data_6YQ5
# 
_entry.id   6YQ5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.371 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   6YQ5         pdb_00006yq5 10.2210/pdb6yq5/pdb 
WWPDB D_1292107513 ?            ?                   
BMRB  27468        ?            ?                   
EMDB  EMD-10792    ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
BMRB .                                                                                             27468     unspecified 
EMDB 'Hybrid structure of the SPP1 tail tube by solid-state NMR and cryo EM - Final EM Refinement' EMD-10792 
'associated EM volume' 
PDB  'Same entry with alternate processing'                                                        6YEG      unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.entry_id                        6YQ5 
_pdbx_database_status.recvd_initial_deposition_date   2020-04-16 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.status_code_nmr_data            REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Zinke, M.'         1 0000-0002-0541-5139 
'Sachowsky, K.A.A.' 2 ?                   
'Zinn-Justin, S.'   3 0000-0002-7680-1088 
'Ravelli, R.'       4 0000-0001-6056-5888 
'Schroder, G.F.'    5 0000-0003-1803-5431 
'Habeck, M.'        6 0000-0002-2188-5667 
'Lange, A.'         7 0000-0002-7534-5973 
# 
loop_
_citation.abstract 
_citation.abstract_id_CAS 
_citation.book_id_ISBN 
_citation.book_publisher 
_citation.book_publisher_city 
_citation.book_title 
_citation.coordinate_linkage 
_citation.country 
_citation.database_id_Medline 
_citation.details 
_citation.id 
_citation.journal_abbrev 
_citation.journal_id_ASTM 
_citation.journal_id_CSD 
_citation.journal_id_ISSN 
_citation.journal_full 
_citation.journal_issue 
_citation.journal_volume 
_citation.language 
_citation.page_first 
_citation.page_last 
_citation.title 
_citation.year 
_citation.database_id_CSD 
_citation.pdbx_database_id_DOI 
_citation.pdbx_database_id_PubMed 
_citation.unpublished_flag 
? ? ? ? ? ? ? UK ? ? primary 'Nat Commun' ? ? 2041-1723 ? ? 11 ? 5759 5759 
'Architecture of the flexible tail tube of bacteriophage SPP1.'           2020 ? 10.1038/s41467-020-19611-1 33188213 ? 
? ? ? ? ? ? ? US ? ? 1       Biorxiv      ? ? 2692-8205 ? ? ?  ? ?    ?    
'Spinal Column Architecture of the Flexible SPP1 Bacteriophage Tail Tube' 2020 ? 10.1101/2020.06.23.166439  ?        ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Zinke, M.'         1  ?                   
primary 'Sachowsky, K.A.A.' 2  0000-0002-5154-5217 
primary 'Oster, C.'         3  ?                   
primary 'Zinn-Justin, S.'   4  ?                   
primary 'Ravelli, R.'       5  0000-0001-6056-5888 
primary 'Schroder, G.F.'    6  0000-0003-1803-5431 
primary 'Habeck, M.'        7  0000-0002-2188-5667 
primary 'Lange, A.'         8  0000-0002-7534-5973 
1       'Zinke, M.'         9  0000-0002-0541-5139 
1       'Sachowsky, K.A.A.' 10 ?                   
1       'Oster, C.'         11 ?                   
1       'Zinn-Justin, S.'   12 0000-0002-7680-1088 
1       'Ravelli, R.'       13 0000-0001-6056-5888 
1       'Schroder, G.F.'    14 0000-0003-1803-5431 
1       'Habeck, M.'        15 0000-0002-2188-5667 
1       'Lange, A.'         16 0000-0002-7534-5973 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Tail tube protein gp17.1*' 
_entity.formula_weight             18617.258 
_entity.pdbx_number_of_molecules   12 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'TTP,Gene product 17.1,gp17.1,Major tail protein,MTP' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;PIMGQDVKYLFQSIDAATGSAPLFPAYQTDGSVSGERELFDEQTKNGRILGPGSVADSGEVTYYGKRGDAGQKAIEDAYQ
NGKQIKFWRVDTVKNENDKYDAQFGFAYIESREYSDGVEGAVEISISLQVIGELKNGEIDTLPEEIVNVSKGGYDFQQPG
QTTGEAPGTVPA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;PIMGQDVKYLFQSIDAATGSAPLFPAYQTDGSVSGERELFDEQTKNGRILGPGSVADSGEVTYYGKRGDAGQKAIEDAYQ
NGKQIKFWRVDTVKNENDKYDAQFGFAYIESREYSDGVEGAVEISISLQVIGELKNGEIDTLPEEIVNVSKGGYDFQQPG
QTTGEAPGTVPA
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J,K,L 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PRO n 
1 2   ILE n 
1 3   MET n 
1 4   GLY n 
1 5   GLN n 
1 6   ASP n 
1 7   VAL n 
1 8   LYS n 
1 9   TYR n 
1 10  LEU n 
1 11  PHE n 
1 12  GLN n 
1 13  SER n 
1 14  ILE n 
1 15  ASP n 
1 16  ALA n 
1 17  ALA n 
1 18  THR n 
1 19  GLY n 
1 20  SER n 
1 21  ALA n 
1 22  PRO n 
1 23  LEU n 
1 24  PHE n 
1 25  PRO n 
1 26  ALA n 
1 27  TYR n 
1 28  GLN n 
1 29  THR n 
1 30  ASP n 
1 31  GLY n 
1 32  SER n 
1 33  VAL n 
1 34  SER n 
1 35  GLY n 
1 36  GLU n 
1 37  ARG n 
1 38  GLU n 
1 39  LEU n 
1 40  PHE n 
1 41  ASP n 
1 42  GLU n 
1 43  GLN n 
1 44  THR n 
1 45  LYS n 
1 46  ASN n 
1 47  GLY n 
1 48  ARG n 
1 49  ILE n 
1 50  LEU n 
1 51  GLY n 
1 52  PRO n 
1 53  GLY n 
1 54  SER n 
1 55  VAL n 
1 56  ALA n 
1 57  ASP n 
1 58  SER n 
1 59  GLY n 
1 60  GLU n 
1 61  VAL n 
1 62  THR n 
1 63  TYR n 
1 64  TYR n 
1 65  GLY n 
1 66  LYS n 
1 67  ARG n 
1 68  GLY n 
1 69  ASP n 
1 70  ALA n 
1 71  GLY n 
1 72  GLN n 
1 73  LYS n 
1 74  ALA n 
1 75  ILE n 
1 76  GLU n 
1 77  ASP n 
1 78  ALA n 
1 79  TYR n 
1 80  GLN n 
1 81  ASN n 
1 82  GLY n 
1 83  LYS n 
1 84  GLN n 
1 85  ILE n 
1 86  LYS n 
1 87  PHE n 
1 88  TRP n 
1 89  ARG n 
1 90  VAL n 
1 91  ASP n 
1 92  THR n 
1 93  VAL n 
1 94  LYS n 
1 95  ASN n 
1 96  GLU n 
1 97  ASN n 
1 98  ASP n 
1 99  LYS n 
1 100 TYR n 
1 101 ASP n 
1 102 ALA n 
1 103 GLN n 
1 104 PHE n 
1 105 GLY n 
1 106 PHE n 
1 107 ALA n 
1 108 TYR n 
1 109 ILE n 
1 110 GLU n 
1 111 SER n 
1 112 ARG n 
1 113 GLU n 
1 114 TYR n 
1 115 SER n 
1 116 ASP n 
1 117 GLY n 
1 118 VAL n 
1 119 GLU n 
1 120 GLY n 
1 121 ALA n 
1 122 VAL n 
1 123 GLU n 
1 124 ILE n 
1 125 SER n 
1 126 ILE n 
1 127 SER n 
1 128 LEU n 
1 129 GLN n 
1 130 VAL n 
1 131 ILE n 
1 132 GLY n 
1 133 GLU n 
1 134 LEU n 
1 135 LYS n 
1 136 ASN n 
1 137 GLY n 
1 138 GLU n 
1 139 ILE n 
1 140 ASP n 
1 141 THR n 
1 142 LEU n 
1 143 PRO n 
1 144 GLU n 
1 145 GLU n 
1 146 ILE n 
1 147 VAL n 
1 148 ASN n 
1 149 VAL n 
1 150 SER n 
1 151 LYS n 
1 152 GLY n 
1 153 GLY n 
1 154 TYR n 
1 155 ASP n 
1 156 PHE n 
1 157 GLN n 
1 158 GLN n 
1 159 PRO n 
1 160 GLY n 
1 161 GLN n 
1 162 THR n 
1 163 THR n 
1 164 GLY n 
1 165 GLU n 
1 166 ALA n 
1 167 PRO n 
1 168 GLY n 
1 169 THR n 
1 170 VAL n 
1 171 PRO n 
1 172 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   172 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 17.1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Bacillus phage SPP1' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10724 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TUBE_BPSPP 
_struct_ref.pdbx_db_accession          O48449 
_struct_ref.pdbx_db_isoform            O48449-2 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;PIMGQDVKYLFQSIDAATGSAPLFPAYQTDGSVSGERELFDEQTKNGRILGPGSVADSGEVTYYGKRGDAGQKAIEDAYQ
NGKQIKFWRVDTVKNENDKYDAQFGFAYIESREYSDGVEGAVEISISLQVIGELKNGEIDTLPEEIVNVSKGGYDFQQPG
QTTGEAPGTVPA
;
_struct_ref.pdbx_align_begin           5 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6YQ5 A 1 ? 172 ? O48449 5 ? 176 ? 5 176 
2  1 6YQ5 B 1 ? 172 ? O48449 5 ? 176 ? 5 176 
3  1 6YQ5 C 1 ? 172 ? O48449 5 ? 176 ? 5 176 
4  1 6YQ5 D 1 ? 172 ? O48449 5 ? 176 ? 5 176 
5  1 6YQ5 E 1 ? 172 ? O48449 5 ? 176 ? 5 176 
6  1 6YQ5 F 1 ? 172 ? O48449 5 ? 176 ? 5 176 
7  1 6YQ5 G 1 ? 172 ? O48449 5 ? 176 ? 5 176 
8  1 6YQ5 H 1 ? 172 ? O48449 5 ? 176 ? 5 176 
9  1 6YQ5 I 1 ? 172 ? O48449 5 ? 176 ? 5 176 
10 1 6YQ5 J 1 ? 172 ? O48449 5 ? 176 ? 5 176 
11 1 6YQ5 K 1 ? 172 ? O48449 5 ? 176 ? 5 176 
12 1 6YQ5 L 1 ? 172 ? O48449 5 ? 176 ? 5 176 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.spectrometer_id 
_pdbx_nmr_exptl.sample_state 
1  1 1  '4D HNhhNH' 1 anisotropic 
2  1 2  '3D HChH'   1 anisotropic 
3  1 6  '3D HChH'   1 anisotropic 
4  1 2  '2D hCH'    1 anisotropic 
5  1 4  '2D hCH'    1 anisotropic 
6  1 6  '2D hCH'    1 anisotropic 
7  1 8  '2D hCH'    1 anisotropic 
8  1 10 '2D hCH'    1 anisotropic 
9  1 11 '2D hCH'    1 anisotropic 
10 1 2  '3D HNhH'   1 anisotropic 
11 1 3  '3D HNhH'   1 anisotropic 
12 1 4  '3D HNhH'   1 anisotropic 
13 1 5  '3D HNhH'   1 anisotropic 
18 1 6  '3D HNhH'   1 anisotropic 
17 1 7  '3D HNhH'   1 anisotropic 
16 1 8  '3D HNhH'   1 anisotropic 
14 1 9  '3D HNhH'   1 anisotropic 
15 1 10 '3D HNhH'   1 anisotropic 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            291 
_pdbx_nmr_exptl_sample_conditions.pressure_units         atm 
_pdbx_nmr_exptl_sample_conditions.pressure               1 
_pdbx_nmr_exptl_sample_conditions.pH                     7.4 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         0.5 
_pdbx_nmr_exptl_sample_conditions.details                ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_err     ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   M 
_pdbx_nmr_exptl_sample_conditions.label                  conditions_1 
_pdbx_nmr_exptl_sample_conditions.pH_err                 ? 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.pressure_err           ? 
_pdbx_nmr_exptl_sample_conditions.temperature_err        ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
_pdbx_nmr_sample_details.label 
_pdbx_nmr_sample_details.type 
_pdbx_nmr_sample_details.details 
1  '100 % u-2H13C15N; 100% backexchanged gp17.1, 20 mM sodium phosphate, 500 mM sodium chloride, 1 mM EDTA, solid' solid uniform 
fiber ? 
2  
'100 % isoleucine-(1HD1, 13CD1)-u-15N; 100% backexchanged gp17.1, 20 mM sodium phosphate, 500 mM sodium chloride, 1 mM EDTA, solid' 
solid isoleucin-methyl       fiber ? 
3  
;100 % 50% isoleucine-(1HD1, 13CD1)-u-14N & 50% u-15N; 100% backexchanged gp17.1, 20 mM sodium phosphate, 500 mM sodium chloride, 1 mM EDTA, solid
;
solid 'isoleucin-methyl mix' fiber ? 
4  '100 % alanine-(1HB, 13CB)-u-15N; 100% backexchanged gp17.1, 20 mM sodium phosphate, 500 mM sodium chloride, 1 mM EDTA, solid' 
solid alanine-methyl         fiber ? 
5  
;100 % 50% alanine-(1HB, 13CB)-u-14N & 50% u-15N; 100% backexchanged gp17.1, 20 mM sodium phosphate, 500 mM sodium chloride, 1 mM EDTA, solid
;
solid 'alanine-methyl mix'   fiber ? 
6  
;100 % leucine-(1HD, 13CD)proR-valine-(1HG, 13CG)proR-u-15N; 100% backexchanged gp17.1, 20 mM sodium phosphate, 500 mM sodium chloride, 1 mM EDTA, solid
;
solid LV-methyl              fiber ? 
7  
;100 % 50% leucine-(1HD, 13CD)proR- valine-(1HG, 13CG)proR-u-14N & 50% u-15N; 100% backexchanged gp17.1, 20 mM sodium phosphate, 500 mM sodium chloride, 1 mM EDTA, solid
;
solid 'LV-methyl mix'        fiber ? 
8  
'100 % threonine-(1HG2, 13CG2)-u-15N; 100% backexchanged gp17.1, 20 mM sodium phosphate, 500 mM sodium chloride, 1 mM EDTA, solid' 
solid threonine-methyl       fiber ? 
9  
;100 % 50% threonine-(1HG2, 13CG2)-u-14N & 50% u-15N; 100% backexchanged gp17.1, 20 mM sodium phosphate, 500 mM sodium chloride, 1 mM EDTA, solid
;
solid 'threonine-methyl mix' fiber ? 
10 
'100 % methionine-(1HE, 13CE)-u-15N; 100% backexchanged gp17.1, 20 mM sodium phosphate, 500 mM sodium chloride, 1 mM EDTA, solid' 
solid methionine-methyl      fiber ? 
11 
;100 % alanine-(1HB, 13CB)- isoleucine-(1HD1, 13CD1)-( 1HG2, 13CG2)-leucine-(1HD, 13CD)proR/proS-valine-(1HG, 13CG)proR/proS-u-15N; 100% backexchanged gp17.1, 20 mM sodium phosphate, 500 mM sodium chloride, 1 mM EDTA, solid
;
solid assignment             fiber ? 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             AVANCE 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    900 
_pdbx_nmr_spectrometer.details           ? 
# 
_pdbx_nmr_refine.entry_id           6YQ5 
_pdbx_nmr_refine.method             na 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   6 
# 
_pdbx_nmr_ensemble.entry_id                                      6YQ5 
_pdbx_nmr_ensemble.conformers_calculated_total_number            500 
_pdbx_nmr_ensemble.conformers_submitted_total_number             10 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function' 
_pdbx_nmr_ensemble.representative_conformer                      ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             6YQ5 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'target function' 
# 
loop_
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
1 collection              TopSpin                                     ? 'Bruker Biospin'          
5 processing              TopSpin                                     ? 'Bruker Biospin'          
4 'data analysis'         'CcpNmr Analysis'                           ? CCPN                      
6 'structure calculation' 'Inferential Structure Determination (ISD)' ? 'Rieping, Nilges, Habeck' 
# 
loop_
_exptl.absorpt_coefficient_mu 
_exptl.absorpt_correction_T_max 
_exptl.absorpt_correction_T_min 
_exptl.absorpt_correction_type 
_exptl.absorpt_process_details 
_exptl.entry_id 
_exptl.crystals_number 
_exptl.details 
_exptl.method 
_exptl.method_details 
? ? ? ? ? 6YQ5 ? ? 'ELECTRON MICROSCOPY' ? 
? ? ? ? ? 6YQ5 ? ? 'SOLID-STATE NMR'     ? 
# 
_struct.entry_id                     6YQ5 
_struct.title                        'Hybrid structure of the SPP1 tail tube by solid-state NMR and cryo EM - NMR Ensemble' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6YQ5 
_struct_keywords.text            'complex, tail tube, scaffolding, DNA transport, VIRAL PROTEIN' 
_struct_keywords.pdbx_keywords   'VIRAL PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 1 ? 
H N N 1 ? 
I N N 1 ? 
J N N 1 ? 
K N N 1 ? 
L N N 1 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 69 ? GLY A 82 ? ASP A 73 GLY A 86 1 ? 14 
HELX_P HELX_P2  AA2 ASP B 69 ? GLY B 82 ? ASP B 73 GLY B 86 1 ? 14 
HELX_P HELX_P3  AA3 ASP C 69 ? GLY C 82 ? ASP C 73 GLY C 86 1 ? 14 
HELX_P HELX_P4  AA4 ASP D 69 ? GLY D 82 ? ASP D 73 GLY D 86 1 ? 14 
HELX_P HELX_P5  AA5 ASP E 69 ? GLY E 82 ? ASP E 73 GLY E 86 1 ? 14 
HELX_P HELX_P6  AA6 ASP F 69 ? GLY F 82 ? ASP F 73 GLY F 86 1 ? 14 
HELX_P HELX_P7  AA7 ASP G 69 ? GLY G 82 ? ASP G 73 GLY G 86 1 ? 14 
HELX_P HELX_P8  AA8 ASP H 69 ? GLY H 82 ? ASP H 73 GLY H 86 1 ? 14 
HELX_P HELX_P9  AA9 ASP I 69 ? GLY I 82 ? ASP I 73 GLY I 86 1 ? 14 
HELX_P HELX_P10 AB1 ASP J 69 ? GLY J 82 ? ASP J 73 GLY J 86 1 ? 14 
HELX_P HELX_P11 AB2 ASP K 69 ? GLY K 82 ? ASP K 73 GLY K 86 1 ? 14 
HELX_P HELX_P12 AB3 ASP L 69 ? GLY L 82 ? ASP L 73 GLY L 86 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4  ? 
AA2 ? 25 ? 
AA3 ? 4  ? 
AA4 ? 4  ? 
AA5 ? 4  ? 
AA6 ? 4  ? 
AA7 ? 4  ? 
AA8 ? 4  ? 
AA9 ? 25 ? 
AB1 ? 4  ? 
AB2 ? 4  ? 
AB3 ? 4  ? 
AB4 ? 4  ? 
AB5 ? 4  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? anti-parallel 
AA1 3  4  ? anti-parallel 
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? anti-parallel 
AA2 5  6  ? anti-parallel 
AA2 6  7  ? anti-parallel 
AA2 7  8  ? anti-parallel 
AA2 8  9  ? anti-parallel 
AA2 9  10 ? anti-parallel 
AA2 10 11 ? anti-parallel 
AA2 11 12 ? anti-parallel 
AA2 12 13 ? anti-parallel 
AA2 13 14 ? anti-parallel 
AA2 14 15 ? anti-parallel 
AA2 15 16 ? anti-parallel 
AA2 16 17 ? anti-parallel 
AA2 17 18 ? anti-parallel 
AA2 18 19 ? anti-parallel 
AA2 19 20 ? anti-parallel 
AA2 20 21 ? anti-parallel 
AA2 21 22 ? anti-parallel 
AA2 22 23 ? anti-parallel 
AA2 23 24 ? anti-parallel 
AA2 24 25 ? anti-parallel 
AA3 1  2  ? anti-parallel 
AA3 2  3  ? anti-parallel 
AA3 3  4  ? anti-parallel 
AA4 1  2  ? anti-parallel 
AA4 2  3  ? anti-parallel 
AA4 3  4  ? anti-parallel 
AA5 1  2  ? anti-parallel 
AA5 2  3  ? anti-parallel 
AA5 3  4  ? anti-parallel 
AA6 1  2  ? anti-parallel 
AA6 2  3  ? anti-parallel 
AA6 3  4  ? anti-parallel 
AA7 1  2  ? anti-parallel 
AA7 2  3  ? anti-parallel 
AA7 3  4  ? anti-parallel 
AA8 1  2  ? anti-parallel 
AA8 2  3  ? anti-parallel 
AA8 3  4  ? anti-parallel 
AA9 1  2  ? anti-parallel 
AA9 2  3  ? anti-parallel 
AA9 3  4  ? anti-parallel 
AA9 4  5  ? anti-parallel 
AA9 5  6  ? anti-parallel 
AA9 6  7  ? anti-parallel 
AA9 7  8  ? anti-parallel 
AA9 8  9  ? anti-parallel 
AA9 9  10 ? anti-parallel 
AA9 10 11 ? anti-parallel 
AA9 11 12 ? anti-parallel 
AA9 12 13 ? anti-parallel 
AA9 13 14 ? anti-parallel 
AA9 14 15 ? anti-parallel 
AA9 15 16 ? anti-parallel 
AA9 16 17 ? anti-parallel 
AA9 17 18 ? anti-parallel 
AA9 18 19 ? anti-parallel 
AA9 19 20 ? anti-parallel 
AA9 20 21 ? anti-parallel 
AA9 21 22 ? anti-parallel 
AA9 22 23 ? anti-parallel 
AA9 23 24 ? anti-parallel 
AA9 24 25 ? anti-parallel 
AB1 1  2  ? anti-parallel 
AB1 2  3  ? anti-parallel 
AB1 3  4  ? anti-parallel 
AB2 1  2  ? anti-parallel 
AB2 2  3  ? anti-parallel 
AB2 3  4  ? anti-parallel 
AB3 1  2  ? anti-parallel 
AB3 2  3  ? anti-parallel 
AB3 3  4  ? anti-parallel 
AB4 1  2  ? anti-parallel 
AB4 2  3  ? anti-parallel 
AB4 3  4  ? anti-parallel 
AB5 1  2  ? anti-parallel 
AB5 2  3  ? anti-parallel 
AB5 3  4  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  VAL A 7   ? SER A 13  ? VAL A 11  SER A 17  
AA1 2  ILE A 85  ? ASP A 91  ? ILE A 89  ASP A 95  
AA1 3  TYR A 100 ? ALA A 107 ? TYR A 104 ALA A 111 
AA1 4  LEU A 134 ? GLU A 138 ? LEU A 138 GLU A 142 
AA2 1  TYR A 27  ? GLU A 36  ? TYR A 31  GLU A 40  
AA2 2  VAL A 55  ? TYR A 63  ? VAL A 59  TYR A 67  
AA2 3  GLU A 123 ? VAL A 130 ? GLU A 127 VAL A 134 
AA2 4  SER A 111 ? GLY A 117 ? SER A 115 GLY A 121 
AA2 5  TYR F 27  ? GLU F 36  ? TYR F 31  GLU F 40  
AA2 6  VAL F 55  ? TYR F 63  ? VAL F 59  TYR F 67  
AA2 7  GLU F 123 ? VAL F 130 ? GLU F 127 VAL F 134 
AA2 8  SER F 111 ? GLY F 117 ? SER F 115 GLY F 121 
AA2 9  TYR E 27  ? GLU E 36  ? TYR E 31  GLU E 40  
AA2 10 VAL E 55  ? TYR E 63  ? VAL E 59  TYR E 67  
AA2 11 GLU E 123 ? VAL E 130 ? GLU E 127 VAL E 134 
AA2 12 SER E 111 ? GLY E 117 ? SER E 115 GLY E 121 
AA2 13 TYR D 27  ? GLU D 36  ? TYR D 31  GLU D 40  
AA2 14 VAL D 55  ? TYR D 63  ? VAL D 59  TYR D 67  
AA2 15 GLU D 123 ? VAL D 130 ? GLU D 127 VAL D 134 
AA2 16 SER D 111 ? GLY D 117 ? SER D 115 GLY D 121 
AA2 17 TYR C 27  ? GLU C 36  ? TYR C 31  GLU C 40  
AA2 18 VAL C 55  ? TYR C 63  ? VAL C 59  TYR C 67  
AA2 19 GLU C 123 ? VAL C 130 ? GLU C 127 VAL C 134 
AA2 20 SER C 111 ? GLY C 117 ? SER C 115 GLY C 121 
AA2 21 TYR B 27  ? GLU B 36  ? TYR B 31  GLU B 40  
AA2 22 VAL B 55  ? TYR B 63  ? VAL B 59  TYR B 67  
AA2 23 GLU B 123 ? VAL B 130 ? GLU B 127 VAL B 134 
AA2 24 SER B 111 ? GLY B 117 ? SER B 115 GLY B 121 
AA2 25 TYR A 27  ? GLU A 36  ? TYR A 31  GLU A 40  
AA3 1  VAL B 7   ? SER B 13  ? VAL B 11  SER B 17  
AA3 2  ILE B 85  ? ASP B 91  ? ILE B 89  ASP B 95  
AA3 3  TYR B 100 ? ALA B 107 ? TYR B 104 ALA B 111 
AA3 4  LEU B 134 ? GLU B 138 ? LEU B 138 GLU B 142 
AA4 1  VAL C 7   ? SER C 13  ? VAL C 11  SER C 17  
AA4 2  ILE C 85  ? ASP C 91  ? ILE C 89  ASP C 95  
AA4 3  TYR C 100 ? ALA C 107 ? TYR C 104 ALA C 111 
AA4 4  LEU C 134 ? GLU C 138 ? LEU C 138 GLU C 142 
AA5 1  VAL D 7   ? SER D 13  ? VAL D 11  SER D 17  
AA5 2  ILE D 85  ? ASP D 91  ? ILE D 89  ASP D 95  
AA5 3  TYR D 100 ? ALA D 107 ? TYR D 104 ALA D 111 
AA5 4  LEU D 134 ? GLU D 138 ? LEU D 138 GLU D 142 
AA6 1  VAL E 7   ? SER E 13  ? VAL E 11  SER E 17  
AA6 2  ILE E 85  ? ASP E 91  ? ILE E 89  ASP E 95  
AA6 3  TYR E 100 ? ALA E 107 ? TYR E 104 ALA E 111 
AA6 4  LEU E 134 ? GLU E 138 ? LEU E 138 GLU E 142 
AA7 1  VAL F 7   ? SER F 13  ? VAL F 11  SER F 17  
AA7 2  ILE F 85  ? ASP F 91  ? ILE F 89  ASP F 95  
AA7 3  TYR F 100 ? ALA F 107 ? TYR F 104 ALA F 111 
AA7 4  LEU F 134 ? GLU F 138 ? LEU F 138 GLU F 142 
AA8 1  VAL G 7   ? SER G 13  ? VAL G 11  SER G 17  
AA8 2  ILE G 85  ? ASP G 91  ? ILE G 89  ASP G 95  
AA8 3  TYR G 100 ? ALA G 107 ? TYR G 104 ALA G 111 
AA8 4  LEU G 134 ? GLU G 138 ? LEU G 138 GLU G 142 
AA9 1  TYR G 27  ? GLU G 36  ? TYR G 31  GLU G 40  
AA9 2  VAL G 55  ? TYR G 63  ? VAL G 59  TYR G 67  
AA9 3  GLU G 123 ? VAL G 130 ? GLU G 127 VAL G 134 
AA9 4  SER G 111 ? GLY G 117 ? SER G 115 GLY G 121 
AA9 5  TYR L 27  ? GLU L 36  ? TYR L 31  GLU L 40  
AA9 6  VAL L 55  ? TYR L 63  ? VAL L 59  TYR L 67  
AA9 7  GLU L 123 ? VAL L 130 ? GLU L 127 VAL L 134 
AA9 8  SER L 111 ? GLY L 117 ? SER L 115 GLY L 121 
AA9 9  TYR K 27  ? GLU K 36  ? TYR K 31  GLU K 40  
AA9 10 VAL K 55  ? TYR K 63  ? VAL K 59  TYR K 67  
AA9 11 GLU K 123 ? VAL K 130 ? GLU K 127 VAL K 134 
AA9 12 SER K 111 ? GLY K 117 ? SER K 115 GLY K 121 
AA9 13 TYR J 27  ? GLU J 36  ? TYR J 31  GLU J 40  
AA9 14 VAL J 55  ? TYR J 63  ? VAL J 59  TYR J 67  
AA9 15 GLU J 123 ? VAL J 130 ? GLU J 127 VAL J 134 
AA9 16 SER J 111 ? GLY J 117 ? SER J 115 GLY J 121 
AA9 17 TYR I 27  ? GLU I 36  ? TYR I 31  GLU I 40  
AA9 18 VAL I 55  ? TYR I 63  ? VAL I 59  TYR I 67  
AA9 19 GLU I 123 ? VAL I 130 ? GLU I 127 VAL I 134 
AA9 20 SER I 111 ? GLY I 117 ? SER I 115 GLY I 121 
AA9 21 TYR H 27  ? GLU H 36  ? TYR H 31  GLU H 40  
AA9 22 VAL H 55  ? TYR H 63  ? VAL H 59  TYR H 67  
AA9 23 GLU H 123 ? VAL H 130 ? GLU H 127 VAL H 134 
AA9 24 SER H 111 ? GLY H 117 ? SER H 115 GLY H 121 
AA9 25 TYR G 27  ? GLU G 36  ? TYR G 31  GLU G 40  
AB1 1  VAL H 7   ? SER H 13  ? VAL H 11  SER H 17  
AB1 2  ILE H 85  ? ASP H 91  ? ILE H 89  ASP H 95  
AB1 3  TYR H 100 ? ALA H 107 ? TYR H 104 ALA H 111 
AB1 4  LEU H 134 ? GLU H 138 ? LEU H 138 GLU H 142 
AB2 1  VAL I 7   ? SER I 13  ? VAL I 11  SER I 17  
AB2 2  ILE I 85  ? ASP I 91  ? ILE I 89  ASP I 95  
AB2 3  TYR I 100 ? ALA I 107 ? TYR I 104 ALA I 111 
AB2 4  LEU I 134 ? GLU I 138 ? LEU I 138 GLU I 142 
AB3 1  VAL J 7   ? SER J 13  ? VAL J 11  SER J 17  
AB3 2  ILE J 85  ? ASP J 91  ? ILE J 89  ASP J 95  
AB3 3  TYR J 100 ? ALA J 107 ? TYR J 104 ALA J 111 
AB3 4  LEU J 134 ? GLU J 138 ? LEU J 138 GLU J 142 
AB4 1  VAL K 7   ? SER K 13  ? VAL K 11  SER K 17  
AB4 2  ILE K 85  ? ASP K 91  ? ILE K 89  ASP K 95  
AB4 3  TYR K 100 ? ALA K 107 ? TYR K 104 ALA K 111 
AB4 4  LEU K 134 ? GLU K 138 ? LEU K 138 GLU K 142 
AB5 1  VAL L 7   ? SER L 13  ? VAL L 11  SER L 17  
AB5 2  ILE L 85  ? ASP L 91  ? ILE L 89  ASP L 95  
AB5 3  TYR L 100 ? ALA L 107 ? TYR L 104 ALA L 111 
AB5 4  LEU L 134 ? GLU L 138 ? LEU L 138 GLU L 142 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N LYS A 8   ? N LYS A 12  O VAL A 90  ? O VAL A 94  
AA1 2  3  N PHE A 87  ? N PHE A 91  O GLY A 105 ? O GLY A 109 
AA1 3  4  N PHE A 104 ? N PHE A 108 O LEU A 134 ? O LEU A 138 
AA2 1  2  N GLY A 35  ? N GLY A 39  O ALA A 56  ? O ALA A 60  
AA2 2  3  N VAL A 61  ? N VAL A 65  O ILE A 126 ? O ILE A 130 
AA2 3  4  O SER A 127 ? O SER A 131 N SER A 111 ? N SER A 115 
AA2 4  5  N ASP A 116 ? N ASP A 120 O ASP F 30  ? O ASP F 34  
AA2 5  6  N GLY F 35  ? N GLY F 39  O ALA F 56  ? O ALA F 60  
AA2 6  7  N VAL F 61  ? N VAL F 65  O ILE F 126 ? O ILE F 130 
AA2 7  8  O SER F 127 ? O SER F 131 N SER F 111 ? N SER F 115 
AA2 8  9  O ARG F 112 ? O ARG F 116 N SER E 34  ? N SER E 38  
AA2 9  10 N GLY E 35  ? N GLY E 39  O ALA E 56  ? O ALA E 60  
AA2 10 11 N VAL E 61  ? N VAL E 65  O ILE E 126 ? O ILE E 130 
AA2 11 12 O SER E 127 ? O SER E 131 N SER E 111 ? N SER E 115 
AA2 12 13 O ASP E 116 ? O ASP E 120 N ASP D 30  ? N ASP D 34  
AA2 13 14 N GLY D 35  ? N GLY D 39  O ALA D 56  ? O ALA D 60  
AA2 14 15 N VAL D 61  ? N VAL D 65  O ILE D 126 ? O ILE D 130 
AA2 15 16 O SER D 127 ? O SER D 131 N SER D 111 ? N SER D 115 
AA2 16 17 O ARG D 112 ? O ARG D 116 N SER C 34  ? N SER C 38  
AA2 17 18 N GLY C 35  ? N GLY C 39  O ALA C 56  ? O ALA C 60  
AA2 18 19 N VAL C 61  ? N VAL C 65  O ILE C 126 ? O ILE C 130 
AA2 19 20 O SER C 127 ? O SER C 131 N SER C 111 ? N SER C 115 
AA2 20 21 O ARG C 112 ? O ARG C 116 N SER B 34  ? N SER B 38  
AA2 21 22 N GLY B 35  ? N GLY B 39  O ALA B 56  ? O ALA B 60  
AA2 22 23 N VAL B 61  ? N VAL B 65  O ILE B 126 ? O ILE B 130 
AA2 23 24 O SER B 127 ? O SER B 131 N SER B 111 ? N SER B 115 
AA2 24 25 O ARG B 112 ? O ARG B 116 N SER A 34  ? N SER A 38  
AA3 1  2  N LYS B 8   ? N LYS B 12  O VAL B 90  ? O VAL B 94  
AA3 2  3  N PHE B 87  ? N PHE B 91  O GLY B 105 ? O GLY B 109 
AA3 3  4  N PHE B 104 ? N PHE B 108 O LEU B 134 ? O LEU B 138 
AA4 1  2  N LYS C 8   ? N LYS C 12  O VAL C 90  ? O VAL C 94  
AA4 2  3  N PHE C 87  ? N PHE C 91  O GLY C 105 ? O GLY C 109 
AA4 3  4  N PHE C 104 ? N PHE C 108 O LEU C 134 ? O LEU C 138 
AA5 1  2  N LYS D 8   ? N LYS D 12  O VAL D 90  ? O VAL D 94  
AA5 2  3  N PHE D 87  ? N PHE D 91  O GLY D 105 ? O GLY D 109 
AA5 3  4  N PHE D 104 ? N PHE D 108 O LEU D 134 ? O LEU D 138 
AA6 1  2  N LYS E 8   ? N LYS E 12  O VAL E 90  ? O VAL E 94  
AA6 2  3  N PHE E 87  ? N PHE E 91  O GLY E 105 ? O GLY E 109 
AA6 3  4  N PHE E 104 ? N PHE E 108 O LEU E 134 ? O LEU E 138 
AA7 1  2  N LYS F 8   ? N LYS F 12  O VAL F 90  ? O VAL F 94  
AA7 2  3  N PHE F 87  ? N PHE F 91  O GLY F 105 ? O GLY F 109 
AA7 3  4  N PHE F 104 ? N PHE F 108 O LEU F 134 ? O LEU F 138 
AA8 1  2  N LYS G 8   ? N LYS G 12  O VAL G 90  ? O VAL G 94  
AA8 2  3  N PHE G 87  ? N PHE G 91  O GLY G 105 ? O GLY G 109 
AA8 3  4  N PHE G 104 ? N PHE G 108 O LEU G 134 ? O LEU G 138 
AA9 1  2  N GLY G 35  ? N GLY G 39  O ALA G 56  ? O ALA G 60  
AA9 2  3  N VAL G 61  ? N VAL G 65  O ILE G 126 ? O ILE G 130 
AA9 3  4  O SER G 127 ? O SER G 131 N SER G 111 ? N SER G 115 
AA9 4  5  N ASP G 116 ? N ASP G 120 O ASP L 30  ? O ASP L 34  
AA9 5  6  N GLY L 35  ? N GLY L 39  O ALA L 56  ? O ALA L 60  
AA9 6  7  N VAL L 61  ? N VAL L 65  O ILE L 126 ? O ILE L 130 
AA9 7  8  O SER L 127 ? O SER L 131 N SER L 111 ? N SER L 115 
AA9 8  9  O ASP L 116 ? O ASP L 120 N ASP K 30  ? N ASP K 34  
AA9 9  10 N GLY K 35  ? N GLY K 39  O ALA K 56  ? O ALA K 60  
AA9 10 11 N VAL K 61  ? N VAL K 65  O ILE K 126 ? O ILE K 130 
AA9 11 12 O SER K 127 ? O SER K 131 N SER K 111 ? N SER K 115 
AA9 12 13 O ASP K 116 ? O ASP K 120 N ASP J 30  ? N ASP J 34  
AA9 13 14 N GLY J 35  ? N GLY J 39  O ALA J 56  ? O ALA J 60  
AA9 14 15 N VAL J 61  ? N VAL J 65  O ILE J 126 ? O ILE J 130 
AA9 15 16 O SER J 127 ? O SER J 131 N SER J 111 ? N SER J 115 
AA9 16 17 O ASP J 116 ? O ASP J 120 N ASP I 30  ? N ASP I 34  
AA9 17 18 N GLY I 35  ? N GLY I 39  O ALA I 56  ? O ALA I 60  
AA9 18 19 N VAL I 61  ? N VAL I 65  O ILE I 126 ? O ILE I 130 
AA9 19 20 O SER I 127 ? O SER I 131 N SER I 111 ? N SER I 115 
AA9 20 21 O ASP I 116 ? O ASP I 120 N ASP H 30  ? N ASP H 34  
AA9 21 22 N GLY H 35  ? N GLY H 39  O ALA H 56  ? O ALA H 60  
AA9 22 23 N VAL H 61  ? N VAL H 65  O ILE H 126 ? O ILE H 130 
AA9 23 24 O SER H 127 ? O SER H 131 N SER H 111 ? N SER H 115 
AA9 24 25 O ASP H 116 ? O ASP H 120 N ASP G 30  ? N ASP G 34  
AB1 1  2  N LYS H 8   ? N LYS H 12  O VAL H 90  ? O VAL H 94  
AB1 2  3  N PHE H 87  ? N PHE H 91  O GLY H 105 ? O GLY H 109 
AB1 3  4  N PHE H 104 ? N PHE H 108 O LEU H 134 ? O LEU H 138 
AB2 1  2  N LYS I 8   ? N LYS I 12  O VAL I 90  ? O VAL I 94  
AB2 2  3  N PHE I 87  ? N PHE I 91  O GLY I 105 ? O GLY I 109 
AB2 3  4  N PHE I 104 ? N PHE I 108 O LEU I 134 ? O LEU I 138 
AB3 1  2  N LYS J 8   ? N LYS J 12  O VAL J 90  ? O VAL J 94  
AB3 2  3  N PHE J 87  ? N PHE J 91  O GLY J 105 ? O GLY J 109 
AB3 3  4  N PHE J 104 ? N PHE J 108 O LEU J 134 ? O LEU J 138 
AB4 1  2  N LYS K 8   ? N LYS K 12  O VAL K 90  ? O VAL K 94  
AB4 2  3  N PHE K 87  ? N PHE K 91  O GLY K 105 ? O GLY K 109 
AB4 3  4  N PHE K 104 ? N PHE K 108 O LEU K 134 ? O LEU K 138 
AB5 1  2  N LYS L 8   ? N LYS L 12  O VAL L 90  ? O VAL L 94  
AB5 2  3  N PHE L 87  ? N PHE L 91  O GLY L 105 ? O GLY L 109 
AB5 3  4  N PHE L 104 ? N PHE L 108 O LEU L 134 ? O LEU L 138 
# 
_atom_sites.entry_id                    6YQ5 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1      N N    . PRO A 1 1   ? 64.239  84.091  94.810  1.00 0.00 ? 5   PRO A N    1  
ATOM 2      C CA   . PRO A 1 1   ? 64.076  84.244  96.258  1.00 0.00 ? 5   PRO A CA   1  
ATOM 3      C C    . PRO A 1 1   ? 63.777  85.734  96.390  1.00 0.00 ? 5   PRO A C    1  
ATOM 4      O O    . PRO A 1 1   ? 63.260  86.340  95.453  1.00 0.00 ? 5   PRO A O    1  
ATOM 5      C CB   . PRO A 1 1   ? 65.426  83.784  96.811  1.00 0.00 ? 5   PRO A CB   1  
ATOM 6      C CG   . PRO A 1 1   ? 66.388  84.007  95.698  1.00 0.00 ? 5   PRO A CG   1  
ATOM 7      C CD   . PRO A 1 1   ? 65.621  83.741  94.442  1.00 0.00 ? 5   PRO A CD   1  
ATOM 8      H HA   . PRO A 1 1   ? 63.319  83.807  96.679  1.00 0.00 ? 5   PRO A HA   1  
ATOM 9      H HB2  . PRO A 1 1   ? 65.676  84.291  97.599  1.00 0.00 ? 5   PRO A HB2  1  
ATOM 10     H HB3  . PRO A 1 1   ? 65.399  82.850  97.071  1.00 0.00 ? 5   PRO A HB3  1  
ATOM 11     H HG2  . PRO A 1 1   ? 66.731  84.914  95.711  1.00 0.00 ? 5   PRO A HG2  1  
ATOM 12     H HG3  . PRO A 1 1   ? 67.152  83.415  95.772  1.00 0.00 ? 5   PRO A HG3  1  
ATOM 13     H HD2  . PRO A 1 1   ? 65.943  84.282  93.704  1.00 0.00 ? 5   PRO A HD2  1  
ATOM 14     H HD3  . PRO A 1 1   ? 65.694  82.813  94.168  1.00 0.00 ? 5   PRO A HD3  1  
ATOM 15     N N    . ILE A 1 2   ? 64.096  86.312  97.544  1.00 0.00 ? 6   ILE A N    1  
ATOM 16     C CA   . ILE A 1 2   ? 63.898  87.731  97.801  1.00 0.00 ? 6   ILE A CA   1  
ATOM 17     C C    . ILE A 1 2   ? 65.051  88.485  97.156  1.00 0.00 ? 6   ILE A C    1  
ATOM 18     O O    . ILE A 1 2   ? 66.220  88.116  97.331  1.00 0.00 ? 6   ILE A O    1  
ATOM 19     C CB   . ILE A 1 2   ? 63.806  88.033  99.303  1.00 0.00 ? 6   ILE A CB   1  
ATOM 20     C CG1  . ILE A 1 2   ? 62.887  87.021  99.988  1.00 0.00 ? 6   ILE A CG1  1  
ATOM 21     C CG2  . ILE A 1 2   ? 63.286  89.433  99.531  1.00 0.00 ? 6   ILE A CG2  1  
ATOM 22     C CD1  . ILE A 1 2   ? 63.232  86.603  101.447 1.00 0.00 ? 6   ILE A CD1  1  
ATOM 23     H H    . ILE A 1 2   ? 64.437  85.883  98.208  1.00 0.00 ? 6   ILE A H    1  
ATOM 24     H HA   . ILE A 1 2   ? 63.055  88.018  97.417  1.00 0.00 ? 6   ILE A HA   1  
ATOM 25     H HB   . ILE A 1 2   ? 64.696  87.965  99.684  1.00 0.00 ? 6   ILE A HB   1  
ATOM 26     H HG12 . ILE A 1 2   ? 61.988  87.385  99.986  1.00 0.00 ? 6   ILE A HG12 1  
ATOM 27     H HG13 . ILE A 1 2   ? 62.870  86.219  99.444  1.00 0.00 ? 6   ILE A HG13 1  
ATOM 28     H HG21 . ILE A 1 2   ? 62.996  89.812  98.686  1.00 0.00 ? 6   ILE A HG21 1  
ATOM 29     H HG22 . ILE A 1 2   ? 62.536  89.403  100.145 1.00 0.00 ? 6   ILE A HG22 1  
ATOM 30     H HG23 . ILE A 1 2   ? 63.992  89.982  99.907  1.00 0.00 ? 6   ILE A HG23 1  
ATOM 31     H HD11 . ILE A 1 2   ? 63.867  87.233  101.823 1.00 0.00 ? 6   ILE A HD11 1  
ATOM 32     H HD12 . ILE A 1 2   ? 62.423  86.602  101.982 1.00 0.00 ? 6   ILE A HD12 1  
ATOM 33     H HD13 . ILE A 1 2   ? 63.620  85.714  101.446 1.00 0.00 ? 6   ILE A HD13 1  
ATOM 34     N N    . MET A 1 3   ? 64.724  89.534  96.410  1.00 0.00 ? 7   MET A N    1  
ATOM 35     C CA   . MET A 1 3   ? 65.709  90.317  95.685  1.00 0.00 ? 7   MET A CA   1  
ATOM 36     C C    . MET A 1 3   ? 66.291  91.410  96.574  1.00 0.00 ? 7   MET A C    1  
ATOM 37     O O    . MET A 1 3   ? 65.754  91.744  97.631  1.00 0.00 ? 7   MET A O    1  
ATOM 38     C CB   . MET A 1 3   ? 65.080  90.933  94.437  1.00 0.00 ? 7   MET A CB   1  
ATOM 39     C CG   . MET A 1 3   ? 65.571  90.348  93.121  1.00 0.00 ? 7   MET A CG   1  
ATOM 40     S SD   . MET A 1 3   ? 66.137  88.645  93.245  1.00 0.00 ? 7   MET A SD   1  
ATOM 41     C CE   . MET A 1 3   ? 64.586  87.758  93.360  1.00 0.00 ? 7   MET A CE   1  
ATOM 42     H H    . MET A 1 3   ? 63.916  89.812  96.312  1.00 0.00 ? 7   MET A H    1  
ATOM 43     H HA   . MET A 1 3   ? 66.429  89.726  95.415  1.00 0.00 ? 7   MET A HA   1  
ATOM 44     H HB2  . MET A 1 3   ? 64.118  90.822  94.487  1.00 0.00 ? 7   MET A HB2  1  
ATOM 45     H HB3  . MET A 1 3   ? 65.256  91.887  94.439  1.00 0.00 ? 7   MET A HB3  1  
ATOM 46     H HG2  . MET A 1 3   ? 64.853  90.395  92.470  1.00 0.00 ? 7   MET A HG2  1  
ATOM 47     H HG3  . MET A 1 3   ? 66.296  90.897  92.785  1.00 0.00 ? 7   MET A HG3  1  
ATOM 48     H HE1  . MET A 1 3   ? 64.069  87.905  92.553  1.00 0.00 ? 7   MET A HE1  1  
ATOM 49     H HE2  . MET A 1 3   ? 64.763  86.810  93.464  1.00 0.00 ? 7   MET A HE2  1  
ATOM 50     H HE3  . MET A 1 3   ? 64.086  88.079  94.127  1.00 0.00 ? 7   MET A HE3  1  
ATOM 51     N N    . GLY A 1 4   ? 67.404  91.986  96.117  1.00 0.00 ? 8   GLY A N    1  
ATOM 52     C CA   . GLY A 1 4   ? 68.022  93.108  96.805  1.00 0.00 ? 8   GLY A CA   1  
ATOM 53     C C    . GLY A 1 4   ? 67.166  94.356  96.868  1.00 0.00 ? 8   GLY A C    1  
ATOM 54     O O    . GLY A 1 4   ? 67.250  95.096  97.853  1.00 0.00 ? 8   GLY A O    1  
ATOM 55     H H    . GLY A 1 4   ? 67.815  91.736  95.404  1.00 0.00 ? 8   GLY A H    1  
ATOM 56     H HA2  . GLY A 1 4   ? 68.245  92.836  97.709  1.00 0.00 ? 8   GLY A HA2  1  
ATOM 57     H HA3  . GLY A 1 4   ? 68.857  93.325  96.360  1.00 0.00 ? 8   GLY A HA3  1  
ATOM 58     N N    . GLN A 1 5   ? 66.357  94.605  95.842  1.00 0.00 ? 9   GLN A N    1  
ATOM 59     C CA   . GLN A 1 5   ? 65.368  95.669  95.850  1.00 0.00 ? 9   GLN A CA   1  
ATOM 60     C C    . GLN A 1 5   ? 64.105  95.280  96.601  1.00 0.00 ? 9   GLN A C    1  
ATOM 61     O O    . GLN A 1 5   ? 63.342  96.164  97.004  1.00 0.00 ? 9   GLN A O    1  
ATOM 62     C CB   . GLN A 1 5   ? 65.008  96.042  94.411  1.00 0.00 ? 9   GLN A CB   1  
ATOM 63     C CG   . GLN A 1 5   ? 66.037  96.935  93.753  1.00 0.00 ? 9   GLN A CG   1  
ATOM 64     C CD   . GLN A 1 5   ? 66.846  97.723  94.755  1.00 0.00 ? 9   GLN A CD   1  
ATOM 65     O OE1  . GLN A 1 5   ? 66.429  98.789  95.204  1.00 0.00 ? 9   GLN A OE1  1  
ATOM 66     N NE2  . GLN A 1 5   ? 68.018  97.208  95.106  1.00 0.00 ? 9   GLN A NE2  1  
ATOM 67     H H    . GLN A 1 5   ? 66.371  94.152  95.112  1.00 0.00 ? 9   GLN A H    1  
ATOM 68     H HA   . GLN A 1 5   ? 65.761  96.427  96.311  1.00 0.00 ? 9   GLN A HA   1  
ATOM 69     H HB2  . GLN A 1 5   ? 64.910  95.231  93.887  1.00 0.00 ? 9   GLN A HB2  1  
ATOM 70     H HB3  . GLN A 1 5   ? 64.148  96.491  94.404  1.00 0.00 ? 9   GLN A HB3  1  
ATOM 71     H HG2  . GLN A 1 5   ? 66.634  96.393  93.214  1.00 0.00 ? 9   GLN A HG2  1  
ATOM 72     H HG3  . GLN A 1 5   ? 65.590  97.549  93.149  1.00 0.00 ? 9   GLN A HG3  1  
ATOM 73     H HE21 . GLN A 1 5   ? 68.276  96.460  94.770  1.00 0.00 ? 9   GLN A HE21 1  
ATOM 74     H HE22 . GLN A 1 5   ? 68.519  97.623  95.668  1.00 0.00 ? 9   GLN A HE22 1  
ATOM 75     N N    . ASP A 1 6   ? 63.884  93.982  96.813  1.00 0.00 ? 10  ASP A N    1  
ATOM 76     C CA   . ASP A 1 6   ? 62.633  93.484  97.366  1.00 0.00 ? 10  ASP A CA   1  
ATOM 77     C C    . ASP A 1 6   ? 62.397  93.881  98.814  1.00 0.00 ? 10  ASP A C    1  
ATOM 78     O O    . ASP A 1 6   ? 61.267  94.239  99.148  1.00 0.00 ? 10  ASP A O    1  
ATOM 79     C CB   . ASP A 1 6   ? 62.570  91.956  97.266  1.00 0.00 ? 10  ASP A CB   1  
ATOM 80     C CG   . ASP A 1 6   ? 61.176  91.441  96.964  1.00 0.00 ? 10  ASP A CG   1  
ATOM 81     O OD1  . ASP A 1 6   ? 60.337  91.411  97.889  1.00 0.00 ? 10  ASP A OD1  1  
ATOM 82     O OD2  . ASP A 1 6   ? 60.929  91.044  95.807  1.00 0.00 ? 10  ASP A OD2  1  
ATOM 83     H H    . ASP A 1 6   ? 64.460  93.368  96.638  1.00 0.00 ? 10  ASP A H    1  
ATOM 84     H HA   . ASP A 1 6   ? 61.937  93.898  96.833  1.00 0.00 ? 10  ASP A HA   1  
ATOM 85     H HB2  . ASP A 1 6   ? 63.178  91.656  96.572  1.00 0.00 ? 10  ASP A HB2  1  
ATOM 86     H HB3  . ASP A 1 6   ? 62.879  91.569  98.101  1.00 0.00 ? 10  ASP A HB3  1  
ATOM 87     N N    . VAL A 1 7   ? 63.397  93.806  99.686  1.00 0.00 ? 11  VAL A N    1  
ATOM 88     C CA   . VAL A 1 7   ? 63.230  94.130  101.100 1.00 0.00 ? 11  VAL A CA   1  
ATOM 89     C C    . VAL A 1 7   ? 63.578  95.595  101.288 1.00 0.00 ? 11  VAL A C    1  
ATOM 90     O O    . VAL A 1 7   ? 64.729  95.993  101.072 1.00 0.00 ? 11  VAL A O    1  
ATOM 91     C CB   . VAL A 1 7   ? 64.116  93.257  102.000 1.00 0.00 ? 11  VAL A CB   1  
ATOM 92     C CG1  . VAL A 1 7   ? 63.840  93.562  103.460 1.00 0.00 ? 11  VAL A CG1  1  
ATOM 93     C CG2  . VAL A 1 7   ? 63.919  91.788  101.706 1.00 0.00 ? 11  VAL A CG2  1  
ATOM 94     H H    . VAL A 1 7   ? 64.195  93.565  99.473  1.00 0.00 ? 11  VAL A H    1  
ATOM 95     H HA   . VAL A 1 7   ? 62.312  93.956  101.357 1.00 0.00 ? 11  VAL A HA   1  
ATOM 96     H HB   . VAL A 1 7   ? 65.044  93.468  101.810 1.00 0.00 ? 11  VAL A HB   1  
ATOM 97     H HG11 . VAL A 1 7   ? 64.388  92.990  104.020 1.00 0.00 ? 11  VAL A HG11 1  
ATOM 98     H HG12 . VAL A 1 7   ? 64.052  94.491  103.642 1.00 0.00 ? 11  VAL A HG12 1  
ATOM 99     H HG13 . VAL A 1 7   ? 62.904  93.401  103.652 1.00 0.00 ? 11  VAL A HG13 1  
ATOM 100    H HG21 . VAL A 1 7   ? 62.974  91.605  101.589 1.00 0.00 ? 11  VAL A HG21 1  
ATOM 101    H HG22 . VAL A 1 7   ? 64.396  91.553  100.896 1.00 0.00 ? 11  VAL A HG22 1  
ATOM 102    H HG23 . VAL A 1 7   ? 64.260  91.262  102.446 1.00 0.00 ? 11  VAL A HG23 1  
ATOM 103    N N    . LYS A 1 8   ? 62.598  96.400  101.697 1.00 0.00 ? 12  LYS A N    1  
ATOM 104    C CA   . LYS A 1 8   ? 62.861  97.805  101.981 1.00 0.00 ? 12  LYS A CA   1  
ATOM 105    C C    . LYS A 1 8   ? 62.401  98.160  103.387 1.00 0.00 ? 12  LYS A C    1  
ATOM 106    O O    . LYS A 1 8   ? 61.549  97.491  103.978 1.00 0.00 ? 12  LYS A O    1  
ATOM 107    C CB   . LYS A 1 8   ? 62.223  98.738  100.940 1.00 0.00 ? 12  LYS A CB   1  
ATOM 108    C CG   . LYS A 1 8   ? 63.152  99.882  100.544 1.00 0.00 ? 12  LYS A CG   1  
ATOM 109    C CD   . LYS A 1 8   ? 62.674  100.675 99.350  1.00 0.00 ? 12  LYS A CD   1  
ATOM 110    C CE   . LYS A 1 8   ? 62.979  99.954  98.061  1.00 0.00 ? 12  LYS A CE   1  
ATOM 111    N NZ   . LYS A 1 8   ? 62.169  100.510 96.946  1.00 0.00 ? 12  LYS A NZ   1  
ATOM 112    H H    . LYS A 1 8   ? 61.782  96.154  101.815 1.00 0.00 ? 12  LYS A H    1  
ATOM 113    H HA   . LYS A 1 8   ? 63.821  97.936  101.927 1.00 0.00 ? 12  LYS A HA   1  
ATOM 114    H HB2  . LYS A 1 8   ? 61.988  98.226  100.150 1.00 0.00 ? 12  LYS A HB2  1  
ATOM 115    H HB3  . LYS A 1 8   ? 61.398  99.103  101.297 1.00 0.00 ? 12  LYS A HB3  1  
ATOM 116    H HG2  . LYS A 1 8   ? 63.253  100.481 101.299 1.00 0.00 ? 12  LYS A HG2  1  
ATOM 117    H HG3  . LYS A 1 8   ? 64.031  99.519  100.349 1.00 0.00 ? 12  LYS A HG3  1  
ATOM 118    H HD2  . LYS A 1 8   ? 61.719  100.827 99.421  1.00 0.00 ? 12  LYS A HD2  1  
ATOM 119    H HD3  . LYS A 1 8   ? 63.101  101.546 99.345  1.00 0.00 ? 12  LYS A HD3  1  
ATOM 120    H HE2  . LYS A 1 8   ? 63.923  100.038 97.853  1.00 0.00 ? 12  LYS A HE2  1  
ATOM 121    H HE3  . LYS A 1 8   ? 62.793  99.008  98.162  1.00 0.00 ? 12  LYS A HE3  1  
ATOM 122    H HZ1  . LYS A 1 8   ? 61.418  100.861 97.270  1.00 0.00 ? 12  LYS A HZ1  1  
ATOM 123    H HZ2  . LYS A 1 8   ? 62.634  101.141 96.526  1.00 0.00 ? 12  LYS A HZ2  1  
ATOM 124    H HZ3  . LYS A 1 8   ? 61.968  99.860  96.372  1.00 0.00 ? 12  LYS A HZ3  1  
ATOM 125    N N    . TYR A 1 9   ? 63.003  99.218  103.923 1.00 0.00 ? 13  TYR A N    1  
ATOM 126    C CA   . TYR A 1 9   ? 62.957  99.534  105.350 1.00 0.00 ? 13  TYR A CA   1  
ATOM 127    C C    . TYR A 1 9   ? 62.337  100.916 105.527 1.00 0.00 ? 13  TYR A C    1  
ATOM 128    O O    . TYR A 1 9   ? 62.830  101.907 104.985 1.00 0.00 ? 13  TYR A O    1  
ATOM 129    C CB   . TYR A 1 9   ? 64.357  99.486  105.973 1.00 0.00 ? 13  TYR A CB   1  
ATOM 130    C CG   . TYR A 1 9   ? 65.097  98.169  105.842 1.00 0.00 ? 13  TYR A CG   1  
ATOM 131    C CD1  . TYR A 1 9   ? 65.409  97.402  106.953 1.00 0.00 ? 13  TYR A CD1  1  
ATOM 132    C CD2  . TYR A 1 9   ? 65.506  97.709  104.600 1.00 0.00 ? 13  TYR A CD2  1  
ATOM 133    C CE1  . TYR A 1 9   ? 66.076  96.211  106.826 1.00 0.00 ? 13  TYR A CE1  1  
ATOM 134    C CE2  . TYR A 1 9   ? 66.189  96.521  104.471 1.00 0.00 ? 13  TYR A CE2  1  
ATOM 135    C CZ   . TYR A 1 9   ? 66.469  95.776  105.591 1.00 0.00 ? 13  TYR A CZ   1  
ATOM 136    O OH   . TYR A 1 9   ? 67.149  94.587  105.493 1.00 0.00 ? 13  TYR A OH   1  
ATOM 137    H H    . TYR A 1 9   ? 63.458  99.783  103.460 1.00 0.00 ? 13  TYR A H    1  
ATOM 138    H HA   . TYR A 1 9   ? 62.416  98.870  105.805 1.00 0.00 ? 13  TYR A HA   1  
ATOM 139    H HB2  . TYR A 1 9   ? 64.897  100.182 105.566 1.00 0.00 ? 13  TYR A HB2  1  
ATOM 140    H HB3  . TYR A 1 9   ? 64.280  99.702  106.916 1.00 0.00 ? 13  TYR A HB3  1  
ATOM 141    H HD1  . TYR A 1 9   ? 65.162  97.700  107.798 1.00 0.00 ? 13  TYR A HD1  1  
ATOM 142    H HD2  . TYR A 1 9   ? 65.315  98.212  103.841 1.00 0.00 ? 13  TYR A HD2  1  
ATOM 143    H HE1  . TYR A 1 9   ? 66.261  95.700  107.581 1.00 0.00 ? 13  TYR A HE1  1  
ATOM 144    H HE2  . TYR A 1 9   ? 66.459  96.226  103.632 1.00 0.00 ? 13  TYR A HE2  1  
ATOM 145    H HH   . TYR A 1 9   ? 67.612  94.586  104.792 1.00 0.00 ? 13  TYR A HH   1  
ATOM 146    N N    . LEU A 1 10  ? 61.256  100.981 106.298 1.00 0.00 ? 14  LEU A N    1  
ATOM 147    C CA   . LEU A 1 10  ? 60.642  102.259 106.631 1.00 0.00 ? 14  LEU A CA   1  
ATOM 148    C C    . LEU A 1 10  ? 60.697  102.474 108.139 1.00 0.00 ? 14  LEU A C    1  
ATOM 149    O O    . LEU A 1 10  ? 60.639  101.513 108.913 1.00 0.00 ? 14  LEU A O    1  
ATOM 150    C CB   . LEU A 1 10  ? 59.199  102.313 106.138 1.00 0.00 ? 14  LEU A CB   1  
ATOM 151    C CG   . LEU A 1 10  ? 58.294  101.110 106.395 1.00 0.00 ? 14  LEU A CG   1  
ATOM 152    C CD1  . LEU A 1 10  ? 56.938  101.573 106.885 1.00 0.00 ? 14  LEU A CD1  1  
ATOM 153    C CD2  . LEU A 1 10  ? 58.129  100.299 105.134 1.00 0.00 ? 14  LEU A CD2  1  
ATOM 154    H H    . LEU A 1 10  ? 60.863  100.295 106.637 1.00 0.00 ? 14  LEU A H    1  
ATOM 155    H HA   . LEU A 1 10  ? 61.135  102.969 106.189 1.00 0.00 ? 14  LEU A HA   1  
ATOM 156    H HB2  . LEU A 1 10  ? 58.778  103.090 106.540 1.00 0.00 ? 14  LEU A HB2  1  
ATOM 157    H HB3  . LEU A 1 10  ? 59.220  102.466 105.180 1.00 0.00 ? 14  LEU A HB3  1  
ATOM 158    H HG   . LEU A 1 10  ? 58.705  100.554 107.075 1.00 0.00 ? 14  LEU A HG   1  
ATOM 159    H HD11 . LEU A 1 10  ? 56.269  101.391 106.207 1.00 0.00 ? 14  LEU A HD11 1  
ATOM 160    H HD12 . LEU A 1 10  ? 56.709  101.099 107.700 1.00 0.00 ? 14  LEU A HD12 1  
ATOM 161    H HD13 . LEU A 1 10  ? 56.966  102.527 107.063 1.00 0.00 ? 14  LEU A HD13 1  
ATOM 162    H HD21 . LEU A 1 10  ? 57.789  99.419  105.357 1.00 0.00 ? 14  LEU A HD21 1  
ATOM 163    H HD22 . LEU A 1 10  ? 57.506  100.746 104.541 1.00 0.00 ? 14  LEU A HD22 1  
ATOM 164    H HD23 . LEU A 1 10  ? 58.988  100.211 104.691 1.00 0.00 ? 14  LEU A HD23 1  
ATOM 165    N N    . PHE A 1 11  ? 60.804  103.732 108.553 1.00 0.00 ? 15  PHE A N    1  
ATOM 166    C CA   . PHE A 1 11  ? 60.784  104.095 109.961 1.00 0.00 ? 15  PHE A CA   1  
ATOM 167    C C    . PHE A 1 11  ? 59.628  105.046 110.236 1.00 0.00 ? 15  PHE A C    1  
ATOM 168    O O    . PHE A 1 11  ? 59.291  105.904 109.417 1.00 0.00 ? 15  PHE A O    1  
ATOM 169    C CB   . PHE A 1 11  ? 62.096  104.764 110.382 1.00 0.00 ? 15  PHE A CB   1  
ATOM 170    C CG   . PHE A 1 11  ? 63.294  104.339 109.582 1.00 0.00 ? 15  PHE A CG   1  
ATOM 171    C CD1  . PHE A 1 11  ? 63.820  105.146 108.585 1.00 0.00 ? 15  PHE A CD1  1  
ATOM 172    C CD2  . PHE A 1 11  ? 63.895  103.117 109.836 1.00 0.00 ? 15  PHE A CD2  1  
ATOM 173    C CE1  . PHE A 1 11  ? 64.924  104.743 107.865 1.00 0.00 ? 15  PHE A CE1  1  
ATOM 174    C CE2  . PHE A 1 11  ? 64.998  102.710 109.114 1.00 0.00 ? 15  PHE A CE2  1  
ATOM 175    C CZ   . PHE A 1 11  ? 65.512  103.524 108.127 1.00 0.00 ? 15  PHE A CZ   1  
ATOM 176    H H    . PHE A 1 11  ? 60.890  104.401 108.021 1.00 0.00 ? 15  PHE A H    1  
ATOM 177    H HA   . PHE A 1 11  ? 60.673  103.281 110.476 1.00 0.00 ? 15  PHE A HA   1  
ATOM 178    H HB2  . PHE A 1 11  ? 61.994  105.726 110.306 1.00 0.00 ? 15  PHE A HB2  1  
ATOM 179    H HB3  . PHE A 1 11  ? 62.260  104.569 111.318 1.00 0.00 ? 15  PHE A HB3  1  
ATOM 180    H HD1  . PHE A 1 11  ? 63.423  105.967 108.400 1.00 0.00 ? 15  PHE A HD1  1  
ATOM 181    H HD2  . PHE A 1 11  ? 63.552  102.565 110.500 1.00 0.00 ? 15  PHE A HD2  1  
ATOM 182    H HE1  . PHE A 1 11  ? 65.273  105.294 107.202 1.00 0.00 ? 15  PHE A HE1  1  
ATOM 183    H HE2  . PHE A 1 11  ? 65.395  101.887 109.294 1.00 0.00 ? 15  PHE A HE2  1  
ATOM 184    H HZ   . PHE A 1 11  ? 66.254  103.250 107.638 1.00 0.00 ? 15  PHE A HZ   1  
ATOM 185    N N    . GLN A 1 12  ? 59.021  104.888 111.409 1.00 0.00 ? 16  GLN A N    1  
ATOM 186    C CA   . GLN A 1 12  ? 58.039  105.856 111.871 1.00 0.00 ? 16  GLN A CA   1  
ATOM 187    C C    . GLN A 1 12  ? 58.472  106.386 113.230 1.00 0.00 ? 16  GLN A C    1  
ATOM 188    O O    . GLN A 1 12  ? 58.743  105.609 114.153 1.00 0.00 ? 16  GLN A O    1  
ATOM 189    C CB   . GLN A 1 12  ? 56.633  105.245 111.943 1.00 0.00 ? 16  GLN A CB   1  
ATOM 190    C CG   . GLN A 1 12  ? 55.498  106.256 111.844 1.00 0.00 ? 16  GLN A CG   1  
ATOM 191    C CD   . GLN A 1 12  ? 54.137  105.618 111.696 1.00 0.00 ? 16  GLN A CD   1  
ATOM 192    O OE1  . GLN A 1 12  ? 53.250  106.165 111.047 1.00 0.00 ? 16  GLN A OE1  1  
ATOM 193    N NE2  . GLN A 1 12  ? 53.964  104.451 112.301 1.00 0.00 ? 16  GLN A NE2  1  
ATOM 194    H H    . GLN A 1 12  ? 59.164  104.233 111.947 1.00 0.00 ? 16  GLN A H    1  
ATOM 195    H HA   . GLN A 1 12  ? 57.994  106.587 111.235 1.00 0.00 ? 16  GLN A HA   1  
ATOM 196    H HB2  . GLN A 1 12  ? 56.538  104.598 111.227 1.00 0.00 ? 16  GLN A HB2  1  
ATOM 197    H HB3  . GLN A 1 12  ? 56.547  104.759 112.777 1.00 0.00 ? 16  GLN A HB3  1  
ATOM 198    H HG2  . GLN A 1 12  ? 55.501  106.815 112.637 1.00 0.00 ? 16  GLN A HG2  1  
ATOM 199    H HG3  . GLN A 1 12  ? 55.658  106.839 111.085 1.00 0.00 ? 16  GLN A HG3  1  
ATOM 200    H HE21 . GLN A 1 12  ? 54.608  104.098 112.747 1.00 0.00 ? 16  GLN A HE21 1  
ATOM 201    H HE22 . GLN A 1 12  ? 53.207  104.046 112.246 1.00 0.00 ? 16  GLN A HE22 1  
ATOM 202    N N    . SER A 1 13  ? 58.547  107.710 113.336 1.00 0.00 ? 17  SER A N    1  
ATOM 203    C CA   . SER A 1 13  ? 58.932  108.363 114.577 1.00 0.00 ? 17  SER A CA   1  
ATOM 204    C C    . SER A 1 13  ? 57.828  108.247 115.622 1.00 0.00 ? 17  SER A C    1  
ATOM 205    O O    . SER A 1 13  ? 56.636  108.231 115.303 1.00 0.00 ? 17  SER A O    1  
ATOM 206    C CB   . SER A 1 13  ? 59.252  109.835 114.325 1.00 0.00 ? 17  SER A CB   1  
ATOM 207    O OG   . SER A 1 13  ? 58.166  110.490 113.701 1.00 0.00 ? 17  SER A OG   1  
ATOM 208    H H    . SER A 1 13  ? 58.376  108.252 112.691 1.00 0.00 ? 17  SER A H    1  
ATOM 209    H HA   . SER A 1 13  ? 59.725  107.917 114.917 1.00 0.00 ? 17  SER A HA   1  
ATOM 210    H HB2  . SER A 1 13  ? 59.459  110.272 115.166 1.00 0.00 ? 17  SER A HB2  1  
ATOM 211    H HB3  . SER A 1 13  ? 60.041  109.906 113.766 1.00 0.00 ? 17  SER A HB3  1  
ATOM 212    H HG   . SER A 1 13  ? 57.486  110.437 114.192 1.00 0.00 ? 17  SER A HG   1  
ATOM 213    N N    . ILE A 1 14  ? 58.239  108.173 116.890 1.00 0.00 ? 18  ILE A N    1  
ATOM 214    C CA   . ILE A 1 14  ? 57.278  108.051 117.979 1.00 0.00 ? 18  ILE A CA   1  
ATOM 215    C C    . ILE A 1 14  ? 56.491  109.335 118.191 1.00 0.00 ? 18  ILE A C    1  
ATOM 216    O O    . ILE A 1 14  ? 55.267  109.287 118.364 1.00 0.00 ? 18  ILE A O    1  
ATOM 217    C CB   . ILE A 1 14  ? 57.982  107.645 119.287 1.00 0.00 ? 18  ILE A CB   1  
ATOM 218    C CG1  . ILE A 1 14  ? 59.302  108.402 119.439 1.00 0.00 ? 18  ILE A CG1  1  
ATOM 219    C CG2  . ILE A 1 14  ? 58.211  106.143 119.330 1.00 0.00 ? 18  ILE A CG2  1  
ATOM 220    C CD1  . ILE A 1 14  ? 59.616  108.848 120.863 1.00 0.00 ? 18  ILE A CD1  1  
ATOM 221    H H    . ILE A 1 14  ? 59.063  108.193 117.136 1.00 0.00 ? 18  ILE A H    1  
ATOM 222    H HA   . ILE A 1 14  ? 56.651  107.356 117.726 1.00 0.00 ? 18  ILE A HA   1  
ATOM 223    H HB   . ILE A 1 14  ? 57.408  107.882 120.032 1.00 0.00 ? 18  ILE A HB   1  
ATOM 224    H HG12 . ILE A 1 14  ? 60.024  107.837 119.123 1.00 0.00 ? 18  ILE A HG12 1  
ATOM 225    H HG13 . ILE A 1 14  ? 59.281  109.184 118.865 1.00 0.00 ? 18  ILE A HG13 1  
ATOM 226    H HG21 . ILE A 1 14  ? 58.091  105.824 120.238 1.00 0.00 ? 18  ILE A HG21 1  
ATOM 227    H HG22 . ILE A 1 14  ? 57.574  105.702 118.746 1.00 0.00 ? 18  ILE A HG22 1  
ATOM 228    H HG23 . ILE A 1 14  ? 59.113  105.944 119.033 1.00 0.00 ? 18  ILE A HG23 1  
ATOM 229    H HD11 . ILE A 1 14  ? 60.077  108.134 121.331 1.00 0.00 ? 18  ILE A HD11 1  
ATOM 230    H HD12 . ILE A 1 14  ? 60.182  109.636 120.838 1.00 0.00 ? 18  ILE A HD12 1  
ATOM 231    H HD13 . ILE A 1 14  ? 58.790  109.058 121.326 1.00 0.00 ? 18  ILE A HD13 1  
ATOM 232    N N    . ASP A 1 15  ? 57.158  110.488 118.178 1.00 0.00 ? 19  ASP A N    1  
ATOM 233    C CA   . ASP A 1 15  ? 56.528  111.746 118.539 1.00 0.00 ? 19  ASP A CA   1  
ATOM 234    C C    . ASP A 1 15  ? 55.594  112.272 117.456 1.00 0.00 ? 19  ASP A C    1  
ATOM 235    O O    . ASP A 1 15  ? 54.680  113.043 117.766 1.00 0.00 ? 19  ASP A O    1  
ATOM 236    C CB   . ASP A 1 15  ? 57.614  112.793 118.840 1.00 0.00 ? 19  ASP A CB   1  
ATOM 237    C CG   . ASP A 1 15  ? 58.695  112.280 119.778 1.00 0.00 ? 19  ASP A CG   1  
ATOM 238    O OD1  . ASP A 1 15  ? 58.368  111.810 120.888 1.00 0.00 ? 19  ASP A OD1  1  
ATOM 239    O OD2  . ASP A 1 15  ? 59.882  112.348 119.396 1.00 0.00 ? 19  ASP A OD2  1  
ATOM 240    H H    . ASP A 1 15  ? 57.987  110.558 117.961 1.00 0.00 ? 19  ASP A H    1  
ATOM 241    H HA   . ASP A 1 15  ? 55.985  111.582 119.325 1.00 0.00 ? 19  ASP A HA   1  
ATOM 242    H HB2  . ASP A 1 15  ? 58.024  113.075 118.008 1.00 0.00 ? 19  ASP A HB2  1  
ATOM 243    H HB3  . ASP A 1 15  ? 57.200  113.577 119.233 1.00 0.00 ? 19  ASP A HB3  1  
ATOM 244    N N    . ALA A 1 16  ? 55.789  111.874 116.200 1.00 0.00 ? 20  ALA A N    1  
ATOM 245    C CA   . ALA A 1 16  ? 54.984  112.437 115.122 1.00 0.00 ? 20  ALA A CA   1  
ATOM 246    C C    . ALA A 1 16  ? 53.496  112.223 115.369 1.00 0.00 ? 20  ALA A C    1  
ATOM 247    O O    . ALA A 1 16  ? 52.700  113.159 115.230 1.00 0.00 ? 20  ALA A O    1  
ATOM 248    C CB   . ALA A 1 16  ? 55.403  111.828 113.785 1.00 0.00 ? 20  ALA A CB   1  
ATOM 249    H H    . ALA A 1 16  ? 56.371  111.290 115.955 1.00 0.00 ? 20  ALA A H    1  
ATOM 250    H HA   . ALA A 1 16  ? 55.140  113.394 115.096 1.00 0.00 ? 20  ALA A HA   1  
ATOM 251    H HB1  . ALA A 1 16  ? 55.911  111.016 113.943 1.00 0.00 ? 20  ALA A HB1  1  
ATOM 252    H HB2  . ALA A 1 16  ? 54.613  111.618 113.263 1.00 0.00 ? 20  ALA A HB2  1  
ATOM 253    H HB3  . ALA A 1 16  ? 55.952  112.463 113.298 1.00 0.00 ? 20  ALA A HB3  1  
ATOM 254    N N    . ALA A 1 17  ? 53.116  110.993 115.749 1.00 0.00 ? 21  ALA A N    1  
ATOM 255    C CA   . ALA A 1 17  ? 51.721  110.545 115.903 1.00 0.00 ? 21  ALA A CA   1  
ATOM 256    C C    . ALA A 1 17  ? 50.929  110.700 114.605 1.00 0.00 ? 21  ALA A C    1  
ATOM 257    O O    . ALA A 1 17  ? 49.802  111.198 114.593 1.00 0.00 ? 21  ALA A O    1  
ATOM 258    C CB   . ALA A 1 17  ? 51.019  111.253 117.068 1.00 0.00 ? 21  ALA A CB   1  
ATOM 259    H H    . ALA A 1 17  ? 53.686  110.375 115.930 1.00 0.00 ? 21  ALA A H    1  
ATOM 260    H HA   . ALA A 1 17  ? 51.755  109.598 116.114 1.00 0.00 ? 21  ALA A HA   1  
ATOM 261    H HB1  . ALA A 1 17  ? 50.265  111.763 116.730 1.00 0.00 ? 21  ALA A HB1  1  
ATOM 262    H HB2  . ALA A 1 17  ? 50.702  110.593 117.704 1.00 0.00 ? 21  ALA A HB2  1  
ATOM 263    H HB3  . ALA A 1 17  ? 51.643  111.852 117.506 1.00 0.00 ? 21  ALA A HB3  1  
ATOM 264    N N    . THR A 1 18  ? 51.531  110.266 113.500 1.00 0.00 ? 22  THR A N    1  
ATOM 265    C CA   . THR A 1 18  ? 50.920  110.338 112.179 1.00 0.00 ? 22  THR A CA   1  
ATOM 266    C C    . THR A 1 18  ? 50.592  108.932 111.704 1.00 0.00 ? 22  THR A C    1  
ATOM 267    O O    . THR A 1 18  ? 51.145  107.955 112.217 1.00 0.00 ? 22  THR A O    1  
ATOM 268    C CB   . THR A 1 18  ? 51.847  111.023 111.167 1.00 0.00 ? 22  THR A CB   1  
ATOM 269    O OG1  . THR A 1 18  ? 51.209  111.070 109.885 1.00 0.00 ? 22  THR A OG1  1  
ATOM 270    C CG2  . THR A 1 18  ? 53.164  110.280 111.048 1.00 0.00 ? 22  THR A CG2  1  
ATOM 271    H H    . THR A 1 18  ? 52.317  109.917 113.499 1.00 0.00 ? 22  THR A H    1  
ATOM 272    H HA   . THR A 1 18  ? 50.110  110.867 112.246 1.00 0.00 ? 22  THR A HA   1  
ATOM 273    H HB   . THR A 1 18  ? 52.027  111.923 111.480 1.00 0.00 ? 22  THR A HB   1  
ATOM 274    H HG1  . THR A 1 18  ? 51.793  111.082 109.282 1.00 0.00 ? 22  THR A HG1  1  
ATOM 275    H HG21 . THR A 1 18  ? 53.805  110.363 110.325 1.00 0.00 ? 22  THR A HG21 1  
ATOM 276    H HG22 . THR A 1 18  ? 53.605  110.263 111.912 1.00 0.00 ? 22  THR A HG22 1  
ATOM 277    H HG23 . THR A 1 18  ? 52.997  109.372 110.752 1.00 0.00 ? 22  THR A HG23 1  
ATOM 278    N N    . GLY A 1 19  ? 49.703  108.835 110.720 1.00 0.00 ? 23  GLY A N    1  
ATOM 279    C CA   . GLY A 1 19  ? 49.288  107.549 110.195 1.00 0.00 ? 23  GLY A CA   1  
ATOM 280    C C    . GLY A 1 19  ? 50.127  107.067 109.029 1.00 0.00 ? 23  GLY A C    1  
ATOM 281    O O    . GLY A 1 19  ? 49.605  106.450 108.097 1.00 0.00 ? 23  GLY A O    1  
ATOM 282    H H    . GLY A 1 19  ? 49.329  109.511 110.343 1.00 0.00 ? 23  GLY A H    1  
ATOM 283    H HA2  . GLY A 1 19  ? 49.327  106.890 110.905 1.00 0.00 ? 23  GLY A HA2  1  
ATOM 284    H HA3  . GLY A 1 19  ? 48.362  107.608 109.913 1.00 0.00 ? 23  GLY A HA3  1  
ATOM 285    N N    . SER A 1 20  ? 51.428  107.345 109.066 1.00 0.00 ? 24  SER A N    1  
ATOM 286    C CA   . SER A 1 20  ? 52.308  106.965 107.967 1.00 0.00 ? 24  SER A CA   1  
ATOM 287    C C    . SER A 1 20  ? 53.776  107.102 108.346 1.00 0.00 ? 24  SER A C    1  
ATOM 288    O O    . SER A 1 20  ? 54.144  108.032 109.072 1.00 0.00 ? 24  SER A O    1  
ATOM 289    C CB   . SER A 1 20  ? 52.007  107.812 106.729 1.00 0.00 ? 24  SER A CB   1  
ATOM 290    O OG   . SER A 1 20  ? 52.691  109.050 106.782 1.00 0.00 ? 24  SER A OG   1  
ATOM 291    H H    . SER A 1 20  ? 51.819  107.752 109.715 1.00 0.00 ? 24  SER A H    1  
ATOM 292    H HA   . SER A 1 20  ? 52.138  106.030 107.769 1.00 0.00 ? 24  SER A HA   1  
ATOM 293    H HB2  . SER A 1 20  ? 52.270  107.327 105.930 1.00 0.00 ? 24  SER A HB2  1  
ATOM 294    H HB3  . SER A 1 20  ? 51.052  107.968 106.664 1.00 0.00 ? 24  SER A HB3  1  
ATOM 295    H HG   . SER A 1 20  ? 53.231  109.100 106.141 1.00 0.00 ? 24  SER A HG   1  
ATOM 296    N N    . ALA A 1 21  ? 54.611  106.178 107.851 1.00 0.00 ? 25  ALA A N    1  
ATOM 297    C CA   . ALA A 1 21  ? 56.034  106.021 108.160 1.00 0.00 ? 25  ALA A CA   1  
ATOM 298    C C    . ALA A 1 21  ? 56.932  106.484 107.016 1.00 0.00 ? 25  ALA A C    1  
ATOM 299    O O    . ALA A 1 21  ? 56.888  105.893 105.930 1.00 0.00 ? 25  ALA A O    1  
ATOM 300    C CB   . ALA A 1 21  ? 56.353  104.568 108.525 1.00 0.00 ? 25  ALA A CB   1  
ATOM 301    H H    . ALA A 1 21  ? 54.339  105.588 107.288 1.00 0.00 ? 25  ALA A H    1  
ATOM 302    H HA   . ALA A 1 21  ? 56.218  106.590 108.924 1.00 0.00 ? 25  ALA A HA   1  
ATOM 303    H HB1  . ALA A 1 21  ? 57.235  104.338 108.194 1.00 0.00 ? 25  ALA A HB1  1  
ATOM 304    H HB2  . ALA A 1 21  ? 56.332  104.464 109.489 1.00 0.00 ? 25  ALA A HB2  1  
ATOM 305    H HB3  . ALA A 1 21  ? 55.694  103.981 108.123 1.00 0.00 ? 25  ALA A HB3  1  
ATOM 306    N N    . PRO A 1 22  ? 57.744  107.546 107.199 1.00 0.00 ? 26  PRO A N    1  
ATOM 307    C CA   . PRO A 1 22  ? 58.634  107.969 106.111 1.00 0.00 ? 26  PRO A CA   1  
ATOM 308    C C    . PRO A 1 22  ? 59.787  107.006 105.897 1.00 0.00 ? 26  PRO A C    1  
ATOM 309    O O    . PRO A 1 22  ? 60.444  106.584 106.854 1.00 0.00 ? 26  PRO A O    1  
ATOM 310    C CB   . PRO A 1 22  ? 59.154  109.333 106.587 1.00 0.00 ? 26  PRO A CB   1  
ATOM 311    C CG   . PRO A 1 22  ? 58.204  109.772 107.639 1.00 0.00 ? 26  PRO A CG   1  
ATOM 312    C CD   . PRO A 1 22  ? 57.780  108.506 108.313 1.00 0.00 ? 26  PRO A CD   1  
ATOM 313    H HA   . PRO A 1 22  ? 58.174  108.000 105.257 1.00 0.00 ? 26  PRO A HA   1  
ATOM 314    H HB2  . PRO A 1 22  ? 60.056  109.261 106.938 1.00 0.00 ? 26  PRO A HB2  1  
ATOM 315    H HB3  . PRO A 1 22  ? 59.185  109.970 105.856 1.00 0.00 ? 26  PRO A HB3  1  
ATOM 316    H HG2  . PRO A 1 22  ? 58.627  110.381 108.264 1.00 0.00 ? 26  PRO A HG2  1  
ATOM 317    H HG3  . PRO A 1 22  ? 57.445  110.239 107.256 1.00 0.00 ? 26  PRO A HG3  1  
ATOM 318    H HD2  . PRO A 1 22  ? 58.407  108.236 109.002 1.00 0.00 ? 26  PRO A HD2  1  
ATOM 319    H HD3  . PRO A 1 22  ? 56.913  108.597 108.739 1.00 0.00 ? 26  PRO A HD3  1  
ATOM 320    N N    . LEU A 1 23  ? 60.037  106.649 104.645 1.00 0.00 ? 27  LEU A N    1  
ATOM 321    C CA   . LEU A 1 23  ? 61.252  105.938 104.289 1.00 0.00 ? 27  LEU A CA   1  
ATOM 322    C C    . LEU A 1 23  ? 62.086  106.815 103.367 1.00 0.00 ? 27  LEU A C    1  
ATOM 323    O O    . LEU A 1 23  ? 61.569  107.686 102.665 1.00 0.00 ? 27  LEU A O    1  
ATOM 324    C CB   . LEU A 1 23  ? 60.954  104.607 103.604 1.00 0.00 ? 27  LEU A CB   1  
ATOM 325    C CG   . LEU A 1 23  ? 59.995  104.602 102.412 1.00 0.00 ? 27  LEU A CG   1  
ATOM 326    C CD1  . LEU A 1 23  ? 60.614  103.828 101.259 1.00 0.00 ? 27  LEU A CD1  1  
ATOM 327    C CD2  . LEU A 1 23  ? 58.625  104.034 102.761 1.00 0.00 ? 27  LEU A CD2  1  
ATOM 328    H H    . LEU A 1 23  ? 59.511  106.811 103.983 1.00 0.00 ? 27  LEU A H    1  
ATOM 329    H HA   . LEU A 1 23  ? 61.740  105.743 105.104 1.00 0.00 ? 27  LEU A HA   1  
ATOM 330    H HB2  . LEU A 1 23  ? 61.797  104.232 103.306 1.00 0.00 ? 27  LEU A HB2  1  
ATOM 331    H HB3  . LEU A 1 23  ? 60.597  104.003 104.274 1.00 0.00 ? 27  LEU A HB3  1  
ATOM 332    H HG   . LEU A 1 23  ? 59.852  105.525 102.149 1.00 0.00 ? 27  LEU A HG   1  
ATOM 333    H HD11 . LEU A 1 23  ? 60.111  104.001 100.447 1.00 0.00 ? 27  LEU A HD11 1  
ATOM 334    H HD12 . LEU A 1 23  ? 61.534  104.111 101.136 1.00 0.00 ? 27  LEU A HD12 1  
ATOM 335    H HD13 . LEU A 1 23  ? 60.592  102.879 101.457 1.00 0.00 ? 27  LEU A HD13 1  
ATOM 336    H HD21 . LEU A 1 23  ? 58.732  103.257 103.330 1.00 0.00 ? 27  LEU A HD21 1  
ATOM 337    H HD22 . LEU A 1 23  ? 58.105  104.707 103.227 1.00 0.00 ? 27  LEU A HD22 1  
ATOM 338    H HD23 . LEU A 1 23  ? 58.164  103.777 101.947 1.00 0.00 ? 27  LEU A HD23 1  
ATOM 339    N N    . PHE A 1 24  ? 63.379  106.569 103.365 1.00 0.00 ? 28  PHE A N    1  
ATOM 340    C CA   . PHE A 1 24  ? 64.208  107.564 102.723 1.00 0.00 ? 28  PHE A CA   1  
ATOM 341    C C    . PHE A 1 24  ? 64.722  107.049 101.380 1.00 0.00 ? 28  PHE A C    1  
ATOM 342    O O    . PHE A 1 24  ? 65.004  105.854 101.247 1.00 0.00 ? 28  PHE A O    1  
ATOM 343    C CB   . PHE A 1 24  ? 65.381  107.929 103.641 1.00 0.00 ? 28  PHE A CB   1  
ATOM 344    C CG   . PHE A 1 24  ? 66.099  109.172 103.236 1.00 0.00 ? 28  PHE A CG   1  
ATOM 345    C CD1  . PHE A 1 24  ? 65.439  110.386 103.230 1.00 0.00 ? 28  PHE A CD1  1  
ATOM 346    C CD2  . PHE A 1 24  ? 67.427  109.135 102.871 1.00 0.00 ? 28  PHE A CD2  1  
ATOM 347    C CE1  . PHE A 1 24  ? 66.091  111.536 102.850 1.00 0.00 ? 28  PHE A CE1  1  
ATOM 348    C CE2  . PHE A 1 24  ? 68.088  110.288 102.489 1.00 0.00 ? 28  PHE A CE2  1  
ATOM 349    C CZ   . PHE A 1 24  ? 67.417  111.490 102.482 1.00 0.00 ? 28  PHE A CZ   1  
ATOM 350    H H    . PHE A 1 24  ? 63.776  105.884 103.702 1.00 0.00 ? 28  PHE A H    1  
ATOM 351    H HA   . PHE A 1 24  ? 63.677  108.359 102.557 1.00 0.00 ? 28  PHE A HA   1  
ATOM 352    H HB2  . PHE A 1 24  ? 65.051  108.037 104.547 1.00 0.00 ? 28  PHE A HB2  1  
ATOM 353    H HB3  . PHE A 1 24  ? 66.011  107.192 103.655 1.00 0.00 ? 28  PHE A HB3  1  
ATOM 354    H HD1  . PHE A 1 24  ? 64.546  110.426 103.486 1.00 0.00 ? 28  PHE A HD1  1  
ATOM 355    H HD2  . PHE A 1 24  ? 67.884  108.325 102.880 1.00 0.00 ? 28  PHE A HD2  1  
ATOM 356    H HE1  . PHE A 1 24  ? 65.634  112.347 102.841 1.00 0.00 ? 28  PHE A HE1  1  
ATOM 357    H HE2  . PHE A 1 24  ? 68.983  110.251 102.239 1.00 0.00 ? 28  PHE A HE2  1  
ATOM 358    H HZ   . PHE A 1 24  ? 67.857  112.268 102.230 1.00 0.00 ? 28  PHE A HZ   1  
ATOM 359    N N    . PRO A 1 25  ? 64.807  107.893 100.354 1.00 0.00 ? 29  PRO A N    1  
ATOM 360    C CA   . PRO A 1 25  ? 65.311  107.420 99.059  1.00 0.00 ? 29  PRO A CA   1  
ATOM 361    C C    . PRO A 1 25  ? 66.820  107.251 99.052  1.00 0.00 ? 29  PRO A C    1  
ATOM 362    O O    . PRO A 1 25  ? 67.515  107.578 100.015 1.00 0.00 ? 29  PRO A O    1  
ATOM 363    C CB   . PRO A 1 25  ? 64.846  108.502 98.077  1.00 0.00 ? 29  PRO A CB   1  
ATOM 364    C CG   . PRO A 1 25  ? 64.695  109.721 98.908  1.00 0.00 ? 29  PRO A CG   1  
ATOM 365    C CD   . PRO A 1 25  ? 64.215  109.236 100.247 1.00 0.00 ? 29  PRO A CD   1  
ATOM 366    H HA   . PRO A 1 25  ? 64.965  106.543 98.832  1.00 0.00 ? 29  PRO A HA   1  
ATOM 367    H HB2  . PRO A 1 25  ? 65.494  108.636 97.367  1.00 0.00 ? 29  PRO A HB2  1  
ATOM 368    H HB3  . PRO A 1 25  ? 64.008  108.257 97.653  1.00 0.00 ? 29  PRO A HB3  1  
ATOM 369    H HG2  . PRO A 1 25  ? 65.538  110.195 98.989  1.00 0.00 ? 29  PRO A HG2  1  
ATOM 370    H HG3  . PRO A 1 25  ? 64.061  110.338 98.512  1.00 0.00 ? 29  PRO A HG3  1  
ATOM 371    H HD2  . PRO A 1 25  ? 64.511  109.816 100.966 1.00 0.00 ? 29  PRO A HD2  1  
ATOM 372    H HD3  . PRO A 1 25  ? 63.246  109.205 100.290 1.00 0.00 ? 29  PRO A HD3  1  
ATOM 373    N N    . ALA A 1 26  ? 67.309  106.733 97.921  1.00 0.00 ? 30  ALA A N    1  
ATOM 374    C CA   . ALA A 1 26  ? 68.727  106.474 97.648  1.00 0.00 ? 30  ALA A CA   1  
ATOM 375    C C    . ALA A 1 26  ? 69.365  105.629 98.752  1.00 0.00 ? 30  ALA A C    1  
ATOM 376    O O    . ALA A 1 26  ? 70.289  106.055 99.444  1.00 0.00 ? 30  ALA A O    1  
ATOM 377    C CB   . ALA A 1 26  ? 69.510  107.774 97.427  1.00 0.00 ? 30  ALA A CB   1  
ATOM 378    H H    . ALA A 1 26  ? 66.800  106.514 97.263  1.00 0.00 ? 30  ALA A H    1  
ATOM 379    H HA   . ALA A 1 26  ? 68.768  105.964 96.824  1.00 0.00 ? 30  ALA A HA   1  
ATOM 380    H HB1  . ALA A 1 26  ? 69.145  108.246 96.663  1.00 0.00 ? 30  ALA A HB1  1  
ATOM 381    H HB2  . ALA A 1 26  ? 69.438  108.333 98.216  1.00 0.00 ? 30  ALA A HB2  1  
ATOM 382    H HB3  . ALA A 1 26  ? 70.444  107.565 97.263  1.00 0.00 ? 30  ALA A HB3  1  
ATOM 383    N N    . TYR A 1 27  ? 68.848  104.412 98.904  1.00 0.00 ? 31  TYR A N    1  
ATOM 384    C CA   . TYR A 1 27  ? 69.442  103.449 99.819  1.00 0.00 ? 31  TYR A CA   1  
ATOM 385    C C    . TYR A 1 27  ? 70.726  102.865 99.241  1.00 0.00 ? 31  TYR A C    1  
ATOM 386    O O    . TYR A 1 27  ? 70.872  102.648 98.039  1.00 0.00 ? 31  TYR A O    1  
ATOM 387    C CB   . TYR A 1 27  ? 68.461  102.327 100.149 1.00 0.00 ? 31  TYR A CB   1  
ATOM 388    C CG   . TYR A 1 27  ? 67.497  102.658 101.257 1.00 0.00 ? 31  TYR A CG   1  
ATOM 389    C CD1  . TYR A 1 27  ? 66.136  102.440 101.101 1.00 0.00 ? 31  TYR A CD1  1  
ATOM 390    C CD2  . TYR A 1 27  ? 67.945  103.190 102.460 1.00 0.00 ? 31  TYR A CD2  1  
ATOM 391    C CE1  . TYR A 1 27  ? 65.244  102.748 102.104 1.00 0.00 ? 31  TYR A CE1  1  
ATOM 392    C CE2  . TYR A 1 27  ? 67.058  103.492 103.477 1.00 0.00 ? 31  TYR A CE2  1  
ATOM 393    C CZ   . TYR A 1 27  ? 65.709  103.262 103.292 1.00 0.00 ? 31  TYR A CZ   1  
ATOM 394    O OH   . TYR A 1 27  ? 64.816  103.558 104.293 1.00 0.00 ? 31  TYR A OH   1  
ATOM 395    H H    . TYR A 1 27  ? 68.153  104.126 98.486  1.00 0.00 ? 31  TYR A H    1  
ATOM 396    H HA   . TYR A 1 27  ? 69.658  103.921 100.638 1.00 0.00 ? 31  TYR A HA   1  
ATOM 397    H HB2  . TYR A 1 27  ? 67.956  102.106 99.351  1.00 0.00 ? 31  TYR A HB2  1  
ATOM 398    H HB3  . TYR A 1 27  ? 68.962  101.534 100.396 1.00 0.00 ? 31  TYR A HB3  1  
ATOM 399    H HD1  . TYR A 1 27  ? 65.820  102.079 100.304 1.00 0.00 ? 31  TYR A HD1  1  
ATOM 400    H HD2  . TYR A 1 27  ? 68.854  103.345 102.583 1.00 0.00 ? 31  TYR A HD2  1  
ATOM 401    H HE1  . TYR A 1 27  ? 64.333  102.609 101.979 1.00 0.00 ? 31  TYR A HE1  1  
ATOM 402    H HE2  . TYR A 1 27  ? 67.368  103.846 104.280 1.00 0.00 ? 31  TYR A HE2  1  
ATOM 403    H HH   . TYR A 1 27  ? 64.724  104.392 104.348 1.00 0.00 ? 31  TYR A HH   1  
ATOM 404    N N    . GLN A 1 28  ? 71.671  102.608 100.131 1.00 0.00 ? 32  GLN A N    1  
ATOM 405    C CA   . GLN A 1 28  ? 72.955  102.030 99.789  1.00 0.00 ? 32  GLN A CA   1  
ATOM 406    C C    . GLN A 1 28  ? 72.838  100.558 100.186 1.00 0.00 ? 32  GLN A C    1  
ATOM 407    O O    . GLN A 1 28  ? 72.954  99.678  99.325  1.00 0.00 ? 32  GLN A O    1  
ATOM 408    C CB   . GLN A 1 28  ? 74.068  102.883 100.439 1.00 0.00 ? 32  GLN A CB   1  
ATOM 409    C CG   . GLN A 1 28  ? 75.442  102.902 99.775  1.00 0.00 ? 32  GLN A CG   1  
ATOM 410    C CD   . GLN A 1 28  ? 76.448  102.040 100.490 1.00 0.00 ? 32  GLN A CD   1  
ATOM 411    O OE1  . GLN A 1 28  ? 76.381  101.873 101.706 1.00 0.00 ? 32  GLN A OE1  1  
ATOM 412    N NE2  . GLN A 1 28  ? 77.396  101.497 99.748  1.00 0.00 ? 32  GLN A NE2  1  
ATOM 413    H H    . GLN A 1 28  ? 71.580  102.769 100.972 1.00 0.00 ? 32  GLN A H    1  
ATOM 414    H HA   . GLN A 1 28  ? 73.203  102.043 98.852  1.00 0.00 ? 32  GLN A HA   1  
ATOM 415    H HB2  . GLN A 1 28  ? 73.750  103.798 100.488 1.00 0.00 ? 32  GLN A HB2  1  
ATOM 416    H HB3  . GLN A 1 28  ? 74.184  102.573 101.351 1.00 0.00 ? 32  GLN A HB3  1  
ATOM 417    H HG2  . GLN A 1 28  ? 75.357  102.600 98.857  1.00 0.00 ? 32  GLN A HG2  1  
ATOM 418    H HG3  . GLN A 1 28  ? 75.769  103.815 99.745  1.00 0.00 ? 32  GLN A HG3  1  
ATOM 419    H HE21 . GLN A 1 28  ? 77.411  101.636 98.900  1.00 0.00 ? 32  GLN A HE21 1  
ATOM 420    H HE22 . GLN A 1 28  ? 77.998  101.004 100.113 1.00 0.00 ? 32  GLN A HE22 1  
ATOM 421    N N    . THR A 1 29  ? 72.659  100.272 101.473 1.00 0.00 ? 33  THR A N    1  
ATOM 422    C CA   . THR A 1 29  ? 72.557  98.898  101.931 1.00 0.00 ? 33  THR A CA   1  
ATOM 423    C C    . THR A 1 29  ? 72.263  98.838  103.428 1.00 0.00 ? 33  THR A C    1  
ATOM 424    O O    . THR A 1 29  ? 72.500  99.783  104.198 1.00 0.00 ? 33  THR A O    1  
ATOM 425    C CB   . THR A 1 29  ? 73.833  98.115  101.625 1.00 0.00 ? 33  THR A CB   1  
ATOM 426    O OG1  . THR A 1 29  ? 73.543  96.713  101.668 1.00 0.00 ? 33  THR A OG1  1  
ATOM 427    C CG2  . THR A 1 29  ? 74.920  98.422  102.645 1.00 0.00 ? 33  THR A CG2  1  
ATOM 428    H H    . THR A 1 29  ? 72.594  100.863 102.095 1.00 0.00 ? 33  THR A H    1  
ATOM 429    H HA   . THR A 1 29  ? 71.819  98.490  101.450 1.00 0.00 ? 33  THR A HA   1  
ATOM 430    H HB   . THR A 1 29  ? 74.148  98.374  100.745 1.00 0.00 ? 33  THR A HB   1  
ATOM 431    H HG1  . THR A 1 29  ? 74.253  96.284  101.795 1.00 0.00 ? 33  THR A HG1  1  
ATOM 432    H HG21 . THR A 1 29  ? 75.872  98.498  102.476 1.00 0.00 ? 33  THR A HG21 1  
ATOM 433    H HG22 . THR A 1 29  ? 75.124  99.370  102.625 1.00 0.00 ? 33  THR A HG22 1  
ATOM 434    H HG23 . THR A 1 29  ? 74.610  98.176  103.531 1.00 0.00 ? 33  THR A HG23 1  
ATOM 435    N N    . ASP A 1 30  ? 71.738  97.689  103.830 1.00 0.00 ? 34  ASP A N    1  
ATOM 436    C CA   . ASP A 1 30  ? 71.090  97.531  105.113 1.00 0.00 ? 34  ASP A CA   1  
ATOM 437    C C    . ASP A 1 30  ? 71.612  96.256  105.748 1.00 0.00 ? 34  ASP A C    1  
ATOM 438    O O    . ASP A 1 30  ? 71.439  95.155  105.219 1.00 0.00 ? 34  ASP A O    1  
ATOM 439    C CB   . ASP A 1 30  ? 69.569  97.482  104.934 1.00 0.00 ? 34  ASP A CB   1  
ATOM 440    C CG   . ASP A 1 30  ? 68.816  98.058  106.116 1.00 0.00 ? 34  ASP A CG   1  
ATOM 441    O OD1  . ASP A 1 30  ? 68.592  97.327  107.103 1.00 0.00 ? 34  ASP A OD1  1  
ATOM 442    O OD2  . ASP A 1 30  ? 68.439  99.247  106.051 1.00 0.00 ? 34  ASP A OD2  1  
ATOM 443    H H    . ASP A 1 30  ? 71.751  96.972  103.355 1.00 0.00 ? 34  ASP A H    1  
ATOM 444    H HA   . ASP A 1 30  ? 71.287  98.284  105.691 1.00 0.00 ? 34  ASP A HA   1  
ATOM 445    H HB2  . ASP A 1 30  ? 69.326  97.971  104.134 1.00 0.00 ? 34  ASP A HB2  1  
ATOM 446    H HB3  . ASP A 1 30  ? 69.294  96.562  104.799 1.00 0.00 ? 34  ASP A HB3  1  
ATOM 447    N N    . GLY A 1 31  ? 72.265  96.411  106.888 1.00 0.00 ? 35  GLY A N    1  
ATOM 448    C CA   . GLY A 1 31  ? 72.628  95.271  107.690 1.00 0.00 ? 35  GLY A CA   1  
ATOM 449    C C    . GLY A 1 31  ? 71.878  95.259  108.996 1.00 0.00 ? 35  GLY A C    1  
ATOM 450    O O    . GLY A 1 31  ? 71.978  96.197  109.793 1.00 0.00 ? 35  GLY A O    1  
ATOM 451    H H    . GLY A 1 31  ? 72.506  97.171  107.210 1.00 0.00 ? 35  GLY A H    1  
ATOM 452    H HA2  . GLY A 1 31  ? 72.440  94.456  107.200 1.00 0.00 ? 35  GLY A HA2  1  
ATOM 453    H HA3  . GLY A 1 31  ? 73.582  95.285  107.863 1.00 0.00 ? 35  GLY A HA3  1  
ATOM 454    N N    . SER A 1 32  ? 71.126  94.191  109.229 1.00 0.00 ? 36  SER A N    1  
ATOM 455    C CA   . SER A 1 32  ? 70.455  93.959  110.501 1.00 0.00 ? 36  SER A CA   1  
ATOM 456    C C    . SER A 1 32  ? 71.109  92.712  111.073 1.00 0.00 ? 36  SER A C    1  
ATOM 457    O O    . SER A 1 32  ? 71.122  91.650  110.448 1.00 0.00 ? 36  SER A O    1  
ATOM 458    C CB   . SER A 1 32  ? 68.960  93.800  110.314 1.00 0.00 ? 36  SER A CB   1  
ATOM 459    O OG   . SER A 1 32  ? 68.416  94.943  109.680 1.00 0.00 ? 36  SER A OG   1  
ATOM 460    H H    . SER A 1 32  ? 70.989  93.574  108.646 1.00 0.00 ? 36  SER A H    1  
ATOM 461    H HA   . SER A 1 32  ? 70.549  94.709  111.109 1.00 0.00 ? 36  SER A HA   1  
ATOM 462    H HB2  . SER A 1 32  ? 68.777  93.010  109.782 1.00 0.00 ? 36  SER A HB2  1  
ATOM 463    H HB3  . SER A 1 32  ? 68.532  93.667  111.175 1.00 0.00 ? 36  SER A HB3  1  
ATOM 464    H HG   . SER A 1 32  ? 68.243  94.762  108.878 1.00 0.00 ? 36  SER A HG   1  
ATOM 465    N N    . VAL A 1 33  ? 71.651  92.846  112.276 1.00 0.00 ? 37  VAL A N    1  
ATOM 466    C CA   . VAL A 1 33  ? 72.435  91.785  112.894 1.00 0.00 ? 37  VAL A CA   1  
ATOM 467    C C    . VAL A 1 33  ? 71.834  91.488  114.266 1.00 0.00 ? 37  VAL A C    1  
ATOM 468    O O    . VAL A 1 33  ? 71.483  92.391  115.032 1.00 0.00 ? 37  VAL A O    1  
ATOM 469    C CB   . VAL A 1 33  ? 73.926  92.147  112.947 1.00 0.00 ? 37  VAL A CB   1  
ATOM 470    C CG1  . VAL A 1 33  ? 74.752  90.896  112.720 1.00 0.00 ? 37  VAL A CG1  1  
ATOM 471    C CG2  . VAL A 1 33  ? 74.309  93.115  111.847 1.00 0.00 ? 37  VAL A CG2  1  
ATOM 472    H H    . VAL A 1 33  ? 71.575  93.554  112.759 1.00 0.00 ? 37  VAL A H    1  
ATOM 473    H HA   . VAL A 1 33  ? 72.393  90.977  112.359 1.00 0.00 ? 37  VAL A HA   1  
ATOM 474    H HB   . VAL A 1 33  ? 74.091  92.549  113.815 1.00 0.00 ? 37  VAL A HB   1  
ATOM 475    H HG11 . VAL A 1 33  ? 74.691  90.633  111.789 1.00 0.00 ? 37  VAL A HG11 1  
ATOM 476    H HG12 . VAL A 1 33  ? 75.679  91.074  112.946 1.00 0.00 ? 37  VAL A HG12 1  
ATOM 477    H HG13 . VAL A 1 33  ? 74.415  90.179  113.281 1.00 0.00 ? 37  VAL A HG13 1  
ATOM 478    H HG21 . VAL A 1 33  ? 73.750  92.960  111.071 1.00 0.00 ? 37  VAL A HG21 1  
ATOM 479    H HG22 . VAL A 1 33  ? 74.185  94.026  112.159 1.00 0.00 ? 37  VAL A HG22 1  
ATOM 480    H HG23 . VAL A 1 33  ? 75.240  92.980  111.607 1.00 0.00 ? 37  VAL A HG23 1  
ATOM 481    N N    . SER A 1 34  ? 71.682  90.204  114.559 1.00 0.00 ? 38  SER A N    1  
ATOM 482    C CA   . SER A 1 34  ? 70.880  89.723  115.678 1.00 0.00 ? 38  SER A CA   1  
ATOM 483    C C    . SER A 1 34  ? 71.652  88.597  116.363 1.00 0.00 ? 38  SER A C    1  
ATOM 484    O O    . SER A 1 34  ? 71.789  87.501  115.820 1.00 0.00 ? 38  SER A O    1  
ATOM 485    C CB   . SER A 1 34  ? 69.515  89.250  115.184 1.00 0.00 ? 38  SER A CB   1  
ATOM 486    O OG   . SER A 1 34  ? 69.627  88.426  114.038 1.00 0.00 ? 38  SER A OG   1  
ATOM 487    H H    . SER A 1 34  ? 72.050  89.573  114.104 1.00 0.00 ? 38  SER A H    1  
ATOM 488    H HA   . SER A 1 34  ? 70.720  90.436  116.317 1.00 0.00 ? 38  SER A HA   1  
ATOM 489    H HB2  . SER A 1 34  ? 69.067  88.761  115.891 1.00 0.00 ? 38  SER A HB2  1  
ATOM 490    H HB3  . SER A 1 34  ? 68.962  90.019  114.976 1.00 0.00 ? 38  SER A HB3  1  
ATOM 491    H HG   . SER A 1 34  ? 69.594  88.902  113.346 1.00 0.00 ? 38  SER A HG   1  
ATOM 492    N N    . GLY A 1 35  ? 72.153  88.872  117.562 1.00 0.00 ? 39  GLY A N    1  
ATOM 493    C CA   . GLY A 1 35  ? 72.935  87.886  118.280 1.00 0.00 ? 39  GLY A CA   1  
ATOM 494    C C    . GLY A 1 35  ? 72.188  87.260  119.437 1.00 0.00 ? 39  GLY A C    1  
ATOM 495    O O    . GLY A 1 35  ? 71.752  87.959  120.355 1.00 0.00 ? 39  GLY A O    1  
ATOM 496    H H    . GLY A 1 35  ? 72.050  89.621  117.972 1.00 0.00 ? 39  GLY A H    1  
ATOM 497    H HA2  . GLY A 1 35  ? 73.210  87.189  117.664 1.00 0.00 ? 39  GLY A HA2  1  
ATOM 498    H HA3  . GLY A 1 35  ? 73.744  88.305  118.613 1.00 0.00 ? 39  GLY A HA3  1  
ATOM 499    N N    . GLU A 1 36  ? 72.034  85.939  119.406 1.00 0.00 ? 40  GLU A N    1  
ATOM 500    C CA   . GLU A 1 36  ? 71.319  85.201  120.442 1.00 0.00 ? 40  GLU A CA   1  
ATOM 501    C C    . GLU A 1 36  ? 72.354  84.564  121.360 1.00 0.00 ? 40  GLU A C    1  
ATOM 502    O O    . GLU A 1 36  ? 73.000  83.579  120.988 1.00 0.00 ? 40  GLU A O    1  
