92.817  92.867  1.00 115.29 ? 86  LYS H NZ    1 
ATOM   5700  N N     . ARG H 4  90  ? 109.981 88.848  96.340  1.00 96.17  ? 87  ARG H N     1 
ATOM   5701  C CA    . ARG H 4  90  ? 110.738 87.780  96.970  1.00 96.10  ? 87  ARG H CA    1 
ATOM   5702  C C     . ARG H 4  90  ? 110.180 87.464  98.338  1.00 96.99  ? 87  ARG H C     1 
ATOM   5703  O O     . ARG H 4  90  ? 109.456 88.267  98.926  1.00 100.18 ? 87  ARG H O     1 
ATOM   5704  C CB    . ARG H 4  90  ? 112.172 88.188  97.141  1.00 96.87  ? 87  ARG H CB    1 
ATOM   5705  C CG    . ARG H 4  90  ? 112.806 88.721  95.916  1.00 99.75  ? 87  ARG H CG    1 
ATOM   5706  C CD    . ARG H 4  90  ? 112.917 87.715  94.879  1.00 102.96 ? 87  ARG H CD    1 
ATOM   5707  N NE    . ARG H 4  90  ? 113.552 88.251  93.714  1.00 107.39 ? 87  ARG H NE    1 
ATOM   5708  C CZ    . ARG H 4  90  ? 114.881 88.312  93.524  1.00 115.22 ? 87  ARG H CZ    1 
ATOM   5709  N NH1   . ARG H 4  90  ? 115.707 87.875  94.444  1.00 115.32 ? 87  ARG H NH1   1 
ATOM   5710  N NH2   . ARG H 4  90  ? 115.357 88.817  92.405  1.00 115.81 ? 87  ARG H NH2   1 
ATOM   5711  N N     . SER H 4  91  ? 110.519 86.289  98.849  1.00 96.14  ? 88  SER H N     1 
ATOM   5712  C CA    . SER H 4  91  ? 110.062 85.879  100.168 1.00 104.71 ? 88  SER H CA    1 
ATOM   5713  C C     . SER H 4  91  ? 111.210 85.846  101.167 1.00 100.86 ? 88  SER H C     1 
ATOM   5714  O O     . SER H 4  91  ? 111.007 85.578  102.354 1.00 99.56  ? 88  SER H O     1 
ATOM   5715  C CB    . SER H 4  91  ? 109.418 84.514  100.078 1.00 113.59 ? 88  SER H CB    1 
ATOM   5716  O OG    . SER H 4  91  ? 110.352 83.546  99.693  1.00 112.17 ? 88  SER H OG    1 
ATOM   5717  N N     . THR H 4  92  ? 112.418 86.134  100.694 1.00 96.49  ? 89  THR H N     1 
ATOM   5718  C CA    . THR H 4  92  ? 113.587 86.006  101.546 1.00 95.82  ? 89  THR H CA    1 
ATOM   5719  C C     . THR H 4  92  ? 114.374 87.300  101.645 1.00 89.99  ? 89  THR H C     1 
ATOM   5720  O O     . THR H 4  92  ? 114.663 87.948  100.640 1.00 92.80  ? 89  THR H O     1 
ATOM   5721  C CB    . THR H 4  92  ? 114.528 84.902  101.027 1.00 99.44  ? 89  THR H CB    1 
ATOM   5722  O OG1   . THR H 4  92  ? 113.804 83.675  100.908 1.00 104.24 ? 89  THR H OG1   1 
ATOM   5723  C CG2   . THR H 4  92  ? 115.685 84.692  102.009 1.00 102.58 ? 89  THR H CG2   1 
ATOM   5724  N N     . ILE H 4  93  ? 114.774 87.631  102.864 1.00 88.55  ? 90  ILE H N     1 
ATOM   5725  C CA    . ILE H 4  93  ? 115.696 88.730  103.110 1.00 85.56  ? 90  ILE H CA    1 
ATOM   5726  C C     . ILE H 4  93  ? 117.089 88.186  103.350 1.00 88.49  ? 90  ILE H C     1 
ATOM   5727  O O     . ILE H 4  93  ? 117.290 87.366  104.242 1.00 89.49  ? 90  ILE H O     1 
ATOM   5728  C CB    . ILE H 4  93  ? 115.256 89.565  104.326 1.00 84.69  ? 90  ILE H CB    1 
ATOM   5729  C CG1   . ILE H 4  93  ? 113.916 90.250  104.032 1.00 90.47  ? 90  ILE H CG1   1 
ATOM   5730  C CG2   . ILE H 4  93  ? 116.336 90.573  104.708 1.00 87.21  ? 90  ILE H CG2   1 
ATOM   5731  C CD1   . ILE H 4  93  ? 113.270 90.907  105.239 1.00 92.10  ? 90  ILE H CD1   1 
ATOM   5732  N N     . THR H 4  94  ? 118.050 88.641  102.562 1.00 85.54  ? 91  THR H N     1 
ATOM   5733  C CA    . THR H 4  94  ? 119.421 88.174  102.683 1.00 86.59  ? 91  THR H CA    1 
ATOM   5734  C C     . THR H 4  94  ? 120.326 89.340  103.032 1.00 87.05  ? 91  THR H C     1 
ATOM   5735  O O     . THR H 4  94  ? 119.857 90.456  103.265 1.00 84.55  ? 91  THR H O     1 
ATOM   5736  C CB    . THR H 4  94  ? 119.915 87.507  101.389 1.00 87.67  ? 91  THR H CB    1 
ATOM   5737  O OG1   . THR H 4  94  ? 120.117 88.498  100.379 1.00 88.12  ? 91  THR H OG1   1 
ATOM   5738  C CG2   . THR H 4  94  ? 118.904 86.488  100.898 1.00 92.98  ? 91  THR H CG2   1 
ATOM   5739  N N     . SER H 4  95  ? 121.623 89.076  103.112 1.00 85.67  ? 92  SER H N     1 
ATOM   5740  C CA    . SER H 4  95  ? 122.570 90.110  103.492 1.00 87.29  ? 92  SER H CA    1 
ATOM   5741  C C     . SER H 4  95  ? 122.547 91.271  102.514 1.00 84.73  ? 92  SER H C     1 
ATOM   5742  O O     . SER H 4  95  ? 122.761 92.420  102.901 1.00 83.59  ? 92  SER H O     1 
ATOM   5743  C CB    . SER H 4  95  ? 123.962 89.528  103.551 1.00 89.62  ? 92  SER H CB    1 
ATOM   5744  O OG    . SER H 4  95  ? 124.388 89.126  102.277 1.00 88.13  ? 92  SER H OG    1 
ATOM   5745  N N     . ARG H 4  96  ? 122.185 90.998  101.269 1.00 82.04  ? 93  ARG H N     1 
ATOM   5746  C CA    . ARG H 4  96  ? 122.134 92.050  100.275 1.00 85.34  ? 93  ARG H CA    1 
ATOM   5747  C C     . ARG H 4  96  ? 121.038 93.060  100.564 1.00 86.39  ? 93  ARG H C     1 
ATOM   5748  O O     . ARG H 4  96  ? 121.238 94.262  100.397 1.00 83.22  ? 93  ARG H O     1 
ATOM   5749  C CB    . ARG H 4  96  ? 121.917 91.485  98.903  1.00 91.12  ? 93  ARG H CB    1 
ATOM   5750  C CG    . ARG H 4  96  ? 121.978 92.527  97.821  1.00 97.45  ? 93  ARG H CG    1 
ATOM   5751  C CD    . ARG H 4  96  ? 121.824 91.961  96.484  1.00 99.06  ? 93  ARG H CD    1 
ATOM   5752  N NE    . ARG H 4  96  ? 122.958 91.143  96.111  1.00 105.67 ? 93  ARG H NE    1 
ATOM   5753  C CZ    . ARG H 4  96  ? 122.939 90.179  95.169  1.00 111.29 ? 93  ARG H CZ    1 
ATOM   5754  N NH1   . ARG H 4  96  ? 121.839 89.922  94.500  1.00 110.51 ? 93  ARG H NH1   1 
ATOM   5755  N NH2   . ARG H 4  96  ? 124.026 89.478  94.920  1.00 112.45 ? 93  ARG H NH2   1 
ATOM   5756  N N     . GLU H 4  97  ? 119.865 92.580  100.953 1.00 85.34  ? 94  GLU H N     1 
ATOM   5757  C CA    . GLU H 4  97  ? 118.765 93.478  101.253 1.00 87.20  ? 94  GLU H CA    1 
ATOM   5758  C C     . GLU H 4  97  ? 119.123 94.338  102.435 1.00 86.20  ? 94  GLU H C     1 
ATOM   5759  O O     . GLU H 4  97  ? 118.816 95.530  102.463 1.00 82.47  ? 94  GLU H O     1 
ATOM   5760  C CB    . GLU H 4  97  ? 117.488 92.699  101.531 1.00 90.48  ? 94  GLU H CB    1 
ATOM   5761  C CG    . GLU H 4  97  ? 116.857 92.091  100.305 1.00 94.46  ? 94  GLU H CG    1 
ATOM   5762  C CD    . GLU H 4  97  ? 117.578 90.884  99.841  1.00 96.78  ? 94  GLU H CD    1 
ATOM   5763  O OE1   . GLU H 4  97  ? 118.446 90.444  100.547 1.00 90.46  ? 94  GLU H OE1   1 
ATOM   5764  O OE2   . GLU H 4  97  ? 117.292 90.412  98.772  1.00 99.68  ? 94  GLU H OE2   1 
ATOM   5765  N N     . ILE H 4  98  ? 119.835 93.751  103.382 1.00 82.26  ? 95  ILE H N     1 
ATOM   5766  C CA    . ILE H 4  98  ? 120.264 94.513  104.531 1.00 80.67  ? 95  ILE H CA    1 
ATOM   5767  C C     . ILE H 4  98  ? 121.222 95.593  104.061 1.00 82.80  ? 95  ILE H C     1 
ATOM   5768  O O     . ILE H 4  98  ? 121.055 96.762  104.399 1.00 81.92  ? 95  ILE H O     1 
ATOM   5769  C CB    . ILE H 4  98  ? 120.954 93.615  105.572 1.00 83.04  ? 95  ILE H CB    1 
ATOM   5770  C CG1   . ILE H 4  98  ? 119.983 92.524  106.098 1.00 85.91  ? 95  ILE H CG1   1 
ATOM   5771  C CG2   . ILE H 4  98  ? 121.482 94.458  106.723 1.00 85.81  ? 95  ILE H CG2   1 
ATOM   5772  C CD1   . ILE H 4  98  ? 118.759 93.036  106.834 1.00 89.46  ? 95  ILE H CD1   1 
ATOM   5773  N N     . GLN H 4  99  ? 122.154 95.230  103.188 1.00 80.42  ? 96  GLN H N     1 
ATOM   5774  C CA    . GLN H 4  99  ? 123.111 96.198  102.680 1.00 81.51  ? 96  GLN H CA    1 
ATOM   5775  C C     . GLN H 4  99  ? 122.436 97.388  102.023 1.00 80.01  ? 96  GLN H C     1 
ATOM   5776  O O     . GLN H 4  99  ? 122.788 98.537  102.299 1.00 80.51  ? 96  GLN H O     1 
ATOM   5777  C CB    . GLN H 4  99  ? 124.043 95.546  101.670 1.00 81.07  ? 96  GLN H CB    1 
ATOM   5778  C CG    . GLN H 4  99  ? 125.036 96.493  101.068 1.00 82.53  ? 96  GLN H CG    1 
ATOM   5779  C CD    . GLN H 4  99  ? 126.041 95.790  100.233 1.00 87.09  ? 96  GLN H CD    1 
ATOM   5780  O OE1   . GLN H 4  99  ? 125.929 95.731  99.007  1.00 90.48  ? 96  GLN H OE1   1 
ATOM   5781  N NE2   . GLN H 4  99  ? 127.039 95.225  100.888 1.00 89.57  ? 96  GLN H NE2   1 
ATOM   5782  N N     . THR H 4  100 ? 121.464 97.119  101.164 1.00 76.79  ? 97  THR H N     1 
ATOM   5783  C CA    . THR H 4  100 ? 120.751 98.188  100.491 1.00 80.04  ? 97  THR H CA    1 
ATOM   5784  C C     . THR H 4  100 ? 119.999 99.038  101.501 1.00 82.08  ? 97  THR H C     1 
ATOM   5785  O O     . THR H 4  100 ? 119.992 100.268 101.414 1.00 81.92  ? 97  THR H O     1 
ATOM   5786  C CB    . THR H 4  100 ? 119.785 97.630  99.433  1.00 83.25  ? 97  THR H CB    1 
ATOM   5787  O OG1   . THR H 4  100 ? 120.530 96.950  98.412  1.00 85.60  ? 97  THR H OG1   1 
ATOM   5788  C CG2   . THR H 4  100 ? 118.973 98.753  98.804  1.00 86.69  ? 97  THR H CG2   1 
ATOM   5789  N N     . ALA H 4  101 ? 119.347 98.380  102.452 1.00 80.69  ? 98  ALA H N     1 
ATOM   5790  C CA    . ALA H 4  101 ? 118.591 99.083  103.474 1.00 84.90  ? 98  ALA H CA    1 
ATOM   5791  C C     . ALA H 4  101 ? 119.498 100.000 104.282 1.00 83.33  ? 98  ALA H C     1 
ATOM   5792  O O     . ALA H 4  101 ? 119.126 101.132 104.594 1.00 83.32  ? 98  ALA H O     1 
ATOM   5793  C CB    . ALA H 4  101 ? 117.903 98.083  104.385 1.00 88.16  ? 98  ALA H CB    1 
ATOM   5794  N N     . VAL H 4  102 ? 120.715 99.543  104.546 1.00 78.82  ? 99  VAL H N     1 
ATOM   5795  C CA    . VAL H 4  102 ? 121.677 100.339 105.289 1.00 77.92  ? 99  VAL H CA    1 
ATOM   5796  C C     . VAL H 4  102 ? 122.036 101.602 104.535 1.00 80.92  ? 99  VAL H C     1 
ATOM   5797  O O     . VAL H 4  102 ? 122.076 102.686 105.114 1.00 80.95  ? 99  VAL H O     1 
ATOM   5798  C CB    . VAL H 4  102 ? 122.945 99.519  105.578 1.00 79.70  ? 99  VAL H CB    1 
ATOM   5799  C CG1   . VAL H 4  102 ? 124.048 100.399 106.118 1.00 84.19  ? 99  VAL H CG1   1 
ATOM   5800  C CG2   . VAL H 4  102 ? 122.625 98.457  106.602 1.00 85.24  ? 99  VAL H CG2   1 
ATOM   5801  N N     . ARG H 4  103 ? 122.270 101.477 103.238 1.00 78.00  ? 100 ARG H N     1 
ATOM   5802  C CA    . ARG H 4  103 ? 122.599 102.646 102.437 1.00 80.12  ? 100 ARG H CA    1 
ATOM   5803  C C     . ARG H 4  103 ? 121.487 103.674 102.433 1.00 81.39  ? 100 ARG H C     1 
ATOM   5804  O O     . ARG H 4  103 ? 121.743 104.876 102.387 1.00 83.86  ? 100 ARG H O     1 
ATOM   5805  C CB    . ARG H 4  103 ? 122.856 102.263 101.006 1.00 81.15  ? 100 ARG H CB    1 
ATOM   5806  C CG    . ARG H 4  103 ? 124.129 101.551 100.764 1.00 86.59  ? 100 ARG H CG    1 
ATOM   5807  C CD    . ARG H 4  103 ? 124.318 101.295 99.328  1.00 91.50  ? 100 ARG H CD    1 
ATOM   5808  N NE    . ARG H 4  103 ? 125.534 100.570 99.066  1.00 96.95  ? 100 ARG H NE    1 
ATOM   5809  C CZ    . ARG H 4  103 ? 126.750 101.128 98.972  1.00 103.88 ? 100 ARG H CZ    1 
ATOM   5810  N NH1   . ARG H 4  103 ? 126.897 102.422 99.134  1.00 103.49 ? 100 ARG H NH1   1 
ATOM   5811  N NH2   . ARG H 4  103 ? 127.800 100.376 98.713  1.00 104.04 ? 100 ARG H NH2   1 
ATOM   5812  N N     . LEU H 4  104 ? 120.253 103.201 102.391 1.00 80.45  ? 101 LEU H N     1 
ATOM   5813  C CA    . LEU H 4  104 ? 119.111 104.095 102.357 1.00 82.81  ? 101 LEU H CA    1 
ATOM   5814  C C     . LEU H 4  104 ? 118.899 104.792 103.696 1.00 83.72  ? 101 LEU H C     1 
ATOM   5815  O O     . LEU H 4  104 ? 118.494 105.954 103.744 1.00 87.66  ? 101 LEU H O     1 
ATOM   5816  C CB    . LEU H 4  104 ? 117.860 103.302 101.970 1.00 86.01  ? 101 LEU H CB    1 
ATOM   5817  C CG    . LEU H 4  104 ? 117.818 102.775 100.520 1.00 88.53  ? 101 LEU H CG    1 
ATOM   5818  C CD1   . LEU H 4  104 ? 116.688 101.771 100.388 1.00 91.21  ? 101 LEU H CD1   1 
ATOM   5819  C CD2   . LEU H 4  104 ? 117.600 103.938 99.548  1.00 90.94  ? 101 LEU H CD2   1 
ATOM   5820  N N     . LEU H 4  105 ? 119.157 104.077 104.783 1.00 81.08  ? 102 LEU H N     1 
ATOM   5821  C CA    . LEU H 4  105 ? 118.904 104.606 106.116 1.00 81.67  ? 102 LEU H CA    1 
ATOM   5822  C C     . LEU H 4  105 ? 120.060 105.409 106.707 1.00 82.11  ? 102 LEU H C     1 
ATOM   5823  O O     . LEU H 4  105 ? 119.828 106.380 107.428 1.00 84.80  ? 102 LEU H O     1 
ATOM   5824  C CB    . LEU H 4  105 ? 118.526 103.452 107.040 1.00 88.05  ? 102 LEU H CB    1 
ATOM   5825  C CG    . LEU H 4  105 ? 117.192 102.759 106.706 0.00 94.43  ? 102 LEU H CG    1 
ATOM   5826  C CD1   . LEU H 4  105 ? 117.114 101.452 107.435 0.00 93.87  ? 102 LEU H CD1   1 
ATOM   5827  C CD2   . LEU H 4  105 ? 116.026 103.649 107.126 0.00 94.65  ? 102 LEU H CD2   1 
ATOM   5828  N N     . LEU H 4  106 ? 121.298 105.015 106.432 1.00 80.79  ? 103 LEU H N     1 
ATOM   5829  C CA    . LEU H 4  106 ? 122.424 105.739 107.003 1.00 81.46  ? 103 LEU H CA    1 
ATOM   5830  C C     . LEU H 4  106 ? 122.990 106.733 105.995 1.00 83.93  ? 103 LEU H C     1 
ATOM   5831  O O     . LEU H 4  106 ? 123.050 106.440 104.805 1.00 85.94  ? 103 LEU H O     1 
ATOM   5832  C CB    . LEU H 4  106 ? 123.539 104.778 107.425 1.00 85.21  ? 103 LEU H CB    1 
ATOM   5833  C CG    . LEU H 4  106 ? 123.193 103.711 108.455 1.00 87.00  ? 103 LEU H CG    1 
ATOM   5834  C CD1   . LEU H 4  106 ? 124.449 102.927 108.772 1.00 91.73  ? 103 LEU H CD1   1 
ATOM   5835  C CD2   . LEU H 4  106 ? 122.631 104.341 109.693 1.00 89.81  ? 103 LEU H CD2   1 
ATOM   5836  N N     . PRO H 4  107 ? 123.393 107.920 106.444 1.00 82.78  ? 104 PRO H N     1 
ATOM   5837  C CA    . PRO H 4  107 ? 124.025 108.969 105.670 1.00 83.03  ? 104 PRO H CA    1 
ATOM   5838  C C     . PRO H 4  107 ? 125.524 108.767 105.487 1.00 88.17  ? 104 PRO H C     1 
ATOM   5839  O O     . PRO H 4  107 ? 126.189 108.162 106.330 1.00 89.59  ? 104 PRO H O     1 
ATOM   5840  C CB    . PRO H 4  107 ? 123.748 110.196 106.539 1.00 88.65  ? 104 PRO H CB    1 
ATOM   5841  C CG    . PRO H 4  107 ? 123.754 109.653 107.945 1.00 91.97  ? 104 PRO H CG    1 
ATOM   5842  C CD    . PRO H 4  107 ? 123.119 108.284 107.835 1.00 85.65  ? 104 PRO H CD    1 
ATOM   5843  N N     . GLY H 4  108 ? 126.060 109.402 104.452 1.00 90.09  ? 105 GLY H N     1 
ATOM   5844  C CA    . GLY H 4  108 ? 127.481 109.726 104.356 1.00 93.56  ? 105 GLY H CA    1 
ATOM   5845  C C     . GLY H 4  108 ? 128.423 108.539 104.483 1.00 92.82  ? 105 GLY H C     1 
ATOM   5846  O O     . GLY H 4  108 ? 128.247 107.504 103.839 1.00 93.37  ? 105 GLY H O     1 
ATOM   5847  N N     . GLU H 4  109 ? 129.455 108.731 105.300 1.00 92.57  ? 106 GLU H N     1 
ATOM   5848  C CA    . GLU H 4  109 ? 130.492 107.740 105.524 1.00 96.43  ? 106 GLU H CA    1 
ATOM   5849  C C     . GLU H 4  109 ? 130.026 106.719 106.538 1.00 93.91  ? 106 GLU H C     1 
ATOM   5850  O O     . GLU H 4  109 ? 130.422 105.552 106.497 1.00 91.41  ? 106 GLU H O     1 
ATOM   5851  C CB    . GLU H 4  109 ? 131.767 108.416 106.026 1.00 102.13 ? 106 GLU H CB    1 
ATOM   5852  C CG    . GLU H 4  109 ? 132.394 109.403 105.043 1.00 108.29 ? 106 GLU H CG    1 
ATOM   5853  C CD    . GLU H 4  109 ? 132.909 108.764 103.776 0.00 116.42 ? 106 GLU H CD    1 
ATOM   5854  O OE1   . GLU H 4  109 ? 133.697 107.846 103.860 0.00 113.75 ? 106 GLU H OE1   1 
ATOM   5855  O OE2   . GLU H 4  109 ? 132.505 109.190 102.721 0.00 115.22 ? 106 GLU H OE2   1 
ATOM   5856  N N     . LEU H 4  110 ? 129.156 107.153 107.441 1.00 92.46  ? 107 LEU H N     1 
ATOM   5857  C CA    . LEU H 4  110 ? 128.658 106.272 108.484 1.00 91.53  ? 107 LEU H CA    1 
ATOM   5858  C C     . LEU H 4  110 ? 128.094 105.031 107.819 1.00 90.74  ? 107 LEU H C     1 
ATOM   5859  O O     . LEU H 4  110 ? 128.369 103.902 108.231 1.00 90.12  ? 107 LEU H O     1 
ATOM   5860  C CB    . LEU H 4  110 ? 127.550 106.975 109.285 1.00 90.75  ? 107 LEU H CB    1 
ATOM   5861  C CG    . LEU H 4  110 ? 126.997 106.238 110.517 1.00 95.56  ? 107 LEU H CG    1 
ATOM   5862  C CD1   . LEU H 4  110 ? 128.086 106.128 111.582 1.00 99.25  ? 107 LEU H CD1   1 
ATOM   5863  C CD2   . LEU H 4  110 ? 125.786 106.997 111.057 1.00 97.53  ? 107 LEU H CD2   1 
ATOM   5864  N N     . ALA H 4  111 ? 127.375 105.254 106.726 1.00 88.14  ? 108 ALA H N     1 
ATOM   5865  C CA    . ALA H 4  111 ? 126.802 104.170 105.954 1.00 88.77  ? 108 ALA H CA    1 
ATOM   5866  C C     . ALA H 4  111 ? 127.868 103.229 105.417 1.00 88.44  ? 108 ALA H C     1 
ATOM   5867  O O     . ALA H 4  111 ? 127.688 102.013 105.425 1.00 88.98  ? 108 ALA H O     1 
ATOM   5868  C CB    . ALA H 4  111 ? 126.003 104.735 104.795 1.00 90.03  ? 108 ALA H CB    1 
ATOM   5869  N N     . LYS H 4  112 ? 128.987 103.780 104.968 1.00 86.54  ? 109 LYS H N     1 
ATOM   5870  C CA    . LYS H 4  112 ? 130.027 102.958 104.369 1.00 87.69  ? 109 LYS H CA    1 
ATOM   5871  C C     . LYS H 4  112 ? 130.665 102.036 105.367 1.00 88.33  ? 109 LYS H C     1 
ATOM   5872  O O     . LYS H 4  112 ? 130.955 100.879 105.064 1.00 87.15  ? 109 LYS H O     1 
ATOM   5873  C CB    . LYS H 4  112 ? 131.115 103.812 103.769 1.00 88.45  ? 109 LYS H CB    1 
ATOM   5874  C CG    . LYS H 4  112 ? 130.734 104.487 102.504 1.00 95.13  ? 109 LYS H CG    1 
ATOM   5875  C CD    . LYS H 4  112 ? 131.739 105.554 102.140 1.00 104.99 ? 109 LYS H CD    1 
ATOM   5876  C CE    . LYS H 4  112 ? 133.124 104.988 101.861 1.00 108.83 ? 109 LYS H CE    1 
ATOM   5877  N NZ    . LYS H 4  112 ? 134.093 106.069 101.559 1.00 107.65 ? 109 LYS H NZ    1 
ATOM   5878  N N     . HIS H 4  113 ? 130.906 102.554 106.554 1.00 86.77  ? 110 HIS H N     1 
ATOM   5879  C CA    . HIS H 4  113 ? 131.568 101.767 107.565 1.00 90.36  ? 110 HIS H CA    1 
ATOM   5880  C C     . HIS H 4  113 ? 130.659 100.634 107.983 1.00 90.34  ? 110 HIS H C     1 
ATOM   5881  O O     . HIS H 4  113 ? 131.105 99.500  108.157 1.00 90.01  ? 110 HIS H O     1 
ATOM   5882  C CB    . HIS H 4  113 ? 131.929 102.637 108.755 1.00 93.00  ? 110 HIS H CB    1 
ATOM   5883  C CG    . HIS H 4  113 ? 133.003 103.618 108.458 1.00 95.67  ? 110 HIS H CG    1 
ATOM   5884  N ND1   . HIS H 4  113 ? 134.297 103.240 108.171 1.00 95.90  ? 110 HIS H ND1   1 
ATOM   5885  C CD2   . HIS H 4  113 ? 132.979 104.966 108.389 1.00 97.16  ? 110 HIS H CD2   1 
ATOM   5886  C CE1   . HIS H 4  113 ? 135.023 104.317 107.941 1.00 100.04 ? 110 HIS H CE1   1 
ATOM   5887  N NE2   . HIS H 4  113 ? 134.248 105.377 108.069 1.00 100.18 ? 110 HIS H NE2   1 
ATOM   5888  N N     . ALA H 4  114 ? 129.367 100.926 108.073 1.00 88.02  ? 111 ALA H N     1 
ATOM   5889  C CA    . ALA H 4  114 ? 128.394 99.903  108.402 1.00 90.28  ? 111 ALA H CA    1 
ATOM   5890  C C     . ALA H 4  114 ? 128.366 98.829  107.324 1.00 89.79  ? 111 ALA H C     1 
ATOM   5891  O O     . ALA H 4  114 ? 128.382 97.635  107.626 1.00 90.51  ? 111 ALA H O     1 
ATOM   5892  C CB    . ALA H 4  114 ? 127.023 100.529 108.557 1.00 93.11  ? 111 ALA H CB    1 
ATOM   5893  N N     . VAL H 4  115 ? 128.435 99.253  106.066 1.00 84.43  ? 112 VAL H N     1 
ATOM   5894  C CA    . VAL H 4  115 ? 128.437 98.318  104.954 1.00 86.65  ? 112 VAL H CA    1 
ATOM   5895  C C     . VAL H 4  115 ? 129.684 97.459  104.948 1.00 90.82  ? 112 VAL H C     1 
ATOM   5896  O O     . VAL H 4  115 ? 129.606 96.250  104.717 1.00 89.97  ? 112 VAL H O     1 
ATOM   5897  C CB    . VAL H 4  115 ? 128.283 99.064  103.615 1.00 88.44  ? 112 VAL H CB    1 
ATOM   5898  C CG1   . VAL H 4  115 ? 128.559 98.137  102.439 1.00 91.83  ? 112 VAL H CG1   1 
ATOM   5899  C CG2   . VAL H 4  115 ? 126.857 99.599  103.506 1.00 94.36  ? 112 VAL H CG2   1 
ATOM   5900  N N     . SER H 4  116 ? 130.834 98.074  105.189 1.00 87.40  ? 113 SER H N     1 
ATOM   5901  C CA    . SER H 4  116 ? 132.083 97.337  105.197 1.00 89.99  ? 113 SER H CA    1 
ATOM   5902  C C     . SER H 4  116 ? 132.079 96.277  106.284 1.00 92.87  ? 113 SER H C     1 
ATOM   5903  O O     . SER H 4  116 ? 132.400 95.115  106.029 1.00 92.34  ? 113 SER H O     1 
ATOM   5904  C CB    . SER H 4  116 ? 133.244 98.282  105.410 1.00 90.29  ? 113 SER H CB    1 
ATOM   5905  O OG    . SER H 4  116 ? 134.460 97.587  105.419 1.00 91.34  ? 113 SER H OG    1 
ATOM   5906  N N     . GLU H 4  117 ? 131.641 96.657  107.481 1.00 91.73  ? 114 GLU H N     1 
ATOM   5907  C CA    . GLU H 4  117 ? 131.616 95.728  108.600 1.00 95.12  ? 114 GLU H CA    1 
ATOM   5908  C C     . GLU H 4  117 ? 130.622 94.608  108.367 1.00 95.41  ? 114 GLU H C     1 
ATOM   5909  O O     . GLU H 4  117 ? 130.883 93.453  108.708 1.00 96.00  ? 114 GLU H O     1 
ATOM   5910  C CB    . GLU H 4  117 ? 131.266 96.467  109.887 1.00 97.01  ? 114 GLU H CB    1 
ATOM   5911  C CG    . GLU H 4  117 ? 132.371 97.356  110.409 1.00 104.34 ? 114 GLU H CG    1 
ATOM   5912  C CD    . GLU H 4  117 ? 133.530 96.571  110.937 1.00 116.23 ? 114 GLU H CD    1 
ATOM   5913  O OE1   . GLU H 4  117 ? 133.312 95.731  111.775 1.00 115.16 ? 114 GLU H OE1   1 
ATOM   5914  O OE2   . GLU H 4  117 ? 134.632 96.788  110.492 1.00 121.04 ? 114 GLU H OE2   1 
ATOM   5915  N N     . GLY H 4  118 ? 129.481 94.945  107.780 1.00 91.61  ? 115 GLY H N     1 
ATOM   5916  C CA    . GLY H 4  118 ? 128.464 93.954  107.480 1.00 91.91  ? 115 GLY H CA    1 
ATOM   5917  C C     . GLY H 4  118 ? 128.984 92.952  106.469 1.00 93.24  ? 115 GLY H C     1 
ATOM   5918  O O     . GLY H 4  118 ? 128.886 91.740  106.669 1.00 91.60  ? 115 GLY H O     1 
ATOM   5919  N N     . THR H 4  119 ? 129.569 93.464  105.394 1.00 92.85  ? 116 THR H N     1 
ATOM   5920  C CA    . THR H 4  119 ? 130.070 92.623  104.324 1.00 95.69  ? 116 THR H CA    1 
ATOM   5921  C C     . THR H 4  119 ? 131.129 91.688  104.867 1.00 96.70  ? 116 THR H C     1 
ATOM   5922  O O     . THR H 4  119 ? 131.154 90.495  104.551 1.00 99.03  ? 116 THR H O     1 
ATOM   5923  C CB    . THR H 4  119 ? 130.671 93.483  103.198 1.00 98.40  ? 116 THR H CB    1 
ATOM   5924  O OG1   . THR H 4  119 ? 129.662 94.359  102.676 1.00 97.28  ? 116 THR H OG1   1 
ATOM   5925  C CG2   . THR H 4  119 ? 131.192 92.597  102.079 1.00 103.97 ? 116 THR H CG2   1 
ATOM   5926  N N     . LYS H 4  120 ? 132.014 92.243  105.678 1.00 93.72  ? 117 LYS H N     1 
ATOM   5927  C CA    . LYS H 4  120 ? 133.080 91.477  106.278 1.00 96.29  ? 117 LYS H CA    1 
ATOM   5928  C C     . LYS H 4  120 ? 132.562 90.401  107.204 1.00 99.41  ? 117 LYS H C     1 
ATOM   5929  O O     . LYS H 4  120 ? 133.003 89.256  107.141 1.00 100.52 ? 117 LYS H O     1 
ATOM   5930  C CB    . LYS H 4  120 ? 133.988 92.387  107.063 1.00 98.42  ? 117 LYS H CB    1 
ATOM   5931  C CG    . LYS H 4  120 ? 135.128 91.672  107.729 1.00 104.45 ? 117 LYS H CG    1 
ATOM   5932  C CD    . LYS H 4  120 ? 136.046 92.645  108.445 1.00 115.91 ? 117 LYS H CD    1 
ATOM   5933  C CE    . LYS H 4  120 ? 135.438 93.129  109.763 1.00 117.73 ? 117 LYS H CE    1 
ATOM   5934  N NZ    . LYS H 4  120 ? 136.368 94.017  110.518 1.00 122.23 ? 117 LYS H NZ    1 
ATOM   5935  N N     . ALA H 4  121 ? 131.633 90.761  108.080 1.00 96.72  ? 118 ALA H N     1 
ATOM   5936  C CA    . ALA H 4  121 ? 131.152 89.809  109.064 1.00 99.49  ? 118 ALA H CA    1 
ATOM   5937  C C     . ALA H 4  121 ? 130.568 88.587  108.383 1.00 101.16 ? 118 ALA H C     1 
ATOM   5938  O O     . ALA H 4  121 ? 130.827 87.457  108.797 1.00 104.96 ? 118 ALA H O     1 
ATOM   5939  C CB    . ALA H 4  121 ? 130.119 90.458  109.964 1.00 106.50 ? 118 ALA H CB    1 
ATOM   5940  N N     . VAL H 4  122 ? 129.856 88.804  107.283 1.00 98.60  ? 119 VAL H N     1 
ATOM   5941  C CA    . VAL H 4  122 ? 129.292 87.689  106.545 1.00 99.41  ? 119 VAL H CA    1 
ATOM   5942  C C     . VAL H 4  122 ? 130.397 86.865  105.927 1.00 103.21 ? 119 VAL H C     1 
ATOM   5943  O O     . VAL H 4  122 ? 130.370 85.634  105.980 1.00 106.06 ? 119 VAL H O     1 
ATOM   5944  C CB    . VAL H 4  122 ? 128.337 88.176  105.448 1.00 99.52  ? 119 VAL H CB    1 
ATOM   5945  C CG1   . VAL H 4  122 ? 127.894 87.003  104.574 1.00 103.69 ? 119 VAL H CG1   1 
ATOM   5946  C CG2   . VAL H 4  122 ? 127.141 88.834  106.090 1.00 99.79  ? 119 VAL H CG2   1 
ATOM   5947  N N     . THR H 4  123 ? 131.372 87.545  105.341 1.00 101.58 ? 120 THR H N     1 
ATOM   5948  C CA    . THR H 4  123 ? 132.482 86.868  104.702 1.00 106.08 ? 120 THR H CA    1 
ATOM   5949  C C     . THR H 4  123 ? 133.215 85.993  105.704 1.00 109.22 ? 120 THR H C     1 
ATOM   5950  O O     . THR H 4  123 ? 133.527 84.837  105.422 1.00 113.00 ? 120 THR H O     1 
ATOM   5951  C CB    . THR H 4  123 ? 133.459 87.888  104.094 1.00 111.26 ? 120 THR H CB    1 
ATOM   5952  O OG1   . THR H 4  123 ? 132.771 88.682  103.115 1.00 109.86 ? 120 THR H OG1   1 
ATOM   5953  C CG2   . THR H 4  123 ? 134.626 87.174  103.432 1.00 114.48 ? 120 THR H CG2   1 
ATOM   5954  N N     . LYS H 4  124 ? 133.462 86.540  106.886 1.00 107.62 ? 121 LYS H N     1 
ATOM   5955  C CA    . LYS H 4  124 ? 134.173 85.827  107.932 1.00 111.68 ? 121 LYS H CA    1 
ATOM   5956  C C     . LYS H 4  124 ? 133.361 84.656  108.440 1.00 112.77 ? 121 LYS H C     1 
ATOM   5957  O O     . LYS H 4  124 ? 133.886 83.568  108.670 1.00 116.77 ? 121 LYS H O     1 
ATOM   5958  C CB    . LYS H 4  124 ? 134.438 86.767  109.098 1.00 113.46 ? 121 LYS H CB    1 
ATOM   5959  C CG    . LYS H 4  124 ? 135.227 86.161  110.265 0.00 122.72 ? 121 LYS H CG    1 
ATOM   5960  C CD    . LYS H 4  124 ? 136.666 85.814  109.889 0.00 136.42 ? 121 LYS H CD    1 
ATOM   5961  C CE    . LYS H 4  124 ? 137.509 87.072  109.659 0.00 159.05 ? 121 LYS H CE    1 
ATOM   5962  N NZ    . LYS H 4  124 ? 138.933 86.747  109.374 0.00 174.59 ? 121 LYS H NZ    1 
ATOM   5963  N N     . TYR H 4  125 ? 132.072 84.890  108.613 1.00 110.16 ? 122 TYR H N     1 
ATOM   5964  C CA    . TYR H 4  125 ? 131.166 83.891  109.135 1.00 112.19 ? 122 TYR H CA    1 
ATOM   5965  C C     . TYR H 4  125 ? 131.171 82.637  108.281 1.00 114.09 ? 122 TYR H C     1 
ATOM   5966  O O     . TYR H 4  125 ? 131.264 81.524  108.800 1.00 117.64 ? 122 TYR H O     1 
ATOM   5967  C CB    . TYR H 4  125 ? 129.760 84.470  109.216 1.00 110.25 ? 122 TYR H CB    1 
ATOM   5968  C CG    . TYR H 4  125 ? 128.751 83.528  109.740 1.00 114.42 ? 122 TYR H CG    1 
ATOM   5969  C CD1   . TYR H 4  125 ? 128.643 83.345  111.094 1.00 119.03 ? 122 TYR H CD1   1 
ATOM   5970  C CD2   . TYR H 4  125 ? 127.916 82.853  108.875 1.00 112.34 ? 122 TYR H CD2   1 
ATOM   5971  C CE1   . TYR H 4  125 ? 127.707 82.487  111.594 1.00 122.20 ? 122 TYR H CE1   1 
ATOM   5972  C CE2   . TYR H 4  125 ? 126.976 81.986  109.372 1.00 113.50 ? 122 TYR H CE2   1 
ATOM   5973  C CZ    . TYR H 4  125 ? 126.869 81.801  110.728 1.00 118.38 ? 122 TYR H CZ    1 
ATOM   5974  O OH    . TYR H 4  125 ? 125.932 80.931  111.229 1.00 123.90 ? 122 TYR H OH    1 
ATOM   5975  N N     . THR H 4  126 ? 131.064 82.811  106.966 1.00 112.48 ? 123 THR H N     1 
ATOM   5976  C CA    . THR H 4  126 ? 131.006 81.660  106.080 1.00 114.43 ? 123 THR H CA    1 
ATOM   5977  C C     . THR H 4  126 ? 132.397 81.132  105.754 1.00 118.41 ? 123 THR H C     1 
ATOM   5978  O O     . THR H 4  126 ? 132.568 79.939  105.492 1.00 123.26 ? 123 THR H O     1 
ATOM   5979  C CB    . THR H 4  126 ? 130.268 82.000  104.773 1.00 117.03 ? 123 THR H CB    1 
ATOM   5980  O OG1   . THR H 4  126 ? 131.006 82.984  104.041 1.00 115.83 ? 123 THR H OG1   1 
ATOM   5981  C CG2   . THR H 4  126 ? 128.887 82.552  105.089 1.00 115.17 ? 123 THR H CG2   1 
ATOM   5982  N N     . SER H 4  127 ? 133.409 81.985  105.872 1.00 119.43 ? 124 SER H N     1 
ATOM   5983  C CA    . SER H 4  127 ? 134.783 81.573  105.613 1.00 126.74 ? 124 SER H CA    1 
ATOM   5984  C C     . SER H 4  127 ? 135.395 80.945  106.854 1.00 131.56 ? 124 SER H C     1 
ATOM   5985  O O     . SER H 4  127 ? 136.361 81.462  107.418 1.00 132.40 ? 124 SER H O     1 
ATOM   5986  C CB    . SER H 4  127 ? 135.620 82.761  105.188 1.00 128.89 ? 124 SER H CB    1 
ATOM   5987  O OG    . SER H 4  127 ? 135.125 83.328  104.008 1.00 125.86 ? 124 SER H OG    1 
ATOM   5988  N N     . ALA H 4  128 ? 134.829 79.824  107.272 1.00 133.21 ? 125 ALA H N     1 
ATOM   5989  C CA    . ALA H 4  128 ? 135.251 79.161  108.494 1.00 148.11 ? 125 ALA H CA    1 
ATOM   5990  C C     . ALA H 4  128 ? 135.351 77.657  108.289 1.00 155.05 ? 125 ALA H C     1 
ATOM   5991  O O     . ALA H 4  128 ? 135.522 77.195  107.161 1.00 149.31 ? 125 ALA H O     1 
ATOM   5992  C CB    . ALA H 4  128 ? 134.281 79.484  109.621 1.00 147.68 ? 125 ALA H CB    1 
ATOM   5993  O OXT   . ALA H 4  128 ? 135.044 76.906  109.213 1.00 160.95 ? 125 ALA H OXT   1 
ATOM   5994  P P     . DC  I 7  19  ? 88.359  116.006 60.241  1.00 600.00 ? 16  DC  I P     1 
ATOM   5995  O OP1   . DC  I 7  19  ? 89.675  115.446 59.840  1.00 600.00 ? 16  DC  I OP1   1 
ATOM   5996  O OP2   . DC  I 7  19  ? 87.126  115.545 59.551  1.00 600.00 ? 16  DC  I OP2   1 
ATOM   5997  O "O5'" . DC  I 7  19  ? 88.100  115.631 61.769  1.00 551.07 ? 16  DC  I "O5'" 1 
ATOM   5998  C "C5'" . DC  I 7  19  ? 88.770  114.511 62.381  1.00 477.40 ? 16  DC  I "C5'" 1 
ATOM   5999  C "C4'" . DC  I 7  19  ? 89.663  114.988 63.506  1.00 557.59 ? 16  DC  I "C4'" 1 
ATOM   6000  O "O4'" . DC  I 7  19  ? 88.967  115.979 64.299  1.00 550.92 ? 16  DC  I "O4'" 1 
ATOM   6001  C "C3'" . DC  I 7  19  ? 90.094  113.890 64.479  1.00 570.51 ? 16  DC  I "C3'" 1 
ATOM   6002  O "O3'" . DC  I 7  19  ? 91.451  114.111 64.904  1.00 543.61 ? 16  DC  I "O3'" 1 
ATOM   6003  C "C2'" . DC  I 7  19  ? 89.133  114.046 65.645  1.00 600.00 ? 16  DC  I "C2'" 1 
ATOM   6004  C "C1'" . DC  I 7  19  ? 88.777  115.522 65.631  1.00 600.00 ? 16  DC  I "C1'" 1 
ATOM   6005  N N1    . DC  I 7  19  ? 87.379  115.814 65.999  1.00 600.00 ? 16  DC  I N1    1 
ATOM   6006  C C2    . DC  I 7  19  ? 87.052  116.047 67.343  1.00 600.00 ? 16  DC  I C2    1 
ATOM   6007  O O2    . DC  I 7  19  ? 87.941  116.004 68.207  1.00 588.78 ? 16  DC  I O2    1 
ATOM   6008  N N3    . DC  I 7  19  ? 85.769  116.315 67.672  1.00 600.00 ? 16  DC  I N3    1 
ATOM   6009  C C4    . DC  I 7  19  ? 84.829  116.356 66.724  1.00 600.00 ? 16  DC  I C4    1 
ATOM   6010  N N4    . DC  I 7  19  ? 83.575  116.624 67.096  1.00 600.00 ? 16  DC  I N4    1 
ATOM   6011  C C5    . DC  I 7  19  ? 85.133  116.122 65.354  1.00 339.07 ? 16  DC  I C5    1 
ATOM   6012  C C6    . DC  I 7  19  ? 86.406  115.859 65.039  1.00 600.00 ? 16  DC  I C6    1 
ATOM   6013  P P     . DT  I 7  20  ? 92.440  112.890 65.282  1.00 540.86 ? 17  DT  I P     1 
ATOM   6014  O OP1   . DT  I 7  20  ? 93.790  113.208 64.754  1.00 530.47 ? 17  DT  I OP1   1 
ATOM   6015  O OP2   . DT  I 7  20  ? 91.786  111.613 64.890  1.00 549.09 ? 17  DT  I OP2   1 
ATOM   6016  O "O5'" . DT  I 7  20  ? 92.498  112.937 66.877  1.00 544.09 ? 17  DT  I "O5'" 1 
ATOM   6017  C "C5'" . DT  I 7  20  ? 93.586  112.314 67.592  1.00 495.43 ? 17  DT  I "C5'" 1 
ATOM   6018  C "C4'" . DT  I 7  20  ? 93.557  112.692 69.060  1.00 500.22 ? 17  DT  I "C4'" 1 
ATOM   6019  O "O4'" . DT  I 7  20  ? 92.268  113.256 69.392  1.00 535.05 ? 17  DT  I "O4'" 1 
ATOM   6020  C "C3'" . DT  I 7  20  ? 93.763  111.540 70.044  1.00 532.70 ? 17  DT  I "C3'" 1 
ATOM   6021  O "O3'" . DT  I 7  20  ? 94.373  112.027 71.254  1.00 531.56 ? 17  DT  I "O3'" 1 
ATOM   6022  C "C2'" . DT  I 7  20  ? 92.340  111.072 70.301  1.00 491.12 ? 17  DT  I "C2'" 1 
ATOM   6023  C "C1'" . DT  I 7  20  ? 91.520  112.349 70.190  1.00 533.15 ? 17  DT  I "C1'" 1 
ATOM   6024  N N1    . DT  I 7  20  ? 90.191  112.190 69.558  1.00 567.04 ? 17  DT  I N1    1 
ATOM   6025  C C2    . DT  I 7  20  ? 89.102  112.777 70.169  1.00 576.37 ? 17  DT  I C2    1 
ATOM   6026  O O2    . DT  I 7  20  ? 89.181  113.419 71.205  1.00 564.89 ? 17  DT  I O2    1 
ATOM   6027  N N3    . DT  I 7  20  ? 87.907  112.586 69.519  1.00 600.00 ? 17  DT  I N3    1 
ATOM   6028  C C4    . DT  I 7  20  ? 87.696  111.885 68.349  1.00 540.75 ? 17  DT  I C4    1 
ATOM   6029  O O4    . DT  I 7  20  ? 86.565  111.799 67.876  1.00 600.00 ? 17  DT  I O4    1 
ATOM   6030  C C5    . DT  I 7  20  ? 88.875  111.296 67.764  1.00 600.00 ? 17  DT  I C5    1 
ATOM   6031  C C7    . DT  I 7  20  ? 88.742  110.512 66.499  1.00 600.00 ? 17  DT  I C7    1 
ATOM   6032  C C6    . DT  I 7  20  ? 90.045  111.475 68.386  1.00 558.18 ? 17  DT  I C6    1 
ATOM   6033  P P     . DG  I 7  21  ? 94.996  111.028 72.362  1.00 519.87 ? 18  DG  I P     1 
ATOM   6034  O OP1   . DG  I 7  21  ? 95.869  111.823 73.263  1.00 535.83 ? 18  DG  I OP1   1 
ATOM   6035  O OP2   . DG  I 7  21  ? 95.554  109.841 71.663  1.00 532.17 ? 18  DG  I OP2   1 
ATOM   6036  O "O5'" . DG  I 7  21  ? 93.720  110.554 73.198  1.00 508.04 ? 18  DG  I "O5'" 1 
ATOM   6037  C "C5'" . DG  I 7  21  ? 93.280  111.325 74.333  1.00 502.24 ? 18  DG  I "C5'" 1 
ATOM   6038  C "C4'" . DG  I 7  21  ? 91.885  110.936 74.781  1.00 480.34 ? 18  DG  I "C4'" 1 
ATOM   6039  O "O4'" . DG  I 7  21  ? 90.997  110.814 73.641  1.00 490.15 ? 18  DG  I "O4'" 1 
ATOM   6040  C "C3'" . DG  I 7  21  ? 91.751  109.622 75.560  1.00 452.39 ? 18  DG  I "C3'" 1 
ATOM   6041  O "O3'" . DG  I 7  21  ? 90.938  109.886 76.719  1.00 429.06 ? 18  DG  I "O3'" 1 
ATOM   6042  C "C2'" . DG  I 7  21  ? 91.044  108.700 74.573  1.00 450.85 ? 18  DG  I "C2'" 1 
ATOM   6043  C "C1'" . DG  I 7  21  ? 90.165  109.682 73.825  1.00 477.38 ? 18  DG  I "C1'" 1 
ATOM   6044  N N9    . DG  I 7  21  ? 89.691  109.247 72.509  1.00 504.54 ? 18  DG  I N9    1 
ATOM   6045  C C8    . DG  I 7  21  ? 90.419  108.650 71.508  1.00 532.29 ? 18  DG  I C8    1 
ATOM   6046  N N7    . DG  I 7  21  ? 89.711  108.385 70.445  1.00 565.99 ? 18  DG  I N7    1 
ATOM   6047  C C5    . DG  I 7  21  ? 88.437  108.832 70.760  1.00 535.61 ? 18  DG  I C5    1 
ATOM   6048  C C6    . DG  I 7  21  ? 87.239  108.813 70.000  1.00 589.01 ? 18  DG  I C6    1 
ATOM   6049  O O6    . DG  I 7  21  ? 87.065  108.384 68.853  1.00 600.00 ? 18  DG  I O6    1 
ATOM   6050  N N1    . DG  I 7  21  ? 86.175  109.368 70.705  1.00 571.55 ? 18  DG  I N1    1 
ATOM   6051  C C2    . DG  I 7  21  ? 86.253  109.876 71.978  1.00 600.00 ? 18  DG  I C2    1 
ATOM   6052  N N2    . DG  I 7  21  ? 85.120  110.370 72.499  1.00 600.00 ? 18  DG  I N2    1 
ATOM   6053  N N3    . DG  I 7  21  ? 87.365  109.899 72.695  1.00 590.50 ? 18  DG  I N3    1 
ATOM   6054  C C4    . DG  I 7  21  ? 88.409  109.365 72.030  1.00 453.52 ? 18  DG  I C4    1 
ATOM   6055  P P     . DC  I 7  22  ? 90.718  108.818 77.908  1.00 381.44 ? 19  DC  I P     1 
ATOM   6056  O OP1   . DC  I 7  22  ? 91.189  109.417 79.184  1.00 302.57 ? 19  DC  I OP1   1 
ATOM   6057  O OP2   . DC  I 7  22  ? 91.218  107.489 77.467  1.00 394.99 ? 19  DC  I OP2   1 
ATOM   6058  O "O5'" . DC  I 7  22  ? 89.131  108.644 77.972  1.00 406.96 ? 19  DC  I "O5'" 1 
ATOM   6059  C "C5'" . DC  I 7  22  ? 88.275  109.790 78.166  1.00 382.65 ? 19  DC  I "C5'" 1 
ATOM   6060  C "C4'" . DC  I 7  22  ? 86.822  109.441 77.919  1.00 388.06 ? 19  DC  I "C4'" 1 
ATOM   6061  O "O4'" . DC  I 7  22  ? 86.613  109.172 76.513  1.00 423.56 ? 19  DC  I "O4'" 1 
ATOM   6062  C "C3'" . DC  I 7  22  ? 86.306  108.219 78.686  1.00 398.67 ? 19  DC  I "C3'" 1 
ATOM   6063  O "O3'" . DC  I 7  22  ? 85.121  108.589 79.413  1.00 378.06 ? 19  DC  I "O3'" 1 
ATOM   6064  C "C2'" . DC  I 7  22  ? 85.997  107.190 77.602  1.00 431.50 ? 19  DC  I "C2'" 1 
ATOM   6065  C "C1'" . DC  I 7  22  ? 85.803  108.021 76.345  1.00 441.86 ? 19  DC  I "C1'" 1 
ATOM   6066  N N1    . DC  I 7  22  ? 86.239  107.357 75.099  1.00 461.61 ? 19  DC  I N1    1 
ATOM   6067  C C2    . DC  I 7  22  ? 85.325  107.145 74.051  1.00 474.22 ? 19  DC  I C2    1 
ATOM   6068  O O2    . DC  I 7  22  ? 84.147  107.515 74.170  1.00 504.77 ? 19  DC  I O2    1 
ATOM   6069  N N3    . DC  I 7  22  ? 85.745  106.538 72.917  1.00 516.25 ? 19  DC  I N3    1 
ATOM   6070  C C4    . DC  I 7  22  ? 87.015  106.144 72.802  1.00 552.54 ? 19  DC  I C4    1 
ATOM   6071  N N4    . DC  I 7  22  ? 87.390  105.549 71.668  1.00 515.68 ? 19  DC  I N4    1 
ATOM   6072  C C5    . DC  I 7  22  ? 87.961  106.344 73.845  1.00 497.29 ? 19  DC  I C5    1 
ATOM   6073  C C6    . DC  I 7  22  ? 87.536  106.946 74.962  1.00 472.34 ? 19  DC  I C6    1 
ATOM   6074  P P     . DA  I 7  23  ? 84.508  107.676 80.596  1.00 355.05 ? 20  DA  I P     1 
ATOM   6075  O OP1   . DA  I 7  23  ? 83.721  108.555 81.497  1.00 268.91 ? 20  DA  I OP1   1 
ATOM   6076  O OP2   . DA  I 7  23  ? 85.598  106.837 81.159  1.00 336.61 ? 20  DA  I OP2   1 
ATOM   6077  O "O5'" . DA  I 7  23  ? 83.496  106.716 79.826  1.00 395.15 ? 20  DA  I "O5'" 1 
ATOM   6078  C "C5'" . DA  I 7  23  ? 82.366  107.258 79.114  1.00 416.07 ? 20  DA  I "C5'" 1 
ATOM   6079  C "C4'" . DA  I 7  23  ? 81.726  106.196 78.253  1.00 435.24 ? 20  DA  I "C4'" 1 
ATOM   6080  O "O4'" . DA  I 7  23  ? 82.488  106.023 77.043  1.00 455.27 ? 20  DA  I "O4'" 1 
ATOM   6081  C "C3'" . DA  I 7  23  ? 81.659  104.806 78.878  1.00 436.06 ? 20  DA  I "C3'" 1 
ATOM   6082  O "O3'" . DA  I 7  23  ? 80.406  104.654 79.572  1.00 433.98 ? 20  DA  I "O3'" 1 
ATOM   6083  C "C2'" . DA  I 7  23  ? 81.758  103.870 77.676  1.00 474.03 ? 20  DA  I "C2'" 1 
ATOM   6084  C "C1'" . DA  I 7  23  ? 82.213  104.740 76.511  1.00 486.05 ? 20  DA  I "C1'" 1 
ATOM   6085  N N9    . DA  I 7  23  ? 83.420  104.247 75.840  1.00 497.82 ? 20  DA  I N9    1 
ATOM   6086  C C8    . DA  I 7  23  ? 84.669  104.062 76.377  1.00 479.56 ? 20  DA  I C8    1 
ATOM   6087  N N7    . DA  I 7  23  ? 85.552  103.602 75.525  1.00 497.87 ? 20  DA  I N7    1 
ATOM   6088  C C5    . DA  I 7  23  ? 84.839  103.474 74.342  1.00 517.45 ? 20  DA  I C5    1 
ATOM   6089  C C6    . DA  I 7  23  ? 85.209  103.036 73.059  1.00 509.32 ? 20  DA  I C6    1 
ATOM   6090  N N6    . DA  I 7  23  ? 86.441  102.628 72.746  1.00 527.29 ? 20  DA  I N6    1 
ATOM   6091  N N1    . DA  I 7  23  ? 84.259  103.029 72.095  1.00 539.07 ? 20  DA  I N1    1 
ATOM   6092  C C2    . DA  I 7  23  ? 83.026  103.437 72.420  1.00 518.02 ? 20  DA  I C2    1 
ATOM   6093  N N3    . DA  I 7  23  ? 82.559  103.871 73.588  1.00 525.59 ? 20  DA  I N3    1 
ATOM   6094  C C4    . DA  I 7  23  ? 83.526  103.867 74.521  1.00 511.97 ? 20  DA  I C4    1 
ATOM   6095  P P     . DG  I 7  24  ? 80.001  103.297 80.352  1.00 426.51 ? 21  DG  I P     1 
ATOM   6096  O OP1   . DG  I 7  24  ? 79.007  103.645 81.398  1.00 357.66 ? 21  DG  I OP1   1 
ATOM   6097  O OP2   . DG  I 7  24  ? 81.245  102.578 80.736  1.00 422.31 ? 21  DG  I OP2   1 
ATOM   6098  O "O5'" . DG  I 7  24  ? 79.261  102.438 79.227  1.00 460.26 ? 21  DG  I "O5'" 1 
ATOM   6099  C "C5'" . DG  I 7  24  ? 78.103  102.965 78.546  1.00 464.03 ? 21  DG  I "C5'" 1 
ATOM   6100  C "C4'" . DG  I 7  24  ? 77.699  102.091 77.375  1.00 477.05 ? 21  DG  I "C4'" 1 
ATOM   6101  O "O4'" . DG  I 7  24  ? 78.774  102.041 76.398  1.00 489.14 ? 21  DG  I "O4'" 1 
ATOM   6102  C "C3'" . DG  I 7  24  ? 77.365  100.633 77.707  1.00 486.54 ? 21  DG  I "C3'" 1 
ATOM   6103  O "O3'" . DG  I 7  24  ? 76.239  100.216 76.911  1.00 495.46 ? 21  DG  I "O3'" 1 
ATOM   6104  C "C2'" . DG  I 7  24  ? 78.631  99.904  77.296  1.00 522.07 ? 21  DG  I "C2'" 1 
ATOM   6105  C "C1'" . DG  I 7  24  ? 79.054  100.689 76.069  1.00 540.96 ? 21  DG  I "C1'" 1 
ATOM   6106  N N9    . DG  I 7  24  ? 80.475  100.566 75.742  1.00 567.02 ? 21  DG  I N9    1 
ATOM   6107  C C8    . DG  I 7  24  ? 81.537  100.727 76.596  1.00 552.02 ? 21  DG  I C8    1 
ATOM   6108  N N7    . DG  I 7  24  ? 82.693  100.553 76.021  1.00 547.48 ? 21  DG  I N7    1 
ATOM   6109  C C5    . DG  I 7  24  ? 82.380  100.257 74.706  1.00 551.57 ? 21  DG  I C5    1 
ATOM   6110  C C6    . DG  I 7  24  ? 83.228  99.971  73.607  1.00 553.67 ? 21  DG  I C6    1 
ATOM   6111  O O6    . DG  I 7  24  ? 84.464  99.923  73.586  1.00 560.39 ? 21  DG  I O6    1 
ATOM   6112  N N1    . DG  I 7  24  ? 82.499  99.725  72.448  1.00 545.32 ? 21  DG  I N1    1 
ATOM   6113  C C2    . DG  I 7  24  ? 81.128  99.752  72.359  1.00 544.38 ? 21  DG  I C2    1 
ATOM   6114  N N2    . DG  I 7  24  ? 80.603  99.489  71.153  1.00 540.35 ? 21  DG  I N2    1 
ATOM   6115  N N3    . DG  I 7  24  ? 80.325  100.020 73.379  1.00 574.24 ? 21  DG  I N3    1 
ATOM   6116  C C4    . DG  I 7  24  ? 81.014  100.260 74.514  1.00 569.69 ? 21  DG  I C4    1 
ATOM   6117  P P     . DG  I 7  25  ? 75.491  98.803  77.142  1.00 421.57 ? 22  DG  I P     1 
ATOM   6118  O OP1   . DG  I 7  25  ? 74.033  99.022  76.970  1.00 526.53 ? 22  DG  I OP1   1 
ATOM   6119  O OP2   . DG  I 7  25  ? 76.001  98.198  78.400  1.00 479.40 ? 22  DG  I OP2   1 
ATOM   6120  O "O5'" . DG  I 7  25  ? 76.010  97.913  75.922  1.00 507.44 ? 22  DG  I "O5'" 1 
ATOM   6121  C "C5'" . DG  I 7  25  ? 75.690  98.283  74.565  1.00 518.62 ? 22  DG  I "C5'" 1 
ATOM   6122  C "C4'" . DG  I 7  25  ? 76.247  97.285  73.571  1.00 536.11 ? 22  DG  I "C4'" 1 
ATOM   6123  O "O4'" . DG  I 7  25  ? 77.674  97.491  73.431  1.00 570.52 ? 22  DG  I "O4'" 1 
ATOM   6124  C "C3'" . DG  I 7  25  ? 76.060  95.802  73.915  1.00 512.17 ? 22  DG  I "C3'" 1 
ATOM   6125  O "O3'" . DG  I 7  25  ? 75.611  95.103  72.739  1.00 497.19 ? 22  DG  I "O3'" 1 
ATOM   6126  C "C2'" . DG  I 7  25  ? 77.455  95.353  74.322  1.00 572.24 ? 22  DG  I "C2'" 1 
ATOM   6127  C "C1'" . DG  I 7  25  ? 78.344  96.244  73.476  1.00 600.00 ? 22  DG  I "C1'" 1 
ATOM   6128  N N9    . DG  I 7  25  ? 79.678  96.463  74.036  1.00 600.00 ? 22  DG  I N9    1 
ATOM   6129  C C8    . DG  I 7  25  ? 79.980  96.894  75.304  1.00 600.00 ? 22  DG  I C8    1 
ATOM   6130  N N7    . DG  I 7  25  ? 81.261  96.995  75.523  1.00 600.00 ? 22  DG  I N7    1 
ATOM   6131  C C5    . DG  I 7  25  ? 81.844  96.608  74.328  1.00 600.00 ? 22  DG  I C5    1 
ATOM   6132  C C6    . DG  I 7  25  ? 83.212  96.517  73.964  1.00 570.74 ? 22  DG  I C6    1 
ATOM   6133  O O6    . DG  I 7  25  ? 84.207  96.772  74.654  1.00 574.18 ? 22  DG  I O6    1 
ATOM   6134  N N1    . DG  I 7  25  ? 83.366  96.080  72.653  1.00 567.79 ? 22  DG  I N1    1 
ATOM   6135  C C2    . DG  I 7  25  ? 82.334  95.770  71.802  1.00 567.28 ? 22  DG  I C2    1 
ATOM   6136  N N2    . DG  I 7  25  ? 82.679  95.364  70.572  1.00 600.00 ? 22  DG  I N2    1 
ATOM   6137  N N3    . DG  I 7  25  ? 81.052  95.853  72.129  1.00 559.57 ? 22  DG  I N3    1 
ATOM   6138  C C4    . DG  I 7  25  ? 80.882  96.275  73.398  1.00 600.00 ? 22  DG  I C4    1 
ATOM   6139  P P     . DC  I 7  26  ? 75.018  93.601  72.799  1.00 479.20 ? 23  DC  I P     1 
ATOM   6140  O OP1   . DC  I 7  26  ? 73.959  93.468  71.767  1.00 510.36 ? 23  DC  I OP1   1 
ATOM   6141  O OP2   . DC  I 7  26  ? 74.740  93.246  74.214  1.00 477.89 ? 23  DC  I OP2   1 
ATOM   6142  O "O5'" . DC  I 7  26  ? 76.249  92.669  72.398  1.00 508.58 ? 23  DC  I "O5'" 1 
ATOM   6143  C "C5'" . DC  I 7  26  ? 76.860  92.770  71.098  1.00 521.10 ? 23  DC  I "C5'" 1 
ATOM   6144  C "C4'" . DC  I 7  26  ? 78.080  91.881  71.013  1.00 515.56 ? 23  DC  I "C4'" 1 
ATOM   6145  O "O4'" . DC  I 7  26  ? 79.219  92.571  71.561  1.00 562.57 ? 23  DC  I "O4'" 1 
ATOM   6146  C "C3'" . DC  I 7  26  ? 77.985  90.566  71.792  1.00 508.98 ? 23  DC  I "C3'" 1 
ATOM   6147  O "O3'" . DC  I 7  26  ? 77.677  89.495  70.881  1.00 487.79 ? 23  DC  I "O3'" 1 
ATOM   6148  C "C2'" . DC  I 7  26  ? 79.369  90.386  72.413  1.00 513.13 ? 23  DC  I "C2'" 1 
ATOM   6149  C "C1'" . DC  I 7  26  ? 80.163  91.607  71.983  1.00 593.65 ? 23  DC  I "C1'" 1 
ATOM   6150  N N1    . DC  I 7  26  ? 80.975  92.201  73.060  1.00 583.38 ? 23  DC  I N1    1 
ATOM   6151  C C2    . DC  I 7  26  ? 82.370  92.222  72.932  1.00 596.77 ? 23  DC  I C2    1 
ATOM   6152  O O2    . DC  I 7  26  ? 82.897  91.741  71.918  1.00 570.17 ? 23  DC  I O2    1 
ATOM   6153  N N3    . DC  I 7  26  ? 83.116  92.768  73.916  1.00 594.40 ? 23  DC  I N3    1 
ATOM   6154  C C4    . DC  I 7  26  ? 82.524  93.279  74.998  1.00 600.00 ? 23  DC  I C4    1 
ATOM   6155  N N4    . DC  I 7  26  ? 83.304  93.806  75.945  1.00 600.00 ? 23  DC  I N4    1 
ATOM   6156  C C5    . DC  I 7  26  ? 81.110  93.271  75.156  1.00 600.00 ? 23  DC  I C5    1 
ATOM   6157  C C6    . DC  I 7  26  ? 80.381  92.728  74.174  1.00 535.25 ? 23  DC  I C6    1 
ATOM   6158  P P     . DC  I 7  27  ? 77.394  87.986  71.384  1.00 481.96 ? 24  DC  I P     1 
ATOM   6159  O OP1   . DC  I 7  27  ? 76.485  87.323  70.414  1.00 473.85 ? 24  DC  I OP1   1 
ATOM   6160  O OP2   . DC  I 7  27  ? 77.055  88.009  72.831  1.00 481.98 ? 24  DC  I OP2   1 
ATOM   6161  O "O5'" . DC  I 7  27  ? 78.820  87.267  71.330  1.00 477.73 ? 24  DC  I "O5'" 1 
ATOM   6162  C "C5'" . DC  I 7  27  ? 79.642  87.324  70.145  1.00 477.25 ? 24  DC  I "C5'" 1 
ATOM   6163  C "C4'" . DC  I 7  27  ? 81.017  86.755  70.419  1.00 474.29 ? 24  DC  I "C4'" 1 
ATOM   6164  O "O4'" . DC  I 7  27  ? 81.780  87.700  71.203  1.00 491.90 ? 24  DC  I "O4'" 1 
ATOM   6165  C "C3'" . DC  I 7  27  ? 81.018  85.435  71.196  1.00 469.20 ? 24  DC  I "C3'" 1 
ATOM   6166  O "O3'" . DC  I 7  27  ? 81.694  84.422  70.434  1.00 469.37 ? 24  DC  I "O3'" 1 
ATOM   6167  C "C2'" . DC  I 7  27  ? 81.779  85.738  72.480  1.00 472.39 ? 24  DC  I "C2'" 1 
ATOM   6168  C "C1'" . DC  I 7  27  ? 82.550  87.008  72.169  1.00 479.31 ? 24  DC  I "C1'" 1 
ATOM   6169  N N1    . DC  I 7  27  ? 82.724  87.909  73.324  1.00 497.44 ? 24  DC  I N1    1 
ATOM   6170  C C2    . DC  I 7  27  ? 84.010  88.337  73.693  1.00 495.64 ? 24  DC  I C2    1 
ATOM   6171  O O2    . DC  I 7  27  ? 84.999  87.956  73.047  1.00 500.26 ? 24  DC  I O2    1 
ATOM   6172  N N3    . DC  I 7  27  ? 84.151  89.162  74.753  1.00 521.94 ? 24  DC  I N3    1 
ATOM   6173  C C4    . DC  I 7  27  ? 83.074  89.560  75.435  1.00 528.50 ? 24  DC  I C4    1 
ATOM   6174  N N4    . DC  I 7  27  ? 83.249  90.374  76.475  1.00 536.60 ? 24  DC  I N4    1 
ATOM   6175  C C5    . DC  I 7  27  ? 81.764  89.142  75.086  1.00 512.70 ? 24  DC  I C5    1 
ATOM   6176  C C6    . DC  I 7  27  ? 81.635  88.327  74.036  1.00 513.67 ? 24  DC  I C6    1 
ATOM   6177  P P     . DG  I 7  28  ? 81.527  82.856  70.785  1.00 465.81 ? 25  DG  I P     1 
ATOM   6178  O OP1   . DG  I 7  28  ? 80.958  82.178  69.593  1.00 452.88 ? 25  DG  I OP1   1 
ATOM   6179  O OP2   . DG  I 7  28  ? 80.820  82.744  72.088  1.00 462.50 ? 25  DG  I OP2   1 
ATOM   6180  O "O5'" . DG  I 7  28  ? 83.016  82.312  71.003  1.00 456.87 ? 25  DG  I "O5'" 1 
ATOM   6181  C "C5'" . DG  I 7  28  ? 84.194  83.155  70.966  1.00 460.67 ? 25  DG  I "C5'" 1 
ATOM   6182  C "C4'" . DG  I 7  28  ? 85.121  82.835  72.120  1.00 448.30 ? 25  DG  I "C4'" 1 
ATOM   6183  O "O4'" . DG  I 7  28  ? 85.147  83.958  73.041  1.00 454.65 ? 25  DG  I "O4'" 1 
ATOM   6184  C "C3'" . DG  I 7  28  ? 84.744  81.604  72.953  1.00 438.29 ? 25  DG  I "C3'" 1 
ATOM   6185  O "O3'" . DG  I 7  28  ? 85.914  80.800  73.188  1.00 427.01 ? 25  DG  I "O3'" 1 
ATOM   6186  C "C2'" . DG  I 7  28  ? 84.224  82.208  74.245  1.00 434.89 ? 25  DG  I "C2'" 1 
ATOM   6187  C "C1'" . DG  I 7  28  ? 85.070  83.463  74.366  1.00 445.38 ? 25  DG  I "C1'" 1 
ATOM   6188  N N9    . DG  I 7  28  ? 84.509  84.497  75.239  1.00 450.07 ? 25  DG  I N9    1 
ATOM   6189  C C8    . DG  I 7  28  ? 83.179  84.782  75.446  1.00 462.74 ? 25  DG  I C8    1 
ATOM   6190  N N7    . DG  I 7  28  ? 82.985  85.757  76.285  1.00 462.28 ? 25  DG  I N7    1 
ATOM   6191  C C5    . DG  I 7  28  ? 84.259  86.146  76.661  1.00 447.01 ? 25  DG  I C5    1 
ATOM   6192  C C6    . DG  I 7  28  ? 84.673  87.164  77.555  1.00 453.83 ? 25  DG  I C6    1 
ATOM   6193  O O6    . DG  I 7  28  ? 83.966  87.942  78.205  1.00 469.84 ? 25  DG  I O6    1 
ATOM   6194  N N1    . DG  I 7  28  ? 86.059  87.229  77.654  1.00 474.64 ? 25  DG  I N1    1 
ATOM   6195  C C2    . DG  I 7  28  ? 86.935  86.416  76.977  1.00 462.06 ? 25  DG  I C2    1 
ATOM   6196  N N2    . DG  I 7  28  ? 88.242  86.634  77.205  1.00 463.63 ? 25  DG  I N2    1 
ATOM   6197  N N3    . DG  I 7  28  ? 86.559  85.460  76.136  1.00 458.30 ? 25  DG  I N3    1 
ATOM   6198  C C4    . DG  I 7  28  ? 85.214  85.381  76.027  1.00 467.51 ? 25  DG  I C4    1 
ATOM   6199  P P     . DC  I 7  29  ? 85.810  79.266  73.686  1.00 416.97 ? 26  DC  I P     1 
ATOM   6200  O OP1   . DC  I 7  29  ? 87.052  78.555  73.293  1.00 398.51 ? 26  DC  I OP1   1 
ATOM   6201  O OP2   . DC  I 7  29  ? 84.484  78.720  73.301  1.00 408.61 ? 26  DC  I OP2   1 
ATOM   6202  O "O5'" . DC  I 7  29  ? 85.747  79.358  75.279  1.00 410.34 ? 26  DC  I "O5'" 1 
ATOM   6203  C "C5'" . DC  I 7  29  ? 86.900  79.076  76.098  1.00 399.36 ? 26  DC  I "C5'" 1 
ATOM   6204  C "C4'" . DC  I 7  29  ? 87.827  80.271  76.116  1.00 400.90 ? 26  DC  I "C4'" 1 
ATOM   6205  O "O4'" . DC  I 7  29  ? 87.065  81.486  76.323  1.00 416.62 ? 26  DC  I "O4'" 1 
ATOM   6206  C "C3'" . DC  I 7  29  ? 88.862  80.278  77.237  1.00 386.92 ? 26  DC  I "C3'" 1 
ATOM   6207  O "O3'" . DC  I 7  29  ? 89.998  81.060  76.828  1.00 381.10 ? 26  DC  I "O3'" 1 
ATOM   6208  C "C2'" . DC  I 7  29  ? 88.098  80.972  78.348  1.00 384.13 ? 26  DC  I "C2'" 1 
ATOM   6209  C "C1'" . DC  I 7  29  ? 87.405  82.072  77.573  1.00 406.80 ? 26  DC  I "C1'" 1 
ATOM   6210  N N1    . DC  I 7  29  ? 86.156  82.600  78.151  1.00 416.92 ? 26  DC  I N1    1 
ATOM   6211  C C2    . DC  I 7  29  ? 86.196  83.713  79.002  1.00 420.20 ? 26  DC  I C2    1 
ATOM   6212  O O2    . DC  I 7  29  ? 87.285  84.240  79.270  1.00 417.15 ? 26  DC  I O2    1 
ATOM   6213  N N3    . DC  I 7  29  ? 85.044  84.193  79.518  1.00 418.55 ? 26  DC  I N3    1 
ATOM   6214  C C4    . DC  I 7  29  ? 83.883  83.608  79.215  1.00 424.19 ? 26  DC  I C4    1 
ATOM   6215  N N4    . DC  I 7  29  ? 82.769  84.113  79.748  1.00 426.79 ? 26  DC  I N4    1 
ATOM   6216  C C5    . DC  I 7  29  ? 83.814  82.475  78.357  1.00 427.73 ? 26  DC  I C5    1 
ATOM   6217  C C6    . DC  I 7  29  ? 84.962  82.012  77.852  1.00 423.94 ? 26  DC  I C6    1 
ATOM   6218  P P     . DT  I 7  30  ? 91.506  80.625  77.198  1.00 375.44 ? 27  DT  I P     1 
ATOM   6219  O OP1   . DT  I 7  30  ? 92.442  81.553  76.517  1.00 366.82 ? 27  DT  I OP1   1 
ATOM   6220  O OP2   . DT  I 7  30  ? 91.634  79.161  76.978  1.00 366.56 ? 27  DT  I OP2   1 