ATOM 503    C CB   . GLU A 1 36  ? 70.394  84.152  119.830 1.00 0.00 ? 40  GLU A CB   1  
ATOM 504    C CG   . GLU A 1 36  ? 69.759  83.219  120.843 1.00 0.00 ? 40  GLU A CG   1  
ATOM 505    C CD   . GLU A 1 36  ? 68.338  82.840  120.478 1.00 0.00 ? 40  GLU A CD   1  
ATOM 506    O OE1  . GLU A 1 36  ? 67.664  82.194  121.303 1.00 0.00 ? 40  GLU A OE1  1  
ATOM 507    O OE2  . GLU A 1 36  ? 67.898  83.177  119.358 1.00 0.00 ? 40  GLU A OE2  1  
ATOM 508    H H    . GLU A 1 36  ? 72.344  85.441  118.777 1.00 0.00 ? 40  GLU A H    1  
ATOM 509    H HA   . GLU A 1 36  ? 70.754  85.802  120.952 1.00 0.00 ? 40  GLU A HA   1  
ATOM 510    H HB2  . GLU A 1 36  ? 69.692  84.604  119.335 1.00 0.00 ? 40  GLU A HB2  1  
ATOM 511    H HB3  . GLU A 1 36  ? 70.898  83.625  119.189 1.00 0.00 ? 40  GLU A HB3  1  
ATOM 512    H HG2  . GLU A 1 36  ? 70.295  82.414  120.917 1.00 0.00 ? 40  GLU A HG2  1  
ATOM 513    H HG3  . GLU A 1 36  ? 69.762  83.643  121.715 1.00 0.00 ? 40  GLU A HG3  1  
ATOM 514    N N    . ARG A 1 37  ? 72.507  85.122  122.555 1.00 0.00 ? 41  ARG A N    1  
ATOM 515    C CA   . ARG A 1 37  ? 73.548  84.693  123.478 1.00 0.00 ? 41  ARG A CA   1  
ATOM 516    C C    . ARG A 1 37  ? 73.217  83.314  124.039 1.00 0.00 ? 41  ARG A C    1  
ATOM 517    O O    . ARG A 1 37  ? 72.059  82.983  124.306 1.00 0.00 ? 41  ARG A O    1  
ATOM 518    C CB   . ARG A 1 37  ? 73.720  85.725  124.583 1.00 0.00 ? 41  ARG A CB   1  
ATOM 519    C CG   . ARG A 1 37  ? 74.943  86.587  124.406 1.00 0.00 ? 41  ARG A CG   1  
ATOM 520    C CD   . ARG A 1 37  ? 76.183  85.819  124.782 1.00 0.00 ? 41  ARG A CD   1  
ATOM 521    N NE   . ARG A 1 37  ? 76.572  84.938  123.686 1.00 0.00 ? 41  ARG A NE   1  
ATOM 522    C CZ   . ARG A 1 37  ? 77.215  83.784  123.836 1.00 0.00 ? 41  ARG A CZ   1  
ATOM 523    N NH1  . ARG A 1 37  ? 77.551  83.358  125.045 1.00 0.00 ? 41  ARG A NH1  1  
ATOM 524    N NH2  . ARG A 1 37  ? 77.520  83.051  122.772 1.00 0.00 ? 41  ARG A NH2  1  
ATOM 525    H H    . ARG A 1 37  ? 72.011  85.759  122.852 1.00 0.00 ? 41  ARG A H    1  
ATOM 526    H HA   . ARG A 1 37  ? 74.391  84.623  123.005 1.00 0.00 ? 41  ARG A HA   1  
ATOM 527    H HB2  . ARG A 1 37  ? 72.933  86.292  124.613 1.00 0.00 ? 41  ARG A HB2  1  
ATOM 528    H HB3  . ARG A 1 37  ? 73.774  85.269  125.438 1.00 0.00 ? 41  ARG A HB3  1  
ATOM 529    H HG2  . ARG A 1 37  ? 75.005  86.885  123.486 1.00 0.00 ? 41  ARG A HG2  1  
ATOM 530    H HG3  . ARG A 1 37  ? 74.867  87.382  124.957 1.00 0.00 ? 41  ARG A HG3  1  
ATOM 531    H HD2  . ARG A 1 37  ? 76.905  86.435  124.985 1.00 0.00 ? 41  ARG A HD2  1  
ATOM 532    H HD3  . ARG A 1 37  ? 76.020  85.298  125.584 1.00 0.00 ? 41  ARG A HD3  1  
ATOM 533    H HE   . ARG A 1 37  ? 76.371  85.183  122.886 1.00 0.00 ? 41  ARG A HE   1  
ATOM 534    H HH11 . ARG A 1 37  ? 77.353  83.828  125.737 1.00 0.00 ? 41  ARG A HH11 1  
ATOM 535    H HH12 . ARG A 1 37  ? 77.966  82.611  125.137 1.00 0.00 ? 41  ARG A HH12 1  
ATOM 536    H HH21 . ARG A 1 37  ? 77.302  83.323  121.986 1.00 0.00 ? 41  ARG A HH21 1  
ATOM 537    H HH22 . ARG A 1 37  ? 77.936  82.305  122.870 1.00 0.00 ? 41  ARG A HH22 1  
ATOM 538    N N    . GLU A 1 38  ? 74.252  82.505  124.251 1.00 0.00 ? 42  GLU A N    1  
ATOM 539    C CA   . GLU A 1 38  ? 74.105  81.082  124.527 1.00 0.00 ? 42  GLU A CA   1  
ATOM 540    C C    . GLU A 1 38  ? 74.848  80.754  125.816 1.00 0.00 ? 42  GLU A C    1  
ATOM 541    O O    . GLU A 1 38  ? 75.511  81.608  126.409 1.00 0.00 ? 42  GLU A O    1  
ATOM 542    C CB   . GLU A 1 38  ? 74.627  80.262  123.349 1.00 0.00 ? 42  GLU A CB   1  
ATOM 543    C CG   . GLU A 1 38  ? 73.664  80.240  122.190 1.00 0.00 ? 42  GLU A CG   1  
ATOM 544    C CD   . GLU A 1 38  ? 73.862  79.040  121.305 1.00 0.00 ? 42  GLU A CD   1  
ATOM 545    O OE1  . GLU A 1 38  ? 73.708  79.177  120.073 1.00 0.00 ? 42  GLU A OE1  1  
ATOM 546    O OE2  . GLU A 1 38  ? 74.196  77.965  121.841 1.00 0.00 ? 42  GLU A OE2  1  
ATOM 547    H H    . GLU A 1 38  ? 75.069  82.773  124.238 1.00 0.00 ? 42  GLU A H    1  
ATOM 548    H HA   . GLU A 1 38  ? 73.168  80.856  124.643 1.00 0.00 ? 42  GLU A HA   1  
ATOM 549    H HB2  . GLU A 1 38  ? 75.475  80.629  123.054 1.00 0.00 ? 42  GLU A HB2  1  
ATOM 550    H HB3  . GLU A 1 38  ? 74.798  79.354  123.642 1.00 0.00 ? 42  GLU A HB3  1  
ATOM 551    H HG2  . GLU A 1 38  ? 72.755  80.243  122.528 1.00 0.00 ? 42  GLU A HG2  1  
ATOM 552    H HG3  . GLU A 1 38  ? 73.775  81.048  121.665 1.00 0.00 ? 42  GLU A HG3  1  
ATOM 553    N N    . LEU A 1 39  ? 74.724  79.501  126.245 1.00 0.00 ? 43  LEU A N    1  
ATOM 554    C CA   . LEU A 1 39  ? 75.346  79.012  127.465 1.00 0.00 ? 43  LEU A CA   1  
ATOM 555    C C    . LEU A 1 39  ? 76.863  79.034  127.336 1.00 0.00 ? 43  LEU A C    1  
ATOM 556    O O    . LEU A 1 39  ? 77.423  78.697  126.289 1.00 0.00 ? 43  LEU A O    1  
ATOM 557    C CB   . LEU A 1 39  ? 74.882  77.587  127.793 1.00 0.00 ? 43  LEU A CB   1  
ATOM 558    C CG   . LEU A 1 39  ? 74.268  77.297  129.164 1.00 0.00 ? 43  LEU A CG   1  
ATOM 559    C CD1  . LEU A 1 39  ? 75.233  77.682  130.271 1.00 0.00 ? 43  LEU A CD1  1  
ATOM 560    C CD2  . LEU A 1 39  ? 72.959  78.048  129.326 1.00 0.00 ? 43  LEU A CD2  1  
ATOM 561    H H    . LEU A 1 39  ? 74.268  78.904  125.827 1.00 0.00 ? 43  LEU A H    1  
ATOM 562    H HA   . LEU A 1 39  ? 75.076  79.601  128.188 1.00 0.00 ? 43  LEU A HA   1  
ATOM 563    H HB2  . LEU A 1 39  ? 74.230  77.330  127.121 1.00 0.00 ? 43  LEU A HB2  1  
ATOM 564    H HB3  . LEU A 1 39  ? 75.646  77.000  127.685 1.00 0.00 ? 43  LEU A HB3  1  
ATOM 565    H HG   . LEU A 1 39  ? 74.090  76.346  129.224 1.00 0.00 ? 43  LEU A HG   1  
ATOM 566    H HD11 . LEU A 1 39  ? 75.987  77.073  130.269 1.00 0.00 ? 43  LEU A HD11 1  
ATOM 567    H HD12 . LEU A 1 39  ? 75.548  78.588  130.126 1.00 0.00 ? 43  LEU A HD12 1  
ATOM 568    H HD13 . LEU A 1 39  ? 74.780  77.632  131.128 1.00 0.00 ? 43  LEU A HD13 1  
ATOM 569    H HD21 . LEU A 1 39  ? 72.333  77.758  128.644 1.00 0.00 ? 43  LEU A HD21 1  
ATOM 570    H HD22 . LEU A 1 39  ? 72.588  77.866  130.203 1.00 0.00 ? 43  LEU A HD22 1  
ATOM 571    H HD23 . LEU A 1 39  ? 73.119  79.000  129.235 1.00 0.00 ? 43  LEU A HD23 1  
ATOM 572    N N    . PHE A 1 40  ? 77.523  79.436  128.424 1.00 0.00 ? 44  PHE A N    1  
ATOM 573    C CA   . PHE A 1 40  ? 78.972  79.345  128.537 1.00 0.00 ? 44  PHE A CA   1  
ATOM 574    C C    . PHE A 1 40  ? 79.398  77.994  129.084 1.00 0.00 ? 44  PHE A C    1  
ATOM 575    O O    . PHE A 1 40  ? 78.900  77.555  130.123 1.00 0.00 ? 44  PHE A O    1  
ATOM 576    C CB   . PHE A 1 40  ? 79.555  80.443  129.434 1.00 0.00 ? 44  PHE A CB   1  
ATOM 577    C CG   . PHE A 1 40  ? 78.700  81.684  129.496 1.00 0.00 ? 44  PHE A CG   1  
ATOM 578    C CD1  . PHE A 1 40  ? 78.052  82.039  130.670 1.00 0.00 ? 44  PHE A CD1  1  
ATOM 579    C CD2  . PHE A 1 40  ? 78.551  82.500  128.384 1.00 0.00 ? 44  PHE A CD2  1  
ATOM 580    C CE1  . PHE A 1 40  ? 77.266  83.177  130.729 1.00 0.00 ? 44  PHE A CE1  1  
ATOM 581    C CE2  . PHE A 1 40  ? 77.771  83.639  128.440 1.00 0.00 ? 44  PHE A CE2  1  
ATOM 582    C CZ   . PHE A 1 40  ? 77.126  83.976  129.610 1.00 0.00 ? 44  PHE A CZ   1  
ATOM 583    H H    . PHE A 1 40  ? 77.137  79.770  129.117 1.00 0.00 ? 44  PHE A H    1  
ATOM 584    H HA   . PHE A 1 40  ? 79.319  79.460  127.639 1.00 0.00 ? 44  PHE A HA   1  
ATOM 585    H HB2  . PHE A 1 40  ? 79.669  80.092  130.332 1.00 0.00 ? 44  PHE A HB2  1  
ATOM 586    H HB3  . PHE A 1 40  ? 80.437  80.683  129.110 1.00 0.00 ? 44  PHE A HB3  1  
ATOM 587    H HD1  . PHE A 1 40  ? 78.147  81.506  131.427 1.00 0.00 ? 44  PHE A HD1  1  
ATOM 588    H HD2  . PHE A 1 40  ? 78.982  82.277  127.591 1.00 0.00 ? 44  PHE A HD2  1  
ATOM 589    H HE1  . PHE A 1 40  ? 76.833  83.403  131.519 1.00 0.00 ? 44  PHE A HE1  1  
ATOM 590    H HE2  . PHE A 1 40  ? 77.681  84.178  127.688 1.00 0.00 ? 44  PHE A HE2  1  
ATOM 591    H HZ   . PHE A 1 40  ? 76.598  84.740  129.647 1.00 0.00 ? 44  PHE A HZ   1  
ATOM 592    N N    . ASP A 1 41  ? 80.320  77.349  128.381 1.00 0.00 ? 45  ASP A N    1  
ATOM 593    C CA   . ASP A 1 41  ? 81.222  76.353  128.945 1.00 0.00 ? 45  ASP A CA   1  
ATOM 594    C C    . ASP A 1 41  ? 80.424  75.077  129.206 1.00 0.00 ? 45  ASP A C    1  
ATOM 595    O O    . ASP A 1 41  ? 79.571  75.022  130.096 1.00 0.00 ? 45  ASP A O    1  
ATOM 596    C CB   . ASP A 1 41  ? 81.899  76.850  130.230 1.00 0.00 ? 45  ASP A CB   1  
ATOM 597    C CG   . ASP A 1 41  ? 82.770  75.792  130.893 1.00 0.00 ? 45  ASP A CG   1  
ATOM 598    O OD1  . ASP A 1 41  ? 83.369  74.971  130.170 1.00 0.00 ? 45  ASP A OD1  1  
ATOM 599    O OD2  . ASP A 1 41  ? 82.822  75.758  132.140 1.00 0.00 ? 45  ASP A OD2  1  
ATOM 600    H H    . ASP A 1 41  ? 80.443  77.482  127.540 1.00 0.00 ? 45  ASP A H    1  
ATOM 601    H HA   . ASP A 1 41  ? 81.936  76.177  128.312 1.00 0.00 ? 45  ASP A HA   1  
ATOM 602    H HB2  . ASP A 1 41  ? 82.443  77.626  130.023 1.00 0.00 ? 45  ASP A HB2  1  
ATOM 603    H HB3  . ASP A 1 41  ? 81.219  77.140  130.857 1.00 0.00 ? 45  ASP A HB3  1  
ATOM 604    N N    . GLU A 1 42  ? 80.699  74.043  128.414 1.00 0.00 ? 46  GLU A N    1  
ATOM 605    C CA   . GLU A 1 42  ? 80.072  72.742  128.608 1.00 0.00 ? 46  GLU A CA   1  
ATOM 606    C C    . GLU A 1 42  ? 80.474  72.074  129.912 1.00 0.00 ? 46  GLU A C    1  
ATOM 607    O O    . GLU A 1 42  ? 79.666  71.334  130.485 1.00 0.00 ? 46  GLU A O    1  
ATOM 608    C CB   . GLU A 1 42  ? 80.412  71.800  127.449 1.00 0.00 ? 46  GLU A CB   1  
ATOM 609    C CG   . GLU A 1 42  ? 79.328  70.806  127.101 1.00 0.00 ? 46  GLU A CG   1  
ATOM 610    C CD   . GLU A 1 42  ? 79.862  69.543  126.465 1.00 0.00 ? 46  GLU A CD   1  
ATOM 611    O OE1  . GLU A 1 42  ? 81.091  69.432  126.284 1.00 0.00 ? 46  GLU A OE1  1  
ATOM 612    O OE2  . GLU A 1 42  ? 79.049  68.646  126.168 1.00 0.00 ? 46  GLU A OE2  1  
ATOM 613    H H    . GLU A 1 42  ? 81.250  74.077  127.754 1.00 0.00 ? 46  GLU A H    1  
ATOM 614    H HA   . GLU A 1 42  ? 79.117  72.910  128.642 1.00 0.00 ? 46  GLU A HA   1  
ATOM 615    H HB2  . GLU A 1 42  ? 80.610  72.333  126.663 1.00 0.00 ? 46  GLU A HB2  1  
ATOM 616    H HB3  . GLU A 1 42  ? 81.221  71.313  127.672 1.00 0.00 ? 46  GLU A HB3  1  
ATOM 617    H HG2  . GLU A 1 42  ? 78.838  70.575  127.905 1.00 0.00 ? 46  GLU A HG2  1  
ATOM 618    H HG3  . GLU A 1 42  ? 78.696  71.224  126.495 1.00 0.00 ? 46  GLU A HG3  1  
ATOM 619    N N    . GLN A 1 43  ? 81.723  72.298  130.355 1.00 0.00 ? 47  GLN A N    1  
ATOM 620    C CA   . GLN A 1 43  ? 82.359  71.626  131.501 1.00 0.00 ? 47  GLN A CA   1  
ATOM 621    C C    . GLN A 1 43  ? 82.683  70.163  131.190 1.00 0.00 ? 47  GLN A C    1  
ATOM 622    O O    . GLN A 1 43  ? 82.880  69.362  132.107 1.00 0.00 ? 47  GLN A O    1  
ATOM 623    C CB   . GLN A 1 43  ? 81.504  71.733  132.775 1.00 0.00 ? 47  GLN A CB   1  
ATOM 624    C CG   . GLN A 1 43  ? 80.992  73.138  133.086 1.00 0.00 ? 47  GLN A CG   1  
ATOM 625    C CD   . GLN A 1 43  ? 79.480  73.238  133.140 1.00 0.00 ? 47  GLN A CD   1  
ATOM 626    O OE1  . GLN A 1 43  ? 78.869  73.956  132.351 1.00 0.00 ? 47  GLN A OE1  1  
ATOM 627    N NE2  . GLN A 1 43  ? 78.870  72.513  134.069 1.00 0.00 ? 47  GLN A NE2  1  
ATOM 628    H H    . GLN A 1 43  ? 82.242  72.870  129.978 1.00 0.00 ? 47  GLN A H    1  
ATOM 629    H HA   . GLN A 1 43  ? 83.195  72.089  131.667 1.00 0.00 ? 47  GLN A HA   1  
ATOM 630    H HB2  . GLN A 1 43  ? 80.744  71.136  132.690 1.00 0.00 ? 47  GLN A HB2  1  
ATOM 631    H HB3  . GLN A 1 43  ? 82.029  71.419  133.529 1.00 0.00 ? 47  GLN A HB3  1  
ATOM 632    H HG2  . GLN A 1 43  ? 81.358  73.425  133.937 1.00 0.00 ? 47  GLN A HG2  1  
ATOM 633    H HG3  . GLN A 1 43  ? 81.325  73.751  132.412 1.00 0.00 ? 47  GLN A HG3  1  
ATOM 634    H HE21 . GLN A 1 43  ? 79.331  72.022  134.604 1.00 0.00 ? 47  GLN A HE21 1  
ATOM 635    H HE22 . GLN A 1 43  ? 78.012  72.534  134.136 1.00 0.00 ? 47  GLN A HE22 1  
ATOM 636    N N    . THR A 1 44  ? 82.801  69.844  129.892 1.00 0.00 ? 48  THR A N    1  
ATOM 637    C CA   . THR A 1 44  ? 82.788  68.480  129.345 1.00 0.00 ? 48  THR A CA   1  
ATOM 638    C C    . THR A 1 44  ? 81.715  67.616  130.011 1.00 0.00 ? 48  THR A C    1  
ATOM 639    O O    . THR A 1 44  ? 82.000  66.595  130.638 1.00 0.00 ? 48  THR A O    1  
ATOM 640    C CB   . THR A 1 44  ? 84.168  67.818  129.438 1.00 0.00 ? 48  THR A CB   1  
ATOM 641    O OG1  . THR A 1 44  ? 85.195  68.812  129.335 1.00 0.00 ? 48  THR A OG1  1  
ATOM 642    C CG2  . THR A 1 44  ? 84.346  66.797  128.324 1.00 0.00 ? 48  THR A CG2  1  
ATOM 643    H H    . THR A 1 44  ? 82.893  70.444  129.283 1.00 0.00 ? 48  THR A H    1  
ATOM 644    H HA   . THR A 1 44  ? 82.564  68.553  128.404 1.00 0.00 ? 48  THR A HA   1  
ATOM 645    H HB   . THR A 1 44  ? 84.235  67.368  130.294 1.00 0.00 ? 48  THR A HB   1  
ATOM 646    H HG1  . THR A 1 44  ? 85.145  69.336  129.989 1.00 0.00 ? 48  THR A HG1  1  
ATOM 647    H HG21 . THR A 1 44  ? 84.786  65.951  128.502 1.00 0.00 ? 48  THR A HG21 1  
ATOM 648    H HG22 . THR A 1 44  ? 83.663  66.112  128.400 1.00 0.00 ? 48  THR A HG22 1  
ATOM 649    H HG23 . THR A 1 44  ? 84.266  67.238  127.463 1.00 0.00 ? 48  THR A HG23 1  
ATOM 650    N N    . LYS A 1 45  ? 80.459  68.040  129.862 1.00 0.00 ? 49  LYS A N    1  
ATOM 651    C CA   . LYS A 1 45  ? 79.322  67.365  130.481 1.00 0.00 ? 49  LYS A CA   1  
ATOM 652    C C    . LYS A 1 45  ? 78.409  66.773  129.416 1.00 0.00 ? 49  LYS A C    1  
ATOM 653    O O    . LYS A 1 45  ? 78.866  66.025  128.545 1.00 0.00 ? 49  LYS A O    1  
ATOM 654    C CB   . LYS A 1 45  ? 78.519  68.320  131.370 1.00 0.00 ? 49  LYS A CB   1  
ATOM 655    C CG   . LYS A 1 45  ? 79.280  68.909  132.542 1.00 0.00 ? 49  LYS A CG   1  
ATOM 656    C CD   . LYS A 1 45  ? 79.076  68.092  133.797 1.00 0.00 ? 49  LYS A CD   1  
ATOM 657    C CE   . LYS A 1 45  ? 80.392  67.852  134.508 1.00 0.00 ? 49  LYS A CE   1  
ATOM 658    N NZ   . LYS A 1 45  ? 81.157  69.117  134.669 1.00 0.00 ? 49  LYS A NZ   1  
ATOM 659    H H    . LYS A 1 45  ? 80.244  68.731  129.396 1.00 0.00 ? 49  LYS A H    1  
ATOM 660    H HA   . LYS A 1 45  ? 79.674  66.652  131.036 1.00 0.00 ? 49  LYS A HA   1  
ATOM 661    H HB2  . LYS A 1 45  ? 78.188  69.047  130.821 1.00 0.00 ? 49  LYS A HB2  1  
ATOM 662    H HB3  . LYS A 1 45  ? 77.745  67.847  131.712 1.00 0.00 ? 49  LYS A HB3  1  
ATOM 663    H HG2  . LYS A 1 45  ? 80.225  68.947  132.329 1.00 0.00 ? 49  LYS A HG2  1  
ATOM 664    H HG3  . LYS A 1 45  ? 78.987  69.821  132.695 1.00 0.00 ? 49  LYS A HG3  1  
ATOM 665    H HD2  . LYS A 1 45  ? 78.463  68.553  134.391 1.00 0.00 ? 49  LYS A HD2  1  
ATOM 666    H HD3  . LYS A 1 45  ? 78.666  67.242  133.571 1.00 0.00 ? 49  LYS A HD3  1  
ATOM 667    H HE2  . LYS A 1 45  ? 80.226  67.460  135.379 1.00 0.00 ? 49  LYS A HE2  1  
ATOM 668    H HE3  . LYS A 1 45  ? 80.922  67.214  134.006 1.00 0.00 ? 49  LYS A HE3  1  
ATOM 669    H HZ1  . LYS A 1 45  ? 81.141  69.573  133.906 1.00 0.00 ? 49  LYS A HZ1  1  
ATOM 670    H HZ2  . LYS A 1 45  ? 80.789  69.607  135.315 1.00 0.00 ? 49  LYS A HZ2  1  
ATOM 671    H HZ3  . LYS A 1 45  ? 82.000  68.929  134.884 1.00 0.00 ? 49  LYS A HZ3  1  
ATOM 672    N N    . ASN A 1 46  ? 77.112  67.092  129.490 1.00 0.00 ? 50  ASN A N    1  
ATOM 673    C CA   . ASN A 1 46  ? 76.148  66.627  128.495 1.00 0.00 ? 50  ASN A CA   1  
ATOM 674    C C    . ASN A 1 46  ? 75.724  67.727  127.529 1.00 0.00 ? 50  ASN A C    1  
ATOM 675    O O    . ASN A 1 46  ? 74.737  67.556  126.807 1.00 0.00 ? 50  ASN A O    1  
ATOM 676    C CB   . ASN A 1 46  ? 74.906  66.050  129.188 1.00 0.00 ? 50  ASN A CB   1  
ATOM 677    C CG   . ASN A 1 46  ? 74.221  64.972  128.369 1.00 0.00 ? 50  ASN A CG   1  
ATOM 678    O OD1  . ASN A 1 46  ? 73.322  65.256  127.580 1.00 0.00 ? 50  ASN A OD1  1  
ATOM 679    N ND2  . ASN A 1 46  ? 74.637  63.726  128.562 1.00 0.00 ? 50  ASN A ND2  1  
ATOM 680    H H    . ASN A 1 46  ? 76.773  67.579  130.112 1.00 0.00 ? 50  ASN A H    1  
ATOM 681    H HA   . ASN A 1 46  ? 76.591  65.937  127.978 1.00 0.00 ? 50  ASN A HA   1  
ATOM 682    H HB2  . ASN A 1 46  ? 75.162  65.683  130.048 1.00 0.00 ? 50  ASN A HB2  1  
ATOM 683    H HB3  . ASN A 1 46  ? 74.276  66.767  129.363 1.00 0.00 ? 50  ASN A HB3  1  
ATOM 684    H HD21 . ASN A 1 46  ? 74.274  63.079  128.127 1.00 0.00 ? 50  ASN A HD21 1  
ATOM 685    H HD22 . ASN A 1 46  ? 75.268  63.567  129.123 1.00 0.00 ? 50  ASN A HD22 1  
ATOM 686    N N    . GLY A 1 47  ? 76.439  68.846  127.496 1.00 0.00 ? 51  GLY A N    1  
ATOM 687    C CA   . GLY A 1 47  ? 76.096  69.949  126.616 1.00 0.00 ? 51  GLY A CA   1  
ATOM 688    C C    . GLY A 1 47  ? 75.542  71.119  127.401 1.00 0.00 ? 51  GLY A C    1  
ATOM 689    O O    . GLY A 1 47  ? 74.329  71.324  127.488 1.00 0.00 ? 51  GLY A O    1  
ATOM 690    H H    . GLY A 1 47  ? 77.135  68.984  127.982 1.00 0.00 ? 51  GLY A H    1  
ATOM 691    H HA2  . GLY A 1 47  ? 76.882  70.229  126.122 1.00 0.00 ? 51  GLY A HA2  1  
ATOM 692    H HA3  . GLY A 1 47  ? 75.442  69.655  125.963 1.00 0.00 ? 51  GLY A HA3  1  
ATOM 693    N N    . ARG A 1 48  ? 76.447  71.904  127.982 1.00 0.00 ? 52  ARG A N    1  
ATOM 694    C CA   . ARG A 1 48  ? 76.059  73.058  128.782 1.00 0.00 ? 52  ARG A CA   1  
ATOM 695    C C    . ARG A 1 48  ? 76.457  74.308  128.003 1.00 0.00 ? 52  ARG A C    1  
ATOM 696    O O    . ARG A 1 48  ? 76.704  75.375  128.572 1.00 0.00 ? 52  ARG A O    1  
ATOM 697    C CB   . ARG A 1 48  ? 76.706  73.004  130.173 1.00 0.00 ? 52  ARG A CB   1  
ATOM 698    C CG   . ARG A 1 48  ? 76.756  71.610  130.823 1.00 0.00 ? 52  ARG A CG   1  
ATOM 699    C CD   . ARG A 1 48  ? 75.642  71.380  131.842 1.00 0.00 ? 52  ARG A CD   1  
ATOM 700    N NE   . ARG A 1 48  ? 74.317  71.631  131.280 1.00 0.00 ? 52  ARG A NE   1  
ATOM 701    C CZ   . ARG A 1 48  ? 73.612  70.729  130.600 1.00 0.00 ? 52  ARG A CZ   1  
ATOM 702    N NH1  . ARG A 1 48  ? 74.101  69.515  130.396 1.00 0.00 ? 52  ARG A NH1  1  
ATOM 703    N NH2  . ARG A 1 48  ? 72.415  71.043  130.123 1.00 0.00 ? 52  ARG A NH2  1  
ATOM 704    H H    . ARG A 1 48  ? 77.296  71.783  127.923 1.00 0.00 ? 52  ARG A H    1  
ATOM 705    H HA   . ARG A 1 48  ? 75.101  73.066  128.936 1.00 0.00 ? 52  ARG A HA   1  
ATOM 706    H HB2  . ARG A 1 48  ? 77.611  73.345  130.104 1.00 0.00 ? 52  ARG A HB2  1  
ATOM 707    H HB3  . ARG A 1 48  ? 76.220  73.602  130.762 1.00 0.00 ? 52  ARG A HB3  1  
ATOM 708    H HG2  . ARG A 1 48  ? 76.696  70.934  130.130 1.00 0.00 ? 52  ARG A HG2  1  
ATOM 709    H HG3  . ARG A 1 48  ? 77.615  71.495  131.260 1.00 0.00 ? 52  ARG A HG3  1  
ATOM 710    H HD2  . ARG A 1 48  ? 75.687  70.467  132.166 1.00 0.00 ? 52  ARG A HD2  1  
ATOM 711    H HD3  . ARG A 1 48  ? 75.782  71.959  132.608 1.00 0.00 ? 52  ARG A HD3  1  
ATOM 712    H HE   . ARG A 1 48  ? 73.972  72.409  131.396 1.00 0.00 ? 52  ARG A HE   1  
ATOM 713    H HH11 . ARG A 1 48  ? 74.877  69.306  130.703 1.00 0.00 ? 52  ARG A HH11 1  
ATOM 714    H HH12 . ARG A 1 48  ? 73.643  68.934  129.957 1.00 0.00 ? 52  ARG A HH12 1  
ATOM 715    H HH21 . ARG A 1 48  ? 72.093  71.829  130.252 1.00 0.00 ? 52  ARG A HH21 1  
ATOM 716    H HH22 . ARG A 1 48  ? 71.962  70.459  129.684 1.00 0.00 ? 52  ARG A HH22 1  
ATOM 717    N N    . ILE A 1 49  ? 76.577  74.163  126.684 1.00 0.00 ? 53  ILE A N    1  
ATOM 718    C CA   . ILE A 1 49  ? 76.917  75.279  125.807 1.00 0.00 ? 53  ILE A CA   1  
ATOM 719    C C    . ILE A 1 49  ? 75.849  75.436  124.730 1.00 0.00 ? 53  ILE A C    1  
ATOM 720    O O    . ILE A 1 49  ? 75.978  76.276  123.833 1.00 0.00 ? 53  ILE A O    1  
ATOM 721    C CB   . ILE A 1 49  ? 78.310  75.100  125.176 1.00 0.00 ? 53  ILE A CB   1  
ATOM 722    C CG1  . ILE A 1 49  ? 78.686  73.618  125.090 1.00 0.00 ? 53  ILE A CG1  1  
ATOM 723    C CG2  . ILE A 1 49  ? 79.353  75.869  125.969 1.00 0.00 ? 53  ILE A CG2  1  
ATOM 724    C CD1  . ILE A 1 49  ? 79.938  73.317  124.268 1.00 0.00 ? 53  ILE A CD1  1  
ATOM 725    H H    . ILE A 1 49  ? 76.464  73.416  126.274 1.00 0.00 ? 53  ILE A H    1  
ATOM 726    H HA   . ILE A 1 49  ? 76.947  76.088  126.343 1.00 0.00 ? 53  ILE A HA   1  
ATOM 727    H HB   . ILE A 1 49  ? 78.281  75.455  124.273 1.00 0.00 ? 53  ILE A HB   1  
ATOM 728    H HG12 . ILE A 1 49  ? 78.816  73.279  125.989 1.00 0.00 ? 53  ILE A HG12 1  
ATOM 729    H HG13 . ILE A 1 49  ? 77.940  73.130  124.707 1.00 0.00 ? 53  ILE A HG13 1  
ATOM 730    H HG21 . ILE A 1 49  ? 78.919  76.571  126.477 1.00 0.00 ? 53  ILE A HG21 1  
ATOM 731    H HG22 . ILE A 1 49  ? 79.808  75.264  126.576 1.00 0.00 ? 53  ILE A HG22 1  
ATOM 732    H HG23 . ILE A 1 49  ? 79.998  76.262  125.361 1.00 0.00 ? 53  ILE A HG23 1  
ATOM 733    H HD11 . ILE A 1 49  ? 80.667  73.080  124.862 1.00 0.00 ? 53  ILE A HD11 1  
ATOM 734    H HD12 . ILE A 1 49  ? 79.760  72.578  123.665 1.00 0.00 ? 53  ILE A HD12 1  
ATOM 735    H HD13 . ILE A 1 49  ? 80.184  74.102  123.753 1.00 0.00 ? 53  ILE A HD13 1  
ATOM 736    N N    . LEU A 1 50  ? 74.794  74.621  124.808 1.00 0.00 ? 54  LEU A N    1  
ATOM 737    C CA   . LEU A 1 50  ? 73.669  74.728  123.887 1.00 0.00 ? 54  LEU A CA   1  
ATOM 738    C C    . LEU A 1 50  ? 72.451  75.369  124.541 1.00 0.00 ? 54  LEU A C    1  
ATOM 739    O O    . LEU A 1 50  ? 71.329  75.161  124.068 1.00 0.00 ? 54  LEU A O    1  
ATOM 740    C CB   . LEU A 1 50  ? 73.270  73.343  123.359 1.00 0.00 ? 54  LEU A CB   1  
ATOM 741    C CG   . LEU A 1 50  ? 73.316  72.942  121.876 1.00 0.00 ? 54  LEU A CG   1  
ATOM 742    C CD1  . LEU A 1 50  ? 71.923  72.749  121.299 1.00 0.00 ? 54  LEU A CD1  1  
ATOM 743    C CD2  . LEU A 1 50  ? 74.085  73.968  121.052 1.00 0.00 ? 54  LEU A CD2  1  
ATOM 744    H H    . LEU A 1 50  ? 74.714  73.997  125.394 1.00 0.00 ? 54  LEU A H    1  
ATOM 745    H HA   . LEU A 1 50  ? 73.962  75.294  123.155 1.00 0.00 ? 54  LEU A HA   1  
ATOM 746    H HB2  . LEU A 1 50  ? 73.827  72.703  123.830 1.00 0.00 ? 54  LEU A HB2  1  
ATOM 747    H HB3  . LEU A 1 50  ? 72.357  73.194  123.651 1.00 0.00 ? 54  LEU A HB3  1  
ATOM 748    H HG   . LEU A 1 50  ? 73.782  72.092  121.829 1.00 0.00 ? 54  LEU A HG   1  
ATOM 749    H HD11 . LEU A 1 50  ? 71.863  71.875  120.883 1.00 0.00 ? 54  LEU A HD11 1  
ATOM 750    H HD12 . LEU A 1 50  ? 71.266  72.815  122.009 1.00 0.00 ? 54  LEU A HD12 1  
ATOM 751    H HD13 . LEU A 1 50  ? 71.750  73.435  120.635 1.00 0.00 ? 54  LEU A HD13 1  
ATOM 752    H HD21 . LEU A 1 50  ? 74.477  73.534  120.278 1.00 0.00 ? 54  LEU A HD21 1  
ATOM 753    H HD22 . LEU A 1 50  ? 73.480  74.667  120.758 1.00 0.00 ? 54  LEU A HD22 1  
ATOM 754    H HD23 . LEU A 1 50  ? 74.789  74.358  121.594 1.00 0.00 ? 54  LEU A HD23 1  
ATOM 755    N N    . GLY A 1 51  ? 72.657  76.139  125.611 1.00 0.00 ? 55  GLY A N    1  
ATOM 756    C CA   . GLY A 1 51  ? 71.587  76.634  126.442 1.00 0.00 ? 55  GLY A CA   1  
ATOM 757    C C    . GLY A 1 51  ? 71.107  78.019  126.067 1.00 0.00 ? 55  GLY A C    1  
ATOM 758    O O    . GLY A 1 51  ? 71.797  78.779  125.383 1.00 0.00 ? 55  GLY A O    1  
ATOM 759    H H    . GLY A 1 51  ? 73.439  76.387  125.869 1.00 0.00 ? 55  GLY A H    1  
ATOM 760    H HA2  . GLY A 1 51  ? 70.839  76.018  126.392 1.00 0.00 ? 55  GLY A HA2  1  
ATOM 761    H HA3  . GLY A 1 51  ? 71.884  76.644  127.366 1.00 0.00 ? 55  GLY A HA3  1  
ATOM 762    N N    . PRO A 1 52  ? 69.903  78.374  126.516 1.00 0.00 ? 56  PRO A N    1  
ATOM 763    C CA   . PRO A 1 52  ? 69.317  79.657  126.116 1.00 0.00 ? 56  PRO A CA   1  
ATOM 764    C C    . PRO A 1 52  ? 69.959  80.857  126.783 1.00 0.00 ? 56  PRO A C    1  
ATOM 765    O O    . PRO A 1 52  ? 70.545  80.754  127.865 1.00 0.00 ? 56  PRO A O    1  
ATOM 766    C CB   . PRO A 1 52  ? 67.835  79.484  126.466 1.00 0.00 ? 56  PRO A CB   1  
ATOM 767    C CG   . PRO A 1 52  ? 67.836  78.520  127.585 1.00 0.00 ? 56  PRO A CG   1  
ATOM 768    C CD   . PRO A 1 52  ? 68.965  77.566  127.313 1.00 0.00 ? 56  PRO A CD   1  
ATOM 769    H HA   . PRO A 1 52  ? 69.445  79.826  125.170 1.00 0.00 ? 56  PRO A HA   1  
ATOM 770    H HB2  . PRO A 1 52  ? 67.431  80.327  126.725 1.00 0.00 ? 56  PRO A HB2  1  
ATOM 771    H HB3  . PRO A 1 52  ? 67.330  79.148  125.709 1.00 0.00 ? 56  PRO A HB3  1  
ATOM 772    H HG2  . PRO A 1 52  ? 67.962  78.974  128.433 1.00 0.00 ? 56  PRO A HG2  1  
ATOM 773    H HG3  . PRO A 1 52  ? 66.990  78.049  127.638 1.00 0.00 ? 56  PRO A HG3  1  
ATOM 774    H HD2  . PRO A 1 52  ? 69.373  77.251  128.134 1.00 0.00 ? 56  PRO A HD2  1  
ATOM 775    H HD3  . PRO A 1 52  ? 68.664  76.783  126.827 1.00 0.00 ? 56  PRO A HD3  1  
ATOM 776    N N    . GLY A 1 53  ? 69.842  82.008  126.130 1.00 0.00 ? 57  GLY A N    1  
ATOM 777    C CA   . GLY A 1 53  ? 70.409  83.244  126.634 1.00 0.00 ? 57  GLY A CA   1  
ATOM 778    C C    . GLY A 1 53  ? 69.673  84.418  126.035 1.00 0.00 ? 57  GLY A C    1  
ATOM 779    O O    . GLY A 1 53  ? 68.698  84.260  125.297 1.00 0.00 ? 57  GLY A O    1  
ATOM 780    H H    . GLY A 1 53  ? 69.429  82.091  125.380 1.00 0.00 ? 57  GLY A H    1  
ATOM 781    H HA2  . GLY A 1 53  ? 70.345  83.269  127.602 1.00 0.00 ? 57  GLY A HA2  1  
ATOM 782    H HA3  . GLY A 1 53  ? 71.351  83.293  126.411 1.00 0.00 ? 57  GLY A HA3  1  
ATOM 783    N N    . SER A 1 54  ? 70.151  85.612  126.372 1.00 0.00 ? 58  SER A N    1  
ATOM 784    C CA   . SER A 1 54  ? 69.542  86.829  125.859 1.00 0.00 ? 58  SER A CA   1  
ATOM 785    C C    . SER A 1 54  ? 69.956  87.064  124.409 1.00 0.00 ? 58  SER A C    1  
ATOM 786    O O    . SER A 1 54  ? 70.808  86.361  123.860 1.00 0.00 ? 58  SER A O    1  
ATOM 787    C CB   . SER A 1 54  ? 69.938  88.026  126.721 1.00 0.00 ? 58  SER A CB   1  
ATOM 788    O OG   . SER A 1 54  ? 68.848  88.911  126.897 1.00 0.00 ? 58  SER A OG   1  
ATOM 789    H H    . SER A 1 54  ? 70.823  85.736  126.894 1.00 0.00 ? 58  SER A H    1  
ATOM 790    H HA   . SER A 1 54  ? 68.579  86.727  125.892 1.00 0.00 ? 58  SER A HA   1  
ATOM 791    H HB2  . SER A 1 54  ? 70.250  87.716  127.586 1.00 0.00 ? 58  SER A HB2  1  
ATOM 792    H HB3  . SER A 1 54  ? 70.677  88.497  126.306 1.00 0.00 ? 58  SER A HB3  1  
ATOM 793    H HG   . SER A 1 54  ? 69.060  89.675  126.620 1.00 0.00 ? 58  SER A HG   1  
ATOM 794    N N    . VAL A 1 55  ? 69.335  88.060  123.789 1.00 0.00 ? 59  VAL A N    1  
ATOM 795    C CA   . VAL A 1 55  ? 69.571  88.386  122.389 1.00 0.00 ? 59  VAL A CA   1  
ATOM 796    C C    . VAL A 1 55  ? 70.004  89.847  122.284 1.00 0.00 ? 59  VAL A C    1  
ATOM 797    O O    . VAL A 1 55  ? 69.381  90.744  122.866 1.00 0.00 ? 59  VAL A O    1  
ATOM 798    C CB   . VAL A 1 55  ? 68.344  88.059  121.513 1.00 0.00 ? 59  VAL A CB   1  
ATOM 799    C CG1  . VAL A 1 55  ? 68.291  88.900  120.229 1.00 0.00 ? 59  VAL A CG1  1  
ATOM 800    C CG2  . VAL A 1 55  ? 68.310  86.574  121.174 1.00 0.00 ? 59  VAL A CG2  1  
ATOM 801    H H    . VAL A 1 55  ? 68.759  88.570  124.173 1.00 0.00 ? 59  VAL A H    1  
ATOM 802    H HA   . VAL A 1 55  ? 70.288  87.833  122.042 1.00 0.00 ? 59  VAL A HA   1  
ATOM 803    H HB   . VAL A 1 55  ? 67.559  88.288  122.034 1.00 0.00 ? 59  VAL A HB   1  
ATOM 804    H HG11 . VAL A 1 55  ? 69.175  89.250  120.035 1.00 0.00 ? 59  VAL A HG11 1  
ATOM 805    H HG12 . VAL A 1 55  ? 67.994  88.346  119.491 1.00 0.00 ? 59  VAL A HG12 1  
ATOM 806    H HG13 . VAL A 1 55  ? 67.671  89.637  120.350 1.00 0.00 ? 59  VAL A HG13 1  
ATOM 807    H HG21 . VAL A 1 55  ? 68.741  86.428  120.319 1.00 0.00 ? 59  VAL A HG21 1  
ATOM 808    H HG22 . VAL A 1 55  ? 68.778  86.075  121.861 1.00 0.00 ? 59  VAL A HG22 1  
ATOM 809    H HG23 . VAL A 1 55  ? 67.389  86.274  121.128 1.00 0.00 ? 59  VAL A HG23 1  
ATOM 810    N N    . ALA A 1 56  ? 71.115  90.075  121.592 1.00 0.00 ? 60  ALA A N    1  
ATOM 811    C CA   . ALA A 1 56  ? 71.607  91.413  121.299 1.00 0.00 ? 60  ALA A CA   1  
ATOM 812    C C    . ALA A 1 56  ? 71.305  91.709  119.842 1.00 0.00 ? 60  ALA A C    1  
ATOM 813    O O    . ALA A 1 56  ? 71.845  91.054  118.946 1.00 0.00 ? 60  ALA A O    1  
ATOM 814    C CB   . ALA A 1 56  ? 73.104  91.535  121.581 1.00 0.00 ? 60  ALA A CB   1  
ATOM 815    H H    . ALA A 1 56  ? 71.610  89.446  121.275 1.00 0.00 ? 60  ALA A H    1  
ATOM 816    H HA   . ALA A 1 56  ? 71.165  92.057  121.874 1.00 0.00 ? 60  ALA A HA   1  
ATOM 817    H HB1  . ALA A 1 56  ? 73.239  92.015  122.414 1.00 0.00 ? 60  ALA A HB1  1  
ATOM 818    H HB2  . ALA A 1 56  ? 73.494  90.649  121.653 1.00 0.00 ? 60  ALA A HB2  1  
ATOM 819    H HB3  . ALA A 1 56  ? 73.531  92.019  120.857 1.00 0.00 ? 60  ALA A HB3  1  
ATOM 820    N N    . ASP A 1 57  ? 70.442  92.689  119.606 1.00 0.00 ? 61  ASP A N    1  
ATOM 821    C CA   . ASP A 1 57  ? 69.924  92.967  118.276 1.00 0.00 ? 61  ASP A CA   1  
ATOM 822    C C    . ASP A 1 57  ? 70.300  94.390  117.900 1.00 0.00 ? 61  ASP A C    1  
ATOM 823    O O    . ASP A 1 57  ? 69.876  95.353  118.556 1.00 0.00 ? 61  ASP A O    1  
ATOM 824    C CB   . ASP A 1 57  ? 68.411  92.746  118.235 1.00 0.00 ? 61  ASP A CB   1  
ATOM 825    C CG   . ASP A 1 57  ? 67.981  91.716  117.200 1.00 0.00 ? 61  ASP A CG   1  
ATOM 826    O OD1  . ASP A 1 57  ? 67.694  90.554  117.544 1.00 0.00 ? 61  ASP A OD1  1  
ATOM 827    O OD2  . ASP A 1 57  ? 67.899  92.092  116.014 1.00 0.00 ? 61  ASP A OD2  1  
ATOM 828    H H    . ASP A 1 57  ? 70.140  93.213  120.216 1.00 0.00 ? 61  ASP A H    1  
ATOM 829    H HA   . ASP A 1 57  ? 70.316  92.359  117.630 1.00 0.00 ? 61  ASP A HA   1  
ATOM 830    H HB2  . ASP A 1 57  ? 68.108  92.461  119.111 1.00 0.00 ? 61  ASP A HB2  1  
ATOM 831    H HB3  . ASP A 1 57  ? 67.973  93.590  118.044 1.00 0.00 ? 61  ASP A HB3  1  
ATOM 832    N N    . SER A 1 58  ? 71.094  94.510  116.842 1.00 0.00 ? 62  SER A N    1  
ATOM 833    C CA   . SER A 1 58  ? 71.598  95.777  116.347 1.00 0.00 ? 62  SER A CA   1  
ATOM 834    C C    . SER A 1 58  ? 71.647  95.760  114.828 1.00 0.00 ? 62  SER A C    1  
ATOM 835    O O    . SER A 1 58  ? 71.897  94.727  114.200 1.00 0.00 ? 62  SER A O    1  
ATOM 836    C CB   . SER A 1 58  ? 72.994  96.061  116.907 1.00 0.00 ? 62  SER A CB   1  
ATOM 837    O OG   . SER A 1 58  ? 73.958  95.215  116.313 1.00 0.00 ? 62  SER A OG   1  
ATOM 838    H H    . SER A 1 58  ? 71.361  93.834  116.383 1.00 0.00 ? 62  SER A H    1  
ATOM 839    H HA   . SER A 1 58  ? 70.998  96.480  116.640 1.00 0.00 ? 62  SER A HA   1  
ATOM 840    H HB2  . SER A 1 58  ? 73.228  96.989  116.746 1.00 0.00 ? 62  SER A HB2  1  
ATOM 841    H HB3  . SER A 1 58  ? 72.993  95.932  117.869 1.00 0.00 ? 62  SER A HB3  1  
ATOM 842    H HG   . SER A 1 58  ? 73.741  95.057  115.517 1.00 0.00 ? 62  SER A HG   1  
ATOM 843    N N    . GLY A 1 59  ? 71.405  96.925  114.242 1.00 0.00 ? 63  GLY A N    1  
ATOM 844    C CA   . GLY A 1 59  ? 71.496  97.075  112.809 1.00 0.00 ? 63  GLY A CA   1  
ATOM 845    C C    . GLY A 1 59  ? 72.150  98.378  112.413 1.00 0.00 ? 63  GLY A C    1  
ATOM 846    O O    . GLY A 1 59  ? 72.147  99.342  113.184 1.00 0.00 ? 63  GLY A O    1  
ATOM 847    H H    . GLY A 1 59  ? 71.184  97.641  114.665 1.00 0.00 ? 63  GLY A H    1  
ATOM 848    H HA2  . GLY A 1 59  ? 72.004  96.336  112.440 1.00 0.00 ? 63  GLY A HA2  1  
ATOM 849    H HA3  . GLY A 1 59  ? 70.608  97.031  112.423 1.00 0.00 ? 63  GLY A HA3  1  
ATOM 850    N N    . GLU A 1 60  ? 72.721  98.421  111.218 1.00 0.00 ? 64  GLU A N    1  
ATOM 851    C CA   . GLU A 1 60  ? 73.290  99.647  110.668 1.00 0.00 ? 64  GLU A CA   1  
ATOM 852    C C    . GLU A 1 60  ? 72.582  99.928  109.353 1.00 0.00 ? 64  GLU A C    1  
ATOM 853    O O    . GLU A 1 60  ? 72.125  99.007  108.671 1.00 0.00 ? 64  GLU A O    1  
ATOM 854    C CB   . GLU A 1 60  ? 74.797  99.519  110.481 1.00 0.00 ? 64  GLU A CB   1  
ATOM 855    C CG   . GLU A 1 60  ? 75.201  98.482  109.453 1.00 0.00 ? 64  GLU A CG   1  
ATOM 856    C CD   . GLU A 1 60  ? 75.607  99.105  108.128 1.00 0.00 ? 64  GLU A CD   1  
ATOM 857    O OE1  . GLU A 1 60  ? 76.632  99.816  108.091 1.00 0.00 ? 64  GLU A OE1  1  
ATOM 858    O OE2  . GLU A 1 60  ? 74.903  98.882  107.122 1.00 0.00 ? 64  GLU A OE2  1  
ATOM 859    H H    . GLU A 1 60  ? 72.790  97.740  110.699 1.00 0.00 ? 64  GLU A H    1  
ATOM 860    H HA   . GLU A 1 60  ? 73.156  100.388 111.280 1.00 0.00 ? 64  GLU A HA   1  
ATOM 861    H HB2  . GLU A 1 60  ? 75.156  100.381 110.218 1.00 0.00 ? 64  GLU A HB2  1  
ATOM 862    H HB3  . GLU A 1 60  ? 75.201  99.292  111.333 1.00 0.00 ? 64  GLU A HB3  1  
ATOM 863    H HG2  . GLU A 1 60  ? 75.939  97.957  109.799 1.00 0.00 ? 64  GLU A HG2  1  
ATOM 864    H HG3  . GLU A 1 60  ? 74.463  97.870  109.307 1.00 0.00 ? 64  GLU A HG3  1  
ATOM 865    N N    . VAL A 1 61  ? 72.491  101.203 108.994 1.00 0.00 ? 65  VAL A N    1  
ATOM 866    C CA   . VAL A 1 61  ? 71.800  101.623 107.783 1.00 0.00 ? 65  VAL A CA   1  
ATOM 867    C C    . VAL A 1 61  ? 72.686  102.608 107.042 1.00 0.00 ? 65  VAL A C    1  
ATOM 868    O O    . VAL A 1 61  ? 73.096  103.627 107.608 1.00 0.00 ? 65  VAL A O    1  
ATOM 869    C CB   . VAL A 1 61  ? 70.436  102.250 108.112 1.00 0.00 ? 65  VAL A CB   1  
ATOM 870    C CG1  . VAL A 1 61  ? 69.690  102.604 106.841 1.00 0.00 ? 65  VAL A CG1  1  
ATOM 871    C CG2  . VAL A 1 61  ? 69.627  101.311 108.977 1.00 0.00 ? 65  VAL A CG2  1  
ATOM 872    H H    . VAL A 1 61  ? 72.830  101.850 109.447 1.00 0.00 ? 65  VAL A H    1  
ATOM 873    H HA   . VAL A 1 61  ? 71.629  100.851 107.222 1.00 0.00 ? 65  VAL A HA   1  
ATOM 874    H HB   . VAL A 1 61  ? 70.581  103.071 108.609 1.00 0.00 ? 65  VAL A HB   1  
ATOM 875    H HG11 . VAL A 1 61  ? 69.518  101.796 106.331 1.00 0.00 ? 65  VAL A HG11 1  
ATOM 876    H HG12 . VAL A 1 61  ? 68.848  103.029 107.066 1.00 0.00 ? 65  VAL A HG12 1  
ATOM 877    H HG13 . VAL A 1 61  ? 70.226  103.212 106.310 1.00 0.00 ? 65  VAL A HG13 1  
ATOM 878    H HG21 . VAL A 1 61  ? 70.144  100.511 109.156 1.00 0.00 ? 65  VAL A HG21 1  
ATOM 879    H HG22 . VAL A 1 61  ? 69.408  101.749 109.814 1.00 0.00 ? 65  VAL A HG22 1  
ATOM 880    H HG23 . VAL A 1 61  ? 68.809  101.070 108.514 1.00 0.00 ? 65  VAL A HG23 1  
ATOM 881    N N    . THR A 1 62  ? 72.997  102.312 105.787 1.00 0.00 ? 66  THR A N    1  
ATOM 882    C CA   . THR A 1 62  ? 73.746  103.247 104.967 1.00 0.00 ? 66  THR A CA   1  
ATOM 883    C C    . THR A 1 62  ? 72.865  103.765 103.841 1.00 0.00 ? 66  THR A C    1  
ATOM 884    O O    . THR A 1 62  ? 72.070  103.015 103.269 1.00 0.00 ? 66  THR A O    1  
ATOM 885    C CB   . THR A 1 62  ? 74.996  102.591 104.395 1.00 0.00 ? 66  THR A CB   1  
ATOM 886    O OG1  . THR A 1 62  ? 74.612  101.449 103.628 1.00 0.00 ? 66  THR A OG1  1  
ATOM 887    C CG2  . THR A 1 62  ? 75.919  102.141 105.509 1.00 0.00 ? 66  THR A CG2  1  
ATOM 888    H H    . THR A 1 62  ? 72.784  101.578 105.394 1.00 0.00 ? 66  THR A H    1  
ATOM 889    H HA   . THR A 1 62  ? 74.025  103.990 105.524 1.00 0.00 ? 66  THR A HA   1  
ATOM 890    H HB   . THR A 1 62  ? 75.461  103.237 103.839 1.00 0.00 ? 66  THR A HB   1  
ATOM 891    H HG1  . THR A 1 62  ? 75.048  100.779 103.887 1.00 0.00 ? 66  THR A HG1  1  
ATOM 892    H HG21 . THR A 1 62  ? 75.890  103.101 105.375 1.00 0.00 ? 66  THR A HG21 1  
ATOM 893    H HG22 . THR A 1 62  ? 76.183  102.908 106.041 1.00 0.00 ? 66  THR A HG22 1  
ATOM 894    H HG23 . THR A 1 62  ? 75.458  101.500 106.073 1.00 0.00 ? 66  THR A HG23 1  
ATOM 895    N N    . TYR A 1 63  ? 72.998  105.056 103.541 1.00 0.00 ? 67  TYR A N    1  
ATOM 896    C CA   . TYR A 1 63  ? 72.277  105.660 102.421 1.00 0.00 ? 67  TYR A CA   1  
ATOM 897    C C    . TYR A 1 63  ? 72.989  106.944 102.007 1.00 0.00 ? 67  TYR A C    1  
ATOM 898    O O    . TYR A 1 63  ? 73.891  107.423 102.699 1.00 0.00 ? 67  TYR A O    1  
ATOM 899    C CB   . TYR A 1 63  ? 70.803  105.912 102.768 1.00 0.00 ? 67  TYR A CB   1  
ATOM 900    C CG   . TYR A 1 63  ? 70.537  106.785 103.974 1.00 0.00 ? 67  TYR A CG   1  
ATOM 901    C CD1  . TYR A 1 63  ? 70.564  106.258 105.253 1.00 0.00 ? 67  TYR A CD1  1  
ATOM 902    C CD2  . TYR A 1 63  ? 70.216  108.128 103.827 1.00 0.00 ? 67  TYR A CD2  1  
ATOM 903    C CE1  . TYR A 1 63  ? 70.301  107.047 106.349 1.00 0.00 ? 67  TYR A CE1  1  
ATOM 904    C CE2  . TYR A 1 63  ? 69.953  108.923 104.915 1.00 0.00 ? 67  TYR A CE2  1  
ATOM 905    C CZ   . TYR A 1 63  ? 69.995  108.378 106.171 1.00 0.00 ? 67  TYR A CZ   1  
ATOM 906    O OH   . TYR A 1 63  ? 69.734  109.178 107.258 1.00 0.00 ? 67  TYR A OH   1  
ATOM 907    H H    . TYR A 1 63  ? 73.501  105.600 103.975 1.00 0.00 ? 67  TYR A H    1  
ATOM 908    H HA   . TYR A 1 63  ? 72.277  105.044 101.671 1.00 0.00 ? 67  TYR A HA   1  
ATOM 909    H HB2  . TYR A 1 63  ? 70.375  106.318 101.998 1.00 0.00 ? 67  TYR A HB2  1  
ATOM 910    H HB3  . TYR A 1 63  ? 70.374  105.055 102.913 1.00 0.00 ? 67  TYR A HB3  1  
ATOM 911    H HD1  . TYR A 1 63  ? 70.763  105.357 105.373 1.00 0.00 ? 67  TYR A HD1  1  
ATOM 912    H HD2  . TYR A 1 63  ? 70.179  108.496 102.974 1.00 0.00 ? 67  TYR A HD2  1  
ATOM 913    H HE1  . TYR A 1 63  ? 70.330  106.684 107.205 1.00 0.00 ? 67  TYR A HE1  1  
ATOM 914    H HE2  . TYR A 1 63  ? 69.748  109.823 104.801 1.00 0.00 ? 67  TYR A HE2  1  
ATOM 915    H HH   . TYR A 1 63  ? 69.293  108.743 107.826 1.00 0.00 ? 67  TYR A HH   1  
ATOM 916    N N    . TYR A 1 64  ? 72.587  107.494 100.861 1.00 0.00 ? 68  TYR A N    1  
ATOM 917    C CA   . TYR A 1 64  ? 73.085  108.773 100.368 1.00 0.00 ? 68  TYR A CA   1  
ATOM 918    C C    . TYR A 1 64  ? 72.073  109.856 100.704 1.00 0.00 ? 68  TYR A C    1  
ATOM 919    O O    . TYR A 1 64  ? 70.931  109.804 100.241 1.00 0.00 ? 68  TYR A O    1  
ATOM 920    C CB   . TYR A 1 64  ? 73.322  108.758 98.856  1.00 0.00 ? 68  TYR A CB   1  
ATOM 921    C CG   . TYR A 1 64  ? 74.097  107.575 98.328  1.00 0.00 ? 68  TYR A CG   1  
ATOM 922    C CD1  . TYR A 1 64  ? 73.453  106.439 97.861  1.00 0.00 ? 68  TYR A CD1  1  
ATOM 923    C CD2  . TYR A 1 64  ? 75.480  107.584 98.333  1.00 0.00 ? 68  TYR A CD2  1  
ATOM 924    C CE1  . TYR A 1 64  ? 74.168  105.360 97.384  1.00 0.00 ? 68  TYR A CE1  1  
ATOM 925    C CE2  . TYR A 1 64  ? 76.201  106.505 97.872  1.00 0.00 ? 68  TYR A CE2  1  
ATOM 926    C CZ   . TYR A 1 64  ? 75.539  105.400 97.392  1.00 0.00 ? 68  TYR A CZ   1  
ATOM 927    O OH   . TYR A 1 64  ? 76.254  104.325 96.926  1.00 0.00 ? 68  TYR A OH   1  
ATOM 928    H H    . TYR A 1 64  ? 72.008  107.127 100.342 1.00 0.00 ? 68  TYR A H    1  
ATOM 929    H HA   . TYR A 1 64  ? 73.937  108.947 100.798 1.00 0.00 ? 68  TYR A HA   1  
ATOM 930    H HB2  . TYR A 1 64  ? 72.461  108.786 98.410  1.00 0.00 ? 68  TYR A HB2  1  
ATOM 931    H HB3  . TYR A 1 64  ? 73.795  109.569 98.612  1.00 0.00 ? 68  TYR A HB3  1  
ATOM 932    H HD1  . TYR A 1 64  ? 72.523  106.404 97.869  1.00 0.00 ? 68  TYR A HD1  1  
ATOM 933    H HD2  . TYR A 1 64  ? 75.930  108.331 98.653  1.00 0.00 ? 68  TYR A HD2  1  
ATOM 934    H HE1  . TYR A 1 64  ? 73.723  104.611 97.059  1.00 0.00 ? 68  TYR A HE1  1  
ATOM 935    H HE2  . TYR A 1 64  ? 77.131  106.524 97.886  1.00 0.00 ? 68  TYR A HE2  1  
ATOM 936    H HH   . TYR A 1 64  ? 76.366  103.772 97.548  1.00 0.00 ? 68  TYR A HH   1  
ATOM 937    N N    . GLY A 1 65  ? 72.500  110.847 101.482 1.00 0.00 ? 69  GLY A N    1  
ATOM 938    C CA   . GLY A 1 65  ? 71.597  111.885 101.938 1.00 0.00 ? 69  GLY A CA   1  
ATOM 939    C C    . GLY A 1 65  ? 71.132  112.844 100.863 1.00 0.00 ? 69  GLY A C    1  
ATOM 940    O O    . GLY A 1 65  ? 71.944  113.376 100.101 1.00 0.00 ? 69  GLY A O    1  
ATOM 941    H H    . GLY A 1 65  ? 73.310  110.931 101.755 1.00 0.00 ? 69  GLY A H    1  
ATOM 942    H HA2  . GLY A 1 65  ? 70.818  111.466 102.337 1.00 0.00 ? 69  GLY A HA2  1  
ATOM 943    H HA3  . GLY A 1 65  ? 72.036  112.393 102.637 1.00 0.00 ? 69  GLY A HA3  1  
ATOM 944    N N    . LYS A 1 66  ? 69.825  113.072 100.790 1.00 0.00 ? 70  LYS A N    1  
ATOM 945    C CA   . LYS A 1 66  ? 69.274  114.059 99.878  1.00 0.00 ? 70  LYS A CA   1  
ATOM 946    C C    . LYS A 1 66  ? 69.132  115.396 100.607 1.00 0.00 ? 70  LYS A C    1  
ATOM 947    O O    . LYS A 1 66  ? 69.003  115.451 101.832 1.00 0.00 ? 70  LYS A O    1  
ATOM 948    C CB   . LYS A 1 66  ? 67.931  113.566 99.324  1.00 0.00 ? 70  LYS A CB   1  
ATOM 949    C CG   . LYS A 1 66  ? 67.896  112.113 98.856  1.00 0.00 ? 70  LYS A CG   1  
ATOM 950    C CD   . LYS A 1 66  ? 67.127  111.950 97.556  1.00 0.00 ? 70  LYS A CD   1  
ATOM 951    C CE   . LYS A 1 66  ? 67.363  110.581 96.938  1.00 0.00 ? 70  LYS A CE   1  
ATOM 952    N NZ   . LYS A 1 66  ? 68.255  110.656 95.750  1.00 0.00 ? 70  LYS A NZ   1  
ATOM 953    H H    . LYS A 1 66  ? 69.238  112.660 101.266 1.00 0.00 ? 70  LYS A H    1  
ATOM 954    H HA   . LYS A 1 66  ? 69.871  114.187 99.125  1.00 0.00 ? 70  LYS A HA   1  
ATOM 955    H HB2  . LYS A 1 66  ? 67.255  113.684 100.009 1.00 0.00 ? 70  LYS A HB2  1  
ATOM 956    H HB3  . LYS A 1 66  ? 67.681  114.134 98.578  1.00 0.00 ? 70  LYS A HB3  1  
ATOM 957    H HG2  . LYS A 1 66  ? 68.804  111.791 98.737  1.00 0.00 ? 70  LYS A HG2  1  
ATOM 958    H HG3  . LYS A 1 66  ? 67.488  111.563 99.543  1.00 0.00 ? 70  LYS A HG3  1  
ATOM 959    H HD2  . LYS A 1 66  ? 66.179  112.072 97.721  1.00 0.00 ? 70  LYS A HD2  1  
ATOM 960    H HD3  . LYS A 1 66  ? 67.397  112.639 96.929  1.00 0.00 ? 70  LYS A HD3  1  
ATOM 961    H HE2  . LYS A 1 66  ? 67.756  109.990 97.600  1.00 0.00 ? 70  LYS A HE2  1  
ATOM 962    H HE3  . LYS A 1 66  ? 66.513  110.191 96.680  1.00 0.00 ? 70  LYS A HE3  1  
ATOM 963    H HZ1  . LYS A 1 66  ? 69.105  110.624 96.014  1.00 0.00 ? 70  LYS A HZ1  1  
ATOM 964    H HZ2  . LYS A 1 66  ? 68.087  109.970 95.208  1.00 0.00 ? 70  LYS A HZ2  1  
ATOM 965    H HZ3  . LYS A 1 66  ? 68.109  111.419 95.316  1.00 0.00 ? 70  LYS A HZ3  1  
ATOM 966    N N    . ARG A 1 67  ? 69.171  116.489 99.836  1.00 0.00 ? 71  ARG A N    1  
ATOM 967    C CA   . ARG A 1 67  ? 69.204  117.832 100.407 1.00 0.00 ? 71  ARG A CA   1  
ATOM 968    C C    . ARG A 1 67  ? 68.190  118.041 101.528 1.00 0.00 ? 71  ARG A C    1  
ATOM 969    O O    . ARG A 1 67  ? 68.571  118.522 102.600 1.00 0.00 ? 71  ARG A O    1  
ATOM 970    C CB   . ARG A 1 67  ? 68.974  118.865 99.306  1.00 0.00 ? 71  ARG A CB   1  
ATOM 971    C CG   . ARG A 1 67  ? 67.842  118.509 98.359  1.00 0.00 ? 71  ARG A CG   1  
ATOM 972    C CD   . ARG A 1 67  ? 68.325  118.438 96.924  1.00 0.00 ? 71  ARG A CD   1  
ATOM 973    N NE   . ARG A 1 67  ? 68.305  117.070 96.415  1.00 0.00 ? 71  ARG A NE   1  
ATOM 974    C CZ   . ARG A 1 67  ? 67.630  116.682 95.339  1.00 0.00 ? 71  ARG A CZ   1  
ATOM 975    N NH1  . ARG A 1 67  ? 67.673  115.416 94.949  1.00 0.00 ? 71  ARG A NH1  1  
ATOM 976    N NH2  . ARG A 1 67  ? 66.911  117.559 94.652  1.00 0.00 ? 71  ARG A NH2  1  
ATOM 977    H H    . ARG A 1 67  ? 69.179  116.469 98.977  1.00 0.00 ? 71  ARG A H    1  
ATOM 978    H HA   . ARG A 1 67  ? 70.083  117.944 100.803 1.00 0.00 ? 71  ARG A HA   1  
ATOM 979    H HB2  . ARG A 1 67  ? 68.784  119.724 99.715  1.00 0.00 ? 71  ARG A HB2  1  
ATOM 980    H HB3  . ARG A 1 67  ? 69.792  118.968 98.795  1.00 0.00 ? 71  ARG A HB3  1  
ATOM 981    H HG2  . ARG A 1 67  ? 67.458  117.656 98.616  1.00 0.00 ? 71  ARG A HG2  1  
ATOM 982    H HG3  . ARG A 1 67  ? 67.136  119.171 98.432  1.00 0.00 ? 71  ARG A HG3  1  
ATOM 983    H HD2  . ARG A 1 67  ? 67.766  118.999 96.366  1.00 0.00 ? 71  ARG A HD2  1  
ATOM 984    H HD3  . ARG A 1 67  ? 69.227  118.791 96.868  1.00 0.00 ? 71  ARG A HD3  1  
ATOM 985    H HE   . ARG A 1 67  ? 68.759  116.476 96.840  1.00 0.00 ? 71  ARG A HE   1  
ATOM 986    H HH11 . ARG A 1 67  ? 68.138  114.845 95.393  1.00 0.00 ? 71  ARG A HH11 1  
ATOM 987    H HH12 . ARG A 1 67  ? 67.236  115.166 94.252  1.00 0.00 ? 71  ARG A HH12 1  
ATOM 988    H HH21 . ARG A 1 67  ? 66.880  118.381 94.903  1.00 0.00 ? 71  ARG A HH21 1  
ATOM 989    H HH22 . ARG A 1 67  ? 66.475  117.305 93.955  1.00 0.00 ? 71  ARG A HH22 1  
ATOM 990    N N    . GLY A 1 68  ? 66.926  117.703 101.316 1.00 0.00 ? 72  GLY A N    1  
ATOM 991    C CA   . GLY A 1 68  ? 65.913  117.802 102.352 1.00 0.00 ? 72  GLY A CA   1  
ATOM 992    C C    . GLY A 1 68  ? 64.741  116.901 102.023 1.00 0.00 ? 72  GLY A C    1  
ATOM 993    O O    . GLY A 1 68  ? 63.868  117.250 101.224 1.00 0.00 ? 72  GLY A O    1  
ATOM 994    H H    . GLY A 1 68  ? 66.631  117.409 100.564 1.00 0.00 ? 72  GLY A H    1  
ATOM 995    H HA2  . GLY A 1 68  ? 66.292  117.551 103.209 1.00 0.00 ? 72  GLY A HA2  1  
ATOM 996    H HA3  . GLY A 1 68  ? 65.612  118.721 102.433 1.00 0.00 ? 72  GLY A HA3  1  
ATOM 997    N N    . ASP A 1 69  ? 64.737  115.723 102.664 1.00 0.00 ? 73  ASP A N    1  
ATOM 998    C CA   . ASP A 1 69  ? 63.613  114.779 102.688 1.00 0.00 ? 73  ASP A CA   1  
ATOM 999    C C    . ASP A 1 69  ? 63.401  114.212 104.098 1.00 0.00 ? 73  ASP A C    1  
ATOM 1000   O O    . ASP A 1 69  ? 64.307  114.149 104.925 1.00 0.00 ? 73  ASP A O    1  
ATOM 1001   C CB   . ASP A 1 69  ? 63.807  113.671 101.644 1.00 0.00 ? 73  ASP A CB   1  
ATOM 1002   C CG   . ASP A 1 69  ? 63.075  113.953 100.346 1.00 0.00 ? 73  ASP A CG   1  
ATOM 1003   O OD1  . ASP A 1 69  ? 61.992  114.575 100.380 1.00 0.00 ? 73  ASP A OD1  1  
ATOM 1004   O OD2  . ASP A 1 69  ? 63.593  113.562 99.281  1.00 0.00 ? 73  ASP A OD2  1  
ATOM 1005   H H    . ASP A 1 69  ? 65.416  115.444 103.112 1.00 0.00 ? 73  ASP A H    1  
ATOM 1006   H HA   . ASP A 1 69  ? 62.805  115.259 102.450 1.00 0.00 ? 73  ASP A HA   1  
ATOM 1007   H HB2  . ASP A 1 69  ? 64.754  113.567 101.461 1.00 0.00 ? 73  ASP A HB2  1  
ATOM 1008   H HB3  . ASP A 1 69  ? 63.495  112.829 102.010 1.00 0.00 ? 73  ASP A HB3  1  
ATOM 1009   N N    . ALA A 1 70  ? 62.164  113.781 104.339 1.00 0.00 ? 74  ALA A N    1  
ATOM 1010   C CA   . ALA A 1 70  ? 61.554  113.667 105.664 1.00 0.00 ? 74  ALA A CA   1  
ATOM 1011   C C    . ALA A 1 70  ? 62.010  112.509 106.554 1.00 0.00 ? 74  ALA A C    1  
ATOM 1012   O O    . ALA A 1 70  ? 62.050  112.672 107.776 1.00 0.00 ? 74  ALA A O    1  
ATOM 1013   C CB   . ALA A 1 70  ? 60.032  113.577 105.514 1.00 0.00 ? 74  ALA A CB   1  
ATOM 1014   H H    . ALA A 1 70  ? 61.634  113.536 103.708 1.00 0.00 ? 74  ALA A H    1  
ATOM 1015   H HA   . ALA A 1 70  ? 61.856  114.466 106.122 1.00 0.00 ? 74  ALA A HA   1  
ATOM 1016   H HB1  . ALA A 1 70  ? 59.782  112.667 105.289 1.00 0.00 ? 74  ALA A HB1  1  
ATOM 1017   H HB2  . ALA A 1 70  ? 59.609  113.832 106.348 1.00 0.00 ? 74  ALA A HB2  1  
ATOM 1018   H HB3  . ALA A 1 70  ? 59.742  114.176 104.809 1.00 0.00 ? 74  ALA A HB3  1  
ATOM 1019   N N    . GLY A 1 71  ? 62.274  111.326 105.987 1.00 0.00 ? 75  GLY A N    1  
ATOM 1020   C CA   . GLY A 1 71  ? 62.948  110.283 106.747 1.00 0.00 ? 75  GLY A CA   1  
ATOM 1021   C C    . GLY A 1 71  ? 64.340  110.689 107.200 1.00 0.00 ? 75  GLY A C    1  
ATOM 1022   O O    . GLY A 1 71  ? 64.741  110.415 108.337 1.00 0.00 ? 75  GLY A O    1  
ATOM 1023   H H    . GLY A 1 71  ? 62.072  111.116 105.178 1.00 0.00 ? 75  GLY A H    1  
ATOM 1024   H HA2  . GLY A 1 71  ? 62.413  110.057 107.524 1.00 0.00 ? 75  GLY A HA2  1  
ATOM 1025   H HA3  . GLY A 1 71  ? 63.011  109.482 106.203 1.00 0.00 ? 75  GLY A HA3  1  
ATOM 1026   N N    . GLN A 1 72  ? 65.085  111.376 106.328 1.00 0.00 ? 76  GLN A N    1  
ATOM 1027   C CA   . GLN A 1 72  ? 66.348  111.968 106.750 1.00 0.00 ? 76  GLN A CA   1  
ATOM 1028   C C    . GLN A 1 72  ? 66.148  113.012 107.839 1.00 0.00 ? 76  GLN A C    1  
ATOM 1029   O O    . GLN A 1 72  ? 66.855  112.972 108.851 1.00 0.00 ? 76  GLN A O    1  
ATOM 1030   C CB   . GLN A 1 72  ? 67.086  112.587 105.561 1.00 0.00 ? 76  GLN A CB   1  
ATOM 1031   C CG   . GLN A 1 72  ? 68.158  113.595 105.930 1.00 0.00 ? 76  GLN A CG   1  
ATOM 1032   C CD   . GLN A 1 72  ? 67.687  115.027 105.798 1.00 0.00 ? 76  GLN A CD   1  
ATOM 1033   O OE1  . GLN A 1 72  ? 67.079  115.580 106.713 1.00 0.00 ? 76  GLN A OE1  1  
ATOM 1034   N NE2  . GLN A 1 72  ? 67.960  115.633 104.648 1.00 0.00 ? 76  GLN A NE2  1  
ATOM 1035   H H    . GLN A 1 72  ? 64.878  111.507 105.504 1.00 0.00 ? 76  GLN A H    1  
ATOM 1036   H HA   . GLN A 1 72  ? 66.887  111.250 107.118 1.00 0.00 ? 76  GLN A HA   1  
ATOM 1037   H HB2  . GLN A 1 72  ? 67.495  111.875 105.044 1.00 0.00 ? 76  GLN A HB2  1  
ATOM 1038   H HB3  . GLN A 1 72  ? 66.438  113.020 104.985 1.00 0.00 ? 76  GLN A HB3  1  
ATOM 1039   H HG2  . GLN A 1 72  ? 68.446  113.436 106.843 1.00 0.00 ? 76  GLN A HG2  1  
ATOM 1040   H HG3  . GLN A 1 72  ? 68.933  113.460 105.361 1.00 0.00 ? 76  GLN A HG3  1  
ATOM 1041   H HE21 . GLN A 1 72  ? 68.387  115.213 104.032 1.00 0.00 ? 76  GLN A HE21 1  
ATOM 1042   H HE22 . GLN A 1 72  ? 67.709  116.446 104.521 1.00 0.00 ? 76  GLN A HE22 1  
ATOM 1043   N N    . LYS A 1 73  ? 65.196  113.934 107.670 1.00 0.00 ? 77  LYS A N    1  
ATOM 1044   C CA   . LYS A 1 73  ? 64.852  114.831 108.761 1.00 0.00 ? 77  LYS A CA   1  
ATOM 1045   C C    . LYS A 1 73  ? 64.284  114.079 109.951 1.00 0.00 ? 77  LYS A C    1  
ATOM 1046   O O    . LYS A 1 73  ? 64.417  114.551 111.079 1.00 0.00 ? 77  LYS A O    1  
ATOM 1047   C CB   . LYS A 1 73  ? 63.854  115.894 108.305 1.00 0.00 ? 77  LYS A CB   1  
ATOM 1048   C CG   . LYS A 1 73  ? 64.425  116.922 107.357 1.00 0.00 ? 77  LYS A CG   1  
ATOM 1049   C CD   . LYS A 1 73  ? 63.438  118.045 107.133 1.00 0.00 ? 77  LYS A CD   1  
ATOM 1050   C CE   . LYS A 1 73  ? 62.403  117.644 106.114 1.00 0.00 ? 77  LYS A CE   1  
ATOM 1051   N NZ   . LYS A 1 73  ? 61.341  116.830 106.758 1.00 0.00 ? 77  LYS A NZ   1  
ATOM 1052   H H    . LYS A 1 73  ? 64.749  114.051 106.945 1.00 0.00 ? 77  LYS A H    1  
ATOM 1053   H HA   . LYS A 1 73  ? 65.675  115.264 109.037 1.00 0.00 ? 77  LYS A HA   1  
ATOM 1054   H HB2  . LYS A 1 73  ? 63.104  115.454 107.874 1.00 0.00 ? 77  LYS A HB2  1  
ATOM 1055   H HB3  . LYS A 1 73  ? 63.505  116.350 109.087 1.00 0.00 ? 77  LYS A HB3  1  
ATOM 1056   H HG2  . LYS A 1 73  ? 65.252  117.278 107.717 1.00 0.00 ? 77  LYS A HG2  1  
ATOM 1057   H HG3  . LYS A 1 73  ? 64.643  116.502 106.510 1.00 0.00 ? 77  LYS A HG3  1  
ATOM 1058   H HD2  . LYS A 1 73  ? 63.004  118.273 107.970 1.00 0.00 ? 77  LYS A HD2  1  
ATOM 1059   H HD3  . LYS A 1 73  ? 63.906  118.839 106.831 1.00 0.00 ? 77  LYS A HD3  1  
ATOM 1060   H HE2  . LYS A 1 73  ? 62.013  118.435 105.710 1.00 0.00 ? 77  LYS A HE2  1  
ATOM 1061   H HE3  . LYS A 1 73  ? 62.820  117.137 105.400 1.00 0.00 ? 77  LYS A HE3  1  
ATOM 1062   H HZ1  . LYS A 1 73  ? 60.682  117.363 107.030 1.00 0.00 ? 77  LYS A HZ1  1  
ATOM 1063   H HZ2  . LYS A 1 73  ? 61.021  116.241 106.172 1.00 0.00 ? 77  LYS A HZ2  1  
ATOM 1064   H HZ3  . LYS A 1 73  ? 61.681  116.398 107.457 1.00 0.00 ? 77  LYS A HZ3  1  
ATOM 1065   N N    . ALA A 1 74  ? 63.646  112.931 109.727 1.00 0.00 ? 78  ALA A N    1  
ATOM 1066   C CA   . ALA A 1 74  ? 63.303  112.059 110.840 1.00 0.00 ? 78  ALA A CA   1  
ATOM 1067   C C    . ALA A 1 74  ? 64.554  111.512 111.507 1.00 0.00 ? 78  ALA A C    1  
ATOM 1068   O O    . ALA A 1 74  ? 64.644  111.510 112.743 1.00 0.00 ? 78  ALA A O    1  
ATOM 1069   C CB   . ALA A 1 74  ? 62.405  110.916 110.369 1.00 0.00 ? 78  ALA A CB   1  
ATOM 1070   H H    . ALA A 1 74  ? 63.408  112.645 108.951 1.00 0.00 ? 78  ALA A H    1  
ATOM 1071   H HA   . ALA A 1 74  ? 62.816  112.584 111.495 1.00 0.00 ? 78  ALA A HA   1  
ATOM 1072   H HB1  . ALA A 1 74  ? 62.822  110.067 110.584 1.00 0.00 ? 78  ALA A HB1  1  
ATOM 1073   H HB2  . ALA A 1 74  ? 61.545  110.975 110.814 1.00 0.00 ? 78  ALA A HB2  1  
ATOM 1074   H HB3  . ALA A 1 74  ? 62.277  110.979 109.410 1.00 0.00 ? 78  ALA A HB3  1  
ATOM 1075   N N    . ILE A 1 75  ? 65.520  111.061 110.702 1.00 0.00 ? 79  ILE A N    1  
ATOM 1076   C CA   . ILE A 1 75  ? 66.822  110.659 111.231 1.00 0.00 ? 79  ILE A CA   1  
ATOM 1077   C C    . ILE A 1 75  ? 67.491  111.828 111.945 1.00 0.00 ? 79  ILE A C    1  
ATOM 1078   O O    . ILE A 1 75  ? 68.034  111.678 113.047 1.00 0.00 ? 79  ILE A O    1  
ATOM 1079   C CB   . ILE A 1 75  ? 67.704  110.105 110.095 1.00 0.00 ? 79  ILE A CB   1  
ATOM 1080   C CG1  . ILE A 1 75  ? 66.973  108.989 109.350 1.00 0.00 ? 79  ILE A CG1  1  
ATOM 1081   C CG2  . ILE A 1 75  ? 69.024  109.589 110.628 1.00 0.00 ? 79  ILE A CG2  1  
ATOM 1082   C CD1  . ILE A 1 75  ? 65.879  108.259 110.162 1.00 0.00 ? 79  ILE A CD1  1  
ATOM 1083   H H    . ILE A 1 75  ? 65.440  110.980 109.849 1.00 0.00 ? 79  ILE A H    1  
ATOM 1084   H HA   . ILE A 1 75  ? 66.698  109.953 111.884 1.00 0.00 ? 79  ILE A HA   1  
ATOM 1085   H HB   . ILE A 1 75  ? 67.887  110.832 109.480 1.00 0.00 ? 79  ILE A HB   1  
ATOM 1086   H HG12 . ILE A 1 75  ? 66.567  109.364 108.553 1.00 0.00 ? 79  ILE A HG12 1  
ATOM 1087   H HG13 . ILE A 1 75  ? 67.626  108.335 109.054 1.00 0.00 ? 79  ILE A HG13 1  
ATOM 1088   H HG21 . ILE A 1 75  ? 69.755  110.036 110.173 1.00 0.00 ? 79  ILE A HG21 1  
ATOM 1089   H HG22 . ILE A 1 75  ? 69.080  109.766 111.580 1.00 0.00 ? 79  ILE A HG22 1  
ATOM 1090   H HG23 . ILE A 1 75  ? 69.084  108.633 110.474 1.00 0.00 ? 79  ILE A HG23 1  
ATOM 1091   H HD11 . ILE A 1 75  ? 66.039  108.390 111.111 1.00 0.00 ? 79  ILE A HD11 1  
ATOM 1092   H HD12 . ILE A 1 75  ? 65.008  108.618 109.929 1.00 0.00 ? 79  ILE A HD12 1  
ATOM 1093   H HD13 . ILE A 1 75  ? 65.902  107.311 109.958 1.00 0.00 ? 79  ILE A HD13 1  
ATOM 1094   N N    . GLU A 1 76  ? 67.427  113.020 111.353 1.00 0.00 ? 80  GLU A N    1  
ATOM 1095   C CA   . GLU A 1 76  ? 68.077  114.181 111.947 1.00 0.00 ? 80  GLU A CA   1  
ATOM 1096   C C    . GLU A 1 76  ? 67.500  114.534 113.312 1.00 0.00 ? 80  GLU A C    1  
ATOM 1097   O O    . GLU A 1 76  ? 68.264  114.747 114.260 1.00 0.00 ? 80  GLU A O    1  
ATOM 1098   C CB   . GLU A 1 76  ? 67.972  115.375 111.004 1.00 0.00 ? 80  GLU A CB   1  
ATOM 1099   C CG   . GLU A 1 76  ? 69.012  115.366 109.903 1.00 0.00 ? 80  GLU A CG   1  
ATOM 1100   C CD   . GLU A 1 76  ? 70.267  116.112 110.290 1.00 0.00 ? 80  GLU A CD   1  
ATOM 1101   O OE1  . GLU A 1 76  ? 70.571  116.172 111.498 1.00 0.00 ? 80  GLU A OE1  1  
ATOM 1102   O OE2  . GLU A 1 76  ? 70.948  116.640 109.389 1.00 0.00 ? 80  GLU A OE2  1  
ATOM 1103   H H    . GLU A 1 76  ? 67.016  113.175 110.613 1.00 0.00 ? 80  GLU A H    1  
ATOM 1104   H HA   . GLU A 1 76  ? 69.010  113.953 112.084 1.00 0.00 ? 80  GLU A HA   1  
ATOM 1105   H HB2  . GLU A 1 76  ? 67.088  115.386 110.605 1.00 0.00 ? 80  GLU A HB2  1  
ATOM 1106   H HB3  . GLU A 1 76  ? 68.062  116.194 111.518 1.00 0.00 ? 80  GLU A HB3  1  
ATOM 1107   H HG2  . GLU A 1 76  ? 69.239  114.449 109.683 1.00 0.00 ? 80  GLU A HG2  1  
ATOM 1108   H HG3  . GLU A 1 76  ? 68.636  115.766 109.102 1.00 0.00 ? 80  GLU A HG3  1  
ATOM 1109   N N    . ASP A 1 77  ? 66.173  114.626 113.434 1.00 0.00 ? 81  ASP A N    1  
ATOM 1110   C CA   . ASP A 1 77  ? 65.567  114.735 114.759 1.00 0.00 ? 81  ASP A CA   1  
ATOM 1111   C C    . ASP A 1 77  ? 65.808  113.485 115.587 1.00 0.00 ? 81  ASP A C    1  
ATOM 1112   O O    . ASP A 1 77  ? 65.923  113.570 116.816 1.00 0.00 ? 81  ASP A O    1  
ATOM 1113   C CB   . ASP A 1 77  ? 64.067  115.008 114.660 1.00 0.00 ? 81  ASP A CB   1  
ATOM 1114   C CG   . ASP A 1 77  ? 63.751  116.255 113.869 1.00 0.00 ? 81  ASP A CG   1  
ATOM 1115   O OD1  . ASP A 1 77  ? 62.872  116.191 112.988 1.00 0.00 ? 81  ASP A OD1  1  
ATOM 1116   O OD2  . ASP A 1 77  ? 64.380  117.302 114.128 1.00 0.00 ? 81  ASP A OD2  1  
ATOM 1117   H H    . ASP A 1 77  ? 65.618  114.627 112.777 1.00 0.00 ? 81  ASP A H    1  
ATOM 1118   H HA   . ASP A 1 77  ? 65.994  115.484 115.203 1.00 0.00 ? 81  ASP A HA   1  
ATOM 1119   H HB2  . ASP A 1 77  ? 63.630  114.247 114.246 1.00 0.00 ? 81  ASP A HB2  1  
ATOM 1120   H HB3  . ASP A 1 77  ? 63.698  115.094 115.554 1.00 0.00 ? 81  ASP A HB3  1  
ATOM 1121   N N    . ALA A 1 78  ? 65.873  112.319 114.945 1.00 0.00 ? 82  ALA A N    1  
ATOM 1122   C CA   . ALA A 1 78  ? 66.212  111.117 115.694 1.00 0.00 ? 82  ALA A CA   1  
ATOM 1123   C C    . ALA A 1 78  ? 67.529  111.276 116.441 1.00 0.00 ? 82  ALA A C    1  
ATOM 1124   O O    . ALA A 1 78  ? 67.555  111.183 117.674 1.00 0.00 ? 82  ALA A O    1  
ATOM 1125   C CB   . ALA A 1 78  ? 66.270  109.913 114.759 1.00 0.00 ? 82  ALA A CB   1  
ATOM 1126   H H    . ALA A 1 78  ? 65.729  112.206 114.105 1.00 0.00 ? 82  ALA A H    1  
ATOM 1127   H HA   . ALA A 1 78  ? 65.516  110.971 116.354 1.00 0.00 ? 82  ALA A HA   1  
ATOM 1128   H HB1  . ALA A 1 78  ? 65.725  109.196 115.119 1.00 0.00 ? 82  ALA A HB1  1  
ATOM 1129   H HB2  . ALA A 1 78  ? 65.935  110.165 113.884 1.00 0.00 ? 82  ALA A HB2  1  
ATOM 1130   H HB3  . ALA A 1 78  ? 67.188  109.610 114.677 1.00 0.00 ? 82  ALA A HB3  1  
ATOM 1131   N N    . TYR A 1 79  ? 68.624  111.535 115.725 1.00 0.00 ? 83  TYR A N    1  
ATOM 1132   C CA   . TYR A 1 79  ? 69.930  111.585 116.369 1.00 0.00 ? 83  TYR A CA   1  
ATOM 1133   C C    . TYR A 1 79  ? 70.153  112.901 117.104 1.00 0.00 ? 83  TYR A C    1  
ATOM 1134   O O    . TYR A 1 79  ? 70.581  112.917 118.262 1.00 0.00 ? 83  TYR A O    1  
ATOM 1135   C CB   . TYR A 1 79  ? 71.035  111.377 115.334 1.00 0.00 ? 83  TYR A CB   1  
ATOM 1136   C CG   . TYR A 1 79  ? 72.407  111.318 115.950 1.00 0.00 ? 83  TYR A CG   1  
ATOM 1137   C CD1  . TYR A 1 79  ? 73.099  110.119 116.005 1.00 0.00 ? 83  TYR A CD1  1  
ATOM 1138   C CD2  . TYR A 1 79  ? 73.005  112.451 116.494 1.00 0.00 ? 83  TYR A CD2  1  
ATOM 1139   C CE1  . TYR A 1 79  ? 74.351  110.044 116.570 1.00 0.00 ? 83  TYR A CE1  1  
ATOM 1140   C CE2  . TYR A 1 79  ? 74.257  112.385 117.069 1.00 0.00 ? 83  TYR A CE2  1  
ATOM 1141   C CZ   . TYR A 1 79  ? 74.926  111.177 117.100 1.00 0.00 ? 83  TYR A CZ   1  
ATOM 1142   O OH   . TYR A 1 79  ? 76.174  111.085 117.665 1.00 0.00 ? 83  TYR A OH   1  
ATOM 1143   H H    . TYR A 1 79  ? 68.629  111.684 114.878 1.00 0.00 ? 83  TYR A H    1  
ATOM 1144   H HA   . TYR A 1 79  ? 69.959  110.871 117.025 1.00 0.00 ? 83  TYR A HA   1  
ATOM 1145   H HB2  . TYR A 1 79  ? 70.867  110.553 114.848 1.00 0.00 ? 83  TYR A HB2  1  
ATOM 1146   H HB3  . TYR A 1 79  ? 71.006  112.098 114.686 1.00 0.00 ? 83  TYR A HB3  1  
ATOM 1147   H HD1  . TYR A 1 79  ? 72.710  109.351 115.654 1.00 0.00 ? 83  TYR A HD1  1  
ATOM 1148   H HD2  . TYR A 1 79  ? 72.554  113.264 116.470 1.00 0.00 ? 83  TYR A HD2  1  
ATOM 1149   H HE1  . TYR A 1 79  ? 74.805  109.233 116.593 1.00 0.00 ? 83  TYR A HE1  1  
ATOM 1150   H HE2  . TYR A 1 79  ? 74.648  113.147 117.432 1.00 0.00 ? 83  TYR A HE2  1  
ATOM 1151   H HH   . TYR A 1 79  ? 76.117  110.709 118.414 1.00 0.00 ? 83  TYR A HH   1  
ATOM 1152   N N    . GLN A 1 80  ? 69.871  114.019 116.433 1.00 0.00 ? 84  GLN A N    1  
ATOM 1153   C CA   . GLN A 1 80  ? 70.298  115.329 116.916 1.00 0.00 ? 84  GLN A CA   1  
ATOM 1154   C C    . GLN A 1 80  ? 69.425  115.830 118.060 1.00 0.00 ? 84  GLN A C    1  
ATOM 1155   O O    . GLN A 1 80  ? 69.922  116.503 118.969 1.00 0.00 ? 84  GLN A O    1  
ATOM 1156   C CB   . GLN A 1 80  ? 70.299  116.323 115.758 1.00 0.00 ? 84  GLN A CB   1  
ATOM 1157   C CG   . GLN A 1 80  ? 71.614  116.434 115.023 1.00 0.00 ? 84  GLN A CG   1  
ATOM 1158   C CD   . GLN A 1 80  ? 72.132  117.854 114.997 1.00 0.00 ? 84  GLN A CD   1  
ATOM 1159   O OE1  . GLN A 1 80  ? 71.358  118.806 114.945 1.00 0.00 ? 84  GLN A OE1  1  
ATOM 1160   N NE2  . GLN A 1 80  ? 73.448  118.004 115.046 1.00 0.00 ? 84  GLN A NE2  1  
ATOM 1161   H H    . GLN A 1 80  ? 69.431  114.039 115.694 1.00 0.00 ? 84  GLN A H    1  
ATOM 1162   H HA   . GLN A 1 80  ? 71.197  115.242 117.267 1.00 0.00 ? 84  GLN A HA   1  
ATOM 1163   H HB2  . GLN A 1 80  ? 69.609  116.066 115.126 1.00 0.00 ? 84  GLN A HB2  1  
ATOM 1164   H HB3  . GLN A 1 80  ? 70.058  117.199 116.099 1.00 0.00 ? 84  GLN A HB3  1  
ATOM 1165   H HG2  . GLN A 1 80  ? 72.270  115.859 115.447 1.00 0.00 ? 84  GLN A HG2  1  
ATOM 1166   H HG3  . GLN A 1 80  ? 71.502  116.114 114.114 1.00 0.00 ? 84  GLN A HG3  1  
ATOM 1167   H HE21 . GLN A 1 80  ? 73.958  117.313 115.082 1.00 0.00 ? 84  GLN A HE21 1  
ATOM 1168   H HE22 . GLN A 1 80  ? 73.791  118.793 115.043 1.00 0.00 ? 84  GLN A HE22 1  
ATOM 1169   N N    . ASN A 1 81  ? 68.127  115.523 118.031 1.00 0.00 ? 85  ASN A N    1  
ATOM 1170   C CA   . ASN A 1 81  ? 67.282  115.828 119.181 1.00 0.00 ? 85  ASN A CA   1  
ATOM 1171   C C    . ASN A 1 81  ? 67.386  114.739 120.239 1.00 0.00 ? 85  ASN A C    1  
ATOM 1172   O O    . ASN A 1 81  ? 67.297  115.017 121.440 1.00 0.00 ? 85  ASN A O    1  
ATOM 1173   C CB   . ASN A 1 81  ? 65.833  116.008 118.737 1.00 0.00 ? 85  ASN A CB   1  
ATOM 1174   C CG   . ASN A 1 81  ? 64.894  116.243 119.899 1.00 0.00 ? 85  ASN A CG   1  
ATOM 1175   O OD1  . ASN A 1 81  ? 64.972  117.265 120.575 1.00 0.00 ? 85  ASN A OD1  1  
ATOM 1176   N ND2  . ASN A 1 81  ? 63.993  115.300 120.129 1.00 0.00 ? 85  ASN A ND2  1  
ATOM 1177   H H    . ASN A 1 81  ? 67.725  115.147 117.370 1.00 0.00 ? 85  ASN A H    1  
ATOM 1178   H HA   . ASN A 1 81  ? 67.593  116.658 119.575 1.00 0.00 ? 85  ASN A HA   1  
ATOM 1179   H HB2  . ASN A 1 81  ? 65.776  116.757 118.124 1.00 0.00 ? 85  ASN A HB2  1  
ATOM 1180   H HB3  . ASN A 1 81  ? 65.547  115.220 118.249 1.00 0.00 ? 85  ASN A HB3  1  
ATOM 1181   H HD21 . ASN A 1 81  ? 63.431  115.389 120.774 1.00 0.00 ? 85  ASN A HD21 1  
ATOM 1182   H HD22 . ASN A 1 81  ? 63.969  114.597 119.634 1.00 0.00 ? 85  ASN A HD22 1  
ATOM 1183   N N    . GLY A 1 82  ? 67.576  113.494 119.810 1.00 0.00 ? 86  GLY A N    1  
ATOM 1184   C CA   . GLY A 1 82  ? 67.719  112.375 120.718 1.00 0.00 ? 86  GLY A CA   1  
ATOM 1185   C C    . GLY A 1 82  ? 66.399  111.710 121.044 1.00 0.00 ? 86  GLY A C    1  
ATOM 1186   O O    . GLY A 1 82  ? 65.855  111.890 122.137 1.00 0.00 ? 86  GLY A O    1  
ATOM 1187   H H    . GLY A 1 82  ? 67.624  113.280 118.978 1.00 0.00 ? 86  GLY A H    1  
ATOM 1188   H HA2  . GLY A 1 82  ? 68.317  111.720 120.325 1.00 0.00 ? 86  GLY A HA2  1  
ATOM 1189   H HA3  . GLY A 1 82  ? 68.133  112.681 121.540 1.00 0.00 ? 86  GLY A HA3  1  
ATOM 1190   N N    . LYS A 1 83  ? 65.890  110.926 120.101 1.00 0.00 ? 87  LYS A N    1  
ATOM 1191   C CA   . LYS A 1 83  ? 64.631  110.194 120.225 1.00 0.00 ? 87  LYS A CA   1  
ATOM 1192   C C    . LYS A 1 83  ? 64.866  108.797 119.662 1.00 0.00 ? 87  LYS A C    1  
ATOM 1193   O O    . LYS A 1 83  ? 65.763  108.593 118.839 1.00 0.00 ? 87  LYS A O    1  
ATOM 1194   C CB   . LYS A 1 83  ? 63.486  110.911 119.484 1.00 0.00 ? 87  LYS A CB   1  
ATOM 1195   C CG   . LYS A 1 83  ? 63.673  111.170 117.997 1.00 0.00 ? 87  LYS A CG   1  
ATOM 1196   C CD   . LYS A 1 83  ? 62.475  110.666 117.212 1.00 0.00 ? 87  LYS A CD   1  
ATOM 1197   C CE   . LYS A 1 83  ? 61.455  111.761 116.986 1.00 0.00 ? 87  LYS A CE   1  
ATOM 1198   N NZ   . LYS A 1 83  ? 61.769  112.526 115.753 1.00 0.00 ? 87  LYS A NZ   1  
ATOM 1199   H H    . LYS A 1 83  ? 66.280  110.800 119.345 1.00 0.00 ? 87  LYS A H    1  
ATOM 1200   H HA   . LYS A 1 83  ? 64.361  110.146 121.156 1.00 0.00 ? 87  LYS A HA   1  
ATOM 1201   H HB2  . LYS A 1 83  ? 62.679  110.384 119.598 1.00 0.00 ? 87  LYS A HB2  1  
ATOM 1202   H HB3  . LYS A 1 83  ? 63.332  111.763 119.920 1.00 0.00 ? 87  LYS A HB3  1  
ATOM 1203   H HG2  . LYS A 1 83  ? 63.792  112.120 117.841 1.00 0.00 ? 87  LYS A HG2  1  
ATOM 1204   H HG3  . LYS A 1 83  ? 64.479  110.729 117.685 1.00 0.00 ? 87  LYS A HG3  1  
ATOM 1205   H HD2  . LYS A 1 83  ? 62.771  110.318 116.357 1.00 0.00 ? 87  LYS A HD2  1  
ATOM 1206   H HD3  . LYS A 1 83  ? 62.061  109.930 117.690 1.00 0.00 ? 87  LYS A HD3  1  
ATOM 1207   H HE2  . LYS A 1 83  ? 60.568  111.374 116.916 1.00 0.00 ? 87  LYS A HE2  1  
ATOM 1208   H HE3  . LYS A 1 83  ? 61.443  112.361 117.749 1.00 0.00 ? 87  LYS A HE3  1  
ATOM 1209   H HZ1  . LYS A 1 83  ? 61.624  113.392 115.896 1.00 0.00 ? 87  LYS A HZ1  1  
ATOM 1210   H HZ2  . LYS A 1 83  ? 62.622  112.399 115.533 1.00 0.00 ? 87  LYS A HZ2  1  
ATOM 1211   H HZ3  . LYS A 1 83  ? 61.248  112.244 115.088 1.00 0.00 ? 87  LYS A HZ3  1  
ATOM 1212   N N    . GLN A 1 84  ? 64.056  107.839 120.091 1.00 0.00 ? 88  GLN A N    1  
ATOM 1213   C CA   . GLN A 1 84  ? 63.987  106.521 119.478 1.00 0.00 ? 88  GLN A CA   1  
ATOM 1214   C C    . GLN A 1 84  ? 62.976  106.570 118.338 1.00 0.00 ? 88  GLN A C    1  
ATOM 1215   O O    . GLN A 1 84  ? 62.002  107.325 118.381 1.00 0.00 ? 88  GLN A O    1  
ATOM 1216   C CB   . GLN A 1 84  ? 63.616  105.456 120.511 1.00 0.00 ? 88  GLN A CB   1  
ATOM 1217   C CG   . GLN A 1 84  ? 62.163  105.506 120.920 1.00 0.00 ? 88  GLN A CG   1  
ATOM 1218   C CD   . GLN A 1 84  ? 61.461  104.178 120.756 1.00 0.00 ? 88  GLN A CD   1  
ATOM 1219   O OE1  . GLN A 1 84  ? 61.290  103.428 121.715 1.00 0.00 ? 88  GLN A OE1  1  
ATOM 1220   N NE2  . GLN A 1 84  ? 61.063  103.874 119.529 1.00 0.00 ? 88  GLN A NE2  1  
ATOM 1221   H H    . GLN A 1 84  ? 63.522  107.938 120.758 1.00 0.00 ? 88  GLN A H    1  
ATOM 1222   H HA   . GLN A 1 84  ? 64.856  106.276 119.125 1.00 0.00 ? 88  GLN A HA   1  
ATOM 1223   H HB2  . GLN A 1 84  ? 63.814  104.579 120.147 1.00 0.00 ? 88  GLN A HB2  1  
ATOM 1224   H HB3  . GLN A 1 84  ? 64.172  105.569 121.297 1.00 0.00 ? 88  GLN A HB3  1  
ATOM 1225   H HG2  . GLN A 1 84  ? 62.102  105.787 121.847 1.00 0.00 ? 88  GLN A HG2  1  
ATOM 1226   H HG3  . GLN A 1 84  ? 61.705  106.177 120.390 1.00 0.00 ? 88  GLN A HG3  1  
ATOM 1227   H HE21 . GLN A 1 84  ? 61.200  104.426 118.884 1.00 0.00 ? 88  GLN A HE21 1  
ATOM 1228   H HE22 . GLN A 1 84  ? 60.669  103.125 119.378 1.00 0.00 ? 88  GLN A HE22 1  
ATOM 1229   N N    . ILE A 1 85  ? 63.208  105.766 117.300 1.00 0.00 ? 89  ILE A N    1  
ATOM 1230   C CA   . ILE A 1 85  ? 62.292  105.727 116.166 1.00 0.00 ? 89  ILE A CA   1  
ATOM 1231   C C    . ILE A 1 85  ? 61.756  104.317 115.984 1.00 0.00 ? 89  ILE A C    1  
ATOM 1232   O O    . ILE A 1 85  ? 62.473  103.329 116.164 1.00 0.00 ? 89  ILE A O    1  
ATOM 1233   C CB   . ILE A 1 85  ? 62.950  106.209 114.857 1.00 0.00 ? 89  ILE A CB   1  
ATOM 1234   C CG1  . ILE A 1 85  ? 63.384  107.672 114.973 1.00 0.00 ? 89  ILE A CG1  1  
ATOM 1235   C CG2  . ILE A 1 85  ? 62.008  105.995 113.689 1.00 0.00 ? 89  ILE A CG2  1  
ATOM 1236   C CD1  . ILE A 1 85  ? 62.518  108.746 114.266 1.00 0.00 ? 89  ILE A CD1  1  
ATOM 1237   H H    . ILE A 1 85  ? 63.885  105.241 117.235 1.00 0.00 ? 89  ILE A H    1  
ATOM 1238   H HA   . ILE A 1 85  ? 61.564  106.337 116.364 1.00 0.00 ? 89  ILE A HA   1  
ATOM 1239   H HB   . ILE A 1 85  ? 63.749  105.684 114.697 1.00 0.00 ? 89  ILE A HB   1  
ATOM 1240   H HG12 . ILE A 1 85  ? 63.425  107.896 115.916 1.00 0.00 ? 89  ILE A HG12 1  
ATOM 1241   H HG13 . ILE A 1 85  ? 64.287  107.742 114.625 1.00 0.00 ? 89  ILE A HG13 1  
ATOM 1242   H HG21 . ILE A 1 85  ? 62.048  105.068 113.407 1.00 0.00 ? 89  ILE A HG21 1  
ATOM 1243   H HG22 . ILE A 1 85  ? 61.102  106.212 113.959 1.00 0.00 ? 89  ILE A HG22 1  
ATOM 1244   H HG23 . ILE A 1 85  ? 62.271  106.569 112.952 1.00 0.00 ? 89  ILE A HG23 1  
ATOM 1245   H HD11 . ILE A 1 85  ? 62.475  109.542 114.818 1.00 0.00 ? 89  ILE A HD11 1  
ATOM 1246   H HD12 . ILE A 1 85  ? 62.913  108.968 113.408 1.00 0.00 ? 89  ILE A HD12 1  
ATOM 1247   H HD13 . ILE A 1 85  ? 61.622  108.400 114.128 1.00 0.00 ? 89  ILE A HD13 1  
ATOM 1248   N N    . LYS A 1 86  ? 60.483  104.231 115.614 1.00 0.00 ? 90  LYS A N    1  
ATOM 1249   C CA   . LYS A 1 86  ? 59.846  102.953 115.333 1.00 0.00 ? 90  LYS A CA   1  
ATOM 1250   C C    . LYS A 1 86  ? 60.380  102.416 114.012 1.00 0.00 ? 90  LYS A C    1  
ATOM 1251   O O    . LYS A 1 86  ? 60.491  103.159 113.028 1.00 0.00 ? 90  LYS A O    1  
ATOM 1252   C CB   . LYS A 1 86  ? 58.324  103.082 115.317 1.00 0.00 ? 90  LYS A CB   1  
ATOM 1253   C CG   . LYS A 1 86  ? 57.777  103.572 116.646 1.00 0.00 ? 90  LYS A CG   1  
ATOM 1254   C CD   . LYS A 1 86  ? 56.300  103.907 116.593 1.00 0.00 ? 90  LYS A CD   1  
ATOM 1255   C CE   . LYS A 1 86  ? 56.068  105.338 116.194 1.00 0.00 ? 90  LYS A CE   1  
ATOM 1256   N NZ   . LYS A 1 86  ? 55.042  105.459 115.127 1.00 0.00 ? 90  LYS A NZ   1  
ATOM 1257   H H    . LYS A 1 86  ? 59.965  104.911 115.520 1.00 0.00 ? 90  LYS A H    1  
ATOM 1258   H HA   . LYS A 1 86  ? 60.062  102.324 116.039 1.00 0.00 ? 90  LYS A HA   1  
ATOM 1259   H HB2  . LYS A 1 86  ? 58.061  103.697 114.614 1.00 0.00 ? 90  LYS A HB2  1  
ATOM 1260   H HB3  . LYS A 1 86  ? 57.930  102.222 115.103 1.00 0.00 ? 90  LYS A HB3  1  
ATOM 1261   H HG2  . LYS A 1 86  ? 57.925  102.891 117.321 1.00 0.00 ? 90  LYS A HG2  1  
ATOM 1262   H HG3  . LYS A 1 86  ? 58.272  104.358 116.924 1.00 0.00 ? 90  LYS A HG3  1  
ATOM 1263   H HD2  . LYS A 1 86  ? 55.858  103.319 115.961 1.00 0.00 ? 90  LYS A HD2  1  
ATOM 1264   H HD3  . LYS A 1 86  ? 55.900  103.744 117.461 1.00 0.00 ? 90  LYS A HD3  1  
ATOM 1265   H HE2  . LYS A 1 86  ? 55.787  105.848 116.971 1.00 0.00 ? 90  LYS A HE2  1  
ATOM 1266   H HE3  . LYS A 1 86  ? 56.902  105.726 115.886 1.00 0.00 ? 90  LYS A HE3  1  
ATOM 1267   H HZ1  . LYS A 1 86  ? 55.097  104.759 114.581 1.00 0.00 ? 90  LYS A HZ1  1  
ATOM 1268   H HZ2  . LYS A 1 86  ? 54.232  105.483 115.496 1.00 0.00 ? 90  LYS A HZ2  1  
ATOM 1269   H HZ3  . LYS A 1 86  ? 55.180  106.207 114.665 1.00 0.00 ? 90  LYS A HZ3  1  
ATOM 1270   N N    . PHE A 1 87  ? 60.689  101.121 114.003 1.00 0.00 ? 91  PHE A N    1  
ATOM 1271   C CA   . PHE A 1 87  ? 61.475  100.467 112.965 1.00 0.00 ? 91  PHE A CA   1  
ATOM 1272   C C    . PHE A 1 87  ? 60.624  99.433  112.240 1.00 0.00 ? 91  PHE A C    1  
ATOM 1273   O O    . PHE A 1 87  ? 60.130  98.480  112.858 1.00 0.00 ? 91  PHE A O    1  
ATOM 1274   C CB   . PHE A 1 87  ? 62.709  99.808  113.578 1.00 0.00 ? 91  PHE A CB   1  
ATOM 1275   C CG   . PHE A 1 87  ? 63.770  99.464  112.584 1.00 0.00 ? 91  PHE A CG   1  
ATOM 1276   C CD1  . PHE A 1 87  ? 65.065  99.894  112.765 1.00 0.00 ? 91  PHE A CD1  1  
ATOM 1277   C CD2  . PHE A 1 87  ? 63.474  98.693  111.475 1.00 0.00 ? 91  PHE A CD2  1  
ATOM 1278   C CE1  . PHE A 1 87  ? 66.050  99.578  111.855 1.00 0.00 ? 91  PHE A CE1  1  
ATOM 1279   C CE2  . PHE A 1 87  ? 64.453  98.371  110.560 1.00 0.00 ? 91  PHE A CE2  1  
ATOM 1280   C CZ   . PHE A 1 87  ? 65.744  98.813  110.753 1.00 0.00 ? 91  PHE A CZ   1  
ATOM 1281   H H    . PHE A 1 87  ? 60.437  100.581 114.623 1.00 0.00 ? 91  PHE A H    1  
ATOM 1282   H HA   . PHE A 1 87  ? 61.768  101.132 112.323 1.00 0.00 ? 91  PHE A HA   1  
ATOM 1283   H HB2  . PHE A 1 87  ? 63.084  100.405 114.245 1.00 0.00 ? 91  PHE A HB2  1  
ATOM 1284   H HB3  . PHE A 1 87  ? 62.437  99.000  114.040 1.00 0.00 ? 91  PHE A HB3  1  
ATOM 1285   H HD1  . PHE A 1 87  ? 65.279  100.405 113.512 1.00 0.00 ? 91  PHE A HD1  1  
ATOM 1286   H HD2  . PHE A 1 87  ? 62.605  98.388  111.345 1.00 0.00 ? 91  PHE A HD2  1  
ATOM 1287   H HE1  . PHE A 1 87  ? 66.920  99.880  111.985 1.00 0.00 ? 91  PHE A HE1  1  
ATOM 1288   H HE2  . PHE A 1 87  ? 64.244  97.856  109.815 1.00 0.00 ? 91  PHE A HE2  1  
ATOM 1289   H HZ   . PHE A 1 87  ? 66.407  98.596  110.138 1.00 0.00 ? 91  PHE A HZ   1  
ATOM 1290   N N    . TRP A 1 88  ? 60.491  99.610  110.927 1.00 0.00 ? 92  TRP A N    1  
ATOM 1291   C CA   . TRP A 1 88  ? 59.704  98.742  110.060 1.00 0.00 ? 92  TRP A CA   1  
ATOM 1292   C C    . TRP A 1 88  ? 60.573  98.329  108.880 1.00 0.00 ? 92  TRP A C    1  
ATOM 1293   O O    . TRP A 1 88  ? 61.180  99.185  108.229 1.00 0.00 ? 92  TRP A O    1  
ATOM 1294   C CB   . TRP A 1 88  ? 58.458  99.468  109.546 1.00 0.00 ? 92  TRP A CB   1  
ATOM 1295   C CG   . TRP A 1 88  ? 57.674  100.252 110.555 1.00 0.00 ? 92  TRP A CG   1  
ATOM 1296   C CD1  . TRP A 1 88  ? 58.012  101.460 111.088 1.00 0.00 ? 92  TRP A CD1  1  
ATOM 1297   C CD2  . TRP A 1 88  ? 56.379  99.932  111.080 1.00 0.00 ? 92  TRP A CD2  1  
ATOM 1298   N NE1  . TRP A 1 88  ? 57.033  101.889 111.948 1.00 0.00 ? 92  TRP A NE1  1  
ATOM 1299   C CE2  . TRP A 1 88  ? 56.015  100.972 111.957 1.00 0.00 ? 92  TRP A CE2  1  
ATOM 1300   C CE3  . TRP A 1 88  ? 55.501  98.858  110.907 1.00 0.00 ? 92  TRP A CE3  1  
ATOM 1301   C CZ2  . TRP A 1 88  ? 54.815  100.971 112.660 1.00 0.00 ? 92  TRP A CZ2  1  
ATOM 1302   C CZ3  . TRP A 1 88  ? 54.310  98.858  111.608 1.00 0.00 ? 92  TRP A CZ3  1  
ATOM 1303   C CH2  . TRP A 1 88  ? 53.978  99.907  112.475 1.00 0.00 ? 92  TRP A CH2  1  
ATOM 1304   H H    . TRP A 1 88  ? 60.868  100.258 110.507 1.00 0.00 ? 92  TRP A H    1  
ATOM 1305   H HA   . TRP A 1 88  ? 59.415  97.963  110.562 1.00 0.00 ? 92  TRP A HA   1  
ATOM 1306   H HB2  . TRP A 1 88  ? 58.730  100.073 108.837 1.00 0.00 ? 92  TRP A HB2  1  
ATOM 1307   H HB3  . TRP A 1 88  ? 57.867  98.810  109.146 1.00 0.00 ? 92  TRP A HB3  1  
ATOM 1308   H HD1  . TRP A 1 88  ? 58.793  101.925 110.898 1.00 0.00 ? 92  TRP A HD1  1  
ATOM 1309   H HE1  . TRP A 1 88  ? 57.054  102.617 112.406 1.00 0.00 ? 92  TRP A HE1  1  
ATOM 1310   H HE3  . TRP A 1 88  ? 55.714  98.158  110.334 1.00 0.00 ? 92  TRP A HE3  1  
ATOM 1311   H HZ2  . TRP A 1 88  ? 54.591  101.667 113.235 1.00 0.00 ? 92  TRP A HZ2  1  
ATOM 1312   H HZ3  . TRP A 1 88  ? 53.718  98.148  111.502 1.00 0.00 ? 92  TRP A HZ3  1  
ATOM 1313   H HH2  . TRP A 1 88  ? 53.170  99.878  112.935 1.00 0.00 ? 92  TRP A HH2  1  
ATOM 1314   N N    . ARG A 1 89  ? 60.628  97.028  108.596 1.00 0.00 ? 93  ARG A N    1  
ATOM 1315   C CA   . ARG A 1 89  ? 61.294  96.525  107.391 1.00 0.00 ? 93  ARG A CA   1  
ATOM 1316   C C    . ARG A 1 89  ? 60.340  95.557  106.704 1.00 0.00 ? 93  ARG A C    1  
ATOM 1317   O O    . ARG A 1 89  ? 60.011  94.495  107.232 1.00 0.00 ? 93  ARG A O    1  
ATOM 1318   C CB   . ARG A 1 89  ? 62.621  95.854  107.718 1.00 0.00 ? 93  ARG A CB   1  
ATOM 1319   C CG   . ARG A 1 89  ? 62.451  94.693  108.676 1.00 0.00 ? 93  ARG A CG   1  
ATOM 1320   C CD   . ARG A 1 89  ? 63.696  93.873  108.853 1.00 0.00 ? 93  ARG A CD   1  
ATOM 1321   N NE   . ARG A 1 89  ? 63.923  93.063  107.665 1.00 0.00 ? 93  ARG A NE   1  
ATOM 1322   C CZ   . ARG A 1 89  ? 65.042  92.390  107.429 1.00 0.00 ? 93  ARG A CZ   1  
ATOM 1323   N NH1  . ARG A 1 89  ? 66.044  92.445  108.292 1.00 0.00 ? 93  ARG A NH1  1  
ATOM 1324   N NH2  . ARG A 1 89  ? 65.159  91.676  106.321 1.00 0.00 ? 93  ARG A NH2  1  
ATOM 1325   H H    . ARG A 1 89  ? 60.284  96.415  109.090 1.00 0.00 ? 93  ARG A H    1  
ATOM 1326   H HA   . ARG A 1 89  ? 61.504  97.266  106.800 1.00 0.00 ? 93  ARG A HA   1  
ATOM 1327   H HB2  . ARG A 1 89  ? 63.033  95.539  106.899 1.00 0.00 ? 93  ARG A HB2  1  
ATOM 1328   H HB3  . ARG A 1 89  ? 63.225  96.506  108.106 1.00 0.00 ? 93  ARG A HB3  1  
ATOM 1329   H HG2  . ARG A 1 89  ? 62.172  95.035  109.540 1.00 0.00 ? 93  ARG A HG2  1  
ATOM 1330   H HG3  . ARG A 1 89  ? 61.738  94.120  108.354 1.00 0.00 ? 93  ARG A HG3  1  
ATOM 1331   H HD2  . ARG A 1 89  ? 64.457  94.454  109.008 1.00 0.00 ? 93  ARG A HD2  1  
ATOM 1332   H HD3  . ARG A 1 89  ? 63.610  93.303  109.632 1.00 0.00 ? 93  ARG A HD3  1  
ATOM 1333   H HE   . ARG A 1 89  ? 63.293  93.017  107.081 1.00 0.00 ? 93  ARG A HE   1  
ATOM 1334   H HH11 . ARG A 1 89  ? 65.971  92.917  109.007 1.00 0.00 ? 93  ARG A HH11 1  
ATOM 1335   H HH12 . ARG A 1 89  ? 66.769  92.008  108.138 1.00 0.00 ? 93  ARG A HH12 1  
ATOM 1336   H HH21 . ARG A 1 89  ? 64.511  91.649  105.756 1.00 0.00 ? 93  ARG A HH21 1  
ATOM 1337   H HH22 . ARG A 1 89  ? 65.883  91.239  106.166 1.00 0.00 ? 93  ARG A HH22 1  
ATOM 1338   N N    . VAL A 1 90  ? 59.903  95.911  105.504 1.00 0.00 ? 94  VAL A N    1  
ATOM 1339   C CA   . VAL A 1 90  ? 58.881  95.132  104.829 1.00 0.00 ? 94  VAL A CA   1  
ATOM 1340   C C    . VAL A 1 90  ? 59.388  94.714  103.458 1.00 0.00 ? 94  VAL A C    1  
ATOM 1341   O O    . VAL A 1 90  ? 60.408  95.205  102.952 1.00 0.00 ? 94  VAL A O    1  
ATOM 1342   C CB   . VAL A 1 90  ? 57.550  95.897  104.705 1.00 0.00 ? 94  VAL A CB   1  
ATOM 1343   C CG1  . VAL A 1 90  ? 57.331  96.771  105.925 1.00 0.00 ? 94  VAL A CG1  1  
ATOM 1344   C CG2  . VAL A 1 90  ? 57.523  96.718  103.434 1.00 0.00 ? 94  VAL A CG2  1  
ATOM 1345   H H    . VAL A 1 90  ? 60.185  96.595  105.066 1.00 0.00 ? 94  VAL A H    1  
ATOM 1346   H HA   . VAL A 1 90  ? 58.701  94.343  105.365 1.00 0.00 ? 94  VAL A HA   1  
ATOM 1347   H HB   . VAL A 1 90  ? 56.826  95.253  104.659 1.00 0.00 ? 94  VAL A HB   1  
ATOM 1348   H HG11 . VAL A 1 90  ? 57.742  97.637  105.780 1.00 0.00 ? 94  VAL A HG11 1  
ATOM 1349   H HG12 . VAL A 1 90  ? 56.379  96.886  106.073 1.00 0.00 ? 94  VAL A HG12 1  
ATOM 1350   H HG13 . VAL A 1 90  ? 57.730  96.348  106.702 1.00 0.00 ? 94  VAL A HG13 1  
ATOM 1351   H HG21 . VAL A 1 90  ? 58.410  97.070  103.256 1.00 0.00 ? 94  VAL A HG21 1  
ATOM 1352   H HG22 . VAL A 1 90  ? 57.242  96.159  102.693 1.00 0.00 ? 94  VAL A HG22 1  
ATOM 1353   H HG23 . VAL A 1 90  ? 56.899  97.454  103.537 1.00 0.00 ? 94  VAL A HG23 1  
ATOM 1354   N N    . ASP A 1 91  ? 58.648  93.796  102.848 1.00 0.00 ? 95  ASP A N    1  
ATOM 1355   C CA   . ASP A 1 91  ? 58.982  93.300  101.527 1.00 0.00 ? 95  ASP A CA   1  
ATOM 1356   C C    . ASP A 1 91  ? 58.000  93.829  100.492 1.00 0.00 ? 95  ASP A C    1  
ATOM 1357   O O    . ASP A 1 91  ? 56.790  93.907  100.721 1.00 0.00 ? 95  ASP A O    1  
ATOM 1358   C CB   . ASP A 1 91  ? 59.015  91.771  101.505 1.00 0.00 ? 95  ASP A CB   1  
ATOM 1359   C CG   . ASP A 1 91  ? 60.217  91.235  100.761 1.00 0.00 ? 95  ASP A CG   1  
ATOM 1360   O OD1  . ASP A 1 91  ? 61.194  91.990  100.609 1.00 0.00 ? 95  ASP A OD1  1  
ATOM 1361   O OD2  . ASP A 1 91  ? 60.175  90.077  100.298 1.00 0.00 ? 95  ASP A OD2  1  
ATOM 1362   H H    . ASP A 1 91  ? 57.941  93.445  103.191 1.00 0.00 ? 95  ASP A H    1  
ATOM 1363   H HA   . ASP A 1 91  ? 59.869  93.623  101.302 1.00 0.00 ? 95  ASP A HA   1  
ATOM 1364   H HB2  . ASP A 1 91  ? 59.026  91.437  102.416 1.00 0.00 ? 95  ASP A HB2  1  
ATOM 1365   H HB3  . ASP A 1 91  ? 58.204  91.437  101.090 1.00 0.00 ? 95  ASP A HB3  1  
ATOM 1366   N N    . THR A 1 92  ? 58.550  94.207  99.339  1.00 0.00 ? 96  THR A N    1  
ATOM 1367   C CA   . THR A 1 92  ? 57.789  94.801  98.249  1.00 0.00 ? 96  THR A CA   1  
ATOM 1368   C C    . THR A 1 92  ? 56.854  93.803  97.574  1.00 0.00 ? 96  THR A C    1  
ATOM 1369   O O    . THR A 1 92  ? 55.789  94.196  97.091  1.00 0.00 ? 96  THR A O    1  
ATOM 1370   C CB   . THR A 1 92  ? 58.758  95.398  97.213  1.00 0.00 ? 96  THR A CB   1  
ATOM 1371   O OG1  . THR A 1 92  ? 59.644  94.367  96.761  1.00 0.00 ? 96  THR A OG1  1  
ATOM 1372   C CG2  . THR A 1 92  ? 59.626  96.509  97.798  1.00 0.00 ? 96  THR A CG2  1  
ATOM 1373   H H    . THR A 1 92  ? 59.388  94.124  99.168  1.00 0.00 ? 96  THR A H    1  
ATOM 1374   H HA   . THR A 1 92  ? 57.231  95.497  98.628  1.00 0.00 ? 96  THR A HA   1  
ATOM 1375   H HB   . THR A 1 92  ? 58.218  95.766  96.495  1.00 0.00 ? 96  THR A HB   1  
ATOM 1376   H HG1  . THR A 1 92  ? 60.029  94.019  97.422  1.00 0.00 ? 96  THR A HG1  1  
ATOM 1377   H HG21 . THR A 1 92  ? 60.250  96.535  97.056  1.00 0.00 ? 96  THR A HG21 1  
ATOM 1378   H HG22 . THR A 1 92  ? 59.059  97.226  98.125  1.00 0.00 ? 96  THR A HG22 1  
ATOM 1379   H HG23 . THR A 1 92  ? 60.153  96.156  98.532  1.00 0.00 ? 96  THR A HG23 1  
ATOM 1380   N N    . VAL A 1 93  ? 57.213  92.517  97.562  1.00 0.00 ? 97  VAL A N    1  
ATOM 1381   C CA   . VAL A 1 93  ? 56.337  91.500  96.997  1.00 0.00 ? 97  VAL A CA   1  
ATOM 1382   C C    . VAL A 1 93  ? 55.068  91.383  97.834  1.00 0.00 ? 97  VAL A C    1  
ATOM 1383   O O    . VAL A 1 93  ? 55.109  91.304  99.069  1.00 0.00 ? 97  VAL A O    1  
ATOM 1384   C CB   . VAL A 1 93  ? 57.065  90.147  96.898  1.00 0.00 ? 97  VAL A CB   1  
ATOM 1385   C CG1  . VAL A 1 93  ? 57.425  89.640  98.282  1.00 0.00 ? 97  VAL A CG1  1  
ATOM 1386   C CG2  . VAL A 1 93  ? 56.207  89.127  96.161  1.00 0.00 ? 97  VAL A CG2  1  
ATOM 1387   H H    . VAL A 1 93  ? 57.955  92.219  97.877  1.00 0.00 ? 97  VAL A H    1  
ATOM 1388   H HA   . VAL A 1 93  ? 56.087  91.764  96.097  1.00 0.00 ? 97  VAL A HA   1  
ATOM 1389   H HB   . VAL A 1 93  ? 57.884  90.274  96.393  1.00 0.00 ? 97  VAL A HB   1  
ATOM 1390   H HG11 . VAL A 1 93  ? 58.363  89.816  98.458  1.00 0.00 ? 97  VAL A HG11 1  
ATOM 1391   H HG12 . VAL A 1 93  ? 56.882  90.095  98.945  1.00 0.00 ? 97  VAL A HG12 1  
ATOM 1392   H HG13 . VAL A 1 93  ? 57.262  88.684  98.330  1.00 0.00 ? 97  VAL A HG13 1  
ATOM 1393   H HG21 . VAL A 1 93  ? 56.714  88.310  96.032  1.00 0.00 ? 97  VAL A HG21 1  
ATOM 1394   H HG22 . VAL A 1 93  ? 55.412  88.936  96.682  1.00 0.00 ? 97  VAL A HG22 1  
ATOM 1395   H HG23 . VAL A 1 93  ? 55.949  89.486  95.297  1.00 0.00 ? 97  VAL A HG23 1  
ATOM 1396   N N    . LYS A 1 94  ? 53.927  91.388  97.156  1.00 0.00 ? 98  LYS A N    1  
ATOM 1397   C CA   . LYS A 1 94  ? 52.632  91.405  97.822  1.00 0.00 ? 98  LYS A CA   1  
ATOM 1398   C C    . LYS A 1 94  ? 52.452  90.133  98.642  1.00 0.00 ? 98  LYS A C    1  
ATOM 1399   O O    . LYS A 1 94  ? 52.720  89.029  98.154  1.00 0.00 ? 98  LYS A O    1  
ATOM 1400   C CB   . LYS A 1 94  ? 51.506  91.557  96.802  1.00 0.00 ? 98  LYS A CB   1  
ATOM 1401   C CG   . LYS A 1 94  ? 50.112  91.422  97.387  1.00 0.00 ? 98  LYS A CG   1  
ATOM 1402   C CD   . LYS A 1 94  ? 49.192  92.530  96.913  1.00 0.00 ? 98  LYS A CD   1  
ATOM 1403   C CE   . LYS A 1 94  ? 49.175  93.687  97.902  1.00 0.00 ? 98  LYS A CE   1  
ATOM 1404   N NZ   . LYS A 1 94  ? 50.451  94.455  97.915  1.00 0.00 ? 98  LYS A NZ   1  
ATOM 1405   H H    . LYS A 1 94  ? 53.882  91.381  96.297  1.00 0.00 ? 98  LYS A H    1  
ATOM 1406   H HA   . LYS A 1 94  ? 52.598  92.166  98.422  1.00 0.00 ? 98  LYS A HA   1  
ATOM 1407   H HB2  . LYS A 1 94  ? 51.584  92.425  96.376  1.00 0.00 ? 98  LYS A HB2  1  
ATOM 1408   H HB3  . LYS A 1 94  ? 51.620  90.890  96.108  1.00 0.00 ? 98  LYS A HB3  1  
ATOM 1409   H HG2  . LYS A 1 94  ? 49.739  90.562  97.138  1.00 0.00 ? 98  LYS A HG2  1  
ATOM 1410   H HG3  . LYS A 1 94  ? 50.166  91.437  98.356  1.00 0.00 ? 98  LYS A HG3  1  
ATOM 1411   H HD2  . LYS A 1 94  ? 49.484  92.847  96.044  1.00 0.00 ? 98  LYS A HD2  1  
ATOM 1412   H HD3  . LYS A 1 94  ? 48.294  92.183  96.802  1.00 0.00 ? 98  LYS A HD3  1  
ATOM 1413   H HE2  . LYS A 1 94  ? 48.445  94.285  97.680  1.00 0.00 ? 98  LYS A HE2  1  
ATOM 1414   H HE3  . LYS A 1 94  ? 49.000  93.344  98.792  1.00 0.00 ? 98  LYS A HE3  1  
ATOM 1415   H HZ1  . LYS A 1 94  ? 50.571  94.846  97.124  1.00 0.00 ? 98  LYS A HZ1  1  
ATOM 1416   H HZ2  . LYS A 1 94  ? 50.416  95.076  98.551  1.00 0.00 ? 98  LYS A HZ2  1  
ATOM 1417   H HZ3  . LYS A 1 94  ? 51.129  93.902  98.077  1.00 0.00 ? 98  LYS A HZ3  1  
ATOM 1418   N N    . ASN A 1 95  ? 52.010  90.289  99.884  1.00 0.00 ? 99  ASN A N    1  
ATOM 1419   C CA   . ASN A 1 95  ? 51.631  89.155  100.709 1.00 0.00 ? 99  ASN A CA   1  
ATOM 1420   C C    . ASN A 1 95  ? 50.288  88.601  100.247 1.00 0.00 ? 99  ASN A C    1  
ATOM 1421   O O    . ASN A 1 95  ? 49.362  89.340  99.909  1.00 0.00 ? 99  ASN A O    1  
ATOM 1422   C CB   . ASN A 1 95  ? 51.573  89.555  102.182 1.00 0.00 ? 99  ASN A CB   1  
ATOM 1423   C CG   . ASN A 1 95  ? 52.097  88.469  103.095 1.00 0.00 ? 99  ASN A CG   1  
ATOM 1424   O OD1  . ASN A 1 95  ? 53.201  88.568  103.626 1.00 0.00 ? 99  ASN A OD1  1  
ATOM 1425   N ND2  . ASN A 1 95  ? 51.302  87.423  103.286 1.00 0.00 ? 99  ASN A ND2  1  
ATOM 1426   H H    . ASN A 1 95  ? 51.922  91.053  100.270 1.00 0.00 ? 99  ASN A H    1  
ATOM 1427   H HA   . ASN A 1 95  ? 52.303  88.463  100.613 1.00 0.00 ? 99  ASN A HA   1  
ATOM 1428   H HB2  . ASN A 1 95  ? 52.092  90.364  102.315 1.00 0.00 ? 99  ASN A HB2  1  
ATOM 1429   H HB3  . ASN A 1 95  ? 50.657  89.761  102.422 1.00 0.00 ? 99  ASN A HB3  1  
ATOM 1430   H HD21 . ASN A 1 95  ? 51.555  86.779  103.797 1.00 0.00 ? 99  ASN A HD21 1  
ATOM 1431   H HD22 . ASN A 1 95  ? 50.536  87.389  102.897 1.00 0.00 ? 99  ASN A HD22 1  
ATOM 1432   N N    . GLU A 1 96  ? 50.184  87.273  100.241 1.00 0.00 ? 100 GLU A N    1  
ATOM 1433   C CA   . GLU A 1 96  ? 48.980  86.608  99.764  1.00 0.00 ? 100 GLU A CA   1  
ATOM 1434   C C    . GLU A 1 96  ? 47.869  86.521  100.797 1.00 0.00 ? 100 GLU A C    1  
ATOM 1435   O O    . GLU A 1 96  ? 46.707  86.367  100.411 1.00 0.00 ? 100 GLU A O    1  
ATOM 1436   C CB   . GLU A 1 96  ? 49.320  85.201  99.255  1.00 0.00 ? 100 GLU A CB   1  
ATOM 1437   C CG   . GLU A 1 96  ? 49.272  85.080  97.734  1.00 0.00 ? 100 GLU A CG   1  
ATOM 1438   C CD   . GLU A 1 96  ? 50.443  85.739  97.033  1.00 0.00 ? 100 GLU A CD   1  
ATOM 1439   O OE1  . GLU A 1 96  ? 50.666  86.951  97.236  1.00 0.00 ? 100 GLU A OE1  1  
ATOM 1440   O OE2  . GLU A 1 96  ? 51.137  85.043  96.264  1.00 0.00 ? 100 GLU A OE2  1  
ATOM 1441   H H    . GLU A 1 96  ? 50.802  86.740  100.511 1.00 0.00 ? 100 GLU A H    1  
ATOM 1442   H HA   . GLU A 1 96  ? 48.641  87.161  99.043  1.00 0.00 ? 100 GLU A HA   1  
ATOM 1443   H HB2  . GLU A 1 96  ? 50.206  84.957  99.565  1.00 0.00 ? 100 GLU A HB2  1  
ATOM 1444   H HB3  . GLU A 1 96  ? 48.699  84.566  99.643  1.00 0.00 ? 100 GLU A HB3  1  
ATOM 1445   H HG2  . GLU A 1 96  ? 49.249  84.141  97.493  1.00 0.00 ? 100 GLU A HG2  1  
ATOM 1446   H HG3  . GLU A 1 96  ? 48.448  85.477  97.411  1.00 0.00 ? 100 GLU A HG3  1  
ATOM 1447   N N    . ASN A 1 97  ? 48.185  86.616  102.088 1.00 0.00 ? 101 ASN A N    1  
ATOM 1448   C CA   . ASN A 1 97  ? 47.134  86.774  103.086 1.00 0.00 ? 101 ASN A CA   1  
ATOM 1449   C C    . ASN A 1 97  ? 47.407  87.985  103.975 1.00 0.00 ? 101 ASN A C    1  
ATOM 1450   O O    . ASN A 1 97  ? 46.929  88.053  105.113 1.00 0.00 ? 101 ASN A O    1  
ATOM 1451   C CB   . ASN A 1 97  ? 46.972  85.480  103.894 1.00 0.00 ? 101 ASN A CB   1  
ATOM 1452   C CG   . ASN A 1 97  ? 46.157  84.423  103.173 1.00 0.00 ? 101 ASN A CG   1  
ATOM 1453   O OD1  . ASN A 1 97  ? 46.702  83.557  102.487 1.00 0.00 ? 101 ASN A OD1  1  
ATOM 1454   N ND2  . ASN A 1 97  ? 44.842  84.484  103.337 1.00 0.00 ? 101 ASN A ND2  1  
ATOM 1455   H H    . ASN A 1 97  ? 48.987  86.591  102.400 1.00 0.00 ? 101 ASN A H    1  
ATOM 1456   H HA   . ASN A 1 97  ? 46.292  86.943  102.635 1.00 0.00 ? 101 ASN A HA   1  
ATOM 1457   H HB2  . ASN A 1 97  ? 47.850  85.120  104.098 1.00 0.00 ? 101 ASN A HB2  1  
ATOM 1458   H HB3  . ASN A 1 97  ? 46.546  85.686  104.741 1.00 0.00 ? 101 ASN A HB3  1  
ATOM 1459   H HD21 . ASN A 1 97  ? 44.333  83.903  102.957 1.00 0.00 ? 101 ASN A HD21 1  
ATOM 1460   H HD22 . ASN A 1 97  ? 44.497  85.104  103.823 1.00 0.00 ? 101 ASN A HD22 1  
ATOM 1461   N N    . ASP A 1 98  ? 48.162  88.953  103.470 1.00 0.00 ? 102 ASP A N    1  
ATOM 1462   C CA   . ASP A 1 98  ? 48.282  90.254  104.105 1.00 0.00 ? 102 ASP A CA   1  
ATOM 1463   C C    . ASP A 1 98  ? 48.618  91.280  103.028 1.00 0.00 ? 102 ASP A C    1  
ATOM 1464   O O    . ASP A 1 98  ? 48.908  90.937  101.880 1.00 0.00 ? 102 ASP A O    1  
ATOM 1465   C CB   . ASP A 1 98  ? 49.339  90.226  105.210 1.00 0.00 ? 102 ASP A CB   1  
ATOM 1466   C CG   . ASP A 1 98  ? 49.303  91.460  106.090 1.00 0.00 ? 102 ASP A CG   1  
ATOM 1467   O OD1  . ASP A 1 98  ? 50.375  91.879  106.570 1.00 0.00 ? 102 ASP A OD1  1  
ATOM 1468   O OD2  . ASP A 1 98  ? 48.203  92.004  106.310 1.00 0.00 ? 102 ASP A OD2  1  
ATOM 1469   H H    . ASP A 1 98  ? 48.619  88.872  102.747 1.00 0.00 ? 102 ASP A H    1  
ATOM 1470   H HA   . ASP A 1 98  ? 47.445  90.497  104.530 1.00 0.00 ? 102 ASP A HA   1  
ATOM 1471   H HB2  . ASP A 1 98  ? 49.205  89.438  105.759 1.00 0.00 ? 102 ASP A HB2  1  
ATOM 1472   H HB3  . ASP A 1 98  ? 50.218  90.146  104.809 1.00 0.00 ? 102 ASP A HB3  1  
ATOM 1473   N N    . LYS A 1 99  ? 48.585  92.557  103.392 1.00 0.00 ? 103 LYS A N    1  
ATOM 1474   C CA   . LYS A 1 99  ? 49.052  93.609  102.503 1.00 0.00 ? 103 LYS A CA   1  
ATOM 1475   C C    . LYS A 1 99  ? 50.491  93.350  102.077 1.00 0.00 ? 103 LYS A C    1  
ATOM 1476   O O    . LYS A 1 99  ? 50.776  93.154  100.891 1.00 0.00 ? 103 LYS A O    1  
ATOM 1477   C CB   . LYS A 1 99  ? 48.939  94.965  103.200 1.00 0.00 ? 103 LYS A CB   1  
ATOM 1478   C CG   . LYS A 1 99  ? 47.515  95.389  103.491 1.00 0.00 ? 103 LYS A CG   1  
ATOM 1479   C CD   . LYS A 1 99  ? 47.241  95.354  104.980 1.00 0.00 ? 103 LYS A CD   1  
ATOM 1480   C CE   . LYS A 1 99  ? 46.316  94.213  105.348 1.00 0.00 ? 103 LYS A CE   1  
ATOM 1481   N NZ   . LYS A 1 99  ? 44.896  94.658  105.363 1.00 0.00 ? 103 LYS A NZ   1  
ATOM 1482   H H    . LYS A 1 99  ? 48.294  92.835  104.153 1.00 0.00 ? 103 LYS A H    1  
ATOM 1483   H HA   . LYS A 1 99  ? 48.496  93.615  101.708 1.00 0.00 ? 103 LYS A HA   1  
ATOM 1484   H HB2  . LYS A 1 99  ? 49.434  94.933  104.033 1.00 0.00 ? 103 LYS A HB2  1  
ATOM 1485   H HB3  . LYS A 1 99  ? 49.361  95.640  102.645 1.00 0.00 ? 103 LYS A HB3  1  
ATOM 1486   H HG2  . LYS A 1 99  ? 47.363  96.285  103.151 1.00 0.00 ? 103 LYS A HG2  1  
ATOM 1487   H HG3  . LYS A 1 99  ? 46.896  94.801  103.030 1.00 0.00 ? 103 LYS A HG3  1  
ATOM 1488   H HD2  . LYS A 1 99  ? 48.078  95.261  105.462 1.00 0.00 ? 103 LYS A HD2  1  
ATOM 1489   H HD3  . LYS A 1 99  ? 46.846  96.195  105.258 1.00 0.00 ? 103 LYS A HD3  1  
ATOM 1490   H HE2  . LYS A 1 99  ? 46.424  93.488  104.713 1.00 0.00 ? 103 LYS A HE2  1  
ATOM 1491   H HE3  . LYS A 1 99  ? 46.558  93.865  106.220 1.00 0.00 ? 103 LYS A HE3  1  
ATOM 1492   H HZ1  . LYS A 1 99  ? 44.767  95.263  104.723 1.00 0.00 ? 103 LYS A HZ1  1  
ATOM 1493   H HZ2  . LYS A 1 99  ? 44.364  93.958  105.220 1.00 0.00 ? 103 LYS A HZ2  1  
ATOM 1494   H HZ3  . LYS A 1 99  ? 44.706  95.018  106.154 1.00 0.00 ? 103 LYS A HZ3  1  
ATOM 1495   N N    . TYR A 1 100 ? 51.399  93.337  103.045 1.00 0.00 ? 104 TYR A N    1  
ATOM 1496   C CA   . TYR A 1 100 ? 52.810  93.086  102.826 1.00 0.00 ? 104 TYR A CA   1  
ATOM 1497   C C    . TYR A 1 100 ? 53.320  92.280  104.014 1.00 0.00 ? 104 TYR A C    1  
ATOM 1498   O O    . TYR A 1 100 ? 52.560  91.937  104.924 1.00 0.00 ? 104 TYR A O    1  
ATOM 1499   C CB   . TYR A 1 100 ? 53.571  94.406  102.659 1.00 0.00 ? 104 TYR A CB   1  
ATOM 1500   C CG   . TYR A 1 100 ? 53.546  94.930  101.239 1.00 0.00 ? 104 TYR A CG   1  
ATOM 1501   C CD1  . TYR A 1 100 ? 53.534  94.067  100.151 1.00 0.00 ? 104 TYR A CD1  1  
ATOM 1502   C CD2  . TYR A 1 100 ? 53.515  96.297  100.990 1.00 0.00 ? 104 TYR A CD2  1  
ATOM 1503   C CE1  . TYR A 1 100 ? 53.504  94.551  98.856  1.00 0.00 ? 104 TYR A CE1  1  
ATOM 1504   C CE2  . TYR A 1 100 ? 53.485  96.791  99.699  1.00 0.00 ? 104 TYR A CE2  1  
ATOM 1505   C CZ   . TYR A 1 100 ? 53.481  95.913  98.639  1.00 0.00 ? 104 TYR A CZ   1  
ATOM 1506   O OH   . TYR A 1 100 ? 53.451  96.397  97.353  1.00 0.00 ? 104 TYR A OH   1  
ATOM 1507   H H    . TYR A 1 100 ? 51.202  93.479  103.870 1.00 0.00 ? 104 TYR A H    1  
ATOM 1508   H HA   . TYR A 1 100 ? 52.951  92.583  102.008 1.00 0.00 ? 104 TYR A HA   1  
ATOM 1509   H HB2  . TYR A 1 100 ? 53.187  95.072  103.251 1.00 0.00 ? 104 TYR A HB2  1  
ATOM 1510   H HB3  . TYR A 1 100 ? 54.493  94.280  102.935 1.00 0.00 ? 104 TYR A HB3  1  
ATOM 1511   H HD1  . TYR A 1 100 ? 53.546  93.148  100.295 1.00 0.00 ? 104 TYR A HD1  1  
ATOM 1512   H HD2  . TYR A 1 100 ? 53.513  96.891  101.706 1.00 0.00 ? 104 TYR A HD2  1  
ATOM 1513   H HE1  . TYR A 1 100 ? 53.501  93.963  98.135  1.00 0.00 ? 104 TYR A HE1  1  
ATOM 1514   H HE2  . TYR A 1 100 ? 53.468  97.708  99.549  1.00 0.00 ? 104 TYR A HE2  1  
ATOM 1515   H HH   . TYR A 1 100 ? 54.192  96.749  97.169  1.00 0.00 ? 104 TYR A HH   1  
ATOM 1516   N N    . ASP A 1 101 ? 54.612  91.973  104.013 1.00 0.00 ? 105 ASP A N    1  
ATOM 1517   C CA   . ASP A 1 101 ? 55.213  91.247  105.123 1.00 0.00 ? 105 ASP A CA   1  
ATOM 1518   C C    . ASP A 1 101 ? 56.377  92.050  105.683 1.00 0.00 ? 105 ASP A C    1  
ATOM 1519   O O    . ASP A 1 101 ? 57.169  92.646  104.944 1.00 0.00 ? 105 ASP A O    1  
ATOM 1520   C CB   . ASP A 1 101 ? 55.640  89.835  104.706 1.00 0.00 ? 105 ASP A CB   1  
ATOM 1521   C CG   . ASP A 1 101 ? 56.450  89.827  103.435 1.00 0.00 ? 105 ASP A CG   1  
ATOM 1522   O OD1  . ASP A 1 101 ? 57.686  89.702  103.527 1.00 0.00 ? 105 ASP A OD1  1  
ATOM 1523   O OD2  . ASP A 1 101 ? 55.854  89.945  102.346 1.00 0.00 ? 105 ASP A OD2  1  
ATOM 1524   H H    . ASP A 1 101 ? 55.158  92.176  103.379 1.00 0.00 ? 105 ASP A H    1  
ATOM 1525   H HA   . ASP A 1 101 ? 54.550  91.136  105.823 1.00 0.00 ? 105 ASP A HA   1  
ATOM 1526   H HB2  . ASP A 1 101 ? 56.160  89.434  105.419 1.00 0.00 ? 105 ASP A HB2  1  
ATOM 1527   H HB3  . ASP A 1 101 ? 54.850  89.284  104.585 1.00 0.00 ? 105 ASP A HB3  1  
ATOM 1528   N N    . ALA A 1 102 ? 56.479  92.043  107.010 1.00 0.00 ? 106 ALA A N    1  
ATOM 1529   C CA   . ALA A 1 102 ? 57.299  93.020  107.705 1.00 0.00 ? 106 ALA A CA   1  
ATOM 1530   C C    . ALA A 1 102 ? 58.049  92.354  108.846 1.00 0.00 ? 106 ALA A C    1  
ATOM 1531   O O    . ALA A 1 102 ? 57.683  91.272  109.313 1.00 0.00 ? 106 ALA A O    1  
ATOM 1532   C CB   . ALA A 1 102 ? 56.435  94.165  108.251 1.00 0.00 ? 106 ALA A CB   1  
ATOM 1533   H H    . ALA A 1 102 ? 56.080  91.479  107.522 1.00 0.00 ? 106 ALA A H    1  
ATOM 1534   H HA   . ALA A 1 102 ? 57.936  93.388  107.073 1.00 0.00 ? 106 ALA A HA   1  
ATOM 1535   H HB1  . ALA A 1 102 ? 55.681  93.798  108.738 1.00 0.00 ? 106 ALA A HB1  1  
ATOM 1536   H HB2  . ALA A 1 102 ? 56.967  94.716  108.846 1.00 0.00 ? 106 ALA A HB2  1  
ATOM 1537   H HB3  . ALA A 1 102 ? 56.111  94.706  107.514 1.00 0.00 ? 106 ALA A HB3  1  
ATOM 1538   N N    . GLN A 1 103 ? 59.113  93.021  109.282 1.00 0.00 ? 107 GLN A N    1  
ATOM 1539   C CA   . GLN A 1 103 ? 59.675  92.846  110.613 1.00 0.00 ? 107 GLN A CA   1  
ATOM 1540   C C    . GLN A 1 103 ? 59.716  94.227  111.253 1.00 0.00 ? 107 GLN A C    1  
ATOM 1541   O O    . GLN A 1 103 ? 60.032  95.216  110.584 1.00 0.00 ? 107 GLN A O    1  
ATOM 1542   C CB   . GLN A 1 103 ? 61.060  92.200  110.562 1.00 0.00 ? 107 GLN A CB   1  
ATOM 1543   C CG   . GLN A 1 103 ? 61.851  92.339  111.867 1.00 0.00 ? 107 GLN A CG   1  
ATOM 1544   C CD   . GLN A 1 103 ? 63.192  91.617  111.840 1.00 0.00 ? 107 GLN A CD   1  
ATOM 1545   O OE1  . GLN A 1 103 ? 63.759  91.376  110.776 1.00 0.00 ? 107 GLN A OE1  1  
ATOM 1546   N NE2  . GLN A 1 103 ? 63.701  91.269  113.013 1.00 0.00 ? 107 GLN A NE2  1  
ATOM 1547   H H    . GLN A 1 103 ? 59.533  93.598  108.803 1.00 0.00 ? 107 GLN A H    1  
ATOM 1548   H HA   . GLN A 1 103 ? 59.128  92.242  111.139 1.00 0.00 ? 107 GLN A HA   1  
ATOM 1549   H HB2  . GLN A 1 103 ? 60.963  91.259  110.352 1.00 0.00 ? 107 GLN A HB2  1  
ATOM 1550   H HB3  . GLN A 1 103 ? 61.569  92.602  109.840 1.00 0.00 ? 107 GLN A HB3  1  
ATOM 1551   H HG2  . GLN A 1 103 ? 62.002  93.281  112.048 1.00 0.00 ? 107 GLN A HG2  1  
ATOM 1552   H HG3  . GLN A 1 103 ? 61.319  91.991  112.599 1.00 0.00 ? 107 GLN A HG3  1  
ATOM 1553   H HE21 . GLN A 1 103 ? 63.277  91.454  113.738 1.00 0.00 ? 107 GLN A HE21 1  
ATOM 1554   H HE22 . GLN A 1 103 ? 64.456  90.858  113.049 1.00 0.00 ? 107 GLN A HE22 1  
ATOM 1555   N N    . PHE A 1 104 ? 59.379  94.290  112.537 1.00 0.00 ? 108 PHE A N    1  
ATOM 1556   C CA   . PHE A 1 104 ? 59.027  95.530  113.213 1.00 0.00 ? 108 PHE A CA   1  
ATOM 1557   C C    . PHE A 1 104 ? 59.771  95.643  114.535 1.00 0.00 ? 108 PHE A C    1  
ATOM 1558   O O    . PHE A 1 104 ? 60.069  94.636  115.182 1.00 0.00 ? 108 PHE A O    1  
ATOM 1559   C CB   . PHE A 1 104 ? 57.500  95.583  113.440 1.00 0.00 ? 108 PHE A CB   1  
ATOM 1560   C CG   . PHE A 1 104 ? 57.032  96.776  114.221 1.00 0.00 ? 108 PHE A CG   1  
ATOM 1561   C CD1  . PHE A 1 104 ? 57.406  98.058  113.854 1.00 0.00 ? 108 PHE A CD1  1  
ATOM 1562   C CD2  . PHE A 1 104 ? 56.217  96.611  115.330 1.00 0.00 ? 108 PHE A CD2  1  
ATOM 1563   C CE1  . PHE A 1 104 ? 56.976  99.153  114.581 1.00 0.00 ? 108 PHE A CE1  1  
ATOM 1564   C CE2  . PHE A 1 104 ? 55.779  97.700  116.059 1.00 0.00 ? 108 PHE A CE2  1  
ATOM 1565   C CZ   . PHE A 1 104 ? 56.158  98.974  115.683 1.00 0.00 ? 108 PHE A CZ   1  
ATOM 1566   H H    . PHE A 1 104 ? 59.349  93.598  113.048 1.00 0.00 ? 108 PHE A H    1  
ATOM 1567   H HA   . PHE A 1 104 ? 59.287  96.280  112.656 1.00 0.00 ? 108 PHE A HA   1  
ATOM 1568   H HB2  . PHE A 1 104 ? 57.056  95.579  112.579 1.00 0.00 ? 108 PHE A HB2  1  
ATOM 1569   H HB3  . PHE A 1 104 ? 57.225  94.777  113.906 1.00 0.00 ? 108 PHE A HB3  1  
ATOM 1570   H HD1  . PHE A 1 104 ? 57.953  98.183  113.111 1.00 0.00 ? 108 PHE A HD1  1  
ATOM 1571   H HD2  . PHE A 1 104 ? 55.962  95.755  115.588 1.00 0.00 ? 108 PHE A HD2  1  
ATOM 1572   H HE1  . PHE A 1 104 ? 57.236  100.009 114.328 1.00 0.00 ? 108 PHE A HE1  1  
ATOM 1573   H HE2  . PHE A 1 104 ? 55.230  97.576  116.799 1.00 0.00 ? 108 PHE A HE2  1  
ATOM 1574   H HZ   . PHE A 1 104 ? 55.865  99.710  116.169 1.00 0.00 ? 108 PHE A HZ   1  
ATOM 1575   N N    . GLY A 1 105 ? 60.086  96.873  114.932 1.00 0.00 ? 109 GLY A N    1  
ATOM 1576   C CA   . GLY A 1 105 ? 60.613  97.080  116.266 1.00 0.00 ? 109 GLY A CA   1  
ATOM 1577   C C    . GLY A 1 105 ? 60.622  98.540  116.649 1.00 0.00 ? 109 GLY A C    1  
ATOM 1578   O O    . GLY A 1 105 ? 60.189  99.407  115.884 1.00 0.00 ? 109 GLY A O    1  
ATOM 1579   H H    . GLY A 1 105 ? 60.003  97.583  114.453 1.00 0.00 ? 109 GLY A H    1  
ATOM 1580   H HA2  . GLY A 1 105 ? 60.079  96.582  116.904 1.00 0.00 ? 109 GLY A HA2  1  
ATOM 1581   H HA3  . GLY A 1 105 ? 61.516  96.727  116.315 1.00 0.00 ? 109 GLY A HA3  1  
ATOM 1582   N N    . PHE A 1 106 ? 61.125  98.798  117.854 1.00 0.00 ? 110 PHE A N    1  
ATOM 1583   C CA   . PHE A 1 106 ? 61.458  100.149 118.289 1.00 0.00 ? 110 PHE A CA   1  
ATOM 1584   C C    . PHE A 1 106 ? 62.975  100.248 118.355 1.00 0.00 ? 110 PHE A C    1  
ATOM 1585   O O    . PHE A 1 106 ? 63.634  99.401  118.964 1.00 0.00 ? 110 PHE A O    1  
ATOM 1586   C CB   . PHE A 1 106 ? 60.829  100.461 119.643 1.00 0.00 ? 110 PHE A CB   1  
ATOM 1587   C CG   . PHE A 1 106 ? 59.381  100.829 119.565 1.00 0.00 ? 110 PHE A CG   1  
ATOM 1588   C CD1  . PHE A 1 106 ? 58.836  101.734 120.461 1.00 0.00 ? 110 PHE A CD1  1  
ATOM 1589   C CD2  . PHE A 1 106 ? 58.567  100.279 118.589 1.00 0.00 ? 110 PHE A CD2  1  
ATOM 1590   C CE1  . PHE A 1 106 ? 57.498  102.073 120.394 1.00 0.00 ? 110 PHE A CE1  1  
ATOM 1591   C CE2  . PHE A 1 106 ? 57.228  100.619 118.514 1.00 0.00 ? 110 PHE A CE2  1  
ATOM 1592   C CZ   . PHE A 1 106 ? 56.694  101.518 119.418 1.00 0.00 ? 110 PHE A CZ   1  
ATOM 1593   H H    . PHE A 1 106 ? 61.282  98.191  118.443 1.00 0.00 ? 110 PHE A H    1  
ATOM 1594   H HA   . PHE A 1 106 ? 61.105  100.800 117.662 1.00 0.00 ? 110 PHE A HA   1  
ATOM 1595   H HB2  . PHE A 1 106 ? 60.928  99.689  120.222 1.00 0.00 ? 110 PHE A HB2  1  
ATOM 1596   H HB3  . PHE A 1 106 ? 61.318  101.190 120.057 1.00 0.00 ? 110 PHE A HB3  1  
ATOM 1597   H HD1  . PHE A 1 106 ? 59.376  102.117 121.114 1.00 0.00 ? 110 PHE A HD1  1  
ATOM 1598   H HD2  . PHE A 1 106 ? 58.924  99.676  117.978 1.00 0.00 ? 110 PHE A HD2  1  
ATOM 1599   H HE1  . PHE A 1 106 ? 57.139  102.674 121.007 1.00 0.00 ? 110 PHE A HE1  1  
ATOM 1600   H HE2  . PHE A 1 106 ? 56.688  100.243 117.857 1.00 0.00 ? 110 PHE A HE2  1  
ATOM 1601   H HZ   . PHE A 1 106 ? 55.795  101.749 119.368 1.00 0.00 ? 110 PHE A HZ   1  
ATOM 1602   N N    . ALA A 1 107 ? 63.525  101.285 117.737 1.00 0.00 ? 111 ALA A N    1  
ATOM 1603   C CA   . ALA A 1 107 ? 64.959  101.391 117.532 1.00 0.00 ? 111 ALA A CA   1  
ATOM 1604   C C    . ALA A 1 107 ? 65.475  102.757 117.961 1.00 0.00 ? 111 ALA A C    1  
ATOM 1605   O O    . ALA A 1 107 ? 64.723  103.732 118.085 1.00 0.00 ? 111 ALA A O    1  
ATOM 1606   C CB   . ALA A 1 107 ? 65.321  101.134 116.068 1.00 0.00 ? 111 ALA A CB   1  
ATOM 1607   H H    . ALA A 1 107 ? 63.075  101.948 117.424 1.00 0.00 ? 111 ALA A H    1  
ATOM 1608   H HA   . ALA A 1 107 ? 65.383  100.715 118.083 1.00 0.00 ? 111 ALA A HA   1  
ATOM 1609   H HB1  . ALA A 1 107 ? 65.106  100.217 115.837 1.00 0.00 ? 111 ALA A HB1  1  
ATOM 1610   H HB2  . ALA A 1 107 ? 64.817  101.738 115.499 1.00 0.00 ? 111 ALA A HB2  1  
ATOM 1611   H HB3  . ALA A 1 107 ? 66.271  101.286 115.937 1.00 0.00 ? 111 ALA A HB3  1  
ATOM 1612   N N    . TYR A 1 108 ? 66.787  102.809 118.171 1.00 0.00 ? 112 TYR A N    1  
ATOM 1613   C CA   . TYR A 1 108 ? 67.462  103.985 118.705 1.00 0.00 ? 112 TYR A CA   1  
ATOM 1614   C C    . TYR A 1 108 ? 68.617  104.327 117.776 1.00 0.00 ? 112 TYR A C    1  
ATOM 1615   O O    . TYR A 1 108 ? 69.026  103.495 116.961 1.00 0.00 ? 112 TYR A O    1  
ATOM 1616   C CB   . TYR A 1 108 ? 67.956  103.718 120.125 1.00 0.00 ? 112 TYR A CB   1  
ATOM 1617   C CG   . TYR A 1 108 ? 67.877  104.914 121.028 1.00 0.00 ? 112 TYR A CG   1  
ATOM 1618   C CD1  . TYR A 1 108 ? 66.693  105.234 121.673 1.00 0.00 ? 112 TYR A CD1  1  
ATOM 1619   C CD2  . TYR A 1 108 ? 68.977  105.732 121.226 1.00 0.00 ? 112 TYR A CD2  1  
ATOM 1620   C CE1  . TYR A 1 108 ? 66.610  106.325 122.501 1.00 0.00 ? 112 TYR A CE1  1  
ATOM 1621   C CE2  . TYR A 1 108 ? 68.902  106.834 122.052 1.00 0.00 ? 112 TYR A CE2  1  
ATOM 1622   C CZ   . TYR A 1 108 ? 67.712  107.123 122.683 1.00 0.00 ? 112 TYR A CZ   1  
ATOM 1623   O OH   . TYR A 1 108 ? 67.611  108.215 123.501 1.00 0.00 ? 112 TYR A OH   1  
ATOM 1624   H H    . TYR A 1 108 ? 67.317  102.153 118.003 1.00 0.00 ? 112 TYR A H    1  
ATOM 1625   H HA   . TYR A 1 108 ? 66.848  104.733 118.753 1.00 0.00 ? 112 TYR A HA   1  
ATOM 1626   H HB2  . TYR A 1 108 ? 67.435  102.997 120.511 1.00 0.00 ? 112 TYR A HB2  1  
ATOM 1627   H HB3  . TYR A 1 108 ? 68.876  103.413 120.086 1.00 0.00 ? 112 TYR A HB3  1  
ATOM 1628   H HD1  . TYR A 1 108 ? 65.943  104.701 121.543 1.00 0.00 ? 112 TYR A HD1  1  
ATOM 1629   H HD2  . TYR A 1 108 ? 69.778  105.535 120.797 1.00 0.00 ? 112 TYR A HD2  1  
ATOM 1630   H HE1  . TYR A 1 108 ? 65.813  106.523 122.937 1.00 0.00 ? 112 TYR A HE1  1  
ATOM 1631   H HE2  . TYR A 1 108 ? 69.646  107.376 122.182 1.00 0.00 ? 112 TYR A HE2  1  
ATOM 1632   H HH   . TYR A 1 108 ? 68.110  108.827 123.214 1.00 0.00 ? 112 TYR A HH   1  
ATOM 1633   N N    . ILE A 1 109 ? 69.130  105.554 117.885 1.00 0.00 ? 113 ILE A N    1  
ATOM 1634   C CA   . ILE A 1 109 ? 70.246  105.988 117.052 1.00 0.00 ? 113 ILE A CA   1  
ATOM 1635   C C    . ILE A 1 109 ? 71.545  105.818 117.821 1.00 0.00 ? 113 ILE A C    1  
ATOM 1636   O O    . ILE A 1 109 ? 72.018  106.752 118.481 1.00 0.00 ? 113 ILE A O    1  
ATOM 1637   C CB   . ILE A 1 109 ? 70.061  107.448 116.616 1.00 0.00 ? 113 ILE A CB   1  
ATOM 1638   C CG1  . ILE A 1 109 ? 68.805  108.042 117.246 1.00 0.00 ? 113 ILE A CG1  1  
ATOM 1639   C CG2  . ILE A 1 109 ? 70.003  107.548 115.107 1.00 0.00 ? 113 ILE A CG2  1  
ATOM 1640   C CD1  . ILE A 1 109 ? 68.980  108.561 118.674 1.00 0.00 ? 113 ILE A CD1  1  
ATOM 1641   H H    . ILE A 1 109 ? 68.844  106.150 118.436 1.00 0.00 ? 113 ILE A H    1  
ATOM 1642   H HA   . ILE A 1 109 ? 70.277  105.440 116.251 1.00 0.00 ? 113 ILE A HA   1  
ATOM 1643   H HB   . ILE A 1 109 ? 70.826  107.959 116.925 1.00 0.00 ? 113 ILE A HB   1  
ATOM 1644   H HG12 . ILE A 1 109 ? 68.493  108.771 116.687 1.00 0.00 ? 113 ILE A HG12 1  
ATOM 1645   H HG13 . ILE A 1 109 ? 68.108  107.366 117.244 1.00 0.00 ? 113 ILE A HG13 1  
ATOM 1646   H HG21 . ILE A 1 109 ? 69.841  108.470 114.849 1.00 0.00 ? 113 ILE A HG21 1  
ATOM 1647   H HG22 . ILE A 1 109 ? 70.846  107.252 114.730 1.00 0.00 ? 113 ILE A HG22 1  
ATOM 1648   H HG23 . ILE A 1 109 ? 69.285  106.988 114.773 1.00 0.00 ? 113 ILE A HG23 1  
ATOM 1649   H HD11 . ILE A 1 109 ? 68.247  109.155 118.895 1.00 0.00 ? 113 ILE A HD11 1  
ATOM 1650   H HD12 . ILE A 1 109 ? 68.987  107.813 119.292 1.00 0.00 ? 113 ILE A HD12 1  
ATOM 1651   H HD13 . ILE A 1 109 ? 69.818  109.043 118.742 1.00 0.00 ? 113 ILE A HD13 1  
ATOM 1652   N N    . GLU A 1 110 ? 72.132  104.623 117.750 1.00 0.00 ? 114 GLU A N    1  
ATOM 1653   C CA   . GLU A 1 110 ? 73.406  104.389 118.414 1.00 0.00 ? 114 GLU A CA   1  
ATOM 1654   C C    . GLU A 1 110 ? 74.554  105.224 117.869 1.00 0.00 ? 114 GLU A C    1  
ATOM 1655   O O    . GLU A 1 110 ? 75.335  105.758 118.664 1.00 0.00 ? 114 GLU A O    1  
ATOM 1656   C CB   . GLU A 1 110 ? 73.788  102.899 118.352 1.00 0.00 ? 114 GLU A CB   1  
ATOM 1657   C CG   . GLU A 1 110 ? 74.203  102.334 119.699 1.00 0.00 ? 114 GLU A CG   1  
ATOM 1658   C CD   . GLU A 1 110 ? 74.262  100.821 119.752 1.00 0.00 ? 114 GLU A CD   1  
ATOM 1659   O OE1  . GLU A 1 110 ? 73.933  100.167 118.740 1.00 0.00 ? 114 GLU A OE1  1  
ATOM 1660   O OE2  . GLU A 1 110 ? 74.622  100.295 120.823 1.00 0.00 ? 114 GLU A OE2  1  
ATOM 1661   H H    . GLU A 1 110 ? 71.812  103.946 117.327 1.00 0.00 ? 114 GLU A H    1  
ATOM 1662   H HA   . GLU A 1 110 ? 73.269  104.665 119.334 1.00 0.00 ? 114 GLU A HA   1  
ATOM 1663   H HB2  . GLU A 1 110 ? 73.034  102.392 118.013 1.00 0.00 ? 114 GLU A HB2  1  
ATOM 1664   H HB3  . GLU A 1 110 ? 74.515  102.783 117.721 1.00 0.00 ? 114 GLU A HB3  1  
ATOM 1665   H HG2  . GLU A 1 110 ? 75.075  102.690 119.932 1.00 0.00 ? 114 GLU A HG2  1  
ATOM 1666   H HG3  . GLU A 1 110 ? 73.581  102.646 120.375 1.00 0.00 ? 114 GLU A HG3  1  
ATOM 1667   N N    . SER A 1 111 ? 74.678  105.366 116.554 1.00 0.00 ? 115 SER A N    1  
ATOM 1668   C CA   . SER A 1 111 ? 75.685  106.246 115.984 1.00 0.00 ? 115 SER A CA   1  
ATOM 1669   C C    . SER A 1 111 ? 75.252  106.657 114.588 1.00 0.00 ? 115 SER A C    1  
ATOM 1670   O O    . SER A 1 111 ? 74.433  105.982 113.958 1.00 0.00 ? 115 SER A O    1  
ATOM 1671   C CB   . SER A 1 111 ? 77.065  105.581 115.936 1.00 0.00 ? 115 SER A CB   1  
ATOM 1672   O OG   . SER A 1 111 ? 78.074  106.523 115.624 1.00 0.00 ? 115 SER A OG   1  
ATOM 1673   H H    . SER A 1 111 ? 74.188  104.959 115.975 1.00 0.00 ? 115 SER A H    1  
ATOM 1674   H HA   . SER A 1 111 ? 75.763  107.029 116.552 1.00 0.00 ? 115 SER A HA   1  
ATOM 1675   H HB2  . SER A 1 111 ? 77.258  105.168 116.792 1.00 0.00 ? 115 SER A HB2  1  
ATOM 1676   H HB3  . SER A 1 111 ? 77.064  104.873 115.274 1.00 0.00 ? 115 SER A HB3  1  
ATOM 1677   H HG   . SER A 1 111 ? 77.955  107.221 116.075 1.00 0.00 ? 115 SER A HG   1  
ATOM 1678   N N    . ARG A 1 112 ? 75.811  107.769 114.120 1.00 0.00 ? 116 ARG A N    1  
ATOM 1679   C CA   . ARG A 1 112 ? 75.583  108.295 112.776 1.00 0.00 ? 116 ARG A CA   1  
ATOM 1680   C C    . ARG A 1 112 ? 76.967  108.677 112.266 1.00 0.00 ? 116 ARG A C    1  
ATOM 1681   O O    . ARG A 1 112 ? 77.857  109.054 113.033 1.00 0.00 ? 116 ARG A O    1  
ATOM 1682   C CB   . ARG A 1 112 ? 74.596  109.464 112.804 1.00 0.00 ? 116 ARG A CB   1  
ATOM 1683   C CG   . ARG A 1 112 ? 73.339  109.334 111.949 1.00 0.00 ? 116 ARG A CG   1  
ATOM 1684   C CD   . ARG A 1 112 ? 73.042  110.652 111.271 1.00 0.00 ? 116 ARG A CD   1  
ATOM 1685   N NE   . ARG A 1 112 ? 72.805  111.688 112.268 1.00 0.00 ? 116 ARG A NE   1  
ATOM 1686   C CZ   . ARG A 1 112 ? 71.992  112.723 112.097 1.00 0.00 ? 116 ARG A CZ   1  
ATOM 1687   N NH1  . ARG A 1 112 ? 71.338  112.876 110.958 1.00 0.00 ? 116 ARG A NH1  1  
ATOM 1688   N NH2  . ARG A 1 112 ? 71.847  113.617 113.063 1.00 0.00 ? 116 ARG A NH2  1  
ATOM 1689   H H    . ARG A 1 112 ? 76.348  108.251 114.587 1.00 0.00 ? 116 ARG A H    1  
ATOM 1690   H HA   . ARG A 1 112 ? 75.170  107.650 112.181 1.00 0.00 ? 116 ARG A HA   1  
ATOM 1691   H HB2  . ARG A 1 112 ? 74.321  109.603 113.724 1.00 0.00 ? 116 ARG A HB2  1  
ATOM 1692   H HB3  . ARG A 1 112 ? 75.068  110.263 112.524 1.00 0.00 ? 116 ARG A HB3  1  
ATOM 1693   H HG2  . ARG A 1 112 ? 73.460  108.639 111.284 1.00 0.00 ? 116 ARG A HG2  1  
ATOM 1694   H HG3  . ARG A 1 112 ? 72.588  109.069 112.502 1.00 0.00 ? 116 ARG A HG3  1  
ATOM 1695   H HD2  . ARG A 1 112 ? 73.785  110.905 110.701 1.00 0.00 ? 116 ARG A HD2  1  
ATOM 1696   H HD3  . ARG A 1 112 ? 72.264  110.561 110.699 1.00 0.00 ? 116 ARG A HD3  1  
ATOM 1697   H HE   . ARG A 1 112 ? 73.222  111.625 113.018 1.00 0.00 ? 116 ARG A HE   1  
ATOM 1698   H HH11 . ARG A 1 112 ? 71.439  112.304 110.323 1.00 0.00 ? 116 ARG A HH11 1  
ATOM 1699   H HH12 . ARG A 1 112 ? 70.811  113.548 110.851 1.00 0.00 ? 116 ARG A HH12 1  
ATOM 1700   H HH21 . ARG A 1 112 ? 72.280  113.527 113.800 1.00 0.00 ? 116 ARG A HH21 1  
ATOM 1701   H HH22 . ARG A 1 112 ? 71.320  114.288 112.952 1.00 0.00 ? 116 ARG A HH22 1  
ATOM 1702   N N    . GLU A 1 113 ? 77.152  108.527 110.963 1.00 0.00 ? 117 GLU A N    1  
ATOM 1703   C CA   . GLU A 1 113 ? 78.413  108.791 110.288 1.00 0.00 ? 117 GLU A CA   1  
ATOM 1704   C C    . GLU A 1 113 ? 78.091  109.562 109.020 1.00 0.00 ? 117 GLU A C    1  
ATOM 1705   O O    . GLU A 1 113 ? 77.178  109.185 108.278 1.00 0.00 ? 117 GLU A O    1  
ATOM 1706   C CB   . GLU A 1 113 ? 79.137  107.488 109.961 1.00 0.00 ? 117 GLU A CB   1  
ATOM 1707   C CG   . GLU A 1 113 ? 80.576  107.676 109.512 1.00 0.00 ? 117 GLU A CG   1  
ATOM 1708   C CD   . GLU A 1 113 ? 80.691  107.974 108.027 1.00 0.00 ? 117 GLU A CD   1  
ATOM 1709   O OE1  . GLU A 1 113 ? 80.199  107.167 107.214 1.00 0.00 ? 117 GLU A OE1  1  
ATOM 1710   O OE2  . GLU A 1 113 ? 81.267  109.024 107.673 1.00 0.00 ? 117 GLU A OE2  1  
ATOM 1711   H H    . GLU A 1 113 ? 76.530  108.261 110.432 1.00 0.00 ? 117 GLU A H    1  
ATOM 1712   H HA   . GLU A 1 113 ? 79.004  109.306 110.860 1.00 0.00 ? 117 GLU A HA   1  
ATOM 1713   H HB2  . GLU A 1 113 ? 79.125  106.918 110.745 1.00 0.00 ? 117 GLU A HB2  1  
ATOM 1714   H HB3  . GLU A 1 113 ? 78.649  107.024 109.264 1.00 0.00 ? 117 GLU A HB3  1  
ATOM 1715   H HG2  . GLU A 1 113 ? 80.976  108.401 110.017 1.00 0.00 ? 117 GLU A HG2  1  
ATOM 1716   H HG3  . GLU A 1 113 ? 81.082  106.873 109.717 1.00 0.00 ? 117 GLU A HG3  1  
ATOM 1717   N N    . TYR A 1 114 ? 78.820  110.644 108.772 1.00 0.00 ? 118 TYR A N    1  
ATOM 1718   C CA   . TYR A 1 114 ? 78.637  111.412 107.553 1.00 0.00 ? 118 TYR A CA   1  
ATOM 1719   C C    . TYR A 1 114 ? 79.947  111.571 106.803 1.00 0.00 ? 118 TYR A C    1  
ATOM 1720   O O    . TYR A 1 114 ? 80.910  112.145 107.318 1.00 0.00 ? 118 TYR A O    1  
ATOM 1721   C CB   . TYR A 1 114 ? 78.008  112.785 107.816 1.00 0.00 ? 118 TYR A CB   1  
ATOM 1722   C CG   . TYR A 1 114 ? 77.296  113.008 109.113 1.00 0.00 ? 118 TYR A CG   1  
ATOM 1723   C CD1  . TYR A 1 114 ? 75.933  112.778 109.210 1.00 0.00 ? 118 TYR A CD1  1  
ATOM 1724   C CD2  . TYR A 1 114 ? 77.966  113.489 110.223 1.00 0.00 ? 118 TYR A CD2  1  
ATOM 1725   C CE1  . TYR A 1 114 ? 75.260  113.006 110.379 1.00 0.00 ? 118 TYR A CE1  1  
ATOM 1726   C CE2  . TYR A 1 114 ? 77.306  113.702 111.397 1.00 0.00 ? 118 TYR A CE2  1  
ATOM 1727   C CZ   . TYR A 1 114 ? 75.949  113.466 111.470 1.00 0.00 ? 118 TYR A CZ   1  
ATOM 1728   O OH   . TYR A 1 114 ? 75.277  113.688 112.647 1.00 0.00 ? 118 TYR A OH   1  
ATOM 1729   H H    . TYR A 1 114 ? 79.427  110.948 109.300 1.00 0.00 ? 118 TYR A H    1  
ATOM 1730   H HA   . TYR A 1 114 ? 78.019  110.908 107.000 1.00 0.00 ? 118 TYR A HA   1  
ATOM 1731   H HB2  . TYR A 1 114 ? 78.712  113.450 107.748 1.00 0.00 ? 118 TYR A HB2  1  
ATOM 1732   H HB3  . TYR A 1 114 ? 77.379  112.963 107.100 1.00 0.00 ? 118 TYR A HB3  1  
ATOM 1733   H HD1  . TYR A 1 114 ? 75.468  112.463 108.468 1.00 0.00 ? 118 TYR A HD1  1  
ATOM 1734   H HD2  . TYR A 1 114 ? 78.876  113.668 110.168 1.00 0.00 ? 118 TYR A HD2  1  
ATOM 1735   H HE1  . TYR A 1 114 ? 74.344  112.850 110.433 1.00 0.00 ? 118 TYR A HE1  1  
ATOM 1736   H HE2  . TYR A 1 114 ? 77.770  114.004 112.145 1.00 0.00 ? 118 TYR A HE2  1  
ATOM 1737   H HH   . TYR A 1 114 ? 74.448  113.658 112.507 1.00 0.00 ? 118 TYR A HH   1  
ATOM 1738   N N    . SER A 1 115 ? 79.966  111.048 105.585 1.00 0.00 ? 119 SER A N    1  
ATOM 1739   C CA   . SER A 1 115 ? 81.116  111.145 104.708 1.00 0.00 ? 119 SER A CA   1  
ATOM 1740   C C    . SER A 1 115 ? 80.811  112.102 103.568 1.00 0.00 ? 119 SER A C    1  
ATOM 1741   O O    . SER A 1 115 ? 79.757  112.002 102.921 1.00 0.00 ? 119 SER A O    1  
ATOM 1742   C CB   . SER A 1 115 ? 81.506  109.782 104.146 1.00 0.00 ? 119 SER A CB   1  
ATOM 1743   O OG   . SER A 1 115 ? 82.845  109.477 104.493 1.00 0.00 ? 119 SER A OG   1  
ATOM 1744   H H    . SER A 1 115 ? 79.302  110.622 105.243 1.00 0.00 ? 119 SER A H    1  
ATOM 1745   H HA   . SER A 1 115 ? 81.864  111.480 105.227 1.00 0.00 ? 119 SER A HA   1  
ATOM 1746   H HB2  . SER A 1 115 ? 80.911  109.099 104.493 1.00 0.00 ? 119 SER A HB2  1  
ATOM 1747   H HB3  . SER A 1 115 ? 81.406  109.781 103.181 1.00 0.00 ? 119 SER A HB3  1  
ATOM 1748   H HG   . SER A 1 115 ? 83.136  108.872 103.988 1.00 0.00 ? 119 SER A HG   1  
ATOM 1749   N N    . ASP A 1 116 ? 81.729  113.037 103.358 1.00 0.00 ? 120 ASP A N    1  
ATOM 1750   C CA   . ASP A 1 116 ? 81.786  113.897 102.185 1.00 0.00 ? 120 ASP A CA   1  
ATOM 1751   C C    . ASP A 1 116 ? 83.087  113.554 101.469 1.00 0.00 ? 120 ASP A C    1  
ATOM 1752   O O    . ASP A 1 116 ? 84.173  113.685 102.041 1.00 0.00 ? 120 ASP A O    1  
ATOM 1753   C CB   . ASP A 1 116 ? 81.745  115.369 102.585 1.00 0.00 ? 120 ASP A CB   1  
ATOM 1754   C CG   . ASP A 1 116 ? 81.757  116.311 101.392 1.00 0.00 ? 120 ASP A CG   1  
ATOM 1755   O OD1  . ASP A 1 116 ? 80.810  116.298 100.579 1.00 0.00 ? 120 ASP A OD1  1  
ATOM 1756   O OD2  . ASP A 1 116 ? 82.745  117.055 101.251 1.00 0.00 ? 120 ASP A OD2  1  
ATOM 1757   H H    . ASP A 1 116 ? 82.362  113.194 103.920 1.00 0.00 ? 120 ASP A H    1  
ATOM 1758   H HA   . ASP A 1 116 ? 81.023  113.753 101.604 1.00 0.00 ? 120 ASP A HA   1  
ATOM 1759   H HB2  . ASP A 1 116 ? 80.947  115.533 103.112 1.00 0.00 ? 120 ASP A HB2  1  
ATOM 1760   H HB3  . ASP A 1 116 ? 82.505  115.566 103.154 1.00 0.00 ? 120 ASP A HB3  1  
ATOM 1761   N N    . GLY A 1 117 ? 82.976  113.122 100.219 1.00 0.00 ? 121 GLY A N    1  
ATOM 1762   C CA   . GLY A 1 117 ? 84.136  112.862 99.390  1.00 0.00 ? 121 GLY A CA   1  
ATOM 1763   C C    . GLY A 1 117 ? 84.153  113.746 98.164  1.00 0.00 ? 121 GLY A C    1  
ATOM 1764   O O    . GLY A 1 117 ? 83.139  114.337 97.775  1.00 0.00 ? 121 GLY A O    1  
ATOM 1765   H H    . GLY A 1 117 ? 82.223  112.973 99.831  1.00 0.00 ? 121 GLY A H    1  
ATOM 1766   H HA2  . GLY A 1 117 ? 84.944  113.009 99.907  1.00 0.00 ? 121 GLY A HA2  1  
ATOM 1767   H HA3  . GLY A 1 117 ? 84.139  111.931 99.118  1.00 0.00 ? 121 GLY A HA3  1  
ATOM 1768   N N    . VAL A 1 118 ? 85.322  113.851 97.542  1.00 0.00 ? 122 VAL A N    1  
ATOM 1769   C CA   . VAL A 1 118 ? 85.487  114.605 96.305  1.00 0.00 ? 122 VAL A CA   1  
ATOM 1770   C C    . VAL A 1 118 ? 84.825  113.891 95.134  1.00 0.00 ? 122 VAL A C    1  
ATOM 1771   O O    . VAL A 1 118 ? 84.319  114.531 94.212  1.00 0.00 ? 122 VAL A O    1  
ATOM 1772   C CB   . VAL A 1 118 ? 86.976  114.890 96.020  1.00 0.00 ? 122 VAL A CB   1  
ATOM 1773   C CG1  . VAL A 1 118 ? 87.506  115.864 97.039  1.00 0.00 ? 122 VAL A CG1  1  
ATOM 1774   C CG2  . VAL A 1 118 ? 87.766  113.606 96.054  1.00 0.00 ? 122 VAL A CG2  1  
ATOM 1775   H H    . VAL A 1 118 ? 86.046  113.483 97.827  1.00 0.00 ? 122 VAL A H    1  
ATOM 1776   H HA   . VAL A 1 118 ? 85.043  115.460 96.417  1.00 0.00 ? 122 VAL A HA   1  
ATOM 1777   H HB   . VAL A 1 118 ? 87.066  115.280 95.137  1.00 0.00 ? 122 VAL A HB   1  
ATOM 1778   H HG11 . VAL A 1 118 ? 88.174  115.426 97.589  1.00 0.00 ? 122 VAL A HG11 1  
ATOM 1779   H HG12 . VAL A 1 118 ? 87.907  116.621 96.585  1.00 0.00 ? 122 VAL A HG12 1  
ATOM 1780   H HG13 . VAL A 1 118 ? 86.778  116.173 97.601  1.00 0.00 ? 122 VAL A HG13 1  
ATOM 1781   H HG21 . VAL A 1 118 ? 88.689  113.799 96.278  1.00 0.00 ? 122 VAL A HG21 1  
ATOM 1782   H HG22 . VAL A 1 118 ? 87.389  113.011 96.722  1.00 0.00 ? 122 VAL A HG22 1  
ATOM 1783   H HG23 . VAL A 1 118 ? 87.727  113.178 95.184  1.00 0.00 ? 122 VAL A HG23 1  
ATOM 1784   N N    . GLU A 1 119 ? 84.818  112.559 95.152  1.00 0.00 ? 123 GLU A N    1  
ATOM 1785   C CA   . GLU A 1 119 ? 84.012  111.809 94.199  1.00 0.00 ? 123 GLU A CA   1  
ATOM 1786   C C    . GLU A 1 119 ? 82.666  111.399 94.760  1.00 0.00 ? 123 GLU A C    1  
ATOM 1787   O O    . GLU A 1 119 ? 82.527  111.288 95.982  1.00 0.00 ? 123 GLU A O    1  
ATOM 1788   C CB   . GLU A 1 119 ? 84.747  110.558 93.711  1.00 0.00 ? 123 GLU A CB   1  
ATOM 1789   C CG   . GLU A 1 119 ? 85.549  110.766 92.440  1.00 0.00 ? 123 GLU A CG   1  
ATOM 1790   C CD   . GLU A 1 119 ? 84.835  111.665 91.452  1.00 0.00 ? 123 GLU A CD   1  
ATOM 1791   O OE1  . GLU A 1 119 ? 83.881  111.193 90.804  1.00 0.00 ? 123 GLU A OE1  1  
ATOM 1792   O OE2  . GLU A 1 119 ? 85.204  112.851 91.344  1.00 0.00 ? 123 GLU A OE2  1  
ATOM 1793   H H    . GLU A 1 119 ? 85.269  112.076 95.703  1.00 0.00 ? 123 GLU A H    1  
ATOM 1794   H HA   . GLU A 1 119 ? 83.859  112.412 93.455  1.00 0.00 ? 123 GLU A HA   1  
ATOM 1795   H HB2  . GLU A 1 119 ? 85.343  110.250 94.412  1.00 0.00 ? 123 GLU A HB2  1  
ATOM 1796   H HB3  . GLU A 1 119 ? 84.099  109.852 93.561  1.00 0.00 ? 123 GLU A HB3  1  
ATOM 1797   H HG2  . GLU A 1 119 ? 86.410  111.152 92.663  1.00 0.00 ? 123 GLU A HG2  1  
ATOM 1798   H HG3  . GLU A 1 119 ? 85.724  109.906 92.025  1.00 0.00 ? 123 GLU A HG3  1  
ATOM 1799   N N    . GLY A 1 120 ? 81.674  111.185 93.902  1.00 0.00 ? 124 GLY A N    1  
ATOM 1800   C CA   . GLY A 1 120 ? 80.459  110.527 94.328  1.00 0.00 ? 124 GLY A CA   1  
ATOM 1801   C C    . GLY A 1 120 ? 79.584  111.531 95.044  1.00 0.00 ? 124 GLY A C    1  
ATOM 1802   O O    . GLY A 1 120 ? 79.629  112.732 94.729  1.00 0.00 ? 124 GLY A O    1  
ATOM 1803   H H    . GLY A 1 120 ? 81.689  111.413 93.074  1.00 0.00 ? 124 GLY A H    1  
ATOM 1804   H HA2  . GLY A 1 120 ? 79.990  110.160 93.562  1.00 0.00 ? 124 GLY A HA2  1  
ATOM 1805   H HA3  . GLY A 1 120 ? 80.667  109.784 94.915  1.00 0.00 ? 124 GLY A HA3  1  
ATOM 1806   N N    . ALA A 1 121 ? 78.756  111.060 95.975  1.00 0.00 ? 125 ALA A N    1  
ATOM 1807   C CA   . ALA A 1 121 ? 77.835  111.935 96.683  1.00 0.00 ? 125 ALA A CA   1  
ATOM 1808   C C    . ALA A 1 121 ? 77.792  111.585 98.169  1.00 0.00 ? 125 ALA A C    1  
ATOM 1809   O O    . ALA A 1 121 ? 78.226  110.509 98.594  1.00 0.00 ? 125 ALA A O    1  
ATOM 1810   C CB   . ALA A 1 121 ? 76.435  111.850 96.078  1.00 0.00 ? 125 ALA A CB   1  
ATOM 1811   H H    . ALA A 1 121 ? 78.715  110.234 96.209  1.00 0.00 ? 125 ALA A H    1  
ATOM 1812   H HA   . ALA A 1 121 ? 78.154  112.846 96.591  1.00 0.00 ? 125 ALA A HA   1  
ATOM 1813   H HB1  . ALA A 1 121 ? 76.450  111.257 95.311  1.00 0.00 ? 125 ALA A HB1  1  
ATOM 1814   H HB2  . ALA A 1 121 ? 75.816  111.504 96.740  1.00 0.00 ? 125 ALA A HB2  1  
ATOM 1815   H HB3  . ALA A 1 121 ? 76.149  112.733 95.798  1.00 0.00 ? 125 ALA A HB3  1  
ATOM 1816   N N    . VAL A 1 122 ? 77.275  112.531 98.959  1.00 0.00 ? 126 VAL A N    1  
ATOM 1817   C CA   . VAL A 1 122 ? 77.334  112.435 100.411 1.00 0.00 ? 126 VAL A CA   1  
ATOM 1818   C C    . VAL A 1 122 ? 76.764  111.101 100.870 1.00 0.00 ? 126 VAL A C    1  
ATOM 1819   O O    . VAL A 1 122 ? 75.752  110.618 100.341 1.00 0.00 ? 126 VAL A O    1  
ATOM 1820   C CB   . VAL A 1 122 ? 76.596  113.621 101.056 1.00 0.00 ? 126 VAL A CB   1  
ATOM 1821   C CG1  . VAL A 1 122 ? 77.083  114.919 100.458 1.00 0.00 ? 126 VAL A CG1  1  
ATOM 1822   C CG2  . VAL A 1 122 ? 75.098  113.507 100.855 1.00 0.00 ? 126 VAL A CG2  1  
ATOM 1823   H H    . VAL A 1 122 ? 76.884  113.239 98.666  1.00 0.00 ? 126 VAL A H    1  
ATOM 1824   H HA   . VAL A 1 122 ? 78.260  112.477 100.698 1.00 0.00 ? 126 VAL A HA   1  
ATOM 1825   H HB   . VAL A 1 122 ? 76.784  113.608 102.007 1.00 0.00 ? 126 VAL A HB   1  
ATOM 1826   H HG11 . VAL A 1 122 ? 76.959  115.638 101.098 1.00 0.00 ? 126 VAL A HG11 1  
ATOM 1827   H HG12 . VAL A 1 122 ? 78.025  114.842 100.238 1.00 0.00 ? 126 VAL A HG12 1  
ATOM 1828   H HG13 . VAL A 1 122 ? 76.579  115.114 99.652  1.00 0.00 ? 126 VAL A HG13 1  
ATOM 1829   H HG21 . VAL A 1 122 ? 74.892  113.575 99.909  1.00 0.00 ? 126 VAL A HG21 1  
ATOM 1830   H HG22 . VAL A 1 122 ? 74.791  112.651 101.192 1.00 0.00 ? 126 VAL A HG22 1  
ATOM 1831   H HG23 . VAL A 1 122 ? 74.652  114.222 101.335 1.00 0.00 ? 126 VAL A HG23 1  
ATOM 1832   N N    . GLU A 1 123 ? 77.451  110.459 101.808 1.00 0.00 ? 127 GLU A N    1  
ATOM 1833   C CA   . GLU A 1 123 ? 77.038  109.134 102.258 1.00 0.00 ? 127 GLU A CA   1  
ATOM 1834   C C    . GLU A 1 123 ? 76.902  109.115 103.770 1.00 0.00 ? 127 GLU A C    1  
ATOM 1835   O O    . GLU A 1 123 ? 77.815  109.526 104.491 1.00 0.00 ? 127 GLU A O    1  
ATOM 1836   C CB   . GLU A 1 123 ? 78.000  108.048 101.753 1.00 0.00 ? 127 GLU A CB   1  
ATOM 1837   C CG   . GLU A 1 123 ? 77.403  106.689 101.419 1.00 0.00 ? 127 GLU A CG   1  
ATOM 1838   C CD   . GLU A 1 123 ? 77.042  105.901 102.662 1.00 0.00 ? 127 GLU A CD   1  
ATOM 1839   O OE1  . GLU A 1 123 ? 75.976  105.253 102.661 1.00 0.00 ? 127 GLU A OE1  1  
ATOM 1840   O OE2  . GLU A 1 123 ? 77.830  105.909 103.629 1.00 0.00 ? 127 GLU A OE2  1  
ATOM 1841   H H    . GLU A 1 123 ? 78.155  110.769 102.195 1.00 0.00 ? 127 GLU A H    1  
ATOM 1842   H HA   . GLU A 1 123 ? 76.168  108.934 101.878 1.00 0.00 ? 127 GLU A HA   1  
ATOM 1843   H HB2  . GLU A 1 123 ? 78.444  108.384 100.959 1.00 0.00 ? 127 GLU A HB2  1  
ATOM 1844   H HB3  . GLU A 1 123 ? 78.686  107.917 102.426 1.00 0.00 ? 127 GLU A HB3  1  
ATOM 1845   H HG2  . GLU A 1 123 ? 76.610  106.811 100.874 1.00 0.00 ? 127 GLU A HG2  1  
ATOM 1846   H HG3  . GLU A 1 123 ? 78.036  106.181 100.889 1.00 0.00 ? 127 GLU A HG3  1  
ATOM 1847   N N    . ILE A 1 124 ? 75.752  108.656 104.243 1.00 0.00 ? 128 ILE A N    1  
ATOM 1848   C CA   . ILE A 1 124 ? 75.466  108.596 105.667 1.00 0.00 ? 128 ILE A CA   1  
ATOM 1849   C C    . ILE A 1 124 ? 75.456  107.141 106.101 1.00 0.00 ? 128 ILE A C    1  
ATOM 1850   O O    . ILE A 1 124 ? 74.769  106.304 105.502 1.00 0.00 ? 128 ILE A O    1  
ATOM 1851   C CB   . ILE A 1 124 ? 74.138  109.286 106.003 1.00 0.00 ? 128 ILE A CB   1  
ATOM 1852   C CG1  . ILE A 1 124 ? 74.024  110.607 105.245 1.00 0.00 ? 128 ILE A CG1  1  
ATOM 1853   C CG2  . ILE A 1 124 ? 74.059  109.560 107.486 1.00 0.00 ? 128 ILE A CG2  1  
ATOM 1854   C CD1  . ILE A 1 124 ? 72.619  111.202 105.198 1.00 0.00 ? 128 ILE A CD1  1  
ATOM 1855   H H    . ILE A 1 124 ? 75.112  108.369 103.745 1.00 0.00 ? 128 ILE A H    1  
ATOM 1856   H HA   . ILE A 1 124 ? 76.157  109.074 106.152 1.00 0.00 ? 128 ILE A HA   1  
ATOM 1857   H HB   . ILE A 1 124 ? 73.411  108.700 105.741 1.00 0.00 ? 128 ILE A HB   1  
ATOM 1858   H HG12 . ILE A 1 124 ? 74.622  111.253 105.654 1.00 0.00 ? 128 ILE A HG12 1  
ATOM 1859   H HG13 . ILE A 1 124 ? 74.334  110.470 104.336 1.00 0.00 ? 128 ILE A HG13 1  
ATOM 1860   H HG21 . ILE A 1 124 ? 73.336  109.041 107.873 1.00 0.00 ? 128 ILE A HG21 1  
ATOM 1861   H HG22 . ILE A 1 124 ? 74.896  109.310 107.907 1.00 0.00 ? 128 ILE A HG22 1  
ATOM 1862   H HG23 . ILE A 1 124 ? 73.892  110.504 107.633 1.00 0.00 ? 128 ILE A HG23 1  
ATOM 1863   H HD11 . ILE A 1 124 ? 72.021  110.585 104.749 1.00 0.00 ? 128 ILE A HD11 1  
ATOM 1864   H HD12 . ILE A 1 124 ? 72.303  111.358 106.102 1.00 0.00 ? 128 ILE A HD12 1  
ATOM 1865   H HD13 . ILE A 1 124 ? 72.640  112.043 104.714 1.00 0.00 ? 128 ILE A HD13 1  
ATOM 1866   N N    . SER A 1 125 ? 76.242  106.840 107.128 1.00 0.00 ? 129 SER A N    1  
ATOM 1867   C CA   . SER A 1 125 ? 76.186  105.567 107.825 1.00 0.00 ? 129 SER A CA   1  
ATOM 1868   C C    . SER A 1 125 ? 75.561  105.803 109.190 1.00 0.00 ? 129 SER A C    1  
ATOM 1869   O O    . SER A 1 125 ? 76.123  106.530 110.012 1.00 0.00 ? 129 SER A O    1  
ATOM 1870   C CB   . SER A 1 125 ? 77.585  104.968 107.976 1.00 0.00 ? 129 SER A CB   1  
ATOM 1871   O OG   . SER A 1 125 ? 77.524  103.563 108.140 1.00 0.00 ? 129 SER A OG   1  
ATOM 1872   H H    . SER A 1 125 ? 76.831  107.381 107.443 1.00 0.00 ? 129 SER A H    1  
ATOM 1873   H HA   . SER A 1 125 ? 75.652  104.936 107.316 1.00 0.00 ? 129 SER A HA   1  
ATOM 1874   H HB2  . SER A 1 125 ? 78.117  105.183 107.195 1.00 0.00 ? 129 SER A HB2  1  
ATOM 1875   H HB3  . SER A 1 125 ? 78.029  105.367 108.741 1.00 0.00 ? 129 SER A HB3  1  
ATOM 1876   H HG   . SER A 1 125 ? 77.763  103.188 107.428 1.00 0.00 ? 129 SER A HG   1  
ATOM 1877   N N    . ILE A 1 126 ? 74.392  105.219 109.425 1.00 0.00 ? 130 ILE A N    1  
ATOM 1878   C CA   . ILE A 1 126 ? 73.725  105.326 110.714 1.00 0.00 ? 130 ILE A CA   1  
ATOM 1879   C C    . ILE A 1 126 ? 73.617  103.937 111.319 1.00 0.00 ? 130 ILE A C    1  
ATOM 1880   O O    . ILE A 1 126 ? 73.152  102.992 110.665 1.00 0.00 ? 130 ILE A O    1  
ATOM 1881   C CB   . ILE A 1 126 ? 72.335  105.994 110.610 1.00 0.00 ? 130 ILE A CB   1  
ATOM 1882   C CG1  . ILE A 1 126 ? 71.245  104.965 110.328 1.00 0.00 ? 130 ILE A CG1  1  
ATOM 1883   C CG2  . ILE A 1 126 ? 72.336  107.060 109.532 1.00 0.00 ? 130 ILE A CG2  1  
ATOM 1884   C CD1  . ILE A 1 126 ? 69.837  105.541 110.176 1.00 0.00 ? 130 ILE A CD1  1  
ATOM 1885   H H    . ILE A 1 126 ? 73.965  104.752 108.843 1.00 0.00 ? 130 ILE A H    1  
ATOM 1886   H HA   . ILE A 1 126 ? 74.255  105.901 111.288 1.00 0.00 ? 130 ILE A HA   1  
ATOM 1887   H HB   . ILE A 1 126 ? 72.144  106.410 111.465 1.00 0.00 ? 130 ILE A HB   1  
ATOM 1888   H HG12 . ILE A 1 126 ? 71.474  104.485 109.516 1.00 0.00 ? 130 ILE A HG12 1  
ATOM 1889   H HG13 . ILE A 1 126 ? 71.238  104.316 111.049 1.00 0.00 ? 130 ILE A HG13 1  
ATOM 1890   H HG21 . ILE A 1 126 ? 72.162  106.649 108.671 1.00 0.00 ? 130 ILE A HG21 1  
ATOM 1891   H HG22 . ILE A 1 126 ? 71.646  107.714 109.723 1.00 0.00 ? 130 ILE A HG22 1  
ATOM 1892   H HG23 . ILE A 1 126 ? 73.201  107.499 109.512 1.00 0.00 ? 130 ILE A HG23 1  
ATOM 1893   H HD11 . ILE A 1 126 ? 69.565  105.957 111.009 1.00 0.00 ? 130 ILE A HD11 1  
ATOM 1894   H HD12 . ILE A 1 126 ? 69.833  106.204 109.468 1.00 0.00 ? 130 ILE A HD12 1  
ATOM 1895   H HD13 . ILE A 1 126 ? 69.217  104.827 109.954 1.00 0.00 ? 130 ILE A HD13 1  
ATOM 1896   N N    . SER A 1 127 ? 74.060  103.814 112.566 1.00 0.00 ? 131 SER A N    1  
ATOM 1897   C CA   . SER A 1 127 ? 74.063  102.555 113.292 1.00 0.00 ? 131 SER A CA   1  
ATOM 1898   C C    . SER A 1 127 ? 73.126  102.650 114.486 1.00 0.00 ? 131 SER A C    1  
ATOM 1899   O O    . SER A 1 127 ? 73.076  103.676 115.176 1.00 0.00 ? 131 SER A O    1  
ATOM 1900   C CB   . SER A 1 127 ? 75.472  102.197 113.761 1.00 0.00 ? 131 SER A CB   1  
ATOM 1901   O OG   . SER A 1 127 ? 76.157  101.452 112.774 1.00 0.00 ? 131 SER A OG   1  
ATOM 1902   H H    . SER A 1 127 ? 74.373  104.474 113.020 1.00 0.00 ? 131 SER A H    1  
ATOM 1903   H HA   . SER A 1 127 ? 73.755  101.856 112.695 1.00 0.00 ? 131 SER A HA   1  
ATOM 1904   H HB2  . SER A 1 127 ? 75.966  103.008 113.961 1.00 0.00 ? 131 SER A HB2  1  
ATOM 1905   H HB3  . SER A 1 127 ? 75.423  101.684 114.584 1.00 0.00 ? 131 SER A HB3  1  
ATOM 1906   H HG   . SER A 1 127 ? 76.025  101.797 112.020 1.00 0.00 ? 131 SER A HG   1  
ATOM 1907   N N    . LEU A 1 128 ? 72.404  101.566 114.738 1.00 0.00 ? 132 LEU A N    1  
ATOM 1908   C CA   . LEU A 1 128 ? 71.355  101.529 115.741 1.00 0.00 ? 132 LEU A CA   1  
ATOM 1909   C C    . LEU A 1 128 ? 71.327  100.170 116.419 1.00 0.00 ? 132 LEU A C    1  
ATOM 1910   O O    . LEU A 1 128 ? 71.623  99.148  115.797 1.00 0.00 ? 132 LEU A O    1  
ATOM 1911   C CB   . LEU A 1 128 ? 69.983  101.805 115.122 1.00 0.00 ? 132 LEU A CB   1  
ATOM 1912   C CG   . LEU A 1 128 ? 69.541  101.071 113.859 1.00 0.00 ? 132 LEU A CG   1  
ATOM 1913   C CD1  . LEU A 1 128 ? 68.618  99.904  114.148 1.00 0.00 ? 132 LEU A CD1  1  
ATOM 1914   C CD2  . LEU A 1 128 ? 68.862  102.062 112.945 1.00 0.00 ? 132 LEU A CD2  1  
ATOM 1915   H H    . LEU A 1 128 ? 72.513  100.821 114.323 1.00 0.00 ? 132 LEU A H    1  
ATOM 1916   H HA   . LEU A 1 128 ? 71.547  102.221 116.394 1.00 0.00 ? 132 LEU A HA   1  
ATOM 1917   H HB2  . LEU A 1 128 ? 69.319  101.624 115.805 1.00 0.00 ? 132 LEU A HB2  1  
ATOM 1918   H HB3  . LEU A 1 128 ? 69.941  102.755 114.930 1.00 0.00 ? 132 LEU A HB3  1  
ATOM 1919   H HG   . LEU A 1 128 ? 70.328  100.694 113.435 1.00 0.00 ? 132 LEU A HG   1  
ATOM 1920   H HD11 . LEU A 1 128 ? 67.813  99.987  113.614 1.00 0.00 ? 132 LEU A HD11 1  
ATOM 1921   H HD12 . LEU A 1 128 ? 69.067  99.073  113.928 1.00 0.00 ? 132 LEU A HD12 1  
ATOM 1922   H HD13 . LEU A 1 128 ? 68.382  99.903  115.090 1.00 0.00 ? 132 LEU A HD13 1  
ATOM 1923   H HD21 . LEU A 1 128 ? 69.378  102.883 112.917 1.00 0.00 ? 132 LEU A HD21 1  
ATOM 1924   H HD22 . LEU A 1 128 ? 68.799  101.690 112.052 1.00 0.00 ? 132 LEU A HD22 1  
ATOM 1925   H HD23 . LEU A 1 128 ? 67.971  102.253 113.279 1.00 0.00 ? 132 LEU A HD23 1  
ATOM 1926   N N    . GLN A 1 129 ? 70.968  100.164 117.696 1.00 0.00 ? 133 GLN A N    1  
ATOM 1927   C CA   . GLN A 1 129 ? 70.638  98.939  118.406 1.00 0.00 ? 133 GLN A CA   1  
ATOM 1928   C C    . GLN A 1 129 ? 69.127  98.870  118.514 1.00 0.00 ? 133 GLN A C    1  
ATOM 1929   O O    . GLN A 1 129 ? 68.446  99.888  118.341 1.00 0.00 ? 133 GLN A O    1  
ATOM 1930   C CB   . GLN A 1 129 ? 71.270  98.908  119.793 1.00 0.00 ? 133 GLN A CB   1  
ATOM 1931   C CG   . GLN A 1 129 ? 72.213  97.766  119.993 1.00 0.00 ? 133 GLN A CG   1  
ATOM 1932   C CD   . GLN A 1 129 ? 71.825  96.934  121.173 1.00 0.00 ? 133 GLN A CD   1  
ATOM 1933   O OE1  . GLN A 1 129 ? 72.631  96.706  122.069 1.00 0.00 ? 133 GLN A OE1  1  
ATOM 1934   N NE2  . GLN A 1 129 ? 70.596  96.438  121.171 1.00 0.00 ? 133 GLN A NE2  1  
ATOM 1935   H H    . GLN A 1 129 ? 70.908  100.874 118.177 1.00 0.00 ? 133 GLN A H    1  
ATOM 1936   H HA   . GLN A 1 129 ? 70.986  98.174  117.922 1.00 0.00 ? 133 GLN A HA   1  
ATOM 1937   H HB2  . GLN A 1 129 ? 71.746  99.741  119.942 1.00 0.00 ? 133 GLN A HB2  1  
ATOM 1938   H HB3  . GLN A 1 129 ? 70.568  98.859  120.460 1.00 0.00 ? 133 GLN A HB3  1  
ATOM 1939   H HG2  . GLN A 1 129 ? 72.225  97.213  119.196 1.00 0.00 ? 133 GLN A HG2  1  
ATOM 1940   H HG3  . GLN A 1 129 ? 73.113  98.105  120.116 1.00 0.00 ? 133 GLN A HG3  1  
ATOM 1941   H HE21 . GLN A 1 129 ? 70.060  96.620  120.525 1.00 0.00 ? 133 GLN A HE21 1  
ATOM 1942   H HE22 . GLN A 1 129 ? 70.335  95.933  121.816 1.00 0.00 ? 133 GLN A HE22 1  
ATOM 1943   N N    . VAL A 1 130 ? 68.597  97.681  118.771 1.00 0.00 ? 134 VAL A N    1  
ATOM 1944   C CA   . VAL A 1 130 ? 67.166  97.530  118.990 1.00 0.00 ? 134 VAL A CA   1  
ATOM 1945   C C    . VAL A 1 130 ? 66.973  96.534  120.126 1.00 0.00 ? 134 VAL A C    1  
ATOM 1946   O O    . VAL A 1 130 ? 67.892  95.782  120.473 1.00 0.00 ? 134 VAL A O    1  
ATOM 1947   C CB   . VAL A 1 130 ? 66.429  97.129  117.693 1.00 0.00 ? 134 VAL A CB   1  
ATOM 1948   C CG1  . VAL A 1 130 ? 64.947  96.946  117.906 1.00 0.00 ? 134 VAL A CG1  1  
ATOM 1949   C CG2  . VAL A 1 130 ? 66.717  98.106  116.559 1.00 0.00 ? 134 VAL A CG2  1  
ATOM 1950   H H    . VAL A 1 130 ? 69.048  96.951  118.822 1.00 0.00 ? 134 VAL A H    1  
ATOM 1951   H HA   . VAL A 1 130 ? 66.770  98.378  119.246 1.00 0.00 ? 134 VAL A HA   1  
ATOM 1952   H HB   . VAL A 1 130 ? 66.779  96.263  117.431 1.00 0.00 ? 134 VAL A HB   1  
ATOM 1953   H HG11 . VAL A 1 130 ? 64.552  96.558  117.109 1.00 0.00 ? 134 VAL A HG11 1  
ATOM 1954   H HG12 . VAL A 1 130 ? 64.799  96.356  118.660 1.00 0.00 ? 134 VAL A HG12 1  
ATOM 1955   H HG13 . VAL A 1 130 ? 64.538  97.807  118.084 1.00 0.00 ? 134 VAL A HG13 1  
ATOM 1956   H HG21 . VAL A 1 130 ? 67.676  98.168  116.422 1.00 0.00 ? 134 VAL A HG21 1  
ATOM 1957   H HG22 . VAL A 1 130 ? 66.293  97.792  115.745 1.00 0.00 ? 134 VAL A HG22 1  
ATOM 1958   H HG23 . VAL A 1 130 ? 66.366  98.981  116.789 1.00 0.00 ? 134 VAL A HG23 1  
ATOM 1959   N N    . ILE A 1 131 ? 65.801  96.588  120.760 1.00 0.00 ? 135 ILE A N    1  
ATOM 1960   C CA   . ILE A 1 131 ? 65.558  95.780  121.951 1.00 0.00 ? 135 ILE A CA   1  
ATOM 1961   C C    . ILE A 1 131 ? 64.731  94.552  121.598 1.00 0.00 ? 135 ILE A C    1  
ATOM 1962   O O    . ILE A 1 131 ? 64.023  93.989  122.441 1.00 0.00 ? 135 ILE A O    1  
ATOM 1963   C CB   . ILE A 1 131 ? 64.868  96.620  123.037 1.00 0.00 ? 135 ILE A CB   1  
ATOM 1964   C CG1  . ILE A 1 131 ? 63.752  97.472  122.426 1.00 0.00 ? 135 ILE A CG1  1  
ATOM 1965   C CG2  . ILE A 1 131 ? 65.886  97.483  123.755 1.00 0.00 ? 135 ILE A CG2  1  
ATOM 1966   C CD1  . ILE A 1 131 ? 62.667  98.032  123.389 1.00 0.00 ? 135 ILE A CD1  1  
ATOM 1967   H H    . ILE A 1 131 ? 65.140  97.082  120.517 1.00 0.00 ? 135 ILE A H    1  
ATOM 1968   H HA   . ILE A 1 131 ? 66.409  95.477  122.303 1.00 0.00 ? 135 ILE A HA   1  
ATOM 1969   H HB   . ILE A 1 131 ? 64.464  96.025  123.688 1.00 0.00 ? 135 ILE A HB   1  
ATOM 1970   H HG12 . ILE A 1 131 ? 64.163  98.223  121.970 1.00 0.00 ? 135 ILE A HG12 1  
ATOM 1971   H HG13 . ILE A 1 131 ? 63.305  96.940  121.749 1.00 0.00 ? 135 ILE A HG13 1  
ATOM 1972   H HG21 . ILE A 1 131 ? 65.428  98.180  124.250 1.00 0.00 ? 135 ILE A HG21 1  
ATOM 1973   H HG22 . ILE A 1 131 ? 66.400  96.936  124.369 1.00 0.00 ? 135 ILE A HG22 1  
ATOM 1974   H HG23 . ILE A 1 131 ? 66.483  97.887  123.105 1.00 0.00 ? 135 ILE A HG23 1  
ATOM 1975   H HD11 . ILE A 1 131 ? 63.096  98.457  124.147 1.00 0.00 ? 135 ILE A HD11 1  
ATOM 1976   H HD12 . ILE A 1 131 ? 62.121  98.682  122.920 1.00 0.00 ? 135 ILE A HD12 1  
ATOM 1977   H HD13 . ILE A 1 131 ? 62.106  97.305  123.702 1.00 0.00 ? 135 ILE A HD13 1  
ATOM 1978   N N    . GLY A 1 132 ? 64.821  94.110  120.352 1.00 0.00 ? 136 GLY A N    1  
ATOM 1979   C CA   . GLY A 1 132 ? 64.110  92.927  119.931 1.00 0.00 ? 136 GLY A CA   1  
ATOM 1980   C C    . GLY A 1 132 ? 63.179  93.215  118.777 1.00 0.00 ? 136 GLY A C    1  
ATOM 1981   O O    . GLY A 1 132 ? 62.039  93.642  118.986 1.00 0.00 ? 136 GLY A O    1  
ATOM 1982   H H    . GLY A 1 132 ? 65.291  94.486  119.737 1.00 0.00 ? 136 GLY A H    1  
ATOM 1983   H HA2  . GLY A 1 132 ? 64.746  92.242  119.670 1.00 0.00 ? 136 GLY A HA2  1  
ATOM 1984   H HA3  . GLY A 1 132 ? 63.601  92.573  120.677 1.00 0.00 ? 136 GLY A HA3  1  
ATOM 1985   N N    . GLU A 1 133 ? 63.662  93.010  117.556 1.00 0.00 ? 137 GLU A N    1  
ATOM 1986   C CA   . GLU A 1 133 ? 62.815  93.133  116.383 1.00 0.00 ? 137 GLU A CA   1  
ATOM 1987   C C    . GLU A 1 133 ? 62.013  91.857  116.163 1.00 0.00 ? 137 GLU A C    1  
ATOM 1988   O O    . GLU A 1 133 ? 62.514  90.738  116.295 1.00 0.00 ? 137 GLU A O    1  
ATOM 1989   C CB   . GLU A 1 133 ? 63.653  93.451  115.149 1.00 0.00 ? 137 GLU A CB   1  
ATOM 1990   C CG   . GLU A 1 133 ? 63.981  94.911  114.993 1.00 0.00 ? 137 GLU A CG   1  
ATOM 1991   C CD   . GLU A 1 133 ? 64.768  95.184  113.728 1.00 0.00 ? 137 GLU A CD   1  
ATOM 1992   O OE1  . GLU A 1 133 ? 64.150  95.236  112.642 1.00 0.00 ? 137 GLU A OE1  1  
ATOM 1993   O OE2  . GLU A 1 133 ? 65.999  95.340  113.811 1.00 0.00 ? 137 GLU A OE2  1  
ATOM 1994   H H    . GLU A 1 133 ? 64.479  92.800  117.389 1.00 0.00 ? 137 GLU A H    1  
ATOM 1995   H HA   . GLU A 1 133 ? 62.195  93.864  116.532 1.00 0.00 ? 137 GLU A HA   1  
ATOM 1996   H HB2  . GLU A 1 133 ? 64.480  92.946  115.192 1.00 0.00 ? 137 GLU A HB2  1  
ATOM 1997   H HB3  . GLU A 1 133 ? 63.178  93.149  114.359 1.00 0.00 ? 137 GLU A HB3  1  
ATOM 1998   H HG2  . GLU A 1 133 ? 63.159  95.426  114.978 1.00 0.00 ? 137 GLU A HG2  1  
ATOM 1999   H HG3  . GLU A 1 133 ? 64.491  95.210  115.761 1.00 0.00 ? 137 GLU A HG3  1  
ATOM 2000   N N    . LEU A 1 134 ? 60.739  92.041  115.834 1.00 0.00 ? 138 LEU A N    1  
ATOM 2001   C CA   . LEU A 1 134 ? 59.816  90.923  115.698 1.00 0.00 ? 138 LEU A CA   1  
ATOM 2002   C C    . LEU A 1 134 ? 59.309  90.904  114.267 1.00 0.00 ? 138 LEU A C    1  
ATOM 2003   O O    . LEU A 1 134 ? 59.313  91.936  113.589 1.00 0.00 ? 138 LEU A O    1  
ATOM 2004   C CB   . LEU A 1 134 ? 58.663  91.045  116.697 1.00 0.00 ? 138 LEU A CB   1  
ATOM 2005   C CG   . LEU A 1 134 ? 58.793  92.015  117.874 1.00 0.00 ? 138 LEU A CG   1  
ATOM 2006   C CD1  . LEU A 1 134 ? 57.487  92.748  118.110 1.00 0.00 ? 138 LEU A CD1  1  
ATOM 2007   C CD2  . LEU A 1 134 ? 59.212  91.268  119.133 1.00 0.00 ? 138 LEU A CD2  1  
ATOM 2008   H H    . LEU A 1 134 ? 60.388  92.812  115.684 1.00 0.00 ? 138 LEU A H    1  
ATOM 2009   H HA   . LEU A 1 134 ? 60.270  90.089  115.894 1.00 0.00 ? 138 LEU A HA   1  
ATOM 2010   H HB2  . LEU A 1 134 ? 57.869  91.297  116.198 1.00 0.00 ? 138 LEU A HB2  1  
ATOM 2011   H HB3  . LEU A 1 134 ? 58.500  90.162  117.063 1.00 0.00 ? 138 LEU A HB3  1  
ATOM 2012   H HG   . LEU A 1 134 ? 59.477  92.668  117.658 1.00 0.00 ? 138 LEU A HG   1  
ATOM 2013   H HD11 . LEU A 1 134 ? 57.449  93.056  119.028 1.00 0.00 ? 138 LEU A HD11 1  
ATOM 2014   H HD12 . LEU A 1 134 ? 57.429  93.508  117.511 1.00 0.00 ? 138 LEU A HD12 1  
ATOM 2015   H HD13 . LEU A 1 134 ? 56.744  92.147  117.940 1.00 0.00 ? 138 LEU A HD13 1  
ATOM 2016   H HD21 . LEU A 1 134 ? 59.784  90.522  118.891 1.00 0.00 ? 138 LEU A HD21 1  
ATOM 2017   H HD22 . LEU A 1 134 ? 59.695  91.869  119.720 1.00 0.00 ? 138 LEU A HD22 1  
ATOM 2018   H HD23 . LEU A 1 134 ? 58.423  90.935  119.589 1.00 0.00 ? 138 LEU A HD23 1  
ATOM 2019   N N    . LYS A 1 135 ? 58.895  89.726  113.810 1.00 0.00 ? 139 LYS A N    1  
ATOM 2020   C CA   . LYS A 1 135 ? 58.426  89.542  112.443 1.00 0.00 ? 139 LYS A CA   1  
ATOM 2021   C C    . LYS A 1 135 ? 56.903  89.532  112.435 1.00 0.00 ? 139 LYS A C    1  
ATOM 2022   O O    . LYS A 1 135 ? 56.275  88.956  113.328 1.00 0.00 ? 139 LYS A O    1  
ATOM 2023   C CB   . LYS A 1 135 ? 58.981  88.244  111.871 1.00 0.00 ? 139 LYS A CB   1  
ATOM 2024   C CG   . LYS A 1 135 ? 60.099  88.440  110.870 1.00 0.00 ? 139 LYS A CG   1  
ATOM 2025   C CD   . LYS A 1 135 ? 61.428  87.983  111.442 1.00 0.00 ? 139 LYS A CD   1  
ATOM 2026   C CE   . LYS A 1 135 ? 62.599  88.576  110.673 1.00 0.00 ? 139 LYS A CE   1  
ATOM 2027   N NZ   . LYS A 1 135 ? 63.831  87.745  110.740 1.00 0.00 ? 139 LYS A NZ   1  
ATOM 2028   H H    . LYS A 1 135 ? 58.879  89.010  114.286 1.00 0.00 ? 139 LYS A H    1  
ATOM 2029   H HA   . LYS A 1 135 ? 58.738  90.273  111.887 1.00 0.00 ? 139 LYS A HA   1  
ATOM 2030   H HB2  . LYS A 1 135 ? 59.306  87.693  112.600 1.00 0.00 ? 139 LYS A HB2  1  
ATOM 2031   H HB3  . LYS A 1 135 ? 58.259  87.755  111.445 1.00 0.00 ? 139 LYS A HB3  1  
ATOM 2032   H HG2  . LYS A 1 135 ? 59.903  87.942  110.061 1.00 0.00 ? 139 LYS A HG2  1  
ATOM 2033   H HG3  . LYS A 1 135 ? 60.154  89.376  110.621 1.00 0.00 ? 139 LYS A HG3  1  
ATOM 2034   H HD2  . LYS A 1 135 ? 61.486  88.243  112.375 1.00 0.00 ? 139 LYS A HD2  1  
ATOM 2035   H HD3  . LYS A 1 135 ? 61.478  87.014  111.414 1.00 0.00 ? 139 LYS A HD3  1  
ATOM 2036   H HE2  . LYS A 1 135 ? 62.344  88.689  109.744 1.00 0.00 ? 139 LYS A HE2  1  
ATOM 2037   H HE3  . LYS A 1 135 ? 62.793  89.459  111.023 1.00 0.00 ? 139 LYS A HE3  1  
ATOM 2038   H HZ1  . LYS A 1 135 ? 64.116  87.568  109.915 1.00 0.00 ? 139 LYS A HZ1  1  
ATOM 2039   H HZ2  . LYS A 1 135 ? 64.464  88.187  111.183 1.00 0.00 ? 139 LYS A HZ2  1  
ATOM 2040   H HZ3  . LYS A 1 135 ? 63.653  86.982  111.162 1.00 0.00 ? 139 LYS A HZ3  1  
ATOM 2041   N N    . ASN A 1 136 ? 56.303  90.161  111.427 1.00 0.00 ? 140 ASN A N    1  
ATOM 2042   C CA   . ASN A 1 136 ? 54.855  90.170  111.269 1.00 0.00 ? 140 ASN A CA   1  
ATOM 2043   C C    . ASN A 1 136 ? 54.517  90.375  109.803 1.00 0.00 ? 140 ASN A C    1  
ATOM 2044   O O    . ASN A 1 136 ? 55.402  90.307  108.944 1.00 0.00 ? 140 ASN A O    1  
ATOM 2045   C CB   . ASN A 1 136 ? 54.198  91.261  112.122 1.00 0.00 ? 140 ASN A CB   1  
ATOM 2046   C CG   . ASN A 1 136 ? 55.001  92.542  112.151 1.00 0.00 ? 140 ASN A CG   1  
ATOM 2047   O OD1  . ASN A 1 136 ? 55.884  92.714  112.988 1.00 0.00 ? 140 ASN A OD1  1  
ATOM 2048   N ND2  . ASN A 1 136 ? 54.678  93.462  111.254 1.00 0.00 ? 140 ASN A ND2  1  
ATOM 2049   H H    . ASN A 1 136 ? 56.727  90.593  110.816 1.00 0.00 ? 140 ASN A H    1  
ATOM 2050   H HA   . ASN A 1 136 ? 54.507  89.318  111.574 1.00 0.00 ? 140 ASN A HA   1  
ATOM 2051   H HB2  . ASN A 1 136 ? 53.311  91.447  111.776 1.00 0.00 ? 140 ASN A HB2  1  
ATOM 2052   H HB3  . ASN A 1 136 ? 54.086  90.934  113.029 1.00 0.00 ? 140 ASN A HB3  1  
ATOM 2053   H HD21 . ASN A 1 136 ? 55.092  94.215  111.243 1.00 0.00 ? 140 ASN A HD21 1  
ATOM 2054   H HD22 . ASN A 1 136 ? 54.054  93.306  110.684 1.00 0.00 ? 140 ASN A HD22 1  
ATOM 2055   N N    . GLY A 1 137 ? 53.240  90.616  109.520 1.00 0.00 ? 141 GLY A N    1  
ATOM 2056   C CA   . GLY A 1 137 ? 52.856  91.037  108.190 1.00 0.00 ? 141 GLY A CA   1  
ATOM 2057   C C    . GLY A 1 137 ? 52.622  92.535  108.130 1.00 0.00 ? 141 GLY A C    1  
ATOM 2058   O O    . GLY A 1 137 ? 52.083  93.146  109.053 1.00 0.00 ? 141 GLY A O    1  
ATOM 2059   H H    . GLY A 1 137 ? 52.592  90.541  110.081 1.00 0.00 ? 141 GLY A H    1  
ATOM 2060   H HA2  . GLY A 1 137 ? 53.549  90.791  107.558 1.00 0.00 ? 141 GLY A HA2  1  
ATOM 2061   H HA3  . GLY A 1 137 ? 52.048  90.571  107.922 1.00 0.00 ? 141 GLY A HA3  1  
ATOM 2062   N N    . GLU A 1 138 ? 53.034  93.131  107.017 1.00 0.00 ? 142 GLU A N    1  
ATOM 2063   C CA   . GLU A 1 138 ? 52.981  94.577  106.869 1.00 0.00 ? 142 GLU A CA   1  
ATOM 2064   C C    . GLU A 1 138 ? 51.588  94.981  106.414 1.00 0.00 ? 142 GLU A C    1  
ATOM 2065   O O    . GLU A 1 138 ? 51.067  94.450  105.430 1.00 0.00 ? 142 GLU A O    1  
ATOM 2066   C CB   . GLU A 1 138 ? 54.061  95.060  105.891 1.00 0.00 ? 142 GLU A CB   1  
ATOM 2067   C CG   . GLU A 1 138 ? 53.813  96.448  105.316 1.00 0.00 ? 142 GLU A CG   1  
ATOM 2068   C CD   . GLU A 1 138 ? 53.957  97.539  106.342 1.00 0.00 ? 142 GLU A CD   1  
ATOM 2069   O OE1  . GLU A 1 138 ? 54.240  98.683  105.938 1.00 0.00 ? 142 GLU A OE1  1  
ATOM 2070   O OE2  . GLU A 1 138 ? 53.803  97.252  107.546 1.00 0.00 ? 142 GLU A OE2  1  
ATOM 2071   H H    . GLU A 1 138 ? 53.349  92.713  106.335 1.00 0.00 ? 142 GLU A H    1  
ATOM 2072   H HA   . GLU A 1 138 ? 53.161  95.001  107.723 1.00 0.00 ? 142 GLU A HA   1  
ATOM 2073   H HB2  . GLU A 1 138 ? 54.918  95.058  106.345 1.00 0.00 ? 142 GLU A HB2  1  
ATOM 2074   H HB3  . GLU A 1 138 ? 54.126  94.426  105.160 1.00 0.00 ? 142 GLU A HB3  1  
ATOM 2075   H HG2  . GLU A 1 138 ? 54.435  96.608  104.590 1.00 0.00 ? 142 GLU A HG2  1  
ATOM 2076   H HG3  . GLU A 1 138 ? 52.921  96.482  104.937 1.00 0.00 ? 142 GLU A HG3  1  
ATOM 2077   N N    . ILE A 1 139 ? 50.995  95.929  107.136 1.00 0.00 ? 143 ILE A N    1  
ATOM 2078   C CA   . ILE A 1 139 ? 49.629  96.348  106.847 1.00 0.00 ? 143 ILE A CA   1  
ATOM 2079   C C    . ILE A 1 139 ? 49.617  97.526  105.880 1.00 0.00 ? 143 ILE A C    1  
ATOM 2080   O O    . ILE A 1 139 ? 48.849  97.535  104.912 1.00 0.00 ? 143 ILE A O    1  
ATOM 2081   C CB   . ILE A 1 139 ? 48.871  96.689  108.144 1.00 0.00 ? 143 ILE A CB   1  
ATOM 2082   C CG1  . ILE A 1 139 ? 49.479  95.950  109.337 1.00 0.00 ? 143 ILE A CG1  1  
ATOM 2083   C CG2  . ILE A 1 139 ? 47.401  96.331  108.009 1.00 0.00 ? 143 ILE A CG2  1  
ATOM 2084   C CD1  . ILE A 1 139 ? 50.634  96.659  110.019 1.00 0.00 ? 143 ILE A CD1  1  
ATOM 2085   H H    . ILE A 1 139 ? 51.365  96.340  107.794 1.00 0.00 ? 143 ILE A H    1  
ATOM 2086   H HA   . ILE A 1 139 ? 49.169  95.606  106.423 1.00 0.00 ? 143 ILE A HA   1  
ATOM 2087   H HB   . ILE A 1 139 ? 48.950  97.643  108.297 1.00 0.00 ? 143 ILE A HB   1  
ATOM 2088   H HG12 . ILE A 1 139 ? 48.782  95.794  109.992 1.00 0.00 ? 143 ILE A HG12 1  
ATOM 2089   H HG13 . ILE A 1 139 ? 49.785  95.079  109.037 1.00 0.00 ? 143 ILE A HG13 1  
ATOM 2090   H HG21 . ILE A 1 139 ? 47.305  95.579  107.404 1.00 0.00 ? 143 ILE A HG21 1  
ATOM 2091   H HG22 . ILE A 1 139 ? 47.044  96.093  108.879 1.00 0.00 ? 143 ILE A HG22 1  
ATOM 2092   H HG23 . ILE A 1 139 ? 46.913  97.092  107.659 1.00 0.00 ? 143 ILE A HG23 1  
ATOM 2093   H HD11 . ILE A 1 139 ? 50.477  96.686  110.976 1.00 0.00 ? 143 ILE A HD11 1  
ATOM 2094   H HD12 . ILE A 1 139 ? 51.459  96.180  109.840 1.00 0.00 ? 143 ILE A HD12 1  
ATOM 2095   H HD13 . ILE A 1 139 ? 50.706  97.563  109.678 1.00 0.00 ? 143 ILE A HD13 1  
ATOM 2096   N N    . ASP A 1 140 ? 50.475  98.517  106.111 1.00 0.00 ? 144 ASP A N    1  
ATOM 2097   C CA   . ASP A 1 140 ? 50.469  99.704  105.267 1.00 0.00 ? 144 ASP A CA   1  
ATOM 2098   C C    . ASP A 1 140 ? 51.343  99.504  104.037 1.00 0.00 ? 144 ASP A C    1  
ATOM 2099   O O    . ASP A 1 140 ? 52.568  99.404  104.133 1.00 0.00 ? 144 ASP A O    1  
ATOM 2100   C CB   . ASP A 1 140 ? 50.926  100.939 106.049 1.00 0.00 ? 144 ASP A CB   1  
ATOM 2101   C CG   . ASP A 1 140 ? 49.779  101.688 106.706 1.00 0.00 ? 144 ASP A CG   1  
ATOM 2102   O OD1  . ASP A 1 140 ? 48.671  101.128 106.830 1.00 0.00 ? 144 ASP A OD1  1  
ATOM 2103   O OD2  . ASP A 1 140 ? 49.999  102.843 107.124 1.00 0.00 ? 144 ASP A OD2  1  
ATOM 2104   H H    . ASP A 1 140 ? 51.060  98.521  106.741 1.00 0.00 ? 144 ASP A H    1  
ATOM 2105   H HA   . ASP A 1 140 ? 49.556  99.851  104.974 1.00 0.00 ? 144 ASP A HA   1  
ATOM 2106   H HB2  . ASP A 1 140 ? 51.559  100.666 106.732 1.00 0.00 ? 144 ASP A HB2  1  
ATOM 2107   H HB3  . ASP A 1 140 ? 51.396  101.539 105.450 1.00 0.00 ? 144 ASP A HB3  1  
ATOM 2108   N N    . THR A 1 141 ? 50.698  99.418  102.875 1.00 0.00 ? 145 THR A N    1  
ATOM 2109   C CA   . THR A 1 141 ? 51.409  99.331  101.606 1.00 0.00 ? 145 THR A CA   1  
ATOM 2110   C C    . THR A 1 141 ? 52.231  100.577 101.316 1.00 0.00 ? 145 THR A C    1  
ATOM 2111   O O    . THR A 1 141 ? 53.393  100.443 100.909 1.00 0.00 ? 145 THR A O    1  
ATOM 2112   C CB   . THR A 1 141 ? 50.448  99.081  100.437 1.00 0.00 ? 145 THR A CB   1  
ATOM 2113   O OG1  . THR A 1 141 ? 49.188  99.708  100.699 1.00 0.00 ? 145 THR A OG1  1  
ATOM 2114   C CG2  . THR A 1 141 ? 50.252  97.604  100.186 1.00 0.00 ? 145 THR A CG2  1  