ATOM   6221  O "O5'" . DT  I 7  30  ? 91.583  80.899  78.764  1.00 361.88 ? 27  DT  I "O5'" 1 
ATOM   6222  C "C5'" . DT  I 7  30  ? 91.614  82.245  79.277  1.00 360.45 ? 27  DT  I "C5'" 1 
ATOM   6223  C "C4'" . DT  I 7  30  ? 91.645  82.218  80.786  1.00 349.29 ? 27  DT  I "C4'" 1 
ATOM   6224  O "O4'" . DT  I 7  30  ? 90.336  82.567  81.311  1.00 353.95 ? 27  DT  I "O4'" 1 
ATOM   6225  C "C3'" . DT  I 7  30  ? 91.970  80.849  81.387  1.00 343.16 ? 27  DT  I "C3'" 1 
ATOM   6226  O "O3'" . DT  I 7  30  ? 92.635  81.002  82.646  1.00 329.79 ? 27  DT  I "O3'" 1 
ATOM   6227  C "C2'" . DT  I 7  30  ? 90.580  80.285  81.599  1.00 342.81 ? 27  DT  I "C2'" 1 
ATOM   6228  C "C1'" . DT  I 7  30  ? 89.884  81.516  82.152  1.00 339.83 ? 27  DT  I "C1'" 1 
ATOM   6229  N N1    . DT  I 7  30  ? 88.402  81.524  82.150  1.00 350.50 ? 27  DT  I N1    1 
ATOM   6230  C C2    . DT  I 7  30  ? 87.773  82.600  82.741  1.00 355.57 ? 27  DT  I C2    1 
ATOM   6231  O O2    . DT  I 7  30  ? 88.383  83.523  83.258  1.00 353.17 ? 27  DT  I O2    1 
ATOM   6232  N N3    . DT  I 7  30  ? 86.400  82.559  82.707  1.00 361.37 ? 27  DT  I N3    1 
ATOM   6233  C C4    . DT  I 7  30  ? 85.613  81.570  82.153  1.00 361.37 ? 27  DT  I C4    1 
ATOM   6234  O O4    . DT  I 7  30  ? 84.388  81.657  82.186  1.00 362.68 ? 27  DT  I O4    1 
ATOM   6235  C C5    . DT  I 7  30  ? 86.332  80.476  81.554  1.00 364.94 ? 27  DT  I C5    1 
ATOM   6236  C C7    . DT  I 7  30  ? 85.558  79.360  80.930  1.00 369.26 ? 27  DT  I C7    1 
ATOM   6237  C C6    . DT  I 7  30  ? 87.667  80.505  81.581  1.00 355.89 ? 27  DT  I C6    1 
ATOM   6238  P P     . DC  I 7  31  ? 94.241  80.997  82.778  1.00 330.82 ? 28  DC  I P     1 
ATOM   6239  O OP1   . DC  I 7  31  ? 94.846  81.819  81.698  1.00 334.63 ? 28  DC  I OP1   1 
ATOM   6240  O OP2   . DC  I 7  31  ? 94.690  79.598  83.004  1.00 329.85 ? 28  DC  I OP2   1 
ATOM   6241  O "O5'" . DC  I 7  31  ? 94.498  81.726  84.171  1.00 320.47 ? 28  DC  I "O5'" 1 
ATOM   6242  C "C5'" . DC  I 7  31  ? 94.132  83.110  84.346  1.00 317.44 ? 28  DC  I "C5'" 1 
ATOM   6243  C "C4'" . DC  I 7  31  ? 93.245  83.287  85.560  1.00 306.01 ? 28  DC  I "C4'" 1 
ATOM   6244  O "O4'" . DC  I 7  31  ? 91.928  82.731  85.303  1.00 312.34 ? 28  DC  I "O4'" 1 
ATOM   6245  C "C3'" . DC  I 7  31  ? 93.748  82.589  86.828  1.00 298.91 ? 28  DC  I "C3'" 1 
ATOM   6246  O "O3'" . DC  I 7  31  ? 93.450  83.379  87.986  1.00 284.47 ? 28  DC  I "O3'" 1 
ATOM   6247  C "C2'" . DC  I 7  31  ? 92.918  81.323  86.852  1.00 299.20 ? 28  DC  I "C2'" 1 
ATOM   6248  C "C1'" . DC  I 7  31  ? 91.581  81.857  86.363  1.00 298.43 ? 28  DC  I "C1'" 1 
ATOM   6249  N N1    . DC  I 7  31  ? 90.596  80.871  85.862  1.00 304.74 ? 28  DC  I N1    1 
ATOM   6250  C C2    . DC  I 7  31  ? 89.233  81.209  85.898  1.00 303.73 ? 28  DC  I C2    1 
ATOM   6251  O O2    . DC  I 7  31  ? 88.886  82.312  86.345  1.00 299.16 ? 28  DC  I O2    1 
ATOM   6252  N N3    . DC  I 7  31  ? 88.313  80.328  85.446  1.00 307.36 ? 28  DC  I N3    1 
ATOM   6253  C C4    . DC  I 7  31  ? 88.703  79.146  84.969  1.00 314.08 ? 28  DC  I C4    1 
ATOM   6254  N N4    . DC  I 7  31  ? 87.767  78.302  84.530  1.00 318.38 ? 28  DC  I N4    1 
ATOM   6255  C C5    . DC  I 7  31  ? 90.072  78.773  84.918  1.00 313.58 ? 28  DC  I C5    1 
ATOM   6256  C C6    . DC  I 7  31  ? 90.975  79.650  85.367  1.00 310.72 ? 28  DC  I C6    1 
ATOM   6257  P P     . DA  I 7  32  ? 94.557  84.303  88.701  1.00 283.48 ? 29  DA  I P     1 
ATOM   6258  O OP1   . DA  I 7  32  ? 95.097  85.265  87.705  1.00 288.31 ? 29  DA  I OP1   1 
ATOM   6259  O OP2   . DA  I 7  32  ? 95.485  83.416  89.450  1.00 285.96 ? 29  DA  I OP2   1 
ATOM   6260  O "O5'" . DA  I 7  32  ? 93.686  85.114  89.760  1.00 272.46 ? 29  DA  I "O5'" 1 
ATOM   6261  C "C5'" . DA  I 7  32  ? 92.875  86.225  89.333  1.00 265.07 ? 29  DA  I "C5'" 1 
ATOM   6262  C "C4'" . DA  I 7  32  ? 91.539  86.236  90.042  1.00 249.17 ? 29  DA  I "C4'" 1 
ATOM   6263  O "O4'" . DA  I 7  32  ? 90.722  85.136  89.569  1.00 258.30 ? 29  DA  I "O4'" 1 
ATOM   6264  C "C3'" . DA  I 7  32  ? 91.583  86.102  91.566  1.00 241.47 ? 29  DA  I "C3'" 1 
ATOM   6265  O "O3'" . DA  I 7  32  ? 90.566  86.956  92.119  1.00 227.99 ? 29  DA  I "O3'" 1 
ATOM   6266  C "C2'" . DA  I 7  32  ? 91.275  84.625  91.778  1.00 244.77 ? 29  DA  I "C2'" 1 
ATOM   6267  C "C1'" . DA  I 7  32  ? 90.281  84.349  90.665  1.00 246.42 ? 29  DA  I "C1'" 1 
ATOM   6268  N N9    . DA  I 7  32  ? 90.208  82.954  90.220  1.00 259.10 ? 29  DA  I N9    1 
ATOM   6269  C C8    . DA  I 7  32  ? 91.225  82.043  90.070  1.00 267.11 ? 29  DA  I C8    1 
ATOM   6270  N N7    . DA  I 7  32  ? 90.826  80.867  89.648  1.00 268.43 ? 29  DA  I N7    1 
ATOM   6271  C C5    . DA  I 7  32  ? 89.457  81.011  89.509  1.00 263.15 ? 29  DA  I C5    1 
ATOM   6272  C C6    . DA  I 7  32  ? 88.453  80.122  89.097  1.00 265.71 ? 29  DA  I C6    1 
ATOM   6273  N N6    . DA  I 7  32  ? 88.688  78.862  88.730  1.00 267.22 ? 29  DA  I N6    1 
ATOM   6274  N N1    . DA  I 7  32  ? 87.184  80.580  89.072  1.00 263.72 ? 29  DA  I N1    1 
ATOM   6275  C C2    . DA  I 7  32  ? 86.958  81.846  89.440  1.00 257.60 ? 29  DA  I C2    1 
ATOM   6276  N N3    . DA  I 7  32  ? 87.815  82.775  89.845  1.00 251.34 ? 29  DA  I N3    1 
ATOM   6277  C C4    . DA  I 7  32  ? 89.064  82.288  89.859  1.00 256.22 ? 29  DA  I C4    1 
ATOM   6278  P P     . DA  I 7  33  ? 90.322  87.132  93.704  1.00 198.33 ? 30  DA  I P     1 
ATOM   6279  O OP1   . DA  I 7  33  ? 90.278  88.584  94.011  1.00 178.20 ? 30  DA  I OP1   1 
ATOM   6280  O OP2   . DA  I 7  33  ? 91.280  86.256  94.428  1.00 197.45 ? 30  DA  I OP2   1 
ATOM   6281  O "O5'" . DA  I 7  33  ? 88.857  86.533  93.901  1.00 210.93 ? 30  DA  I "O5'" 1 
ATOM   6282  C "C5'" . DA  I 7  33  ? 87.791  86.892  92.997  1.00 211.64 ? 30  DA  I "C5'" 1 
ATOM   6283  C "C4'" . DA  I 7  33  ? 86.540  86.097  93.289  1.00 199.99 ? 30  DA  I "C4'" 1 
ATOM   6284  O "O4'" . DA  I 7  33  ? 86.668  84.777  92.709  1.00 214.36 ? 30  DA  I "O4'" 1 
ATOM   6285  C "C3'" . DA  I 7  33  ? 86.222  85.891  94.771  1.00 192.31 ? 30  DA  I "C3'" 1 
ATOM   6286  O "O3'" . DA  I 7  33  ? 84.809  86.071  94.975  1.00 189.49 ? 30  DA  I "O3'" 1 
ATOM   6287  C "C2'" . DA  I 7  33  ? 86.652  84.451  95.018  1.00 198.61 ? 30  DA  I "C2'" 1 
ATOM   6288  C "C1'" . DA  I 7  33  ? 86.372  83.789  93.680  1.00 207.51 ? 30  DA  I "C1'" 1 
ATOM   6289  N N9    . DA  I 7  33  ? 87.198  82.612  93.394  1.00 219.29 ? 30  DA  I N9    1 
ATOM   6290  C C8    . DA  I 7  33  ? 88.557  82.482  93.515  1.00 225.67 ? 30  DA  I C8    1 
ATOM   6291  N N7    . DA  I 7  33  ? 89.012  81.298  93.180  1.00 230.63 ? 30  DA  I N7    1 
ATOM   6292  C C5    . DA  I 7  33  ? 87.875  80.600  92.812  1.00 225.91 ? 30  DA  I C5    1 
ATOM   6293  C C6    . DA  I 7  33  ? 87.677  79.287  92.358  1.00 228.15 ? 30  DA  I C6    1 
ATOM   6294  N N6    . DA  I 7  33  ? 88.658  78.398  92.182  1.00 230.76 ? 30  DA  I N6    1 
ATOM   6295  N N1    . DA  I 7  33  ? 86.416  78.902  92.079  1.00 230.33 ? 30  DA  I N1    1 
ATOM   6296  C C2    . DA  I 7  33  ? 85.427  79.784  92.251  1.00 227.73 ? 30  DA  I C2    1 
ATOM   6297  N N3    . DA  I 7  33  ? 85.487  81.043  92.671  1.00 221.76 ? 30  DA  I N3    1 
ATOM   6298  C C4    . DA  I 7  33  ? 86.751  81.394  92.940  1.00 220.32 ? 30  DA  I C4    1 
ATOM   6299  P P     . DT  I 7  34  ? 84.133  86.096  96.441  1.00 164.23 ? 31  DT  I P     1 
ATOM   6300  O OP1   . DT  I 7  34  ? 83.121  87.183  96.471  1.00 157.13 ? 31  DT  I OP1   1 
ATOM   6301  O OP2   . DT  I 7  34  ? 85.209  86.066  97.465  1.00 162.12 ? 31  DT  I OP2   1 
ATOM   6302  O "O5'" . DT  I 7  34  ? 83.367  84.700  96.489  1.00 171.03 ? 31  DT  I "O5'" 1 
ATOM   6303  C "C5'" . DT  I 7  34  ? 82.445  84.348  95.441  1.00 172.16 ? 31  DT  I "C5'" 1 
ATOM   6304  C "C4'" . DT  I 7  34  ? 81.954  82.930  95.609  1.00 173.22 ? 31  DT  I "C4'" 1 
ATOM   6305  O "O4'" . DT  I 7  34  ? 82.976  82.010  95.159  1.00 184.23 ? 31  DT  I "O4'" 1 
ATOM   6306  C "C3'" . DT  I 7  34  ? 81.592  82.519  97.039  1.00 171.59 ? 31  DT  I "C3'" 1 
ATOM   6307  O "O3'" . DT  I 7  34  ? 80.253  82.000  97.037  1.00 171.63 ? 31  DT  I "O3'" 1 
ATOM   6308  C "C2'" . DT  I 7  34  ? 82.615  81.441  97.381  1.00 176.31 ? 31  DT  I "C2'" 1 
ATOM   6309  C "C1'" . DT  I 7  34  ? 83.002  80.893  96.022  1.00 181.20 ? 31  DT  I "C1'" 1 
ATOM   6310  N N1    . DT  I 7  34  ? 84.346  80.280  95.949  1.00 188.97 ? 31  DT  I N1    1 
ATOM   6311  C C2    . DT  I 7  34  ? 84.453  78.996  95.463  1.00 192.60 ? 31  DT  I C2    1 
ATOM   6312  O O2    . DT  I 7  34  ? 83.493  78.344  95.091  1.00 191.33 ? 31  DT  I O2    1 
ATOM   6313  N N3    . DT  I 7  34  ? 85.732  78.498  95.425  1.00 197.85 ? 31  DT  I N3    1 
ATOM   6314  C C4    . DT  I 7  34  ? 86.887  79.138  95.816  1.00 200.21 ? 31  DT  I C4    1 
ATOM   6315  O O4    . DT  I 7  34  ? 87.974  78.571  95.723  1.00 202.57 ? 31  DT  I O4    1 
ATOM   6316  C C5    . DT  I 7  34  ? 86.704  80.477  96.314  1.00 200.26 ? 31  DT  I C5    1 
ATOM   6317  C C7    . DT  I 7  34  ? 87.906  81.236  96.765  1.00 207.65 ? 31  DT  I C7    1 
ATOM   6318  C C6    . DT  I 7  34  ? 85.463  80.976  96.356  1.00 194.46 ? 31  DT  I C6    1 
ATOM   6319  P P     . DT  I 7  35  ? 79.460  81.639  98.396  1.00 166.52 ? 32  DT  I P     1 
ATOM   6320  O OP1   . DT  I 7  35  ? 78.027  81.970  98.201  1.00 171.45 ? 32  DT  I OP1   1 
ATOM   6321  O OP2   . DT  I 7  35  ? 80.197  82.219  99.548  1.00 168.49 ? 32  DT  I OP2   1 
ATOM   6322  O "O5'" . DT  I 7  35  ? 79.603  80.054  98.471  1.00 173.37 ? 32  DT  I "O5'" 1 
ATOM   6323  C "C5'" . DT  I 7  35  ? 79.265  79.237  97.334  1.00 177.06 ? 32  DT  I "C5'" 1 
ATOM   6324  C "C4'" . DT  I 7  35  ? 79.610  77.790  97.593  1.00 177.83 ? 32  DT  I "C4'" 1 
ATOM   6325  O "O4'" . DT  I 7  35  ? 81.018  77.579  97.351  1.00 178.21 ? 32  DT  I "O4'" 1 
ATOM   6326  C "C3'" . DT  I 7  35  ? 79.329  77.291  99.012  1.00 178.41 ? 32  DT  I "C3'" 1 
ATOM   6327  O "O3'" . DT  I 7  35  ? 78.397  76.201  98.933  1.00 182.02 ? 32  DT  I "O3'" 1 
ATOM   6328  C "C2'" . DT  I 7  35  ? 80.688  76.826  99.534  1.00 174.70 ? 32  DT  I "C2'" 1 
ATOM   6329  C "C1'" . DT  I 7  35  ? 81.509  76.630  98.273  1.00 175.06 ? 32  DT  I "C1'" 1 
ATOM   6330  N N1    . DT  I 7  35  ? 82.959  76.863  98.432  1.00 175.18 ? 32  DT  I N1    1 
ATOM   6331  C C2    . DT  I 7  35  ? 83.831  75.851  98.093  1.00 174.83 ? 32  DT  I C2    1 
ATOM   6332  O O2    . DT  I 7  35  ? 83.459  74.769  97.668  1.00 176.75 ? 32  DT  I O2    1 
ATOM   6333  N N3    . DT  I 7  35  ? 85.158  76.154  98.271  1.00 177.71 ? 32  DT  I N3    1 
ATOM   6334  C C4    . DT  I 7  35  ? 85.685  77.339  98.743  1.00 178.19 ? 32  DT  I C4    1 
ATOM   6335  O O4    . DT  I 7  35  ? 86.899  77.482  98.852  1.00 180.75 ? 32  DT  I O4    1 
ATOM   6336  C C5    . DT  I 7  35  ? 84.717  78.350  99.078  1.00 178.31 ? 32  DT  I C5    1 
ATOM   6337  C C7    . DT  I 7  35  ? 85.202  79.658  99.609  1.00 183.95 ? 32  DT  I C7    1 
ATOM   6338  C C6    . DT  I 7  35  ? 83.422  78.068  98.909  1.00 175.73 ? 32  DT  I C6    1 
ATOM   6339  P P     . DG  I 7  36  ? 77.625  75.636  100.230 1.00 181.93 ? 33  DG  I P     1 
ATOM   6340  O OP1   . DG  I 7  36  ? 76.326  75.070  99.786  1.00 184.91 ? 33  DG  I OP1   1 
ATOM   6341  O OP2   . DG  I 7  36  ? 77.649  76.677  101.290 1.00 180.87 ? 33  DG  I OP2   1 
ATOM   6342  O "O5'" . DG  I 7  36  ? 78.559  74.436  100.701 1.00 179.47 ? 33  DG  I "O5'" 1 
ATOM   6343  C "C5'" . DG  I 7  36  ? 78.946  73.404  99.773  1.00 180.34 ? 33  DG  I "C5'" 1 
ATOM   6344  C "C4'" . DG  I 7  36  ? 79.873  72.417  100.442 1.00 176.57 ? 33  DG  I "C4'" 1 
ATOM   6345  O "O4'" . DG  I 7  36  ? 81.243  72.881  100.321 1.00 172.02 ? 33  DG  I "O4'" 1 
ATOM   6346  C "C3'" . DG  I 7  36  ? 79.631  72.198  101.937 1.00 174.81 ? 33  DG  I "C3'" 1 
ATOM   6347  O "O3'" . DG  I 7  36  ? 79.789  70.803  102.236 1.00 173.54 ? 33  DG  I "O3'" 1 
ATOM   6348  C "C2'" . DG  I 7  36  ? 80.729  73.025  102.581 1.00 169.11 ? 33  DG  I "C2'" 1 
ATOM   6349  C "C1'" . DG  I 7  36  ? 81.865  72.836  101.595 1.00 165.31 ? 33  DG  I "C1'" 1 
ATOM   6350  N N9    . DG  I 7  36  ? 82.902  73.865  101.638 1.00 163.15 ? 33  DG  I N9    1 
ATOM   6351  C C8    . DG  I 7  36  ? 82.746  75.205  101.899 1.00 164.02 ? 33  DG  I C8    1 
ATOM   6352  N N7    . DG  I 7  36  ? 83.866  75.867  101.867 1.00 163.35 ? 33  DG  I N7    1 
ATOM   6353  C C5    . DG  I 7  36  ? 84.822  74.912  101.567 1.00 162.68 ? 33  DG  I C5    1 
ATOM   6354  C C6    . DG  I 7  36  ? 86.222  75.039  101.401 1.00 164.32 ? 33  DG  I C6    1 
ATOM   6355  O O6    . DG  I 7  36  ? 86.916  76.057  101.486 1.00 162.15 ? 33  DG  I O6    1 
ATOM   6356  N N1    . DG  I 7  36  ? 86.815  73.818  101.103 1.00 163.48 ? 33  DG  I N1    1 
ATOM   6357  C C2    . DG  I 7  36  ? 86.145  72.627  100.982 1.00 160.62 ? 33  DG  I C2    1 
ATOM   6358  N N2    . DG  I 7  36  ? 86.895  71.552  100.689 1.00 163.88 ? 33  DG  I N2    1 
ATOM   6359  N N3    . DG  I 7  36  ? 84.837  72.495  101.133 1.00 159.53 ? 33  DG  I N3    1 
ATOM   6360  C C4    . DG  I 7  36  ? 84.244  73.671  101.423 1.00 162.97 ? 33  DG  I C4    1 
ATOM   6361  P P     . DG  I 7  37  ? 79.271  70.164  103.622 1.00 181.10 ? 34  DG  I P     1 
ATOM   6362  O OP1   . DG  I 7  37  ? 78.542  68.909  103.308 1.00 176.28 ? 34  DG  I OP1   1 
ATOM   6363  O OP2   . DG  I 7  37  ? 78.596  71.223  104.418 1.00 175.89 ? 34  DG  I OP2   1 
ATOM   6364  O "O5'" . DG  I 7  37  ? 80.629  69.788  104.366 1.00 170.92 ? 34  DG  I "O5'" 1 
ATOM   6365  C "C5'" . DG  I 7  37  ? 81.119  68.433  104.356 1.00 168.67 ? 34  DG  I "C5'" 1 
ATOM   6366  C "C4'" . DG  I 7  37  ? 82.630  68.413  104.364 1.00 167.85 ? 34  DG  I "C4'" 1 
ATOM   6367  O "O4'" . DG  I 7  37  ? 83.143  69.654  103.845 1.00 163.77 ? 34  DG  I "O4'" 1 
ATOM   6368  C "C3'" . DG  I 7  37  ? 83.290  68.279  105.731 1.00 163.80 ? 34  DG  I "C3'" 1 
ATOM   6369  O "O3'" . DG  I 7  37  ? 83.489  66.888  106.034 1.00 165.64 ? 34  DG  I "O3'" 1 
ATOM   6370  C "C2'" . DG  I 7  37  ? 84.624  68.998  105.562 1.00 157.58 ? 34  DG  I "C2'" 1 
ATOM   6371  C "C1'" . DG  I 7  37  ? 84.483  69.800  104.279 1.00 158.13 ? 34  DG  I "C1'" 1 
ATOM   6372  N N9    . DG  I 7  37  ? 84.756  71.221  104.449 1.00 154.95 ? 34  DG  I N9    1 
ATOM   6373  C C8    . DG  I 7  37  ? 83.850  72.220  104.699 1.00 156.04 ? 34  DG  I C8    1 
ATOM   6374  N N7    . DG  I 7  37  ? 84.401  73.398  104.798 1.00 152.98 ? 34  DG  I N7    1 
ATOM   6375  C C5    . DG  I 7  37  ? 85.753  73.161  104.602 1.00 151.06 ? 34  DG  I C5    1 
ATOM   6376  C C6    . DG  I 7  37  ? 86.851  74.056  104.595 1.00 147.83 ? 34  DG  I C6    1 
ATOM   6377  O O6    . DG  I 7  37  ? 86.839  75.281  104.763 1.00 149.16 ? 34  DG  I O6    1 
ATOM   6378  N N1    . DG  I 7  37  ? 88.051  73.392  104.358 1.00 150.83 ? 34  DG  I N1    1 
ATOM   6379  C C2    . DG  I 7  37  ? 88.174  72.041  104.156 1.00 151.42 ? 34  DG  I C2    1 
ATOM   6380  N N2    . DG  I 7  37  ? 89.412  71.577  103.941 1.00 150.14 ? 34  DG  I N2    1 
ATOM   6381  N N3    . DG  I 7  37  ? 87.156  71.198  104.160 1.00 149.99 ? 34  DG  I N3    1 
ATOM   6382  C C4    . DG  I 7  37  ? 85.986  71.822  104.387 1.00 151.53 ? 34  DG  I C4    1 
ATOM   6383  P P     . DT  I 7  38  ? 83.942  66.406  107.504 1.00 165.86 ? 35  DT  I P     1 
ATOM   6384  O OP1   . DT  I 7  38  ? 83.790  64.932  107.577 1.00 167.17 ? 35  DT  I OP1   1 
ATOM   6385  O OP2   . DT  I 7  38  ? 83.259  67.266  108.504 1.00 165.49 ? 35  DT  I OP2   1 
ATOM   6386  O "O5'" . DT  I 7  38  ? 85.497  66.753  107.537 1.00 158.92 ? 35  DT  I "O5'" 1 
ATOM   6387  C "C5'" . DT  I 7  38  ? 86.432  65.943  106.802 1.00 158.76 ? 35  DT  I "C5'" 1 
ATOM   6388  C "C4'" . DT  I 7  38  ? 87.850  66.413  107.034 1.00 157.28 ? 35  DT  I "C4'" 1 
ATOM   6389  O "O4'" . DT  I 7  38  ? 87.961  67.817  106.701 1.00 153.60 ? 35  DT  I "O4'" 1 
ATOM   6390  C "C3'" . DT  I 7  38  ? 88.355  66.256  108.469 1.00 154.79 ? 35  DT  I "C3'" 1 
ATOM   6391  O "O3'" . DT  I 7  38  ? 89.569  65.488  108.463 1.00 155.43 ? 35  DT  I "O3'" 1 
ATOM   6392  C "C2'" . DT  I 7  38  ? 88.618  67.680  108.942 1.00 147.00 ? 35  DT  I "C2'" 1 
ATOM   6393  C "C1'" . DT  I 7  38  ? 88.770  68.472  107.660 1.00 147.77 ? 35  DT  I "C1'" 1 
ATOM   6394  N N1    . DT  I 7  38  ? 88.305  69.868  107.764 1.00 144.83 ? 35  DT  I N1    1 
ATOM   6395  C C2    . DT  I 7  38  ? 89.209  70.892  107.576 1.00 139.88 ? 35  DT  I C2    1 
ATOM   6396  O O2    . DT  I 7  38  ? 90.389  70.705  107.325 1.00 138.43 ? 35  DT  I O2    1 
ATOM   6397  N N3    . DT  I 7  38  ? 88.675  72.151  107.694 1.00 137.75 ? 35  DT  I N3    1 
ATOM   6398  C C4    . DT  I 7  38  ? 87.363  72.477  107.974 1.00 138.93 ? 35  DT  I C4    1 
ATOM   6399  O O4    . DT  I 7  38  ? 87.017  73.652  108.049 1.00 137.64 ? 35  DT  I O4    1 
ATOM   6400  C C5    . DT  I 7  38  ? 86.479  71.357  108.159 1.00 142.68 ? 35  DT  I C5    1 
ATOM   6401  C C7    . DT  I 7  38  ? 85.042  71.618  108.469 1.00 142.56 ? 35  DT  I C7    1 
ATOM   6402  C C6    . DT  I 7  38  ? 86.986  70.127  108.046 1.00 145.41 ? 35  DT  I C6    1 
ATOM   6403  P P     . DC  I 7  39  ? 90.190  64.872  109.819 1.00 163.62 ? 36  DC  I P     1 
ATOM   6404  O OP1   . DC  I 7  39  ? 91.007  63.683  109.472 1.00 161.10 ? 36  DC  I OP1   1 
ATOM   6405  O OP2   . DC  I 7  39  ? 89.115  64.775  110.840 1.00 157.61 ? 36  DC  I OP2   1 
ATOM   6406  O "O5'" . DC  I 7  39  ? 91.150  66.016  110.373 1.00 148.05 ? 36  DC  I "O5'" 1 
ATOM   6407  C "C5'" . DC  I 7  39  ? 92.260  66.488  109.588 1.00 146.49 ? 36  DC  I "C5'" 1 
ATOM   6408  C "C4'" . DC  I 7  39  ? 92.867  67.719  110.217 1.00 143.11 ? 36  DC  I "C4'" 1 
ATOM   6409  O "O4'" . DC  I 7  39  ? 92.008  68.852  109.994 1.00 139.84 ? 36  DC  I "O4'" 1 
ATOM   6410  C "C3'" . DC  I 7  39  ? 93.064  67.630  111.731 1.00 140.07 ? 36  DC  I "C3'" 1 
ATOM   6411  O "O3'" . DC  I 7  39  ? 94.462  67.431  112.002 1.00 138.07 ? 36  DC  I "O3'" 1 
ATOM   6412  C "C2'" . DC  I 7  39  ? 92.566  68.971  112.270 1.00 132.35 ? 36  DC  I "C2'" 1 
ATOM   6413  C "C1'" . DC  I 7  39  ? 92.191  69.781  111.042 1.00 133.40 ? 36  DC  I "C1'" 1 
ATOM   6414  N N1    . DC  I 7  39  ? 90.937  70.542  111.168 1.00 130.28 ? 36  DC  I N1    1 
ATOM   6415  C C2    . DC  I 7  39  ? 90.964  71.941  111.112 1.00 127.14 ? 36  DC  I C2    1 
ATOM   6416  O O2    . DC  I 7  39  ? 92.048  72.526  110.961 1.00 126.40 ? 36  DC  I O2    1 
ATOM   6417  N N3    . DC  I 7  39  ? 89.808  72.627  111.224 1.00 126.96 ? 36  DC  I N3    1 
ATOM   6418  C C4    . DC  I 7  39  ? 88.657  71.973  111.387 1.00 128.14 ? 36  DC  I C4    1 
ATOM   6419  N N4    . DC  I 7  39  ? 87.537  72.687  111.495 1.00 129.23 ? 36  DC  I N4    1 
ATOM   6420  C C5    . DC  I 7  39  ? 88.600  70.557  111.450 1.00 129.98 ? 36  DC  I C5    1 
ATOM   6421  C C6    . DC  I 7  39  ? 89.750  69.889  111.337 1.00 132.00 ? 36  DC  I C6    1 
ATOM   6422  P P     . DG  I 7  40  ? 95.034  67.196  113.492 1.00 142.35 ? 37  DG  I P     1 
ATOM   6423  O OP1   . DG  I 7  40  ? 96.275  66.389  113.386 1.00 141.01 ? 37  DG  I OP1   1 
ATOM   6424  O OP2   . DG  I 7  40  ? 93.925  66.726  114.361 1.00 137.25 ? 37  DG  I OP2   1 
ATOM   6425  O "O5'" . DG  I 7  40  ? 95.435  68.668  113.952 1.00 132.41 ? 37  DG  I "O5'" 1 
ATOM   6426  C "C5'" . DG  I 7  40  ? 96.245  69.497  113.094 1.00 130.48 ? 37  DG  I "C5'" 1 
ATOM   6427  C "C4'" . DG  I 7  40  ? 96.326  70.913  113.613 1.00 129.20 ? 37  DG  I "C4'" 1 
ATOM   6428  O "O4'" . DG  I 7  40  ? 95.038  71.566  113.494 1.00 127.30 ? 37  DG  I "O4'" 1 
ATOM   6429  C "C3'" . DG  I 7  40  ? 96.745  71.073  115.071 1.00 126.78 ? 37  DG  I "C3'" 1 
ATOM   6430  O "O3'" . DG  I 7  40  ? 97.637  72.194  115.136 1.00 125.64 ? 37  DG  I "O3'" 1 
ATOM   6431  C "C2'" . DG  I 7  40  ? 95.434  71.362  115.785 1.00 122.36 ? 37  DG  I "C2'" 1 
ATOM   6432  C "C1'" . DG  I 7  40  ? 94.667  72.145  114.735 1.00 120.23 ? 37  DG  I "C1'" 1 
ATOM   6433  N N9    . DG  I 7  40  ? 93.211  72.060  114.819 1.00 119.20 ? 37  DG  I N9    1 
ATOM   6434  C C8    . DG  I 7  40  ? 92.452  70.933  115.006 1.00 121.74 ? 37  DG  I C8    1 
ATOM   6435  N N7    . DG  I 7  40  ? 91.171  71.173  115.030 1.00 119.37 ? 37  DG  I N7    1 
ATOM   6436  C C5    . DG  I 7  40  ? 91.077  72.541  114.849 1.00 119.10 ? 37  DG  I C5    1 
ATOM   6437  C C6    . DG  I 7  40  ? 89.935  73.378  114.786 1.00 120.93 ? 37  DG  I C6    1 
ATOM   6438  O O6    . DG  I 7  40  ? 88.743  73.058  114.879 1.00 120.01 ? 37  DG  I O6    1 
ATOM   6439  N N1    . DG  I 7  40  ? 90.286  74.708  114.591 1.00 118.58 ? 37  DG  I N1    1 
ATOM   6440  C C2    . DG  I 7  40  ? 91.572  75.171  114.473 1.00 119.26 ? 37  DG  I C2    1 
ATOM   6441  N N2    . DG  I 7  40  ? 91.714  76.492  114.289 1.00 119.66 ? 37  DG  I N2    1 
ATOM   6442  N N3    . DG  I 7  40  ? 92.646  74.398  114.530 1.00 117.66 ? 37  DG  I N3    1 
ATOM   6443  C C4    . DG  I 7  40  ? 92.326  73.104  114.718 1.00 117.09 ? 37  DG  I C4    1 
ATOM   6444  P P     . DT  I 7  41  ? 98.627  72.454  116.378 1.00 136.24 ? 38  DT  I P     1 
ATOM   6445  O OP1   . DT  I 7  41  ? 100.022 72.452  115.873 1.00 129.93 ? 38  DT  I OP1   1 
ATOM   6446  O OP2   . DT  I 7  41  ? 98.241  71.546  117.490 1.00 129.01 ? 38  DT  I OP2   1 
ATOM   6447  O "O5'" . DT  I 7  41  ? 98.250  73.941  116.805 1.00 122.19 ? 38  DT  I "O5'" 1 
ATOM   6448  C "C5'" . DT  I 7  41  ? 98.076  74.972  115.813 1.00 118.69 ? 38  DT  I "C5'" 1 
ATOM   6449  C "C4'" . DT  I 7  41  ? 97.291  76.124  116.390 1.00 115.61 ? 38  DT  I "C4'" 1 
ATOM   6450  O "O4'" . DT  I 7  41  ? 95.877  75.798  116.396 1.00 114.02 ? 38  DT  I "O4'" 1 
ATOM   6451  C "C3'" . DT  I 7  41  ? 97.647  76.479  117.835 1.00 114.92 ? 38  DT  I "C3'" 1 
ATOM   6452  O "O3'" . DT  I 7  41  ? 97.562  77.895  118.032 1.00 111.82 ? 38  DT  I "O3'" 1 
ATOM   6453  C "C2'" . DT  I 7  41  ? 96.542  75.784  118.610 1.00 111.18 ? 38  DT  I "C2'" 1 
ATOM   6454  C "C1'" . DT  I 7  41  ? 95.363  76.047  117.690 1.00 109.97 ? 38  DT  I "C1'" 1 
ATOM   6455  N N1    . DT  I 7  41  ? 94.146  75.223  117.886 1.00 110.82 ? 38  DT  I N1    1 
ATOM   6456  C C2    . DT  I 7  41  ? 92.929  75.818  117.632 1.00 111.55 ? 38  DT  I C2    1 
ATOM   6457  O O2    . DT  I 7  41  ? 92.822  76.973  117.255 1.00 110.69 ? 38  DT  I O2    1 
ATOM   6458  N N3    . DT  I 7  41  ? 91.835  75.014  117.830 1.00 112.05 ? 38  DT  I N3    1 
ATOM   6459  C C4    . DT  I 7  41  ? 91.835  73.701  118.249 1.00 114.00 ? 38  DT  I C4    1 
ATOM   6460  O O4    . DT  I 7  41  ? 90.778  73.089  118.385 1.00 116.19 ? 38  DT  I O4    1 
ATOM   6461  C C5    . DT  I 7  41  ? 93.137  73.139  118.496 1.00 112.07 ? 38  DT  I C5    1 
ATOM   6462  C C7    . DT  I 7  41  ? 93.230  71.719  118.948 1.00 117.41 ? 38  DT  I C7    1 
ATOM   6463  C C6    . DT  I 7  41  ? 94.211  73.912  118.307 1.00 111.10 ? 38  DT  I C6    1 
ATOM   6464  P P     . DA  I 7  42  ? 98.810  78.887  117.787 1.00 114.25 ? 39  DA  I P     1 
ATOM   6465  O OP1   . DA  I 7  42  ? 99.462  78.556  116.496 1.00 113.28 ? 39  DA  I OP1   1 
ATOM   6466  O OP2   . DA  I 7  42  ? 99.619  78.931  119.032 1.00 113.18 ? 39  DA  I OP2   1 
ATOM   6467  O "O5'" . DA  I 7  42  ? 98.088  80.298  117.623 1.00 108.26 ? 39  DA  I "O5'" 1 
ATOM   6468  C "C5'" . DA  I 7  42  ? 97.252  80.545  116.475 1.00 109.77 ? 39  DA  I "C5'" 1 
ATOM   6469  C "C4'" . DA  I 7  42  ? 96.239  81.637  116.739 1.00 106.78 ? 39  DA  I "C4'" 1 
ATOM   6470  O "O4'" . DA  I 7  42  ? 95.085  81.079  117.401 1.00 106.25 ? 39  DA  I "O4'" 1 
ATOM   6471  C "C3'" . DA  I 7  42  ? 96.683  82.792  117.629 1.00 105.52 ? 39  DA  I "C3'" 1 
ATOM   6472  O "O3'" . DA  I 7  42  ? 95.932  83.961  117.248 1.00 104.93 ? 39  DA  I "O3'" 1 
ATOM   6473  C "C2'" . DA  I 7  42  ? 96.323  82.285  119.023 1.00 105.57 ? 39  DA  I "C2'" 1 
ATOM   6474  C "C1'" . DA  I 7  42  ? 95.091  81.424  118.779 1.00 105.08 ? 39  DA  I "C1'" 1 
ATOM   6475  N N9    . DA  I 7  42  ? 95.022  80.172  119.533 1.00 105.11 ? 39  DA  I N9    1 
ATOM   6476  C C8    . DA  I 7  42  ? 96.018  79.479  120.179 1.00 106.34 ? 39  DA  I C8    1 
ATOM   6477  N N7    . DA  I 7  42  ? 95.606  78.381  120.757 1.00 107.11 ? 39  DA  I N7    1 
ATOM   6478  C C5    . DA  I 7  42  ? 94.255  78.347  120.476 1.00 106.24 ? 39  DA  I C5    1 
ATOM   6479  C C6    . DA  I 7  42  ? 93.253  77.434  120.809 1.00 107.75 ? 39  DA  I C6    1 
ATOM   6480  N N6    . DA  I 7  42  ? 93.476  76.338  121.527 1.00 110.14 ? 39  DA  I N6    1 
ATOM   6481  N N1    . DA  I 7  42  ? 92.002  77.686  120.378 1.00 108.27 ? 39  DA  I N1    1 
ATOM   6482  C C2    . DA  I 7  42  ? 91.793  78.791  119.658 1.00 107.90 ? 39  DA  I C2    1 
ATOM   6483  N N3    . DA  I 7  42  ? 92.654  79.725  119.279 1.00 104.82 ? 39  DA  I N3    1 
ATOM   6484  C C4    . DA  I 7  42  ? 93.883  79.440  119.727 1.00 104.15 ? 39  DA  I C4    1 
ATOM   6485  P P     . DG  I 7  43  ? 96.034  85.372  118.023 1.00 107.58 ? 40  DG  I P     1 
ATOM   6486  O OP1   . DG  I 7  43  ? 95.911  86.464  117.024 1.00 98.94  ? 40  DG  I OP1   1 
ATOM   6487  O OP2   . DG  I 7  43  ? 97.218  85.330  118.920 1.00 109.45 ? 40  DG  I OP2   1 
ATOM   6488  O "O5'" . DG  I 7  43  ? 94.720  85.358  118.930 1.00 104.37 ? 40  DG  I "O5'" 1 
ATOM   6489  C "C5'" . DG  I 7  43  ? 93.430  85.193  118.308 1.00 104.62 ? 40  DG  I "C5'" 1 
ATOM   6490  C "C4'" . DG  I 7  43  ? 92.344  84.892  119.317 1.00 107.39 ? 40  DG  I "C4'" 1 
ATOM   6491  O "O4'" . DG  I 7  43  ? 92.561  83.594  119.921 1.00 105.84 ? 40  DG  I "O4'" 1 
ATOM   6492  C "C3'" . DG  I 7  43  ? 92.176  85.874  120.475 1.00 108.37 ? 40  DG  I "C3'" 1 
ATOM   6493  O "O3'" . DG  I 7  43  ? 90.774  86.158  120.575 1.00 110.62 ? 40  DG  I "O3'" 1 
ATOM   6494  C "C2'" . DG  I 7  43  ? 92.678  85.089  121.680 1.00 107.06 ? 40  DG  I "C2'" 1 
ATOM   6495  C "C1'" . DG  I 7  43  ? 92.290  83.672  121.308 1.00 105.63 ? 40  DG  I "C1'" 1 
ATOM   6496  N N9    . DG  I 7  43  ? 93.056  82.615  121.968 1.00 104.97 ? 40  DG  I N9    1 
ATOM   6497  C C8    . DG  I 7  43  ? 94.406  82.604  122.211 1.00 104.10 ? 40  DG  I C8    1 
ATOM   6498  N N7    . DG  I 7  43  ? 94.812  81.524  122.814 1.00 104.14 ? 40  DG  I N7    1 
ATOM   6499  C C5    . DG  I 7  43  ? 93.664  80.772  122.981 1.00 103.58 ? 40  DG  I C5    1 
ATOM   6500  C C6    . DG  I 7  43  ? 93.491  79.500  123.576 1.00 105.39 ? 40  DG  I C6    1 
ATOM   6501  O O6    . DG  I 7  43  ? 94.351  78.770  124.082 1.00 107.43 ? 40  DG  I O6    1 
ATOM   6502  N N1    . DG  I 7  43  ? 92.165  79.094  123.542 1.00 105.41 ? 40  DG  I N1    1 
ATOM   6503  C C2    . DG  I 7  43  ? 91.135  79.821  123.004 1.00 106.39 ? 40  DG  I C2    1 
ATOM   6504  N N2    . DG  I 7  43  ? 89.919  79.257  123.067 1.00 109.02 ? 40  DG  I N2    1 
ATOM   6505  N N3    . DG  I 7  43  ? 91.284  81.015  122.444 1.00 106.16 ? 40  DG  I N3    1 
ATOM   6506  C C4    . DG  I 7  43  ? 92.568  81.427  122.467 1.00 103.83 ? 40  DG  I C4    1 
ATOM   6507  P P     . DA  I 7  44  ? 90.168  87.342  121.482 1.00 118.36 ? 41  DA  I P     1 
ATOM   6508  O OP1   . DA  I 7  44  ? 89.559  88.353  120.582 1.00 118.14 ? 41  DA  I OP1   1 
ATOM   6509  O OP2   . DA  I 7  44  ? 91.196  87.756  122.471 1.00 113.81 ? 41  DA  I OP2   1 
ATOM   6510  O "O5'" . DA  I 7  44  ? 88.996  86.595  122.261 1.00 114.00 ? 41  DA  I "O5'" 1 
ATOM   6511  C "C5'" . DA  I 7  44  ? 88.014  85.826  121.534 1.00 114.76 ? 41  DA  I "C5'" 1 
ATOM   6512  C "C4'" . DA  I 7  44  ? 87.207  84.961  122.471 1.00 119.00 ? 41  DA  I "C4'" 1 
ATOM   6513  O "O4'" . DA  I 7  44  ? 88.025  83.864  122.945 1.00 116.78 ? 41  DA  I "O4'" 1 
ATOM   6514  C "C3'" . DA  I 7  44  ? 86.673  85.670  123.713 1.00 117.72 ? 41  DA  I "C3'" 1 
ATOM   6515  O "O3'" . DA  I 7  44  ? 85.328  85.229  123.954 1.00 121.34 ? 41  DA  I "O3'" 1 
ATOM   6516  C "C2'" . DA  I 7  44  ? 87.625  85.216  124.812 1.00 115.83 ? 41  DA  I "C2'" 1 
ATOM   6517  C "C1'" . DA  I 7  44  ? 88.023  83.822  124.361 1.00 114.09 ? 41  DA  I "C1'" 1 
ATOM   6518  N N9    . DA  I 7  44  ? 89.357  83.393  124.787 1.00 109.17 ? 41  DA  I N9    1 
ATOM   6519  C C8    . DA  I 7  44  ? 90.544  84.068  124.662 1.00 108.52 ? 41  DA  I C8    1 
ATOM   6520  N N7    . DA  I 7  44  ? 91.578  83.419  125.140 1.00 105.85 ? 41  DA  I N7    1 
ATOM   6521  C C5    . DA  I 7  44  ? 91.035  82.237  125.612 1.00 104.08 ? 41  DA  I C5    1 
ATOM   6522  C C6    . DA  I 7  44  ? 91.610  81.121  126.234 1.00 105.99 ? 41  DA  I C6    1 
ATOM   6523  N N6    . DA  I 7  44  ? 92.908  81.011  126.502 1.00 107.77 ? 41  DA  I N6    1 
ATOM   6524  N N1    . DA  I 7  44  ? 90.794  80.107  126.581 1.00 108.75 ? 41  DA  I N1    1 
ATOM   6525  C C2    . DA  I 7  44  ? 89.490  80.219  126.314 1.00 108.82 ? 41  DA  I C2    1 
ATOM   6526  N N3    . DA  I 7  44  ? 88.832  81.216  125.733 1.00 108.64 ? 41  DA  I N3    1 
ATOM   6527  C C4    . DA  I 7  44  ? 89.670  82.207  125.401 1.00 107.06 ? 41  DA  I C4    1 
ATOM   6528  P P     . DC  I 7  45  ? 84.354  85.975  124.999 1.00 134.75 ? 42  DC  I P     1 
ATOM   6529  O OP1   . DC  I 7  45  ? 82.946  85.742  124.589 1.00 127.99 ? 42  DC  I OP1   1 
ATOM   6530  O OP2   . DC  I 7  45  ? 84.854  87.354  125.231 1.00 129.54 ? 42  DC  I OP2   1 
ATOM   6531  O "O5'" . DC  I 7  45  ? 84.623  85.223  126.374 1.00 126.84 ? 42  DC  I "O5'" 1 
ATOM   6532  C "C5'" . DC  I 7  45  ? 84.390  83.808  126.481 1.00 127.90 ? 42  DC  I "C5'" 1 
ATOM   6533  C "C4'" . DC  I 7  45  ? 84.983  83.272  127.760 1.00 126.27 ? 42  DC  I "C4'" 1 
ATOM   6534  O "O4'" . DC  I 7  45  ? 86.394  83.049  127.599 1.00 119.69 ? 42  DC  I "O4'" 1 
ATOM   6535  C "C3'" . DC  I 7  45  ? 84.873  84.206  128.964 1.00 127.28 ? 42  DC  I "C3'" 1 
ATOM   6536  O "O3'" . DC  I 7  45  ? 83.702  83.858  129.721 1.00 131.15 ? 42  DC  I "O3'" 1 
ATOM   6537  C "C2'" . DC  I 7  45  ? 86.162  83.950  129.746 1.00 122.47 ? 42  DC  I "C2'" 1 
ATOM   6538  C "C1'" . DC  I 7  45  ? 86.947  82.967  128.895 1.00 118.90 ? 42  DC  I "C1'" 1 
ATOM   6539  N N1    . DC  I 7  45  ? 88.389  83.249  128.803 1.00 113.36 ? 42  DC  I N1    1 
ATOM   6540  C C2    . DC  I 7  45  ? 89.294  82.311  129.310 1.00 111.46 ? 42  DC  I C2    1 
ATOM   6541  O O2    . DC  I 7  45  ? 88.862  81.270  129.823 1.00 114.30 ? 42  DC  I O2    1 
ATOM   6542  N N3    . DC  I 7  45  ? 90.617  82.557  129.230 1.00 108.84 ? 42  DC  I N3    1 
ATOM   6543  C C4    . DC  I 7  45  ? 91.052  83.685  128.673 1.00 108.64 ? 42  DC  I C4    1 
ATOM   6544  N N4    . DC  I 7  45  ? 92.370  83.885  128.618 1.00 109.69 ? 42  DC  I N4    1 
ATOM   6545  C C5    . DC  I 7  45  ? 90.157  84.658  128.151 1.00 107.76 ? 42  DC  I C5    1 
ATOM   6546  C C6    . DC  I 7  45  ? 88.847  84.403  128.234 1.00 110.88 ? 42  DC  I C6    1 
ATOM   6547  P P     . DA  I 7  46  ? 83.278  84.639  131.069 1.00 138.21 ? 43  DA  I P     1 
ATOM   6548  O OP1   . DA  I 7  46  ? 81.807  84.518  131.231 1.00 139.49 ? 43  DA  I OP1   1 
ATOM   6549  O OP2   . DA  I 7  46  ? 83.907  85.985  131.056 1.00 135.42 ? 43  DA  I OP2   1 
ATOM   6550  O "O5'" . DA  I 7  46  ? 83.977  83.785  132.220 1.00 132.41 ? 43  DA  I "O5'" 1 
ATOM   6551  C "C5'" . DA  I 7  46  ? 83.775  82.360  132.303 1.00 131.65 ? 43  DA  I "C5'" 1 
ATOM   6552  C "C4'" . DA  I 7  46  ? 84.731  81.739  133.295 1.00 131.73 ? 43  DA  I "C4'" 1 
ATOM   6553  O "O4'" . DA  I 7  46  ? 86.087  81.851  132.800 1.00 125.99 ? 43  DA  I "O4'" 1 
ATOM   6554  C "C3'" . DA  I 7  46  ? 84.725  82.361  134.694 1.00 131.41 ? 43  DA  I "C3'" 1 
ATOM   6555  O "O3'" . DA  I 7  46  ? 84.648  81.308  135.671 1.00 132.23 ? 43  DA  I "O3'" 1 
ATOM   6556  C "C2'" . DA  I 7  46  ? 86.059  83.095  134.766 1.00 126.56 ? 43  DA  I "C2'" 1 
ATOM   6557  C "C1'" . DA  I 7  46  ? 86.940  82.271  133.848 1.00 122.23 ? 43  DA  I "C1'" 1 
ATOM   6558  N N9    . DA  I 7  46  ? 88.058  83.007  133.256 1.00 117.12 ? 43  DA  I N9    1 
ATOM   6559  C C8    . DA  I 7  46  ? 88.019  84.188  132.562 1.00 117.30 ? 43  DA  I C8    1 
ATOM   6560  N N7    . DA  I 7  46  ? 89.191  84.602  132.152 1.00 112.86 ? 43  DA  I N7    1 
ATOM   6561  C C5    . DA  I 7  46  ? 90.062  83.627  132.606 1.00 111.74 ? 43  DA  I C5    1 
ATOM   6562  C C6    . DA  I 7  46  ? 91.450  83.483  132.497 1.00 111.05 ? 43  DA  I C6    1 
ATOM   6563  N N6    . DA  I 7  46  ? 92.226  84.361  131.868 1.00 111.91 ? 43  DA  I N6    1 
ATOM   6564  N N1    . DA  I 7  46  ? 92.020  82.397  133.061 1.00 112.62 ? 43  DA  I N1    1 
ATOM   6565  C C2    . DA  I 7  46  ? 91.227  81.524  133.691 1.00 114.43 ? 43  DA  I C2    1 
ATOM   6566  N N3    . DA  I 7  46  ? 89.909  81.549  133.859 1.00 113.85 ? 43  DA  I N3    1 
ATOM   6567  C C4    . DA  I 7  46  ? 89.380  82.639  133.288 1.00 113.56 ? 43  DA  I C4    1 
ATOM   6568  P P     . DG  I 7  47  ? 84.409  81.603  137.238 1.00 142.18 ? 44  DG  I P     1 
ATOM   6569  O OP1   . DG  I 7  47  ? 83.681  80.448  137.819 1.00 136.16 ? 44  DG  I OP1   1 
ATOM   6570  O OP2   . DG  I 7  47  ? 83.852  82.973  137.384 1.00 135.56 ? 44  DG  I OP2   1 
ATOM   6571  O "O5'" . DG  I 7  47  ? 85.889  81.606  137.827 1.00 130.84 ? 44  DG  I "O5'" 1 
ATOM   6572  C "C5'" . DG  I 7  47  ? 86.753  80.476  137.603 1.00 131.44 ? 44  DG  I "C5'" 1 
ATOM   6573  C "C4'" . DG  I 7  47  ? 88.094  80.688  138.262 1.00 132.22 ? 44  DG  I "C4'" 1 
ATOM   6574  O "O4'" . DG  I 7  47  ? 88.975  81.389  137.348 1.00 124.02 ? 44  DG  I "O4'" 1 
ATOM   6575  C "C3'" . DG  I 7  47  ? 88.080  81.511  139.554 1.00 132.12 ? 44  DG  I "C3'" 1 
ATOM   6576  O "O3'" . DG  I 7  47  ? 88.970  80.896  140.498 1.00 130.82 ? 44  DG  I "O3'" 1 
ATOM   6577  C "C2'" . DG  I 7  47  ? 88.609  82.860  139.098 1.00 125.16 ? 44  DG  I "C2'" 1 
ATOM   6578  C "C1'" . DG  I 7  47  ? 89.615  82.441  138.047 1.00 120.75 ? 44  DG  I "C1'" 1 
ATOM   6579  N N9    . DG  I 7  47  ? 89.975  83.491  137.099 1.00 115.27 ? 44  DG  I N9    1 
ATOM   6580  C C8    . DG  I 7  47  ? 89.138  84.391  136.489 1.00 114.61 ? 44  DG  I C8    1 
ATOM   6581  N N7    . DG  I 7  47  ? 89.761  85.211  135.694 1.00 111.89 ? 44  DG  I N7    1 
ATOM   6582  C C5    . DG  I 7  47  ? 91.089  84.832  135.783 1.00 110.64 ? 44  DG  I C5    1 
ATOM   6583  C C6    . DG  I 7  47  ? 92.237  85.359  135.143 1.00 110.42 ? 44  DG  I C6    1 
ATOM   6584  O O6    . DG  I 7  47  ? 92.300  86.299  134.343 1.00 111.14 ? 44  DG  I O6    1 
ATOM   6585  N N1    . DG  I 7  47  ? 93.390  84.678  135.515 1.00 110.01 ? 44  DG  I N1    1 
ATOM   6586  C C2    . DG  I 7  47  ? 93.431  83.625  136.392 1.00 111.76 ? 44  DG  I C2    1 
ATOM   6587  N N2    . DG  I 7  47  ? 94.638  83.092  136.630 1.00 112.97 ? 44  DG  I N2    1 
ATOM   6588  N N3    . DG  I 7  47  ? 92.365  83.124  136.995 1.00 112.78 ? 44  DG  I N3    1 
ATOM   6589  C C4    . DG  I 7  47  ? 91.238  83.772  136.646 1.00 112.25 ? 44  DG  I C4    1 
ATOM   6590  P P     . DC  I 7  48  ? 89.017  81.333  142.048 1.00 139.54 ? 45  DC  I P     1 
ATOM   6591  O OP1   . DC  I 7  48  ? 88.755  80.139  142.889 1.00 135.78 ? 45  DC  I OP1   1 
ATOM   6592  O OP2   . DC  I 7  48  ? 88.221  82.575  142.231 1.00 134.36 ? 45  DC  I OP2   1 
ATOM   6593  O "O5'" . DC  I 7  48  ? 90.525  81.800  142.268 1.00 128.74 ? 45  DC  I "O5'" 1 
ATOM   6594  C "C5'" . DC  I 7  48  ? 91.609  80.865  142.106 1.00 128.78 ? 45  DC  I "C5'" 1 
ATOM   6595  C "C4'" . DC  I 7  48  ? 92.941  81.579  142.124 1.00 129.23 ? 45  DC  I "C4'" 1 
ATOM   6596  O "O4'" . DC  I 7  48  ? 93.051  82.430  140.957 1.00 122.75 ? 45  DC  I "O4'" 1 
ATOM   6597  C "C3'" . DC  I 7  48  ? 93.182  82.477  143.343 1.00 128.60 ? 45  DC  I "C3'" 1 
ATOM   6598  O "O3'" . DC  I 7  48  ? 94.487  82.198  143.881 1.00 132.06 ? 45  DC  I "O3'" 1 
ATOM   6599  C "C2'" . DC  I 7  48  ? 93.093  83.885  142.771 1.00 124.49 ? 45  DC  I "C2'" 1 
ATOM   6600  C "C1'" . DC  I 7  48  ? 93.553  83.696  141.340 1.00 120.99 ? 45  DC  I "C1'" 1 
ATOM   6601  N N1    . DC  I 7  48  ? 93.039  84.702  140.392 1.00 117.88 ? 45  DC  I N1    1 
ATOM   6602  C C2    . DC  I 7  48  ? 93.942  85.455  139.633 1.00 115.41 ? 45  DC  I C2    1 
ATOM   6603  O O2    . DC  I 7  48  ? 95.158  85.269  139.769 1.00 115.45 ? 45  DC  I O2    1 
ATOM   6604  N N3    . DC  I 7  48  ? 93.475  86.375  138.764 1.00 111.96 ? 45  DC  I N3    1 
ATOM   6605  C C4    . DC  I 7  48  ? 92.163  86.561  138.634 1.00 111.63 ? 45  DC  I C4    1 
ATOM   6606  N N4    . DC  I 7  48  ? 91.746  87.483  137.765 1.00 110.91 ? 45  DC  I N4    1 
ATOM   6607  C C5    . DC  I 7  48  ? 91.220  85.813  139.390 1.00 112.84 ? 45  DC  I C5    1 
ATOM   6608  C C6    . DC  I 7  48  ? 91.695  84.903  140.247 1.00 118.63 ? 45  DC  I C6    1 
ATOM   6609  P P     . DT  I 7  49  ? 95.039  82.883  145.236 1.00 138.81 ? 46  DT  I P     1 
ATOM   6610  O OP1   . DT  I 7  49  ? 95.711  81.839  146.049 1.00 135.88 ? 46  DT  I OP1   1 
ATOM   6611  O OP2   . DT  I 7  49  ? 93.949  83.695  145.835 1.00 131.82 ? 46  DT  I OP2   1 
ATOM   6612  O "O5'" . DT  I 7  49  ? 96.153  83.882  144.688 1.00 126.39 ? 46  DT  I "O5'" 1 
ATOM   6613  C "C5'" . DT  I 7  49  ? 97.065  83.442  143.665 1.00 124.95 ? 46  DT  I "C5'" 1 
ATOM   6614  C "C4'" . DT  I 7  49  ? 98.095  84.501  143.356 1.00 126.47 ? 46  DT  I "C4'" 1 
ATOM   6615  O "O4'" . DT  I 7  49  ? 97.570  85.392  142.346 1.00 123.27 ? 46  DT  I "O4'" 1 
ATOM   6616  C "C3'" . DT  I 7  49  ? 98.528  85.378  144.529 1.00 126.34 ? 46  DT  I "C3'" 1 
ATOM   6617  O "O3'" . DT  I 7  49  ? 99.944  85.591  144.439 1.00 127.41 ? 46  DT  I "O3'" 1 
ATOM   6618  C "C2'" . DT  I 7  49  ? 97.758  86.673  144.309 1.00 122.05 ? 46  DT  I "C2'" 1 
ATOM   6619  C "C1'" . DT  I 7  49  ? 97.622  86.733  142.796 1.00 120.09 ? 46  DT  I "C1'" 1 
ATOM   6620  N N1    . DT  I 7  49  ? 96.412  87.413  142.284 1.00 116.06 ? 46  DT  I N1    1 
ATOM   6621  C C2    . DT  I 7  49  ? 96.566  88.330  141.268 1.00 114.78 ? 46  DT  I C2    1 
ATOM   6622  O O2    . DT  I 7  49  ? 97.650  88.603  140.777 1.00 113.64 ? 46  DT  I O2    1 
ATOM   6623  N N3    . DT  I 7  49  ? 95.402  88.918  140.842 1.00 114.89 ? 46  DT  I N3    1 
ATOM   6624  C C4    . DT  I 7  49  ? 94.128  88.691  141.319 1.00 111.98 ? 46  DT  I C4    1 
ATOM   6625  O O4    . DT  I 7  49  ? 93.169  89.291  140.839 1.00 111.73 ? 46  DT  I O4    1 
ATOM   6626  C C5    . DT  I 7  49  ? 94.038  87.722  142.382 1.00 114.31 ? 46  DT  I C5    1 
ATOM   6627  C C7    . DT  I 7  49  ? 92.698  87.421  142.964 1.00 116.01 ? 46  DT  I C7    1 
ATOM   6628  C C6    . DT  I 7  49  ? 95.166  87.139  142.806 1.00 116.03 ? 46  DT  I C6    1 
ATOM   6629  P P     . DC  I 7  50  ? 100.810 86.168  145.670 1.00 137.94 ? 47  DC  I P     1 
ATOM   6630  O OP1   . DC  I 7  50  ? 102.166 85.568  145.619 1.00 131.70 ? 47  DC  I OP1   1 
ATOM   6631  O OP2   . DC  I 7  50  ? 100.000 86.091  146.914 1.00 130.34 ? 47  DC  I OP2   1 
ATOM   6632  O "O5'" . DC  I 7  50  ? 100.926 87.729  145.369 1.00 124.85 ? 47  DC  I "O5'" 1 
ATOM   6633  C "C5'" . DC  I 7  50  ? 101.389 88.206  144.091 1.00 122.36 ? 47  DC  I "C5'" 1 
ATOM   6634  C "C4'" . DC  I 7  50  ? 101.131 89.690  143.956 1.00 120.95 ? 47  DC  I "C4'" 1 
ATOM   6635  O "O4'" . DC  I 7  50  ? 99.758  89.922  143.537 1.00 117.88 ? 47  DC  I "O4'" 1 
ATOM   6636  C "C3'" . DC  I 7  50  ? 101.296 90.488  145.259 1.00 118.18 ? 47  DC  I "C3'" 1 
ATOM   6637  O "O3'" . DC  I 7  50  ? 101.836 91.795  145.009 1.00 115.47 ? 47  DC  I "O3'" 1 
ATOM   6638  C "C2'" . DC  I 7  50  ? 99.859  90.620  145.716 1.00 115.32 ? 47  DC  I "C2'" 1 
ATOM   6639  C "C1'" . DC  I 7  50  ? 99.210  90.918  144.380 1.00 113.94 ? 47  DC  I "C1'" 1 
ATOM   6640  N N1    . DC  I 7  50  ? 97.734  90.865  144.311 1.00 111.67 ? 47  DC  I N1    1 
ATOM   6641  C C2    . DC  I 7  50  ? 97.090  91.641  143.339 1.00 108.32 ? 47  DC  I C2    1 
ATOM   6642  O O2    . DC  I 7  50  ? 97.769  92.340  142.574 1.00 108.16 ? 47  DC  I O2    1 
ATOM   6643  N N3    . DC  I 7  50  ? 95.745  91.618  143.248 1.00 108.63 ? 47  DC  I N3    1 
ATOM   6644  C C4    . DC  I 7  50  ? 95.037  90.859  144.082 1.00 110.59 ? 47  DC  I C4    1 
ATOM   6645  N N4    . DC  I 7  50  ? 93.709  90.864  143.960 1.00 111.69 ? 47  DC  I N4    1 
ATOM   6646  C C5    . DC  I 7  50  ? 95.658  90.058  145.079 1.00 109.24 ? 47  DC  I C5    1 
ATOM   6647  C C6    . DC  I 7  50  ? 96.992  90.090  145.160 1.00 109.83 ? 47  DC  I C6    1 
ATOM   6648  P P     . DT  I 7  51  ? 103.417 92.056  144.837 1.00 121.63 ? 48  DT  I P     1 
ATOM   6649  O OP1   . DT  I 7  51  ? 104.056 90.802  144.372 1.00 120.73 ? 48  DT  I OP1   1 
ATOM   6650  O OP2   . DT  I 7  51  ? 103.905 92.728  146.067 1.00 121.63 ? 48  DT  I OP2   1 
ATOM   6651  O "O5'" . DT  I 7  51  ? 103.453 93.112  143.642 1.00 117.22 ? 48  DT  I "O5'" 1 
ATOM   6652  C "C5'" . DT  I 7  51  ? 103.142 92.682  142.304 1.00 116.98 ? 48  DT  I "C5'" 1 
ATOM   6653  C "C4'" . DT  I 7  51  ? 102.936 93.847  141.364 1.00 115.36 ? 48  DT  I "C4'" 1 
ATOM   6654  O "O4'" . DT  I 7  51  ? 101.541 94.222  141.358 1.00 113.48 ? 48  DT  I "O4'" 1 
ATOM   6655  C "C3'" . DT  I 7  51  ? 103.705 95.127  141.666 1.00 111.78 ? 48  DT  I "C3'" 1 
ATOM   6656  O "O3'" . DT  I 7  51  ? 104.000 95.770  140.415 1.00 113.36 ? 48  DT  I "O3'" 1 
ATOM   6657  C "C2'" . DT  I 7  51  ? 102.716 95.939  142.492 1.00 109.75 ? 48  DT  I "C2'" 1 
ATOM   6658  C "C1'" . DT  I 7  51  ? 101.361 95.500  141.949 1.00 109.89 ? 48  DT  I "C1'" 1 
ATOM   6659  N N1    . DT  I 7  51  ? 100.258 95.369  142.930 1.00 107.43 ? 48  DT  I N1    1 
ATOM   6660  C C2    . DT  I 7  51  ? 99.001  95.775  142.536 1.00 107.14 ? 48  DT  I C2    1 
ATOM   6661  O O2    . DT  I 7  51  ? 98.768  96.235  141.430 1.00 107.61 ? 48  DT  I O2    1 
ATOM   6662  N N3    . DT  I 7  51  ? 98.020  95.626  143.482 1.00 105.79 ? 48  DT  I N3    1 
ATOM   6663  C C4    . DT  I 7  51  ? 98.163  95.124  144.755 1.00 106.13 ? 48  DT  I C4    1 
ATOM   6664  O O4    . DT  I 7  51  ? 97.188  95.044  145.499 1.00 107.16 ? 48  DT  I O4    1 
ATOM   6665  C C5    . DT  I 7  51  ? 99.499  94.720  145.104 1.00 109.20 ? 48  DT  I C5    1 
ATOM   6666  C C7    . DT  I 7  51  ? 99.750  94.176  146.468 1.00 110.28 ? 48  DT  I C7    1 
ATOM   6667  C C6    . DT  I 7  51  ? 100.465 94.858  144.193 1.00 109.28 ? 48  DT  I C6    1 
ATOM   6668  P P     . DA  I 7  52  ? 105.029 97.005  140.293 1.00 119.77 ? 49  DA  I P     1 
ATOM   6669  O OP1   . DA  I 7  52  ? 105.684 96.929  138.963 1.00 118.46 ? 49  DA  I OP1   1 
ATOM   6670  O OP2   . DA  I 7  52  ? 105.865 97.047  141.521 1.00 120.50 ? 49  DA  I OP2   1 
ATOM   6671  O "O5'" . DA  I 7  52  ? 104.068 98.275  140.304 1.00 111.41 ? 49  DA  I "O5'" 1 
ATOM   6672  C "C5'" . DA  I 7  52  ? 103.040 98.429  139.307 1.00 109.29 ? 49  DA  I "C5'" 1 
ATOM   6673  C "C4'" . DA  I 7  52  ? 102.010 99.435  139.761 1.00 106.94 ? 49  DA  I "C4'" 1 
ATOM   6674  O "O4'" . DA  I 7  52  ? 101.288 98.904  140.902 1.00 106.01 ? 49  DA  I "O4'" 1 
ATOM   6675  C "C3'" . DA  I 7  52  ? 102.583 100.783 140.225 1.00 108.40 ? 49  DA  I "C3'" 1 
ATOM   6676  O "O3'" . DA  I 7  52  ? 101.722 101.869 139.856 1.00 105.26 ? 49  DA  I "O3'" 1 
ATOM   6677  C "C2'" . DA  I 7  52  ? 102.540 100.637 141.732 1.00 108.55 ? 49  DA  I "C2'" 1 
ATOM   6678  C "C1'" . DA  I 7  52  ? 101.211 99.926  141.872 1.00 103.47 ? 49  DA  I "C1'" 1 
ATOM   6679  N N9    . DA  I 7  52  ? 100.931 99.356  143.188 1.00 103.19 ? 49  DA  I N9    1 
ATOM   6680  C C8    . DA  I 7  52  ? 101.815 98.932  144.147 1.00 103.32 ? 49  DA  I C8    1 
ATOM   6681  N N7    . DA  I 7  52  ? 101.241 98.473  145.230 1.00 103.11 ? 49  DA  I N7    1 
ATOM   6682  C C5    . DA  I 7  52  ? 99.889  98.605  144.966 1.00 103.74 ? 49  DA  I C5    1 
ATOM   6683  C C6    . DA  I 7  52  ? 98.750  98.295  145.718 1.00 104.96 ? 49  DA  I C6    1 
ATOM   6684  N N6    . DA  I 7  52  ? 98.805  97.769  146.940 1.00 105.71 ? 49  DA  I N6    1 
ATOM   6685  N N1    . DA  I 7  52  ? 97.543  98.547  145.170 1.00 104.43 ? 49  DA  I N1    1 
ATOM   6686  C C2    . DA  I 7  52  ? 97.505  99.075  143.943 1.00 105.38 ? 49  DA  I C2    1 
ATOM   6687  N N3    . DA  I 7  52  ? 98.507  99.408  143.137 1.00 102.70 ? 49  DA  I N3    1 
ATOM   6688  C C4    . DA  I 7  52  ? 99.685  99.145  143.714 1.00 101.17 ? 49  DA  I C4    1 
ATOM   6689  P P     . DG  I 7  53  ? 101.825 102.641 138.447 1.00 106.90 ? 50  DG  I P     1 
ATOM   6690  O OP1   . DG  I 7  53  ? 102.012 101.649 137.359 1.00 104.28 ? 50  DG  I OP1   1 
ATOM   6691  O OP2   . DG  I 7  53  ? 102.790 103.759 138.603 1.00 101.21 ? 50  DG  I OP2   1 
ATOM   6692  O "O5'" . DG  I 7  53  ? 100.364 103.260 138.313 1.00 98.72  ? 50  DG  I "O5'" 1 
ATOM   6693  C "C5'" . DG  I 7  53  ? 99.215  102.388 138.320 1.00 102.44 ? 50  DG  I "C5'" 1 
ATOM   6694  C "C4'" . DG  I 7  53  ? 98.044  103.017 139.037 1.00 101.86 ? 50  DG  I "C4'" 1 
ATOM   6695  O "O4'" . DG  I 7  53  ? 97.940  102.475 140.378 1.00 100.87 ? 50  DG  I "O4'" 1 
ATOM   6696  C "C3'" . DG  I 7  53  ? 98.078  104.537 139.193 1.00 99.05  ? 50  DG  I "C3'" 1 
ATOM   6697  O "O3'" . DG  I 7  53  ? 96.758  105.031 138.921 1.00 98.56  ? 50  DG  I "O3'" 1 
ATOM   6698  C "C2'" . DG  I 7  53  ? 98.465  104.728 140.651 1.00 100.06 ? 50  DG  I "C2'" 1 
ATOM   6699  C "C1'" . DG  I 7  53  ? 97.810  103.532 141.315 1.00 99.91  ? 50  DG  I "C1'" 1 
ATOM   6700  N N9    . DG  I 7  53  ? 98.429  103.103 142.568 1.00 101.50 ? 50  DG  I N9    1 
ATOM   6701  C C8    . DG  I 7  53  ? 99.769  103.023 142.860 1.00 100.80 ? 50  DG  I C8    1 
ATOM   6702  N N7    . DG  I 7  53  ? 100.007 102.601 144.071 1.00 99.87  ? 50  DG  I N7    1 
ATOM   6703  C C5    . DG  I 7  53  ? 98.751  102.389 144.613 1.00 100.79 ? 50  DG  I C5    1 
ATOM   6704  C C6    . DG  I 7  53  ? 98.373  101.929 145.899 1.00 102.47 ? 50  DG  I C6    1 
ATOM   6705  O O6    . DG  I 7  53  ? 99.102  101.606 146.844 1.00 103.19 ? 50  DG  I O6    1 
ATOM   6706  N N1    . DG  I 7  53  ? 96.991  101.860 146.031 1.00 103.90 ? 50  DG  I N1    1 
ATOM   6707  C C2    . DG  I 7  53  ? 96.092  102.191 145.050 1.00 104.42 ? 50  DG  I C2    1 
ATOM   6708  N N2    . DG  I 7  53  ? 94.794  102.062 145.358 1.00 109.36 ? 50  DG  I N2    1 
ATOM   6709  N N3    . DG  I 7  53  ? 96.434  102.620 143.848 1.00 101.48 ? 50  DG  I N3    1 
ATOM   6710  C C4    . DG  I 7  53  ? 97.769  102.694 143.699 1.00 100.38 ? 50  DG  I C4    1 
ATOM   6711  P P     . DC  I 7  54  ? 96.425  106.599 138.768 1.00 96.94  ? 51  DC  I P     1 
ATOM   6712  O OP1   . DC  I 7  54  ? 95.614  106.796 137.540 1.00 93.14  ? 51  DC  I OP1   1 
ATOM   6713  O OP2   . DC  I 7  54  ? 97.663  107.388 138.991 1.00 100.32 ? 51  DC  I OP2   1 
ATOM   6714  O "O5'" . DC  I 7  54  ? 95.523  106.914 140.042 1.00 99.26  ? 51  DC  I "O5'" 1 
ATOM   6715  C "C5'" . DC  I 7  54  ? 94.354  106.119 140.315 1.00 103.34 ? 51  DC  I "C5'" 1 
ATOM   6716  C "C4'" . DC  I 7  54  ? 93.865  106.350 141.724 1.00 110.13 ? 51  DC  I "C4'" 1 
ATOM   6717  O "O4'" . DC  I 7  54  ? 94.726  105.673 142.661 1.00 106.18 ? 51  DC  I "O4'" 1 
ATOM   6718  C "C3'" . DC  I 7  54  ? 93.819  107.816 142.157 1.00 110.61 ? 51  DC  I "C3'" 1 
ATOM   6719  O "O3'" . DC  I 7  54  ? 92.447  108.186 142.361 1.00 116.99 ? 51  DC  I "O3'" 1 
ATOM   6720  C "C2'" . DC  I 7  54  ? 94.616  107.862 143.460 1.00 109.37 ? 51  DC  I "C2'" 1 
ATOM   6721  C "C1'" . DC  I 7  54  ? 94.760  106.409 143.865 1.00 109.25 ? 51  DC  I "C1'" 1 
ATOM   6722  N N1    . DC  I 7  54  ? 96.022  106.088 144.555 1.00 105.95 ? 51  DC  I N1    1 
ATOM   6723  C C2    . DC  I 7  54  ? 95.985  105.581 145.859 1.00 109.62 ? 51  DC  I C2    1 
ATOM   6724  O O2    . DC  I 7  54  ? 94.892  105.409 146.415 1.00 109.15 ? 51  DC  I O2    1 
ATOM   6725  N N3    . DC  I 7  54  ? 97.141  105.286 146.491 1.00 105.79 ? 51  DC  I N3    1 
ATOM   6726  C C4    . DC  I 7  54  ? 98.304  105.479 145.871 1.00 103.32 ? 51  DC  I C4    1 
ATOM   6727  N N4    . DC  I 7  54  ? 99.422  105.175 146.530 1.00 103.32 ? 51  DC  I N4    1 
ATOM   6728  C C5    . DC  I 7  54  ? 98.374  105.993 144.548 1.00 101.26 ? 51  DC  I C5    1 
ATOM   6729  C C6    . DC  I 7  54  ? 97.222  106.281 143.933 1.00 102.48 ? 51  DC  I C6    1 
ATOM   6730  P P     . DA  I 7  55  ? 91.998  109.710 142.636 1.00 135.21 ? 52  DA  I P     1 
ATOM   6731  O OP1   . DA  I 7  55  ? 90.631  109.895 142.086 1.00 130.17 ? 52  DA  I OP1   1 
ATOM   6732  O OP2   . DA  I 7  55  ? 93.093  110.616 142.204 1.00 125.21 ? 52  DA  I OP2   1 
ATOM   6733  O "O5'" . DA  I 7  55  ? 91.908  109.775 144.223 1.00 123.11 ? 52  DA  I "O5'" 1 
ATOM   6734  C "C5'" . DA  I 7  55  ? 91.157  108.789 144.955 1.00 122.79 ? 52  DA  I "C5'" 1 
ATOM   6735  C "C4'" . DA  I 7  55  ? 91.347  108.984 146.437 1.00 123.34 ? 52  DA  I "C4'" 1 
ATOM   6736  O "O4'" . DA  I 7  55  ? 92.594  108.374 146.839 1.00 118.41 ? 52  DA  I "O4'" 1 
ATOM   6737  C "C3'" . DA  I 7  55  ? 91.400  110.444 146.900 1.00 126.26 ? 52  DA  I "C3'" 1 
ATOM   6738  O "O3'" . DA  I 7  55  ? 90.451  110.627 147.964 1.00 128.87 ? 52  DA  I "O3'" 1 
ATOM   6739  C "C2'" . DA  I 7  55  ? 92.838  110.623 147.380 1.00 120.64 ? 52  DA  I "C2'" 1 
ATOM   6740  C "C1'" . DA  I 7  55  ? 93.249  109.216 147.764 1.00 117.08 ? 52  DA  I "C1'" 1 
ATOM   6741  N N9    . DA  I 7  55  ? 94.686  108.962 147.678 1.00 113.47 ? 52  DA  I N9    1 
ATOM   6742  C C8    . DA  I 7  55  ? 95.536  109.231 146.635 1.00 111.64 ? 52  DA  I C8    1 
ATOM   6743  N N7    . DA  I 7  55  ? 96.778  108.885 146.863 1.00 109.81 ? 52  DA  I N7    1 
ATOM   6744  C C5    . DA  I 7  55  ? 96.744  108.351 148.141 1.00 110.27 ? 52  DA  I C5    1 
ATOM   6745  C C6    . DA  I 7  55  ? 97.742  107.807 148.962 1.00 112.82 ? 52  DA  I C6    1 
ATOM   6746  N N6    . DA  I 7  55  ? 99.020  107.700 148.604 1.00 112.63 ? 52  DA  I N6    1 
ATOM   6747  N N1    . DA  I 7  55  ? 97.376  107.366 150.183 1.00 112.08 ? 52  DA  I N1    1 
ATOM   6748  C C2    . DA  I 7  55  ? 96.093  107.473 150.542 1.00 113.97 ? 52  DA  I C2    1 
ATOM   6749  N N3    . DA  I 7  55  ? 95.066  107.966 149.860 1.00 113.75 ? 52  DA  I N3    1 
ATOM   6750  C C4    . DA  I 7  55  ? 95.463  108.395 148.654 1.00 112.60 ? 52  DA  I C4    1 
ATOM   6751  P P     . DC  I 7  56  ? 90.117  112.076 148.586 1.00 139.54 ? 53  DC  I P     1 
ATOM   6752  O OP1   . DC  I 7  56  ? 88.706  112.085 149.049 1.00 135.10 ? 53  DC  I OP1   1 
ATOM   6753  O OP2   . DC  I 7  56  ? 90.614  113.133 147.666 1.00 132.37 ? 53  DC  I OP2   1 
ATOM   6754  O "O5'" . DC  I 7  56  ? 91.075  112.173 149.852 1.00 128.05 ? 53  DC  I "O5'" 1 
ATOM   6755  C "C5'" . DC  I 7  56  ? 91.066  111.130 150.844 1.00 128.74 ? 53  DC  I "C5'" 1 
ATOM   6756  C "C4'" . DC  I 7  56  ? 92.223  111.297 151.796 1.00 128.94 ? 53  DC  I "C4'" 1 
ATOM   6757  O "O4'" . DC  I 7  56  ? 93.436  110.801 151.205 1.00 122.89 ? 53  DC  I "O4'" 1 
ATOM   6758  C "C3'" . DC  I 7  56  ? 92.549  112.739 152.174 1.00 131.08 ? 53  DC  I "C3'" 1 
ATOM   6759  O "O3'" . DC  I 7  56  ? 91.858  113.085 153.386 1.00 133.70 ? 53  DC  I "O3'" 1 
ATOM   6760  C "C2'" . DC  I 7  56  ? 94.064  112.728 152.373 1.00 124.33 ? 53  DC  I "C2'" 1 
ATOM   6761  C "C1'" . DC  I 7  56  ? 94.499  111.330 151.968 1.00 121.65 ? 53  DC  I "C1'" 1 
ATOM   6762  N N1    . DC  I 7  56  ? 95.724  111.294 151.155 1.00 117.09 ? 53  DC  I N1    1 
ATOM   6763  C C2    . DC  I 7  56  ? 96.909  110.840 151.741 1.00 115.79 ? 53  DC  I C2    1 
ATOM   6764  O O2    . DC  I 7  56  ? 96.902  110.478 152.925 1.00 116.96 ? 53  DC  I O2    1 
ATOM   6765  N N3    . DC  I 7  56  ? 98.039  110.802 151.007 1.00 114.35 ? 53  DC  I N3    1 
ATOM   6766  C C4    . DC  I 7  56  ? 98.018  111.196 149.736 1.00 114.69 ? 53  DC  I C4    1 
ATOM   6767  N N4    . DC  I 7  56  ? 99.160  111.141 149.050 1.00 115.23 ? 53  DC  I N4    1 
ATOM   6768  C C5    . DC  I 7  56  ? 96.828  111.666 149.112 1.00 112.75 ? 53  DC  I C5    1 
ATOM   6769  C C6    . DC  I 7  56  ? 95.714  111.698 149.850 1.00 114.93 ? 53  DC  I C6    1 
ATOM   6770  P P     . DC  I 7  57  ? 91.915  114.572 154.010 1.00 141.53 ? 54  DC  I P     1 
ATOM   6771  O OP1   . DC  I 7  57  ? 90.707  114.788 154.845 1.00 138.00 ? 54  DC  I OP1   1 
ATOM   6772  O OP2   . DC  I 7  57  ? 92.267  115.539 152.937 1.00 136.13 ? 54  DC  I OP2   1 
ATOM   6773  O "O5'" . DC  I 7  57  ? 93.200  114.558 154.954 1.00 129.20 ? 54  DC  I "O5'" 1 
ATOM   6774  C "C5'" . DC  I 7  57  ? 93.352  113.571 155.992 1.00 129.46 ? 54  DC  I "C5'" 1 
ATOM   6775  C "C4'" . DC  I 7  57  ? 94.739  113.653 156.587 1.00 129.57 ? 54  DC  I "C4'" 1 
ATOM   6776  O "O4'" . DC  I 7  57  ? 95.707  113.178 155.629 1.00 124.70 ? 54  DC  I "O4'" 1 
ATOM   6777  C "C3'" . DC  I 7  57  ? 95.172  115.069 156.964 1.00 129.48 ? 54  DC  I "C3'" 1 
ATOM   6778  O "O3'" . DC  I 7  57  ? 95.211  115.200 158.394 1.00 132.03 ? 54  DC  I "O3'" 1 
ATOM   6779  C "C2'" . DC  I 7  57  ? 96.566  115.228 156.367 1.00 123.77 ? 54  DC  I "C2'" 1 
ATOM   6780  C "C1'" . DC  I 7  57  ? 96.930  113.856 155.836 1.00 121.68 ? 54  DC  I "C1'" 1 
ATOM   6781  N N1    . DC  I 7  57  ? 97.641  113.892 154.547 1.00 118.78 ? 54  DC  I N1    1 
ATOM   6782  C C2    . DC  I 7  57  ? 98.987  113.507 154.477 1.00 116.12 ? 54  DC  I C2    1 
ATOM   6783  O O2    . DC  I 7  57  ? 99.577  113.137 155.503 1.00 116.67 ? 54  DC  I O2    1 
ATOM   6784  N N3    . DC  I 7  57  ? 99.623  113.544 153.287 1.00 115.15 ? 54  DC  I N3    1 
ATOM   6785  C C4    . DC  I 7  57  ? 98.969  113.945 152.197 1.00 114.36 ? 54  DC  I C4    1 
ATOM   6786  N N4    . DC  I 7  57  ? 99.631  113.969 151.040 1.00 114.53 ? 54  DC  I N4    1 
ATOM   6787  C C5    . DC  I 7  57  ? 97.607  114.342 152.239 1.00 115.48 ? 54  DC  I C5    1 
ATOM   6788  C C6    . DC  I 7  57  ? 96.988  114.301 153.421 1.00 118.05 ? 54  DC  I C6    1 
ATOM   6789  P P     . DG  I 7  58  ? 95.291  116.644 159.109 1.00 143.94 ? 55  DG  I P     1 
ATOM   6790  O OP1   . DG  I 7  58  ? 94.837  116.488 160.514 1.00 138.78 ? 55  DG  I OP1   1 
ATOM   6791  O OP2   . DG  I 7  58  ? 94.632  117.646 158.233 1.00 136.41 ? 55  DG  I OP2   1 
ATOM   6792  O "O5'" . DG  I 7  58  ? 96.852  116.960 159.121 1.00 131.12 ? 55  DG  I "O5'" 1 
ATOM   6793  C "C5'" . DG  I 7  58  ? 97.692  116.419 160.157 1.00 131.95 ? 55  DG  I "C5'" 1 
ATOM   6794  C "C4'" . DG  I 7  58  ? 99.152  116.575 159.800 1.00 133.28 ? 55  DG  I "C4'" 1 
ATOM   6795  O "O4'" . DG  I 7  58  ? 99.364  116.164 158.434 1.00 127.31 ? 55  DG  I "O4'" 1 
ATOM   6796  C "C3'" . DG  I 7  58  ? 99.715  117.994 159.905 1.00 133.79 ? 55  DG  I "C3'" 1 
ATOM   6797  O "O3'" . DG  I 7  58  ? 100.654 118.035 160.993 1.00 135.65 ? 55  DG  I "O3'" 1 
ATOM   6798  C "C2'" . DG  I 7  58  ? 100.408 118.241 158.566 1.00 125.77 ? 55  DG  I "C2'" 1 
ATOM   6799  C "C1'" . DG  I 7  58  ? 100.471 116.873 157.918 1.00 123.11 ? 55  DG  I "C1'" 1 
ATOM   6800  N N9    . DG  I 7  58  ? 100.345 116.898 156.465 1.00 118.26 ? 55  DG  I N9    1 
ATOM   6801  C C8    . DG  I 7  58  ? 99.219  117.194 155.741 1.00 117.13 ? 55  DG  I C8    1 
ATOM   6802  N N7    . DG  I 7  58  ? 99.405  117.133 154.454 1.00 114.28 ? 55  DG  I N7    1 
ATOM   6803  C C5    . DG  I 7  58  ? 100.735 116.776 154.319 1.00 113.93 ? 55  DG  I C5    1 
ATOM   6804  C C6    . DG  I 7  58  ? 101.508 116.559 153.154 1.00 112.83 ? 55  DG  I C6    1 
ATOM   6805  O O6    . DG  I 7  58  ? 101.148 116.641 151.975 1.00 112.68 ? 55  DG  I O6    1 
ATOM   6806  N N1    . DG  I 7  58  ? 102.817 116.210 153.465 1.00 112.60 ? 55  DG  I N1    1 
ATOM   6807  C C2    . DG  I 7  58  ? 103.316 116.091 154.737 1.00 113.75 ? 55  DG  I C2    1 
ATOM   6808  N N2    . DG  I 7  58  ? 104.608 115.745 154.840 1.00 113.49 ? 55  DG  I N2    1 
ATOM   6809  N N3    . DG  I 7  58  ? 102.603 116.289 155.834 1.00 114.72 ? 55  DG  I N3    1 
ATOM   6810  C C4    . DG  I 7  58  ? 101.330 116.628 155.551 1.00 115.20 ? 55  DG  I C4    1 
ATOM   6811  P P     . DC  I 7  59  ? 101.255 119.423 161.552 1.00 144.21 ? 56  DC  I P     1 
ATOM   6812  O OP1   . DC  I 7  59  ? 101.612 119.245 162.982 1.00 139.93 ? 56  DC  I OP1   1 
ATOM   6813  O OP2   . DC  I 7  59  ? 100.368 120.538 161.131 1.00 138.34 ? 56  DC  I OP2   1 
ATOM   6814  O "O5'" . DC  I 7  59  ? 102.590 119.642 160.709 1.00 131.71 ? 56  DC  I "O5'" 1 
ATOM   6815  C "C5'" . DC  I 7  59  ? 103.594 118.611 160.655 1.00 131.45 ? 56  DC  I "C5'" 1 
ATOM   6816  C "C4'" . DC  I 7  59  ? 104.730 119.019 159.747 1.00 129.41 ? 56  DC  I "C4'" 1 
ATOM   6817  O "O4'" . DC  I 7  59  ? 104.364 118.772 158.369 1.00 122.93 ? 56  DC  I "O4'" 1 
ATOM   6818  C "C3'" . DC  I 7  59  ? 105.130 120.495 159.835 1.00 126.84 ? 56  DC  I "C3'" 1 
ATOM   6819  O "O3'" . DC  I 7  59  ? 106.548 120.575 160.046 1.00 127.33 ? 56  DC  I "O3'" 1 
ATOM   6820  C "C2'" . DC  I 7  59  ? 104.729 121.069 158.481 1.00 122.42 ? 56  DC  I "C2'" 1 
ATOM   6821  C "C1'" . DC  I 7  59  ? 104.777 119.860 157.564 1.00 119.81 ? 56  DC  I "C1'" 1 
ATOM   6822  N N1    . DC  I 7  59  ? 103.872 119.909 156.398 1.00 116.46 ? 56  DC  I N1    1 
ATOM   6823  C C2    . DC  I 7  59  ? 104.380 119.665 155.114 1.00 113.07 ? 56  DC  I C2    1 
ATOM   6824  O O2    . DC  I 7  59  ? 105.584 119.414 154.965 1.00 113.15 ? 56  DC  I O2    1 
ATOM   6825  N N3    . DC  I 7  59  ? 103.548 119.709 154.052 1.00 110.57 ? 56  DC  I N3    1 
ATOM   6826  C C4    . DC  I 7  59  ? 102.256 119.981 154.230 1.00 110.98 ? 56  DC  I C4    1 
ATOM   6827  N N4    . DC  I 7  59  ? 101.467 120.016 153.156 1.00 110.92 ? 56  DC  I N4    1 
ATOM   6828  C C5    . DC  I 7  59  ? 101.713 120.234 155.517 1.00 112.74 ? 56  DC  I C5    1 
ATOM   6829  C C6    . DC  I 7  59  ? 102.544 120.188 156.561 1.00 115.53 ? 56  DC  I C6    1 
ATOM   6830  P P     . DT  I 7  60  ? 107.299 121.963 160.379 1.00 137.29 ? 57  DT  I P     1 
ATOM   6831  O OP1   . DT  I 7  60  ? 108.208 121.738 161.529 1.00 135.28 ? 57  DT  I OP1   1 
ATOM   6832  O OP2   . DT  I 7  60  ? 106.287 123.049 160.441 1.00 130.93 ? 57  DT  I OP2   1 
ATOM   6833  O "O5'" . DT  I 7  60  ? 108.185 122.195 159.073 1.00 126.76 ? 57  DT  I "O5'" 1 
ATOM   6834  C "C5'" . DT  I 7  60  ? 109.084 121.167 158.616 1.00 126.85 ? 57  DT  I "C5'" 1 
ATOM   6835  C "C4'" . DT  I 7  60  ? 109.605 121.479 157.232 1.00 123.43 ? 57  DT  I "C4'" 1 
ATOM   6836  O "O4'" . DT  I 7  60  ? 108.531 121.351 156.272 1.00 118.05 ? 57  DT  I "O4'" 1 
ATOM   6837  C "C3'" . DT  I 7  60  ? 110.196 122.878 157.048 1.00 119.00 ? 57  DT  I "C3'" 1 
ATOM   6838  O "O3'" . DT  I 7  60  ? 111.513 122.746 156.492 1.00 121.25 ? 57  DT  I "O3'" 1 
ATOM   6839  C "C2'" . DT  I 7  60  ? 109.242 123.562 156.074 1.00 114.73 ? 57  DT  I "C2'" 1 
ATOM   6840  C "C1'" . DT  I 7  60  ? 108.610 122.401 155.330 1.00 114.05 ? 57  DT  I "C1'" 1 
ATOM   6841  N N1    . DT  I 7  60  ? 107.244 122.650 154.829 1.00 111.10 ? 57  DT  I N1    1 
ATOM   6842  C C2    . DT  I 7  60  ? 106.984 122.457 153.490 1.00 110.36 ? 57  DT  I C2    1 
ATOM   6843  O O2    . DT  I 7  60  ? 107.830 122.087 152.693 1.00 109.69 ? 57  DT  I O2    1 
ATOM   6844  N N3    . DT  I 7  60  ? 105.688 122.709 153.115 1.00 108.58 ? 57  DT  I N3    1 
ATOM   6845  C C4    . DT  I 7  60  ? 104.654 123.128 153.926 1.00 108.06 ? 57  DT  I C4    1 
ATOM   6846  O O4    . DT  I 7  60  ? 103.535 123.314 153.457 1.00 108.10 ? 57  DT  I O4    1 
ATOM   6847  C C5    . DT  I 7  60  ? 104.999 123.311 155.312 1.00 110.16 ? 57  DT  I C5    1 
ATOM   6848  C C7    . DT  I 7  60  ? 103.943 123.772 156.260 1.00 112.37 ? 57  DT  I C7    1 
ATOM   6849  C C6    . DT  I 7  60  ? 106.256 123.066 155.689 1.00 112.01 ? 57  DT  I C6    1 
ATOM   6850  P P     . DT  I 7  61  ? 112.547 123.983 156.421 1.00 130.83 ? 58  DT  I P     1 
ATOM   6851  O OP1   . DT  I 7  61  ? 113.927 123.440 156.448 1.00 124.29 ? 58  DT  I OP1   1 
ATOM   6852  O OP2   . DT  I 7  61  ? 112.136 125.000 157.423 1.00 126.18 ? 58  DT  I OP2   1 
ATOM   6853  O "O5'" . DT  I 7  61  ? 112.276 124.583 154.972 1.00 118.65 ? 58  DT  I "O5'" 1 
ATOM   6854  C "C5'" . DT  I 7  61  ? 112.336 123.733 153.812 1.00 117.56 ? 58  DT  I "C5'" 1 
ATOM   6855  C "C4'" . DT  I 7  61  ? 111.811 124.460 152.598 1.00 114.76 ? 58  DT  I "C4'" 1 
ATOM   6856  O "O4'" . DT  I 7  61  ? 110.362 124.482 152.625 1.00 110.12 ? 58  DT  I "O4'" 1 
ATOM   6857  C "C3'" . DT  I 7  61  ? 112.258 125.918 152.475 1.00 114.38 ? 58  DT  I "C3'" 1 
ATOM   6858  O "O3'" . DT  I 7  61  ? 112.639 126.187 151.123 1.00 113.29 ? 58  DT  I "O3'" 1 
ATOM   6859  C "C2'" . DT  I 7  61  ? 111.004 126.700 152.817 1.00 108.46 ? 58  DT  I "C2'" 1 
ATOM   6860  C "C1'" . DT  I 7  61  ? 109.928 125.779 152.271 1.00 105.99 ? 58  DT  I "C1'" 1 
ATOM   6861  N N1    . DT  I 7  61  ? 108.559 125.986 152.789 1.00 104.76 ? 58  DT  I N1    1 
ATOM   6862  C C2    . DT  I 7  61  ? 107.517 125.871 151.897 1.00 103.17 ? 58  DT  I C2    1 
ATOM   6863  O O2    . DT  I 7  61  ? 107.681 125.604 150.720 1.00 102.51 ? 58  DT  I O2    1 
ATOM   6864  N N3    . DT  I 7  61  ? 106.273 126.078 152.435 1.00 103.99 ? 58  DT  I N3    1 
ATOM   6865  C C4    . DT  I 7  61  ? 105.973 126.381 153.745 1.00 105.73 ? 58  DT  I C4    1 
ATOM   6866  O O4    . DT  I 7  61  ? 104.805 126.544 154.096 1.00 107.70 ? 58  DT  I O4    1 
ATOM   6867  C C5    . DT  I 7  61  ? 107.109 126.484 154.624 1.00 105.85 ? 58  DT  I C5    1 
ATOM   6868  C C7    . DT  I 7  61  ? 106.879 126.805 156.064 1.00 111.59 ? 58  DT  I C7    1 
ATOM   6869  C C6    . DT  I 7  61  ? 108.326 126.286 154.112 1.00 104.07 ? 58  DT  I C6    1 
ATOM   6870  P P     . DA  I 7  62  ? 114.182 126.340 150.689 1.00 122.18 ? 59  DA  I P     1 
ATOM   6871  O OP1   . DA  I 7  62  ? 114.923 125.114 151.080 1.00 120.26 ? 59  DA  I OP1   1 
ATOM   6872  O OP2   . DA  I 7  62  ? 114.662 127.670 151.145 1.00 119.47 ? 59  DA  I OP2   1 
ATOM   6873  O "O5'" . DA  I 7  62  ? 114.083 126.367 149.102 1.00 117.94 ? 59  DA  I "O5'" 1 
ATOM   6874  C "C5'" . DA  I 7  62  ? 113.922 125.135 148.375 1.00 119.87 ? 59  DA  I "C5'" 1 
ATOM   6875  C "C4'" . DA  I 7  62  ? 112.939 125.298 147.240 1.00 118.15 ? 59  DA  I "C4'" 1 
ATOM   6876  O "O4'" . DA  I 7  62  ? 111.640 125.677 147.757 1.00 112.80 ? 59  DA  I "O4'" 1 
ATOM   6877  C "C3'" . DA  I 7  62  ? 113.304 126.361 146.207 1.00 118.41 ? 59  DA  I "C3'" 1 
ATOM   6878  O "O3'" . DA  I 7  62  ? 112.886 125.894 144.914 1.00 116.50 ? 59  DA  I "O3'" 1 
ATOM   6879  C "C2'" . DA  I 7  62  ? 112.501 127.566 146.676 1.00 112.68 ? 59  DA  I "C2'" 1 
ATOM   6880  C "C1'" . DA  I 7  62  ? 111.232 126.922 147.208 1.00 108.28 ? 59  DA  I "C1'" 1 
ATOM   6881  N N9    . DA  I 7  62  ? 110.547 127.671 148.265 1.00 106.55 ? 59  DA  I N9    1 
ATOM   6882  C C8    . DA  I 7  62  ? 111.096 128.397 149.291 1.00 106.20 ? 59  DA  I C8    1 
ATOM   6883  N N7    . DA  I 7  62  ? 110.210 128.953 150.080 1.00 103.92 ? 59  DA  I N7    1 
ATOM   6884  C C5    . DA  I 7  62  ? 108.996 128.570 149.541 1.00 101.09 ? 59  DA  I C5    1 
ATOM   6885  C C6    . DA  I 7  62  ? 107.671 128.834 149.919 1.00 100.94 ? 59  DA  I C6    1 
ATOM   6886  N N6    . DA  I 7  62  ? 107.334 129.576 150.973 1.00 101.62 ? 59  DA  I N6    1 
ATOM   6887  N N1    . DA  I 7  62  ? 106.687 128.302 149.165 1.00 100.57 ? 59  DA  I N1    1 
ATOM   6888  C C2    . DA  I 7  62  ? 107.027 127.556 148.108 1.00 100.83 ? 59  DA  I C2    1 
ATOM   6889  N N3    . DA  I 7  62  ? 108.234 127.237 147.655 1.00 101.47 ? 59  DA  I N3    1 
ATOM   6890  C C4    . DA  I 7  62  ? 109.187 127.781 148.424 1.00 101.96 ? 59  DA  I C4    1 
ATOM   6891  P P     . DA  I 7  63  ? 113.179 126.708 143.554 1.00 120.59 ? 60  DA  I P     1 
ATOM   6892  O OP1   . DA  I 7  63  ? 113.695 125.753 142.542 1.00 116.58 ? 60  DA  I OP1   1 
ATOM   6893  O OP2   . DA  I 7  63  ? 113.962 127.925 143.890 1.00 118.01 ? 60  DA  I OP2   1 
ATOM   6894  O "O5'" . DA  I 7  63  ? 111.721 127.164 143.108 1.00 110.04 ? 60  DA  I "O5'" 1 
ATOM   6895  C "C5'" . DA  I 7  63  ? 110.663 126.191 143.013 1.00 110.28 ? 60  DA  I "C5'" 1 
ATOM   6896  C "C4'" . DA  I 7  63  ? 109.335 126.860 142.759 1.00 103.80 ? 60  DA  I "C4'" 1 
ATOM   6897  O "O4'" . DA  I 7  63  ? 108.891 127.518 143.970 1.00 102.63 ? 60  DA  I "O4'" 1 
ATOM   6898  C "C3'" . DA  I 7  63  ? 109.323 127.930 141.668 1.00 98.74  ? 60  DA  I "C3'" 1 
ATOM   6899  O "O3'" . DA  I 7  63  ? 108.087 127.806 140.946 1.00 97.67  ? 60  DA  I "O3'" 1 
ATOM   6900  C "C2'" . DA  I 7  63  ? 109.394 129.220 142.474 1.00 98.38  ? 60  DA  I "C2'" 1 
ATOM   6901  C "C1'" . DA  I 7  63  ? 108.558 128.865 143.688 1.00 97.54  ? 60  DA  I "C1'" 1 
ATOM   6902  N N9    . DA  I 7  63  ? 108.822 129.649 144.896 1.00 97.96  ? 60  DA  I N9    1 
ATOM   6903  C C8    . DA  I 7  63  ? 110.030 130.021 145.427 1.00 100.16 ? 60  DA  I C8    1 
ATOM   6904  N N7    . DA  I 7  63  ? 109.931 130.724 146.530 1.00 97.41  ? 60  DA  I N7    1 
ATOM   6905  C C5    . DA  I 7  63  ? 108.566 130.822 146.739 1.00 97.47  ? 60  DA  I C5    1 
ATOM   6906  C C6    . DA  I 7  63  ? 107.804 131.443 147.740 1.00 98.02  ? 60  DA  I C6    1 
ATOM   6907  N N6    . DA  I 7  63  ? 108.333 132.111 148.764 1.00 99.89  ? 60  DA  I N6    1 
ATOM   6908  N N1    . DA  I 7  63  ? 106.461 131.355 147.656 1.00 99.61  ? 60  DA  I N1    1 
ATOM   6909  C C2    . DA  I 7  63  ? 105.933 130.684 146.628 1.00 99.47  ? 60  DA  I C2    1 
ATOM   6910  N N3    . DA  I 7  63  ? 106.544 130.059 145.628 1.00 96.69  ? 60  DA  I N3    1 
ATOM   6911  C C4    . DA  I 7  63  ? 107.874 130.166 145.742 1.00 96.96  ? 60  DA  I C4    1 
ATOM   6912  P P     . DA  I 7  64  ? 107.720 128.702 139.658 1.00 96.63  ? 61  DA  I P     1 
ATOM   6913  O OP1   . DA  I 7  64  ? 107.288 127.792 138.569 1.00 96.37  ? 61  DA  I OP1   1 
ATOM   6914  O OP2   . DA  I 7  64  ? 108.823 129.666 139.418 1.00 95.85  ? 61  DA  I OP2   1 
ATOM   6915  O "O5'" . DA  I 7  64  ? 106.448 129.522 140.159 1.00 97.03  ? 61  DA  I "O5'" 1 
ATOM   6916  C "C5'" . DA  I 7  64  ? 105.405 128.869 140.910 1.00 95.85  ? 61  DA  I "C5'" 1 
ATOM   6917  C "C4'" . DA  I 7  64  ? 104.350 129.857 141.344 1.00 94.96  ? 61  DA  I "C4'" 1 
ATOM   6918  O "O4'" . DA  I 7  64  ? 104.774 130.514 142.561 1.00 95.92  ? 61  DA  I "O4'" 1 
ATOM   6919  C "C3'" . DA  I 7  64  ? 104.036 130.973 140.350 1.00 92.90  ? 61  DA  I "C3'" 1 
ATOM   6920  O "O3'" . DA  I 7  64  ? 102.626 131.233 140.399 1.00 93.89  ? 61  DA  I "O3'" 1 
ATOM   6921  C "C2'" . DA  I 7  64  ? 104.851 132.141 140.887 1.00 93.76  ? 61  DA  I "C2'" 1 
ATOM   6922  C "C1'" . DA  I 7  64  ? 104.781 131.920 142.386 1.00 93.84  ? 61  DA  I "C1'" 1 
ATOM   6923  N N9    . DA  I 7  64  ? 105.912 132.451 143.147 1.00 93.86  ? 61  DA  I N9    1 
ATOM   6924  C C8    . DA  I 7  64  ? 107.250 132.315 142.888 1.00 93.13  ? 61  DA  I C8    1 
ATOM   6925  N N7    . DA  I 7  64  ? 108.025 132.908 143.764 1.00 93.62  ? 61  DA  I N7    1 
ATOM   6926  C C5    . DA  I 7  64  ? 107.134 133.473 144.661 1.00 94.56  ? 61  DA  I C5    1 
ATOM   6927  C C6    . DA  I 7  64  ? 107.318 134.239 145.822 1.00 97.61  ? 61  DA  I C6    1 
ATOM   6928  N N6    . DA  I 7  64  ? 108.511 134.584 146.303 1.00 98.95  ? 61  DA  I N6    1 
ATOM   6929  N N1    . DA  I 7  64  ? 106.219 134.648 146.486 1.00 99.16  ? 61  DA  I N1    1 
ATOM   6930  C C2    . DA  I 7  64  ? 105.022 134.304 146.004 1.00 98.04  ? 61  DA  I C2    1 
ATOM   6931  N N3    . DA  I 7  64  ? 104.723 133.589 144.927 1.00 95.90  ? 61  DA  I N3    1 
ATOM   6932  C C4    . DA  I 7  64  ? 105.834 133.201 144.291 1.00 94.47  ? 61  DA  I C4    1 
ATOM   6933  P P     . DC  I 7  65  ? 101.899 132.266 139.402 1.00 97.99  ? 62  DC  I P     1 
ATOM   6934  O OP1   . DC  I 7  65  ? 100.675 131.627 138.861 1.00 99.30  ? 62  DC  I OP1   1 
ATOM   6935  O OP2   . DC  I 7  65  ? 102.910 132.857 138.488 1.00 97.47  ? 62  DC  I OP2   1 
ATOM   6936  O "O5'" . DC  I 7  65  ? 101.477 133.471 140.355 1.00 100.02 ? 62  DC  I "O5'" 1 
ATOM   6937  C "C5'" . DC  I 7  65  ? 100.843 133.208 141.621 1.00 99.92  ? 62  DC  I "C5'" 1 
ATOM   6938  C "C4'" . DC  I 7  65  ? 100.497 134.499 142.322 1.00 104.40 ? 62  DC  I "C4'" 1 
ATOM   6939  O "O4'" . DC  I 7  65  ? 101.616 134.914 143.137 1.00 100.80 ? 62  DC  I "O4'" 1 
ATOM   6940  C "C3'" . DC  I 7  65  ? 100.168 135.664 141.389 1.00 104.40 ? 62  DC  I "C3'" 1 
ATOM   6941  O "O3'" . DC  I 7  65  ? 98.973  136.313 141.849 1.00 109.15 ? 62  DC  I "O3'" 1 
ATOM   6942  C "C2'" . DC  I 7  65  ? 101.380 136.579 141.495 1.00 104.05 ? 62  DC  I "C2'" 1 
ATOM   6943  C "C1'" . DC  I 7  65  ? 101.964 136.258 142.858 1.00 102.29 ? 62  DC  I "C1'" 1 
ATOM   6944  N N1    . DC  I 7  65  ? 103.433 136.347 142.935 1.00 97.94  ? 62  DC  I N1    1 
ATOM   6945  C C2    . DC  I 7  65  ? 104.025 137.082 143.969 1.00 100.89 ? 62  DC  I C2    1 
ATOM   6946  O O2    . DC  I 7  65  ? 103.310 137.648 144.808 1.00 102.88 ? 62  DC  I O2    1 
ATOM   6947  N N3    . DC  I 7  65  ? 105.370 137.161 144.038 1.00 100.73 ? 62  DC  I N3    1 
ATOM   6948  C C4    . DC  I 7  65  ? 106.120 136.543 143.125 1.00 99.34  ? 62  DC  I C4    1 
ATOM   6949  N N4    . DC  I 7  65  ? 107.445 136.645 143.228 1.00 98.72  ? 62  DC  I N4    1 
ATOM   6950  C C5    . DC  I 7  65  ? 105.548 135.792 142.065 1.00 94.84  ? 62  DC  I C5    1 
ATOM   6951  C C6    . DC  I 7  65  ? 104.216 135.721 142.009 1.00 95.25  ? 62  DC  I C6    1 
ATOM   6952  P P     . DG  I 7  66  ? 98.235  137.461 140.991 1.00 123.46 ? 63  DG  I P     1 
ATOM   6953  O OP1   . DG  I 7  66  ? 96.784  137.402 141.298 1.00 120.43 ? 63  DG  I OP1   1 
ATOM   6954  O OP2   . DG  I 7  66  ? 98.693  137.374 139.581 1.00 115.30 ? 63  DG  I OP2   1 
ATOM   6955  O "O5'" . DG  I 7  66  ? 98.824  138.803 141.618 1.00 117.31 ? 63  DG  I "O5'" 1 
ATOM   6956  C "C5'" . DG  I 7  66  ? 98.725  139.033 143.036 1.00 117.36 ? 63  DG  I "C5'" 1 
ATOM   6957  C "C4'" . DG  I 7  66  ? 99.396  140.328 143.430 1.00 116.74 ? 63  DG  I "C4'" 1 
ATOM   6958  O "O4'" . DG  I 7  66  ? 100.820 140.110 143.571 1.00 110.47 ? 63  DG  I "O4'" 1 
ATOM   6959  C "C3'" . DG  I 7  66  ? 99.239  141.497 142.455 1.00 118.73 ? 63  DG  I "C3'" 1 
ATOM   6960  O "O3'" . DG  I 7  66  ? 98.976  142.682 143.222 1.00 121.08 ? 63  DG  I "O3'" 1 
ATOM   6961  C "C2'" . DG  I 7  66  ? 100.596 141.562 141.772 1.00 113.73 ? 63  DG  I "C2'" 1 
ATOM   6962  C "C1'" . DG  I 7  66  ? 101.524 141.132 142.888 1.00 111.56 ? 63  DG  I "C1'" 1 
ATOM   6963  N N9    . DG  I 7  66  ? 102.800 140.581 142.446 1.00 108.57 ? 63  DG  I N9    1 
ATOM   6964  C C8    . DG  I 7  66  ? 103.021 139.711 141.408 1.00 105.13 ? 63  DG  I C8    1 
ATOM   6965  N N7    . DG  I 7  66  ? 104.275 139.398 141.258 1.00 103.75 ? 63  DG  I N7    1 
ATOM   6966  C C5    . DG  I 7  66  ? 104.923 140.102 142.257 1.00 105.15 ? 63  DG  I C5    1 
ATOM   6967  C C6    . DG  I 7  66  ? 106.296 140.158 142.590 1.00 105.38 ? 63  DG  I C6    1 
ATOM   6968  O O6    . DG  I 7  66  ? 107.236 139.571 142.045 1.00 107.53 ? 63  DG  I O6    1 
ATOM   6969  N N1    . DG  I 7  66  ? 106.526 140.996 143.674 1.00 108.27 ? 63  DG  I N1    1 
ATOM   6970  C C2    . DG  I 7  66  ? 105.555 141.692 144.348 1.00 108.81 ? 63  DG  I C2    1 
ATOM   6971  N N2    . DG  I 7  66  ? 105.967 142.453 145.373 1.00 111.62 ? 63  DG  I N2    1 
ATOM   6972  N N3    . DG  I 7  66  ? 104.269 141.645 144.047 1.00 108.44 ? 63  DG  I N3    1 
ATOM   6973  C C4    . DG  I 7  66  ? 104.028 140.837 142.998 1.00 106.83 ? 63  DG  I C4    1 
ATOM   6974  P P     . DC  I 7  67  ? 98.562  144.082 142.542 1.00 136.75 ? 64  DC  I P     1 
ATOM   6975  O OP1   . DC  I 7  67  ? 97.328  144.585 143.196 1.00 129.61 ? 64  DC  I OP1   1 
ATOM   6976  O OP2   . DC  I 7  67  ? 98.630  143.947 141.063 1.00 129.02 ? 64  DC  I OP2   1 
ATOM   6977  O "O5'" . DC  I 7  67  ? 99.773  145.054 142.901 1.00 124.11 ? 64  DC  I "O5'" 1 
ATOM   6978  C "C5'" . DC  I 7  67  ? 100.193 145.226 144.268 1.00 123.88 ? 64  DC  I "C5'" 1 
ATOM   6979  C "C4'" . DC  I 7  67  ? 101.533 145.918 144.330 1.00 121.00 ? 64  DC  I "C4'" 1 
ATOM   6980  O "O4'" . DC  I 7  67  ? 102.571 144.998 143.946 1.00 114.20 ? 64  DC  I "O4'" 1 
ATOM   6981  C "C3'" . DC  I 7  67  ? 101.667 147.132 143.411 1.00 120.86 ? 64  DC  I "C3'" 1 
ATOM   6982  O "O3'" . DC  I 7  67  ? 101.721 148.316 144.222 1.00 125.46 ? 64  DC  I "O3'" 1 
ATOM   6983  C "C2'" . DC  I 7  67  ? 102.976 146.915 142.657 1.00 115.52 ? 64  DC  I "C2'" 1 
ATOM   6984  C "C1'" . DC  I 7  67  ? 103.615 145.707 143.314 1.00 113.65 ? 64  DC  I "C1'" 1 
ATOM   6985  N N1    . DC  I 7  67  ? 104.262 144.779 142.373 1.00 110.17 ? 64  DC  I N1    1 
ATOM   6986  C C2    . DC  I 7  67  ? 105.650 144.599 142.422 1.00 110.61 ? 64  DC  I C2    1 
ATOM   6987  O O2    . DC  I 7  67  ? 106.317 145.226 143.257 1.00 109.20 ? 64  DC  I O2    1 
ATOM   6988  N N3    . DC  I 7  67  ? 106.236 143.745 141.558 1.00 106.98 ? 64  DC  I N3    1 
ATOM   6989  C C4    . DC  I 7  67  ? 105.494 143.083 140.670 1.00 106.94 ? 64  DC  I C4    1 
ATOM   6990  N N4    . DC  I 7  67  ? 106.112 142.249 139.834 1.00 107.23 ? 64  DC  I N4    1 
ATOM   6991  C C5    . DC  I 7  67  ? 104.084 143.248 140.597 1.00 105.45 ? 64  DC  I C5    1 
ATOM   6992  C C6    . DC  I 7  67  ? 103.515 144.096 141.458 1.00 109.04 ? 64  DC  I C6    1 
ATOM   6993  P P     . DA  I 7  68  ? 101.638 149.798 143.592 1.00 137.11 ? 65  DA  I P     1 
ATOM   6994  O OP1   . DA  I 7  68  ? 100.999 150.688 144.592 1.00 132.82 ? 65  DA  I OP1   1 
ATOM   6995  O OP2   . DA  I 7  68  ? 101.071 149.704 142.222 1.00 128.83 ? 65  DA  I OP2   1 
ATOM   6996  O "O5'" . DA  I 7  68  ? 103.169 150.218 143.461 1.00 126.53 ? 65  DA  I "O5'" 1 
ATOM   6997  C "C5'" . DA  I 7  68  ? 104.063 150.089 144.583 1.00 125.26 ? 65  DA  I "C5'" 1 
ATOM   6998  C "C4'" . DA  I 7  68  ? 105.471 150.468 144.192 1.00 123.86 ? 65  DA  I "C4'" 1 
ATOM   6999  O "O4'" . DA  I 7  68  ? 106.076 149.379 143.456 1.00 117.57 ? 65  DA  I "O4'" 1 
ATOM   7000  C "C3'" . DA  I 7  68  ? 105.596 151.705 143.301 1.00 122.97 ? 65  DA  I "C3'" 1 
ATOM   7001  O "O3'" . DA  I 7  68  ? 106.760 152.447 143.698 1.00 125.97 ? 65  DA  I "O3'" 1 
ATOM   7002  C "C2'" . DA  I 7  68  ? 105.762 151.105 141.913 1.00 117.73 ? 65  DA  I "C2'" 1 
ATOM   7003  C "C1'" . DA  I 7  68  ? 106.557 149.848 142.208 1.00 113.53 ? 65  DA  I "C1'" 1 
ATOM   7004  N N9    . DA  I 7  68  ? 106.391 148.767 141.238 1.00 110.14 ? 65  DA  I N9    1 
ATOM   7005  C C8    . DA  I 7  68  ? 105.250 148.356 140.600 1.00 111.81 ? 65  DA  I C8    1 
ATOM   7006  N N7    . DA  I 7  68  ? 105.433 147.350 139.782 1.00 107.98 ? 65  DA  I N7    1 
ATOM   7007  C C5    . DA  I 7  68  ? 106.787 147.081 139.891 1.00 107.48 ? 65  DA  I C5    1 
ATOM   7008  C C6    . DA  I 7  68  ? 107.611 146.130 139.278 1.00 107.11 ? 65  DA  I C6    1 
ATOM   7009  N N6    . DA  I 7  68  ? 107.167 145.236 138.399 1.00 108.87 ? 65  DA  I N6    1 
ATOM   7010  N N1    . DA  I 7  68  ? 108.919 146.128 139.602 1.00 108.66 ? 65  DA  I N1    1 
ATOM   7011  C C2    . DA  I 7  68  ? 109.355 147.031 140.486 1.00 109.78 ? 65  DA  I C2    1 
ATOM   7012  N N3    . DA  I 7  68  ? 108.679 147.976 141.128 1.00 108.73 ? 65  DA  I N3    1 
ATOM   7013  C C4    . DA  I 7  68  ? 107.387 147.947 140.781 1.00 108.74 ? 65  DA  I C4    1 
ATOM   7014  P P     . DC  I 7  69  ? 107.097 153.907 143.103 1.00 137.37 ? 66  DC  I P     1 
ATOM   7015  O OP1   . DC  I 7  69  ? 107.570 154.777 144.209 1.00 129.63 ? 66  DC  I OP1   1 
ATOM   7016  O OP2   . DC  I 7  69  ? 105.981 154.345 142.224 1.00 130.86 ? 66  DC  I OP2   1 
ATOM   7017  O "O5'" . DC  I 7  69  ? 108.307 153.643 142.101 1.00 124.12 ? 66  DC  I "O5'" 1 
ATOM   7018  C "C5'" . DC  I 7  69  ? 109.517 153.020 142.570 1.00 122.78 ? 66  DC  I "C5'" 1 
ATOM   7019  C "C4'" . DC  I 7  69  ? 110.449 152.740 141.416 1.00 121.67 ? 66  DC  I "C4'" 1 
ATOM   7020  O "O4'" . DC  I 7  69  ? 109.993 151.574 140.692 1.00 117.20 ? 66  DC  I "O4'" 1 
ATOM   7021  C "C3'" . DC  I 7  69  ? 110.559 153.871 140.387 1.00 119.40 ? 66  DC  I "C3'" 1 
ATOM   7022  O "O3'" . DC  I 7  69  ? 111.948 154.167 140.178 1.00 119.68 ? 66  DC  I "O3'" 1 
ATOM   7023  C "C2'" . DC  I 7  69  ? 109.912 153.289 139.137 1.00 116.12 ? 66  DC  I "C2'" 1 
ATOM   7024  C "C1'" . DC  I 7  69  ? 110.150 151.800 139.307 1.00 115.07 ? 66  DC  I "C1'" 1 
ATOM   7025  N N1    . DC  I 7  69  ? 109.218 150.905 138.595 1.00 111.16 ? 66  DC  I N1    1 
ATOM   7026  C C2    . DC  I 7  69  ? 109.736 149.851 137.828 1.00 111.03 ? 66  DC  I C2    1 
ATOM   7027  O O2    . DC  I 7  69  ? 110.963 149.690 137.756 1.00 110.78 ? 66  DC  I O2    1 
ATOM   7028  N N3    . DC  I 7  69  ? 108.892 149.025 137.177 1.00 108.86 ? 66  DC  I N3    1 
ATOM   7029  C C4    . DC  I 7  69  ? 107.577 149.216 137.268 1.00 109.34 ? 66  DC  I C4    1 
ATOM   7030  N N4    . DC  I 7  69  ? 106.776 148.379 136.608 1.00 108.41 ? 66  DC  I N4    1 
ATOM   7031  C C5    . DC  I 7  69  ? 107.021 150.275 138.035 1.00 108.55 ? 66  DC  I C5    1 
ATOM   7032  C C6    . DC  I 7  69  ? 107.866 151.087 138.676 1.00 109.74 ? 66  DC  I C6    1 
ATOM   7033  P P     . DG  I 7  70  ? 112.450 155.460 139.356 1.00 124.82 ? 67  DG  I P     1 
ATOM   7034  O OP1   . DG  I 7  70  ? 113.469 156.163 140.174 1.00 122.35 ? 67  DG  I OP1   1 
ATOM   7035  O OP2   . DG  I 7  70  ? 111.263 156.201 138.860 1.00 120.56 ? 67  DG  I OP2   1 
ATOM   7036  O "O5'" . DG  I 7  70  ? 113.180 154.808 138.098 1.00 117.40 ? 67  DG  I "O5'" 1 
ATOM   7037  C "C5'" . DG  I 7  70  ? 113.689 153.463 138.188 1.00 115.76 ? 67  DG  I "C5'" 1 
ATOM   7038  C "C4'" . DG  I 7  70  ? 114.550 153.109 137.004 1.00 116.72 ? 67  DG  I "C4'" 1 
ATOM   7039  O "O4'" . DG  I 7  70  ? 113.873 152.118 136.197 1.00 116.15 ? 67  DG  I "O4'" 1 
ATOM   7040  C "C3'" . DG  I 7  70  ? 114.891 154.229 136.035 1.00 116.94 ? 67  DG  I "C3'" 1 
ATOM   7041  O "O3'" . DG  I 7  70  ? 116.128 153.871 135.402 1.00 119.12 ? 67  DG  I "O3'" 1 
ATOM   7042  C "C2'" . DG  I 7  70  ? 113.717 154.194 135.068 1.00 114.94 ? 67  DG  I "C2'" 1 
ATOM   7043  C "C1'" . DG  I 7  70  ? 113.360 152.714 135.011 1.00 113.28 ? 67  DG  I "C1'" 1 
ATOM   7044  N N9    . DG  I 7  70  ? 111.929 152.407 134.964 1.00 112.10 ? 67  DG  I N9    1 
ATOM   7045  C C8    . DG  I 7  70  ? 110.893 153.091 135.550 1.00 111.83 ? 67  DG  I C8    1 
ATOM   7046  N N7    . DG  I 7  70  ? 109.726 152.551 135.321 1.00 109.43 ? 67  DG  I N7    1 
ATOM   7047  C C5    . DG  I 7  70  ? 110.008 151.446 134.537 1.00 108.95 ? 67  DG  I C5    1 
ATOM   7048  C C6    . DG  I 7  70  ? 109.146 150.470 133.976 1.00 105.69 ? 67  DG  I C6    1 
ATOM   7049  O O6    . DG  I 7  70  ? 107.915 150.385 134.067 1.00 106.78 ? 67  DG  I O6    1 
ATOM   7050  N N1    . DG  I 7  70  ? 109.856 149.522 133.249 1.00 106.20 ? 67  DG  I N1    1 
ATOM   7051  C C2    . DG  I 7  70  ? 111.217 149.517 133.083 1.00 107.99 ? 67  DG  I C2    1 
ATOM   7052  N N2    . DG  I 7  70  ? 111.727 148.521 132.348 1.00 108.79 ? 67  DG  I N2    1 
ATOM   7053  N N3    . DG  I 7  70  ? 112.028 150.420 133.602 1.00 109.49 ? 67  DG  I N3    1 
ATOM   7054  C C4    . DG  I 7  70  ? 111.361 151.347 134.310 1.00 108.03 ? 67  DG  I C4    1 
ATOM   7055  P P     . DT  I 7  71  ? 116.959 154.857 134.435 1.00 128.07 ? 68  DT  I P     1 
ATOM   7056  O OP1   . DT  I 7  71  ? 118.348 154.951 134.948 1.00 122.46 ? 68  DT  I OP1   1 
ATOM   7057  O OP2   . DT  I 7  71  ? 116.170 156.097 134.216 1.00 122.81 ? 68  DT  I OP2   1 
ATOM   7058  O "O5'" . DT  I 7  71  ? 116.987 154.040 133.067 1.00 118.25 ? 68  DT  I "O5'" 1 
ATOM   7059  C "C5'" . DT  I 7  71  ? 117.283 152.628 133.055 1.00 115.20 ? 68  DT  I "C5'" 1 
ATOM   7060  C "C4'" . DT  I 7  71  ? 116.845 152.003 131.752 1.00 113.64 ? 68  DT  I "C4'" 1 
ATOM   7061  O "O4'" . DT  I 7  71  ? 115.405 151.830 131.755 1.00 112.31 ? 68  DT  I "O4'" 1 
ATOM   7062  C "C3'" . DT  I 7  71  ? 117.165 152.821 130.498 1.00 113.75 ? 68  DT  I "C3'" 1 
ATOM   7063  O "O3'" . DT  I 7  71  ? 117.486 151.951 129.407 1.00 111.29 ? 68  DT  I "O3'" 1 
ATOM   7064  C "C2'" . DT  I 7  71  ? 115.843 153.512 130.223 1.00 111.75 ? 68  DT  I "C2'" 1 
ATOM   7065  C "C1'" . DT  I 7  71  ? 114.874 152.394 130.571 1.00 109.88 ? 68  DT  I "C1'" 1 
ATOM   7066  N N1    . DT  I 7  71  ? 113.462 152.763 130.825 1.00 109.23 ? 68  DT  I N1    1 
ATOM   7067  C C2    . DT  I 7  71  ? 112.498 151.828 130.515 1.00 108.07 ? 68  DT  I C2    1 
ATOM   7068  O O2    . DT  I 7  71  ? 112.766 150.732 130.052 1.00 107.64 ? 68  DT  I O2    1 
ATOM   7069  N N3    . DT  I 7  71  ? 111.206 152.219 130.770 1.00 108.14 ? 68  DT  I N3    1 
ATOM   7070  C C4    . DT  I 7  71  ? 110.792 153.425 131.292 1.00 109.50 ? 68  DT  I C4    1 
ATOM   7071  O O4    . DT  I 7  71  ? 109.598 153.651 131.474 1.00 108.58 ? 68  DT  I O4    1 
ATOM   7072  C C5    . DT  I 7  71  ? 111.848 154.355 131.593 1.00 111.15 ? 68  DT  I C5    1 
ATOM   7073  C C7    . DT  I 7  71  ? 111.492 155.686 132.166 1.00 116.63 ? 68  DT  I C7    1 
ATOM   7074  C C6    . DT  I 7  71  ? 113.109 153.987 131.350 1.00 110.63 ? 68  DT  I C6    1 
ATOM   7075  P P     . DA  I 7  72  ? 118.989 151.450 129.118 1.00 118.12 ? 69  DA  I P     1 
ATOM   7076  O OP1   . DA  I 7  72  ? 119.620 151.054 130.401 1.00 121.48 ? 69  DA  I OP1   1 
ATOM   7077  O OP2   . DA  I 7  72  ? 119.653 152.453 128.245 1.00 117.39 ? 69  DA  I OP2   1 
ATOM   7078  O "O5'" . DA  I 7  72  ? 118.742 150.135 128.256 1.00 112.39 ? 69  DA  I "O5'" 1 
ATOM   7079  C "C5'" . DA  I 7  72  ? 118.160 148.972 128.872 1.00 115.44 ? 69  DA  I "C5'" 1 
ATOM   7080  C "C4'" . DA  I 7  72  ? 117.449 148.108 127.858 1.00 111.36 ? 69  DA  I "C4'" 1 
ATOM   7081  O "O4'" . DA  I 7  72  ? 116.108 148.604 127.653 1.00 106.42 ? 69  DA  I "O4'" 1 
ATOM   7082  C "C3'" . DA  I 7  72  ? 118.067 148.033 126.466 1.00 107.64 ? 69  DA  I "C3'" 1 
ATOM   7083  O "O3'" . DA  I 7  72  ? 117.762 146.732 125.929 1.00 106.36 ? 69  DA  I "O3'" 1 
ATOM   7084  C "C2'" . DA  I 7  72  ? 117.365 149.171 125.729 1.00 104.41 ? 69  DA  I "C2'" 1 
ATOM   7085  C "C1'" . DA  I 7  72  ? 115.989 149.212 126.374 1.00 103.95 ? 69  DA  I "C1'" 1 
ATOM   7086  N N9    . DA  I 7  72  ? 115.424 150.550 126.568 1.00 105.66 ? 69  DA  I N9    1 
ATOM   7087  C C8    . DA  I 7  72  ? 116.055 151.770 126.654 1.00 105.76 ? 69  DA  I C8    1 
ATOM   7088  N N7    . DA  I 7  72  ? 115.235 152.776 126.833 1.00 105.55 ? 69  DA  I N7    1 
ATOM   7089  C C5    . DA  I 7  72  ? 113.987 152.184 126.866 1.00 105.18 ? 69  DA  I C5    1 
ATOM   7090  C C6    . DA  I 7  72  ? 112.702 152.708 127.031 1.00 104.10 ? 69  DA  I C6    1 
ATOM   7091  N N6    . DA  I 7  72  ? 112.458 154.004 127.196 1.00 105.54 ? 69  DA  I N6    1 
ATOM   7092  N N1    . DA  I 7  72  ? 111.663 151.851 127.017 1.00 104.99 ? 69  DA  I N1    1 
ATOM   7093  C C2    . DA  I 7  72  ? 111.921 150.551 126.849 1.00 104.64 ? 69  DA  I C2    1 
ATOM   7094  N N3    . DA  I 7  72  ? 113.085 149.937 126.687 1.00 104.14 ? 69  DA  I N3    1 
ATOM   7095  C C4    . DA  I 7  72  ? 114.090 150.820 126.706 1.00 105.05 ? 69  DA  I C4    1 
ATOM   7096  P P     . DC  I 7  73  ? 118.078 146.287 124.412 1.00 107.56 ? 70  DC  I P     1 
ATOM   7097  O OP1   . DC  I 7  73  ? 118.600 144.896 124.412 1.00 107.70 ? 70  DC  I OP1   1 
ATOM   7098  O OP2   . DC  I 7  73  ? 118.829 147.372 123.731 1.00 107.08 ? 70  DC  I OP2   1 
ATOM   7099  O "O5'" . DC  I 7  73  ? 116.641 146.300 123.725 1.00 101.36 ? 70  DC  I "O5'" 1 
ATOM   7100  C "C5'" . DC  I 7  73  ? 115.537 145.634 124.367 1.00 99.36  ? 70  DC  I "C5'" 1 
ATOM   7101  C "C4'" . DC  I 7  73  ? 114.230 145.973 123.694 1.00 99.29  ? 70  DC  I "C4'" 1 
ATOM   7102  O "O4'" . DC  I 7  73  ? 113.856 147.334 124.009 1.00 99.64  ? 70  DC  I "O4'" 1 
ATOM   7103  C "C3'" . DC  I 7  73  ? 114.233 145.862 122.170 1.00 98.31  ? 70  DC  I "C3'" 1 
ATOM   7104  O "O3'" . DC  I 7  73  ? 113.067 145.121 121.781 1.00 97.46  ? 70  DC  I "O3'" 1 
ATOM   7105  C "C2'" . DC  I 7  73  ? 114.179 147.312 121.708 1.00 99.01  ? 70  DC  I "C2'" 1 
ATOM   7106  C "C1'" . DC  I 7  73  ? 113.426 147.997 122.837 1.00 99.21  ? 70  DC  I "C1'" 1 
ATOM   7107  N N1    . DC  I 7  73  ? 113.686 149.443 123.029 1.00 99.75  ? 70  DC  I N1    1 
ATOM   7108  C C2    . DC  I 7  73  ? 112.606 150.306 123.275 1.00 102.56 ? 70  DC  I C2    1 
ATOM   7109  O O2    . DC  I 7  73  ? 111.455 149.851 123.325 1.00 101.38 ? 70  DC  I O2    1 
ATOM   7110  N N3    . DC  I 7  73  ? 112.830 151.625 123.455 1.00 101.65 ? 70  DC  I N3    1 
ATOM   7111  C C4    . DC  I 7  73  ? 114.073 152.100 123.398 1.00 102.52 ? 70  DC  I C4    1 
ATOM   7112  N N4    . DC  I 7  73  ? 114.260 153.409 123.580 1.00 103.33 ? 70  DC  I N4    1 
ATOM   7113  C C5    . DC  I 7  73  ? 115.187 151.255 123.151 1.00 100.17 ? 70  DC  I C5    1 
ATOM   7114  C C6    . DC  I 7  73  ? 114.954 149.950 122.975 1.00 99.56  ? 70  DC  I C6    1 
ATOM   7115  P P     . DG  I 7  74  ? 112.783 144.638 120.269 1.00 101.31 ? 71  DG  I P     1 
ATOM   7116  O OP1   . DG  I 7  74  ? 112.508 143.180 120.289 1.00 93.52  ? 71  DG  I OP1   1 
ATOM   7117  O OP2   . DG  I 7  74  ? 113.849 145.175 119.386 1.00 98.81  ? 71  DG  I OP2   1 
ATOM   7118  O "O5'" . DG  I 7  74  ? 111.425 145.402 119.930 1.00 97.08  ? 71  DG  I "O5'" 1 
ATOM   7119  C "C5'" . DG  I 7  74  ? 110.412 145.543 120.947 1.00 96.83  ? 71  DG  I "C5'" 1 
ATOM   7120  C "C4'" . DG  I 7  74  ? 109.212 146.304 120.438 1.00 99.12  ? 71  DG  I "C4'" 1 
ATOM   7121  O "O4'" . DG  I 7  74  ? 109.395 147.715 120.698 1.00 101.64 ? 71  DG  I "O4'" 1 
ATOM   7122  C "C3'" . DG  I 7  74  ? 108.913 146.193 118.949 1.00 99.12  ? 71  DG  I "C3'" 1 
ATOM   7123  O "O3'" . DG  I 7  74  ? 107.489 146.277 118.778 1.00 101.88 ? 71  DG  I "O3'" 1 
ATOM   7124  C "C2'" . DG  I 7  74  ? 109.625 147.406 118.375 1.00 99.76  ? 71  DG  I "C2'" 1 
ATOM   7125  C "C1'" . DG  I 7  74  ? 109.469 148.440 119.479 1.00 100.39 ? 71  DG  I "C1'" 1 
ATOM   7126  N N9    . DG  I 7  74  ? 110.584 149.376 119.600 1.00 100.30 ? 71  DG  I N9    1 
ATOM   7127  C C8    . DG  I 7  74  ? 111.920 149.100 119.457 1.00 98.90  ? 71  DG  I C8    1 
ATOM   7128  N N7    . DG  I 7  74  ? 112.682 150.144 119.626 1.00 99.19  ? 71  DG  I N7    1 
ATOM   7129  C C5    . DG  I 7  74  ? 111.798 151.171 119.899 1.00 101.45 ? 71  DG  I C5    1 
ATOM   7130  C C6    . DG  I 7  74  ? 112.045 152.537 120.170 1.00 103.20 ? 71  DG  I C6    1 
ATOM   7131  O O6    . DG  I 7  74  ? 113.133 153.121 120.224 1.00 103.71 ? 71  DG  I O6    1 
ATOM   7132  N N1    . DG  I 7  74  ? 110.866 153.236 120.392 1.00 103.89 ? 71  DG  I N1    1 
ATOM   7133  C C2    . DG  I 7  74  ? 109.610 152.688 120.357 1.00 104.42 ? 71  DG  I C2    1 
ATOM   7134  N N2    . DG  I 7  74  ? 108.590 153.525 120.598 1.00 108.30 ? 71  DG  I N2    1 
ATOM   7135  N N3    . DG  I 7  74  ? 109.366 151.411 120.105 1.00 102.91 ? 71  DG  I N3    1 
ATOM   7136  C C4    . DG  I 7  74  ? 110.499 150.716 119.887 1.00 101.00 ? 71  DG  I C4    1 
ATOM   7137  P P     . DC  I 7  75  ? 106.765 146.036 117.359 1.00 107.07 ? 72  DC  I P     1 
ATOM   7138  O OP1   . DC  I 7  75  ? 105.555 145.207 117.578 1.00 106.53 ? 72  DC  I OP1   1 
ATOM   7139  O OP2   . DC  I 7  75  ? 107.781 145.637 116.350 1.00 105.57 ? 72  DC  I OP2   1 
ATOM   7140  O "O5'" . DC  I 7  75  ? 106.317 147.497 116.908 1.00 107.72 ? 72  DC  I "O5'" 1 
ATOM   7141  C "C5'" . DC  I 7  75  ? 105.479 148.299 117.761 1.00 109.16 ? 72  DC  I "C5'" 1 
ATOM   7142  C "C4'" . DC  I 7  75  ? 105.446 149.732 117.284 1.00 113.74 ? 72  DC  I "C4'" 1 
ATOM   7143  O "O4'" . DC  I 7  75  ? 106.678 150.390 117.642 1.00 107.59 ? 72  DC  I "O4'" 1 
ATOM   7144  C "C3'" . DC  I 7  75  ? 105.286 149.900 115.772 1.00 113.63 ? 72  DC  I "C3'" 1 
ATOM   7145  O "O3'" . DC  I 7  75  ? 103.972 150.418 115.501 1.00 116.98 ? 72  DC  I "O3'" 1 
ATOM   7146  C "C2'" . DC  I 7  75  ? 106.374 150.894 115.371 1.00 110.06 ? 72  DC  I "C2'" 1 
ATOM   7147  C "C1'" . DC  I 7  75  ? 106.983 151.373 116.674 1.00 108.70 ? 72  DC  I "C1'" 1 
ATOM   7148  N N1    . DC  I 7  75  ? 108.449 151.522 116.632 1.00 105.10 ? 72  DC  I N1    1 
ATOM   7149  C C2    . DC  I 7  75  ? 109.026 152.772 116.889 1.00 107.62 ? 72  DC  I C2    1 
ATOM   7150  O O2    . DC  I 7  75  ? 108.299 153.742 117.147 1.00 106.12 ? 72  DC  I O2    1 
ATOM   7151  N N3    . DC  I 7  75  ? 110.369 152.902 116.851 1.00 105.30 ? 72  DC  I N3    1 
ATOM   7152  C C4    . DC  I 7  75  ? 111.130 151.845 116.571 1.00 102.77 ? 72  DC  I C4    1 
ATOM   7153  N N4    . DC  I 7  75  ? 112.452 152.013 116.543 1.00 103.81 ? 72  DC  I N4    1 
ATOM   7154  C C5    . DC  I 7  75  ? 110.573 150.566 116.305 1.00 98.44  ? 72  DC  I C5    1 
ATOM   7155  C C6    . DC  I 7  75  ? 109.243 150.450 116.346 1.00 101.11 ? 72  DC  I C6    1 
ATOM   7156  P P     . DG  I 7  76  ? 103.407 150.611 114.002 1.00 123.39 ? 73  DG  I P     1 
ATOM   7157  O OP1   . DG  I 7  76  ? 101.929 150.492 114.048 1.00 121.30 ? 73  DG  I OP1   1 
ATOM   7158  O OP2   . DG  I 7  76  ? 104.187 149.741 113.085 1.00 117.46 ? 73  DG  I OP2   1 
ATOM   7159  O "O5'" . DG  I 7  76  ? 103.776 152.127 113.673 1.00 117.00 ? 73  DG  I "O5'" 1 
ATOM   7160  C "C5'" . DG  I 7  76  ? 103.456 153.176 114.608 1.00 118.42 ? 73  DG  I "C5'" 1 
ATOM   7161  C "C4'" . DG  I 7  76  ? 104.041 154.497 114.163 1.00 121.10 ? 73  DG  I "C4'" 1 
ATOM   7162  O "O4'" . DG  I 7  76  ? 105.462 154.528 114.459 1.00 116.65 ? 73  DG  I "O4'" 1 
ATOM   7163  C "C3'" . DG  I 7  76  ? 103.911 154.817 112.673 1.00 122.30 ? 73  DG  I "C3'" 1 
ATOM   7164  O "O3'" . DG  I 7  76  ? 103.592 156.211 112.535 1.00 123.57 ? 73  DG  I "O3'" 1 
ATOM   7165  C "C2'" . DG  I 7  76  ? 105.299 154.505 112.140 1.00 117.22 ? 73  DG  I "C2'" 1 
ATOM   7166  C "C1'" . DG  I 7  76  ? 106.179 154.923 113.301 1.00 114.20 ? 73  DG  I "C1'" 1 
ATOM   7167  N N9    . DG  I 7  76  ? 107.491 154.280 113.330 1.00 109.30 ? 73  DG  I N9    1 
ATOM   7168  C C8    . DG  I 7  76  ? 107.769 152.949 113.147 1.00 108.33 ? 73  DG  I C8    1 
ATOM   7169  N N7    . DG  I 7  76  ? 109.038 152.671 113.231 1.00 104.90 ? 73  DG  I N7    1 
ATOM   7170  C C5    . DG  I 7  76  ? 109.637 153.891 113.483 1.00 104.62 ? 73  DG  I C5    1 
ATOM   7171  C C6    . DG  I 7  76  ? 111.001 154.213 113.671 1.00 104.61 ? 73  DG  I C6    1 
ATOM   7172  O O6    . DG  I 7  76  ? 111.973 153.451 113.649 1.00 105.98 ? 73  DG  I O6    1 
ATOM   7173  N N1    . DG  I 7  76  ? 111.180 155.570 113.901 1.00 105.66 ? 73  DG  I N1    1 
ATOM   7174  C C2    . DG  I 7  76  ? 110.172 156.498 113.946 1.00 106.86 ? 73  DG  I C2    1 
ATOM   7175  N N2    . DG  I 7  76  ? 110.542 157.764 114.183 1.00 108.02 ? 73  DG  I N2    1 
ATOM   7176  N N3    . DG  I 7  76  ? 108.891 156.209 113.774 1.00 106.88 ? 73  DG  I N3    1 
ATOM   7177  C C4    . DG  I 7  76  ? 108.699 154.895 113.548 1.00 105.78 ? 73  DG  I C4    1 
ATOM   7178  P P     . DC  I 7  77  ? 103.184 156.871 111.121 1.00 134.45 ? 74  DC  I P     1 
ATOM   7179  O OP1   . DC  I 7  77  ? 101.968 157.699 111.314 1.00 128.30 ? 74  DC  I OP1   1 
ATOM   7180  O OP2   . DC  I 7  77  ? 103.229 155.828 110.063 1.00 128.30 ? 74  DC  I OP2   1 
ATOM   7181  O "O5'" . DC  I 7  77  ? 104.411 157.828 110.780 1.00 123.21 ? 74  DC  I "O5'" 1 
ATOM   7182  C "C5'" . DC  I 7  77  ? 104.892 158.766 111.760 1.00 122.82 ? 74  DC  I "C5'" 1 
ATOM   7183  C "C4'" . DC  I 7  77  ? 106.057 159.557 111.216 1.00 123.74 ? 74  DC  I "C4'" 1 
ATOM   7184  O "O4'" . DC  I 7  77  ? 107.282 158.820 111.440 1.00 115.79 ? 74  DC  I "O4'" 1 
ATOM   7185  C "C3'" . DC  I 7  77  ? 105.992 159.857 109.718 1.00 122.56 ? 74  DC  I "C3'" 1 
ATOM   7186  O "O3'" . DC  I 7  77  ? 106.316 161.240 109.509 1.00 124.62 ? 74  DC  I "O3'" 1 
ATOM   7187  C "C2'" . DC  I 7  77  ? 107.042 158.936 109.113 1.00 116.76 ? 74  DC  I "C2'" 1 
ATOM   7188  C "C1'" . DC  I 7  77  ? 108.037 158.750 110.245 1.00 114.73 ? 74  DC  I "C1'" 1 
ATOM   7189  N N1    . DC  I 7  77  ? 108.740 157.452 110.248 1.00 111.50 ? 74  DC  I N1    1 
ATOM   7190  C C2    . DC  I 7  77  ? 110.138 157.423 110.333 1.00 110.70 ? 74  DC  I C2    1 
ATOM   7191  O O2    . DC  I 7  77  ? 110.771 158.484 110.404 1.00 110.75 ? 74  DC  I O2    1 
ATOM   7192  N N3    . DC  I 7  77  ? 110.778 156.236 110.338 1.00 106.83 ? 74  DC  I N3    1 
ATOM   7193  C C4    . DC  I 7  77  ? 110.081 155.104 110.261 1.00 107.15 ? 74  DC  I C4    1 
ATOM   7194  N N4    . DC  I 7  77  ? 110.753 153.952 110.268 1.00 107.32 ? 74  DC  I N4    1 
ATOM   7195  C C5    . DC  I 7  77  ? 108.663 155.101 110.173 1.00 106.24 ? 74  DC  I C5    1 
ATOM   7196  C C6    . DC  I 7  77  ? 108.040 156.283 110.170 1.00 110.07 ? 74  DC  I C6    1 
ATOM   7197  P P     . DT  I 7  78  ? 106.114 161.968 108.084 1.00 134.31 ? 75  DT  I P     1 
ATOM   7198  O OP1   . DT  I 7  78  ? 105.550 163.319 108.326 1.00 127.61 ? 75  DT  I OP1   1 
ATOM   7199  O OP2   . DT  I 7  78  ? 105.415 161.034 107.164 1.00 127.98 ? 75  DT  I OP2   1 
ATOM   7200  O "O5'" . DT  I 7  78  ? 107.611 162.134 107.564 1.00 123.43 ? 75  DT  I "O5'" 1 
ATOM   7201  C "C5'" . DT  I 7  78  ? 108.598 162.789 108.381 1.00 126.44 ? 75  DT  I "C5'" 1 
ATOM   7202  C "C4'" . DT  I 7  78  ? 109.981 162.570 107.817 1.00 124.44 ? 75  DT  I "C4'" 1 
ATOM   7203  O "O4'" . DT  I 7  78  ? 110.413 161.226 108.109 1.00 119.07 ? 75  DT  I "O4'" 1 
ATOM   7204  C "C3'" . DT  I 7  78  ? 110.101 162.740 106.303 1.00 123.40 ? 75  DT  I "C3'" 1 
ATOM   7205  O "O3'" . DT  I 7  78  ? 110.857 163.932 106.033 1.00 126.00 ? 75  DT  I "O3'" 1 
ATOM   7206  C "C2'" . DT  I 7  78  ? 110.842 161.492 105.828 1.00 118.77 ? 75  DT  I "C2'" 1 
ATOM   7207  C "C1'" . DT  I 7  78  ? 111.304 160.807 107.099 1.00 117.05 ? 75  DT  I "C1'" 1 
ATOM   7208  N N1    . DT  I 7  78  ? 111.258 159.334 107.039 1.00 113.54 ? 75  DT  I N1    1 
ATOM   7209  C C2    . DT  I 7  78  ? 112.432 158.629 107.186 1.00 111.49 ? 75  DT  I C2    1 
ATOM   7210  O O2    . DT  I 7  78  ? 113.513 159.166 107.365 1.00 111.95 ? 75  DT  I O2    1 
ATOM   7211  N N3    . DT  I 7  78  ? 112.292 157.265 107.117 1.00 109.59 ? 75  DT  I N3    1 
ATOM   7212  C C4    . DT  I 7  78  ? 111.123 156.559 106.918 1.00 109.16 ? 75  DT  I C4    1 
ATOM   7213  O O4    . DT  I 7  78  ? 111.140 155.331 106.881 1.00 108.74 ? 75  DT  I O4    1 
ATOM   7214  C C5    . DT  I 7  78  ? 109.936 157.362 106.772 1.00 109.57 ? 75  DT  I C5    1 
ATOM   7215  C C7    . DT  I 7  78  ? 108.628 156.682 106.549 1.00 113.08 ? 75  DT  I C7    1 
ATOM   7216  C C6    . DT  I 7  78  ? 110.062 158.690 106.838 1.00 111.38 ? 75  DT  I C6    1 
ATOM   7217  P P     . DG  I 7  79  ? 111.010 164.536 104.545 1.00 133.08 ? 76  DG  I P     1 
ATOM   7218  O OP1   . DG  I 7  79  ? 111.254 165.995 104.662 1.00 129.92 ? 76  DG  I OP1   1 
ATOM   7219  O OP2   . DG  I 7  79  ? 109.882 164.046 103.713 1.00 126.75 ? 76  DG  I OP2   1 
ATOM   7220  O "O5'" . DG  I 7  79  ? 112.346 163.846 104.014 1.00 126.18 ? 76  DG  I "O5'" 1 
ATOM   7221  C "C5'" . DG  I 7  79  ? 113.554 163.906 104.798 1.00 128.36 ? 76  DG  I "C5'" 1 
ATOM   7222  C "C4'" . DG  I 7  79  ? 114.640 163.050 104.188 1.00 128.22 ? 76  DG  I "C4'" 1 
ATOM   7223  O "O4'" . DG  I 7  79  ? 114.376 161.651 104.464 1.00 122.44 ? 76  DG  I "O4'" 1 
ATOM   7224  C "C3'" . DG  I 7  79  ? 114.810 163.164 102.673 1.00 128.68 ? 76  DG  I "C3'" 1 
ATOM   7225  O "O3'" . DG  I 7  79  ? 116.214 163.267 102.392 1.00 127.02 ? 76  DG  I "O3'" 1 
ATOM   7226  C "C2'" . DG  I 7  79  ? 114.230 161.859 102.149 1.00 121.94 ? 76  DG  I "C2'" 1 
ATOM   7227  C "C1'" . DG  I 7  79  ? 114.527 160.891 103.278 1.00 118.81 ? 76  DG  I "C1'" 1 
ATOM   7228  N N9    . DG  I 7  79  ? 113.619 159.748 103.360 1.00 114.93 ? 76  DG  I N9    1 
ATOM   7229  C C8    . DG  I 7  79  ? 112.247 159.769 103.329 1.00 114.80 ? 76  DG  I C8    1 
ATOM   7230  N N7    . DG  I 7  79  ? 111.711 158.586 103.427 1.00 109.96 ? 76  DG  I N7    1 
ATOM   7231  C C5    . DG  I 7  79  ? 112.792 157.729 103.528 1.00 110.30 ? 76  DG  I C5    1 
ATOM   7232  C C6    . DG  I 7  79  ? 112.834 156.319 103.657 1.00 107.28 ? 76  DG  I C6    1 
ATOM   7233  O O6    . DG  I 7  79  ? 111.887 155.525 103.711 1.00 108.00 ? 76  DG  I O6    1 
ATOM   7234  N N1    . DG  I 7  79  ? 114.140 155.852 103.727 1.00 106.41 ? 76  DG  I N1    1 
ATOM   7235  C C2    . DG  I 7  79  ? 115.261 156.643 103.678 1.00 110.10 ? 76  DG  I C2    1 
ATOM   7236  N N2    . DG  I 7  79  ? 116.441 156.012 103.759 1.00 110.98 ? 76  DG  I N2    1 
ATOM   7237  N N3    . DG  I 7  79  ? 115.234 157.959 103.557 1.00 110.54 ? 76  DG  I N3    1 
ATOM   7238  C C4    . DG  I 7  79  ? 113.976 158.430 103.487 1.00 111.17 ? 76  DG  I C4    1 
ATOM   7239  P P     . DT  I 7  80  ? 116.785 163.674 100.941 1.00 134.89 ? 77  DT  I P     1 
ATOM   7240  O OP1   . DT  I 7  80  ? 117.672 164.853 101.103 1.00 130.57 ? 77  DT  I OP1   1 
ATOM   7241  O OP2   . DT  I 7  80  ? 115.653 163.729 99.980  1.00 129.34 ? 77  DT  I OP2   1 
ATOM   7242  O "O5'" . DT  I 7  80  ? 117.685 162.414 100.568 1.00 125.20 ? 77  DT  I "O5'" 1 
ATOM   7243  C "C5'" . DT  I 7  80  ? 118.688 161.945 101.489 1.00 125.95 ? 77  DT  I "C5'" 1 
ATOM   7244  C "C4'" . DT  I 7  80  ? 119.231 160.604 101.058 1.00 125.71 ? 77  DT  I "C4'" 1 
ATOM   7245  O "O4'" . DT  I 7  80  ? 118.247 159.577 101.319 1.00 119.86 ? 77  DT  I "O4'" 1 
ATOM   7246  C "C3'" . DT  I 7  80  ? 119.604 160.493 99.579  1.00 123.05 ? 77  DT  I "C3'" 1 
ATOM   7247  O "O3'" . DT  I 7  80  ? 120.944 159.985 99.487  1.00 125.06 ? 77  DT  I "O3'" 1 
ATOM   7248  C "C2'" . DT  I 7  80  ? 118.595 159.501 99.011  1.00 118.75 ? 77  DT  I "C2'" 1 
ATOM   7249  C "C1'" . DT  I 7  80  ? 118.189 158.686 100.224 1.00 117.35 ? 77  DT  I "C1'" 1 
ATOM   7250  N N1    . DT  I 7  80  ? 116.822 158.133 100.173 1.00 113.99 ? 77  DT  I N1    1 
ATOM   7251  C C2    . DT  I 7  80  ? 116.653 156.776 100.349 1.00 112.30 ? 77  DT  I C2    1 
ATOM   7252  O O2    . DT  I 7  80  ? 117.580 156.007 100.544 1.00 113.42 ? 77  DT  I O2    1 
ATOM   7253  N N3    . DT  I 7  80  ? 115.351 156.348 100.290 1.00 110.50 ? 77  DT  I N3    1 
ATOM   7254  C C4    . DT  I 7  80  ? 114.230 157.121 100.078 1.00 108.88 ? 77  DT  I C4    1 
ATOM   7255  O O4    . DT  I 7  80  ? 113.118 156.602 100.053 1.00 108.39 ? 77  DT  I O4    1 
ATOM   7256  C C5    . DT  I 7  80  ? 114.479 158.529 99.901  1.00 110.71 ? 77  DT  I C5    1 
ATOM   7257  C C7    . DT  I 7  80  ? 113.320 159.435 99.654  1.00 113.96 ? 77  DT  I C7    1 
ATOM   7258  C C6    . DT  I 7  80  ? 115.743 158.959 99.957  1.00 113.20 ? 77  DT  I C6    1 
ATOM   7259  P P     . DC  I 7  81  ? 121.782 160.013 98.110  1.00 133.94 ? 78  DC  I P     1 
ATOM   7260  O OP1   . DC  I 7  81  ? 123.223 160.156 98.435  1.00 130.03 ? 78  DC  I OP1   1 
ATOM   7261  O OP2   . DC  I 7  81  ? 121.128 160.948 97.158  1.00 125.31 ? 78  DC  I OP2   1 
ATOM   7262  O "O5'" . DC  I 7  81  ? 121.540 158.571 97.476  1.00 123.25 ? 78  DC  I "O5'" 1 