ATOM 2115   H H    . THR A 1 141 ? 49.842  99.408  102.802 1.00 0.00 ? 145 THR A H    1  
ATOM 2116   H HA   . THR A 1 141 ? 52.014  98.577  101.692 1.00 0.00 ? 145 THR A HA   1  
ATOM 2117   H HB   . THR A 1 141 ? 50.841  99.467  99.639  1.00 0.00 ? 145 THR A HB   1  
ATOM 2118   H HG1  . THR A 1 141 ? 49.059  100.324 100.141 1.00 0.00 ? 145 THR A HG1  1  
ATOM 2119   H HG21 . THR A 1 141 ? 49.721  97.406  99.399  1.00 0.00 ? 145 THR A HG21 1  
ATOM 2120   H HG22 . THR A 1 141 ? 51.107  97.196  99.972  1.00 0.00 ? 145 THR A HG22 1  
ATOM 2121   H HG23 . THR A 1 141 ? 49.884  97.186  100.980 1.00 0.00 ? 145 THR A HG23 1  
ATOM 2122   N N    . LEU A 1 142 ? 51.667  101.777 101.548 1.00 0.00 ? 146 LEU A N    1  
ATOM 2123   C CA   . LEU A 1 142 ? 52.233  103.083 101.213 1.00 0.00 ? 146 LEU A CA   1  
ATOM 2124   C C    . LEU A 1 142 ? 52.591  103.114 99.731  1.00 0.00 ? 146 LEU A C    1  
ATOM 2125   O O    . LEU A 1 142 ? 53.774  103.227 99.385  1.00 0.00 ? 146 LEU A O    1  
ATOM 2126   C CB   . LEU A 1 142 ? 53.452  103.414 102.081 1.00 0.00 ? 146 LEU A CB   1  
ATOM 2127   C CG   . LEU A 1 142 ? 53.288  103.430 103.607 1.00 0.00 ? 146 LEU A CG   1  
ATOM 2128   C CD1  . LEU A 1 142 ? 54.625  103.164 104.286 1.00 0.00 ? 146 LEU A CD1  1  
ATOM 2129   C CD2  . LEU A 1 142 ? 52.628  104.699 104.148 1.00 0.00 ? 146 LEU A CD2  1  
ATOM 2130   H H    . LEU A 1 142 ? 50.899  101.846 101.927 1.00 0.00 ? 146 LEU A H    1  
ATOM 2131   H HA   . LEU A 1 142 ? 51.566  103.763 101.395 1.00 0.00 ? 146 LEU A HA   1  
ATOM 2132   H HB2  . LEU A 1 142 ? 54.148  102.774 101.866 1.00 0.00 ? 146 LEU A HB2  1  
ATOM 2133   H HB3  . LEU A 1 142 ? 53.776  104.287 101.811 1.00 0.00 ? 146 LEU A HB3  1  
ATOM 2134   H HG   . LEU A 1 142 ? 52.673  102.713 103.823 1.00 0.00 ? 146 LEU A HG   1  
ATOM 2135   H HD11 . LEU A 1 142 ? 54.815  102.212 104.265 1.00 0.00 ? 146 LEU A HD11 1  
ATOM 2136   H HD12 . LEU A 1 142 ? 55.327  103.642 103.818 1.00 0.00 ? 146 LEU A HD12 1  
ATOM 2137   H HD13 . LEU A 1 142 ? 54.586  103.465 105.207 1.00 0.00 ? 146 LEU A HD13 1  
ATOM 2138   H HD21 . LEU A 1 142 ? 52.835  105.445 103.564 1.00 0.00 ? 146 LEU A HD21 1  
ATOM 2139   H HD22 . LEU A 1 142 ? 51.667  104.574 104.185 1.00 0.00 ? 146 LEU A HD22 1  
ATOM 2140   H HD23 . LEU A 1 142 ? 52.964  104.884 105.039 1.00 0.00 ? 146 LEU A HD23 1  
ATOM 2141   N N    . PRO A 1 143 ? 51.592  102.990 98.831  1.00 0.00 ? 147 PRO A N    1  
ATOM 2142   C CA   . PRO A 1 143 ? 51.861  102.567 97.445  1.00 0.00 ? 147 PRO A CA   1  
ATOM 2143   C C    . PRO A 1 143 ? 52.624  103.570 96.596  1.00 0.00 ? 147 PRO A C    1  
ATOM 2144   O O    . PRO A 1 143 ? 53.006  103.290 95.455  1.00 0.00 ? 147 PRO A O    1  
ATOM 2145   C CB   . PRO A 1 143 ? 50.452  102.373 96.865  1.00 0.00 ? 147 PRO A CB   1  
ATOM 2146   C CG   . PRO A 1 143 ? 49.566  102.193 98.050  1.00 0.00 ? 147 PRO A CG   1  
ATOM 2147   C CD   . PRO A 1 143 ? 50.149  103.078 99.103  1.00 0.00 ? 147 PRO A CD   1  
ATOM 2148   H HA   . PRO A 1 143 ? 52.440  101.788 97.436  1.00 0.00 ? 147 PRO A HA   1  
ATOM 2149   H HB2  . PRO A 1 143 ? 50.182  103.141 96.337  1.00 0.00 ? 147 PRO A HB2  1  
ATOM 2150   H HB3  . PRO A 1 143 ? 50.418  101.600 96.280  1.00 0.00 ? 147 PRO A HB3  1  
ATOM 2151   H HG2  . PRO A 1 143 ? 48.652  102.444 97.847  1.00 0.00 ? 147 PRO A HG2  1  
ATOM 2152   H HG3  . PRO A 1 143 ? 49.549  101.268 98.339  1.00 0.00 ? 147 PRO A HG3  1  
ATOM 2153   H HD2  . PRO A 1 143 ? 49.823  103.989 99.030  1.00 0.00 ? 147 PRO A HD2  1  
ATOM 2154   H HD3  . PRO A 1 143 ? 49.930  102.769 99.996  1.00 0.00 ? 147 PRO A HD3  1  
ATOM 2155   N N    . GLU A 1 144 ? 52.853  104.748 97.170  1.00 0.00 ? 148 GLU A N    1  
ATOM 2156   C CA   . GLU A 1 144 ? 53.710  105.766 96.583  1.00 0.00 ? 148 GLU A CA   1  
ATOM 2157   C C    . GLU A 1 144 ? 55.141  105.274 96.434  1.00 0.00 ? 148 GLU A C    1  
ATOM 2158   O O    . GLU A 1 144 ? 55.802  105.595 95.441  1.00 0.00 ? 148 GLU A O    1  
ATOM 2159   C CB   . GLU A 1 144 ? 53.676  107.038 97.430  1.00 0.00 ? 148 GLU A CB   1  
ATOM 2160   C CG   . GLU A 1 144 ? 52.412  107.188 98.245  1.00 0.00 ? 148 GLU A CG   1  
ATOM 2161   C CD   . GLU A 1 144 ? 52.568  106.671 99.656  1.00 0.00 ? 148 GLU A CD   1  
ATOM 2162   O OE1  . GLU A 1 144 ? 53.719  106.490 100.108 1.00 0.00 ? 148 GLU A OE1  1  
ATOM 2163   O OE2  . GLU A 1 144 ? 51.535  106.462 100.323 1.00 0.00 ? 148 GLU A OE2  1  
ATOM 2164   H H    . GLU A 1 144 ? 52.508  104.980 97.923  1.00 0.00 ? 148 GLU A H    1  
ATOM 2165   H HA   . GLU A 1 144 ? 53.370  105.963 95.696  1.00 0.00 ? 148 GLU A HA   1  
ATOM 2166   H HB2  . GLU A 1 144 ? 54.440  107.040 98.028  1.00 0.00 ? 148 GLU A HB2  1  
ATOM 2167   H HB3  . GLU A 1 144 ? 53.770  107.808 96.848  1.00 0.00 ? 148 GLU A HB3  1  
ATOM 2168   H HG2  . GLU A 1 144 ? 52.157  108.124 98.272  1.00 0.00 ? 148 GLU A HG2  1  
ATOM 2169   H HG3  . GLU A 1 144 ? 51.690  106.711 97.807  1.00 0.00 ? 148 GLU A HG3  1  
ATOM 2170   N N    . GLU A 1 145 ? 55.632  104.504 97.403  1.00 0.00 ? 149 GLU A N    1  
ATOM 2171   C CA   . GLU A 1 145 ? 57.026  104.099 97.433  1.00 0.00 ? 149 GLU A CA   1  
ATOM 2172   C C    . GLU A 1 145 ? 57.237  102.608 97.218  1.00 0.00 ? 149 GLU A C    1  
ATOM 2173   O O    . GLU A 1 145 ? 57.823  102.230 96.200  1.00 0.00 ? 149 GLU A O    1  
ATOM 2174   C CB   . GLU A 1 145 ? 57.654  104.510 98.773  1.00 0.00 ? 149 GLU A CB   1  
ATOM 2175   C CG   . GLU A 1 145 ? 58.049  105.981 98.848  1.00 0.00 ? 149 GLU A CG   1  
ATOM 2176   C CD   . GLU A 1 145 ? 57.402  106.716 100.008 1.00 0.00 ? 149 GLU A CD   1  
ATOM 2177   O OE1  . GLU A 1 145 ? 57.692  107.913 100.207 1.00 0.00 ? 149 GLU A OE1  1  
ATOM 2178   O OE2  . GLU A 1 145 ? 56.592  106.094 100.722 1.00 0.00 ? 149 GLU A OE2  1  
ATOM 2179   H H    . GLU A 1 145 ? 55.163  104.204 98.058  1.00 0.00 ? 149 GLU A H    1  
ATOM 2180   H HA   . GLU A 1 145 ? 57.456  104.552 96.690  1.00 0.00 ? 149 GLU A HA   1  
ATOM 2181   H HB2  . GLU A 1 145 ? 57.026  104.316 99.487  1.00 0.00 ? 149 GLU A HB2  1  
ATOM 2182   H HB3  . GLU A 1 145 ? 58.441  103.965 98.931  1.00 0.00 ? 149 GLU A HB3  1  
ATOM 2183   H HG2  . GLU A 1 145 ? 59.014  106.047 98.929  1.00 0.00 ? 149 GLU A HG2  1  
ATOM 2184   H HG3  . GLU A 1 145 ? 57.803  106.419 98.018  1.00 0.00 ? 149 GLU A HG3  1  
ATOM 2185   N N    . ILE A 1 146 ? 56.792  101.753 98.131  1.00 0.00 ? 150 ILE A N    1  
ATOM 2186   C CA   . ILE A 1 146 ? 56.946  100.310 98.013  1.00 0.00 ? 150 ILE A CA   1  
ATOM 2187   C C    . ILE A 1 146 ? 56.261  99.782  96.759  1.00 0.00 ? 150 ILE A C    1  
ATOM 2188   O O    . ILE A 1 146 ? 56.876  99.096  95.944  1.00 0.00 ? 150 ILE A O    1  
ATOM 2189   C CB   . ILE A 1 146 ? 56.420  99.595  99.277  1.00 0.00 ? 150 ILE A CB   1  
ATOM 2190   C CG1  . ILE A 1 146 ? 57.210  100.048 100.503 1.00 0.00 ? 150 ILE A CG1  1  
ATOM 2191   C CG2  . ILE A 1 146 ? 56.501  98.086  99.123  1.00 0.00 ? 150 ILE A CG2  1  
ATOM 2192   C CD1  . ILE A 1 146 ? 56.492  101.071 101.340 1.00 0.00 ? 150 ILE A CD1  1  
ATOM 2193   H H    . ILE A 1 146 ? 56.384  102.000 98.847  1.00 0.00 ? 150 ILE A H    1  
ATOM 2194   H HA   . ILE A 1 146 ? 57.893  100.119 97.931  1.00 0.00 ? 150 ILE A HA   1  
ATOM 2195   H HB   . ILE A 1 146 ? 55.488  99.836  99.397  1.00 0.00 ? 150 ILE A HB   1  
ATOM 2196   H HG12 . ILE A 1 146 ? 57.411  99.275  101.053 1.00 0.00 ? 150 ILE A HG12 1  
ATOM 2197   H HG13 . ILE A 1 146 ? 58.059  100.417 100.212 1.00 0.00 ? 150 ILE A HG13 1  
ATOM 2198   H HG21 . ILE A 1 146 ? 56.175  97.832  98.246  1.00 0.00 ? 150 ILE A HG21 1  
ATOM 2199   H HG22 . ILE A 1 146 ? 57.423  97.799  99.222  1.00 0.00 ? 150 ILE A HG22 1  
ATOM 2200   H HG23 . ILE A 1 146 ? 55.956  97.661  99.805  1.00 0.00 ? 150 ILE A HG23 1  
ATOM 2201   H HD11 . ILE A 1 146 ? 55.539  101.022 101.166 1.00 0.00 ? 150 ILE A HD11 1  
ATOM 2202   H HD12 . ILE A 1 146 ? 56.657  100.894 102.280 1.00 0.00 ? 150 ILE A HD12 1  
ATOM 2203   H HD13 . ILE A 1 146 ? 56.816  101.958 101.117 1.00 0.00 ? 150 ILE A HD13 1  
ATOM 2204   N N    . VAL A 1 147 ? 54.985  100.108 96.583  1.00 0.00 ? 151 VAL A N    1  
ATOM 2205   C CA   . VAL A 1 147 ? 54.209  99.598  95.463  1.00 0.00 ? 151 VAL A CA   1  
ATOM 2206   C C    . VAL A 1 147 ? 54.754  100.237 94.191  1.00 0.00 ? 151 VAL A C    1  
ATOM 2207   O O    . VAL A 1 147 ? 55.070  99.547  93.213  1.00 0.00 ? 151 VAL A O    1  
ATOM 2208   C CB   . VAL A 1 147 ? 52.710  99.891  95.676  1.00 0.00 ? 151 VAL A CB   1  
ATOM 2209   C CG1  . VAL A 1 147 ? 51.887  99.624  94.419  1.00 0.00 ? 151 VAL A CG1  1  
ATOM 2210   C CG2  . VAL A 1 147 ? 52.182  99.086  96.856  1.00 0.00 ? 151 VAL A CG2  1  
ATOM 2211   H H    . VAL A 1 147 ? 54.548  100.630 97.108  1.00 0.00 ? 151 VAL A H    1  
ATOM 2212   H HA   . VAL A 1 147 ? 54.290  98.634  95.390  1.00 0.00 ? 151 VAL A HA   1  
ATOM 2213   H HB   . VAL A 1 147 ? 52.620  100.836 95.875  1.00 0.00 ? 151 VAL A HB   1  
ATOM 2214   H HG11 . VAL A 1 147 ? 52.186  98.799  94.005  1.00 0.00 ? 151 VAL A HG11 1  
ATOM 2215   H HG12 . VAL A 1 147 ? 50.949  99.544  94.656  1.00 0.00 ? 151 VAL A HG12 1  
ATOM 2216   H HG13 . VAL A 1 147 ? 52.001  100.357 93.796  1.00 0.00 ? 151 VAL A HG13 1  
ATOM 2217   H HG21 . VAL A 1 147 ? 52.400  99.542  97.684  1.00 0.00 ? 151 VAL A HG21 1  
ATOM 2218   H HG22 . VAL A 1 147 ? 51.219  98.996  96.781  1.00 0.00 ? 151 VAL A HG22 1  
ATOM 2219   H HG23 . VAL A 1 147 ? 52.590  98.206  96.856  1.00 0.00 ? 151 VAL A HG23 1  
ATOM 2220   N N    . ASN A 1 148 ? 54.909  101.566 94.222  1.00 0.00 ? 152 ASN A N    1  
ATOM 2221   C CA   . ASN A 1 148 ? 55.355  102.309 93.047  1.00 0.00 ? 152 ASN A CA   1  
ATOM 2222   C C    . ASN A 1 148 ? 56.802  102.769 93.195  1.00 0.00 ? 152 ASN A C    1  
ATOM 2223   O O    . ASN A 1 148 ? 57.087  103.698 93.959  1.00 0.00 ? 152 ASN A O    1  
ATOM 2224   C CB   . ASN A 1 148 ? 54.433  103.504 92.816  1.00 0.00 ? 152 ASN A CB   1  
ATOM 2225   C CG   . ASN A 1 148 ? 55.050  104.568 91.925  1.00 0.00 ? 152 ASN A CG   1  
ATOM 2226   O OD1  . ASN A 1 148 ? 55.114  105.746 92.278  1.00 0.00 ? 152 ASN A OD1  1  
ATOM 2227   N ND2  . ASN A 1 148 ? 55.514  104.148 90.756  1.00 0.00 ? 152 ASN A ND2  1  
ATOM 2228   H H    . ASN A 1 148 ? 54.758  102.052 94.915  1.00 0.00 ? 152 ASN A H    1  
ATOM 2229   H HA   . ASN A 1 148 ? 55.316  101.719 92.278  1.00 0.00 ? 152 ASN A HA   1  
ATOM 2230   H HB2  . ASN A 1 148 ? 53.606  103.195 92.415  1.00 0.00 ? 152 ASN A HB2  1  
ATOM 2231   H HB3  . ASN A 1 148 ? 54.204  103.900 93.672  1.00 0.00 ? 152 ASN A HB3  1  
ATOM 2232   H HD21 . ASN A 1 148 ? 55.876  104.707 90.212  1.00 0.00 ? 152 ASN A HD21 1  
ATOM 2233   H HD22 . ASN A 1 148 ? 55.452  103.318 90.543  1.00 0.00 ? 152 ASN A HD22 1  
ATOM 2234   N N    . VAL A 1 149 ? 57.724  102.145 92.468  1.00 0.00 ? 153 VAL A N    1  
ATOM 2235   C CA   . VAL A 1 149 ? 59.086  102.658 92.414  1.00 0.00 ? 153 VAL A CA   1  
ATOM 2236   C C    . VAL A 1 149 ? 59.503  102.739 90.944  1.00 0.00 ? 153 VAL A C    1  
ATOM 2237   O O    . VAL A 1 149 ? 59.869  101.742 90.309  1.00 0.00 ? 153 VAL A O    1  
ATOM 2238   C CB   . VAL A 1 149 ? 60.036  101.824 93.308  1.00 0.00 ? 153 VAL A CB   1  
ATOM 2239   C CG1  . VAL A 1 149 ? 60.069  100.336 92.928  1.00 0.00 ? 153 VAL A CG1  1  
ATOM 2240   C CG2  . VAL A 1 149 ? 61.440  102.420 93.315  1.00 0.00 ? 153 VAL A CG2  1  
ATOM 2241   H H    . VAL A 1 149 ? 57.583  101.434 92.005  1.00 0.00 ? 153 VAL A H    1  
ATOM 2242   H HA   . VAL A 1 149 ? 59.139  103.553 92.784  1.00 0.00 ? 153 VAL A HA   1  
ATOM 2243   H HB   . VAL A 1 149 ? 59.676  101.867 94.208  1.00 0.00 ? 153 VAL A HB   1  
ATOM 2244   H HG11 . VAL A 1 149 ? 60.721  100.196 92.225  1.00 0.00 ? 153 VAL A HG11 1  
ATOM 2245   H HG12 . VAL A 1 149 ? 60.313  99.809  93.705  1.00 0.00 ? 153 VAL A HG12 1  
ATOM 2246   H HG13 . VAL A 1 149 ? 59.193  100.062 92.615  1.00 0.00 ? 153 VAL A HG13 1  
ATOM 2247   H HG21 . VAL A 1 149 ? 61.779  102.461 92.406  1.00 0.00 ? 153 VAL A HG21 1  
ATOM 2248   H HG22 . VAL A 1 149 ? 61.411  103.314 93.690  1.00 0.00 ? 153 VAL A HG22 1  
ATOM 2249   H HG23 . VAL A 1 149 ? 62.026  101.864 93.852  1.00 0.00 ? 153 VAL A HG23 1  
ATOM 2250   N N    . SER A 1 150 ? 59.385  103.935 90.370  1.00 0.00 ? 154 SER A N    1  
ATOM 2251   C CA   . SER A 1 150 ? 59.590  104.110 88.940  1.00 0.00 ? 154 SER A CA   1  
ATOM 2252   C C    . SER A 1 150 ? 61.003  104.558 88.595  1.00 0.00 ? 154 SER A C    1  
ATOM 2253   O O    . SER A 1 150 ? 61.711  105.088 89.457  1.00 0.00 ? 154 SER A O    1  
ATOM 2254   C CB   . SER A 1 150 ? 58.567  105.125 88.409  1.00 0.00 ? 154 SER A CB   1  
ATOM 2255   O OG   . SER A 1 150 ? 58.493  105.089 86.998  1.00 0.00 ? 154 SER A OG   1  
ATOM 2256   H H    . SER A 1 150 ? 59.186  104.657 90.794  1.00 0.00 ? 154 SER A H    1  
ATOM 2257   H HA   . SER A 1 150 ? 59.464  103.247 88.516  1.00 0.00 ? 154 SER A HA   1  
ATOM 2258   H HB2  . SER A 1 150 ? 57.694  104.935 88.786  1.00 0.00 ? 154 SER A HB2  1  
ATOM 2259   H HB3  . SER A 1 150 ? 58.813  106.018 88.699  1.00 0.00 ? 154 SER A HB3  1  
ATOM 2260   H HG   . SER A 1 150 ? 58.849  105.780 86.681  1.00 0.00 ? 154 SER A HG   1  
ATOM 2261   N N    . LYS A 1 151 ? 61.440  104.358 87.357  1.00 0.00 ? 155 LYS A N    1  
ATOM 2262   C CA   . LYS A 1 151 ? 62.746  104.858 86.945  1.00 0.00 ? 155 LYS A CA   1  
ATOM 2263   C C    . LYS A 1 151 ? 62.764  106.349 86.626  1.00 0.00 ? 155 LYS A C    1  
ATOM 2264   O O    . LYS A 1 151 ? 63.837  106.885 86.334  1.00 0.00 ? 155 LYS A O    1  
ATOM 2265   C CB   . LYS A 1 151 ? 63.241  104.062 85.726  1.00 0.00 ? 155 LYS A CB   1  
ATOM 2266   C CG   . LYS A 1 151 ? 63.545  102.599 85.972  1.00 0.00 ? 155 LYS A CG   1  
ATOM 2267   C CD   . LYS A 1 151 ? 64.906  102.428 86.625  1.00 0.00 ? 155 LYS A CD   1  
ATOM 2268   C CE   . LYS A 1 151 ? 65.447  101.017 86.444  1.00 0.00 ? 155 LYS A CE   1  
ATOM 2269   N NZ   . LYS A 1 151 ? 66.677  100.977 85.607  1.00 0.00 ? 155 LYS A NZ   1  
ATOM 2270   H H    . LYS A 1 151 ? 61.002  103.939 86.747  1.00 0.00 ? 155 LYS A H    1  
ATOM 2271   H HA   . LYS A 1 151 ? 63.339  104.734 87.703  1.00 0.00 ? 155 LYS A HA   1  
ATOM 2272   H HB2  . LYS A 1 151 ? 62.569  104.122 85.028  1.00 0.00 ? 155 LYS A HB2  1  
ATOM 2273   H HB3  . LYS A 1 151 ? 64.043  104.490 85.385  1.00 0.00 ? 155 LYS A HB3  1  
ATOM 2274   H HG2  . LYS A 1 151 ? 62.860  102.214 86.539  1.00 0.00 ? 155 LYS A HG2  1  
ATOM 2275   H HG3  . LYS A 1 151 ? 63.523  102.114 85.132  1.00 0.00 ? 155 LYS A HG3  1  
ATOM 2276   H HD2  . LYS A 1 151 ? 65.530  103.065 86.244  1.00 0.00 ? 155 LYS A HD2  1  
ATOM 2277   H HD3  . LYS A 1 151 ? 64.839  102.629 87.571  1.00 0.00 ? 155 LYS A HD3  1  
ATOM 2278   H HE2  . LYS A 1 151 ? 65.639  100.634 87.314  1.00 0.00 ? 155 LYS A HE2  1  
ATOM 2279   H HE3  . LYS A 1 151 ? 64.764  100.463 86.034  1.00 0.00 ? 155 LYS A HE3  1  
ATOM 2280   H HZ1  . LYS A 1 151 ? 67.208  101.656 85.829  1.00 0.00 ? 155 LYS A HZ1  1  
ATOM 2281   H HZ2  . LYS A 1 151 ? 67.104  100.209 85.743  1.00 0.00 ? 155 LYS A HZ2  1  
ATOM 2282   H HZ3  . LYS A 1 151 ? 66.454  101.045 84.748  1.00 0.00 ? 155 LYS A HZ3  1  
ATOM 2283   N N    . GLY A 1 152 ? 61.640  107.055 86.738  1.00 0.00 ? 156 GLY A N    1  
ATOM 2284   C CA   . GLY A 1 152 ? 61.579  108.460 86.384  1.00 0.00 ? 156 GLY A CA   1  
ATOM 2285   C C    . GLY A 1 152 ? 61.148  108.692 84.950  1.00 0.00 ? 156 GLY A C    1  
ATOM 2286   O O    . GLY A 1 152 ? 60.970  109.838 84.526  1.00 0.00 ? 156 GLY A O    1  
ATOM 2287   H H    . GLY A 1 152 ? 60.896  106.729 87.021  1.00 0.00 ? 156 GLY A H    1  
ATOM 2288   H HA2  . GLY A 1 152 ? 60.960  108.912 86.979  1.00 0.00 ? 156 GLY A HA2  1  
ATOM 2289   H HA3  . GLY A 1 152 ? 62.451  108.861 86.523  1.00 0.00 ? 156 GLY A HA3  1  
ATOM 2290   N N    . GLY A 1 153 ? 60.974  107.614 84.197  1.00 0.00 ? 157 GLY A N    1  
ATOM 2291   C CA   . GLY A 1 153 ? 60.624  107.700 82.791  1.00 0.00 ? 157 GLY A CA   1  
ATOM 2292   C C    . GLY A 1 153 ? 59.149  108.016 82.599  1.00 0.00 ? 157 GLY A C    1  
ATOM 2293   O O    . GLY A 1 153 ? 58.293  107.499 83.319  1.00 0.00 ? 157 GLY A O    1  
ATOM 2294   H H    . GLY A 1 153 ? 61.056  106.810 84.491  1.00 0.00 ? 157 GLY A H    1  
ATOM 2295   H HA2  . GLY A 1 153 ? 61.161  108.386 82.365  1.00 0.00 ? 157 GLY A HA2  1  
ATOM 2296   H HA3  . GLY A 1 153 ? 60.835  106.860 82.353  1.00 0.00 ? 157 GLY A HA3  1  
ATOM 2297   N N    . TYR A 1 154 ? 58.877  108.873 81.622  1.00 0.00 ? 158 TYR A N    1  
ATOM 2298   C CA   . TYR A 1 154 ? 57.532  109.277 81.236  1.00 0.00 ? 158 TYR A CA   1  
ATOM 2299   C C    . TYR A 1 154 ? 57.462  109.345 79.711  1.00 0.00 ? 158 TYR A C    1  
ATOM 2300   O O    . TYR A 1 154 ? 58.475  109.581 79.046  1.00 0.00 ? 158 TYR A O    1  
ATOM 2301   C CB   . TYR A 1 154 ? 57.167  110.604 81.906  1.00 0.00 ? 158 TYR A CB   1  
ATOM 2302   C CG   . TYR A 1 154 ? 57.402  110.612 83.408  1.00 0.00 ? 158 TYR A CG   1  
ATOM 2303   C CD1  . TYR A 1 154 ? 58.266  111.530 83.995  1.00 0.00 ? 158 TYR A CD1  1  
ATOM 2304   C CD2  . TYR A 1 154 ? 56.751  109.711 84.238  1.00 0.00 ? 158 TYR A CD2  1  
ATOM 2305   C CE1  . TYR A 1 154 ? 58.478  111.549 85.355  1.00 0.00 ? 158 TYR A CE1  1  
ATOM 2306   C CE2  . TYR A 1 154 ? 56.958  109.723 85.605  1.00 0.00 ? 158 TYR A CE2  1  
ATOM 2307   C CZ   . TYR A 1 154 ? 57.823  110.644 86.154  1.00 0.00 ? 158 TYR A CZ   1  
ATOM 2308   O OH   . TYR A 1 154 ? 58.041  110.668 87.510  1.00 0.00 ? 158 TYR A OH   1  
ATOM 2309   H H    . TYR A 1 154 ? 59.491  109.247 81.151  1.00 0.00 ? 158 TYR A H    1  
ATOM 2310   H HA   . TYR A 1 154 ? 56.877  108.628 81.538  1.00 0.00 ? 158 TYR A HA   1  
ATOM 2311   H HB2  . TYR A 1 154 ? 57.686  111.316 81.502  1.00 0.00 ? 158 TYR A HB2  1  
ATOM 2312   H HB3  . TYR A 1 154 ? 56.233  110.800 81.732  1.00 0.00 ? 158 TYR A HB3  1  
ATOM 2313   H HD1  . TYR A 1 154 ? 58.711  112.144 83.456  1.00 0.00 ? 158 TYR A HD1  1  
ATOM 2314   H HD2  . TYR A 1 154 ? 56.166  109.088 83.869  1.00 0.00 ? 158 TYR A HD2  1  
ATOM 2315   H HE1  . TYR A 1 154 ? 59.059  112.169 85.729  1.00 0.00 ? 158 TYR A HE1  1  
ATOM 2316   H HE2  . TYR A 1 154 ? 56.516  109.114 86.151  1.00 0.00 ? 158 TYR A HE2  1  
ATOM 2317   H HH   . TYR A 1 154 ? 57.325  110.860 87.906  1.00 0.00 ? 158 TYR A HH   1  
ATOM 2318   N N    . ASP A 1 155 ? 56.262  109.107 79.161  1.00 0.00 ? 159 ASP A N    1  
ATOM 2319   C CA   . ASP A 1 155 ? 56.133  108.686 77.765  1.00 0.00 ? 159 ASP A CA   1  
ATOM 2320   C C    . ASP A 1 155 ? 56.724  109.643 76.735  1.00 0.00 ? 159 ASP A C    1  
ATOM 2321   O O    . ASP A 1 155 ? 57.578  109.213 75.955  1.00 0.00 ? 159 ASP A O    1  
ATOM 2322   C CB   . ASP A 1 155 ? 54.660  108.458 77.434  1.00 0.00 ? 159 ASP A CB   1  
ATOM 2323   C CG   . ASP A 1 155 ? 54.462  107.378 76.401  1.00 0.00 ? 159 ASP A CG   1  
ATOM 2324   O OD1  . ASP A 1 155 ? 53.834  107.664 75.359  1.00 0.00 ? 159 ASP A OD1  1  
ATOM 2325   O OD2  . ASP A 1 155 ? 54.927  106.243 76.631  1.00 0.00 ? 159 ASP A OD2  1  
ATOM 2326   H H    . ASP A 1 155 ? 55.516  109.185 79.581  1.00 0.00 ? 159 ASP A H    1  
ATOM 2327   H HA   . ASP A 1 155 ? 56.655  107.871 77.699  1.00 0.00 ? 159 ASP A HA   1  
ATOM 2328   H HB2  . ASP A 1 155 ? 54.182  108.217 78.244  1.00 0.00 ? 159 ASP A HB2  1  
ATOM 2329   H HB3  . ASP A 1 155 ? 54.271  109.286 77.112  1.00 0.00 ? 159 ASP A HB3  1  
ATOM 2330   N N    . PHE A 1 156 ? 56.308  110.920 76.752  1.00 0.00 ? 160 PHE A N    1  
ATOM 2331   C CA   . PHE A 1 156 ? 56.898  112.066 76.046  1.00 0.00 ? 160 PHE A CA   1  
ATOM 2332   C C    . PHE A 1 156 ? 56.725  113.319 76.896  1.00 0.00 ? 160 PHE A C    1  
ATOM 2333   O O    . PHE A 1 156 ? 55.899  113.373 77.812  1.00 0.00 ? 160 PHE A O    1  
ATOM 2334   C CB   . PHE A 1 156 ? 56.314  112.364 74.655  1.00 0.00 ? 160 PHE A CB   1  
ATOM 2335   C CG   . PHE A 1 156 ? 55.030  113.148 74.667  1.00 0.00 ? 160 PHE A CG   1  
ATOM 2336   C CD1  . PHE A 1 156 ? 53.915  112.666 75.335  1.00 0.00 ? 160 PHE A CD1  1  
ATOM 2337   C CD2  . PHE A 1 156 ? 54.908  114.318 73.932  1.00 0.00 ? 160 PHE A CD2  1  
ATOM 2338   C CE1  . PHE A 1 156 ? 52.726  113.367 75.322  1.00 0.00 ? 160 PHE A CE1  1  
ATOM 2339   C CE2  . PHE A 1 156 ? 53.723  115.023 73.915  1.00 0.00 ? 160 PHE A CE2  1  
ATOM 2340   C CZ   . PHE A 1 156 ? 52.630  114.547 74.609  1.00 0.00 ? 160 PHE A CZ   1  
ATOM 2341   H H    . PHE A 1 156 ? 55.620  111.153 77.213  1.00 0.00 ? 160 PHE A H    1  
ATOM 2342   H HA   . PHE A 1 156 ? 57.826  111.822 75.907  1.00 0.00 ? 160 PHE A HA   1  
ATOM 2343   H HB2  . PHE A 1 156 ? 56.973  112.853 74.139  1.00 0.00 ? 160 PHE A HB2  1  
ATOM 2344   H HB3  . PHE A 1 156 ? 56.162  111.523 74.195  1.00 0.00 ? 160 PHE A HB3  1  
ATOM 2345   H HD1  . PHE A 1 156 ? 53.969  111.861 75.797  1.00 0.00 ? 160 PHE A HD1  1  
ATOM 2346   H HD2  . PHE A 1 156 ? 55.635  114.630 73.444  1.00 0.00 ? 160 PHE A HD2  1  
ATOM 2347   H HE1  . PHE A 1 156 ? 51.991  113.046 75.792  1.00 0.00 ? 160 PHE A HE1  1  
ATOM 2348   H HE2  . PHE A 1 156 ? 53.661  115.819 73.436  1.00 0.00 ? 160 PHE A HE2  1  
ATOM 2349   H HZ   . PHE A 1 156 ? 51.830  115.019 74.597  1.00 0.00 ? 160 PHE A HZ   1  
ATOM 2350   N N    . GLN A 1 157 ? 57.523  114.333 76.557  1.00 0.00 ? 161 GLN A N    1  
ATOM 2351   C CA   . GLN A 1 157 ? 57.194  115.736 76.813  1.00 0.00 ? 161 GLN A CA   1  
ATOM 2352   C C    . GLN A 1 157 ? 57.733  116.518 75.624  1.00 0.00 ? 161 GLN A C    1  
ATOM 2353   O O    . GLN A 1 157 ? 58.880  116.968 75.662  1.00 0.00 ? 161 GLN A O    1  
ATOM 2354   C CB   . GLN A 1 157 ? 57.797  116.232 78.121  1.00 0.00 ? 161 GLN A CB   1  
ATOM 2355   C CG   . GLN A 1 157 ? 57.034  115.748 79.340  1.00 0.00 ? 161 GLN A CG   1  
ATOM 2356   C CD   . GLN A 1 157 ? 57.025  116.751 80.479  1.00 0.00 ? 161 GLN A CD   1  
ATOM 2357   O OE1  . GLN A 1 157 ? 57.876  117.636 80.557  1.00 0.00 ? 161 GLN A OE1  1  
ATOM 2358   N NE2  . GLN A 1 157 ? 56.059  116.605 81.378  1.00 0.00 ? 161 GLN A NE2  1  
ATOM 2359   H H    . GLN A 1 157 ? 58.281  114.223 76.165  1.00 0.00 ? 161 GLN A H    1  
ATOM 2360   H HA   . GLN A 1 157 ? 56.236  115.852 76.910  1.00 0.00 ? 161 GLN A HA   1  
ATOM 2361   H HB2  . GLN A 1 157 ? 58.718  115.934 78.182  1.00 0.00 ? 161 GLN A HB2  1  
ATOM 2362   H HB3  . GLN A 1 157 ? 57.812  117.202 78.118  1.00 0.00 ? 161 GLN A HB3  1  
ATOM 2363   H HG2  . GLN A 1 157 ? 56.120  115.551 79.084  1.00 0.00 ? 161 GLN A HG2  1  
ATOM 2364   H HG3  . GLN A 1 157 ? 57.427  114.918 79.651  1.00 0.00 ? 161 GLN A HG3  1  
ATOM 2365   H HE21 . GLN A 1 157 ? 55.482  115.974 81.290  1.00 0.00 ? 161 GLN A HE21 1  
ATOM 2366   H HE22 . GLN A 1 157 ? 56.011  117.141 82.049  1.00 0.00 ? 161 GLN A HE22 1  
ATOM 2367   N N    . GLN A 1 158 ? 56.913  116.688 74.574  1.00 0.00 ? 162 GLN A N    1  
ATOM 2368   C CA   . GLN A 1 158 ? 57.451  117.168 73.301  1.00 0.00 ? 162 GLN A CA   1  
ATOM 2369   C C    . GLN A 1 158 ? 57.017  118.595 72.941  1.00 0.00 ? 162 GLN A C    1  
ATOM 2370   O O    . GLN A 1 158 ? 57.753  119.255 72.191  1.00 0.00 ? 162 GLN A O    1  
ATOM 2371   C CB   . GLN A 1 158 ? 57.144  116.163 72.183  1.00 0.00 ? 162 GLN A CB   1  
ATOM 2372   C CG   . GLN A 1 158 ? 58.141  116.145 71.045  1.00 0.00 ? 162 GLN A CG   1  
ATOM 2373   C CD   . GLN A 1 158 ? 58.300  114.761 70.455  1.00 0.00 ? 162 GLN A CD   1  
ATOM 2374   O OE1  . GLN A 1 158 ? 57.341  113.994 70.382  1.00 0.00 ? 162 GLN A OE1  1  
ATOM 2375   N NE2  . GLN A 1 158 ? 59.512  114.432 70.030  1.00 0.00 ? 162 GLN A NE2  1  
ATOM 2376   H H    . GLN A 1 158 ? 56.067  116.535 74.581  1.00 0.00 ? 162 GLN A H    1  
ATOM 2377   H HA   . GLN A 1 158 ? 58.414  117.229 73.406  1.00 0.00 ? 162 GLN A HA   1  
ATOM 2378   H HB2  . GLN A 1 158 ? 57.098  115.274 72.569  1.00 0.00 ? 162 GLN A HB2  1  
ATOM 2379   H HB3  . GLN A 1 158 ? 56.265  116.360 71.822  1.00 0.00 ? 162 GLN A HB3  1  
ATOM 2380   H HG2  . GLN A 1 158 ? 57.852  116.760 70.353  1.00 0.00 ? 162 GLN A HG2  1  
ATOM 2381   H HG3  . GLN A 1 158 ? 59.000  116.462 71.364  1.00 0.00 ? 162 GLN A HG3  1  
ATOM 2382   H HE21 . GLN A 1 158 ? 60.159  114.994 70.097  1.00 0.00 ? 162 GLN A HE21 1  
ATOM 2383   H HE22 . GLN A 1 158 ? 59.651  113.655 69.687  1.00 0.00 ? 162 GLN A HE22 1  
ATOM 2384   N N    . PRO A 1 159 ? 55.883  119.139 73.420  1.00 0.00 ? 163 PRO A N    1  
ATOM 2385   C CA   . PRO A 1 159 ? 55.649  120.571 73.171  1.00 0.00 ? 163 PRO A CA   1  
ATOM 2386   C C    . PRO A 1 159 ? 56.452  121.491 74.071  1.00 0.00 ? 163 PRO A C    1  
ATOM 2387   O O    . PRO A 1 159 ? 56.206  122.704 74.061  1.00 0.00 ? 163 PRO A O    1  
ATOM 2388   C CB   . PRO A 1 159 ? 54.128  120.722 73.352  1.00 0.00 ? 163 PRO A CB   1  
ATOM 2389   C CG   . PRO A 1 159 ? 53.583  119.358 73.294  1.00 0.00 ? 163 PRO A CG   1  
ATOM 2390   C CD   . PRO A 1 159 ? 54.641  118.527 73.932  1.00 0.00 ? 163 PRO A CD   1  
ATOM 2391   H HA   . PRO A 1 159 ? 55.924  120.815 72.273  1.00 0.00 ? 163 PRO A HA   1  
ATOM 2392   H HB2  . PRO A 1 159 ? 53.919  121.145 74.199  1.00 0.00 ? 163 PRO A HB2  1  
ATOM 2393   H HB3  . PRO A 1 159 ? 53.747  121.279 72.655  1.00 0.00 ? 163 PRO A HB3  1  
ATOM 2394   H HG2  . PRO A 1 159 ? 52.741  119.289 73.771  1.00 0.00 ? 163 PRO A HG2  1  
ATOM 2395   H HG3  . PRO A 1 159 ? 53.415  119.080 72.380  1.00 0.00 ? 163 PRO A HG3  1  
ATOM 2396   H HD2  . PRO A 1 159 ? 54.593  118.563 74.901  1.00 0.00 ? 163 PRO A HD2  1  
ATOM 2397   H HD3  . PRO A 1 159 ? 54.568  117.593 73.680  1.00 0.00 ? 163 PRO A HD3  1  
ATOM 2398   N N    . GLY A 1 160 ? 57.376  120.958 74.865  1.00 0.00 ? 164 GLY A N    1  
ATOM 2399   C CA   . GLY A 1 160 ? 58.037  121.774 75.862  1.00 0.00 ? 164 GLY A CA   1  
ATOM 2400   C C    . GLY A 1 160 ? 57.312  122.046 77.165  1.00 0.00 ? 164 GLY A C    1  
ATOM 2401   O O    . GLY A 1 160 ? 56.644  123.079 77.274  1.00 0.00 ? 164 GLY A O    1  
ATOM 2402   H H    . GLY A 1 160 ? 57.629  120.137 74.840  1.00 0.00 ? 164 GLY A H    1  
ATOM 2403   H HA2  . GLY A 1 160 ? 58.882  121.351 76.077  1.00 0.00 ? 164 GLY A HA2  1  
ATOM 2404   H HA3  . GLY A 1 160 ? 58.244  122.630 75.455  1.00 0.00 ? 164 GLY A HA3  1  
ATOM 2405   N N    . GLN A 1 161 ? 57.392  121.146 78.149  1.00 0.00 ? 165 GLN A N    1  
ATOM 2406   C CA   . GLN A 1 161 ? 56.774  121.432 79.441  1.00 0.00 ? 165 GLN A CA   1  
ATOM 2407   C C    . GLN A 1 161 ? 57.816  121.890 80.451  1.00 0.00 ? 165 GLN A C    1  
ATOM 2408   O O    . GLN A 1 161 ? 58.095  121.182 81.427  1.00 0.00 ? 165 GLN A O    1  
ATOM 2409   C CB   . GLN A 1 161 ? 56.022  120.211 79.969  1.00 0.00 ? 165 GLN A CB   1  
ATOM 2410   C CG   . GLN A 1 161 ? 54.801  119.871 79.143  1.00 0.00 ? 165 GLN A CG   1  
ATOM 2411   C CD   . GLN A 1 161 ? 55.166  119.193 77.837  1.00 0.00 ? 165 GLN A CD   1  
ATOM 2412   O OE1  . GLN A 1 161 ? 55.417  117.989 77.799  1.00 0.00 ? 165 GLN A OE1  1  
ATOM 2413   N NE2  . GLN A 1 161 ? 55.185  119.964 76.757  1.00 0.00 ? 165 GLN A NE2  1  
ATOM 2414   H H    . GLN A 1 161 ? 57.788  120.384 78.090  1.00 0.00 ? 165 GLN A H    1  
ATOM 2415   H HA   . GLN A 1 161 ? 56.137  122.152 79.312  1.00 0.00 ? 165 GLN A HA   1  
ATOM 2416   H HB2  . GLN A 1 161 ? 56.622  119.449 79.982  1.00 0.00 ? 165 GLN A HB2  1  
ATOM 2417   H HB3  . GLN A 1 161 ? 55.753  120.375 80.886  1.00 0.00 ? 165 GLN A HB3  1  
ATOM 2418   H HG2  . GLN A 1 161 ? 54.217  119.290 79.656  1.00 0.00 ? 165 GLN A HG2  1  
ATOM 2419   H HG3  . GLN A 1 161 ? 54.302  120.682 78.957  1.00 0.00 ? 165 GLN A HG3  1  
ATOM 2420   H HE21 . GLN A 1 161 ? 55.004  120.801 76.824  1.00 0.00 ? 165 GLN A HE21 1  
ATOM 2421   H HE22 . GLN A 1 161 ? 55.378  119.625 75.991  1.00 0.00 ? 165 GLN A HE22 1  
ATOM 2422   N N    . THR A 1 162 ? 58.381  123.086 80.231  1.00 0.00 ? 166 THR A N    1  
ATOM 2423   C CA   . THR A 1 162 ? 59.345  123.760 81.117  1.00 0.00 ? 166 THR A CA   1  
ATOM 2424   C C    . THR A 1 162 ? 60.139  122.762 81.959  1.00 0.00 ? 166 THR A C    1  
ATOM 2425   O O    . THR A 1 162 ? 59.913  122.606 83.160  1.00 0.00 ? 166 THR A O    1  
ATOM 2426   C CB   . THR A 1 162 ? 58.659  124.792 82.024  1.00 0.00 ? 166 THR A CB   1  
ATOM 2427   O OG1  . THR A 1 162 ? 58.015  125.794 81.227  1.00 0.00 ? 166 THR A OG1  1  
ATOM 2428   C CG2  . THR A 1 162 ? 59.669  125.462 82.924  1.00 0.00 ? 166 THR A CG2  1  
ATOM 2429   H H    . THR A 1 162 ? 58.204  123.548 79.528  1.00 0.00 ? 166 THR A H    1  
ATOM 2430   H HA   . THR A 1 162 ? 59.967  124.229 80.540  1.00 0.00 ? 166 THR A HA   1  
ATOM 2431   H HB   . THR A 1 162 ? 58.001  124.328 82.566  1.00 0.00 ? 166 THR A HB   1  
ATOM 2432   H HG1  . THR A 1 162 ? 57.194  125.620 81.168  1.00 0.00 ? 166 THR A HG1  1  
ATOM 2433   H HG21 . THR A 1 162 ? 59.758  124.800 83.627  1.00 0.00 ? 166 THR A HG21 1  
ATOM 2434   H HG22 . THR A 1 162 ? 60.101  124.794 83.479  1.00 0.00 ? 166 THR A HG22 1  
ATOM 2435   H HG23 . THR A 1 162 ? 60.336  125.913 82.383  1.00 0.00 ? 166 THR A HG23 1  
ATOM 2436   N N    . THR A 1 163 ? 61.066  122.059 81.315  1.00 0.00 ? 167 THR A N    1  
ATOM 2437   C CA   . THR A 1 163 ? 61.678  120.910 81.956  1.00 0.00 ? 167 THR A CA   1  
ATOM 2438   C C    . THR A 1 163 ? 63.002  121.328 82.582  1.00 0.00 ? 167 THR A C    1  
ATOM 2439   O O    . THR A 1 163 ? 63.566  122.370 82.239  1.00 0.00 ? 167 THR A O    1  
ATOM 2440   C CB   . THR A 1 163 ? 61.908  119.779 80.945  1.00 0.00 ? 167 THR A CB   1  
ATOM 2441   O OG1  . THR A 1 163 ? 60.953  119.884 79.886  1.00 0.00 ? 167 THR A OG1  1  
ATOM 2442   C CG2  . THR A 1 163 ? 61.651  118.453 81.595  1.00 0.00 ? 167 THR A CG2  1  
ATOM 2443   H H    . THR A 1 163 ? 61.348  122.230 80.521  1.00 0.00 ? 167 THR A H    1  
ATOM 2444   H HA   . THR A 1 163 ? 61.080  120.581 82.646  1.00 0.00 ? 167 THR A HA   1  
ATOM 2445   H HB   . THR A 1 163 ? 62.820  119.848 80.621  1.00 0.00 ? 167 THR A HB   1  
ATOM 2446   H HG1  . THR A 1 163 ? 61.355  119.938 79.151  1.00 0.00 ? 167 THR A HG1  1  
ATOM 2447   H HG21 . THR A 1 163 ? 61.804  117.863 80.840  1.00 0.00 ? 167 THR A HG21 1  
ATOM 2448   H HG22 . THR A 1 163 ? 62.253  118.338 82.346  1.00 0.00 ? 167 THR A HG22 1  
ATOM 2449   H HG23 . THR A 1 163 ? 60.733  118.419 81.908  1.00 0.00 ? 167 THR A HG23 1  
ATOM 2450   N N    . GLY A 1 164 ? 63.490  120.507 83.512  1.00 0.00 ? 168 GLY A N    1  
ATOM 2451   C CA   . GLY A 1 164 ? 64.812  120.679 84.080  1.00 0.00 ? 168 GLY A CA   1  
ATOM 2452   C C    . GLY A 1 164 ? 65.541  119.363 84.256  1.00 0.00 ? 168 GLY A C    1  
ATOM 2453   O O    . GLY A 1 164 ? 65.262  118.396 83.543  1.00 0.00 ? 168 GLY A O    1  
ATOM 2454   H H    . GLY A 1 164 ? 63.056  119.835 83.828  1.00 0.00 ? 168 GLY A H    1  
ATOM 2455   H HA2  . GLY A 1 164 ? 65.335  121.260 83.506  1.00 0.00 ? 168 GLY A HA2  1  
ATOM 2456   H HA3  . GLY A 1 164 ? 64.737  121.121 84.940  1.00 0.00 ? 168 GLY A HA3  1  
ATOM 2457   N N    . GLU A 1 165 ? 66.478  119.317 85.207  1.00 0.00 ? 169 GLU A N    1  
ATOM 2458   C CA   . GLU A 1 165 ? 67.278  118.114 85.427  1.00 0.00 ? 169 GLU A CA   1  
ATOM 2459   C C    . GLU A 1 165 ? 66.431  116.977 85.986  1.00 0.00 ? 169 GLU A C    1  
ATOM 2460   O O    . GLU A 1 165 ? 66.790  115.802 85.859  1.00 0.00 ? 169 GLU A O    1  
ATOM 2461   C CB   . GLU A 1 165 ? 68.444  118.429 86.370  1.00 0.00 ? 169 GLU A CB   1  
ATOM 2462   C CG   . GLU A 1 165 ? 69.843  118.070 85.854  1.00 0.00 ? 169 GLU A CG   1  
ATOM 2463   C CD   . GLU A 1 165 ? 70.497  119.165 85.038  1.00 0.00 ? 169 GLU A CD   1  
ATOM 2464   O OE1  . GLU A 1 165 ? 71.312  118.831 84.154  1.00 0.00 ? 169 GLU A OE1  1  
ATOM 2465   O OE2  . GLU A 1 165 ? 70.210  120.355 85.285  1.00 0.00 ? 169 GLU A OE2  1  
ATOM 2466   H H    . GLU A 1 165 ? 66.665  119.971 85.734  1.00 0.00 ? 169 GLU A H    1  
ATOM 2467   H HA   . GLU A 1 165 ? 67.629  117.821 84.571  1.00 0.00 ? 169 GLU A HA   1  
ATOM 2468   H HB2  . GLU A 1 165 ? 68.426  119.378 86.570  1.00 0.00 ? 169 GLU A HB2  1  
ATOM 2469   H HB3  . GLU A 1 165 ? 68.296  117.960 87.206  1.00 0.00 ? 169 GLU A HB3  1  
ATOM 2470   H HG2  . GLU A 1 165 ? 70.413  117.859 86.611  1.00 0.00 ? 169 GLU A HG2  1  
ATOM 2471   H HG3  . GLU A 1 165 ? 69.782  117.268 85.313  1.00 0.00 ? 169 GLU A HG3  1  
ATOM 2472   N N    . ALA A 1 166 ? 65.308  117.315 86.630  1.00 0.00 ? 170 ALA A N    1  
ATOM 2473   C CA   . ALA A 1 166 ? 64.416  116.346 87.255  1.00 0.00 ? 170 ALA A CA   1  
ATOM 2474   C C    . ALA A 1 166 ? 63.577  115.672 86.182  1.00 0.00 ? 170 ALA A C    1  
ATOM 2475   O O    . ALA A 1 166 ? 63.419  116.217 85.085  1.00 0.00 ? 170 ALA A O    1  
ATOM 2476   C CB   . ALA A 1 166 ? 63.517  117.020 88.288  1.00 0.00 ? 170 ALA A CB   1  
ATOM 2477   H H    . ALA A 1 166 ? 65.045  118.130 86.715  1.00 0.00 ? 170 ALA A H    1  
ATOM 2478   H HA   . ALA A 1 166 ? 64.948  115.680 87.716  1.00 0.00 ? 170 ALA A HA   1  
ATOM 2479   H HB1  . ALA A 1 166 ? 63.136  116.347 88.874  1.00 0.00 ? 170 ALA A HB1  1  
ATOM 2480   H HB2  . ALA A 1 166 ? 64.040  117.647 88.813  1.00 0.00 ? 170 ALA A HB2  1  
ATOM 2481   H HB3  . ALA A 1 166 ? 62.804  117.496 87.834  1.00 0.00 ? 170 ALA A HB3  1  
ATOM 2482   N N    . PRO A 1 167 ? 62.984  114.527 86.480  1.00 0.00 ? 171 PRO A N    1  
ATOM 2483   C CA   . PRO A 1 167 ? 62.609  113.570 85.438  1.00 0.00 ? 171 PRO A CA   1  
ATOM 2484   C C    . PRO A 1 167 ? 61.254  113.880 84.814  1.00 0.00 ? 171 PRO A C    1  
ATOM 2485   O O    . PRO A 1 167 ? 60.843  113.294 83.816  1.00 0.00 ? 171 PRO A O    1  
ATOM 2486   C CB   . PRO A 1 167 ? 62.522  112.263 86.213  1.00 0.00 ? 171 PRO A CB   1  
ATOM 2487   C CG   . PRO A 1 167 ? 62.078  112.673 87.566  1.00 0.00 ? 171 PRO A CG   1  
ATOM 2488   C CD   . PRO A 1 167 ? 62.676  114.021 87.831  1.00 0.00 ? 171 PRO A CD   1  
ATOM 2489   H HA   . PRO A 1 167 ? 63.225  113.576 84.689  1.00 0.00 ? 171 PRO A HA   1  
ATOM 2490   H HB2  . PRO A 1 167 ? 61.893  111.649 85.804  1.00 0.00 ? 171 PRO A HB2  1  
ATOM 2491   H HB3  . PRO A 1 167 ? 63.380  111.812 86.243  1.00 0.00 ? 171 PRO A HB3  1  
ATOM 2492   H HG2  . PRO A 1 167 ? 61.110  112.713 87.613  1.00 0.00 ? 171 PRO A HG2  1  
ATOM 2493   H HG3  . PRO A 1 167 ? 62.368  112.032 88.232  1.00 0.00 ? 171 PRO A HG3  1  
ATOM 2494   H HD2  . PRO A 1 167 ? 62.057  114.602 88.299  1.00 0.00 ? 171 PRO A HD2  1  
ATOM 2495   H HD3  . PRO A 1 167 ? 63.474  113.957 88.379  1.00 0.00 ? 171 PRO A HD3  1  
ATOM 2496   N N    . GLY A 1 168 ? 60.558  114.827 85.443  1.00 0.00 ? 172 GLY A N    1  
ATOM 2497   C CA   . GLY A 1 168 ? 59.411  115.478 84.844  1.00 0.00 ? 172 GLY A CA   1  
ATOM 2498   C C    . GLY A 1 168 ? 59.015  116.830 85.398  1.00 0.00 ? 172 GLY A C    1  
ATOM 2499   O O    . GLY A 1 168 ? 58.392  116.900 86.461  1.00 0.00 ? 172 GLY A O    1  
ATOM 2500   H H    . GLY A 1 168 ? 60.745  115.106 86.235  1.00 0.00 ? 172 GLY A H    1  
ATOM 2501   H HA2  . GLY A 1 168 ? 59.585  115.582 83.895  1.00 0.00 ? 172 GLY A HA2  1  
ATOM 2502   H HA3  . GLY A 1 168 ? 58.648  114.884 84.929  1.00 0.00 ? 172 GLY A HA3  1  
ATOM 2503   N N    . THR A 1 169 ? 59.366  117.912 84.712  1.00 0.00 ? 173 THR A N    1  
ATOM 2504   C CA   . THR A 1 169 ? 58.849  119.222 85.071  1.00 0.00 ? 173 THR A CA   1  
ATOM 2505   C C    . THR A 1 169 ? 57.615  119.538 84.238  1.00 0.00 ? 173 THR A C    1  
ATOM 2506   O O    . THR A 1 169 ? 57.338  118.902 83.218  1.00 0.00 ? 173 THR A O    1  
ATOM 2507   C CB   . THR A 1 169 ? 59.901  120.327 84.896  1.00 0.00 ? 173 THR A CB   1  
ATOM 2508   O OG1  . THR A 1 169 ? 61.206  119.738 84.886  1.00 0.00 ? 173 THR A OG1  1  
ATOM 2509   C CG2  . THR A 1 169 ? 59.849  121.308 86.041  1.00 0.00 ? 173 THR A CG2  1  
ATOM 2510   H H    . THR A 1 169 ? 59.901  117.907 84.037  1.00 0.00 ? 173 THR A H    1  
ATOM 2511   H HA   . THR A 1 169 ? 58.611  119.196 86.012  1.00 0.00 ? 173 THR A HA   1  
ATOM 2512   H HB   . THR A 1 169 ? 59.716  120.789 84.064  1.00 0.00 ? 173 THR A HB   1  
ATOM 2513   H HG1  . THR A 1 169 ? 61.786  120.340 84.975  1.00 0.00 ? 173 THR A HG1  1  
ATOM 2514   H HG21 . THR A 1 169 ? 60.447  121.980 85.679  1.00 0.00 ? 173 THR A HG21 1  
ATOM 2515   H HG22 . THR A 1 169 ? 58.970  121.718 86.076  1.00 0.00 ? 173 THR A HG22 1  
ATOM 2516   H HG23 . THR A 1 169 ? 60.021  120.843 86.874  1.00 0.00 ? 173 THR A HG23 1  
ATOM 2517   N N    . VAL A 1 170 ? 56.870  120.533 84.705  1.00 0.00 ? 174 VAL A N    1  
ATOM 2518   C CA   . VAL A 1 170 ? 55.665  121.019 84.040  1.00 0.00 ? 174 VAL A CA   1  
ATOM 2519   C C    . VAL A 1 170 ? 55.852  122.500 83.724  1.00 0.00 ? 174 VAL A C    1  
ATOM 2520   O O    . VAL A 1 170 ? 56.812  123.112 84.217  1.00 0.00 ? 174 VAL A O    1  
ATOM 2521   C CB   . VAL A 1 170 ? 54.427  120.756 84.912  1.00 0.00 ? 174 VAL A CB   1  
ATOM 2522   C CG1  . VAL A 1 170 ? 54.466  119.342 85.441  1.00 0.00 ? 174 VAL A CG1  1  
ATOM 2523   C CG2  . VAL A 1 170 ? 54.371  121.735 86.062  1.00 0.00 ? 174 VAL A CG2  1  
ATOM 2524   H H    . VAL A 1 170 ? 57.054  120.955 85.431  1.00 0.00 ? 174 VAL A H    1  
ATOM 2525   H HA   . VAL A 1 170 ? 55.519  120.542 83.208  1.00 0.00 ? 174 VAL A HA   1  
ATOM 2526   H HB   . VAL A 1 170 ? 53.634  120.874 84.367  1.00 0.00 ? 174 VAL A HB   1  
ATOM 2527   H HG11 . VAL A 1 170 ? 54.577  119.360 86.404  1.00 0.00 ? 174 VAL A HG11 1  
ATOM 2528   H HG12 . VAL A 1 170 ? 53.637  118.890 85.220  1.00 0.00 ? 174 VAL A HG12 1  
ATOM 2529   H HG13 . VAL A 1 170 ? 55.210  118.866 85.039  1.00 0.00 ? 174 VAL A HG13 1  
ATOM 2530   H HG21 . VAL A 1 170 ? 53.823  121.367 86.773  1.00 0.00 ? 174 VAL A HG21 1  
ATOM 2531   H HG22 . VAL A 1 170 ? 55.268  121.894 86.396  1.00 0.00 ? 174 VAL A HG22 1  
ATOM 2532   H HG23 . VAL A 1 170 ? 53.986  122.572 85.758  1.00 0.00 ? 174 VAL A HG23 1  
ATOM 2533   N N    . PRO A 1 171 ? 54.993  123.114 82.885  1.00 0.00 ? 175 PRO A N    1  
ATOM 2534   C CA   . PRO A 1 171 ? 55.169  124.541 82.580  1.00 0.00 ? 175 PRO A CA   1  
ATOM 2535   C C    . PRO A 1 171 ? 54.777  125.418 83.752  1.00 0.00 ? 175 PRO A C    1  
ATOM 2536   O O    . PRO A 1 171 ? 53.589  125.530 84.072  1.00 0.00 ? 175 PRO A O    1  
ATOM 2537   C CB   . PRO A 1 171 ? 54.152  124.794 81.459  1.00 0.00 ? 175 PRO A CB   1  
ATOM 2538   C CG   . PRO A 1 171 ? 53.874  123.465 80.888  1.00 0.00 ? 175 PRO A CG   1  
ATOM 2539   C CD   . PRO A 1 171 ? 53.988  122.493 82.004  1.00 0.00 ? 175 PRO A CD   1  
ATOM 2540   H HA   . PRO A 1 171 ? 56.092  124.768 82.389  1.00 0.00 ? 175 PRO A HA   1  
ATOM 2541   H HB2  . PRO A 1 171 ? 53.344  125.204 81.805  1.00 0.00 ? 175 PRO A HB2  1  
ATOM 2542   H HB3  . PRO A 1 171 ? 54.511  125.397 80.789  1.00 0.00 ? 175 PRO A HB3  1  
ATOM 2543   H HG2  . PRO A 1 171 ? 52.988  123.437 80.495  1.00 0.00 ? 175 PRO A HG2  1  
ATOM 2544   H HG3  . PRO A 1 171 ? 54.505  123.255 80.181  1.00 0.00 ? 175 PRO A HG3  1  
ATOM 2545   H HD2  . PRO A 1 171 ? 53.140  122.367 82.458  1.00 0.00 ? 175 PRO A HD2  1  
ATOM 2546   H HD3  . PRO A 1 171 ? 54.274  121.619 81.691  1.00 0.00 ? 175 PRO A HD3  1  
ATOM 2547   N N    . ALA A 1 172 ? 55.780  126.046 84.364  1.00 0.00 ? 176 ALA A N    1  
ATOM 2548   C CA   . ALA A 1 172 ? 55.672  126.803 85.612  1.00 0.00 ? 176 ALA A CA   1  
ATOM 2549   C C    . ALA A 1 172 ? 55.128  125.955 86.759  1.00 0.00 ? 176 ALA A C    1  
ATOM 2550   O O    . ALA A 1 172 ? 55.430  124.768 86.862  1.00 0.00 ? 176 ALA A O    1  
ATOM 2551   C CB   . ALA A 1 172 ? 54.814  128.061 85.419  1.00 0.00 ? 176 ALA A CB   1  
ATOM 2552   H H    . ALA A 1 172 ? 56.580  126.043 84.048  1.00 0.00 ? 176 ALA A H    1  
ATOM 2553   H HA   . ALA A 1 172 ? 56.571  127.073 85.856  1.00 0.00 ? 176 ALA A HA   1  
ATOM 2554   H HB1  . ALA A 1 172 ? 54.231  128.177 86.186  1.00 0.00 ? 176 ALA A HB1  1  
ATOM 2555   H HB2  . ALA A 1 172 ? 55.390  128.836 85.332  1.00 0.00 ? 176 ALA A HB2  1  
ATOM 2556   H HB3  . ALA A 1 172 ? 54.277  127.967 84.617  1.00 0.00 ? 176 ALA A HB3  1  
ATOM 2557   N N    . PRO B 1 1   ? 86.959  63.535  94.752  1.00 0.00 ? 5   PRO B N    1  
ATOM 2558   C CA   . PRO B 1 1   ? 86.748  63.468  96.201  1.00 0.00 ? 5   PRO B CA   1  
ATOM 2559   C C    . PRO B 1 1   ? 85.307  63.949  96.336  1.00 0.00 ? 5   PRO B C    1  
ATOM 2560   O O    . PRO B 1 1   ? 84.522  63.803  95.400  1.00 0.00 ? 5   PRO B O    1  
ATOM 2561   C CB   . PRO B 1 1   ? 87.820  64.409  96.753  1.00 0.00 ? 5   PRO B CB   1  
ATOM 2562   C CG   . PRO B 1 1   ? 88.102  65.356  95.640  1.00 0.00 ? 5   PRO B CG   1  
ATOM 2563   C CD   . PRO B 1 1   ? 87.950  64.560  94.384  1.00 0.00 ? 5   PRO B CD   1  
ATOM 2564   H HA   . PRO B 1 1   ? 86.752  62.593  96.620  1.00 0.00 ? 5   PRO B HA   1  
ATOM 2565   H HB2  . PRO B 1 1   ? 87.505  64.877  97.542  1.00 0.00 ? 5   PRO B HB2  1  
ATOM 2566   H HB3  . PRO B 1 1   ? 88.617  63.922  97.012  1.00 0.00 ? 5   PRO B HB3  1  
ATOM 2567   H HG2  . PRO B 1 1   ? 87.486  66.105  95.655  1.00 0.00 ? 5   PRO B HG2  1  
ATOM 2568   H HG3  . PRO B 1 1   ? 88.996  65.725  95.714  1.00 0.00 ? 5   PRO B HG3  1  
ATOM 2569   H HD2  . PRO B 1 1   ? 87.640  65.109  93.647  1.00 0.00 ? 5   PRO B HD2  1  
ATOM 2570   H HD3  . PRO B 1 1   ? 88.791  64.163  94.108  1.00 0.00 ? 5   PRO B HD3  1  
ATOM 2571   N N    . ILE B 1 2   ? 84.966  64.511  97.491  1.00 0.00 ? 6   ILE B N    1  
ATOM 2572   C CA   . ILE B 1 2   ? 83.637  65.045  97.750  1.00 0.00 ? 6   ILE B CA   1  
ATOM 2573   C C    . ILE B 1 2   ? 83.555  66.421  97.108  1.00 0.00 ? 6   ILE B C    1  
ATOM 2574   O O    . ILE B 1 2   ? 84.457  67.251  97.282  1.00 0.00 ? 6   ILE B O    1  
ATOM 2575   C CB   . ILE B 1 2   ? 83.331  65.114  99.253  1.00 0.00 ? 6   ILE B CB   1  
ATOM 2576   C CG1  . ILE B 1 2   ? 83.754  63.813  99.936  1.00 0.00 ? 6   ILE B CG1  1  
ATOM 2577   C CG2  . ILE B 1 2   ? 81.859  65.358  99.484  1.00 0.00 ? 6   ILE B CG2  1  
ATOM 2578   C CD1  . ILE B 1 2   ? 84.290  63.902  101.394 1.00 0.00 ? 6   ILE B CD1  1  
ATOM 2579   H H    . ILE B 1 2   ? 85.509  64.594  98.154  1.00 0.00 ? 6   ILE B H    1  
ATOM 2580   H HA   . ILE B 1 2   ? 82.968  64.457  97.368  1.00 0.00 ? 6   ILE B HA   1  
ATOM 2581   H HB   . ILE B 1 2   ? 83.834  65.851  99.635  1.00 0.00 ? 6   ILE B HB   1  
ATOM 2582   H HG12 . ILE B 1 2   ? 82.991  63.214  99.935  1.00 0.00 ? 6   ILE B HG12 1  
ATOM 2583   H HG13 . ILE B 1 2   ? 84.440  63.399  99.390  1.00 0.00 ? 6   ILE B HG13 1  
ATOM 2584   H HG21 . ILE B 1 2   ? 81.384  65.296  98.640  1.00 0.00 ? 6   ILE B HG21 1  
ATOM 2585   H HG22 . ILE B 1 2   ? 81.513  64.692  100.098 1.00 0.00 ? 6   ILE B HG22 1  
ATOM 2586   H HG23 . ILE B 1 2   ? 81.734  66.243  99.861  1.00 0.00 ? 6   ILE B HG23 1  
ATOM 2587   H HD11 . ILE B 1 2   ? 84.060  64.766  101.772 1.00 0.00 ? 6   ILE B HD11 1  
ATOM 2588   H HD12 . ILE B 1 2   ? 83.890  63.199  101.930 1.00 0.00 ? 6   ILE B HD12 1  
ATOM 2589   H HD13 . ILE B 1 2   ? 85.255  63.797  101.392 1.00 0.00 ? 6   ILE B HD13 1  
ATOM 2590   N N    . MET B 1 3   ? 82.481  66.660  96.364  1.00 0.00 ? 7   MET B N    1  
ATOM 2591   C CA   . MET B 1 3   ? 82.290  67.904  95.641  1.00 0.00 ? 7   MET B CA   1  
ATOM 2592   C C    . MET B 1 3   ? 81.633  68.952  96.532  1.00 0.00 ? 7   MET B C    1  
ATOM 2593   O O    . MET B 1 3   ? 81.078  68.651  97.589  1.00 0.00 ? 7   MET B O    1  
ATOM 2594   C CB   . MET B 1 3   ? 81.441  67.667  94.394  1.00 0.00 ? 7   MET B CB   1  
ATOM 2595   C CG   . MET B 1 3   ? 82.190  67.803  93.077  1.00 0.00 ? 7   MET B CG   1  
ATOM 2596   S SD   . MET B 1 3   ? 83.949  67.448  93.197  1.00 0.00 ? 7   MET B SD   1  
ATOM 2597   C CE   . MET B 1 3   ? 83.948  65.661  93.310  1.00 0.00 ? 7   MET B CE   1  
ATOM 2598   H H    . MET B 1 3   ? 81.838  66.097  96.266  1.00 0.00 ? 7   MET B H    1  
ATOM 2599   H HA   . MET B 1 3   ? 83.160  68.236  95.369  1.00 0.00 ? 7   MET B HA   1  
ATOM 2600   H HB2  . MET B 1 3   ? 81.059  66.777  94.443  1.00 0.00 ? 7   MET B HB2  1  
ATOM 2601   H HB3  . MET B 1 3   ? 80.701  68.294  94.397  1.00 0.00 ? 7   MET B HB3  1  
ATOM 2602   H HG2  . MET B 1 3   ? 81.792  67.204  92.425  1.00 0.00 ? 7   MET B HG2  1  
ATOM 2603   H HG3  . MET B 1 3   ? 82.074  68.706  92.741  1.00 0.00 ? 7   MET B HG3  1  
ATOM 2604   H HE1  . MET B 1 3   ? 83.562  65.286  92.504  1.00 0.00 ? 7   MET B HE1  1  
ATOM 2605   H HE2  . MET B 1 3   ? 84.858  65.343  93.412  1.00 0.00 ? 7   MET B HE2  1  
ATOM 2606   H HE3  . MET B 1 3   ? 83.422  65.385  94.078  1.00 0.00 ? 7   MET B HE3  1  
ATOM 2607   N N    . GLY B 1 4   ? 81.685  70.204  96.076  1.00 0.00 ? 8   GLY B N    1  
ATOM 2608   C CA   . GLY B 1 4   ? 81.020  71.298  96.766  1.00 0.00 ? 8   GLY B CA   1  
ATOM 2609   C C    . GLY B 1 4   ? 79.512  71.175  96.832  1.00 0.00 ? 8   GLY B C    1  
ATOM 2610   O O    . GLY B 1 4   ? 78.913  71.615  97.819  1.00 0.00 ? 8   GLY B O    1  
ATOM 2611   H H    . GLY B 1 4   ? 82.105  70.438  95.363  1.00 0.00 ? 8   GLY B H    1  
ATOM 2612   H HA2  . GLY B 1 4   ? 81.369  71.354  97.670  1.00 0.00 ? 8   GLY B HA2  1  
ATOM 2613   H HA3  . GLY B 1 4   ? 81.246  72.130  96.322  1.00 0.00 ? 8   GLY B HA3  1  
ATOM 2614   N N    . GLN B 1 5   ? 78.892  70.599  95.806  1.00 0.00 ? 9   GLN B N    1  
ATOM 2615   C CA   . GLN B 1 5   ? 77.477  70.270  95.816  1.00 0.00 ? 9   GLN B CA   1  
ATOM 2616   C C    . GLN B 1 5   ? 77.188  68.979  96.566  1.00 0.00 ? 9   GLN B C    1  
ATOM 2617   O O    . GLN B 1 5   ? 76.042  68.756  96.971  1.00 0.00 ? 9   GLN B O    1  
ATOM 2618   C CB   . GLN B 1 5   ? 76.972  70.145  94.377  1.00 0.00 ? 9   GLN B CB   1  
ATOM 2619   C CG   . GLN B 1 5   ? 76.708  71.482  93.721  1.00 0.00 ? 9   GLN B CG   1  
ATOM 2620   C CD   . GLN B 1 5   ? 76.428  72.574  94.726  1.00 0.00 ? 9   GLN B CD   1  
ATOM 2621   O OE1  . GLN B 1 5   ? 75.296  72.742  95.177  1.00 0.00 ? 9   GLN B OE1  1  
ATOM 2622   N NE2  . GLN B 1 5   ? 77.458  73.334  95.075  1.00 0.00 ? 9   GLN B NE2  1  
ATOM 2623   H H    . GLN B 1 5   ? 79.290  70.387  95.075  1.00 0.00 ? 9   GLN B H    1  
ATOM 2624   H HA   . GLN B 1 5   ? 77.015  70.987  96.279  1.00 0.00 ? 9   GLN B HA   1  
ATOM 2625   H HB2  . GLN B 1 5   ? 77.626  69.657  93.852  1.00 0.00 ? 9   GLN B HB2  1  
ATOM 2626   H HB3  . GLN B 1 5   ? 76.155  69.621  94.372  1.00 0.00 ? 9   GLN B HB3  1  
ATOM 2627   H HG2  . GLN B 1 5   ? 77.474  71.731  93.182  1.00 0.00 ? 9   GLN B HG2  1  
ATOM 2628   H HG3  . GLN B 1 5   ? 75.952  71.399  93.119  1.00 0.00 ? 9   GLN B HG3  1  
ATOM 2629   H HE21 . GLN B 1 5   ? 78.235  73.187  94.739  1.00 0.00 ? 9   GLN B HE21 1  
ATOM 2630   H HE22 . GLN B 1 5   ? 77.348  73.975  95.639  1.00 0.00 ? 9   GLN B HE22 1  
ATOM 2631   N N    . ASP B 1 6   ? 78.204  68.142  96.775  1.00 0.00 ? 10  ASP B N    1  
ATOM 2632   C CA   . ASP B 1 6   ? 78.016  66.808  97.327  1.00 0.00 ? 10  ASP B CA   1  
ATOM 2633   C C    . ASP B 1 6   ? 77.556  66.798  98.776  1.00 0.00 ? 10  ASP B C    1  
ATOM 2634   O O    . ASP B 1 6   ? 76.684  65.996  99.111  1.00 0.00 ? 10  ASP B O    1  
ATOM 2635   C CB   . ASP B 1 6   ? 79.310  65.994  97.225  1.00 0.00 ? 10  ASP B CB   1  
ATOM 2636   C CG   . ASP B 1 6   ? 79.064  64.529  96.921  1.00 0.00 ? 10  ASP B CG   1  
ATOM 2637   O OD1  . ASP B 1 6   ? 78.674  63.784  97.845  1.00 0.00 ? 10  ASP B OD1  1  
ATOM 2638   O OD2  . ASP B 1 6   ? 79.283  64.119  95.763  1.00 0.00 ? 10  ASP B OD2  1  
ATOM 2639   H H    . ASP B 1 6   ? 79.024  68.337  96.599  1.00 0.00 ? 10  ASP B H    1  
ATOM 2640   H HA   . ASP B 1 6   ? 77.309  66.411  96.795  1.00 0.00 ? 10  ASP B HA   1  
ATOM 2641   H HB2  . ASP B 1 6   ? 79.871  66.374  96.530  1.00 0.00 ? 10  ASP B HB2  1  
ATOM 2642   H HB3  . ASP B 1 6   ? 79.800  66.069  98.058  1.00 0.00 ? 10  ASP B HB3  1  
ATOM 2643   N N    . VAL B 1 7   ? 78.120  67.629  99.648  1.00 0.00 ? 11  VAL B N    1  
ATOM 2644   C CA   . VAL B 1 7   ? 77.758  67.643  101.062 1.00 0.00 ? 11  VAL B CA   1  
ATOM 2645   C C    . VAL B 1 7   ? 76.660  68.673  101.254 1.00 0.00 ? 11  VAL B C    1  
ATOM 2646   O O    . VAL B 1 7   ? 76.887  69.869  101.039 1.00 0.00 ? 11  VAL B O    1  
ATOM 2647   C CB   . VAL B 1 7   ? 78.957  67.977  101.961 1.00 0.00 ? 11  VAL B CB   1  
ATOM 2648   C CG1  . VAL B 1 7   ? 78.558  67.887  103.421 1.00 0.00 ? 11  VAL B CG1  1  
ATOM 2649   C CG2  . VAL B 1 7   ? 80.134  67.076  101.664 1.00 0.00 ? 11  VAL B CG2  1  
ATOM 2650   H H    . VAL B 1 7   ? 78.726  68.201  99.435  1.00 0.00 ? 11  VAL B H    1  
ATOM 2651   H HA   . VAL B 1 7   ? 77.453  66.760  101.319 1.00 0.00 ? 11  VAL B HA   1  
ATOM 2652   H HB   . VAL B 1 7   ? 79.235  68.887  101.772 1.00 0.00 ? 11  VAL B HB   1  
ATOM 2653   H HG11 . VAL B 1 7   ? 79.327  68.077  103.980 1.00 0.00 ? 11  VAL B HG11 1  
ATOM 2654   H HG12 . VAL B 1 7   ? 77.858  68.533  103.606 1.00 0.00 ? 11  VAL B HG12 1  
ATOM 2655   H HG13 . VAL B 1 7   ? 78.233  66.994  103.613 1.00 0.00 ? 11  VAL B HG13 1  
ATOM 2656   H HG21 . VAL B 1 7   ? 79.823  66.165  101.547 1.00 0.00 ? 11  VAL B HG21 1  
ATOM 2657   H HG22 . VAL B 1 7   ? 80.573  67.374  100.853 1.00 0.00 ? 11  VAL B HG22 1  
ATOM 2658   H HG23 . VAL B 1 7   ? 80.761  67.109  102.403 1.00 0.00 ? 11  VAL B HG23 1  
ATOM 2659   N N    . LYS B 1 8   ? 75.475  68.222  101.664 1.00 0.00 ? 12  LYS B N    1  
ATOM 2660   C CA   . LYS B 1 8   ? 74.388  69.149  101.952 1.00 0.00 ? 12  LYS B CA   1  
ATOM 2661   C C    . LYS B 1 8   ? 73.853  68.924  103.358 1.00 0.00 ? 12  LYS B C    1  
ATOM 2662   O O    . LYS B 1 8   ? 74.011  67.851  103.948 1.00 0.00 ? 12  LYS B O    1  
ATOM 2663   C CB   . LYS B 1 8   ? 73.258  69.060  100.912 1.00 0.00 ? 12  LYS B CB   1  
ATOM 2664   C CG   . LYS B 1 8   ? 72.728  70.436  100.518 1.00 0.00 ? 12  LYS B CG   1  
ATOM 2665   C CD   . LYS B 1 8   ? 71.800  70.417  99.326  1.00 0.00 ? 12  LYS B CD   1  
ATOM 2666   C CE   . LYS B 1 8   ? 72.575  70.324  98.035  1.00 0.00 ? 12  LYS B CE   1  
ATOM 2667   N NZ   . LYS B 1 8   ? 71.688  69.899  96.921  1.00 0.00 ? 12  LYS B NZ   1  
ATOM 2668   H H    . LYS B 1 8   ? 75.284  67.392  101.781 1.00 0.00 ? 12  LYS B H    1  
ATOM 2669   H HA   . LYS B 1 8   ? 74.750  70.047  101.897 1.00 0.00 ? 12  LYS B HA   1  
ATOM 2670   H HB2  . LYS B 1 8   ? 73.585  68.603  100.120 1.00 0.00 ? 12  LYS B HB2  1  
ATOM 2671   H HB3  . LYS B 1 8   ? 72.532  68.525  101.270 1.00 0.00 ? 12  LYS B HB3  1  
ATOM 2672   H HG2  . LYS B 1 8   ? 72.259  70.820  101.275 1.00 0.00 ? 12  LYS B HG2  1  
ATOM 2673   H HG3  . LYS B 1 8   ? 73.479  71.018  100.323 1.00 0.00 ? 12  LYS B HG3  1  
ATOM 2674   H HD2  . LYS B 1 8   ? 71.193  69.664  99.397  1.00 0.00 ? 12  LYS B HD2  1  
ATOM 2675   H HD3  . LYS B 1 8   ? 71.256  71.220  99.323  1.00 0.00 ? 12  LYS B HD3  1  
ATOM 2676   H HE2  . LYS B 1 8   ? 72.972  71.185  97.828  1.00 0.00 ? 12  LYS B HE2  1  
ATOM 2677   H HE3  . LYS B 1 8   ? 73.303  69.693  98.134  1.00 0.00 ? 12  LYS B HE3  1  
ATOM 2678   H HZ1  . LYS B 1 8   ? 71.011  69.422  97.246  1.00 0.00 ? 12  LYS B HZ1  1  
ATOM 2679   H HZ2  . LYS B 1 8   ? 71.371  70.617  96.502  1.00 0.00 ? 12  LYS B HZ2  1  
ATOM 2680   H HZ3  . LYS B 1 8   ? 72.151  69.402  96.347  1.00 0.00 ? 12  LYS B HZ3  1  
ATOM 2681   N N    . TYR B 1 9   ? 73.235  69.973  103.896 1.00 0.00 ? 13  TYR B N    1  
ATOM 2682   C CA   . TYR B 1 9   ? 72.941  70.087  105.323 1.00 0.00 ? 13  TYR B CA   1  
ATOM 2683   C C    . TYR B 1 9   ? 71.433  70.236  105.503 1.00 0.00 ? 13  TYR B C    1  
ATOM 2684   O O    . TYR B 1 9   ? 70.818  71.157  104.964 1.00 0.00 ? 13  TYR B O    1  
ATOM 2685   C CB   . TYR B 1 9   ? 73.679  71.278  105.947 1.00 0.00 ? 13  TYR B CB   1  
ATOM 2686   C CG   . TYR B 1 9   ? 75.189  71.265  105.813 1.00 0.00 ? 13  TYR B CG   1  
ATOM 2687   C CD1  . TYR B 1 9   ? 76.012  71.153  106.922 1.00 0.00 ? 13  TYR B CD1  1  
ATOM 2688   C CD2  . TYR B 1 9   ? 75.789  71.393  104.570 1.00 0.00 ? 13  TYR B CD2  1  
ATOM 2689   C CE1  . TYR B 1 9   ? 77.377  71.140  106.794 1.00 0.00 ? 13  TYR B CE1  1  
ATOM 2690   C CE2  . TYR B 1 9   ? 77.160  71.395  104.439 1.00 0.00 ? 13  TYR B CE2  1  
ATOM 2691   C CZ   . TYR B 1 9   ? 77.948  71.266  105.557 1.00 0.00 ? 13  TYR B CZ   1  
ATOM 2692   O OH   . TYR B 1 9   ? 79.317  71.266  105.457 1.00 0.00 ? 13  TYR B OH   1  
ATOM 2693   H H    . TYR B 1 9   ? 72.970  70.648  103.434 1.00 0.00 ? 13  TYR B H    1  
ATOM 2694   H HA   . TYR B 1 9   ? 73.248  69.288  105.777 1.00 0.00 ? 13  TYR B HA   1  
ATOM 2695   H HB2  . TYR B 1 9   ? 73.343  72.093  105.542 1.00 0.00 ? 13  TYR B HB2  1  
ATOM 2696   H HB3  . TYR B 1 9   ? 73.455  71.317  106.890 1.00 0.00 ? 13  TYR B HB3  1  
ATOM 2697   H HD1  . TYR B 1 9   ? 75.632  71.086  107.768 1.00 0.00 ? 13  TYR B HD1  1  
ATOM 2698   H HD2  . TYR B 1 9   ? 75.258  71.478  103.812 1.00 0.00 ? 13  TYR B HD2  1  
ATOM 2699   H HE1  . TYR B 1 9   ? 77.914  71.046  107.547 1.00 0.00 ? 13  TYR B HE1  1  
ATOM 2700   H HE2  . TYR B 1 9   ? 77.550  71.484  103.599 1.00 0.00 ? 13  TYR B HE2  1  
ATOM 2701   H HH   . TYR B 1 9   ? 79.547  71.667  104.756 1.00 0.00 ? 13  TYR B HH   1  
ATOM 2702   N N    . LEU B 1 10  ? 70.841  69.330  106.274 1.00 0.00 ? 14  LEU B N    1  
ATOM 2703   C CA   . LEU B 1 10  ? 69.427  69.432  106.610 1.00 0.00 ? 14  LEU B CA   1  
ATOM 2704   C C    . LEU B 1 10  ? 69.270  69.585  108.118 1.00 0.00 ? 14  LEU B C    1  
ATOM 2705   O O    . LEU B 1 10  ? 70.077  69.056  108.891 1.00 0.00 ? 14  LEU B O    1  
ATOM 2706   C CB   . LEU B 1 10  ? 68.662  68.207  106.116 1.00 0.00 ? 14  LEU B CB   1  
ATOM 2707   C CG   . LEU B 1 10  ? 69.257  66.824  106.371 1.00 0.00 ? 14  LEU B CG   1  
ATOM 2708   C CD1  . LEU B 1 10  ? 68.181  65.877  106.861 1.00 0.00 ? 14  LEU B CD1  1  
ATOM 2709   C CD2  . LEU B 1 10  ? 69.876  66.280  105.108 1.00 0.00 ? 14  LEU B CD2  1  
ATOM 2710   H H    . LEU B 1 10  ? 71.241  68.648  106.612 1.00 0.00 ? 14  LEU B H    1  
ATOM 2711   H HA   . LEU B 1 10  ? 69.056  70.214  106.170 1.00 0.00 ? 14  LEU B HA   1  
ATOM 2712   H HB2  . LEU B 1 10  ? 67.780  68.228  106.519 1.00 0.00 ? 14  LEU B HB2  1  
ATOM 2713   H HB3  . LEU B 1 10  ? 68.538  68.303  105.159 1.00 0.00 ? 14  LEU B HB3  1  
ATOM 2714   H HG   . LEU B 1 10  ? 69.945  66.904  107.050 1.00 0.00 ? 14  LEU B HG   1  
ATOM 2715   H HD11 . LEU B 1 10  ? 68.006  65.207  106.183 1.00 0.00 ? 14  LEU B HD11 1  
ATOM 2716   H HD12 . LEU B 1 10  ? 68.480  65.442  107.675 1.00 0.00 ? 14  LEU B HD12 1  
ATOM 2717   H HD13 . LEU B 1 10  ? 67.368  66.375  107.041 1.00 0.00 ? 14  LEU B HD13 1  
ATOM 2718   H HD21 . LEU B 1 10  ? 70.471  65.546  105.329 1.00 0.00 ? 14  LEU B HD21 1  
ATOM 2719   H HD22 . LEU B 1 10  ? 69.178  65.961  104.516 1.00 0.00 ? 14  LEU B HD22 1  
ATOM 2720   H HD23 . LEU B 1 10  ? 70.379  66.981  104.665 1.00 0.00 ? 14  LEU B HD23 1  
ATOM 2721   N N    . PHE B 1 11  ? 68.233  70.303  108.535 1.00 0.00 ? 15  PHE B N    1  
ATOM 2722   C CA   . PHE B 1 11  ? 67.911  70.465  109.944 1.00 0.00 ? 15  PHE B CA   1  
ATOM 2723   C C    . PHE B 1 11  ? 66.511  69.933  110.220 1.00 0.00 ? 15  PHE B C    1  
ATOM 2724   O O    . PHE B 1 11  ? 65.597  70.069  109.402 1.00 0.00 ? 15  PHE B O    1  
ATOM 2725   C CB   . PHE B 1 11  ? 67.983  71.935  110.366 1.00 0.00 ? 15  PHE B CB   1  
ATOM 2726   C CG   . PHE B 1 11  ? 68.946  72.764  109.565 1.00 0.00 ? 15  PHE B CG   1  
ATOM 2727   C CD1  . PHE B 1 11  ? 68.506  73.622  108.570 1.00 0.00 ? 15  PHE B CD1  1  
ATOM 2728   C CD2  . PHE B 1 11  ? 70.306  72.678  109.817 1.00 0.00 ? 15  PHE B CD2  1  
ATOM 2729   C CE1  . PHE B 1 11  ? 69.403  74.381  107.850 1.00 0.00 ? 15  PHE B CE1  1  
ATOM 2730   C CE2  . PHE B 1 11  ? 71.206  73.433  109.094 1.00 0.00 ? 15  PHE B CE2  1  
ATOM 2731   C CZ   . PHE B 1 11  ? 70.753  74.285  108.109 1.00 0.00 ? 15  PHE B CZ   1  
ATOM 2732   H H    . PHE B 1 11  ? 67.694  70.711  108.004 1.00 0.00 ? 15  PHE B H    1  
ATOM 2733   H HA   . PHE B 1 11  ? 68.563  69.963  110.456 1.00 0.00 ? 15  PHE B HA   1  
ATOM 2734   H HB2  . PHE B 1 11  ? 67.098  72.325  110.292 1.00 0.00 ? 15  PHE B HB2  1  
ATOM 2735   H HB3  . PHE B 1 11  ? 68.236  71.979  111.302 1.00 0.00 ? 15  PHE B HB3  1  
ATOM 2736   H HD1  . PHE B 1 11  ? 67.596  73.687  108.387 1.00 0.00 ? 15  PHE B HD1  1  
ATOM 2737   H HD2  . PHE B 1 11  ? 70.615  72.105  110.480 1.00 0.00 ? 15  PHE B HD2  1  
ATOM 2738   H HE1  . PHE B 1 11  ? 69.097  74.959  107.188 1.00 0.00 ? 15  PHE B HE1  1  
ATOM 2739   H HE2  . PHE B 1 11  ? 72.117  73.368  109.272 1.00 0.00 ? 15  PHE B HE2  1  
ATOM 2740   H HZ   . PHE B 1 11  ? 71.359  74.793  107.620 1.00 0.00 ? 15  PHE B HZ   1  
ATOM 2741   N N    . GLN B 1 12  ? 66.349  69.327  111.393 1.00 0.00 ? 16  GLN B N    1  
ATOM 2742   C CA   . GLN B 1 12  ? 65.021  68.956  111.857 1.00 0.00 ? 16  GLN B CA   1  
ATOM 2743   C C    . GLN B 1 12  ? 64.779  69.593  113.217 1.00 0.00 ? 16  GLN B C    1  
ATOM 2744   O O    . GLN B 1 12  ? 65.589  69.441  114.138 1.00 0.00 ? 16  GLN B O    1  
ATOM 2745   C CB   . GLN B 1 12  ? 64.853  67.432  111.927 1.00 0.00 ? 16  GLN B CB   1  
ATOM 2746   C CG   . GLN B 1 12  ? 63.410  66.950  111.830 1.00 0.00 ? 16  GLN B CG   1  
ATOM 2747   C CD   . GLN B 1 12  ? 63.287  65.452  111.680 1.00 0.00 ? 16  GLN B CD   1  
ATOM 2748   O OE1  . GLN B 1 12  ? 62.371  64.956  111.032 1.00 0.00 ? 16  GLN B OE1  1  
ATOM 2749   N NE2  . GLN B 1 12  ? 64.215  64.721  112.282 1.00 0.00 ? 16  GLN B NE2  1  
ATOM 2750   H H    . GLN B 1 12  ? 66.989  69.125  111.929 1.00 0.00 ? 16  GLN B H    1  
ATOM 2751   H HA   . GLN B 1 12  ? 64.363  69.281  111.222 1.00 0.00 ? 16  GLN B HA   1  
ATOM 2752   H HB2  . GLN B 1 12  ? 65.365  67.029  111.209 1.00 0.00 ? 16  GLN B HB2  1  
ATOM 2753   H HB3  . GLN B 1 12  ? 65.232  67.115  112.760 1.00 0.00 ? 16  GLN B HB3  1  
ATOM 2754   H HG2  . GLN B 1 12  ? 62.929  67.230  112.624 1.00 0.00 ? 16  GLN B HG2  1  
ATOM 2755   H HG3  . GLN B 1 12  ? 62.983  67.380  111.072 1.00 0.00 ? 16  GLN B HG3  1  
ATOM 2756   H HE21 . GLN B 1 12  ? 64.842  65.104  112.728 1.00 0.00 ? 16  GLN B HE21 1  
ATOM 2757   H HE22 . GLN B 1 12  ? 64.190  63.863  112.227 1.00 0.00 ? 16  GLN B HE22 1  
ATOM 2758   N N    . SER B 1 13  ? 63.667  70.317  113.325 1.00 0.00 ? 17  SER B N    1  
ATOM 2759   C CA   . SER B 1 13  ? 63.294  70.974  114.568 1.00 0.00 ? 17  SER B CA   1  
ATOM 2760   C C    . SER B 1 13  ? 62.848  69.957  115.613 1.00 0.00 ? 17  SER B C    1  
ATOM 2761   O O    . SER B 1 13  ? 62.269  68.915  115.293 1.00 0.00 ? 17  SER B O    1  
ATOM 2762   C CB   . SER B 1 13  ? 62.176  71.983  114.319 1.00 0.00 ? 17  SER B CB   1  
ATOM 2763   O OG   . SER B 1 13  ? 61.066  71.368  113.696 1.00 0.00 ? 17  SER B OG   1  
ATOM 2764   H H    . SER B 1 13  ? 63.111  70.439  112.681 1.00 0.00 ? 17  SER B H    1  
ATOM 2765   H HA   . SER B 1 13  ? 64.076  71.440  114.907 1.00 0.00 ? 17  SER B HA   1  
ATOM 2766   H HB2  . SER B 1 13  ? 61.901  72.380  115.160 1.00 0.00 ? 17  SER B HB2  1  
ATOM 2767   H HB3  . SER B 1 13  ? 62.506  72.704  113.760 1.00 0.00 ? 17  SER B HB3  1  
ATOM 2768   H HG   . SER B 1 13  ? 60.775  70.751  114.187 1.00 0.00 ? 17  SER B HG   1  
ATOM 2769   N N    . ILE B 1 14  ? 63.118  70.275  116.881 1.00 0.00 ? 18  ILE B N    1  
ATOM 2770   C CA   . ILE B 1 14  ? 62.748  69.380  117.969 1.00 0.00 ? 18  ILE B CA   1  
ATOM 2771   C C    . ILE B 1 14  ? 61.243  69.335  118.183 1.00 0.00 ? 18  ILE B C    1  
ATOM 2772   O O    . ILE B 1 14  ? 60.677  68.249  118.356 1.00 0.00 ? 18  ILE B O    1  
ATOM 2773   C CB   . ILE B 1 14  ? 63.453  69.787  119.276 1.00 0.00 ? 18  ILE B CB   1  
ATOM 2774   C CG1  . ILE B 1 14  ? 63.452  71.309  119.430 1.00 0.00 ? 18  ILE B CG1  1  
ATOM 2775   C CG2  . ILE B 1 14  ? 64.870  69.239  119.316 1.00 0.00 ? 18  ILE B CG2  1  
ATOM 2776   C CD1  . ILE B 1 14  ? 63.224  71.802  120.855 1.00 0.00 ? 18  ILE B CD1  1  
ATOM 2777   H H    . ILE B 1 14  ? 63.511  71.000  117.126 1.00 0.00 ? 18  ILE B H    1  
ATOM 2778   H HA   . ILE B 1 14  ? 63.040  68.490  117.714 1.00 0.00 ? 18  ILE B HA   1  
ATOM 2779   H HB   . ILE B 1 14  ? 62.963  69.406  120.022 1.00 0.00 ? 18  ILE B HB   1  
ATOM 2780   H HG12 . ILE B 1 14  ? 64.301  71.654  119.113 1.00 0.00 ? 18  ILE B HG12 1  
ATOM 2781   H HG13 . ILE B 1 14  ? 62.763  71.680  118.857 1.00 0.00 ? 18  ILE B HG13 1  
ATOM 2782   H HG21 . ILE B 1 14  ? 65.089  68.975  120.224 1.00 0.00 ? 18  ILE B HG21 1  
ATOM 2783   H HG22 . ILE B 1 14  ? 64.935  68.468  118.731 1.00 0.00 ? 18  ILE B HG22 1  
ATOM 2784   H HG23 . ILE B 1 14  ? 65.491  69.923  119.019 1.00 0.00 ? 18  ILE B HG23 1  
ATOM 2785   H HD11 . ILE B 1 14  ? 64.073  71.846  121.321 1.00 0.00 ? 18  ILE B HD11 1  
ATOM 2786   H HD12 . ILE B 1 14  ? 62.822  72.684  120.832 1.00 0.00 ? 18  ILE B HD12 1  
ATOM 2787   H HD13 . ILE B 1 14  ? 62.632  71.189  121.318 1.00 0.00 ? 18  ILE B HD13 1  
ATOM 2788   N N    . ASP B 1 15  ? 60.575  70.487  118.173 1.00 0.00 ? 19  ASP B N    1  
ATOM 2789   C CA   . ASP B 1 15  ? 59.170  70.566  118.536 1.00 0.00 ? 19  ASP B CA   1  
ATOM 2790   C C    . ASP B 1 15  ? 58.248  70.018  117.454 1.00 0.00 ? 19  ASP B C    1  
ATOM 2791   O O    . ASP B 1 15  ? 57.125  69.608  117.765 1.00 0.00 ? 19  ASP B O    1  
ATOM 2792   C CB   . ASP B 1 15  ? 58.803  72.028  118.840 1.00 0.00 ? 19  ASP B CB   1  
ATOM 2793   C CG   . ASP B 1 15  ? 59.787  72.709  119.777 1.00 0.00 ? 19  ASP B CG   1  
ATOM 2794   O OD1  . ASP B 1 15  ? 60.034  72.191  120.886 1.00 0.00 ? 19  ASP B OD1  1  
ATOM 2795   O OD2  . ASP B 1 15  ? 60.318  73.774  119.395 1.00 0.00 ? 19  ASP B OD2  1  
ATOM 2796   H H    . ASP B 1 15  ? 60.925  71.241  117.955 1.00 0.00 ? 19  ASP B H    1  
ATOM 2797   H HA   . ASP B 1 15  ? 59.044  70.012  119.322 1.00 0.00 ? 19  ASP B HA   1  
ATOM 2798   H HB2  . ASP B 1 15  ? 58.760  72.525  118.008 1.00 0.00 ? 19  ASP B HB2  1  
ATOM 2799   H HB3  . ASP B 1 15  ? 57.917  72.058  119.234 1.00 0.00 ? 19  ASP B HB3  1  
ATOM 2800   N N    . ALA B 1 16  ? 58.688  69.990  116.197 1.00 0.00 ? 20  ALA B N    1  
ATOM 2801   C CA   . ALA B 1 16  ? 57.798  69.573  115.121 1.00 0.00 ? 20  ALA B CA   1  
ATOM 2802   C C    . ALA B 1 16  ? 57.244  68.175  115.367 1.00 0.00 ? 20  ALA B C    1  
ATOM 2803   O O    . ALA B 1 16  ? 56.035  67.950  115.229 1.00 0.00 ? 20  ALA B O    1  
ATOM 2804   C CB   . ALA B 1 16  ? 58.532  69.636  113.782 1.00 0.00 ? 20  ALA B CB   1  
ATOM 2805   H H    . ALA B 1 16  ? 59.484  70.205  115.951 1.00 0.00 ? 20  ALA B H    1  
ATOM 2806   H HA   . ALA B 1 16  ? 57.044  70.184  115.096 1.00 0.00 ? 20  ALA B HA   1  
ATOM 2807   H HB1  . ALA B 1 16  ? 59.489  69.672  113.939 1.00 0.00 ? 20  ALA B HB1  1  
ATOM 2808   H HB2  . ALA B 1 16  ? 58.321  68.846  113.260 1.00 0.00 ? 20  ALA B HB2  1  
ATOM 2809   H HB3  . ALA B 1 16  ? 58.254  70.428  113.297 1.00 0.00 ? 20  ALA B HB3  1  
ATOM 2810   N N    . ALA B 1 17  ? 58.122  67.234  115.744 1.00 0.00 ? 21  ALA B N    1  
ATOM 2811   C CA   . ALA B 1 17  ? 57.819  65.801  115.896 1.00 0.00 ? 21  ALA B CA   1  
ATOM 2812   C C    . ALA B 1 17  ? 57.287  65.192  114.599 1.00 0.00 ? 21  ALA B C    1  
ATOM 2813   O O    . ALA B 1 17  ? 56.296  64.462  114.588 1.00 0.00 ? 21  ALA B O    1  
ATOM 2814   C CB   . ALA B 1 17  ? 56.857  65.542  117.063 1.00 0.00 ? 21  ALA B CB   1  
ATOM 2815   H H    . ALA B 1 17  ? 58.942  67.421  115.924 1.00 0.00 ? 21  ALA B H    1  
ATOM 2816   H HA   . ALA B 1 17  ? 58.657  65.359  116.106 1.00 0.00 ? 21  ALA B HA   1  
ATOM 2817   H HB1  . ALA B 1 17  ? 56.040  65.142  116.726 1.00 0.00 ? 21  ALA B HB1  1  
ATOM 2818   H HB2  . ALA B 1 17  ? 57.273  64.938  117.698 1.00 0.00 ? 21  ALA B HB2  1  
ATOM 2819   H HB3  . ALA B 1 17  ? 56.648  66.381  117.503 1.00 0.00 ? 21  ALA B HB3  1  
ATOM 2820   N N    . THR B 1 18  ? 57.962  65.500  113.493 1.00 0.00 ? 22  THR B N    1  
ATOM 2821   C CA   . THR B 1 18  ? 57.594  65.007  112.172 1.00 0.00 ? 22  THR B CA   1  
ATOM 2822   C C    . THR B 1 18  ? 58.649  64.024  111.694 1.00 0.00 ? 22  THR B C    1  
ATOM 2823   O O    . THR B 1 18  ? 59.773  64.017  112.205 1.00 0.00 ? 22  THR B O    1  
ATOM 2824   C CB   . THR B 1 18  ? 57.458  66.153  111.162 1.00 0.00 ? 22  THR B CB   1  
ATOM 2825   O OG1  . THR B 1 18  ? 57.098  65.624  109.880 1.00 0.00 ? 22  THR B OG1  1  
ATOM 2826   C CG2  . THR B 1 18  ? 58.757  66.926  111.041 1.00 0.00 ? 22  THR B CG2  1  
ATOM 2827   H H    . THR B 1 18  ? 58.656  66.008  113.491 1.00 0.00 ? 22  THR B H    1  
ATOM 2828   H HA   . THR B 1 18  ? 56.732  64.567  112.240 1.00 0.00 ? 22  THR B HA   1  
ATOM 2829   H HB   . THR B 1 18  ? 56.767  66.756  111.476 1.00 0.00 ? 22  THR B HB   1  
ATOM 2830   H HG1  . THR B 1 18  ? 57.377  66.138  109.277 1.00 0.00 ? 22  THR B HG1  1  
ATOM 2831   H HG21 . THR B 1 18  ? 59.003  67.524  110.319 1.00 0.00 ? 22  THR B HG21 1  
ATOM 2832   H HG22 . THR B 1 18  ? 58.994  67.300  111.905 1.00 0.00 ? 22  THR B HG22 1  
ATOM 2833   H HG23 . THR B 1 18  ? 59.462  66.331  110.743 1.00 0.00 ? 22  THR B HG23 1  
ATOM 2834   N N    . GLY B 1 19  ? 58.290  63.206  110.710 1.00 0.00 ? 23  GLY B N    1  
ATOM 2835   C CA   . GLY B 1 19  ? 59.198  62.207  110.182 1.00 0.00 ? 23  GLY B CA   1  
ATOM 2836   C C    . GLY B 1 19  ? 60.032  62.696  109.015 1.00 0.00 ? 23  GLY B C    1  
ATOM 2837   O O    . GLY B 1 19  ? 60.306  61.938  108.082 1.00 0.00 ? 23  GLY B O    1  
ATOM 2838   H H    . GLY B 1 19  ? 57.517  63.218  110.334 1.00 0.00 ? 23  GLY B H    1  
ATOM 2839   H HA2  . GLY B 1 19  ? 59.791  61.912  110.891 1.00 0.00 ? 23  GLY B HA2  1  
ATOM 2840   H HA3  . GLY B 1 19  ? 58.686  61.433  109.900 1.00 0.00 ? 23  GLY B HA3  1  
ATOM 2841   N N    . SER B 1 20  ? 60.438  63.964  109.053 1.00 0.00 ? 24  SER B N    1  
ATOM 2842   C CA   . SER B 1 20  ? 61.203  64.539  107.954 1.00 0.00 ? 24  SER B CA   1  
ATOM 2843   C C    . SER B 1 20  ? 61.815  65.881  108.333 1.00 0.00 ? 24  SER B C    1  
ATOM 2844   O O    . SER B 1 20  ? 61.192  66.661  109.061 1.00 0.00 ? 24  SER B O    1  
ATOM 2845   C CB   . SER B 1 20  ? 60.317  64.700  106.717 1.00 0.00 ? 24  SER B CB   1  
ATOM 2846   O OG   . SER B 1 20  ? 59.582  65.909  106.773 1.00 0.00 ? 24  SER B OG   1  
ATOM 2847   H H    . SER B 1 20  ? 60.280  64.504  109.704 1.00 0.00 ? 24  SER B H    1  
ATOM 2848   H HA   . SER B 1 20  ? 61.929  63.927  107.753 1.00 0.00 ? 24  SER B HA   1  
ATOM 2849   H HB2  . SER B 1 20  ? 60.866  64.689  105.918 1.00 0.00 ? 24  SER B HB2  1  
ATOM 2850   H HB3  . SER B 1 20  ? 59.706  63.949  106.652 1.00 0.00 ? 24  SER B HB3  1  
ATOM 2851   H HG   . SER B 1 20  ? 59.806  66.404  106.132 1.00 0.00 ? 24  SER B HG   1  
ATOM 2852   N N    . ALA B 1 21  ? 63.031  66.147  107.836 1.00 0.00 ? 25  ALA B N    1  
ATOM 2853   C CA   . ALA B 1 21  ? 63.875  67.303  108.146 1.00 0.00 ? 25  ALA B CA   1  
ATOM 2854   C C    . ALA B 1 21  ? 63.918  68.314  107.003 1.00 0.00 ? 25  ALA B C    1  
ATOM 2855   O O    . ALA B 1 21  ? 64.406  67.983  105.915 1.00 0.00 ? 25  ALA B O    1  
ATOM 2856   C CB   . ALA B 1 21  ? 65.295  66.857  108.507 1.00 0.00 ? 25  ALA B CB   1  
ATOM 2857   H H    . ALA B 1 21  ? 63.406  65.617  107.272 1.00 0.00 ? 25  ALA B H    1  
ATOM 2858   H HA   . ALA B 1 21  ? 63.474  67.744  108.911 1.00 0.00 ? 25  ALA B HA   1  
ATOM 2859   H HB1  . ALA B 1 21  ? 65.932  67.508  108.177 1.00 0.00 ? 25  ALA B HB1  1  
ATOM 2860   H HB2  . ALA B 1 21  ? 65.376  66.786  109.472 1.00 0.00 ? 25  ALA B HB2  1  
ATOM 2861   H HB3  . ALA B 1 21  ? 65.476  65.994  108.104 1.00 0.00 ? 25  ALA B HB3  1  
ATOM 2862   N N    . PRO B 1 22  ? 63.400  69.545  107.188 1.00 0.00 ? 26  PRO B N    1  
ATOM 2863   C CA   . PRO B 1 22  ? 63.474  70.529  106.101 1.00 0.00 ? 26  PRO B CA   1  
ATOM 2864   C C    . PRO B 1 22  ? 64.882  71.051  105.885 1.00 0.00 ? 26  PRO B C    1  
ATOM 2865   O O    . PRO B 1 22  ? 65.576  71.410  106.841 1.00 0.00 ? 26  PRO B O    1  
ATOM 2866   C CB   . PRO B 1 22  ? 62.550  71.659  106.579 1.00 0.00 ? 26  PRO B CB   1  
ATOM 2867   C CG   . PRO B 1 22  ? 61.699  71.051  107.632 1.00 0.00 ? 26  PRO B CG   1  
ATOM 2868   C CD   . PRO B 1 22  ? 62.587  70.052  108.304 1.00 0.00 ? 26  PRO B CD   1  
ATOM 2869   H HA   . PRO B 1 22  ? 63.217  70.147  105.247 1.00 0.00 ? 26  PRO B HA   1  
ATOM 2870   H HB2  . PRO B 1 22  ? 63.062  72.404  106.931 1.00 0.00 ? 26  PRO B HB2  1  
ATOM 2871   H HB3  . PRO B 1 22  ? 62.011  72.003  105.850 1.00 0.00 ? 26  PRO B HB3  1  
ATOM 2872   H HG2  . PRO B 1 22  ? 61.381  71.720  108.259 1.00 0.00 ? 26  PRO B HG2  1  
ATOM 2873   H HG3  . PRO B 1 22  ? 60.915  70.625  107.251 1.00 0.00 ? 26  PRO B HG3  1  
ATOM 2874   H HD2  . PRO B 1 22  ? 63.135  70.462  108.993 1.00 0.00 ? 26  PRO B HD2  1  
ATOM 2875   H HD3  . PRO B 1 22  ? 62.078  69.345  108.730 1.00 0.00 ? 26  PRO B HD3  1  
ATOM 2876   N N    . LEU B 1 23  ? 65.314  71.092  104.632 1.00 0.00 ? 27  LEU B N    1  
ATOM 2877   C CA   . LEU B 1 23  ? 66.535  71.794  104.275 1.00 0.00 ? 27  LEU B CA   1  
ATOM 2878   C C    . LEU B 1 23  ? 66.187  72.953  103.355 1.00 0.00 ? 27  LEU B C    1  
ATOM 2879   O O    . LEU B 1 23  ? 65.172  72.939  102.655 1.00 0.00 ? 27  LEU B O    1  
ATOM 2880   C CB   . LEU B 1 23  ? 67.540  70.874  103.587 1.00 0.00 ? 27  LEU B CB   1  
ATOM 2881   C CG   . LEU B 1 23  ? 67.066  70.040  102.395 1.00 0.00 ? 27  LEU B CG   1  
ATOM 2882   C CD1  . LEU B 1 23  ? 68.043  70.194  101.241 1.00 0.00 ? 27  LEU B CD1  1  
ATOM 2883   C CD2  . LEU B 1 23  ? 66.878  68.569  102.743 1.00 0.00 ? 27  LEU B CD2  1  
ATOM 2884   H H    . LEU B 1 23  ? 64.911  70.717  103.971 1.00 0.00 ? 27  LEU B H    1  
ATOM 2885   H HA   . LEU B 1 23  ? 66.948  72.119  105.090 1.00 0.00 ? 27  LEU B HA   1  
ATOM 2886   H HB2  . LEU B 1 23  ? 68.284  71.419  103.289 1.00 0.00 ? 27  LEU B HB2  1  
ATOM 2887   H HB3  . LEU B 1 23  ? 67.888  70.263  104.256 1.00 0.00 ? 27  LEU B HB3  1  
ATOM 2888   H HG   . LEU B 1 23  ? 66.193  70.376  102.134 1.00 0.00 ? 27  LEU B HG   1  
ATOM 2889   H HD11 . LEU B 1 23  ? 67.642  69.845  100.429 1.00 0.00 ? 27  LEU B HD11 1  
ATOM 2890   H HD12 . LEU B 1 23  ? 68.254  71.133  101.119 1.00 0.00 ? 27  LEU B HD12 1  
ATOM 2891   H HD13 . LEU B 1 23  ? 68.855  69.703  101.437 1.00 0.00 ? 27  LEU B HD13 1  
ATOM 2892   H HD21 . LEU B 1 23  ? 67.607  68.275  103.311 1.00 0.00 ? 27  LEU B HD21 1  
ATOM 2893   H HD22 . LEU B 1 23  ? 66.036  68.452  103.210 1.00 0.00 ? 27  LEU B HD22 1  
ATOM 2894   H HD23 . LEU B 1 23  ? 66.871  68.042  101.928 1.00 0.00 ? 27  LEU B HD23 1  
ATOM 2895   N N    . PHE B 1 24  ? 67.043  73.953  103.353 1.00 0.00 ? 28  PHE B N    1  
ATOM 2896   C CA   . PHE B 1 24  ? 66.591  75.169  102.713 1.00 0.00 ? 28  PHE B CA   1  
ATOM 2897   C C    . PHE B 1 24  ? 67.291  75.360  101.369 1.00 0.00 ? 28  PHE B C    1  
ATOM 2898   O O    . PHE B 1 24  ? 68.468  75.011  101.234 1.00 0.00 ? 28  PHE B O    1  
ATOM 2899   C CB   . PHE B 1 24  ? 66.859  76.367  103.632 1.00 0.00 ? 28  PHE B CB   1  
ATOM 2900   C CG   . PHE B 1 24  ? 66.137  77.607  103.230 1.00 0.00 ? 28  PHE B CG   1  
ATOM 2901   C CD1  . PHE B 1 24  ? 64.755  77.639  103.226 1.00 0.00 ? 28  PHE B CD1  1  
ATOM 2902   C CD2  . PHE B 1 24  ? 66.828  78.742  102.864 1.00 0.00 ? 28  PHE B CD2  1  
ATOM 2903   C CE1  . PHE B 1 24  ? 64.081  78.776  102.848 1.00 0.00 ? 28  PHE B CE1  1  
ATOM 2904   C CE2  . PHE B 1 24  ? 66.156  79.889  102.486 1.00 0.00 ? 28  PHE B CE2  1  
ATOM 2905   C CZ   . PHE B 1 24  ? 64.779  79.904  102.481 1.00 0.00 ? 28  PHE B CZ   1  
ATOM 2906   H H    . PHE B 1 24  ? 67.835  73.957  103.688 1.00 0.00 ? 28  PHE B H    1  
ATOM 2907   H HA   . PHE B 1 24  ? 65.637  75.103  102.549 1.00 0.00 ? 28  PHE B HA   1  
ATOM 2908   H HB2  . PHE B 1 24  ? 66.603  76.133  104.538 1.00 0.00 ? 28  PHE B HB2  1  
ATOM 2909   H HB3  . PHE B 1 24  ? 67.811  76.547  103.645 1.00 0.00 ? 28  PHE B HB3  1  
ATOM 2910   H HD1  . PHE B 1 24  ? 64.276  76.884  103.482 1.00 0.00 ? 28  PHE B HD1  1  
ATOM 2911   H HD2  . PHE B 1 24  ? 67.758  78.736  102.872 1.00 0.00 ? 28  PHE B HD2  1  
ATOM 2912   H HE1  . PHE B 1 24  ? 63.150  78.784  102.841 1.00 0.00 ? 28  PHE B HE1  1  
ATOM 2913   H HE2  . PHE B 1 24  ? 66.632  80.648  102.235 1.00 0.00 ? 28  PHE B HE2  1  
ATOM 2914   H HZ   . PHE B 1 24  ? 64.322  80.674  102.230 1.00 0.00 ? 28  PHE B HZ   1  
ATOM 2915   N N    . PRO B 1 25  ? 66.599  75.854  100.345 1.00 0.00 ? 29  PRO B N    1  
ATOM 2916   C CA   . PRO B 1 25  ? 67.258  76.058  99.049  1.00 0.00 ? 29  PRO B CA   1  
ATOM 2917   C C    . PRO B 1 25  ? 68.155  77.284  99.042  1.00 0.00 ? 29  PRO B C    1  
ATOM 2918   O O    . PRO B 1 25  ? 68.218  78.048  100.005 1.00 0.00 ? 29  PRO B O    1  
ATOM 2919   C CB   . PRO B 1 25  ? 66.087  76.193  98.069  1.00 0.00 ? 29  PRO B CB   1  