ATOM   7263  C "C5'" . DC  I 7  81  ? 121.777 157.372 98.240  1.00 122.72 ? 78  DC  I "C5'" 1 
ATOM   7264  C "C4'" . DC  I 7  81  ? 121.258 156.164 97.495  1.00 119.50 ? 78  DC  I "C4'" 1 
ATOM   7265  O "O4'" . DC  I 7  81  ? 119.816 156.082 97.638  1.00 115.97 ? 78  DC  I "O4'" 1 
ATOM   7266  C "C3'" . DC  I 7  81  ? 121.523 156.190 95.982  1.00 119.38 ? 78  DC  I "C3'" 1 
ATOM   7267  O "O3'" . DC  I 7  81  ? 121.807 154.878 95.472  1.00 117.55 ? 78  DC  I "O3'" 1 
ATOM   7268  C "C2'" . DC  I 7  81  ? 120.192 156.670 95.439  1.00 116.17 ? 78  DC  I "C2'" 1 
ATOM   7269  C "C1'" . DC  I 7  81  ? 119.246 155.915 96.354  1.00 113.87 ? 78  DC  I "C1'" 1 
ATOM   7270  N N1    . DC  I 7  81  ? 117.838 156.365 96.408  1.00 112.07 ? 78  DC  I N1    1 
ATOM   7271  C C2    . DC  I 7  81  ? 116.847 155.401 96.628  1.00 108.23 ? 78  DC  I C2    1 
ATOM   7272  O O2    . DC  I 7  81  ? 117.177 154.216 96.767  1.00 109.87 ? 78  DC  I O2    1 
ATOM   7273  N N3    . DC  I 7  81  ? 115.552 155.772 96.686  1.00 108.82 ? 78  DC  I N3    1 
ATOM   7274  C C4    . DC  I 7  81  ? 115.223 157.053 96.533  1.00 110.32 ? 78  DC  I C4    1 
ATOM   7275  N N4    . DC  I 7  81  ? 113.934 157.385 96.597  1.00 113.07 ? 78  DC  I N4    1 
ATOM   7276  C C5    . DC  I 7  81  ? 116.202 158.058 96.307  1.00 111.15 ? 78  DC  I C5    1 
ATOM   7277  C C6    . DC  I 7  81  ? 117.483 157.678 96.252  1.00 111.70 ? 78  DC  I C6    1 
ATOM   7278  P P     . DC  I 7  82  ? 123.253 154.187 95.651  1.00 122.23 ? 79  DC  I P     1 
ATOM   7279  O OP1   . DC  I 7  82  ? 123.930 154.781 96.829  1.00 123.71 ? 79  DC  I OP1   1 
ATOM   7280  O OP2   . DC  I 7  82  ? 123.926 154.174 94.326  1.00 116.86 ? 79  DC  I OP2   1 
ATOM   7281  O "O5'" . DC  I 7  82  ? 122.943 152.646 95.953  1.00 117.46 ? 79  DC  I "O5'" 1 
ATOM   7282  C "C5'" . DC  I 7  82  ? 121.744 152.208 96.633  1.00 116.87 ? 79  DC  I "C5'" 1 
ATOM   7283  C "C4'" . DC  I 7  82  ? 121.036 151.119 95.851  1.00 116.58 ? 79  DC  I "C4'" 1 
ATOM   7284  O "O4'" . DC  I 7  82  ? 119.703 151.565 95.482  1.00 113.64 ? 79  DC  I "O4'" 1 
ATOM   7285  C "C3'" . DC  I 7  82  ? 121.694 150.729 94.527  1.00 118.75 ? 79  DC  I "C3'" 1 
ATOM   7286  O "O3'" . DC  I 7  82  ? 121.330 149.392 94.159  1.00 119.16 ? 79  DC  I "O3'" 1 
ATOM   7287  C "C2'" . DC  I 7  82  ? 121.032 151.701 93.580  1.00 115.83 ? 79  DC  I "C2'" 1 
ATOM   7288  C "C1'" . DC  I 7  82  ? 119.595 151.594 94.065  1.00 113.15 ? 79  DC  I "C1'" 1 
ATOM   7289  N N1    . DC  I 7  82  ? 118.668 152.683 93.697  1.00 110.64 ? 79  DC  I N1    1 
ATOM   7290  C C2    . DC  I 7  82  ? 117.294 152.462 93.862  1.00 110.12 ? 79  DC  I C2    1 
ATOM   7291  O O2    . DC  I 7  82  ? 116.900 151.372 94.303  1.00 110.10 ? 79  DC  I O2    1 
ATOM   7292  N N3    . DC  I 7  82  ? 116.418 153.436 93.539  1.00 110.89 ? 79  DC  I N3    1 
ATOM   7293  C C4    . DC  I 7  82  ? 116.863 154.599 93.066  1.00 111.38 ? 79  DC  I C4    1 
ATOM   7294  N N4    . DC  I 7  82  ? 115.969 155.539 92.757  1.00 111.94 ? 79  DC  I N4    1 
ATOM   7295  C C5    . DC  I 7  82  ? 118.247 154.854 92.885  1.00 112.28 ? 79  DC  I C5    1 
ATOM   7296  C C6    . DC  I 7  82  ? 119.106 153.885 93.208  1.00 112.22 ? 79  DC  I C6    1 
ATOM   7297  P P     . DC  I 7  83  ? 122.310 148.136 94.387  1.00 123.54 ? 80  DC  I P     1 
ATOM   7298  O OP1   . DC  I 7  83  ? 122.865 148.183 95.763  1.00 120.33 ? 80  DC  I OP1   1 
ATOM   7299  O OP2   . DC  I 7  83  ? 123.212 148.024 93.213  1.00 121.92 ? 80  DC  I OP2   1 
ATOM   7300  O "O5'" . DC  I 7  83  ? 121.336 146.882 94.255  1.00 115.81 ? 80  DC  I "O5'" 1 
ATOM   7301  C "C5'" . DC  I 7  83  ? 120.297 146.665 95.228  1.00 114.88 ? 80  DC  I "C5'" 1 
ATOM   7302  C "C4'" . DC  I 7  83  ? 118.976 146.335 94.566  1.00 112.51 ? 80  DC  I "C4'" 1 
ATOM   7303  O "O4'" . DC  I 7  83  ? 118.413 147.519 93.951  1.00 111.75 ? 80  DC  I "O4'" 1 
ATOM   7304  C "C3'" . DC  I 7  83  ? 119.038 145.270 93.469  1.00 111.83 ? 80  DC  I "C3'" 1 
ATOM   7305  O "O3'" . DC  I 7  83  ? 117.940 144.367 93.660  1.00 106.93 ? 80  DC  I "O3'" 1 
ATOM   7306  C "C2'" . DC  I 7  83  ? 118.894 146.073 92.183  1.00 109.48 ? 80  DC  I "C2'" 1 
ATOM   7307  C "C1'" . DC  I 7  83  ? 118.022 147.240 92.616  1.00 109.03 ? 80  DC  I "C1'" 1 
ATOM   7308  N N1    . DC  I 7  83  ? 118.174 148.494 91.846  1.00 110.79 ? 80  DC  I N1    1 
ATOM   7309  C C2    . DC  I 7  83  ? 117.030 149.230 91.499  1.00 108.05 ? 80  DC  I C2    1 
ATOM   7310  O O2    . DC  I 7  83  ? 115.909 148.822 91.837  1.00 107.79 ? 80  DC  I O2    1 
ATOM   7311  N N3    . DC  I 7  83  ? 117.163 150.378 90.799  1.00 109.24 ? 80  DC  I N3    1 
ATOM   7312  C C4    . DC  I 7  83  ? 118.375 150.802 90.443  1.00 110.48 ? 80  DC  I C4    1 
ATOM   7313  N N4    . DC  I 7  83  ? 118.471 151.937 89.752  1.00 112.92 ? 80  DC  I N4    1 
ATOM   7314  C C5    . DC  I 7  83  ? 119.549 150.080 90.776  1.00 109.74 ? 80  DC  I C5    1 
ATOM   7315  C C6    . DC  I 7  83  ? 119.409 148.948 91.470  1.00 111.26 ? 80  DC  I C6    1 
ATOM   7316  P P     . DC  I 7  84  ? 117.778 142.994 92.832  1.00 106.69 ? 81  DC  I P     1 
ATOM   7317  O OP1   . DC  I 7  84  ? 117.808 141.849 93.777  1.00 102.05 ? 81  DC  I OP1   1 
ATOM   7318  O OP2   . DC  I 7  84  ? 118.678 143.025 91.650  1.00 107.90 ? 81  DC  I OP2   1 
ATOM   7319  O "O5'" . DC  I 7  84  ? 116.316 143.114 92.219  1.00 101.62 ? 81  DC  I "O5'" 1 
ATOM   7320  C "C5'" . DC  I 7  84  ? 115.202 143.400 93.084  1.00 101.34 ? 81  DC  I "C5'" 1 
ATOM   7321  C "C4'" . DC  I 7  84  ? 113.997 143.830 92.285  1.00 102.96 ? 81  DC  I "C4'" 1 
ATOM   7322  O "O4'" . DC  I 7  84  ? 114.242 145.125 91.685  1.00 102.72 ? 81  DC  I "O4'" 1 
ATOM   7323  C "C3'" . DC  I 7  84  ? 113.612 142.892 91.143  1.00 100.98 ? 81  DC  I "C3'" 1 
ATOM   7324  O "O3'" . DC  I 7  84  ? 112.183 142.772 91.134  1.00 99.22  ? 81  DC  I "O3'" 1 
ATOM   7325  C "C2'" . DC  I 7  84  ? 114.145 143.611 89.913  1.00 100.45 ? 81  DC  I "C2'" 1 
ATOM   7326  C "C1'" . DC  I 7  84  ? 113.989 145.073 90.292  1.00 100.50 ? 81  DC  I "C1'" 1 
ATOM   7327  N N1    . DC  I 7  84  ? 114.927 146.011 89.642  1.00 103.38 ? 81  DC  I N1    1 
ATOM   7328  C C2    . DC  I 7  84  ? 114.430 147.187 89.064  1.00 105.88 ? 81  DC  I C2    1 
ATOM   7329  O O2    . DC  I 7  84  ? 113.215 147.420 89.102  1.00 106.78 ? 81  DC  I O2    1 
ATOM   7330  N N3    . DC  I 7  84  ? 115.281 148.051 88.470  1.00 107.60 ? 81  DC  I N3    1 
ATOM   7331  C C4    . DC  I 7  84  ? 116.584 147.782 88.439  1.00 108.09 ? 81  DC  I C4    1 
ATOM   7332  N N4    . DC  I 7  84  ? 117.397 148.656 87.845  1.00 111.21 ? 81  DC  I N4    1 
ATOM   7333  C C5    . DC  I 7  84  ? 117.119 146.599 89.015  1.00 105.97 ? 81  DC  I C5    1 
ATOM   7334  C C6    . DC  I 7  84  ? 116.268 145.751 89.600  1.00 103.56 ? 81  DC  I C6    1 
ATOM   7335  P P     . DC  I 7  85  ? 111.382 141.776 90.154  1.00 100.07 ? 82  DC  I P     1 
ATOM   7336  O OP1   . DC  I 7  85  ? 110.538 140.873 90.975  1.00 96.29  ? 82  DC  I OP1   1 
ATOM   7337  O OP2   . DC  I 7  85  ? 112.319 141.223 89.143  1.00 103.65 ? 82  DC  I OP2   1 
ATOM   7338  O "O5'" . DC  I 7  85  ? 110.441 142.764 89.327  1.00 102.45 ? 82  DC  I "O5'" 1 
ATOM   7339  C "C5'" . DC  I 7  85  ? 109.921 143.954 89.955  1.00 103.96 ? 82  DC  I "C5'" 1 
ATOM   7340  C "C4'" . DC  I 7  85  ? 109.107 144.778 88.987  1.00 110.98 ? 82  DC  I "C4'" 1 
ATOM   7341  O "O4'" . DC  I 7  85  ? 109.959 145.766 88.365  1.00 110.86 ? 82  DC  I "O4'" 1 
ATOM   7342  C "C3'" . DC  I 7  85  ? 108.454 143.992 87.855  1.00 109.29 ? 82  DC  I "C3'" 1 
ATOM   7343  O "O3'" . DC  I 7  85  ? 107.147 144.533 87.607  1.00 119.20 ? 82  DC  I "O3'" 1 
ATOM   7344  C "C2'" . DC  I 7  85  ? 109.390 144.218 86.678  1.00 108.80 ? 82  DC  I "C2'" 1 
ATOM   7345  C "C1'" . DC  I 7  85  ? 110.021 145.574 86.961  1.00 111.63 ? 82  DC  I "C1'" 1 
ATOM   7346  N N1    . DC  I 7  85  ? 111.439 145.709 86.566  1.00 107.84 ? 82  DC  I N1    1 
ATOM   7347  C C2    . DC  I 7  85  ? 111.860 146.858 85.875  1.00 110.05 ? 82  DC  I C2    1 
ATOM   7348  O O2    . DC  I 7  85  ? 111.040 147.748 85.601  1.00 111.28 ? 82  DC  I O2    1 
ATOM   7349  N N3    . DC  I 7  85  ? 113.156 146.980 85.518  1.00 108.91 ? 82  DC  I N3    1 
ATOM   7350  C C4    . DC  I 7  85  ? 114.023 146.014 85.822  1.00 107.81 ? 82  DC  I C4    1 
ATOM   7351  N N4    . DC  I 7  85  ? 115.295 146.166 85.453  1.00 108.98 ? 82  DC  I N4    1 
ATOM   7352  C C5    . DC  I 7  85  ? 113.629 144.843 86.516  1.00 104.11 ? 82  DC  I C5    1 
ATOM   7353  C C6    . DC  I 7  85  ? 112.345 144.731 86.866  1.00 104.67 ? 82  DC  I C6    1 
ATOM   7354  P P     . DG  I 7  86  ? 106.100 143.845 86.591  1.00 122.57 ? 83  DG  I P     1 
ATOM   7355  O OP1   . DG  I 7  86  ? 104.730 144.074 87.113  1.00 128.80 ? 83  DG  I OP1   1 
ATOM   7356  O OP2   . DG  I 7  86  ? 106.553 142.462 86.295  1.00 120.14 ? 83  DG  I OP2   1 
ATOM   7357  O "O5'" . DG  I 7  86  ? 106.280 144.710 85.265  1.00 120.77 ? 83  DG  I "O5'" 1 
ATOM   7358  C "C5'" . DG  I 7  86  ? 106.312 146.147 85.340  1.00 127.40 ? 83  DG  I "C5'" 1 
ATOM   7359  C "C4'" . DG  I 7  86  ? 106.392 146.759 83.962  1.00 126.82 ? 83  DG  I "C4'" 1 
ATOM   7360  O "O4'" . DG  I 7  86  ? 107.778 146.979 83.603  1.00 117.53 ? 83  DG  I "O4'" 1 
ATOM   7361  C "C3'" . DG  I 7  86  ? 105.800 145.928 82.830  1.00 127.75 ? 83  DG  I "C3'" 1 
ATOM   7362  O "O3'" . DG  I 7  86  ? 105.226 146.825 81.871  1.00 138.23 ? 83  DG  I "O3'" 1 
ATOM   7363  C "C2'" . DG  I 7  86  ? 107.016 145.209 82.270  1.00 124.35 ? 83  DG  I "C2'" 1 
ATOM   7364  C "C1'" . DG  I 7  86  ? 108.102 146.257 82.422  1.00 119.29 ? 83  DG  I "C1'" 1 
ATOM   7365  N N9    . DG  I 7  86  ? 109.455 145.730 82.594  1.00 115.41 ? 83  DG  I N9    1 
ATOM   7366  C C8    . DG  I 7  86  ? 109.833 144.576 83.234  1.00 113.58 ? 83  DG  I C8    1 
ATOM   7367  N N7    . DG  I 7  86  ? 111.120 144.379 83.225  1.00 110.91 ? 83  DG  I N7    1 
ATOM   7368  C C5    . DG  I 7  86  ? 111.624 145.467 82.538  1.00 110.37 ? 83  DG  I C5    1 
ATOM   7369  C C6    . DG  I 7  86  ? 112.960 145.799 82.215  1.00 112.32 ? 83  DG  I C6    1 
ATOM   7370  O O6    . DG  I 7  86  ? 113.989 145.171 82.487  1.00 113.40 ? 83  DG  I O6    1 
ATOM   7371  N N1    . DG  I 7  86  ? 113.031 146.991 81.506  1.00 113.66 ? 83  DG  I N1    1 
ATOM   7372  C C2    . DG  I 7  86  ? 111.952 147.764 81.158  1.00 114.66 ? 83  DG  I C2    1 
ATOM   7373  N N2    . DG  I 7  86  ? 112.221 148.884 80.473  1.00 117.23 ? 83  DG  I N2    1 
ATOM   7374  N N3    . DG  I 7  86  ? 110.698 147.464 81.455  1.00 115.57 ? 83  DG  I N3    1 
ATOM   7375  C C4    . DG  I 7  86  ? 110.611 146.309 82.141  1.00 112.40 ? 83  DG  I C4    1 
ATOM   7376  P P     . DC  I 7  87  ? 104.245 146.301 80.712  1.00 143.09 ? 84  DC  I P     1 
ATOM   7377  O OP1   . DC  I 7  87  ? 103.477 147.456 80.184  1.00 150.40 ? 84  DC  I OP1   1 
ATOM   7378  O OP2   . DC  I 7  87  ? 103.540 145.081 81.185  1.00 139.72 ? 84  DC  I OP2   1 
ATOM   7379  O "O5'" . DC  I 7  87  ? 105.240 145.771 79.588  1.00 137.99 ? 84  DC  I "O5'" 1 
ATOM   7380  C "C5'" . DC  I 7  87  ? 105.065 146.151 78.215  1.00 141.07 ? 84  DC  I "C5'" 1 
ATOM   7381  C "C4'" . DC  I 7  87  ? 106.279 146.896 77.713  1.00 138.01 ? 84  DC  I "C4'" 1 
ATOM   7382  O "O4'" . DC  I 7  87  ? 107.436 146.592 78.526  1.00 132.39 ? 84  DC  I "O4'" 1 
ATOM   7383  C "C3'" . DC  I 7  87  ? 106.662 146.543 76.277  1.00 136.05 ? 84  DC  I "C3'" 1 
ATOM   7384  O "O3'" . DC  I 7  87  ? 106.444 147.678 75.426  1.00 138.01 ? 84  DC  I "O3'" 1 
ATOM   7385  C "C2'" . DC  I 7  87  ? 108.138 146.174 76.339  1.00 131.29 ? 84  DC  I "C2'" 1 
ATOM   7386  C "C1'" . DC  I 7  87  ? 108.596 146.604 77.717  1.00 128.36 ? 84  DC  I "C1'" 1 
ATOM   7387  N N1    . DC  I 7  87  ? 109.584 145.698 78.330  1.00 123.38 ? 84  DC  I N1    1 
ATOM   7388  C C2    . DC  I 7  87  ? 110.955 145.930 78.143  1.00 117.14 ? 84  DC  I C2    1 
ATOM   7389  O O2    . DC  I 7  87  ? 111.327 146.896 77.463  1.00 118.70 ? 84  DC  I O2    1 
ATOM   7390  N N3    . DC  I 7  87  ? 111.853 145.095 78.710  1.00 113.37 ? 84  DC  I N3    1 
ATOM   7391  C C4    . DC  I 7  87  ? 111.430 144.062 79.438  1.00 114.36 ? 84  DC  I C4    1 
ATOM   7392  N N4    . DC  I 7  87  ? 112.345 143.258 79.982  1.00 114.06 ? 84  DC  I N4    1 
ATOM   7393  C C5    . DC  I 7  87  ? 110.048 143.801 79.642  1.00 115.36 ? 84  DC  I C5    1 
ATOM   7394  C C6    . DC  I 7  87  ? 109.170 144.634 79.078  1.00 120.53 ? 84  DC  I C6    1 
ATOM   7395  P P     . DG  I 7  88  ? 106.167 147.497 73.848  1.00 141.28 ? 85  DG  I P     1 
ATOM   7396  O OP1   . DG  I 7  88  ? 105.555 148.750 73.340  1.00 139.48 ? 85  DG  I OP1   1 
ATOM   7397  O OP2   . DG  I 7  88  ? 105.473 146.200 73.637  1.00 139.55 ? 85  DG  I OP2   1 
ATOM   7398  O "O5'" . DG  I 7  88  ? 107.634 147.374 73.245  1.00 135.24 ? 85  DG  I "O5'" 1 
ATOM   7399  C "C5'" . DG  I 7  88  ? 108.509 148.515 73.264  1.00 130.79 ? 85  DG  I "C5'" 1 
ATOM   7400  C "C4'" . DG  I 7  88  ? 109.833 148.185 72.620  1.00 129.07 ? 85  DG  I "C4'" 1 
ATOM   7401  O "O4'" . DG  I 7  88  ? 110.629 147.392 73.532  1.00 123.88 ? 85  DG  I "O4'" 1 
ATOM   7402  C "C3'" . DG  I 7  88  ? 109.753 147.395 71.313  1.00 130.09 ? 85  DG  I "C3'" 1 
ATOM   7403  O "O3'" . DG  I 7  88  ? 110.654 147.996 70.371  1.00 129.39 ? 85  DG  I "O3'" 1 
ATOM   7404  C "C2'" . DG  I 7  88  ? 110.199 145.995 71.708  1.00 125.76 ? 85  DG  I "C2'" 1 
ATOM   7405  C "C1'" . DG  I 7  88  ? 111.148 146.256 72.862  1.00 121.84 ? 85  DG  I "C1'" 1 
ATOM   7406  N N9    . DG  I 7  88  ? 111.225 145.176 73.840  1.00 117.53 ? 85  DG  I N9    1 
ATOM   7407  C C8    . DG  I 7  88  ? 110.178 144.492 74.399  1.00 118.06 ? 85  DG  I C8    1 
ATOM   7408  N N7    . DG  I 7  88  ? 110.552 143.580 75.249  1.00 115.15 ? 85  DG  I N7    1 
ATOM   7409  C C5    . DG  I 7  88  ? 111.932 143.665 75.251  1.00 116.99 ? 85  DG  I C5    1 
ATOM   7410  C C6    . DG  I 7  88  ? 112.891 142.923 75.980  1.00 113.86 ? 85  DG  I C6    1 
ATOM   7411  O O6    . DG  I 7  88  ? 112.694 142.016 76.796  1.00 114.74 ? 85  DG  I O6    1 
ATOM   7412  N N1    . DG  I 7  88  ? 114.186 143.330 75.684  1.00 115.79 ? 85  DG  I N1    1 
ATOM   7413  C C2    . DG  I 7  88  ? 114.512 144.325 74.799  1.00 118.65 ? 85  DG  I C2    1 
ATOM   7414  N N2    . DG  I 7  88  ? 115.819 144.580 74.642  1.00 117.69 ? 85  DG  I N2    1 
ATOM   7415  N N3    . DG  I 7  88  ? 113.625 145.026 74.113  1.00 115.72 ? 85  DG  I N3    1 
ATOM   7416  C C4    . DG  I 7  88  ? 112.363 144.645 74.387  1.00 114.45 ? 85  DG  I C4    1 
ATOM   7417  P P     . DT  I 7  89  ? 110.670 147.588 68.811  1.00 143.18 ? 86  DT  I P     1 
ATOM   7418  O OP1   . DT  I 7  89  ? 110.842 148.825 68.011  1.00 135.25 ? 86  DT  I OP1   1 
ATOM   7419  O OP2   . DT  I 7  89  ? 109.517 146.690 68.542  1.00 134.40 ? 86  DT  I OP2   1 
ATOM   7420  O "O5'" . DT  I 7  89  ? 112.003 146.725 68.694  1.00 130.84 ? 86  DT  I "O5'" 1 
ATOM   7421  C "C5'" . DT  I 7  89  ? 113.260 147.281 69.121  1.00 129.19 ? 86  DT  I "C5'" 1 
ATOM   7422  C "C4'" . DT  I 7  89  ? 114.337 146.224 69.152  1.00 125.06 ? 86  DT  I "C4'" 1 
ATOM   7423  O "O4'" . DT  I 7  89  ? 114.157 145.384 70.317  1.00 121.36 ? 86  DT  I "O4'" 1 
ATOM   7424  C "C3'" . DT  I 7  89  ? 114.391 145.290 67.939  1.00 122.20 ? 86  DT  I "C3'" 1 
ATOM   7425  O "O3'" . DT  I 7  89  ? 115.727 145.318 67.408  1.00 126.82 ? 86  DT  I "O3'" 1 
ATOM   7426  C "C2'" . DT  I 7  89  ? 114.039 143.924 68.519  1.00 118.28 ? 86  DT  I "C2'" 1 
ATOM   7427  C "C1'" . DT  I 7  89  ? 114.468 144.054 69.967  1.00 118.27 ? 86  DT  I "C1'" 1 
ATOM   7428  N N1    . DT  I 7  89  ? 113.790 143.142 70.914  1.00 116.13 ? 86  DT  I N1    1 
ATOM   7429  C C2    . DT  I 7  89  ? 114.572 142.423 71.791  1.00 114.92 ? 86  DT  I C2    1 
ATOM   7430  O O2    . DT  I 7  89  ? 115.788 142.510 71.822  1.00 115.20 ? 86  DT  I O2    1 
ATOM   7431  N N3    . DT  I 7  89  ? 113.880 141.597 72.638  1.00 112.62 ? 86  DT  I N3    1 
ATOM   7432  C C4    . DT  I 7  89  ? 112.517 141.417 72.698  1.00 112.55 ? 86  DT  I C4    1 
ATOM   7433  O O4    . DT  I 7  89  ? 112.029 140.639 73.516  1.00 113.64 ? 86  DT  I O4    1 
ATOM   7434  C C5    . DT  I 7  89  ? 111.757 142.197 71.755  1.00 114.65 ? 86  DT  I C5    1 
ATOM   7435  C C7    . DT  I 7  89  ? 110.273 142.059 71.749  1.00 114.41 ? 86  DT  I C7    1 
ATOM   7436  C C6    . DT  I 7  89  ? 112.419 143.008 70.922  1.00 115.53 ? 86  DT  I C6    1 
ATOM   7437  P P     . DT  I 7  90  ? 116.148 144.540 66.057  1.00 139.17 ? 87  DT  I P     1 
ATOM   7438  O OP1   . DT  I 7  90  ? 117.071 145.409 65.285  1.00 134.08 ? 87  DT  I OP1   1 
ATOM   7439  O OP2   . DT  I 7  90  ? 114.918 144.016 65.407  1.00 131.17 ? 87  DT  I OP2   1 
ATOM   7440  O "O5'" . DT  I 7  90  ? 116.976 143.298 66.617  1.00 129.49 ? 87  DT  I "O5'" 1 
ATOM   7441  C "C5'" . DT  I 7  90  ? 118.082 143.516 67.516  1.00 128.84 ? 87  DT  I "C5'" 1 
ATOM   7442  C "C4'" . DT  I 7  90  ? 118.599 142.215 68.089  1.00 126.74 ? 87  DT  I "C4'" 1 
ATOM   7443  O "O4'" . DT  I 7  90  ? 117.633 141.661 69.014  1.00 121.73 ? 87  DT  I "O4'" 1 
ATOM   7444  C "C3'" . DT  I 7  90  ? 118.915 141.108 67.080  1.00 124.67 ? 87  DT  I "C3'" 1 
ATOM   7445  O "O3'" . DT  I 7  90  ? 120.213 140.584 67.399  1.00 126.23 ? 87  DT  I "O3'" 1 
ATOM   7446  C "C2'" . DT  I 7  90  ? 117.814 140.081 67.324  1.00 119.92 ? 87  DT  I "C2'" 1 
ATOM   7447  C "C1'" . DT  I 7  90  ? 117.523 140.268 68.800  1.00 118.08 ? 87  DT  I "C1'" 1 
ATOM   7448  N N1    . DT  I 7  90  ? 116.179 139.845 69.252  1.00 113.77 ? 87  DT  I N1    1 
ATOM   7449  C C2    . DT  I 7  90  ? 116.089 138.961 70.305  1.00 108.72 ? 87  DT  I C2    1 
ATOM   7450  O O2    . DT  I 7  90  ? 117.066 138.509 70.878  1.00 110.57 ? 87  DT  I O2    1 
ATOM   7451  N N3    . DT  I 7  90  ? 114.809 138.623 70.665  1.00 108.09 ? 87  DT  I N3    1 
ATOM   7452  C C4    . DT  I 7  90  ? 113.636 139.067 70.093  1.00 110.44 ? 87  DT  I C4    1 
ATOM   7453  O O4    . DT  I 7  90  ? 112.549 138.682 70.521  1.00 110.67 ? 87  DT  I O4    1 
ATOM   7454  C C5    . DT  I 7  90  ? 113.803 139.988 68.997  1.00 111.44 ? 87  DT  I C5    1 
ATOM   7455  C C7    . DT  I 7  90  ? 112.586 140.510 68.309  1.00 114.96 ? 87  DT  I C7    1 
ATOM   7456  C C6    . DT  I 7  90  ? 115.046 140.326 68.637  1.00 113.38 ? 87  DT  I C6    1 
ATOM   7457  P P     . DT  I 7  91  ? 120.988 139.525 66.462  1.00 139.50 ? 88  DT  I P     1 
ATOM   7458  O OP1   . DT  I 7  91  ? 122.400 139.963 66.332  1.00 132.22 ? 88  DT  I OP1   1 
ATOM   7459  O OP2   . DT  I 7  91  ? 120.176 139.285 65.241  1.00 134.08 ? 88  DT  I OP2   1 
ATOM   7460  O "O5'" . DT  I 7  91  ? 120.955 138.199 67.346  1.00 125.82 ? 88  DT  I "O5'" 1 
ATOM   7461  C "C5'" . DT  I 7  91  ? 121.457 138.227 68.696  1.00 122.13 ? 88  DT  I "C5'" 1 
ATOM   7462  C "C4'" . DT  I 7  91  ? 121.145 136.942 69.427  1.00 119.43 ? 88  DT  I "C4'" 1 
ATOM   7463  O "O4'" . DT  I 7  91  ? 119.726 136.863 69.699  1.00 115.24 ? 88  DT  I "O4'" 1 
ATOM   7464  C "C3'" . DT  I 7  91  ? 121.521 135.645 68.707  1.00 117.81 ? 88  DT  I "C3'" 1 
ATOM   7465  O "O3'" . DT  I 7  91  ? 122.267 134.840 69.634  1.00 117.40 ? 88  DT  I "O3'" 1 
ATOM   7466  C "C2'" . DT  I 7  91  ? 120.172 135.020 68.361  1.00 112.69 ? 88  DT  I "C2'" 1 
ATOM   7467  C "C1'" . DT  I 7  91  ? 119.277 135.543 69.466  1.00 111.07 ? 88  DT  I "C1'" 1 
ATOM   7468  N N1    . DT  I 7  91  ? 117.835 135.613 69.148  1.00 109.00 ? 88  DT  I N1    1 
ATOM   7469  C C2    . DT  I 7  91  ? 116.949 134.937 69.959  1.00 106.89 ? 88  DT  I C2    1 
ATOM   7470  O O2    . DT  I 7  91  ? 117.302 134.283 70.925  1.00 106.60 ? 88  DT  I O2    1 
ATOM   7471  N N3    . DT  I 7  91  ? 115.631 135.054 69.597  1.00 106.11 ? 88  DT  I N3    1 
ATOM   7472  C C4    . DT  I 7  91  ? 115.123 135.763 68.529  1.00 107.21 ? 88  DT  I C4    1 
ATOM   7473  O O4    . DT  I 7  91  ? 113.912 135.789 68.318  1.00 108.80 ? 88  DT  I O4    1 
ATOM   7474  C C5    . DT  I 7  91  ? 116.104 136.444 67.723  1.00 106.51 ? 88  DT  I C5    1 
ATOM   7475  C C7    . DT  I 7  91  ? 115.637 137.233 66.545  1.00 110.51 ? 88  DT  I C7    1 
ATOM   7476  C C6    . DT  I 7  91  ? 117.392 136.338 68.067  1.00 107.33 ? 88  DT  I C6    1 
ATOM   7477  P P     . DT  I 7  92  ? 122.979 133.453 69.227  1.00 125.46 ? 89  DT  I P     1 
ATOM   7478  O OP1   . DT  I 7  92  ? 124.361 133.460 69.768  1.00 119.14 ? 89  DT  I OP1   1 
ATOM   7479  O OP2   . DT  I 7  92  ? 122.756 133.209 67.778  1.00 121.86 ? 89  DT  I OP2   1 
ATOM   7480  O "O5'" . DT  I 7  92  ? 122.126 132.383 70.044  1.00 115.83 ? 89  DT  I "O5'" 1 
ATOM   7481  C "C5'" . DT  I 7  92  ? 121.839 132.604 71.438  1.00 114.60 ? 89  DT  I "C5'" 1 
ATOM   7482  C "C4'" . DT  I 7  92  ? 120.848 131.588 71.952  1.00 112.63 ? 89  DT  I "C4'" 1 
ATOM   7483  O "O4'" . DT  I 7  92  ? 119.525 131.911 71.479  1.00 110.17 ? 89  DT  I "O4'" 1 
ATOM   7484  C "C3'" . DT  I 7  92  ? 121.122 130.145 71.541  1.00 111.14 ? 89  DT  I "C3'" 1 
ATOM   7485  O "O3'" . DT  I 7  92  ? 121.275 129.376 72.740  1.00 112.59 ? 89  DT  I "O3'" 1 
ATOM   7486  C "C2'" . DT  I 7  92  ? 119.882 129.717 70.758  1.00 107.79 ? 89  DT  I "C2'" 1 
ATOM   7487  C "C1'" . DT  I 7  92  ? 118.823 130.724 71.171  1.00 108.38 ? 89  DT  I "C1'" 1 
ATOM   7488  N N1    . DT  I 7  92  ? 117.838 131.074 70.128  1.00 106.54 ? 89  DT  I N1    1 
ATOM   7489  C C2    . DT  I 7  92  ? 116.502 130.803 70.346  1.00 106.61 ? 89  DT  I C2    1 
ATOM   7490  O O2    . DT  I 7  92  ? 116.087 130.281 71.368  1.00 108.55 ? 89  DT  I O2    1 
ATOM   7491  N N3    . DT  I 7  92  ? 115.666 131.169 69.320  1.00 106.20 ? 89  DT  I N3    1 
ATOM   7492  C C4    . DT  I 7  92  ? 116.024 131.764 68.128  1.00 106.42 ? 89  DT  I C4    1 
ATOM   7493  O O4    . DT  I 7  92  ? 115.168 132.042 67.292  1.00 108.70 ? 89  DT  I O4    1 
ATOM   7494  C C5    . DT  I 7  92  ? 117.434 132.016 67.967  1.00 104.47 ? 89  DT  I C5    1 
ATOM   7495  C C7    . DT  I 7  92  ? 117.909 132.658 66.707  1.00 107.77 ? 89  DT  I C7    1 
ATOM   7496  C C6    . DT  I 7  92  ? 118.257 131.665 68.960  1.00 105.58 ? 89  DT  I C6    1 
ATOM   7497  P P     . DA  I 7  93  ? 122.011 127.945 72.765  1.00 120.09 ? 90  DA  I P     1 
ATOM   7498  O OP1   . DA  I 7  93  ? 122.810 127.862 74.014  1.00 116.31 ? 90  DA  I OP1   1 
ATOM   7499  O OP2   . DA  I 7  93  ? 122.671 127.721 71.452  1.00 116.90 ? 90  DA  I OP2   1 
ATOM   7500  O "O5'" . DA  I 7  93  ? 120.794 126.928 72.885  1.00 112.39 ? 90  DA  I "O5'" 1 
ATOM   7501  C "C5'" . DA  I 7  93  ? 119.811 127.066 73.928  1.00 110.46 ? 90  DA  I "C5'" 1 
ATOM   7502  C "C4'" . DA  I 7  93  ? 118.517 126.418 73.506  1.00 108.54 ? 90  DA  I "C4'" 1 
ATOM   7503  O "O4'" . DA  I 7  93  ? 118.005 127.096 72.330  1.00 107.84 ? 90  DA  I "O4'" 1 
ATOM   7504  C "C3'" . DA  I 7  93  ? 118.639 124.936 73.120  1.00 107.39 ? 90  DA  I "C3'" 1 
ATOM   7505  O "O3'" . DA  I 7  93  ? 117.504 124.185 73.576  1.00 103.55 ? 90  DA  I "O3'" 1 
ATOM   7506  C "C2'" . DA  I 7  93  ? 118.617 124.995 71.607  1.00 109.01 ? 90  DA  I "C2'" 1 
ATOM   7507  C "C1'" . DA  I 7  93  ? 117.617 126.112 71.396  1.00 105.68 ? 90  DA  I "C1'" 1 
ATOM   7508  N N9    . DA  I 7  93  ? 117.585 126.679 70.048  1.00 104.68 ? 90  DA  I N9    1 
ATOM   7509  C C8    . DA  I 7  93  ? 118.608 126.806 69.140  1.00 107.18 ? 90  DA  I C8    1 
ATOM   7510  N N7    . DA  I 7  93  ? 118.244 127.357 68.010  1.00 105.91 ? 90  DA  I N7    1 
ATOM   7511  C C5    . DA  I 7  93  ? 116.892 127.608 68.185  1.00 103.24 ? 90  DA  I C5    1 
ATOM   7512  C C6    . DA  I 7  93  ? 115.931 128.180 67.343  1.00 105.07 ? 90  DA  I C6    1 
ATOM   7513  N N6    . DA  I 7  93  ? 116.193 128.623 66.115  1.00 104.41 ? 90  DA  I N6    1 
ATOM   7514  N N1    . DA  I 7  93  ? 114.675 128.285 67.818  1.00 106.62 ? 90  DA  I N1    1 
ATOM   7515  C C2    . DA  I 7  93  ? 114.421 127.841 69.053  1.00 105.88 ? 90  DA  I C2    1 
ATOM   7516  N N3    . DA  I 7  93  ? 115.242 127.286 69.936  1.00 104.30 ? 90  DA  I N3    1 
ATOM   7517  C C4    . DA  I 7  93  ? 116.476 127.196 69.431  1.00 104.17 ? 90  DA  I C4    1 
ATOM   7518  P P     . DA  I 7  94  ? 117.436 123.534 75.047  1.00 106.12 ? 91  DA  I P     1 
ATOM   7519  O OP1   . DA  I 7  94  ? 118.197 124.400 75.978  1.00 102.64 ? 91  DA  I OP1   1 
ATOM   7520  O OP2   . DA  I 7  94  ? 117.784 122.096 74.923  1.00 104.60 ? 91  DA  I OP2   1 
ATOM   7521  O "O5'" . DA  I 7  94  ? 115.887 123.639 75.409  1.00 102.84 ? 91  DA  I "O5'" 1 
ATOM   7522  C "C5'" . DA  I 7  94  ? 115.172 124.883 75.254  1.00 104.30 ? 91  DA  I "C5'" 1 
ATOM   7523  C "C4'" . DA  I 7  94  ? 113.701 124.644 75.004  1.00 105.03 ? 91  DA  I "C4'" 1 
ATOM   7524  O "O4'" . DA  I 7  94  ? 113.389 124.981 73.632  1.00 106.45 ? 91  DA  I "O4'" 1 
ATOM   7525  C "C3'" . DA  I 7  94  ? 113.212 123.210 75.188  1.00 103.10 ? 91  DA  I "C3'" 1 
ATOM   7526  O "O3'" . DA  I 7  94  ? 111.825 123.228 75.567  1.00 102.41 ? 91  DA  I "O3'" 1 
ATOM   7527  C "C2'" . DA  I 7  94  ? 113.404 122.632 73.797  1.00 103.86 ? 91  DA  I "C2'" 1 
ATOM   7528  C "C1'" . DA  I 7  94  ? 113.057 123.810 72.900  1.00 104.69 ? 91  DA  I "C1'" 1 
ATOM   7529  N N9    . DA  I 7  94  ? 113.780 123.845 71.627  1.00 104.47 ? 91  DA  I N9    1 
ATOM   7530  C C8    . DA  I 7  94  ? 115.067 123.448 71.360  1.00 103.89 ? 91  DA  I C8    1 
ATOM   7531  N N7    . DA  I 7  94  ? 115.421 123.607 70.108  1.00 103.03 ? 91  DA  I N7    1 
ATOM   7532  C C5    . DA  I 7  94  ? 114.295 124.144 69.511  1.00 104.09 ? 91  DA  I C5    1 
ATOM   7533  C C6    . DA  I 7  94  ? 114.025 124.540 68.194  1.00 105.94 ? 91  DA  I C6    1 
ATOM   7534  N N6    . DA  I 7  94  ? 114.908 124.451 67.203  1.00 106.70 ? 91  DA  I N6    1 
ATOM   7535  N N1    . DA  I 7  94  ? 112.800 125.036 67.924  1.00 109.23 ? 91  DA  I N1    1 
ATOM   7536  C C2    . DA  I 7  94  ? 111.917 125.122 68.924  1.00 109.24 ? 91  DA  I C2    1 
ATOM   7537  N N3    . DA  I 7  94  ? 112.053 124.783 70.201  1.00 106.61 ? 91  DA  I N3    1 
ATOM   7538  C C4    . DA  I 7  94  ? 113.278 124.294 70.433  1.00 104.75 ? 91  DA  I C4    1 
ATOM   7539  P P     . DC  I 7  95  ? 111.024 121.887 75.969  1.00 105.92 ? 92  DC  I P     1 
ATOM   7540  O OP1   . DC  I 7  95  ? 110.055 122.215 77.045  1.00 101.27 ? 92  DC  I OP1   1 
ATOM   7541  O OP2   . DC  I 7  95  ? 111.992 120.775 76.146  1.00 102.20 ? 92  DC  I OP2   1 
ATOM   7542  O "O5'" . DC  I 7  95  ? 110.219 121.501 74.647  1.00 106.05 ? 92  DC  I "O5'" 1 
ATOM   7543  C "C5'" . DC  I 7  95  ? 109.148 122.341 74.177  1.00 109.21 ? 92  DC  I "C5'" 1 
ATOM   7544  C "C4'" . DC  I 7  95  ? 108.858 122.098 72.712  1.00 112.97 ? 92  DC  I "C4'" 1 
ATOM   7545  O "O4'" . DC  I 7  95  ? 110.055 122.231 71.927  1.00 109.36 ? 92  DC  I "O4'" 1 
ATOM   7546  C "C3'" . DC  I 7  95  ? 108.315 120.710 72.371  1.00 114.47 ? 92  DC  I "C3'" 1 
ATOM   7547  O "O3'" . DC  I 7  95  ? 106.894 120.798 72.182  1.00 118.10 ? 92  DC  I "O3'" 1 
ATOM   7548  C "C2'" . DC  I 7  95  ? 109.026 120.335 71.068  1.00 113.36 ? 92  DC  I "C2'" 1 
ATOM   7549  C "C1'" . DC  I 7  95  ? 109.816 121.577 70.701  1.00 111.29 ? 92  DC  I "C1'" 1 
ATOM   7550  N N1    . DC  I 7  95  ? 111.121 121.339 70.056  1.00 109.36 ? 92  DC  I N1    1 
ATOM   7551  C C2    . DC  I 7  95  ? 111.275 121.611 68.692  1.00 110.02 ? 92  DC  I C2    1 
ATOM   7552  O O2    . DC  I 7  95  ? 110.313 122.044 68.044  1.00 113.04 ? 92  DC  I O2    1 
ATOM   7553  N N3    . DC  I 7  95  ? 112.470 121.397 68.102  1.00 109.54 ? 92  DC  I N3    1 
ATOM   7554  C C4    . DC  I 7  95  ? 113.491 120.930 68.819  1.00 109.53 ? 92  DC  I C4    1 
ATOM   7555  N N4    . DC  I 7  95  ? 114.656 120.733 68.198  1.00 111.88 ? 92  DC  I N4    1 
ATOM   7556  C C5    . DC  I 7  95  ? 113.363 120.643 70.206  1.00 107.35 ? 92  DC  I C5    1 
ATOM   7557  C C6    . DC  I 7  95  ? 112.174 120.860 70.778  1.00 107.48 ? 92  DC  I C6    1 
ATOM   7558  P P     . DC  I 7  96  ? 105.969 119.485 72.044  1.00 129.21 ? 93  DC  I P     1 
ATOM   7559  O OP1   . DC  I 7  96  ? 104.599 119.816 72.507  1.00 126.09 ? 93  DC  I OP1   1 
ATOM   7560  O OP2   . DC  I 7  96  ? 106.695 118.320 72.613  1.00 124.70 ? 93  DC  I OP2   1 
ATOM   7561  O "O5'" . DC  I 7  96  ? 105.931 119.190 70.479  1.00 125.08 ? 93  DC  I "O5'" 1 
ATOM   7562  C "C5'" . DC  I 7  96  ? 105.444 120.175 69.548  1.00 127.78 ? 93  DC  I "C5'" 1 
ATOM   7563  C "C4'" . DC  I 7  96  ? 105.653 119.696 68.131  1.00 128.59 ? 93  DC  I "C4'" 1 
ATOM   7564  O "O4'" . DC  I 7  96  ? 107.037 119.877 67.765  1.00 120.89 ? 93  DC  I "O4'" 1 
ATOM   7565  C "C3'" . DC  I 7  96  ? 105.337 118.215 67.915  1.00 129.55 ? 93  DC  I "C3'" 1 
ATOM   7566  O "O3'" . DC  I 7  96  ? 104.162 118.087 67.097  1.00 133.83 ? 93  DC  I "O3'" 1 
ATOM   7567  C "C2'" . DC  I 7  96  ? 106.564 117.646 67.210  1.00 124.87 ? 93  DC  I "C2'" 1 
ATOM   7568  C "C1'" . DC  I 7  96  ? 107.433 118.845 66.886  1.00 121.44 ? 93  DC  I "C1'" 1 
ATOM   7569  N N1    . DC  I 7  96  ? 108.868 118.609 67.108  1.00 117.63 ? 93  DC  I N1    1 
ATOM   7570  C C2    . DC  I 7  96  ? 109.772 118.742 66.046  1.00 118.18 ? 93  DC  I C2    1 
ATOM   7571  O O2    . DC  I 7  96  ? 109.358 119.056 64.920  1.00 119.22 ? 93  DC  I O2    1 
ATOM   7572  N N3    . DC  I 7  96  ? 111.085 118.523 66.267  1.00 116.78 ? 93  DC  I N3    1 
ATOM   7573  C C4    . DC  I 7  96  ? 111.505 118.184 67.487  1.00 115.46 ? 93  DC  I C4    1 
ATOM   7574  N N4    . DC  I 7  96  ? 112.806 117.975 67.671  1.00 116.62 ? 93  DC  I N4    1 
ATOM   7575  C C5    . DC  I 7  96  ? 110.611 118.043 68.579  1.00 112.50 ? 93  DC  I C5    1 
ATOM   7576  C C6    . DC  I 7  96  ? 109.316 118.262 68.348  1.00 114.29 ? 93  DC  I C6    1 
ATOM   7577  P P     . DG  I 7  97  ? 103.399 116.675 66.917  1.00 141.69 ? 94  DG  I P     1 
ATOM   7578  O OP1   . DG  I 7  97  ? 102.005 116.956 66.495  1.00 140.16 ? 94  DG  I OP1   1 
ATOM   7579  O OP2   . DG  I 7  97  ? 103.648 115.842 68.122  1.00 135.82 ? 94  DG  I OP2   1 
ATOM   7580  O "O5'" . DG  I 7  97  ? 104.166 116.003 65.693  1.00 134.48 ? 94  DG  I "O5'" 1 
ATOM   7581  C "C5'" . DG  I 7  97  ? 104.130 116.619 64.392  1.00 134.19 ? 94  DG  I "C5'" 1 
ATOM   7582  C "C4'" . DG  I 7  97  ? 105.072 115.921 63.439  1.00 138.31 ? 94  DG  I "C4'" 1 
ATOM   7583  O "O4'" . DG  I 7  97  ? 106.443 116.167 63.842  1.00 132.10 ? 94  DG  I "O4'" 1 
ATOM   7584  C "C3'" . DG  I 7  97  ? 104.916 114.399 63.341  1.00 140.25 ? 94  DG  I "C3'" 1 
ATOM   7585  O "O3'" . DG  I 7  97  ? 104.852 114.029 61.951  1.00 142.75 ? 94  DG  I "O3'" 1 
ATOM   7586  C "C2'" . DG  I 7  97  ? 106.177 113.868 64.008  1.00 134.98 ? 94  DG  I "C2'" 1 
ATOM   7587  C "C1'" . DG  I 7  97  ? 107.182 114.964 63.725  1.00 131.52 ? 94  DG  I "C1'" 1 
ATOM   7588  N N9    . DG  I 7  97  ? 108.296 115.004 64.668  1.00 125.65 ? 94  DG  I N9    1 
ATOM   7589  C C8    . DG  I 7  97  ? 108.224 114.971 66.038  1.00 123.40 ? 94  DG  I C8    1 
ATOM   7590  N N7    . DG  I 7  97  ? 109.391 115.018 66.615  1.00 120.37 ? 94  DG  I N7    1 
ATOM   7591  C C5    . DG  I 7  97  ? 110.289 115.087 65.564  1.00 120.73 ? 94  DG  I C5    1 
ATOM   7592  C C6    . DG  I 7  97  ? 111.703 115.159 65.574  1.00 128.10 ? 94  DG  I C6    1 
ATOM   7593  O O6    . DG  I 7  97  ? 112.459 115.176 66.551  1.00 120.48 ? 94  DG  I O6    1 
ATOM   7594  N N1    . DG  I 7  97  ? 112.221 115.212 64.287  1.00 122.45 ? 94  DG  I N1    1 
ATOM   7595  C C2    . DG  I 7  97  ? 111.474 115.198 63.137  1.00 122.90 ? 94  DG  I C2    1 
ATOM   7596  N N2    . DG  I 7  97  ? 112.154 115.258 61.985  1.00 123.77 ? 94  DG  I N2    1 
ATOM   7597  N N3    . DG  I 7  97  ? 110.152 115.132 63.114  1.00 123.38 ? 94  DG  I N3    1 
ATOM   7598  C C4    . DG  I 7  97  ? 109.630 115.079 64.355  1.00 123.56 ? 94  DG  I C4    1 
ATOM   7599  P P     . DC  I 7  98  ? 104.516 112.524 61.476  1.00 153.22 ? 95  DC  I P     1 
ATOM   7600  O OP1   . DC  I 7  98  ? 103.789 112.582 60.183  1.00 146.45 ? 95  DC  I OP1   1 
ATOM   7601  O OP2   . DC  I 7  98  ? 103.954 111.767 62.624  1.00 145.43 ? 95  DC  I OP2   1 
ATOM   7602  O "O5'" . DC  I 7  98  ? 105.945 111.864 61.236  1.00 144.30 ? 95  DC  I "O5'" 1 
ATOM   7603  C "C5'" . DC  I 7  98  ? 106.881 112.463 60.322  1.00 142.86 ? 95  DC  I "C5'" 1 
ATOM   7604  C "C4'" . DC  I 7  98  ? 108.204 111.738 60.368  1.00 143.47 ? 95  DC  I "C4'" 1 
ATOM   7605  O "O4'" . DC  I 7  98  ? 109.005 112.246 61.450  1.00 136.27 ? 95  DC  I "O4'" 1 
ATOM   7606  C "C3'" . DC  I 7  98  ? 108.111 110.230 60.612  1.00 145.35 ? 95  DC  I "C3'" 1 
ATOM   7607  O "O3'" . DC  I 7  98  ? 108.221 109.537 59.357  1.00 148.98 ? 95  DC  I "O3'" 1 
ATOM   7608  C "C2'" . DC  I 7  98  ? 109.297 109.925 61.527  1.00 139.10 ? 95  DC  I "C2'" 1 
ATOM   7609  C "C1'" . DC  I 7  98  ? 109.974 111.264 61.752  1.00 135.21 ? 95  DC  I "C1'" 1 
ATOM   7610  N N1    . DC  I 7  98  ? 110.438 111.465 63.133  1.00 128.74 ? 95  DC  I N1    1 
ATOM   7611  C C2    . DC  I 7  98  ? 111.813 111.537 63.382  1.00 124.96 ? 95  DC  I C2    1 
ATOM   7612  O O2    . DC  I 7  98  ? 112.609 111.432 62.438  1.00 126.63 ? 95  DC  I O2    1 
ATOM   7613  N N3    . DC  I 7  98  ? 112.248 111.720 64.644  1.00 123.14 ? 95  DC  I N3    1 
ATOM   7614  C C4    . DC  I 7  98  ? 111.369 111.829 65.640  1.00 123.48 ? 95  DC  I C4    1 
ATOM   7615  N N4    . DC  I 7  98  ? 111.844 112.008 66.872  1.00 123.57 ? 95  DC  I N4    1 
ATOM   7616  C C5    . DC  I 7  98  ? 109.966 111.759 65.418  1.00 124.08 ? 95  DC  I C5    1 
ATOM   7617  C C6    . DC  I 7  98  ? 109.547 111.578 64.162  1.00 127.01 ? 95  DC  I C6    1 
ATOM   7618  P P     . DC  I 7  99  ? 108.104 107.930 59.245  1.00 154.29 ? 96  DC  I P     1 
ATOM   7619  O OP1   . DC  I 7  99  ? 107.644 107.579 57.878  1.00 155.64 ? 96  DC  I OP1   1 
ATOM   7620  O OP2   . DC  I 7  99  ? 107.384 107.408 60.436  1.00 151.97 ? 96  DC  I OP2   1 
ATOM   7621  O "O5'" . DC  I 7  99  ? 109.600 107.406 59.437  1.00 149.58 ? 96  DC  I "O5'" 1 
ATOM   7622  C "C5'" . DC  I 7  99  ? 110.680 107.923 58.634  1.00 149.33 ? 96  DC  I "C5'" 1 
ATOM   7623  C "C4'" . DC  I 7  99  ? 112.014 107.474 59.187  1.00 147.73 ? 96  DC  I "C4'" 1 
ATOM   7624  O "O4'" . DC  I 7  99  ? 112.279 108.141 60.438  1.00 140.06 ? 96  DC  I "O4'" 1 
ATOM   7625  C "C3'" . DC  I 7  99  ? 112.110 105.977 59.478  1.00 148.51 ? 96  DC  I "C3'" 1 
ATOM   7626  O "O3'" . DC  I 7  99  ? 112.938 105.360 58.479  1.00 149.23 ? 96  DC  I "O3'" 1 
ATOM   7627  C "C2'" . DC  I 7  99  ? 112.745 105.884 60.864  1.00 140.56 ? 96  DC  I "C2'" 1 
ATOM   7628  C "C1'" . DC  I 7  99  ? 113.102 107.311 61.234  1.00 137.31 ? 96  DC  I "C1'" 1 
ATOM   7629  N N1    . DC  I 7  99  ? 112.845 107.643 62.646  1.00 132.61 ? 96  DC  I N1    1 
ATOM   7630  C C2    . DC  I 7  99  ? 113.923 107.870 63.511  1.00 125.96 ? 96  DC  I C2    1 
ATOM   7631  O O2    . DC  I 7  99  ? 115.082 107.789 63.080  1.00 126.57 ? 96  DC  I O2    1 
ATOM   7632  N N3    . DC  I 7  99  ? 113.681 108.174 64.805  1.00 125.05 ? 96  DC  I N3    1 
ATOM   7633  C C4    . DC  I 7  99  ? 112.425 108.256 65.245  1.00 124.00 ? 96  DC  I C4    1 
ATOM   7634  N N4    . DC  I 7  99  ? 112.225 108.558 66.529  1.00 123.62 ? 96  DC  I N4    1 
ATOM   7635  C C5    . DC  I 7  99  ? 111.312 108.029 64.390  1.00 126.07 ? 96  DC  I C5    1 
ATOM   7636  C C6    . DC  I 7  99  ? 111.564 107.730 63.113  1.00 131.01 ? 96  DC  I C6    1 
ATOM   7637  P P     . DA  I 7  100 ? 113.069 103.757 58.345  1.00 154.78 ? 97  DA  I P     1 
ATOM   7638  O OP1   . DA  I 7  100 ? 113.368 103.435 56.927  1.00 153.60 ? 97  DA  I OP1   1 
ATOM   7639  O OP2   . DA  I 7  100 ? 111.901 103.125 59.011  1.00 150.10 ? 97  DA  I OP2   1 
ATOM   7640  O "O5'" . DA  I 7  100 ? 114.363 103.428 59.213  1.00 150.07 ? 97  DA  I "O5'" 1 
ATOM   7641  C "C5'" . DA  I 7  100 ? 115.585 104.169 59.026  1.00 145.73 ? 97  DA  I "C5'" 1 
ATOM   7642  C "C4'" . DA  I 7  100 ? 116.631 103.720 60.017  1.00 145.34 ? 97  DA  I "C4'" 1 
ATOM   7643  O "O4'" . DA  I 7  100 ? 116.380 104.340 61.303  1.00 140.91 ? 97  DA  I "O4'" 1 
ATOM   7644  C "C3'" . DA  I 7  100 ? 116.685 102.213 60.277  1.00 145.41 ? 97  DA  I "C3'" 1 
ATOM   7645  O "O3'" . DA  I 7  100 ? 118.063 101.825 60.387  1.00 142.56 ? 97  DA  I "O3'" 1 
ATOM   7646  C "C2'" . DA  I 7  100 ? 115.949 102.073 61.603  1.00 139.66 ? 97  DA  I "C2'" 1 
ATOM   7647  C "C1'" . DA  I 7  100 ? 116.358 103.348 62.316  1.00 135.08 ? 97  DA  I "C1'" 1 
ATOM   7648  N N9    . DA  I 7  100 ? 115.448 103.801 63.369  1.00 130.71 ? 97  DA  I N9    1 
ATOM   7649  C C8    . DA  I 7  100 ? 114.076 103.853 63.351  1.00 131.40 ? 97  DA  I C8    1 
ATOM   7650  N N7    . DA  I 7  100 ? 113.548 104.314 64.458  1.00 125.85 ? 97  DA  I N7    1 
ATOM   7651  C C5    . DA  I 7  100 ? 114.646 104.582 65.260  1.00 123.75 ? 97  DA  I C5    1 
ATOM   7652  C C6    . DA  I 7  100 ? 114.757 105.091 66.562  1.00 121.60 ? 97  DA  I C6    1 
ATOM   7653  N N6    . DA  I 7  100 ? 113.707 105.431 67.305  1.00 119.91 ? 97  DA  I N6    1 
ATOM   7654  N N1    . DA  I 7  100 ? 115.996 105.240 67.077  1.00 118.45 ? 97  DA  I N1    1 
ATOM   7655  C C2    . DA  I 7  100 ? 117.043 104.893 66.318  1.00 120.36 ? 97  DA  I C2    1 
ATOM   7656  N N3    . DA  I 7  100 ? 117.064 104.405 65.082  1.00 123.36 ? 97  DA  I N3    1 
ATOM   7657  C C4    . DA  I 7  100 ? 115.819 104.271 64.604  1.00 125.73 ? 97  DA  I C4    1 
ATOM   7658  P P     . DA  I 7  101 ? 118.534 100.286 60.473  1.00 149.07 ? 98  DA  I P     1 
ATOM   7659  O OP1   . DA  I 7  101 ? 119.542 100.049 59.410  1.00 148.28 ? 98  DA  I OP1   1 
ATOM   7660  O OP2   . DA  I 7  101 ? 117.330 99.420  60.556  1.00 145.37 ? 98  DA  I OP2   1 
ATOM   7661  O "O5'" . DA  I 7  101 ? 119.275 100.231 61.880  1.00 139.05 ? 98  DA  I "O5'" 1 
ATOM   7662  C "C5'" . DA  I 7  101 ? 120.112 101.325 62.300  1.00 140.27 ? 98  DA  I "C5'" 1 
ATOM   7663  C "C4'" . DA  I 7  101 ? 120.757 101.020 63.626  1.00 142.79 ? 98  DA  I "C4'" 1 
ATOM   7664  O "O4'" . DA  I 7  101 ? 119.918 101.526 64.688  1.00 133.86 ? 98  DA  I "O4'" 1 
ATOM   7665  C "C3'" . DA  I 7  101 ? 120.974 99.538  63.920  1.00 142.24 ? 98  DA  I "C3'" 1 
ATOM   7666  O "O3'" . DA  I 7  101 ? 122.206 99.390  64.640  1.00 141.43 ? 98  DA  I "O3'" 1 
ATOM   7667  C "C2'" . DA  I 7  101 ? 119.766 99.173  64.773  1.00 134.80 ? 98  DA  I "C2'" 1 
ATOM   7668  C "C1'" . DA  I 7  101 ? 119.457 100.465 65.509  1.00 130.40 ? 98  DA  I "C1'" 1 
ATOM   7669  N N9    . DA  I 7  101 ? 118.035 100.695 65.765  1.00 125.57 ? 98  DA  I N9    1 
ATOM   7670  C C8    . DA  I 7  101 ? 116.962 100.442 64.948  1.00 126.80 ? 98  DA  I C8    1 
ATOM   7671  N N7    . DA  I 7  101 ? 115.807 100.768 65.476  1.00 121.67 ? 98  DA  I N7    1 
ATOM   7672  C C5    . DA  I 7  101 ? 116.144 101.266 66.722  1.00 119.88 ? 98  DA  I C5    1 
ATOM   7673  C C6    . DA  I 7  101 ? 115.374 101.780 67.772  1.00 118.51 ? 98  DA  I C6    1 
ATOM   7674  N N6    . DA  I 7  101 ? 114.047 101.878 67.737  1.00 119.68 ? 98  DA  I N6    1 
ATOM   7675  N N1    . DA  I 7  101 ? 116.020 102.193 68.881  1.00 118.21 ? 98  DA  I N1    1 
ATOM   7676  C C2    . DA  I 7  101 ? 117.352 102.093 68.918  1.00 119.42 ? 98  DA  I C2    1 
ATOM   7677  N N3    . DA  I 7  101 ? 118.184 101.630 67.996  1.00 120.04 ? 98  DA  I N3    1 
ATOM   7678  C C4    . DA  I 7  101 ? 117.511 101.228 66.911  1.00 120.59 ? 98  DA  I C4    1 
ATOM   7679  P P     . DG  I 7  102 ? 122.851 97.948  64.955  1.00 153.12 ? 99  DG  I P     1 
ATOM   7680  O OP1   . DG  I 7  102 ? 124.328 98.077  64.891  1.00 147.41 ? 99  DG  I OP1   1 
ATOM   7681  O OP2   . DG  I 7  102 ? 122.165 96.926  64.122  1.00 142.92 ? 99  DG  I OP2   1 
ATOM   7682  O "O5'" . DG  I 7  102 ? 122.437 97.707  66.473  1.00 139.38 ? 99  DG  I "O5'" 1 
ATOM   7683  C "C5'" . DG  I 7  102 ? 122.663 98.720  67.472  1.00 137.34 ? 99  DG  I "C5'" 1 
ATOM   7684  C "C4'" . DG  I 7  102 ? 121.997 98.320  68.763  1.00 132.66 ? 99  DG  I "C4'" 1 
ATOM   7685  O "O4'" . DG  I 7  102 ? 120.585 98.656  68.698  1.00 127.41 ? 99  DG  I "O4'" 1 
ATOM   7686  C "C3'" . DG  I 7  102 ? 122.063 96.818  69.072  1.00 132.50 ? 99  DG  I "C3'" 1 
ATOM   7687  O "O3'" . DG  I 7  102 ? 122.301 96.582  70.466  1.00 128.04 ? 99  DG  I "O3'" 1 
ATOM   7688  C "C2'" . DG  I 7  102 ? 120.669 96.350  68.717  1.00 127.84 ? 99  DG  I "C2'" 1 
ATOM   7689  C "C1'" . DG  I 7  102 ? 119.845 97.543  69.157  1.00 122.52 ? 99  DG  I "C1'" 1 
ATOM   7690  N N9    . DG  I 7  102 ? 118.489 97.588  68.615  1.00 119.29 ? 99  DG  I N9    1 
ATOM   7691  C C8    . DG  I 7  102 ? 118.049 97.101  67.409  1.00 120.40 ? 99  DG  I C8    1 
ATOM   7692  N N7    . DG  I 7  102 ? 116.774 97.292  67.213  1.00 119.24 ? 99  DG  I N7    1 
ATOM   7693  C C5    . DG  I 7  102 ? 116.344 97.940  68.358  1.00 118.27 ? 99  DG  I C5    1 
ATOM   7694  C C6    . DG  I 7  102 ? 115.055 98.403  68.719  1.00 118.35 ? 99  DG  I C6    1 
ATOM   7695  O O6    . DG  I 7  102 ? 114.003 98.324  68.073  1.00 118.71 ? 99  DG  I O6    1 
ATOM   7696  N N1    . DG  I 7  102 ? 115.061 99.007  69.970  1.00 117.65 ? 99  DG  I N1    1 
ATOM   7697  C C2    . DG  I 7  102 ? 116.167 99.149  70.768  1.00 117.15 ? 99  DG  I C2    1 
ATOM   7698  N N2    . DG  I 7  102 ? 115.973 99.763  71.944  1.00 117.78 ? 99  DG  I N2    1 
ATOM   7699  N N3    . DG  I 7  102 ? 117.376 98.722  70.441  1.00 117.05 ? 99  DG  I N3    1 
ATOM   7700  C C4    . DG  I 7  102 ? 117.390 98.132  69.231  1.00 120.49 ? 99  DG  I C4    1 
ATOM   7701  P P     . DG  I 7  103 ? 123.775 96.624  71.111  1.00 132.30 ? 100 DG  I P     1 
ATOM   7702  O OP1   . DG  I 7  103 ? 124.582 97.632  70.383  1.00 132.75 ? 100 DG  I OP1   1 
ATOM   7703  O OP2   . DG  I 7  103 ? 124.262 95.226  71.233  1.00 133.23 ? 100 DG  I OP2   1 
ATOM   7704  O "O5'" . DG  I 7  103 ? 123.475 97.177  72.574  1.00 128.28 ? 100 DG  I "O5'" 1 
ATOM   7705  C "C5'" . DG  I 7  103 ? 122.732 98.401  72.746  1.00 127.73 ? 100 DG  I "C5'" 1 
ATOM   7706  C "C4'" . DG  I 7  103 ? 122.043 98.441  74.088  1.00 126.95 ? 100 DG  I "C4'" 1 
ATOM   7707  O "O4'" . DG  I 7  103 ? 120.615 98.272  73.906  1.00 122.52 ? 100 DG  I "O4'" 1 
ATOM   7708  C "C3'" . DG  I 7  103 ? 122.443 97.375  75.101  1.00 127.89 ? 100 DG  I "C3'" 1 
ATOM   7709  O "O3'" . DG  I 7  103 ? 122.259 97.937  76.413  1.00 124.19 ? 100 DG  I "O3'" 1 
ATOM   7710  C "C2'" . DG  I 7  103 ? 121.462 96.253  74.792  1.00 122.12 ? 100 DG  I "C2'" 1 
ATOM   7711  C "C1'" . DG  I 7  103 ? 120.199 97.000  74.392  1.00 119.83 ? 100 DG  I "C1'" 1 
ATOM   7712  N N9    . DG  I 7  103 ? 119.400 96.355  73.346  1.00 120.03 ? 100 DG  I N9    1 
ATOM   7713  C C8    . DG  I 7  103 ? 119.837 95.581  72.296  1.00 120.23 ? 100 DG  I C8    1 
ATOM   7714  N N7    . DG  I 7  103 ? 118.868 95.153  71.534  1.00 117.43 ? 100 DG  I N7    1 
ATOM   7715  C C5    . DG  I 7  103 ? 117.725 95.673  72.109  1.00 116.97 ? 100 DG  I C5    1 
ATOM   7716  C C6    . DG  I 7  103 ? 116.369 95.548  71.722  1.00 117.19 ? 100 DG  I C6    1 
ATOM   7717  O O6    . DG  I 7  103 ? 115.897 94.936  70.758  1.00 118.01 ? 100 DG  I O6    1 
ATOM   7718  N N1    . DG  I 7  103 ? 115.526 96.235  72.585  1.00 116.43 ? 100 DG  I N1    1 
ATOM   7719  C C2    . DG  I 7  103 ? 115.936 96.950  73.682  1.00 116.52 ? 100 DG  I C2    1 
ATOM   7720  N N2    . DG  I 7  103 ? 114.971 97.547  74.398  1.00 118.95 ? 100 DG  I N2    1 
ATOM   7721  N N3    . DG  I 7  103 ? 117.199 97.074  74.051  1.00 116.94 ? 100 DG  I N3    1 
ATOM   7722  C C4    . DG  I 7  103 ? 118.034 96.415  73.226  1.00 117.44 ? 100 DG  I C4    1 
ATOM   7723  P P     . DG  I 7  104 ? 122.523 97.126  77.782  1.00 128.33 ? 101 DG  I P     1 
ATOM   7724  O OP1   . DG  I 7  104 ? 123.274 98.009  78.709  1.00 123.36 ? 101 DG  I OP1   1 
ATOM   7725  O OP2   . DG  I 7  104 ? 123.062 95.783  77.446  1.00 125.61 ? 101 DG  I OP2   1 
ATOM   7726  O "O5'" . DG  I 7  104 ? 121.049 96.941  78.354  1.00 117.62 ? 101 DG  I "O5'" 1 
ATOM   7727  C "C5'" . DG  I 7  104 ? 120.148 98.066  78.382  1.00 116.74 ? 101 DG  I "C5'" 1 
ATOM   7728  C "C4'" . DG  I 7  104 ? 118.755 97.646  78.784  1.00 112.40 ? 101 DG  I "C4'" 1 
ATOM   7729  O "O4'" . DG  I 7  104 ? 118.107 96.970  77.679  1.00 112.84 ? 101 DG  I "O4'" 1 
ATOM   7730  C "C3'" . DG  I 7  104 ? 118.651 96.699  79.972  1.00 106.44 ? 101 DG  I "C3'" 1 
ATOM   7731  O "O3'" . DG  I 7  104 ? 117.475 97.066  80.704  1.00 102.98 ? 101 DG  I "O3'" 1 
ATOM   7732  C "C2'" . DG  I 7  104 ? 118.502 95.343  79.305  1.00 109.96 ? 101 DG  I "C2'" 1 
ATOM   7733  C "C1'" . DG  I 7  104 ? 117.663 95.684  78.085  1.00 110.68 ? 101 DG  I "C1'" 1 
ATOM   7734  N N9    . DG  I 7  104 ? 117.824 94.789  76.938  1.00 113.59 ? 101 DG  I N9    1 
ATOM   7735  C C8    . DG  I 7  104 ? 118.982 94.204  76.492  1.00 115.18 ? 101 DG  I C8    1 
ATOM   7736  N N7    . DG  I 7  104 ? 118.810 93.458  75.437  1.00 113.29 ? 101 DG  I N7    1 
ATOM   7737  C C5    . DG  I 7  104 ? 117.458 93.553  75.168  1.00 112.57 ? 101 DG  I C5    1 
ATOM   7738  C C6    . DG  I 7  104 ? 116.690 92.957  74.140  1.00 115.49 ? 101 DG  I C6    1 
ATOM   7739  O O6    . DG  I 7  104 ? 117.074 92.205  73.237  1.00 117.92 ? 101 DG  I O6    1 
ATOM   7740  N N1    . DG  I 7  104 ? 115.351 93.315  74.227  1.00 116.62 ? 101 DG  I N1    1 
ATOM   7741  C C2    . DG  I 7  104 ? 114.819 94.142  75.184  1.00 116.78 ? 101 DG  I C2    1 
ATOM   7742  N N2    . DG  I 7  104 ? 113.499 94.371  75.104  1.00 120.94 ? 101 DG  I N2    1 
ATOM   7743  N N3    . DG  I 7  104 ? 115.528 94.704  76.151  1.00 114.47 ? 101 DG  I N3    1 
ATOM   7744  C C4    . DG  I 7  104 ? 116.832 94.370  76.082  1.00 115.52 ? 101 DG  I C4    1 
ATOM   7745  P P     . DG  I 7  105 ? 117.164 96.549  82.194  1.00 102.39 ? 102 DG  I P     1 
ATOM   7746  O OP1   . DG  I 7  105 ? 117.184 97.719  83.108  1.00 96.41  ? 102 DG  I OP1   1 
ATOM   7747  O OP2   . DG  I 7  105 ? 118.027 95.375  82.481  1.00 109.12 ? 102 DG  I OP2   1 
ATOM   7748  O "O5'" . DG  I 7  105 ? 115.660 96.039  82.056  1.00 106.69 ? 102 DG  I "O5'" 1 
ATOM   7749  C "C5'" . DG  I 7  105 ? 114.670 96.858  81.398  1.00 108.96 ? 102 DG  I "C5'" 1 
ATOM   7750  C "C4'" . DG  I 7  105 ? 113.425 96.062  81.088  1.00 115.15 ? 102 DG  I "C4'" 1 
ATOM   7751  O "O4'" . DG  I 7  105 ? 113.644 95.255  79.903  1.00 116.84 ? 102 DG  I "O4'" 1 
ATOM   7752  C "C3'" . DG  I 7  105 ? 112.966 95.097  82.175  1.00 115.08 ? 102 DG  I "C3'" 1 
ATOM   7753  O "O3'" . DG  I 7  105 ? 111.531 95.090  82.193  1.00 120.16 ? 102 DG  I "O3'" 1 
ATOM   7754  C "C2'" . DG  I 7  105 ? 113.529 93.769  81.700  1.00 116.30 ? 102 DG  I "C2'" 1 
ATOM   7755  C "C1'" . DG  I 7  105 ? 113.401 93.886  80.193  1.00 116.87 ? 102 DG  I "C1'" 1 
ATOM   7756  N N9    . DG  I 7  105 ? 114.368 93.094  79.435  1.00 115.82 ? 102 DG  I N9    1 
ATOM   7757  C C8    . DG  I 7  105 ? 115.712 92.971  79.682  1.00 114.05 ? 102 DG  I C8    1 
ATOM   7758  N N7    . DG  I 7  105 ? 116.323 92.194  78.831  1.00 114.37 ? 102 DG  I N7    1 
ATOM   7759  C C5    . DG  I 7  105 ? 115.324 91.778  77.972  1.00 114.50 ? 102 DG  I C5    1 
ATOM   7760  C C6    . DG  I 7  105 ? 115.388 90.921  76.848  1.00 119.43 ? 102 DG  I C6    1 
ATOM   7761  O O6    . DG  I 7  105 ? 116.378 90.346  76.379  1.00 120.00 ? 102 DG  I O6    1 
ATOM   7762  N N1    . DG  I 7  105 ? 114.142 90.761  76.255  1.00 119.15 ? 102 DG  I N1    1 
ATOM   7763  C C2    . DG  I 7  105 ? 112.982 91.350  76.692  1.00 121.51 ? 102 DG  I C2    1 
ATOM   7764  N N2    . DG  I 7  105 ? 111.876 91.074  75.986  1.00 124.36 ? 102 DG  I N2    1 
ATOM   7765  N N3    . DG  I 7  105 ? 112.910 92.155  77.740  1.00 118.54 ? 102 DG  I N3    1 
ATOM   7766  C C4    . DG  I 7  105 ? 114.110 92.323  78.329  1.00 116.46 ? 102 DG  I C4    1 
ATOM   7767  P P     . DA  I 7  106 ? 110.682 94.369  83.357  1.00 133.83 ? 103 DA  I P     1 
ATOM   7768  O OP1   . DA  I 7  106 ? 109.645 95.320  83.828  1.00 131.86 ? 103 DA  I OP1   1 
ATOM   7769  O OP2   . DA  I 7  106 ? 111.625 93.763  84.333  1.00 128.08 ? 103 DA  I OP2   1 
ATOM   7770  O "O5'" . DA  I 7  106 ? 109.955 93.186  82.581  1.00 129.43 ? 103 DA  I "O5'" 1 
ATOM   7771  C "C5'" . DA  I 7  106 ? 109.236 93.452  81.362  1.00 132.07 ? 103 DA  I "C5'" 1 
ATOM   7772  C "C4'" . DA  I 7  106 ? 108.713 92.171  80.761  1.00 136.07 ? 103 DA  I "C4'" 1 
ATOM   7773  O "O4'" . DA  I 7  106 ? 109.767 91.544  79.996  1.00 127.45 ? 103 DA  I "O4'" 1 
ATOM   7774  C "C3'" . DA  I 7  106 ? 108.221 91.127  81.763  1.00 136.80 ? 103 DA  I "C3'" 1 
ATOM   7775  O "O3'" . DA  I 7  106 ? 107.007 90.547  81.260  1.00 143.13 ? 103 DA  I "O3'" 1 
ATOM   7776  C "C2'" . DA  I 7  106 ? 109.360 90.117  81.807  1.00 132.37 ? 103 DA  I "C2'" 1 
ATOM   7777  C "C1'" . DA  I 7  106 ? 109.940 90.201  80.407  1.00 128.58 ? 103 DA  I "C1'" 1 
ATOM   7778  N N9    . DA  I 7  106 ? 111.368 89.896  80.323  1.00 122.77 ? 103 DA  I N9    1 
ATOM   7779  C C8    . DA  I 7  106 ? 112.376 90.307  81.156  1.00 120.63 ? 103 DA  I C8    1 
ATOM   7780  N N7    . DA  I 7  106 ? 113.561 89.866  80.815  1.00 118.11 ? 103 DA  I N7    1 
ATOM   7781  C C5    . DA  I 7  106 ? 113.316 89.113  79.679  1.00 120.17 ? 103 DA  I C5    1 
ATOM   7782  C C6    . DA  I 7  106 ? 114.158 88.377  78.835  1.00 120.30 ? 103 DA  I C6    1 
ATOM   7783  N N6    . DA  I 7  106 ? 115.475 88.272  79.007  1.00 120.02 ? 103 DA  I N6    1 