ATOM 2920   C CG   . PRO B 1 25  ? 64.955  76.668  98.902  1.00 0.00 ? 29  PRO B CG   1  
ATOM 2921   C CD   . PRO B 1 25  ? 65.139  76.008  100.241 1.00 0.00 ? 29  PRO B CD   1  
ATOM 2922   H HA   . PRO B 1 25  ? 67.847  75.322  98.820  1.00 0.00 ? 29  PRO B HA   1  
ATOM 2923   H HB2  . PRO B 1 25  ? 66.291  76.823  97.360  1.00 0.00 ? 29  PRO B HB2  1  
ATOM 2924   H HB3  . PRO B 1 25  ? 65.881  75.345  97.645  1.00 0.00 ? 29  PRO B HB3  1  
ATOM 2925   H HG2  . PRO B 1 25  ? 64.963  77.634  98.985  1.00 0.00 ? 29  PRO B HG2  1  
ATOM 2926   H HG3  . PRO B 1 25  ? 64.104  76.425  98.507  1.00 0.00 ? 29  PRO B HG3  1  
ATOM 2927   H HD2  . PRO B 1 25  ? 64.785  76.553  100.960 1.00 0.00 ? 29  PRO B HD2  1  
ATOM 2928   H HD3  . PRO B 1 25  ? 64.685  75.152  100.283 1.00 0.00 ? 29  PRO B HD3  1  
ATOM 2929   N N    . ALA B 1 26  ? 68.846  77.452  97.910  1.00 0.00 ? 30  ALA B N    1  
ATOM 2930   C CA   . ALA B 1 26  ? 69.775  78.553  97.637  1.00 0.00 ? 30  ALA B CA   1  
ATOM 2931   C C    . ALA B 1 26  ? 70.827  78.686  98.739  1.00 0.00 ? 30  ALA B C    1  
ATOM 2932   O O    . ALA B 1 26  ? 70.918  79.698  99.432  1.00 0.00 ? 30  ALA B O    1  
ATOM 2933   C CB   . ALA B 1 26  ? 69.036  79.879  97.419  1.00 0.00 ? 30  ALA B CB   1  
ATOM 2934   H H    . ALA B 1 26  ? 68.781  76.902  97.252  1.00 0.00 ? 30  ALA B H    1  
ATOM 2935   H HA   . ALA B 1 26  ? 70.236  78.336  96.812  1.00 0.00 ? 30  ALA B HA   1  
ATOM 2936   H HB1  . ALA B 1 26  ? 68.444  79.798  96.656  1.00 0.00 ? 30  ALA B HB1  1  
ATOM 2937   H HB2  . ALA B 1 26  ? 68.517  80.094  98.209  1.00 0.00 ? 30  ALA B HB2  1  
ATOM 2938   H HB3  . ALA B 1 26  ? 69.681  80.586  97.255  1.00 0.00 ? 30  ALA B HB3  1  
ATOM 2939   N N    . TYR B 1 27  ? 71.626  77.632  98.889  1.00 0.00 ? 31  TYR B N    1  
ATOM 2940   C CA   . TYR B 1 27  ? 72.758  77.668  99.802  1.00 0.00 ? 31  TYR B CA   1  
ATOM 2941   C C    . TYR B 1 27  ? 73.903  78.492  99.223  1.00 0.00 ? 31  TYR B C    1  
ATOM 2942   O O    . TYR B 1 27  ? 74.161  78.512  98.020  1.00 0.00 ? 31  TYR B O    1  
ATOM 2943   C CB   . TYR B 1 27  ? 73.245  76.258  100.129 1.00 0.00 ? 31  TYR B CB   1  
ATOM 2944   C CG   . TYR B 1 27  ? 72.480  75.585  101.238 1.00 0.00 ? 31  TYR B CG   1  
ATOM 2945   C CD1  . TYR B 1 27  ? 71.993  74.296  101.081 1.00 0.00 ? 31  TYR B CD1  1  
ATOM 2946   C CD2  . TYR B 1 27  ? 72.243  76.237  102.442 1.00 0.00 ? 31  TYR B CD2  1  
ATOM 2947   C CE1  . TYR B 1 27  ? 71.283  73.673  102.084 1.00 0.00 ? 31  TYR B CE1  1  
ATOM 2948   C CE2  . TYR B 1 27  ? 71.543  75.616  103.459 1.00 0.00 ? 31  TYR B CE2  1  
ATOM 2949   C CZ   . TYR B 1 27  ? 71.071  74.332  103.273 1.00 0.00 ? 31  TYR B CZ   1  
ATOM 2950   O OH   . TYR B 1 27  ? 70.371  73.703  104.275 1.00 0.00 ? 31  TYR B OH   1  
ATOM 2951   H H    . TYR B 1 27  ? 71.528  76.887  98.470  1.00 0.00 ? 31  TYR B H    1  
ATOM 2952   H HA   . TYR B 1 27  ? 72.458  78.089  100.622 1.00 0.00 ? 31  TYR B HA   1  
ATOM 2953   H HB2  . TYR B 1 27  ? 73.184  75.711  99.331  1.00 0.00 ? 31  TYR B HB2  1  
ATOM 2954   H HB3  . TYR B 1 27  ? 74.182  76.298  100.375 1.00 0.00 ? 31  TYR B HB3  1  
ATOM 2955   H HD1  . TYR B 1 27  ? 72.147  73.843  100.284 1.00 0.00 ? 31  TYR B HD1  1  
ATOM 2956   H HD2  . TYR B 1 27  ? 72.560  77.102  102.566 1.00 0.00 ? 31  TYR B HD2  1  
ATOM 2957   H HE1  . TYR B 1 27  ? 70.950  72.814  101.959 1.00 0.00 ? 31  TYR B HE1  1  
ATOM 2958   H HE2  . TYR B 1 27  ? 71.390  76.060  104.263 1.00 0.00 ? 31  TYR B HE2  1  
ATOM 2959   H HH   . TYR B 1 27  ? 69.602  74.037  104.332 1.00 0.00 ? 31  TYR B HH   1  
ATOM 2960   N N    . GLN B 1 28  ? 74.597  79.183  100.113 1.00 0.00 ? 32  GLN B N    1  
ATOM 2961   C CA   . GLN B 1 28  ? 75.736  80.010  99.769  1.00 0.00 ? 32  GLN B CA   1  
ATOM 2962   C C    . GLN B 1 28  ? 76.956  79.176  100.163 1.00 0.00 ? 32  GLN B C    1  
ATOM 2963   O O    . GLN B 1 28  ? 77.775  78.840  99.301  1.00 0.00 ? 32  GLN B O    1  
ATOM 2964   C CB   . GLN B 1 28  ? 75.551  81.399  100.421 1.00 0.00 ? 32  GLN B CB   1  
ATOM 2965   C CG   . GLN B 1 28  ? 76.216  82.602  99.758  1.00 0.00 ? 32  GLN B CG   1  
ATOM 2966   C CD   . GLN B 1 28  ? 77.466  83.045  100.471 1.00 0.00 ? 32  GLN B CD   1  
ATOM 2967   O OE1  . GLN B 1 28  ? 77.579  82.902  101.686 1.00 0.00 ? 32  GLN B OE1  1  
ATOM 2968   N NE2  . GLN B 1 28  ? 78.407  83.598  99.728  1.00 0.00 ? 32  GLN B NE2  1  
ATOM 2969   H H    . GLN B 1 28  ? 74.414  79.183  100.953 1.00 0.00 ? 32  GLN B H    1  
ATOM 2970   H HA   . GLN B 1 28  ? 75.847  80.233  98.832  1.00 0.00 ? 32  GLN B HA   1  
ATOM 2971   H HB2  . GLN B 1 28  ? 74.599  81.578  100.473 1.00 0.00 ? 32  GLN B HB2  1  
ATOM 2972   H HB3  . GLN B 1 28  ? 75.879  81.345  101.333 1.00 0.00 ? 32  GLN B HB3  1  
ATOM 2973   H HG2  . GLN B 1 28  ? 76.434  82.379  98.840  1.00 0.00 ? 32  GLN B HG2  1  
ATOM 2974   H HG3  . GLN B 1 28  ? 75.587  83.339  99.730  1.00 0.00 ? 32  GLN B HG3  1  
ATOM 2975   H HE21 . GLN B 1 28  ? 78.292  83.681  98.880  1.00 0.00 ? 32  GLN B HE21 1  
ATOM 2976   H HE22 . GLN B 1 28  ? 79.135  83.875  100.092 1.00 0.00 ? 32  GLN B HE22 1  
ATOM 2977   N N    . THR B 1 29  ? 77.117  78.877  101.450 1.00 0.00 ? 33  THR B N    1  
ATOM 2978   C CA   . THR B 1 29  ? 78.259  78.105  101.905 1.00 0.00 ? 33  THR B CA   1  
ATOM 2979   C C    . THR B 1 29  ? 78.168  77.819  103.402 1.00 0.00 ? 33  THR B C    1  
ATOM 2980   O O    . THR B 1 29  ? 77.467  78.493  104.174 1.00 0.00 ? 33  THR B O    1  
ATOM 2981   C CB   . THR B 1 29  ? 79.572  78.823  101.598 1.00 0.00 ? 33  THR B CB   1  
ATOM 2982   O OG1  . THR B 1 29  ? 80.645  77.874  101.638 1.00 0.00 ? 33  THR B OG1  1  
ATOM 2983   C CG2  . THR B 1 29  ? 79.849  79.917  102.618 1.00 0.00 ? 33  THR B CG2  1  
ATOM 2984   H H    . THR B 1 29  ? 76.573  79.114  102.073 1.00 0.00 ? 33  THR B H    1  
ATOM 2985   H HA   . THR B 1 29  ? 78.246  77.263  101.423 1.00 0.00 ? 33  THR B HA   1  
ATOM 2986   H HB   . THR B 1 29  ? 79.503  79.227  100.719 1.00 0.00 ? 33  THR B HB   1  
ATOM 2987   H HG1  . THR B 1 29  ? 81.371  78.277  101.765 1.00 0.00 ? 33  THR B HG1  1  
ATOM 2988   H HG21 . THR B 1 29  ? 80.256  80.782  102.449 1.00 0.00 ? 33  THR B HG21 1  
ATOM 2989   H HG22 . THR B 1 29  ? 79.127  80.566  102.600 1.00 0.00 ? 33  THR B HG22 1  
ATOM 2990   H HG23 . THR B 1 29  ? 79.909  79.526  103.504 1.00 0.00 ? 33  THR B HG23 1  
ATOM 2991   N N    . ASP B 1 30  ? 78.904  76.791  103.801 1.00 0.00 ? 34  ASP B N    1  
ATOM 2992   C CA   . ASP B 1 30  ? 78.721  76.149  105.084 1.00 0.00 ? 34  ASP B CA   1  
ATOM 2993   C C    . ASP B 1 30  ? 80.088  75.967  105.716 1.00 0.00 ? 34  ASP B C    1  
ATOM 2994   O O    . ASP B 1 30  ? 80.957  75.270  105.185 1.00 0.00 ? 34  ASP B O    1  
ATOM 2995   C CB   . ASP B 1 30  ? 78.007  74.805  104.905 1.00 0.00 ? 34  ASP B CB   1  
ATOM 2996   C CG   . ASP B 1 30  ? 77.136  74.436  106.087 1.00 0.00 ? 34  ASP B CG   1  
ATOM 2997   O OD1  . ASP B 1 30  ? 77.659  73.877  107.073 1.00 0.00 ? 34  ASP B OD1  1  
ATOM 2998   O OD2  . ASP B 1 30  ? 75.916  74.700  106.025 1.00 0.00 ? 34  ASP B OD2  1  
ATOM 2999   H H    . ASP B 1 30  ? 79.532  76.446  103.325 1.00 0.00 ? 34  ASP B H    1  
ATOM 3000   H HA   . ASP B 1 30  ? 78.167  76.694  105.664 1.00 0.00 ? 34  ASP B HA   1  
ATOM 3001   H HB2  . ASP B 1 30  ? 77.461  74.838  104.105 1.00 0.00 ? 34  ASP B HB2  1  
ATOM 3002   H HB3  . ASP B 1 30  ? 78.669  74.109  104.768 1.00 0.00 ? 34  ASP B HB3  1  
ATOM 3003   N N    . GLY B 1 31  ? 80.280  76.610  106.857 1.00 0.00 ? 35  GLY B N    1  
ATOM 3004   C CA   . GLY B 1 31  ? 81.451  76.357  107.657 1.00 0.00 ? 35  GLY B CA   1  
ATOM 3005   C C    . GLY B 1 31  ? 81.091  75.698  108.963 1.00 0.00 ? 35  GLY B C    1  
ATOM 3006   O O    . GLY B 1 31  ? 80.328  76.251  109.762 1.00 0.00 ? 35  GLY B O    1  
ATOM 3007   H H    . GLY B 1 31  ? 79.741  77.196  107.181 1.00 0.00 ? 35  GLY B H    1  
ATOM 3008   H HA2  . GLY B 1 31  ? 82.064  75.789  107.165 1.00 0.00 ? 35  GLY B HA2  1  
ATOM 3009   H HA3  . GLY B 1 31  ? 81.913  77.191  107.830 1.00 0.00 ? 35  GLY B HA3  1  
ATOM 3010   N N    . SER B 1 32  ? 81.644  74.515  109.193 1.00 0.00 ? 36  SER B N    1  
ATOM 3011   C CA   . SER B 1 32  ? 81.514  73.815  110.465 1.00 0.00 ? 36  SER B CA   1  
ATOM 3012   C C    . SER B 1 32  ? 82.922  73.763  111.035 1.00 0.00 ? 36  SER B C    1  
ATOM 3013   O O    . SER B 1 32  ? 83.848  73.247  110.407 1.00 0.00 ? 36  SER B O    1  
ATOM 3014   C CB   . SER B 1 32  ? 80.908  72.440  110.277 1.00 0.00 ? 36  SER B CB   1  
ATOM 3015   O OG   . SER B 1 32  ? 79.645  72.537  109.646 1.00 0.00 ? 36  SER B OG   1  
ATOM 3016   H H    . SER B 1 32  ? 82.111  74.090  108.609 1.00 0.00 ? 36  SER B H    1  
ATOM 3017   H HA   . SER B 1 32  ? 80.911  74.269  111.075 1.00 0.00 ? 36  SER B HA   1  
ATOM 3018   H HB2  . SER B 1 32  ? 81.502  71.889  109.743 1.00 0.00 ? 36  SER B HB2  1  
ATOM 3019   H HB3  . SER B 1 32  ? 80.813  72.002  111.137 1.00 0.00 ? 36  SER B HB3  1  
ATOM 3020   H HG   . SER B 1 32  ? 79.714  72.298  108.843 1.00 0.00 ? 36  SER B HG   1  
ATOM 3021   N N    . VAL B 1 33  ? 83.077  74.298  112.238 1.00 0.00 ? 37  VAL B N    1  
ATOM 3022   C CA   . VAL B 1 33  ? 84.388  74.450  112.854 1.00 0.00 ? 37  VAL B CA   1  
ATOM 3023   C C    . VAL B 1 33  ? 84.350  73.780  114.225 1.00 0.00 ? 37  VAL B C    1  
ATOM 3024   O O    . VAL B 1 33  ? 83.393  73.923  114.992 1.00 0.00 ? 37  VAL B O    1  
ATOM 3025   C CB   . VAL B 1 33  ? 84.816  75.924  112.908 1.00 0.00 ? 37  VAL B CB   1  
ATOM 3026   C CG1  . VAL B 1 33  ? 86.311  76.019  112.679 1.00 0.00 ? 37  VAL B CG1  1  
ATOM 3027   C CG2  . VAL B 1 33  ? 84.165  76.739  111.810 1.00 0.00 ? 37  VAL B CG2  1  
ATOM 3028   H H    . VAL B 1 33  ? 82.426  74.584  112.722 1.00 0.00 ? 37  VAL B H    1  
ATOM 3029   H HA   . VAL B 1 33  ? 85.068  74.012  112.317 1.00 0.00 ? 37  VAL B HA   1  
ATOM 3030   H HB   . VAL B 1 33  ? 84.551  76.265  113.776 1.00 0.00 ? 37  VAL B HB   1  
ATOM 3031   H HG11 . VAL B 1 33  ? 86.508  75.836  111.746 1.00 0.00 ? 37  VAL B HG11 1  
ATOM 3032   H HG12 . VAL B 1 33  ? 86.618  76.911  112.904 1.00 0.00 ? 37  VAL B HG12 1  
ATOM 3033   H HG13 . VAL B 1 33  ? 86.767  75.369  113.238 1.00 0.00 ? 37  VAL B HG13 1  
ATOM 3034   H HG21 . VAL B 1 33  ? 84.019  76.177  111.033 1.00 0.00 ? 37  VAL B HG21 1  
ATOM 3035   H HG22 . VAL B 1 33  ? 83.313  77.083  112.124 1.00 0.00 ? 37  VAL B HG22 1  
ATOM 3036   H HG23 . VAL B 1 33  ? 84.744  77.479  111.570 1.00 0.00 ? 37  VAL B HG23 1  
ATOM 3037   N N    . SER B 1 34  ? 85.389  73.009  114.516 1.00 0.00 ? 38  SER B N    1  
ATOM 3038   C CA   . SER B 1 34  ? 85.410  72.073  115.634 1.00 0.00 ? 38  SER B CA   1  
ATOM 3039   C C    . SER B 1 34  ? 86.771  72.182  116.316 1.00 0.00 ? 38  SER B C    1  
ATOM 3040   O O    . SER B 1 34  ? 87.789  71.756  115.771 1.00 0.00 ? 38  SER B O    1  
ATOM 3041   C CB   . SER B 1 34  ? 85.141  70.654  115.138 1.00 0.00 ? 38  SER B CB   1  
ATOM 3042   O OG   . SER B 1 34  ? 85.909  70.343  113.990 1.00 0.00 ? 38  SER B OG   1  
ATOM 3043   H H    . SER B 1 34  ? 86.119  73.014  114.059 1.00 0.00 ? 38  SER B H    1  
ATOM 3044   H HA   . SER B 1 34  ? 84.713  72.287  116.274 1.00 0.00 ? 38  SER B HA   1  
ATOM 3045   H HB2  . SER B 1 34  ? 85.343  70.021  115.844 1.00 0.00 ? 38  SER B HB2  1  
ATOM 3046   H HB3  . SER B 1 34  ? 84.198  70.557  114.932 1.00 0.00 ? 38  SER B HB3  1  
ATOM 3047   H HG   . SER B 1 34  ? 85.478  70.551  113.300 1.00 0.00 ? 38  SER B HG   1  
ATOM 3048   N N    . GLY B 1 35  ? 86.784  72.752  117.516 1.00 0.00 ? 39  GLY B N    1  
ATOM 3049   C CA   . GLY B 1 35  ? 88.029  72.939  118.232 1.00 0.00 ? 39  GLY B CA   1  
ATOM 3050   C C    . GLY B 1 35  ? 88.204  71.979  119.387 1.00 0.00 ? 39  GLY B C    1  
ATOM 3051   O O    . GLY B 1 35  ? 87.381  71.947  120.307 1.00 0.00 ? 39  GLY B O    1  
ATOM 3052   H H    . GLY B 1 35  ? 86.084  73.034  117.927 1.00 0.00 ? 39  GLY B H    1  
ATOM 3053   H HA2  . GLY B 1 35  ? 88.769  72.832  117.614 1.00 0.00 ? 39  GLY B HA2  1  
ATOM 3054   H HA3  . GLY B 1 35  ? 88.068  73.849  118.566 1.00 0.00 ? 39  GLY B HA3  1  
ATOM 3055   N N    . GLU B 1 36  ? 89.273  71.188  119.354 1.00 0.00 ? 40  GLU B N    1  
ATOM 3056   C CA   . GLU B 1 36  ? 89.559  70.200  120.388 1.00 0.00 ? 40  GLU B CA   1  
ATOM 3057   C C    . GLU B 1 36  ? 90.628  70.780  121.305 1.00 0.00 ? 40  GLU B C    1  
ATOM 3058   O O    . GLU B 1 36  ? 91.803  70.851  120.931 1.00 0.00 ? 40  GLU B O    1  
ATOM 3059   C CB   . GLU B 1 36  ? 90.008  68.876  119.773 1.00 0.00 ? 40  GLU B CB   1  
ATOM 3060   C CG   . GLU B 1 36  ? 90.504  67.860  120.785 1.00 0.00 ? 40  GLU B CG   1  
ATOM 3061   C CD   . GLU B 1 36  ? 90.125  66.440  120.418 1.00 0.00 ? 40  GLU B CD   1  
ATOM 3062   O OE1  . GLU B 1 36  ? 90.353  65.533  121.242 1.00 0.00 ? 40  GLU B OE1  1  
ATOM 3063   O OE2  . GLU B 1 36  ? 89.613  66.226  119.300 1.00 0.00 ? 40  GLU B OE2  1  
ATOM 3064   H H    . GLU B 1 36  ? 89.858  71.211  118.723 1.00 0.00 ? 40  GLU B H    1  
ATOM 3065   H HA   . GLU B 1 36  ? 88.758  70.008  120.900 1.00 0.00 ? 40  GLU B HA   1  
ATOM 3066   H HB2  . GLU B 1 36  ? 89.267  68.492  119.279 1.00 0.00 ? 40  GLU B HB2  1  
ATOM 3067   H HB3  . GLU B 1 36  ? 90.715  69.052  119.132 1.00 0.00 ? 40  GLU B HB3  1  
ATOM 3068   H HG2  . GLU B 1 36  ? 91.469  67.925  120.857 1.00 0.00 ? 40  GLU B HG2  1  
ATOM 3069   H HG3  . GLU B 1 36  ? 90.139  68.073  121.658 1.00 0.00 ? 40  GLU B HG3  1  
ATOM 3070   N N    . ARG B 1 37  ? 90.222  71.189  122.501 1.00 0.00 ? 41  ARG B N    1  
ATOM 3071   C CA   . ARG B 1 37  ? 91.113  71.877  123.424 1.00 0.00 ? 41  ARG B CA   1  
ATOM 3072   C C    . ARG B 1 37  ? 92.146  70.904  123.982 1.00 0.00 ? 41  ARG B C    1  
ATOM 3073   O O    . ARG B 1 37  ? 91.858  69.734  124.248 1.00 0.00 ? 41  ARG B O    1  
ATOM 3074   C CB   . ARG B 1 37  ? 90.305  72.538  124.531 1.00 0.00 ? 41  ARG B CB   1  
ATOM 3075   C CG   . ARG B 1 37  ? 90.165  74.028  124.356 1.00 0.00 ? 41  ARG B CG   1  
ATOM 3076   C CD   . ARG B 1 37  ? 91.448  74.722  124.731 1.00 0.00 ? 41  ARG B CD   1  
ATOM 3077   N NE   . ARG B 1 37  ? 92.404  74.623  123.632 1.00 0.00 ? 41  ARG B NE   1  
ATOM 3078   C CZ   . ARG B 1 37  ? 93.726  74.607  123.780 1.00 0.00 ? 41  ARG B CZ   1  
ATOM 3079   N NH1  . ARG B 1 37  ? 94.264  74.685  124.988 1.00 0.00 ? 41  ARG B NH1  1  
ATOM 3080   N NH2  . ARG B 1 37  ? 94.511  74.508  122.715 1.00 0.00 ? 41  ARG B NH2  1  
ATOM 3081   H H    . ARG B 1 37  ? 89.423  71.074  122.799 1.00 0.00 ? 41  ARG B H    1  
ATOM 3082   H HA   . ARG B 1 37  ? 91.592  72.575  122.951 1.00 0.00 ? 41  ARG B HA   1  
ATOM 3083   H HB2  . ARG B 1 37  ? 89.422  72.138  124.562 1.00 0.00 ? 41  ARG B HB2  1  
ATOM 3084   H HB3  . ARG B 1 37  ? 90.729  72.358  125.385 1.00 0.00 ? 41  ARG B HB3  1  
ATOM 3085   H HG2  . ARG B 1 37  ? 89.936  74.231  123.436 1.00 0.00 ? 41  ARG B HG2  1  
ATOM 3086   H HG3  . ARG B 1 37  ? 89.438  74.357  124.908 1.00 0.00 ? 41  ARG B HG3  1  
ATOM 3087   H HD2  . ARG B 1 37  ? 91.273  75.654  124.935 1.00 0.00 ? 41  ARG B HD2  1  
ATOM 3088   H HD3  . ARG B 1 37  ? 91.821  74.321  125.531 1.00 0.00 ? 41  ARG B HD3  1  
ATOM 3089   H HE   . ARG B 1 37  ? 92.090  74.572  122.833 1.00 0.00 ? 41  ARG B HE   1  
ATOM 3090   H HH11 . ARG B 1 37  ? 93.759  74.746  125.682 1.00 0.00 ? 41  ARG B HH11 1  
ATOM 3091   H HH12 . ARG B 1 37  ? 95.119  74.674  125.080 1.00 0.00 ? 41  ARG B HH12 1  
ATOM 3092   H HH21 . ARG B 1 37  ? 94.166  74.456  121.930 1.00 0.00 ? 41  ARG B HH21 1  
ATOM 3093   H HH22 . ARG B 1 37  ? 95.366  74.498  122.811 1.00 0.00 ? 41  ARG B HH22 1  
ATOM 3094   N N    . GLU B 1 38  ? 93.362  71.400  124.192 1.00 0.00 ? 42  GLU B N    1  
ATOM 3095   C CA   . GLU B 1 38  ? 94.525  70.564  124.466 1.00 0.00 ? 42  GLU B CA   1  
ATOM 3096   C C    . GLU B 1 38  ? 95.181  71.044  125.754 1.00 0.00 ? 42  GLU B C    1  
ATOM 3097   O O    . GLU B 1 38  ? 94.770  72.043  126.349 1.00 0.00 ? 42  GLU B O    1  
ATOM 3098   C CB   . GLU B 1 38  ? 95.493  70.611  123.286 1.00 0.00 ? 42  GLU B CB   1  
ATOM 3099   C CG   . GLU B 1 38  ? 95.032  69.766  122.126 1.00 0.00 ? 42  GLU B CG   1  
ATOM 3100   C CD   . GLU B 1 38  ? 96.171  69.342  121.239 1.00 0.00 ? 42  GLU B CD   1  
ATOM 3101   O OE1  . GLU B 1 38  ? 95.973  69.278  120.008 1.00 0.00 ? 42  GLU B OE1  1  
ATOM 3102   O OE2  . GLU B 1 38  ? 97.270  69.097  121.772 1.00 0.00 ? 42  GLU B OE2  1  
ATOM 3103   H H    . GLU B 1 38  ? 93.536  72.241  124.180 1.00 0.00 ? 42  GLU B H    1  
ATOM 3104   H HA   . GLU B 1 38  ? 94.256  69.639  124.581 1.00 0.00 ? 42  GLU B HA   1  
ATOM 3105   H HB2  . GLU B 1 38  ? 95.596  71.529  122.992 1.00 0.00 ? 42  GLU B HB2  1  
ATOM 3106   H HB3  . GLU B 1 38  ? 96.368  70.307  123.577 1.00 0.00 ? 42  GLU B HB3  1  
ATOM 3107   H HG2  . GLU B 1 38  ? 94.578  68.978  122.464 1.00 0.00 ? 42  GLU B HG2  1  
ATOM 3108   H HG3  . GLU B 1 38  ? 94.385  70.264  121.603 1.00 0.00 ? 42  GLU B HG3  1  
ATOM 3109   N N    . LEU B 1 39  ? 96.207  70.313  126.181 1.00 0.00 ? 43  LEU B N    1  
ATOM 3110   C CA   . LEU B 1 39  ? 96.942  70.609  127.400 1.00 0.00 ? 43  LEU B CA   1  
ATOM 3111   C C    . LEU B 1 39  ? 97.678  71.936  127.271 1.00 0.00 ? 43  LEU B C    1  
ATOM 3112   O O    . LEU B 1 39  ? 98.247  72.255  126.223 1.00 0.00 ? 43  LEU B O    1  
ATOM 3113   C CB   . LEU B 1 39  ? 97.949  69.497  127.724 1.00 0.00 ? 43  LEU B CB   1  
ATOM 3114   C CG   . LEU B 1 39  ? 97.897  68.818  129.094 1.00 0.00 ? 43  LEU B CG   1  
ATOM 3115   C CD1  . LEU B 1 39  ? 98.045  69.846  130.203 1.00 0.00 ? 43  LEU B CD1  1  
ATOM 3116   C CD2  . LEU B 1 39  ? 96.596  68.056  129.258 1.00 0.00 ? 43  LEU B CD2  1  
ATOM 3117   H H    . LEU B 1 39  ? 96.498  69.621  125.761 1.00 0.00 ? 43  LEU B H    1  
ATOM 3118   H HA   . LEU B 1 39  ? 96.298  70.666  128.123 1.00 0.00 ? 43  LEU B HA   1  
ATOM 3119   H HB2  . LEU B 1 39  ? 97.847  68.805  127.052 1.00 0.00 ? 43  LEU B HB2  1  
ATOM 3120   H HB3  . LEU B 1 39  ? 98.838  69.868  127.615 1.00 0.00 ? 43  LEU B HB3  1  
ATOM 3121   H HG   . LEU B 1 39  ? 98.635  68.191  129.153 1.00 0.00 ? 43  LEU B HG   1  
ATOM 3122   H HD11 . LEU B 1 39  ? 98.949  70.198  130.199 1.00 0.00 ? 43  LEU B HD11 1  
ATOM 3123   H HD12 . LEU B 1 39  ? 97.416  70.570  130.059 1.00 0.00 ? 43  LEU B HD12 1  
ATOM 3124   H HD13 . LEU B 1 39  ? 97.865  69.427  131.059 1.00 0.00 ? 43  LEU B HD13 1  
ATOM 3125   H HD21 . LEU B 1 39  ? 96.534  67.369  128.576 1.00 0.00 ? 43  LEU B HD21 1  
ATOM 3126   H HD22 . LEU B 1 39  ? 96.570  67.643  130.135 1.00 0.00 ? 43  LEU B HD22 1  
ATOM 3127   H HD23 . LEU B 1 39  ? 95.848  68.668  129.169 1.00 0.00 ? 43  LEU B HD23 1  
ATOM 3128   N N    . PHE B 1 40  ? 97.658  72.707  128.360 1.00 0.00 ? 44  PHE B N    1  
ATOM 3129   C CA   . PHE B 1 40  ? 98.458  73.919  128.473 1.00 0.00 ? 44  PHE B CA   1  
ATOM 3130   C C    . PHE B 1 40  ? 99.843  73.616  129.016 1.00 0.00 ? 44  PHE B C    1  
ATOM 3131   O O    . PHE B 1 40  ? 99.978  72.965  130.055 1.00 0.00 ? 44  PHE B O    1  
ATOM 3132   C CB   . PHE B 1 40  ? 97.797  74.970  129.372 1.00 0.00 ? 44  PHE B CB   1  
ATOM 3133   C CG   . PHE B 1 40  ? 96.295  74.845  129.436 1.00 0.00 ? 44  PHE B CG   1  
ATOM 3134   C CD1  . PHE B 1 40  ? 95.667  74.458  130.611 1.00 0.00 ? 44  PHE B CD1  1  
ATOM 3135   C CD2  . PHE B 1 40  ? 95.512  75.122  128.326 1.00 0.00 ? 44  PHE B CD2  1  
ATOM 3136   C CE1  . PHE B 1 40  ? 94.289  74.341  130.672 1.00 0.00 ? 44  PHE B CE1  1  
ATOM 3137   C CE2  . PHE B 1 40  ? 94.136  75.012  128.384 1.00 0.00 ? 44  PHE B CE2  1  
ATOM 3138   C CZ   . PHE B 1 40  ? 93.524  74.619  129.555 1.00 0.00 ? 44  PHE B CZ   1  
ATOM 3139   H H    . PHE B 1 40  ? 97.178  72.538  129.053 1.00 0.00 ? 44  PHE B H    1  
ATOM 3140   H HA   . PHE B 1 40  ? 98.529  74.278  127.575 1.00 0.00 ? 44  PHE B HA   1  
ATOM 3141   H HB2  . PHE B 1 40  ? 98.159  74.893  130.269 1.00 0.00 ? 44  PHE B HB2  1  
ATOM 3142   H HB3  . PHE B 1 40  ? 98.027  75.855  129.048 1.00 0.00 ? 44  PHE B HB3  1  
ATOM 3143   H HD1  . PHE B 1 40  ? 96.178  74.275  131.367 1.00 0.00 ? 44  PHE B HD1  1  
ATOM 3144   H HD2  . PHE B 1 40  ? 95.918  75.387  127.532 1.00 0.00 ? 44  PHE B HD2  1  
ATOM 3145   H HE1  . PHE B 1 40  ? 93.879  74.076  131.463 1.00 0.00 ? 44  PHE B HE1  1  
ATOM 3146   H HE2  . PHE B 1 40  ? 93.622  75.203  127.633 1.00 0.00 ? 44  PHE B HE2  1  
ATOM 3147   H HZ   . PHE B 1 40  ? 92.599  74.540  129.593 1.00 0.00 ? 44  PHE B HZ   1  
ATOM 3148   N N    . ASP B 1 41  ? 100.860 74.097  128.313 1.00 0.00 ? 45  ASP B N    1  
ATOM 3149   C CA   . ASP B 1 41  ? 102.174 74.383  128.875 1.00 0.00 ? 45  ASP B CA   1  
ATOM 3150   C C    . ASP B 1 41  ? 102.884 73.056  129.133 1.00 0.00 ? 45  ASP B C    1  
ATOM 3151   O O    . ASP B 1 41  ? 102.509 72.288  130.023 1.00 0.00 ? 45  ASP B O    1  
ATOM 3152   C CB   . ASP B 1 41  ? 102.081 75.216  130.161 1.00 0.00 ? 45  ASP B CB   1  
ATOM 3153   C CG   . ASP B 1 41  ? 103.433 75.445  130.822 1.00 0.00 ? 45  ASP B CG   1  
ATOM 3154   O OD1  . ASP B 1 41  ? 104.442 75.558  130.097 1.00 0.00 ? 45  ASP B OD1  1  
ATOM 3155   O OD2  . ASP B 1 41  ? 103.491 75.472  132.069 1.00 0.00 ? 45  ASP B OD2  1  
ATOM 3156   H H    . ASP B 1 41  ? 100.804 74.270  127.473 1.00 0.00 ? 45  ASP B H    1  
ATOM 3157   H HA   . ASP B 1 41  ? 102.680 74.916  128.242 1.00 0.00 ? 45  ASP B HA   1  
ATOM 3158   H HB2  . ASP B 1 41  ? 101.678 76.074  129.956 1.00 0.00 ? 45  ASP B HB2  1  
ATOM 3159   H HB3  . ASP B 1 41  ? 101.492 74.770  130.789 1.00 0.00 ? 45  ASP B HB3  1  
ATOM 3160   N N    . GLU B 1 42  ? 103.917 72.782  128.339 1.00 0.00 ? 46  GLU B N    1  
ATOM 3161   C CA   . GLU B 1 42  ? 104.735 71.590  128.531 1.00 0.00 ? 46  GLU B CA   1  
ATOM 3162   C C    . GLU B 1 42  ? 105.516 71.606  129.833 1.00 0.00 ? 46  GLU B C    1  
ATOM 3163   O O    . GLU B 1 42  ? 105.757 70.537  130.405 1.00 0.00 ? 46  GLU B O    1  
ATOM 3164   C CB   . GLU B 1 42  ? 105.719 71.419  127.370 1.00 0.00 ? 46  GLU B CB   1  
ATOM 3165   C CG   . GLU B 1 42  ? 106.042 69.984  127.019 1.00 0.00 ? 46  GLU B CG   1  
ATOM 3166   C CD   . GLU B 1 42  ? 107.402 69.821  126.381 1.00 0.00 ? 46  GLU B CD   1  
ATOM 3167   O OE1  . GLU B 1 42  ? 108.110 70.832  126.200 1.00 0.00 ? 46  GLU B OE1  1  
ATOM 3168   O OE2  . GLU B 1 42  ? 107.776 68.669  126.082 1.00 0.00 ? 46  GLU B OE2  1  
ATOM 3169   H H    . GLU B 1 42  ? 104.160 73.277  127.679 1.00 0.00 ? 46  GLU B H    1  
ATOM 3170   H HA   . GLU B 1 42  ? 104.114 70.845  128.564 1.00 0.00 ? 46  GLU B HA   1  
ATOM 3171   H HB2  . GLU B 1 42  ? 105.353 71.856  126.585 1.00 0.00 ? 46  GLU B HB2  1  
ATOM 3172   H HB3  . GLU B 1 42  ? 106.543 71.878  127.591 1.00 0.00 ? 46  GLU B HB3  1  
ATOM 3173   H HG2  . GLU B 1 42  ? 106.000 69.443  127.823 1.00 0.00 ? 46  GLU B HG2  1  
ATOM 3174   H HG3  . GLU B 1 42  ? 105.364 69.645  126.414 1.00 0.00 ? 46  GLU B HG3  1  
ATOM 3175   N N    . GLN B 1 43  ? 105.944 72.800  130.277 1.00 0.00 ? 47  GLN B N    1  
ATOM 3176   C CA   . GLN B 1 43  ? 106.845 73.017  131.422 1.00 0.00 ? 47  GLN B CA   1  
ATOM 3177   C C    . GLN B 1 43  ? 108.274 72.571  131.108 1.00 0.00 ? 47  GLN B C    1  
ATOM 3178   O O    . GLN B 1 43  ? 109.069 72.342  132.023 1.00 0.00 ? 47  GLN B O    1  
ATOM 3179   C CB   . GLN B 1 43  ? 106.329 72.327  132.696 1.00 0.00 ? 47  GLN B CB   1  
ATOM 3180   C CG   . GLN B 1 43  ? 104.856 72.580  133.009 1.00 0.00 ? 47  GLN B CG   1  
ATOM 3181   C CD   . GLN B 1 43  ? 104.017 71.319  133.063 1.00 0.00 ? 47  GLN B CD   1  
ATOM 3182   O OE1  . GLN B 1 43  ? 103.089 71.145  132.275 1.00 0.00 ? 47  GLN B OE1  1  
ATOM 3183   N NE2  . GLN B 1 43  ? 104.345 70.427  133.991 1.00 0.00 ? 47  GLN B NE2  1  
ATOM 3184   H H    . GLN B 1 43  ? 105.705 73.536  129.901 1.00 0.00 ? 47  GLN B H    1  
ATOM 3185   H HA   . GLN B 1 43  ? 106.859 73.972  131.588 1.00 0.00 ? 47  GLN B HA   1  
ATOM 3186   H HB2  . GLN B 1 43  ? 106.469 71.370  132.610 1.00 0.00 ? 47  GLN B HB2  1  
ATOM 3187   H HB3  . GLN B 1 43  ? 106.863 72.625  133.449 1.00 0.00 ? 47  GLN B HB3  1  
ATOM 3188   H HG2  . GLN B 1 43  ? 104.790 73.040  133.861 1.00 0.00 ? 47  GLN B HG2  1  
ATOM 3189   H HG3  . GLN B 1 43  ? 104.488 73.175  132.337 1.00 0.00 ? 47  GLN B HG3  1  
ATOM 3190   H HE21 . GLN B 1 43  ? 105.001 70.583  134.525 1.00 0.00 ? 47  GLN B HE21 1  
ATOM 3191   H HE22 . GLN B 1 43  ? 103.900 69.693  134.058 1.00 0.00 ? 47  GLN B HE22 1  
ATOM 3192   N N    . THR B 1 44  ? 108.608 72.516  129.810 1.00 0.00 ? 48  THR B N    1  
ATOM 3193   C CA   . THR B 1 44  ? 109.784 71.827  129.259 1.00 0.00 ? 48  THR B CA   1  
ATOM 3194   C C    . THR B 1 44  ? 110.001 70.466  129.923 1.00 0.00 ? 48  THR B C    1  
ATOM 3195   O O    . THR B 1 44  ? 111.030 70.205  130.549 1.00 0.00 ? 48  THR B O    1  
ATOM 3196   C CB   . THR B 1 44  ? 111.045 72.696  129.351 1.00 0.00 ? 48  THR B CB   1  
ATOM 3197   O OG1  . THR B 1 44  ? 110.693 74.081  129.251 1.00 0.00 ? 48  THR B OG1  1  
ATOM 3198   C CG2  . THR B 1 44  ? 112.017 72.344  128.235 1.00 0.00 ? 48  THR B CG2  1  
ATOM 3199   H H    . THR B 1 44  ? 108.132 72.895  129.201 1.00 0.00 ? 48  THR B H    1  
ATOM 3200   H HA   . THR B 1 44  ? 109.608 71.671  128.318 1.00 0.00 ? 48  THR B HA   1  
ATOM 3201   H HB   . THR B 1 44  ? 111.469 72.529  130.206 1.00 0.00 ? 48  THR B HB   1  
ATOM 3202   H HG1  . THR B 1 44  ? 110.214 74.297  129.906 1.00 0.00 ? 48  THR B HG1  1  
ATOM 3203   H HG21 . THR B 1 44  ? 112.970 72.305  128.411 1.00 0.00 ? 48  THR B HG21 1  
ATOM 3204   H HG22 . THR B 1 44  ? 112.272 71.411  128.310 1.00 0.00 ? 48  THR B HG22 1  
ATOM 3205   H HG23 . THR B 1 44  ? 111.593 72.494  127.375 1.00 0.00 ? 48  THR B HG23 1  
ATOM 3206   N N    . LYS B 1 45  ? 109.008 69.587  129.775 1.00 0.00 ? 49  LYS B N    1  
ATOM 3207   C CA   . LYS B 1 45  ? 109.031 68.264  130.393 1.00 0.00 ? 49  LYS B CA   1  
ATOM 3208   C C    . LYS B 1 45  ? 109.088 67.179  129.326 1.00 0.00 ? 49  LYS B C    1  
ATOM 3209   O O    . LYS B 1 45  ? 109.963 67.205  128.453 1.00 0.00 ? 49  LYS B O    1  
ATOM 3210   C CB   . LYS B 1 45  ? 107.804 68.042  131.284 1.00 0.00 ? 49  LYS B CB   1  
ATOM 3211   C CG   . LYS B 1 45  ? 107.673 68.993  132.456 1.00 0.00 ? 49  LYS B CG   1  
ATOM 3212   C CD   . LYS B 1 45  ? 108.282 68.408  133.710 1.00 0.00 ? 49  LYS B CD   1  
ATOM 3213   C CE   . LYS B 1 45  ? 109.146 69.431  134.421 1.00 0.00 ? 49  LYS B CE   1  
ATOM 3214   N NZ   . LYS B 1 45  ? 108.429 70.723  134.585 1.00 0.00 ? 49  LYS B NZ   1  
ATOM 3215   H H    . LYS B 1 45  ? 108.301 69.745  129.311 1.00 0.00 ? 49  LYS B H    1  
ATOM 3216   H HA   . LYS B 1 45  ? 109.825 68.215  130.946 1.00 0.00 ? 49  LYS B HA   1  
ATOM 3217   H HB2  . LYS B 1 45  ? 107.007 68.116  130.735 1.00 0.00 ? 49  LYS B HB2  1  
ATOM 3218   H HB3  . LYS B 1 45  ? 107.830 67.135  131.624 1.00 0.00 ? 49  LYS B HB3  1  
ATOM 3219   H HG2  . LYS B 1 45  ? 108.109 69.833  132.244 1.00 0.00 ? 49  LYS B HG2  1  
ATOM 3220   H HG3  . LYS B 1 45  ? 106.736 69.192  132.611 1.00 0.00 ? 49  LYS B HG3  1  
ATOM 3221   H HD2  . LYS B 1 45  ? 107.579 68.105  134.305 1.00 0.00 ? 49  LYS B HD2  1  
ATOM 3222   H HD3  . LYS B 1 45  ? 108.816 67.631  133.482 1.00 0.00 ? 49  LYS B HD3  1  
ATOM 3223   H HE2  . LYS B 1 45  ? 109.405 69.090  135.291 1.00 0.00 ? 49  LYS B HE2  1  
ATOM 3224   H HE3  . LYS B 1 45  ? 109.962 69.573  133.918 1.00 0.00 ? 49  LYS B HE3  1  
ATOM 3225   H HZ1  . LYS B 1 45  ? 108.024 70.936  133.822 1.00 0.00 ? 49  LYS B HZ1  1  
ATOM 3226   H HZ2  . LYS B 1 45  ? 107.822 70.646  135.231 1.00 0.00 ? 49  LYS B HZ2  1  
ATOM 3227   H HZ3  . LYS B 1 45  ? 109.012 71.361  134.799 1.00 0.00 ? 49  LYS B HZ3  1  
ATOM 3228   N N    . ASN B 1 46  ? 108.166 66.212  129.401 1.00 0.00 ? 50  ASN B N    1  
ATOM 3229   C CA   . ASN B 1 46  ? 108.089 65.145  128.405 1.00 0.00 ? 50  ASN B CA   1  
ATOM 3230   C C    . ASN B 1 46  ? 106.922 65.326  127.440 1.00 0.00 ? 50  ASN B C    1  
ATOM 3231   O O    . ASN B 1 46  ? 106.579 64.385  126.718 1.00 0.00 ? 50  ASN B O    1  
ATOM 3232   C CB   . ASN B 1 46  ? 107.973 63.781  129.096 1.00 0.00 ? 50  ASN B CB   1  
ATOM 3233   C CG   . ASN B 1 46  ? 108.567 62.651  128.274 1.00 0.00 ? 50  ASN B CG   1  
ATOM 3234   O OD1  . ASN B 1 46  ? 107.872 62.013  127.486 1.00 0.00 ? 50  ASN B OD1  1  
ATOM 3235   N ND2  . ASN B 1 46  ? 109.855 62.392  128.466 1.00 0.00 ? 50  ASN B ND2  1  
ATOM 3236   H H    . ASN B 1 46  ? 107.576 66.159  130.024 1.00 0.00 ? 50  ASN B H    1  
ATOM 3237   H HA   . ASN B 1 46  ? 108.908 65.188  127.885 1.00 0.00 ? 50  ASN B HA   1  
ATOM 3238   H HB2  . ASN B 1 46  ? 108.421 63.819  129.955 1.00 0.00 ? 50  ASN B HB2  1  
ATOM 3239   H HB3  . ASN B 1 46  ? 107.039 63.590  129.272 1.00 0.00 ? 50  ASN B HB3  1  
ATOM 3240   H HD21 . ASN B 1 46  ? 110.235 61.756  128.029 1.00 0.00 ? 50  ASN B HD21 1  
ATOM 3241   H HD22 . ASN B 1 46  ? 110.308 62.861  129.026 1.00 0.00 ? 50  ASN B HD22 1  
ATOM 3242   N N    . GLY B 1 47  ? 106.307 66.503  127.410 1.00 0.00 ? 51  GLY B N    1  
ATOM 3243   C CA   . GLY B 1 47  ? 105.178 66.754  126.532 1.00 0.00 ? 51  GLY B CA   1  
ATOM 3244   C C    . GLY B 1 47  ? 103.888 66.855  127.319 1.00 0.00 ? 51  GLY B C    1  
ATOM 3245   O O    . GLY B 1 47  ? 103.108 65.904  127.407 1.00 0.00 ? 51  GLY B O    1  
ATOM 3246   H H    . GLY B 1 47  ? 106.534 67.174  127.897 1.00 0.00 ? 51  GLY B H    1  
ATOM 3247   H HA2  . GLY B 1 47  ? 105.324 67.576  126.039 1.00 0.00 ? 51  GLY B HA2  1  
ATOM 3248   H HA3  . GLY B 1 47  ? 105.106 66.041  125.879 1.00 0.00 ? 51  GLY B HA3  1  
ATOM 3249   N N    . ARG B 1 48  ? 103.658 68.029  127.902 1.00 0.00 ? 52  ARG B N    1  
ATOM 3250   C CA   . ARG B 1 48  ? 102.465 68.265  128.704 1.00 0.00 ? 52  ARG B CA   1  
ATOM 3251   C C    . ARG B 1 48  ? 101.577 69.233  127.928 1.00 0.00 ? 52  ARG B C    1  
ATOM 3252   O O    . ARG B 1 48  ? 100.775 69.977  128.499 1.00 0.00 ? 52  ARG B O    1  
ATOM 3253   C CB   . ARG B 1 48  ? 102.836 68.798  130.095 1.00 0.00 ? 52  ARG B CB   1  
ATOM 3254   C CG   . ARG B 1 48  ? 104.071 68.148  130.743 1.00 0.00 ? 52  ARG B CG   1  
ATOM 3255   C CD   . ARG B 1 48  ? 103.720 67.066  131.761 1.00 0.00 ? 52  ARG B CD   1  
ATOM 3256   N NE   . ARG B 1 48  ? 102.842 66.042  131.199 1.00 0.00 ? 52  ARG B NE   1  
ATOM 3257   C CZ   . ARG B 1 48  ? 103.272 64.983  130.517 1.00 0.00 ? 52  ARG B CZ   1  
ATOM 3258   N NH1  . ARG B 1 48  ? 104.569 64.803  130.311 1.00 0.00 ? 52  ARG B NH1  1  
ATOM 3259   N NH2  . ARG B 1 48  ? 102.405 64.101  130.040 1.00 0.00 ? 52  ARG B NH2  1  
ATOM 3260   H H    . ARG B 1 48  ? 104.185 68.706  127.843 1.00 0.00 ? 52  ARG B H    1  
ATOM 3261   H HA   . ARG B 1 48  ? 101.983 67.439  128.858 1.00 0.00 ? 52  ARG B HA   1  
ATOM 3262   H HB2  . ARG B 1 48  ? 102.991 69.753  130.028 1.00 0.00 ? 52  ARG B HB2  1  
ATOM 3263   H HB3  . ARG B 1 48  ? 102.077 68.673  130.686 1.00 0.00 ? 52  ARG B HB3  1  
ATOM 3264   H HG2  . ARG B 1 48  ? 104.627 67.761  130.048 1.00 0.00 ? 52  ARG B HG2  1  
ATOM 3265   H HG3  . ARG B 1 48  ? 104.600 68.835  131.180 1.00 0.00 ? 52  ARG B HG3  1  
ATOM 3266   H HD2  . ARG B 1 48  ? 104.535 66.651  132.083 1.00 0.00 ? 52  ARG B HD2  1  
ATOM 3267   H HD3  . ARG B 1 48  ? 103.288 67.474  132.528 1.00 0.00 ? 52  ARG B HD3  1  
ATOM 3268   H HE   . ARG B 1 48  ? 101.995 66.129  131.316 1.00 0.00 ? 52  ARG B HE   1  
ATOM 3269   H HH11 . ARG B 1 48  ? 105.137 65.372  130.618 1.00 0.00 ? 52  ARG B HH11 1  
ATOM 3270   H HH12 . ARG B 1 48  ? 104.844 64.118  129.870 1.00 0.00 ? 52  ARG B HH12 1  
ATOM 3271   H HH21 . ARG B 1 48  ? 101.562 64.212  130.171 1.00 0.00 ? 52  ARG B HH21 1  
ATOM 3272   H HH22 . ARG B 1 48  ? 102.685 63.417  129.600 1.00 0.00 ? 52  ARG B HH22 1  
ATOM 3273   N N    . ILE B 1 49  ? 101.761 69.267  126.608 1.00 0.00 ? 53  ILE B N    1  
ATOM 3274   C CA   . ILE B 1 49  ? 100.960 70.118  125.734 1.00 0.00 ? 53  ILE B CA   1  
ATOM 3275   C C    . ILE B 1 49  ? 100.291 69.271  124.657 1.00 0.00 ? 53  ILE B C    1  
ATOM 3276   O O    . ILE B 1 49  ? 99.625  69.801  123.762 1.00 0.00 ? 53  ILE B O    1  
ATOM 3277   C CB   . ILE B 1 49  ? 101.807 71.238  125.102 1.00 0.00 ? 53  ILE B CB   1  
ATOM 3278   C CG1  . ILE B 1 49  ? 103.279 70.828  125.013 1.00 0.00 ? 53  ILE B CG1  1  
ATOM 3279   C CG2  . ILE B 1 49  ? 101.660 72.524  125.897 1.00 0.00 ? 53  ILE B CG2  1  
ATOM 3280   C CD1  . ILE B 1 49  ? 104.162 71.765  124.191 1.00 0.00 ? 53  ILE B CD1  1  
ATOM 3281   H H    . ILE B 1 49  ? 102.352 68.797  126.197 1.00 0.00 ? 53  ILE B H    1  
ATOM 3282   H HA   . ILE B 1 49  ? 100.274 70.545  126.272 1.00 0.00 ? 53  ILE B HA   1  
ATOM 3283   H HB   . ILE B 1 49  ? 101.483 71.390  124.201 1.00 0.00 ? 53  ILE B HB   1  
ATOM 3284   H HG12 . ILE B 1 49  ? 103.640 70.771  125.912 1.00 0.00 ? 53  ILE B HG12 1  
ATOM 3285   H HG13 . ILE B 1 49  ? 103.331 69.938  124.630 1.00 0.00 ? 53  ILE B HG13 1  
ATOM 3286   H HG21 . ILE B 1 49  ? 100.835 72.496  126.407 1.00 0.00 ? 53  ILE B HG21 1  
ATOM 3287   H HG22 . ILE B 1 49  ? 102.411 72.618  126.504 1.00 0.00 ? 53  ILE B HG22 1  
ATOM 3288   H HG23 . ILE B 1 49  ? 101.638 73.280  125.290 1.00 0.00 ? 53  ILE B HG23 1  
ATOM 3289   H HD11 . ILE B 1 49  ? 104.731 72.279  124.786 1.00 0.00 ? 53  ILE B HD11 1  
ATOM 3290   H HD12 . ILE B 1 49  ? 104.713 71.245  123.587 1.00 0.00 ? 53  ILE B HD12 1  
ATOM 3291   H HD13 . ILE B 1 49  ? 103.602 72.370  123.678 1.00 0.00 ? 53  ILE B HD13 1  
ATOM 3292   N N    . LEU B 1 50  ? 100.474 67.950  124.733 1.00 0.00 ? 54  LEU B N    1  
ATOM 3293   C CA   . LEU B 1 50  ? 99.820  67.028  123.812 1.00 0.00 ? 54  LEU B CA   1  
ATOM 3294   C C    . LEU B 1 50  ? 98.660  66.289  124.468 1.00 0.00 ? 54  LEU B C    1  
ATOM 3295   O O    . LEU B 1 50  ? 98.282  65.212  123.994 1.00 0.00 ? 54  LEU B O    1  
ATOM 3296   C CB   . LEU B 1 50  ? 100.823 65.994  123.281 1.00 0.00 ? 54  LEU B CB   1  
ATOM 3297   C CG   . LEU B 1 50  ? 101.191 65.836  121.797 1.00 0.00 ? 54  LEU B CG   1  
ATOM 3298   C CD1  . LEU B 1 50  ? 100.665 64.532  121.220 1.00 0.00 ? 54  LEU B CD1  1  
ATOM 3299   C CD2  . LEU B 1 50  ? 100.681 67.015  120.976 1.00 0.00 ? 54  LEU B CD2  1  
ATOM 3300   H H    . LEU B 1 50  ? 100.977 67.569  125.318 1.00 0.00 ? 54  LEU B H    1  
ATOM 3301   H HA   . LEU B 1 50  ? 99.474  67.564  123.082 1.00 0.00 ? 54  LEU B HA   1  
ATOM 3302   H HB2  . LEU B 1 50  ? 101.656 66.158  123.751 1.00 0.00 ? 54  LEU B HB2  1  
ATOM 3303   H HB3  . LEU B 1 50  ? 100.499 65.127  123.573 1.00 0.00 ? 54  LEU B HB3  1  
ATOM 3304   H HG   . LEU B 1 50  ? 102.160 65.818  121.749 1.00 0.00 ? 54  LEU B HG   1  
ATOM 3305   H HD11 . LEU B 1 50  ? 101.392 64.046  120.802 1.00 0.00 ? 54  LEU B HD11 1  
ATOM 3306   H HD12 . LEU B 1 50  ? 100.282 63.994  121.930 1.00 0.00 ? 54  LEU B HD12 1  
ATOM 3307   H HD13 . LEU B 1 50  ? 99.983  64.724  120.557 1.00 0.00 ? 54  LEU B HD13 1  
ATOM 3308   H HD21 . LEU B 1 50  ? 101.252 67.140  120.201 1.00 0.00 ? 54  LEU B HD21 1  
ATOM 3309   H HD22 . LEU B 1 50  ? 99.774  66.837  120.683 1.00 0.00 ? 54  LEU B HD22 1  
ATOM 3310   H HD23 . LEU B 1 50  ? 100.694 67.818  121.519 1.00 0.00 ? 54  LEU B HD23 1  
ATOM 3311   N N    . GLY B 1 51  ? 98.095  66.849  125.539 1.00 0.00 ? 55  GLY B N    1  
ATOM 3312   C CA   . GLY B 1 51  ? 97.135  66.166  126.371 1.00 0.00 ? 55  GLY B CA   1  
ATOM 3313   C C    . GLY B 1 51  ? 95.695  66.439  125.998 1.00 0.00 ? 55  GLY B C    1  
ATOM 3314   O O    . GLY B 1 51  ? 95.377  67.416  125.317 1.00 0.00 ? 55  GLY B O    1  
ATOM 3315   H H    . GLY B 1 51  ? 98.269  67.651  125.798 1.00 0.00 ? 55  GLY B H    1  
ATOM 3316   H HA2  . GLY B 1 51  ? 97.298  65.211  126.319 1.00 0.00 ? 55  GLY B HA2  1  
ATOM 3317   H HA3  . GLY B 1 51  ? 97.276  66.428  127.294 1.00 0.00 ? 55  GLY B HA3  1  
ATOM 3318   N N    . PRO B 1 52  ? 94.789  65.569  126.448 1.00 0.00 ? 56  PRO B N    1  
ATOM 3319   C CA   . PRO B 1 52  ? 93.384  65.700  126.051 1.00 0.00 ? 56  PRO B CA   1  
ATOM 3320   C C    . PRO B 1 52  ? 92.662  66.853  126.720 1.00 0.00 ? 56  PRO B C    1  
ATOM 3321   O O    . PRO B 1 52  ? 93.045  67.309  127.802 1.00 0.00 ? 56  PRO B O    1  
ATOM 3322   C CB   . PRO B 1 52  ? 92.797  64.327  126.400 1.00 0.00 ? 56  PRO B CB   1  
ATOM 3323   C CG   . PRO B 1 52  ? 93.636  63.848  127.517 1.00 0.00 ? 56  PRO B CG   1  
ATOM 3324   C CD   . PRO B 1 52  ? 95.024  64.353  127.243 1.00 0.00 ? 56  PRO B CD   1  
ATOM 3325   H HA   . PRO B 1 52  ? 93.299  65.896  125.105 1.00 0.00 ? 56  PRO B HA   1  
ATOM 3326   H HB2  . PRO B 1 52  ? 91.866  64.395  126.660 1.00 0.00 ? 56  PRO B HB2  1  
ATOM 3327   H HB3  . PRO B 1 52  ? 92.836  63.723  125.642 1.00 0.00 ? 56  PRO B HB3  1  
ATOM 3328   H HG2  . PRO B 1 52  ? 93.307  64.181  128.365 1.00 0.00 ? 56  PRO B HG2  1  
ATOM 3329   H HG3  . PRO B 1 52  ? 93.624  62.879  127.569 1.00 0.00 ? 56  PRO B HG3  1  
ATOM 3330   H HD2  . PRO B 1 52  ? 95.502  64.549  128.064 1.00 0.00 ? 56  PRO B HD2  1  
ATOM 3331   H HD3  . PRO B 1 52  ? 95.554  63.703  126.755 1.00 0.00 ? 56  PRO B HD3  1  
ATOM 3332   N N    . GLY B 1 53  ? 91.604  67.324  126.069 1.00 0.00 ? 57  GLY B N    1  
ATOM 3333   C CA   . GLY B 1 53  ? 90.815  68.429  126.576 1.00 0.00 ? 57  GLY B CA   1  
ATOM 3334   C C    . GLY B 1 53  ? 89.429  68.376  125.979 1.00 0.00 ? 57  GLY B C    1  
ATOM 3335   O O    . GLY B 1 53  ? 89.081  67.451  125.241 1.00 0.00 ? 57  GLY B O    1  
ATOM 3336   H H    . GLY B 1 53  ? 91.326  67.008  125.319 1.00 0.00 ? 57  GLY B H    1  
ATOM 3337   H HA2  . GLY B 1 53  ? 90.762  68.385  127.544 1.00 0.00 ? 57  GLY B HA2  1  
ATOM 3338   H HA3  . GLY B 1 53  ? 91.241  69.272  126.353 1.00 0.00 ? 57  GLY B HA3  1  
ATOM 3339   N N    . SER B 1 54  ? 88.632  69.383  126.319 1.00 0.00 ? 58  SER B N    1  
ATOM 3340   C CA   . SER B 1 54  ? 87.272  69.461  125.808 1.00 0.00 ? 58  SER B CA   1  
ATOM 3341   C C    . SER B 1 54  ? 87.272  69.939  124.359 1.00 0.00 ? 58  SER B C    1  
ATOM 3342   O O    . SER B 1 54  ? 88.304  70.329  123.808 1.00 0.00 ? 58  SER B O    1  
ATOM 3343   C CB   . SER B 1 54  ? 86.432  70.398  126.673 1.00 0.00 ? 58  SER B CB   1  
ATOM 3344   O OG   . SER B 1 54  ? 85.123  69.893  126.851 1.00 0.00 ? 58  SER B OG   1  
ATOM 3345   H H    . SER B 1 54  ? 88.859  70.028  126.841 1.00 0.00 ? 58  SER B H    1  
ATOM 3346   H HA   . SER B 1 54  ? 86.881  68.574  125.841 1.00 0.00 ? 58  SER B HA   1  
ATOM 3347   H HB2  . SER B 1 54  ? 86.858  70.513  127.537 1.00 0.00 ? 58  SER B HB2  1  
ATOM 3348   H HB3  . SER B 1 54  ? 86.390  71.274  126.259 1.00 0.00 ? 58  SER B HB3  1  
ATOM 3349   H HG   . SER B 1 54  ? 84.564  70.457  126.575 1.00 0.00 ? 58  SER B HG   1  
ATOM 3350   N N    . VAL B 1 55  ? 86.098  69.896  123.740 1.00 0.00 ? 59  VAL B N    1  
ATOM 3351   C CA   . VAL B 1 55  ? 85.929  70.264  122.341 1.00 0.00 ? 59  VAL B CA   1  
ATOM 3352   C C    . VAL B 1 55  ? 84.877  71.367  122.240 1.00 0.00 ? 59  VAL B C    1  
ATOM 3353   O O    . VAL B 1 55  ? 83.790  71.271  122.823 1.00 0.00 ? 59  VAL B O    1  
ATOM 3354   C CB   . VAL B 1 55  ? 85.602  69.038  121.464 1.00 0.00 ? 59  VAL B CB   1  
ATOM 3355   C CG1  . VAL B 1 55  ? 84.844  69.412  120.182 1.00 0.00 ? 59  VAL B CG1  1  
ATOM 3356   C CG2  . VAL B 1 55  ? 86.873  68.271  121.123 1.00 0.00 ? 59  VAL B CG2  1  
ATOM 3357   H H    . VAL B 1 55  ? 85.369  69.649  124.126 1.00 0.00 ? 59  VAL B H    1  
ATOM 3358   H HA   . VAL B 1 55  ? 86.766  70.612  121.993 1.00 0.00 ? 59  VAL B HA   1  
ATOM 3359   H HB   . VAL B 1 55  ? 85.014  68.470  121.986 1.00 0.00 ? 59  VAL B HB   1  
ATOM 3360   H HG11 . VAL B 1 55  ? 84.979  70.353  119.989 1.00 0.00 ? 59  VAL B HG11 1  
ATOM 3361   H HG12 . VAL B 1 55  ? 85.176  68.879  119.443 1.00 0.00 ? 59  VAL B HG12 1  
ATOM 3362   H HG13 . VAL B 1 55  ? 83.897  69.239  120.305 1.00 0.00 ? 59  VAL B HG13 1  
ATOM 3363   H HG21 . VAL B 1 55  ? 87.213  68.573  120.267 1.00 0.00 ? 59  VAL B HG21 1  
ATOM 3364   H HG22 . VAL B 1 55  ? 87.540  68.428  121.809 1.00 0.00 ? 59  VAL B HG22 1  
ATOM 3365   H HG23 . VAL B 1 55  ? 86.675  67.322  121.075 1.00 0.00 ? 59  VAL B HG23 1  
ATOM 3366   N N    . ALA B 1 56  ? 85.231  72.444  121.548 1.00 0.00 ? 60  ALA B N    1  
ATOM 3367   C CA   . ALA B 1 56  ? 84.314  73.537  121.258 1.00 0.00 ? 60  ALA B CA   1  
ATOM 3368   C C    . ALA B 1 56  ? 83.904  73.424  119.801 1.00 0.00 ? 60  ALA B C    1  
ATOM 3369   O O    . ALA B 1 56  ? 84.740  73.568  118.904 1.00 0.00 ? 60  ALA B O    1  
ATOM 3370   C CB   . ALA B 1 56  ? 84.953  74.896  121.541 1.00 0.00 ? 60  ALA B CB   1  
ATOM 3371   H H    . ALA B 1 56  ? 86.022  72.562  121.230 1.00 0.00 ? 60  ALA B H    1  
ATOM 3372   H HA   . ALA B 1 56  ? 83.536  73.473  121.834 1.00 0.00 ? 60  ALA B HA   1  
ATOM 3373   H HB1  . ALA B 1 56  ? 84.605  75.250  122.374 1.00 0.00 ? 60  ALA B HB1  1  
ATOM 3374   H HB2  . ALA B 1 56  ? 85.915  74.793  121.610 1.00 0.00 ? 60  ALA B HB2  1  
ATOM 3375   H HB3  . ALA B 1 56  ? 84.744  75.508  120.818 1.00 0.00 ? 60  ALA B HB3  1  
ATOM 3376   N N    . ASP B 1 57  ? 82.625  73.162  119.567 1.00 0.00 ? 61  ASP B N    1  
ATOM 3377   C CA   . ASP B 1 57  ? 82.124  72.853  118.238 1.00 0.00 ? 61  ASP B CA   1  
ATOM 3378   C C    . ASP B 1 57  ? 81.075  73.886  117.864 1.00 0.00 ? 61  ASP B C    1  
ATOM 3379   O O    . ASP B 1 57  ? 80.030  73.997  118.523 1.00 0.00 ? 61  ASP B O    1  
ATOM 3380   C CB   . ASP B 1 57  ? 81.563  71.430  118.196 1.00 0.00 ? 61  ASP B CB   1  
ATOM 3381   C CG   . ASP B 1 57  ? 82.241  70.547  117.158 1.00 0.00 ? 61  ASP B CG   1  
ATOM 3382   O OD1  . ASP B 1 57  ? 83.108  69.719  117.500 1.00 0.00 ? 61  ASP B OD1  1  
ATOM 3383   O OD2  . ASP B 1 57  ? 81.873  70.663  115.973 1.00 0.00 ? 61  ASP B OD2  1  
ATOM 3384   H H    . ASP B 1 57  ? 82.021  73.160  120.178 1.00 0.00 ? 61  ASP B H    1  
ATOM 3385   H HA   . ASP B 1 57  ? 82.845  72.891  117.590 1.00 0.00 ? 61  ASP B HA   1  
ATOM 3386   H HB2  . ASP B 1 57  ? 81.661  71.024  119.071 1.00 0.00 ? 61  ASP B HB2  1  
ATOM 3387   H HB3  . ASP B 1 57  ? 80.612  71.470  118.006 1.00 0.00 ? 61  ASP B HB3  1  
ATOM 3388   N N    . SER B 1 58  ? 81.365  74.637  116.807 1.00 0.00 ? 62  SER B N    1  
ATOM 3389   C CA   . SER B 1 58  ? 80.515  75.704  116.314 1.00 0.00 ? 62  SER B CA   1  
ATOM 3390   C C    . SER B 1 58  ? 80.551  75.740  114.795 1.00 0.00 ? 62  SER B C    1  
ATOM 3391   O O    . SER B 1 58  ? 81.571  75.445  114.166 1.00 0.00 ? 62  SER B O    1  
ATOM 3392   C CB   . SER B 1 58  ? 80.963  77.056  116.876 1.00 0.00 ? 62  SER B CB   1  
ATOM 3393   O OG   . SER B 1 58  ? 82.176  77.473  116.280 1.00 0.00 ? 62  SER B OG   1  
ATOM 3394   H H    . SER B 1 58  ? 82.083  74.533  116.346 1.00 0.00 ? 62  SER B H    1  
ATOM 3395   H HA   . SER B 1 58  ? 79.607  75.532  116.609 1.00 0.00 ? 62  SER B HA   1  
ATOM 3396   H HB2  . SER B 1 58  ? 80.274  77.720  116.716 1.00 0.00 ? 62  SER B HB2  1  
ATOM 3397   H HB3  . SER B 1 58  ? 81.076  76.990  117.837 1.00 0.00 ? 62  SER B HB3  1  
ATOM 3398   H HG   . SER B 1 58  ? 82.204  77.206  115.484 1.00 0.00 ? 62  SER B HG   1  
ATOM 3399   N N    . GLY B 1 59  ? 79.419  76.110  114.212 1.00 0.00 ? 63  GLY B N    1  
ATOM 3400   C CA   . GLY B 1 59  ? 79.332  76.266  112.779 1.00 0.00 ? 63  GLY B CA   1  
ATOM 3401   C C    . GLY B 1 59  ? 78.526  77.482  112.386 1.00 0.00 ? 63  GLY B C    1  
ATOM 3402   O O    . GLY B 1 59  ? 77.690  77.957  113.158 1.00 0.00 ? 63  GLY B O    1  
ATOM 3403   H H    . GLY B 1 59  ? 78.689  76.274  114.636 1.00 0.00 ? 63  GLY B H    1  
ATOM 3404   H HA2  . GLY B 1 59  ? 80.225  76.339  112.408 1.00 0.00 ? 63  GLY B HA2  1  
ATOM 3405   H HA3  . GLY B 1 59  ? 78.928  75.473  112.393 1.00 0.00 ? 63  GLY B HA3  1  
ATOM 3406   N N    . GLU B 1 60  ? 78.770  77.999  111.191 1.00 0.00 ? 64  GLU B N    1  
ATOM 3407   C CA   . GLU B 1 60  ? 77.988  79.103  110.644 1.00 0.00 ? 64  GLU B CA   1  
ATOM 3408   C C    . GLU B 1 60  ? 77.390  78.630  109.329 1.00 0.00 ? 64  GLU B C    1  
ATOM 3409   O O    . GLU B 1 60  ? 77.961  77.777  108.646 1.00 0.00 ? 64  GLU B O    1  
ATOM 3410   C CB   . GLU B 1 60  ? 78.848  80.347  110.457 1.00 0.00 ? 64  GLU B CB   1  
ATOM 3411   C CG   . GLU B 1 60  ? 79.947  80.183  109.426 1.00 0.00 ? 64  GLU B CG   1  
ATOM 3412   C CD   . GLU B 1 60  ? 79.606  80.847  108.103 1.00 0.00 ? 64  GLU B CD   1  
ATOM 3413   O OE1  . GLU B 1 60  ? 79.499  82.090  108.067 1.00 0.00 ? 64  GLU B OE1  1  
ATOM 3414   O OE2  . GLU B 1 60  ? 79.448  80.126  107.096 1.00 0.00 ? 64  GLU B OE2  1  
ATOM 3415   H H    . GLU B 1 60  ? 79.395  77.721  110.671 1.00 0.00 ? 64  GLU B H    1  
ATOM 3416   H HA   . GLU B 1 60  ? 77.280  79.354  111.257 1.00 0.00 ? 64  GLU B HA   1  
ATOM 3417   H HB2  . GLU B 1 60  ? 78.279  81.087  110.195 1.00 0.00 ? 64  GLU B HB2  1  
ATOM 3418   H HB3  . GLU B 1 60  ? 79.248  80.584  111.308 1.00 0.00 ? 64  GLU B HB3  1  
ATOM 3419   H HG2  . GLU B 1 60  ? 80.770  80.563  109.772 1.00 0.00 ? 64  GLU B HG2  1  
ATOM 3420   H HG3  . GLU B 1 60  ? 80.111  79.239  109.279 1.00 0.00 ? 64  GLU B HG3  1  
ATOM 3421   N N    . VAL B 1 61  ? 76.239  79.186  108.973 1.00 0.00 ? 65  VAL B N    1  
ATOM 3422   C CA   . VAL B 1 61  ? 75.528  78.796  107.762 1.00 0.00 ? 65  VAL B CA   1  
ATOM 3423   C C    . VAL B 1 61  ? 75.113  80.056  107.024 1.00 0.00 ? 65  VAL B C    1  
ATOM 3424   O O    . VAL B 1 61  ? 74.434  80.917  107.592 1.00 0.00 ? 65  VAL B O    1  
ATOM 3425   C CB   . VAL B 1 61  ? 74.307  77.924  108.093 1.00 0.00 ? 65  VAL B CB   1  
ATOM 3426   C CG1  . VAL B 1 61  ? 73.627  77.454  106.822 1.00 0.00 ? 65  VAL B CG1  1  
ATOM 3427   C CG2  . VAL B 1 61  ? 74.721  76.754  108.955 1.00 0.00 ? 65  VAL B CG2  1  
ATOM 3428   H H    . VAL B 1 61  ? 75.846  79.801  109.428 1.00 0.00 ? 65  VAL B H    1  
ATOM 3429   H HA   . VAL B 1 61  ? 76.112  78.264  107.200 1.00 0.00 ? 65  VAL B HA   1  
ATOM 3430   H HB   . VAL B 1 61  ? 73.668  78.457  108.591 1.00 0.00 ? 65  VAL B HB   1  
ATOM 3431   H HG11 . VAL B 1 61  ? 74.242  76.904  106.311 1.00 0.00 ? 65  VAL B HG11 1  
ATOM 3432   H HG12 . VAL B 1 61  ? 72.840  76.935  107.048 1.00 0.00 ? 65  VAL B HG12 1  
ATOM 3433   H HG13 . VAL B 1 61  ? 73.365  78.223  106.292 1.00 0.00 ? 65  VAL B HG13 1  
ATOM 3434   H HG21 . VAL B 1 61  ? 75.673  76.804  109.133 1.00 0.00 ? 65  VAL B HG21 1  
ATOM 3435   H HG22 . VAL B 1 61  ? 74.233  76.781  109.793 1.00 0.00 ? 65  VAL B HG22 1  
ATOM 3436   H HG23 . VAL B 1 61  ? 74.523  75.925  108.492 1.00 0.00 ? 65  VAL B HG23 1  
ATOM 3437   N N    . THR B 1 62  ? 75.523  80.180  105.768 1.00 0.00 ? 66  THR B N    1  
ATOM 3438   C CA   . THR B 1 62  ? 75.082  81.296  104.950 1.00 0.00 ? 66  THR B CA   1  
ATOM 3439   C C    . THR B 1 62  ? 74.193  80.790  103.825 1.00 0.00 ? 66  THR B C    1  
ATOM 3440   O O    . THR B 1 62  ? 74.448  79.728  103.251 1.00 0.00 ? 66  THR B O    1  
ATOM 3441   C CB   . THR B 1 62  ? 76.271  82.055  104.377 1.00 0.00 ? 66  THR B CB   1  
ATOM 3442   O OG1  . THR B 1 62  ? 77.071  81.154  103.608 1.00 0.00 ? 66  THR B OG1  1  
ATOM 3443   C CG2  . THR B 1 62  ? 77.123  82.631  105.491 1.00 0.00 ? 66  THR B CG2  1  
ATOM 3444   H H    . THR B 1 62  ? 76.053  79.630  105.374 1.00 0.00 ? 66  THR B H    1  
ATOM 3445   H HA   . THR B 1 62  ? 74.577  81.906  105.509 1.00 0.00 ? 66  THR B HA   1  
ATOM 3446   H HB   . THR B 1 62  ? 75.942  82.779  103.823 1.00 0.00 ? 66  THR B HB   1  
ATOM 3447   H HG1  . THR B 1 62  ? 77.869  81.199  103.865 1.00 0.00 ? 66  THR B HG1  1  
ATOM 3448   H HG21 . THR B 1 62  ? 76.275  83.083  105.358 1.00 0.00 ? 66  THR B HG21 1  
ATOM 3449   H HG22 . THR B 1 62  ? 76.589  83.240  106.024 1.00 0.00 ? 66  THR B HG22 1  
ATOM 3450   H HG23 . THR B 1 62  ? 77.451  81.911  106.053 1.00 0.00 ? 66  THR B HG23 1  
ATOM 3451   N N    . TYR B 1 63  ? 73.138  81.547  103.528 1.00 0.00 ? 67  TYR B N    1  
ATOM 3452   C CA   . TYR B 1 63  ? 72.254  81.223  102.409 1.00 0.00 ? 67  TYR B CA   1  
ATOM 3453   C C    . TYR B 1 63  ? 71.493  82.480  101.998 1.00 0.00 ? 67  TYR B C    1  
ATOM 3454   O O    . TYR B 1 63  ? 71.527  83.500  102.691 1.00 0.00 ? 67  TYR B O    1  
ATOM 3455   C CB   . TYR B 1 63  ? 71.303  80.070  102.756 1.00 0.00 ? 67  TYR B CB   1  
ATOM 3456   C CG   . TYR B 1 63  ? 70.415  80.271  103.964 1.00 0.00 ? 67  TYR B CG   1  
ATOM 3457   C CD1  . TYR B 1 63  ? 70.889  80.031  105.242 1.00 0.00 ? 67  TYR B CD1  1  
ATOM 3458   C CD2  . TYR B 1 63  ? 69.091  80.660  103.820 1.00 0.00 ? 67  TYR B CD2  1  
ATOM 3459   C CE1  . TYR B 1 63  ? 70.075  80.194  106.339 1.00 0.00 ? 67  TYR B CE1  1  
ATOM 3460   C CE2  . TYR B 1 63  ? 68.272  80.826  104.909 1.00 0.00 ? 67  TYR B CE2  1  
ATOM 3461   C CZ   . TYR B 1 63  ? 68.767  80.590  106.164 1.00 0.00 ? 67  TYR B CZ   1  
ATOM 3462   O OH   . TYR B 1 63  ? 67.946  80.760  107.252 1.00 0.00 ? 67  TYR B OH   1  
ATOM 3463   H H    . TYR B 1 63  ? 72.917  82.254  103.963 1.00 0.00 ? 67  TYR B H    1  
ATOM 3464   H HA   . TYR B 1 63  ? 72.788  80.918  101.658 1.00 0.00 ? 67  TYR B HA   1  
ATOM 3465   H HB2  . TYR B 1 63  ? 70.736  79.901  101.987 1.00 0.00 ? 67  TYR B HB2  1  
ATOM 3466   H HB3  . TYR B 1 63  ? 71.834  79.271  102.899 1.00 0.00 ? 67  TYR B HB3  1  
ATOM 3467   H HD1  . TYR B 1 63  ? 71.769  79.756  105.360 1.00 0.00 ? 67  TYR B HD1  1  
ATOM 3468   H HD2  . TYR B 1 63  ? 68.751  80.812  102.968 1.00 0.00 ? 67  TYR B HD2  1  
ATOM 3469   H HE1  . TYR B 1 63  ? 70.405  80.037  107.194 1.00 0.00 ? 67  TYR B HE1  1  
ATOM 3470   H HE2  . TYR B 1 63  ? 67.389  81.096  104.796 1.00 0.00 ? 67  TYR B HE2  1  
ATOM 3471   H HH   . TYR B 1 63  ? 68.104  80.161  107.820 1.00 0.00 ? 67  TYR B HH   1  
ATOM 3472   N N    . TYR B 1 64  ? 70.814  82.406  100.853 1.00 0.00 ? 68  TYR B N    1  
ATOM 3473   C CA   . TYR B 1 64  ? 69.952  83.474  100.363 1.00 0.00 ? 68  TYR B CA   1  
ATOM 3474   C C    . TYR B 1 64  ? 68.509  83.135  100.700 1.00 0.00 ? 68  TYR B C    1  
ATOM 3475   O O    . TYR B 1 64  ? 67.985  82.118  100.237 1.00 0.00 ? 68  TYR B O    1  
ATOM 3476   C CB   . TYR B 1 64  ? 70.080  83.675  98.851  1.00 0.00 ? 68  TYR B CB   1  
ATOM 3477   C CG   . TYR B 1 64  ? 71.490  83.759  98.320  1.00 0.00 ? 68  TYR B CG   1  
ATOM 3478   C CD1  . TYR B 1 64  ? 72.155  82.636  97.851  1.00 0.00 ? 68  TYR B CD1  1  
ATOM 3479   C CD2  . TYR B 1 64  ? 72.170  84.963  98.325  1.00 0.00 ? 68  TYR B CD2  1  
ATOM 3480   C CE1  . TYR B 1 64  ? 73.446  82.721  97.372  1.00 0.00 ? 68  TYR B CE1  1  
ATOM 3481   C CE2  . TYR B 1 64  ? 73.464  85.053  97.863  1.00 0.00 ? 68  TYR B CE2  1  
ATOM 3482   C CZ   . TYR B 1 64  ? 74.092  83.930  97.380  1.00 0.00 ? 68  TYR B CZ   1  
ATOM 3483   O OH   . TYR B 1 64  ? 75.380  84.017  96.912  1.00 0.00 ? 68  TYR B OH   1  
ATOM 3484   H H    . TYR B 1 64  ? 70.844  81.722  100.333 1.00 0.00 ? 68  TYR B H    1  
ATOM 3485   H HA   . TYR B 1 64  ? 70.225  84.300  100.793 1.00 0.00 ? 68  TYR B HA   1  
ATOM 3486   H HB2  . TYR B 1 64  ? 69.627  82.942  98.404  1.00 0.00 ? 68  TYR B HB2  1  
ATOM 3487   H HB3  . TYR B 1 64  ? 69.611  84.488  98.608  1.00 0.00 ? 68  TYR B HB3  1  
ATOM 3488   H HD1  . TYR B 1 64  ? 71.723  81.812  97.859  1.00 0.00 ? 68  TYR B HD1  1  
ATOM 3489   H HD2  . TYR B 1 64  ? 71.746  85.726  98.647  1.00 0.00 ? 68  TYR B HD2  1  
ATOM 3490   H HE1  . TYR B 1 64  ? 73.874  81.963  97.045  1.00 0.00 ? 68  TYR B HE1  1  
ATOM 3491   H HE2  . TYR B 1 64  ? 73.910  85.870  97.876  1.00 0.00 ? 68  TYR B HE2  1  
ATOM 3492   H HH   . TYR B 1 64  ? 75.917  83.838  97.533  1.00 0.00 ? 68  TYR B HH   1  
ATOM 3493   N N    . GLY B 1 65  ? 67.863  83.996  101.480 1.00 0.00 ? 69  GLY B N    1  
ATOM 3494   C CA   . GLY B 1 65  ? 66.513  83.729  101.938 1.00 0.00 ? 69  GLY B CA   1  
ATOM 3495   C C    . GLY B 1 65  ? 65.449  83.803  100.865 1.00 0.00 ? 69  GLY B C    1  
ATOM 3496   O O    . GLY B 1 65  ? 65.390  84.773  100.105 1.00 0.00 ? 69  GLY B O    1  
ATOM 3497   H H    . GLY B 1 65  ? 68.193  84.742  101.753 1.00 0.00 ? 69  GLY B H    1  
ATOM 3498   H HA2  . GLY B 1 65  ? 66.491  82.844  102.337 1.00 0.00 ? 69  GLY B HA2  1  
ATOM 3499   H HA3  . GLY B 1 65  ? 66.293  84.362  102.639 1.00 0.00 ? 69  GLY B HA3  1  
ATOM 3500   N N    . LYS B 1 66  ? 64.601  82.782  100.793 1.00 0.00 ? 70  LYS B N    1  
ATOM 3501   C CA   . LYS B 1 66  ? 63.469  82.796  99.883  1.00 0.00 ? 70  LYS B CA   1  
ATOM 3502   C C    . LYS B 1 66  ? 62.239  83.337  100.614 1.00 0.00 ? 70  LYS B C    1  
ATOM 3503   O O    . LYS B 1 66  ? 62.131  83.251  101.839 1.00 0.00 ? 70  LYS B O    1  
ATOM 3504   C CB   . LYS B 1 66  ? 63.228  81.387  99.327  1.00 0.00 ? 70  LYS B CB   1  
ATOM 3505   C CG   . LYS B 1 66  ? 64.471  80.635  98.856  1.00 0.00 ? 70  LYS B CG   1  
ATOM 3506   C CD   . LYS B 1 66  ? 64.228  79.887  97.555  1.00 0.00 ? 70  LYS B CD   1  
ATOM 3507   C CE   . LYS B 1 66  ? 65.532  79.412  96.935  1.00 0.00 ? 70  LYS B CE   1  
ATOM 3508   N NZ   . LYS B 1 66  ? 65.908  80.225  95.747  1.00 0.00 ? 70  LYS B NZ   1  
ATOM 3509   H H    . LYS B 1 66  ? 64.667  82.068  101.268 1.00 0.00 ? 70  LYS B H    1  
ATOM 3510   H HA   . LYS B 1 66  ? 63.654  83.379  99.130  1.00 0.00 ? 70  LYS B HA   1  
ATOM 3511   H HB2  . LYS B 1 66  ? 62.791  80.858  100.012 1.00 0.00 ? 70  LYS B HB2  1  
ATOM 3512   H HB3  . LYS B 1 66  ? 62.610  81.453  98.582  1.00 0.00 ? 70  LYS B HB3  1  
ATOM 3513   H HG2  . LYS B 1 66  ? 65.201  81.262  98.736  1.00 0.00 ? 70  LYS B HG2  1  
ATOM 3514   H HG3  . LYS B 1 66  ? 64.746  80.006  99.542  1.00 0.00 ? 70  LYS B HG3  1  
ATOM 3515   H HD2  . LYS B 1 66  ? 63.651  79.126  97.721  1.00 0.00 ? 70  LYS B HD2  1  
ATOM 3516   H HD3  . LYS B 1 66  ? 63.763  80.465  96.930  1.00 0.00 ? 70  LYS B HD3  1  
ATOM 3517   H HE2  . LYS B 1 66  ? 66.241  79.459  97.596  1.00 0.00 ? 70  LYS B HE2  1  
ATOM 3518   H HE3  . LYS B 1 66  ? 65.447  78.481  96.676  1.00 0.00 ? 70  LYS B HE3  1  
ATOM 3519   H HZ1  . LYS B 1 66  ? 66.359  80.946  96.011  1.00 0.00 ? 70  LYS B HZ1  1  
ATOM 3520   H HZ2  . LYS B 1 66  ? 66.419  79.739  95.204  1.00 0.00 ? 70  LYS B HZ2  1  
ATOM 3521   H HZ3  . LYS B 1 66  ? 65.173  80.478  95.315  1.00 0.00 ? 70  LYS B HZ3  1  
ATOM 3522   N N    . ARG B 1 67  ? 61.310  83.915  99.846  1.00 0.00 ? 71  ARG B N    1  
ATOM 3523   C CA   . ARG B 1 67  ? 60.162  84.611  100.419 1.00 0.00 ? 71  ARG B CA   1  
ATOM 3524   C C    . ARG B 1 67  ? 59.478  83.834  101.540 1.00 0.00 ? 71  ARG B C    1  
ATOM 3525   O O    . ARG B 1 67  ? 59.252  84.402  102.613 1.00 0.00 ? 71  ARG B O    1  
ATOM 3526   C CB   . ARG B 1 67  ? 59.149  84.926  99.320  1.00 0.00 ? 71  ARG B CB   1  
ATOM 3527   C CG   . ARG B 1 67  ? 58.893  83.768  98.372  1.00 0.00 ? 71  ARG B CG   1  
ATOM 3528   C CD   . ARG B 1 67  ? 59.193  84.153  96.937  1.00 0.00 ? 71  ARG B CD   1  
ATOM 3529   N NE   . ARG B 1 67  ? 60.370  83.456  96.426  1.00 0.00 ? 71  ARG B NE   1  
ATOM 3530   C CZ   . ARG B 1 67  ? 60.368  82.680  95.348  1.00 0.00 ? 71  ARG B CZ   1  
ATOM 3531   N NH1  . ARG B 1 67  ? 61.488  82.088  94.956  1.00 0.00 ? 71  ARG B NH1  1  
ATOM 3532   N NH2  . ARG B 1 67  ? 59.250  82.492  94.663  1.00 0.00 ? 71  ARG B NH2  1  
ATOM 3533   H H    . ARG B 1 67  ? 61.330  83.913  98.986  1.00 0.00 ? 71  ARG B H    1  
ATOM 3534   H HA   . ARG B 1 67  ? 60.502  85.429  100.815 1.00 0.00 ? 71  ARG B HA   1  
ATOM 3535   H HB2  . ARG B 1 67  ? 58.310  85.188  99.730  1.00 0.00 ? 71  ARG B HB2  1  
ATOM 3536   H HB3  . ARG B 1 67  ? 59.465  85.687  98.809  1.00 0.00 ? 71  ARG B HB3  1  
ATOM 3537   H HG2  . ARG B 1 67  ? 59.443  83.011  98.627  1.00 0.00 ? 71  ARG B HG2  1  
ATOM 3538   H HG3  . ARG B 1 67  ? 57.968  83.485  98.446  1.00 0.00 ? 71  ARG B HG3  1  
ATOM 3539   H HD2  . ARG B 1 67  ? 58.427  83.948  96.380  1.00 0.00 ? 71  ARG B HD2  1  
ATOM 3540   H HD3  . ARG B 1 67  ? 59.335  85.112  96.882  1.00 0.00 ? 71  ARG B HD3  1  
ATOM 3541   H HE   . ARG B 1 67  ? 61.111  83.555  96.850  1.00 0.00 ? 71  ARG B HE   1  
ATOM 3542   H HH11 . ARG B 1 67  ? 62.215  82.207  95.399  1.00 0.00 ? 71  ARG B HH11 1  
ATOM 3543   H HH12 . ARG B 1 67  ? 61.486  81.585  94.259  1.00 0.00 ? 71  ARG B HH12 1  
ATOM 3544   H HH21 . ARG B 1 67  ? 58.521  82.874  94.915  1.00 0.00 ? 71  ARG B HH21 1  
ATOM 3545   H HH22 . ARG B 1 67  ? 59.252  81.988  93.966  1.00 0.00 ? 71  ARG B HH22 1  
ATOM 3546   N N    . GLY B 1 68  ? 59.142  82.569  101.327 1.00 0.00 ? 72  GLY B N    1  
ATOM 3547   C CA   . GLY B 1 68  ? 58.555  81.738  102.363 1.00 0.00 ? 72  GLY B CA   1  
ATOM 3548   C C    . GLY B 1 68  ? 58.753  80.273  102.033 1.00 0.00 ? 72  GLY B C    1  
ATOM 3549   O O    . GLY B 1 68  ? 58.016  79.691  101.234 1.00 0.00 ? 72  GLY B O    1  
ATOM 3550   H H    . GLY B 1 68  ? 59.250  82.168  100.575 1.00 0.00 ? 72  GLY B H    1  
ATOM 3551   H HA2  . GLY B 1 68  ? 58.962  81.941  103.220 1.00 0.00 ? 72  GLY B HA2  1  
ATOM 3552   H HA3  . GLY B 1 68  ? 57.608  81.933  102.446 1.00 0.00 ? 72  GLY B HA3  1  
ATOM 3553   N N    . ASP B 1 69  ? 59.774  79.684  102.670 1.00 0.00 ? 73  ASP B N    1  
ATOM 3554   C CA   . ASP B 1 69  ? 60.035  78.239  102.693 1.00 0.00 ? 73  ASP B CA   1  
ATOM 3555   C C    . ASP B 1 69  ? 60.424  77.772  104.102 1.00 0.00 ? 73  ASP B C    1  
ATOM 3556   O O    . ASP B 1 69  ? 60.930  78.526  104.929 1.00 0.00 ? 73  ASP B O    1  
ATOM 3557   C CB   . ASP B 1 69  ? 61.091  77.858  101.647 1.00 0.00 ? 73  ASP B CB   1  
ATOM 3558   C CG   . ASP B 1 69  ? 60.480  77.364  100.349 1.00 0.00 ? 73  ASP B CG   1  
ATOM 3559   O OD1  . ASP B 1 69  ? 59.402  76.735  100.384 1.00 0.00 ? 73  ASP B OD1  1  
ATOM 3560   O OD2  . ASP B 1 69  ? 61.075  77.621  99.283  1.00 0.00 ? 73  ASP B OD2  1  
ATOM 3561   H H    . ASP B 1 69  ? 60.355  80.133  103.119 1.00 0.00 ? 73  ASP B H    1  
ATOM 3562   H HA   . ASP B 1 69  ? 59.216  77.777  102.455 1.00 0.00 ? 73  ASP B HA   1  
ATOM 3563   H HB2  . ASP B 1 69  ? 61.652  78.628  101.463 1.00 0.00 ? 73  ASP B HB2  1  
ATOM 3564   H HB3  . ASP B 1 69  ? 61.667  77.168  102.011 1.00 0.00 ? 73  ASP B HB3  1  
ATOM 3565   N N    . ALA B 1 70  ? 60.183  76.484  104.342 1.00 0.00 ? 74  ALA B N    1  
ATOM 3566   C CA   . ALA B 1 70  ? 59.981  75.896  105.666 1.00 0.00 ? 74  ALA B CA   1  
ATOM 3567   C C    . ALA B 1 70  ? 61.214  75.715  106.554 1.00 0.00 ? 74  ALA B C    1  
ATOM 3568   O O    . ALA B 1 70  ? 61.094  75.830  107.776 1.00 0.00 ? 74  ALA B O    1  
ATOM 3569   C CB   . ALA B 1 70  ? 59.302  74.532  105.515 1.00 0.00 ? 74  ALA B CB   1  
ATOM 3570   H H    . ALA B 1 70  ? 60.131  75.903  103.709 1.00 0.00 ? 74  ALA B H    1  
ATOM 3571   H HA   . ALA B 1 70  ? 59.438  76.555  106.126 1.00 0.00 ? 74  ALA B HA   1  
ATOM 3572   H HB1  . ALA B 1 70  ? 59.967  73.862  105.289 1.00 0.00 ? 74  ALA B HB1  1  
ATOM 3573   H HB2  . ALA B 1 70  ? 58.872  74.290  106.350 1.00 0.00 ? 74  ALA B HB2  1  
ATOM 3574   H HB3  . ALA B 1 70  ? 58.637  74.578  104.811 1.00 0.00 ? 74  ALA B HB3  1  
ATOM 3575   N N    . GLY B 1 71  ? 62.370  75.357  105.984 1.00 0.00 ? 75  GLY B N    1  
ATOM 3576   C CA   . GLY B 1 71  ? 63.612  75.422  106.742 1.00 0.00 ? 75  GLY B CA   1  
ATOM 3577   C C    . GLY B 1 71  ? 63.952  76.831  107.196 1.00 0.00 ? 75  GLY B C    1  
ATOM 3578   O O    . GLY B 1 71  ? 64.392  77.042  108.333 1.00 0.00 ? 75  GLY B O    1  
ATOM 3579   H H    . GLY B 1 71  ? 62.451  75.078  105.175 1.00 0.00 ? 75  GLY B H    1  
ATOM 3580   H HA2  . GLY B 1 71  ? 63.543  74.845  107.519 1.00 0.00 ? 75  GLY B HA2  1  
ATOM 3581   H HA3  . GLY B 1 71  ? 64.337  75.079  106.197 1.00 0.00 ? 75  GLY B HA3  1  
ATOM 3582   N N    . GLN B 1 72  ? 63.725  77.820  106.326 1.00 0.00 ? 76  GLN B N    1  
ATOM 3583   C CA   . GLN B 1 72  ? 63.841  79.209  106.750 1.00 0.00 ? 76  GLN B CA   1  
ATOM 3584   C C    . GLN B 1 72  ? 62.837  79.554  107.840 1.00 0.00 ? 76  GLN B C    1  
ATOM 3585   O O    . GLN B 1 72  ? 63.224  80.146  108.852 1.00 0.00 ? 76  GLN B O    1  
ATOM 3586   C CB   . GLN B 1 72  ? 63.668  80.159  105.562 1.00 0.00 ? 76  GLN B CB   1  
ATOM 3587   C CG   . GLN B 1 72  ? 63.327  81.591  105.933 1.00 0.00 ? 76  GLN B CG   1  
ATOM 3588   C CD   . GLN B 1 72  ? 61.851  81.894  105.804 1.00 0.00 ? 76  GLN B CD   1  
ATOM 3589   O OE1  . GLN B 1 72  ? 61.070  81.641  106.720 1.00 0.00 ? 76  GLN B OE1  1  
ATOM 3590   N NE2  . GLN B 1 72  ? 61.458  82.434  104.656 1.00 0.00 ? 76  GLN B NE2  1  
ATOM 3591   H H    . GLN B 1 72  ? 63.507  77.707  105.502 1.00 0.00 ? 76  GLN B H    1  
ATOM 3592   H HA   . GLN B 1 72  ? 64.732  79.321  107.116 1.00 0.00 ? 76  GLN B HA   1  
ATOM 3593   H HB2  . GLN B 1 72  ? 64.489  80.160  105.044 1.00 0.00 ? 76  GLN B HB2  1  
ATOM 3594   H HB3  . GLN B 1 72  ? 62.969  79.813  104.986 1.00 0.00 ? 76  GLN B HB3  1  
ATOM 3595   H HG2  . GLN B 1 72  ? 63.609  81.760  106.845 1.00 0.00 ? 76  GLN B HG2  1  
ATOM 3596   H HG3  . GLN B 1 72  ? 63.829  82.196  105.364 1.00 0.00 ? 76  GLN B HG3  1  
ATOM 3597   H HE21 . GLN B 1 72  ? 62.034  82.596  104.038 1.00 0.00 ? 76  GLN B HE21 1  
ATOM 3598   H HE22 . GLN B 1 72  ? 60.628  82.620  104.530 1.00 0.00 ? 76  GLN B HE22 1  
ATOM 3599   N N    . LYS B 1 73  ? 61.563  79.187  107.673 1.00 0.00 ? 77  LYS B N    1  
ATOM 3600   C CA   . LYS B 1 73  ? 60.616  79.333  108.766 1.00 0.00 ? 77  LYS B CA   1  
ATOM 3601   C C    . LYS B 1 73  ? 60.988  78.464  109.954 1.00 0.00 ? 77  LYS B C    1  
ATOM 3602   O O    . LYS B 1 73  ? 60.646  78.813  111.083 1.00 0.00 ? 77  LYS B O    1  
ATOM 3603   C CB   . LYS B 1 73  ? 59.197  78.996  108.312 1.00 0.00 ? 77  LYS B CB   1  
ATOM 3604   C CG   . LYS B 1 73  ? 58.587  80.004  107.366 1.00 0.00 ? 77  LYS B CG   1  
ATOM 3605   C CD   . LYS B 1 73  ? 57.122  79.706  107.144 1.00 0.00 ? 77  LYS B CD   1  
ATOM 3606   C CE   . LYS B 1 73  ? 56.953  78.610  106.124 1.00 0.00 ? 77  LYS B CE   1  
ATOM 3607   N NZ   . LYS B 1 73  ? 57.132  77.283  106.766 1.00 0.00 ? 77  LYS B NZ   1  
ATOM 3608   H H    . LYS B 1 73  ? 61.238  78.858  106.948 1.00 0.00 ? 77  LYS B H    1  
ATOM 3609   H HA   . LYS B 1 73  ? 60.650  80.262  109.043 1.00 0.00 ? 77  LYS B HA   1  
ATOM 3610   H HB2  . LYS B 1 73  ? 59.205  78.127  107.880 1.00 0.00 ? 77  LYS B HB2  1  
ATOM 3611   H HB3  . LYS B 1 73  ? 58.629  78.919  109.095 1.00 0.00 ? 77  LYS B HB3  1  
ATOM 3612   H HG2  . LYS B 1 73  ? 58.689  80.897  107.727 1.00 0.00 ? 77  LYS B HG2  1  
ATOM 3613   H HG3  . LYS B 1 73  ? 59.058  79.985  106.518 1.00 0.00 ? 77  LYS B HG3  1  
ATOM 3614   H HD2  . LYS B 1 73  ? 56.709  79.442  107.982 1.00 0.00 ? 77  LYS B HD2  1  
ATOM 3615   H HD3  . LYS B 1 73  ? 56.665  80.507  106.844 1.00 0.00 ? 77  LYS B HD3  1  
ATOM 3616   H HE2  . LYS B 1 73  ? 56.072  78.665  105.722 1.00 0.00 ? 77  LYS B HE2  1  
ATOM 3617   H HE3  . LYS B 1 73  ? 57.599  78.721  105.409 1.00 0.00 ? 77  LYS B HE3  1  
ATOM 3618   H HZ1  . LYS B 1 73  ? 56.343  76.976  107.039 1.00 0.00 ? 77  LYS B HZ1  1  
ATOM 3619   H HZ2  . LYS B 1 73  ? 57.484  76.713  106.179 1.00 0.00 ? 77  LYS B HZ2  1  
ATOM 3620   H HZ3  . LYS B 1 73  ? 57.678  77.362  107.465 1.00 0.00 ? 77  LYS B HZ3  1  
ATOM 3621   N N    . ALA B 1 74  ? 61.667  77.341  109.727 1.00 0.00 ? 78  ALA B N    1  
ATOM 3622   C CA   . ALA B 1 74  ? 62.254  76.608  110.839 1.00 0.00 ? 78  ALA B CA   1  
ATOM 3623   C C    . ALA B 1 74  ? 63.352  77.421  111.505 1.00 0.00 ? 78  ALA B C    1  
ATOM 3624   O O    . ALA B 1 74  ? 63.401  77.497  112.741 1.00 0.00 ? 78  ALA B O    1  
ATOM 3625   C CB   . ALA B 1 74  ? 62.799  75.261  110.366 1.00 0.00 ? 78  ALA B CB   1  
ATOM 3626   H H    . ALA B 1 74  ? 61.795  76.993  108.952 1.00 0.00 ? 78  ALA B H    1  
ATOM 3627   H HA   . ALA B 1 74  ? 61.558  76.446  111.495 1.00 0.00 ? 78  ALA B HA   1  
ATOM 3628   H HB1  . ALA B 1 74  ? 63.743  75.201  110.579 1.00 0.00 ? 78  ALA B HB1  1  
ATOM 3629   H HB2  . ALA B 1 74  ? 62.321  74.545  110.811 1.00 0.00 ? 78  ALA B HB2  1  
ATOM 3630   H HB3  . ALA B 1 74  ? 62.679  75.183  109.407 1.00 0.00 ? 78  ALA B HB3  1  
ATOM 3631   N N    . ILE B 1 75  ? 64.223  78.036  110.699 1.00 0.00 ? 79  ILE B N    1  
ATOM 3632   C CA   . ILE B 1 75  ? 65.219  78.966  111.228 1.00 0.00 ? 79  ILE B CA   1  
ATOM 3633   C C    . ILE B 1 75  ? 64.539  80.127  111.945 1.00 0.00 ? 79  ILE B C    1  
ATOM 3634   O O    . ILE B 1 75  ? 64.941  80.521  113.046 1.00 0.00 ? 79  ILE B O    1  
ATOM 3635   C CB   . ILE B 1 75  ? 66.137  79.456  110.091 1.00 0.00 ? 79  ILE B CB   1  
ATOM 3636   C CG1  . ILE B 1 75  ? 66.740  78.268  109.343 1.00 0.00 ? 79  ILE B CG1  1  
ATOM 3637   C CG2  . ILE B 1 75  ? 67.241  80.344  110.623 1.00 0.00 ? 79  ILE B CG2  1  
ATOM 3638   C CD1  . ILE B 1 75  ? 66.831  76.955  110.154 1.00 0.00 ? 79  ILE B CD1  1  
ATOM 3639   H H    . ILE B 1 75  ? 64.252  77.927  109.846 1.00 0.00 ? 79  ILE B H    1  
ATOM 3640   H HA   . ILE B 1 75  ? 65.771  78.506  111.880 1.00 0.00 ? 79  ILE B HA   1  
ATOM 3641   H HB   . ILE B 1 75  ? 65.596  79.977  109.477 1.00 0.00 ? 79  ILE B HB   1  
ATOM 3642   H HG12 . ILE B 1 75  ? 66.212  78.103  108.547 1.00 0.00 ? 79  ILE B HG12 1  
ATOM 3643   H HG13 . ILE B 1 75  ? 67.632  78.510  109.047 1.00 0.00 ? 79  ILE B HG13 1  
ATOM 3644   H HG21 . ILE B 1 75  ? 67.216  81.201  110.169 1.00 0.00 ? 79  ILE B HG21 1  
ATOM 3645   H HG22 . ILE B 1 75  ? 67.117  80.480  111.575 1.00 0.00 ? 79  ILE B HG22 1  
ATOM 3646   H HG23 . ILE B 1 75  ? 68.101  79.922  110.467 1.00 0.00 ? 79  ILE B HG23 1  
ATOM 3647   H HD11 . ILE B 1 75  ? 66.799  77.157  111.103 1.00 0.00 ? 79  ILE B HD11 1  
ATOM 3648   H HD12 . ILE B 1 75  ? 66.086  76.379  109.921 1.00 0.00 ? 79  ILE B HD12 1  
ATOM 3649   H HD13 . ILE B 1 75  ? 67.665  76.504  109.948 1.00 0.00 ? 79  ILE B HD13 1  
ATOM 3650   N N    . GLU B 1 76  ? 63.471  80.664  111.354 1.00 0.00 ? 80  GLU B N    1  
ATOM 3651   C CA   . GLU B 1 76  ? 62.788  81.804  111.952 1.00 0.00 ? 80  GLU B CA   1  
ATOM 3652   C C    . GLU B 1 76  ? 62.197  81.478  113.317 1.00 0.00 ? 80  GLU B C    1  
ATOM 3653   O O    . GLU B 1 76  ? 62.394  82.245  114.265 1.00 0.00 ? 80  GLU B O    1  
ATOM 3654   C CB   . GLU B 1 76  ? 61.698  82.308  111.011 1.00 0.00 ? 80  GLU B CB   1  
ATOM 3655   C CG   . GLU B 1 76  ? 62.221  83.207  109.909 1.00 0.00 ? 80  GLU B CG   1  
ATOM 3656   C CD   . GLU B 1 76  ? 62.199  84.667  110.298 1.00 0.00 ? 80  GLU B CD   1  
ATOM 3657   O OE1  . GLU B 1 76  ? 62.300  84.959  111.507 1.00 0.00 ? 80  GLU B OE1  1  
ATOM 3658   O OE2  . GLU B 1 76  ? 62.078  85.521  109.398 1.00 0.00 ? 80  GLU B OE2  1  
ATOM 3659   H H    . GLU B 1 76  ? 63.132  80.385  110.615 1.00 0.00 ? 80  GLU B H    1  
ATOM 3660   H HA   . GLU B 1 76  ? 63.450  82.500  112.088 1.00 0.00 ? 80  GLU B HA   1  
ATOM 3661   H HB2  . GLU B 1 76  ? 61.249  81.547  110.612 1.00 0.00 ? 80  GLU B HB2  1  
ATOM 3662   H HB3  . GLU B 1 76  ? 61.034  82.792  111.527 1.00 0.00 ? 80  GLU B HB3  1  
ATOM 3663   H HG2  . GLU B 1 76  ? 63.130  82.949  109.688 1.00 0.00 ? 80  GLU B HG2  1  
ATOM 3664   H HG3  . GLU B 1 76  ? 61.687  83.080  109.110 1.00 0.00 ? 80  GLU B HG3  1  
ATOM 3665   N N    . ASP B 1 77  ? 61.458  80.372  113.439 1.00 0.00 ? 81  ASP B N    1  
ATOM 3666   C CA   . ASP B 1 77  ? 61.065  79.899  114.764 1.00 0.00 ? 81  ASP B CA   1  
ATOM 3667   C C    . ASP B 1 77  ? 62.270  79.485  115.590 1.00 0.00 ? 81  ASP B C    1  
ATOM 3668   O O    . ASP B 1 77  ? 62.255  79.626  116.818 1.00 0.00 ? 81  ASP B O    1  
ATOM 3669   C CB   . ASP B 1 77  ? 60.082  78.733  114.665 1.00 0.00 ? 81  ASP B CB   1  
ATOM 3670   C CG   . ASP B 1 77  ? 58.841  79.079  113.877 1.00 0.00 ? 81  ASP B CG   1  
ATOM 3671   O OD1  . ASP B 1 77  ? 58.459  78.286  112.995 1.00 0.00 ? 81  ASP B OD1  1  
ATOM 3672   O OD2  . ASP B 1 77  ? 58.246  80.146  114.138 1.00 0.00 ? 81  ASP B OD2  1  
ATOM 3673   H H    . ASP B 1 77  ? 61.181  79.891  112.782 1.00 0.00 ? 81  ASP B H    1  
ATOM 3674   H HA   . ASP B 1 77  ? 60.627  80.641  115.210 1.00 0.00 ? 81  ASP B HA   1  
ATOM 3675   H HB2  . ASP B 1 77  ? 60.524  77.976  114.249 1.00 0.00 ? 81  ASP B HB2  1  
ATOM 3676   H HB3  . ASP B 1 77  ? 59.826  78.455  115.559 1.00 0.00 ? 81  ASP B HB3  1  
ATOM 3677   N N    . ALA B 1 78  ? 63.313  78.963  114.946 1.00 0.00 ? 82  ALA B N    1  
ATOM 3678   C CA   . ALA B 1 78  ? 64.526  78.658  115.691 1.00 0.00 ? 82  ALA B CA   1  
ATOM 3679   C C    . ALA B 1 78  ? 65.044  79.879  116.440 1.00 0.00 ? 82  ALA B C    1  
ATOM 3680   O O    . ALA B 1 78  ? 65.140  79.854  117.672 1.00 0.00 ? 82  ALA B O    1  
ATOM 3681   C CB   . ALA B 1 78  ? 65.598  78.111  114.754 1.00 0.00 ? 82  ALA B CB   1  
ATOM 3682   H H    . ALA B 1 78  ? 63.339  78.782  114.105 1.00 0.00 ? 82  ALA B H    1  
ATOM 3683   H HA   . ALA B 1 78  ? 64.308  77.981  116.351 1.00 0.00 ? 82  ALA B HA   1  
ATOM 3684   H HB1  . ALA B 1 78  ? 65.950  77.281  115.113 1.00 0.00 ? 82  ALA B HB1  1  
ATOM 3685   H HB2  . ALA B 1 78  ? 65.211  77.946  113.879 1.00 0.00 ? 82  ALA B HB2  1  
ATOM 3686   H HB3  . ALA B 1 78  ? 66.318  78.757  114.672 1.00 0.00 ? 82  ALA B HB3  1  
ATOM 3687   N N    . TYR B 1 79  ? 65.362  80.959  115.724 1.00 0.00 ? 83  TYR B N    1  
ATOM 3688   C CA   . TYR B 1 79  ? 65.970  82.116  116.368 1.00 0.00 ? 83  TYR B CA   1  
ATOM 3689   C C    . TYR B 1 79  ? 64.939  82.963  117.106 1.00 0.00 ? 83  TYR B C    1  
ATOM 3690   O O    . TYR B 1 79  ? 65.141  83.341  118.264 1.00 0.00 ? 83  TYR B O    1  
ATOM 3691   C CB   . TYR B 1 79  ? 66.698  82.973  115.333 1.00 0.00 ? 83  TYR B CB   1  
ATOM 3692   C CG   . TYR B 1 79  ? 67.432  84.133  115.949 1.00 0.00 ? 83  TYR B CG   1  
ATOM 3693   C CD1  . TYR B 1 79  ? 68.816  84.138  116.002 1.00 0.00 ? 83  TYR B CD1  1  
ATOM 3694   C CD2  . TYR B 1 79  ? 66.747  85.214  116.496 1.00 0.00 ? 83  TYR B CD2  1  
ATOM 3695   C CE1  . TYR B 1 79  ? 69.505  85.185  116.567 1.00 0.00 ? 83  TYR B CE1  1  
ATOM 3696   C CE2  . TYR B 1 79  ? 67.428  86.268  117.070 1.00 0.00 ? 83  TYR B CE2  1  
ATOM 3697   C CZ   . TYR B 1 79  ? 68.809  86.247  117.100 1.00 0.00 ? 83  TYR B CZ   1  
ATOM 3698   O OH   . TYR B 1 79  ? 69.510  87.284  117.664 1.00 0.00 ? 83  TYR B OH   1  
ATOM 3699   H H    . TYR B 1 79  ? 65.235  81.038  114.878 1.00 0.00 ? 83  TYR B H    1  
ATOM 3700   H HA   . TYR B 1 79  ? 66.605  81.785  117.023 1.00 0.00 ? 83  TYR B HA   1  
ATOM 3701   H HB2  . TYR B 1 79  ? 67.328  82.418  114.846 1.00 0.00 ? 83  TYR B HB2  1  
ATOM 3702   H HB3  . TYR B 1 79  ? 66.056  83.307  114.687 1.00 0.00 ? 83  TYR B HB3  1  
ATOM 3703   H HD1  . TYR B 1 79  ? 69.289  83.418  115.649 1.00 0.00 ? 83  TYR B HD1  1  
ATOM 3704   H HD2  . TYR B 1 79  ? 65.818  85.227  116.473 1.00 0.00 ? 83  TYR B HD2  1  
ATOM 3705   H HE1  . TYR B 1 79  ? 70.434  85.177  116.589 1.00 0.00 ? 83  TYR B HE1  1  
ATOM 3706   H HE2  . TYR B 1 79  ? 66.961  86.986  117.435 1.00 0.00 ? 83  TYR B HE2  1  
ATOM 3707   H HH   . TYR B 1 79  ? 69.809  87.046  118.413 1.00 0.00 ? 83  TYR B HH   1  
ATOM 3708   N N    . GLN B 1 80  ? 63.828  83.275  116.437 1.00 0.00 ? 84  GLN B N    1  
ATOM 3709   C CA   . GLN B 1 80  ? 62.905  84.296  116.922 1.00 0.00 ? 84  GLN B CA   1  
ATOM 3710   C C    . GLN B 1 80  ? 62.038  83.786  118.068 1.00 0.00 ? 84  GLN B C    1  
ATOM 3711   O O    . GLN B 1 80  ? 61.703  84.551  118.979 1.00 0.00 ? 84  GLN B O    1  
ATOM 3712   C CB   . GLN B 1 80  ? 62.041  84.793  115.767 1.00 0.00 ? 84  GLN B CB   1  
ATOM 3713   C CG   . GLN B 1 80  ? 62.597  85.989  115.032 1.00 0.00 ? 84  GLN B CG   1  
ATOM 3714   C CD   . GLN B 1 80  ? 61.623  87.146  115.009 1.00 0.00 ? 84  GLN B CD   1  
ATOM 3715   O OE1  . GLN B 1 80  ? 60.412  86.947  114.959 1.00 0.00 ? 84  GLN B OE1  1  
ATOM 3716   N NE2  . GLN B 1 80  ? 62.147  88.361  115.059 1.00 0.00 ? 84  GLN B NE2  1  
ATOM 3717   H H    . GLN B 1 80  ? 63.591  82.904  115.698 1.00 0.00 ? 84  GLN B H    1  
ATOM 3718   H HA   . GLN B 1 80  ? 63.428  85.033  117.274 1.00 0.00 ? 84  GLN B HA   1  
ATOM 3719   H HB2  . GLN B 1 80  ? 61.920  84.067  115.134 1.00 0.00 ? 84  GLN B HB2  1  
ATOM 3720   H HB3  . GLN B 1 80  ? 61.161  85.019  116.110 1.00 0.00 ? 84  GLN B HB3  1  
ATOM 3721   H HG2  . GLN B 1 80  ? 63.423  86.272  115.456 1.00 0.00 ? 84  GLN B HG2  1  
ATOM 3722   H HG3  . GLN B 1 80  ? 62.818  85.735  114.123 1.00 0.00 ? 84  GLN B HG3  1  
ATOM 3723   H HE21 . GLN B 1 80  ? 63.000  88.460  115.093 1.00 0.00 ? 84  GLN B HE21 1  
ATOM 3724   H HE22 . GLN B 1 80  ? 61.633  89.051  115.058 1.00 0.00 ? 84  GLN B HE22 1  
ATOM 3725   N N    . ASN B 1 81  ? 61.659  82.508  118.038 1.00 0.00 ? 85  ASN B N    1  
ATOM 3726   C CA   . ASN B 1 81  ? 60.976  81.925  119.188 1.00 0.00 ? 85  ASN B CA   1  
ATOM 3727   C C    . ASN B 1 81  ? 61.975  81.472  120.244 1.00 0.00 ? 85  ASN B C    1  
ATOM 3728   O O    . ASN B 1 81  ? 61.691  81.532  121.445 1.00 0.00 ? 85  ASN B O    1  
ATOM 3729   C CB   . ASN B 1 81  ? 60.099  80.757  118.745 1.00 0.00 ? 85  ASN B CB   1  
ATOM 3730   C CG   . ASN B 1 81  ? 59.430  80.058  119.907 1.00 0.00 ? 85  ASN B CG   1  
ATOM 3731   O OD1  . ASN B 1 81  ? 58.583  80.633  120.585 1.00 0.00 ? 85  ASN B OD1  1  
ATOM 3732   N ND2  . ASN B 1 81  ? 59.801  78.807  120.135 1.00 0.00 ? 85  ASN B ND2  1  
ATOM 3733   H H    . ASN B 1 81  ? 61.785  81.973  117.376 1.00 0.00 ? 85  ASN B H    1  
ATOM 3734   H HA   . ASN B 1 81  ? 60.411  82.607  119.584 1.00 0.00 ? 85  ASN B HA   1  
ATOM 3735   H HB2  . ASN B 1 81  ? 59.420  81.081  118.133 1.00 0.00 ? 85  ASN B HB2  1  
ATOM 3736   H HB3  . ASN B 1 81  ? 60.639  80.119  118.255 1.00 0.00 ? 85  ASN B HB3  1  
ATOM 3737   H HD21 . ASN B 1 81  ? 59.445  78.364  120.780 1.00 0.00 ? 85  ASN B HD21 1  
ATOM 3738   H HD22 . ASN B 1 81  ? 60.398  78.438  119.638 1.00 0.00 ? 85  ASN B HD22 1  
ATOM 3739   N N    . GLY B 1 82  ? 63.148  81.019  119.813 1.00 0.00 ? 86  GLY B N    1  
ATOM 3740   C CA   . GLY B 1 82  ? 64.192  80.585  120.718 1.00 0.00 ? 86  GLY B CA   1  
ATOM 3741   C C    . GLY B 1 82  ? 64.113  79.109  121.043 1.00 0.00 ? 86  GLY B C    1  
ATOM 3742   O O    . GLY B 1 82  ? 63.689  78.725  122.136 1.00 0.00 ? 86  GLY B O    1  
ATOM 3743   H H    . GLY B 1 82  ? 63.357  80.956  118.981 1.00 0.00 ? 86  GLY B H    1  
ATOM 3744   H HA2  . GLY B 1 82  ? 65.058  80.779  120.324 1.00 0.00 ? 86  GLY B HA2  1  
ATOM 3745   H HA3  . GLY B 1 82  ? 64.134  81.096  121.541 1.00 0.00 ? 86  GLY B HA3  1  
ATOM 3746   N N    . LYS B 1 83  ? 64.539  78.279  120.099 1.00 0.00 ? 87  LYS B N    1  
ATOM 3747   C CA   . LYS B 1 83  ? 64.548  76.823  120.221 1.00 0.00 ? 87  LYS B CA   1  
ATOM 3748   C C    . LYS B 1 83  ? 65.876  76.332  119.655 1.00 0.00 ? 87  LYS B C    1  
ATOM 3749   O O    . LYS B 1 83  ? 66.498  77.010  118.832 1.00 0.00 ? 87  LYS B O    1  
ATOM 3750   C CB   . LYS B 1 83  ? 63.356  76.186  119.481 1.00 0.00 ? 87  LYS B CB   1  
ATOM 3751   C CG   . LYS B 1 83  ? 63.222  76.479  117.994 1.00 0.00 ? 87  LYS B CG   1  
ATOM 3752   C CD   . LYS B 1 83  ? 63.062  75.190  117.208 1.00 0.00 ? 87  LYS B CD   1  
ATOM 3753   C CE   . LYS B 1 83  ? 61.604  74.850  116.984 1.00 0.00 ? 87  LYS B CE   1  
ATOM 3754   N NZ   . LYS B 1 83  ? 61.095  75.503  115.752 1.00 0.00 ? 87  LYS B NZ   1  
ATOM 3755   H H    . LYS B 1 83  ? 64.841  78.556  119.342 1.00 0.00 ? 87  LYS B H    1  
ATOM 3756   H HA   . LYS B 1 83  ? 64.457  76.563  121.151 1.00 0.00 ? 87  LYS B HA   1  
ATOM 3757   H HB2  . LYS B 1 83  ? 63.412  75.224  119.593 1.00 0.00 ? 87  LYS B HB2  1  
ATOM 3758   H HB3  . LYS B 1 83  ? 62.540  76.476  119.918 1.00 0.00 ? 87  LYS B HB3  1  
ATOM 3759   H HG2  . LYS B 1 83  ? 62.456  77.055  117.840 1.00 0.00 ? 87  LYS B HG2  1  
ATOM 3760   H HG3  . LYS B 1 83  ? 64.004  76.960  117.682 1.00 0.00 ? 87  LYS B HG3  1  
ATOM 3761   H HD2  . LYS B 1 83  ? 63.510  75.275  116.352 1.00 0.00 ? 87  LYS B HD2  1  
ATOM 3762   H HD3  . LYS B 1 83  ? 63.495  74.464  117.684 1.00 0.00 ? 87  LYS B HD3  1  
ATOM 3763   H HE2  . LYS B 1 83  ? 61.499  73.887  116.913 1.00 0.00 ? 87  LYS B HE2  1  
ATOM 3764   H HE3  . LYS B 1 83  ? 61.079  75.137  117.749 1.00 0.00 ? 87  LYS B HE3  1  
ATOM 3765   H HZ1  . LYS B 1 83  ? 60.272  75.808  115.897 1.00 0.00 ? 87  LYS B HZ1  1  
ATOM 3766   H HZ2  . LYS B 1 83  ? 61.629  76.181  115.533 1.00 0.00 ? 87  LYS B HZ2  1  
ATOM 3767   H HZ3  . LYS B 1 83  ? 61.079  74.912  115.087 1.00 0.00 ? 87  LYS B HZ3  1  
ATOM 3768   N N    . GLN B 1 84  ? 66.305  75.153  120.082 1.00 0.00 ? 88  GLN B N    1  
ATOM 3769   C CA   . GLN B 1 84  ? 67.414  74.439  119.466 1.00 0.00 ? 88  GLN B CA   1  
ATOM 3770   C C    . GLN B 1 84  ? 66.867  73.587  118.326 1.00 0.00 ? 88  GLN B C    1  
ATOM 3771   O O    . GLN B 1 84  ? 65.728  73.117  118.370 1.00 0.00 ? 88  GLN B O    1  
ATOM 3772   C CB   . GLN B 1 84  ? 68.155  73.586  120.496 1.00 0.00 ? 88  GLN B CB   1  
ATOM 3773   C CG   . GLN B 1 84  ? 67.390  72.350  120.906 1.00 0.00 ? 88  GLN B CG   1  
ATOM 3774   C CD   . GLN B 1 84  ? 68.193  71.080  120.739 1.00 0.00 ? 88  GLN B CD   1  
ATOM 3775   O OE1  . GLN B 1 84  ? 68.761  70.558  121.696 1.00 0.00 ? 88  GLN B OE1  1  
ATOM 3776   N NE2  . GLN B 1 84  ? 68.257  70.586  119.511 1.00 0.00 ? 88  GLN B NE2  1  
ATOM 3777   H H    . GLN B 1 84  ? 65.955  74.738  120.749 1.00 0.00 ? 88  GLN B H    1  
ATOM 3778   H HA   . GLN B 1 84  ? 68.058  75.072  119.112 1.00 0.00 ? 88  GLN B HA   1  
ATOM 3779   H HB2  . GLN B 1 84  ? 69.014  73.322  120.131 1.00 0.00 ? 88  GLN B HB2  1  
ATOM 3780   H HB3  . GLN B 1 84  ? 68.335  74.124  121.283 1.00 0.00 ? 88  GLN B HB3  1  
ATOM 3781   H HG2  . GLN B 1 84  ? 67.118  72.435  121.833 1.00 0.00 ? 88  GLN B HG2  1  
ATOM 3782   H HG3  . GLN B 1 84  ? 66.580  72.287  120.377 1.00 0.00 ? 88  GLN B HG3  1  
ATOM 3783   H HE21 . GLN B 1 84  ? 67.845  70.980  118.867 1.00 0.00 ? 88  GLN B HE21 1  
ATOM 3784   H HE22 . GLN B 1 84  ? 68.710  69.871  119.359 1.00 0.00 ? 88  GLN B HE22 1  
ATOM 3785   N N    . ILE B 1 85  ? 67.678  73.390  117.286 1.00 0.00 ? 89  ILE B N    1  
ATOM 3786   C CA   . ILE B 1 85  ? 67.255  72.577  116.152 1.00 0.00 ? 89  ILE B CA   1  
ATOM 3787   C C    . ILE B 1 85  ? 68.211  71.411  115.967 1.00 0.00 ? 89  ILE B C    1  
ATOM 3788   O O    . ILE B 1 85  ? 69.425  71.542  116.145 1.00 0.00 ? 89  ILE B O    1  
ATOM 3789   C CB   . ILE B 1 85  ? 67.161  73.389  114.845 1.00 0.00 ? 89  ILE B CB   1  
ATOM 3790   C CG1  . ILE B 1 85  ? 66.108  74.492  114.963 1.00 0.00 ? 89  ILE B CG1  1  
ATOM 3791   C CG2  . ILE B 1 85  ? 66.876  72.467  113.675 1.00 0.00 ? 89  ILE B CG2  1  
ATOM 3792   C CD1  . ILE B 1 85  ? 64.744  74.276  114.258 1.00 0.00 ? 89  ILE B CD1  1  
ATOM 3793   H H    . ILE B 1 85  ? 68.470  73.716  117.220 1.00 0.00 ? 89  ILE B H    1  
ATOM 3794   H HA   . ILE B 1 85  ? 66.364  72.249  116.351 1.00 0.00 ? 89  ILE B HA   1  
ATOM 3795   H HB   . ILE B 1 85  ? 68.014  73.822  114.683 1.00 0.00 ? 89  ILE B HB   1  
ATOM 3796   H HG12 . ILE B 1 85  ? 65.935  74.638  115.906 1.00 0.00 ? 89  ILE B HG12 1  
ATOM 3797   H HG13 . ILE B 1 85  ? 66.495  75.311  114.615 1.00 0.00 ? 89  ILE B HG13 1  
ATOM 3798   H HG21 . ILE B 1 85  ? 67.700  72.040  113.392 1.00 0.00 ? 89  ILE B HG21 1  
ATOM 3799   H HG22 . ILE B 1 85  ? 66.238  71.788  113.946 1.00 0.00 ? 89  ILE B HG22 1  
ATOM 3800   H HG23 . ILE B 1 85  ? 66.508  72.981  112.940 1.00 0.00 ? 89  ILE B HG23 1  
ATOM 3801   H HD11 . ILE B 1 85  ? 64.034  74.634  114.812 1.00 0.00 ? 89  ILE B HD11 1  
ATOM 3802   H HD12 . ILE B 1 85  ? 64.747  74.731  113.401 1.00 0.00 ? 89  ILE B HD12 1  
ATOM 3803   H HD13 . ILE B 1 85  ? 64.599  73.327  114.120 1.00 0.00 ? 89  ILE B HD13 1  
ATOM 3804   N N    . LYS B 1 86  ? 67.653  70.264  115.597 1.00 0.00 ? 90  LYS B N    1  
ATOM 3805   C CA   . LYS B 1 86  ? 68.444  69.077  115.312 1.00 0.00 ? 90  LYS B CA   1  
ATOM 3806   C C    . LYS B 1 86  ? 69.174  69.274  113.991 1.00 0.00 ? 90  LYS B C    1  
ATOM 3807   O O    . LYS B 1 86  ? 68.582  69.741  113.008 1.00 0.00 ? 90  LYS B O    1  
ATOM 3808   C CB   . LYS B 1 86  ? 67.575  67.821  115.297 1.00 0.00 ? 90  LYS B CB   1  
ATOM 3809   C CG   . LYS B 1 86  ? 66.881  67.587  116.627 1.00 0.00 ? 90  LYS B CG   1  
ATOM 3810   C CD   . LYS B 1 86  ? 65.855  66.472  116.574 1.00 0.00 ? 90  LYS B CD   1  
ATOM 3811   C CE   . LYS B 1 86  ? 64.498  66.983  116.178 1.00 0.00 ? 90  LYS B CE   1  
ATOM 3812   N NZ   . LYS B 1 86  ? 63.881  66.154  115.111 1.00 0.00 ? 90  LYS B NZ   1  
ATOM 3813   H H    . LYS B 1 86  ? 66.805  70.153  115.504 1.00 0.00 ? 90  LYS B H    1  
ATOM 3814   H HA   . LYS B 1 86  ? 69.098  68.950  116.018 1.00 0.00 ? 90  LYS B HA   1  
ATOM 3815   H HB2  . LYS B 1 86  ? 66.910  67.899  114.595 1.00 0.00 ? 90  LYS B HB2  1  
ATOM 3816   H HB3  . LYS B 1 86  ? 68.125  67.051  115.081 1.00 0.00 ? 90  LYS B HB3  1  
ATOM 3817   H HG2  . LYS B 1 86  ? 67.546  67.376  117.300 1.00 0.00 ? 90  LYS B HG2  1  
ATOM 3818   H HG3  . LYS B 1 86  ? 66.445  68.407  116.906 1.00 0.00 ? 90  LYS B HG3  1  
ATOM 3819   H HD2  . LYS B 1 86  ? 66.145  65.797  115.941 1.00 0.00 ? 90  LYS B HD2  1  
ATOM 3820   H HD3  . LYS B 1 86  ? 65.799  66.043  117.442 1.00 0.00 ? 90  LYS B HD3  1  
ATOM 3821   H HE2  . LYS B 1 86  ? 63.917  66.992  116.956 1.00 0.00 ? 90  LYS B HE2  1  
ATOM 3822   H HE3  . LYS B 1 86  ? 64.575  67.900  115.871 1.00 0.00 ? 90  LYS B HE3  1  
ATOM 3823   H HZ1  . LYS B 1 86  ? 64.515  65.855  114.563 1.00 0.00 ? 90  LYS B HZ1  1  
ATOM 3824   H HZ2  . LYS B 1 86  ? 63.458  65.463  115.480 1.00 0.00 ? 90  LYS B HZ2  1  
ATOM 3825   H HZ3  . LYS B 1 86  ? 63.300  66.647  114.651 1.00 0.00 ? 90  LYS B HZ3  1  
ATOM 3826   N N    . PHE B 1 87  ? 70.451  68.899  113.979 1.00 0.00 ? 91  PHE B N    1  
ATOM 3827   C CA   . PHE B 1 87  ? 71.407  69.257  112.940 1.00 0.00 ? 91  PHE B CA   1  
ATOM 3828   C C    . PHE B 1 87  ? 71.880  68.005  112.213 1.00 0.00 ? 91  PHE B C    1  
ATOM 3829   O O    . PHE B 1 87  ? 72.463  67.102  112.829 1.00 0.00 ? 91  PHE B O    1  
ATOM 3830   C CB   . PHE B 1 87  ? 72.593  69.999  113.552 1.00 0.00 ? 91  PHE B CB   1  
ATOM 3831   C CG   . PHE B 1 87  ? 73.418  70.750  112.558 1.00 0.00 ? 91  PHE B CG   1  
ATOM 3832   C CD1  . PHE B 1 87  ? 73.689  72.087  112.740 1.00 0.00 ? 91  PHE B CD1  1  
ATOM 3833   C CD2  . PHE B 1 87  ? 73.938  70.111  111.447 1.00 0.00 ? 91  PHE B CD2  1  
ATOM 3834   C CE1  . PHE B 1 87  ? 74.451  72.785  111.829 1.00 0.00 ? 91  PHE B CE1  1  
ATOM 3835   C CE2  . PHE B 1 87  ? 74.702  70.802  110.532 1.00 0.00 ? 91  PHE B CE2  1  
ATOM 3836   C CZ   . PHE B 1 87  ? 74.960  72.141  110.725 1.00 0.00 ? 91  PHE B CZ   1  
ATOM 3837   H H    . PHE B 1 87  ? 70.794  68.411  114.599 1.00 0.00 ? 91  PHE B H    1  
ATOM 3838   H HA   . PHE B 1 87  ? 70.974  69.842  112.299 1.00 0.00 ? 91  PHE B HA   1  
ATOM 3839   H HB2  . PHE B 1 87  ? 72.263  70.621  114.220 1.00 0.00 ? 91  PHE B HB2  1  
ATOM 3840   H HB3  . PHE B 1 87  ? 73.160  69.361  114.012 1.00 0.00 ? 91  PHE B HB3  1  
ATOM 3841   H HD1  . PHE B 1 87  ? 73.353  72.525  113.488 1.00 0.00 ? 91  PHE B HD1  1  
ATOM 3842   H HD2  . PHE B 1 87  ? 73.770  69.206  111.316 1.00 0.00 ? 91  PHE B HD2  1  
ATOM 3843   H HE1  . PHE B 1 87  ? 74.621  73.690  111.960 1.00 0.00 ? 91  PHE B HE1  1  
ATOM 3844   H HE2  . PHE B 1 87  ? 75.044  70.365  109.785 1.00 0.00 ? 91  PHE B HE2  1  
ATOM 3845   H HZ   . PHE B 1 87  ? 75.478  72.609  110.110 1.00 0.00 ? 91  PHE B HZ   1  
ATOM 3846   N N    . TRP B 1 88  ? 71.658  67.979  110.901 1.00 0.00 ? 92  TRP B N    1  
ATOM 3847   C CA   . TRP B 1 88  ? 72.019  66.866  110.031 1.00 0.00 ? 92  TRP B CA   1  
ATOM 3848   C C    . TRP B 1 88  ? 72.807  67.416  108.851 1.00 0.00 ? 92  TRP B C    1  
ATOM 3849   O O    . TRP B 1 88  ? 72.365  68.369  108.201 1.00 0.00 ? 92  TRP B O    1  
ATOM 3850   C CB   . TRP B 1 88  ? 70.768  66.147  109.518 1.00 0.00 ? 92  TRP B CB   1  
ATOM 3851   C CG   . TRP B 1 88  ? 69.700  65.854  110.529 1.00 0.00 ? 92  TRP B CG   1  
ATOM 3852   C CD1  . TRP B 1 88  ? 68.821  66.747  111.065 1.00 0.00 ? 92  TRP B CD1  1  
ATOM 3853   C CD2  . TRP B 1 88  ? 69.334  64.571  111.053 1.00 0.00 ? 92  TRP B CD2  1  
ATOM 3854   N NE1  . TRP B 1 88  ? 67.963  66.111  111.925 1.00 0.00 ? 92  TRP B NE1  1  
ATOM 3855   C CE2  . TRP B 1 88  ? 68.252  64.772  111.932 1.00 0.00 ? 92  TRP B CE2  1  
ATOM 3856   C CE3  . TRP B 1 88  ? 69.830  63.276  110.878 1.00 0.00 ? 92  TRP B CE3  1  
ATOM 3857   C CZ2  . TRP B 1 88  ? 67.658  63.729  112.635 1.00 0.00 ? 92  TRP B CZ2  1  
ATOM 3858   C CZ3  . TRP B 1 88  ? 69.239  62.241  111.579 1.00 0.00 ? 92  TRP B CZ3  1  
ATOM 3859   C CH2  . TRP B 1 88  ? 68.165  62.474  112.447 1.00 0.00 ? 92  TRP B CH2  1  
ATOM 3860   H H    . TRP B 1 88  ? 71.282  68.629  110.481 1.00 0.00 ? 92  TRP B H    1  
ATOM 3861   H HA   . TRP B 1 88  ? 72.551  66.227  110.531 1.00 0.00 ? 92  TRP B HA   1  
ATOM 3862   H HB2  . TRP B 1 88  ? 70.377  66.684  108.811 1.00 0.00 ? 92  TRP B HB2  1  
ATOM 3863   H HB3  . TRP B 1 88  ? 71.044  65.307  109.117 1.00 0.00 ? 92  TRP B HB3  1  
ATOM 3864   H HD1  . TRP B 1 88  ? 68.805  67.657  110.875 1.00 0.00 ? 92  TRP B HD1  1  
ATOM 3865   H HE1  . TRP B 1 88  ? 67.343  66.490  112.385 1.00 0.00 ? 92  TRP B HE1  1  
ATOM 3866   H HE3  . TRP B 1 88  ? 70.542  63.114  110.303 1.00 0.00 ? 92  TRP B HE3  1  
ATOM 3867   H HZ2  . TRP B 1 88  ? 66.943  63.880  113.211 1.00 0.00 ? 92  TRP B HZ2  1  
ATOM 3868   H HZ3  . TRP B 1 88  ? 69.560  61.375  111.471 1.00 0.00 ? 92  TRP B HZ3  1  
ATOM 3869   H HH2  . TRP B 1 88  ? 67.789  61.758  112.907 1.00 0.00 ? 92  TRP B HH2  1  
ATOM 3870   N N    . ARG B 1 89  ? 73.963  66.817  108.564 1.00 0.00 ? 93  ARG B N    1  
ATOM 3871   C CA   . ARG B 1 89  ? 74.728  67.146  107.358 1.00 0.00 ? 93  ARG B CA   1  
ATOM 3872   C C    . ARG B 1 89  ? 75.093  65.838  106.669 1.00 0.00 ? 93  ARG B C    1  
ATOM 3873   O O    . ARG B 1 89  ? 75.851  65.024  107.195 1.00 0.00 ? 93  ARG B O    1  
ATOM 3874   C CB   . ARG B 1 89  ? 75.970  67.964  107.684 1.00 0.00 ? 93  ARG B CB   1  
ATOM 3875   C CG   . ARG B 1 89  ? 76.895  67.238  108.639 1.00 0.00 ? 93  ARG B CG   1  
ATOM 3876   C CD   . ARG B 1 89  ? 78.225  67.911  108.815 1.00 0.00 ? 93  ARG B CD   1  
ATOM 3877   N NE   . ARG B 1 89  ? 79.039  67.706  107.625 1.00 0.00 ? 93  ARG B NE   1  
ATOM 3878   C CZ   . ARG B 1 89  ? 80.179  68.343  107.389 1.00 0.00 ? 93  ARG B CZ   1  
ATOM 3879   N NH1  . ARG B 1 89  ? 80.631  69.238  108.252 1.00 0.00 ? 93  ARG B NH1  1  
ATOM 3880   N NH2  . ARG B 1 89  ? 80.855  68.091  106.279 1.00 0.00 ? 93  ARG B NH2  1  
ATOM 3881   H H    . ARG B 1 89  ? 74.324  66.213  109.057 1.00 0.00 ? 93  ARG B H    1  
ATOM 3882   H HA   . ARG B 1 89  ? 74.189  67.698  106.769 1.00 0.00 ? 93  ARG B HA   1  
ATOM 3883   H HB2  . ARG B 1 89  ? 76.447  68.165  106.864 1.00 0.00 ? 93  ARG B HB2  1  
ATOM 3884   H HB3  . ARG B 1 89  ? 75.706  68.812  108.073 1.00 0.00 ? 93  ARG B HB3  1  
ATOM 3885   H HG2  . ARG B 1 89  ? 76.461  67.165  109.504 1.00 0.00 ? 93  ARG B HG2  1  
ATOM 3886   H HG3  . ARG B 1 89  ? 77.037  66.335  108.316 1.00 0.00 ? 93  ARG B HG3  1  
ATOM 3887   H HD2  . ARG B 1 89  ? 78.100  68.859  108.972 1.00 0.00 ? 93  ARG B HD2  1  
ATOM 3888   H HD3  . ARG B 1 89  ? 78.679  67.551  109.593 1.00 0.00 ? 93  ARG B HD3  1  
ATOM 3889   H HE   . ARG B 1 89  ? 78.765  67.137  107.042 1.00 0.00 ? 93  ARG B HE   1  
ATOM 3890   H HH11 . ARG B 1 89  ? 80.187  69.409  108.968 1.00 0.00 ? 93  ARG B HH11 1  
ATOM 3891   H HH12 . ARG B 1 89  ? 81.370  69.650  108.097 1.00 0.00 ? 93  ARG B HH12 1  
ATOM 3892   H HH21 . ARG B 1 89  ? 80.556  67.515  105.714 1.00 0.00 ? 93  ARG B HH21 1  
ATOM 3893   H HH22 . ARG B 1 89  ? 81.594  68.502  106.123 1.00 0.00 ? 93  ARG B HH22 1  
ATOM 3894   N N    . VAL B 1 90  ? 74.566  65.637  105.470 1.00 0.00 ? 94  VAL B N    1  
ATOM 3895   C CA   . VAL B 1 90  ? 74.733  64.363  104.792 1.00 0.00 ? 94  VAL B CA   1  
ATOM 3896   C C    . VAL B 1 90  ? 75.345  64.597  103.421 1.00 0.00 ? 94  VAL B C    1  
ATOM 3897   O O    . VAL B 1 90  ? 75.426  65.726  102.916 1.00 0.00 ? 94  VAL B O    1  
ATOM 3898   C CB   . VAL B 1 90  ? 73.408  63.589  104.670 1.00 0.00 ? 94  VAL B CB   1  
ATOM 3899   C CG1  . VAL B 1 90  ? 72.542  63.831  105.892 1.00 0.00 ? 94  VAL B CG1  1  
ATOM 3900   C CG2  . VAL B 1 90  ? 72.679  63.975  103.401 1.00 0.00 ? 94  VAL B CG2  1  
ATOM 3901   H H    . VAL B 1 90  ? 74.112  66.222  105.033 1.00 0.00 ? 94  VAL B H    1  
ATOM 3902   H HA   . VAL B 1 90  ? 75.329  63.814  105.327 1.00 0.00 ? 94  VAL B HA   1  
ATOM 3903   H HB   . VAL B 1 90  ? 73.606  62.640  104.623 1.00 0.00 ? 94  VAL B HB   1  
ATOM 3904   H HG11 . VAL B 1 90  ? 71.995  64.619  105.749 1.00 0.00 ? 94  VAL B HG11 1  
ATOM 3905   H HG12 . VAL B 1 90  ? 71.969  63.063  106.040 1.00 0.00 ? 94  VAL B HG12 1  
ATOM 3906   H HG13 . VAL B 1 90  ? 73.108  63.967  106.668 1.00 0.00 ? 94  VAL B HG13 1  
ATOM 3907   H HG21 . VAL B 1 90  ? 72.814  64.920  103.224 1.00 0.00 ? 94  VAL B HG21 1  
ATOM 3908   H HG22 . VAL B 1 90  ? 73.024  63.454  102.659 1.00 0.00 ? 94  VAL B HG22 1  
ATOM 3909   H HG23 . VAL B 1 90  ? 71.731  63.799  103.505 1.00 0.00 ? 94  VAL B HG23 1  
ATOM 3910   N N    . ASP B 1 91  ? 75.773  63.499  102.810 1.00 0.00 ? 95  ASP B N    1  
ATOM 3911   C CA   . ASP B 1 91  ? 76.367  63.544  101.487 1.00 0.00 ? 95  ASP B CA   1  
ATOM 3912   C C    . ASP B 1 91  ? 75.418  62.956  100.453 1.00 0.00 ? 95  ASP B C    1  
ATOM 3913   O O    . ASP B 1 91  ? 74.749  61.945  100.682 1.00 0.00 ? 95  ASP B O    1  
ATOM 3914   C CB   . ASP B 1 91  ? 77.710  62.813  101.462 1.00 0.00 ? 95  ASP B CB   1  
ATOM 3915   C CG   . ASP B 1 91  ? 78.772  63.589  100.717 1.00 0.00 ? 95  ASP B CG   1  
ATOM 3916   O OD1  . ASP B 1 91  ? 78.602  64.813  100.567 1.00 0.00 ? 95  ASP B OD1  1  
ATOM 3917   O OD2  . ASP B 1 91  ? 79.755  62.978  100.252 1.00 0.00 ? 95  ASP B OD2  1  
ATOM 3918   H H    . ASP B 1 91  ? 75.726  62.711  103.151 1.00 0.00 ? 95  ASP B H    1  
ATOM 3919   H HA   . ASP B 1 91  ? 76.527  64.474  101.262 1.00 0.00 ? 95  ASP B HA   1  
ATOM 3920   H HB2  . ASP B 1 91  ? 78.007  62.655  102.372 1.00 0.00 ? 95  ASP B HB2  1  
ATOM 3921   H HB3  . ASP B 1 91  ? 77.596  61.944  101.046 1.00 0.00 ? 95  ASP B HB3  1  
ATOM 3922   N N    . THR B 1 92  ? 75.361  63.623  99.301  1.00 0.00 ? 96  THR B N    1  
ATOM 3923   C CA   . THR B 1 92  ? 74.466  63.259  98.212  1.00 0.00 ? 96  THR B CA   1  
ATOM 3924   C C    . THR B 1 92  ? 74.866  61.952  97.535  1.00 0.00 ? 96  THR B C    1  
ATOM 3925   O O    . THR B 1 92  ? 73.995  61.224  97.052  1.00 0.00 ? 96  THR B O    1  
ATOM 3926   C CB   . THR B 1 92  ? 74.428  64.398  97.177  1.00 0.00 ? 96  THR B CB   1  
ATOM 3927   O OG1  . THR B 1 92  ? 75.762  64.655  96.724  1.00 0.00 ? 96  THR B OG1  1  
ATOM 3928   C CG2  . THR B 1 92  ? 73.896  65.703  97.765  1.00 0.00 ? 96  THR B CG2  1  
ATOM 3929   H H    . THR B 1 92  ? 75.850  64.309  99.130  1.00 0.00 ? 96  THR B H    1  
ATOM 3930   H HA   . THR B 1 92  ? 73.585  63.121  98.593  1.00 0.00 ? 96  THR B HA   1  
ATOM 3931   H HB   . THR B 1 92  ? 73.839  64.113  96.460  1.00 0.00 ? 96  THR B HB   1  
ATOM 3932   H HG1  . THR B 1 92  ? 76.257  64.814  97.384  1.00 0.00 ? 96  THR B HG1  1  
ATOM 3933   H HG21 . THR B 1 92  ? 74.183  66.258  97.023  1.00 0.00 ? 96  THR B HG21 1  
ATOM 3934   H HG22 . THR B 1 92  ? 72.993  65.566  98.093  1.00 0.00 ? 96  THR B HG22 1  
ATOM 3935   H HG23 . THR B 1 92  ? 74.466  65.984  98.498  1.00 0.00 ? 96  THR B HG23 1  
ATOM 3936   N N    . VAL B 1 93  ? 76.160  61.624  97.521  1.00 0.00 ? 97  VAL B N    1  
ATOM 3937   C CA   . VAL B 1 93  ? 76.606  60.359  96.953  1.00 0.00 ? 97  VAL B CA   1  
ATOM 3938   C C    . VAL B 1 93  ? 76.078  59.200  97.789  1.00 0.00 ? 97  VAL B C    1  
ATOM 3939   O O    . VAL B 1 93  ? 76.169  59.194  99.024  1.00 0.00 ? 97  VAL B O    1  
ATOM 3940   C CB   . VAL B 1 93  ? 78.142  60.318  96.851  1.00 0.00 ? 97  VAL B CB   1  
ATOM 3941   C CG1  . VAL B 1 93  ? 78.764  60.377  98.235  1.00 0.00 ? 97  VAL B CG1  1  
ATOM 3942   C CG2  . VAL B 1 93  ? 78.599  59.068  96.112  1.00 0.00 ? 97  VAL B CG2  1  
ATOM 3943   H H    . VAL B 1 93  ? 76.789  62.120  97.834  1.00 0.00 ? 97  VAL B H    1  
ATOM 3944   H HA   . VAL B 1 93  ? 76.251  60.275  96.053  1.00 0.00 ? 97  VAL B HA   1  
ATOM 3945   H HB   . VAL B 1 93  ? 78.438  61.093  96.347  1.00 0.00 ? 97  VAL B HB   1  
ATOM 3946   H HG11 . VAL B 1 93  ? 79.077  61.278  98.411  1.00 0.00 ? 97  VAL B HG11 1  
ATOM 3947   H HG12 . VAL B 1 93  ? 78.100  60.132  98.898  1.00 0.00 ? 97  VAL B HG12 1  
ATOM 3948   H HG13 . VAL B 1 93  ? 79.511  59.761  98.281  1.00 0.00 ? 97  VAL B HG13 1  
ATOM 3949   H HG21 . VAL B 1 93  ? 79.560  59.102  95.982  1.00 0.00 ? 97  VAL B HG21 1  
ATOM 3950   H HG22 . VAL B 1 93  ? 78.371  58.283  96.633  1.00 0.00 ? 97  VAL B HG22 1  
ATOM 3951   H HG23 . VAL B 1 93  ? 78.158  59.023  95.249  1.00 0.00 ? 97  VAL B HG23 1  
ATOM 3952   N N    . LYS B 1 94  ? 75.506  58.212  97.112  1.00 0.00 ? 98  LYS B N    1  
ATOM 3953   C CA   . LYS B 1 94  ? 74.848  57.096  97.778  1.00 0.00 ? 98  LYS B CA   1  
ATOM 3954   C C    . LYS B 1 94  ? 75.864  56.307  98.594  1.00 0.00 ? 98  LYS B C    1  
ATOM 3955   O O    . LYS B 1 94  ? 76.954  55.992  98.104  1.00 0.00 ? 98  LYS B O    1  
ATOM 3956   C CB   . LYS B 1 94  ? 74.155  56.196  96.757  1.00 0.00 ? 98  LYS B CB   1  
ATOM 3957   C CG   . LYS B 1 94  ? 73.580  54.919  97.342  1.00 0.00 ? 98  LYS B CG   1  
ATOM 3958   C CD   . LYS B 1 94  ? 72.160  54.673  96.870  1.00 0.00 ? 98  LYS B CD   1  
ATOM 3959   C CE   . LYS B 1 94  ? 71.150  55.232  97.861  1.00 0.00 ? 98  LYS B CE   1  
ATOM 3960   N NZ   . LYS B 1 94  ? 71.117  56.721  97.876  1.00 0.00 ? 98  LYS B NZ   1  
ATOM 3961   H H    . LYS B 1 94  ? 75.487  58.171  96.253  1.00 0.00 ? 98  LYS B H    1  
ATOM 3962   H HA   . LYS B 1 94  ? 74.172  57.445  98.379  1.00 0.00 ? 98  LYS B HA   1  
ATOM 3963   H HB2  . LYS B 1 94  ? 73.440  56.696  96.333  1.00 0.00 ? 98  LYS B HB2  1  
ATOM 3964   H HB3  . LYS B 1 94  ? 74.790  55.965  96.062  1.00 0.00 ? 98  LYS B HB3  1  
ATOM 3965   H HG2  . LYS B 1 94  ? 74.140  54.168  97.091  1.00 0.00 ? 98  LYS B HG2  1  
ATOM 3966   H HG3  . LYS B 1 94  ? 73.595  54.972  98.310  1.00 0.00 ? 98  LYS B HG3  1  
ATOM 3967   H HD2  . LYS B 1 94  ? 72.029  55.085  96.002  1.00 0.00 ? 98  LYS B HD2  1  
ATOM 3968   H HD3  . LYS B 1 94  ? 72.014  53.721  96.758  1.00 0.00 ? 98  LYS B HD3  1  
ATOM 3969   H HE2  . LYS B 1 94  ? 70.267  54.896  97.640  1.00 0.00 ? 98  LYS B HE2  1  
ATOM 3970   H HE3  . LYS B 1 94  ? 71.362  54.908  98.750  1.00 0.00 ? 98  LYS B HE3  1  
ATOM 3971   H HZ1  . LYS B 1 94  ? 70.836  57.020  97.086  1.00 0.00 ? 98  LYS B HZ1  1  
ATOM 3972   H HZ2  . LYS B 1 94  ? 70.562  56.999  98.513  1.00 0.00 ? 98  LYS B HZ2  1  
ATOM 3973   H HZ3  . LYS B 1 94  ? 71.935  57.034  98.037  1.00 0.00 ? 98  LYS B HZ3  1  
ATOM 3974   N N    . ASN B 1 95  ? 75.510  55.999  99.837  1.00 0.00 ? 99  ASN B N    1  
ATOM 3975   C CA   . ASN B 1 95  ? 76.307  55.106  100.659 1.00 0.00 ? 99  ASN B CA   1  
ATOM 3976   C C    . ASN B 1 95  ? 76.119  53.666  100.196 1.00 0.00 ? 99  ASN B C    1  
ATOM 3977   O O    . ASN B 1 95  ? 75.018  53.231  99.859  1.00 0.00 ? 99  ASN B O    1  
ATOM 3978   C CB   . ASN B 1 95  ? 75.935  55.253  102.133 1.00 0.00 ? 99  ASN B CB   1  
ATOM 3979   C CG   . ASN B 1 95  ? 77.138  55.166  103.044 1.00 0.00 ? 99  ASN B CG   1  
ATOM 3980   O OD1  . ASN B 1 95  ? 77.602  56.173  103.575 1.00 0.00 ? 99  ASN B OD1  1  
ATOM 3981   N ND2  . ASN B 1 95  ? 77.651  53.957  103.232 1.00 0.00 ? 99  ASN B ND2  1  
ATOM 3982   H H    . ASN B 1 95  ? 74.804  56.303  100.224 1.00 0.00 ? 99  ASN B H    1  
ATOM 3983   H HA   . ASN B 1 95  ? 77.242  55.345  100.562 1.00 0.00 ? 99  ASN B HA   1  
ATOM 3984   H HB2  . ASN B 1 95  ? 75.490  56.105  102.268 1.00 0.00 ? 99  ASN B HB2  1  
ATOM 3985   H HB3  . ASN B 1 95  ? 75.300  54.560  102.373 1.00 0.00 ? 99  ASN B HB3  1  
ATOM 3986   H HD21 . ASN B 1 95  ? 78.336  53.855  103.743 1.00 0.00 ? 99  ASN B HD21 1  
ATOM 3987   H HD22 . ASN B 1 95  ? 77.299  53.275  102.844 1.00 0.00 ? 99  ASN B HD22 1  
ATOM 3988   N N    . GLU B 1 96  ? 77.220  52.915  100.187 1.00 0.00 ? 100 GLU B N    1  
ATOM 3989   C CA   . GLU B 1 96  ? 77.197  51.541  99.709  1.00 0.00 ? 100 GLU B CA   1  
ATOM 3990   C C    . GLU B 1 96  ? 76.723  50.532  100.741 1.00 0.00 ? 100 GLU B C    1  
ATOM 3991   O O    . GLU B 1 96  ? 76.278  49.448  100.354 1.00 0.00 ? 100 GLU B O    1  
ATOM 3992   C CB   . GLU B 1 96  ? 78.587  51.137  99.197  1.00 0.00 ? 100 GLU B CB   1  
ATOM 3993   C CG   . GLU B 1 96  ? 78.665  51.037  97.675  1.00 0.00 ? 100 GLU B CG   1  
ATOM 3994   C CD   . GLU B 1 96  ? 78.674  52.381  96.976  1.00 0.00 ? 100 GLU B CD   1  
ATOM 3995   O OE1  . GLU B 1 96  ? 77.734  53.177  97.182  1.00 0.00 ? 100 GLU B OE1  1  
ATOM 3996   O OE2  . GLU B 1 96  ? 79.622  52.638  96.206  1.00 0.00 ? 100 GLU B OE2  1  
ATOM 3997   H H    . GLU B 1 96  ? 77.991  53.186  100.456 1.00 0.00 ? 100 GLU B H    1  
ATOM 3998   H HA   . GLU B 1 96  ? 76.548  51.522  98.989  1.00 0.00 ? 100 GLU B HA   1  
ATOM 3999   H HB2  . GLU B 1 96  ? 79.240  51.784  99.506  1.00 0.00 ? 100 GLU B HB2  1  
ATOM 4000   H HB3  . GLU B 1 96  ? 78.830  50.282  99.583  1.00 0.00 ? 100 GLU B HB3  1  
ATOM 4001   H HG2  . GLU B 1 96  ? 79.468  50.550  97.432  1.00 0.00 ? 100 GLU B HG2  1  
ATOM 4002   H HG3  . GLU B 1 96  ? 77.910  50.519  97.354  1.00 0.00 ? 100 GLU B HG3  1  
ATOM 4003   N N    . ASN B 1 97  ? 76.800  50.852  102.032 1.00 0.00 ? 101 ASN B N    1  
ATOM 4004   C CA   . ASN B 1 97  ? 76.142  50.018  103.030 1.00 0.00 ? 101 ASN B CA   1  
ATOM 4005   C C    . ASN B 1 97  ? 75.228  50.855  103.923 1.00 0.00 ? 101 ASN B C    1  
ATOM 4006   O O    . ASN B 1 97  ? 74.934  50.473  105.060 1.00 0.00 ? 101 ASN B O    1  
ATOM 4007   C CB   . ASN B 1 97  ? 77.185  49.233  103.836 1.00 0.00 ? 101 ASN B CB   1  
ATOM 4008   C CG   . ASN B 1 97  ? 77.696  48.001  103.113 1.00 0.00 ? 101 ASN B CG   1  
ATOM 4009   O OD1  . ASN B 1 97  ? 78.717  48.044  102.425 1.00 0.00 ? 101 ASN B OD1  1  
ATOM 4010   N ND2  . ASN B 1 97  ? 76.989  46.890  103.276 1.00 0.00 ? 101 ASN B ND2  1  
ATOM 4011   H H    . ASN B 1 97  ? 77.221  51.535  102.345 1.00 0.00 ? 101 ASN B H    1  
ATOM 4012   H HA   . ASN B 1 97  ? 75.576  49.372  102.579 1.00 0.00 ? 101 ASN B HA   1  
ATOM 4013   H HB2  . ASN B 1 97  ? 77.934  49.815  104.039 1.00 0.00 ? 101 ASN B HB2  1  
ATOM 4014   H HB3  . ASN B 1 97  ? 76.796  48.965  104.684 1.00 0.00 ? 101 ASN B HB3  1  
ATOM 4015   H HD21 . ASN B 1 97  ? 77.240  46.161  102.895 1.00 0.00 ? 101 ASN B HD21 1  
ATOM 4016   H HD22 . ASN B 1 97  ? 76.281  46.898  103.764 1.00 0.00 ? 101 ASN B HD22 1  
ATOM 4017   N N    . ASP B 1 98  ? 74.762  51.992  103.420 1.00 0.00 ? 102 ASP B N    1  
ATOM 4018   C CA   . ASP B 1 98  ? 73.695  52.743  104.057 1.00 0.00 ? 102 ASP B CA   1  
ATOM 4019   C C    . ASP B 1 98  ? 72.970  53.545  102.982 1.00 0.00 ? 102 ASP B C    1  
ATOM 4020   O O    . ASP B 1 98  ? 73.409  53.628  101.834 1.00 0.00 ? 102 ASP B O    1  
ATOM 4021   C CB   . ASP B 1 98  ? 74.246  53.644  105.162 1.00 0.00 ? 102 ASP B CB   1  
ATOM 4022   C CG   . ASP B 1 98  ? 73.159  54.225  106.045 1.00 0.00 ? 102 ASP B CG   1  
ATOM 4023   O OD1  . ASP B 1 98  ? 73.329  55.364  106.526 1.00 0.00 ? 102 ASP B OD1  1  
ATOM 4024   O OD2  . ASP B 1 98  ? 72.140  53.541  106.266 1.00 0.00 ? 102 ASP B OD2  1  
ATOM 4025   H H    . ASP B 1 98  ? 75.059  52.350  102.696 1.00 0.00 ? 102 ASP B H    1  
ATOM 4026   H HA   . ASP B 1 98  ? 73.068  52.137  104.482 1.00 0.00 ? 102 ASP B HA   1  
ATOM 4027   H HB2  . ASP B 1 98  ? 74.864  53.136  105.710 1.00 0.00 ? 102 ASP B HB2  1  
ATOM 4028   H HB3  . ASP B 1 98  ? 74.752  54.368  104.761 1.00 0.00 ? 102 ASP B HB3  1  
ATOM 4029   N N    . LYS B 1 99  ? 71.845  54.151  103.349 1.00 0.00 ? 103 LYS B N    1  
ATOM 4030   C CA   . LYS B 1 99  ? 71.164  55.081  102.462 1.00 0.00 ? 103 LYS B CA   1  
ATOM 4031   C C    . LYS B 1 99  ? 72.103  56.201  102.035 1.00 0.00 ? 103 LYS B C    1  
ATOM 4032   O O    . LYS B 1 99  ? 72.413  56.352  100.850 1.00 0.00 ? 103 LYS B O    1  
ATOM 4033   C CB   . LYS B 1 99  ? 69.932  55.655  103.161 1.00 0.00 ? 103 LYS B CB   1  
ATOM 4034   C CG   . LYS B 1 99  ? 68.857  54.631  103.454 1.00 0.00 ? 103 LYS B CG   1  
ATOM 4035   C CD   . LYS B 1 99  ? 68.754  54.374  104.942 1.00 0.00 ? 103 LYS B CD   1  
ATOM 4036   C CE   . LYS B 1 99  ? 69.284  53.004  105.307 1.00 0.00 ? 103 LYS B CE   1  
ATOM 4037   N NZ   . LYS B 1 99  ? 68.192  51.992  105.323 1.00 0.00 ? 103 LYS B NZ   1  
ATOM 4038   H H    . LYS B 1 99  ? 71.461  54.036  104.110 1.00 0.00 ? 103 LYS B H    1  
ATOM 4039   H HA   . LYS B 1 99  ? 70.881  54.603  101.667 1.00 0.00 ? 103 LYS B HA   1  
ATOM 4040   H HB2  . LYS B 1 99  ? 70.207  56.068  103.994 1.00 0.00 ? 103 LYS B HB2  1  
ATOM 4041   H HB3  . LYS B 1 99  ? 69.555  56.358  102.608 1.00 0.00 ? 103 LYS B HB3  1  
ATOM 4042   H HG2  . LYS B 1 99  ? 68.004  54.945  103.115 1.00 0.00 ? 103 LYS B HG2  1  
ATOM 4043   H HG3  . LYS B 1 99  ? 69.058  53.802  102.991 1.00 0.00 ? 103 LYS B HG3  1  
ATOM 4044   H HD2  . LYS B 1 99  ? 69.251  55.053  105.424 1.00 0.00 ? 103 LYS B HD2  1  
ATOM 4045   H HD3  . LYS B 1 99  ? 67.828  54.449  105.222 1.00 0.00 ? 103 LYS B HD3  1  
ATOM 4046   H HE2  . LYS B 1 99  ? 69.965  52.738  104.671 1.00 0.00 ? 103 LYS B HE2  1  
ATOM 4047   H HE3  . LYS B 1 99  ? 69.708  53.040  106.179 1.00 0.00 ? 103 LYS B HE3  1  
ATOM 4048   H HZ1  . LYS B 1 99  ? 67.602  52.182  104.684 1.00 0.00 ? 103 LYS B HZ1  1  
ATOM 4049   H HZ2  . LYS B 1 99  ? 68.535  51.183  105.179 1.00 0.00 ? 103 LYS B HZ2  1  
ATOM 4050   H HZ3  . LYS B 1 99  ? 67.786  52.006  106.115 1.00 0.00 ? 103 LYS B HZ3  1  
ATOM 4051   N N    . TYR B 1 100 ? 72.568  56.981  103.003 1.00 0.00 ? 104 TYR B N    1  
ATOM 4052   C CA   . TYR B 1 100 ? 73.486  58.081  102.785 1.00 0.00 ? 104 TYR B CA   1  
ATOM 4053   C C    . TYR B 1 100 ? 74.441  58.121  103.971 1.00 0.00 ? 104 TYR B C    1  
ATOM 4054   O O    . TYR B 1 100 ? 74.362  57.290  104.880 1.00 0.00 ? 104 TYR B O    1  
ATOM 4055   C CB   . TYR B 1 100 ? 72.719  59.398  102.620 1.00 0.00 ? 104 TYR B CB   1  
ATOM 4056   C CG   . TYR B 1 100 ? 72.250  59.638  101.202 1.00 0.00 ? 104 TYR B CG   1  
ATOM 4057   C CD1  . TYR B 1 100 ? 72.991  59.199  100.111 1.00 0.00 ? 104 TYR B CD1  1  
ATOM 4058   C CD2  . TYR B 1 100 ? 71.047  60.291  100.955 1.00 0.00 ? 104 TYR B CD2  1  
ATOM 4059   C CE1  . TYR B 1 100 ? 72.553  59.416  98.817  1.00 0.00 ? 104 TYR B CE1  1  
ATOM 4060   C CE2  . TYR B 1 100 ? 70.602  60.512  99.665  1.00 0.00 ? 104 TYR B CE2  1  
ATOM 4061   C CZ   . TYR B 1 100 ? 71.360  60.073  98.603  1.00 0.00 ? 104 TYR B CZ   1  
ATOM 4062   O OH   . TYR B 1 100 ? 70.923  60.290  97.318  1.00 0.00 ? 104 TYR B OH   1  
ATOM 4063   H H    . TYR B 1 100 ? 72.348  56.880  103.829 1.00 0.00 ? 104 TYR B H    1  
ATOM 4064   H HA   . TYR B 1 100 ? 73.992  57.954  101.966 1.00 0.00 ? 104 TYR B HA   1  
ATOM 4065   H HB2  . TYR B 1 100 ? 71.951  59.395  103.213 1.00 0.00 ? 104 TYR B HB2  1  
ATOM 4066   H HB3  . TYR B 1 100 ? 73.287  60.135  102.897 1.00 0.00 ? 104 TYR B HB3  1  
ATOM 4067   H HD1  . TYR B 1 100 ? 73.794  58.753  100.254 1.00 0.00 ? 104 TYR B HD1  1  
ATOM 4068   H HD2  . TYR B 1 100 ? 70.533  60.584  101.672 1.00 0.00 ? 104 TYR B HD2  1  
ATOM 4069   H HE1  . TYR B 1 100 ? 73.061  59.122  98.096  1.00 0.00 ? 104 TYR B HE1  1  
ATOM 4070   H HE2  . TYR B 1 100 ? 69.798  60.954  99.517  1.00 0.00 ? 104 TYR B HE2  1  
ATOM 4071   H HH   . TYR B 1 100 ? 70.986  61.107  97.135  1.00 0.00 ? 104 TYR B HH   1  
ATOM 4072   N N    . ASP B 1 101 ? 75.350  59.090  103.969 1.00 0.00 ? 105 ASP B N    1  
ATOM 4073   C CA   . ASP B 1 101 ? 76.280  59.248  105.078 1.00 0.00 ? 105 ASP B CA   1  
ATOM 4074   C C    . ASP B 1 101 ? 76.163  60.658  105.641 1.00 0.00 ? 105 ASP B C    1  
ATOM 4075   O O    . ASP B 1 101 ? 76.038  61.642  104.902 1.00 0.00 ? 105 ASP B O    1  
ATOM 4076   C CB   . ASP B 1 101 ? 77.717  58.918  104.658 1.00 0.00 ? 105 ASP B CB   1  
ATOM 4077   C CG   . ASP B 1 101 ? 78.125  59.618  103.388 1.00 0.00 ? 105 ASP B CG   1  
ATOM 4078   O OD1  . ASP B 1 101 ? 78.848  60.629  103.479 1.00 0.00 ? 105 ASP B OD1  1  
ATOM 4079   O OD2  . ASP B 1 101 ? 77.724  59.162  102.298 1.00 0.00 ? 105 ASP B OD2  1  
ATOM 4080   H H    . ASP B 1 101 ? 75.444  59.665  103.336 1.00 0.00 ? 105 ASP B H    1  
ATOM 4081   H HA   . ASP B 1 101 ? 76.048  58.617  105.777 1.00 0.00 ? 105 ASP B HA   1  
ATOM 4082   H HB2  . ASP B 1 101 ? 78.325  59.169  105.371 1.00 0.00 ? 105 ASP B HB2  1  
ATOM 4083   H HB3  . ASP B 1 101 ? 77.802  57.959  104.536 1.00 0.00 ? 105 ASP B HB3  1  
ATOM 4084   N N    . ALA B 1 102 ? 76.222  60.741  106.967 1.00 0.00 ? 106 ALA B N    1  
ATOM 4085   C CA   . ALA B 1 102 ? 75.783  61.937  107.664 1.00 0.00 ? 106 ALA B CA   1  
ATOM 4086   C C    . ALA B 1 102 ? 76.736  62.255  108.804 1.00 0.00 ? 106 ALA B C    1  
ATOM 4087   O O    . ALA B 1 102 ? 77.494  61.400  109.269 1.00 0.00 ? 106 ALA B O    1  
ATOM 4088   C CB   . ALA B 1 102 ? 74.361  61.757  108.212 1.00 0.00 ? 106 ALA B CB   1  
ATOM 4089   H H    . ALA B 1 102 ? 76.514  60.114  107.478 1.00 0.00 ? 106 ALA B H    1  
ATOM 4090   H HA   . ALA B 1 102 ? 75.780  62.674  107.034 1.00 0.00 ? 106 ALA B HA   1  
ATOM 4091   H HB1  . ALA B 1 102 ? 74.305  60.919  108.698 1.00 0.00 ? 106 ALA B HB1  1  
ATOM 4092   H HB2  . ALA B 1 102 ? 74.148  62.491  108.808 1.00 0.00 ? 106 ALA B HB2  1  
ATOM 4093   H HB3  . ALA B 1 102 ? 73.730  61.745  107.476 1.00 0.00 ? 106 ALA B HB3  1  
ATOM 4094   N N    . GLN B 1 103 ? 76.687  63.509  109.242 1.00 0.00 ? 107 GLN B N    1  
ATOM 4095   C CA   . GLN B 1 103 ? 77.120  63.909  110.572 1.00 0.00 ? 107 GLN B CA   1  
ATOM 4096   C C    . GLN B 1 103 ? 75.944  64.630  111.215 1.00 0.00 ? 107 GLN B C    1  
ATOM 4097   O O    . GLN B 1 103 ? 75.242  65.397  110.548 1.00 0.00 ? 107 GLN B O    1  
ATOM 4098   C CB   . GLN B 1 103 ? 78.369  64.790  110.521 1.00 0.00 ? 107 GLN B CB   1  
ATOM 4099   C CG   . GLN B 1 103 ? 78.644  65.544  111.825 1.00 0.00 ? 107 GLN B CG   1  
ATOM 4100   C CD   . GLN B 1 103 ? 79.937  66.347  111.797 1.00 0.00 ? 107 GLN B CD   1  
ATOM 4101   O OE1  . GLN B 1 103 ? 80.427  66.721  110.734 1.00 0.00 ? 107 GLN B OE1  1  
ATOM 4102   N NE2  . GLN B 1 103 ? 80.494  66.615  112.970 1.00 0.00 ? 107 GLN B NE2  1  
ATOM 4103   H H    . GLN B 1 103 ? 76.395  64.162  108.763 1.00 0.00 ? 107 GLN B H    1  
ATOM 4104   H HA   . GLN B 1 103 ? 77.374  63.134  111.097 1.00 0.00 ? 107 GLN B HA   1  
ATOM 4105   H HB2  . GLN B 1 103 ? 79.137  64.237  110.308 1.00 0.00 ? 107 GLN B HB2  1  
ATOM 4106   H HB3  . GLN B 1 103 ? 78.273  65.432  109.799 1.00 0.00 ? 107 GLN B HB3  1  
ATOM 4107   H HG2  . GLN B 1 103 ? 77.902  66.143  112.008 1.00 0.00 ? 107 GLN B HG2  1  
ATOM 4108   H HG3  . GLN B 1 103 ? 78.683  64.908  112.557 1.00 0.00 ? 107 GLN B HG3  1  
ATOM 4109   H HE21 . GLN B 1 103 ? 80.124  66.338  113.695 1.00 0.00 ? 107 GLN B HE21 1  
ATOM 4110   H HE22 . GLN B 1 103 ? 81.226  67.066  113.005 1.00 0.00 ? 107 GLN B HE22 1  
ATOM 4111   N N    . PHE B 1 104 ? 75.724  64.368  112.499 1.00 0.00 ? 108 PHE B N    1  
ATOM 4112   C CA   . PHE B 1 104 ? 74.474  64.678  113.178 1.00 0.00 ? 108 PHE B CA   1  
ATOM 4113   C C    . PHE B 1 104 ? 74.748  65.378  114.500 1.00 0.00 ? 108 PHE B C    1  
ATOM 4114   O O    . PHE B 1 104 ? 75.771  65.135  115.145 1.00 0.00 ? 108 PHE B O    1  
ATOM 4115   C CB   . PHE B 1 104 ? 73.670  63.379  113.405 1.00 0.00 ? 108 PHE B CB   1  
ATOM 4116   C CG   . PHE B 1 104 ? 72.402  63.565  114.188 1.00 0.00 ? 108 PHE B CG   1  
ATOM 4117   C CD1  . PHE B 1 104 ? 71.476  64.528  113.823 1.00 0.00 ? 108 PHE B CD1  1  
ATOM 4118   C CD2  . PHE B 1 104 ? 72.142  62.775  115.296 1.00 0.00 ? 108 PHE B CD2  1  
ATOM 4119   C CE1  . PHE B 1 104 ? 70.313  64.698  114.552 1.00 0.00 ? 108 PHE B CE1  1  
ATOM 4120   C CE2  . PHE B 1 104 ? 70.981  62.935  116.027 1.00 0.00 ? 108 PHE B CE2  1  
ATOM 4121   C CZ   . PHE B 1 104 ? 70.064  63.898  115.654 1.00 0.00 ? 108 PHE B CZ   1  
ATOM 4122   H H    . PHE B 1 104 ? 76.310  63.997  113.009 1.00 0.00 ? 108 PHE B H    1  
ATOM 4123   H HA   . PHE B 1 104 ? 73.951  65.277  112.622 1.00 0.00 ? 108 PHE B HA   1  
ATOM 4124   H HB2  . PHE B 1 104 ? 73.451  62.992  112.543 1.00 0.00 ? 108 PHE B HB2  1  
ATOM 4125   H HB3  . PHE B 1 104 ? 74.232  62.739  113.868 1.00 0.00 ? 108 PHE B HB3  1  
ATOM 4126   H HD1  . PHE B 1 104 ? 71.638  65.065  113.081 1.00 0.00 ? 108 PHE B HD1  1  
ATOM 4127   H HD2  . PHE B 1 104 ? 72.759  62.127  115.552 1.00 0.00 ? 108 PHE B HD2  1  
ATOM 4128   H HE1  . PHE B 1 104 ? 69.699  65.349  114.302 1.00 0.00 ? 108 PHE B HE1  1  
ATOM 4129   H HE2  . PHE B 1 104 ? 70.817  62.396  116.767 1.00 0.00 ? 108 PHE B HE2  1  
ATOM 4130   H HZ   . PHE B 1 104 ? 69.280  64.009  116.142 1.00 0.00 ? 108 PHE B HZ   1  
ATOM 4131   N N    . GLY B 1 105 ? 73.838  66.262  114.899 1.00 0.00 ? 109 GLY B N    1  
ATOM 4132   C CA   . GLY B 1 105 ? 73.923  66.821  116.234 1.00 0.00 ? 109 GLY B CA   1  
ATOM 4133   C C    . GLY B 1 105 ? 72.661  67.554  116.620 1.00 0.00 ? 109 GLY B C    1  
ATOM 4134   O O    . GLY B 1 105 ? 71.692  67.611  115.857 1.00 0.00 ? 109 GLY B O    1  
ATOM 4135   H H    . GLY B 1 105 ? 73.180  66.543  114.422 1.00 0.00 ? 109 GLY B H    1  
ATOM 4136   H HA2  . GLY B 1 105 ? 74.090  66.109  116.871 1.00 0.00 ? 109 GLY B HA2  1  
ATOM 4137   H HA3  . GLY B 1 105 ? 74.677  67.429  116.282 1.00 0.00 ? 109 GLY B HA3  1  
ATOM 4138   N N    . PHE B 1 106 ? 72.689  68.117  117.826 1.00 0.00 ? 110 PHE B N    1  
ATOM 4139   C CA   . PHE B 1 106 ? 71.684  69.077  118.263 1.00 0.00 ? 110 PHE B CA   1  
ATOM 4140   C C    . PHE B 1 106 ? 72.351  70.443  118.330 1.00 0.00 ? 110 PHE B C    1  
ATOM 4141   O O    . PHE B 1 106 ? 73.415  70.593  118.938 1.00 0.00 ? 110 PHE B O    1  
ATOM 4142   C CB   . PHE B 1 106 ? 71.102  68.686  119.618 1.00 0.00 ? 110 PHE B CB   1  
ATOM 4143   C CG   . PHE B 1 106 ? 70.063  67.612  119.541 1.00 0.00 ? 110 PHE B CG   1  
ATOM 4144   C CD1  . PHE B 1 106 ? 69.008  67.588  120.438 1.00 0.00 ? 110 PHE B CD1  1  
ATOM 4145   C CD2  . PHE B 1 106 ? 70.133  66.633  118.563 1.00 0.00 ? 110 PHE B CD2  1  
ATOM 4146   C CE1  . PHE B 1 106 ? 68.048  66.596  120.372 1.00 0.00 ? 110 PHE B CE1  1  
ATOM 4147   C CE2  . PHE B 1 106 ? 69.173  65.641  118.488 1.00 0.00 ? 110 PHE B CE2  1  
ATOM 4148   C CZ   . PHE B 1 106 ? 68.129  65.624  119.394 1.00 0.00 ? 110 PHE B CZ   1  
ATOM 4149   H H    . PHE B 1 106 ? 73.295  67.951  118.414 1.00 0.00 ? 110 PHE B H    1  
ATOM 4150   H HA   . PHE B 1 106 ? 70.942  69.096  117.637 1.00 0.00 ? 110 PHE B HA   1  
ATOM 4151   H HB2  . PHE B 1 106 ? 71.822  68.386  120.195 1.00 0.00 ? 110 PHE B HB2  1  
ATOM 4152   H HB3  . PHE B 1 106 ? 70.714  69.472  120.033 1.00 0.00 ? 110 PHE B HB3  1  
ATOM 4153   H HD1  . PHE B 1 106 ? 68.945  68.246  121.092 1.00 0.00 ? 110 PHE B HD1  1  
ATOM 4154   H HD2  . PHE B 1 106 ? 70.834  66.644  117.951 1.00 0.00 ? 110 PHE B HD2  1  
ATOM 4155   H HE1  . PHE B 1 106 ? 67.349  66.582  120.986 1.00 0.00 ? 110 PHE B HE1  1  
ATOM 4156   H HE2  . PHE B 1 106 ? 69.230  64.986  117.830 1.00 0.00 ? 110 PHE B HE2  1  
ATOM 4157   H HZ   . PHE B 1 106 ? 67.481  64.958  119.345 1.00 0.00 ? 110 PHE B HZ   1  
ATOM 4158   N N    . ALA B 1 107 ? 71.725  71.436  117.714 1.00 0.00 ? 111 ALA B N    1  
ATOM 4159   C CA   . ALA B 1 107 ? 72.344  72.734  117.510 1.00 0.00 ? 111 ALA B CA   1  
ATOM 4160   C C    . ALA B 1 107 ? 71.417  73.860  117.942 1.00 0.00 ? 111 ALA B C    1  
ATOM 4161   O O    . ALA B 1 107 ? 70.198  73.692  118.067 1.00 0.00 ? 111 ALA B O    1  
ATOM 4162   C CB   . ALA B 1 107 ? 72.745  72.922  116.045 1.00 0.00 ? 111 ALA B CB   1  
ATOM 4163   H H    . ALA B 1 107 ? 70.925  71.376  117.402 1.00 0.00 ? 111 ALA B H    1  
ATOM 4164   H HA   . ALA B 1 107 ? 73.143  72.765  118.060 1.00 0.00 ? 111 ALA B HA   1  
ATOM 4165   H HB1  . ALA B 1 107 ? 73.434  72.280  115.812 1.00 0.00 ? 111 ALA B HB1  1  
ATOM 4166   H HB2  . ALA B 1 107 ? 71.970  72.785  115.477 1.00 0.00 ? 111 ALA B HB2  1  
ATOM 4167   H HB3  . ALA B 1 107 ? 73.085  73.822  115.915 1.00 0.00 ? 111 ALA B HB3  1  
ATOM 4168   N N    . TYR B 1 108 ? 72.024  75.024  118.152 1.00 0.00 ? 112 TYR B N    1  
ATOM 4169   C CA   . TYR B 1 108 ? 71.341  76.193  118.689 1.00 0.00 ? 112 TYR B CA   1  
ATOM 4170   C C    . TYR B 1 108 ? 71.616  77.367  117.760 1.00 0.00 ? 112 TYR B C    1  
ATOM 4171   O O    . TYR B 1 108 ? 72.540  77.309  116.944 1.00 0.00 ? 112 TYR B O    1  
ATOM 4172   C CB   . TYR B 1 108 ? 71.821  76.488  120.108 1.00 0.00 ? 112 TYR B CB   1  
ATOM 4173   C CG   . TYR B 1 108 ? 70.745  77.013  121.013 1.00 0.00 ? 112 TYR B CG   1  
ATOM 4174   C CD1  . TYR B 1 108 ? 69.879  76.144  121.659 1.00 0.00 ? 112 TYR B CD1  1  
ATOM 4175   C CD2  . TYR B 1 108 ? 70.582  78.374  121.213 1.00 0.00 ? 112 TYR B CD2  1  
ATOM 4176   C CE1  . TYR B 1 108 ? 68.893  76.613  122.489 1.00 0.00 ? 112 TYR B CE1  1  
ATOM 4177   C CE2  . TYR B 1 108 ? 69.590  78.855  122.042 1.00 0.00 ? 112 TYR B CE2  1  
ATOM 4178   C CZ   . TYR B 1 108 ? 68.749  77.966  122.673 1.00 0.00 ? 112 TYR B CZ   1  
ATOM 4179   O OH   . TYR B 1 108 ? 67.753  78.420  123.493 1.00 0.00 ? 112 TYR B OH   1  
ATOM 4180   H H    . TYR B 1 108 ? 72.857  75.158  117.983 1.00 0.00 ? 112 TYR B H    1  
ATOM 4181   H HA   . TYR B 1 108 ? 70.386  76.033  118.738 1.00 0.00 ? 112 TYR B HA   1  
ATOM 4182   H HB2  . TYR B 1 108 ? 72.187  75.677  120.492 1.00 0.00 ? 112 TYR B HB2  1  
ATOM 4183   H HB3  . TYR B 1 108 ? 72.542  77.135  120.069 1.00 0.00 ? 112 TYR B HB3  1  
ATOM 4184   H HD1  . TYR B 1 108 ? 69.969  75.228  121.527 1.00 0.00 ? 112 TYR B HD1  1  
ATOM 4185   H HD2  . TYR B 1 108 ? 71.151  78.971  120.784 1.00 0.00 ? 112 TYR B HD2  1  
ATOM 4186   H HE1  . TYR B 1 108 ? 68.325  76.019  122.925 1.00 0.00 ? 112 TYR B HE1  1  
ATOM 4187   H HE2  . TYR B 1 108 ? 69.490  79.770  122.173 1.00 0.00 ? 112 TYR B HE2  1  
ATOM 4188   H HH   . TYR B 1 108 ? 67.469  79.158  123.208 1.00 0.00 ? 112 TYR B HH   1  
ATOM 4189   N N    . ILE B 1 109 ? 70.806  78.422  117.872 1.00 0.00 ? 113 ILE B N    1  
ATOM 4190   C CA   . ILE B 1 109 ? 70.985  79.607  117.040 1.00 0.00 ? 113 ILE B CA   1  
ATOM 4191   C C    . ILE B 1 109 ? 71.778  80.649  117.809 1.00 0.00 ? 113 ILE B C    1  
ATOM 4192   O O    . ILE B 1 109 ? 71.205  81.523  118.471 1.00 0.00 ? 113 ILE B O    1  
ATOM 4193   C CB   . ILE B 1 109 ? 69.625  80.173  116.607 1.00 0.00 ? 113 ILE B CB   1  
ATOM 4194   C CG1  . ILE B 1 109 ? 68.486  79.377  117.238 1.00 0.00 ? 113 ILE B CG1  1  
ATOM 4195   C CG2  . ILE B 1 109 ? 69.506  80.174  115.098 1.00 0.00 ? 113 ILE B CG2  1  
ATOM 4196   C CD1  . ILE B 1 109 ? 68.125  79.786  118.667 1.00 0.00 ? 113 ILE B CD1  1  
ATOM 4197   H H    . ILE B 1 109 ? 70.149  78.469  118.424 1.00 0.00 ? 113 ILE B H    1  
ATOM 4198   H HA   . ILE B 1 109 ? 71.473  79.363  116.238 1.00 0.00 ? 113 ILE B HA   1  
ATOM 4199   H HB   . ILE B 1 109 ? 69.562  81.090  116.917 1.00 0.00 ? 113 ILE B HB   1  
ATOM 4200   H HG12 . ILE B 1 109 ? 67.697  79.469  116.680 1.00 0.00 ? 113 ILE B HG12 1  
ATOM 4201   H HG13 . ILE B 1 109 ? 68.726  78.437  117.235 1.00 0.00 ? 113 ILE B HG13 1  
ATOM 4202   H HG21 . ILE B 1 109 ? 68.626  80.492  114.842 1.00 0.00 ? 113 ILE B HG21 1  
ATOM 4203   H HG22 . ILE B 1 109 ? 70.182  80.759  114.721 1.00 0.00 ? 113 ILE B HG22 1  
ATOM 4204   H HG23 . ILE B 1 109 ? 69.634  79.273  114.762 1.00 0.00 ? 113 ILE B HG23 1  
ATOM 4205   H HD11 . ILE B 1 109 ? 67.245  79.445  118.889 1.00 0.00 ? 113 ILE B HD11 1  
ATOM 4206   H HD12 . ILE B 1 109 ? 68.778  79.419  119.283 1.00 0.00 ? 113 ILE B HD12 1  
ATOM 4207   H HD13 . ILE B 1 109 ? 68.123  80.753  118.736 1.00 0.00 ? 113 ILE B HD13 1  
ATOM 4208   N N    . GLU B 1 110 ? 73.107  80.564  117.735 1.00 0.00 ? 114 GLU B N    1  
ATOM 4209   C CA   . GLU B 1 110 ? 73.945  81.552  118.400 1.00 0.00 ? 114 GLU B CA   1  
ATOM 4210   C C    . GLU B 1 110 ? 73.790  82.964  117.857 1.00 0.00 ? 114 GLU B C    1  
ATOM 4211   O O    . GLU B 1 110 ? 73.716  83.906  118.653 1.00 0.00 ? 114 GLU B O    1  
ATOM 4212   C CB   . GLU B 1 110 ? 75.427  81.143  118.334 1.00 0.00 ? 114 GLU B CB   1  
ATOM 4213   C CG   . GLU B 1 110 ? 76.126  81.221  119.681 1.00 0.00 ? 114 GLU B CG   1  
ATOM 4214   C CD   . GLU B 1 110 ? 77.468  80.520  119.730 1.00 0.00 ? 114 GLU B CD   1  
ATOM 4215   O OE1  . GLU B 1 110 ? 77.871  79.910  118.717 1.00 0.00 ? 114 GLU B OE1  1  
ATOM 4216   O OE2  . GLU B 1 110 ? 78.106  80.569  120.800 1.00 0.00 ? 114 GLU B OE2  1  
ATOM 4217   H H    . GLU B 1 110 ? 73.535  79.950  117.311 1.00 0.00 ? 114 GLU B H    1  
ATOM 4218   H HA   . GLU B 1 110 ? 73.639  81.569  119.320 1.00 0.00 ? 114 GLU B HA   1  
ATOM 4219   H HB2  . GLU B 1 110 ? 75.492  80.237  117.994 1.00 0.00 ? 114 GLU B HB2  1  
ATOM 4220   H HB3  . GLU B 1 110 ? 75.889  81.716  117.703 1.00 0.00 ? 114 GLU B HB3  1  
ATOM 4221   H HG2  . GLU B 1 110 ? 76.252  82.154  119.914 1.00 0.00 ? 114 GLU B HG2  1  
ATOM 4222   H HG3  . GLU B 1 110 ? 75.547  80.835  120.357 1.00 0.00 ? 114 GLU B HG3  1  
ATOM 4223   N N    . SER B 1 111 ? 73.727  83.144  116.542 1.00 0.00 ? 115 SER B N    1  
ATOM 4224   C CA   . SER B 1 111 ? 73.462  84.455  115.974 1.00 0.00 ? 115 SER B CA   1  
ATOM 4225   C C    . SER B 1 111 ? 72.888  84.286  114.579 1.00 0.00 ? 115 SER B C    1  
ATOM 4226   O O    . SER B 1 111 ? 73.066  83.241  113.947 1.00 0.00 ? 115 SER B O    1  
ATOM 4227   C CB   . SER B 1 111 ? 74.725  85.323  115.925 1.00 0.00 ? 115 SER B CB   1  
ATOM 4228   O OG   . SER B 1 111 ? 74.409  86.667  115.615 1.00 0.00 ? 115 SER B OG   1  
ATOM 4229   H H    . SER B 1 111 ? 73.835  82.517  115.962 1.00 0.00 ? 115 SER B H    1  
ATOM 4230   H HA   . SER B 1 111 ? 72.823  84.912  116.543 1.00 0.00 ? 115 SER B HA   1  
ATOM 4231   H HB2  . SER B 1 111 ? 75.181  85.284  116.780 1.00 0.00 ? 115 SER B HB2  1  
ATOM 4232   H HB3  . SER B 1 111 ? 75.338  84.970  115.261 1.00 0.00 ? 115 SER B HB3  1  
ATOM 4233   H HG   . SER B 1 111 ? 73.745  86.910  116.067 1.00 0.00 ? 115 SER B HG   1  
ATOM 4234   N N    . ARG B 1 112 ? 72.201  85.324  114.113 1.00 0.00 ? 116 ARG B N    1  
ATOM 4235   C CA   . ARG B 1 112 ? 71.629  85.390  112.770 1.00 0.00 ? 116 ARG B CA   1  
ATOM 4236   C C    . ARG B 1 112 ? 71.985  86.781  112.261 1.00 0.00 ? 116 ARG B C    1  
ATOM 4237   O O    . ARG B 1 112 ? 72.100  87.740  113.029 1.00 0.00 ? 116 ARG B O    1  
ATOM 4238   C CB   . ARG B 1 112 ? 70.124  85.114  112.800 1.00 0.00 ? 116 ARG B CB   1  
ATOM 4239   C CG   . ARG B 1 112 ? 69.610  83.960  111.945 1.00 0.00 ? 116 ARG B CG   1  
ATOM 4240   C CD   . ARG B 1 112 ? 68.318  84.358  111.269 1.00 0.00 ? 116 ARG B CD   1  
ATOM 4241   N NE   . ARG B 1 112 ? 67.303  84.667  112.268 1.00 0.00 ? 116 ARG B NE   1  
ATOM 4242   C CZ   . ARG B 1 112 ? 66.000  84.476  112.099 1.00 0.00 ? 116 ARG B CZ   1  
ATOM 4243   N NH1  . ARG B 1 112 ? 65.540  83.986  110.960 1.00 0.00 ? 116 ARG B NH1  1  
ATOM 4244   N NH2  . ARG B 1 112 ? 65.154  84.794  113.067 1.00 0.00 ? 116 ARG B NH2  1  
ATOM 4245   H H    . ARG B 1 112 ? 72.050  86.030  114.581 1.00 0.00 ? 116 ARG B H    1  
ATOM 4246   H HA   . ARG B 1 112 ? 71.982  84.711  112.173 1.00 0.00 ? 116 ARG B HA   1  
ATOM 4247   H HB2  . ARG B 1 112 ? 69.868  84.944  113.720 1.00 0.00 ? 116 ARG B HB2  1  
ATOM 4248   H HB3  . ARG B 1 112 ? 69.664  85.921  112.522 1.00 0.00 ? 116 ARG B HB3  1  
ATOM 4249   H HG2  . ARG B 1 112 ? 70.272  83.720  111.278 1.00 0.00 ? 116 ARG B HG2  1  
ATOM 4250   H HG3  . ARG B 1 112 ? 69.468  83.176  112.497 1.00 0.00 ? 116 ARG B HG3  1  
ATOM 4251   H HD2  . ARG B 1 112 ? 68.466  85.129  110.700 1.00 0.00 ? 116 ARG B HD2  1  
ATOM 4252   H HD3  . ARG B 1 112 ? 68.009  83.638  110.697 1.00 0.00 ? 116 ARG B HD3  1  
ATOM 4253   H HE   . ARG B 1 112 ? 67.566  84.996  113.018 1.00 0.00 ? 116 ARG B HE   1  
ATOM 4254   H HH11 . ARG B 1 112 ? 66.085  83.790  110.324 1.00 0.00 ? 116 ARG B HH11 1  
ATOM 4255   H HH12 . ARG B 1 112 ? 64.696  83.863  110.855 1.00 0.00 ? 116 ARG B HH12 1  
ATOM 4256   H HH21 . ARG B 1 112 ? 65.449  85.124  113.804 1.00 0.00 ? 116 ARG B HH21 1  
ATOM 4257   H HH22 . ARG B 1 112 ? 64.310  84.670  112.957 1.00 0.00 ? 116 ARG B HH22 1  
ATOM 4258   N N    . GLU B 1 113 ? 72.204  86.869  110.957 1.00 0.00 ? 117 GLU B N    1  
ATOM 4259   C CA   . GLU B 1 113 ? 72.601  88.095  110.283 1.00 0.00 ? 117 GLU B CA   1  
ATOM 4260   C C    . GLU B 1 113 ? 71.769  88.200  109.017 1.00 0.00 ? 117 GLU B C    1  
ATOM 4261   O O    . GLU B 1 113 ? 71.642  87.221  108.274 1.00 0.00 ? 117 GLU B O    1  
ATOM 4262   C CB   . GLU B 1 113 ? 74.091  88.076  109.954 1.00 0.00 ? 117 GLU B CB   1  
ATOM 4263   C CG   . GLU B 1 113 ? 74.643  89.418  109.505 1.00 0.00 ? 117 GLU B CG   1  
ATOM 4264   C CD   . GLU B 1 113 ? 74.438  89.668  108.021 1.00 0.00 ? 117 GLU B CD   1  
ATOM 4265   O OE1  . GLU B 1 113 ? 74.893  88.841  107.207 1.00 0.00 ? 117 GLU B OE1  1  
ATOM 4266   O OE2  . GLU B 1 113 ? 73.813  90.690  107.669 1.00 0.00 ? 117 GLU B OE2  1  
ATOM 4267   H H    . GLU B 1 113 ? 72.125  86.197  110.425 1.00 0.00 ? 117 GLU B H    1  
ATOM 4268   H HA   . GLU B 1 113 ? 72.449  88.863  110.856 1.00 0.00 ? 117 GLU B HA   1  
ATOM 4269   H HB2  . GLU B 1 113 ? 74.581  87.781  110.737 1.00 0.00 ? 117 GLU B HB2  1  
ATOM 4270   H HB3  . GLU B 1 113 ? 74.250  87.422  109.256 1.00 0.00 ? 117 GLU B HB3  1  
ATOM 4271   H HG2  . GLU B 1 113 ? 74.213  90.125  110.012 1.00 0.00 ? 117 GLU B HG2  1  
ATOM 4272   H HG3  . GLU B 1 113 ? 75.591  89.458  109.709 1.00 0.00 ? 117 GLU B HG3  1  
ATOM 4273   N N    . TYR B 1 114 ? 71.193  89.371  108.771 1.00 0.00 ? 118 TYR B N    1  
ATOM 4274   C CA   . TYR B 1 114 ? 70.434  89.596  107.553 1.00 0.00 ? 118 TYR B CA   1  
ATOM 4275   C C    . TYR B 1 114 ? 70.945  90.812  106.804 1.00 0.00 ? 118 TYR B C    1  
ATOM 4276   O O    . TYR B 1 114 ? 70.927  91.932  107.321 1.00 0.00 ? 118 TYR B O    1  
ATOM 4277   C CB   . TYR B 1 114 ? 68.930  89.732  107.819 1.00 0.00 ? 118 TYR B CB   1  
ATOM 4278   C CG   . TYR B 1 114 ? 68.385  89.223  109.117 1.00 0.00 ? 118 TYR B CG   1  
ATOM 4279   C CD1  . TYR B 1 114 ? 67.907  87.926  109.213 1.00 0.00 ? 118 TYR B CD1  1  
ATOM 4280   C CD2  . TYR B 1 114 ? 68.303  90.042  110.227 1.00 0.00 ? 118 TYR B CD2  1  
ATOM 4281   C CE1  . TYR B 1 114 ? 67.377  87.454  110.382 1.00 0.00 ? 118 TYR B CE1  1  
ATOM 4282   C CE2  . TYR B 1 114 ? 67.792  89.575  111.402 1.00 0.00 ? 118 TYR B CE2  1  
ATOM 4283   C CZ   . TYR B 1 114 ? 67.322  88.280  111.474 1.00 0.00 ? 118 TYR B CZ   1  
ATOM 4284   O OH   . TYR B 1 114 ? 66.796  87.805  112.652 1.00 0.00 ? 118 TYR B OH   1  
ATOM 4285   H H    . TYR B 1 114 ? 71.232  90.048  109.300 1.00 0.00 ? 118 TYR B H    1  
ATOM 4286   H HA   . TYR B 1 114 ? 70.562  88.809  107.000 1.00 0.00 ? 118 TYR B HA   1  
ATOM 4287   H HB2  . TYR B 1 114 ? 68.703  90.673  107.753 1.00 0.00 ? 118 TYR B HB2  1  
ATOM 4288   H HB3  . TYR B 1 114 ? 68.462  89.275  107.104 1.00 0.00 ? 118 TYR B HB3  1  
ATOM 4289   H HD1  . TYR B 1 114 ? 67.948  87.367  108.470 1.00 0.00 ? 118 TYR B HD1  1  
ATOM 4290   H HD2  . TYR B 1 114 ? 68.599  90.922  110.173 1.00 0.00 ? 118 TYR B HD2  1  
ATOM 4291   H HE1  . TYR B 1 114 ? 67.056  86.582  110.435 1.00 0.00 ? 118 TYR B HE1  1  
ATOM 4292   H HE2  . TYR B 1 114 ? 67.761  90.126  112.150 1.00 0.00 ? 118 TYR B HE2  1  
ATOM 4293   H HH   . TYR B 1 114 ? 66.411  87.072  112.512 1.00 0.00 ? 118 TYR B HH   1  
ATOM 4294   N N    . SER B 1 115 ? 71.407  90.570  105.585 1.00 0.00 ? 119 SER B N    1  
ATOM 4295   C CA   . SER B 1 115 ? 71.893  91.617  104.708 1.00 0.00 ? 119 SER B CA   1  
ATOM 4296   C C    . SER B 1 115 ? 70.910  91.829  103.571 1.00 0.00 ? 119 SER B C    1  
ATOM 4297   O O    . SER B 1 115 ? 70.471  90.866  102.923 1.00 0.00 ? 119 SER B O    1  
ATOM 4298   C CB   . SER B 1 115 ? 73.269  91.278  104.144 1.00 0.00 ? 119 SER B CB   1  
ATOM 4299   O OG   . SER B 1 115 ? 74.200  92.288  104.491 1.00 0.00 ? 119 SER B OG   1  
ATOM 4300   H H    . SER B 1 115 ? 71.446  89.782  105.242 1.00 0.00 ? 119 SER B H    1  
ATOM 4301   H HA   . SER B 1 115 ? 71.975  92.432  105.228 1.00 0.00 ? 119 SER B HA   1  
ATOM 4302   H HB2  . SER B 1 115 ? 73.566  90.421  104.489 1.00 0.00 ? 119 SER B HB2  1  
ATOM 4303   H HB3  . SER B 1 115 ? 73.218  91.192  103.179 1.00 0.00 ? 119 SER B HB3  1  
ATOM 4304   H HG   . SER B 1 115 ? 74.868  92.240  103.984 1.00 0.00 ? 119 SER B HG   1  
ATOM 4305   N N    . ASP B 1 116 ? 70.554  93.091  103.363 1.00 0.00 ? 120 ASP B N    1  
ATOM 4306   C CA   . ASP B 1 116 ? 69.834  93.570  102.192 1.00 0.00 ? 120 ASP B CA   1  
ATOM 4307   C C    . ASP B 1 116 ? 70.778  94.528  101.475 1.00 0.00 ? 120 ASP B C    1  
ATOM 4308   O O    . ASP B 1 116 ? 71.205  95.535  102.047 1.00 0.00 ? 120 ASP B O    1  
ATOM 4309   C CB   . ASP B 1 116 ? 68.537  94.265  102.595 1.00 0.00 ? 120 ASP B CB   1  
ATOM 4310   C CG   . ASP B 1 116 ? 67.724  94.745  101.403 1.00 0.00 ? 120 ASP B CG   1  
ATOM 4311   O OD1  . ASP B 1 116 ? 67.263  93.919  100.590 1.00 0.00 ? 120 ASP B OD1  1  
ATOM 4312   O OD2  . ASP B 1 116 ? 67.570  95.973  101.263 1.00 0.00 ? 120 ASP B OD2  1  
ATOM 4313   H H    . ASP B 1 116 ? 70.733  93.717  103.925 1.00 0.00 ? 120 ASP B H    1  
ATOM 4314   H HA   . ASP B 1 116 ? 69.579  92.836  101.610 1.00 0.00 ? 120 ASP B HA   1  
ATOM 4315   H HB2  . ASP B 1 116 ? 67.999  93.653  103.122 1.00 0.00 ? 120 ASP B HB2  1  
ATOM 4316   H HB3  . ASP B 1 116 ? 68.745  95.022  103.164 1.00 0.00 ? 120 ASP B HB3  1  
ATOM 4317   N N    . GLY B 1 117 ? 71.095  94.218  100.224 1.00 0.00 ? 121 GLY B N    1  
ATOM 4318   C CA   . GLY B 1 117 ? 71.896  95.097  99.395  1.00 0.00 ? 121 GLY B CA   1  
ATOM 4319   C C    . GLY B 1 117 ? 71.135  95.553  98.171  1.00 0.00 ? 121 GLY B C    1  
ATOM 4320   O O    . GLY B 1 117 ? 70.118  94.967  97.783  1.00 0.00 ? 121 GLY B O    1  
ATOM 4321   H H    . GLY B 1 117 ? 70.849  93.492  99.836  1.00 0.00 ? 121 GLY B H    1  
ATOM 4322   H HA2  . GLY B 1 117 ? 72.171  95.870  99.912  1.00 0.00 ? 121 GLY B HA2  1  
ATOM 4323   H HA3  . GLY B 1 117 ? 72.705  94.637  99.121  1.00 0.00 ? 121 GLY B HA3  1  
ATOM 4324   N N    . VAL B 1 118 ? 71.625  96.620  97.549  1.00 0.00 ? 122 VAL B N    1  
ATOM 4325   C CA   . VAL B 1 118 ? 71.050  97.140  96.313  1.00 0.00 ? 122 VAL B CA   1  
ATOM 4326   C C    . VAL B 1 118 ? 71.339  96.212  95.141  1.00 0.00 ? 122 VAL B C    1  
ATOM 4327   O O    . VAL B 1 118 ? 70.530  96.092  94.220  1.00 0.00 ? 122 VAL B O    1  
ATOM 4328   C CB   . VAL B 1 118 ? 71.542  98.574  96.030  1.00 0.00 ? 122 VAL B CB   1  
ATOM 4329   C CG1  . VAL B 1 118 ? 70.963  99.516  97.051  1.00 0.00 ? 122 VAL B CG1  1  
ATOM 4330   C CG2  . VAL B 1 118 ? 73.049  98.620  96.061  1.00 0.00 ? 122 VAL B CG2  1  
ATOM 4331   H H    . VAL B 1 118 ? 72.304  97.064  97.833  1.00 0.00 ? 122 VAL B H    1  
ATOM 4332   H HA   . VAL B 1 118 ? 70.088  97.179  96.427  1.00 0.00 ? 122 VAL B HA   1  
ATOM 4333   H HB   . VAL B 1 118 ? 71.247  98.847  95.147  1.00 0.00 ? 122 VAL B HB   1  
ATOM 4334   H HG11 . VAL B 1 118 ? 71.676  99.877  97.600  1.00 0.00 ? 122 VAL B HG11 1  
ATOM 4335   H HG12 . VAL B 1 118 ? 70.504  100.241 96.598  1.00 0.00 ? 122 VAL B HG12 1  
ATOM 4336   H HG13 . VAL B 1 118 ? 70.334  99.038  97.613  1.00 0.00 ? 122 VAL B HG13 1  
ATOM 4337   H HG21 . VAL B 1 118 ? 73.341  99.517  96.286  1.00 0.00 ? 122 VAL B HG21 1  
ATOM 4338   H HG22 . VAL B 1 118 ? 73.379  97.997  96.728  1.00 0.00 ? 122 VAL B HG22 1  
ATOM 4339   H HG23 . VAL B 1 118 ? 73.400  98.375  95.190  1.00 0.00 ? 122 VAL B HG23 1  
ATOM 4340   N N    . GLU B 1 119 ? 72.491  95.543  95.156  1.00 0.00 ? 123 GLU B N    1  
ATOM 4341   C CA   . GLU B 1 119 ? 72.739  94.472  94.202  1.00 0.00 ? 123 GLU B CA   1  
ATOM 4342   C C    . GLU B 1 119 ? 72.426  93.100  94.761  1.00 0.00 ? 123 GLU B C    1  
ATOM 4343   O O    . GLU B 1 119 ? 72.456  92.922  95.983  1.00 0.00 ? 123 GLU B O    1  
ATOM 4344   C CB   . GLU B 1 119 ? 74.189  94.488  93.711  1.00 0.00 ? 123 GLU B CB   1  
ATOM 4345   C CG   . GLU B 1 119 ? 74.406  95.289  92.441  1.00 0.00 ? 123 GLU B CG   1  
ATOM 4346   C CD   . GLU B 1 119 ? 73.269  95.117  91.454  1.00 0.00 ? 123 GLU B CD   1  
ATOM 4347   O OE1  . GLU B 1 119 ? 73.203  94.056  90.805  1.00 0.00 ? 123 GLU B OE1  1  
ATOM 4348   O OE2  . GLU B 1 119 ? 72.423  96.027  91.349  1.00 0.00 ? 123 GLU B OE2  1  
ATOM 4349   H H    . GLU B 1 119 ? 73.134  95.693  95.707  1.00 0.00 ? 123 GLU B H    1  
ATOM 4350   H HA   . GLU B 1 119 ? 72.139  94.640  93.459  1.00 0.00 ? 123 GLU B HA   1  
ATOM 4351   H HB2  . GLU B 1 119 ? 74.754  94.852  94.412  1.00 0.00 ? 123 GLU B HB2  1  
ATOM 4352   H HB3  . GLU B 1 119 ? 74.479  93.575  93.560  1.00 0.00 ? 123 GLU B HB3  1  
ATOM 4353   H HG2  . GLU B 1 119 ? 74.499  96.228  92.665  1.00 0.00 ? 123 GLU B HG2  1  
ATOM 4354   H HG3  . GLU B 1 119 ? 75.237  95.014  92.024  1.00 0.00 ? 123 GLU B HG3  1  
ATOM 4355   N N    . GLY B 1 120 ? 72.118  92.133  93.903  1.00 0.00 ? 124 GLY B N    1  
ATOM 4356   C CA   . GLY B 1 120 ? 72.085  90.751  94.327  1.00 0.00 ? 124 GLY B CA   1  
ATOM 4357   C C    . GLY B 1 120 ? 70.781  90.491  95.045  1.00 0.00 ? 124 GLY B C    1  
ATOM 4358   O O    . GLY B 1 120 ? 69.761  91.127  94.733  1.00 0.00 ? 124 GLY B O    1  
ATOM 4359   H H    . GLY B 1 120 ? 71.926  92.261  93.075  1.00 0.00 ? 124 GLY B H    1  
ATOM 4360   H HA2  . GLY B 1 120 ? 72.169  90.163  93.560  1.00 0.00 ? 124 GLY B HA2  1  
ATOM 4361   H HA3  . GLY B 1 120 ? 72.834  90.562  94.913  1.00 0.00 ? 124 GLY B HA3  1  
ATOM 4362   N N    . ALA B 1 121 ? 70.779  89.538  95.975  1.00 0.00 ? 125 ALA B N    1  
ATOM 4363   C CA   . ALA B 1 121 ? 69.563  89.172  96.685  1.00 0.00 ? 125 ALA B CA   1  
ATOM 4364   C C    . ALA B 1 121 ? 69.847  88.959  98.170  1.00 0.00 ? 125 ALA B C    1  
ATOM 4365   O O    . ALA B 1 121 ? 70.998  88.800  98.592  1.00 0.00 ? 125 ALA B O    1  
ATOM 4366   C CB   . ALA B 1 121 ? 68.940  87.916  96.079  1.00 0.00 ? 125 ALA B CB   1  
ATOM 4367   H H    . ALA B 1 121 ? 71.476  89.091  96.207  1.00 0.00 ? 125 ALA B H    1  
ATOM 4368   H HA   . ALA B 1 121 ? 68.931  89.902  96.595  1.00 0.00 ? 125 ALA B HA   1  
ATOM 4369   H HB1  . ALA B 1 121 ? 69.460  87.635  95.311  1.00 0.00 ? 125 ALA B HB1  1  
ATOM 4370   H HB2  . ALA B 1 121 ? 68.933  87.206  96.741  1.00 0.00 ? 125 ALA B HB2  1  
ATOM 4371   H HB3  . ALA B 1 121 ? 68.030  88.107  95.801  1.00 0.00 ? 125 ALA B HB3  1  
ATOM 4372   N N    . VAL B 1 122 ? 68.771  88.980  98.961  1.00 0.00 ? 126 VAL B N    1  
ATOM 4373   C CA   . VAL B 1 122 ? 68.886  88.982  100.414 1.00 0.00 ? 126 VAL B CA   1  
ATOM 4374   C C    . VAL B 1 122 ? 69.761  87.823  100.869 1.00 0.00 ? 126 VAL B C    1  
ATOM 4375   O O    . VAL B 1 122 ? 69.676  86.705  100.340 1.00 0.00 ? 126 VAL B O    1  
ATOM 4376   C CB   . VAL B 1 122 ? 67.491  88.931  101.060 1.00 0.00 ? 126 VAL B CB   1  
ATOM 4377   C CG1  . VAL B 1 122 ? 66.606  89.999  100.465 1.00 0.00 ? 126 VAL B CG1  1  
ATOM 4378   C CG2  . VAL B 1 122 ? 66.845  87.574  100.859 1.00 0.00 ? 126 VAL B CG2  1  
ATOM 4379   H H    . VAL B 1 122 ? 67.962  88.993  98.670  1.00 0.00 ? 126 VAL B H    1  
ATOM 4380   H HA   . VAL B 1 122 ? 69.311  89.805  100.701 1.00 0.00 ? 126 VAL B HA   1  
ATOM 4381   H HB   . VAL B 1 122 ? 67.598  89.086  102.012 1.00 0.00 ? 126 VAL B HB   1  
ATOM 4382   H HG11 . VAL B 1 122 ? 65.922  90.248  101.107 1.00 0.00 ? 126 VAL B HG11 1  
ATOM 4383   H HG12 . VAL B 1 122 ? 67.141  90.778  100.246 1.00 0.00 ? 126 VAL B HG12 1  
ATOM 4384   H HG13 . VAL B 1 122 ? 66.185  89.660  99.659  1.00 0.00 ? 126 VAL B HG13 1  
ATOM 4385   H HG21 . VAL B 1 122 ? 66.683  87.431  99.914  1.00 0.00 ? 126 VAL B HG21 1  
ATOM 4386   H HG22 . VAL B 1 122 ? 67.436  86.881  101.194 1.00 0.00 ? 126 VAL B HG22 1  
ATOM 4387   H HG23 . VAL B 1 122 ? 66.004  87.542  101.340 1.00 0.00 ? 126 VAL B HG23 1  
ATOM 4388   N N    . GLU B 1 123 ? 70.662  88.099  101.807 1.00 0.00 ? 127 GLU B N    1  
ATOM 4389   C CA   . GLU B 1 123 ? 71.606  87.081  102.254 1.00 0.00 ? 127 GLU B CA   1  
ATOM 4390   C C    . GLU B 1 123 ? 71.558  86.952  103.766 1.00 0.00 ? 127 GLU B C    1  
ATOM 4391   O O    . GLU B 1 123 ? 71.656  87.948  104.488 1.00 0.00 ? 127 GLU B O    1  
ATOM 4392   C CB   . GLU B 1 123 ? 73.026  87.377  101.747 1.00 0.00 ? 127 GLU B CB   1  
ATOM 4393   C CG   . GLU B 1 123 ? 73.908  86.184  101.410 1.00 0.00 ? 127 GLU B CG   1  
ATOM 4394   C CD   . GLU B 1 123 ? 74.414  85.478  102.651 1.00 0.00 ? 127 GLU B CD   1  
ATOM 4395   O OE1  . GLU B 1 123 ? 74.446  84.230  102.648 1.00 0.00 ? 127 GLU B OE1  1  
ATOM 4396   O OE2  . GLU B 1 123 ? 74.800  86.164  103.618 1.00 0.00 ? 127 GLU B OE2  1  
ATOM 4397   H H    . GLU B 1 123 ? 70.743  88.863  102.194 1.00 0.00 ? 127 GLU B H    1  
ATOM 4398   H HA   . GLU B 1 123 ? 71.347  86.228  101.873 1.00 0.00 ? 127 GLU B HA   1  
ATOM 4399   H HB2  . GLU B 1 123 ? 72.953  87.930  100.953 1.00 0.00 ? 127 GLU B HB2  1  
ATOM 4400   H HB3  . GLU B 1 123 ? 73.482  87.906  102.420 1.00 0.00 ? 127 GLU B HB3  1  
ATOM 4401   H HG2  . GLU B 1 123 ? 73.406  85.557  100.865 1.00 0.00 ? 127 GLU B HG2  1  
ATOM 4402   H HG3  . GLU B 1 123 ? 74.662  86.481  100.879 1.00 0.00 ? 127 GLU B HG3  1  
ATOM 4403   N N    . ILE B 1 124 ? 71.385  85.725  104.238 1.00 0.00 ? 128 ILE B N    1  
ATOM 4404   C CA   . ILE B 1 124 ? 71.297  85.447  105.661 1.00 0.00 ? 128 ILE B CA   1  
ATOM 4405   C C    . ILE B 1 124 ? 72.556  84.713  106.093 1.00 0.00 ? 128 ILE B C    1  
ATOM 4406   O O    . ILE B 1 124 ? 72.939  83.702  105.492 1.00 0.00 ? 128 ILE B O    1  
ATOM 4407   C CB   . ILE B 1 124 ? 70.039  84.637  105.999 1.00 0.00 ? 128 ILE B CB   1  
ATOM 4408   C CG1  . ILE B 1 124 ? 68.835  85.195  105.243 1.00 0.00 ? 128 ILE B CG1  1  
ATOM 4409   C CG2  . ILE B 1 124 ? 69.764  84.702  107.482 1.00 0.00 ? 128 ILE B CG2  1  
ATOM 4410   C CD1  . ILE B 1 124 ? 67.620  84.272  105.197 1.00 0.00 ? 128 ILE B CD1  1  
ATOM 4411   H H    . ILE B 1 124 ? 71.315  85.028  103.739 1.00 0.00 ? 128 ILE B H    1  
ATOM 4412   H HA   . ILE B 1 124 ? 71.227  86.283  106.147 1.00 0.00 ? 128 ILE B HA   1  
ATOM 4413   H HB   . ILE B 1 124 ? 70.185  83.714  105.735 1.00 0.00 ? 128 ILE B HB   1  
ATOM 4414   H HG12 . ILE B 1 124 ? 68.573  86.034  105.654 1.00 0.00 ? 128 ILE B HG12 1  
ATOM 4415   H HG13 . ILE B 1 124 ? 69.106  85.397  104.334 1.00 0.00 ? 128 ILE B HG13 1  
ATOM 4416   H HG21 . ILE B 1 124 ? 69.856  83.817  107.868 1.00 0.00 ? 128 ILE B HG21 1  
ATOM 4417   H HG22 . ILE B 1 124 ? 70.398  85.304  107.902 1.00 0.00 ? 128 ILE B HG22 1  
ATOM 4418   H HG23 . ILE B 1 124 ? 68.863  85.027  107.631 1.00 0.00 ? 128 ILE B HG23 1  
ATOM 4419   H HD11 . ILE B 1 124 ? 67.857  83.447  104.747 1.00 0.00 ? 128 ILE B HD11 1  
ATOM 4420   H HD12 . ILE B 1 124 ? 67.329  84.074  106.101 1.00 0.00 ? 128 ILE B HD12 1  
ATOM 4421   H HD13 . ILE B 1 124 ? 66.900  84.708  104.715 1.00 0.00 ? 128 ILE B HD13 1  
ATOM 4422   N N    . SER B 1 125 ? 73.209  85.244  107.119 1.00 0.00 ? 129 SER B N    1  
ATOM 4423   C CA   . SER B 1 125 ? 74.287  84.562  107.813 1.00 0.00 ? 129 SER B CA   1  
ATOM 4424   C C    . SER B 1 125 ? 73.773  84.136  109.179 1.00 0.00 ? 129 SER B C    1  
ATOM 4425   O O    . SER B 1 125 ? 73.424  84.984  110.002 1.00 0.00 ? 129 SER B O    1  
ATOM 4426   C CB   . SER B 1 125 ? 75.502  85.478  107.964 1.00 0.00 ? 129 SER B CB   1  
ATOM 4427   O OG   . SER B 1 125 ? 76.692  84.727  108.125 1.00 0.00 ? 129 SER B OG   1  
ATOM 4428   H H    . SER B 1 125 ? 73.034  86.024  107.435 1.00 0.00 ? 129 SER B H    1  
ATOM 4429   H HA   . SER B 1 125 ? 74.569  83.786  107.303 1.00 0.00 ? 129 SER B HA   1  
ATOM 4430   H HB2  . SER B 1 125 ? 75.580  86.048  107.183 1.00 0.00 ? 129 SER B HB2  1  
ATOM 4431   H HB3  . SER B 1 125 ? 75.379  86.061  108.729 1.00 0.00 ? 129 SER B HB3  1  
ATOM 4432   H HG   . SER B 1 125 ? 77.135  84.748  107.411 1.00 0.00 ? 129 SER B HG   1  
ATOM 4433   N N    . ILE B 1 126 ? 73.699  82.831  109.412 1.00 0.00 ? 130 ILE B N    1  
ATOM 4434   C CA   . ILE B 1 126 ? 73.277  82.304  110.701 1.00 0.00 ? 130 ILE B CA   1  
ATOM 4435   C C    . ILE B 1 126 ? 74.430  81.518  111.303 1.00 0.00 ? 130 ILE B C    1  
ATOM 4436   O O    . ILE B 1 126 ? 75.017  80.647  110.648 1.00 0.00 ? 130 ILE B O    1  
ATOM 4437   C CB   . ILE B 1 126 ? 72.007  81.430  110.598 1.00 0.00 ? 130 ILE B CB   1  
ATOM 4438   C CG1  . ILE B 1 126 ? 72.357  79.973  110.315 1.00 0.00 ? 130 ILE B CG1  1  
ATOM 4439   C CG2  . ILE B 1 126 ? 71.081  81.962  109.523 1.00 0.00 ? 130 ILE B CG2  1  
ATOM 4440   C CD1  . ILE B 1 126 ? 71.157  79.037  110.163 1.00 0.00 ? 130 ILE B CD1  1  
ATOM 4441   H H    . ILE B 1 126 ? 73.891  82.229  108.829 1.00 0.00 ? 130 ILE B H    1  
ATOM 4442   H HA   . ILE B 1 126 ? 73.043  83.049  111.276 1.00 0.00 ? 130 ILE B HA   1  
ATOM 4443   H HB   . ILE B 1 126 ? 71.552  81.470  111.454 1.00 0.00 ? 130 ILE B HB   1  
ATOM 4444   H HG12 . ILE B 1 126 ? 72.886  79.934  109.502 1.00 0.00 ? 130 ILE B HG12 1  
ATOM 4445   H HG13 . ILE B 1 126 ? 72.918  79.643  111.034 1.00 0.00 ? 130 ILE B HG13 1  
ATOM 4446   H HG21 . ILE B 1 126 ? 71.349  81.608  108.660 1.00 0.00 ? 130 ILE B HG21 1  
ATOM 4447   H HG22 . ILE B 1 126 ? 70.170  81.689  109.715 1.00 0.00 ? 130 ILE B HG22 1  
ATOM 4448   H HG23 . ILE B 1 126 ? 71.129  82.931  109.504 1.00 0.00 ? 130 ILE B HG23 1  
ATOM 4449   H HD11 . ILE B 1 126 ? 70.662  79.007  110.997 1.00 0.00 ? 130 ILE B HD11 1  
ATOM 4450   H HD12 . ILE B 1 126 ? 70.579  79.364  109.456 1.00 0.00 ? 130 ILE B HD12 1  
ATOM 4451   H HD13 . ILE B 1 126 ? 71.468  78.146  109.939 1.00 0.00 ? 130 ILE B HD13 1  
ATOM 4452   N N    . SER B 1 127 ? 74.759  81.841  112.550 1.00 0.00 ? 131 SER B N    1  
ATOM 4453   C CA   . SER B 1 127 ? 75.854  81.216  113.274 1.00 0.00 ? 131 SER B CA   1  
ATOM 4454   C C    . SER B 1 127 ? 75.308  80.449  114.468 1.00 0.00 ? 131 SER B C    1  
ATOM 4455   O O    . SER B 1 127 ? 74.394  80.915  115.160 1.00 0.00 ? 131 SER B O    1  
ATOM 4456   C CB   . SER B 1 127 ? 76.866  82.260  113.743 1.00 0.00 ? 131 SER B CB   1  
ATOM 4457   O OG   . SER B 1 127 ? 77.851  82.485  112.754 1.00 0.00 ? 131 SER B OG   1  
ATOM 4458   H H    . SER B 1 127 ? 74.342  82.440  113.006 1.00 0.00 ? 131 SER B H    1  
ATOM 4459   H HA   . SER B 1 127 ? 76.306  80.603  112.675 1.00 0.00 ? 131 SER B HA   1  
ATOM 4460   H HB2  . SER B 1 127 ? 76.408  83.092  113.945 1.00 0.00 ? 131 SER B HB2  1  
ATOM 4461   H HB3  . SER B 1 127 ? 77.288  81.962  114.564 1.00 0.00 ? 131 SER B HB3  1  
ATOM 4462   H HG   . SER B 1 127 ? 77.485  82.544  112.001 1.00 0.00 ? 131 SER B HG   1  
ATOM 4463   N N    . LEU B 1 128 ? 75.890  79.284  114.717 1.00 0.00 ? 132 LEU B N    1  
ATOM 4464   C CA   . LEU B 1 128 ? 75.402  78.354  115.721 1.00 0.00 ? 132 LEU B CA   1  
ATOM 4465   C C    . LEU B 1 128 ? 76.569  77.653  116.396 1.00 0.00 ? 132 LEU B C    1  
ATOM 4466   O O    . LEU B 1 128 ? 77.601  77.403  115.772 1.00 0.00 ? 132 LEU B O    1  
ATOM 4467   C CB   . LEU B 1 128 ? 74.480  77.301  115.101 1.00 0.00 ? 132 LEU B CB   1  
ATOM 4468   C CG   . LEU B 1 128 ? 74.894  76.554  113.837 1.00 0.00 ? 132 LEU B CG   1  
ATOM 4469   C CD1  . LEU B 1 128 ? 75.449  75.173  114.124 1.00 0.00 ? 132 LEU B CD1  1  
ATOM 4470   C CD2  . LEU B 1 128 ? 73.695  76.459  112.925 1.00 0.00 ? 132 LEU B CD2  1  
ATOM 4471   H H    . LEU B 1 128 ? 76.590  79.008  114.301 1.00 0.00 ? 132 LEU B H    1  
ATOM 4472   H HA   . LEU B 1 128 ? 74.899  78.864  116.374 1.00 0.00 ? 132 LEU B HA   1  
ATOM 4473   H HB2  . LEU B 1 128 ? 74.307  76.634  115.784 1.00 0.00 ? 132 LEU B HB2  1  
ATOM 4474   H HB3  . LEU B 1 128 ? 73.634  77.738  114.912 1.00 0.00 ? 132 LEU B HB3  1  
ATOM 4475   H HG   . LEU B 1 128 ? 75.612  77.051  113.412 1.00 0.00 ? 132 LEU B HG   1  
ATOM 4476   H HD11 . LEU B 1 128 ? 74.975  74.516  113.589 1.00 0.00 ? 132 LEU B HD11 1  
ATOM 4477   H HD12 . LEU B 1 128 ? 76.393  75.150  113.901 1.00 0.00 ? 132 LEU B HD12 1  
ATOM 4478   H HD13 . LEU B 1 128 ? 75.334  74.967  115.065 1.00 0.00 ? 132 LEU B HD13 1  
ATOM 4479   H HD21 . LEU B 1 128 ? 73.240  77.315  112.898 1.00 0.00 ? 132 LEU B HD21 1  
ATOM 4480   H HD22 . LEU B 1 128 ? 73.986  76.220  112.031 1.00 0.00 ? 132 LEU B HD22 1  
ATOM 4481   H HD23 . LEU B 1 128 ? 73.088  75.781  113.259 1.00 0.00 ? 132 LEU B HD23 1  
ATOM 4482   N N    . GLN B 1 129 ? 76.397  77.337  117.672 1.00 0.00 ? 133 GLN B N    1  
ATOM 4483   C CA   . GLN B 1 129 ? 77.297  76.440  118.380 1.00 0.00 ? 133 GLN B CA   1  
ATOM 4484   C C    . GLN B 1 129 ? 76.606  75.096  118.487 1.00 0.00 ? 133 GLN B C    1  
ATOM 4485   O O    . GLN B 1 129 ? 75.384  75.011  118.316 1.00 0.00 ? 133 GLN B O    1  
ATOM 4486   C CB   . GLN B 1 129 ? 77.641  76.973  119.767 1.00 0.00 ? 133 GLN B CB   1  
ATOM 4487   C CG   . GLN B 1 129 ? 79.101  77.222  119.964 1.00 0.00 ? 133 GLN B CG   1  
ATOM 4488   C CD   . GLN B 1 129 ? 79.632  76.471  121.143 1.00 0.00 ? 133 GLN B CD   1  
ATOM 4489   O OE1  . GLN B 1 129 ? 80.231  77.056  122.038 1.00 0.00 ? 133 GLN B OE1  1  
ATOM 4490   N NE2  . GLN B 1 129 ? 79.451  75.158  121.140 1.00 0.00 ? 133 GLN B NE2  1  
ATOM 4491   H H    . GLN B 1 129 ? 75.753  77.638  118.154 1.00 0.00 ? 133 GLN B H    1  
ATOM 4492   H HA   . GLN B 1 129 ? 78.133  76.363  117.894 1.00 0.00 ? 133 GLN B HA   1  
ATOM 4493   H HB2  . GLN B 1 129 ? 77.155  77.799  119.918 1.00 0.00 ? 133 GLN B HB2  1  
ATOM 4494   H HB3  . GLN B 1 129 ? 77.335  76.338  120.434 1.00 0.00 ? 133 GLN B HB3  1  
ATOM 4495   H HG2  . GLN B 1 129 ? 79.586  76.959  119.167 1.00 0.00 ? 133 GLN B HG2  1  
ATOM 4496   H HG3  . GLN B 1 129 ? 79.254  78.172  120.089 1.00 0.00 ? 133 GLN B HG3  1  
ATOM 4497   H HE21 . GLN B 1 129 ? 79.025  74.784  120.494 1.00 0.00 ? 133 GLN B HE21 1  
ATOM 4498   H HE22 . GLN B 1 129 ? 79.761  74.680  121.784 1.00 0.00 ? 133 GLN B HE22 1  
ATOM 4499   N N    . VAL B 1 130 ? 77.374  74.045  118.742 1.00 0.00 ? 134 VAL B N    1  
ATOM 4500   C CA   . VAL B 1 130 ? 76.795  72.728  118.961 1.00 0.00 ? 134 VAL B CA   1  
ATOM 4501   C C    . VAL B 1 130 ? 77.565  72.063  120.094 1.00 0.00 ? 134 VAL B C    1  
ATOM 4502   O O    . VAL B 1 130 ? 78.675  72.486  120.439 1.00 0.00 ? 134 VAL B O    1  
ATOM 4503   C CB   . VAL B 1 130 ? 76.774  71.889  117.663 1.00 0.00 ? 134 VAL B CB   1  
ATOM 4504   C CG1  . VAL B 1 130 ? 76.196  70.513  117.874 1.00 0.00 ? 134 VAL B CG1  1  
ATOM 4505   C CG2  . VAL B 1 130 ? 76.067  72.627  116.531 1.00 0.00 ? 134 VAL B CG2  1  
ATOM 4506   H H    . VAL B 1 130 ? 78.232  74.072  118.791 1.00 0.00 ? 134 VAL B H    1  
ATOM 4507   H HA   . VAL B 1 130 ? 75.863  72.805  119.218 1.00 0.00 ? 134 VAL B HA   1  
ATOM 4508   H HB   . VAL B 1 130 ? 77.698  71.763  117.398 1.00 0.00 ? 134 VAL B HB   1  
ATOM 4509   H HG11 . VAL B 1 130 ? 76.335  69.978  117.077 1.00 0.00 ? 134 VAL B HG11 1  
ATOM 4510   H HG12 . VAL B 1 130 ? 76.636  70.090  118.628 1.00 0.00 ? 134 VAL B HG12 1  
ATOM 4511   H HG13 . VAL B 1 130 ? 75.246  70.586  118.054 1.00 0.00 ? 134 VAL B HG13 1  
ATOM 4512   H HG21 . VAL B 1 130 ? 76.490  73.490  116.393 1.00 0.00 ? 134 VAL B HG21 1  
ATOM 4513   H HG22 . VAL B 1 130 ? 76.128  72.104  115.716 1.00 0.00 ? 134 VAL B HG22 1  
ATOM 4514   H HG23 . VAL B 1 130 ? 75.134  72.757  116.762 1.00 0.00 ? 134 VAL B HG23 1  
ATOM 4515   N N    . ILE B 1 131 ? 76.936  71.072  120.728 1.00 0.00 ? 135 ILE B N    1  
ATOM 4516   C CA   . ILE B 1 131 ? 77.518  70.458  121.918 1.00 0.00 ? 135 ILE B CA   1  
ATOM 4517   C C    . ILE B 1 131 ? 78.172  69.131  121.562 1.00 0.00 ? 135 ILE B C    1  
ATOM 4518   O O    . ILE B 1 131 ? 78.310  68.236  122.404 1.00 0.00 ? 135 ILE B O    1  
ATOM 4519   C CB   . ILE B 1 131 ? 76.448  70.276  123.005 1.00 0.00 ? 135 ILE B CB   1  
ATOM 4520   C CG1  . ILE B 1 131 ? 75.153  69.732  122.396 1.00 0.00 ? 135 ILE B CG1  1  
ATOM 4521   C CG2  . ILE B 1 131 ? 76.207  71.588  123.725 1.00 0.00 ? 135 ILE B CG2  1  
ATOM 4522   C CD1  . ILE B 1 131 ? 74.130  69.068  123.360 1.00 0.00 ? 135 ILE B CD1  1  
ATOM 4523   H H    . ILE B 1 131 ? 76.179  70.745  120.486 1.00 0.00 ? 135 ILE B H    1  
ATOM 4524   H HA   . ILE B 1 131 ? 78.205  71.046  122.269 1.00 0.00 ? 135 ILE B HA   1  
ATOM 4525   H HB   . ILE B 1 131 ? 76.765  69.629  123.655 1.00 0.00 ? 135 ILE B HB   1  
ATOM 4526   H HG12 . ILE B 1 131 ? 74.705  70.463  121.941 1.00 0.00 ? 135 ILE B HG12 1  
ATOM 4527   H HG13 . ILE B 1 131 ? 75.392  69.081  121.718 1.00 0.00 ? 135 ILE B HG13 1  
ATOM 4528   H HG21 . ILE B 1 131 ? 75.375  71.537  124.221 1.00 0.00 ? 135 ILE B HG21 1  
ATOM 4529   H HG22 . ILE B 1 131 ? 76.938  71.761  124.337 1.00 0.00 ? 135 ILE B HG22 1  
ATOM 4530   H HG23 . ILE B 1 131 ? 76.153  72.308  123.076 1.00 0.00 ? 135 ILE B HG23 1  
ATOM 4531   H HD11 . ILE B 1 131 ? 73.975  69.651  124.119 1.00 0.00 ? 135 ILE B HD11 1  