ATOM   7784  N N1    . DA  I 7  106 ? 113.596 87.741  77.790  1.00 121.88 ? 103 DA  I N1    1 
ATOM   7785  C C2    . DA  I 7  106 ? 112.275 87.842  77.614  1.00 124.01 ? 103 DA  I C2    1 
ATOM   7786  N N3    . DA  I 7  106 ? 111.381 88.503  78.338  1.00 123.04 ? 103 DA  I N3    1 
ATOM   7787  C C4    . DA  I 7  106 ? 111.971 89.123  79.368  1.00 121.74 ? 103 DA  I C4    1 
ATOM   7788  P P     . DT  I 7  107 ? 106.114 89.518  82.124  1.00 154.24 ? 104 DT  I P     1 
ATOM   7789  O OP1   . DT  I 7  107 ? 104.683 89.837  81.896  1.00 163.52 ? 104 DT  I OP1   1 
ATOM   7790  O OP2   . DT  I 7  107 ? 106.647 89.472  83.511  1.00 149.27 ? 104 DT  I OP2   1 
ATOM   7791  O "O5'" . DT  I 7  107 ? 106.434 88.122  81.430  1.00 141.93 ? 104 DT  I "O5'" 1 
ATOM   7792  C "C5'" . DT  I 7  107 ? 106.299 87.976  80.004  1.00 144.20 ? 104 DT  I "C5'" 1 
ATOM   7793  C "C4'" . DT  I 7  107 ? 106.818 86.633  79.555  1.00 143.69 ? 104 DT  I "C4'" 1 
ATOM   7794  O "O4'" . DT  I 7  107 ? 108.259 86.676  79.471  1.00 134.95 ? 104 DT  I "O4'" 1 
ATOM   7795  C "C3'" . DT  I 7  107 ? 106.466 85.456  80.466  1.00 146.36 ? 104 DT  I "C3'" 1 
ATOM   7796  O "O3'" . DT  I 7  107 ? 105.691 84.518  79.703  1.00 148.41 ? 104 DT  I "O3'" 1 
ATOM   7797  C "C2'" . DT  I 7  107 ? 107.818 84.876  80.881  1.00 137.94 ? 104 DT  I "C2'" 1 
ATOM   7798  C "C1'" . DT  I 7  107 ? 108.774 85.413  79.833  1.00 134.41 ? 104 DT  I "C1'" 1 
ATOM   7799  N N1    . DT  I 7  107 ? 110.165 85.613  80.288  1.00 129.47 ? 104 DT  I N1    1 
ATOM   7800  C C2    . DT  I 7  107 ? 111.180 85.012  79.576  1.00 126.90 ? 104 DT  I C2    1 
ATOM   7801  O O2    . DT  I 7  107 ? 110.984 84.323  78.589  1.00 129.85 ? 104 DT  I O2    1 
ATOM   7802  N N3    . DT  I 7  107 ? 112.441 85.247  80.063  1.00 127.31 ? 104 DT  I N3    1 
ATOM   7803  C C4    . DT  I 7  107 ? 112.782 86.002  81.163  1.00 123.30 ? 104 DT  I C4    1 
ATOM   7804  O O4    . DT  I 7  107 ? 113.963 86.131  81.485  1.00 123.15 ? 104 DT  I O4    1 
ATOM   7805  C C5    . DT  I 7  107 ? 111.672 86.601  81.861  1.00 125.24 ? 104 DT  I C5    1 
ATOM   7806  C C7    . DT  I 7  107 ? 111.949 87.431  83.070  1.00 127.40 ? 104 DT  I C7    1 
ATOM   7807  C C6    . DT  I 7  107 ? 110.438 86.380  81.397  1.00 126.46 ? 104 DT  I C6    1 
ATOM   7808  P P     . DT  I 7  108 ? 104.945 83.256  80.376  1.00 155.64 ? 105 DT  I P     1 
ATOM   7809  O OP1   . DT  I 7  108 ? 103.731 82.952  79.578  1.00 152.94 ? 105 DT  I OP1   1 
ATOM   7810  O OP2   . DT  I 7  108 ? 104.822 83.496  81.837  1.00 149.77 ? 105 DT  I OP2   1 
ATOM   7811  O "O5'" . DT  I 7  108 ? 105.996 82.083  80.156  1.00 149.97 ? 105 DT  I "O5'" 1 
ATOM   7812  C "C5'" . DT  I 7  108 ? 106.514 81.811  78.840  1.00 149.06 ? 105 DT  I "C5'" 1 
ATOM   7813  C "C4'" . DT  I 7  108 ? 107.624 80.792  78.914  1.00 148.00 ? 105 DT  I "C4'" 1 
ATOM   7814  O "O4'" . DT  I 7  108 ? 108.866 81.449  79.229  1.00 141.64 ? 105 DT  I "O4'" 1 
ATOM   7815  C "C3'" . DT  I 7  108 ? 107.440 79.715  79.980  1.00 150.92 ? 105 DT  I "C3'" 1 
ATOM   7816  O "O3'" . DT  I 7  108 ? 106.979 78.512  79.343  1.00 154.40 ? 105 DT  I "O3'" 1 
ATOM   7817  C "C2'" . DT  I 7  108 ? 108.830 79.532  80.587  1.00 143.57 ? 105 DT  I "C2'" 1 
ATOM   7818  C "C1'" . DT  I 7  108 ? 109.724 80.512  79.845  1.00 139.91 ? 105 DT  I "C1'" 1 
ATOM   7819  N N1    . DT  I 7  108 ? 110.656 81.247  80.720  1.00 133.79 ? 105 DT  I N1    1 
ATOM   7820  C C2    . DT  I 7  108 ? 112.010 81.099  80.514  1.00 129.64 ? 105 DT  I C2    1 
ATOM   7821  O O2    . DT  I 7  108 ? 112.479 80.388  79.638  1.00 130.29 ? 105 DT  I O2    1 
ATOM   7822  N N3    . DT  I 7  108 ? 112.800 81.819  81.374  1.00 127.02 ? 105 DT  I N3    1 
ATOM   7823  C C4    . DT  I 7  108 ? 112.381 82.648  82.395  1.00 126.30 ? 105 DT  I C4    1 
ATOM   7824  O O4    . DT  I 7  108 ? 113.201 83.239  83.093  1.00 126.09 ? 105 DT  I O4    1 
ATOM   7825  C C5    . DT  I 7  108 ? 110.952 82.753  82.553  1.00 128.02 ? 105 DT  I C5    1 
ATOM   7826  C C7    . DT  I 7  108 ? 110.412 83.621  83.640  1.00 128.40 ? 105 DT  I C7    1 
ATOM   7827  C C6    . DT  I 7  108 ? 110.173 82.058  81.721  1.00 131.05 ? 105 DT  I C6    1 
ATOM   7828  P P     . DA  I 7  109 ? 106.546 77.203  80.182  1.00 157.92 ? 106 DA  I P     1 
ATOM   7829  O OP1   . DA  I 7  109 ? 105.593 76.419  79.357  1.00 161.49 ? 106 DA  I OP1   1 
ATOM   7830  O OP2   . DA  I 7  109 ? 106.157 77.621  81.554  1.00 156.24 ? 106 DA  I OP2   1 
ATOM   7831  O "O5'" . DA  I 7  109 ? 107.904 76.376  80.295  1.00 153.40 ? 106 DA  I "O5'" 1 
ATOM   7832  C "C5'" . DA  I 7  109 ? 108.627 75.983  79.112  1.00 154.04 ? 106 DA  I "C5'" 1 
ATOM   7833  C "C4'" . DA  I 7  109 ? 110.017 75.514  79.469  1.00 152.99 ? 106 DA  I "C4'" 1 
ATOM   7834  O "O4'" . DA  I 7  109 ? 110.754 76.602  80.070  1.00 145.41 ? 106 DA  I "O4'" 1 
ATOM   7835  C "C3'" . DA  I 7  109 ? 110.079 74.345  80.457  1.00 154.53 ? 106 DA  I "C3'" 1 
ATOM   7836  O "O3'" . DA  I 7  109 ? 110.819 73.267  79.858  1.00 155.85 ? 106 DA  I "O3'" 1 
ATOM   7837  C "C2'" . DA  I 7  109 ? 110.804 74.917  81.673  1.00 145.69 ? 106 DA  I "C2'" 1 
ATOM   7838  C "C1'" . DA  I 7  109 ? 111.569 76.099  81.109  1.00 142.23 ? 106 DA  I "C1'" 1 
ATOM   7839  N N9    . DA  I 7  109 ? 111.796 77.180  82.070  1.00 134.98 ? 106 DA  I N9    1 
ATOM   7840  C C8    . DA  I 7  109 ? 110.859 77.883  82.782  1.00 134.73 ? 106 DA  I C8    1 
ATOM   7841  N N7    . DA  I 7  109 ? 111.366 78.799  83.569  1.00 128.82 ? 106 DA  I N7    1 
ATOM   7842  C C5    . DA  I 7  109 ? 112.732 78.690  83.364  1.00 129.20 ? 106 DA  I C5    1 
ATOM   7843  C C6    . DA  I 7  109 ? 113.822 79.386  83.905  1.00 128.12 ? 106 DA  I C6    1 
ATOM   7844  N N6    . DA  I 7  109 ? 113.696 80.362  84.800  1.00 124.99 ? 106 DA  I N6    1 
ATOM   7845  N N1    . DA  I 7  109 ? 115.059 79.037  83.493  1.00 123.61 ? 106 DA  I N1    1 
ATOM   7846  C C2    . DA  I 7  109 ? 115.173 78.053  82.595  1.00 125.82 ? 106 DA  I C2    1 
ATOM   7847  N N3    . DA  I 7  109 ? 114.224 77.327  82.011  1.00 129.29 ? 106 DA  I N3    1 
ATOM   7848  C C4    . DA  I 7  109 ? 113.011 77.698  82.444  1.00 131.00 ? 106 DA  I C4    1 
ATOM   7849  P P     . DC  I 7  110 ? 110.906 71.804  80.532  1.00 160.91 ? 107 DC  I P     1 
ATOM   7850  O OP1   . DC  I 7  110 ? 111.040 70.790  79.457  1.00 162.41 ? 107 DC  I OP1   1 
ATOM   7851  O OP2   . DC  I 7  110 ? 109.838 71.677  81.558  1.00 158.50 ? 107 DC  I OP2   1 
ATOM   7852  O "O5'" . DC  I 7  110 ? 112.260 71.845  81.374  1.00 154.57 ? 107 DC  I "O5'" 1 
ATOM   7853  C "C5'" . DC  I 7  110 ? 113.498 72.235  80.750  1.00 153.10 ? 107 DC  I "C5'" 1 
ATOM   7854  C "C4'" . DC  I 7  110 ? 114.559 72.505  81.791  1.00 147.98 ? 107 DC  I "C4'" 1 
ATOM   7855  O "O4'" . DC  I 7  110 ? 114.283 73.750  82.465  1.00 140.92 ? 107 DC  I "O4'" 1 
ATOM   7856  C "C3'" . DC  I 7  110 ? 114.671 71.444  82.890  1.00 147.22 ? 107 DC  I "C3'" 1 
ATOM   7857  O "O3'" . DC  I 7  110 ? 115.940 70.782  82.765  1.00 148.26 ? 107 DC  I "O3'" 1 
ATOM   7858  C "C2'" . DC  I 7  110 ? 114.580 72.233  84.196  1.00 139.94 ? 107 DC  I "C2'" 1 
ATOM   7859  C "C1'" . DC  I 7  110 ? 114.817 73.668  83.768  1.00 137.19 ? 107 DC  I "C1'" 1 
ATOM   7860  N N1    . DC  I 7  110 ? 114.150 74.689  84.596  1.00 132.31 ? 107 DC  I N1    1 
ATOM   7861  C C2    . DC  I 7  110 ? 114.927 75.657  85.243  1.00 129.07 ? 107 DC  I C2    1 
ATOM   7862  O O2    . DC  I 7  110 ? 116.157 75.637  85.109  1.00 128.01 ? 107 DC  I O2    1 
ATOM   7863  N N3    . DC  I 7  110 ? 114.323 76.596  86.000  1.00 126.74 ? 107 DC  I N3    1 
ATOM   7864  C C4    . DC  I 7  110 ? 112.997 76.597  86.128  1.00 126.52 ? 107 DC  I C4    1 
ATOM   7865  N N4    . DC  I 7  110 ? 112.442 77.543  86.889  1.00 127.81 ? 107 DC  I N4    1 
ATOM   7866  C C5    . DC  I 7  110 ? 112.181 75.626  85.485  1.00 128.65 ? 107 DC  I C5    1 
ATOM   7867  C C6    . DC  I 7  110 ? 112.792 74.701  84.736  1.00 131.51 ? 107 DC  I C6    1 
ATOM   7868  P P     . DT  I 7  111 ? 116.304 69.447  83.596  1.00 157.41 ? 108 DT  I P     1 
ATOM   7869  O OP1   . DT  I 7  111 ? 117.181 68.600  82.751  1.00 154.99 ? 108 DT  I OP1   1 
ATOM   7870  O OP2   . DT  I 7  111 ? 115.050 68.877  84.154  1.00 153.11 ? 108 DT  I OP2   1 
ATOM   7871  O "O5'" . DT  I 7  111 ? 117.169 70.011  84.810  1.00 149.68 ? 108 DT  I "O5'" 1 
ATOM   7872  C "C5'" . DT  I 7  111 ? 118.379 70.753  84.565  1.00 148.74 ? 108 DT  I "C5'" 1 
ATOM   7873  C "C4'" . DT  I 7  111 ? 118.850 71.438  85.826  1.00 146.24 ? 108 DT  I "C4'" 1 
ATOM   7874  O "O4'" . DT  I 7  111 ? 117.957 72.521  86.147  1.00 139.63 ? 108 DT  I "O4'" 1 
ATOM   7875  C "C3'" . DT  I 7  111 ? 118.895 70.561  87.078  1.00 145.18 ? 108 DT  I "C3'" 1 
ATOM   7876  O "O3'" . DT  I 7  111 ? 120.247 70.121  87.298  1.00 144.67 ? 108 DT  I "O3'" 1 
ATOM   7877  C "C2'" . DT  I 7  111 ? 118.422 71.480  88.203  1.00 137.43 ? 108 DT  I "C2'" 1 
ATOM   7878  C "C1'" . DT  I 7  111 ? 118.057 72.788  87.529  1.00 135.75 ? 108 DT  I "C1'" 1 
ATOM   7879  N N1    . DT  I 7  111 ? 116.771 73.342  87.985  1.00 131.35 ? 108 DT  I N1    1 
ATOM   7880  C C2    . DT  I 7  111 ? 116.780 74.504  88.723  1.00 128.17 ? 108 DT  I C2    1 
ATOM   7881  O O2    . DT  I 7  111 ? 117.805 75.099  89.015  1.00 127.50 ? 108 DT  I O2    1 
ATOM   7882  N N3    . DT  I 7  111 ? 115.538 74.946  89.104  1.00 125.65 ? 108 DT  I N3    1 
ATOM   7883  C C4    . DT  I 7  111 ? 114.322 74.353  88.828  1.00 125.22 ? 108 DT  I C4    1 
ATOM   7884  O O4    . DT  I 7  111 ? 113.277 74.857  89.231  1.00 125.47 ? 108 DT  I O4    1 
ATOM   7885  C C5    . DT  I 7  111 ? 114.392 73.140  88.054  1.00 127.26 ? 108 DT  I C5    1 
ATOM   7886  C C7    . DT  I 7  111 ? 113.125 72.428  87.714  1.00 128.11 ? 108 DT  I C7    1 
ATOM   7887  C C6    . DT  I 7  111 ? 115.595 72.702  87.678  1.00 130.69 ? 108 DT  I C6    1 
ATOM   7888  P P     . DC  I 7  112 ? 120.652 69.158  88.530  1.00 149.57 ? 109 DC  I P     1 
ATOM   7889  O OP1   . DC  I 7  112 ? 121.854 68.375  88.148  1.00 148.60 ? 109 DC  I OP1   1 
ATOM   7890  O OP2   . DC  I 7  112 ? 119.434 68.469  89.029  1.00 144.37 ? 109 DC  I OP2   1 
ATOM   7891  O "O5'" . DC  I 7  112 ? 121.044 70.165  89.705  1.00 138.43 ? 109 DC  I "O5'" 1 
ATOM   7892  C "C5'" . DC  I 7  112 ? 122.105 71.121  89.515  1.00 136.83 ? 109 DC  I "C5'" 1 
ATOM   7893  C "C4'" . DC  I 7  112 ? 122.013 72.259  90.510  1.00 136.87 ? 109 DC  I "C4'" 1 
ATOM   7894  O "O4'" . DC  I 7  112 ? 120.663 72.773  90.575  1.00 134.66 ? 109 DC  I "O4'" 1 
ATOM   7895  C "C3'" . DC  I 7  112 ? 122.409 71.905  91.944  1.00 135.24 ? 109 DC  I "C3'" 1 
ATOM   7896  O "O3'" . DC  I 7  112 ? 123.369 72.870  92.401  1.00 135.41 ? 109 DC  I "O3'" 1 
ATOM   7897  C "C2'" . DC  I 7  112 ? 121.107 72.005  92.731  1.00 129.04 ? 109 DC  I "C2'" 1 
ATOM   7898  C "C1'" . DC  I 7  112 ? 120.291 72.996  91.923  1.00 130.22 ? 109 DC  I "C1'" 1 
ATOM   7899  N N1    . DC  I 7  112 ? 118.825 72.829  91.993  1.00 128.31 ? 109 DC  I N1    1 
ATOM   7900  C C2    . DC  I 7  112 ? 118.027 73.855  92.523  1.00 126.82 ? 109 DC  I C2    1 
ATOM   7901  O O2    . DC  I 7  112 ? 118.559 74.896  92.935  1.00 125.99 ? 109 DC  I O2    1 
ATOM   7902  N N3    . DC  I 7  112 ? 116.686 73.694  92.576  1.00 123.81 ? 109 DC  I N3    1 
ATOM   7903  C C4    . DC  I 7  112 ? 116.133 72.567  92.128  1.00 124.73 ? 109 DC  I C4    1 
ATOM   7904  N N4    . DC  I 7  112 ? 114.806 72.449  92.201  1.00 124.08 ? 109 DC  I N4    1 
ATOM   7905  C C5    . DC  I 7  112 ? 116.915 71.510  91.589  1.00 127.95 ? 109 DC  I C5    1 
ATOM   7906  C C6    . DC  I 7  112 ? 118.240 71.681  91.540  1.00 129.88 ? 109 DC  I C6    1 
ATOM   7907  P P     . DC  I 7  113 ? 124.358 72.578  93.637  1.00 139.38 ? 110 DC  I P     1 
ATOM   7908  O OP1   . DC  I 7  113 ? 125.680 73.183  93.340  1.00 134.59 ? 110 DC  I OP1   1 
ATOM   7909  O OP2   . DC  I 7  113 ? 124.252 71.143  94.010  1.00 133.79 ? 110 DC  I OP2   1 
ATOM   7910  O "O5'" . DC  I 7  113 ? 123.696 73.355  94.862  1.00 131.39 ? 110 DC  I "O5'" 1 
ATOM   7911  C "C5'" . DC  I 7  113 ? 123.180 74.692  94.702  1.00 130.07 ? 110 DC  I "C5'" 1 
ATOM   7912  C "C4'" . DC  I 7  113 ? 122.342 75.088  95.896  1.00 128.55 ? 110 DC  I "C4'" 1 
ATOM   7913  O "O4'" . DC  I 7  113 ? 120.986 74.598  95.730  1.00 126.02 ? 110 DC  I "O4'" 1 
ATOM   7914  C "C3'" . DC  I 7  113 ? 122.817 74.512  97.233  1.00 129.54 ? 110 DC  I "C3'" 1 
ATOM   7915  O "O3'" . DC  I 7  113 ? 122.502 75.413  98.303  1.00 126.36 ? 110 DC  I "O3'" 1 
ATOM   7916  C "C2'" . DC  I 7  113 ? 121.961 73.266  97.343  1.00 125.46 ? 110 DC  I "C2'" 1 
ATOM   7917  C "C1'" . DC  I 7  113 ? 120.633 73.828  96.866  1.00 123.04 ? 110 DC  I "C1'" 1 
ATOM   7918  N N1    . DC  I 7  113 ? 119.581 72.873  96.461  1.00 122.75 ? 110 DC  I N1    1 
ATOM   7919  C C2    . DC  I 7  113 ? 118.249 73.294  96.541  1.00 120.93 ? 110 DC  I C2    1 
ATOM   7920  O O2    . DC  I 7  113 ? 118.001 74.437  96.945  1.00 120.32 ? 110 DC  I O2    1 
ATOM   7921  N N3    . DC  I 7  113 ? 117.257 72.454  96.177  1.00 121.02 ? 110 DC  I N3    1 
ATOM   7922  C C4    . DC  I 7  113 ? 117.553 71.229  95.745  1.00 123.20 ? 110 DC  I C4    1 
ATOM   7923  N N4    . DC  I 7  113 ? 116.548 70.424  95.393  1.00 124.57 ? 110 DC  I N4    1 
ATOM   7924  C C5    . DC  I 7  113 ? 118.894 70.769  95.653  1.00 122.91 ? 110 DC  I C5    1 
ATOM   7925  C C6    . DC  I 7  113 ? 119.867 71.611  96.016  1.00 123.07 ? 110 DC  I C6    1 
ATOM   7926  P P     . DC  I 7  114 ? 123.550 76.504  98.855  1.00 128.43 ? 111 DC  I P     1 
ATOM   7927  O OP1   . DC  I 7  114 ? 124.139 77.259  97.719  1.00 126.87 ? 111 DC  I OP1   1 
ATOM   7928  O OP2   . DC  I 7  114 ? 124.424 75.848  99.860  1.00 126.83 ? 111 DC  I OP2   1 
ATOM   7929  O "O5'" . DC  I 7  114 ? 122.631 77.490  99.709  1.00 123.92 ? 111 DC  I "O5'" 1 
ATOM   7930  C "C5'" . DC  I 7  114 ? 121.755 78.421  99.042  1.00 122.26 ? 111 DC  I "C5'" 1 
ATOM   7931  C "C4'" . DC  I 7  114 ? 120.541 78.754  99.881  1.00 119.93 ? 111 DC  I "C4'" 1 
ATOM   7932  O "O4'" . DC  I 7  114 ? 119.509 77.759  99.690  1.00 121.49 ? 111 DC  I "O4'" 1 
ATOM   7933  C "C3'" . DC  I 7  114 ? 120.784 78.871  101.384 1.00 118.89 ? 111 DC  I "C3'" 1 
ATOM   7934  O "O3'" . DC  I 7  114 ? 120.205 80.113  101.823 1.00 115.67 ? 111 DC  I "O3'" 1 
ATOM   7935  C "C2'" . DC  I 7  114 ? 120.093 77.651  101.989 1.00 116.44 ? 111 DC  I "C2'" 1 
ATOM   7936  C "C1'" . DC  I 7  114 ? 119.141 77.144  100.914 1.00 118.09 ? 111 DC  I "C1'" 1 
ATOM   7937  N N1    . DC  I 7  114 ? 119.164 75.683  100.686 1.00 118.90 ? 111 DC  I N1    1 
ATOM   7938  C C2    . DC  I 7  114 ? 117.957 74.996  100.483 1.00 119.09 ? 111 DC  I C2    1 
ATOM   7939  O O2    . DC  I 7  114 ? 116.887 75.620  100.501 1.00 118.09 ? 111 DC  I O2    1 
ATOM   7940  N N3    . DC  I 7  114 ? 117.977 73.662  100.269 1.00 120.09 ? 111 DC  I N3    1 
ATOM   7941  C C4    . DC  I 7  114 ? 119.140 73.010  100.255 1.00 121.11 ? 111 DC  I C4    1 
ATOM   7942  N N4    . DC  I 7  114 ? 119.129 71.693  100.043 1.00 122.35 ? 111 DC  I N4    1 
ATOM   7943  C C5    . DC  I 7  114 ? 120.374 73.677  100.460 1.00 120.31 ? 111 DC  I C5    1 
ATOM   7944  C C6    . DC  I 7  114 ? 120.343 74.993  100.668 1.00 119.67 ? 111 DC  I C6    1 
ATOM   7945  P P     . DT  I 7  115 ? 120.212 80.613  103.358 1.00 115.81 ? 112 DT  I P     1 
ATOM   7946  O OP1   . DT  I 7  115 ? 120.303 82.094  103.370 1.00 107.82 ? 112 DT  I OP1   1 
ATOM   7947  O OP2   . DT  I 7  115 ? 121.203 79.808  104.117 1.00 116.71 ? 112 DT  I OP2   1 
ATOM   7948  O "O5'" . DT  I 7  115 ? 118.754 80.198  103.848 1.00 110.14 ? 112 DT  I "O5'" 1 
ATOM   7949  C "C5'" . DT  I 7  115 ? 117.615 80.468  103.008 1.00 110.26 ? 112 DT  I "C5'" 1 
ATOM   7950  C "C4'" . DT  I 7  115 ? 116.350 79.891  103.598 1.00 109.56 ? 112 DT  I "C4'" 1 
ATOM   7951  O "O4'" . DT  I 7  115 ? 116.272 78.478  103.290 1.00 109.97 ? 112 DT  I "O4'" 1 
ATOM   7952  C "C3'" . DT  I 7  115 ? 116.213 80.002  105.114 1.00 108.04 ? 112 DT  I "C3'" 1 
ATOM   7953  O "O3'" . DT  I 7  115 ? 114.834 80.234  105.430 1.00 104.00 ? 112 DT  I "O3'" 1 
ATOM   7954  C "C2'" . DT  I 7  115 ? 116.665 78.630  105.586 1.00 109.41 ? 112 DT  I "C2'" 1 
ATOM   7955  C "C1'" . DT  I 7  115 ? 116.113 77.734  104.485 1.00 109.82 ? 112 DT  I "C1'" 1 
ATOM   7956  N N1    . DT  I 7  115 ? 116.770 76.421  104.272 1.00 112.42 ? 112 DT  I N1    1 
ATOM   7957  C C2    . DT  I 7  115 ? 115.978 75.365  103.867 1.00 114.32 ? 112 DT  I C2    1 
ATOM   7958  O O2    . DT  I 7  115 ? 114.775 75.464  103.681 1.00 116.84 ? 112 DT  I O2    1 
ATOM   7959  N N3    . DT  I 7  115 ? 116.646 74.179  103.683 1.00 116.61 ? 112 DT  I N3    1 
ATOM   7960  C C4    . DT  I 7  115 ? 117.992 73.946  103.859 1.00 117.42 ? 112 DT  I C4    1 
ATOM   7961  O O4    . DT  I 7  115 ? 118.468 72.832  103.657 1.00 120.98 ? 112 DT  I O4    1 
ATOM   7962  C C5    . DT  I 7  115 ? 118.758 75.085  104.282 1.00 113.89 ? 112 DT  I C5    1 
ATOM   7963  C C7    . DT  I 7  115 ? 120.226 74.916  104.495 1.00 119.22 ? 112 DT  I C7    1 
ATOM   7964  C C6    . DT  I 7  115 ? 118.124 76.246  104.465 1.00 112.82 ? 112 DT  I C6    1 
ATOM   7965  P P     . DA  I 7  116 ? 114.421 80.538  106.976 1.00 104.75 ? 113 DA  I P     1 
ATOM   7966  O OP1   . DA  I 7  116 ? 113.794 81.870  107.049 1.00 100.03 ? 113 DA  I OP1   1 
ATOM   7967  O OP2   . DA  I 7  116 ? 115.586 80.250  107.850 1.00 108.36 ? 113 DA  I OP2   1 
ATOM   7968  O "O5'" . DA  I 7  116 ? 113.303 79.447  107.272 1.00 109.78 ? 113 DA  I "O5'" 1 
ATOM   7969  C "C5'" . DA  I 7  116 ? 111.929 79.730  106.978 1.00 111.71 ? 113 DA  I "C5'" 1 
ATOM   7970  C "C4'" . DA  I 7  116 ? 111.149 78.442  106.874 1.00 116.66 ? 113 DA  I "C4'" 1 
ATOM   7971  O "O4'" . DA  I 7  116 ? 111.997 77.385  106.363 1.00 116.05 ? 113 DA  I "O4'" 1 
ATOM   7972  C "C3'" . DA  I 7  116 ? 110.588 77.930  108.200 1.00 120.27 ? 113 DA  I "C3'" 1 
ATOM   7973  O "O3'" . DA  I 7  116 ? 109.311 77.371  107.901 1.00 124.67 ? 113 DA  I "O3'" 1 
ATOM   7974  C "C2'" . DA  I 7  116 ? 111.574 76.848  108.599 1.00 122.35 ? 113 DA  I "C2'" 1 
ATOM   7975  C "C1'" . DA  I 7  116 ? 111.976 76.280  107.251 1.00 120.19 ? 113 DA  I "C1'" 1 
ATOM   7976  N N9    . DA  I 7  116 ? 113.298 75.656  107.221 1.00 118.96 ? 113 DA  I N9    1 
ATOM   7977  C C8    . DA  I 7  116 ? 114.514 76.250  107.452 1.00 117.02 ? 113 DA  I C8    1 
ATOM   7978  N N7    . DA  I 7  116 ? 115.531 75.431  107.346 1.00 117.34 ? 113 DA  I N7    1 
ATOM   7979  C C5    . DA  I 7  116 ? 114.947 74.215  107.022 1.00 119.71 ? 113 DA  I C5    1 
ATOM   7980  C C6    . DA  I 7  116 ? 115.488 72.941  106.773 1.00 122.96 ? 113 DA  I C6    1 
ATOM   7981  N N6    . DA  I 7  116 ? 116.794 72.670  106.819 1.00 123.47 ? 113 DA  I N6    1 
ATOM   7982  N N1    . DA  I 7  116 ? 114.630 71.940  106.482 1.00 125.53 ? 113 DA  I N1    1 
ATOM   7983  C C2    . DA  I 7  116 ? 113.319 72.212  106.441 1.00 126.67 ? 113 DA  I C2    1 
ATOM   7984  N N3    . DA  I 7  116 ? 112.691 73.366  106.652 1.00 123.56 ? 113 DA  I N3    1 
ATOM   7985  C C4    . DA  I 7  116 ? 113.572 74.339  106.941 1.00 121.35 ? 113 DA  I C4    1 
ATOM   7986  P P     . DG  I 7  117 ? 108.223 77.138  109.047 1.00 135.98 ? 114 DG  I P     1 
ATOM   7987  O OP1   . DG  I 7  117 ? 106.891 77.119  108.393 1.00 136.57 ? 114 DG  I OP1   1 
ATOM   7988  O OP2   . DG  I 7  117 ? 108.479 78.082  110.165 1.00 132.36 ? 114 DG  I OP2   1 
ATOM   7989  O "O5'" . DG  I 7  117 ? 108.545 75.667  109.559 1.00 134.50 ? 114 DG  I "O5'" 1 
ATOM   7990  C "C5'" . DG  I 7  117 ? 108.271 74.541  108.709 1.00 137.22 ? 114 DG  I "C5'" 1 
ATOM   7991  C "C4'" . DG  I 7  117 ? 108.672 73.252  109.384 1.00 140.71 ? 114 DG  I "C4'" 1 
ATOM   7992  O "O4'" . DG  I 7  117 ? 110.084 73.019  109.167 1.00 133.53 ? 114 DG  I "O4'" 1 
ATOM   7993  C "C3'" . DG  I 7  117 ? 108.450 73.188  110.898 1.00 143.86 ? 114 DG  I "C3'" 1 
ATOM   7994  O "O3'" . DG  I 7  117 ? 107.768 71.961  111.201 1.00 146.92 ? 114 DG  I "O3'" 1 
ATOM   7995  C "C2'" . DG  I 7  117 ? 109.860 73.204  111.471 1.00 139.76 ? 114 DG  I "C2'" 1 
ATOM   7996  C "C1'" . DG  I 7  117 ? 110.665 72.551  110.368 1.00 136.21 ? 114 DG  I "C1'" 1 
ATOM   7997  N N9    . DG  I 7  117 ? 112.081 72.901  110.355 1.00 130.71 ? 114 DG  I N9    1 
ATOM   7998  C C8    . DG  I 7  117 ? 112.647 74.132  110.571 1.00 127.63 ? 114 DG  I C8    1 
ATOM   7999  N N7    . DG  I 7  117 ? 113.946 74.121  110.491 1.00 126.51 ? 114 DG  I N7    1 
ATOM   8000  C C5    . DG  I 7  117 ? 114.258 72.804  110.205 1.00 127.82 ? 114 DG  I C5    1 
ATOM   8001  C C6    . DG  I 7  117 ? 115.515 72.181  110.004 1.00 130.78 ? 114 DG  I C6    1 
ATOM   8002  O O6    . DG  I 7  117 ? 116.639 72.695  110.039 1.00 130.48 ? 114 DG  I O6    1 
ATOM   8003  N N1    . DG  I 7  117 ? 115.373 70.824  109.737 1.00 132.14 ? 114 DG  I N1    1 
ATOM   8004  C C2    . DG  I 7  117 ? 114.175 70.157  109.674 1.00 133.27 ? 114 DG  I C2    1 
ATOM   8005  N N2    . DG  I 7  117 ? 114.230 68.847  109.404 1.00 136.01 ? 114 DG  I N2    1 
ATOM   8006  N N3    . DG  I 7  117 ? 113.000 70.729  109.860 1.00 132.51 ? 114 DG  I N3    1 
ATOM   8007  C C4    . DG  I 7  117 ? 113.117 72.041  110.119 1.00 132.11 ? 114 DG  I C4    1 
ATOM   8008  P P     . DT  I 7  118 ? 107.178 71.631  112.667 1.00 159.43 ? 115 DT  I P     1 
ATOM   8009  O OP1   . DT  I 7  118 ? 105.820 71.057  112.503 1.00 154.86 ? 115 DT  I OP1   1 
ATOM   8010  O OP2   . DT  I 7  118 ? 107.377 72.816  113.541 1.00 151.13 ? 115 DT  I OP2   1 
ATOM   8011  O "O5'" . DT  I 7  118 ? 108.150 70.479  113.180 1.00 150.73 ? 115 DT  I "O5'" 1 
ATOM   8012  C "C5'" . DT  I 7  118 ? 108.380 69.309  112.373 1.00 151.72 ? 115 DT  I "C5'" 1 
ATOM   8013  C "C4'" . DT  I 7  118 ? 109.524 68.498  112.928 1.00 153.23 ? 115 DT  I "C4'" 1 
ATOM   8014  O "O4'" . DT  I 7  118 ? 110.773 69.097  112.526 1.00 146.11 ? 115 DT  I "O4'" 1 
ATOM   8015  C "C3'" . DT  I 7  118 ? 109.569 68.381  114.453 1.00 156.78 ? 115 DT  I "C3'" 1 
ATOM   8016  O "O3'" . DT  I 7  118 ? 109.258 67.026  114.821 1.00 159.18 ? 115 DT  I "O3'" 1 
ATOM   8017  C "C2'" . DT  I 7  118 ? 111.005 68.746  114.826 1.00 152.18 ? 115 DT  I "C2'" 1 
ATOM   8018  C "C1'" . DT  I 7  118 ? 111.744 68.797  113.502 1.00 148.79 ? 115 DT  I "C1'" 1 
ATOM   8019  N N1    . DT  I 7  118 ? 112.797 69.829  113.458 1.00 142.99 ? 115 DT  I N1    1 
ATOM   8020  C C2    . DT  I 7  118 ? 114.086 69.439  113.173 1.00 143.01 ? 115 DT  I C2    1 
ATOM   8021  O O2    . DT  I 7  118 ? 114.396 68.280  112.951 1.00 144.74 ? 115 DT  I O2    1 
ATOM   8022  N N3    . DT  I 7  118 ? 115.003 70.458  113.156 1.00 139.83 ? 115 DT  I N3    1 
ATOM   8023  C C4    . DT  I 7  118 ? 114.764 71.796  113.390 1.00 138.43 ? 115 DT  I C4    1 
ATOM   8024  O O4    . DT  I 7  118 ? 115.686 72.607  113.342 1.00 138.16 ? 115 DT  I O4    1 
ATOM   8025  C C5    . DT  I 7  118 ? 113.392 72.133  113.682 1.00 137.14 ? 115 DT  I C5    1 
ATOM   8026  C C7    . DT  I 7  118 ? 113.041 73.556  113.958 1.00 137.91 ? 115 DT  I C7    1 
ATOM   8027  C C6    . DT  I 7  118 ? 112.490 71.148  113.702 1.00 139.47 ? 115 DT  I C6    1 
ATOM   8028  P P     . DC  I 7  119 ? 109.067 66.564  116.356 1.00 164.84 ? 116 DC  I P     1 
ATOM   8029  O OP1   . DC  I 7  119 ? 108.178 65.376  116.391 1.00 162.39 ? 116 DC  I OP1   1 
ATOM   8030  O OP2   . DC  I 7  119 ? 108.762 67.754  117.192 1.00 159.83 ? 116 DC  I OP2   1 
ATOM   8031  O "O5'" . DC  I 7  119 ? 110.530 66.126  116.818 1.00 161.47 ? 116 DC  I "O5'" 1 
ATOM   8032  C "C5'" . DC  I 7  119 ? 111.292 65.180  116.042 1.00 164.91 ? 116 DC  I "C5'" 1 
ATOM   8033  C "C4'" . DC  I 7  119 ? 112.731 65.140  116.504 1.00 165.71 ? 116 DC  I "C4'" 1 
ATOM   8034  O "O4'" . DC  I 7  119 ? 113.425 66.337  116.080 1.00 160.01 ? 116 DC  I "O4'" 1 
ATOM   8035  C "C3'" . DC  I 7  119 ? 112.926 65.047  118.023 1.00 169.40 ? 116 DC  I "C3'" 1 
ATOM   8036  O "O3'" . DC  I 7  119 ? 113.676 63.857  118.320 1.00 173.82 ? 116 DC  I "O3'" 1 
ATOM   8037  C "C2'" . DC  I 7  119 ? 113.704 66.313  118.372 1.00 165.98 ? 116 DC  I "C2'" 1 
ATOM   8038  C "C1'" . DC  I 7  119 ? 114.384 66.661  117.065 1.00 160.96 ? 116 DC  I "C1'" 1 
ATOM   8039  N N1    . DC  I 7  119 ? 114.762 68.079  116.912 1.00 156.50 ? 116 DC  I N1    1 
ATOM   8040  C C2    . DC  I 7  119 ? 116.109 68.404  116.707 1.00 156.26 ? 116 DC  I C2    1 
ATOM   8041  O O2    . DC  I 7  119 ? 116.954 67.500  116.658 1.00 158.84 ? 116 DC  I O2    1 
ATOM   8042  N N3    . DC  I 7  119 ? 116.466 69.697  116.567 1.00 155.29 ? 116 DC  I N3    1 
ATOM   8043  C C4    . DC  I 7  119 ? 115.540 70.654  116.622 1.00 150.24 ? 116 DC  I C4    1 
ATOM   8044  N N4    . DC  I 7  119 ? 115.940 71.918  116.479 1.00 150.49 ? 116 DC  I N4    1 
ATOM   8045  C C5    . DC  I 7  119 ? 114.165 70.357  116.829 1.00 149.23 ? 116 DC  I C5    1 
ATOM   8046  C C6    . DC  I 7  119 ? 113.822 69.071  116.967 1.00 153.70 ? 116 DC  I C6    1 
ATOM   8047  P P     . DT  I 7  120 ? 113.957 63.363  119.830 1.00 174.42 ? 117 DT  I P     1 
ATOM   8048  O OP1   . DT  I 7  120 ? 113.846 61.884  119.867 1.00 180.29 ? 117 DT  I OP1   1 
ATOM   8049  O OP2   . DT  I 7  120 ? 113.142 64.187  120.759 1.00 178.13 ? 117 DT  I OP2   1 
ATOM   8050  O "O5'" . DT  I 7  120 ? 115.486 63.756  120.042 1.00 176.46 ? 117 DT  I "O5'" 1 
ATOM   8051  C "C5'" . DT  I 7  120 ? 116.440 63.539  118.987 1.00 174.12 ? 117 DT  I "C5'" 1 
ATOM   8052  C "C4'" . DT  I 7  120 ? 117.841 63.815  119.470 1.00 180.30 ? 117 DT  I "C4'" 1 
ATOM   8053  O "O4'" . DT  I 7  120 ? 118.203 65.174  119.135 1.00 174.08 ? 117 DT  I "O4'" 1 
ATOM   8054  C "C3'" . DT  I 7  120 ? 118.060 63.649  120.972 1.00 184.22 ? 117 DT  I "C3'" 1 
ATOM   8055  O "O3'" . DT  I 7  120 ? 119.265 62.892  121.170 1.00 188.36 ? 117 DT  I "O3'" 1 
ATOM   8056  C "C2'" . DT  I 7  120 ? 118.188 65.077  121.492 1.00 180.16 ? 117 DT  I "C2'" 1 
ATOM   8057  C "C1'" . DT  I 7  120 ? 118.651 65.873  120.280 1.00 176.23 ? 117 DT  I "C1'" 1 
ATOM   8058  N N1    . DT  I 7  120 ? 118.125 67.254  120.191 1.00 169.21 ? 117 DT  I N1    1 
ATOM   8059  C C2    . DT  I 7  120 ? 119.010 68.270  119.895 1.00 167.51 ? 117 DT  I C2    1 
ATOM   8060  O O2    . DT  I 7  120 ? 120.201 68.082  119.703 1.00 172.32 ? 117 DT  I O2    1 
ATOM   8061  N N3    . DT  I 7  120 ? 118.448 69.521  119.828 1.00 164.89 ? 117 DT  I N3    1 
ATOM   8062  C C4    . DT  I 7  120 ? 117.124 69.854  120.024 1.00 164.64 ? 117 DT  I C4    1 
ATOM   8063  O O4    . DT  I 7  120 ? 116.756 71.024  119.932 1.00 162.37 ? 117 DT  I O4    1 
ATOM   8064  C C5    . DT  I 7  120 ? 116.255 68.746  120.330 1.00 162.67 ? 117 DT  I C5    1 
ATOM   8065  C C7    . DT  I 7  120 ? 114.807 69.016  120.568 1.00 158.54 ? 117 DT  I C7    1 
ATOM   8066  C C6    . DT  I 7  120 ? 116.788 67.520  120.396 1.00 167.77 ? 117 DT  I C6    1 
ATOM   8067  P P     . DC  I 7  121 ? 119.720 62.346  122.618 1.00 190.14 ? 118 DC  I P     1 
ATOM   8068  O OP1   . DC  I 7  121 ? 120.492 61.091  122.435 1.00 195.53 ? 118 DC  I OP1   1 
ATOM   8069  O OP2   . DC  I 7  121 ? 118.564 62.391  123.551 1.00 192.31 ? 118 DC  I OP2   1 
ATOM   8070  O "O5'" . DC  I 7  121 ? 120.704 63.476  123.158 1.00 191.14 ? 118 DC  I "O5'" 1 
ATOM   8071  C "C5'" . DC  I 7  121 ? 121.788 63.950  122.338 1.00 190.13 ? 118 DC  I "C5'" 1 
ATOM   8072  C "C4'" . DC  I 7  121 ? 122.327 65.250  122.878 1.00 189.96 ? 118 DC  I "C4'" 1 
ATOM   8073  O "O4'" . DC  I 7  121 ? 121.430 66.335  122.556 1.00 183.71 ? 118 DC  I "O4'" 1 
ATOM   8074  C "C3'" . DC  I 7  121 ? 122.515 65.289  124.398 1.00 193.99 ? 118 DC  I "C3'" 1 
ATOM   8075  O "O3'" . DC  I 7  121 ? 123.925 65.386  124.665 1.00 198.99 ? 118 DC  I "O3'" 1 
ATOM   8076  C "C2'" . DC  I 7  121 ? 121.737 66.533  124.837 1.00 189.45 ? 118 DC  I "C2'" 1 
ATOM   8077  C "C1'" . DC  I 7  121 ? 121.580 67.322  123.552 1.00 185.35 ? 118 DC  I "C1'" 1 
ATOM   8078  N N1    . DC  I 7  121 ? 120.416 68.230  123.501 1.00 180.82 ? 118 DC  I N1    1 
ATOM   8079  C C2    . DC  I 7  121 ? 120.631 69.589  123.236 1.00 179.55 ? 118 DC  I C2    1 
ATOM   8080  O O2    . DC  I 7  121 ? 121.788 69.997  123.053 1.00 184.56 ? 118 DC  I O2    1 
ATOM   8081  N N3    . DC  I 7  121 ? 119.578 70.431  123.186 1.00 177.25 ? 118 DC  I N3    1 
ATOM   8082  C C4    . DC  I 7  121 ? 118.345 69.968  123.387 1.00 174.27 ? 118 DC  I C4    1 
ATOM   8083  N N4    . DC  I 7  121 ? 117.333 70.835  123.328 1.00 174.11 ? 118 DC  I N4    1 
ATOM   8084  C C5    . DC  I 7  121 ? 118.091 68.596  123.657 1.00 171.99 ? 118 DC  I C5    1 
ATOM   8085  C C6    . DC  I 7  121 ? 119.143 67.769  123.706 1.00 177.51 ? 118 DC  I C6    1 
ATOM   8086  P P     . DC  I 7  122 ? 124.550 65.461  126.150 1.00 196.48 ? 119 DC  I P     1 
ATOM   8087  O OP1   . DC  I 7  122 ? 125.658 64.479  126.258 1.00 204.53 ? 119 DC  I OP1   1 
ATOM   8088  O OP2   . DC  I 7  122 ? 123.449 65.472  127.146 1.00 202.82 ? 119 DC  I OP2   1 
ATOM   8089  O "O5'" . DC  I 7  122 ? 125.153 66.936  126.214 1.00 204.37 ? 119 DC  I "O5'" 1 
ATOM   8090  C "C5'" . DC  I 7  122 ? 125.471 67.634  124.993 1.00 203.99 ? 119 DC  I "C5'" 1 
ATOM   8091  C "C4'" . DC  I 7  122 ? 126.183 68.934  125.270 1.00 211.35 ? 119 DC  I "C4'" 1 
ATOM   8092  O "O4'" . DC  I 7  122 ? 125.267 70.037  125.086 1.00 206.27 ? 119 DC  I "O4'" 1 
ATOM   8093  C "C3'" . DC  I 7  122 ? 126.744 69.092  126.677 1.00 214.59 ? 119 DC  I "C3'" 1 
ATOM   8094  O "O3'" . DC  I 7  122 ? 127.932 69.894  126.590 1.00 222.10 ? 119 DC  I "O3'" 1 
ATOM   8095  C "C2'" . DC  I 7  122 ? 125.613 69.795  127.416 1.00 214.21 ? 119 DC  I "C2'" 1 
ATOM   8096  C "C1'" . DC  I 7  122 ? 124.931 70.627  126.333 1.00 212.32 ? 119 DC  I "C1'" 1 
ATOM   8097  N N1    . DC  I 7  122 ? 123.454 70.693  126.403 1.00 204.32 ? 119 DC  I N1    1 
ATOM   8098  C C2    . DC  I 7  122 ? 122.810 71.913  126.137 1.00 204.30 ? 119 DC  I C2    1 
ATOM   8099  O O2    . DC  I 7  122 ? 123.485 72.913  125.851 1.00 209.40 ? 119 DC  I O2    1 
ATOM   8100  N N3    . DC  I 7  122 ? 121.461 71.981  126.197 1.00 200.23 ? 119 DC  I N3    1 
ATOM   8101  C C4    . DC  I 7  122 ? 120.755 70.893  126.507 1.00 193.96 ? 119 DC  I C4    1 
ATOM   8102  N N4    . DC  I 7  122 ? 119.426 70.989  126.559 1.00 192.83 ? 119 DC  I N4    1 
ATOM   8103  C C5    . DC  I 7  122 ? 121.376 69.648  126.780 1.00 194.18 ? 119 DC  I C5    1 
ATOM   8104  C C6    . DC  I 7  122 ? 122.709 69.590  126.718 1.00 199.50 ? 119 DC  I C6    1 
ATOM   8105  P P     . DA  I 7  123 ? 128.860 70.259  127.856 1.00 220.22 ? 120 DA  I P     1 
ATOM   8106  O OP1   . DA  I 7  123 ? 130.274 70.009  127.480 1.00 229.08 ? 120 DA  I OP1   1 
ATOM   8107  O OP2   . DA  I 7  123 ? 128.298 69.618  129.073 1.00 229.57 ? 120 DA  I OP2   1 
ATOM   8108  O "O5'" . DA  I 7  123 ? 128.648 71.833  127.984 1.00 231.27 ? 120 DA  I "O5'" 1 
ATOM   8109  C "C5'" . DA  I 7  123 ? 128.479 72.637  126.799 1.00 231.97 ? 120 DA  I "C5'" 1 
ATOM   8110  C "C4'" . DA  I 7  123 ? 128.369 74.098  127.152 1.00 239.85 ? 120 DA  I "C4'" 1 
ATOM   8111  O "O4'" . DA  I 7  123 ? 126.974 74.457  127.256 1.00 237.80 ? 120 DA  I "O4'" 1 
ATOM   8112  C "C3'" . DA  I 7  123 ? 129.021 74.499  128.472 1.00 245.65 ? 120 DA  I "C3'" 1 
ATOM   8113  O "O3'" . DA  I 7  123 ? 129.624 75.794  128.325 1.00 252.95 ? 120 DA  I "O3'" 1 
ATOM   8114  C "C2'" . DA  I 7  123 ? 127.857 74.524  129.455 1.00 247.74 ? 120 DA  I "C2'" 1 
ATOM   8115  C "C1'" . DA  I 7  123 ? 126.634 74.801  128.590 1.00 245.33 ? 120 DA  I "C1'" 1 
ATOM   8116  N N9    . DA  I 7  123 ? 125.443 74.030  128.956 1.00 238.84 ? 120 DA  I N9    1 
ATOM   8117  C C8    . DA  I 7  123 ? 125.373 72.746  129.435 1.00 233.86 ? 120 DA  I C8    1 
ATOM   8118  N N7    . DA  I 7  123 ? 124.153 72.332  129.669 1.00 230.21 ? 120 DA  I N7    1 
ATOM   8119  C C5    . DA  I 7  123 ? 123.365 73.414  129.323 1.00 232.85 ? 120 DA  I C5    1 
ATOM   8120  C C6    . DA  I 7  123 ? 121.979 73.604  129.343 1.00 230.29 ? 120 DA  I C6    1 
ATOM   8121  N N6    . DA  I 7  123 ? 121.131 72.662  129.748 1.00 229.78 ? 120 DA  I N6    1 
ATOM   8122  N N1    . DA  I 7  123 ? 121.497 74.799  128.935 1.00 229.84 ? 120 DA  I N1    1 
ATOM   8123  C C2    . DA  I 7  123 ? 122.377 75.726  128.535 1.00 235.13 ? 120 DA  I C2    1 
ATOM   8124  N N3    . DA  I 7  123 ? 123.704 75.663  128.469 1.00 238.16 ? 120 DA  I N3    1 
ATOM   8125  C C4    . DA  I 7  123 ? 124.143 74.465  128.883 1.00 237.75 ? 120 DA  I C4    1 
ATOM   8126  P P     . DG  I 7  124 ? 130.531 76.459  129.483 1.00 251.98 ? 121 DG  I P     1 
ATOM   8127  O OP1   . DG  I 7  124 ? 131.602 77.254  128.830 1.00 264.37 ? 121 DG  I OP1   1 
ATOM   8128  O OP2   . DG  I 7  124 ? 130.894 75.411  130.472 1.00 257.45 ? 121 DG  I OP2   1 
ATOM   8129  O "O5'" . DG  I 7  124 ? 129.515 77.466  130.184 1.00 262.42 ? 121 DG  I "O5'" 1 
ATOM   8130  C "C5'" . DG  I 7  124 ? 128.994 78.590  129.450 1.00 264.99 ? 121 DG  I "C5'" 1 
ATOM   8131  C "C4'" . DG  I 7  124 ? 127.663 79.034  130.006 1.00 267.36 ? 121 DG  I "C4'" 1 
ATOM   8132  O "O4'" . DG  I 7  124 ? 126.774 77.907  130.142 1.00 261.80 ? 121 DG  I "O4'" 1 
ATOM   8133  C "C3'" . DG  I 7  124 ? 127.702 79.692  131.386 1.00 273.65 ? 121 DG  I "C3'" 1 
ATOM   8134  O "O3'" . DG  I 7  124 ? 127.513 81.108  131.214 1.00 277.92 ? 121 DG  I "O3'" 1 
ATOM   8135  C "C2'" . DG  I 7  124 ? 126.540 79.053  132.149 1.00 279.36 ? 121 DG  I "C2'" 1 
ATOM   8136  C "C1'" . DG  I 7  124 ? 125.795 78.248  131.100 1.00 269.71 ? 121 DG  I "C1'" 1 
ATOM   8137  N N9    . DG  I 7  124 ? 125.179 77.019  131.599 1.00 266.52 ? 121 DG  I N9    1 
ATOM   8138  C C8    . DG  I 7  124 ? 125.818 75.883  132.031 1.00 262.64 ? 121 DG  I C8    1 
ATOM   8139  N N7    . DG  I 7  124 ? 124.999 74.945  132.415 1.00 260.92 ? 121 DG  I N7    1 
ATOM   8140  C C5    . DG  I 7  124 ? 123.740 75.492  132.228 1.00 264.17 ? 121 DG  I C5    1 
ATOM   8141  C C6    . DG  I 7  124 ? 122.455 74.942  132.470 1.00 266.64 ? 121 DG  I C6    1 
ATOM   8142  O O6    . DG  I 7  124 ? 122.168 73.823  132.911 1.00 266.43 ? 121 DG  I O6    1 
ATOM   8143  N N1    . DG  I 7  124 ? 121.444 75.838  132.141 1.00 265.24 ? 121 DG  I N1    1 
ATOM   8144  C C2    . DG  I 7  124 ? 121.643 77.100  131.644 1.00 267.76 ? 121 DG  I C2    1 
ATOM   8145  N N2    . DG  I 7  124 ? 120.539 77.816  131.387 1.00 269.33 ? 121 DG  I N2    1 
ATOM   8146  N N3    . DG  I 7  124 ? 122.837 77.624  131.412 1.00 269.56 ? 121 DG  I N3    1 
ATOM   8147  C C4    . DG  I 7  124 ? 123.833 76.771  131.725 1.00 266.51 ? 121 DG  I C4    1 
ATOM   8148  P P     . DG  I 7  125 ? 127.662 82.156  132.432 1.00 282.95 ? 122 DG  I P     1 
ATOM   8149  O OP1   . DG  I 7  125 ? 128.064 83.467  131.865 1.00 290.64 ? 122 DG  I OP1   1 
ATOM   8150  O OP2   . DG  I 7  125 ? 128.488 81.530  133.496 1.00 287.57 ? 122 DG  I OP2   1 
ATOM   8151  O "O5'" . DG  I 7  125 ? 126.168 82.282  132.974 1.00 288.45 ? 122 DG  I "O5'" 1 
ATOM   8152  C "C5'" . DG  I 7  125 ? 125.087 82.568  132.065 1.00 291.10 ? 122 DG  I "C5'" 1 
ATOM   8153  C "C4'" . DG  I 7  125 ? 123.755 82.517  132.777 1.00 298.62 ? 122 DG  I "C4'" 1 
ATOM   8154  O "O4'" . DG  I 7  125 ? 123.370 81.134  132.984 1.00 292.56 ? 122 DG  I "O4'" 1 
ATOM   8155  C "C3'" . DG  I 7  125 ? 123.703 83.184  134.153 1.00 302.99 ? 122 DG  I "C3'" 1 
ATOM   8156  O "O3'" . DG  I 7  125 ? 122.471 83.917  134.256 1.00 310.05 ? 122 DG  I "O3'" 1 
ATOM   8157  C "C2'" . DG  I 7  125 ? 123.735 82.003  135.110 1.00 305.71 ? 122 DG  I "C2'" 1 
ATOM   8158  C "C1'" . DG  I 7  125 ? 122.974 80.949  134.333 1.00 302.35 ? 122 DG  I "C1'" 1 
ATOM   8159  N N9    . DG  I 7  125 ? 123.285 79.575  134.716 1.00 298.27 ? 122 DG  I N9    1 
ATOM   8160  C C8    . DG  I 7  125 ? 124.528 79.019  134.888 1.00 294.01 ? 122 DG  I C8    1 
ATOM   8161  N N7    . DG  I 7  125 ? 124.487 77.764  135.232 1.00 294.80 ? 122 DG  I N7    1 
ATOM   8162  C C5    . DG  I 7  125 ? 123.136 77.471  135.291 1.00 297.85 ? 122 DG  I C5    1 
ATOM   8163  C C6    . DG  I 7  125 ? 122.477 76.260  135.614 1.00 302.56 ? 122 DG  I C6    1 
ATOM   8164  O O6    . DG  I 7  125 ? 122.985 75.175  135.916 1.00 304.99 ? 122 DG  I O6    1 
ATOM   8165  N N1    . DG  I 7  125 ? 121.094 76.397  135.556 1.00 304.98 ? 122 DG  I N1    1 
ATOM   8166  C C2    . DG  I 7  125 ? 120.431 77.555  135.228 1.00 305.36 ? 122 DG  I C2    1 
ATOM   8167  N N2    . DG  I 7  125 ? 119.091 77.498  135.223 1.00 303.92 ? 122 DG  I N2    1 
ATOM   8168  N N3    . DG  I 7  125 ? 121.038 78.691  134.925 1.00 305.72 ? 122 DG  I N3    1 
ATOM   8169  C C4    . DG  I 7  125 ? 122.380 78.577  134.976 1.00 300.46 ? 122 DG  I C4    1 
ATOM   8170  P P     . DC  I 7  126 ? 122.150 84.898  135.495 1.00 316.78 ? 123 DC  I P     1 
ATOM   8171  O OP1   . DC  I 7  126 ? 121.546 86.149  134.970 1.00 321.05 ? 123 DC  I OP1   1 
ATOM   8172  O OP2   . DC  I 7  126 ? 123.329 84.948  136.397 1.00 320.03 ? 123 DC  I OP2   1 
ATOM   8173  O "O5'" . DC  I 7  126 ? 121.051 84.106  136.334 1.00 327.04 ? 123 DC  I "O5'" 1 
ATOM   8174  C "C5'" . DC  I 7  126 ? 119.897 83.547  135.679 1.00 328.46 ? 123 DC  I "C5'" 1 
ATOM   8175  C "C4'" . DC  I 7  126 ? 118.984 82.895  136.688 1.00 342.07 ? 123 DC  I "C4'" 1 
ATOM   8176  O "O4'" . DC  I 7  126 ? 119.346 81.503  136.828 1.00 334.62 ? 123 DC  I "O4'" 1 
ATOM   8177  C "C3'" . DC  I 7  126 ? 119.035 83.514  138.087 1.00 352.71 ? 123 DC  I "C3'" 1 
ATOM   8178  O "O3'" . DC  I 7  126 ? 117.704 83.871  138.490 1.00 361.32 ? 123 DC  I "O3'" 1 
ATOM   8179  C "C2'" . DC  I 7  126 ? 119.615 82.419  138.974 1.00 359.80 ? 123 DC  I "C2'" 1 
ATOM   8180  C "C1'" . DC  I 7  126 ? 119.386 81.138  138.194 1.00 352.91 ? 123 DC  I "C1'" 1 
ATOM   8181  N N1    . DC  I 7  126 ? 120.456 80.135  138.348 1.00 343.01 ? 123 DC  I N1    1 
ATOM   8182  C C2    . DC  I 7  126 ? 120.130 78.828  138.741 1.00 349.68 ? 123 DC  I C2    1 
ATOM   8183  O O2    . DC  I 7  126 ? 118.947 78.526  138.957 1.00 353.89 ? 123 DC  I O2    1 
ATOM   8184  N N3    . DC  I 7  126 ? 121.114 77.914  138.878 1.00 348.61 ? 123 DC  I N3    1 
ATOM   8185  C C4    . DC  I 7  126 ? 122.380 78.258  138.641 1.00 342.51 ? 123 DC  I C4    1 
ATOM   8186  N N4    . DC  I 7  126 ? 123.319 77.324  138.791 1.00 344.27 ? 123 DC  I N4    1 
ATOM   8187  C C5    . DC  I 7  126 ? 122.742 79.575  138.243 1.00 335.63 ? 123 DC  I C5    1 
ATOM   8188  C C6    . DC  I 7  126 ? 121.759 80.471  138.110 1.00 334.95 ? 123 DC  I C6    1 
ATOM   8189  P P     . DC  I 7  127 ? 117.415 84.765  139.801 1.00 373.91 ? 124 DC  I P     1 
ATOM   8190  O OP1   . DC  I 7  127 ? 116.175 85.550  139.579 1.00 374.83 ? 124 DC  I OP1   1 
ATOM   8191  O OP2   . DC  I 7  127 ? 118.670 85.443  140.220 1.00 369.53 ? 124 DC  I OP2   1 
ATOM   8192  O "O5'" . DC  I 7  127 ? 117.147 83.691  140.950 1.00 383.30 ? 124 DC  I "O5'" 1 
ATOM   8193  C "C5'" . DC  I 7  127 ? 116.176 82.644  140.760 1.00 386.32 ? 124 DC  I "C5'" 1 
ATOM   8194  C "C4'" . DC  I 7  127 ? 116.277 81.607  141.855 1.00 393.49 ? 124 DC  I "C4'" 1 
ATOM   8195  O "O4'" . DC  I 7  127 ? 117.443 80.779  141.645 1.00 387.91 ? 124 DC  I "O4'" 1 
ATOM   8196  C "C3'" . DC  I 7  127 ? 116.392 82.173  143.273 1.00 408.03 ? 124 DC  I "C3'" 1 
ATOM   8197  O "O3'" . DC  I 7  127 ? 115.382 81.564  144.094 1.00 418.48 ? 124 DC  I "O3'" 1 
ATOM   8198  C "C2'" . DC  I 7  127 ? 117.789 81.768  143.733 1.00 416.49 ? 124 DC  I "C2'" 1 
ATOM   8199  C "C1'" . DC  I 7  127 ? 118.092 80.548  142.880 1.00 403.54 ? 124 DC  I "C1'" 1 
ATOM   8200  N N1    . DC  I 7  127 ? 119.518 80.303  142.584 1.00 399.44 ? 124 DC  I N1    1 
ATOM   8201  C C2    . DC  I 7  127 ? 120.024 79.003  142.715 1.00 397.53 ? 124 DC  I C2    1 
ATOM   8202  O O2    . DC  I 7  127 ? 119.269 78.088  143.077 1.00 399.72 ? 124 DC  I O2    1 
ATOM   8203  N N3    . DC  I 7  127 ? 121.326 78.766  142.446 1.00 392.31 ? 124 DC  I N3    1 
ATOM   8204  C C4    . DC  I 7  127 ? 122.119 79.766  142.059 1.00 393.07 ? 124 DC  I C4    1 
ATOM   8205  N N4    . DC  I 7  127 ? 123.398 79.490  141.804 1.00 393.95 ? 124 DC  I N4    1 
ATOM   8206  C C5    . DC  I 7  127 ? 121.637 81.094  141.918 1.00 392.48 ? 124 DC  I C5    1 
ATOM   8207  C C6    . DC  I 7  127 ? 120.346 81.317  142.186 1.00 394.55 ? 124 DC  I C6    1 
ATOM   8208  P P     . DT  I 7  128 ? 114.642 82.366  145.282 1.00 426.11 ? 125 DT  I P     1 
ATOM   8209  O OP1   . DT  I 7  128 ? 113.421 81.609  145.655 1.00 426.62 ? 125 DT  I OP1   1 
ATOM   8210  O OP2   . DT  I 7  128 ? 114.526 83.795  144.893 1.00 416.65 ? 125 DT  I OP2   1 
ATOM   8211  O "O5'" . DT  I 7  128 ? 115.680 82.257  146.481 1.00 443.03 ? 125 DT  I "O5'" 1 
ATOM   8212  C "C5'" . DT  I 7  128 ? 115.975 80.976  147.064 1.00 461.27 ? 125 DT  I "C5'" 1 
ATOM   8213  C "C4'" . DT  I 7  128 ? 117.179 81.070  147.969 1.00 472.66 ? 125 DT  I "C4'" 1 
ATOM   8214  O "O4'" . DT  I 7  128 ? 118.330 80.493  147.326 1.00 467.46 ? 125 DT  I "O4'" 1 
ATOM   8215  C "C3'" . DT  I 7  128 ? 117.653 82.472  148.332 1.00 470.57 ? 125 DT  I "C3'" 1 
ATOM   8216  O "O3'" . DT  I 7  128 ? 116.853 83.010  149.400 1.00 482.75 ? 125 DT  I "O3'" 1 
ATOM   8217  C "C2'" . DT  I 7  128 ? 119.080 82.200  148.789 1.00 486.21 ? 125 DT  I "C2'" 1 
ATOM   8218  C "C1'" . DT  I 7  128 ? 119.477 80.937  148.029 1.00 479.16 ? 125 DT  I "C1'" 1 
ATOM   8219  N N1    . DT  I 7  128 ? 120.589 81.104  147.073 1.00 463.75 ? 125 DT  I N1    1 
ATOM   8220  C C2    . DT  I 7  128 ? 121.473 80.058  146.955 1.00 459.97 ? 125 DT  I C2    1 
ATOM   8221  O O2    . DT  I 7  128 ? 121.364 79.024  147.599 1.00 481.82 ? 125 DT  I O2    1 
ATOM   8222  N N3    . DT  I 7  128 ? 122.489 80.264  146.060 1.00 448.65 ? 125 DT  I N3    1 
ATOM   8223  C C4    . DT  I 7  128 ? 122.708 81.382  145.284 1.00 442.77 ? 125 DT  I C4    1 
ATOM   8224  O O4    . DT  I 7  128 ? 123.674 81.422  144.520 1.00 440.90 ? 125 DT  I O4    1 
ATOM   8225  C C5    . DT  I 7  128 ? 121.744 82.444  145.455 1.00 445.79 ? 125 DT  I C5    1 
ATOM   8226  C C7    . DT  I 7  128 ? 121.906 83.697  144.657 1.00 446.03 ? 125 DT  I C7    1 
ATOM   8227  C C6    . DT  I 7  128 ? 120.744 82.256  146.328 1.00 455.26 ? 125 DT  I C6    1 
ATOM   8228  P P     . DT  I 7  129 ? 117.177 84.445  150.071 1.00 486.55 ? 126 DT  I P     1 
ATOM   8229  O OP1   . DT  I 7  129 ? 115.950 84.936  150.747 1.00 484.05 ? 126 DT  I OP1   1 
ATOM   8230  O OP2   . DT  I 7  129 ? 117.845 85.302  149.057 1.00 485.31 ? 126 DT  I OP2   1 
ATOM   8231  O "O5'" . DT  I 7  129 ? 118.257 84.094  151.193 1.00 506.34 ? 126 DT  I "O5'" 1 
ATOM   8232  C "C5'" . DT  I 7  129 ? 117.941 83.170  152.253 1.00 523.26 ? 126 DT  I "C5'" 1 
ATOM   8233  C "C4'" . DT  I 7  129 ? 119.168 82.878  153.088 1.00 526.32 ? 126 DT  I "C4'" 1 
ATOM   8234  O "O4'" . DT  I 7  129 ? 120.082 82.053  152.336 1.00 528.11 ? 126 DT  I "O4'" 1 
ATOM   8235  C "C3'" . DT  I 7  129 ? 119.965 84.102  153.522 1.00 529.54 ? 126 DT  I "C3'" 1 
ATOM   8236  O "O3'" . DT  I 7  129 ? 119.530 84.494  154.832 1.00 540.68 ? 126 DT  I "O3'" 1 
ATOM   8237  C "C2'" . DT  I 7  129 ? 121.403 83.607  153.558 1.00 535.67 ? 126 DT  I "C2'" 1 
ATOM   8238  C "C1'" . DT  I 7  129 ? 121.425 82.431  152.591 1.00 531.03 ? 126 DT  I "C1'" 1 
ATOM   8239  N N1    . DT  I 7  129 ? 122.062 82.710  151.288 1.00 518.40 ? 126 DT  I N1    1 
ATOM   8240  C C2    . DT  I 7  129 ? 123.035 81.843  150.843 1.00 506.00 ? 126 DT  I C2    1 
ATOM   8241  O O2    . DT  I 7  129 ? 123.389 80.860  151.477 1.00 520.18 ? 126 DT  I O2    1 
ATOM   8242  N N3    . DT  I 7  129 ? 123.579 82.166  149.627 1.00 492.29 ? 126 DT  I N3    1 
ATOM   8243  C C4    . DT  I 7  129 ? 123.256 83.245  148.829 1.00 488.18 ? 126 DT  I C4    1 
ATOM   8244  O O4    . DT  I 7  129 ? 123.831 83.414  147.757 1.00 482.89 ? 126 DT  I O4    1 
ATOM   8245  C C5    . DT  I 7  129 ? 122.231 84.113  149.352 1.00 499.07 ? 126 DT  I C5    1 
ATOM   8246  C C7    . DT  I 7  129 ? 121.812 85.302  148.548 1.00 493.65 ? 126 DT  I C7    1 
ATOM   8247  C C6    . DT  I 7  129 ? 121.692 83.808  150.538 1.00 505.75 ? 126 DT  I C6    1 
ATOM   8248  P P     . DT  I 7  130 ? 119.906 85.932  155.449 1.00 530.81 ? 127 DT  I P     1 
ATOM   8249  O OP1   . DT  I 7  130 ? 119.174 86.090  156.730 1.00 549.14 ? 127 DT  I OP1   1 
ATOM   8250  O OP2   . DT  I 7  130 ? 119.750 86.956  154.385 1.00 532.59 ? 127 DT  I OP2   1 
ATOM   8251  O "O5'" . DT  I 7  130 ? 121.462 85.795  155.774 1.00 518.02 ? 127 DT  I "O5'" 1 
ATOM   8252  C "C5'" . DT  I 7  130 ? 121.986 86.308  157.015 1.00 495.17 ? 127 DT  I "C5'" 1 
ATOM   8253  C "C4'" . DT  I 7  130 ? 123.347 85.715  157.324 1.00 542.68 ? 127 DT  I "C4'" 1 
ATOM   8254  O "O4'" . DT  I 7  130 ? 123.876 85.046  156.154 1.00 530.21 ? 127 DT  I "O4'" 1 
ATOM   8255  C "C3'" . DT  I 7  130 ? 124.415 86.720  157.752 1.00 493.59 ? 127 DT  I "C3'" 1 
ATOM   8256  O "O3'" . DT  I 7  130 ? 125.294 86.120  158.719 1.00 499.63 ? 127 DT  I "O3'" 1 
ATOM   8257  C "C2'" . DT  I 7  130 ? 125.147 87.009  156.451 1.00 515.89 ? 127 DT  I "C2'" 1 
ATOM   8258  C "C1'" . DT  I 7  130 ? 125.049 85.698  155.691 1.00 528.57 ? 127 DT  I "C1'" 1 
ATOM   8259  N N1    . DT  I 7  130 ? 124.915 85.848  154.228 1.00 533.75 ? 127 DT  I N1    1 
ATOM   8260  C C2    . DT  I 7  130 ? 125.894 85.325  153.410 1.00 529.71 ? 127 DT  I C2    1 
ATOM   8261  O O2    . DT  I 7  130 ? 126.878 84.738  153.835 1.00 540.85 ? 127 DT  I O2    1 
ATOM   8262  N N3    . DT  I 7  130 ? 125.678 85.514  152.067 1.00 526.65 ? 127 DT  I N3    1 
ATOM   8263  C C4    . DT  I 7  130 ? 124.609 86.158  151.475 1.00 523.11 ? 127 DT  I C4    1 
ATOM   8264  O O4    . DT  I 7  130 ? 124.547 86.249  150.252 1.00 517.17 ? 127 DT  I O4    1 
ATOM   8265  C C5    . DT  I 7  130 ? 123.625 86.679  152.392 1.00 527.50 ? 127 DT  I C5    1 
ATOM   8266  C C7    . DT  I 7  130 ? 122.425 87.388  151.856 1.00 529.15 ? 127 DT  I C7    1 
ATOM   8267  C C6    . DT  I 7  130 ? 123.825 86.501  153.700 1.00 527.69 ? 127 DT  I C6    1 
ATOM   8268  P P     . DG  I 7  131 ? 126.232 87.020  159.677 1.00 532.89 ? 128 DG  I P     1 
ATOM   8269  O OP1   . DG  I 7  131 ? 126.767 86.147  160.748 1.00 516.92 ? 128 DG  I OP1   1 
ATOM   8270  O OP2   . DG  I 7  131 ? 125.490 88.253  160.041 1.00 508.57 ? 128 DG  I OP2   1 
ATOM   8271  O "O5'" . DG  I 7  131 ? 127.444 87.429  158.728 1.00 535.15 ? 128 DG  I "O5'" 1 
ATOM   8272  C "C5'" . DG  I 7  131 ? 128.450 86.453  158.397 1.00 548.07 ? 128 DG  I "C5'" 1 
ATOM   8273  C "C4'" . DG  I 7  131 ? 129.584 87.064  157.601 1.00 545.17 ? 128 DG  I "C4'" 1 
ATOM   8274  O "O4'" . DG  I 7  131 ? 129.203 87.136  156.203 1.00 537.90 ? 128 DG  I "O4'" 1 
ATOM   8275  C "C3'" . DG  I 7  131 ? 130.008 88.484  157.988 1.00 532.73 ? 128 DG  I "C3'" 1 
ATOM   8276  O "O3'" . DG  I 7  131 ? 131.433 88.601  157.828 1.00 532.67 ? 128 DG  I "O3'" 1 
ATOM   8277  C "C2'" . DG  I 7  131 ? 129.275 89.332  156.966 1.00 528.75 ? 128 DG  I "C2'" 1 
ATOM   8278  C "C1'" . DG  I 7  131 ? 129.393 88.461  155.732 1.00 528.60 ? 128 DG  I "C1'" 1 
ATOM   8279  N N9    . DG  I 7  131 ? 128.406 88.710  154.686 1.00 527.37 ? 128 DG  I N9    1 
ATOM   8280  C C8    . DG  I 7  131 ? 127.117 89.165  154.822 1.00 525.85 ? 128 DG  I C8    1 
ATOM   8281  N N7    . DG  I 7  131 ? 126.491 89.277  153.683 1.00 526.19 ? 128 DG  I N7    1 
ATOM   8282  C C5    . DG  I 7  131 ? 127.422 88.873  152.741 1.00 519.58 ? 128 DG  I C5    1 
ATOM   8283  C C6    . DG  I 7  131 ? 127.325 88.780  151.330 1.00 514.61 ? 128 DG  I C6    1 
ATOM   8284  O O6    . DG  I 7  131 ? 126.356 89.046  150.608 1.00 513.58 ? 128 DG  I O6    1 
ATOM   8285  N N1    . DG  I 7  131 ? 128.513 88.322  150.766 1.00 513.43 ? 128 DG  I N1    1 
ATOM   8286  C C2    . DG  I 7  131 ? 129.646 87.998  151.472 1.00 517.19 ? 128 DG  I C2    1 
ATOM   8287  N N2    . DG  I 7  131 ? 130.702 87.572  150.763 1.00 518.53 ? 128 DG  I N2    1 
ATOM   8288  N N3    . DG  I 7  131 ? 129.745 88.081  152.785 1.00 524.38 ? 128 DG  I N3    1 
ATOM   8289  C C4    . DG  I 7  131 ? 128.606 88.522  153.348 1.00 522.09 ? 128 DG  I C4    1 
ATOM   8290  P P     . DT  I 7  132 ? 132.259 89.878  158.369 1.00 516.34 ? 129 DT  I P     1 
ATOM   8291  O OP1   . DT  I 7  132 ? 133.497 89.385  159.020 1.00 522.75 ? 129 DT  I OP1   1 
ATOM   8292  O OP2   . DT  I 7  132 ? 131.331 90.756  159.130 1.00 518.05 ? 129 DT  I OP2   1 
ATOM   8293  O "O5'" . DT  I 7  132 ? 132.663 90.639  157.025 1.00 504.37 ? 129 DT  I "O5'" 1 
ATOM   8294  C "C5'" . DT  I 7  132 ? 133.942 91.291  156.903 1.00 502.63 ? 129 DT  I "C5'" 1 
ATOM   8295  C "C4'" . DT  I 7  132 ? 134.623 90.895  155.609 1.00 497.65 ? 129 DT  I "C4'" 1 
ATOM   8296  O "O4'" . DT  I 7  132 ? 133.636 90.409  154.668 1.00 504.06 ? 129 DT  I "O4'" 1 
ATOM   8297  C "C3'" . DT  I 7  132 ? 135.386 92.014  154.898 1.00 488.22 ? 129 DT  I "C3'" 1 
ATOM   8298  O "O3'" . DT  I 7  132 ? 136.641 91.506  154.411 1.00 494.42 ? 129 DT  I "O3'" 1 
ATOM   8299  C "C2'" . DT  I 7  132 ? 134.472 92.406  153.746 1.00 488.44 ? 129 DT  I "C2'" 1 
ATOM   8300  C "C1'" . DT  I 7  132 ? 133.692 91.138  153.454 1.00 494.12 ? 129 DT  I "C1'" 1 
ATOM   8301  N N1    . DT  I 7  132 ? 132.298 91.366  153.023 1.00 496.96 ? 129 DT  I N1    1 
ATOM   8302  C C2    . DT  I 7  132 ? 131.962 91.159  151.701 1.00 496.37 ? 129 DT  I C2    1 
ATOM   8303  O O2    . DT  I 7  132 ? 132.764 90.795  150.855 1.00 500.02 ? 129 DT  I O2    1 
ATOM   8304  N N3    . DT  I 7  132 ? 130.642 91.396  151.403 1.00 494.27 ? 129 DT  I N3    1 