ATOM 4532   H HD12 . ILE B 1 131 ? 73.294  68.918  122.891 1.00 0.00 ? 135 ILE B HD12 1  
ATOM 4533   H HD13 . ILE B 1 131 ? 74.483  68.220  123.671 1.00 0.00 ? 135 ILE B HD13 1  
ATOM 4534   N N    . GLY B 1 132 ? 78.598  68.991  120.315 1.00 0.00 ? 136 GLY B N    1  
ATOM 4535   C CA   . GLY B 1 132 ? 79.271  67.786  119.891 1.00 0.00 ? 136 GLY B CA   1  
ATOM 4536   C C    . GLY B 1 132 ? 78.556  67.123  118.738 1.00 0.00 ? 136 GLY B C    1  
ATOM 4537   O O    . GLY B 1 132 ? 77.619  66.346  118.948 1.00 0.00 ? 136 GLY B O    1  
ATOM 4538   H H    . GLY B 1 132 ? 78.505  69.586  119.701 1.00 0.00 ? 136 GLY B H    1  
ATOM 4539   H HA2  . GLY B 1 132 ? 80.181  67.998  119.629 1.00 0.00 ? 136 GLY B HA2  1  
ATOM 4540   H HA3  . GLY B 1 132 ? 79.326  67.167  120.636 1.00 0.00 ? 136 GLY B HA3  1  
ATOM 4541   N N    . GLU B 1 133 ? 78.972  67.442  117.517 1.00 0.00 ? 137 GLU B N    1  
ATOM 4542   C CA   . GLU B 1 133 ? 78.442  66.770  116.343 1.00 0.00 ? 137 GLU B CA   1  
ATOM 4543   C C    . GLU B 1 133 ? 79.150  65.439  116.121 1.00 0.00 ? 137 GLU B C    1  
ATOM 4544   O O    . GLU B 1 133 ? 80.371  65.318  116.251 1.00 0.00 ? 137 GLU B O    1  
ATOM 4545   C CB   . GLU B 1 133 ? 78.581  67.656  115.110 1.00 0.00 ? 137 GLU B CB   1  
ATOM 4546   C CG   . GLU B 1 133 ? 77.477  68.666  114.957 1.00 0.00 ? 137 GLU B CG   1  
ATOM 4547   C CD   . GLU B 1 133 ? 77.629  69.487  113.693 1.00 0.00 ? 137 GLU B CD   1  
ATOM 4548   O OE1  . GLU B 1 133 ? 77.275  68.978  112.607 1.00 0.00 ? 137 GLU B OE1  1  
ATOM 4549   O OE2  . GLU B 1 133 ? 78.106  70.632  113.777 1.00 0.00 ? 137 GLU B OE2  1  
ATOM 4550   H H    . GLU B 1 133 ? 79.561  68.046  117.349 1.00 0.00 ? 137 GLU B H    1  
ATOM 4551   H HA   . GLU B 1 133 ? 77.500  66.595  116.494 1.00 0.00 ? 137 GLU B HA   1  
ATOM 4552   H HB2  . GLU B 1 133 ? 79.430  68.123  115.152 1.00 0.00 ? 137 GLU B HB2  1  
ATOM 4553   H HB3  . GLU B 1 133 ? 78.605  67.094  114.320 1.00 0.00 ? 137 GLU B HB3  1  
ATOM 4554   H HG2  . GLU B 1 133 ? 76.622  68.209  114.943 1.00 0.00 ? 137 GLU B HG2  1  
ATOM 4555   H HG3  . GLU B 1 133 ? 77.472  69.257  115.726 1.00 0.00 ? 137 GLU B HG3  1  
ATOM 4556   N N    . LEU B 1 134 ? 78.356  64.426  115.792 1.00 0.00 ? 138 LEU B N    1  
ATOM 4557   C CA   . LEU B 1 134 ? 78.868  63.069  115.653 1.00 0.00 ? 138 LEU B CA   1  
ATOM 4558   C C    . LEU B 1 134 ? 78.630  62.621  114.222 1.00 0.00 ? 138 LEU B C    1  
ATOM 4559   O O    . LEU B 1 134 ? 77.735  63.139  113.547 1.00 0.00 ? 138 LEU B O    1  
ATOM 4560   C CB   . LEU B 1 134 ? 78.190  62.128  116.652 1.00 0.00 ? 138 LEU B CB   1  
ATOM 4561   C CG   . LEU B 1 134 ? 77.415  62.722  117.832 1.00 0.00 ? 138 LEU B CG   1  
ATOM 4562   C CD1  . LEU B 1 134 ? 76.131  61.953  118.068 1.00 0.00 ? 138 LEU B CD1  1  
ATOM 4563   C CD2  . LEU B 1 134 ? 78.274  62.712  119.089 1.00 0.00 ? 138 LEU B CD2  1  
ATOM 4564   H H    . LEU B 1 134 ? 77.513  64.504  115.644 1.00 0.00 ? 138 LEU B H    1  
ATOM 4565   H HA   . LEU B 1 134 ? 79.817  63.048  115.848 1.00 0.00 ? 138 LEU B HA   1  
ATOM 4566   H HB2  . LEU B 1 134 ? 77.577  61.565  116.154 1.00 0.00 ? 138 LEU B HB2  1  
ATOM 4567   H HB3  . LEU B 1 134 ? 78.876  61.547  117.017 1.00 0.00 ? 138 LEU B HB3  1  
ATOM 4568   H HG   . LEU B 1 134 ? 77.188  63.641  117.616 1.00 0.00 ? 138 LEU B HG   1  
ATOM 4569   H HD11 . LEU B 1 134 ? 75.846  62.072  118.988 1.00 0.00 ? 138 LEU B HD11 1  
ATOM 4570   H HD12 . LEU B 1 134 ? 75.441  62.282  117.472 1.00 0.00 ? 138 LEU B HD12 1  
ATOM 4571   H HD13 . LEU B 1 134 ? 76.282  61.010  117.898 1.00 0.00 ? 138 LEU B HD13 1  
ATOM 4572   H HD21 . LEU B 1 134 ? 79.205  62.839  118.846 1.00 0.00 ? 138 LEU B HD21 1  
ATOM 4573   H HD22 . LEU B 1 134 ? 77.994  63.430  119.678 1.00 0.00 ? 138 LEU B HD22 1  
ATOM 4574   H HD23 . LEU B 1 134 ? 78.171  61.862  119.544 1.00 0.00 ? 138 LEU B HD23 1  
ATOM 4575   N N    . LYS B 1 135 ? 79.445  61.677  113.763 1.00 0.00 ? 139 LYS B N    1  
ATOM 4576   C CA   . LYS B 1 135 ? 79.369  61.180  112.395 1.00 0.00 ? 139 LYS B CA   1  
ATOM 4577   C C    . LYS B 1 135 ? 78.621  59.854  112.387 1.00 0.00 ? 139 LYS B C    1  
ATOM 4578   O O    . LYS B 1 135 ? 78.810  59.022  113.279 1.00 0.00 ? 139 LYS B O    1  
ATOM 4579   C CB   . LYS B 1 135 ? 80.770  61.017  111.821 1.00 0.00 ? 139 LYS B CB   1  
ATOM 4580   C CG   . LYS B 1 135 ? 81.155  62.086  110.820 1.00 0.00 ? 139 LYS B CG   1  
ATOM 4581   C CD   . LYS B 1 135 ? 82.213  63.011  111.392 1.00 0.00 ? 139 LYS B CD   1  
ATOM 4582   C CE   . LYS B 1 135 ? 82.280  64.323  110.624 1.00 0.00 ? 139 LYS B CE   1  
ATOM 4583   N NZ   . LYS B 1 135 ? 83.613  64.979  110.689 1.00 0.00 ? 139 LYS B NZ   1  
ATOM 4584   H H    . LYS B 1 135 ? 80.059  61.307  114.238 1.00 0.00 ? 139 LYS B H    1  
ATOM 4585   H HA   . LYS B 1 135 ? 78.889  61.815  111.841 1.00 0.00 ? 139 LYS B HA   1  
ATOM 4586   H HB2  . LYS B 1 135 ? 81.411  61.024  112.549 1.00 0.00 ? 139 LYS B HB2  1  
ATOM 4587   H HB3  . LYS B 1 135 ? 80.835  60.149  111.393 1.00 0.00 ? 139 LYS B HB3  1  
ATOM 4588   H HG2  . LYS B 1 135 ? 81.488  61.670  110.010 1.00 0.00 ? 139 LYS B HG2  1  
ATOM 4589   H HG3  . LYS B 1 135 ? 80.370  62.600  110.574 1.00 0.00 ? 139 LYS B HG3  1  
ATOM 4590   H HD2  . LYS B 1 135 ? 82.018  63.190  112.325 1.00 0.00 ? 139 LYS B HD2  1  
ATOM 4591   H HD3  . LYS B 1 135 ? 83.078  62.573  111.362 1.00 0.00 ? 139 LYS B HD3  1  
ATOM 4592   H HE2  . LYS B 1 135 ? 82.053  64.159  109.695 1.00 0.00 ? 139 LYS B HE2  1  
ATOM 4593   H HE3  . LYS B 1 135 ? 81.611  64.930  110.976 1.00 0.00 ? 139 LYS B HE3  1  
ATOM 4594   H HZ1  . LYS B 1 135 ? 83.906  65.139  109.864 1.00 0.00 ? 139 LYS B HZ1  1  
ATOM 4595   H HZ2  . LYS B 1 135 ? 83.545  65.747  111.134 1.00 0.00 ? 139 LYS B HZ2  1  
ATOM 4596   H HZ3  . LYS B 1 135 ? 84.187  64.444  111.110 1.00 0.00 ? 139 LYS B HZ3  1  
ATOM 4597   N N    . ASN B 1 136 ? 77.776  59.647  111.380 1.00 0.00 ? 140 ASN B N    1  
ATOM 4598   C CA   . ASN B 1 136 ? 77.047  58.395  111.222 1.00 0.00 ? 140 ASN B CA   1  
ATOM 4599   C C    . ASN B 1 136 ? 76.698  58.206  109.756 1.00 0.00 ? 140 ASN B C    1  
ATOM 4600   O O    . ASN B 1 136 ? 77.197  58.941  108.898 1.00 0.00 ? 140 ASN B O    1  
ATOM 4601   C CB   . ASN B 1 136 ? 75.775  58.367  112.078 1.00 0.00 ? 140 ASN B CB   1  
ATOM 4602   C CG   . ASN B 1 136 ? 75.063  59.700  112.109 1.00 0.00 ? 140 ASN B CG   1  
ATOM 4603   O OD1  . ASN B 1 136 ? 75.354  60.551  112.947 1.00 0.00 ? 140 ASN B OD1  1  
ATOM 4604   N ND2  . ASN B 1 136 ? 74.103  59.879  111.214 1.00 0.00 ? 140 ASN B ND2  1  
ATOM 4605   H H    . ASN B 1 136 ? 77.610  60.231  110.770 1.00 0.00 ? 140 ASN B H    1  
ATOM 4606   H HA   . ASN B 1 136 ? 77.614  57.669  111.525 1.00 0.00 ? 140 ASN B HA   1  
ATOM 4607   H HB2  . ASN B 1 136 ? 75.172  57.690  111.732 1.00 0.00 ? 140 ASN B HB2  1  
ATOM 4608   H HB3  . ASN B 1 136 ? 76.005  58.106  112.983 1.00 0.00 ? 140 ASN B HB3  1  
ATOM 4609   H HD21 . ASN B 1 136 ? 73.655  60.613  111.205 1.00 0.00 ? 140 ASN B HD21 1  
ATOM 4610   H HD22 . ASN B 1 136 ? 73.927  59.261  110.643 1.00 0.00 ? 140 ASN B HD22 1  
ATOM 4611   N N    . GLY B 1 137 ? 75.854  57.218  109.474 1.00 0.00 ? 141 GLY B N    1  
ATOM 4612   C CA   . GLY B 1 137 ? 75.296  57.096  108.144 1.00 0.00 ? 141 GLY B CA   1  
ATOM 4613   C C    . GLY B 1 137 ? 73.880  57.637  108.088 1.00 0.00 ? 141 GLY B C    1  
ATOM 4614   O O    . GLY B 1 137 ? 73.084  57.472  109.011 1.00 0.00 ? 141 GLY B O    1  
ATOM 4615   H H    . GLY B 1 137 ? 75.599  56.618  110.034 1.00 0.00 ? 141 GLY B H    1  
ATOM 4616   H HA2  . GLY B 1 137 ? 75.853  57.575  107.512 1.00 0.00 ? 141 GLY B HA2  1  
ATOM 4617   H HA3  . GLY B 1 137 ? 75.298  56.163  107.875 1.00 0.00 ? 141 GLY B HA3  1  
ATOM 4618   N N    . GLU B 1 138 ? 73.566  58.293  106.976 1.00 0.00 ? 142 GLU B N    1  
ATOM 4619   C CA   . GLU B 1 138 ? 72.284  58.966  106.830 1.00 0.00 ? 142 GLU B CA   1  
ATOM 4620   C C    . GLU B 1 138 ? 71.241  57.958  106.376 1.00 0.00 ? 142 GLU B C    1  
ATOM 4621   O O    . GLU B 1 138 ? 71.441  57.243  105.391 1.00 0.00 ? 142 GLU B O    1  
ATOM 4622   C CB   . GLU B 1 138 ? 72.401  60.144  105.854 1.00 0.00 ? 142 GLU B CB   1  
ATOM 4623   C CG   . GLU B 1 138 ? 71.072  60.619  105.282 1.00 0.00 ? 142 GLU B CG   1  
ATOM 4624   C CD   . GLU B 1 138 ? 70.199  61.286  106.309 1.00 0.00 ? 142 GLU B CD   1  
ATOM 4625   O OE1  . GLU B 1 138 ? 69.346  62.100  105.908 1.00 0.00 ? 142 GLU B OE1  1  
ATOM 4626   O OE2  . GLU B 1 138 ? 70.373  61.008  107.514 1.00 0.00 ? 142 GLU B OE2  1  
ATOM 4627   H H    . GLU B 1 138 ? 74.084  58.359  106.293 1.00 0.00 ? 142 GLU B H    1  
ATOM 4628   H HA   . GLU B 1 138 ? 72.007  59.332  107.685 1.00 0.00 ? 142 GLU B HA   1  
ATOM 4629   H HB2  . GLU B 1 138 ? 72.829  60.886  106.308 1.00 0.00 ? 142 GLU B HB2  1  
ATOM 4630   H HB3  . GLU B 1 138 ? 72.982  59.886  105.121 1.00 0.00 ? 142 GLU B HB3  1  
ATOM 4631   H HG2  . GLU B 1 138 ? 71.241  61.240  104.556 1.00 0.00 ? 142 GLU B HG2  1  
ATOM 4632   H HG3  . GLU B 1 138 ? 70.598  59.863  104.903 1.00 0.00 ? 142 GLU B HG3  1  
ATOM 4633   N N    . ILE B 1 139 ? 70.124  57.914  107.100 1.00 0.00 ? 143 ILE B N    1  
ATOM 4634   C CA   . ILE B 1 139 ? 69.081  56.937  106.812 1.00 0.00 ? 143 ILE B CA   1  
ATOM 4635   C C    . ILE B 1 139 ? 68.052  57.514  105.847 1.00 0.00 ? 143 ILE B C    1  
ATOM 4636   O O    . ILE B 1 139 ? 67.660  56.853  104.879 1.00 0.00 ? 143 ILE B O    1  
ATOM 4637   C CB   . ILE B 1 139 ? 68.410  56.448  108.109 1.00 0.00 ? 143 ILE B CB   1  
ATOM 4638   C CG1  . ILE B 1 139 ? 69.356  56.607  109.300 1.00 0.00 ? 143 ILE B CG1  1  
ATOM 4639   C CG2  . ILE B 1 139 ? 67.990  54.995  107.973 1.00 0.00 ? 143 ILE B CG2  1  
ATOM 4640   C CD1  . ILE B 1 139 ? 69.317  57.961  109.985 1.00 0.00 ? 143 ILE B CD1  1  
ATOM 4641   H H    . ILE B 1 139 ? 69.953  58.439  107.759 1.00 0.00 ? 143 ILE B H    1  
ATOM 4642   H HA   . ILE B 1 139 ? 69.496  56.171  106.386 1.00 0.00 ? 143 ILE B HA   1  
ATOM 4643   H HB   . ILE B 1 139 ? 67.622  56.991  108.264 1.00 0.00 ? 143 ILE B HB   1  
ATOM 4644   H HG12 . ILE B 1 139 ? 69.146  55.924  109.956 1.00 0.00 ? 143 ILE B HG12 1  
ATOM 4645   H HG13 . ILE B 1 139 ? 70.263  56.440  108.999 1.00 0.00 ? 143 ILE B HG13 1  
ATOM 4646   H HG21 . ILE B 1 139 ? 68.594  54.539  107.366 1.00 0.00 ? 143 ILE B HG21 1  
ATOM 4647   H HG22 . ILE B 1 139 ? 68.021  54.566  108.843 1.00 0.00 ? 143 ILE B HG22 1  
ATOM 4648   H HG23 . ILE B 1 139 ? 67.086  54.950  107.624 1.00 0.00 ? 143 ILE B HG23 1  
ATOM 4649   H HD11 . ILE B 1 139 ? 69.216  57.837  110.941 1.00 0.00 ? 143 ILE B HD11 1  
ATOM 4650   H HD12 . ILE B 1 139 ? 70.142  58.439  109.804 1.00 0.00 ? 143 ILE B HD12 1  
ATOM 4651   H HD13 . ILE B 1 139 ? 68.567  58.473  109.645 1.00 0.00 ? 143 ILE B HD13 1  
ATOM 4652   N N    . ASP B 1 140 ? 67.619  58.751  106.080 1.00 0.00 ? 144 ASP B N    1  
ATOM 4653   C CA   . ASP B 1 140 ? 66.584  59.337  105.239 1.00 0.00 ? 144 ASP B CA   1  
ATOM 4654   C C    . ASP B 1 140 ? 67.190  59.997  104.009 1.00 0.00 ? 144 ASP B C    1  
ATOM 4655   O O    . ASP B 1 140 ? 67.887  61.010  104.105 1.00 0.00 ? 144 ASP B O    1  
ATOM 4656   C CB   . ASP B 1 140 ? 65.741  60.347  106.024 1.00 0.00 ? 144 ASP B CB   1  
ATOM 4657   C CG   . ASP B 1 140 ? 64.522  59.723  106.681 1.00 0.00 ? 144 ASP B CG   1  
ATOM 4658   O OD1  . ASP B 1 140 ? 64.458  58.483  106.804 1.00 0.00 ? 144 ASP B OD1  1  
ATOM 4659   O OD2  . ASP B 1 140 ? 63.630  60.488  107.102 1.00 0.00 ? 144 ASP B OD2  1  
ATOM 4660   H H    . ASP B 1 140 ? 67.907  59.259  106.710 1.00 0.00 ? 144 ASP B H    1  
ATOM 4661   H HA   . ASP B 1 140 ? 66.003  58.618  104.946 1.00 0.00 ? 144 ASP B HA   1  
ATOM 4662   H HB2  . ASP B 1 140 ? 66.294  60.760  106.706 1.00 0.00 ? 144 ASP B HB2  1  
ATOM 4663   H HB3  . ASP B 1 140 ? 65.453  61.053  105.425 1.00 0.00 ? 144 ASP B HB3  1  
ATOM 4664   N N    . THR B 1 141 ? 66.943  59.397  102.846 1.00 0.00 ? 145 THR B N    1  
ATOM 4665   C CA   . THR B 1 141 ? 67.370  59.972  101.577 1.00 0.00 ? 145 THR B CA   1  
ATOM 4666   C C    . THR B 1 141 ? 66.696  61.305  101.290 1.00 0.00 ? 145 THR B C    1  
ATOM 4667   O O    . THR B 1 141 ? 67.389  62.247  100.883 1.00 0.00 ? 145 THR B O    1  
ATOM 4668   C CB   . THR B 1 141 ? 67.107  59.015  100.407 1.00 0.00 ? 145 THR B CB   1  
ATOM 4669   O OG1  . THR B 1 141 ? 65.936  58.233  100.670 1.00 0.00 ? 145 THR B OG1  1  
ATOM 4670   C CG2  . THR B 1 141 ? 68.291  58.111  100.153 1.00 0.00 ? 145 THR B CG2  1  
ATOM 4671   H H    . THR B 1 141 ? 66.525  58.649  102.773 1.00 0.00 ? 145 THR B H    1  
ATOM 4672   H HA   . THR B 1 141 ? 68.324  60.121  101.662 1.00 0.00 ? 145 THR B HA   1  
ATOM 4673   H HB   . THR B 1 141 ? 66.966  59.548  99.610  1.00 0.00 ? 145 THR B HB   1  
ATOM 4674   H HG1  . THR B 1 141 ? 65.337  58.428  100.114 1.00 0.00 ? 145 THR B HG1  1  
ATOM 4675   H HG21 . THR B 1 141 ? 68.197  57.552  99.365  1.00 0.00 ? 145 THR B HG21 1  
ATOM 4676   H HG22 . THR B 1 141 ? 69.069  58.650  99.939  1.00 0.00 ? 145 THR B HG22 1  
ATOM 4677   H HG23 . THR B 1 141 ? 68.471  57.583  100.946 1.00 0.00 ? 145 THR B HG23 1  
ATOM 4678   N N    . LEU B 1 142 ? 65.375  61.411  101.524 1.00 0.00 ? 146 LEU B N    1  
ATOM 4679   C CA   . LEU B 1 142 ? 64.523  62.552  101.191 1.00 0.00 ? 146 LEU B CA   1  
ATOM 4680   C C    . LEU B 1 142 ? 64.672  62.880  99.710  1.00 0.00 ? 146 LEU B C    1  
ATOM 4681   O O    . LEU B 1 142 ? 65.161  63.962  99.364  1.00 0.00 ? 146 LEU B O    1  
ATOM 4682   C CB   . LEU B 1 142 ? 64.843  63.773  102.060 1.00 0.00 ? 146 LEU B CB   1  
ATOM 4683   C CG   . LEU B 1 142 ? 64.750  63.637  103.586 1.00 0.00 ? 146 LEU B CG   1  
ATOM 4684   C CD1  . LEU B 1 142 ? 65.647  64.664  104.265 1.00 0.00 ? 146 LEU B CD1  1  
ATOM 4685   C CD2  . LEU B 1 142 ? 63.322  63.695  104.130 1.00 0.00 ? 146 LEU B CD2  1  
ATOM 4686   H H    . LEU B 1 142 ? 64.934  60.779  101.903 1.00 0.00 ? 146 LEU B H    1  
ATOM 4687   H HA   . LEU B 1 142 ? 63.601  62.311  101.375 1.00 0.00 ? 146 LEU B HA   1  
ATOM 4688   H HB2  . LEU B 1 142 ? 65.744  64.059  101.845 1.00 0.00 ? 146 LEU B HB2  1  
ATOM 4689   H HB3  . LEU B 1 142 ? 64.246  64.489  101.792 1.00 0.00 ? 146 LEU B HB3  1  
ATOM 4690   H HG   . LEU B 1 142 ? 65.067  62.747  103.801 1.00 0.00 ? 146 LEU B HG   1  
ATOM 4691   H HD11 . LEU B 1 142 ? 66.567  64.356  104.243 1.00 0.00 ? 146 LEU B HD11 1  
ATOM 4692   H HD12 . LEU B 1 142 ? 65.580  65.512  103.799 1.00 0.00 ? 146 LEU B HD12 1  
ATOM 4693   H HD13 . LEU B 1 142 ? 65.368  64.779  105.187 1.00 0.00 ? 146 LEU B HD13 1  
ATOM 4694   H HD21 . LEU B 1 142 ? 62.777  64.246  103.548 1.00 0.00 ? 146 LEU B HD21 1  
ATOM 4695   H HD22 . LEU B 1 142 ? 62.953  62.799  104.166 1.00 0.00 ? 146 LEU B HD22 1  
ATOM 4696   H HD23 . LEU B 1 142 ? 63.330  64.077  105.021 1.00 0.00 ? 146 LEU B HD23 1  
ATOM 4697   N N    . PRO B 1 143 ? 64.281  61.953  98.809  1.00 0.00 ? 147 PRO B N    1  
ATOM 4698   C CA   . PRO B 1 143 ? 64.779  61.978  97.423  1.00 0.00 ? 147 PRO B CA   1  
ATOM 4699   C C    . PRO B 1 143 ? 64.287  63.139  96.575  1.00 0.00 ? 147 PRO B C    1  
ATOM 4700   O O    . PRO B 1 143 ? 64.718  63.333  95.434  1.00 0.00 ? 147 PRO B O    1  
ATOM 4701   C CB   . PRO B 1 143 ? 64.246  60.659  96.842  1.00 0.00 ? 147 PRO B CB   1  
ATOM 4702   C CG   . PRO B 1 143 ? 63.964  59.800  98.027  1.00 0.00 ? 147 PRO B CG   1  
ATOM 4703   C CD   . PRO B 1 143 ? 63.487  60.744  99.081  1.00 0.00 ? 147 PRO B CD   1  
ATOM 4704   H HA   . PRO B 1 143 ? 65.743  62.093  97.412  1.00 0.00 ? 147 PRO B HA   1  
ATOM 4705   H HB2  . PRO B 1 143 ? 63.445  60.807  96.315  1.00 0.00 ? 147 PRO B HB2  1  
ATOM 4706   H HB3  . PRO B 1 143 ? 64.899  60.246  96.255  1.00 0.00 ? 147 PRO B HB3  1  
ATOM 4707   H HG2  . PRO B 1 143 ? 63.291  59.131  97.823  1.00 0.00 ? 147 PRO B HG2  1  
ATOM 4708   H HG3  . PRO B 1 143 ? 64.759  59.324  98.314  1.00 0.00 ? 147 PRO B HG3  1  
ATOM 4709   H HD2  . PRO B 1 143 ? 62.535  60.914  99.010  1.00 0.00 ? 147 PRO B HD2  1  
ATOM 4710   H HD3  . PRO B 1 143 ? 63.648  60.400  99.974  1.00 0.00 ? 147 PRO B HD3  1  
ATOM 4711   N N    . GLU B 1 144 ? 63.380  63.923  97.152  1.00 0.00 ? 148 GLU B N    1  
ATOM 4712   C CA   . GLU B 1 144 ? 62.922  65.173  96.568  1.00 0.00 ? 148 GLU B CA   1  
ATOM 4713   C C    . GLU B 1 144 ? 64.060  66.170  96.418  1.00 0.00 ? 148 GLU B C    1  
ATOM 4714   O O    . GLU B 1 144 ? 64.108  66.904  95.426  1.00 0.00 ? 148 GLU B O    1  
ATOM 4715   C CB   . GLU B 1 144 ? 61.803  65.775  97.417  1.00 0.00 ? 148 GLU B CB   1  
ATOM 4716   C CG   . GLU B 1 144 ? 61.045  64.751  98.232  1.00 0.00 ? 148 GLU B CG   1  
ATOM 4717   C CD   . GLU B 1 144 ? 61.574  64.629  99.642  1.00 0.00 ? 148 GLU B CD   1  
ATOM 4718   O OE1  . GLU B 1 144 ? 62.303  65.536  100.094 1.00 0.00 ? 148 GLU B OE1  1  
ATOM 4719   O OE2  . GLU B 1 144 ? 61.243  63.628  100.308 1.00 0.00 ? 148 GLU B OE2  1  
ATOM 4720   H H    . GLU B 1 144 ? 63.009  63.738  97.906  1.00 0.00 ? 148 GLU B H    1  
ATOM 4721   H HA   . GLU B 1 144 ? 62.580  64.977  95.681  1.00 0.00 ? 148 GLU B HA   1  
ATOM 4722   H HB2  . GLU B 1 144 ? 62.182  66.438  98.015  1.00 0.00 ? 148 GLU B HB2  1  
ATOM 4723   H HB3  . GLU B 1 144 ? 61.180  66.240  96.836  1.00 0.00 ? 148 GLU B HB3  1  
ATOM 4724   H HG2  . GLU B 1 144 ? 60.106  64.996  98.261  1.00 0.00 ? 148 GLU B HG2  1  
ATOM 4725   H HG3  . GLU B 1 144 ? 61.099  63.888  97.793  1.00 0.00 ? 148 GLU B HG3  1  
ATOM 4726   N N    . GLU B 1 145 ? 64.973  66.212  97.385  1.00 0.00 ? 149 GLU B N    1  
ATOM 4727   C CA   . GLU B 1 145 ? 66.018  67.220  97.415  1.00 0.00 ? 149 GLU B CA   1  
ATOM 4728   C C    . GLU B 1 145 ? 67.417  66.663  97.197  1.00 0.00 ? 149 GLU B C    1  
ATOM 4729   O O    . GLU B 1 145 ? 68.034  66.984  96.178  1.00 0.00 ? 149 GLU B O    1  
ATOM 4730   C CB   . GLU B 1 145 ? 65.975  67.968  98.755  1.00 0.00 ? 149 GLU B CB   1  
ATOM 4731   C CG   . GLU B 1 145 ? 64.896  69.042  98.834  1.00 0.00 ? 149 GLU B CG   1  
ATOM 4732   C CD   . GLU B 1 145 ? 63.938  68.845  99.995  1.00 0.00 ? 149 GLU B CD   1  
ATOM 4733   O OE1  . GLU B 1 145 ? 63.044  69.691  100.197 1.00 0.00 ? 149 GLU B OE1  1  
ATOM 4734   O OE2  . GLU B 1 145 ? 64.077  67.832  100.708 1.00 0.00 ? 149 GLU B OE2  1  
ATOM 4735   H H    . GLU B 1 145 ? 65.002  65.655  98.040  1.00 0.00 ? 149 GLU B H    1  
ATOM 4736   H HA   . GLU B 1 145 ? 65.838  67.819  96.673  1.00 0.00 ? 149 GLU B HA   1  
ATOM 4737   H HB2  . GLU B 1 145 ? 65.833  67.326  99.469  1.00 0.00 ? 149 GLU B HB2  1  
ATOM 4738   H HB3  . GLU B 1 145 ? 66.840  68.380  98.913  1.00 0.00 ? 149 GLU B HB3  1  
ATOM 4739   H HG2  . GLU B 1 145 ? 65.319  69.911  98.915  1.00 0.00 ? 149 GLU B HG2  1  
ATOM 4740   H HG3  . GLU B 1 145 ? 64.392  69.047  98.005  1.00 0.00 ? 149 GLU B HG3  1  
ATOM 4741   N N    . ILE B 1 146 ? 67.938  65.850  98.108  1.00 0.00 ? 150 ILE B N    1  
ATOM 4742   C CA   . ILE B 1 146 ? 69.267  65.267  97.987  1.00 0.00 ? 150 ILE B CA   1  
ATOM 4743   C C    . ILE B 1 146 ? 69.382  64.411  96.732  1.00 0.00 ? 150 ILE B C    1  
ATOM 4744   O O    . ILE B 1 146 ? 70.282  64.605  95.915  1.00 0.00 ? 150 ILE B O    1  
ATOM 4745   C CB   . ILE B 1 146 ? 69.627  64.454  99.250  1.00 0.00 ? 150 ILE B CB   1  
ATOM 4746   C CG1  . ILE B 1 146 ? 69.629  65.363  100.476 1.00 0.00 ? 150 ILE B CG1  1  
ATOM 4747   C CG2  . ILE B 1 146 ? 70.977  63.773  99.093  1.00 0.00 ? 150 ILE B CG2  1  
ATOM 4748   C CD1  . ILE B 1 146 ? 68.386  65.248  101.316 1.00 0.00 ? 150 ILE B CD1  1  
ATOM 4749   H H    . ILE B 1 146 ? 67.522  65.618  98.825  1.00 0.00 ? 150 ILE B H    1  
ATOM 4750   H HA   . ILE B 1 146 ? 69.903  65.994  97.905  1.00 0.00 ? 150 ILE B HA   1  
ATOM 4751   H HB   . ILE B 1 146 ? 68.956  63.764  99.370  1.00 0.00 ? 150 ILE B HB   1  
ATOM 4752   H HG12 . ILE B 1 146 ? 70.401  65.152  101.025 1.00 0.00 ? 150 ILE B HG12 1  
ATOM 4753   H HG13 . ILE B 1 146 ? 69.731  66.283  100.187 1.00 0.00 ? 150 ILE B HG13 1  
ATOM 4754   H HG21 . ILE B 1 146 ? 71.034  63.365  98.215  1.00 0.00 ? 150 ILE B HG21 1  
ATOM 4755   H HG22 . ILE B 1 146 ? 71.684  64.430  99.191  1.00 0.00 ? 150 ILE B HG22 1  
ATOM 4756   H HG23 . ILE B 1 146 ? 71.076  63.088  99.773  1.00 0.00 ? 150 ILE B HG23 1  
ATOM 4757   H HD11 . ILE B 1 146 ? 67.955  64.396  101.141 1.00 0.00 ? 150 ILE B HD11 1  
ATOM 4758   H HD12 . ILE B 1 146 ? 68.624  65.301  102.255 1.00 0.00 ? 150 ILE B HD12 1  
ATOM 4759   H HD13 . ILE B 1 146 ? 67.778  65.970  101.094 1.00 0.00 ? 150 ILE B HD13 1  
ATOM 4760   N N    . VAL B 1 147 ? 68.464  63.467  96.556  1.00 0.00 ? 151 VAL B N    1  
ATOM 4761   C CA   . VAL B 1 147 ? 68.520  62.541  95.435  1.00 0.00 ? 151 VAL B CA   1  
ATOM 4762   C C    . VAL B 1 147 ? 68.234  63.333  94.165  1.00 0.00 ? 151 VAL B C    1  
ATOM 4763   O O    . VAL B 1 147 ? 68.988  63.265  93.185  1.00 0.00 ? 151 VAL B O    1  
ATOM 4764   C CB   . VAL B 1 147 ? 67.521  61.386  95.649  1.00 0.00 ? 151 VAL B CB   1  
ATOM 4765   C CG1  . VAL B 1 147 ? 67.341  60.540  94.391  1.00 0.00 ? 151 VAL B CG1  1  
ATOM 4766   C CG2  . VAL B 1 147 ? 67.959  60.526  96.826  1.00 0.00 ? 151 VAL B CG2  1  
ATOM 4767   H H    . VAL B 1 147 ? 67.795  63.346  97.083  1.00 0.00 ? 151 VAL B H    1  
ATOM 4768   H HA   . VAL B 1 147 ? 69.396  62.132  95.360  1.00 0.00 ? 151 VAL B HA   1  
ATOM 4769   H HB   . VAL B 1 147 ? 66.656  61.777  95.849  1.00 0.00 ? 151 VAL B HB   1  
ATOM 4770   H HG11 . VAL B 1 147 ? 68.204  60.390  93.975  1.00 0.00 ? 151 VAL B HG11 1  
ATOM 4771   H HG12 . VAL B 1 147 ? 66.944  59.687  94.628  1.00 0.00 ? 151 VAL B HG12 1  
ATOM 4772   H HG13 . VAL B 1 147 ? 66.760  61.005  93.769  1.00 0.00 ? 151 VAL B HG13 1  
ATOM 4773   H HG21 . VAL B 1 147 ? 67.672  60.940  97.655  1.00 0.00 ? 151 VAL B HG21 1  
ATOM 4774   H HG22 . VAL B 1 147 ? 67.558  59.646  96.751  1.00 0.00 ? 151 VAL B HG22 1  
ATOM 4775   H HG23 . VAL B 1 147 ? 68.925  60.442  96.825  1.00 0.00 ? 151 VAL B HG23 1  
ATOM 4776   N N    . ASN B 1 148 ? 67.158  64.128  94.198  1.00 0.00 ? 152 ASN B N    1  
ATOM 4777   C CA   . ASN B 1 148 ? 66.733  64.886  93.025  1.00 0.00 ? 152 ASN B CA   1  
ATOM 4778   C C    . ASN B 1 148 ? 67.053  66.370  93.174  1.00 0.00 ? 152 ASN B C    1  
ATOM 4779   O O    . ASN B 1 148 ? 66.391  67.078  93.940  1.00 0.00 ? 152 ASN B O    1  
ATOM 4780   C CB   . ASN B 1 148 ? 65.237  64.680  92.796  1.00 0.00 ? 152 ASN B CB   1  
ATOM 4781   C CG   . ASN B 1 148 ? 64.620  65.745  91.908  1.00 0.00 ? 152 ASN B CG   1  
ATOM 4782   O OD1  . ASN B 1 148 ? 63.629  66.386  92.263  1.00 0.00 ? 152 ASN B OD1  1  
ATOM 4783   N ND2  . ASN B 1 148 ? 65.212  65.941  90.738  1.00 0.00 ? 152 ASN B ND2  1  
ATOM 4784   H H    . ASN B 1 148 ? 66.662  64.238  94.892  1.00 0.00 ? 152 ASN B H    1  
ATOM 4785   H HA   . ASN B 1 148 ? 67.224  64.559  92.255  1.00 0.00 ? 152 ASN B HA   1  
ATOM 4786   H HB2  . ASN B 1 148 ? 65.094  63.809  92.394  1.00 0.00 ? 152 ASN B HB2  1  
ATOM 4787   H HB3  . ASN B 1 148 ? 64.781  64.677  93.652  1.00 0.00 ? 152 ASN B HB3  1  
ATOM 4788   H HD21 . ASN B 1 148 ? 64.907  66.533  90.195  1.00 0.00 ? 152 ASN B HD21 1  
ATOM 4789   H HD22 . ASN B 1 148 ? 65.902  65.474  90.523  1.00 0.00 ? 152 ASN B HD22 1  
ATOM 4790   N N    . VAL B 1 149 ? 68.052  66.860  92.446  1.00 0.00 ? 153 VAL B N    1  
ATOM 4791   C CA   . VAL B 1 149 ? 68.285  68.297  92.393  1.00 0.00 ? 153 VAL B CA   1  
ATOM 4792   C C    . VAL B 1 149 ? 68.419  68.701  90.924  1.00 0.00 ? 153 VAL B C    1  
ATOM 4793   O O    . VAL B 1 149 ? 69.464  68.524  90.286  1.00 0.00 ? 153 VAL B O    1  
ATOM 4794   C CB   . VAL B 1 149 ? 69.481  68.706  93.286  1.00 0.00 ? 153 VAL B CB   1  
ATOM 4795   C CG1  . VAL B 1 149 ? 70.788  67.995  92.903  1.00 0.00 ? 153 VAL B CG1  1  
ATOM 4796   C CG2  . VAL B 1 149 ? 69.662  70.221  93.294  1.00 0.00 ? 153 VAL B CG2  1  
ATOM 4797   H H    . VAL B 1 149 ? 68.598  66.385  91.981  1.00 0.00 ? 153 VAL B H    1  
ATOM 4798   H HA   . VAL B 1 149 ? 67.534  68.788  92.765  1.00 0.00 ? 153 VAL B HA   1  
ATOM 4799   H HB   . VAL B 1 149 ? 69.267  68.414  94.186  1.00 0.00 ? 153 VAL B HB   1  
ATOM 4800   H HG11 . VAL B 1 149 ? 71.233  68.492  92.199  1.00 0.00 ? 153 VAL B HG11 1  
ATOM 4801   H HG12 . VAL B 1 149 ? 71.368  67.944  93.678  1.00 0.00 ? 153 VAL B HG12 1  
ATOM 4802   H HG13 . VAL B 1 149 ? 70.589  67.099  92.589  1.00 0.00 ? 153 VAL B HG13 1  
ATOM 4803   H HG21 . VAL B 1 149 ? 69.793  70.536  92.386  1.00 0.00 ? 153 VAL B HG21 1  
ATOM 4804   H HG22 . VAL B 1 149 ? 68.873  70.639  93.671  1.00 0.00 ? 153 VAL B HG22 1  
ATOM 4805   H HG23 . VAL B 1 149 ? 70.437  70.451  93.830  1.00 0.00 ? 153 VAL B HG23 1  
ATOM 4806   N N    . SER B 1 150 ? 67.321  69.194  90.352  1.00 0.00 ? 154 SER B N    1  
ATOM 4807   C CA   . SER B 1 150 ? 67.269  69.460  88.922  1.00 0.00 ? 154 SER B CA   1  
ATOM 4808   C C    . SER B 1 150 ? 67.582  70.910  88.579  1.00 0.00 ? 154 SER B C    1  
ATOM 4809   O O    . SER B 1 150 ? 67.476  71.787  89.441  1.00 0.00 ? 154 SER B O    1  
ATOM 4810   C CB   . SER B 1 150 ? 65.879  69.079  88.393  1.00 0.00 ? 154 SER B CB   1  
ATOM 4811   O OG   . SER B 1 150 ? 65.871  68.998  86.982  1.00 0.00 ? 154 SER B OG   1  
ATOM 4812   H H    . SER B 1 150 ? 66.597  69.380  90.777  1.00 0.00 ? 154 SER B H    1  
ATOM 4813   H HA   . SER B 1 150 ? 67.955  68.923  88.496  1.00 0.00 ? 154 SER B HA   1  
ATOM 4814   H HB2  . SER B 1 150 ? 65.610  68.226  88.770  1.00 0.00 ? 154 SER B HB2  1  
ATOM 4815   H HB3  . SER B 1 150 ? 65.227  69.735  88.685  1.00 0.00 ? 154 SER B HB3  1  
ATOM 4816   H HG   . SER B 1 150 ? 65.448  69.651  86.666  1.00 0.00 ? 154 SER B HG   1  
ATOM 4817   N N    . LYS B 1 151 ? 67.971  71.191  87.340  1.00 0.00 ? 155 LYS B N    1  
ATOM 4818   C CA   . LYS B 1 151 ? 68.186  72.573  86.929  1.00 0.00 ? 155 LYS B CA   1  
ATOM 4819   C C    . LYS B 1 151 ? 66.900  73.330  86.613  1.00 0.00 ? 155 LYS B C    1  
ATOM 4820   O O    . LYS B 1 151 ? 66.968  74.529  86.322  1.00 0.00 ? 155 LYS B O    1  
ATOM 4821   C CB   . LYS B 1 151 ? 69.120  72.608  85.708  1.00 0.00 ? 155 LYS B CB   1  
ATOM 4822   C CG   . LYS B 1 151 ? 70.542  72.145  85.952  1.00 0.00 ? 155 LYS B CG   1  
ATOM 4823   C CD   . LYS B 1 151 ? 71.368  73.240  86.605  1.00 0.00 ? 155 LYS B CD   1  
ATOM 4824   C CE   . LYS B 1 151 ? 72.861  73.007  86.421  1.00 0.00 ? 155 LYS B CE   1  
ATOM 4825   N NZ   . LYS B 1 151 ? 73.505  74.056  85.584  1.00 0.00 ? 155 LYS B NZ   1  
ATOM 4826   H H    . LYS B 1 151 ? 68.115  70.603  86.729  1.00 0.00 ? 155 LYS B H    1  
ATOM 4827   H HA   . LYS B 1 151 ? 68.589  73.025  87.688  1.00 0.00 ? 155 LYS B HA   1  
ATOM 4828   H HB2  . LYS B 1 151 ? 68.733  72.056  85.011  1.00 0.00 ? 155 LYS B HB2  1  
ATOM 4829   H HB3  . LYS B 1 151 ? 69.147  73.517  85.369  1.00 0.00 ? 155 LYS B HB3  1  
ATOM 4830   H HG2  . LYS B 1 151 ? 70.536  71.357  86.518  1.00 0.00 ? 155 LYS B HG2  1  
ATOM 4831   H HG3  . LYS B 1 151 ? 70.949  71.885  85.111  1.00 0.00 ? 155 LYS B HG3  1  
ATOM 4832   H HD2  . LYS B 1 151 ? 71.124  74.099  86.226  1.00 0.00 ? 155 LYS B HD2  1  
ATOM 4833   H HD3  . LYS B 1 151 ? 71.161  73.280  87.552  1.00 0.00 ? 155 LYS B HD3  1  
ATOM 4834   H HE2  . LYS B 1 151 ? 73.290  72.983  87.290  1.00 0.00 ? 155 LYS B HE2  1  
ATOM 4835   H HE3  . LYS B 1 151 ? 73.001  72.140  86.010  1.00 0.00 ? 155 LYS B HE3  1  
ATOM 4836   H HZ1  . LYS B 1 151 ? 73.181  74.854  85.808  1.00 0.00 ? 155 LYS B HZ1  1  
ATOM 4837   H HZ2  . LYS B 1 151 ? 74.385  74.045  85.719  1.00 0.00 ? 155 LYS B HZ2  1  
ATOM 4838   H HZ3  . LYS B 1 151 ? 73.334  73.897  84.725  1.00 0.00 ? 155 LYS B HZ3  1  
ATOM 4839   N N    . GLY B 1 152 ? 65.729  72.706  86.726  1.00 0.00 ? 156 GLY B N    1  
ATOM 4840   C CA   . GLY B 1 152 ? 64.479  73.352  86.375  1.00 0.00 ? 156 GLY B CA   1  
ATOM 4841   C C    . GLY B 1 152 ? 64.062  73.095  84.941  1.00 0.00 ? 156 GLY B C    1  
ATOM 4842   O O    . GLY B 1 152 ? 62.977  73.511  84.520  1.00 0.00 ? 156 GLY B O    1  
ATOM 4843   H H    . GLY B 1 152 ? 65.643  71.898  87.008  1.00 0.00 ? 156 GLY B H    1  
ATOM 4844   H HA2  . GLY B 1 152 ? 63.780  73.039  86.971  1.00 0.00 ? 156 GLY B HA2  1  
ATOM 4845   H HA3  . GLY B 1 152 ? 64.565  74.308  86.515  1.00 0.00 ? 156 GLY B HA3  1  
ATOM 4846   N N    . GLY B 1 153 ? 64.908  72.409  84.186  1.00 0.00 ? 157 GLY B N    1  
ATOM 4847   C CA   . GLY B 1 153 ? 64.658  72.150  82.781  1.00 0.00 ? 157 GLY B CA   1  
ATOM 4848   C C    . GLY B 1 153 ? 63.650  71.027  82.589  1.00 0.00 ? 157 GLY B C    1  
ATOM 4849   O O    . GLY B 1 153 ? 63.674  70.027  83.308  1.00 0.00 ? 157 GLY B O    1  
ATOM 4850   H H    . GLY B 1 153 ? 65.648  72.080  84.479  1.00 0.00 ? 157 GLY B H    1  
ATOM 4851   H HA2  . GLY B 1 153 ? 64.329  72.957  82.356  1.00 0.00 ? 157 GLY B HA2  1  
ATOM 4852   H HA3  . GLY B 1 153 ? 65.491  71.916  82.341  1.00 0.00 ? 157 GLY B HA3  1  
ATOM 4853   N N    . TYR B 1 154 ? 62.770  71.218  81.614  1.00 0.00 ? 158 TYR B N    1  
ATOM 4854   C CA   . TYR B 1 154 ? 61.750  70.253  81.228  1.00 0.00 ? 158 TYR B CA   1  
ATOM 4855   C C    . TYR B 1 154 ? 61.654  70.228  79.704  1.00 0.00 ? 158 TYR B C    1  
ATOM 4856   O O    . TYR B 1 154 ? 61.951  71.225  79.039  1.00 0.00 ? 158 TYR B O    1  
ATOM 4857   C CB   . TYR B 1 154 ? 60.418  70.595  81.901  1.00 0.00 ? 158 TYR B CB   1  
ATOM 4858   C CG   . TYR B 1 154 ? 60.531  70.801  83.403  1.00 0.00 ? 158 TYR B CG   1  
ATOM 4859   C CD1  . TYR B 1 154 ? 60.165  72.007  83.992  1.00 0.00 ? 158 TYR B CD1  1  
ATOM 4860   C CD2  . TYR B 1 154 ? 60.990  69.787  84.231  1.00 0.00 ? 158 TYR B CD2  1  
ATOM 4861   C CE1  . TYR B 1 154 ? 60.256  72.198  85.352  1.00 0.00 ? 158 TYR B CE1  1  
ATOM 4862   C CE2  . TYR B 1 154 ? 61.084  69.972  85.598  1.00 0.00 ? 158 TYR B CE2  1  
ATOM 4863   C CZ   . TYR B 1 154 ? 60.717  71.179  86.149  1.00 0.00 ? 158 TYR B CZ   1  
ATOM 4864   O OH   . TYR B 1 154 ? 60.806  71.379  87.505  1.00 0.00 ? 158 TYR B OH   1  
ATOM 4865   H H    . TYR B 1 154 ? 62.749  71.937  81.144  1.00 0.00 ? 158 TYR B H    1  
ATOM 4866   H HA   . TYR B 1 154 ? 61.987  69.362  81.529  1.00 0.00 ? 158 TYR B HA   1  
ATOM 4867   H HB2  . TYR B 1 154 ? 60.058  71.400  81.498  1.00 0.00 ? 158 TYR B HB2  1  
ATOM 4868   H HB3  . TYR B 1 154 ? 59.784  69.882  81.727  1.00 0.00 ? 158 TYR B HB3  1  
ATOM 4869   H HD1  . TYR B 1 154 ? 59.852  72.699  83.455  1.00 0.00 ? 158 TYR B HD1  1  
ATOM 4870   H HD2  . TYR B 1 154 ? 61.239  68.971  83.861  1.00 0.00 ? 158 TYR B HD2  1  
ATOM 4871   H HE1  . TYR B 1 154 ? 60.007  73.011  85.728  1.00 0.00 ? 158 TYR B HE1  1  
ATOM 4872   H HE2  . TYR B 1 154 ? 61.394  69.284  86.143  1.00 0.00 ? 158 TYR B HE2  1  
ATOM 4873   H HH   . TYR B 1 154 ? 60.285  70.853  87.901  1.00 0.00 ? 158 TYR B HH   1  
ATOM 4874   N N    . ASP B 1 155 ? 61.262  69.069  79.153  1.00 0.00 ? 159 ASP B N    1  
ATOM 4875   C CA   . ASP B 1 155 ? 61.561  68.749  77.756  1.00 0.00 ? 159 ASP B CA   1  
ATOM 4876   C C    . ASP B 1 155 ? 61.023  69.739  76.728  1.00 0.00 ? 159 ASP B C    1  
ATOM 4877   O O    . ASP B 1 155 ? 61.820  70.267  75.947  1.00 0.00 ? 159 ASP B O    1  
ATOM 4878   C CB   . ASP B 1 155 ? 61.026  67.358  77.425  1.00 0.00 ? 159 ASP B CB   1  
ATOM 4879   C CG   . ASP B 1 155 ? 61.863  66.651  76.388  1.00 0.00 ? 159 ASP B CG   1  
ATOM 4880   O OD1  . ASP B 1 155 ? 61.301  66.249  75.348  1.00 0.00 ? 159 ASP B OD1  1  
ATOM 4881   O OD2  . ASP B 1 155 ? 63.080  66.490  76.617  1.00 0.00 ? 159 ASP B OD2  1  
ATOM 4882   H H    . ASP B 1 155 ? 60.824  68.459  79.573  1.00 0.00 ? 159 ASP B H    1  
ATOM 4883   H HA   . ASP B 1 155 ? 62.528  68.797  77.688  1.00 0.00 ? 159 ASP B HA   1  
ATOM 4884   H HB2  . ASP B 1 155 ? 60.999  66.823  78.234  1.00 0.00 ? 159 ASP B HB2  1  
ATOM 4885   H HB3  . ASP B 1 155 ? 60.114  67.432  77.104  1.00 0.00 ? 159 ASP B HB3  1  
ATOM 4886   N N    . PHE B 1 156 ? 59.709  70.013  76.747  1.00 0.00 ? 160 PHE B N    1  
ATOM 4887   C CA   . PHE B 1 156 ? 59.006  71.096  76.044  1.00 0.00 ? 160 PHE B CA   1  
ATOM 4888   C C    . PHE B 1 156 ? 57.834  71.568  76.897  1.00 0.00 ? 160 PHE B C    1  
ATOM 4889   O O    . PHE B 1 156 ? 57.378  70.876  77.812  1.00 0.00 ? 160 PHE B O    1  
ATOM 4890   C CB   . PHE B 1 156 ? 58.455  70.738  74.653  1.00 0.00 ? 160 PHE B CB   1  
ATOM 4891   C CG   . PHE B 1 156 ? 57.136  70.014  74.667  1.00 0.00 ? 160 PHE B CG   1  
ATOM 4892   C CD1  . PHE B 1 156 ? 57.002  68.806  75.333  1.00 0.00 ? 160 PHE B CD1  1  
ATOM 4893   C CD2  . PHE B 1 156 ? 56.059  70.491  73.934  1.00 0.00 ? 160 PHE B CD2  1  
ATOM 4894   C CE1  . PHE B 1 156 ? 55.802  68.123  75.321  1.00 0.00 ? 160 PHE B CE1  1  
ATOM 4895   C CE2  . PHE B 1 156 ? 54.858  69.814  73.918  1.00 0.00 ? 160 PHE B CE2  1  
ATOM 4896   C CZ   . PHE B 1 156 ? 54.730  68.627  74.611  1.00 0.00 ? 160 PHE B CZ   1  
ATOM 4897   H H    . PHE B 1 156 ? 59.165  69.531  77.209  1.00 0.00 ? 160 PHE B H    1  
ATOM 4898   H HA   . PHE B 1 156 ? 59.679  71.780  75.905  1.00 0.00 ? 160 PHE B HA   1  
ATOM 4899   H HB2  . PHE B 1 156 ? 58.357  71.554  74.139  1.00 0.00 ? 160 PHE B HB2  1  
ATOM 4900   H HB3  . PHE B 1 156 ? 59.108  70.189  74.192  1.00 0.00 ? 160 PHE B HB3  1  
ATOM 4901   H HD1  . PHE B 1 156 ? 57.727  68.452  75.794  1.00 0.00 ? 160 PHE B HD1  1  
ATOM 4902   H HD2  . PHE B 1 156 ? 56.149  71.277  73.447  1.00 0.00 ? 160 PHE B HD2  1  
ATOM 4903   H HE1  . PHE B 1 156 ? 55.716  67.325  75.791  1.00 0.00 ? 160 PHE B HE1  1  
ATOM 4904   H HE2  . PHE B 1 156 ? 54.136  70.155  73.441  1.00 0.00 ? 160 PHE B HE2  1  
ATOM 4905   H HZ   . PHE B 1 156 ? 53.922  68.168  74.600  1.00 0.00 ? 160 PHE B HZ   1  
ATOM 4906   N N    . GLN B 1 157 ? 57.350  72.764  76.559  1.00 0.00 ? 161 GLN B N    1  
ATOM 4907   C CA   . GLN B 1 157 ? 55.970  73.176  76.819  1.00 0.00 ? 161 GLN B CA   1  
ATOM 4908   C C    . GLN B 1 157 ? 55.558  74.034  75.631  1.00 0.00 ? 161 GLN B C    1  
ATOM 4909   O O    . GLN B 1 157 ? 55.738  75.252  75.671  1.00 0.00 ? 161 GLN B O    1  
ATOM 4910   C CB   . GLN B 1 157 ? 55.842  73.944  78.128  1.00 0.00 ? 161 GLN B CB   1  
ATOM 4911   C CG   . GLN B 1 157 ? 55.884  73.040  79.346  1.00 0.00 ? 161 GLN B CG   1  
ATOM 4912   C CD   . GLN B 1 157 ? 55.012  73.529  80.486  1.00 0.00 ? 161 GLN B CD   1  
ATOM 4913   O OE1  . GLN B 1 157 ? 54.667  74.708  80.566  1.00 0.00 ? 161 GLN B OE1  1  
ATOM 4914   N NE2  . GLN B 1 157 ? 54.659  72.618  81.385  1.00 0.00 ? 161 GLN B NE2  1  
ATOM 4915   H H    . GLN B 1 157 ? 57.822  73.368  76.168  1.00 0.00 ? 161 GLN B H    1  
ATOM 4916   H HA   . GLN B 1 157 ? 55.393  72.402  76.916  1.00 0.00 ? 161 GLN B HA   1  
ATOM 4917   H HB2  . GLN B 1 157 ? 56.558  74.595  78.188  1.00 0.00 ? 161 GLN B HB2  1  
ATOM 4918   H HB3  . GLN B 1 157 ? 55.008  74.439  78.127  1.00 0.00 ? 161 GLN B HB3  1  
ATOM 4919   H HG2  . GLN B 1 157 ? 55.601  72.149  79.089  1.00 0.00 ? 161 GLN B HG2  1  
ATOM 4920   H HG3  . GLN B 1 157 ? 56.801  72.968  79.655  1.00 0.00 ? 161 GLN B HG3  1  
ATOM 4921   H HE21 . GLN B 1 157 ? 54.920  71.803  81.296  1.00 0.00 ? 161 GLN B HE21 1  
ATOM 4922   H HE22 . GLN B 1 157 ? 54.172  72.842  82.057  1.00 0.00 ? 161 GLN B HE22 1  
ATOM 4923   N N    . GLN B 1 158 ? 55.001  73.408  74.581  1.00 0.00 ? 162 GLN B N    1  
ATOM 4924   C CA   . GLN B 1 158 ? 54.849  74.115  73.309  1.00 0.00 ? 162 GLN B CA   1  
ATOM 4925   C C    . GLN B 1 158 ? 53.395  74.448  72.952  1.00 0.00 ? 162 GLN B C    1  
ATOM 4926   O O    . GLN B 1 158 ? 53.187  75.415  72.203  1.00 0.00 ? 162 GLN B O    1  
ATOM 4927   C CB   . GLN B 1 158 ? 55.567  73.350  72.189  1.00 0.00 ? 162 GLN B CB   1  
ATOM 4928   C CG   . GLN B 1 158 ? 56.076  74.207  71.051  1.00 0.00 ? 162 GLN B CG   1  
ATOM 4929   C CD   . GLN B 1 158 ? 57.356  73.658  70.458  1.00 0.00 ? 162 GLN B CD   1  
ATOM 4930   O OE1  . GLN B 1 158 ? 57.544  72.445  70.384  1.00 0.00 ? 162 GLN B OE1  1  
ATOM 4931   N NE2  . GLN B 1 158 ? 58.243  74.547  70.033  1.00 0.00 ? 162 GLN B NE2  1  
ATOM 4932   H H    . GLN B 1 158 ? 54.713  72.598  74.588  1.00 0.00 ? 162 GLN B H    1  
ATOM 4933   H HA   . GLN B 1 158 ? 55.276  74.980  73.414  1.00 0.00 ? 162 GLN B HA   1  
ATOM 4934   H HB2  . GLN B 1 158 ? 56.316  72.868  72.574  1.00 0.00 ? 162 GLN B HB2  1  
ATOM 4935   H HB3  . GLN B 1 158 ? 54.959  72.686  71.828  1.00 0.00 ? 162 GLN B HB3  1  
ATOM 4936   H HG2  . GLN B 1 158 ? 55.398  74.263  70.360  1.00 0.00 ? 162 GLN B HG2  1  
ATOM 4937   H HG3  . GLN B 1 158 ? 56.229  75.110  71.371  1.00 0.00 ? 162 GLN B HG3  1  
ATOM 4938   H HE21 . GLN B 1 158 ? 58.076  75.387  70.101  1.00 0.00 ? 162 GLN B HE21 1  
ATOM 4939   H HE22 . GLN B 1 158 ? 58.985  74.282  69.688  1.00 0.00 ? 162 GLN B HE22 1  
ATOM 4940   N N    . PRO B 1 159 ? 52.360  73.734  73.432  1.00 0.00 ? 163 PRO B N    1  
ATOM 4941   C CA   . PRO B 1 159 ? 51.001  74.243  73.185  1.00 0.00 ? 163 PRO B CA   1  
ATOM 4942   C C    . PRO B 1 159 ? 50.604  75.396  74.088  1.00 0.00 ? 163 PRO B C    1  
ATOM 4943   O O    . PRO B 1 159 ? 49.428  75.787  74.080  1.00 0.00 ? 163 PRO B O    1  
ATOM 4944   C CB   . PRO B 1 159 ? 50.114  72.999  73.367  1.00 0.00 ? 163 PRO B CB   1  
ATOM 4945   C CG   . PRO B 1 159 ? 51.027  71.848  73.306  1.00 0.00 ? 163 PRO B CG   1  
ATOM 4946   C CD   . PRO B 1 159 ? 52.274  72.351  73.942  1.00 0.00 ? 163 PRO B CD   1  
ATOM 4947   H HA   . PRO B 1 159 ? 50.924  74.605  72.288  1.00 0.00 ? 163 PRO B HA   1  
ATOM 4948   H HB2  . PRO B 1 159 ? 49.645  73.026  74.215  1.00 0.00 ? 163 PRO B HB2  1  
ATOM 4949   H HB3  . PRO B 1 159 ? 49.440  72.946  72.671  1.00 0.00 ? 163 PRO B HB3  1  
ATOM 4950   H HG2  . PRO B 1 159 ? 50.668  71.082  73.783  1.00 0.00 ? 163 PRO B HG2  1  
ATOM 4951   H HG3  . PRO B 1 159 ? 51.183  71.565  72.391  1.00 0.00 ? 163 PRO B HG3  1  
ATOM 4952   H HD2  . PRO B 1 159 ? 52.221  72.327  74.911  1.00 0.00 ? 163 PRO B HD2  1  
ATOM 4953   H HD3  . PRO B 1 159 ? 53.048  71.824  73.688  1.00 0.00 ? 163 PRO B HD3  1  
ATOM 4954   N N    . GLY B 1 160 ? 51.526  75.932  74.881  1.00 0.00 ? 164 GLY B N    1  
ATOM 4955   C CA   . GLY B 1 160 ? 51.149  76.910  75.880  1.00 0.00 ? 164 GLY B CA   1  
ATOM 4956   C C    . GLY B 1 160 ? 50.554  76.415  77.184  1.00 0.00 ? 164 GLY B C    1  
ATOM 4957   O O    . GLY B 1 160 ? 49.326  76.349  77.294  1.00 0.00 ? 164 GLY B O    1  
ATOM 4958   H H    . GLY B 1 160 ? 52.364  75.743  74.854  1.00 0.00 ? 164 GLY B H    1  
ATOM 4959   H HA2  . GLY B 1 160 ? 51.937  77.433  76.094  1.00 0.00 ? 164 GLY B HA2  1  
ATOM 4960   H HA3  . GLY B 1 160 ? 50.508  77.516  75.474  1.00 0.00 ? 164 GLY B HA3  1  
ATOM 4961   N N    . GLN B 1 161 ? 51.377  76.036  78.165  1.00 0.00 ? 165 GLN B N    1  
ATOM 4962   C CA   . GLN B 1 161 ? 50.824  75.641  79.458  1.00 0.00 ? 165 GLN B CA   1  
ATOM 4963   C C    . GLN B 1 161 ? 50.946  76.771  80.469  1.00 0.00 ? 165 GLN B C    1  
ATOM 4964   O O    . GLN B 1 161 ? 51.700  76.660  81.444  1.00 0.00 ? 165 GLN B O    1  
ATOM 4965   C CB   . GLN B 1 161 ? 51.510  74.381  79.983  1.00 0.00 ? 165 GLN B CB   1  
ATOM 4966   C CG   . GLN B 1 161 ? 51.196  73.152  79.157  1.00 0.00 ? 165 GLN B CG   1  
ATOM 4967   C CD   . GLN B 1 161 ? 51.964  73.134  77.849  1.00 0.00 ? 165 GLN B CD   1  
ATOM 4968   O OE1  . GLN B 1 161 ? 53.133  72.753  77.809  1.00 0.00 ? 165 GLN B OE1  1  
ATOM 4969   N NE2  . GLN B 1 161 ? 51.303  73.535  76.771  1.00 0.00 ? 165 GLN B NE2  1  
ATOM 4970   H H    . GLN B 1 161 ? 52.234  76.000  78.105  1.00 0.00 ? 165 GLN B H    1  
ATOM 4971   H HA   . GLN B 1 161 ? 49.882  75.445  79.330  1.00 0.00 ? 165 GLN B HA   1  
ATOM 4972   H HB2  . GLN B 1 161 ? 52.470  74.521  79.995  1.00 0.00 ? 165 GLN B HB2  1  
ATOM 4973   H HB3  . GLN B 1 161 ? 51.236  74.227  80.901  1.00 0.00 ? 165 GLN B HB3  1  
ATOM 4974   H HG2  . GLN B 1 161 ? 51.411  72.357  79.668  1.00 0.00 ? 165 GLN B HG2  1  
ATOM 4975   H HG3  . GLN B 1 161 ? 50.245  73.123  78.972  1.00 0.00 ? 165 GLN B HG3  1  
ATOM 4976   H HE21 . GLN B 1 161 ? 50.487  73.794  76.839  1.00 0.00 ? 165 GLN B HE21 1  
ATOM 4977   H HE22 . GLN B 1 161 ? 51.692  73.535  76.004  1.00 0.00 ? 165 GLN B HE22 1  
ATOM 4978   N N    . THR B 1 162 ? 50.189  77.856  80.252  1.00 0.00 ? 166 THR B N    1  
ATOM 4979   C CA   . THR B 1 162 ? 50.085  79.026  81.139  1.00 0.00 ? 166 THR B CA   1  
ATOM 4980   C C    . THR B 1 162 ? 51.347  79.218  81.979  1.00 0.00 ? 166 THR B C    1  
ATOM 4981   O O    . THR B 1 162 ? 51.371  78.944  83.179  1.00 0.00 ? 166 THR B O    1  
ATOM 4982   C CB   . THR B 1 162 ? 48.849  78.943  82.048  1.00 0.00 ? 166 THR B CB   1  
ATOM 4983   O OG1  . THR B 1 162 ? 47.659  78.883  81.253  1.00 0.00 ? 166 THR B OG1  1  
ATOM 4984   C CG2  . THR B 1 162 ? 48.772  80.152  82.950  1.00 0.00 ? 166 THR B CG2  1  
ATOM 4985   H H    . THR B 1 162 ? 49.698  77.933  79.549  1.00 0.00 ? 166 THR B H    1  
ATOM 4986   H HA   . THR B 1 162 ? 49.986  79.800  80.563  1.00 0.00 ? 166 THR B HA   1  
ATOM 4987   H HB   . THR B 1 162 ? 48.926  78.141  82.589  1.00 0.00 ? 166 THR B HB   1  
ATOM 4988   H HG1  . THR B 1 162 ? 47.402  78.085  81.193  1.00 0.00 ? 166 THR B HG1  1  
ATOM 4989   H HG21 . THR B 1 162 ? 49.392  79.899  83.652  1.00 0.00 ? 166 THR B HG21 1  
ATOM 4990   H HG22 . THR B 1 162 ? 49.567  80.194  83.504  1.00 0.00 ? 166 THR B HG22 1  
ATOM 4991   H HG23 . THR B 1 162 ? 48.711  80.955  82.410  1.00 0.00 ? 166 THR B HG23 1  
ATOM 4992   N N    . THR B 1 163 ? 52.416  79.674  81.334  1.00 0.00 ? 167 THR B N    1  
ATOM 4993   C CA   . THR B 1 163 ? 53.719  79.633  81.973  1.00 0.00 ? 167 THR B CA   1  
ATOM 4994   C C    . THR B 1 163 ? 54.015  80.989  82.600  1.00 0.00 ? 167 THR B C    1  
ATOM 4995   O O    . THR B 1 163 ? 53.391  81.997  82.259  1.00 0.00 ? 167 THR B O    1  
ATOM 4996   C CB   . THR B 1 163 ? 54.813  79.272  80.960  1.00 0.00 ? 167 THR B CB   1  
ATOM 4997   O OG1  . THR B 1 163 ? 54.246  78.496  79.901  1.00 0.00 ? 167 THR B OG1  1  
ATOM 4998   C CG2  . THR B 1 163 ? 55.837  78.388  81.607  1.00 0.00 ? 167 THR B CG2  1  
ATOM 4999   H H    . THR B 1 163 ? 52.407  80.005  80.540  1.00 0.00 ? 167 THR B H    1  
ATOM 5000   H HA   . THR B 1 163 ? 53.708  78.950  82.662  1.00 0.00 ? 167 THR B HA   1  
ATOM 5001   H HB   . THR B 1 163 ? 55.206  80.097  80.636  1.00 0.00 ? 167 THR B HB   1  
ATOM 5002   H HG1  . THR B 1 163 ? 54.397  78.873  79.166  1.00 0.00 ? 167 THR B HG1  1  
ATOM 5003   H HG21 . THR B 1 163 ? 56.423  78.229  80.850  1.00 0.00 ? 167 THR B HG21 1  
ATOM 5004   H HG22 . THR B 1 163 ? 56.237  78.853  82.358  1.00 0.00 ? 167 THR B HG22 1  
ATOM 5005   H HG23 . THR B 1 163 ? 55.411  77.575  81.920  1.00 0.00 ? 167 THR B HG23 1  
ATOM 5006   N N    . GLY B 1 164 ? 54.971  81.003  83.528  1.00 0.00 ? 168 GLY B N    1  
ATOM 5007   C CA   . GLY B 1 164 ? 55.481  82.235  84.097  1.00 0.00 ? 168 GLY B CA   1  
ATOM 5008   C C    . GLY B 1 164 ? 56.985  82.213  84.271  1.00 0.00 ? 168 GLY B C    1  
ATOM 5009   O O    . GLY B 1 164 ? 57.684  81.491  83.555  1.00 0.00 ? 168 GLY B O    1  
ATOM 5010   H H    . GLY B 1 164 ? 55.340  80.292  83.843  1.00 0.00 ? 168 GLY B H    1  
ATOM 5011   H HA2  . GLY B 1 164 ? 55.235  82.978  83.524  1.00 0.00 ? 168 GLY B HA2  1  
ATOM 5012   H HA3  . GLY B 1 164 ? 55.061  82.388  84.957  1.00 0.00 ? 168 GLY B HA3  1  
ATOM 5013   N N    . GLU B 1 165 ? 57.493  83.002  85.222  1.00 0.00 ? 169 GLU B N    1  
ATOM 5014   C CA   . GLU B 1 165 ? 58.935  83.097  85.439  1.00 0.00 ? 169 GLU B CA   1  
ATOM 5015   C C    . GLU B 1 165 ? 59.501  81.796  85.996  1.00 0.00 ? 169 GLU B C    1  
ATOM 5016   O O    . GLU B 1 165 ? 60.699  81.524  85.866  1.00 0.00 ? 169 GLU B O    1  
ATOM 5017   C CB   . GLU B 1 165 ? 59.242  84.265  86.383  1.00 0.00 ? 169 GLU B CB   1  
ATOM 5018   C CG   . GLU B 1 165 ? 60.248  85.301  85.867  1.00 0.00 ? 169 GLU B CG   1  
ATOM 5019   C CD   . GLU B 1 165 ? 59.622  86.414  85.053  1.00 0.00 ? 169 GLU B CD   1  
ATOM 5020   O OE1  . GLU B 1 165 ? 60.316  86.955  84.168  1.00 0.00 ? 169 GLU B OE1  1  
ATOM 5021   O OE2  . GLU B 1 165 ? 58.448  86.755  85.302  1.00 0.00 ? 169 GLU B OE2  1  
ATOM 5022   H H    . GLU B 1 165 ? 57.019  83.488  85.749  1.00 0.00 ? 169 GLU B H    1  
ATOM 5023   H HA   . GLU B 1 165 ? 59.362  83.258  84.583  1.00 0.00 ? 169 GLU B HA   1  
ATOM 5024   H HB2  . GLU B 1 165 ? 58.410  84.721  86.585  1.00 0.00 ? 169 GLU B HB2  1  
ATOM 5025   H HB3  . GLU B 1 165 ? 59.577  83.902  87.218  1.00 0.00 ? 169 GLU B HB3  1  
ATOM 5026   H HG2  . GLU B 1 165 ? 60.716  85.689  86.623  1.00 0.00 ? 169 GLU B HG2  1  
ATOM 5027   H HG3  . GLU B 1 165 ? 60.914  84.849  85.324  1.00 0.00 ? 169 GLU B HG3  1  
ATOM 5028   N N    . ALA B 1 166 ? 58.650  80.990  86.640  1.00 0.00 ? 170 ALA B N    1  
ATOM 5029   C CA   . ALA B 1 166 ? 59.048  79.733  87.263  1.00 0.00 ? 170 ALA B CA   1  
ATOM 5030   C C    . ALA B 1 166 ? 59.215  78.671  86.188  1.00 0.00 ? 170 ALA B C    1  
ATOM 5031   O O    . ALA B 1 166 ? 58.661  78.807  85.092  1.00 0.00 ? 170 ALA B O    1  
ATOM 5032   C CB   . ALA B 1 166 ? 58.018  79.287  88.297  1.00 0.00 ? 170 ALA B CB   1  
ATOM 5033   H H    . ALA B 1 166 ? 57.813  81.166  86.726  1.00 0.00 ? 170 ALA B H    1  
ATOM 5034   H HA   . ALA B 1 166 ? 59.892  79.863  87.723  1.00 0.00 ? 170 ALA B HA   1  
ATOM 5035   H HB1  . ALA B 1 166 ? 58.414  78.621  88.881  1.00 0.00 ? 170 ALA B HB1  1  
ATOM 5036   H HB2  . ALA B 1 166 ? 57.736  80.052  88.824  1.00 0.00 ? 170 ALA B HB2  1  
ATOM 5037   H HB3  . ALA B 1 166 ? 57.250  78.905  87.844  1.00 0.00 ? 170 ALA B HB3  1  
ATOM 5038   N N    . PRO B 1 167 ? 59.914  77.587  86.484  1.00 0.00 ? 171 PRO B N    1  
ATOM 5039   C CA   . PRO B 1 167 ? 60.556  76.787  85.440  1.00 0.00 ? 171 PRO B CA   1  
ATOM 5040   C C    . PRO B 1 167 ? 59.612  75.766  84.816  1.00 0.00 ? 171 PRO B C    1  
ATOM 5041   O O    . PRO B 1 167 ? 59.915  75.120  83.818  1.00 0.00 ? 171 PRO B O    1  
ATOM 5042   C CB   . PRO B 1 167 ? 61.648  76.061  86.212  1.00 0.00 ? 171 PRO B CB   1  
ATOM 5043   C CG   . PRO B 1 167 ? 61.073  75.878  87.566  1.00 0.00 ? 171 PRO B CG   1  
ATOM 5044   C CD   . PRO B 1 167 ? 60.202  77.067  87.834  1.00 0.00 ? 171 PRO B CD   1  
ATOM 5045   H HA   . PRO B 1 167 ? 60.856  77.326  84.691  1.00 0.00 ? 171 PRO B HA   1  
ATOM 5046   H HB2  . PRO B 1 167 ? 61.867  75.210  85.802  1.00 0.00 ? 171 PRO B HB2  1  
ATOM 5047   H HB3  . PRO B 1 167 ? 62.466  76.581  86.242  1.00 0.00 ? 171 PRO B HB3  1  
ATOM 5048   H HG2  . PRO B 1 167 ? 60.558  75.058  87.613  1.00 0.00 ? 171 PRO B HG2  1  
ATOM 5049   H HG3  . PRO B 1 167 ? 61.776  75.810  88.231  1.00 0.00 ? 171 PRO B HG3  1  
ATOM 5050   H HD2  . PRO B 1 167 ? 59.391  76.818  88.303  1.00 0.00 ? 171 PRO B HD2  1  
ATOM 5051   H HD3  . PRO B 1 167 ? 60.655  77.727  88.382  1.00 0.00 ? 171 PRO B HD3  1  
ATOM 5052   N N    . GLY B 1 168 ? 58.446  75.632  85.447  1.00 0.00 ? 172 GLY B N    1  
ATOM 5053   C CA   . GLY B 1 168 ? 57.309  74.962  84.849  1.00 0.00 ? 172 GLY B CA   1  
ATOM 5054   C C    . GLY B 1 168 ? 55.940  75.290  85.406  1.00 0.00 ? 172 GLY B C    1  
ATOM 5055   O O    . GLY B 1 168 ? 55.572  74.782  86.469  1.00 0.00 ? 172 GLY B O    1  
ATOM 5056   H H    . GLY B 1 168 ? 58.298  75.932  86.240  1.00 0.00 ? 172 GLY B H    1  
ATOM 5057   H HA2  . GLY B 1 168 ? 57.304  75.166  83.900  1.00 0.00 ? 172 GLY B HA2  1  
ATOM 5058   H HA3  . GLY B 1 168 ? 57.446  74.005  84.932  1.00 0.00 ? 172 GLY B HA3  1  
ATOM 5059   N N    . THR B 1 169 ? 55.175  76.133  84.722  1.00 0.00 ? 173 THR B N    1  
ATOM 5060   C CA   . THR B 1 169 ? 53.782  76.336  85.084  1.00 0.00 ? 173 THR B CA   1  
ATOM 5061   C C    . THR B 1 169 ? 52.893  75.422  84.252  1.00 0.00 ? 173 THR B C    1  
ATOM 5062   O O    . THR B 1 169 ? 53.305  74.867  83.230  1.00 0.00 ? 173 THR B O    1  
ATOM 5063   C CB   . THR B 1 169 ? 53.346  77.797  84.911  1.00 0.00 ? 173 THR B CB   1  
ATOM 5064   O OG1  . THR B 1 169 ? 54.506  78.637  84.900  1.00 0.00 ? 173 THR B OG1  1  
ATOM 5065   C CG2  . THR B 1 169 ? 52.471  78.239  86.058  1.00 0.00 ? 173 THR B CG2  1  
ATOM 5066   H H    . THR B 1 169 ? 55.444  76.595  84.048  1.00 0.00 ? 173 THR B H    1  
ATOM 5067   H HA   . THR B 1 169 ? 53.688  76.115  86.024  1.00 0.00 ? 173 THR B HA   1  
ATOM 5068   H HB   . THR B 1 169 ? 52.852  77.868  84.080  1.00 0.00 ? 173 THR B HB   1  
ATOM 5069   H HG1  . THR B 1 169 ? 54.272  79.439  84.991  1.00 0.00 ? 173 THR B HG1  1  
ATOM 5070   H HG21 . THR B 1 169 ? 52.185  79.092  85.698  1.00 0.00 ? 173 THR B HG21 1  
ATOM 5071   H HG22 . THR B 1 169 ? 51.678  77.680  86.094  1.00 0.00 ? 173 THR B HG22 1  
ATOM 5072   H HG23 . THR B 1 169 ? 52.961  78.156  86.891  1.00 0.00 ? 173 THR B HG23 1  
ATOM 5073   N N    . VAL B 1 170 ? 51.660  75.271  84.720  1.00 0.00 ? 174 VAL B N    1  
ATOM 5074   C CA   . VAL B 1 170 ? 50.638  74.467  84.055  1.00 0.00 ? 174 VAL B CA   1  
ATOM 5075   C C    . VAL B 1 170 ? 49.446  75.366  83.743  1.00 0.00 ? 174 VAL B C    1  
ATOM 5076   O O    . VAL B 1 170 ? 49.393  76.502  84.237  1.00 0.00 ? 174 VAL B O    1  
ATOM 5077   C CB   . VAL B 1 170 ? 50.252  73.261  84.927  1.00 0.00 ? 174 VAL B CB   1  
ATOM 5078   C CG1  . VAL B 1 170 ? 51.500  72.592  85.454  1.00 0.00 ? 174 VAL B CG1  1  
ATOM 5079   C CG2  . VAL B 1 170 ? 49.377  73.698  86.079  1.00 0.00 ? 174 VAL B CG2  1  
ATOM 5080   H H    . VAL B 1 170 ? 51.387  75.639  85.447  1.00 0.00 ? 174 VAL B H    1  
ATOM 5081   H HA   . VAL B 1 170 ? 50.978  74.105  83.223  1.00 0.00 ? 174 VAL B HA   1  
ATOM 5082   H HB   . VAL B 1 170 ? 49.755  72.632  84.382  1.00 0.00 ? 174 VAL B HB   1  
ATOM 5083   H HG11 . VAL B 1 170 ? 51.540  72.696  86.417  1.00 0.00 ? 174 VAL B HG11 1  
ATOM 5084   H HG12 . VAL B 1 170 ? 51.479  71.648  85.231  1.00 0.00 ? 174 VAL B HG12 1  
ATOM 5085   H HG13 . VAL B 1 170 ? 52.282  73.001  85.051  1.00 0.00 ? 174 VAL B HG13 1  
ATOM 5086   H HG21 . VAL B 1 170 ? 49.425  73.039  86.789  1.00 0.00 ? 174 VAL B HG21 1  
ATOM 5087   H HG22 . VAL B 1 170 ? 49.685  74.555  86.413  1.00 0.00 ? 174 VAL B HG22 1  
ATOM 5088   H HG23 . VAL B 1 170 ? 48.459  73.780  85.776  1.00 0.00 ? 174 VAL B HG23 1  
ATOM 5089   N N    . PRO B 1 171 ? 48.484  74.927  82.905  1.00 0.00 ? 175 PRO B N    1  
ATOM 5090   C CA   . PRO B 1 171 ? 47.333  75.789  82.603  1.00 0.00 ? 175 PRO B CA   1  
ATOM 5091   C C    . PRO B 1 171 ? 46.380  75.884  83.776  1.00 0.00 ? 175 PRO B C    1  
ATOM 5092   O O    . PRO B 1 171 ? 45.692  74.908  84.097  1.00 0.00 ? 175 PRO B O    1  
ATOM 5093   C CB   . PRO B 1 171 ? 46.606  75.034  81.482  1.00 0.00 ? 175 PRO B CB   1  
ATOM 5094   C CG   . PRO B 1 171 ? 47.620  74.133  80.908  1.00 0.00 ? 175 PRO B CG   1  
ATOM 5095   C CD   . PRO B 1 171 ? 48.522  73.747  82.022  1.00 0.00 ? 175 PRO B CD   1  
ATOM 5096   H HA   . PRO B 1 171 ? 47.595  76.704  82.413  1.00 0.00 ? 175 PRO B HA   1  
ATOM 5097   H HB2  . PRO B 1 171 ? 45.849  74.536  81.829  1.00 0.00 ? 175 PRO B HB2  1  
ATOM 5098   H HB3  . PRO B 1 171 ? 46.260  75.646  80.813  1.00 0.00 ? 175 PRO B HB3  1  
ATOM 5099   H HG2  . PRO B 1 171 ? 47.203  73.351  80.515  1.00 0.00 ? 175 PRO B HG2  1  
ATOM 5100   H HG3  . PRO B 1 171 ? 48.115  74.577  80.202  1.00 0.00 ? 175 PRO B HG3  1  
ATOM 5101   H HD2  . PRO B 1 171 ? 48.211  72.948  82.476  1.00 0.00 ? 175 PRO B HD2  1  
ATOM 5102   H HD3  . PRO B 1 171 ? 49.422  73.561  81.708  1.00 0.00 ? 175 PRO B HD3  1  
ATOM 5103   N N    . ALA B 1 172 ? 46.334  77.066  84.390  1.00 0.00 ? 176 ALA B N    1  
ATOM 5104   C CA   . ALA B 1 172 ? 45.626  77.347  85.640  1.00 0.00 ? 176 ALA B CA   1  
ATOM 5105   C C    . ALA B 1 172 ? 46.093  76.452  86.784  1.00 0.00 ? 176 ALA B C    1  
ATOM 5106   O O    . ALA B 1 172 ? 47.274  76.124  86.885  1.00 0.00 ? 176 ALA B O    1  
ATOM 5107   C CB   . ALA B 1 172 ? 44.107  77.228  85.449  1.00 0.00 ? 176 ALA B CB   1  
ATOM 5108   H H    . ALA B 1 172 ? 46.734  77.759  84.074  1.00 0.00 ? 176 ALA B H    1  
ATOM 5109   H HA   . ALA B 1 172 ? 45.839  78.261  85.884  1.00 0.00 ? 176 ALA B HA   1  
ATOM 5110   H HB1  . ALA B 1 172 ? 43.718  76.779  86.216  1.00 0.00 ? 176 ALA B HB1  1  
ATOM 5111   H HB2  . ALA B 1 172 ? 43.721  78.114  85.363  1.00 0.00 ? 176 ALA B HB2  1  
ATOM 5112   H HB3  . ALA B 1 172 ? 43.921  76.716  84.647  1.00 0.00 ? 176 ALA B HB3  1  
ATOM 5113   N N    . PRO C 1 1   ? 116.206 72.832  94.823  1.00 0.00 ? 5   PRO C N    1  
ATOM 5114   C CA   . PRO C 1 1   ? 116.152 72.620  96.272  1.00 0.00 ? 5   PRO C CA   1  
ATOM 5115   C C    . PRO C 1 1   ? 115.012 71.617  96.406  1.00 0.00 ? 5   PRO C C    1  
ATOM 5116   O O    . PRO C 1 1   ? 114.747 70.862  95.472  1.00 0.00 ? 5   PRO C O    1  
ATOM 5117   C CB   . PRO C 1 1   ? 115.874 74.022  96.819  1.00 0.00 ? 5   PRO C CB   1  
ATOM 5118   C CG   . PRO C 1 1   ? 115.201 74.738  95.702  1.00 0.00 ? 5   PRO C CG   1  
ATOM 5119   C CD   . PRO C 1 1   ? 115.818 74.203  94.449  1.00 0.00 ? 5   PRO C CD   1  
ATOM 5120   H HA   . PRO C 1 1   ? 116.909 72.185  96.696  1.00 0.00 ? 5   PRO C HA   1  
ATOM 5121   H HB2  . PRO C 1 1   ? 115.308 73.987  97.607  1.00 0.00 ? 5   PRO C HB2  1  
ATOM 5122   H HB3  . PRO C 1 1   ? 116.695 74.467  97.079  1.00 0.00 ? 5   PRO C HB3  1  
ATOM 5123   H HG2  . PRO C 1 1   ? 114.244 74.581  95.714  1.00 0.00 ? 5   PRO C HG2  1  
ATOM 5124   H HG3  . PRO C 1 1   ? 115.331 75.697  95.773  1.00 0.00 ? 5   PRO C HG3  1  
ATOM 5125   H HD2  . PRO C 1 1   ? 115.190 74.208  93.710  1.00 0.00 ? 5   PRO C HD2  1  
ATOM 5126   H HD3  . PRO C 1 1   ? 116.584 74.730  94.175  1.00 0.00 ? 5   PRO C HD3  1  
ATOM 5127   N N    . ILE C 1 2   ? 114.350 71.608  97.559  1.00 0.00 ? 6   ILE C N    1  
ATOM 5128   C CA   . ILE C 1 2   ? 113.219 70.727  97.817  1.00 0.00 ? 6   ILE C CA   1  
ATOM 5129   C C    . ILE C 1 2   ? 111.991 71.346  97.167  1.00 0.00 ? 6   ILE C C    1  
ATOM 5130   O O    . ILE C 1 2   ? 111.725 72.543  97.337  1.00 0.00 ? 6   ILE C O    1  
ATOM 5131   C CB   . ILE C 1 2   ? 113.001 70.502  99.319  1.00 0.00 ? 6   ILE C CB   1  
ATOM 5132   C CG1  . ILE C 1 2   ? 114.336 70.216  100.008 1.00 0.00 ? 6   ILE C CG1  1  
ATOM 5133   C CG2  . ILE C 1 2   ? 112.049 69.353  99.550  1.00 0.00 ? 6   ILE C CG2  1  
ATOM 5134   C CD1  . ILE C 1 2   ? 114.523 70.729  101.466 1.00 0.00 ? 6   ILE C CD1  1  
ATOM 5135   H H    . ILE C 1 2   ? 114.549 72.120  98.221  1.00 0.00 ? 6   ILE C H    1  
ATOM 5136   H HA   . ILE C 1 2   ? 113.394 69.852  97.437  1.00 0.00 ? 6   ILE C HA   1  
ATOM 5137   H HB   . ILE C 1 2   ? 112.614 71.308  99.697  1.00 0.00 ? 6   ILE C HB   1  
ATOM 5138   H HG12 . ILE C 1 2   ? 114.471 69.256  100.010 1.00 0.00 ? 6   ILE C HG12 1  
ATOM 5139   H HG13 . ILE C 1 2   ? 115.040 70.600  99.464  1.00 0.00 ? 6   ILE C HG13 1  
ATOM 5140   H HG21 . ILE C 1 2   ? 111.868 68.908  98.707  1.00 0.00 ? 6   ILE C HG21 1  
ATOM 5141   H HG22 . ILE C 1 2   ? 112.449 68.721  100.168 1.00 0.00 ? 6   ILE C HG22 1  
ATOM 5142   H HG23 . ILE C 1 2   ? 111.220 69.690  99.923  1.00 0.00 ? 6   ILE C HG23 1  
ATOM 5143   H HD11 . ILE C 1 2   ? 113.659 70.965  101.839 1.00 0.00 ? 6   ILE C HD11 1  
ATOM 5144   H HD12 . ILE C 1 2   ? 114.928 70.032  102.004 1.00 0.00 ? 6   ILE C HD12 1  
ATOM 5145   H HD13 . ILE C 1 2   ? 115.098 71.510  101.463 1.00 0.00 ? 6   ILE C HD13 1  
ATOM 5146   N N    . MET C 1 3   ? 111.248 70.534  96.423  1.00 0.00 ? 7   MET C N    1  
ATOM 5147   C CA   . MET C 1 3   ? 110.078 70.992  95.694  1.00 0.00 ? 7   MET C CA   1  
ATOM 5148   C C    . MET C 1 3   ? 108.839 70.953  96.582  1.00 0.00 ? 7   MET C C    1  
ATOM 5149   O O    . MET C 1 3   ? 108.817 70.325  97.640  1.00 0.00 ? 7   MET C O    1  
ATOM 5150   C CB   . MET C 1 3   ? 109.862 70.135  94.449  1.00 0.00 ? 7   MET C CB   1  
ATOM 5151   C CG   . MET C 1 3   ? 110.125 70.847  93.131  1.00 0.00 ? 7   MET C CG   1  
ATOM 5152   S SD   . MET C 1 3   ? 111.316 72.190  93.252  1.00 0.00 ? 7   MET C SD   1  
ATOM 5153   C CE   . MET C 1 3   ? 112.860 71.292  93.374  1.00 0.00 ? 7   MET C CE   1  
ATOM 5154   H H    . MET C 1 3   ? 111.411 69.695  96.328  1.00 0.00 ? 7   MET C H    1  
ATOM 5155   H HA   . MET C 1 3   ? 110.230 71.910  95.421  1.00 0.00 ? 7   MET C HA   1  
ATOM 5156   H HB2  . MET C 1 3   ? 110.439 69.358  94.503  1.00 0.00 ? 7   MET C HB2  1  
ATOM 5157   H HB3  . MET C 1 3   ? 108.948 69.810  94.450  1.00 0.00 ? 7   MET C HB3  1  
ATOM 5158   H HG2  . MET C 1 3   ? 110.445 70.200  92.483  1.00 0.00 ? 7   MET C HG2  1  
ATOM 5159   H HG3  . MET C 1 3   ? 109.287 71.199  92.791  1.00 0.00 ? 7   MET C HG3  1  
ATOM 5160   H HE1  . MET C 1 3   ? 112.993 70.768  92.569  1.00 0.00 ? 7   MET C HE1  1  
ATOM 5161   H HE2  . MET C 1 3   ? 113.592 71.920  93.476  1.00 0.00 ? 7   MET C HE2  1  
ATOM 5162   H HE3  . MET C 1 3   ? 112.831 70.701  94.143  1.00 0.00 ? 7   MET C HE3  1  
ATOM 5163   N N    . GLY C 1 4   ? 107.784 71.626  96.120  1.00 0.00 ? 8   GLY C N    1  
ATOM 5164   C CA   . GLY C 1 4   ? 106.502 71.602  96.805  1.00 0.00 ? 8   GLY C CA   1  
ATOM 5165   C C    . GLY C 1 4   ? 105.851 70.236  96.872  1.00 0.00 ? 8   GLY C C    1  
ATOM 5166   O O    . GLY C 1 4   ? 105.166 69.943  97.858  1.00 0.00 ? 8   GLY C O    1  
ATOM 5167   H H    . GLY C 1 4   ? 107.796 72.104  95.405  1.00 0.00 ? 8   GLY C H    1  
ATOM 5168   H HA2  . GLY C 1 4   ? 106.625 71.935  97.708  1.00 0.00 ? 8   GLY C HA2  1  
ATOM 5169   H HA3  . GLY C 1 4   ? 105.898 72.214  96.357  1.00 0.00 ? 8   GLY C HA3  1  
ATOM 5170   N N    . GLN C 1 5   ? 106.041 69.407  95.850  1.00 0.00 ? 9   GLN C N    1  
ATOM 5171   C CA   . GLN C 1 5   ? 105.615 68.019  95.863  1.00 0.00 ? 9   GLN C CA   1  
ATOM 5172   C C    . GLN C 1 5   ? 106.583 67.123  96.618  1.00 0.00 ? 9   GLN C C    1  
ATOM 5173   O O    . GLN C 1 5   ? 106.199 66.021  97.025  1.00 0.00 ? 9   GLN C O    1  
ATOM 5174   C CB   . GLN C 1 5   ? 105.475 67.515  94.425  1.00 0.00 ? 9   GLN C CB   1  
ATOM 5175   C CG   . GLN C 1 5   ? 104.188 67.956  93.763  1.00 0.00 ? 9   GLN C CG   1  
ATOM 5176   C CD   . GLN C 1 5   ? 103.100 68.266  94.762  1.00 0.00 ? 9   GLN C CD   1  
ATOM 5177   O OE1  . GLN C 1 5   ? 102.384 67.373  95.213  1.00 0.00 ? 9   GLN C OE1  1  
ATOM 5178   N NE2  . GLN C 1 5   ? 102.958 69.540  95.107  1.00 0.00 ? 9   GLN C NE2  1  
ATOM 5179   H H    . GLN C 1 5   ? 106.428 69.643  95.119  1.00 0.00 ? 9   GLN C H    1  
ATOM 5180   H HA   . GLN C 1 5   ? 104.761 67.981  96.323  1.00 0.00 ? 9   GLN C HA   1  
ATOM 5181   H HB2  . GLN C 1 5   ? 106.227 67.834  93.901  1.00 0.00 ? 9   GLN C HB2  1  
ATOM 5182   H HB3  . GLN C 1 5   ? 105.517 66.546  94.422  1.00 0.00 ? 9   GLN C HB3  1  
ATOM 5183   H HG2  . GLN C 1 5   ? 104.359 68.742  93.222  1.00 0.00 ? 9   GLN C HG2  1  
ATOM 5184   H HG3  . GLN C 1 5   ? 103.882 67.259  93.162  1.00 0.00 ? 9   GLN C HG3  1  
ATOM 5185   H HE21 . GLN C 1 5   ? 103.477 70.137  94.771  1.00 0.00 ? 9   GLN C HE21 1  
ATOM 5186   H HE22 . GLN C 1 5   ? 102.347 69.768  95.668  1.00 0.00 ? 9   GLN C HE22 1  
ATOM 5187   N N    . ASP C 1 6   ? 107.816 67.582  96.831  1.00 0.00 ? 10  ASP C N    1  
ATOM 5188   C CA   . ASP C 1 6   ? 108.873 66.751  97.389  1.00 0.00 ? 10  ASP C CA   1  
ATOM 5189   C C    . ASP C 1 6   ? 108.646 66.353  98.839  1.00 0.00 ? 10  ASP C C    1  
ATOM 5190   O O    . ASP C 1 6   ? 108.900 65.197  99.178  1.00 0.00 ? 10  ASP C O    1  
ATOM 5191   C CB   . ASP C 1 6   ? 110.227 67.461  97.290  1.00 0.00 ? 10  ASP C CB   1  
ATOM 5192   C CG   . ASP C 1 6   ? 111.372 66.511  96.993  1.00 0.00 ? 10  ASP C CG   1  
ATOM 5193   O OD1  . ASP C 1 6   ? 111.816 65.803  97.921  1.00 0.00 ? 10  ASP C OD1  1  
ATOM 5194   O OD2  . ASP C 1 6   ? 111.841 66.491  95.836  1.00 0.00 ? 10  ASP C OD2  1  
ATOM 5195   H H    . ASP C 1 6   ? 108.061 68.388  96.653  1.00 0.00 ? 10  ASP C H    1  
ATOM 5196   H HA   . ASP C 1 6   ? 108.864 65.939  96.860  1.00 0.00 ? 10  ASP C HA   1  
ATOM 5197   H HB2  . ASP C 1 6   ? 110.184 68.134  96.593  1.00 0.00 ? 10  ASP C HB2  1  
ATOM 5198   H HB3  . ASP C 1 6   ? 110.406 67.925  98.122  1.00 0.00 ? 10  ASP C HB3  1  
ATOM 5199   N N    . VAL C 1 7   ? 108.208 67.260  99.706  1.00 0.00 ? 11  VAL C N    1  
ATOM 5200   C CA   . VAL C 1 7   ? 108.008 66.959  101.121 1.00 0.00 ? 11  VAL C CA   1  
ATOM 5201   C C    . VAL C 1 7   ? 106.565 66.527  101.308 1.00 0.00 ? 11  VAL C C    1  
ATOM 5202   O O    . VAL C 1 7   ? 105.645 67.323  101.088 1.00 0.00 ? 11  VAL C O    1  
ATOM 5203   C CB   . VAL C 1 7   ? 108.318 68.166  102.017 1.00 0.00 ? 11  VAL C CB   1  
ATOM 5204   C CG1  . VAL C 1 7   ? 108.190 67.780  103.478 1.00 0.00 ? 11  VAL C CG1  1  
ATOM 5205   C CG2  . VAL C 1 7   ? 109.690 68.730  101.724 1.00 0.00 ? 11  VAL C CG2  1  
ATOM 5206   H H    . VAL C 1 7   ? 108.017 68.071  99.490  1.00 0.00 ? 11  VAL C H    1  
ATOM 5207   H HA   . VAL C 1 7   ? 108.618 66.252  101.382 1.00 0.00 ? 11  VAL C HA   1  
ATOM 5208   H HB   . VAL C 1 7   ? 107.672 68.863  101.823 1.00 0.00 ? 11  VAL C HB   1  
ATOM 5209   H HG11 . VAL C 1 7   ? 108.410 68.543  104.035 1.00 0.00 ? 11  VAL C HG11 1  
ATOM 5210   H HG12 . VAL C 1 7   ? 107.279 67.500  103.660 1.00 0.00 ? 11  VAL C HG12 1  
ATOM 5211   H HG13 . VAL C 1 7   ? 108.798 67.051  103.674 1.00 0.00 ? 11  VAL C HG13 1  
ATOM 5212   H HG21 . VAL C 1 7   ? 110.322 68.003  101.611 1.00 0.00 ? 11  VAL C HG21 1  
ATOM 5213   H HG22 . VAL C 1 7   ? 109.656 69.257  100.911 1.00 0.00 ? 11  VAL C HG22 1  
ATOM 5214   H HG23 . VAL C 1 7   ? 109.973 69.291  102.462 1.00 0.00 ? 11  VAL C HG23 1  
ATOM 5215   N N    . LYS C 1 8   ? 106.358 65.277  101.722 1.00 0.00 ? 12  LYS C N    1  
ATOM 5216   C CA   . LYS C 1 8   ? 105.010 64.803  102.005 1.00 0.00 ? 12  LYS C CA   1  
ATOM 5217   C C    . LYS C 1 8   ? 104.930 64.232  103.413 1.00 0.00 ? 12  LYS C C    1  
ATOM 5218   O O    . LYS C 1 8   ? 105.935 63.832  104.008 1.00 0.00 ? 12  LYS C O    1  
ATOM 5219   C CB   . LYS C 1 8   ? 104.523 63.779  100.967 1.00 0.00 ? 12  LYS C CB   1  
ATOM 5220   C CG   . LYS C 1 8   ? 103.069 64.010  100.567 1.00 0.00 ? 12  LYS C CG   1  
ATOM 5221   C CD   . LYS C 1 8   ? 102.623 63.195  99.376  1.00 0.00 ? 12  LYS C CD   1  
ATOM 5222   C CE   . LYS C 1 8   ? 103.097 63.814  98.085  1.00 0.00 ? 12  LYS C CE   1  
ATOM 5223   N NZ   . LYS C 1 8   ? 103.024 62.831  96.974  1.00 0.00 ? 12  LYS C NZ   1  
ATOM 5224   H H    . LYS C 1 8   ? 106.979 64.695  101.843 1.00 0.00 ? 12  LYS C H    1  
ATOM 5225   H HA   . LYS C 1 8   ? 104.416 65.568  101.946 1.00 0.00 ? 12  LYS C HA   1  
ATOM 5226   H HB2  . LYS C 1 8   ? 105.086 63.829  100.177 1.00 0.00 ? 12  LYS C HB2  1  
ATOM 5227   H HB3  . LYS C 1 8   ? 104.620 62.884  101.328 1.00 0.00 ? 12  LYS C HB3  1  
ATOM 5228   H HG2  . LYS C 1 8   ? 102.498 63.800  101.323 1.00 0.00 ? 12  LYS C HG2  1  
ATOM 5229   H HG3  . LYS C 1 8   ? 102.943 64.952  100.369 1.00 0.00 ? 12  LYS C HG3  1  
ATOM 5230   H HD2  . LYS C 1 8   ? 102.970 62.292  99.451  1.00 0.00 ? 12  LYS C HD2  1  
ATOM 5231   H HD3  . LYS C 1 8   ? 101.656 63.127  99.369  1.00 0.00 ? 12  LYS C HD3  1  
ATOM 5232   H HE2  . LYS C 1 8   ? 102.553 64.589  97.873  1.00 0.00 ? 12  LYS C HE2  1  
ATOM 5233   H HE3  . LYS C 1 8   ? 104.009 64.127  98.186  1.00 0.00 ? 12  LYS C HE3  1  
ATOM 5234   H HZ1  . LYS C 1 8   ? 103.095 62.006  97.301  1.00 0.00 ? 12  LYS C HZ1  1  
ATOM 5235   H HZ2  . LYS C 1 8   ? 102.245 62.916  96.552  1.00 0.00 ? 12  LYS C HZ2  1  
ATOM 5236   H HZ3  . LYS C 1 8   ? 103.688 62.980  96.401  1.00 0.00 ? 12  LYS C HZ3  1  
ATOM 5237   N N    . TYR C 1 9   ? 103.711 64.226  103.947 1.00 0.00 ? 13  TYR C N    1  
ATOM 5238   C CA   . TYR C 1 9   ? 103.459 64.034  105.374 1.00 0.00 ? 13  TYR C CA   1  
ATOM 5239   C C    . TYR C 1 9   ? 102.573 62.805  105.554 1.00 0.00 ? 13  TYR C C    1  
ATOM 5240   O O    . TYR C 1 9   ? 101.469 62.734  105.011 1.00 0.00 ? 13  TYR C O    1  
ATOM 5241   C CB   . TYR C 1 9   ? 102.798 65.272  105.991 1.00 0.00 ? 13  TYR C CB   1  
ATOM 5242   C CG   . TYR C 1 9   ? 103.568 66.571  105.856 1.00 0.00 ? 13  TYR C CG   1  
ATOM 5243   C CD1  . TYR C 1 9   ? 104.074 67.230  106.965 1.00 0.00 ? 13  TYR C CD1  1  
ATOM 5244   C CD2  . TYR C 1 9   ? 103.764 67.150  104.612 1.00 0.00 ? 13  TYR C CD2  1  
ATOM 5245   C CE1  . TYR C 1 9   ? 104.771 68.403  106.836 1.00 0.00 ? 13  TYR C CE1  1  
ATOM 5246   C CE2  . TYR C 1 9   ? 104.451 68.337  104.480 1.00 0.00 ? 13  TYR C CE2  1  
ATOM 5247   C CZ   . TYR C 1 9   ? 104.954 68.956  105.599 1.00 0.00 ? 13  TYR C CZ   1  
ATOM 5248   O OH   . TYR C 1 9   ? 105.642 70.140  105.497 1.00 0.00 ? 13  TYR C OH   1  
ATOM 5249   H H    . TYR C 1 9   ? 102.996 64.335  103.482 1.00 0.00 ? 13  TYR C H    1  
ATOM 5250   H HA   . TYR C 1 9   ? 104.303 63.899  105.831 1.00 0.00 ? 13  TYR C HA   1  
ATOM 5251   H HB2  . TYR C 1 9   ? 101.926 65.390  105.582 1.00 0.00 ? 13  TYR C HB2  1  
ATOM 5252   H HB3  . TYR C 1 9   ? 102.649 65.101  106.934 1.00 0.00 ? 13  TYR C HB3  1  
ATOM 5253   H HD1  . TYR C 1 9   ? 103.938 66.870  107.812 1.00 0.00 ? 13  TYR C HD1  1  
ATOM 5254   H HD2  . TYR C 1 9   ? 103.426 66.731  103.855 1.00 0.00 ? 13  TYR C HD2  1  
ATOM 5255   H HE1  . TYR C 1 9   ? 105.120 68.822  107.589 1.00 0.00 ? 13  TYR C HE1  1  
ATOM 5256   H HE2  . TYR C 1 9   ? 104.573 68.715  103.640 1.00 0.00 ? 13  TYR C HE2  1  
ATOM 5257   H HH   . TYR C 1 9   ? 105.413 70.538  104.794 1.00 0.00 ? 13  TYR C HH   1  
ATOM 5258   N N    . LEU C 1 10  ? 103.056 61.841  106.329 1.00 0.00 ? 14  LEU C N    1  
ATOM 5259   C CA   . LEU C 1 10  ? 102.256 60.670  106.666 1.00 0.00 ? 14  LEU C CA   1  
ATOM 5260   C C    . LEU C 1 10  ? 102.039 60.616  108.173 1.00 0.00 ? 14  LEU C C    1  
ATOM 5261   O O    . LEU C 1 10  ? 102.900 61.050  108.948 1.00 0.00 ? 14  LEU C O    1  
ATOM 5262   C CB   . LEU C 1 10  ? 102.933 59.392  106.179 1.00 0.00 ? 14  LEU C CB   1  
ATOM 5263   C CG   . LEU C 1 10  ? 104.427 59.212  106.439 1.00 0.00 ? 14  LEU C CG   1  
ATOM 5264   C CD1  . LEU C 1 10  ? 104.704 57.808  106.935 1.00 0.00 ? 14  LEU C CD1  1  
ATOM 5265   C CD2  . LEU C 1 10  ? 105.213 59.470  105.179 1.00 0.00 ? 14  LEU C CD2  1  
ATOM 5266   H H    . LEU C 1 10  ? 103.845 61.845  106.671 1.00 0.00 ? 14  LEU C H    1  
ATOM 5267   H HA   . LEU C 1 10  ? 101.396 60.741  106.222 1.00 0.00 ? 14  LEU C HA   1  
ATOM 5268   H HB2  . LEU C 1 10  ? 102.470 58.641  106.583 1.00 0.00 ? 14  LEU C HB2  1  
ATOM 5269   H HB3  . LEU C 1 10  ? 102.791 59.330  105.221 1.00 0.00 ? 14  LEU C HB3  1  
ATOM 5270   H HG   . LEU C 1 10  ? 104.701 59.849  107.117 1.00 0.00 ? 14  LEU C HG   1  
ATOM 5271   H HD11 . LEU C 1 10  ? 105.198 57.318  106.260 1.00 0.00 ? 14  LEU C HD11 1  
ATOM 5272   H HD12 . LEU C 1 10  ? 105.227 57.850  107.751 1.00 0.00 ? 14  LEU C HD12 1  
ATOM 5273   H HD13 . LEU C 1 10  ? 103.864 57.356  107.113 1.00 0.00 ? 14  LEU C HD13 1  
ATOM 5274   H HD21 . LEU C 1 10  ? 106.145 59.617  105.403 1.00 0.00 ? 14  LEU C HD21 1  
ATOM 5275   H HD22 . LEU C 1 10  ? 105.140 58.705  104.588 1.00 0.00 ? 14  LEU C HD22 1  
ATOM 5276   H HD23 . LEU C 1 10  ? 104.861 60.256  104.732 1.00 0.00 ? 14  LEU C HD23 1  
ATOM 5277   N N    . PHE C 1 11  ? 100.897 60.081  108.588 1.00 0.00 ? 15  PHE C N    1  
ATOM 5278   C CA   . PHE C 1 11  ? 100.589 59.887  109.996 1.00 0.00 ? 15  PHE C CA   1  
ATOM 5279   C C    . PHE C 1 11  ? 100.345 58.412  110.276 1.00 0.00 ? 15  PHE C C    1  
ATOM 5280   O O    . PHE C 1 11  ? 99.771  57.687  109.458 1.00 0.00 ? 15  PHE C O    1  
ATOM 5281   C CB   . PHE C 1 11  ? 99.353  60.690  110.411 1.00 0.00 ? 15  PHE C CB   1  
ATOM 5282   C CG   . PHE C 1 11  ? 99.122  61.936  109.606 1.00 0.00 ? 15  PHE C CG   1  
ATOM 5283   C CD1  . PHE C 1 11  ? 98.163  61.984  108.607 1.00 0.00 ? 15  PHE C CD1  1  
ATOM 5284   C CD2  . PHE C 1 11  ? 99.879  63.070  109.857 1.00 0.00 ? 15  PHE C CD2  1  
ATOM 5285   C CE1  . PHE C 1 11  ? 97.960  63.139  107.882 1.00 0.00 ? 15  PHE C CE1  1  
ATOM 5286   C CE2  . PHE C 1 11  ? 99.681  64.226  109.130 1.00 0.00 ? 15  PHE C CE2  1  
ATOM 5287   C CZ   . PHE C 1 11  ? 98.721  64.259  108.141 1.00 0.00 ? 15  PHE C CZ   1  
ATOM 5288   H H    . PHE C 1 11  ? 100.274 59.819  108.056 1.00 0.00 ? 15  PHE C H    1  
ATOM 5289   H HA   . PHE C 1 11  ? 101.349 60.201  110.511 1.00 0.00 ? 15  PHE C HA   1  
ATOM 5290   H HB2  . PHE C 1 11  ? 98.571  60.120  110.336 1.00 0.00 ? 15  PHE C HB2  1  
ATOM 5291   H HB3  . PHE C 1 11  ? 99.438  60.933  111.347 1.00 0.00 ? 15  PHE C HB3  1  
ATOM 5292   H HD1  . PHE C 1 11  ? 97.651  61.229  108.424 1.00 0.00 ? 15  PHE C HD1  1  
ATOM 5293   H HD2  . PHE C 1 11  ? 100.527 63.051  110.523 1.00 0.00 ? 15  PHE C HD2  1  
ATOM 5294   H HE1  . PHE C 1 11  ? 97.309  63.163  107.218 1.00 0.00 ? 15  PHE C HE1  1  
ATOM 5295   H HE2  . PHE C 1 11  ? 100.194 64.982  109.308 1.00 0.00 ? 15  PHE C HE2  1  
ATOM 5296   H HZ   . PHE C 1 11  ? 98.587  65.036  107.649 1.00 0.00 ? 15  PHE C HZ   1  
ATOM 5297   N N    . GLN C 1 12  ? 100.783 57.970  111.452 1.00 0.00 ? 16  GLN C N    1  
ATOM 5298   C CA   . GLN C 1 12  ? 100.435 56.637  111.918 1.00 0.00 ? 16  GLN C CA   1  
ATOM 5299   C C    . GLN C 1 12  ? 99.758  56.752  113.276 1.00 0.00 ? 16  GLN C C    1  
ATOM 5300   O O    . GLN C 1 12  ? 100.293 57.378  114.197 1.00 0.00 ? 16  GLN C O    1  
ATOM 5301   C CB   . GLN C 1 12  ? 101.668 55.726  111.996 1.00 0.00 ? 16  GLN C CB   1  
ATOM 5302   C CG   . GLN C 1 12  ? 101.361 54.236  111.902 1.00 0.00 ? 16  GLN C CG   1  
ATOM 5303   C CD   . GLN C 1 12  ? 102.595 53.377  111.760 1.00 0.00 ? 16  GLN C CD   1  
ATOM 5304   O OE1  . GLN C 1 12  ? 102.567 52.334  111.115 1.00 0.00 ? 16  GLN C OE1  1  
ATOM 5305   N NE2  . GLN C 1 12  ? 103.691 53.814  112.365 1.00 0.00 ? 16  GLN C NE2  1  
ATOM 5306   H H    . GLN C 1 12  ? 101.277 58.424  111.989 1.00 0.00 ? 16  GLN C H    1  
ATOM 5307   H HA   . GLN C 1 12  ? 99.826  56.230  111.283 1.00 0.00 ? 16  GLN C HA   1  
ATOM 5308   H HB2  . GLN C 1 12  ? 102.277 55.965  111.280 1.00 0.00 ? 16  GLN C HB2  1  
ATOM 5309   H HB3  . GLN C 1 12  ? 102.130 55.898  112.831 1.00 0.00 ? 16  GLN C HB3  1  
ATOM 5310   H HG2  . GLN C 1 12  ? 100.874 53.963  112.695 1.00 0.00 ? 16  GLN C HG2  1  
ATOM 5311   H HG3  . GLN C 1 12  ? 100.777 54.080  111.143 1.00 0.00 ? 16  GLN C HG3  1  
ATOM 5312   H HE21 . GLN C 1 12  ? 103.673 54.550  112.808 1.00 0.00 ? 16  GLN C HE21 1  
ATOM 5313   H HE22 . GLN C 1 12  ? 104.420 53.361  112.313 1.00 0.00 ? 16  GLN C HE22 1  
ATOM 5314   N N    . SER C 1 13  ? 98.573  56.154  113.382 1.00 0.00 ? 17  SER C N    1  
ATOM 5315   C CA   . SER C 1 13  ? 97.813  56.166  114.622 1.00 0.00 ? 17  SER C CA   1  
ATOM 5316   C C    . SER C 1 13  ? 98.465  55.272  115.671 1.00 0.00 ? 17  SER C C    1  
ATOM 5317   O O    . SER C 1 13  ? 99.076  54.247  115.357 1.00 0.00 ? 17  SER C O    1  
ATOM 5318   C CB   . SER C 1 13  ? 96.379  55.705  114.368 1.00 0.00 ? 17  SER C CB   1  
ATOM 5319   O OG   . SER C 1 13  ? 96.357  54.434  113.749 1.00 0.00 ? 17  SER C OG   1  
ATOM 5320   H H    . SER C 1 13  ? 98.190  55.732  112.737 1.00 0.00 ? 17  SER C H    1  
ATOM 5321   H HA   . SER C 1 13  ? 97.801  57.076  114.957 1.00 0.00 ? 17  SER C HA   1  
ATOM 5322   H HB2  . SER C 1 13  ? 95.895  55.668  115.208 1.00 0.00 ? 17  SER C HB2  1  
ATOM 5323   H HB3  . SER C 1 13  ? 95.924  56.350  113.806 1.00 0.00 ? 17  SER C HB3  1  
ATOM 5324   H HG   . SER C 1 13  ? 96.742  53.874  114.243 1.00 0.00 ? 17  SER C HG   1  
ATOM 5325   N N    . ILE C 1 14  ? 98.320  55.669  116.937 1.00 0.00 ? 18  ILE C N    1  
ATOM 5326   C CA   . ILE C 1 14  ? 98.905  54.903  118.030 1.00 0.00 ? 18  ILE C CA   1  
ATOM 5327   C C    . ILE C 1 14  ? 98.187  53.580  118.245 1.00 0.00 ? 18  ILE C C    1  
ATOM 5328   O O    . ILE C 1 14  ? 98.840  52.545  118.424 1.00 0.00 ? 18  ILE C O    1  
ATOM 5329   C CB   . ILE C 1 14  ? 98.901  55.721  119.335 1.00 0.00 ? 18  ILE C CB   1  
ATOM 5330   C CG1  . ILE C 1 14  ? 97.585  56.485  119.481 1.00 0.00 ? 18  ILE C CG1  1  
ATOM 5331   C CG2  . ILE C 1 14  ? 100.087 56.671  119.377 1.00 0.00 ? 18  ILE C CG2  1  
ATOM 5332   C CD1  . ILE C 1 14  ? 97.039  56.540  120.904 1.00 0.00 ? 18  ILE C CD1  1  
ATOM 5333   H H    . ILE C 1 14  ? 97.890  56.374  117.179 1.00 0.00 ? 18  ILE C H    1  
ATOM 5334   H HA   . ILE C 1 14  ? 99.821  54.707  117.779 1.00 0.00 ? 18  ILE C HA   1  
ATOM 5335   H HB   . ILE C 1 14  ? 98.983  55.108  120.083 1.00 0.00 ? 18  ILE C HB   1  
ATOM 5336   H HG12 . ILE C 1 14  ? 97.713  57.392  119.162 1.00 0.00 ? 18  ILE C HG12 1  