ATOM   8305  C C4    . DT  I 7  132 ? 129.651 91.809  152.272 1.00 498.62 ? 129 DT  I C4    1 
ATOM   8306  O O4    . DT  I 7  132 ? 128.501 91.979  151.869 1.00 500.92 ? 129 DT  I O4    1 
ATOM   8307  C C5    . DT  I 7  132 ? 130.076 92.005  153.636 1.00 502.32 ? 129 DT  I C5    1 
ATOM   8308  C C7    . DT  I 7  132 ? 129.077 92.460  154.646 1.00 511.93 ? 129 DT  I C7    1 
ATOM   8309  C C6    . DT  I 7  132 ? 131.357 91.777  153.937 1.00 498.46 ? 129 DT  I C6    1 
ATOM   8310  P P     . DT  I 7  133 ? 137.900 92.479  154.131 1.00 491.34 ? 130 DT  I P     1 
ATOM   8311  O OP1   . DT  I 7  133 ? 139.105 91.634  153.933 1.00 522.08 ? 130 DT  I OP1   1 
ATOM   8312  O OP2   . DT  I 7  133 ? 137.914 93.537  155.174 1.00 522.86 ? 130 DT  I OP2   1 
ATOM   8313  O "O5'" . DT  I 7  133 ? 137.534 93.159  152.738 1.00 491.72 ? 130 DT  I "O5'" 1 
ATOM   8314  C "C5'" . DT  I 7  133 ? 137.869 92.493  151.507 1.00 498.95 ? 130 DT  I "C5'" 1 
ATOM   8315  C "C4'" . DT  I 7  133 ? 137.357 93.266  150.310 1.00 485.84 ? 130 DT  I "C4'" 1 
ATOM   8316  O "O4'" . DT  I 7  133 ? 135.909 93.276  150.315 1.00 483.24 ? 130 DT  I "O4'" 1 
ATOM   8317  C "C3'" . DT  I 7  133 ? 137.794 94.734  150.225 1.00 492.81 ? 130 DT  I "C3'" 1 
ATOM   8318  O "O3'" . DT  I 7  133 ? 138.322 94.998  148.914 1.00 486.54 ? 130 DT  I "O3'" 1 
ATOM   8319  C "C2'" . DT  I 7  133 ? 136.501 95.509  150.440 1.00 482.31 ? 130 DT  I "C2'" 1 
ATOM   8320  C "C1'" . DT  I 7  133 ? 135.467 94.547  149.883 1.00 476.25 ? 130 DT  I "C1'" 1 
ATOM   8321  N N1    . DT  I 7  133 ? 134.066 94.729  150.332 1.00 474.55 ? 130 DT  I N1    1 
ATOM   8322  C C2    . DT  I 7  133 ? 133.064 94.607  149.389 1.00 475.64 ? 130 DT  I C2    1 
ATOM   8323  O O2    . DT  I 7  133 ? 133.285 94.360  148.213 1.00 479.80 ? 130 DT  I O2    1 
ATOM   8324  N N3    . DT  I 7  133 ? 131.791 94.784  149.872 1.00 471.44 ? 130 DT  I N3    1 
ATOM   8325  C C4    . DT  I 7  133 ? 131.426 95.065  151.172 1.00 475.44 ? 130 DT  I C4    1 
ATOM   8326  O O4    . DT  I 7  133 ? 130.243 95.196  151.468 1.00 478.05 ? 130 DT  I O4    1 
ATOM   8327  C C5    . DT  I 7  133 ? 132.517 95.180  152.105 1.00 477.11 ? 130 DT  I C5    1 
ATOM   8328  C C7    . DT  I 7  133 ? 132.207 95.496  153.531 1.00 484.86 ? 130 DT  I C7    1 
ATOM   8329  C C6    . DT  I 7  133 ? 133.763 95.010  151.648 1.00 476.42 ? 130 DT  I C6    1 
ATOM   8330  P P     . DA  I 7  134 ? 139.362 96.201  148.641 1.00 491.93 ? 131 DA  I P     1 
ATOM   8331  O OP1   . DA  I 7  134 ? 140.683 95.604  148.321 1.00 518.31 ? 131 DA  I OP1   1 
ATOM   8332  O OP2   . DA  I 7  134 ? 139.253 97.181  149.753 1.00 488.55 ? 131 DA  I OP2   1 
ATOM   8333  O "O5'" . DA  I 7  134 ? 138.793 96.888  147.321 1.00 487.76 ? 131 DA  I "O5'" 1 
ATOM   8334  C "C5'" . DA  I 7  134 ? 137.779 97.910  147.389 1.00 474.17 ? 131 DA  I "C5'" 1 
ATOM   8335  C "C4'" . DA  I 7  134 ? 136.566 97.493  146.592 1.00 466.45 ? 131 DA  I "C4'" 1 
ATOM   8336  O "O4'" . DA  I 7  134 ? 135.499 97.138  147.504 1.00 467.03 ? 131 DA  I "O4'" 1 
ATOM   8337  C "C3'" . DA  I 7  134 ? 135.985 98.574  145.679 1.00 453.09 ? 131 DA  I "C3'" 1 
ATOM   8338  O "O3'" . DA  I 7  134 ? 135.449 97.972  144.486 1.00 455.51 ? 131 DA  I "O3'" 1 
ATOM   8339  C "C2'" . DA  I 7  134 ? 134.864 99.142  146.529 1.00 450.17 ? 131 DA  I "C2'" 1 
ATOM   8340  C "C1'" . DA  I 7  134 ? 134.341 97.887  147.189 1.00 456.53 ? 131 DA  I "C1'" 1 
ATOM   8341  N N9    . DA  I 7  134 ? 133.569 98.089  148.415 1.00 457.67 ? 131 DA  I N9    1 
ATOM   8342  C C8    . DA  I 7  134 ? 134.025 98.249  149.698 1.00 465.36 ? 131 DA  I C8    1 
ATOM   8343  N N7    . DA  I 7  134 ? 133.070 98.407  150.583 1.00 464.76 ? 131 DA  I N7    1 
ATOM   8344  C C5    . DA  I 7  134 ? 131.907 98.346  149.830 1.00 457.73 ? 131 DA  I C5    1 
ATOM   8345  C C6    . DA  I 7  134 ? 130.549 98.444  150.172 1.00 456.32 ? 131 DA  I C6    1 
ATOM   8346  N N6    . DA  I 7  134 ? 130.107 98.632  151.414 1.00 458.65 ? 131 DA  I N6    1 
ATOM   8347  N N1    . DA  I 7  134 ? 129.640 98.342  149.177 1.00 450.81 ? 131 DA  I N1    1 
ATOM   8348  C C2    . DA  I 7  134 ? 130.080 98.157  147.931 1.00 450.77 ? 131 DA  I C2    1 
ATOM   8349  N N3    . DA  I 7  134 ? 131.327 98.048  147.485 1.00 455.49 ? 131 DA  I N3    1 
ATOM   8350  C C4    . DA  I 7  134 ? 132.202 98.153  148.496 1.00 456.02 ? 131 DA  I C4    1 
ATOM   8351  P P     . DT  I 7  135 ? 135.649 98.636  143.027 1.00 448.60 ? 132 DT  I P     1 
ATOM   8352  O OP1   . DT  I 7  135 ? 136.382 97.663  142.180 1.00 460.43 ? 132 DT  I OP1   1 
ATOM   8353  O OP2   . DT  I 7  135 ? 136.213 99.999  143.213 1.00 465.03 ? 132 DT  I OP2   1 
ATOM   8354  O "O5'" . DT  I 7  135 ? 134.174 98.805  142.422 1.00 436.06 ? 132 DT  I "O5'" 1 
ATOM   8355  C "C5'" . DT  I 7  135 ? 132.956 98.569  143.168 1.00 425.99 ? 132 DT  I "C5'" 1 
ATOM   8356  C "C4'" . DT  I 7  135 ? 131.947 99.672  142.924 1.00 417.79 ? 132 DT  I "C4'" 1 
ATOM   8357  O "O4'" . DT  I 7  135 ? 131.280 99.994  144.175 1.00 432.30 ? 132 DT  I "O4'" 1 
ATOM   8358  C "C3'" . DT  I 7  135 ? 132.519 101.007 142.445 1.00 403.35 ? 132 DT  I "C3'" 1 
ATOM   8359  O "O3'" . DT  I 7  135 ? 131.491 101.775 141.802 1.00 393.11 ? 132 DT  I "O3'" 1 
ATOM   8360  C "C2'" . DT  I 7  135 ? 132.860 101.640 143.775 1.00 405.94 ? 132 DT  I "C2'" 1 
ATOM   8361  C "C1'" . DT  I 7  135 ? 131.553 101.352 144.494 1.00 422.40 ? 132 DT  I "C1'" 1 
ATOM   8362  N N1    . DT  I 7  135 ? 131.518 101.501 145.963 1.00 434.05 ? 132 DT  I N1    1 
ATOM   8363  C C2    . DT  I 7  135 ? 130.287 101.376 146.566 1.00 435.36 ? 132 DT  I C2    1 
ATOM   8364  O O2    . DT  I 7  135 ? 129.263 101.153 145.939 1.00 430.41 ? 132 DT  I O2    1 
ATOM   8365  N N3    . DT  I 7  135 ? 130.294 101.519 147.929 1.00 438.32 ? 132 DT  I N3    1 
ATOM   8366  C C4    . DT  I 7  135 ? 131.385 101.770 148.733 1.00 447.81 ? 132 DT  I C4    1 
ATOM   8367  O O4    . DT  I 7  135 ? 131.245 101.873 149.951 1.00 458.26 ? 132 DT  I O4    1 
ATOM   8368  C C5    . DT  I 7  135 ? 132.643 101.890 148.039 1.00 448.65 ? 132 DT  I C5    1 
ATOM   8369  C C7    . DT  I 7  135 ? 133.879 102.154 148.833 1.00 465.75 ? 132 DT  I C7    1 
ATOM   8370  C C6    . DT  I 7  135 ? 132.649 101.753 146.709 1.00 440.83 ? 132 DT  I C6    1 
ATOM   8371  P P     . DG  I 7  136 ? 131.814 102.823 140.646 1.00 371.48 ? 133 DG  I P     1 
ATOM   8372  O OP1   . DG  I 7  136 ? 132.322 102.072 139.471 1.00 357.64 ? 133 DG  I OP1   1 
ATOM   8373  O OP2   . DG  I 7  136 ? 132.624 103.922 141.229 1.00 382.47 ? 133 DG  I OP2   1 
ATOM   8374  O "O5'" . DG  I 7  136 ? 130.361 103.383 140.314 1.00 369.76 ? 133 DG  I "O5'" 1 
ATOM   8375  C "C5'" . DG  I 7  136 ? 129.196 102.753 140.891 1.00 342.70 ? 133 DG  I "C5'" 1 
ATOM   8376  C "C4'" . DG  I 7  136 ? 128.292 103.787 141.521 1.00 352.59 ? 133 DG  I "C4'" 1 
ATOM   8377  O "O4'" . DG  I 7  136 ? 128.551 103.846 142.944 1.00 382.43 ? 133 DG  I "O4'" 1 
ATOM   8378  C "C3'" . DG  I 7  136 ? 128.494 105.212 141.005 1.00 352.65 ? 133 DG  I "C3'" 1 
ATOM   8379  O "O3'" . DG  I 7  136 ? 127.242 105.903 140.948 1.00 344.62 ? 133 DG  I "O3'" 1 
ATOM   8380  C "C2'" . DG  I 7  136 ? 129.398 105.829 142.054 1.00 378.99 ? 133 DG  I "C2'" 1 
ATOM   8381  C "C1'" . DG  I 7  136 ? 128.838 105.186 143.302 1.00 386.56 ? 133 DG  I "C1'" 1 
ATOM   8382  N N9    . DG  I 7  136 ? 129.730 105.165 144.454 1.00 402.95 ? 133 DG  I N9    1 
ATOM   8383  C C8    . DG  I 7  136 ? 131.104 105.133 144.458 1.00 404.72 ? 133 DG  I C8    1 
ATOM   8384  N N7    . DG  I 7  136 ? 131.611 105.126 145.660 1.00 418.71 ? 133 DG  I N7    1 
ATOM   8385  C C5    . DG  I 7  136 ? 130.506 105.157 146.499 1.00 421.49 ? 133 DG  I C5    1 
ATOM   8386  C C6    . DG  I 7  136 ? 130.426 105.165 147.916 1.00 430.72 ? 133 DG  I C6    1 
ATOM   8387  O O6    . DG  I 7  136 ? 131.347 105.143 148.741 1.00 437.41 ? 133 DG  I O6    1 
ATOM   8388  N N1    . DG  I 7  136 ? 129.105 105.199 148.352 1.00 426.59 ? 133 DG  I N1    1 
ATOM   8389  C C2    . DG  I 7  136 ? 128.004 105.223 147.533 1.00 426.58 ? 133 DG  I C2    1 
ATOM   8390  N N2    . DG  I 7  136 ? 126.812 105.256 148.143 1.00 429.56 ? 133 DG  I N2    1 
ATOM   8391  N N3    . DG  I 7  136 ? 128.065 105.215 146.213 1.00 415.44 ? 133 DG  I N3    1 
ATOM   8392  C C4    . DG  I 7  136 ? 129.338 105.181 145.768 1.00 411.83 ? 133 DG  I C4    1 
ATOM   8393  P P     . DC  I 7  137 ? 126.851 106.719 139.632 1.00 352.40 ? 134 DC  I P     1 
ATOM   8394  O OP1   . DC  I 7  137 ? 126.083 105.815 138.739 1.00 338.77 ? 134 DC  I OP1   1 
ATOM   8395  O OP2   . DC  I 7  137 ? 128.076 107.396 139.137 1.00 339.18 ? 134 DC  I OP2   1 
ATOM   8396  O "O5'" . DC  I 7  137 ? 125.877 107.856 140.165 1.00 372.91 ? 134 DC  I "O5'" 1 
ATOM   8397  C "C5'" . DC  I 7  137 ? 126.411 109.004 140.841 1.00 376.21 ? 134 DC  I "C5'" 1 
ATOM   8398  C "C4'" . DC  I 7  137 ? 126.201 108.842 142.326 1.00 385.23 ? 134 DC  I "C4'" 1 
ATOM   8399  O "O4'" . DC  I 7  137 ? 127.422 108.440 142.970 1.00 389.32 ? 134 DC  I "O4'" 1 
ATOM   8400  C "C3'" . DC  I 7  137 ? 125.744 110.098 143.063 1.00 392.48 ? 134 DC  I "C3'" 1 
ATOM   8401  O "O3'" . DC  I 7  137 ? 124.337 109.950 143.237 1.00 394.13 ? 134 DC  I "O3'" 1 
ATOM   8402  C "C2'" . DC  I 7  137 ? 126.464 110.022 144.404 1.00 399.38 ? 134 DC  I "C2'" 1 
ATOM   8403  C "C1'" . DC  I 7  137 ? 127.273 108.732 144.342 1.00 400.85 ? 134 DC  I "C1'" 1 
ATOM   8404  N N1    . DC  I 7  137 ? 128.615 108.804 144.935 1.00 407.77 ? 134 DC  I N1    1 
ATOM   8405  C C2    . DC  I 7  137 ? 128.736 108.826 146.325 1.00 417.33 ? 134 DC  I C2    1 
ATOM   8406  O O2    . DC  I 7  137 ? 127.707 108.802 147.016 1.00 416.24 ? 134 DC  I O2    1 
ATOM   8407  N N3    . DC  I 7  137 ? 129.968 108.878 146.881 1.00 415.09 ? 134 DC  I N3    1 
ATOM   8408  C C4    . DC  I 7  137 ? 131.051 108.899 146.102 1.00 416.70 ? 134 DC  I C4    1 
ATOM   8409  N N4    . DC  I 7  137 ? 132.246 108.952 146.693 1.00 420.88 ? 134 DC  I N4    1 
ATOM   8410  C C5    . DC  I 7  137 ? 130.956 108.872 144.680 1.00 407.72 ? 134 DC  I C5    1 
ATOM   8411  C C6    . DC  I 7  137 ? 129.730 108.824 144.144 1.00 397.85 ? 134 DC  I C6    1 
ATOM   8412  P P     . DA  I 7  138 ? 123.354 111.197 143.098 1.00 396.72 ? 135 DA  I P     1 
ATOM   8413  O OP1   . DA  I 7  138 ? 122.005 110.663 142.785 1.00 396.13 ? 135 DA  I OP1   1 
ATOM   8414  O OP2   . DA  I 7  138 ? 123.968 112.213 142.205 1.00 394.97 ? 135 DA  I OP2   1 
ATOM   8415  O "O5'" . DA  I 7  138 ? 123.329 111.777 144.581 1.00 400.59 ? 135 DA  I "O5'" 1 
ATOM   8416  C "C5'" . DA  I 7  138 ? 122.269 112.652 145.012 1.00 402.13 ? 135 DA  I "C5'" 1 
ATOM   8417  C "C4'" . DA  I 7  138 ? 122.315 112.849 146.510 1.00 404.76 ? 135 DA  I "C4'" 1 
ATOM   8418  O "O4'" . DA  I 7  138 ? 123.566 112.338 147.027 1.00 408.92 ? 135 DA  I "O4'" 1 
ATOM   8419  C "C3'" . DA  I 7  138 ? 122.262 114.305 146.959 1.00 405.47 ? 135 DA  I "C3'" 1 
ATOM   8420  O "O3'" . DA  I 7  138 ? 121.719 114.388 148.280 1.00 405.11 ? 135 DA  I "O3'" 1 
ATOM   8421  C "C2'" . DA  I 7  138 ? 123.727 114.695 146.978 1.00 408.75 ? 135 DA  I "C2'" 1 
ATOM   8422  C "C1'" . DA  I 7  138 ? 124.399 113.412 147.448 1.00 411.32 ? 135 DA  I "C1'" 1 
ATOM   8423  N N9    . DA  I 7  138 ? 125.727 113.194 146.880 1.00 413.74 ? 135 DA  I N9    1 
ATOM   8424  C C8    . DA  I 7  138 ? 126.117 113.328 145.571 1.00 410.59 ? 135 DA  I C8    1 
ATOM   8425  N N7    . DA  I 7  138 ? 127.385 113.066 145.367 1.00 416.44 ? 135 DA  I N7    1 
ATOM   8426  C C5    . DA  I 7  138 ? 127.861 112.731 146.627 1.00 420.75 ? 135 DA  I C5    1 
ATOM   8427  C C6    . DA  I 7  138 ? 129.134 112.350 147.086 1.00 427.42 ? 135 DA  I C6    1 
ATOM   8428  N N6    . DA  I 7  138 ? 130.203 112.233 146.295 1.00 429.05 ? 135 DA  I N6    1 
ATOM   8429  N N1    . DA  I 7  138 ? 129.273 112.090 148.404 1.00 427.57 ? 135 DA  I N1    1 
ATOM   8430  C C2    . DA  I 7  138 ? 128.201 112.208 149.197 1.00 435.24 ? 135 DA  I C2    1 
ATOM   8431  N N3    . DA  I 7  138 ? 126.956 112.558 148.885 1.00 423.31 ? 135 DA  I N3    1 
ATOM   8432  C C4    . DA  I 7  138 ? 126.852 112.808 147.568 1.00 421.83 ? 135 DA  I C4    1 
ATOM   8433  P P     . DA  I 7  139 ? 120.930 115.702 148.747 1.00 403.57 ? 136 DA  I P     1 
ATOM   8434  O OP1   . DA  I 7  139 ? 119.537 115.313 149.081 1.00 403.83 ? 136 DA  I OP1   1 
ATOM   8435  O OP2   . DA  I 7  139 ? 121.174 116.778 147.750 1.00 405.17 ? 136 DA  I OP2   1 
ATOM   8436  O "O5'" . DA  I 7  139 ? 121.667 116.112 150.096 1.00 408.18 ? 136 DA  I "O5'" 1 
ATOM   8437  C "C5'" . DA  I 7  139 ? 122.769 117.037 150.084 1.00 407.95 ? 136 DA  I "C5'" 1 
ATOM   8438  C "C4'" . DA  I 7  139 ? 123.843 116.559 151.029 1.00 410.12 ? 136 DA  I "C4'" 1 
ATOM   8439  O "O4'" . DA  I 7  139 ? 124.864 115.853 150.287 1.00 414.46 ? 136 DA  I "O4'" 1 
ATOM   8440  C "C3'" . DA  I 7  139 ? 124.561 117.659 151.809 1.00 414.02 ? 136 DA  I "C3'" 1 
ATOM   8441  O "O3'" . DA  I 7  139 ? 124.766 117.220 153.161 1.00 414.66 ? 136 DA  I "O3'" 1 
ATOM   8442  C "C2'" . DA  I 7  139 ? 125.885 117.809 151.076 1.00 420.40 ? 136 DA  I "C2'" 1 
ATOM   8443  C "C1'" . DA  I 7  139 ? 126.139 116.413 150.542 1.00 419.93 ? 136 DA  I "C1'" 1 
ATOM   8444  N N9    . DA  I 7  139 ? 126.894 116.367 149.288 1.00 422.79 ? 136 DA  I N9    1 
ATOM   8445  C C8    . DA  I 7  139 ? 126.457 116.683 148.028 1.00 419.92 ? 136 DA  I C8    1 
ATOM   8446  N N7    . DA  I 7  139 ? 127.367 116.538 147.097 1.00 424.11 ? 136 DA  I N7    1 
ATOM   8447  C C5    . DA  I 7  139 ? 128.481 116.097 147.792 1.00 426.64 ? 136 DA  I C5    1 
ATOM   8448  C C6    . DA  I 7  139 ? 129.781 115.764 147.380 1.00 429.10 ? 136 DA  I C6    1 
ATOM   8449  N N6    . DA  I 7  139 ? 130.199 115.816 146.115 1.00 436.52 ? 136 DA  I N6    1 
ATOM   8450  N N1    . DA  I 7  139 ? 130.652 115.362 148.325 1.00 436.68 ? 136 DA  I N1    1 
ATOM   8451  C C2    . DA  I 7  139 ? 130.241 115.304 149.596 1.00 438.35 ? 136 DA  I C2    1 
ATOM   8452  N N3    . DA  I 7  139 ? 129.049 115.593 150.107 1.00 433.08 ? 136 DA  I N3    1 
ATOM   8453  C C4    . DA  I 7  139 ? 128.205 115.989 149.141 1.00 428.29 ? 136 DA  I C4    1 
ATOM   8454  P P     . DA  I 7  140 ? 124.920 118.265 154.379 1.00 415.55 ? 137 DA  I P     1 
ATOM   8455  O OP1   . DA  I 7  140 ? 124.486 117.586 155.626 1.00 416.17 ? 137 DA  I OP1   1 
ATOM   8456  O OP2   . DA  I 7  140 ? 124.286 119.550 153.985 1.00 415.15 ? 137 DA  I OP2   1 
ATOM   8457  O "O5'" . DA  I 7  140 ? 126.490 118.500 154.464 1.00 423.20 ? 137 DA  I "O5'" 1 
ATOM   8458  C "C5'" . DA  I 7  140 ? 127.042 119.821 154.330 1.00 425.81 ? 137 DA  I "C5'" 1 
ATOM   8459  C "C4'" . DA  I 7  140 ? 128.541 119.758 154.475 1.00 430.80 ? 137 DA  I "C4'" 1 
ATOM   8460  O "O4'" . DA  I 7  140 ? 129.105 119.113 153.309 1.00 432.89 ? 137 DA  I "O4'" 1 
ATOM   8461  C "C3'" . DA  I 7  140 ? 129.232 121.113 154.599 1.00 432.46 ? 137 DA  I "C3'" 1 
ATOM   8462  O "O3'" . DA  I 7  140 ? 130.305 121.021 155.551 1.00 436.14 ? 137 DA  I "O3'" 1 
ATOM   8463  C "C2'" . DA  I 7  140 ? 129.754 121.372 153.194 1.00 434.49 ? 137 DA  I "C2'" 1 
ATOM   8464  C "C1'" . DA  I 7  140 ? 130.010 119.979 152.647 1.00 435.48 ? 137 DA  I "C1'" 1 
ATOM   8465  N N9    . DA  I 7  140 ? 129.779 119.850 151.209 1.00 434.76 ? 137 DA  I N9    1 
ATOM   8466  C C8    . DA  I 7  140 ? 128.598 119.981 150.523 1.00 432.42 ? 137 DA  I C8    1 
ATOM   8467  N N7    . DA  I 7  140 ? 128.712 119.807 149.229 1.00 434.54 ? 137 DA  I N7    1 
ATOM   8468  C C5    . DA  I 7  140 ? 130.060 119.541 149.051 1.00 438.00 ? 137 DA  I C5    1 
ATOM   8469  C C6    . DA  I 7  140 ? 130.833 119.271 147.907 1.00 438.43 ? 137 DA  I C6    1 
ATOM   8470  N N6    . DA  I 7  140 ? 130.346 119.211 146.667 1.00 442.72 ? 137 DA  I N6    1 
ATOM   8471  N N1    . DA  I 7  140 ? 132.152 119.055 148.083 1.00 447.19 ? 137 DA  I N1    1 
ATOM   8472  C C2    . DA  I 7  140 ? 132.656 119.113 149.319 1.00 447.54 ? 137 DA  I C2    1 
ATOM   8473  N N3    . DA  I 7  140 ? 132.036 119.359 150.466 1.00 442.74 ? 137 DA  I N3    1 
ATOM   8474  C C4    . DA  I 7  140 ? 130.728 119.568 150.262 1.00 439.00 ? 137 DA  I C4    1 
ATOM   8475  P P     . DT  I 7  141 ? 130.950 122.336 156.230 1.00 440.01 ? 138 DT  I P     1 
ATOM   8476  O OP1   . DT  I 7  141 ? 131.562 121.941 157.523 1.00 436.58 ? 138 DT  I OP1   1 
ATOM   8477  O OP2   . DT  I 7  141 ? 129.941 123.425 156.197 1.00 433.89 ? 138 DT  I OP2   1 
ATOM   8478  O "O5'" . DT  I 7  141 ? 132.121 122.721 155.222 1.00 443.17 ? 138 DT  I "O5'" 1 
ATOM   8479  C "C5'" . DT  I 7  141 ? 133.218 121.815 155.008 1.00 444.70 ? 138 DT  I "C5'" 1 
ATOM   8480  C "C4'" . DT  I 7  141 ? 134.210 122.407 154.037 1.00 447.92 ? 138 DT  I "C4'" 1 
ATOM   8481  O "O4'" . DT  I 7  141 ? 133.785 122.120 152.683 1.00 447.16 ? 138 DT  I "O4'" 1 
ATOM   8482  C "C3'" . DT  I 7  141 ? 134.392 123.927 154.119 1.00 451.72 ? 138 DT  I "C3'" 1 
ATOM   8483  O "O3'" . DT  I 7  141 ? 135.799 124.210 154.145 1.00 453.42 ? 138 DT  I "O3'" 1 
ATOM   8484  C "C2'" . DT  I 7  141 ? 133.742 124.431 152.835 1.00 451.92 ? 138 DT  I "C2'" 1 
ATOM   8485  C "C1'" . DT  I 7  141 ? 133.989 123.270 151.890 1.00 449.46 ? 138 DT  I "C1'" 1 
ATOM   8486  N N1    . DT  I 7  141 ? 133.106 123.178 150.706 1.00 449.12 ? 138 DT  I N1    1 
ATOM   8487  C C2    . DT  I 7  141 ? 133.688 122.856 149.499 1.00 450.12 ? 138 DT  I C2    1 
ATOM   8488  O O2    . DT  I 7  141 ? 134.885 122.646 149.373 1.00 453.15 ? 138 DT  I O2    1 
ATOM   8489  N N3    . DT  I 7  141 ? 132.816 122.786 148.442 1.00 449.44 ? 138 DT  I N3    1 
ATOM   8490  C C4    . DT  I 7  141 ? 131.454 123.000 148.465 1.00 447.36 ? 138 DT  I C4    1 
ATOM   8491  O O4    . DT  I 7  141 ? 130.790 122.901 147.434 1.00 449.00 ? 138 DT  I O4    1 
ATOM   8492  C C5    . DT  I 7  141 ? 130.910 123.333 149.758 1.00 444.21 ? 138 DT  I C5    1 
ATOM   8493  C C7    . DT  I 7  141 ? 129.443 123.585 149.875 1.00 442.60 ? 138 DT  I C7    1 
ATOM   8494  C C6    . DT  I 7  141 ? 131.748 123.405 150.798 1.00 444.45 ? 138 DT  I C6    1 
ATOM   8495  P P     . DA  I 7  142 ? 136.393 125.678 154.449 1.00 458.42 ? 139 DA  I P     1 
ATOM   8496  O OP1   . DA  I 7  142 ? 137.240 125.599 155.666 1.00 451.54 ? 139 DA  I OP1   1 
ATOM   8497  O OP2   . DA  I 7  142 ? 135.283 126.666 154.386 1.00 455.68 ? 139 DA  I OP2   1 
ATOM   8498  O "O5'" . DA  I 7  142 ? 137.343 125.927 153.195 1.00 459.61 ? 139 DA  I "O5'" 1 
ATOM   8499  C "C5'" . DA  I 7  142 ? 138.315 124.938 152.801 1.00 459.87 ? 139 DA  I "C5'" 1 
ATOM   8500  C "C4'" . DA  I 7  142 ? 138.902 125.278 151.452 1.00 460.48 ? 139 DA  I "C4'" 1 
ATOM   8501  O "O4'" . DA  I 7  142 ? 137.923 125.013 150.416 1.00 460.08 ? 139 DA  I "O4'" 1 
ATOM   8502  C "C3'" . DA  I 7  142 ? 139.319 126.740 151.281 1.00 463.91 ? 139 DA  I "C3'" 1 
ATOM   8503  O "O3'" . DA  I 7  142 ? 140.541 126.802 150.527 1.00 463.33 ? 139 DA  I "O3'" 1 
ATOM   8504  C "C2'" . DA  I 7  142 ? 138.154 127.331 150.502 1.00 463.08 ? 139 DA  I "C2'" 1 
ATOM   8505  C "C1'" . DA  I 7  142 ? 137.750 126.169 149.614 1.00 460.89 ? 139 DA  I "C1'" 1 
ATOM   8506  N N9    . DA  I 7  142 ? 136.360 126.212 149.158 1.00 461.28 ? 139 DA  I N9    1 
ATOM   8507  C C8    . DA  I 7  142 ? 135.233 126.492 149.890 1.00 456.53 ? 139 DA  I C8    1 
ATOM   8508  N N7    . DA  I 7  142 ? 134.124 126.454 149.192 1.00 455.75 ? 139 DA  I N7    1 
ATOM   8509  C C5    . DA  I 7  142 ? 134.550 126.128 147.914 1.00 454.69 ? 139 DA  I C5    1 
ATOM   8510  C C6    . DA  I 7  142 ? 133.855 125.936 146.712 1.00 458.35 ? 139 DA  I C6    1 
ATOM   8511  N N6    . DA  I 7  142 ? 132.532 126.053 146.608 1.00 458.21 ? 139 DA  I N6    1 
ATOM   8512  N N1    . DA  I 7  142 ? 134.573 125.619 145.613 1.00 459.20 ? 139 DA  I N1    1 
ATOM   8513  C C2    . DA  I 7  142 ? 135.902 125.506 145.734 1.00 457.75 ? 139 DA  I C2    1 
ATOM   8514  N N3    . DA  I 7  142 ? 136.667 125.662 146.809 1.00 458.97 ? 139 DA  I N3    1 
ATOM   8515  C C4    . DA  I 7  142 ? 135.922 125.976 147.879 1.00 459.25 ? 139 DA  I C4    1 
ATOM   8516  P P     . DC  I 7  143 ? 141.406 128.158 150.415 1.00 464.88 ? 140 DC  I P     1 
ATOM   8517  O OP1   . DC  I 7  143 ? 142.803 127.800 150.062 1.00 456.13 ? 140 DC  I OP1   1 
ATOM   8518  O OP2   . DC  I 7  143 ? 141.127 129.012 151.599 1.00 464.63 ? 140 DC  I OP2   1 
ATOM   8519  O "O5'" . DC  I 7  143 ? 140.742 128.947 149.196 1.00 465.00 ? 140 DC  I "O5'" 1 
ATOM   8520  C "C5'" . DC  I 7  143 ? 141.533 129.407 148.085 1.00 465.04 ? 140 DC  I "C5'" 1 
ATOM   8521  C "C4'" . DC  I 7  143 ? 141.196 128.626 146.834 1.00 465.24 ? 140 DC  I "C4'" 1 
ATOM   8522  O "O4'" . DC  I 7  143 ? 139.816 128.185 146.872 1.00 463.88 ? 140 DC  I "O4'" 1 
ATOM   8523  C "C3'" . DC  I 7  143 ? 141.356 129.426 145.541 1.00 465.48 ? 140 DC  I "C3'" 1 
ATOM   8524  O "O3'" . DC  I 7  143 ? 142.017 128.623 144.550 1.00 464.62 ? 140 DC  I "O3'" 1 
ATOM   8525  C "C2'" . DC  I 7  143 ? 139.926 129.742 145.128 1.00 467.10 ? 140 DC  I "C2'" 1 
ATOM   8526  C "C1'" . DC  I 7  143 ? 139.128 128.586 145.698 1.00 466.86 ? 140 DC  I "C1'" 1 
ATOM   8527  N N1    . DC  I 7  143 ? 137.748 128.926 146.096 1.00 466.04 ? 140 DC  I N1    1 
ATOM   8528  C C2    . DC  I 7  143 ? 136.689 128.760 145.188 1.00 466.43 ? 140 DC  I C2    1 
ATOM   8529  O O2    . DC  I 7  143 ? 136.919 128.329 144.048 1.00 467.75 ? 140 DC  I O2    1 
ATOM   8530  N N3    . DC  I 7  143 ? 135.432 129.075 145.574 1.00 466.45 ? 140 DC  I N3    1 
ATOM   8531  C C4    . DC  I 7  143 ? 135.207 129.537 146.805 1.00 464.79 ? 140 DC  I C4    1 
ATOM   8532  N N4    . DC  I 7  143 ? 133.951 129.836 147.147 1.00 468.21 ? 140 DC  I N4    1 
ATOM   8533  C C5    . DC  I 7  143 ? 136.260 129.715 147.744 1.00 464.65 ? 140 DC  I C5    1 
ATOM   8534  C C6    . DC  I 7  143 ? 137.499 129.401 147.352 1.00 464.49 ? 140 DC  I C6    1 
ATOM   8535  P P     . DA  I 7  144 ? 142.941 129.282 143.403 1.00 464.96 ? 141 DA  I P     1 
ATOM   8536  O OP1   . DA  I 7  144 ? 143.996 128.303 143.041 1.00 455.37 ? 141 DA  I OP1   1 
ATOM   8537  O OP2   . DA  I 7  144 ? 143.330 130.650 143.835 1.00 464.15 ? 141 DA  I OP2   1 
ATOM   8538  O "O5'" . DA  I 7  144 ? 141.949 129.423 142.168 1.00 467.38 ? 141 DA  I "O5'" 1 
ATOM   8539  C "C5'" . DA  I 7  144 ? 141.504 130.717 141.722 1.00 467.25 ? 141 DA  I "C5'" 1 
ATOM   8540  C "C4'" . DA  I 7  144 ? 140.406 130.550 140.699 1.00 468.40 ? 141 DA  I "C4'" 1 
ATOM   8541  O "O4'" . DA  I 7  144 ? 139.148 130.310 141.374 1.00 472.68 ? 141 DA  I "O4'" 1 
ATOM   8542  C "C3'" . DA  I 7  144 ? 140.184 131.756 139.790 1.00 469.09 ? 141 DA  I "C3'" 1 
ATOM   8543  O "O3'" . DA  I 7  144 ? 139.895 131.303 138.455 1.00 467.36 ? 141 DA  I "O3'" 1 
ATOM   8544  C "C2'" . DA  I 7  144 ? 138.983 132.450 140.416 1.00 472.72 ? 141 DA  I "C2'" 1 
ATOM   8545  C "C1'" . DA  I 7  144 ? 138.198 131.306 141.035 1.00 473.75 ? 141 DA  I "C1'" 1 
ATOM   8546  N N9    . DA  I 7  144 ? 137.474 131.660 142.258 1.00 475.78 ? 141 DA  I N9    1 
ATOM   8547  C C8    . DA  I 7  144 ? 137.995 131.986 143.483 1.00 476.76 ? 141 DA  I C8    1 
ATOM   8548  N N7    . DA  I 7  144 ? 137.092 132.256 144.392 1.00 474.36 ? 141 DA  I N7    1 
ATOM   8549  C C5    . DA  I 7  144 ? 135.891 132.096 143.720 1.00 470.74 ? 141 DA  I C5    1 
ATOM   8550  C C6    . DA  I 7  144 ? 134.555 132.237 144.126 1.00 474.83 ? 141 DA  I C6    1 
ATOM   8551  N N6    . DA  I 7  144 ? 134.186 132.584 145.357 1.00 479.16 ? 141 DA  I N6    1 
ATOM   8552  N N1    . DA  I 7  144 ? 133.593 132.008 143.211 1.00 476.94 ? 141 DA  I N1    1 
ATOM   8553  C C2    . DA  I 7  144 ? 133.958 131.661 141.973 1.00 475.67 ? 141 DA  I C2    1 
ATOM   8554  N N3    . DA  I 7  144 ? 135.177 131.495 141.472 1.00 476.28 ? 141 DA  I N3    1 
ATOM   8555  C C4    . DA  I 7  144 ? 136.111 131.731 142.405 1.00 472.47 ? 141 DA  I C4    1 
ATOM   8556  P P     . DT  I 7  145 ? 140.016 132.310 137.206 1.00 467.91 ? 142 DT  I P     1 
ATOM   8557  O OP1   . DT  I 7  145 ? 140.304 131.504 135.993 1.00 452.18 ? 142 DT  I OP1   1 
ATOM   8558  O OP2   . DT  I 7  145 ? 140.932 133.414 137.590 1.00 466.14 ? 142 DT  I OP2   1 
ATOM   8559  O "O5'" . DT  I 7  145 ? 138.540 132.898 137.074 1.00 469.46 ? 142 DT  I "O5'" 1 
ATOM   8560  C "C5'" . DT  I 7  145 ? 137.400 132.020 137.015 1.00 469.18 ? 142 DT  I "C5'" 1 
ATOM   8561  C "C4'" . DT  I 7  145 ? 136.115 132.813 136.947 1.00 468.96 ? 142 DT  I "C4'" 1 
ATOM   8562  O "O4'" . DT  I 7  145 ? 135.604 133.050 138.281 1.00 476.16 ? 142 DT  I "O4'" 1 
ATOM   8563  C "C3'" . DT  I 7  145 ? 136.222 134.187 136.278 1.00 467.17 ? 142 DT  I "C3'" 1 
ATOM   8564  O "O3'" . DT  I 7  145 ? 135.121 134.338 135.375 1.00 463.19 ? 142 DT  I "O3'" 1 
ATOM   8565  C "C2'" . DT  I 7  145 ? 136.105 135.158 137.440 1.00 469.11 ? 142 DT  I "C2'" 1 
ATOM   8566  C "C1'" . DT  I 7  145 ? 135.195 134.401 138.382 1.00 472.94 ? 142 DT  I "C1'" 1 
ATOM   8567  N N1    . DT  I 7  145 ? 135.300 134.803 139.794 1.00 476.09 ? 142 DT  I N1    1 
ATOM   8568  C C2    . DT  I 7  145 ? 134.135 135.000 140.499 1.00 478.30 ? 142 DT  I C2    1 
ATOM   8569  O O2    . DT  I 7  145 ? 133.027 134.855 140.010 1.00 475.73 ? 142 DT  I O2    1 
ATOM   8570  N N3    . DT  I 7  145 ? 134.317 135.369 141.809 1.00 477.58 ? 142 DT  I N3    1 
ATOM   8571  C C4    . DT  I 7  145 ? 135.518 135.558 142.465 1.00 480.79 ? 142 DT  I C4    1 
ATOM   8572  O O4    . DT  I 7  145 ? 135.524 135.894 143.646 1.00 482.13 ? 142 DT  I O4    1 
ATOM   8573  C C5    . DT  I 7  145 ? 136.699 135.337 141.663 1.00 481.22 ? 142 DT  I C5    1 
ATOM   8574  C C7    . DT  I 7  145 ? 138.045 135.524 142.287 1.00 482.00 ? 142 DT  I C7    1 
ATOM   8575  C C6    . DT  I 7  145 ? 136.532 134.978 140.384 1.00 481.93 ? 142 DT  I C6    1 
ATOM   8576  P P     . DC  I 7  146 ? 135.063 135.558 134.323 1.00 461.47 ? 143 DC  I P     1 
ATOM   8577  O OP1   . DC  I 7  146 ? 134.627 135.012 133.013 1.00 452.06 ? 143 DC  I OP1   1 
ATOM   8578  O OP2   . DC  I 7  146 ? 136.338 136.314 134.414 1.00 458.69 ? 143 DC  I OP2   1 
ATOM   8579  O "O5'" . DC  I 7  146 ? 133.881 136.461 134.893 1.00 453.38 ? 143 DC  I "O5'" 1 
ATOM   8580  C "C5'" . DC  I 7  146 ? 132.564 135.907 135.084 1.00 446.47 ? 143 DC  I "C5'" 1 
ATOM   8581  C "C4'" . DC  I 7  146 ? 131.660 136.895 135.786 1.00 441.54 ? 143 DC  I "C4'" 1 
ATOM   8582  O "O4'" . DC  I 7  146 ? 132.044 137.015 137.177 1.00 456.69 ? 143 DC  I "O4'" 1 
ATOM   8583  C "C3'" . DC  I 7  146 ? 131.674 138.315 135.216 1.00 433.92 ? 143 DC  I "C3'" 1 
ATOM   8584  O "O3'" . DC  I 7  146 ? 130.341 138.838 135.208 1.00 421.92 ? 143 DC  I "O3'" 1 
ATOM   8585  C "C2'" . DC  I 7  146 ? 132.524 139.083 136.212 1.00 436.04 ? 143 DC  I "C2'" 1 
ATOM   8586  C "C1'" . DC  I 7  146 ? 132.173 138.386 137.511 1.00 448.53 ? 143 DC  I "C1'" 1 
ATOM   8587  N N1    . DC  I 7  146 ? 133.188 138.500 138.568 1.00 460.89 ? 143 DC  I N1    1 
ATOM   8588  C C2    . DC  I 7  146 ? 132.767 138.694 139.886 1.00 462.98 ? 143 DC  I C2    1 
ATOM   8589  O O2    . DC  I 7  146 ? 131.553 138.771 140.123 1.00 461.53 ? 143 DC  I O2    1 
ATOM   8590  N N3    . DC  I 7  146 ? 133.692 138.791 140.868 1.00 474.87 ? 143 DC  I N3    1 
ATOM   8591  C C4    . DC  I 7  146 ? 134.990 138.702 140.572 1.00 472.17 ? 143 DC  I C4    1 
ATOM   8592  N N4    . DC  I 7  146 ? 135.867 138.810 141.572 1.00 479.03 ? 143 DC  I N4    1 
ATOM   8593  C C5    . DC  I 7  146 ? 135.447 138.503 139.237 1.00 469.71 ? 143 DC  I C5    1 
ATOM   8594  C C6    . DC  I 7  146 ? 134.520 138.408 138.275 1.00 463.70 ? 143 DC  I C6    1 
ATOM   8595  P P     . DC  I 7  147 ? 129.852 139.795 134.019 1.00 411.94 ? 144 DC  I P     1 
ATOM   8596  O OP1   . DC  I 7  147 ? 128.795 139.081 133.260 1.00 389.64 ? 144 DC  I OP1   1 
ATOM   8597  O OP2   . DC  I 7  147 ? 131.054 140.300 133.308 1.00 409.54 ? 144 DC  I OP2   1 
ATOM   8598  O "O5'" . DC  I 7  147 ? 129.176 141.011 134.797 1.00 404.84 ? 144 DC  I "O5'" 1 
ATOM   8599  C "C5'" . DC  I 7  147 ? 127.826 140.914 135.293 1.00 384.94 ? 144 DC  I "C5'" 1 
ATOM   8600  C "C4'" . DC  I 7  147 ? 127.581 141.941 136.374 1.00 376.90 ? 144 DC  I "C4'" 1 
ATOM   8601  O "O4'" . DC  I 7  147 ? 128.577 141.799 137.418 1.00 401.18 ? 144 DC  I "O4'" 1 
ATOM   8602  C "C3'" . DC  I 7  147 ? 127.659 143.398 135.913 1.00 376.27 ? 144 DC  I "C3'" 1 
ATOM   8603  O "O3'" . DC  I 7  147 ? 126.680 144.197 136.589 1.00 338.80 ? 144 DC  I "O3'" 1 
ATOM   8604  C "C2'" . DC  I 7  147 ? 129.041 143.824 136.366 1.00 388.76 ? 144 DC  I "C2'" 1 
ATOM   8605  C "C1'" . DC  I 7  147 ? 129.171 143.061 137.668 1.00 403.47 ? 144 DC  I "C1'" 1 
ATOM   8606  N N1    . DC  I 7  147 ? 130.559 142.838 138.095 1.00 433.03 ? 144 DC  I N1    1 
ATOM   8607  C C2    . DC  I 7  147 ? 130.863 142.884 139.458 1.00 443.90 ? 144 DC  I C2    1 
ATOM   8608  O O2    . DC  I 7  147 ? 129.948 143.089 140.269 1.00 447.19 ? 144 DC  I O2    1 
ATOM   8609  N N3    . DC  I 7  147 ? 132.143 142.701 139.857 1.00 461.18 ? 144 DC  I N3    1 
ATOM   8610  C C4    . DC  I 7  147 ? 133.099 142.487 138.950 1.00 452.20 ? 144 DC  I C4    1 
ATOM   8611  N N4    . DC  I 7  147 ? 134.347 142.304 139.387 1.00 468.97 ? 144 DC  I N4    1 
ATOM   8612  C C5    . DC  I 7  147 ? 132.818 142.446 137.554 1.00 444.62 ? 144 DC  I C5    1 
ATOM   8613  C C6    . DC  I 7  147 ? 131.547 142.627 137.174 1.00 435.23 ? 144 DC  I C6    1 
ATOM   8614  P P     . DT  I 7  148 ? 126.139 145.555 135.922 1.00 329.10 ? 145 DT  I P     1 
ATOM   8615  O OP1   . DT  I 7  148 ? 125.081 146.107 136.804 1.00 277.59 ? 145 DT  I OP1   1 
ATOM   8616  O OP2   . DT  I 7  148 ? 125.829 145.273 134.498 1.00 343.02 ? 145 DT  I OP2   1 
ATOM   8617  O "O5'" . DT  I 7  148 ? 127.406 146.520 135.972 1.00 359.63 ? 145 DT  I "O5'" 1 
ATOM   8618  C "C5'" . DT  I 7  148 ? 127.288 147.880 136.432 1.00 353.40 ? 145 DT  I "C5'" 1 
ATOM   8619  C "C4'" . DT  I 7  148 ? 127.019 147.909 137.919 1.00 377.98 ? 145 DT  I "C4'" 1 
ATOM   8620  O "O4'" . DT  I 7  148 ? 127.540 146.704 138.532 1.00 411.66 ? 145 DT  I "O4'" 1 
ATOM   8621  C "C3'" . DT  I 7  148 ? 127.679 149.065 138.665 1.00 399.48 ? 145 DT  I "C3'" 1 
ATOM   8622  O "O3'" . DT  I 7  148 ? 126.794 150.186 138.758 1.00 382.81 ? 145 DT  I "O3'" 1 
ATOM   8623  C "C2'" . DT  I 7  148 ? 127.946 148.468 140.032 1.00 418.57 ? 145 DT  I "C2'" 1 
ATOM   8624  C "C1'" . DT  I 7  148 ? 128.302 147.034 139.687 1.00 426.95 ? 145 DT  I "C1'" 1 
ATOM   8625  N N1    . DT  I 7  148 ? 129.725 146.830 139.363 1.00 441.40 ? 145 DT  I N1    1 
ATOM   8626  C C2    . DT  I 7  148 ? 130.624 146.761 140.402 1.00 457.02 ? 145 DT  I C2    1 
ATOM   8627  O O2    . DT  I 7  148 ? 130.299 146.859 141.574 1.00 468.46 ? 145 DT  I O2    1 
ATOM   8628  N N3    . DT  I 7  148 ? 131.928 146.568 140.017 1.00 468.03 ? 145 DT  I N3    1 
ATOM   8629  C C4    . DT  I 7  148 ? 132.408 146.439 138.728 1.00 462.42 ? 145 DT  I C4    1 
ATOM   8630  O O4    . DT  I 7  148 ? 133.609 146.273 138.536 1.00 469.93 ? 145 DT  I O4    1 
ATOM   8631  C C5    . DT  I 7  148 ? 131.409 146.523 137.688 1.00 443.03 ? 145 DT  I C5    1 
ATOM   8632  C C7    . DT  I 7  148 ? 131.836 146.403 136.259 1.00 432.96 ? 145 DT  I C7    1 
ATOM   8633  C C6    . DT  I 7  148 ? 130.135 146.716 138.053 1.00 436.25 ? 145 DT  I C6    1 
ATOM   8634  P P     . DG  I 7  149 ? 127.374 151.676 138.664 1.00 397.95 ? 146 DG  I P     1 
ATOM   8635  O OP1   . DG  I 7  149 ? 126.478 152.463 137.780 1.00 364.67 ? 146 DG  I OP1   1 
ATOM   8636  O OP2   . DG  I 7  149 ? 128.823 151.586 138.350 1.00 399.45 ? 146 DG  I OP2   1 
ATOM   8637  O "O5'" . DG  I 7  149 ? 127.213 152.218 140.154 1.00 404.53 ? 146 DG  I "O5'" 1 
ATOM   8638  C "C5'" . DG  I 7  149 ? 128.356 152.660 140.910 1.00 413.58 ? 146 DG  I "C5'" 1 
ATOM   8639  C "C4'" . DG  I 7  149 ? 128.465 151.875 142.197 1.00 419.02 ? 146 DG  I "C4'" 1 
ATOM   8640  O "O4'" . DG  I 7  149 ? 129.183 150.647 141.947 1.00 427.11 ? 146 DG  I "O4'" 1 
ATOM   8641  C "C3'" . DG  I 7  149 ? 129.240 152.575 143.309 1.00 427.01 ? 146 DG  I "C3'" 1 
ATOM   8642  O "O3'" . DG  I 7  149 ? 128.785 152.121 144.587 1.00 412.71 ? 146 DG  I "O3'" 1 
ATOM   8643  C "C2'" . DG  I 7  149 ? 130.666 152.119 143.061 1.00 435.39 ? 146 DG  I "C2'" 1 
ATOM   8644  C "C1'" . DG  I 7  149 ? 130.490 150.711 142.505 1.00 442.23 ? 146 DG  I "C1'" 1 
ATOM   8645  N N9    . DG  I 7  149 ? 131.440 150.370 141.452 1.00 450.94 ? 146 DG  I N9    1 
ATOM   8646  C C8    . DG  I 7  149 ? 131.173 150.207 140.114 1.00 442.68 ? 146 DG  I C8    1 
ATOM   8647  N N7    . DG  I 7  149 ? 132.233 149.910 139.413 1.00 452.92 ? 146 DG  I N7    1 
ATOM   8648  C C5    . DG  I 7  149 ? 133.263 149.881 140.343 1.00 463.77 ? 146 DG  I C5    1 
ATOM   8649  C C6    . DG  I 7  149 ? 134.647 149.615 140.175 1.00 477.35 ? 146 DG  I C6    1 
ATOM   8650  O O6    . DG  I 7  149 ? 135.259 149.340 139.135 1.00 475.40 ? 146 DG  I O6    1 
ATOM   8651  N N1    . DG  I 7  149 ? 135.332 149.691 141.383 1.00 490.20 ? 146 DG  I N1    1 
ATOM   8652  C C2    . DG  I 7  149 ? 134.763 149.987 142.597 1.00 488.98 ? 146 DG  I C2    1 
ATOM   8653  N N2    . DG  I 7  149 ? 135.592 150.010 143.650 1.00 497.58 ? 146 DG  I N2    1 
ATOM   8654  N N3    . DG  I 7  149 ? 133.474 150.233 142.768 1.00 474.37 ? 146 DG  I N3    1 
ATOM   8655  C C4    . DG  I 7  149 ? 132.790 150.164 141.606 1.00 465.74 ? 146 DG  I C4    1 
ATOM   8656  O "O5'" . DC  J 7  152 ? 144.549 148.405 142.088 1.00 511.29 ? 3   DC  J "O5'" 1 
ATOM   8657  C "C5'" . DC  J 7  152 ? 143.931 147.739 143.204 1.00 512.95 ? 3   DC  J "C5'" 1 
ATOM   8658  C "C4'" . DC  J 7  152 ? 142.961 148.669 143.896 1.00 513.49 ? 3   DC  J "C4'" 1 
ATOM   8659  O "O4'" . DC  J 7  152 ? 142.046 149.221 142.918 1.00 514.12 ? 3   DC  J "O4'" 1 
ATOM   8660  C "C3'" . DC  J 7  152 ? 142.081 148.000 144.950 1.00 513.37 ? 3   DC  J "C3'" 1 
ATOM   8661  O "O3'" . DC  J 7  152 ? 141.756 148.949 145.971 1.00 513.72 ? 3   DC  J "O3'" 1 
ATOM   8662  C "C2'" . DC  J 7  152 ? 140.831 147.653 144.167 1.00 510.09 ? 3   DC  J "C2'" 1 
ATOM   8663  C "C1'" . DC  J 7  152 ? 140.714 148.854 143.247 1.00 514.59 ? 3   DC  J "C1'" 1 
ATOM   8664  N N1    . DC  J 7  152 ? 139.995 148.587 141.994 1.00 510.70 ? 3   DC  J N1    1 
ATOM   8665  C C2    . DC  J 7  152 ? 138.628 148.869 141.933 1.00 506.23 ? 3   DC  J C2    1 
ATOM   8666  O O2    . DC  J 7  152 ? 138.067 149.333 142.937 1.00 510.20 ? 3   DC  J O2    1 
ATOM   8667  N N3    . DC  J 7  152 ? 137.953 148.626 140.786 1.00 505.31 ? 3   DC  J N3    1 
ATOM   8668  C C4    . DC  J 7  152 ? 138.594 148.123 139.729 1.00 503.98 ? 3   DC  J C4    1 
ATOM   8669  N N4    . DC  J 7  152 ? 137.889 147.900 138.618 1.00 499.54 ? 3   DC  J N4    1 
ATOM   8670  C C5    . DC  J 7  152 ? 139.989 147.828 139.764 1.00 510.09 ? 3   DC  J C5    1 
ATOM   8671  C C6    . DC  J 7  152 ? 140.643 148.071 140.907 1.00 510.03 ? 3   DC  J C6    1 
ATOM   8672  P P     . DA  J 7  153 ? 141.375 148.453 147.446 1.00 517.20 ? 4   DA  J P     1 
ATOM   8673  O OP1   . DA  J 7  153 ? 142.470 148.858 148.363 1.00 508.49 ? 4   DA  J OP1   1 
ATOM   8674  O OP2   . DA  J 7  153 ? 140.973 147.025 147.369 1.00 509.40 ? 4   DA  J OP2   1 
ATOM   8675  O "O5'" . DA  J 7  153 ? 140.088 149.326 147.796 1.00 510.34 ? 4   DA  J "O5'" 1 
ATOM   8676  C "C5'" . DA  J 7  153 ? 139.060 149.564 146.815 1.00 508.62 ? 4   DA  J "C5'" 1 
ATOM   8677  C "C4'" . DA  J 7  153 ? 137.794 148.835 147.200 1.00 506.94 ? 4   DA  J "C4'" 1 
ATOM   8678  O "O4'" . DA  J 7  153 ? 137.050 148.482 146.009 1.00 508.29 ? 4   DA  J "O4'" 1 
ATOM   8679  C "C3'" . DA  J 7  153 ? 138.015 147.527 147.963 1.00 502.93 ? 4   DA  J "C3'" 1 
ATOM   8680  O "O3'" . DA  J 7  153 ? 137.027 147.402 148.988 1.00 502.34 ? 4   DA  J "O3'" 1 
ATOM   8681  C "C2'" . DA  J 7  153 ? 137.805 146.462 146.903 1.00 502.62 ? 4   DA  J "C2'" 1 
ATOM   8682  C "C1'" . DA  J 7  153 ? 136.735 147.099 146.040 1.00 506.91 ? 4   DA  J "C1'" 1 
ATOM   8683  N N9    . DA  J 7  153 ? 136.700 146.617 144.662 1.00 509.53 ? 4   DA  J N9    1 
ATOM   8684  C C8    . DA  J 7  153 ? 137.732 146.097 143.922 1.00 511.43 ? 4   DA  J C8    1 
ATOM   8685  N N7    . DA  J 7  153 ? 137.389 145.752 142.704 1.00 510.68 ? 4   DA  J N7    1 
ATOM   8686  C C5    . DA  J 7  153 ? 136.038 146.062 142.640 1.00 504.40 ? 4   DA  J C5    1 
ATOM   8687  C C6    . DA  J 7  153 ? 135.086 145.933 141.614 1.00 481.17 ? 4   DA  J C6    1 
ATOM   8688  N N6    . DA  J 7  153 ? 135.361 145.434 140.407 1.00 504.77 ? 4   DA  J N6    1 
ATOM   8689  N N1    . DA  J 7  153 ? 133.823 146.333 141.876 1.00 454.32 ? 4   DA  J N1    1 
ATOM   8690  C C2    . DA  J 7  153 ? 133.546 146.829 143.088 1.00 495.48 ? 4   DA  J C2    1 
ATOM   8691  N N3    . DA  J 7  153 ? 134.354 147.002 144.132 1.00 509.79 ? 4   DA  J N3    1 
ATOM   8692  C C4    . DA  J 7  153 ? 135.600 146.594 143.839 1.00 494.31 ? 4   DA  J C4    1 
ATOM   8693  P P     . DG  J 7  154 ? 137.434 146.851 150.431 1.00 500.97 ? 5   DG  J P     1 
ATOM   8694  O OP1   . DG  J 7  154 ? 137.565 148.013 151.346 1.00 496.63 ? 5   DG  J OP1   1 
ATOM   8695  O OP2   . DG  J 7  154 ? 138.577 145.917 150.262 1.00 496.69 ? 5   DG  J OP2   1 
ATOM   8696  O "O5'" . DG  J 7  154 ? 136.155 146.006 150.863 1.00 496.30 ? 5   DG  J "O5'" 1 
ATOM   8697  C "C5'" . DG  J 7  154 ? 135.632 144.971 150.010 1.00 494.95 ? 5   DG  J "C5'" 1 
ATOM   8698  C "C4'" . DG  J 7  154 ? 134.282 145.374 149.464 1.00 492.31 ? 5   DG  J "C4'" 1 
ATOM   8699  O "O4'" . DG  J 7  154 ? 134.361 145.472 148.021 1.00 494.31 ? 5   DG  J "O4'" 1 
ATOM   8700  C "C3'" . DG  J 7  154 ? 133.163 144.375 149.750 1.00 489.21 ? 5   DG  J "C3'" 1 
ATOM   8701  O "O3'" . DG  J 7  154 ? 131.911 145.058 149.869 1.00 487.13 ? 5   DG  J "O3'" 1 
ATOM   8702  C "C2'" . DG  J 7  154 ? 133.154 143.522 148.498 1.00 489.56 ? 5   DG  J "C2'" 1 
ATOM   8703  C "C1'" . DG  J 7  154 ? 133.459 144.549 147.426 1.00 492.44 ? 5   DG  J "C1'" 1 
ATOM   8704  N N9    . DG  J 7  154 ? 134.101 143.993 146.239 1.00 494.41 ? 5   DG  J N9    1 
ATOM   8705  C C8    . DG  J 7  154 ? 135.412 143.604 146.111 1.00 501.90 ? 5   DG  J C8    1 
ATOM   8706  N N7    . DG  J 7  154 ? 135.695 143.137 144.925 1.00 499.55 ? 5   DG  J N7    1 
ATOM   8707  C C5    . DG  J 7  154 ? 134.495 143.215 144.231 1.00 486.49 ? 5   DG  J C5    1 
ATOM   8708  C C6    . DG  J 7  154 ? 134.181 142.852 142.896 1.00 493.93 ? 5   DG  J C6    1 
ATOM   8709  O O6    . DG  J 7  154 ? 134.924 142.371 142.032 1.00 490.03 ? 5   DG  J O6    1 
ATOM   8710  N N1    . DG  J 7  154 ? 132.845 143.100 142.600 1.00 488.87 ? 5   DG  J N1    1 
ATOM   8711  C C2    . DG  J 7  154 ? 131.927 143.629 143.474 1.00 487.65 ? 5   DG  J C2    1 
ATOM   8712  N N2    . DG  J 7  154 ? 130.684 143.793 142.999 1.00 481.08 ? 5   DG  J N2    1 
ATOM   8713  N N3    . DG  J 7  154 ? 132.207 143.971 144.721 1.00 496.37 ? 5   DG  J N3    1 
ATOM   8714  C C4    . DG  J 7  154 ? 133.501 143.739 145.029 1.00 484.30 ? 5   DG  J C4    1 
ATOM   8715  P P     . DG  J 7  155 ? 130.753 144.472 150.810 1.00 483.50 ? 6   DG  J P     1 
ATOM   8716  O OP1   . DG  J 7  155 ? 129.495 145.185 150.476 1.00 481.62 ? 6   DG  J OP1   1 
ATOM   8717  O OP2   . DG  J 7  155 ? 131.251 144.474 152.209 1.00 480.57 ? 6   DG  J OP2   1 
ATOM   8718  O "O5'" . DG  J 7  155 ? 130.615 142.960 150.328 1.00 479.28 ? 6   DG  J "O5'" 1 
ATOM   8719  C "C5'" . DG  J 7  155 ? 129.346 142.282 150.357 1.00 477.53 ? 6   DG  J "C5'" 1 
ATOM   8720  C "C4'" . DG  J 7  155 ? 128.654 142.396 149.018 1.00 473.78 ? 6   DG  J "C4'" 1 
ATOM   8721  O "O4'" . DG  J 7  155 ? 129.636 142.463 147.956 1.00 478.47 ? 6   DG  J "O4'" 1 
ATOM   8722  C "C3'" . DG  J 7  155 ? 127.742 141.217 148.674 1.00 471.17 ? 6   DG  J "C3'" 1 
ATOM   8723  O "O3'" . DG  J 7  155 ? 126.567 141.683 148.004 1.00 465.90 ? 6   DG  J "O3'" 1 
ATOM   8724  C "C2'" . DG  J 7  155 ? 128.589 140.385 147.731 1.00 469.78 ? 6   DG  J "C2'" 1 
ATOM   8725  C "C1'" . DG  J 7  155 ? 129.372 141.453 146.995 1.00 478.03 ? 6   DG  J "C1'" 1 
ATOM   8726  N N9    . DG  J 7  155 ? 130.650 141.001 146.458 1.00 484.77 ? 6   DG  J N9    1 
ATOM   8727  C C8    . DG  J 7  155 ? 131.832 140.859 147.143 1.00 483.67 ? 6   DG  J C8    1 
ATOM   8728  N N7    . DG  J 7  155 ? 132.814 140.441 146.392 1.00 485.20 ? 6   DG  J N7    1 
ATOM   8729  C C5    . DG  J 7  155 ? 132.243 140.287 145.136 1.00 481.10 ? 6   DG  J C5    1 
ATOM   8730  C C6    . DG  J 7  155 ? 132.819 139.862 143.912 1.00 487.86 ? 6   DG  J C6    1 
ATOM   8731  O O6    . DG  J 7  155 ? 133.983 139.509 143.689 1.00 481.19 ? 6   DG  J O6    1 
ATOM   8732  N N1    . DG  J 7  155 ? 131.881 139.848 142.884 1.00 481.42 ? 6   DG  J N1    1 
ATOM   8733  C C2    . DG  J 7  155 ? 130.562 140.211 143.013 1.00 476.07 ? 6   DG  J C2    1 
ATOM   8734  N N2    . DG  J 7  155 ? 129.817 140.140 141.901 1.00 476.94 ? 6   DG  J N2    1 
ATOM   8735  N N3    . DG  J 7  155 ? 130.016 140.616 144.147 1.00 482.94 ? 6   DG  J N3    1 
ATOM   8736  C C4    . DG  J 7  155 ? 130.908 140.630 145.160 1.00 478.59 ? 6   DG  J C4    1 
ATOM   8737  P P     . DA  J 7  156 ? 125.139 141.068 148.375 1.00 464.44 ? 7   DA  J P     1 
ATOM   8738  O OP1   . DA  J 7  156 ? 124.164 142.185 148.454 1.00 446.19 ? 7   DA  J OP1   1 
ATOM   8739  O OP2   . DA  J 7  156 ? 125.316 140.164 149.540 1.00 460.25 ? 7   DA  J OP2   1 
ATOM   8740  O "O5'" . DA  J 7  156 ? 124.785 140.185 147.097 1.00 465.14 ? 7   DA  J "O5'" 1 
ATOM   8741  C "C5'" . DA  J 7  156 ? 125.161 138.797 147.030 1.00 463.60 ? 7   DA  J "C5'" 1 
ATOM   8742  C "C4'" . DA  J 7  156 ? 125.299 138.365 145.589 1.00 463.61 ? 7   DA  J "C4'" 1 
ATOM   8743  O "O4'" . DA  J 7  156 ? 126.683 138.477 145.179 1.00 470.28 ? 7   DA  J "O4'" 1 
ATOM   8744  C "C3'" . DA  J 7  156 ? 124.889 136.917 145.317 1.00 465.81 ? 7   DA  J "C3'" 1 
ATOM   8745  O "O3'" . DA  J 7  156 ? 124.175 136.828 144.081 1.00 463.39 ? 7   DA  J "O3'" 1 
ATOM   8746  C "C2'" . DA  J 7  156 ? 126.216 136.187 145.220 1.00 467.08 ? 7   DA  J "C2'" 1 
ATOM   8747  C "C1'" . DA  J 7  156 ? 127.122 137.248 144.626 1.00 472.04 ? 7   DA  J "C1'" 1 
ATOM   8748  N N9    . DA  J 7  156 ? 128.531 137.078 144.971 1.00 471.39 ? 7   DA  J N9    1 
ATOM   8749  C C8    . DA  J 7  156 ? 129.124 137.246 146.198 1.00 484.10 ? 7   DA  J C8    1 
ATOM   8750  N N7    . DA  J 7  156 ? 130.413 137.009 146.199 1.00 481.82 ? 7   DA  J N7    1 
ATOM   8751  C C5    . DA  J 7  156 ? 130.688 136.653 144.886 1.00 488.74 ? 7   DA  J C5    1 
ATOM   8752  C C6    . DA  J 7  156 ? 131.877 136.281 144.236 1.00 484.39 ? 7   DA  J C6    1 
ATOM   8753  N N6    . DA  J 7  156 ? 133.061 136.205 144.846 1.00 483.82 ? 7   DA  J N6    1 
ATOM   8754  N N1    . DA  J 7  156 ? 131.807 135.988 142.919 1.00 483.53 ? 7   DA  J N1    1 
ATOM   8755  C C2    . DA  J 7  156 ? 130.619 136.068 142.307 1.00 476.73 ? 7   DA  J C2    1 
ATOM   8756  N N3    . DA  J 7  156 ? 129.433 136.404 142.810 1.00 479.14 ? 7   DA  J N3    1 
ATOM   8757  C C4    . DA  J 7  156 ? 129.537 136.689 144.119 1.00 483.50 ? 7   DA  J C4    1 
ATOM   8758  P P     . DT  J 7  157 ? 122.907 135.852 143.948 1.00 460.34 ? 8   DT  J P     1 
ATOM   8759  O OP1   . DT  J 7  157 ? 121.761 136.662 143.463 1.00 454.65 ? 8   DT  J OP1   1 
ATOM   8760  O OP2   . DT  J 7  157 ? 122.779 135.080 145.211 1.00 454.25 ? 8   DT  J OP2   1 
ATOM   8761  O "O5'" . DT  J 7  157 ? 123.340 134.851 142.787 1.00 463.36 ? 8   DT  J "O5'" 1 
ATOM   8762  C "C5'" . DT  J 7  157 ? 124.315 133.817 143.021 1.00 460.37 ? 8   DT  J "C5'" 1 
ATOM   8763  C "C4'" . DT  J 7  157 ? 125.299 133.768 141.876 1.00 457.28 ? 8   DT  J "C4'" 1 
ATOM   8764  O "O4'" . DT  J 7  157 ? 126.638 134.033 142.360 1.00 468.09 ? 8   DT  J "O4'" 1 
ATOM   8765  C "C3'" . DT  J 7  157 ? 125.371 132.428 141.143 1.00 452.51 ? 8   DT  J "C3'" 1 
ATOM   8766  O "O3'" . DT  J 7  157 ? 125.509 132.691 139.745 1.00 437.94 ? 8   DT  J "O3'" 1 
ATOM   8767  C "C2'" . DT  J 7  157 ? 126.638 131.796 141.691 1.00 458.28 ? 8   DT  J "C2'" 1 
ATOM   8768  C "C1'" . DT  J 7  157 ? 127.515 133.012 141.914 1.00 466.30 ? 8   DT  J "C1'" 1 
ATOM   8769  N N1    . DT  J 7  157 ? 128.561 132.836 142.935 1.00 471.95 ? 8   DT  J N1    1 
ATOM   8770  C C2    . DT  J 7  157 ? 129.819 132.458 142.522 1.00 475.13 ? 8   DT  J C2    1 
ATOM   8771  O O2    . DT  J 7  157 ? 130.105 132.257 141.354 1.00 471.97 ? 8   DT  J O2    1 
ATOM   8772  N N3    . DT  J 7  157 ? 130.736 132.326 143.535 1.00 480.48 ? 8   DT  J N3    1 
ATOM   8773  C C4    . DT  J 7  157 ? 130.525 132.530 144.886 1.00 477.52 ? 8   DT  J C4    1 
ATOM   8774  O O4    . DT  J 7  157 ? 131.447 132.371 145.680 1.00 477.57 ? 8   DT  J O4    1 
ATOM   8775  C C5    . DT  J 7  157 ? 129.184 132.928 145.246 1.00 476.84 ? 8   DT  J C5    1 
ATOM   8776  C C7    . DT  J 7  157 ? 128.860 133.168 146.686 1.00 485.50 ? 8   DT  J C7    1 
ATOM   8777  C C6    . DT  J 7  157 ? 128.281 133.058 144.265 1.00 474.06 ? 8   DT  J C6    1 
ATOM   8778  P P     . DG  J 7  158 ? 125.131 131.574 138.666 1.00 435.97 ? 9   DG  J P     1 
ATOM   8779  O OP1   . DG  J 7  158 ? 124.613 132.264 137.458 1.00 407.75 ? 9   DG  J OP1   1 
ATOM   8780  O OP2   . DG  J 7  158 ? 124.303 130.530 139.324 1.00 431.01 ? 9   DG  J OP2   1 
ATOM   8781  O "O5'" . DG  J 7  158 ? 126.543 130.929 138.307 1.00 438.29 ? 9   DG  J "O5'" 1 
ATOM   8782  C "C5'" . DG  J 7  158 ? 126.800 129.531 138.544 1.00 435.05 ? 9   DG  J "C5'" 1 
ATOM   8783  C "C4'" . DG  J 7  158 ? 128.226 129.195 138.173 1.00 431.89 ? 9   DG  J "C4'" 1 
ATOM   8784  O "O4'" . DG  J 7  158 ? 129.129 129.654 139.212 1.00 445.42 ? 9   DG  J "O4'" 1 
ATOM   8785  C "C3'" . DG  J 7  158 ? 128.524 127.710 137.983 1.00 429.80 ? 9   DG  J "C3'" 1 
ATOM   8786  O "O3'" . DG  J 7  158 ? 129.445 127.564 136.887 1.00 418.43 ? 9   DG  J "O3'" 1 
ATOM   8787  C "C2'" . DG  J 7  158 ? 129.154 127.316 139.311 1.00 438.20 ? 9   DG  J "C2'" 1 
ATOM   8788  C "C1'" . DG  J 7  158 ? 129.909 128.572 139.706 1.00 443.04 ? 9   DG  J "C1'" 1 
ATOM   8789  N N9    . DG  J 7  158 ? 130.058 128.763 141.149 1.00 458.15 ? 9   DG  J N9    1 
ATOM   8790  C C8    . DG  J 7  158 ? 129.054 129.032 142.045 1.00 458.84 ? 9   DG  J C8    1 
ATOM   8791  N N7    . DG  J 7  158 ? 129.476 129.158 143.270 1.00 464.73 ? 9   DG  J N7    1 
ATOM   8792  C C5    . DG  J 7  158 ? 130.845 128.962 143.185 1.00 463.69 ? 9   DG  J C5    1 
ATOM   8793  C C6    . DG  J 7  158 ? 131.833 128.981 144.202 1.00 465.85 ? 9   DG  J C6    1 
ATOM   8794  O O6    . DG  J 7  158 ? 131.680 129.185 145.413 1.00 469.24 ? 9   DG  J O6    1 
ATOM   8795  N N1    . DG  J 7  158 ? 133.102 128.735 143.691 1.00 466.26 ? 9   DG  J N1    1 
ATOM   8796  C C2    . DG  J 7  158 ? 133.382 128.498 142.368 1.00 464.33 ? 9   DG  J C2    1 
ATOM   8797  N N2    . DG  J 7  158 ? 134.670 128.276 142.059 1.00 469.43 ? 9   DG  J N2    1 
ATOM   8798  N N3    . DG  J 7  158 ? 132.467 128.476 141.409 1.00 460.80 ? 9   DG  J N3    1 
ATOM   8799  C C4    . DG  J 7  158 ? 131.225 128.716 141.883 1.00 459.63 ? 9   DG  J C4    1 
ATOM   8800  P P     . DT  J 7  159 ? 129.765 126.131 136.217 1.00 415.18 ? 10  DT  J P     1 
ATOM   8801  O OP1   . DT  J 7  159 ? 130.102 126.349 134.788 1.00 370.84 ? 10  DT  J OP1   1 
ATOM   8802  O OP2   . DT  J 7  159 ? 128.678 125.185 136.583 1.00 414.38 ? 10  DT  J OP2   1 
ATOM   8803  O "O5'" . DT  J 7  159 ? 131.086 125.693 136.990 1.00 423.63 ? 10  DT  J "O5'" 1 
ATOM   8804  C "C5'" . DT  J 7  159 ? 131.692 124.407 136.779 1.00 431.34 ? 10  DT  J "C5'" 1 
ATOM   8805  C "C4'" . DT  J 7  159 ? 133.096 124.416 137.338 1.00 439.70 ? 10  DT  J "C4'" 1 
ATOM   8806  O "O4'" . DT  J 7  159 ? 133.086 125.145 138.587 1.00 447.84 ? 10  DT  J "O4'" 1 
ATOM   8807  C "C3'" . DT  J 7  159 ? 133.692 123.036 137.632 1.00 443.94 ? 10  DT  J "C3'" 1 
ATOM   8808  O "O3'" . DT  J 7  159 ? 135.017 122.944 137.080 1.00 449.36 ? 10  DT  J "O3'" 1 
ATOM   8809  C "C2'" . DT  J 7  159 ? 133.733 122.965 139.153 1.00 447.93 ? 10  DT  J "C2'" 1 
ATOM   8810  C "C1'" . DT  J 7  159 ? 133.762 124.417 139.590 1.00 454.79 ? 10  DT  J "C1'" 1 
ATOM   8811  N N1    . DT  J 7  159 ? 133.060 124.679 140.861 1.00 454.14 ? 10  DT  J N1    1 
ATOM   8812  C C2    . DT  J 7  159 ? 133.801 124.892 142.003 1.00 456.04 ? 10  DT  J C2    1 
ATOM   8813  O O2    . DT  J 7  159 ? 135.022 124.877 142.019 1.00 458.57 ? 10  DT  J O2    1 
ATOM   8814  N N3    . DT  J 7  159 ? 133.055 125.126 143.132 1.00 459.13 ? 10  DT  J N3    1 
ATOM   8815  C C4    . DT  J 7  159 ? 131.676 125.167 143.228 1.00 457.56 ? 10  DT  J C4    1 
ATOM   8816  O O4    . DT  J 7  159 ? 131.132 125.389 144.306 1.00 456.37 ? 10  DT  J O4    1 
ATOM   8817  C C5    . DT  J 7  159 ? 130.968 124.936 141.994 1.00 455.18 ? 10  DT  J C5    1 
ATOM   8818  C C7    . DT  J 7  159 ? 129.476 124.963 142.004 1.00 454.46 ? 10  DT  J C7    1 
ATOM   8819  C C6    . DT  J 7  159 ? 131.685 124.707 140.889 1.00 456.57 ? 10  DT  J C6    1 
ATOM   8820  P P     . DA  J 7  160 ? 135.754 121.518 136.879 1.00 454.90 ? 11  DA  J P     1 
ATOM   8821  O OP1   . DA  J 7  160 ? 136.792 121.675 135.830 1.00 434.99 ? 11  DA  J OP1   1 
ATOM   8822  O OP2   . DA  J 7  160 ? 134.711 120.470 136.729 1.00 451.13 ? 11  DA  J OP2   1 
ATOM   8823  O "O5'" . DA  J 7  160 ? 136.489 121.275 138.273 1.00 454.92 ? 11  DA  J "O5'" 1 
ATOM   8824  C "C5'" . DA  J 7  160 ? 137.735 121.937 138.561 1.00 456.74 ? 11  DA  J "C5'" 1 
ATOM   8825  C "C4'" . DA  J 7  160 ? 138.166 121.696 139.992 1.00 459.05 ? 11  DA  J "C4'" 1 
ATOM   8826  O "O4'" . DA  J 7  160 ? 137.118 122.110 140.901 1.00 459.33 ? 11  DA  J "O4'" 1 
ATOM   8827  C "C3'" . DA  J 7  160 ? 138.502 120.244 140.351 1.00 461.15 ? 11  DA  J "C3'" 1 
ATOM   8828  O "O3'" . DA  J 7  160 ? 139.767 120.215 141.036 1.00 460.40 ? 11  DA  J "O3'" 1 
ATOM   8829  C "C2'" . DA  J 7  160 ? 137.357 119.828 141.270 1.00 461.88 ? 11  DA  J "C2'" 1 
ATOM   8830  C "C1'" . DA  J 7  160 ? 136.964 121.140 141.920 1.00 460.38 ? 11  DA  J "C1'" 1 
ATOM   8831  N N9    . DA  J 7  160 ? 135.581 121.191 142.400 1.00 462.37 ? 11  DA  J N9    1 
ATOM   8832  C C8    . DA  J 7  160 ? 134.437 120.871 141.715 1.00 457.59 ? 11  DA  J C8    1 
ATOM   8833  N N7    . DA  J 7  160 ? 133.339 121.019 142.413 1.00 456.91 ? 11  DA  J N7    1 
ATOM   8834  C C5    . DA  J 7  160 ? 133.787 121.464 143.644 1.00 459.27 ? 11  DA  J C5    1 
ATOM   8835  C C6    . DA  J 7  160 ? 133.114 121.806 144.826 1.00 457.80 ? 11  DA  J C6    1 
ATOM   8836  N N6    . DA  J 7  160 ? 131.791 121.748 144.971 1.00 453.59 ? 11  DA  J N6    1 
ATOM   8837  N N1    . DA  J 7  160 ? 133.859 122.213 145.874 1.00 458.73 ? 11  DA  J N1    1 
ATOM   8838  C C2    . DA  J 7  160 ? 135.187 122.270 145.734 1.00 460.49 ? 11  DA  J C2    1 
ATOM   8839  N N3    . DA  J 7  160 ? 135.934 121.977 144.675 1.00 461.66 ? 11  DA  J N3    1 
ATOM   8840  C C4    . DA  J 7  160 ? 135.166 121.575 143.651 1.00 457.92 ? 11  DA  J C4    1 
ATOM   8841  P P     . DT  J 7  161 ? 140.515 118.833 141.409 1.00 461.31 ? 12  DT  J P     1 
ATOM   8842  O OP1   . DT  J 7  161 ? 141.979 119.072 141.372 1.00 459.00 ? 12  DT  J OP1   1 
ATOM   8843  O OP2   . DT  J 7  161 ? 139.925 117.744 140.588 1.00 459.37 ? 12  DT  J OP2   1 
ATOM   8844  O "O5'" . DT  J 7  161 ? 140.084 118.600 142.926 1.00 462.49 ? 12  DT  J "O5'" 1 
ATOM   8845  C "C5'" . DT  J 7  161 ? 140.321 119.625 143.911 1.00 463.84 ? 12  DT  J "C5'" 1 
ATOM   8846  C "C4'" . DT  J 7  161 ? 139.857 119.176 145.278 1.00 463.52 ? 12  DT  J "C4'" 1 
ATOM   8847  O "O4'" . DT  J 7  161 ? 138.433 119.412 145.412 1.00 463.29 ? 12  DT  J "O4'" 1 
ATOM   8848  C "C3'" . DT  J 7  161 ? 140.075 117.693 145.589 1.00 462.45 ? 12  DT  J "C3'" 1 
ATOM   8849  O "O3'" . DT  J 7  161 ? 140.573 117.556 146.927 1.00 462.46 ? 12  DT  J "O3'" 1 
ATOM   8850  C "C2'" . DT  J 7  161 ? 138.677 117.107 145.480 1.00 462.28 ? 12  DT  J "C2'" 1 
ATOM   8851  C "C1'" . DT  J 7  161 ? 137.830 118.265 145.976 1.00 459.97 ? 12  DT  J "C1'" 1 
ATOM   8852  N N1    . DT  J 7  161 ? 136.399 118.254 145.596 1.00 461.97 ? 12  DT  J N1    1 
ATOM   8853  C C2    . DT  J 7  161 ? 135.479 118.615 146.558 1.00 459.52 ? 12  DT  J C2    1 
ATOM   8854  O O2    . DT  J 7  161 ? 135.796 118.937 147.692 1.00 456.43 ? 12  DT  J O2    1 
ATOM   8855  N N3    . DT  J 7  161 ? 134.171 118.586 146.145 1.00 458.44 ? 12  DT  J N3    1 
ATOM   8856  C C4    . DT  J 7  161 ? 133.692 118.240 144.900 1.00 461.07 ? 12  DT  J C4    1 
ATOM   8857  O O4    . DT  J 7  161 ? 132.480 118.263 144.673 1.00 457.58 ? 12  DT  J O4    1 
ATOM   8858  C C5    . DT  J 7  161 ? 134.707 117.873 143.940 1.00 458.85 ? 12  DT  J C5    1 
ATOM   8859  C C7    . DT  J 7  161 ? 134.287 117.477 142.563 1.00 464.95 ? 12  DT  J C7    1 
ATOM   8860  C C6    . DT  J 7  161 ? 135.988 117.897 144.328 1.00 457.44 ? 12  DT  J C6    1 
ATOM   8861  P P     . DT  J 7  162 ? 141.544 116.340 147.349 1.00 462.02 ? 13  DT  J P     1 
ATOM   8862  O OP1   . DT  J 7  162 ? 142.921 116.869 147.504 1.00 464.42 ? 13  DT  J OP1   1 
ATOM   8863  O OP2   . DT  J 7  162 ? 141.295 115.197 146.431 1.00 459.95 ? 13  DT  J OP2   1 
ATOM   8864  O "O5'" . DT  J 7  162 ? 140.995 115.938 148.788 1.00 464.05 ? 13  DT  J "O5'" 1 
ATOM   8865  C "C5'" . DT  J 7  162 ? 139.841 115.088 148.920 1.00 465.57 ? 13  DT  J "C5'" 1 
ATOM   8866  C "C4'" . DT  J 7  162 ? 138.893 115.647 149.958 1.00 458.40 ? 13  DT  J "C4'" 1 
ATOM   8867  O "O4'" . DT  J 7  162 ? 137.720 116.193 149.307 1.00 458.20 ? 13  DT  J "O4'" 1 
ATOM   8868  C "C3'" . DT  J 7  162 ? 138.382 114.639 150.988 1.00 458.70 ? 13  DT  J "C3'" 1 
ATOM   8869  O "O3'" . DT  J 7  162 ? 138.343 115.263 152.281 1.00 462.61 ? 13  DT  J "O3'" 1 
ATOM   8870  C "C2'" . DT  J 7  162 ? 136.983 114.309 150.488 1.00 453.64 ? 13  DT  J "C2'" 1 
ATOM   8871  C "C1'" . DT  J 7  162 ? 136.543 115.602 149.833 1.00 453.45 ? 13  DT  J "C1'" 1 
ATOM   8872  N N1    . DT  J 7  162 ? 135.595 115.418 148.718 1.00 455.42 ? 13  DT  J N1    1 
ATOM   8873  C C2    . DT  J 7  162 ? 134.250 115.600 148.955 1.00 453.03 ? 13  DT  J C2    1 
ATOM   8874  O O2    . DT  J 7  162 ? 133.800 115.908 150.048 1.00 450.62 ? 13  DT  J O2    1 
ATOM   8875  N N3    . DT  J 7  162 ? 133.447 115.409 147.858 1.00 448.41 ? 13  DT  J N3    1 
ATOM   8876  C C4    . DT  J 7  162 ? 133.841 115.061 146.581 1.00 450.98 ? 13  DT  J C4    1 
ATOM   8877  O O4    . DT  J 7  162 ? 133.005 114.924 145.686 1.00 452.08 ? 13  DT  J O4    1 
ATOM   8878  C C5    . DT  J 7  162 ? 135.263 114.887 146.409 1.00 453.97 ? 13  DT  J C5    1 
ATOM   8879  C C7    . DT  J 7  162 ? 135.792 114.502 145.066 1.00 458.59 ? 13  DT  J C7    1 
ATOM   8880  C C6    . DT  J 7  162 ? 136.055 115.071 147.469 1.00 452.05 ? 13  DT  J C6    1 
ATOM   8881  P P     . DT  J 7  163 ? 138.268 114.392 153.637 1.00 472.71 ? 14  DT  J P     1 
ATOM   8882  O OP1   . DT  J 7  163 ? 138.762 115.229 154.758 1.00 452.69 ? 14  DT  J OP1   1 
ATOM   8883  O OP2   . DT  J 7  163 ? 138.887 113.066 153.379 1.00 481.77 ? 14  DT  J OP2   1 
ATOM   8884  O "O5'" . DT  J 7  163 ? 136.702 114.176 153.823 1.00 469.85 ? 14  DT  J "O5'" 1 
ATOM   8885  C "C5'" . DT  J 7  163 ? 136.170 112.878 154.140 1.00 469.48 ? 14  DT  J "C5'" 1 
ATOM   8886  C "C4'" . DT  J 7  163 ? 134.688 112.986 154.407 1.00 458.92 ? 14  DT  J "C4'" 1 
ATOM   8887  O "O4'" . DT  J 7  163 ? 134.005 113.316 153.175 1.00 454.34 ? 14  DT  J "O4'" 1 
ATOM   8888  C "C3'" . DT  J 7  163 ? 134.029 111.722 154.956 1.00 452.98 ? 14  DT  J "C3'" 1 
ATOM   8889  O "O3'" . DT  J 7  163 ? 133.188 112.067 156.069 1.00 452.84 ? 14  DT  J "O3'" 1 
ATOM   8890  C "C2'" . DT  J 7  163 ? 133.194 111.201 153.797 1.00 448.23 ? 14  DT  J "C2'" 1 
ATOM   8891  C "C1'" . DT  J 7  163 ? 132.925 112.430 152.952 1.00 448.70 ? 14  DT  J "C1'" 1 
ATOM   8892  N N1    . DT  J 7  163 ? 132.855 112.175 151.500 1.00 445.94 ? 14  DT  J N1    1 
ATOM   8893  C C2    . DT  J 7  163 ? 131.622 112.199 150.886 1.00 440.63 ? 14  DT  J C2    1 
ATOM   8894  O O2    . DT  J 7  163 ? 130.578 112.418 151.483 1.00 443.00 ? 14  DT  J O2    1 
ATOM   8895  N N3    . DT  J 7  163 ? 131.654 111.954 149.536 1.00 437.18 ? 14  DT  J N3    1 
ATOM   8896  C C4    . DT  J 7  163 ? 132.761 111.693 148.756 1.00 441.51 ? 14  DT  J C4    1 
ATOM   8897  O O4    . DT  J 7  163 ? 132.638 111.493 147.548 1.00 441.29 ? 14  DT  J O4    1 
ATOM   8898  C C5    . DT  J 7  163 ? 134.017 111.682 149.464 1.00 443.87 ? 14  DT  J C5    1 
ATOM   8899  C C7    . DT  J 7  163 ? 135.269 111.402 148.700 1.00 449.51 ? 14  DT  J C7    1 
ATOM   8900  C C6    . DT  J 7  163 ? 134.002 111.921 150.781 1.00 445.58 ? 14  DT  J C6    1 
ATOM   8901  P P     . DG  J 7  164 ? 132.972 111.063 157.315 1.00 450.74 ? 15  DG  J P     1 
ATOM   8902  O OP1   . DG  J 7  164 ? 132.292 111.816 158.398 1.00 447.01 ? 15  DG  J OP1   1 
ATOM   8903  O OP2   . DG  J 7  164 ? 134.265 110.388 157.600 1.00 474.14 ? 15  DG  J OP2   1 
ATOM   8904  O "O5'" . DG  J 7  164 ? 131.959 109.971 156.741 1.00 450.03 ? 15  DG  J "O5'" 1 
ATOM   8905  C "C5'" . DG  J 7  164 ? 130.851 109.497 157.536 1.00 449.96 ? 15  DG  J "C5'" 1 
ATOM   8906  C "C4'" . DG  J 7  164 ? 129.552 109.616 156.767 1.00 446.28 ? 15  DG  J "C4'" 1 
ATOM   8907  O "O4'" . DG  J 7  164 ? 129.835 109.844 155.363 1.00 447.64 ? 15  DG  J "O4'" 1 
ATOM   8908  C "C3'" . DG  J 7  164 ? 128.649 108.382 156.790 1.00 444.81 ? 15  DG  J "C3'" 1 
ATOM   8909  O "O3'" . DG  J 7  164 ? 127.278 108.808 156.678 1.00 441.44 ? 15  DG  J "O3'" 1 
ATOM   8910  C "C2'" . DG  J 7  164 ? 129.092 107.650 155.537 1.00 445.09 ? 15  DG  J "C2'" 1 
ATOM   8911  C "C1'" . DG  J 7  164 ? 129.241 108.816 154.582 1.00 443.02 ? 15  DG  J "C1'" 1 
ATOM   8912  N N9    . DG  J 7  164 ? 130.122 108.593 153.442 1.00 445.38 ? 15  DG  J N9    1 
ATOM   8913  C C8    . DG  J 7  164 ? 131.474 108.363 153.481 1.00 444.65 ? 15  DG  J C8    1 
ATOM   8914  N N7    . DG  J 7  164 ? 132.002 108.208 152.300 1.00 443.17 ? 15  DG  J N7    1 
ATOM   8915  C C5    . DG  J 7  164 ? 130.935 108.344 151.430 1.00 443.19 ? 15  DG  J C5    1 
ATOM   8916  C C6    . DG  J 7  164 ? 130.901 108.274 150.019 1.00 432.86 ? 15  DG  J C6    1 
ATOM   8917  O O6    . DG  J 7  164 ? 131.847 108.073 149.247 1.00 437.40 ? 15  DG  J O6    1 
ATOM   8918  N N1    . DG  J 7  164 ? 129.613 108.467 149.527 1.00 438.98 ? 15  DG  J N1    1 
ATOM   8919  C C2    . DG  J 7  164 ? 128.500 108.698 150.301 1.00 435.81 ? 15  DG  J C2    1 
ATOM   8920  N N2    . DG  J 7  164 ? 127.339 108.861 149.643 1.00 432.28 ? 15  DG  J N2    1 
ATOM   8921  N N3    . DG  J 7  164 ? 128.523 108.767 151.624 1.00 440.10 ? 15  DG  J N3    1 
ATOM   8922  C C4    . DG  J 7  164 ? 129.765 108.581 152.117 1.00 442.54 ? 15  DG  J C4    1 
ATOM   8923  P P     . DC  J 7  165 ? 126.050 107.885 157.172 1.00 437.54 ? 16  DC  J P     1 
ATOM   8924  O OP1   . DC  J 7  165 ? 125.111 108.723 157.964 1.00 431.64 ? 16  DC  J OP1   1 
ATOM   8925  O OP2   . DC  J 7  165 ? 126.600 106.628 157.747 1.00 452.61 ? 16  DC  J OP2   1 
ATOM   8926  O "O5'" . DC  J 7  165 ? 125.324 107.416 155.827 1.00 435.88 ? 16  DC  J "O5'" 1 
ATOM   8927  C "C5'" . DC  J 7  165 ? 124.033 107.950 155.455 1.00 433.33 ? 16  DC  J "C5'" 1 
ATOM   8928  C "C4'" . DC  J 7  165 ? 123.487 107.236 154.235 1.00 432.19 ? 16  DC  J "C4'" 1 
ATOM   8929  O "O4'" . DC  J 7  165 ? 124.546 107.071 153.260 1.00 436.02 ? 16  DC  J "O4'" 1 
ATOM   8930  C "C3'" . DC  J 7  165 ? 122.939 105.829 154.498 1.00 433.46 ? 16  DC  J "C3'" 1 
ATOM   8931  O "O3'" . DC  J 7  165 ? 121.799 105.567 153.656 1.00 433.86 ? 16  DC  J "O3'" 1 
ATOM   8932  C "C2'" . DC  J 7  165 ? 124.098 104.944 154.091 1.00 435.08 ? 16  DC  J "C2'" 1 
ATOM   8933  C "C1'" . DC  J 7  165 ? 124.649 105.705 152.898 1.00 433.32 ? 16  DC  J "C1'" 1 
ATOM   8934  N N1    . DC  J 7  165 ? 126.058 105.456 152.524 1.00 438.59 ? 16  DC  J N1    1 
ATOM   8935  C C2    . DC  J 7  165 ? 126.393 105.463 151.165 1.00 438.33 ? 16  DC  J C2    1 
ATOM   8936  O O2    . DC  J 7  165 ? 125.502 105.673 150.326 1.00 437.70 ? 16  DC  J O2    1 
ATOM   8937  N N3    . DC  J 7  165 ? 127.675 105.240 150.790 1.00 437.17 ? 16  DC  J N3    1 
ATOM   8938  C C4    . DC  J 7  165 ? 128.608 105.017 151.719 1.00 444.72 ? 16  DC  J C4    1 
ATOM   8939  N N4    . DC  J 7  165 ? 129.862 104.801 151.317 1.00 451.98 ? 16  DC  J N4    1 
ATOM   8940  C C5    . DC  J 7  165 ? 128.300 105.003 153.105 1.00 447.64 ? 16  DC  J C5    1 
ATOM   8941  C C6    . DC  J 7  165 ? 127.030 105.224 153.462 1.00 438.03 ? 16  DC  J C6    1 
ATOM   8942  P P     . DA  J 7  166 ? 120.311 105.341 154.248 1.00 436.62 ? 17  DA  J P     1 
ATOM   8943  O OP1   . DA  J 7  166 ? 119.442 106.425 153.716 1.00 434.78 ? 17  DA  J OP1   1 
ATOM   8944  O OP2   . DA  J 7  166 ? 120.399 105.131 155.718 1.00 433.34 ? 17  DA  J OP2   1 
ATOM   8945  O "O5'" . DA  J 7  166 ? 119.819 103.966 153.597 1.00 432.59 ? 17  DA  J "O5'" 1 
ATOM   8946  C "C5'" . DA  J 7  166 ? 120.728 102.910 153.220 1.00 431.94 ? 17  DA  J "C5'" 1 
ATOM   8947  C "C4'" . DA  J 7  166 ? 120.841 102.867 151.717 1.00 429.44 ? 17  DA  J "C4'" 1 
ATOM   8948  O "O4'" . DA  J 7  166 ? 122.199 103.166 151.320 1.00 432.72 ? 17  DA  J "O4'" 1 
ATOM   8949  C "C3'" . DA  J 7  166 ? 120.489 101.532 151.071 1.00 427.20 ? 17  DA  J "C3'" 1 
ATOM   8950  O "O3'" . DA  J 7  166 ? 119.782 101.788 149.847 1.00 426.48 ? 17  DA  J "O3'" 1 
ATOM   8951  C "C2'" . DA  J 7  166 ? 121.850 100.899 150.812 1.00 430.36 ? 17  DA  J "C2'" 1 
ATOM   8952  C "C1'" . DA  J 7  166 ? 122.748 102.100 150.567 1.00 430.54 ? 17  DA  J "C1'" 1 
ATOM   8953  N N9    . DA  J 7  166 ? 124.128 101.948 151.024 1.00 436.63 ? 17  DA  J N9    1 
ATOM   8954  C C8    . DA  J 7  166 ? 124.572 101.851 152.316 1.00 434.47 ? 17  DA  J C8    1 
ATOM   8955  N N7    . DA  J 7  166 ? 125.870 101.726 152.425 1.00 437.85 ? 17  DA  J N7    1 
ATOM   8956  C C5    . DA  J 7  166 ? 126.313 101.739 151.115 1.00 440.28 ? 17  DA  J C5    1 
ATOM   8957  C C6    . DA  J 7  166 ? 127.595 101.646 150.559 1.00 440.06 ? 17  DA  J C6    1 
ATOM   8958  N N6    . DA  J 7  166 ? 128.705 101.511 151.287 1.00 445.73 ? 17  DA  J N6    1 
ATOM   8959  N N1    . DA  J 7  166 ? 127.700 101.693 149.215 1.00 436.02 ? 17  DA  J N1    1 
ATOM   8960  C C2    . DA  J 7  166 ? 126.581 101.827 148.495 1.00 436.78 ? 17  DA  J C2    1 
ATOM   8961  N N3    . DA  J 7  166 ? 125.321 101.928 148.903 1.00 435.94 ? 17  DA  J N3    1 
ATOM   8962  C C4    . DA  J 7  166 ? 125.253 101.876 150.240 1.00 439.66 ? 17  DA  J C4    1 
ATOM   8963  P P     . DT  J 7  167 ? 118.798 100.689 149.198 1.00 422.50 ? 18  DT  J P     1 
ATOM   8964  O OP1   . DT  J 7  167 ? 117.853 101.385 148.291 1.00 425.65 ? 18  DT  J OP1   1 
ATOM   8965  O OP2   . DT  J 7  167 ? 118.272 99.831  150.293 1.00 423.17 ? 18  DT  J OP2   1 
ATOM   8966  O "O5'" . DT  J 7  167 ? 119.790 99.815  148.315 1.00 424.78 ? 18  DT  J "O5'" 1 
ATOM   8967  C "C5'" . DT  J 7  167 ? 120.601 100.439 147.301 1.00 424.76 ? 18  DT  J "C5'" 1 
ATOM   8968  C "C4'" . DT  J 7  167 ? 121.595 99.451  146.748 1.00 425.36 ? 18  DT  J "C4'" 1 
ATOM   8969  O "O4'" . DT  J 7  167 ? 122.846 99.558  147.471 1.00 429.95 ? 18  DT  J "O4'" 1 
ATOM   8970  C "C3'" . DT  J 7  167 ? 121.161 97.987  146.849 1.00 428.37 ? 18  DT  J "C3'" 1 
ATOM   8971  O "O3'" . DT  J 7  167 ? 121.292 97.365  145.563 1.00 429.86 ? 18  DT  J "O3'" 1 
ATOM   8972  C "C2'" . DT  J 7  167 ? 122.142 97.391  147.849 1.00 431.97 ? 18  DT  J "C2'" 1 
ATOM   8973  C "C1'" . DT  J 7  167 ? 123.372 98.259  147.631 1.00 431.14 ? 18  DT  J "C1'" 1 
ATOM   8974  N N1    . DT  J 7  167 ? 124.389 98.283  148.714 1.00 433.84 ? 18  DT  J N1    1 
ATOM   8975  C C2    . DT  J 7  167 ? 125.718 98.373  148.346 1.00 439.91 ? 18  DT  J C2    1 
ATOM   8976  O O2    . DT  J 7  167 ? 126.084 98.436  147.183 1.00 443.66 ? 18  DT  J O2    1 
ATOM   8977  N N3    . DT  J 7  167 ? 126.609 98.390  149.392 1.00 443.58 ? 18  DT  J N3    1 
ATOM   8978  C C4    . DT  J 7  167 ? 126.317 98.326  150.738 1.00 442.86 ? 18  DT  J C4    1 
ATOM   8979  O O4    . DT  J 7  167 ? 127.218 98.351  151.577 1.00 448.74 ? 18  DT  J O4    1 
ATOM   8980  C C5    . DT  J 7  167 ? 124.914 98.234  151.054 1.00 438.07 ? 18  DT  J C5    1 
ATOM   8981  C C7    . DT  J 7  167 ? 124.505 98.160  152.490 1.00 442.03 ? 18  DT  J C7    1 
ATOM   8982  C C6    . DT  J 7  167 ? 124.034 98.216  150.047 1.00 433.93 ? 18  DT  J C6    1 
ATOM   8983  P P     . DA  J 7  168 ? 120.352 96.129  145.119 1.00 429.92 ? 19  DA  J P     1 
ATOM   8984  O OP1   . DA  J 7  168 ? 119.106 96.664  144.508 1.00 429.91 ? 19  DA  J OP1   1 
ATOM   8985  O OP2   . DA  J 7  168 ? 120.267 95.180  146.266 1.00 428.24 ? 19  DA  J OP2   1 
ATOM   8986  O "O5'" . DA  J 7  168 ? 121.214 95.436  143.972 1.00 435.29 ? 19  DA  J "O5'" 1 
ATOM   8987  C "C5'" . DA  J 7  168 ? 122.379 94.661  144.313 1.00 435.91 ? 19  DA  J "C5'" 1 
ATOM   8988  C "C4'" . DA  J 7  168 ? 123.609 95.203  143.620 1.00 439.48 ? 19  DA  J "C4'" 1 
ATOM   8989  O "O4'" . DA  J 7  168 ? 124.312 96.086  144.520 1.00 443.10 ? 19  DA  J "O4'" 1 
ATOM   8990  C "C3'" . DA  J 7  168 ? 124.608 94.130  143.196 1.00 443.19 ? 19  DA  J "C3'" 1 
ATOM   8991  O "O3'" . DA  J 7  168 ? 124.491 93.904  141.779 1.00 444.45 ? 19  DA  J "O3'" 1 
ATOM   8992  C "C2'" . DA  J 7  168 ? 125.973 94.712  143.533 1.00 449.69 ? 19  DA  J "C2'" 1 
ATOM   8993  C "C1'" . DA  J 7  168 ? 125.699 95.796  144.558 1.00 450.76 ? 19  DA  J "C1'" 1 
ATOM   8994  N N9    . DA  J 7  168 ? 126.029 95.450  145.937 1.00 452.09 ? 19  DA  J N9    1 
ATOM   8995  C C8    . DA  J 7  168 ? 125.163 95.212  146.972 1.00 446.56 ? 19  DA  J C8    1 
ATOM   8996  N N7    . DA  J 7  168 ? 125.754 94.931  148.104 1.00 453.01 ? 19  DA  J N7    1 
ATOM   8997  C C5    . DA  J 7  168 ? 127.101 94.987  147.793 1.00 459.26 ? 19  DA  J C5    1 
ATOM   8998  C C6    . DA  J 7  168 ? 128.247 94.783  148.568 1.00 463.40 ? 19  DA  J C6    1 
ATOM   8999  N N6    . DA  J 7  168 ? 128.201 94.472  149.859 1.00 468.30 ? 19  DA  J N6    1 
ATOM   9000  N N1    . DA  J 7  168 ? 129.449 94.909  147.963 1.00 466.99 ? 19  DA  J N1    1 
ATOM   9001  C C2    . DA  J 7  168 ? 129.470 95.222  146.663 1.00 466.84 ? 19  DA  J C2    1 
ATOM   9002  N N3    . DA  J 7  168 ? 128.458 95.439  145.827 1.00 463.56 ? 19  DA  J N3    1 
ATOM   9003  C C4    . DA  J 7  168 ? 127.287 95.303  146.463 1.00 460.59 ? 19  DA  J C4    1 
ATOM   9004  P P     . DA  J 7  169 ? 124.622 92.418  141.187 1.00 447.70 ? 20  DA  J P     1 
ATOM   9005  O OP1   . DA  J 7  169 ? 124.423 92.489  139.718 1.00 439.83 ? 20  DA  J OP1   1 
ATOM   9006  O OP2   . DA  J 7  169 ? 123.764 91.522  142.004 1.00 444.25 ? 20  DA  J OP2   1 
ATOM   9007  O "O5'" . DA  J 7  169 ? 126.146 92.047  141.469 1.00 453.74 ? 20  DA  J "O5'" 1 
ATOM   9008  C "C5'" . DA  J 7  169 ? 127.196 92.512  140.600 1.00 455.06 ? 20  DA  J "C5'" 1 
ATOM   9009  C "C4'" . DA  J 7  169 ? 128.547 92.222  141.210 1.00 464.44 ? 20  DA  J "C4'" 1 
ATOM   9010  O "O4'" . DA  J 7  169 ? 128.528 92.562  142.617 1.00 468.27 ? 20  DA  J "O4'" 1 
ATOM   9011  C "C3'" . DA  J 7  169 ? 128.983 90.758  141.130 1.00 467.50 ? 20  DA  J "C3'" 1 
ATOM   9012  O "O3'" . DA  J 7  169 ? 130.373 90.649  140.791 1.00 475.89 ? 20  DA  J "O3'" 1 
ATOM   9013  C "C2'" . DA  J 7  169 ? 128.666 90.216  142.513 1.00 471.36 ? 20  DA  J "C2'" 1 
ATOM   9014  C "C1'" . DA  J 7  169 ? 128.847 91.428  143.411 1.00 473.75 ? 20  DA  J "C1'" 1 
ATOM   9015  N N9    . DA  J 7  169 ? 127.974 91.444  144.585 1.00 472.56 ? 20  DA  J N9    1 
ATOM   9016  C C8    . DA  J 7  169 ? 126.601 91.460  144.605 1.00 467.53 ? 20  DA  J C8    1 
ATOM   9017  N N7    . DA  J 7  169 ? 126.090 91.475  145.812 1.00 470.33 ? 20  DA  J N7    1 
ATOM   9018  C C5    . DA  J 7  169 ? 127.201 91.465  146.644 1.00 472.80 ? 20  DA  J C5    1 
ATOM   9019  C C6    . DA  J 7  169 ? 127.334 91.466  148.044 1.00 478.60 ? 20  DA  J C6    1 
ATOM   9020  N N6    . DA  J 7  169 ? 126.299 91.484  148.887 1.00 484.25 ? 20  DA  J N6    1 
ATOM   9021  N N1    . DA  J 7  169 ? 128.584 91.450  148.556 1.00 485.96 ? 20  DA  J N1    1 
ATOM   9022  C C2    . DA  J 7  169 ? 129.622 91.433  147.710 1.00 485.78 ? 20  DA  J C2    1 
ATOM   9023  N N3    . DA  J 7  169 ? 129.624 91.430  146.379 1.00 481.63 ? 20  DA  J N3    1 
ATOM   9024  C C4    . DA  J 7  169 ? 128.368 91.445  145.902 1.00 474.87 ? 20  DA  J C4    1 
ATOM   9025  P P     . DC  J 7  170 ? 130.900 89.371  139.998 1.00 473.91 ? 21  DC  J P     1 
ATOM   9026  O OP1   . DC  J 7  170 ? 131.717 89.793  138.832 1.00 474.97 ? 21  DC  J OP1   1 
ATOM   9027  O OP2   . DC  J 7  170 ? 129.738 88.463  139.812 1.00 475.21 ? 21  DC  J OP2   1 
ATOM   9028  O "O5'" . DC  J 7  170 ? 131.836 88.601  141.028 1.00 483.55 ? 21  DC  J "O5'" 1 
ATOM   9029  C "C5'" . DC  J 7  170 ? 131.387 87.407  141.694 1.00 485.23 ? 21  DC  J "C5'" 1 
ATOM   9030  C "C4'" . DC  J 7  170 ? 132.090 87.274  143.025 1.00 494.10 ? 21  DC  J "C4'" 1 
ATOM   9031  O "O4'" . DC  J 7  170 ? 131.313 87.941  144.045 1.00 496.71 ? 21  DC  J "O4'" 1 
ATOM   9032  C "C3'" . DC  J 7  170 ? 132.288 85.832  143.497 1.00 498.66 ? 21  DC  J "C3'" 1 
ATOM   9033  O "O3'" . DC  J 7  170 ? 133.657 85.621  143.879 1.00 508.53 ? 21  DC  J "O3'" 1 
ATOM   9034  C "C2'" . DC  J 7  170 ? 131.367 85.700  144.701 1.00 497.72 ? 21  DC  J "C2'" 1 
ATOM   9035  C "C1'" . DC  J 7  170 ? 131.225 87.125  145.197 1.00 497.27 ? 21  DC  J "C1'" 1 
ATOM   9036  N N1    . DC  J 7  170 ? 129.935 87.425  145.845 1.00 494.30 ? 21  DC  J N1    1 
ATOM   9037  C C2    . DC  J 7  170 ? 129.880 87.567  147.236 1.00 503.27 ? 21  DC  J C2    1 
ATOM   9038  O O2    . DC  J 7  170 ? 130.917 87.433  147.901 1.00 509.10 ? 21  DC  J O2    1 
ATOM   9039  N N3    . DC  J 7  170 ? 128.698 87.846  147.830 1.00 500.03 ? 21  DC  J N3    1 
ATOM   9040  C C4    . DC  J 7  170 ? 127.597 87.984  147.090 1.00 493.81 ? 21  DC  J C4    1 
ATOM   9041  N N4    . DC  J 7  170 ? 126.448 88.260  147.714 1.00 495.24 ? 21  DC  J N4    1 
ATOM   9042  C C5    . DC  J 7  170 ? 127.624 87.844  145.674 1.00 486.78 ? 21  DC  J C5    1 
ATOM   9043  C C6    . DC  J 7  170 ? 128.800 87.568  145.100 1.00 487.55 ? 21  DC  J C6    1 
ATOM   9044  P P     . DA  J 7  171 ? 134.401 84.274  143.371 1.00 512.42 ? 22  DA  J P     1 
ATOM   9045  O OP1   . DA  J 7  171 ? 135.769 84.648  142.934 1.00 539.38 ? 22  DA  J OP1   1 
ATOM   9046  O OP2   . DA  J 7  171 ? 133.496 83.578  142.423 1.00 509.68 ? 22  DA  J OP2   1 
ATOM   9047  O "O5'" . DA  J 7  171 ? 134.518 83.378  144.687 1.00 509.32 ? 22  DA  J "O5'" 1 
ATOM   9048  C "C5'" . DA  J 7  171 ? 133.769 82.149  144.902 1.00 511.90 ? 22  DA  J "C5'" 1 
ATOM   9049  C "C4'" . DA  J 7  171 ? 133.548 82.020  146.390 1.00 509.04 ? 22  DA  J "C4'" 1 
ATOM   9050  O "O4'" . DA  J 7  171 ? 132.677 83.112  146.753 1.00 505.42 ? 22  DA  J "O4'" 1 
ATOM   9051  C "C3'" . DA  J 7  171 ? 132.904 80.766  146.984 1.00 493.60 ? 22  DA  J "C3'" 1 
ATOM   9052  O "O3'" . DA  J 7  171 ? 133.947 79.921  147.510 1.00 498.01 ? 22  DA  J "O3'" 1 
ATOM   9053  C "C2'" . DA  J 7  171 ? 132.095 81.303  148.167 1.00 491.17 ? 22  DA  J "C2'" 1 
ATOM   9054  C "C1'" . DA  J 7  171 ? 131.943 82.796  147.919 1.00 495.11 ? 22  DA  J "C1'" 1 
ATOM   9055  N N9    . DA  J 7  171 ? 130.562 83.232  147.717 1.00 497.19 ? 22  DA  J N9    1 
ATOM   9056  C C8    . DA  J 7  171 ? 129.780 83.183  146.592 1.00 495.59 ? 22  DA  J C8    1 
ATOM   9057  N N7    . DA  J 7  171 ? 128.569 83.655  146.770 1.00 492.85 ? 22  DA  J N7    1 
ATOM   9058  C C5    . DA  J 7  171 ? 128.556 84.042  148.104 1.00 498.46 ? 22  DA  J C5    1 
ATOM   9059  C C6    . DA  J 7  171 ? 127.565 84.620  148.917 1.00 504.10 ? 22  DA  J C6    1 
ATOM   9060  N N6    . DA  J 7  171 ? 126.342 84.922  148.491 1.00 502.70 ? 22  DA  J N6    1 
ATOM   9061  N N1    . DA  J 7  171 ? 127.879 84.878  150.205 1.00 508.21 ? 22  DA  J N1    1 
ATOM   9062  C C2    . DA  J 7  171 ? 129.107 84.575  150.636 1.00 522.05 ? 22  DA  J C2    1 
ATOM   9063  N N3    . DA  J 7  171 ? 130.121 84.028  149.972 1.00 519.89 ? 22  DA  J N3    1 
ATOM   9064  C C4    . DA  J 7  171 ? 129.772 83.775  148.699 1.00 502.15 ? 22  DA  J C4    1 
ATOM   9065  P P     . DA  J 7  172 ? 133.949 78.324  147.238 1.00 480.18 ? 23  DA  J P     1 
ATOM   9066  O OP1   . DA  J 7  172 ? 134.895 77.680  148.184 1.00 489.93 ? 23  DA  J OP1   1 
ATOM   9067  O OP2   . DA  J 7  172 ? 134.114 78.112  145.778 1.00 491.39 ? 23  DA  J OP2   1 
ATOM   9068  O "O5'" . DA  J 7  172 ? 132.464 77.890  147.627 1.00 475.27 ? 23  DA  J "O5'" 1 
ATOM   9069  C "C5'" . DA  J 7  172 ? 132.100 77.641  148.997 1.00 478.32 ? 23  DA  J "C5'" 1 
ATOM   9070  C "C4'" . DA  J 7  172 ? 131.194 76.437  149.102 1.00 475.54 ? 23  DA  J "C4'" 1 
ATOM   9071  O "O4'" . DA  J 7  172 ? 129.826 76.877  149.225 1.00 464.59 ? 23  DA  J "O4'" 1 
ATOM   9072  C "C3'" . DA  J 7  172 ? 131.194 75.489  147.909 1.00 465.70 ? 23  DA  J "C3'" 1 
ATOM   9073  O "O3'" . DA  J 7  172 ? 130.832 74.175  148.363 1.00 464.11 ? 23  DA  J "O3'" 1 
ATOM   9074  C "C2'" . DA  J 7  172 ? 130.121 76.084  147.004 1.00 456.61 ? 23  DA  J "C2'" 1 
ATOM   9075  C "C1'" . DA  J 7  172 ? 129.155 76.751  147.977 1.00 455.62 ? 23  DA  J "C1'" 1 
ATOM   9076  N N9    . DA  J 7  172 ? 128.710 78.092  147.608 1.00 458.91 ? 23  DA  J N9    1 
ATOM   9077  C C8    . DA  J 7  172 ? 129.362 79.056  146.878 1.00 465.89 ? 23  DA  J C8    1 
ATOM   9078  N N7    . DA  J 7  172 ? 128.676 80.159  146.729 1.00 467.44 ? 23  DA  J N7    1 
ATOM   9079  C C5    . DA  J 7  172 ? 127.495 79.909  147.406 1.00 465.34 ? 23  DA  J C5    1 
ATOM   9080  C C6    . DA  J 7  172 ? 126.345 80.683  147.626 1.00 470.49 ? 23  DA  J C6    1 
ATOM   9081  N N6    . DA  J 7  172 ? 126.182 81.923  147.166 1.00 474.67 ? 23  DA  J N6    1 
ATOM   9082  N N1    . DA  J 7  172 ? 125.345 80.132  148.344 1.00 470.01 ? 23  DA  J N1    1 
ATOM   9083  C C2    . DA  J 7  172 ? 125.499 78.888  148.805 1.00 473.05 ? 23  DA  J C2    1 
ATOM   9084  N N3    . DA  J 7  172 ? 126.528 78.064  148.666 1.00 464.66 ? 23  DA  J N3    1 
ATOM   9085  C C4    . DA  J 7  172 ? 127.505 78.640  147.949 1.00 457.44 ? 23  DA  J C4    1 
ATOM   9086  P P     . DA  J 7  173 ? 130.915 72.877  147.409 1.00 456.98 ? 24  DA  J P     1 
ATOM   9087  O OP1   . DA  J 7  173 ? 131.374 71.729  148.230 1.00 475.90 ? 24  DA  J OP1   1 
ATOM   9088  O OP2   . DA  J 7  173 ? 131.653 73.239  146.172 1.00 449.83 ? 24  DA  J OP2   1 
ATOM   9089  O "O5'" . DA  J 7  173 ? 129.391 72.636  147.011 1.00 444.57 ? 24  DA  J "O5'" 1 
ATOM   9090  C "C5'" . DA  J 7  173 ? 128.348 72.790  147.994 1.00 449.81 ? 24  DA  J "C5'" 1 
ATOM   9091  C "C4'" . DA  J 7  173 ? 127.083 72.107  147.542 1.00 439.96 ? 24  DA  J "C4'" 1 
ATOM   9092  O "O4'" . DA  J 7  173 ? 126.063 73.099  147.307 1.00 451.47 ? 24  DA  J "O4'" 1 
ATOM   9093  C "C3'" . DA  J 7  173 ? 127.212 71.280  146.267 1.00 423.51 ? 24  DA  J "C3'" 1 
ATOM   9094  O "O3'" . DA  J 7  173 ? 126.576 70.010  146.478 1.00 416.40 ? 24  DA  J "O3'" 1 
ATOM   9095  C "C2'" . DA  J 7  173 ? 126.495 72.090  145.192 1.00 414.42 ? 24  DA  J "C2'" 1 
ATOM   9096  C "C1'" . DA  J 7  173 ? 125.723 73.174  145.932 1.00 421.61 ? 24  DA  J "C1'" 1 
ATOM   9097  N N9    . DA  J 7  173 ? 125.997 74.543  145.481 1.00 427.81 ? 24  DA  J N9    1 
ATOM   9098  C C8    . DA  J 7  173 ? 127.139 75.054  144.911 1.00 429.01 ? 24  DA  J C8    1 
ATOM   9099  N N7    . DA  J 7  173 ? 127.060 76.329  144.618 1.00 431.56 ? 24  DA  J N7    1 
ATOM   9100  C C5    . DA  J 7  173 ? 125.784 76.684  145.021 1.00 433.11 ? 24  DA  J C5    1 
ATOM   9101  C C6    . DA  J 7  173 ? 125.090 77.901  144.975 1.00 434.85 ? 24  DA  J C6    1 
ATOM   9102  N N6    . DA  J 7  173 ? 125.595 79.037  144.494 1.00 438.63 ? 24  DA  J N6    1 
ATOM   9103  N N1    . DA  J 7  173 ? 123.832 77.916  145.457 1.00 433.26 ? 24  DA  J N1    1 
ATOM   9104  C C2    . DA  J 7  173 ? 123.316 76.782  145.944 1.00 440.61 ? 24  DA  J C2    1 
ATOM   9105  N N3    . DA  J 7  173 ? 123.866 75.578  146.038 1.00 436.47 ? 24  DA  J N3    1 
ATOM   9106  C C4    . DA  J 7  173 ? 125.118 75.596  145.551 1.00 431.83 ? 24  DA  J C4    1 
ATOM   9107  P P     . DG  J 7  174 ? 126.762 68.771  145.461 1.00 409.24 ? 25  DG  J P     1 
ATOM   9108  O OP1   . DG  J 7  174 ? 126.739 67.517  146.255 1.00 406.39 ? 25  DG  J OP1   1 
ATOM   9109  O OP2   . DG  J 7  174 ? 127.913 69.051  144.563 1.00 404.17 ? 25  DG  J OP2   1 
ATOM   9110  O "O5'" . DG  J 7  174 ? 125.432 68.831  144.587 1.00 399.59 ? 25  DG  J "O5'" 1 
ATOM   9111  C "C5'" . DG  J 7  174 ? 124.136 68.828  145.219 1.00 399.20 ? 25  DG  J "C5'" 1 
ATOM   9112  C "C4'" . DG  J 7  174 ? 123.079 69.297  144.249 1.00 393.22 ? 25  DG  J "C4'" 1 
ATOM   9113  O "O4'" . DG  J 7  174 ? 123.185 70.735  144.076 1.00 401.17 ? 25  DG  J "O4'" 1 
ATOM   9114  C "C3'" . DG  J 7  174 ? 123.173 68.698  142.842 1.00 381.23 ? 25  DG  J "C3'" 1 
ATOM   9115  O "O3'" . DG  J 7  174 ? 121.855 68.445  142.342 1.00 368.51 ? 25  DG  J "O3'" 1 
ATOM   9116  C "C2'" . DG  J 7  174 ? 123.806 69.822  142.050 1.00 384.26 ? 25  DG  J "C2'" 1 
ATOM   9117  C "C1'" . DG  J 7  174 ? 123.127 71.014  142.690 1.00 385.91 ? 25  DG  J "C1'" 1 
ATOM   9118  N N9    . DG  J 7  174 ? 123.745 72.309  142.420 1.00 396.77 ? 25  DG  J N9    1 
ATOM   9119  C C8    . DG  J 7  174 ? 125.040 72.566  142.039 1.00 393.74 ? 25  DG  J C8    1 
ATOM   9120  N N7    . DG  J 7  174 ? 125.282 73.836  141.872 1.00 394.52 ? 25  DG  J N7    1 
ATOM   9121  C C5    . DG  J 7  174 ? 124.076 74.455  142.160 1.00 397.67 ? 25  DG  J C5    1 
ATOM   9122  C C6    . DG  J 7  174 ? 123.725 75.826  142.150 1.00 393.09 ? 25  DG  J C6    1 
ATOM   9123  O O6    . DG  J 7  174 ? 124.440 76.797  141.874 1.00 394.90 ? 25  DG  J O6    1 
ATOM   9124  N N1    . DG  J 7  174 ? 122.394 76.016  142.507 1.00 391.26 ? 25  DG  J N1    1 
ATOM   9125  C C2    . DG  J 7  174 ? 121.516 75.011  142.832 1.00 388.96 ? 25  DG  J C2    1 
ATOM   9126  N N2    . DG  J 7  174 ? 120.267 75.383  143.152 1.00 404.68 ? 25  DG  J N2    1 
ATOM   9127  N N3    . DG  J 7  174 ? 121.834 73.729  142.843 1.00 388.76 ? 25  DG  J N3    1 
ATOM   9128  C C4    . DG  J 7  174 ? 123.120 73.526  142.500 1.00 394.70 ? 25  DG  J C4    1 
ATOM   9129  P P     . DG  J 7  175 ? 121.350 66.973  141.935 1.00 362.07 ? 26  DG  J P     1 
ATOM   9130  O OP1   . DG  J 7  175 ? 121.391 66.102  143.136 1.00 370.73 ? 26  DG  J OP1   1 
ATOM   9131  O OP2   . DG  J 7  175 ? 122.068 66.566  140.698 1.00 358.52 ? 26  DG  J OP2   1 
ATOM   9132  O "O5'" . DG  J 7  175 ? 119.826 67.246  141.562 1.00 357.35 ? 26  DG  J "O5'" 1 
ATOM   9133  C "C5'" . DG  J 7  175 ? 118.924 67.780  142.554 1.00 357.08 ? 26  DG  J "C5'" 1 
ATOM   9134  C "C4'" . DG  J 7  175 ? 117.949 68.762  141.944 1.00 347.77 ? 26  DG  J "C4'" 1 
ATOM   9135  O "O4'" . DG  J 7  175 ? 118.586 70.058  141.788 1.00 350.84 ? 26  DG  J "O4'" 1 
ATOM   9136  C "C3'" . DG  J 7  175 ? 117.402 68.394  140.564 1.00 343.62 ? 26  DG  J "C3'" 1 
ATOM   9137  O "O3'" . DG  J 7  175 ? 116.021 68.792  140.502 1.00 337.07 ? 26  DG  J "O3'" 1 
ATOM   9138  C "C2'" . DG  J 7  175 ? 118.272 69.221  139.634 1.00 340.60 ? 26  DG  J "C2'" 1 
ATOM   9139  C "C1'" . DG  J 7  175 ? 118.477 70.489  140.440 1.00 339.68 ? 26  DG  J "C1'" 1 
ATOM   9140  N N9    . DG  J 7  175 ? 119.687 71.232  140.089 1.00 347.02 ? 26  DG  J N9    1 
ATOM   9141  C C8    . DG  J 7  175 ? 120.943 70.723  139.869 1.00 353.77 ? 26  DG  J C8    1 
ATOM   9142  N N7    . DG  J 7  175 ? 121.823 71.638  139.569 1.00 356.92 ? 26  DG  J N7    1 
ATOM   9143  C C5    . DG  J 7  175 ? 121.107 72.822  139.590 1.00 351.87 ? 26  DG  J C5    1 
ATOM   9144  C C6    . DG  J 7  175 ? 121.530 74.151  139.343 1.00 351.63 ? 26  DG  J C6    1 
ATOM   9145  O O6    . DG  J 7  175 ? 122.663 74.549  139.049 1.00 352.26 ? 26  DG  J O6    1 
ATOM   9146  N N1    . DG  J 7  175 ? 120.482 75.055  139.470 1.00 347.59 ? 26  DG  J N1    1 
ATOM   9147  C C2    . DG  J 7  175 ? 119.189 74.721  139.793 1.00 347.19 ? 26  DG  J C2    1 
ATOM   9148  N N2    . DG  J 7  175 ? 118.309 75.733  139.871 1.00 351.66 ? 26  DG  J N2    1 
ATOM   9149  N N3    . DG  J 7  175 ? 118.784 73.483  140.028 1.00 343.12 ? 26  DG  J N3    1 
ATOM   9150  C C4    . DG  J 7  175 ? 119.787 72.590  139.908 1.00 349.46 ? 26  DG  J C4    1 
ATOM   9151  P P     . DC  J 7  176 ? 115.075 68.453  139.241 1.00 330.56 ? 27  DC  J P     1 
ATOM   9152  O OP1   . DC  J 7  176 ? 113.769 67.953  139.739 1.00 328.04 ? 27  DC  J OP1   1 
ATOM   9153  O OP2   . DC  J 7  176 ? 115.853 67.671  138.244 1.00 331.96 ? 27  DC  J OP2   1 
ATOM   9154  O "O5'" . DC  J 7  176 ? 114.853 69.866  138.538 1.00 323.59 ? 27  DC  J "O5'" 1 
ATOM   9155  C "C5'" . DC  J 7  176 ? 114.438 71.009  139.309 1.00 330.68 ? 27  DC  J "C5'" 1 
ATOM   9156  C "C4'" . DC  J 7  176 ? 114.384 72.241  138.437 1.00 310.01 ? 27  DC  J "C4'" 1 
ATOM   9157  O "O4'" . DC  J 7  176 ? 115.715 72.791  138.295 1.00 315.97 ? 27  DC  J "O4'" 1 
ATOM   9158  C "C3'" . DC  J 7  176 ? 113.862 72.005  137.018 1.00 303.67 ? 27  DC  J "C3'" 1 
ATOM   9159  O "O3'" . DC  J 7  176 ? 112.947 73.060  136.685 1.00 295.33 ? 27  DC  J "O3'" 1 
ATOM   9160  C "C2'" . DC  J 7  176 ? 115.126 72.055  136.170 1.00 302.71 ? 27  DC  J "C2'" 1 
ATOM   9161  C "C1'" . DC  J 7  176 ? 115.982 73.050  136.929 1.00 306.20 ? 27  DC  J "C1'" 1 
ATOM   9162  N N1    . DC  J 7  176 ? 117.438 72.930  136.723 1.00 314.38 ? 27  DC  J N1    1 
ATOM   9163  C C2    . DC  J 7  176 ? 118.179 74.079  136.414 1.00 310.16 ? 27  DC  J C2    1 
ATOM   9164  O O2    . DC  J 7  176 ? 117.600 75.171  136.317 1.00 305.32 ? 27  DC  J O2    1 
ATOM   9165  N N3    . DC  J 7  176 ? 119.511 73.979  136.226 1.00 311.80 ? 27  DC  J N3    1 
ATOM   9166  C C4    . DC  J 7  176 ? 120.113 72.795  136.335 1.00 318.22 ? 27  DC  J C4    1 
ATOM   9167  N N4    . DC  J 7  176 ? 121.431 72.739  136.142 1.00 318.52 ? 27  DC  J N4    1 
ATOM   9168  C C5    . DC  J 7  176 ? 119.389 71.611  136.646 1.00 324.50 ? 27  DC  J C5    1 
ATOM   9169  C C6    . DC  J 7  176 ? 118.069 71.722  136.830 1.00 320.50 ? 27  DC  J C6    1 
ATOM   9170  P P     . DC  J 7  177 ? 112.104 73.080  135.311 1.00 284.08 ? 28  DC  J P     1 
ATOM   9171  O OP1   . DC  J 7  177 ? 110.681 73.358  135.625 1.00 296.15 ? 28  DC  J OP1   1 
ATOM   9172  O OP2   . DC  J 7  177 ? 112.482 71.902  134.487 1.00 293.30 ? 28  DC  J OP2   1 
ATOM   9173  O "O5'" . DC  J 7  177 ? 112.714 74.322  134.519 1.00 280.64 ? 28  DC  J "O5'" 1 
ATOM   9174  C "C5'" . DC  J 7  177 ? 113.147 75.496  135.234 1.00 283.21 ? 28  DC  J "C5'" 1 
ATOM   9175  C "C4'" . DC  J 7  177 ? 113.444 76.627  134.281 1.00 271.61 ? 28  DC  J "C4'" 1 
ATOM   9176  O "O4'" . DC  J 7  177 ? 114.872 76.750  134.091 1.00 271.83 ? 28  DC  J "O4'" 1 
ATOM   9177  C "C3'" . DC  J 7  177 ? 112.832 76.470  132.894 1.00 265.74 ? 28  DC  J "C3'" 1 
ATOM   9178  O "O3'" . DC  J 7  177 ? 112.342 77.748  132.462 1.00 262.44 ? 28  DC  J "O3'" 1 
ATOM   9179  C "C2'" . DC  J 7  177 ? 113.986 75.982  132.026 1.00 258.28 ? 28  DC  J "C2'" 1 
ATOM   9180  C "C1'" . DC  J 7  177 ? 115.241 76.446  132.755 1.00 260.29 ? 28  DC  J "C1'" 1 
ATOM   9181  N N1    . DC  J 7  177 ? 116.329 75.450  132.823 1.00 265.78 ? 28  DC  J N1    1 
ATOM   9182  C C2    . DC  J 7  177 ? 117.643 75.858  132.555 1.00 263.40 ? 28  DC  J C2    1 
ATOM   9183  O O2    . DC  J 7  177 ? 117.867 77.042  132.264 1.00 262.60 ? 28  DC  J O2    1 
ATOM   9184  N N3    . DC  J 7  177 ? 118.645 74.954  132.618 1.00 266.09 ? 28  DC  J N3    1 
ATOM   9185  C C4    . DC  J 7  177 ? 118.380 73.686  132.933 1.00 274.24 ? 28  DC  J C4    1 
ATOM   9186  N N4    . DC  J 7  177 ? 119.397 72.823  132.983 1.00 272.69 ? 28  DC  J N4    1 
ATOM   9187  C C5    . DC  J 7  177 ? 117.059 73.242  133.208 1.00 276.34 ? 28  DC  J C5    1 
ATOM   9188  C C6    . DC  J 7  177 ? 116.074 74.145  133.144 1.00 272.85 ? 28  DC  J C6    1 
ATOM   9189  P P     . DT  J 7  178 ? 111.366 77.915  131.188 1.00 252.41 ? 29  DT  J P     1 
ATOM   9190  O OP1   . DT  J 7  178 ? 110.470 79.071  131.435 1.00 262.84 ? 29  DT  J OP1   1 
ATOM   9191  O OP2   . DT  J 7  178 ? 110.779 76.590  130.856 1.00 256.71 ? 29  DT  J OP2   1 
ATOM   9192  O "O5'" . DT  J 7  178 ? 112.378 78.309  130.022 1.00 248.50 ? 29  DT  J "O5'" 1 
ATOM   9193  C "C5'" . DT  J 7  178 ? 113.394 79.313  130.220 1.00 248.81 ? 29  DT  J "C5'" 1 
ATOM   9194  C "C4'" . DT  J 7  178 ? 114.445 79.191  129.144 1.00 236.50 ? 29  DT  J "C4'" 1 
ATOM   9195  O "O4'" . DT  J 7  178 ? 115.442 78.207  129.535 1.00 236.10 ? 29  DT  J "O4'" 1 
ATOM   9196  C "C3'" . DT  J 7  178 ? 113.902 78.722  127.784 1.00 228.24 ? 29  DT  J "C3'" 1 
ATOM   9197  O "O3'" . DT  J 7  178 ? 114.515 79.438  126.705 1.00 220.37 ? 29  DT  J "O3'" 1 
ATOM   9198  C "C2'" . DT  J 7  178 ? 114.360 77.280  127.740 1.00 227.07 ? 29  DT  J "C2'" 1 
ATOM   9199  C "C1'" . DT  J 7  178 ? 115.722 77.429  128.391 1.00 226.41 ? 29  DT  J "C1'" 1 
ATOM   9200  N N1    . DT  J 7  178 ? 116.426 76.183  128.769 1.00 229.03 ? 29  DT  J N1    1 
ATOM   9201  C C2    . DT  J 7  178 ? 117.807 76.201  128.761 1.00 226.99 ? 29  DT  J C2    1 
ATOM   9202  O O2    . DT  J 7  178 ? 118.459 77.190  128.465 1.00 221.69 ? 29  DT  J O2    1 
ATOM   9203  N N3    . DT  J 7  178 ? 118.402 75.014  129.115 1.00 231.59 ? 29  DT  J N3    1 
ATOM   9204  C C4    . DT  J 7  178 ? 117.765 73.840  129.466 1.00 235.03 ? 29  DT  J C4    1 
ATOM   9205  O O4    . DT  J 7  178 ? 118.414 72.841  129.764 1.00 235.80 ? 29  DT  J O4    1 
ATOM   9206  C C5    . DT  J 7  178 ? 116.324 73.893  129.454 1.00 239.24 ? 29  DT  J C5    1 
ATOM   9207  C C7    . DT  J 7  178 ? 115.550 72.668  129.819 1.00 246.97 ? 29  DT  J C7    1 
ATOM   9208  C C6    . DT  J 7  178 ? 115.737 75.040  129.111 1.00 236.70 ? 29  DT  J C6    1 
ATOM   9209  P P     . DG  J 7  179 ? 113.962 80.859  126.188 1.00 218.02 ? 30  DG  J P     1 
ATOM   9210  O OP1   . DG  J 7  179 ? 113.560 81.667  127.366 1.00 230.07 ? 30  DG  J OP1   1 
ATOM   9211  O OP2   . DG  J 7  179 ? 112.988 80.601  125.096 1.00 225.25 ? 30  DG  J OP2   1 
ATOM   9212  O "O5'" . DG  J 7  179 ? 115.273 81.501  125.550 1.00 216.54 ? 30  DG  J "O5'" 1 
ATOM   9213  C "C5'" . DG  J 7  179 ? 116.468 81.661  126.342 1.00 214.80 ? 30  DG  J "C5'" 1 
ATOM   9214  C "C4'" . DG  J 7  179 ? 117.706 81.327  125.542 1.00 202.93 ? 30  DG  J "C4'" 1 
ATOM   9215  O "O4'" . DG  J 7  179 ? 118.144 79.978  125.849 1.00 204.40 ? 30  DG  J "O4'" 1 
ATOM   9216  C "C3'" . DG  J 7  179 ? 117.566 81.399  124.022 1.00 200.57 ? 30  DG  J "C3'" 1 
ATOM   9217  O "O3'" . DG  J 7  179 ? 118.732 82.068  123.514 1.00 194.17 ? 30  DG  J "O3'" 1 
ATOM   9218  C "C2'" . DG  J 7  179 ? 117.502 79.937  123.600 1.00 194.00 ? 30  DG  J "C2'" 1 
ATOM   9219  C "C1'" . DG  J 7  179 ? 118.346 79.240  124.653 1.00 193.60 ? 30  DG  J "C1'" 1 
ATOM   9220  N N9    . DG  J 7  179 ? 117.971 77.850  124.916 1.00 195.96 ? 30  DG  J N9    1 
ATOM   9221  C C8    . DG  J 7  179 ? 116.701 77.331  124.997 1.00 201.93 ? 30  DG  J C8    1 
ATOM   9222  N N7    . DG  J 7  179 ? 116.684 76.052  125.247 1.00 202.15 ? 30  DG  J N7    1 
ATOM   9223  C C5    . DG  J 7  179 ? 118.018 75.702  125.336 1.00 194.85 ? 30  DG  J C5    1 
ATOM   9224  C C6    . DG  J 7  179 ? 118.611 74.444  125.591 1.00 196.41 ? 30  DG  J C6    1 
ATOM   9225  O O6    . DG  J 7  179 ? 118.049 73.362  125.796 1.00 199.07 ? 30  DG  J O6    1 
ATOM   9226  N N1    . DG  J 7  179 ? 119.998 74.525  125.596 1.00 195.49 ? 30  DG  J N1    1 
ATOM   9227  C C2    . DG  J 7  179 ? 120.719 75.673  125.382 1.00 192.58 ? 30  DG  J C2    1 
ATOM   9228  N N2    . DG  J 7  179 ? 122.055 75.546  125.425 1.00 196.35 ? 30  DG  J N2    1 
ATOM   9229  N N3    . DG  J 7  179 ? 120.175 76.856  125.144 1.00 190.70 ? 30  DG  J N3    1 
ATOM   9230  C C4    . DG  J 7  179 ? 118.827 76.797  125.135 1.00 190.04 ? 30  DG  J C4    1 
ATOM   9231  P P     . DG  J 7  180 ? 118.931 82.427  121.956 1.00 185.29 ? 31  DG  J P     1 
ATOM   9232  O OP1   . DG  J 7  180 ? 119.414 83.827  121.859 1.00 168.38 ? 31  DG  J OP1   1 
ATOM   9233  O OP2   . DG  J 7  180 ? 117.712 82.013  121.214 1.00 178.08 ? 31  DG  J OP2   1 
ATOM   9234  O "O5'" . DG  J 7  180 ? 120.121 81.455  121.538 1.00 180.04 ? 31  DG  J "O5'" 1 
ATOM   9235  C "C5'" . DG  J 7  180 ? 121.271 81.315  122.395 1.00 177.20 ? 31  DG  J "C5'" 1 
ATOM   9236  C "C4'" . DG  J 7  180 ? 122.187 80.232  121.889 1.00 171.60 ? 31  DG  J "C4'" 1 
ATOM   9237  O "O4'" . DG  J 7  180 ? 121.699 78.946  122.338 1.00 175.77 ? 31  DG  J "O4'" 1 
ATOM   9238  C "C3'" . DG  J 7  180 ? 122.334 80.149  120.372 1.00 167.05 ? 31  DG  J "C3'" 1 
ATOM   9239  O "O3'" . DG  J 7  180 ? 123.737 80.115  120.069 1.00 163.89 ? 31  DG  J "O3'" 1 
ATOM   9240  C "C2'" . DG  J 7  180 ? 121.625 78.852  119.998 1.00 166.06 ? 31  DG  J "C2'" 1 
ATOM   9241  C "C1'" . DG  J 7  180 ? 121.689 78.020  121.267 1.00 168.25 ? 31  DG  J "C1'" 1 
ATOM   9242  N N9    . DG  J 7  180 ? 120.539 77.135  121.463 1.00 172.02 ? 31  DG  J N9    1 
ATOM   9243  C C8    . DG  J 7  180 ? 119.213 77.466  121.326 1.00 175.81 ? 31  DG  J C8    1 
ATOM   9244  N N7    . DG  J 7  180 ? 118.406 76.473  121.566 1.00 176.24 ? 31  DG  J N7    1 
ATOM   9245  C C5    . DG  J 7  180 ? 119.245 75.418  121.878 1.00 176.20 ? 31  DG  J C5    1 
ATOM   9246  C C6    . DG  J 7  180 ? 118.934 74.082  122.226 1.00 175.78 ? 31  DG  J C6    1 
ATOM   9247  O O6    . DG  J 7  180 ? 117.818 73.559  122.329 1.00 177.02 ? 31  DG  J O6    1 
ATOM   9248  N N1    . DG  J 7  180 ? 120.080 73.333  122.466 1.00 176.44 ? 31  DG  J N1    1 
ATOM   9249  C C2    . DG  J 7  180 ? 121.363 73.811  122.381 1.00 174.59 ? 31  DG  J C2    1 
ATOM   9250  N N2    . DG  J 7  180 ? 122.340 72.930  122.653 1.00 177.42 ? 31  DG  J N2    1 
ATOM   9251  N N3    . DG  J 7  180 ? 121.667 75.061  122.058 1.00 172.13 ? 31  DG  J N3    1 
ATOM   9252  C C4    . DG  J 7  180 ? 120.566 75.805  121.820 1.00 172.08 ? 31  DG  J C4    1 
ATOM   9253  P P     . DA  J 7  181 ? 124.309 80.139  118.563 1.00 153.76 ? 32  DA  J P     1 
ATOM   9254  O OP1   . DA  J 7  181 ? 125.506 81.015  118.532 1.00 149.59 ? 32  DA  J OP1   1 
ATOM   9255  O OP2   . DA  J 7  181 ? 123.181 80.394  117.628 1.00 154.09 ? 32  DA  J OP2   1 
ATOM   9256  O "O5'" . DA  J 7  181 ? 124.788 78.635  118.357 1.00 156.94 ? 32  DA  J "O5'" 1 
ATOM   9257  C "C5'" . DA  J 7  181 ? 125.551 77.968  119.381 1.00 157.97 ? 32  DA  J "C5'" 1 
ATOM   9258  C "C4'" . DA  J 7  181 ? 125.748 76.516  119.033 1.00 158.12 ? 32  DA  J "C4'" 1 
ATOM   9259  O "O4'" . DA  J 7  181 ? 124.554 75.777  119.388 1.00 160.10 ? 32  DA  J "O4'" 1 
ATOM   9260  C "C3'" . DA  J 7  181 ? 126.010 76.228  117.554 1.00 157.56 ? 32  DA  J "C3'" 1 
ATOM   9261  O "O3'" . DA  J 7  181 ? 127.035 75.227  117.459 1.00 159.39 ? 32  DA  J "O3'" 1 
ATOM   9262  C "C2'" . DA  J 7  181 ? 124.663 75.714  117.064 1.00 155.50 ? 32  DA  J "C2'" 1 
ATOM   9263  C "C1'" . DA  J 7  181 ? 124.138 74.988  118.289 1.00 156.90 ? 32  DA  J "C1'" 1 
ATOM   9264  N N9    . DA  J 7  181 ? 122.682 74.851  118.351 1.00 156.38 ? 32  DA  J N9    1 
ATOM   9265  C C8    . DA  J 7  181 ? 121.724 75.774  118.019 1.00 159.01 ? 32  DA  J C8    1 
ATOM   9266  N N7    . DA  J 7  181 ? 120.497 75.350  118.185 1.00 159.23 ? 32  DA  J N7    1 
ATOM   9267  C C5    . DA  J 7  181 ? 120.655 74.058  118.659 1.00 160.15 ? 32  DA  J C5    1 
ATOM   9268  C C6    . DA  J 7  181 ? 119.733 73.068  119.028 1.00 161.06 ? 32  DA  J C6    1 
ATOM   9269  N N6    . DA  J 7  181 ? 118.411 73.233  118.977 1.00 161.54 ? 32  DA  J N6    1 
ATOM   9270  N N1    . DA  J 7  181 ? 120.220 71.885  119.458 1.00 161.75 ? 32  DA  J N1    1 
ATOM   9271  C C2    . DA  J 7  181 ? 121.546 71.721  119.508 1.00 159.28 ? 32  DA  J C2    1 
ATOM   9272  N N3    . DA  J 7  181 ? 122.511 72.576  119.188 1.00 156.51 ? 32  DA  J N3    1 
ATOM   9273  C C4    . DA  J 7  181 ? 121.994 73.738  118.765 1.00 158.39 ? 32  DA  J C4    1 
ATOM   9274  P P     . DG  J 7  182 ? 127.679 74.775  116.052 1.00 160.91 ? 33  DG  J P     1 
ATOM   9275  O OP1   . DG  J 7  182 ? 129.143 74.631  116.241 1.00 161.50 ? 33  DG  J OP1   1 
ATOM   9276  O OP2   . DG  J 7  182 ? 127.156 75.661  114.980 1.00 159.40 ? 33  DG  J OP2   1 
ATOM   9277  O "O5'" . DG  J 7  182 ? 127.055 73.324  115.840 1.00 160.11 ? 33  DG  J "O5'" 1 
ATOM   9278  C "C5'" . DG  J 7  182 ? 127.073 72.363  116.915 1.00 163.98 ? 33  DG  J "C5'" 1 
ATOM   9279  C "C4'" . DG  J 7  182 ? 126.502 71.042  116.459 1.00 161.23 ? 33  DG  J "C4'" 1 
ATOM   9280  O "O4'" . DG  J 7  182 ? 125.078 71.011  116.728 1.00 154.66 ? 33  DG  J "O4'" 1 
ATOM   9281  C "C3'" . DG  J 7  182 ? 126.665 70.744  114.970 1.00 160.24 ? 33  DG  J "C3'" 1 
ATOM   9282  O "O3'" . DG  J 7  182 ? 127.005 69.362  114.799 1.00 162.15 ? 33  DG  J "O3'" 1 
ATOM   9283  C "C2'" . DG  J 7  182 ? 125.291 71.032  114.398 1.00 154.30 ? 33  DG  J "C2'" 1 
ATOM   9284  C "C1'" . DG  J 7  182 ? 124.370 70.670  115.547 1.00 151.44 ? 33  DG  J "C1'" 1 
ATOM   9285  N N9    . DG  J 7  182 ? 123.108 71.403  115.549 1.00 149.03 ? 33  DG  J N9    1 
ATOM   9286  C C8    . DG  J 7  182 ? 122.928 72.740  115.294 1.00 149.42 ? 33  DG  J C8    1 
ATOM   9287  N N7    . DG  J 7  182 ? 121.682 73.113  115.365 1.00 148.74 ? 33  DG  J N7    1 
ATOM   9288  C C5    . DG  J 7  182 ? 120.998 71.955  115.688 1.00 147.44 ? 33  DG  J C5    1 
ATOM   9289  C C6    . DG  J 7  182 ? 119.614 71.744  115.896 1.00 149.40 ? 33  DG  J C6    1 
ATOM   9290  O O6    . DG  J 7  182 ? 118.698 72.572  115.837 1.00 149.35 ? 33  DG  J O6    1 
ATOM   9291  N N1    . DG  J 7  182 ? 119.340 70.418  116.204 1.00 151.82 ? 33  DG  J N1    1 
ATOM   9292  C C2    . DG  J 7  182 ? 120.278 69.422  116.297 1.00 149.04 ? 33  DG  J C2    1 
ATOM   9293  N N2    . DG  J 7  182 ? 119.814 68.201  116.605 1.00 154.02 ? 33  DG  J N2    1 
ATOM   9294  N N3    . DG  J 7  182 ? 121.575 69.606  116.104 1.00 149.73 ? 33  DG  J N3    1 
ATOM   9295  C C4    . DG  J 7  182 ? 121.861 70.889  115.805 1.00 147.34 ? 33  DG  J C4    1 
ATOM   9296  P P     . DA  J 7  183 ? 127.890 68.864  113.549 1.00 171.81 ? 34  DA  J P     1 
ATOM   9297  O OP1   . DA  J 7  183 ? 129.196 68.388  114.067 1.00 169.96 ? 34  DA  J OP1   1 
ATOM   9298  O OP2   . DA  J 7  183 ? 127.854 69.910  112.494 1.00 164.04 ? 34  DA  J OP2   1 
ATOM   9299  O "O5'" . DA  J 7  183 ? 127.077 67.607  113.014 1.00 162.30 ? 34  DA  J "O5'" 1 
ATOM   9300  C "C5'" . DA  J 7  183 ? 126.038 67.774  112.033 1.00 160.02 ? 34  DA  J "C5'" 1 
ATOM   9301  C "C4'" . DA  J 7  183 ? 124.816 66.986  112.434 1.00 159.16 ? 34  DA  J "C4'" 1 
ATOM   9302  O "O4'" . DA  J 7  183 ? 123.846 67.880  113.028 1.00 152.62 ? 34  DA  J "O4'" 1 
ATOM   9303  C "C3'" . DA  J 7  183 ? 124.111 66.273  111.279 1.00 158.67 ? 34  DA  J "C3'" 1 
ATOM   9304  O "O3'" . DA  J 7  183 ? 123.957 64.878  111.589 1.00 164.10 ? 34  DA  J "O3'" 1 
ATOM   9305  C "C2'" . DA  J 7  183 ? 122.760 66.964  111.174 1.00 152.33 ? 34  DA  J "C2'" 1 
ATOM   9306  C "C1'" . DA  J 7  183 ? 122.554 67.582  112.541 1.00 149.20 ? 34  DA  J "C1'" 1 
ATOM   9307  N N9    . DA  J 7  183 ? 121.787 68.827  112.512 1.00 146.13 ? 34  DA  J N9    1 
ATOM   9308  C C8    . DA  J 7  183 ? 122.245 70.096  112.276 1.00 144.54 ? 34  DA  J C8    1 
ATOM   9309  N N7    . DA  J 7  183 ? 121.311 71.012  112.317 1.00 142.86 ? 34  DA  J N7    1 
ATOM   9310  C C5    . DA  J 7  183 ? 120.159 70.298  112.601 1.00 142.08 ? 34  DA  J C5    1 
ATOM   9311  C C6    . DA  J 7  183 ? 118.824 70.689  112.776 1.00 141.61 ? 34  DA  J C6    1 
ATOM   9312  N N6    . DA  J 7  183 ? 118.410 71.954  112.686 1.00 140.87 ? 34  DA  J N6    1 
ATOM   9313  N N1    . DA  J 7  183 ? 117.915 69.732  113.047 1.00 142.18 ? 34  DA  J N1    1 
ATOM   9314  C C2    . DA  J 7  183 ? 118.336 68.467  113.135 1.00 143.49 ? 34  DA  J C2    1 
ATOM   9315  N N3    . DA  J 7  183 ? 119.564 67.974  112.992 1.00 144.23 ? 34  DA  J N3    1 
ATOM   9316  C C4    . DA  J 7  183 ? 120.438 68.953  112.723 1.00 143.05 ? 34  DA  J C4    1 
ATOM   9317  P P     . DC  J 7  184 ? 123.844 63.772  110.421 1.00 168.33 ? 35  DC  J P     1 
ATOM   9318  O OP1   . DC  J 7  184 ? 123.909 62.420  111.031 1.00 169.05 ? 35  DC  J OP1   1 
ATOM   9319  O OP2   . DC  J 7  184 ? 124.769 64.144  109.320 1.00 165.95 ? 35  DC  J OP2   1 
ATOM   9320  O "O5'" . DC  J 7  184 ? 122.393 63.988  109.801 1.00 162.72 ? 35  DC  J "O5'" 1 
ATOM   9321  C "C5'" . DC  J 7  184 ? 121.233 63.429  110.443 1.00 161.57 ? 35  DC  J "C5'" 1 
ATOM   9322  C "C4'" . DC  J 7  184 ? 119.979 63.847  109.714 1.00 159.12 ? 35  DC  J "C4'" 1 
ATOM   9323  O "O4'" . DC  J 7  184 ? 119.615 65.184  110.099 1.00 152.81 ? 35  DC  J "O4'" 1 
ATOM   9324  C "C3'" . DC  J 7  184 ? 120.101 63.887  108.189 1.00 158.50 ? 35  DC  J "C3'" 1 
ATOM   9325  O "O3'" . DC  J 7  184 ? 119.542 62.682  107.639 1.00 157.61 ? 35  DC  J "O3'" 1 
ATOM   9326  C "C2'" . DC  J 7  184 ? 119.298 65.120  107.776 1.00 150.47 ? 35  DC  J "C2'" 1 
ATOM   9327  C "C1'" . DC  J 7  184 ? 118.801 65.722  109.079 1.00 148.93 ? 35  DC  J "C1'" 1 
ATOM   9328  N N1    . DC  J 7  184 ? 118.905 67.188  109.151 1.00 143.63 ? 35  DC  J N1    1 
ATOM   9329  C C2    . DC  J 7  184 ? 117.742 67.947  109.313 1.00 138.90 ? 35  DC  J C2    1 
ATOM   9330  O O2    . DC  J 7  184 ? 116.647 67.374  109.390 1.00 138.89 ? 35  DC  J O2    1 
ATOM   9331  N N3    . DC  J 7  184 ? 117.835 69.290  109.381 1.00 142.65 ? 35  DC  J N3    1 
ATOM   9332  C C4    . DC  J 7  184 ? 119.025 69.881  109.294 1.00 136.51 ? 35  DC  J C4    1 
ATOM   9333  N N4    . DC  J 7  184 ? 119.066 71.211  109.365 1.00 137.52 ? 35  DC  J N4    1 
ATOM   9334  C C5    . DC  J 7  184 ? 120.224 69.136  109.128 1.00 139.59 ? 35  DC  J C5    1 
ATOM   9335  C C6    . DC  J 7  184 ? 120.119 67.805  109.062 1.00 143.11 ? 35  DC  J C6    1 
ATOM   9336  P P     . DT  J 7  185 ? 119.566 62.364  106.055 1.00 162.74 ? 36  DT  J P     1 
ATOM   9337  O OP1   . DT  J 7  185 ? 119.554 60.891  105.878 1.00 165.32 ? 36  DT  J OP1   1 
ATOM   9338  O OP2   . DT  J 7  185 ? 120.643 63.170  105.424 1.00 161.23 ? 36  DT  J OP2   1 
ATOM   9339  O "O5'" . DT  J 7  185 ? 118.165 62.941  105.550 1.00 156.39 ? 36  DT  J "O5'" 1 
ATOM   9340  C "C5'" . DT  J 7  185 ? 116.930 62.421  106.082 1.00 154.92 ? 36  DT  J "C5'" 1 
ATOM   9341  C "C4'" . DT  J 7  185 ? 115.773 63.353  105.791 1.00 151.71 ? 36  DT  J "C4'" 1 
ATOM   9342  O "O4'" . DT  J 7  185 ? 116.080 64.685  106.269 1.00 146.53 ? 36  DT  J "O4'" 1 
ATOM   9343  C "C3'" . DT  J 7  185 ? 115.391 63.503  104.313 1.00 152.34 ? 36  DT  J "C3'" 1 
ATOM   9344  O "O3'" . DT  J 7  185 ? 113.981 63.260  104.165 1.00 152.83 ? 36  DT  J "O3'" 1 
ATOM   9345  C "C2'" . DT  J 7  185 ? 115.729 64.955  104.002 1.00 143.07 ? 36  DT  J "C2'" 1 
ATOM   9346  C "C1'" . DT  J 7  185 ? 115.555 65.622  105.352 1.00 141.00 ? 36  DT  J "C1'" 1 
ATOM   9347  N N1    . DT  J 7  185 ? 116.273 66.901  105.518 1.00 137.25 ? 36  DT  J N1    1 
ATOM   9348  C C2    . DT  J 7  185 ? 115.549 68.024  105.862 1.00 133.12 ? 36  DT  J C2    1 
ATOM   9349  O O2    . DT  J 7  185 ? 114.340 68.011  106.037 1.00 133.40 ? 36  DT  J O2    1 
ATOM   9350  N N3    . DT  J 7  185 ? 116.295 69.169  105.998 1.00 131.76 ? 36  DT  J N3    1 
ATOM   9351  C C4    . DT  J 7  185 ? 117.660 69.294  105.826 1.00 131.87 ? 36  DT  J C4    1 
ATOM   9352  O O4    . DT  J 7  185 ? 118.207 70.381  105.981 1.00 129.88 ? 36  DT  J O4    1 
ATOM   9353  C C5    . DT  J 7  185 ? 118.351 68.082  105.468 1.00 132.78 ? 36  DT  J C5    1 
ATOM   9354  C C7    . DT  J 7  185 ? 119.828 68.132  105.257 1.00 133.27 ? 36  DT  J C7    1 
ATOM   9355  C C6    . DT  J 7  185 ? 117.635 66.963  105.334 1.00 137.53 ? 36  DT  J C6    1 
ATOM   9356  P P     . DA  J 7  186 ? 113.285 63.053  102.721 1.00 152.35 ? 37  DA  J P     1 
ATOM   9357  O OP1   . DA  J 7  186 ? 112.273 61.976  102.846 1.00 152.87 ? 37  DA  J OP1   1 
ATOM   9358  O OP2   . DA  J 7  186 ? 114.352 62.943  101.693 1.00 148.30 ? 37  DA  J OP2   1 
ATOM   9359  O "O5'" . DA  J 7  186 ? 112.517 64.429  102.480 1.00 143.25 ? 37  DA  J "O5'" 1 
ATOM   9360  C "C5'" . DA  J 7  186 ? 111.948 65.151  103.589 1.00 140.74 ? 37  DA  J "C5'" 1 
ATOM   9361  C "C4'" . DA  J 7  186 ? 110.930 66.160  103.123 1.00 141.65 ? 37  DA  J "C4'" 1 
ATOM   9362  O "O4'" . DA  J 7  186 ? 111.490 67.486  103.222 1.00 136.90 ? 37  DA  J "O4'" 1 
ATOM   9363  C "C3'" . DA  J 7  186 ? 110.465 66.030  101.680 1.00 142.41 ? 37  DA  J "C3'" 1 
ATOM   9364  O "O3'" . DA  J 7  186 ? 109.125 66.543  101.599 1.00 142.63 ? 37  DA  J "O3'" 1 
ATOM   9365  C "C2'" . DA  J 7  186 ? 111.470 66.896  100.924 1.00 136.21 ? 37  DA  J "C2'" 1 
ATOM   9366  C "C1'" . DA  J 7  186 ? 111.858 67.968  101.937 1.00 133.02 ? 37  DA  J "C1'" 1 
ATOM   9367  N N9    . DA  J 7  186 ? 113.282 68.302  102.000 1.00 128.07 ? 37  DA  J N9    1 
ATOM   9368  C C8    . DA  J 7  186 ? 114.373 67.516  101.725 1.00 129.26 ? 37  DA  J C8    1 
ATOM   9369  N N7    . DA  J 7  186 ? 115.521 68.129  101.888 1.00 125.92 ? 37  DA  J N7    1 
ATOM   9370  C C5    . DA  J 7  186 ? 115.160 69.401  102.294 1.00 124.34 ? 37  DA  J C5    1 
ATOM   9371  C C6    . DA  J 7  186 ? 115.912 70.532  102.629 1.00 123.19 ? 37  DA  J C6    1 
ATOM   9372  N N6    . DA  J 7  186 ? 117.241 70.567  102.603 1.00 124.91 ? 37  DA  J N6    1 
ATOM   9373  N N1    . DA  J 7  186 ? 115.244 71.646  102.992 1.00 123.07 ? 37  DA  J N1    1 
ATOM   9374  C C2    . DA  J 7  186 ? 113.908 71.608  103.015 1.00 124.93 ? 37  DA  J C2    1 
ATOM   9375  N N3    . DA  J 7  186 ? 113.091 70.605  102.724 1.00 125.00 ? 37  DA  J N3    1 
ATOM   9376  C C4    . DA  J 7  186 ? 113.789 69.519  102.367 1.00 124.87 ? 37  DA  J C4    1 
ATOM   9377  P P     . DG  J 7  187 ? 108.243 66.480  100.252 1.00 153.02 ? 38  DG  J P     1 
ATOM   9378  O OP1   . DG  J 7  187 ? 106.815 66.378  100.642 1.00 146.73 ? 38  DG  J OP1   1 
ATOM   9379  O OP2   . DG  J 7  187 ? 108.831 65.462  99.342  1.00 145.68 ? 38  DG  J OP2   1 
ATOM   9380  O "O5'" . DG  J 7  187 ? 108.485 67.920  99.617  1.00 141.39 ? 38  DG  J "O5'" 1 
ATOM   9381  C "C5'" . DG  J 7  187 ? 108.322 69.104  100.424 1.00 136.34 ? 38  DG  J "C5'" 1 
ATOM   9382  C "C4'" . DG  J 7  187 ? 108.784 70.326  99.672  1.00 135.49 ? 38  DG  J "C4'" 1 
ATOM   9383  O "O4'" . DG  J 7  187 ? 110.223 70.466  99.811  1.00 131.47 ? 38  DG  J "O4'" 1 
ATOM   9384  C "C3'" . DG  J 7  187 ? 108.516 70.303  98.164  1.00 136.10 ? 38  DG  J "C3'" 1 
ATOM   9385  O "O3'" . DG  J 7  187 ? 108.164 71.617  97.716  1.00 132.34 ? 38  DG  J "O3'" 1 
ATOM   9386  C "C2'" . DG  J 7  187 ? 109.868 69.922  97.599  1.00 131.43 ? 38  DG  J "C2'" 1 
ATOM   9387  C "C1'" . DG  J 7  187 ? 110.772 70.705  98.528  1.00 126.34 ? 38  DG  J "C1'" 1 
ATOM   9388  N N9    . DG  J 7  187 ? 112.179 70.314  98.529  1.00 123.70 ? 38  DG  J N9    1 
ATOM   9389  C C8    . DG  J 7  187 ? 112.725 69.120  98.128  1.00 124.32 ? 38  DG  J C8    1 
ATOM   9390  N N7    . DG  J 7  187 ? 114.022 69.084  98.251  1.00 123.50 ? 38  DG  J N7    1 
ATOM   9391  C C5    . DG  J 7  187 ? 114.355 70.327  98.762  1.00 123.57 ? 38  DG  J C5    1 
ATOM   9392  C C6    . DG  J 7  187 ? 115.618 70.871  99.104  1.00 122.51 ? 38  DG  J C6    1 
ATOM   9393  O O6    . DG  J 7  187 ? 116.733 70.340  99.019  1.00 122.86 ? 38  DG  J O6    1 
ATOM   9394  N N1    . DG  J 7  187 ? 115.500 72.168  99.589  1.00 120.36 ? 38  DG  J N1    1 
ATOM   9395  C C2    . DG  J 7  187 ? 114.319 72.851  99.726  1.00 119.89 ? 38  DG  J C2    1 
ATOM   9396  N N2    . DG  J 7  187 ? 114.401 74.096  100.215 1.00 121.13 ? 38  DG  J N2    1 
ATOM   9397  N N3    . DG  J 7  187 ? 113.137 72.352  99.412  1.00 120.21 ? 38  DG  J N3    1 
ATOM   9398  C C4    . DG  J 7  187 ? 113.229 71.096  98.939  1.00 129.12 ? 38  DG  J C4    1 
ATOM   9399  P P     . DG  J 7  188 ? 106.635 72.078  97.520  1.00 135.80 ? 39  DG  J P     1 
ATOM   9400  O OP1   . DG  J 7  188 ? 105.870 71.768  98.755  1.00 137.37 ? 39  DG  J OP1   1 
ATOM   9401  O OP2   . DG  J 7  188 ? 106.159 71.567  96.207  1.00 139.79 ? 39  DG  J OP2   1 
ATOM   9402  O "O5'" . DG  J 7  188 ? 106.781 73.660  97.415  1.00 134.04 ? 39  DG  J "O5'" 1 
ATOM   9403  C "C5'" . DG  J 7  188 ? 107.015 74.429  98.611  1.00 131.81 ? 39  DG  J "C5'" 1 
ATOM   9404  C "C4'" . DG  J 7  188 ? 108.022 75.533  98.379  1.00 131.62 ? 39  DG  J "C4'" 1 
ATOM   9405  O "O4'" . DG  J 7  188 ? 109.343 74.974  98.164  1.00 126.29 ? 39  DG  J "O4'" 1 
ATOM   9406  C "C3'" . DG  J 7  188 ? 107.764 76.457  97.194  1.00 127.38 ? 39  DG  J "C3'" 1 
ATOM   9407  O "O3'" . DG  J 7  188 ? 108.149 77.775  97.608  1.00 124.78 ? 39  DG  J "O3'" 1 
ATOM   9408  C "C2'" . DG  J 7  188 ? 108.681 75.896  96.117  1.00 122.42 ? 39  DG  J "C2'" 1 
ATOM   9409  C "C1'" . DG  J 7  188 ? 109.876 75.414  96.922  1.00 121.27 ? 39  DG  J "C1'" 1 
ATOM   9410  N N9    . DG  J 7  188 ? 110.610 74.290  96.338  1.00 120.39 ? 39  DG  J N9    1 
ATOM   9411  C C8    . DG  J 7  188 ? 110.090 73.210  95.667  1.00 122.22 ? 39  DG  J C8    1 
ATOM   9412  N N7    . DG  J 7  188 ? 111.000 72.366  95.268  1.00 119.80 ? 39  DG  J N7    1 
ATOM   9413  C C5    . DG  J 7  188 ? 112.192 72.918  95.697  1.00 118.46 ? 39  DG  J C5    1 
ATOM   9414  C C6    . DG  J 7  188 ? 113.518 72.447  95.550  1.00 119.72 ? 39  DG  J C6    1 
ATOM   9415  O O6    . DG  J 7  188 ? 113.900 71.412  94.994  1.00 120.34 ? 39  DG  J O6    1 
ATOM   9416  N N1    . DG  J 7  188 ? 114.437 73.310  96.132  1.00 118.75 ? 39  DG  J N1    1 
ATOM   9417  C C2    . DG  J 7  188 ? 114.118 74.480  96.774  1.00 119.15 ? 39  DG  J C2    1 
ATOM   9418  N N2    . DG  J 7  188 ? 115.147 75.184  97.274  1.00 118.80 ? 39  DG  J N2    1 
ATOM   9419  N N3    . DG  J 7  188 ? 112.880 74.930  96.918  1.00 118.12 ? 39  DG  J N3    1 
ATOM   9420  C C4    . DG  J 7  188 ? 111.973 74.104  96.358  1.00 117.91 ? 39  DG  J C4    1 
ATOM   9421  P P     . DG  J 7  189 ? 107.877 79.105  96.743  1.00 124.40 ? 40  DG  J P     1 
ATOM   9422  O OP1   . DG  J 7  189 ? 106.900 79.947  97.476  1.00 122.95 ? 40  DG  J OP1   1 
ATOM   9423  O OP2   . DG  J 7  189 ? 107.609 78.717  95.335  1.00 122.29 ? 40  DG  J OP2   1 
ATOM   9424  O "O5'" . DG  J 7  189 ? 109.301 79.818  96.799  1.00 116.79 ? 40  DG  J "O5'" 1 
ATOM   9425  C "C5'" . DG  J 7  189 ? 110.155 79.619  97.944  1.00 117.44 ? 40  DG  J "C5'" 1 
ATOM   9426  C "C4'" . DG  J 7  189 ? 111.445 80.387  97.816  1.00 113.63 ? 40  DG  J "C4'" 1 
ATOM   9427  O "O4'" . DG  J 7  189 ? 112.472 79.509  97.303  1.00 113.91 ? 40  DG  J "O4'" 1 
ATOM   9428  C "C3'" . DG  J 7  189 ? 111.436 81.586  96.879  1.00 110.07 ? 40  DG  J "C3'" 1 
ATOM   9429  O "O3'" . DG  J 7  189 ? 112.407 82.533  97.359  1.00 109.03 ? 40  DG  J "O3'" 1 
ATOM   9430  C "C2'" . DG  J 7  189 ? 111.833 80.966  95.549  1.00 111.24 ? 40  DG  J "C2'" 1 
ATOM   9431  C "C1'" . DG  J 7  189 ? 112.739 79.808  95.940  1.00 112.26 ? 40  DG  J "C1'" 1 
ATOM   9432  N N9    . DG  J 7  189 ? 112.531 78.591  95.153  1.00 114.05 ? 40  DG  J N9    1 
ATOM   9433  C C8    . DG  J 7  189 ? 111.340 78.078  94.698  1.00 114.21 ? 40  DG  J C8    1 
ATOM   9434  N N7    . DG  J 7  189 ? 111.481 76.974  94.021  1.00 113.80 ? 40  DG  J N7    1 
ATOM   9435  C C5    . DG  J 7  189 ? 112.843 76.742  94.027  1.00 113.47 ? 40  DG  J C5    1 
ATOM   9436  C C6    . DG  J 7  189 ? 113.587 75.688  93.448  1.00 116.71 ? 40  DG  J C6    1 
ATOM   9437  O O6    . DG  J 7  189 ? 113.169 74.724  92.799  1.00 118.11 ? 40  DG  J O6    1 
ATOM   9438  N N1    . DG  J 7  189 ? 114.947 75.830  93.689  1.00 116.79 ? 40  DG  J N1    1 
ATOM   9439  C C2    . DG  J 7  189 ? 115.517 76.858  94.397  1.00 116.53 ? 40  DG  J C2    1 
ATOM   9440  N N2    . DG  J 7  189 ? 116.852 76.819  94.523  1.00 119.93 ? 40  DG  J N2    1 
ATOM   9441  N N3    . DG  J 7  189 ? 114.830 77.849  94.944  1.00 114.58 ? 40  DG  J N3    1 
ATOM   9442  C C4    . DG  J 7  189 ? 113.506 77.727  94.721  1.00 113.56 ? 40  DG  J C4    1 
ATOM   9443  P P     . DA  J 7  190 ? 112.703 83.944  96.634  1.00 110.31 ? 41  DA  J P     1 
ATOM   9444  O OP1   . DA  J 7  190 ? 112.998 84.950  97.686  1.00 102.02 ? 41  DA  J OP1   1 
ATOM   9445  O OP2   . DA  J 7  190 ? 111.628 84.210  95.644  1.00 111.67 ? 41  DA  J OP2   1 
ATOM   9446  O "O5'" . DA  J 7  190 ? 114.050 83.648  95.833  1.00 111.47 ? 41  DA  J "O5'" 1 
ATOM   9447  C "C5'" . DA  J 7  190 ? 115.179 83.072  96.520  1.00 111.62 ? 41  DA  J "C5'" 1 
ATOM   9448  C "C4'" . DA  J 7  190 ? 116.296 82.717  95.565  1.00 116.73 ? 41  DA  J "C4'" 1 
ATOM   9449  O "O4'" . DA  J 7  190 ? 115.953 81.513  94.839  1.00 115.82 ? 41  DA  J "O4'" 1 
ATOM   9450  C "C3'" . DA  J 7  190 ? 116.648 83.759  94.502  1.00 119.04 ? 41  DA  J "C3'" 1 
ATOM   9451  O "O3'" . DA  J 7  190 ? 118.077 83.752  94.341  1.00 122.47 ? 41  DA  J "O3'" 1 
ATOM   9452  C "C2'" . DA  J 7  190 ? 115.936 83.221  93.268  1.00 115.47 ? 41  DA  J "C2'" 1 
ATOM   9453  C "C1'" . DA  J 7  190 ? 116.124 81.727  93.449  1.00 115.39 ? 41  DA  J "C1'" 1 
ATOM   9454  N N9    . DA  J 7  190 ? 115.168 80.864  92.755  1.00 114.38 ? 41  DA  J N9    1 
ATOM   9455  C C8    . DA  J 7  190 ? 113.820 81.040  92.584  1.00 113.35 ? 41  DA  J C8    1 
ATOM   9456  N N7    . DA  J 7  190 ? 113.239 80.077  91.914  1.00 112.50 ? 41  DA  J N7    1 
ATOM   9457  C C5    . DA  J 7  190 ? 114.275 79.207  91.623  1.00 112.11 ? 41  DA  J C5    1 
ATOM   9458  C C6    . DA  J 7  190 ? 114.315 77.989  90.933  1.00 114.68 ? 41  DA  J C6    1 
ATOM   9459  N N6    . DA  J 7  190 ? 113.239 77.422  90.392  1.00 117.99 ? 41  DA  J N6    1 
ATOM   9460  N N1    . DA  J 7  190 ? 115.509 77.369  90.817  1.00 117.98 ? 41  DA  J N1    1 
ATOM   9461  C C2    . DA  J 7  190 ? 116.581 77.951  91.365  1.00 119.90 ? 41  DA  J C2    1 
ATOM   9462  N N3    . DA  J 7  190 ? 116.666 79.093  92.038  1.00 116.70 ? 41  DA  J N3    1 
ATOM   9463  C C4    . DA  J 7  190 ? 115.466 79.679  92.134  1.00 114.01 ? 41  DA  J C4    1 
ATOM   9464  P P     . DG  J 7  191 ? 118.873 84.803  93.413  1.00 129.13 ? 42  DG  J P     1 
ATOM   9465  O OP1   . DG  J 7  191 ? 119.900 85.474  94.248  1.00 122.65 ? 42  DG  J OP1   1 
ATOM   9466  O OP2   . DG  J 7  191 ? 117.882 85.619  92.665  1.00 123.17 ? 42  DG  J OP2   1 
ATOM   9467  O "O5'" . DG  J 7  191 ? 119.618 83.852  92.371  1.00 123.14 ? 42  DG  J "O5'" 1 
ATOM   9468  C "C5'" . DG  J 7  191 ? 120.293 82.658  92.823  1.00 122.46 ? 42  DG  J "C5'" 1 
ATOM   9469  C "C4'" . DG  J 7  191 ? 120.893 81.901  91.661  1.00 124.81 ? 42  DG  J "C4'" 1 
ATOM   9470  O "O4'" . DG  J 7  191 ? 119.900 81.003  91.106  1.00 121.09 ? 42  DG  J "O4'" 1 
ATOM   9471  C "C3'" . DG  J 7  191 ? 121.394 82.755  90.500  1.00 123.64 ? 42  DG  J "C3'" 1 
ATOM   9472  O "O3'" . DG  J 7  191 ? 122.604 82.175  89.987  1.00 127.36 ? 42  DG  J "O3'" 1 
ATOM   9473  C "C2'" . DG  J 7  191 ? 120.262 82.669  89.492  1.00 121.08 ? 42  DG  J "C2'" 1 
ATOM   9474  C "C1'" . DG  J 7  191 ? 119.693 81.281  89.730  1.00 119.35 ? 42  DG  J "C1'" 1 
ATOM   9475  N N9    . DG  J 7  191 ? 118.260 81.173  89.462  1.00 117.20 ? 42  DG  J N9    1 
ATOM   9476  C C8    . DG  J 7  191 ? 117.270 82.017  89.898  1.00 116.48 ? 42  DG  J C8    1 
ATOM   9477  N N7    . DG  J 7  191 ? 116.080 81.666  89.497  1.00 113.25 ? 42  DG  J N7    1 
ATOM   9478  C C5    . DG  J 7  191 ? 116.295 80.520  88.751  1.00 114.76 ? 42  DG  J C5    1 
ATOM   9479  C C6    . DG  J 7  191 ? 115.375 79.690  88.063  1.00 117.66 ? 42  DG  J C6    1 
ATOM   9480  O O6    . DG  J 7  191 ? 114.145 79.810  87.979  1.00 119.27 ? 42  DG  J O6    1 
ATOM   9481  N N1    . DG  J 7  191 ? 116.014 78.630  87.432  1.00 119.32 ? 42  DG  J N1    1 
ATOM   9482  C C2    . DG  J 7  191 ? 117.367 78.400  87.461  1.00 119.99 ? 42  DG  J C2    1 
ATOM   9483  N N2    . DG  J 7  191 ? 117.805 77.324  86.792  1.00 123.47 ? 42  DG  J N2    1 
ATOM   9484  N N3    . DG  J 7  191 ? 118.234 79.167  88.100  1.00 117.33 ? 42  DG  J N3    1 
ATOM   9485  C C4    . DG  J 7  191 ? 117.635 80.202  88.718  1.00 115.18 ? 42  DG  J C4    1 
ATOM   9486  P P     . DT  J 7  192 ? 123.557 82.952  88.942  1.00 132.25 ? 43  DT  J P     1 
ATOM   9487  O OP1   . DT  J 7  192 ? 124.968 82.717  89.335  1.00 130.07 ? 43  DT  J OP1   1 
ATOM   9488  O OP2   . DT  J 7  192 ? 123.060 84.343  88.784  1.00 129.97 ? 43  DT  J OP2   1 
ATOM   9489  O "O5'" . DT  J 7  192 ? 123.282 82.180  87.577  1.00 129.60 ? 43  DT  J "O5'" 1 
ATOM   9490  C "C5'" . DT  J 7  192 ? 123.515 80.763  87.487  1.00 133.49 ? 43  DT  J "C5'" 1 
ATOM   9491  C "C4'" . DT  J 7  192 ? 123.000 80.220  86.176  1.00 134.63 ? 43  DT  J "C4'" 1 
ATOM   9492  O "O4'" . DT  J 7  192 ? 121.566 80.083  86.244  1.00 126.84 ? 43  DT  J "O4'" 1 
ATOM   9493  C "C3'" . DT  J 7  192 ? 123.294 81.081  84.947  1.00 136.43 ? 43  DT  J "C3'" 1 
ATOM   9494  O "O3'" . DT  J 7  192 ? 124.221 80.369  84.110  1.00 141.42 ? 43  DT  J "O3'" 1 
ATOM   9495  C "C2'" . DT  J 7  192 ? 121.940 81.259  84.259  1.00 130.82 ? 43  DT  J "C2'" 1 
ATOM   9496  C "C1'" . DT  J 7  192 ? 121.029 80.265  84.953  1.00 126.99 ? 43  DT  J "C1'" 1 
ATOM   9497  N N1    . DT  J 7  192 ? 119.637 80.722  85.114  1.00 121.21 ? 43  DT  J N1    1 
ATOM   9498  C C2    . DT  J 7  192 ? 118.627 79.965  84.564  1.00 121.51 ? 43  DT  J C2    1 
ATOM   9499  O O2    . DT  J 7  192 ? 118.830 78.932  83.947  1.00 123.37 ? 43  DT  J O2    1 
ATOM   9500  N N3    . DT  J 7  192 ? 117.366 80.465  84.764  1.00 120.17 ? 43  DT  J N3    1 
ATOM   9501  C C4    . DT  J 7  192 ? 117.026 81.617  85.443  1.00 117.83 ? 43  DT  J C4    1 
ATOM   9502  O O4    . DT  J 7  192 ? 115.849 81.950  85.551  1.00 118.95 ? 43  DT  J O4    1 
ATOM   9503  C C5    . DT  J 7  192 ? 118.132 82.357  85.989  1.00 116.06 ? 43  DT  J C5    1 
ATOM   9504  C C7    . DT  J 7  192 ? 117.852 83.620  86.732  1.00 116.74 ? 43  DT  J C7    1 
ATOM   9505  C C6    . DT  J 7  192 ? 119.364 81.880  85.801  1.00 118.66 ? 43  DT  J C6    1 
ATOM   9506  P P     . DA  J 7  193 ? 124.914 81.042  82.818  1.00 150.99 ? 44  DA  J P     1 
ATOM   9507  O OP1   . DA  J 7  193 ? 126.229 80.388  82.605  1.00 150.12 ? 44  DA  J OP1   1 
ATOM   9508  O OP2   . DA  J 7  193 ? 124.841 82.520  82.952  1.00 145.76 ? 44  DA  J OP2   1 
ATOM   9509  O "O5'" . DA  J 7  193 ? 123.947 80.610  81.629  1.00 142.40 ? 44  DA  J "O5'" 1 
ATOM   9510  C "C5'" . DA  J 7  193 ? 123.573 79.230  81.460  1.00 139.67 ? 44  DA  J "C5'" 1 
ATOM   9511  C "C4'" . DA  J 7  193 ? 122.543 79.088  80.367  1.00 141.97 ? 44  DA  J "C4'" 1 
ATOM   9512  O "O4'" . DA  J 7  193 ? 121.242 79.460  80.880  1.00 135.63 ? 44  DA  J "O4'" 1 
ATOM   9513  C "C3'" . DA  J 7  193 ? 122.778 79.948  79.122  1.00 143.80 ? 44  DA  J "C3'" 1 
ATOM   9514  O "O3'" . DA  J 7  193 ? 122.548 79.136  77.959  1.00 143.29 ? 44  DA  J "O3'" 1 
ATOM   9515  C "C2'" . DA  J 7  193 ? 121.736 81.051  79.259  1.00 137.20 ? 44  DA  J "C2'" 1 
ATOM   9516  C "C1'" . DA  J 7  193 ? 120.604 80.336  79.970  1.00 132.63 ? 44  DA  J "C1'" 1 
ATOM   9517  N N9    . DA  J 7  193 ? 119.701 81.200  80.733  1.00 127.82 ? 44  DA  J N9    1 
ATOM   9518  C C8    . DA  J 7  193 ? 120.016 82.252  81.554  1.00 126.36 ? 44  DA  J C8    1 
ATOM   9519  N N7    . DA  J 7  193 ? 118.975 82.830  82.100  1.00 121.91 ? 44  DA  J N7    1 
ATOM   9520  C C5    . DA  J 7  193 ? 117.901 82.112  81.603  1.00 121.26 ? 44  DA  J C5    1 
ATOM   9521  C C6    . DA  J 7  193 ? 116.520 82.225  81.804  1.00 126.70 ? 44  DA  J C6    1 
ATOM   9522  N N6    . DA  J 7  193 ? 115.969 83.148  82.589  1.00 121.94 ? 44  DA  J N6    1 
ATOM   9523  N N1    . DA  J 7  193 ? 115.717 81.352  81.161  1.00 122.40 ? 44  DA  J N1    1 
ATOM   9524  C C2    . DA  J 7  193 ? 116.282 80.429  80.376  1.00 123.95 ? 44  DA  J C2    1 
ATOM   9525  N N3    . DA  J 7  193 ? 117.567 80.221  80.110  1.00 125.00 ? 44  DA  J N3    1 
ATOM   9526  C C4    . DA  J 7  193 ? 118.333 81.106  80.762  1.00 125.02 ? 44  DA  J C4    1 
ATOM   9527  P P     . DA  J 7  194 ? 122.868 79.645  76.463  1.00 150.79 ? 45  DA  J P     1 
ATOM   9528  O OP1   . DA  J 7  194 ? 123.566 78.552  75.741  1.00 145.75 ? 45  DA  J OP1   1 
ATOM   9529  O OP2   . DA  J 7  194 ? 123.489 80.993  76.540  1.00 146.75 ? 45  DA  J OP2   1 
ATOM   9530  O "O5'" . DA  J 7  194 ? 121.415 79.810  75.831  1.00 142.61 ? 45  DA  J "O5'" 1 
ATOM   9531  C "C5'" . DA  J 7  194 ? 120.463 78.733  75.909  1.00 141.54 ? 45  DA  J "C5'" 1 
ATOM   9532  C "C4'" . DA  J 7  194 ? 119.114 79.183  75.405  1.00 143.56 ? 45  DA  J "C4'" 1 
ATOM   9533  O "O4'" . DA  J 7  194 ? 118.453 79.949  76.438  1.00 136.27 ? 45  DA  J "O4'" 1 
ATOM   9534  C "C3'" . DA  J 7  194 ? 119.148 80.069  74.156  1.00 145.02 ? 45  DA  J "C3'" 1 
ATOM   9535  O "O3'" . DA  J 7  194 ? 118.216 79.551  73.194  1.00 147.31 ? 45  DA  J "O3'" 1 
ATOM   9536  C "C2'" . DA  J 7  194 ? 118.719 81.438  74.671  1.00 139.75 ? 45  DA  J "C2'" 1 
ATOM   9537  C "C1'" . DA  J 7  194 ? 117.849 81.090  75.862  1.00 135.88 ? 45  DA  J "C1'" 1 
ATOM   9538  N N9    . DA  J 7  194 ? 117.777 82.133  76.884  1.00 129.31 ? 45  DA  J N9    1 
ATOM   9539  C C8    . DA  J 7  194 ? 118.811 82.820  77.465  1.00 128.50 ? 45  DA  J C8    1 
ATOM   9540  N N7    . DA  J 7  194 ? 118.428 83.702  78.353  1.00 125.44 ? 45  DA  J N7    1 
ATOM   9541  C C5    . DA  J 7  194 ? 117.048 83.589  78.359  1.00 124.08 ? 45  DA  J C5    1 
ATOM   9542  C C6    . DA  J 7  194 ? 116.047 84.252  79.087  1.00 125.72 ? 45  DA  J C6    1 
ATOM   9543  N N6    . DA  J 7  194 ? 116.292 85.202  79.986  1.00 123.28 ? 45  DA  J N6    1 
ATOM   9544  N N1    . DA  J 7  194 ? 114.765 83.903  78.855  1.00 124.50 ? 45  DA  J N1    1 
ATOM   9545  C C2    . DA  J 7  194 ? 114.519 82.950  77.952  1.00 125.75 ? 45  DA  J C2    1 
ATOM   9546  N N3    . DA  J 7  194 ? 115.372 82.256  77.206  1.00 126.84 ? 45  DA  J N3    1 
ATOM   9547  C C4    . DA  J 7  194 ? 116.634 82.627  77.460  1.00 126.71 ? 45  DA  J C4    1 
ATOM   9548  P P     . DT  J 7  195 ? 118.158 80.087  71.673  1.00 159.39 ? 46  DT  J P     1 
ATOM   9549  O OP1   . DT  J 7  195 ? 117.898 78.930  70.782  1.00 154.59 ? 46  DT  J OP1   1 
ATOM   9550  O OP2   . DT  J 7  195 ? 119.340 80.953  71.427  1.00 150.57 ? 46  DT  J OP2   1 
ATOM   9551  O "O5'" . DT  J 7  195 ? 116.864 81.016  71.678  1.00 150.72 ? 46  DT  J "O5'" 1 
ATOM   9552  C "C5'" . DT  J 7  195 ? 115.600 80.507  72.144  1.00 149.37 ? 46  DT  J "C5'" 1 
ATOM   9553  C "C4'" . DT  J 7  195 ? 114.597 81.625  72.275  1.00 146.27 ? 46  DT  J "C4'" 1 
ATOM   9554  O "O4'" . DT  J 7  195 ? 114.823 82.329  73.510  1.00 138.56 ? 46  DT  J "O4'" 1 
ATOM   9555  C "C3'" . DT  J 7  195 ? 114.652 82.686  71.177  1.00 147.68 ? 46  DT  J "C3'" 1 
ATOM   9556  O "O3'" . DT  J 7  195 ? 113.568 82.462  70.261  1.00 149.51 ? 46  DT  J "O3'" 1 
ATOM   9557  C "C2'" . DT  J 7  195 ? 114.485 84.013  71.915  1.00 140.22 ? 46  DT  J "C2'" 1 
ATOM   9558  C "C1'" . DT  J 7  195 ? 114.309 83.635  73.374  1.00 136.73 ? 46  DT  J "C1'" 1 
ATOM   9559  N N1    . DT  J 7  195 ? 115.034 84.509  74.312  1.00 131.36 ? 46  DT  J N1    1 
ATOM   9560  C C2    . DT  J 7  195 ? 114.306 85.243  75.220  1.00 129.03 ? 46  DT  J C2    1 
ATOM   9561  O O2    . DT  J 7  195 ? 113.087 85.204  75.281  1.00 129.10 ? 46  DT  J O2    1 
ATOM   9562  N N3    . DT  J 7  195 ? 115.058 86.028  76.055  1.00 128.79 ? 46  DT  J N3    1 
ATOM   9563  C C4    . DT  J 7  195 ? 116.431 86.151  76.074  1.00 124.52 ? 46  DT  J C4    1 
ATOM   9564  O O4    . DT  J 7  195 ? 116.976 86.896  76.886  1.00 124.93 ? 46  DT  J O4    1 
ATOM   9565  C C5    . DT  J 7  195 ? 117.129 85.354  75.095  1.00 127.43 ? 46  DT  J C5    1 
ATOM   9566  C C7    . DT  J 7  195 ? 118.618 85.429  75.037  1.00 127.90 ? 46  DT  J C7    1 
ATOM   9567  C C6    . DT  J 7  195 ? 116.407 84.584  74.276  1.00 130.52 ? 46  DT  J C6    1 
ATOM   9568  P P     . DC  J 7  196 ? 113.410 83.306  68.895  1.00 152.60 ? 47  DC  J P     1 
ATOM   9569  O OP1   . DC  J 7  196 ? 112.678 82.478  67.903  1.00 156.69 ? 47  DC  J OP1   1 
ATOM   9570  O OP2   . DC  J 7  196 ? 114.719 83.916  68.543  1.00 152.93 ? 47  DC  J OP2   1 
ATOM   9571  O "O5'" . DC  J 7  196 ? 112.498 84.550  69.302  1.00 148.25 ? 47  DC  J "O5'" 1 
ATOM   9572  C "C5'" . DC  J 7  196 ? 111.155 84.349  69.783  1.00 148.71 ? 47  DC  J "C5'" 1 
ATOM   9573  C "C4'" . DC  J 7  196 ? 110.637 85.594  70.469  1.00 150.52 ? 47  DC  J "C4'" 1 
ATOM   9574  O "O4'" . DC  J 7  196 ? 111.531 85.977  71.533  1.00 144.15 ? 47  DC  J "O4'" 1 
ATOM   9575  C "C3'" . DC  J 7  196 ? 110.498 86.818  69.561  1.00 150.90 ? 47  DC  J "C3'" 1 
ATOM   9576  O "O3'" . DC  J 7  196 ? 109.103 87.133  69.412  1.00 148.93 ? 47  DC  J "O3'" 1 
ATOM   9577  C "C2'" . DC  J 7  196 ? 111.247 87.936  70.286  1.00 142.51 ? 47  DC  J "C2'" 1 
ATOM   9578  C "C1'" . DC  J 7  196 ? 111.523 87.384  71.671  1.00 140.74 ? 47  DC  J "C1'" 1 
ATOM   9579  N N1    . DC  J 7  196 ? 112.828 87.779  72.233  1.00 135.02 ? 47  DC  J N1    1 
ATOM   9580  C C2    . DC  J 7  196 ? 112.877 88.609  73.361  1.00 131.24 ? 47  DC  J C2    1 
ATOM   9581  O O2    . DC  J 7  196 ? 111.820 89.006  73.873  1.00 130.20 ? 47  DC  J O2    1 
ATOM   9582  N N3    . DC  J 7  196 ? 114.079 88.963  73.870  1.00 127.52 ? 47  DC  J N3    1 
ATOM   9583  C C4    . DC  J 7  196 ? 115.202 88.522  73.298  1.00 127.85 ? 47  DC  J C4    1 
ATOM   9584  N N4    . DC  J 7  196 ? 116.368 88.893  73.828  1.00 127.47 ? 47  DC  J N4    1 
ATOM   9585  C C5    . DC  J 7  196 ? 115.180 87.681  72.153  1.00 130.16 ? 47  DC  J C5    1 
ATOM   9586  C C6    . DC  J 7  196 ? 113.986 87.337  71.660  1.00 134.99 ? 47  DC  J C6    1 
ATOM   9587  P P     . DC  J 7  197 ? 108.577 88.223  68.347  1.00 154.08 ? 48  DC  J P     1 
ATOM   9588  O OP1   . DC  J 7  197 ? 107.215 87.836  67.903  1.00 154.56 ? 48  DC  J OP1   1 
ATOM   9589  O OP2   . DC  J 7  197 ? 109.648 88.485  67.350  1.00 152.54 ? 48  DC  J OP2   1 
ATOM   9590  O "O5'" . DC  J 7  197 ? 108.481 89.574  69.188  1.00 145.74 ? 48  DC  J "O5'" 1 
ATOM   9591  C "C5'" . DC  J 7  197 ? 107.716 89.618  70.408  1.00 143.48 ? 48  DC  J "C5'" 1 
ATOM   9592  C "C4'" . DC  J 7  197 ? 107.944 90.920  71.141  1.00 139.69 ? 48  DC  J "C4'" 1 
ATOM   9593  O "O4'" . DC  J 7  197 ? 109.306 90.987  71.631  1.00 135.86 ? 48  DC  J "O4'" 1 
ATOM   9594  C "C3'" . DC  J 7  197 ? 107.740 92.182  70.303  1.00 136.75 ? 48  DC  J "C3'" 1 
ATOM   9595  O "O3'" . DC  J 7  197 ? 107.103 93.175  71.117  1.00 132.90 ? 48  DC  J "O3'" 1 
ATOM   9596  C "C2'" . DC  J 7  197 ? 109.162 92.592  69.959  1.00 132.66 ? 48  DC  J "C2'" 1 
ATOM   9597  C "C1'" . DC  J 7  197 ? 109.890 92.218  71.237  1.00 129.75 ? 48  DC  J "C1'" 1 
ATOM   9598  N N1    . DC  J 7  197 ? 111.347 92.000  71.139  1.00 128.01 ? 48  DC  J N1    1 
ATOM   9599  C C2    . DC  J 7  197 ? 112.178 92.522  72.140  1.00 125.54 ? 48  DC  J C2    1 
ATOM   9600  O O2    . DC  J 7  197 ? 111.677 93.156  73.080  1.00 125.64 ? 48  DC  J O2    1 
ATOM   9601  N N3    . DC  J 7  197 ? 113.512 92.327  72.068  1.00 124.40 ? 48  DC  J N3    1 
ATOM   9602  C C4    . DC  J 7  197 ? 114.029 91.641  71.048  1.00 124.26 ? 48  DC  J C4    1 
ATOM   9603  N N4    . DC  J 7  197 ? 115.351 91.467  71.010  1.00 122.94 ? 48  DC  J N4    1 
ATOM   9604  C C5    . DC  J 7  197 ? 113.214 91.100  70.017  1.00 123.86 ? 48  DC  J C5    1 
ATOM   9605  C C6    . DC  J 7  197 ? 111.895 91.299  70.100  1.00 130.69 ? 48  DC  J C6    1 
ATOM   9606  P P     . DC  J 7  198 ? 106.281 94.408  70.488  1.00 135.00 ? 49  DC  J P     1 
ATOM   9607  O OP1   . DC  J 7  198 ? 104.837 94.067  70.467  1.00 137.36 ? 49  DC  J OP1   1 
ATOM   9608  O OP2   . DC  J 7  198 ? 106.972 94.863  69.253  1.00 134.91 ? 49  DC  J OP2   1 
ATOM   9609  O "O5'" . DC  J 7  198 ? 106.525 95.587  71.533  1.00 128.95 ? 49  DC  J "O5'" 1 
ATOM   9610  C "C5'" . DC  J 7  198 ? 106.107 95.444  72.904  1.00 127.70 ? 49  DC  J "C5'" 1 
ATOM   9611  C "C4'" . DC  J 7  198 ? 107.059 96.158  73.839  1.00 127.00 ? 49  DC  J "C4'" 1 
ATOM   9612  O "O4'" . DC  J 7  198 ? 108.421 95.750  73.574  1.00 126.66 ? 49  DC  J "O4'" 1 
ATOM   9613  C "C3'" . DC  J 7  198 ? 107.030 97.683  73.737  1.00 125.59 ? 49  DC  J "C3'" 1 
ATOM   9614  O "O3'" . DC  J 7  198 ? 106.878 98.235  75.055  1.00 125.90 ? 49  DC  J "O3'" 1 
ATOM   9615  C "C2'" . DC  J 7  198 ? 108.380 98.052  73.134  1.00 122.73 ? 49  DC  J "C2'" 1 
ATOM   9616  C "C1'" . DC  J 7  198 ? 109.273 96.879  73.491  1.00 123.48 ? 49  DC  J "C1'" 1 
ATOM   9617  N N1    . DC  J 7  198 ? 110.311 96.553  72.493  1.00 122.82 ? 49  DC  J N1    1 
ATOM   9618  C C2    . DC  J 7  198 ? 111.670 96.642  72.833  1.00 120.99 ? 49  DC  J C2    1 
ATOM   9619  O O2    . DC  J 7  198 ? 111.999 97.001  73.973  1.00 120.31 ? 49  DC  J O2    1 
ATOM   9620  N N3    . DC  J 7  198 ? 112.607 96.334  71.910  1.00 120.31 ? 49  DC  J N3    1 
ATOM   9621  C C4    . DC  J 7  198 ? 112.236 95.950  70.689  1.00 122.06 ? 49  DC  J C4    1 
ATOM   9622  N N4    . DC  J 7  198 ? 113.190 95.656  69.806  1.00 121.14 ? 49  DC  J N4    1 
ATOM   9623  C C5    . DC  J 7  198 ? 110.869 95.853  70.316  1.00 124.41 ? 49  DC  J C5    1 
ATOM   9624  C C6    . DC  J 7  198 ? 109.951 96.159  71.237  1.00 124.25 ? 49  DC  J C6    1 
ATOM   9625  P P     . DC  J 7  199 ? 106.413 99.759  75.302  1.00 128.87 ? 50  DC  J P     1 
ATOM   9626  O OP1   . DC  J 7  199 ? 105.647 99.824  76.571  1.00 124.21 ? 50  DC  J OP1   1 
ATOM   9627  O OP2   . DC  J 7  199 ? 105.831 100.297 74.044  1.00 126.54 ? 50  DC  J OP2   1 
ATOM   9628  O "O5'" . DC  J 7  199 ? 107.779 100.562 75.483  1.00 124.54 ? 50  DC  J "O5'" 1 
ATOM   9629  C "C5'" . DC  J 7  199 ? 108.740 100.165 76.483  1.00 124.05 ? 50  DC  J "C5'" 1 
ATOM   9630  C "C4'" . DC  J 7  199 ? 110.071 100.846 76.255  1.00 119.64 ? 50  DC  J "C4'" 1 
ATOM   9631  O "O4'" . DC  J 7  199 ? 110.701 100.310 75.063  1.00 117.66 ? 50  DC  J "O4'" 1 
ATOM   9632  C "C3'" . DC  J 7  199 ? 109.988 102.359 76.029  1.00 120.35 ? 50  DC  J "C3'" 1 
ATOM   9633  O "O3'" . DC  J 7  199 ? 111.134 103.019 76.576  1.00 115.90 ? 50  DC  J "O3'" 1 
ATOM   9634  C "C2'" . DC  J 7  199 ? 110.042 102.460 74.522  1.00 117.72 ? 50  DC  J "C2'" 1 
ATOM   9635  C "C1'" . DC  J 7  199 ? 111.073 101.386 74.221  1.00 115.76 ? 50  DC  J "C1'" 1 
ATOM   9636  N N1    . DC  J 7  199 ? 111.145 100.894 72.829  1.00 115.84 ? 50  DC  J N1    1 
ATOM   9637  C C2    . DC  J 7  199 ? 112.392 100.508 72.322  1.00 114.45 ? 50  DC  J C2    1 
ATOM   9638  O O2    . DC  J 7  199 ? 113.395 100.588 73.043  1.00 115.87 ? 50  DC  J O2    1 
ATOM   9639  N N3    . DC  J 7  199 ? 112.488 100.054 71.055  1.00 116.05 ? 50  DC  J N3    1 
ATOM   9640  C C4    . DC  J 7  199 ? 111.399 99.975  70.296  1.00 118.95 ? 50  DC  J C4    1 
ATOM   9641  N N4    . DC  J 7  199 ? 111.532 99.523  69.047  1.00 121.18 ? 50  DC  J N4    1 
ATOM   9642  C C5    . DC  J 7  199 ? 110.120 100.359 70.778  1.00 116.51 ? 50  DC  J C5    1 
ATOM   9643  C C6    . DC  J 7  199 ? 110.036 100.807 72.034  1.00 116.58 ? 50  DC  J C6    1 
ATOM   9644  P P     . DT  J 7  200 ? 111.133 103.687 78.041  1.00 118.39 ? 51  DT  J P     1 
ATOM   9645  O OP1   . DT  J 7  200 ? 110.724 102.667 79.041  1.00 114.76 ? 51  DT  J OP1   1 
ATOM   9646  O OP2   . DT  J 7  200 ? 110.396 104.975 77.954  1.00 109.32 ? 51  DT  J OP2   1 
ATOM   9647  O "O5'" . DT  J 7  200 ? 112.676 104.015 78.257  1.00 110.22 ? 51  DT  J "O5'" 1 
ATOM   9648  C "C5'" . DT  J 7  200 ? 113.678 103.007 78.014  1.00 116.08 ? 51  DT  J "C5'" 1 
ATOM   9649  C "C4'" . DT  J 7  200 ? 114.728 103.498 77.043  1.00 113.44 ? 51  DT  J "C4'" 1 
ATOM   9650  O "O4'" . DT  J 7  200 ? 114.415 103.069 75.703  1.00 113.07 ? 51  DT  J "O4'" 1 
ATOM   9651  C "C3'" . DT  J 7  200 ? 114.916 105.014 76.958  1.00 109.84 ? 51  DT  J "C3'" 1 
ATOM   9652  O "O3'" . DT  J 7  200 ? 116.132 105.336 77.655  1.00 107.51 ? 51  DT  J "O3'" 1 
ATOM   9653  C "C2'" . DT  J 7  200 ? 115.006 105.304 75.454  1.00 109.36 ? 51  DT  J "C2'" 1 
ATOM   9654  C "C1'" . DT  J 7  200 ? 115.095 103.929 74.817  1.00 111.79 ? 51  DT  J "C1'" 1 
ATOM   9655  N N1    . DT  J 7  200 ? 114.474 103.792 73.483  1.00 111.89 ? 51  DT  J N1    1 
ATOM   9656  C C2    . DT  J 7  200 ? 115.235 103.245 72.474  1.00 114.52 ? 51  DT  J C2    1 
ATOM   9657  O O2    . DT  J 7  200 ? 116.386 102.874 72.636  1.00 114.11 ? 51  DT  J O2    1 
ATOM   9658  N N3    . DT  J 7  200 ? 114.599 103.143 71.263  1.00 114.67 ? 51  DT  J N3    1 
ATOM   9659  C C4    . DT  J 7  200 ? 113.310 103.526 70.965  1.00 114.24 ? 51  DT  J C4    1 
ATOM   9660  O O4    . DT  J 7  200 ? 112.863 103.373 69.830  1.00 116.17 ? 51  DT  J O4    1 
ATOM   9661  C C5    . DT  J 7  200 ? 112.570 104.092 72.062  1.00 112.37 ? 51  DT  J C5    1 
ATOM   9662  C C7    . DT  J 7  200 ? 111.169 104.542 71.812  1.00 116.55 ? 51  DT  J C7    1 
ATOM   9663  C C6    . DT  J 7  200 ? 113.177 104.196 73.251  1.00 111.74 ? 51  DT  J C6    1 
ATOM   9664  P P     . DT  J 7  201 ? 116.711 106.836 77.787  1.00 107.30 ? 52  DT  J P     1 
ATOM   9665  O OP1   . DT  J 7  201 ? 117.458 106.938 79.065  1.00 100.37 ? 52  DT  J OP1   1 
ATOM   9666  O OP2   . DT  J 7  201 ? 115.616 107.796 77.498  1.00 108.44 ? 52  DT  J OP2   1 
ATOM   9667  O "O5'" . DT  J 7  201 ? 117.754 106.910 76.584  1.00 106.15 ? 52  DT  J "O5'" 1 
ATOM   9668  C "C5'" . DT  J 7  201 ? 118.673 105.828 76.341  1.00 109.21 ? 52  DT  J "C5'" 1 
ATOM   9669  C "C4'" . DT  J 7  201 ? 119.275 105.941 74.962  1.00 112.71 ? 52  DT  J "C4'" 1 
ATOM   9670  O "O4'" . DT  J 7  201 ? 118.287 105.602 73.965  1.00 110.05 ? 52  DT  J "O4'" 1 
ATOM   9671  C "C3'" . DT  J 7  201 ? 119.802 107.329 74.592  1.00 114.16 ? 52  DT  J "C3'" 1 
ATOM   9672  O "O3'" . DT  J 7  201 ? 121.215 107.233 74.360  1.00 119.21 ? 52  DT  J "O3'" 1 
ATOM   9673  C "C2'" . DT  J 7  201 ? 119.049 107.693 73.314  1.00 112.56 ? 52  DT  J "C2'" 1 
ATOM   9674  C "C1'" . DT  J 7  201 ? 118.553 106.355 72.802  1.00 112.59 ? 52  DT  J "C1'" 1 
ATOM   9675  N N1    . DT  J 7  201 ? 117.313 106.416 72.000  1.00 111.10 ? 52  DT  J N1    1 
ATOM   9676  C C2    . DT  J 7  201 ? 117.326 105.909 70.717  1.00 113.97 ? 52  DT  J C2    1 
ATOM   9677  O O2    . DT  J 7  201 ? 118.316 105.410 70.207  1.00 115.64 ? 52  DT  J O2    1 
ATOM   9678  N N3    . DT  J 7  201 ? 116.132 106.009 70.048  1.00 114.86 ? 52  DT  J N3    1 
ATOM   9679  C C4    . DT  J 7  201 ? 114.956 106.552 70.525  1.00 114.96 ? 52  DT  J C4    1 
ATOM   9680  O O4    . DT  J 7  201 ? 113.952 106.578 69.819  1.00 116.55 ? 52  DT  J O4    1 
ATOM   9681  C C5    . DT  J 7  201 ? 115.016 107.062 71.870  1.00 112.08 ? 52  DT  J C5    1 
ATOM   9682  C C7    . DT  J 7  201 ? 113.791 107.675 72.462  1.00 114.75 ? 52  DT  J C7    1 
ATOM   9683  C C6    . DT  J 7  201 ? 116.172 106.970 72.530  1.00 110.28 ? 52  DT  J C6    1 
ATOM   9684  P P     . DG  J 7  202 ? 122.161 108.536 74.289  1.00 129.25 ? 53  DG  J P     1 
ATOM   9685  O OP1   . DG  J 7  202 ? 123.542 108.123 74.642  1.00 126.24 ? 53  DG  J OP1   1 
ATOM   9686  O OP2   . DG  J 7  202 ? 121.511 109.639 75.042  1.00 123.61 ? 53  DG  J OP2   1 
ATOM   9687  O "O5'" . DG  J 7  202 ? 122.131 108.916 72.745  1.00 121.09 ? 53  DG  J "O5'" 1 
ATOM   9688  C "C5'" . DG  J 7  202 ? 122.582 107.975 71.756  1.00 124.72 ? 53  DG  J "C5'" 1 
ATOM   9689  C "C4'" . DG  J 7  202 ? 122.162 108.419 70.378  1.00 128.54 ? 53  DG  J "C4'" 1 
ATOM   9690  O "O4'" . DG  J 7  202 ? 120.757 108.157 70.187  1.00 123.44 ? 53  DG  J "O4'" 1 
ATOM   9691  C "C3'" . DG  J 7  202 ? 122.346 109.908 70.078  1.00 130.27 ? 53  DG  J "C3'" 1 
ATOM   9692  O "O3'" . DG  J 7  202 ? 123.503 110.060 69.236  1.00 134.44 ? 53  DG  J "O3'" 1 
ATOM   9693  C "C2'" . DG  J 7  202 ? 121.056 110.315 69.365  1.00 124.41 ? 53  DG  J "C2'" 1 
ATOM   9694  C "C1'" . DG  J 7  202 ? 120.302 109.016 69.164  1.00 122.09 ? 53  DG  J "C1'" 1 
ATOM   9695  N N9    . DG  J 7  202 ? 118.855 109.158 69.272  1.00 117.01 ? 53  DG  J N9    1 
ATOM   9696  C C8    . DG  J 7  202 ? 118.131 109.557 70.368  1.00 115.20 ? 53  DG  J C8    1 
ATOM   9697  N N7    . DG  J 7  202 ? 116.847 109.587 70.149  1.00 114.15 ? 53  DG  J N7    1 
ATOM   9698  C C5    . DG  J 7  202 ? 116.715 109.184 68.831  1.00 113.61 ? 53  DG  J C5    1 
ATOM   9699  C C6    . DG  J 7  202 ? 115.560 109.020 68.030  1.00 116.40 ? 53  DG  J C6    1 
ATOM   9700  O O6    . DG  J 7  202 ? 114.378 109.206 68.341  1.00 118.46 ? 53  DG  J O6    1 
ATOM   9701  N N1    . DG  J 7  202 ? 115.882 108.592 66.747  1.00 117.91 ? 53  DG  J N1    1 
ATOM   9702  C C2    . DG  J 7  202 ? 117.153 108.356 66.293  1.00 118.64 ? 53  DG  J C2    1 
ATOM   9703  N N2    . DG  J 7  202 ? 117.273 107.947 65.020  1.00 120.99 ? 53  DG  J N2    1 
ATOM   9704  N N3    . DG  J 7  202 ? 118.238 108.502 67.032  1.00 117.84 ? 53  DG  J N3    1 
ATOM   9705  C C4    . DG  J 7  202 ? 117.946 108.917 68.278  1.00 120.43 ? 53  DG  J C4    1 
ATOM   9706  P P     . DG  J 7  203 ? 124.037 111.501 68.742  1.00 144.37 ? 54  DG  J P     1 
ATOM   9707  O OP1   . DG  J 7  203 ? 125.502 111.399 68.521  1.00 142.69 ? 54  DG  J OP1   1 
ATOM   9708  O OP2   . DG  J 7  203 ? 123.503 112.547 69.653  1.00 139.30 ? 54  DG  J OP2   1 
ATOM   9709  O "O5'" . DG  J 7  203 ? 123.327 111.675 67.326  1.00 135.11 ? 54  DG  J "O5'" 1 
ATOM   9710  C "C5'" . DG  J 7  203 ? 123.331 110.594 66.372  1.00 136.02 ? 54  DG  J "C5'" 1 
ATOM   9711  C "C4'" . DG  J 7  203 ? 122.431 110.906 65.201  1.00 134.71 ? 54  DG  J "C4'" 1 
ATOM   9712  O "O4'" . DG  J 7  203 ? 121.048 110.701 65.581  1.00 126.65 ? 54  DG  J "O4'" 1 
ATOM   9713  C "C3'" . DG  J 7  203 ? 122.526 112.329 64.647  1.00 138.05 ? 54  DG  J "C3'" 1 
ATOM   9714  O "O3'" . DG  J 7  203 ? 122.733 112.249 63.227  1.00 140.70 ? 54  DG  J "O3'" 1 
ATOM   9715  C "C2'" . DG  J 7  203 ? 121.174 112.942 64.981  1.00 133.09 ? 54  DG  J "C2'" 1 
ATOM   9716  C "C1'" . DG  J 7  203 ? 120.260 111.735 65.023  1.00 126.45 ? 54  DG  J "C1'" 1 
ATOM   9717  N N9    . DG  J 7  203 ? 119.072 111.924 65.849  1.00 122.30 ? 54  DG  J N9    1 
ATOM   9718  C C8    . DG  J 7  203 ? 119.028 112.265 67.178  1.00 120.86 ? 54  DG  J C8    1 
ATOM   9719  N N7    . DG  J 7  203 ? 117.815 112.363 67.642  1.00 118.84 ? 54  DG  J N7    1 
ATOM   9720  C C5    . DG  J 7  203 ? 117.007 112.071 66.556  1.00 119.35 ? 54  DG  J C5    1 
ATOM   9721  C C6    . DG  J 7  203 ? 115.595 112.020 66.451  1.00 119.81 ? 54  DG  J C6    1 
ATOM   9722  O O6    . DG  J 7  203 ? 114.754 112.233 67.332  1.00 121.32 ? 54  DG  J O6    1 
ATOM   9723  N N1    . DG  J 7  203 ? 115.189 111.684 65.166  1.00 127.43 ? 54  DG  J N1    1 
ATOM   9724  C C2    . DG  J 7  203 ? 116.035 111.429 64.117  1.00 122.30 ? 54  DG  J C2    1 
ATOM   9725  N N2    . DG  J 7  203 ? 115.457 111.118 62.949  1.00 123.61 ? 54  DG  J N2    1 
ATOM   9726  N N3    . DG  J 7  203 ? 117.355 111.471 64.203  1.00 121.74 ? 54  DG  J N3    1 
ATOM   9727  C C4    . DG  J 7  203 ? 117.768 111.797 65.442  1.00 120.96 ? 54  DG  J C4    1 
ATOM   9728  P P     . DC  J 7  204 ? 123.152 113.532 62.345  1.00 150.05 ? 55  DC  J P     1 
ATOM   9729  O OP1   . DC  J 7  204 ? 123.999 113.078 61.214  1.00 145.75 ? 55  DC  J OP1   1 
ATOM   9730  O OP2   . DC  J 7  204 ? 123.617 114.616 63.249  1.00 145.10 ? 55  DC  J OP2   1 
ATOM   9731  O "O5'" . DC  J 7  204 ? 121.770 114.071 61.772  1.00 140.40 ? 55  DC  J "O5'" 1 
ATOM   9732  C "C5'" . DC  J 7  204 ? 120.931 113.226 60.965  1.00 140.66 ? 55  DC  J "C5'" 1 
ATOM   9733  C "C4'" . DC  J 7  204 ? 119.692 113.977 60.545  1.00 140.64 ? 55  DC  J "C4'" 1 
ATOM   9734  O "O4'" . DC  J 7  204 ? 118.658 113.786 61.527  1.00 132.46 ? 55  DC  J "O4'" 1 
ATOM   9735  C "C3'" . DC  J 7  204 ? 119.877 115.491 60.422  1.00 142.66 ? 55  DC  J "C3'" 1 
ATOM   9736  O "O3'" . DC  J 7  204 ? 119.940 115.847 59.032  1.00 147.08 ? 55  DC  J "O3'" 1 
ATOM   9737  C "C2'" . DC  J 7  204 ? 118.646 116.089 61.098  1.00 133.18 ? 55  DC  J "C2'" 1 
ATOM   9738  C "C1'" . DC  J 7  204 ? 117.790 114.897 61.482  1.00 129.63 ? 55  DC  J "C1'" 1 
ATOM   9739  N N1    . DC  J 7  204 ? 117.156 115.025 62.802  1.00 125.11 ? 55  DC  J N1    1 
ATOM   9740  C C2    . DC  J 7  204 ? 115.761 115.058 62.892  1.00 122.89 ? 55  DC  J C2    1 
ATOM   9741  O O2    . DC  J 7  204 ? 115.080 114.981 61.858  1.00 124.11 ? 55  DC  J O2    1 
ATOM   9742  N N3    . DC  J 7  204 ? 115.182 115.174 64.104  1.00 121.50 ? 55  DC  J N3    1 
ATOM   9743  C C4    . DC  J 7  204 ? 115.941 115.255 65.198  1.00 121.46 ? 55  DC  J C4    1 
ATOM   9744  N N4    . DC  J 7  204 ? 115.330 115.368 66.376  1.00 122.39 ? 55  DC  J N4    1 
ATOM   9745  C C5    . DC  J 7  204 ? 117.360 115.224 65.135  1.00 121.57 ? 55  DC  J C5    1 
ATOM   9746  C C6    . DC  J 7  204 ? 117.922 115.109 63.930  1.00 123.34 ? 55  DC  J C6    1 
ATOM   9747  P P     . DG  J 7  205 ? 120.342 117.333 58.544  1.00 148.95 ? 56  DG  J P     1 
ATOM   9748  O OP1   . DG  J 7  205 ? 120.928 117.231 57.184  1.00 152.39 ? 56  DG  J OP1   1 
ATOM   9749  O OP2   . DG  J 7  205 ? 121.112 118.000 59.626  1.00 146.97 ? 56  DG  J OP2   1 
ATOM   9750  O "O5'" . DG  J 7  205 ? 118.932 118.065 58.427  1.00 144.55 ? 56  DG  J "O5'" 1 
ATOM   9751  C "C5'" . DG  J 7  205 ? 117.848 117.463 57.693  1.00 140.37 ? 56  DG  J "C5'" 1 
ATOM   9752  C "C4'" . DG  J 7  205 ? 116.598 118.299 57.822  1.00 141.71 ? 56  DG  J "C4'" 1 
ATOM   9753  O "O4'" . DG  J 7  205 ? 115.961 118.035 59.100  1.00 134.21 ? 56  DG  J "O4'" 1 
ATOM   9754  C "C3'" . DG  J 7  205 ? 116.812 119.812 57.759  1.00 143.45 ? 56  DG  J "C3'" 1 
ATOM   9755  O "O3'" . DG  J 7  205 ? 115.748 120.392 56.989  1.00 142.87 ? 56  DG  J "O3'" 1 
ATOM   9756  C "C2'" . DG  J 7  205 ? 116.735 120.226 59.219  1.00 135.96 ? 56  DG  J "C2'" 1 
ATOM   9757  C "C1'" . DG  J 7  205 ? 115.698 119.264 59.761  1.00 129.83 ? 56  DG  J "C1'" 1 
ATOM   9758  N N9    . DG  J 7  205 ? 115.769 119.035 61.203  1.00 124.38 ? 56  DG  J N9    1 
ATOM   9759  C C8    . DG  J 7  205 ? 116.898 118.888 61.971  1.00 124.18 ? 56  DG  J C8    1 
ATOM   9760  N N7    . DG  J 7  205 ? 116.640 118.695 63.233  1.00 119.31 ? 56  DG  J N7    1 
ATOM   9761  C C5    . DG  J 7  205 ? 115.259 118.714 63.306  1.00 121.69 ? 56  DG  J C5    1 
ATOM   9762  C C6    . DG  J 7  205 ? 114.402 118.558 64.420  1.00 121.75 ? 56  DG  J C6    1 
ATOM   9763  O O6    . DG  J 7  205 ? 114.710 118.361 65.600  1.00 119.49 ? 56  DG  J O6    1 
ATOM   9764  N N1    . DG  J 7  205 ? 113.065 118.647 64.055  1.00 118.73 ? 56  DG  J N1    1 
ATOM   9765  C C2    . DG  J 7  205 ? 112.609 118.860 62.779  1.00 120.83 ? 56  DG  J C2    1 
ATOM   9766  N N2    . DG  J 7  205 ? 111.277 118.913 62.628  1.00 121.28 ? 56  DG  J N2    1 
ATOM   9767  N N3    . DG  J 7  205 ? 113.400 119.007 61.728  1.00 121.46 ? 56  DG  J N3    1 
ATOM   9768  C C4    . DG  J 7  205 ? 114.704 118.923 62.063  1.00 123.25 ? 56  DG  J C4    1 
ATOM   9769  P P     . DG  J 7  206 ? 115.774 121.926 56.494  1.00 149.09 ? 57  DG  J P     1 
ATOM   9770  O OP1   . DG  J 7  206 ? 115.564 121.942 55.025  1.00 147.47 ? 57  DG  J OP1   1 
ATOM   9771  O OP2   . DG  J 7  206 ? 116.966 122.597 57.076  1.00 144.91 ? 57  DG  J OP2   1 
ATOM   9772  O "O5'" . DG  J 7  206 ? 114.480 122.536 57.193  1.00 139.04 ? 57  DG  J "O5'" 1 
ATOM   9773  C "C5'" . DG  J 7  206 ? 113.206 121.875 57.061  1.00 138.54 ? 57  DG  J "C5'" 1 
ATOM   9774  C "C4'" . DG  J 7  206 ? 112.180 122.504 57.971  1.00 137.76 ? 57  DG  J "C4'" 1 
ATOM   9775  O "O4'" . DG  J 7  206 ? 112.378 122.018 59.321  1.00 131.08 ? 57  DG  J "O4'" 1 
ATOM   9776  C "C3'" . DG  J 7  206 ? 112.203 124.031 58.045  1.00 135.85 ? 57  DG  J "C3'" 1 
ATOM   9777  O "O3'" . DG  J 7  206 ? 110.854 124.501 57.899  1.00 133.96 ? 57  DG  J "O3'" 1 
ATOM   9778  C "C2'" . DG  J 7  206 ? 112.766 124.320 59.430  1.00 131.01 ? 57  DG  J "C2'" 1 
ATOM   9779  C "C1'" . DG  J 7  206 ? 112.363 123.100 60.235  1.00 127.47 ? 57  DG  J "C1'" 1 
ATOM   9780  N N9    . DG  J 7  206 ? 113.285 122.781 61.323  1.00 123.60 ? 57  DG  J N9    1 
ATOM   9781  C C8    . DG  J 7  206 ? 114.650 122.666 61.240  1.00 124.57 ? 57  DG  J C8    1 
ATOM   9782  N N7    . DG  J 7  206 ? 115.212 122.374 62.379  1.00 119.20 ? 57  DG  J N7    1 
ATOM   9783  C C5    . DG  J 7  206 ? 114.155 122.290 63.270  1.00 119.68 ? 57  DG  J C5    1 
ATOM   9784  C C6    . DG  J 7  206 ? 114.147 121.999 64.657  1.00 118.17 ? 57  DG  J C6    1 
ATOM   9785  O O6    . DG  J 7  206 ? 115.109 121.751 65.393  1.00 116.49 ? 57  DG  J O6    1 
ATOM   9786  N N1    . DG  J 7  206 ? 112.857 122.015 65.177  1.00 117.39 ? 57  DG  J N1    1 
ATOM   9787  C C2    . DG  J 7  206 ? 111.721 122.278 64.453  1.00 118.81 ? 57  DG  J C2    1 
ATOM   9788  N N2    . DG  J 7  206 ? 110.563 122.247 65.129  1.00 117.76 ? 57  DG  J N2    1 
ATOM   9789  N N3    . DG  J 7  206 ? 111.717 122.549 63.157  1.00 120.47 ? 57  DG  J N3    1 
ATOM   9790  C C4    . DG  J 7  206 ? 112.959 122.539 62.634  1.00 121.02 ? 57  DG  J C4    1 
ATOM   9791  P P     . DT  J 7  207 ? 110.474 126.066 57.806  1.00 139.24 ? 58  DT  J P     1 
ATOM   9792  O OP1   . DT  J 7  207 ? 109.565 126.260 56.649  1.00 138.14 ? 58  DT  J OP1   1 
ATOM   9793  O OP2   . DT  J 7  207 ? 111.722 126.868 57.906  1.00 133.37 ? 58  DT  J OP2   1 
ATOM   9794  O "O5'" . DT  J 7  207 ? 109.639 126.288 59.144  1.00 131.40 ? 58  DT  J "O5'" 1 
ATOM   9795  C "C5'" . DT  J 7  207 ? 108.612 125.350 59.517  1.00 133.41 ? 58  DT  J "C5'" 1 
ATOM   9796  C "C4'" . DT  J 7  207 ? 108.071 125.661 60.891  1.00 132.15 ? 58  DT  J "C4'" 1 
ATOM   9797  O "O4'" . DT  J 7  207 ? 109.013 125.207 61.890  1.00 127.28 ? 58  DT  J "O4'" 1 
ATOM   9798  C "C3'" . DT  J 7  207 ? 107.807 127.139 61.172  1.00 128.70 ? 58  DT  J "C3'" 1 
ATOM   9799  O "O3'" . DT  J 7  207 ? 106.504 127.263 61.760  1.00 130.42 ? 58  DT  J "O3'" 1 
ATOM   9800  C "C2'" . DT  J 7  207 ? 108.908 127.527 62.153  1.00 125.56 ? 58  DT  J "C2'" 1 
ATOM   9801  C "C1'" . DT  J 7  207 ? 109.215 126.218 62.858  1.00 124.74 ? 58  DT  J "C1'" 1 
ATOM   9802  N N1    . DT  J 7  207 ? 110.598 126.083 63.361  1.00 120.26 ? 58  DT  J N1    1 
ATOM   9803  C C2    . DT  J 7  207 ? 110.785 125.721 64.677  1.00 118.03 ? 58  DT  J C2    1 
ATOM   9804  O O2    . DT  J 7  207 ? 109.865 125.507 65.449  1.00 118.84 ? 58  DT  J O2    1 
ATOM   9805  N N3    . DT  J 7  207 ? 112.097 125.615 65.064  1.00 115.81 ? 58  DT  J N3    1 
ATOM   9806  C C4    . DT  J 7  207 ? 113.214 125.831 64.286  1.00 115.46 ? 58  DT  J C4    1 
ATOM   9807  O O4    . DT  J 7  207 ? 114.336 125.695 64.765  1.00 113.50 ? 58  DT  J O4    1 
ATOM   9808  C C5    . DT  J 7  207 ? 112.947 126.207 62.922  1.00 118.51 ? 58  DT  J C5    1 
ATOM   9809  C C7    . DT  J 7  207 ? 114.100 126.469 62.013  1.00 119.50 ? 58  DT  J C7    1 
ATOM   9810  C C6    . DT  J 7  207 ? 111.673 126.313 62.532  1.00 119.66 ? 58  DT  J C6    1 
ATOM   9811  P P     . DT  J 7  208 ? 105.769 128.688 61.932  1.00 143.54 ? 59  DT  J P     1 
ATOM   9812  O OP1   . DT  J 7  208 ? 104.304 128.462 61.897  1.00 136.77 ? 59  DT  J OP1   1 
ATOM   9813  O OP2   . DT  J 7  208 ? 106.387 129.658 60.991  1.00 137.39 ? 59  DT  J OP2   1 
ATOM   9814  O "O5'" . DT  J 7  208 ? 106.174 129.113 63.412  1.00 130.12 ? 59  DT  J "O5'" 1 
ATOM   9815  C "C5'" . DT  J 7  208 ? 105.923 128.222 64.513  1.00 128.82 ? 59  DT  J "C5'" 1 
ATOM   9816  C "C4'" . DT  J 7  208 ? 106.625 128.708 65.757  1.00 126.04 ? 59  DT  J "C4'" 1 
ATOM   9817  O "O4'" . DT  J 7  208 ? 108.037 128.389 65.684  1.00 121.63 ? 59  DT  J "O4'" 1 
ATOM   9818  C "C3'" . DT  J 7  208 ? 106.543 130.218 66.002  1.00 124.48 ? 59  DT  J "C3'" 1 
ATOM   9819  O "O3'" . DT  J 7  208 ? 106.225 130.460 67.376  1.00 122.80 ? 59  DT  J "O3'" 1 
ATOM   9820  C "C2'" . DT  J 7  208 ? 107.954 130.698 65.714  1.00 118.82 ? 59  DT  J "C2'" 1 
ATOM   9821  C "C1'" . DT  J 7  208 ? 108.766 129.497 66.165  1.00 115.93 ? 59  DT  J "C1'" 1 
ATOM   9822  N N1    . DT  J 7  208 ? 110.154 129.414 65.664  1.00 114.17 ? 59  DT  J N1    1 
ATOM   9823  C C2    . DT  J 7  208 ? 111.125 128.979 66.538  1.00 111.84 ? 59  DT  J C2    1 
ATOM   9824  O O2    . DT  J 7  208 ? 110.885 128.659 67.690  1.00 111.85 ? 59  DT  J O2    1 
ATOM   9825  N N3    . DT  J 7  208 ? 112.392 128.927 66.013  1.00 113.02 ? 59  DT  J N3    1 
ATOM   9826  C C4    . DT  J 7  208 ? 112.777 129.259 64.731  1.00 114.47 ? 59  DT  J C4    1 
ATOM   9827  O O4    . DT  J 7  208 ? 113.955 129.167 64.390  1.00 115.42 ? 59  DT  J O4    1 
ATOM   9828  C C5    . DT  J 7  208 ? 111.711 129.704 63.870  1.00 114.98 ? 59  DT  J C5    1 
ATOM   9829  C C7    . DT  J 7  208 ? 112.030 130.079 62.460  1.00 119.97 ? 59  DT  J C7    1 
ATOM   9830  C C6    . DT  J 7  208 ? 110.474 129.760 64.370  1.00 113.89 ? 59  DT  J C6    1 
ATOM   9831  P P     . DA  J 7  209 ? 104.757 130.924 67.844  1.00 128.62 ? 60  DA  J P     1 
ATOM   9832  O OP1   . DA  J 7  209 ? 103.754 129.941 67.359  1.00 129.39 ? 60  DA  J OP1   1 
ATOM   9833  O OP2   . DA  J 7  209 ? 104.600 132.364 67.511  1.00 126.16 ? 60  DA  J OP2   1 
ATOM   9834  O "O5'" . DA  J 7  209 ? 104.849 130.786 69.426  1.00 125.45 ? 60  DA  J "O5'" 1 
ATOM   9835  C "C5'" . DA  J 7  209 ? 104.702 129.493 70.043  1.00 125.20 ? 60  DA  J "C5'" 1 
ATOM   9836  C "C4'" . DA  J 7  209 ? 105.721 129.292 71.141  1.00 122.98 ? 60  DA  J "C4'" 1 
ATOM   9837  O "O4'" . DA  J 7  209 ? 107.063 129.383 70.601  1.00 119.46 ? 60  DA  J "O4'" 1 
ATOM   9838  C "C3'" . DA  J 7  209 ? 105.658 130.302 72.283  1.00 122.50 ? 60  DA  J "C3'" 1 
ATOM   9839  O "O3'" . DA  J 7  209 ? 105.936 129.616 73.514  1.00 120.24 ? 60  DA  J "O3'" 1 
ATOM   9840  C "C2'" . DA  J 7  209 ? 106.757 131.289 71.916  1.00 119.11 ? 60  DA  J "C2'" 1 
ATOM   9841  C "C1'" . DA  J 7  209 ? 107.800 130.385 71.286  1.00 115.08 ? 60  DA  J "C1'" 1 
ATOM   9842  N N9    . DA  J 7  209 ? 108.684 131.036 70.315  1.00 112.57 ? 60  DA  J N9    1 
ATOM   9843  C C8    . DA  J 7  209 ? 108.362 131.944 69.337  1.00 112.67 ? 60  DA  J C8    1 
ATOM   9844  N N7    . DA  J 7  209 ? 109.387 132.340 68.622  1.00 109.55 ? 60  DA  J N7    1 
ATOM   9845  C C5    . DA  J 7  209 ? 110.456 131.648 69.163  1.00 107.47 ? 60  DA  J C5    1 
ATOM   9846  C C6    . DA  J 7  209 ? 111.822 131.628 68.847  1.00 107.83 ? 60  DA  J C6    1 
ATOM   9847  N N6    . DA  J 7  209 ? 112.365 132.351 67.869  1.00 108.48 ? 60  DA  J N6    1 
ATOM   9848  N N1    . DA  J 7  209 ? 112.624 130.830 69.580  1.00 107.13 ? 60  DA  J N1    1 
ATOM   9849  C C2    . DA  J 7  209 ? 112.075 130.105 70.560  1.00 107.33 ? 60  DA  J C2    1 
ATOM   9850  N N3    . DA  J 7  209 ? 110.807 130.039 70.950  1.00 107.48 ? 60  DA  J N3    1 
ATOM   9851  C C4    . DA  J 7  209 ? 110.038 130.843 70.204  1.00 107.88 ? 60  DA  J C4    1 
ATOM   9852  P P     . DA  J 7  210 ? 105.826 130.335 74.952  1.00 127.31 ? 61  DA  J P     1 
ATOM   9853  O OP1   . DA  J 7  210 ? 105.111 129.418 75.875  1.00 124.82 ? 61  DA  J OP1   1 
ATOM   9854  O OP2   . DA  J 7  210 ? 105.327 131.720 74.751  1.00 123.10 ? 61  DA  J OP2   1 
ATOM   9855  O "O5'" . DA  J 7  210 ? 107.347 130.419 75.414  1.00 115.32 ? 61  DA  J "O5'" 1 
ATOM   9856  C "C5'" . DA  J 7  210 ? 108.153 129.227 75.438  1.00 115.03 ? 61  DA  J "C5'" 1 
ATOM   9857  C "C4'" . DA  J 7  210 ? 109.595 129.555 75.738  1.00 110.43 ? 61  DA  J "C4'" 1 
ATOM   9858  O "O4'" . DA  J 7  210 ? 110.195 130.198 74.590  1.00 109.74 ? 61  DA  J "O4'" 1 
ATOM   9859  C "C3'" . DA  J 7  210 ? 109.837 130.490 76.922  1.00 104.40 ? 61  DA  J "C3'" 1 
ATOM   9860  O "O3'" . DA  J 7  210 ? 110.987 130.006 77.632  1.00 101.32 ? 61  DA  J "O3'" 1 
ATOM   9861  C "C2'" . DA  J 7  210 ? 110.101 131.827 76.243  1.00 104.09 ? 61  DA  J "C2'" 1 
ATOM   9862  C "C1'" . DA  J 7  210 ? 110.840 131.393 74.992  1.00 103.16 ? 61  DA  J "C1'" 1 
ATOM   9863  N N9    . DA  J 7  210 ? 110.791 132.326 73.865  1.00 103.89 ? 61  DA  J N9    1 
ATOM   9864  C C8    . DA  J 7  210 ? 109.717 133.028 73.379  1.00 105.48 ? 61  DA  J C8    1 
ATOM   9865  N N7    . DA  J 7  210 ? 110.001 133.785 72.347  1.00 102.20 ? 61  DA  J N7    1 
ATOM   9866  C C5    . DA  J 7  210 ? 111.352 133.567 72.138  1.00 101.22 ? 61  DA  J C5    1 
ATOM   9867  C C6    . DA  J 7  210 ? 112.257 134.072 71.193  1.00 102.53 ? 61  DA