ATOM 5337   H HG13 . ILE C 1 14  ? 96.920  56.073  118.908 1.00 0.00 ? 18  ILE C HG13 1  
ATOM 5338   H HG21 . ILE C 1 14  ? 100.422 56.731  120.285 1.00 0.00 ? 18  ILE C HG21 1  
ATOM 5339   H HG22 . ILE C 1 14  ? 100.789 56.338  118.795 1.00 0.00 ? 18  ILE C HG22 1  
ATOM 5340   H HG23 . ILE C 1 14  ? 99.809  57.550  119.076 1.00 0.00 ? 18  ILE C HG23 1  
ATOM 5341   H HD11 . ILE C 1 14  ? 97.426  57.297  121.370 1.00 0.00 ? 18  ILE C HD11 1  
ATOM 5342   H HD12 . ILE C 1 14  ? 96.074  56.635  120.877 1.00 0.00 ? 18  ILE C HD12 1  
ATOM 5343   H HD13 . ILE C 1 14  ? 97.270  55.721  121.371 1.00 0.00 ? 18  ILE C HD13 1  
ATOM 5344   N N    . ASP C 1 15  ? 96.855  53.580  118.231 1.00 0.00 ? 19  ASP C N    1  
ATOM 5345   C CA   . ASP C 1 15  ? 96.080  52.406  118.594 1.00 0.00 ? 19  ASP C CA   1  
ATOM 5346   C C    . ASP C 1 15  ? 96.094  51.330  117.516 1.00 0.00 ? 19  ASP C C    1  
ATOM 5347   O O    . ASP C 1 15  ? 95.884  50.154  117.830 1.00 0.00 ? 19  ASP C O    1  
ATOM 5348   C CB   . ASP C 1 15  ? 94.630  52.824  118.892 1.00 0.00 ? 19  ASP C CB   1  
ATOM 5349   C CG   . ASP C 1 15  ? 94.531  54.020  119.825 1.00 0.00 ? 19  ASP C CG   1  
ATOM 5350   O OD1  . ASP C 1 15  ? 95.099  53.977  120.936 1.00 0.00 ? 19  ASP C OD1  1  
ATOM 5351   O OD2  . ASP C 1 15  ? 93.879  55.012  119.437 1.00 0.00 ? 19  ASP C OD2  1  
ATOM 5352   H H    . ASP C 1 15  ? 96.380  54.261  118.009 1.00 0.00 ? 19  ASP C H    1  
ATOM 5353   H HA   . ASP C 1 15  ? 96.492  52.022  119.383 1.00 0.00 ? 19  ASP C HA   1  
ATOM 5354   H HB2  . ASP C 1 15  ? 94.182  53.034  118.057 1.00 0.00 ? 19  ASP C HB2  1  
ATOM 5355   H HB3  . ASP C 1 15  ? 94.158  52.074  119.286 1.00 0.00 ? 19  ASP C HB3  1  
ATOM 5356   N N    . ALA C 1 16  ? 96.344  51.693  116.258 1.00 0.00 ? 20  ALA C N    1  
ATOM 5357   C CA   . ALA C 1 16  ? 96.261  50.711  115.185 1.00 0.00 ? 20  ALA C CA   1  
ATOM 5358   C C    . ALA C 1 16  ? 97.191  49.530  115.438 1.00 0.00 ? 20  ALA C C    1  
ATOM 5359   O O    . ALA C 1 16  ? 96.779  48.372  115.302 1.00 0.00 ? 20  ALA C O    1  
ATOM 5360   C CB   . ALA C 1 16  ? 96.581  51.373  113.845 1.00 0.00 ? 20  ALA C CB   1  
ATOM 5361   H H    . ALA C 1 16  ? 96.558  52.489  116.011 1.00 0.00 ? 20  ALA C H    1  
ATOM 5362   H HA   . ALA C 1 16  ? 95.355  50.366  115.158 1.00 0.00 ? 20  ALA C HA   1  
ATOM 5363   H HB1  . ALA C 1 16  ? 97.030  52.220  114.001 1.00 0.00 ? 20  ALA C HB1  1  
ATOM 5364   H HB2  . ALA C 1 16  ? 97.160  50.793  113.327 1.00 0.00 ? 20  ALA C HB2  1  
ATOM 5365   H HB3  . ALA C 1 16  ? 95.758  51.529  113.357 1.00 0.00 ? 20  ALA C HB3  1  
ATOM 5366   N N    . ALA C 1 17  ? 98.445  49.818  115.818 1.00 0.00 ? 21  ALA C N    1  
ATOM 5367   C CA   . ALA C 1 17  ? 99.531  48.836  115.978 1.00 0.00 ? 21  ALA C CA   1  
ATOM 5368   C C    . ALA C 1 17  ? 99.796  48.067  114.684 1.00 0.00 ? 21  ALA C C    1  
ATOM 5369   O O    . ALA C 1 17  ? 99.929  46.843  114.677 1.00 0.00 ? 21  ALA C O    1  
ATOM 5370   C CB   . ALA C 1 17  ? 99.268  47.878  117.147 1.00 0.00 ? 21  ALA C CB   1  
ATOM 5371   H H    . ALA C 1 17  ? 98.694  50.622  115.997 1.00 0.00 ? 21  ALA C H    1  
ATOM 5372   H HA   . ALA C 1 17  ? 100.333 49.340  116.189 1.00 0.00 ? 21  ALA C HA   1  
ATOM 5373   H HB1  . ALA C 1 17  ? 99.204  46.970  116.812 1.00 0.00 ? 21  ALA C HB1  1  
ATOM 5374   H HB2  . ALA C 1 17  ? 99.996  47.937  117.784 1.00 0.00 ? 21  ALA C HB2  1  
ATOM 5375   H HB3  . ALA C 1 17  ? 98.436  48.121  117.583 1.00 0.00 ? 21  ALA C HB3  1  
ATOM 5376   N N    . THR C 1 18  ? 99.872  48.802  113.576 1.00 0.00 ? 22  THR C N    1  
ATOM 5377   C CA   . THR C 1 18  ? 100.118 48.232  112.258 1.00 0.00 ? 22  THR C CA   1  
ATOM 5378   C C    . THR C 1 18  ? 101.501 48.649  111.784 1.00 0.00 ? 22  THR C C    1  
ATOM 5379   O O    . THR C 1 18  ? 102.069 49.620  112.294 1.00 0.00 ? 22  THR C O    1  
ATOM 5380   C CB   . THR C 1 18  ? 99.063  48.687  111.242 1.00 0.00 ? 22  THR C CB   1  
ATOM 5381   O OG1  . THR C 1 18  ? 99.344  48.106  109.963 1.00 0.00 ? 22  THR C OG1  1  
ATOM 5382   C CG2  . THR C 1 18  ? 99.047  50.199  111.117 1.00 0.00 ? 22  THR C CG2  1  
ATOM 5383   H H    . THR C 1 18  ? 99.781  49.657  113.571 1.00 0.00 ? 22  THR C H    1  
ATOM 5384   H HA   . THR C 1 18  ? 100.065 47.266  112.328 1.00 0.00 ? 22  THR C HA   1  
ATOM 5385   H HB   . THR C 1 18  ? 98.193  48.394  111.554 1.00 0.00 ? 22  THR C HB   1  
ATOM 5386   H HG1  . THR C 1 18  ? 99.042  48.604  109.357 1.00 0.00 ? 22  THR C HG1  1  
ATOM 5387   H HG21 . THR C 1 18  ? 98.656  50.710  110.392 1.00 0.00 ? 22  THR C HG21 1  
ATOM 5388   H HG22 . THR C 1 18  ? 98.840  50.593  111.979 1.00 0.00 ? 22  THR C HG22 1  
ATOM 5389   H HG23 . THR C 1 18  ? 99.917  50.508  110.822 1.00 0.00 ? 22  THR C HG23 1  
ATOM 5390   N N    . GLY C 1 19  ? 102.031 47.925  110.804 1.00 0.00 ? 23  GLY C N    1  
ATOM 5391   C CA   . GLY C 1 19  ? 103.353 48.207  110.280 1.00 0.00 ? 23  GLY C CA   1  
ATOM 5392   C C    . GLY C 1 19  ? 103.353 49.170  109.110 1.00 0.00 ? 23  GLY C C    1  
ATOM 5393   O O    . GLY C 1 19  ? 104.149 49.023  108.180 1.00 0.00 ? 23  GLY C O    1  
ATOM 5394   H H    . GLY C 1 19  ? 101.634 47.261  110.428 1.00 0.00 ? 23  GLY C H    1  
ATOM 5395   H HA2  . GLY C 1 19  ? 103.903 48.574  110.990 1.00 0.00 ? 23  GLY C HA2  1  
ATOM 5396   H HA3  . GLY C 1 19  ? 103.766 47.375  110.002 1.00 0.00 ? 23  GLY C HA3  1  
ATOM 5397   N N    . SER C 1 20  ? 102.460 50.158  109.142 1.00 0.00 ? 24  SER C N    1  
ATOM 5398   C CA   . SER C 1 20  ? 102.351 51.105  108.039 1.00 0.00 ? 24  SER C CA   1  
ATOM 5399   C C    . SER C 1 20  ? 101.497 52.310  108.411 1.00 0.00 ? 24  SER C C    1  
ATOM 5400   O O    . SER C 1 20  ? 100.506 52.165  109.136 1.00 0.00 ? 24  SER C O    1  
ATOM 5401   C CB   . SER C 1 20  ? 101.771 50.416  106.802 1.00 0.00 ? 24  SER C CB   1  
ATOM 5402   O OG   . SER C 1 20  ? 100.357 50.388  106.853 1.00 0.00 ? 24  SER C OG   1  
ATOM 5403   H H    . SER C 1 20  ? 101.911 50.295  109.790 1.00 0.00 ? 24  SER C H    1  
ATOM 5404   H HA   . SER C 1 20  ? 103.246 51.425  107.841 1.00 0.00 ? 24  SER C HA   1  
ATOM 5405   H HB2  . SER C 1 20  ? 102.060 50.883  106.002 1.00 0.00 ? 24  SER C HB2  1  
ATOM 5406   H HB3  . SER C 1 20  ? 102.114 49.510  106.741 1.00 0.00 ? 24  SER C HB3  1  
ATOM 5407   H HG   . SER C 1 20  ? 100.044 50.828  106.209 1.00 0.00 ? 24  SER C HG   1  
ATOM 5408   N N    . ALA C 1 21  ? 101.880 53.493  107.913 1.00 0.00 ? 25  ALA C N    1  
ATOM 5409   C CA   . ALA C 1 21  ? 101.303 54.804  108.216 1.00 0.00 ? 25  ALA C CA   1  
ATOM 5410   C C    . ALA C 1 21  ? 100.455 55.346  107.068 1.00 0.00 ? 25  ALA C C    1  
ATOM 5411   O O    . ALA C 1 21  ? 100.990 55.599  105.982 1.00 0.00 ? 25  ALA C O    1  
ATOM 5412   C CB   . ALA C 1 21  ? 102.400 55.809  108.579 1.00 0.00 ? 25  ALA C CB   1  
ATOM 5413   H H    . ALA C 1 21  ? 102.528 53.550  107.351 1.00 0.00 ? 25  ALA C H    1  
ATOM 5414   H HA   . ALA C 1 21  ? 100.717 54.681  108.979 1.00 0.00 ? 25  ALA C HA   1  
ATOM 5415   H HB1  . ALA C 1 21  ? 102.159 56.687  108.245 1.00 0.00 ? 25  ALA C HB1  1  
ATOM 5416   H HB2  . ALA C 1 21  ? 102.499 55.847  109.543 1.00 0.00 ? 25  ALA C HB2  1  
ATOM 5417   H HB3  . ALA C 1 21  ? 103.239 55.531  108.179 1.00 0.00 ? 25  ALA C HB3  1  
ATOM 5418   N N    . PRO C 1 22  ? 99.129  55.517  107.248 1.00 0.00 ? 26  PRO C N    1  
ATOM 5419   C CA   . PRO C 1 22  ? 98.319  56.072  106.156 1.00 0.00 ? 26  PRO C CA   1  
ATOM 5420   C C    . PRO C 1 22  ? 98.576  57.551  105.937 1.00 0.00 ? 26  PRO C C    1  
ATOM 5421   O O    . PRO C 1 22  ? 98.610  58.334  106.891 1.00 0.00 ? 26  PRO C O    1  
ATOM 5422   C CB   . PRO C 1 22  ? 96.876  55.841  106.630 1.00 0.00 ? 26  PRO C CB   1  
ATOM 5423   C CG   . PRO C 1 22  ? 96.971  54.803  107.686 1.00 0.00 ? 26  PRO C CG   1  
ATOM 5424   C CD   . PRO C 1 22  ? 98.278  55.072  108.362 1.00 0.00 ? 26  PRO C CD   1  
ATOM 5425   H HA   . PRO C 1 22  ? 98.523  55.655  105.305 1.00 0.00 ? 26  PRO C HA   1  
ATOM 5426   H HB2  . PRO C 1 22  ? 96.488  56.660  106.978 1.00 0.00 ? 26  PRO C HB2  1  
ATOM 5427   H HB3  . PRO C 1 22  ? 96.311  55.547  105.900 1.00 0.00 ? 26  PRO C HB3  1  
ATOM 5428   H HG2  . PRO C 1 22  ? 96.231  54.867  108.310 1.00 0.00 ? 26  PRO C HG2  1  
ATOM 5429   H HG3  . PRO C 1 22  ? 96.947  53.911  107.307 1.00 0.00 ? 26  PRO C HG3  1  
ATOM 5430   H HD2  . PRO C 1 22  ? 98.196  55.754  109.049 1.00 0.00 ? 26  PRO C HD2  1  
ATOM 5431   H HD3  . PRO C 1 22  ? 98.632  54.278  108.792 1.00 0.00 ? 26  PRO C HD3  1  
ATOM 5432   N N    . LEU C 1 23  ? 98.762  57.941  104.683 1.00 0.00 ? 27  LEU C N    1  
ATOM 5433   C CA   . LEU C 1 23  ? 98.770  59.348  104.322 1.00 0.00 ? 27  LEU C CA   1  
ATOM 5434   C C    . LEU C 1 23  ? 97.596  59.627  103.397 1.00 0.00 ? 27  LEU C C    1  
ATOM 5435   O O    . LEU C 1 23  ? 97.101  58.741  102.698 1.00 0.00 ? 27  LEU C O    1  
ATOM 5436   C CB   . LEU C 1 23  ? 100.073 59.754  103.638 1.00 0.00 ? 27  LEU C CB   1  
ATOM 5437   C CG   . LEU C 1 23  ? 100.560 58.921  102.450 1.00 0.00 ? 27  LEU C CG   1  
ATOM 5438   C CD1  . LEU C 1 23  ? 100.922 59.840  101.295 1.00 0.00 ? 27  LEU C CD1  1  
ATOM 5439   C CD2  . LEU C 1 23  ? 101.736 58.020  102.805 1.00 0.00 ? 27  LEU C CD2  1  
ATOM 5440   H H    . LEU C 1 23  ? 98.887  57.403  104.024 1.00 0.00 ? 27  LEU C H    1  
ATOM 5441   H HA   . LEU C 1 23  ? 98.693  59.871  105.135 1.00 0.00 ? 27  LEU C HA   1  
ATOM 5442   H HB2  . LEU C 1 23  ? 99.976  60.670  103.337 1.00 0.00 ? 27  LEU C HB2  1  
ATOM 5443   H HB3  . LEU C 1 23  ? 100.773 59.749  104.310 1.00 0.00 ? 27  LEU C HB3  1  
ATOM 5444   H HG   . LEU C 1 23  ? 99.832  58.335  102.188 1.00 0.00 ? 27  LEU C HG   1  
ATOM 5445   H HD11 . LEU C 1 23  ? 101.025 59.316  100.485 1.00 0.00 ? 27  LEU C HD11 1  
ATOM 5446   H HD12 . LEU C 1 23  ? 100.216 60.494  101.168 1.00 0.00 ? 27  LEU C HD12 1  
ATOM 5447   H HD13 . LEU C 1 23  ? 101.754 60.296  101.492 1.00 0.00 ? 27  LEU C HD13 1  
ATOM 5448   H HD21 . LEU C 1 23  ? 102.354 58.505  103.374 1.00 0.00 ? 27  LEU C HD21 1  
ATOM 5449   H HD22 . LEU C 1 23  ? 101.413 57.235  103.273 1.00 0.00 ? 27  LEU C HD22 1  
ATOM 5450   H HD23 . LEU C 1 23  ? 102.191 57.748  101.993 1.00 0.00 ? 27  LEU C HD23 1  
ATOM 5451   N N    . PHE C 1 24  ? 97.161  60.870  103.389 1.00 0.00 ? 28  PHE C N    1  
ATOM 5452   C CA   . PHE C 1 24  ? 95.885  61.087  102.744 1.00 0.00 ? 28  PHE C CA   1  
ATOM 5453   C C    . PHE C 1 24  ? 96.077  61.785  101.399 1.00 0.00 ? 28  PHE C C    1  
ATOM 5454   O O    . PHE C 1 24  ? 96.970  62.627  101.265 1.00 0.00 ? 28  PHE C O    1  
ATOM 5455   C CB   . PHE C 1 24  ? 94.981  61.924  103.658 1.00 0.00 ? 28  PHE C CB   1  
ATOM 5456   C CG   . PHE C 1 24  ? 93.547  61.921  103.250 1.00 0.00 ? 28  PHE C CG   1  
ATOM 5457   C CD1  . PHE C 1 24  ? 92.825  60.742  103.247 1.00 0.00 ? 28  PHE C CD1  1  
ATOM 5458   C CD2  . PHE C 1 24  ? 92.914  63.088  102.879 1.00 0.00 ? 28  PHE C CD2  1  
ATOM 5459   C CE1  . PHE C 1 24  ? 91.505  60.729  102.864 1.00 0.00 ? 28  PHE C CE1  1  
ATOM 5460   C CE2  . PHE C 1 24  ? 91.586  63.082  102.495 1.00 0.00 ? 28  PHE C CE2  1  
ATOM 5461   C CZ   . PHE C 1 24  ? 90.881  61.898  102.491 1.00 0.00 ? 28  PHE C CZ   1  
ATOM 5462   H H    . PHE C 1 24  ? 97.554  61.558  103.724 1.00 0.00 ? 28  PHE C H    1  
ATOM 5463   H HA   . PHE C 1 24  ? 95.464  60.229  102.581 1.00 0.00 ? 28  PHE C HA   1  
ATOM 5464   H HB2  . PHE C 1 24  ? 95.051  61.587  104.565 1.00 0.00 ? 28  PHE C HB2  1  
ATOM 5465   H HB3  . PHE C 1 24  ? 95.303  62.838  103.669 1.00 0.00 ? 28  PHE C HB3  1  
ATOM 5466   H HD1  . PHE C 1 24  ? 93.237  59.949  103.507 1.00 0.00 ? 28  PHE C HD1  1  
ATOM 5467   H HD2  . PHE C 1 24  ? 93.386  63.889  102.886 1.00 0.00 ? 28  PHE C HD2  1  
ATOM 5468   H HE1  . PHE C 1 24  ? 91.031  59.928  102.858 1.00 0.00 ? 28  PHE C HE1  1  
ATOM 5469   H HE2  . PHE C 1 24  ? 91.170  63.874  102.240 1.00 0.00 ? 28  PHE C HE2  1  
ATOM 5470   H HZ   . PHE C 1 24  ? 89.987  61.889  102.237 1.00 0.00 ? 28  PHE C HZ   1  
ATOM 5471   N N    . PRO C 1 25  ? 95.306  61.431  100.373 1.00 0.00 ? 29  PRO C N    1  
ATOM 5472   C CA   . PRO C 1 25  ? 95.465  62.100  99.076  1.00 0.00 ? 29  PRO C CA   1  
ATOM 5473   C C    . PRO C 1 25  ? 94.856  63.491  99.063  1.00 0.00 ? 29  PRO C C    1  
ATOM 5474   O O    . PRO C 1 25  ? 94.223  63.933  100.022 1.00 0.00 ? 29  PRO C O    1  
ATOM 5475   C CB   . PRO C 1 25  ? 94.763  61.152  98.096  1.00 0.00 ? 29  PRO C CB   1  
ATOM 5476   C CG   . PRO C 1 25  ? 93.782  60.414  98.928  1.00 0.00 ? 29  PRO C CG   1  
ATOM 5477   C CD   . PRO C 1 25  ? 94.440  60.246  100.269 1.00 0.00 ? 29  PRO C CD   1  
ATOM 5478   H HA   . PRO C 1 25  ? 96.398  62.239  98.850  1.00 0.00 ? 29  PRO C HA   1  
ATOM 5479   H HB2  . PRO C 1 25  ? 94.324  61.643  97.383  1.00 0.00 ? 29  PRO C HB2  1  
ATOM 5480   H HB3  . PRO C 1 25  ? 95.395  60.547  97.676  1.00 0.00 ? 29  PRO C HB3  1  
ATOM 5481   H HG2  . PRO C 1 25  ? 92.950  60.907  99.006  1.00 0.00 ? 29  PRO C HG2  1  
ATOM 5482   H HG3  . PRO C 1 25  ? 93.566  59.555  98.535  1.00 0.00 ? 29  PRO C HG3  1  
ATOM 5483   H HD2  . PRO C 1 25  ? 93.788  60.216  100.987 1.00 0.00 ? 29  PRO C HD2  1  
ATOM 5484   H HD3  . PRO C 1 25  ? 94.952  59.424  100.316 1.00 0.00 ? 29  PRO C HD3  1  
ATOM 5485   N N    . ALA C 1 26  ? 95.062  64.169  97.928  1.00 0.00 ? 30  ALA C N    1  
ATOM 5486   C CA   . ALA C 1 26  ? 94.577  65.525  97.650  1.00 0.00 ? 30  ALA C CA   1  
ATOM 5487   C C    . ALA C 1 26  ? 94.987  66.505  98.750  1.00 0.00 ? 30  ALA C C    1  
ATOM 5488   O O    . ALA C 1 26  ? 94.154  67.094  99.439  1.00 0.00 ? 30  ALA C O    1  
ATOM 5489   C CB   . ALA C 1 26  ? 93.060  65.552  97.426  1.00 0.00 ? 30  ALA C CB   1  
ATOM 5490   H H    . ALA C 1 26  ? 95.507  63.835  97.273  1.00 0.00 ? 30  ALA C H    1  
ATOM 5491   H HA   . ALA C 1 26  ? 94.999  65.813  96.825  1.00 0.00 ? 30  ALA C HA   1  
ATOM 5492   H HB1  . ALA C 1 26  ? 92.835  64.996  96.664  1.00 0.00 ? 30  ALA C HB1  1  
ATOM 5493   H HB2  . ALA C 1 26  ? 92.611  65.213  98.215  1.00 0.00 ? 30  ALA C HB2  1  
ATOM 5494   H HB3  . ALA C 1 26  ? 92.774  66.463  97.258  1.00 0.00 ? 30  ALA C HB3  1  
ATOM 5495   N N    . TYR C 1 27  ? 96.299  66.667  98.905  1.00 0.00 ? 31  TYR C N    1  
ATOM 5496   C CA   . TYR C 1 27  ? 96.833  67.667  99.817  1.00 0.00 ? 31  TYR C CA   1  
ATOM 5497   C C    . TYR C 1 27  ? 96.697  69.068  99.233  1.00 0.00 ? 31  TYR C C    1  
ATOM 5498   O O    . TYR C 1 27  ? 96.814  69.299  98.030  1.00 0.00 ? 31  TYR C O    1  
ATOM 5499   C CB   . TYR C 1 27  ? 98.296  67.380  100.151 1.00 0.00 ? 31  TYR C CB   1  
ATOM 5500   C CG   . TYR C 1 27  ? 98.489  66.384  101.263 1.00 0.00 ? 31  TYR C CG   1  
ATOM 5501   C CD1  . TYR C 1 27  ? 99.359  65.315  101.113 1.00 0.00 ? 31  TYR C CD1  1  
ATOM 5502   C CD2  . TYR C 1 27  ? 97.802  66.510  102.464 1.00 0.00 ? 31  TYR C CD2  1  
ATOM 5503   C CE1  . TYR C 1 27  ? 99.538  64.392  102.119 1.00 0.00 ? 31  TYR C CE1  1  
ATOM 5504   C CE2  . TYR C 1 27  ? 97.983  65.596  103.485 1.00 0.00 ? 31  TYR C CE2  1  
ATOM 5505   C CZ   . TYR C 1 27  ? 98.858  64.542  103.305 1.00 0.00 ? 31  TYR C CZ   1  
ATOM 5506   O OH   . TYR C 1 27  ? 99.046  63.624  104.311 1.00 0.00 ? 31  TYR C OH   1  
ATOM 5507   H H    . TYR C 1 27  ? 96.895  66.206  98.489  1.00 0.00 ? 31  TYR C H    1  
ATOM 5508   H HA   . TYR C 1 27  ? 96.315  67.621  100.635 1.00 0.00 ? 31  TYR C HA   1  
ATOM 5509   H HB2  . TYR C 1 27  ? 98.741  67.051  99.354  1.00 0.00 ? 31  TYR C HB2  1  
ATOM 5510   H HB3  . TYR C 1 27  ? 98.731  68.212  100.395 1.00 0.00 ? 31  TYR C HB3  1  
ATOM 5511   H HD1  . TYR C 1 27  ? 99.831  65.219  100.317 1.00 0.00 ? 31  TYR C HD1  1  
ATOM 5512   H HD2  . TYR C 1 27  ? 97.213  67.220  102.583 1.00 0.00 ? 31  TYR C HD2  1  
ATOM 5513   H HE1  . TYR C 1 27  ? 100.114 63.672  101.998 1.00 0.00 ? 31  TYR C HE1  1  
ATOM 5514   H HE2  . TYR C 1 27  ? 97.520  65.689  104.286 1.00 0.00 ? 31  TYR C HE2  1  
ATOM 5515   H HH   . TYR C 1 27  ? 98.371  63.128  104.367 1.00 0.00 ? 31  TYR C HH   1  
ATOM 5516   N N    . GLN C 1 28  ? 96.445  70.018  100.119 1.00 0.00 ? 32  GLN C N    1  
ATOM 5517   C CA   . GLN C 1 28  ? 96.303  71.418  99.771  1.00 0.00 ? 32  GLN C CA   1  
ATOM 5518   C C    . GLN C 1 28  ? 97.636  72.055  100.168 1.00 0.00 ? 32  GLN C C    1  
ATOM 5519   O O    . GLN C 1 28  ? 98.341  72.592  99.307  1.00 0.00 ? 32  GLN C O    1  
ATOM 5520   C CB   . GLN C 1 28  ? 95.007  71.957  100.417 1.00 0.00 ? 32  GLN C CB   1  
ATOM 5521   C CG   . GLN C 1 28  ? 94.304  73.135  99.747  1.00 0.00 ? 32  GLN C CG   1  
ATOM 5522   C CD   . GLN C 1 28  ? 94.546  74.440  100.457 1.00 0.00 ? 32  GLN C CD   1  
ATOM 5523   O OE1  . GLN C 1 28  ? 94.721  74.470  101.673 1.00 0.00 ? 32  GLN C OE1  1  
ATOM 5524   N NE2  . GLN C 1 28  ? 94.543  75.529  99.711  1.00 0.00 ? 32  GLN C NE2  1  
ATOM 5525   H H    . GLN C 1 28  ? 96.350  69.862  100.960 1.00 0.00 ? 32  GLN C H    1  
ATOM 5526   H HA   . GLN C 1 28  ? 96.169  71.623  98.833  1.00 0.00 ? 32  GLN C HA   1  
ATOM 5527   H HB2  . GLN C 1 28  ? 94.374  71.224  100.468 1.00 0.00 ? 32  GLN C HB2  1  
ATOM 5528   H HB3  . GLN C 1 28  ? 95.215  72.216  101.328 1.00 0.00 ? 32  GLN C HB3  1  
ATOM 5529   H HG2  . GLN C 1 28  ? 94.609  73.209  98.830  1.00 0.00 ? 32  GLN C HG2  1  
ATOM 5530   H HG3  . GLN C 1 28  ? 93.350  72.961  99.716  1.00 0.00 ? 32  GLN C HG3  1  
ATOM 5531   H HE21 . GLN C 1 28  ? 94.416  75.469  98.863  1.00 0.00 ? 32  GLN C HE21 1  
ATOM 5532   H HE22 . GLN C 1 28  ? 94.667  76.299  100.073 1.00 0.00 ? 32  GLN C HE22 1  
ATOM 5533   N N    . THR C 1 29  ? 97.970  72.048  101.456 1.00 0.00 ? 33  THR C N    1  
ATOM 5534   C CA   . THR C 1 29  ? 99.210  72.649  101.914 1.00 0.00 ? 33  THR C CA   1  
ATOM 5535   C C    . THR C 1 29  ? 99.407  72.431  103.412 1.00 0.00 ? 33  THR C C    1  
ATOM 5536   O O    . THR C 1 29  ? 98.469  72.166  104.181 1.00 0.00 ? 33  THR C O    1  
ATOM 5537   C CB   . THR C 1 29  ? 99.250  74.145  101.602 1.00 0.00 ? 33  THR C CB   1  
ATOM 5538   O OG1  . THR C 1 29  ? 100.609 74.596  101.646 1.00 0.00 ? 33  THR C OG1  1  
ATOM 5539   C CG2  . THR C 1 29  ? 98.439  74.936  102.617 1.00 0.00 ? 33  THR C CG2  1  
ATOM 5540   H H    . THR C 1 29  ? 97.490  71.699  102.078 1.00 0.00 ? 33  THR C H    1  
ATOM 5541   H HA   . THR C 1 29  ? 99.934  72.213  101.436 1.00 0.00 ? 33  THR C HA   1  
ATOM 5542   H HB   . THR C 1 29  ? 98.869  74.285  100.721 1.00 0.00 ? 33  THR C HB   1  
ATOM 5543   H HG1  . THR C 1 29  ? 100.625 75.426  101.770 1.00 0.00 ? 33  THR C HG1  1  
ATOM 5544   H HG21 . THR C 1 29  ? 97.896  75.722  102.444 1.00 0.00 ? 33  THR C HG21 1  
ATOM 5545   H HG22 . THR C 1 29  ? 97.515  74.638  102.597 1.00 0.00 ? 33  THR C HG22 1  
ATOM 5546   H HG23 . THR C 1 29  ? 98.804  74.794  103.505 1.00 0.00 ? 33  THR C HG23 1  
ATOM 5547   N N    . ASP C 1 30  ? 100.663 72.553  103.816 1.00 0.00 ? 34  ASP C N    1  
ATOM 5548   C CA   . ASP C 1 30  ? 101.122 72.076  105.102 1.00 0.00 ? 34  ASP C CA   1  
ATOM 5549   C C    . ASP C 1 30  ? 101.963 73.168  105.734 1.00 0.00 ? 34  ASP C C    1  
ATOM 5550   O O    . ASP C 1 30  ? 103.004 73.568  105.205 1.00 0.00 ? 34  ASP C O    1  
ATOM 5551   C CB   . ASP C 1 30  ? 101.926 70.783  104.930 1.00 0.00 ? 34  ASP C CB   1  
ATOM 5552   C CG   . ASP C 1 30  ? 101.803 69.847  106.114 1.00 0.00 ? 34  ASP C CG   1  
ATOM 5553   O OD1  . ASP C 1 30  ? 102.545 70.023  107.102 1.00 0.00 ? 34  ASP C OD1  1  
ATOM 5554   O OD2  . ASP C 1 30  ? 100.962 68.926  106.051 1.00 0.00 ? 34  ASP C OD2  1  
ATOM 5555   H H    . ASP C 1 30  ? 101.279 72.921  103.341 1.00 0.00 ? 34  ASP C H    1  
ATOM 5556   H HA   . ASP C 1 30  ? 100.370 71.872  105.679 1.00 0.00 ? 34  ASP C HA   1  
ATOM 5557   H HB2  . ASP C 1 30  ? 101.626 70.325  104.130 1.00 0.00 ? 34  ASP C HB2  1  
ATOM 5558   H HB3  . ASP C 1 30  ? 102.861 71.005  104.795 1.00 0.00 ? 34  ASP C HB3  1  
ATOM 5559   N N    . GLY C 1 31  ? 101.500 73.661  106.871 1.00 0.00 ? 35  GLY C N    1  
ATOM 5560   C CA   . GLY C 1 31  ? 102.304 74.548  107.671 1.00 0.00 ? 35  GLY C CA   1  
ATOM 5561   C C    . GLY C 1 31  ? 102.688 73.910  108.981 1.00 0.00 ? 35  GLY C C    1  
ATOM 5562   O O    . GLY C 1 31  ? 101.824 73.531  109.777 1.00 0.00 ? 35  GLY C O    1  
ATOM 5563   H H    . GLY C 1 31  ? 100.721 73.490  107.192 1.00 0.00 ? 35  GLY C H    1  
ATOM 5564   H HA2  . GLY C 1 31  ? 103.105 74.792  107.182 1.00 0.00 ? 35  GLY C HA2  1  
ATOM 5565   H HA3  . GLY C 1 31  ? 101.814 75.368  107.840 1.00 0.00 ? 35  GLY C HA3  1  
ATOM 5566   N N    . SER C 1 32  ? 103.988 73.795  109.216 1.00 0.00 ? 36  SER C N    1  
ATOM 5567   C CA   . SER C 1 32  ? 104.523 73.335  110.491 1.00 0.00 ? 36  SER C CA   1  
ATOM 5568   C C    . SER C 1 32  ? 105.273 74.528  111.060 1.00 0.00 ? 36  SER C C    1  
ATOM 5569   O O    . SER C 1 32  ? 106.187 75.068  110.434 1.00 0.00 ? 36  SER C O    1  
ATOM 5570   C CB   . SER C 1 32  ? 105.409 72.120  110.310 1.00 0.00 ? 36  SER C CB   1  
ATOM 5571   O OG   . SER C 1 32  ? 104.692 71.075  109.679 1.00 0.00 ? 36  SER C OG   1  
ATOM 5572   H H    . SER C 1 32  ? 104.592 73.983  108.633 1.00 0.00 ? 36  SER C H    1  
ATOM 5573   H HA   . SER C 1 32  ? 103.825 73.043  111.099 1.00 0.00 ? 36  SER C HA   1  
ATOM 5574   H HB2  . SER C 1 32  ? 106.185 72.355  109.779 1.00 0.00 ? 36  SER C HB2  1  
ATOM 5575   H HB3  . SER C 1 32  ? 105.736 71.820  111.173 1.00 0.00 ? 36  SER C HB3  1  
ATOM 5576   H HG   . SER C 1 32  ? 104.937 71.012  108.878 1.00 0.00 ? 36  SER C HG   1  
ATOM 5577   N N    . VAL C 1 33  ? 104.884 74.935  112.261 1.00 0.00 ? 37  VAL C N    1  
ATOM 5578   C CA   . VAL C 1 33  ? 105.409 76.146  112.875 1.00 0.00 ? 37  VAL C CA   1  
ATOM 5579   C C    . VAL C 1 33  ? 105.964 75.781  114.250 1.00 0.00 ? 37  VAL C C    1  
ATOM 5580   O O    . VAL C 1 33  ? 105.357 75.028  115.017 1.00 0.00 ? 37  VAL C O    1  
ATOM 5581   C CB   . VAL C 1 33  ? 104.349 77.256  112.922 1.00 0.00 ? 37  VAL C CB   1  
ATOM 5582   C CG1  . VAL C 1 33  ? 105.019 78.597  112.691 1.00 0.00 ? 37  VAL C CG1  1  
ATOM 5583   C CG2  . VAL C 1 33  ? 103.321 77.100  111.821 1.00 0.00 ? 37  VAL C CG2  1  
ATOM 5584   H H    . VAL C 1 33  ? 104.308 74.517  112.744 1.00 0.00 ? 37  VAL C H    1  
ATOM 5585   H HA   . VAL C 1 33  ? 106.131 76.513  112.340 1.00 0.00 ? 37  VAL C HA   1  
ATOM 5586   H HB   . VAL C 1 33  ? 103.917 77.202  113.789 1.00 0.00 ? 37  VAL C HB   1  
ATOM 5587   H HG11 . VAL C 1 33  ? 105.279 78.673  111.759 1.00 0.00 ? 37  VAL C HG11 1  
ATOM 5588   H HG12 . VAL C 1 33  ? 104.401 79.311  112.912 1.00 0.00 ? 37  VAL C HG12 1  
ATOM 5589   H HG13 . VAL C 1 33  ? 105.807 78.666  113.253 1.00 0.00 ? 37  VAL C HG13 1  
ATOM 5590   H HG21 . VAL C 1 33  ? 103.737 76.689  111.046 1.00 0.00 ? 37  VAL C HG21 1  
ATOM 5591   H HG22 . VAL C 1 33  ? 102.594 76.537  112.133 1.00 0.00 ? 37  VAL C HG22 1  
ATOM 5592   H HG23 . VAL C 1 33  ? 102.972 77.971  111.576 1.00 0.00 ? 37  VAL C HG23 1  
ATOM 5593   N N    . SER C 1 34  ? 107.151 76.293  114.543 1.00 0.00 ? 38  SER C N    1  
ATOM 5594   C CA   . SER C 1 34  ? 107.967 75.844  115.665 1.00 0.00 ? 38  SER C CA   1  
ATOM 5595   C C    . SER C 1 34  ? 108.554 77.078  116.346 1.00 0.00 ? 38  SER C C    1  
ATOM 5596   O O    . SER C 1 34  ? 109.435 77.743  115.802 1.00 0.00 ? 38  SER C O    1  
ATOM 5597   C CB   . SER C 1 34  ? 109.061 74.897  115.176 1.00 0.00 ? 38  SER C CB   1  
ATOM 5598   O OG   . SER C 1 34  ? 109.720 75.402  114.030 1.00 0.00 ? 38  SER C OG   1  
ATOM 5599   H H    . SER C 1 34  ? 107.515 76.925  114.086 1.00 0.00 ? 38  SER C H    1  
ATOM 5600   H HA   . SER C 1 34  ? 107.429 75.351  116.305 1.00 0.00 ? 38  SER C HA   1  
ATOM 5601   H HB2  . SER C 1 34  ? 109.707 74.756  115.885 1.00 0.00 ? 38  SER C HB2  1  
ATOM 5602   H HB3  . SER C 1 34  ? 108.672 74.033  114.971 1.00 0.00 ? 38  SER C HB3  1  
ATOM 5603   H HG   . SER C 1 34  ? 109.326 75.132  113.338 1.00 0.00 ? 38  SER C HG   1  
ATOM 5604   N N    . GLY C 1 35  ? 108.063 77.379  117.543 1.00 0.00 ? 39  GLY C N    1  
ATOM 5605   C CA   . GLY C 1 35  ? 108.524 78.552  118.257 1.00 0.00 ? 39  GLY C CA   1  
ATOM 5606   C C    . GLY C 1 35  ? 109.438 78.224  119.417 1.00 0.00 ? 39  GLY C C    1  
ATOM 5607   O O    . GLY C 1 35  ? 109.049 77.500  120.338 1.00 0.00 ? 39  GLY C O    1  
ATOM 5608   H H    . GLY C 1 35  ? 107.466 76.916  117.954 1.00 0.00 ? 39  GLY C H    1  
ATOM 5609   H HA2  . GLY C 1 35  ? 108.991 79.136  117.640 1.00 0.00 ? 39  GLY C HA2  1  
ATOM 5610   H HA3  . GLY C 1 35  ? 107.756 79.044  118.587 1.00 0.00 ? 39  GLY C HA3  1  
ATOM 5611   N N    . GLU C 1 36  ? 110.658 78.751  119.387 1.00 0.00 ? 40  GLU C N    1  
ATOM 5612   C CA   . GLU C 1 36  ? 111.653 78.506  120.426 1.00 0.00 ? 40  GLU C CA   1  
ATOM 5613   C C    . GLU C 1 36  ? 111.685 79.724  121.338 1.00 0.00 ? 40  GLU C C    1  
ATOM 5614   O O    . GLU C 1 36  ? 112.215 80.775  120.963 1.00 0.00 ? 40  GLU C O    1  
ATOM 5615   C CB   . GLU C 1 36  ? 113.025 78.227  119.817 1.00 0.00 ? 40  GLU C CB   1  
ATOM 5616   C CG   . GLU C 1 36  ? 114.150 78.148  120.832 1.00 0.00 ? 40  GLU C CG   1  
ATOM 5617   C CD   . GLU C 1 36  ? 115.189 77.107  120.473 1.00 0.00 ? 40  GLU C CD   1  
ATOM 5618   O OE1  . GLU C 1 36  ? 116.084 76.850  121.301 1.00 0.00 ? 40  GLU C OE1  1  
ATOM 5619   O OE2  . GLU C 1 36  ? 115.120 76.553  119.356 1.00 0.00 ? 40  GLU C OE2  1  
ATOM 5620   H H    . GLU C 1 36  ? 110.935 79.266  118.756 1.00 0.00 ? 40  GLU C H    1  
ATOM 5621   H HA   . GLU C 1 36  ? 111.415 77.718  120.938 1.00 0.00 ? 40  GLU C HA   1  
ATOM 5622   H HB2  . GLU C 1 36  ? 112.987 77.392  119.325 1.00 0.00 ? 40  GLU C HB2  1  
ATOM 5623   H HB3  . GLU C 1 36  ? 113.231 78.925  119.174 1.00 0.00 ? 40  GLU C HB3  1  
ATOM 5624   H HG2  . GLU C 1 36  ? 114.578 79.016  120.904 1.00 0.00 ? 40  GLU C HG2  1  
ATOM 5625   H HG3  . GLU C 1 36  ? 113.779 77.942  121.705 1.00 0.00 ? 40  GLU C HG3  1  
ATOM 5626   N N    . ARG C 1 37  ? 111.123 79.582  122.533 1.00 0.00 ? 41  ARG C N    1  
ATOM 5627   C CA   . ARG C 1 37  ? 110.972 80.701  123.452 1.00 0.00 ? 41  ARG C CA   1  
ATOM 5628   C C    . ARG C 1 37  ? 112.331 81.107  124.014 1.00 0.00 ? 41  ARG C C    1  
ATOM 5629   O O    . ARG C 1 37  ? 113.196 80.271  124.286 1.00 0.00 ? 41  ARG C O    1  
ATOM 5630   C CB   . ARG C 1 37  ? 109.990 80.338  124.556 1.00 0.00 ? 41  ARG C CB   1  
ATOM 5631   C CG   . ARG C 1 37  ? 108.632 80.964  124.375 1.00 0.00 ? 41  ARG C CG   1  
ATOM 5632   C CD   . ARG C 1 37  ? 108.675 82.424  124.745 1.00 0.00 ? 41  ARG C CD   1  
ATOM 5633   N NE   . ARG C 1 37  ? 109.245 83.197  123.647 1.00 0.00 ? 41  ARG C NE   1  
ATOM 5634   C CZ   . ARG C 1 37  ? 109.923 84.332  123.793 1.00 0.00 ? 41  ARG C CZ   1  
ATOM 5635   N NH1  . ARG C 1 37  ? 110.121 84.841  125.001 1.00 0.00 ? 41  ARG C NH1  1  
ATOM 5636   N NH2  . ARG C 1 37  ? 110.406 84.959  122.728 1.00 0.00 ? 41  ARG C NH2  1  
ATOM 5637   H H    . ARG C 1 37  ? 110.819 78.835  122.833 1.00 0.00 ? 41  ARG C H    1  
ATOM 5638   H HA   . ARG C 1 37  ? 110.611 81.465  122.975 1.00 0.00 ? 41  ARG C HA   1  
ATOM 5639   H HB2  . ARG C 1 37  ? 109.893 79.373  124.590 1.00 0.00 ? 41  ARG C HB2  1  
ATOM 5640   H HB3  . ARG C 1 37  ? 110.356 80.616  125.411 1.00 0.00 ? 41  ARG C HB3  1  
ATOM 5641   H HG2  . ARG C 1 37  ? 108.345 80.866  123.454 1.00 0.00 ? 41  ARG C HG2  1  
ATOM 5642   H HG3  . ARG C 1 37  ? 107.980 80.503  124.926 1.00 0.00 ? 41  ARG C HG3  1  
ATOM 5643   H HD2  . ARG C 1 37  ? 107.781 82.741  124.945 1.00 0.00 ? 41  ARG C HD2  1  
ATOM 5644   H HD3  . ARG C 1 37  ? 109.206 82.547  125.548 1.00 0.00 ? 41  ARG C HD3  1  
ATOM 5645   H HE   . ARG C 1 37  ? 109.135 82.897  122.848 1.00 0.00 ? 41  ARG C HE   1  
ATOM 5646   H HH11 . ARG C 1 37  ? 109.811 84.437  125.694 1.00 0.00 ? 41  ARG C HH11 1  
ATOM 5647   H HH12 . ARG C 1 37  ? 110.559 85.575  125.091 1.00 0.00 ? 41  ARG C HH12 1  
ATOM 5648   H HH21 . ARG C 1 37  ? 110.281 84.631  121.943 1.00 0.00 ? 41  ARG C HH21 1  
ATOM 5649   H HH22 . ARG C 1 37  ? 110.844 85.693  122.824 1.00 0.00 ? 41  ARG C HH22 1  
ATOM 5650   N N    . GLU C 1 38  ? 112.512 82.408  124.221 1.00 0.00 ? 42  GLU C N    1  
ATOM 5651   C CA   . GLU C 1 38  ? 113.817 82.995  124.497 1.00 0.00 ? 42  GLU C CA   1  
ATOM 5652   C C    . GLU C 1 38  ? 113.727 83.807  125.783 1.00 0.00 ? 42  GLU C C    1  
ATOM 5653   O O    . GLU C 1 38  ? 112.654 83.956  126.373 1.00 0.00 ? 42  GLU C O    1  
ATOM 5654   C CB   . GLU C 1 38  ? 114.268 83.852  123.317 1.00 0.00 ? 42  GLU C CB   1  
ATOM 5655   C CG   . GLU C 1 38  ? 114.771 83.026  122.162 1.00 0.00 ? 42  GLU C CG   1  
ATOM 5656   C CD   . GLU C 1 38  ? 115.713 83.795  121.275 1.00 0.00 ? 42  GLU C CD   1  
ATOM 5657   O OE1  . GLU C 1 38  ? 115.673 83.587  120.045 1.00 0.00 ? 42  GLU C OE1  1  
ATOM 5658   O OE2  . GLU C 1 38  ? 116.475 84.624  121.809 1.00 0.00 ? 42  GLU C OE2  1  
ATOM 5659   H H    . GLU C 1 38  ? 111.871 82.982  124.205 1.00 0.00 ? 42  GLU C H    1  
ATOM 5660   H HA   . GLU C 1 38  ? 114.482 82.298  124.617 1.00 0.00 ? 42  GLU C HA   1  
ATOM 5661   H HB2  . GLU C 1 38  ? 113.526 84.402  123.018 1.00 0.00 ? 42  GLU C HB2  1  
ATOM 5662   H HB3  . GLU C 1 38  ? 114.968 84.457  123.608 1.00 0.00 ? 42  GLU C HB3  1  
ATOM 5663   H HG2  . GLU C 1 38  ? 115.223 82.238  122.503 1.00 0.00 ? 42  GLU C HG2  1  
ATOM 5664   H HG3  . GLU C 1 38  ? 114.017 82.715  121.636 1.00 0.00 ? 42  GLU C HG3  1  
ATOM 5665   N N    . LEU C 1 39  ? 114.872 84.329  126.212 1.00 0.00 ? 43  LEU C N    1  
ATOM 5666   C CA   . LEU C 1 39  ? 114.982 85.117  127.429 1.00 0.00 ? 43  LEU C CA   1  
ATOM 5667   C C    . LEU C 1 39  ? 114.204 86.419  127.294 1.00 0.00 ? 43  LEU C C    1  
ATOM 5668   O O    . LEU C 1 39  ? 114.218 87.068  126.244 1.00 0.00 ? 43  LEU C O    1  
ATOM 5669   C CB   . LEU C 1 39  ? 116.448 85.430  127.758 1.00 0.00 ? 43  LEU C CB   1  
ATOM 5670   C CG   . LEU C 1 39  ? 117.003 85.048  129.132 1.00 0.00 ? 43  LEU C CG   1  
ATOM 5671   C CD1  . LEU C 1 39  ? 116.185 85.695  130.235 1.00 0.00 ? 43  LEU C CD1  1  
ATOM 5672   C CD2  . LEU C 1 39  ? 117.008 83.540  129.300 1.00 0.00 ? 43  LEU C CD2  1  
ATOM 5673   H H    . LEU C 1 39  ? 115.619 84.231  125.796 1.00 0.00 ? 43  LEU C H    1  
ATOM 5674   H HA   . LEU C 1 39  ? 114.606 84.591  128.153 1.00 0.00 ? 43  LEU C HA   1  
ATOM 5675   H HB2  . LEU C 1 39  ? 116.997 84.991  127.089 1.00 0.00 ? 43  LEU C HB2  1  
ATOM 5676   H HB3  . LEU C 1 39  ? 116.574 86.385  127.647 1.00 0.00 ? 43  LEU C HB3  1  
ATOM 5677   H HG   . LEU C 1 39  ? 117.916 85.371  129.193 1.00 0.00 ? 43  LEU C HG   1  
ATOM 5678   H HD11 . LEU C 1 39  ? 116.335 86.653  130.229 1.00 0.00 ? 43  LEU C HD11 1  
ATOM 5679   H HD12 . LEU C 1 39  ? 115.243 85.515  130.089 1.00 0.00 ? 43  LEU C HD12 1  
ATOM 5680   H HD13 . LEU C 1 39  ? 116.454 85.332  131.094 1.00 0.00 ? 43  LEU C HD13 1  
ATOM 5681   H HD21 . LEU C 1 39  ? 117.574 83.140  128.621 1.00 0.00 ? 43  LEU C HD21 1  
ATOM 5682   H HD22 . LEU C 1 39  ? 117.350 83.313  130.179 1.00 0.00 ? 43  LEU C HD22 1  
ATOM 5683   H HD23 . LEU C 1 39  ? 116.104 83.201  129.208 1.00 0.00 ? 43  LEU C HD23 1  
ATOM 5684   N N    . PHE C 1 40  ? 113.524 86.792  128.379 1.00 0.00 ? 44  PHE C N    1  
ATOM 5685   C CA   . PHE C 1 40  ? 112.877 88.094  128.486 1.00 0.00 ? 44  PHE C CA   1  
ATOM 5686   C C    . PHE C 1 40  ? 113.833 89.140  129.030 1.00 0.00 ? 44  PHE C C    1  
ATOM 5687   O O    . PHE C 1 40  ? 114.459 88.933  130.072 1.00 0.00 ? 44  PHE C O    1  
ATOM 5688   C CB   . PHE C 1 40  ? 111.633 88.052  129.381 1.00 0.00 ? 44  PHE C CB   1  
ATOM 5689   C CG   . PHE C 1 40  ? 110.986 86.690  129.447 1.00 0.00 ? 44  PHE C CG   1  
ATOM 5690   C CD1  . PHE C 1 40  ? 111.001 85.957  130.624 1.00 0.00 ? 44  PHE C CD1  1  
ATOM 5691   C CD2  . PHE C 1 40  ? 110.357 86.149  128.335 1.00 0.00 ? 44  PHE C CD2  1  
ATOM 5692   C CE1  . PHE C 1 40  ? 110.410 84.707  130.686 1.00 0.00 ? 44  PHE C CE1  1  
ATOM 5693   C CE2  . PHE C 1 40  ? 109.761 84.904  128.395 1.00 0.00 ? 44  PHE C CE2  1  
ATOM 5694   C CZ   . PHE C 1 40  ? 109.790 84.181  129.568 1.00 0.00 ? 44  PHE C CZ   1  
ATOM 5695   H H    . PHE C 1 40  ? 113.426 86.294  129.073 1.00 0.00 ? 44  PHE C H    1  
ATOM 5696   H HA   . PHE C 1 40  ? 112.605 88.333  127.586 1.00 0.00 ? 44  PHE C HA   1  
ATOM 5697   H HB2  . PHE C 1 40  ? 111.878 88.329  130.277 1.00 0.00 ? 44  PHE C HB2  1  
ATOM 5698   H HB3  . PHE C 1 40  ? 110.984 88.694  129.052 1.00 0.00 ? 44  PHE C HB3  1  
ATOM 5699   H HD1  . PHE C 1 40  ? 111.413 86.309  131.380 1.00 0.00 ? 44  PHE C HD1  1  
ATOM 5700   H HD2  . PHE C 1 40  ? 110.335 86.631  127.540 1.00 0.00 ? 44  PHE C HD2  1  
ATOM 5701   H HE1  . PHE C 1 40  ? 110.430 84.222  131.478 1.00 0.00 ? 44  PHE C HE1  1  
ATOM 5702   H HE2  . PHE C 1 40  ? 109.341 84.554  127.644 1.00 0.00 ? 44  PHE C HE2  1  
ATOM 5703   H HZ   . PHE C 1 40  ? 109.393 83.342  129.608 1.00 0.00 ? 44  PHE C HZ   1  
ATOM 5704   N N    . ASP C 1 41  ? 113.931 90.259  128.324 1.00 0.00 ? 45  ASP C N    1  
ATOM 5705   C CA   . ASP C 1 41  ? 114.341 91.540  128.883 1.00 0.00 ? 45  ASP C CA   1  
ATOM 5706   C C    . ASP C 1 41  ? 115.844 91.489  129.147 1.00 0.00 ? 45  ASP C C    1  
ATOM 5707   O O    . ASP C 1 41  ? 116.316 90.782  130.040 1.00 0.00 ? 45  ASP C O    1  
ATOM 5708   C CB   . ASP C 1 41  ? 113.568 91.883  130.166 1.00 0.00 ? 45  ASP C CB   1  
ATOM 5709   C CG   . ASP C 1 41  ? 114.048 93.168  130.824 1.00 0.00 ? 45  ASP C CG   1  
ATOM 5710   O OD1  . ASP C 1 41  ? 114.460 94.095  130.098 1.00 0.00 ? 45  ASP C OD1  1  
ATOM 5711   O OD2  . ASP C 1 41  ? 114.048 93.236  132.071 1.00 0.00 ? 45  ASP C OD2  1  
ATOM 5712   H H    . ASP C 1 41  ? 113.755 90.295  127.482 1.00 0.00 ? 45  ASP C H    1  
ATOM 5713   H HA   . ASP C 1 41  ? 114.136 92.244  128.247 1.00 0.00 ? 45  ASP C HA   1  
ATOM 5714   H HB2  . ASP C 1 41  ? 112.625 91.965  129.956 1.00 0.00 ? 45  ASP C HB2  1  
ATOM 5715   H HB3  . ASP C 1 41  ? 113.657 91.151  130.795 1.00 0.00 ? 45  ASP C HB3  1  
ATOM 5716   N N    . GLU C 1 42  ? 116.603 92.242  128.353 1.00 0.00 ? 46  GLU C N    1  
ATOM 5717   C CA   . GLU C 1 42  ? 118.043 92.351  128.550 1.00 0.00 ? 46  GLU C CA   1  
ATOM 5718   C C    . GLU C 1 42  ? 118.417 93.038  129.852 1.00 0.00 ? 46  GLU C C    1  
ATOM 5719   O O    . GLU C 1 42  ? 119.461 92.712  130.428 1.00 0.00 ? 46  GLU C O    1  
ATOM 5720   C CB   . GLU C 1 42  ? 118.690 93.112  127.389 1.00 0.00 ? 46  GLU C CB   1  
ATOM 5721   C CG   . GLU C 1 42  ? 120.094 92.670  127.045 1.00 0.00 ? 46  GLU C CG   1  
ATOM 5722   C CD   . GLU C 1 42  ? 120.921 93.763  126.407 1.00 0.00 ? 46  GLU C CD   1  
ATOM 5723   O OE1  . GLU C 1 42  ? 120.403 94.881  126.220 1.00 0.00 ? 46  GLU C OE1  1  
ATOM 5724   O OE2  . GLU C 1 42  ? 122.106 93.506  126.113 1.00 0.00 ? 46  GLU C OE2  1  
ATOM 5725   H H    . GLU C 1 42  ? 116.299 92.699  127.691 1.00 0.00 ? 46  GLU C H    1  
ATOM 5726   H HA   . GLU C 1 42  ? 118.376 91.440  128.587 1.00 0.00 ? 46  GLU C HA   1  
ATOM 5727   H HB2  . GLU C 1 42  ? 118.131 93.014  126.602 1.00 0.00 ? 46  GLU C HB2  1  
ATOM 5728   H HB3  . GLU C 1 42  ? 118.706 94.057  127.608 1.00 0.00 ? 46  GLU C HB3  1  
ATOM 5729   H HG2  . GLU C 1 42  ? 120.538 92.364  127.852 1.00 0.00 ? 46  GLU C HG2  1  
ATOM 5730   H HG3  . GLU C 1 42  ? 120.049 91.911  126.442 1.00 0.00 ? 46  GLU C HG3  1  
ATOM 5731   N N    . GLN C 1 43  ? 117.598 94.009  130.289 1.00 0.00 ? 47  GLN C N    1  
ATOM 5732   C CA   . GLN C 1 43  ? 117.859 94.901  131.433 1.00 0.00 ? 47  GLN C CA   1  
ATOM 5733   C C    . GLN C 1 43  ? 118.963 95.912  131.120 1.00 0.00 ? 47  GLN C C    1  
ATOM 5734   O O    . GLN C 1 43  ? 119.557 96.488  132.036 1.00 0.00 ? 47  GLN C O    1  
ATOM 5735   C CB   . GLN C 1 43  ? 118.191 94.112  132.710 1.00 0.00 ? 47  GLN C CB   1  
ATOM 5736   C CG   . GLN C 1 43  ? 117.231 92.966  133.024 1.00 0.00 ? 47  GLN C CG   1  
ATOM 5737   C CD   . GLN C 1 43  ? 117.901 91.608  133.084 1.00 0.00 ? 47  GLN C CD   1  
ATOM 5738   O OE1  . GLN C 1 43  ? 117.587 90.716  132.298 1.00 0.00 ? 47  GLN C OE1  1  
ATOM 5739   N NE2  . GLN C 1 43  ? 118.833 91.446  134.016 1.00 0.00 ? 47  GLN C NE2  1  
ATOM 5740   H H    . GLN C 1 43  ? 116.843 94.171  129.911 1.00 0.00 ? 47  GLN C H    1  
ATOM 5741   H HA   . GLN C 1 43  ? 117.039 95.393  131.595 1.00 0.00 ? 47  GLN C HA   1  
ATOM 5742   H HB2  . GLN C 1 43  ? 119.089 93.753  132.628 1.00 0.00 ? 47  GLN C HB2  1  
ATOM 5743   H HB3  . GLN C 1 43  ? 118.199 94.726  133.462 1.00 0.00 ? 47  GLN C HB3  1  
ATOM 5744   H HG2  . GLN C 1 43  ? 116.797 93.143  133.873 1.00 0.00 ? 47  GLN C HG2  1  
ATOM 5745   H HG3  . GLN C 1 43  ? 116.535 92.945  132.349 1.00 0.00 ? 47  GLN C HG3  1  
ATOM 5746   H HE21 . GLN C 1 43  ? 119.025 92.093  134.549 1.00 0.00 ? 47  GLN C HE21 1  
ATOM 5747   H HE22 . GLN C 1 43  ? 119.243 90.693  134.086 1.00 0.00 ? 47  GLN C HE22 1  
ATOM 5748   N N    . THR C 1 44  ? 119.183 96.169  129.822 1.00 0.00 ? 48  THR C N    1  
ATOM 5749   C CA   . THR C 1 44  ? 120.371 96.839  129.273 1.00 0.00 ? 48  THR C CA   1  
ATOM 5750   C C    . THR C 1 44  ? 121.656 96.345  129.944 1.00 0.00 ? 48  THR C C    1  
ATOM 5751   O O    . THR C 1 44  ? 122.395 97.105  130.570 1.00 0.00 ? 48  THR C O    1  
ATOM 5752   C CB   . THR C 1 44  ? 120.253 98.365  129.360 1.00 0.00 ? 48  THR C CB   1  
ATOM 5753   O OG1  . THR C 1 44  ? 118.879 98.756  129.254 1.00 0.00 ? 48  THR C OG1  1  
ATOM 5754   C CG2  . THR C 1 44  ? 121.050 99.026  128.245 1.00 0.00 ? 48  THR C CG2  1  
ATOM 5755   H H    . THR C 1 44  ? 118.619 95.946  129.212 1.00 0.00 ? 48  THR C H    1  
ATOM 5756   H HA   . THR C 1 44  ? 120.422 96.605  128.333 1.00 0.00 ? 48  THR C HA   1  
ATOM 5757   H HB   . THR C 1 44  ? 120.608 98.651  130.216 1.00 0.00 ? 48  THR C HB   1  
ATOM 5758   H HG1  . THR C 1 44  ? 118.450 98.453  129.908 1.00 0.00 ? 48  THR C HG1  1  
ATOM 5759   H HG21 . THR C 1 44  ? 121.562 99.831  128.421 1.00 0.00 ? 48  THR C HG21 1  
ATOM 5760   H HG22 . THR C 1 44  ? 121.985 98.777  128.324 1.00 0.00 ? 48  THR C HG22 1  
ATOM 5761   H HG23 . THR C 1 44  ? 120.710 98.732  127.385 1.00 0.00 ? 48  THR C HG23 1  
ATOM 5762   N N    . LYS C 1 45  ? 121.917 95.044  129.800 1.00 0.00 ? 49  LYS C N    1  
ATOM 5763   C CA   . LYS C 1 45  ? 123.070 94.401  130.424 1.00 0.00 ? 49  LYS C CA   1  
ATOM 5764   C C    . LYS C 1 45  ? 124.041 93.902  129.363 1.00 0.00 ? 49  LYS C C    1  
ATOM 5765   O O    . LYS C 1 45  ? 124.461 94.669  128.489 1.00 0.00 ? 49  LYS C O    1  
ATOM 5766   C CB   . LYS C 1 45  ? 122.642 93.231  131.317 1.00 0.00 ? 49  LYS C CB   1  
ATOM 5767   C CG   . LYS C 1 45  ? 121.750 93.599  132.486 1.00 0.00 ? 49  LYS C CG   1  
ATOM 5768   C CD   . LYS C 1 45  ? 122.557 93.836  133.742 1.00 0.00 ? 49  LYS C CD   1  
ATOM 5769   C CE   . LYS C 1 45  ? 122.104 95.098  134.447 1.00 0.00 ? 49  LYS C CE   1  
ATOM 5770   N NZ   . LYS C 1 45  ? 120.626 95.128  134.605 1.00 0.00 ? 49  LYS C NZ   1  
ATOM 5771   H H    . LYS C 1 45  ? 121.427 94.510  129.336 1.00 0.00 ? 49  LYS C H    1  
ATOM 5772   H HA   . LYS C 1 45  ? 123.509 95.065  130.978 1.00 0.00 ? 49  LYS C HA   1  
ATOM 5773   H HB2  . LYS C 1 45  ? 122.180 92.578  130.769 1.00 0.00 ? 49  LYS C HB2  1  
ATOM 5774   H HB3  . LYS C 1 45  ? 123.439 92.799  131.661 1.00 0.00 ? 49  LYS C HB3  1  
ATOM 5775   H HG2  . LYS C 1 45  ? 121.244 94.398  132.269 1.00 0.00 ? 49  LYS C HG2  1  
ATOM 5776   H HG3  . LYS C 1 45  ? 121.107 92.890  132.640 1.00 0.00 ? 49  LYS C HG3  1  
ATOM 5777   H HD2  . LYS C 1 45  ? 122.463 93.077  134.338 1.00 0.00 ? 49  LYS C HD2  1  
ATOM 5778   H HD3  . LYS C 1 45  ? 123.498 93.906  133.517 1.00 0.00 ? 49  LYS C HD3  1  
ATOM 5779   H HE2  . LYS C 1 45  ? 122.526 95.154  135.318 1.00 0.00 ? 49  LYS C HE2  1  
ATOM 5780   H HE3  . LYS C 1 45  ? 122.393 95.874  133.943 1.00 0.00 ? 49  LYS C HE3  1  
ATOM 5781   H HZ1  . LYS C 1 45  ? 120.241 94.883  133.842 1.00 0.00 ? 49  LYS C HZ1  1  
ATOM 5782   H HZ2  . LYS C 1 45  ? 120.385 94.567  135.253 1.00 0.00 ? 49  LYS C HZ2  1  
ATOM 5783   H HZ3  . LYS C 1 45  ? 120.367 95.953  134.816 1.00 0.00 ? 49  LYS C HZ3  1  
ATOM 5784   N N    . ASN C 1 46  ? 124.414 92.620  129.443 1.00 0.00 ? 50  ASN C N    1  
ATOM 5785   C CA   . ASN C 1 46  ? 125.301 92.014  128.452 1.00 0.00 ? 50  ASN C CA   1  
ATOM 5786   C C    . ASN C 1 46  ? 124.562 91.093  127.487 1.00 0.00 ? 50  ASN C C    1  
ATOM 5787   O O    . ASN C 1 46  ? 125.207 90.321  126.770 1.00 0.00 ? 50  ASN C O    1  
ATOM 5788   C CB   . ASN C 1 46  ? 126.420 91.231  129.150 1.00 0.00 ? 50  ASN C CB   1  
ATOM 5789   C CG   . ASN C 1 46  ? 127.698 91.174  128.333 1.00 0.00 ? 50  ASN C CG   1  
ATOM 5790   O OD1  . ASN C 1 46  ? 127.904 90.251  127.548 1.00 0.00 ? 50  ASN C OD1  1  
ATOM 5791   N ND2  . ASN C 1 46  ? 128.568 92.158  128.524 1.00 0.00 ? 50  ASN C ND2  1  
ATOM 5792   H H    . ASN C 1 46  ? 124.161 92.085  130.066 1.00 0.00 ? 50  ASN C H    1  
ATOM 5793   H HA   . ASN C 1 46  ? 125.677 92.742  127.932 1.00 0.00 ? 50  ASN C HA   1  
ATOM 5794   H HB2  . ASN C 1 46  ? 126.609 91.640  130.008 1.00 0.00 ? 50  ASN C HB2  1  
ATOM 5795   H HB3  . ASN C 1 46  ? 126.115 90.328  129.327 1.00 0.00 ? 50  ASN C HB3  1  
ATOM 5796   H HD21 . ASN C 1 46  ? 129.311 92.166  128.090 1.00 0.00 ? 50  ASN C HD21 1  
ATOM 5797   H HD22 . ASN C 1 46  ? 128.389 92.787  129.083 1.00 0.00 ? 50  ASN C HD22 1  
ATOM 5798   N N    . GLY C 1 47  ? 123.236 91.152  127.452 1.00 0.00 ? 51  GLY C N    1  
ATOM 5799   C CA   . GLY C 1 47  ? 122.455 90.299  126.574 1.00 0.00 ? 51  GLY C CA   1  
ATOM 5800   C C    . GLY C 1 47  ? 121.717 89.237  127.361 1.00 0.00 ? 51  GLY C C    1  
ATOM 5801   O O    . GLY C 1 47  ? 122.146 88.085  127.454 1.00 0.00 ? 51  GLY C O    1  
ATOM 5802   H H    . GLY C 1 47  ? 122.767 91.687  127.935 1.00 0.00 ? 51  GLY C H    1  
ATOM 5803   H HA2  . GLY C 1 47  ? 121.819 90.837  126.077 1.00 0.00 ? 51  GLY C HA2  1  
ATOM 5804   H HA3  . GLY C 1 47  ? 123.038 89.877  125.924 1.00 0.00 ? 51  GLY C HA3  1  
ATOM 5805   N N    . ARG C 1 48  ? 120.584 89.630  127.939 1.00 0.00 ? 52  ARG C N    1  
ATOM 5806   C CA   . ARG C 1 48  ? 119.778 88.719  128.740 1.00 0.00 ? 52  ARG C CA   1  
ATOM 5807   C C    . ARG C 1 48  ? 118.498 88.435  127.960 1.00 0.00 ? 52  ARG C C    1  
ATOM 5808   O O    . ARG C 1 48  ? 117.449 88.117  128.529 1.00 0.00 ? 52  ARG C O    1  
ATOM 5809   C CB   . ARG C 1 48  ? 119.498 89.312  130.129 1.00 0.00 ? 52  ARG C CB   1  
ATOM 5810   C CG   . ARG C 1 48  ? 120.678 90.055  130.779 1.00 0.00 ? 52  ARG C CG   1  
ATOM 5811   C CD   . ARG C 1 48  ? 121.433 89.211  131.802 1.00 0.00 ? 52  ARG C CD   1  
ATOM 5812   N NE   . ARG C 1 48  ? 121.880 87.936  131.246 1.00 0.00 ? 52  ARG C NE   1  
ATOM 5813   C CZ   . ARG C 1 48  ? 123.015 87.774  130.569 1.00 0.00 ? 52  ARG C CZ   1  
ATOM 5814   N NH1  . ARG C 1 48  ? 123.822 88.805  130.362 1.00 0.00 ? 52  ARG C NH1  1  
ATOM 5815   N NH2  . ARG C 1 48  ? 123.343 86.579  130.096 1.00 0.00 ? 52  ARG C NH2  1  
ATOM 5816   H H    . ARG C 1 48  ? 120.264 90.425  127.876 1.00 0.00 ? 52  ARG C H    1  
ATOM 5817   H HA   . ARG C 1 48  ? 120.249 87.887  128.899 1.00 0.00 ? 52  ARG C HA   1  
ATOM 5818   H HB2  . ARG C 1 48  ? 118.750 89.925  130.057 1.00 0.00 ? 52  ARG C HB2  1  
ATOM 5819   H HB3  . ARG C 1 48  ? 119.223 88.594  130.721 1.00 0.00 ? 52  ARG C HB3  1  
ATOM 5820   H HG2  . ARG C 1 48  ? 121.294 90.340  130.086 1.00 0.00 ? 52  ARG C HG2  1  
ATOM 5821   H HG3  . ARG C 1 48  ? 120.348 90.858  131.212 1.00 0.00 ? 52  ARG C HG3  1  
ATOM 5822   H HD2  . ARG C 1 48  ? 122.200 89.708  132.126 1.00 0.00 ? 52  ARG C HD2  1  
ATOM 5823   H HD3  . ARG C 1 48  ? 120.860 89.045  132.568 1.00 0.00 ? 52  ARG C HD3  1  
ATOM 5824   H HE   . ARG C 1 48  ? 121.379 87.247  131.363 1.00 0.00 ? 52  ARG C HE   1  
ATOM 5825   H HH11 . ARG C 1 48  ? 123.614 89.582  130.666 1.00 0.00 ? 52  ARG C HH11 1  
ATOM 5826   H HH12 . ARG C 1 48  ? 124.554 88.697  129.924 1.00 0.00 ? 52  ARG C HH12 1  
ATOM 5827   H HH21 . ARG C 1 48  ? 122.824 85.907  130.227 1.00 0.00 ? 52  ARG C HH21 1  
ATOM 5828   H HH22 . ARG C 1 48  ? 124.077 86.477  129.659 1.00 0.00 ? 52  ARG C HH22 1  
ATOM 5829   N N    . ILE C 1 49  ? 118.565 88.607  126.641 1.00 0.00 ? 53  ILE C N    1  
ATOM 5830   C CA   . ILE C 1 49  ? 117.431 88.339  125.763 1.00 0.00 ? 53  ILE C CA   1  
ATOM 5831   C C    . ILE C 1 49  ? 117.831 87.332  124.691 1.00 0.00 ? 53  ILE C C    1  
ATOM 5832   O O    . ILE C 1 49  ? 117.042 87.020  123.794 1.00 0.00 ? 53  ILE C O    1  
ATOM 5833   C CB   . ILE C 1 49  ? 116.890 89.632  125.126 1.00 0.00 ? 53  ILE C CB   1  
ATOM 5834   C CG1  . ILE C 1 49  ? 117.984 90.699  125.037 1.00 0.00 ? 53  ILE C CG1  1  
ATOM 5835   C CG2  . ILE C 1 49  ? 115.701 90.153  125.915 1.00 0.00 ? 53  ILE C CG2  1  
ATOM 5836   C CD1  . ILE C 1 49  ? 117.620 91.930  124.210 1.00 0.00 ? 53  ILE C CD1  1  
ATOM 5837   H H    . ILE C 1 49  ? 119.270 88.881  126.231 1.00 0.00 ? 53  ILE C H    1  
ATOM 5838   H HA   . ILE C 1 49  ? 116.715 87.962  126.299 1.00 0.00 ? 53  ILE C HA   1  
ATOM 5839   H HB   . ILE C 1 49  ? 116.599 89.426  124.224 1.00 0.00 ? 53  ILE C HB   1  
ATOM 5840   H HG12 . ILE C 1 49  ? 118.212 90.985  125.936 1.00 0.00 ? 53  ILE C HG12 1  
ATOM 5841   H HG13 . ILE C 1 49  ? 118.781 90.295  124.658 1.00 0.00 ? 53  ILE C HG13 1  
ATOM 5842   H HG21 . ILE C 1 49  ? 115.309 89.428  126.425 1.00 0.00 ? 53  ILE C HG21 1  
ATOM 5843   H HG22 . ILE C 1 49  ? 115.995 90.852  126.520 1.00 0.00 ? 53  ILE C HG22 1  
ATOM 5844   H HG23 . ILE C 1 49  ? 115.039 90.512  125.304 1.00 0.00 ? 53  ILE C HG23 1  
ATOM 5845   H HD11 . ILE C 1 49  ? 117.459 92.682  124.802 1.00 0.00 ? 53  ILE C HD11 1  
ATOM 5846   H HD12 . ILE C 1 49  ? 118.349 92.144  123.608 1.00 0.00 ? 53  ILE C HD12 1  
ATOM 5847   H HD13 . ILE C 1 49  ? 116.818 91.749  123.695 1.00 0.00 ? 53  ILE C HD13 1  
ATOM 5848   N N    . LEU C 1 50  ? 119.065 86.826  124.773 1.00 0.00 ? 54  LEU C N    1  
ATOM 5849   C CA   . LEU C 1 50  ? 119.537 85.796  123.857 1.00 0.00 ? 54  LEU C CA   1  
ATOM 5850   C C    . LEU C 1 50  ? 119.591 84.423  124.516 1.00 0.00 ? 54  LEU C C    1  
ATOM 5851   O O    . LEU C 1 50  ? 120.333 83.554  124.048 1.00 0.00 ? 54  LEU C O    1  
ATOM 5852   C CB   . LEU C 1 50  ? 120.937 86.142  123.330 1.00 0.00 ? 54  LEU C CB   1  
ATOM 5853   C CG   . LEU C 1 50  ? 121.264 86.376  121.847 1.00 0.00 ? 54  LEU C CG   1  
ATOM 5854   C CD1  . LEU C 1 50  ? 122.129 85.265  121.275 1.00 0.00 ? 54  LEU C CD1  1  
ATOM 5855   C CD2  . LEU C 1 50  ? 119.991 86.525  121.020 1.00 0.00 ? 54  LEU C CD2  1  
ATOM 5856   H H    . LEU C 1 50  ? 119.644 87.072  125.359 1.00 0.00 ? 54  LEU C H    1  
ATOM 5857   H HA   . LEU C 1 50  ? 118.902 85.764  123.124 1.00 0.00 ? 54  LEU C HA   1  
ATOM 5858   H HB2  . LEU C 1 50  ? 121.211 86.946  123.798 1.00 0.00 ? 54  LEU C HB2  1  
ATOM 5859   H HB3  . LEU C 1 50  ? 121.522 85.427  123.625 1.00 0.00 ? 54  LEU C HB3  1  
ATOM 5860   H HG   . LEU C 1 50  ? 121.766 87.204  121.798 1.00 0.00 ? 54  LEU C HG   1  
ATOM 5861   H HD11 . LEU C 1 50  ? 122.916 85.648  120.860 1.00 0.00 ? 54  LEU C HD11 1  
ATOM 5862   H HD12 . LEU C 1 50  ? 122.399 84.666  121.989 1.00 0.00 ? 54  LEU C HD12 1  
ATOM 5863   H HD13 . LEU C 1 50  ? 121.623 84.770  120.612 1.00 0.00 ? 54  LEU C HD13 1  
ATOM 5864   H HD21 . LEU C 1 50  ? 120.173 87.079  120.244 1.00 0.00 ? 54  LEU C HD21 1  
ATOM 5865   H HD22 . LEU C 1 50  ? 119.690 85.650  120.729 1.00 0.00 ? 54  LEU C HD22 1  
ATOM 5866   H HD23 . LEU C 1 50  ? 119.301 86.941  121.559 1.00 0.00 ? 54  LEU C HD23 1  
ATOM 5867   N N    . GLY C 1 51  ? 118.819 84.220  125.585 1.00 0.00 ? 55  GLY C N    1  
ATOM 5868   C CA   . GLY C 1 51  ? 118.925 83.049  126.422 1.00 0.00 ? 55  GLY C CA   1  
ATOM 5869   C C    . GLY C 1 51  ? 117.967 81.939  126.049 1.00 0.00 ? 55  GLY C C    1  
ATOM 5870   O O    . GLY C 1 51  ? 116.964 82.153  125.362 1.00 0.00 ? 55  GLY C O    1  
ATOM 5871   H H    . GLY C 1 51  ? 118.212 84.773  125.840 1.00 0.00 ? 55  GLY C H    1  
ATOM 5872   H HA2  . GLY C 1 51  ? 119.832 82.710  126.374 1.00 0.00 ? 55  GLY C HA2  1  
ATOM 5873   H HA3  . GLY C 1 51  ? 118.765 83.305  127.344 1.00 0.00 ? 55  GLY C HA3  1  
ATOM 5874   N N    . PRO C 1 52  ? 118.261 80.720  126.503 1.00 0.00 ? 56  PRO C N    1  
ATOM 5875   C CA   . PRO C 1 52  ? 117.444 79.570  126.106 1.00 0.00 ? 56  PRO C CA   1  
ATOM 5876   C C    . PRO C 1 52  ? 116.083 79.527  126.770 1.00 0.00 ? 56  PRO C C    1  
ATOM 5877   O O    . PRO C 1 52  ? 115.877 80.090  127.850 1.00 0.00 ? 56  PRO C O    1  
ATOM 5878   C CB   . PRO C 1 52  ? 118.335 78.374  126.462 1.00 0.00 ? 56  PRO C CB   1  
ATOM 5879   C CG   . PRO C 1 52  ? 119.167 78.862  127.581 1.00 0.00 ? 56  PRO C CG   1  
ATOM 5880   C CD   . PRO C 1 52  ? 119.428 80.316  127.304 1.00 0.00 ? 56  PRO C CD   1  
ATOM 5881   H HA   . PRO C 1 52  ? 117.236 79.592  125.160 1.00 0.00 ? 56  PRO C HA   1  
ATOM 5882   H HB2  . PRO C 1 52  ? 117.807 77.604  126.723 1.00 0.00 ? 56  PRO C HB2  1  
ATOM 5883   H HB3  . PRO C 1 52  ? 118.881 78.102  125.707 1.00 0.00 ? 56  PRO C HB3  1  
ATOM 5884   H HG2  . PRO C 1 52  ? 118.710 78.747  128.428 1.00 0.00 ? 56  PRO C HG2  1  
ATOM 5885   H HG3  . PRO C 1 52  ? 119.999 78.365  127.637 1.00 0.00 ? 56  PRO C HG3  1  
ATOM 5886   H HD2  . PRO C 1 52  ? 119.496 80.830  128.123 1.00 0.00 ? 56  PRO C HD2  1  
ATOM 5887   H HD3  . PRO C 1 52  ? 120.258 80.445  126.819 1.00 0.00 ? 56  PRO C HD3  1  
ATOM 5888   N N    . GLY C 1 53  ? 115.146 78.847  126.118 1.00 0.00 ? 57  GLY C N    1  
ATOM 5889   C CA   . GLY C 1 53  ? 113.792 78.721  126.620 1.00 0.00 ? 57  GLY C CA   1  
ATOM 5890   C C    . GLY C 1 53  ? 113.144 77.494  126.025 1.00 0.00 ? 57  GLY C C    1  
ATOM 5891   O O    . GLY C 1 53  ? 113.771 76.726  125.291 1.00 0.00 ? 57  GLY C O    1  
ATOM 5892   H H    . GLY C 1 53  ? 115.282 78.445  125.370 1.00 0.00 ? 57  GLY C H    1  
ATOM 5893   H HA2  . GLY C 1 53  ? 113.800 78.656  127.589 1.00 0.00 ? 57  GLY C HA2  1  
ATOM 5894   H HA3  . GLY C 1 53  ? 113.278 79.512  126.393 1.00 0.00 ? 57  GLY C HA3  1  
ATOM 5895   N N    . SER C 1 54  ? 111.871 77.312  126.361 1.00 0.00 ? 58  SER C N    1  
ATOM 5896   C CA   . SER C 1 54  ? 111.123 76.173  125.850 1.00 0.00 ? 58  SER C CA   1  
ATOM 5897   C C    . SER C 1 54  ? 110.715 76.409  124.399 1.00 0.00 ? 58  SER C C    1  
ATOM 5898   O O    . SER C 1 54  ? 110.898 77.495  123.845 1.00 0.00 ? 58  SER C O    1  
ATOM 5899   C CB   . SER C 1 54  ? 109.888 75.920  126.712 1.00 0.00 ? 58  SER C CB   1  
ATOM 5900   O OG   . SER C 1 54  ? 109.666 74.535  126.892 1.00 0.00 ? 58  SER C OG   1  
ATOM 5901   H H    . SER C 1 54  ? 111.426 77.834  126.879 1.00 0.00 ? 58  SER C H    1  
ATOM 5902   H HA   . SER C 1 54  ? 111.694 75.390  125.887 1.00 0.00 ? 58  SER C HA   1  
ATOM 5903   H HB2  . SER C 1 54  ? 109.999 76.349  127.575 1.00 0.00 ? 58  SER C HB2  1  
ATOM 5904   H HB3  . SER C 1 54  ? 109.110 76.323  126.293 1.00 0.00 ? 58  SER C HB3  1  
ATOM 5905   H HG   . SER C 1 54  ? 108.899 74.334  126.614 1.00 0.00 ? 58  SER C HG   1  
ATOM 5906   N N    . VAL C 1 55  ? 110.165 75.370  123.782 1.00 0.00 ? 59  VAL C N    1  
ATOM 5907   C CA   . VAL C 1 55  ? 109.767 75.405  122.380 1.00 0.00 ? 59  VAL C CA   1  
ATOM 5908   C C    . VAL C 1 55  ? 108.286 75.049  122.275 1.00 0.00 ? 59  VAL C C    1  
ATOM 5909   O O    . VAL C 1 55  ? 107.820 74.062  122.860 1.00 0.00 ? 59  VAL C O    1  
ATOM 5910   C CB   . VAL C 1 55  ? 110.666 74.504  121.510 1.00 0.00 ? 59  VAL C CB   1  
ATOM 5911   C CG1  . VAL C 1 55  ? 109.967 74.032  120.227 1.00 0.00 ? 59  VAL C CG1  1  
ATOM 5912   C CG2  . VAL C 1 55  ? 111.969 75.216  121.171 1.00 0.00 ? 59  VAL C CG2  1  
ATOM 5913   H H    . VAL C 1 55  ? 110.011 74.617  124.168 1.00 0.00 ? 59  VAL C H    1  
ATOM 5914   H HA   . VAL C 1 55  ? 109.888 76.302  122.031 1.00 0.00 ? 59  VAL C HA   1  
ATOM 5915   H HB   . VAL C 1 55  ? 110.860 73.712  122.035 1.00 0.00 ? 59  VAL C HB   1  
ATOM 5916   H HG11 . VAL C 1 55  ? 109.222 74.621  120.029 1.00 0.00 ? 59  VAL C HG11 1  
ATOM 5917   H HG12 . VAL C 1 55  ? 110.597 74.049  119.489 1.00 0.00 ? 59  VAL C HG12 1  
ATOM 5918   H HG13 . VAL C 1 55  ? 109.640 73.127  120.351 1.00 0.00 ? 59  VAL C HG13 1  
ATOM 5919   H HG21 . VAL C 1 55  ? 111.882 75.659  120.313 1.00 0.00 ? 59  VAL C HG21 1  
ATOM 5920   H HG22 . VAL C 1 55  ? 112.166 75.874  121.856 1.00 0.00 ? 59  VAL C HG22 1  
ATOM 5921   H HG23 . VAL C 1 55  ? 112.690 74.569  121.128 1.00 0.00 ? 59  VAL C HG23 1  
ATOM 5922   N N    . ALA C 1 56  ? 107.534 75.894  121.578 1.00 0.00 ? 60  ALA C N    1  
ATOM 5923   C CA   . ALA C 1 56  ? 106.130 75.649  121.283 1.00 0.00 ? 60  ALA C CA   1  
ATOM 5924   C C    . ALA C 1 56  ? 106.027 75.233  119.828 1.00 0.00 ? 60  ALA C C    1  
ATOM 5925   O O    . ALA C 1 56  ? 106.326 76.026  118.929 1.00 0.00 ? 60  ALA C O    1  
ATOM 5926   C CB   . ALA C 1 56  ? 105.274 76.885  121.559 1.00 0.00 ? 60  ALA C CB   1  
ATOM 5927   H H    . ALA C 1 56  ? 107.831 76.636  121.259 1.00 0.00 ? 60  ALA C H    1  
ATOM 5928   H HA   . ALA C 1 56  ? 105.792 74.946  121.860 1.00 0.00 ? 60  ALA C HA   1  
ATOM 5929   H HB1  . ALA C 1 56  ? 104.790 76.764  122.391 1.00 0.00 ? 60  ALA C HB1  1  
ATOM 5930   H HB2  . ALA C 1 56  ? 105.846 77.666  121.628 1.00 0.00 ? 60  ALA C HB2  1  
ATOM 5931   H HB3  . ALA C 1 56  ? 104.643 77.010  120.833 1.00 0.00 ? 60  ALA C HB3  1  
ATOM 5932   N N    . ASP C 1 57  ? 105.612 73.995  119.596 1.00 0.00 ? 61  ASP C N    1  
ATOM 5933   C CA   . ASP C 1 57  ? 105.632 73.403  118.268 1.00 0.00 ? 61  ASP C CA   1  
ATOM 5934   C C    . ASP C 1 57  ? 104.213 73.014  117.891 1.00 0.00 ? 61  ASP C C    1  
ATOM 5935   O O    . ASP C 1 57  ? 103.590 72.167  118.549 1.00 0.00 ? 61  ASP C O    1  
ATOM 5936   C CB   . ASP C 1 57  ? 106.581 72.203  118.233 1.00 0.00 ? 61  ASP C CB   1  
ATOM 5937   C CG   . ASP C 1 57  ? 107.690 72.342  117.199 1.00 0.00 ? 61  ASP C CG   1  
ATOM 5938   O OD1  . ASP C 1 57  ? 108.839 72.677  117.545 1.00 0.00 ? 61  ASP C OD1  1  
ATOM 5939   O OD2  . ASP C 1 57  ? 107.408 72.079  116.014 1.00 0.00 ? 61  ASP C OD2  1  
ATOM 5940   H H    . ASP C 1 57  ? 105.308 73.473  120.207 1.00 0.00 ? 61  ASP C H    1  
ATOM 5941   H HA   . ASP C 1 57  ? 105.964 74.043  117.620 1.00 0.00 ? 61  ASP C HA   1  
ATOM 5942   H HB2  . ASP C 1 57  ? 106.978 72.087  119.111 1.00 0.00 ? 61  ASP C HB2  1  
ATOM 5943   H HB3  . ASP C 1 57  ? 106.070 71.400  118.044 1.00 0.00 ? 61  ASP C HB3  1  
ATOM 5944   N N    . SER C 1 58  ? 103.714 73.637  116.830 1.00 0.00 ? 62  SER C N    1  
ATOM 5945   C CA   . SER C 1 58  ? 102.366 73.437  116.332 1.00 0.00 ? 62  SER C CA   1  
ATOM 5946   C C    . SER C 1 58  ? 102.359 73.482  114.813 1.00 0.00 ? 62  SER C C    1  
ATOM 5947   O O    . SER C 1 58  ? 103.128 74.214  114.185 1.00 0.00 ? 62  SER C O    1  
ATOM 5948   C CB   . SER C 1 58  ? 101.420 74.505  116.887 1.00 0.00 ? 62  SER C CB   1  
ATOM 5949   O OG   . SER C 1 58  ? 101.671 75.762  116.288 1.00 0.00 ? 62  SER C OG   1  
ATOM 5950   H H    . SER C 1 58  ? 104.166 74.205  116.369 1.00 0.00 ? 62  SER C H    1  
ATOM 5951   H HA   . SER C 1 58  ? 102.057 72.567  116.629 1.00 0.00 ? 62  SER C HA   1  
ATOM 5952   H HB2  . SER C 1 58  ? 100.500 74.243  116.725 1.00 0.00 ? 62  SER C HB2  1  
ATOM 5953   H HB3  . SER C 1 58  ? 101.530 74.573  117.849 1.00 0.00 ? 62  SER C HB3  1  
ATOM 5954   H HG   . SER C 1 58  ? 101.918 75.650  115.494 1.00 0.00 ? 62  SER C HG   1  
ATOM 5955   N N    . GLY C 1 59  ? 101.472 72.687  114.229 1.00 0.00 ? 63  GLY C N    1  
ATOM 5956   C CA   . GLY C 1 59  ? 101.299 72.686  112.796 1.00 0.00 ? 63  GLY C CA   1  
ATOM 5957   C C    . GLY C 1 59  ? 99.844  72.598  112.398 1.00 0.00 ? 63  GLY C C    1  
ATOM 5958   O O    . GLY C 1 59  ? 99.010  72.116  113.168 1.00 0.00 ? 63  GLY C O    1  
ATOM 5959   H H    . GLY C 1 59  ? 100.962 72.140  114.653 1.00 0.00 ? 63  GLY C H    1  
ATOM 5960   H HA2  . GLY C 1 59  ? 101.686 73.494  112.424 1.00 0.00 ? 63  GLY C HA2  1  
ATOM 5961   H HA3  . GLY C 1 59  ? 101.783 71.937  112.413 1.00 0.00 ? 63  GLY C HA3  1  
ATOM 5962   N N    . GLU C 1 60  ? 99.524  73.066  111.200 1.00 0.00 ? 64  GLU C N    1  
ATOM 5963   C CA   . GLU C 1 60  ? 98.179  72.943  110.648 1.00 0.00 ? 64  GLU C CA   1  
ATOM 5964   C C    . GLU C 1 60  ? 98.292  72.184  109.335 1.00 0.00 ? 64  GLU C C    1  
ATOM 5965   O O    . GLU C 1 60  ? 99.319  72.247  108.656 1.00 0.00 ? 64  GLU C O    1  
ATOM 5966   C CB   . GLU C 1 60  ? 97.536  74.311  110.455 1.00 0.00 ? 64  GLU C CB   1  
ATOM 5967   C CG   . GLU C 1 60  ? 98.233  75.176  109.424 1.00 0.00 ? 64  GLU C CG   1  
ATOM 5968   C CD   . GLU C 1 60  ? 97.493  75.210  108.098 1.00 0.00 ? 64  GLU C CD   1  
ATOM 5969   O OE1  . GLU C 1 60  ? 96.364  75.742  108.056 1.00 0.00 ? 64  GLU C OE1  1  
ATOM 5970   O OE2  . GLU C 1 60  ? 98.041  74.708  107.094 1.00 0.00 ? 64  GLU C OE2  1  
ATOM 5971   H H    . GLU C 1 60  ? 100.080 73.465  110.680 1.00 0.00 ? 64  GLU C H    1  
ATOM 5972   H HA   . GLU C 1 60  ? 97.603  72.458  111.260 1.00 0.00 ? 64  GLU C HA   1  
ATOM 5973   H HB2  . GLU C 1 60  ? 96.610  74.189  110.190 1.00 0.00 ? 64  GLU C HB2  1  
ATOM 5974   H HB3  . GLU C 1 60  ? 97.528  74.777  111.304 1.00 0.00 ? 64  GLU C HB3  1  
ATOM 5975   H HG2  . GLU C 1 60  ? 98.317  76.079  109.767 1.00 0.00 ? 64  GLU C HG2  1  
ATOM 5976   H HG3  . GLU C 1 60  ? 99.133  74.842  109.281 1.00 0.00 ? 64  GLU C HG3  1  
ATOM 5977   N N    . VAL C 1 61  ? 97.235  71.466  108.978 1.00 0.00 ? 65  VAL C N    1  
ATOM 5978   C CA   . VAL C 1 61  ? 97.219  70.653  107.770 1.00 0.00 ? 65  VAL C CA   1  
ATOM 5979   C C    . VAL C 1 61  ? 95.924  70.924  107.026 1.00 0.00 ? 65  VAL C C    1  
ATOM 5980   O O    . VAL C 1 61  ? 94.836  70.771  107.590 1.00 0.00 ? 65  VAL C O    1  
ATOM 5981   C CB   . VAL C 1 61  ? 97.358  69.160  108.105 1.00 0.00 ? 65  VAL C CB   1  
ATOM 5982   C CG1  . VAL C 1 61  ? 97.428  68.332  106.837 1.00 0.00 ? 65  VAL C CG1  1  
ATOM 5983   C CG2  . VAL C 1 61  ? 98.575  68.933  108.973 1.00 0.00 ? 65  VAL C CG2  1  
ATOM 5984   H H    . VAL C 1 61  ? 96.504  71.437  109.430 1.00 0.00 ? 65  VAL C H    1  
ATOM 5985   H HA   . VAL C 1 61  ? 97.974  70.888  107.209 1.00 0.00 ? 65  VAL C HA   1  
ATOM 5986   H HB   . VAL C 1 61  ? 96.575  68.876  108.601 1.00 0.00 ? 65  VAL C HB   1  
ATOM 5987   H HG11 . VAL C 1 61  ? 98.214  68.585  106.328 1.00 0.00 ? 65  VAL C HG11 1  
ATOM 5988   H HG12 . VAL C 1 61  ? 97.481  67.391  107.066 1.00 0.00 ? 65  VAL C HG12 1  
ATOM 5989   H HG13 . VAL C 1 61  ? 96.634  68.489  106.304 1.00 0.00 ? 65  VAL C HG13 1  
ATOM 5990   H HG21 . VAL C 1 61  ? 99.009  69.781  109.150 1.00 0.00 ? 65  VAL C HG21 1  
ATOM 5991   H HG22 . VAL C 1 61  ? 98.304  68.527  109.811 1.00 0.00 ? 65  VAL C HG22 1  
ATOM 5992   H HG23 . VAL C 1 61  ? 99.194  68.343  108.514 1.00 0.00 ? 65  VAL C HG23 1  
ATOM 5993   N N    . THR C 1 62  ? 96.028  71.337  105.769 1.00 0.00 ? 66  THR C N    1  
ATOM 5994   C CA   . THR C 1 62  ? 94.844  71.514  104.946 1.00 0.00 ? 66  THR C CA   1  
ATOM 5995   C C    . THR C 1 62  ? 94.839  70.487  103.824 1.00 0.00 ? 66  THR C C    1  
ATOM 5996   O O    . THR C 1 62  ? 95.887  70.172  103.255 1.00 0.00 ? 66  THR C O    1  
ATOM 5997   C CB   . THR C 1 62  ? 94.787  72.922  104.369 1.00 0.00 ? 66  THR C CB   1  
ATOM 5998   O OG1  . THR C 1 62  ? 95.970  73.159  103.603 1.00 0.00 ? 66  THR C OG1  1  
ATOM 5999   C CG2  . THR C 1 62  ? 94.713  73.951  105.479 1.00 0.00 ? 66  THR C CG2  1  
ATOM 6000   H H    . THR C 1 62  ? 96.771  71.518  105.377 1.00 0.00 ? 66  THR C H    1  
ATOM 6001   H HA   . THR C 1 62  ? 94.060  71.386  105.502 1.00 0.00 ? 66  THR C HA   1  
ATOM 6002   H HB   . THR C 1 62  ? 93.997  72.999  103.811 1.00 0.00 ? 66  THR C HB   1  
ATOM 6003   H HG1  . THR C 1 62  ? 96.331  73.872  103.859 1.00 0.00 ? 66  THR C HG1  1  
ATOM 6004   H HG21 . THR C 1 62  ? 93.897  73.444  105.345 1.00 0.00 ? 66  THR C HG21 1  
ATOM 6005   H HG22 . THR C 1 62  ? 93.916  73.797  106.010 1.00 0.00 ? 66  THR C HG22 1  
ATOM 6006   H HG23 . THR C 1 62  ? 95.498  73.874  106.044 1.00 0.00 ? 66  THR C HG23 1  
ATOM 6007   N N    . TYR C 1 63  ? 93.656  69.955  103.524 1.00 0.00 ? 67  TYR C N    1  
ATOM 6008   C CA   . TYR C 1 63  ? 93.496  69.024  102.407 1.00 0.00 ? 67  TYR C CA   1  
ATOM 6009   C C    . TYR C 1 63  ? 92.029  68.996  101.991 1.00 0.00 ? 67  TYR C C    1  
ATOM 6010   O O    . TYR C 1 63  ? 91.160  69.540  102.679 1.00 0.00 ? 67  TYR C O    1  
ATOM 6011   C CB   . TYR C 1 63  ? 94.014  67.624  102.760 1.00 0.00 ? 67  TYR C CB   1  
ATOM 6012   C CG   . TYR C 1 63  ? 93.390  66.961  103.968 1.00 0.00 ? 67  TYR C CG   1  
ATOM 6013   C CD1  . TYR C 1 63  ? 93.830  67.253  105.247 1.00 0.00 ? 67  TYR C CD1  1  
ATOM 6014   C CD2  . TYR C 1 63  ? 92.388  66.010  103.823 1.00 0.00 ? 67  TYR C CD2  1  
ATOM 6015   C CE1  . TYR C 1 63  ? 93.277  66.635  106.344 1.00 0.00 ? 67  TYR C CE1  1  
ATOM 6016   C CE2  . TYR C 1 63  ? 91.830  65.389  104.913 1.00 0.00 ? 67  TYR C CE2  1  
ATOM 6017   C CZ   . TYR C 1 63  ? 92.278  65.703  106.168 1.00 0.00 ? 67  TYR C CZ   1  
ATOM 6018   O OH   . TYR C 1 63  ? 91.714  65.081  107.256 1.00 0.00 ? 67  TYR C OH   1  
ATOM 6019   H H    . TYR C 1 63  ? 92.932  70.120  103.956 1.00 0.00 ? 67  TYR C H    1  
ATOM 6020   H HA   . TYR C 1 63  ? 94.030  69.330  101.657 1.00 0.00 ? 67  TYR C HA   1  
ATOM 6021   H HB2  . TYR C 1 63  ? 93.879  67.046  101.993 1.00 0.00 ? 67  TYR C HB2  1  
ATOM 6022   H HB3  . TYR C 1 63  ? 94.971  67.682  102.907 1.00 0.00 ? 67  TYR C HB3  1  
ATOM 6023   H HD1  . TYR C 1 63  ? 94.510  67.877  105.366 1.00 0.00 ? 67  TYR C HD1  1  
ATOM 6024   H HD2  . TYR C 1 63  ? 92.090  65.790  102.971 1.00 0.00 ? 67  TYR C HD2  1  
ATOM 6025   H HE1  . TYR C 1 63  ? 93.575  66.845  107.199 1.00 0.00 ? 67  TYR C HE1  1  
ATOM 6026   H HE2  . TYR C 1 63  ? 91.153  64.761  104.799 1.00 0.00 ? 67  TYR C HE2  1  
ATOM 6027   H HH   . TYR C 1 63  ? 92.310  64.919  107.826 1.00 0.00 ? 67  TYR C HH   1  
ATOM 6028   N N    . TYR C 1 64  ? 91.756  68.368  100.847 1.00 0.00 ? 68  TYR C N    1  
ATOM 6029   C CA   . TYR C 1 64  ? 90.400  68.158  100.352 1.00 0.00 ? 68  TYR C CA   1  
ATOM 6030   C C    . TYR C 1 64  ? 89.968  66.741  100.692 1.00 0.00 ? 68  TYR C C    1  
ATOM 6031   O O    . TYR C 1 64  ? 90.586  65.776  100.234 1.00 0.00 ? 68  TYR C O    1  
ATOM 6032   C CB   . TYR C 1 64  ? 90.297  68.365  98.839  1.00 0.00 ? 68  TYR C CB   1  
ATOM 6033   C CG   . TYR C 1 64  ? 90.935  69.625  98.307  1.00 0.00 ? 68  TYR C CG   1  
ATOM 6034   C CD1  . TYR C 1 64  ? 92.241  69.635  97.842  1.00 0.00 ? 68  TYR C CD1  1  
ATOM 6035   C CD2  . TYR C 1 64  ? 90.235  70.818  98.306  1.00 0.00 ? 68  TYR C CD2  1  
ATOM 6036   C CE1  . TYR C 1 64  ? 92.818  70.792  97.362  1.00 0.00 ? 68  TYR C CE1  1  
ATOM 6037   C CE2  . TYR C 1 64  ? 90.808  71.980  97.842  1.00 0.00 ? 68  TYR C CE2  1  
ATOM 6038   C CZ   . TYR C 1 64  ? 92.097  71.958  97.365  1.00 0.00 ? 68  TYR C CZ   1  
ATOM 6039   O OH   . TYR C 1 64  ? 92.671  73.114  96.895  1.00 0.00 ? 68  TYR C OH   1  
ATOM 6040   H H    . TYR C 1 64  ? 92.364  68.049  100.330 1.00 0.00 ? 68  TYR C H    1  
ATOM 6041   H HA   . TYR C 1 64  ? 89.822  68.810  100.778 1.00 0.00 ? 68  TYR C HA   1  
ATOM 6042   H HB2  . TYR C 1 64  ? 90.705  67.604  98.397  1.00 0.00 ? 68  TYR C HB2  1  
ATOM 6043   H HB3  . TYR C 1 64  ? 89.359  68.367  98.593  1.00 0.00 ? 68  TYR C HB3  1  
ATOM 6044   H HD1  . TYR C 1 64  ? 92.737  68.847  97.855  1.00 0.00 ? 68  TYR C HD1  1  
ATOM 6045   H HD2  . TYR C 1 64  ? 89.361  70.835  98.624  1.00 0.00 ? 68  TYR C HD2  1  
ATOM 6046   H HE1  . TYR C 1 64  ? 93.690  70.781  97.039  1.00 0.00 ? 68  TYR C HE1  1  
ATOM 6047   H HE2  . TYR C 1 64  ? 90.326  72.776  97.851  1.00 0.00 ? 68  TYR C HE2  1  
ATOM 6048   H HH   . TYR C 1 64  ? 93.093  73.490  97.517  1.00 0.00 ? 68  TYR C HH   1  
ATOM 6049   N N    . GLY C 1 65  ? 88.896  66.617  101.469 1.00 0.00 ? 69  GLY C N    1  
ATOM 6050   C CA   . GLY C 1 65  ? 88.448  65.317  101.929 1.00 0.00 ? 69  GLY C CA   1  
ATOM 6051   C C    . GLY C 1 65  ? 87.853  64.431  100.856 1.00 0.00 ? 69  GLY C C    1  
ATOM 6052   O O    . GLY C 1 65  ? 86.987  64.865  100.092 1.00 0.00 ? 69  GLY C O    1  
ATOM 6053   H H    . GLY C 1 65  ? 88.416  67.278  101.738 1.00 0.00 ? 69  GLY C H    1  
ATOM 6054   H HA2  . GLY C 1 65  ? 89.200  64.855  102.332 1.00 0.00 ? 69  GLY C HA2  1  
ATOM 6055   H HA3  . GLY C 1 65  ? 87.787  65.446  102.627 1.00 0.00 ? 69  GLY C HA3  1  
ATOM 6056   N N    . LYS C 1 66  ? 88.310  63.185  100.790 1.00 0.00 ? 70  LYS C N    1  
ATOM 6057   C CA   . LYS C 1 66  ? 87.733  62.211  99.880  1.00 0.00 ? 70  LYS C CA   1  
ATOM 6058   C C    . LYS C 1 66  ? 86.645  61.421  100.610 1.00 0.00 ? 70  LYS C C    1  
ATOM 6059   O O    . LYS C 1 66  ? 86.660  61.287  101.836 1.00 0.00 ? 70  LYS C O    1  
ATOM 6060   C CB   . LYS C 1 66  ? 88.832  61.292  99.331  1.00 0.00 ? 70  LYS C CB   1  
ATOM 6061   C CG   . LYS C 1 66  ? 90.109  61.988  98.863  1.00 0.00 ? 70  LYS C CG   1  
ATOM 6062   C CD   . LYS C 1 66  ? 90.638  61.399  97.566  1.00 0.00 ? 70  LYS C CD   1  
ATOM 6063   C CE   . LYS C 1 66  ? 91.706  62.286  96.947  1.00 0.00 ? 70  LYS C CE   1  
ATOM 6064   N NZ   . LYS C 1 66  ? 91.196  63.016  95.755  1.00 0.00 ? 70  LYS C NZ   1  
ATOM 6065   H H    . LYS C 1 66  ? 88.959  62.885  101.268 1.00 0.00 ? 70  LYS C H    1  
ATOM 6066   H HA   . LYS C 1 66  ? 87.324  62.661  99.125  1.00 0.00 ? 70  LYS C HA   1  
ATOM 6067   H HB2  . LYS C 1 66  ? 89.067  60.650  100.019 1.00 0.00 ? 70  LYS C HB2  1  
ATOM 6068   H HB3  . LYS C 1 66  ? 88.468  60.788  98.586  1.00 0.00 ? 70  LYS C HB3  1  
ATOM 6069   H HG2  . LYS C 1 66  ? 89.933  62.934  98.740  1.00 0.00 ? 70  LYS C HG2  1  
ATOM 6070   H HG3  . LYS C 1 66  ? 90.788  61.912  99.552  1.00 0.00 ? 70  LYS C HG3  1  
ATOM 6071   H HD2  . LYS C 1 66  ? 91.006  60.518  97.736  1.00 0.00 ? 70  LYS C HD2  1  
ATOM 6072   H HD3  . LYS C 1 66  ? 89.907  61.285  96.939  1.00 0.00 ? 70  LYS C HD3  1  
ATOM 6073   H HE2  . LYS C 1 66  ? 92.019  62.924  97.607  1.00 0.00 ? 70  LYS C HE2  1  
ATOM 6074   H HE3  . LYS C 1 66  ? 92.469  61.744  96.692  1.00 0.00 ? 70  LYS C HE3  1  
ATOM 6075   H HZ1  . LYS C 1 66  ? 90.798  63.768  96.015  1.00 0.00 ? 70  LYS C HZ1  1  
ATOM 6076   H HZ2  . LYS C 1 66  ? 91.875  63.212  95.214  1.00 0.00 ? 70  LYS C HZ2  1  
ATOM 6077   H HZ3  . LYS C 1 66  ? 90.610  62.505  95.322  1.00 0.00 ? 70  LYS C HZ3  1  
ATOM 6078   N N    . ARG C 1 67  ? 85.681  60.905  99.840  1.00 0.00 ? 71  ARG C N    1  
ATOM 6079   C CA   . ARG C 1 67  ? 84.500  60.264  100.411 1.00 0.00 ? 71  ARG C CA   1  
ATOM 6080   C C    . ARG C 1 67  ? 84.824  59.285  101.536 1.00 0.00 ? 71  ARG C C    1  
ATOM 6081   O O    . ARG C 1 67  ? 84.216  59.378  102.606 1.00 0.00 ? 71  ARG C O    1  
ATOM 6082   C CB   . ARG C 1 67  ? 83.723  59.543  99.311  1.00 0.00 ? 71  ARG C CB   1  
ATOM 6083   C CG   . ARG C 1 67  ? 84.599  58.737  98.368  1.00 0.00 ? 71  ARG C CG   1  
ATOM 6084   C CD   . ARG C 1 67  ? 84.422  59.186  96.932  1.00 0.00 ? 71  ARG C CD   1  
ATOM 6085   N NE   . ARG C 1 67  ? 85.618  59.851  96.423  1.00 0.00 ? 71  ARG C NE   1  
ATOM 6086   C CZ   . ARG C 1 67  ? 86.293  59.457  95.349  1.00 0.00 ? 71  ARG C CZ   1  
ATOM 6087   N NH1  . ARG C 1 67  ? 87.368  60.126  94.959  1.00 0.00 ? 71  ARG C NH1  1  
ATOM 6088   N NH2  . ARG C 1 67  ? 85.895  58.393  94.665  1.00 0.00 ? 71  ARG C NH2  1  
ATOM 6089   H H    . ARG C 1 67  ? 85.695  60.918  98.980  1.00 0.00 ? 71  ARG C H    1  
ATOM 6090   H HA   . ARG C 1 67  ? 83.963  60.970  100.803 1.00 0.00 ? 71  ARG C HA   1  
ATOM 6091   H HB2  . ARG C 1 67  ? 83.074  58.950  99.720  1.00 0.00 ? 71  ARG C HB2  1  
ATOM 6092   H HB3  . ARG C 1 67  ? 83.226  60.197  98.796  1.00 0.00 ? 71  ARG C HB3  1  
ATOM 6093   H HG2  . ARG C 1 67  ? 85.530  58.833  98.627  1.00 0.00 ? 71  ARG C HG2  1  
ATOM 6094   H HG3  . ARG C 1 67  ? 84.380  57.795  98.445  1.00 0.00 ? 71  ARG C HG3  1  
ATOM 6095   H HD2  . ARG C 1 67  ? 84.217  58.418  96.376  1.00 0.00 ? 71  ARG C HD2  1  
ATOM 6096   H HD3  . ARG C 1 67  ? 83.665  59.790  96.872  1.00 0.00 ? 71  ARG C HD3  1  
ATOM 6097   H HE   . ARG C 1 67  ? 85.904  60.543  96.845  1.00 0.00 ? 71  ARG C HE   1  
ATOM 6098   H HH11 . ARG C 1 67  ? 87.628  60.816  95.401  1.00 0.00 ? 71  ARG C HH11 1  
ATOM 6099   H HH12 . ARG C 1 67  ? 87.805  59.871  94.263  1.00 0.00 ? 71  ARG C HH12 1  
ATOM 6100   H HH21 . ARG C 1 67  ? 85.198  57.956  94.916  1.00 0.00 ? 71  ARG C HH21 1  
ATOM 6101   H HH22 . ARG C 1 67  ? 86.335  58.140  93.970  1.00 0.00 ? 71  ARG C HH22 1  
ATOM 6102   N N    . GLY C 1 68  ? 85.750  58.359  101.329 1.00 0.00 ? 72  GLY C N    1  
ATOM 6103   C CA   . GLY C 1 68  ? 86.170  57.437  102.370 1.00 0.00 ? 72  GLY C CA   1  
ATOM 6104   C C    . GLY C 1 68  ? 87.537  56.872  102.046 1.00 0.00 ? 72  GLY C C    1  
ATOM 6105   O O    . GLY C 1 68  ? 87.674  55.939  101.250 1.00 0.00 ? 72  GLY C O    1  
ATOM 6106   H H    . GLY C 1 68  ? 86.154  58.248  100.578 1.00 0.00 ? 72  GLY C H    1  
ATOM 6107   H HA2  . GLY C 1 68  ? 86.196  57.894  103.225 1.00 0.00 ? 72  GLY C HA2  1  
ATOM 6108   H HA3  . GLY C 1 68  ? 85.526  56.716  102.452 1.00 0.00 ? 72  GLY C HA3  1  
ATOM 6109   N N    . ASP C 1 69  ? 88.557  57.461  102.685 1.00 0.00 ? 73  ASP C N    1  
ATOM 6110   C CA   . ASP C 1 69  ? 89.938  56.961  102.714 1.00 0.00 ? 73  ASP C CA   1  
ATOM 6111   C C    . ASP C 1 69  ? 90.532  57.066  104.125 1.00 0.00 ? 73  ASP C C    1  
ATOM 6112   O O    . ASP C 1 69  ? 90.131  57.885  104.949 1.00 0.00 ? 73  ASP C O    1  
ATOM 6113   C CB   . ASP C 1 69  ? 90.801  57.679  101.669 1.00 0.00 ? 73  ASP C CB   1  
ATOM 6114   C CG   . ASP C 1 69  ? 90.926  56.899  100.374 1.00 0.00 ? 73  ASP C CG   1  
ATOM 6115   O OD1  . ASP C 1 69  ? 90.929  55.650  100.413 1.00 0.00 ? 73  ASP C OD1  1  
ATOM 6116   O OD2  . ASP C 1 69  ? 91.008  57.539  99.307  1.00 0.00 ? 73  ASP C OD2  1  
ATOM 6117   H H    . ASP C 1 69  ? 88.459  58.189  103.131 1.00 0.00 ? 73  ASP C H    1  
ATOM 6118   H HA   . ASP C 1 69  ? 89.927  56.019  102.480 1.00 0.00 ? 73  ASP C HA   1  
ATOM 6119   H HB2  . ASP C 1 69  ? 90.418  58.550  101.482 1.00 0.00 ? 73  ASP C HB2  1  
ATOM 6120   H HB3  . ASP C 1 69  ? 91.686  57.832  102.037 1.00 0.00 ? 73  ASP C HB3  1  
ATOM 6121   N N    . ALA C 1 70  ? 91.524  56.212  104.372 1.00 0.00 ? 74  ALA C N    1  
ATOM 6122   C CA   . ALA C 1 70  ? 91.925  55.746  105.699 1.00 0.00 ? 74  ALA C CA   1  
ATOM 6123   C C    . ALA C 1 70  ? 92.698  56.724  106.586 1.00 0.00 ? 74  ALA C C    1  
ATOM 6124   O O    . ALA C 1 70  ? 92.534  56.682  107.808 1.00 0.00 ? 74  ALA C O    1  
ATOM 6125   C CB   . ALA C 1 70  ? 92.765  54.473  105.555 1.00 0.00 ? 74  ALA C CB   1  
ATOM 6126   H H    . ALA C 1 70  ? 92.002  55.873  103.742 1.00 0.00 ? 74  ALA C H    1  
ATOM 6127   H HA   . ALA C 1 70  ? 91.081  55.609  106.156 1.00 0.00 ? 74  ALA C HA   1  
ATOM 6128   H HB1  . ALA C 1 70  ? 93.679  54.711  105.331 1.00 0.00 ? 74  ALA C HB1  1  
ATOM 6129   H HB2  . ALA C 1 70  ? 92.755  53.982  106.391 1.00 0.00 ? 74  ALA C HB2  1  
ATOM 6130   H HB3  . ALA C 1 70  ? 92.394  53.919  104.851 1.00 0.00 ? 74  ALA C HB3  1  
ATOM 6131   N N    . GLY C 1 71  ? 93.591  57.542  106.018 1.00 0.00 ? 75  GLY C N    1  
ATOM 6132   C CA   . GLY C 1 71  ? 94.155  58.651  106.775 1.00 0.00 ? 75  GLY C CA   1  
ATOM 6133   C C    . GLY C 1 71  ? 93.106  59.654  107.222 1.00 0.00 ? 75  GLY C C    1  
ATOM 6134   O O    . GLY C 1 71  ? 93.140  60.143  108.357 1.00 0.00 ? 75  GLY C O    1  
ATOM 6135   H H    . GLY C 1 71  ? 93.875  57.469  105.210 1.00 0.00 ? 75  GLY C H    1  
ATOM 6136   H HA2  . GLY C 1 71  ? 94.617  58.303  107.554 1.00 0.00 ? 75  GLY C HA2  1  
ATOM 6137   H HA3  . GLY C 1 71  ? 94.819  59.104  106.230 1.00 0.00 ? 75  GLY C HA3  1  
ATOM 6138   N N    . GLN C 1 72  ? 92.140  59.952  106.347 1.00 0.00 ? 76  GLN C N    1  
ATOM 6139   C CA   . GLN C 1 72  ? 90.995  60.751  106.764 1.00 0.00 ? 76  GLN C CA   1  
ATOM 6140   C C    . GLN C 1 72  ? 90.189  60.059  107.854 1.00 0.00 ? 76  GLN C C    1  
ATOM 6141   O O    . GLN C 1 72  ? 89.868  60.695  108.863 1.00 0.00 ? 76  GLN C O    1  
ATOM 6142   C CB   . GLN C 1 72  ? 90.092  61.075  105.572 1.00 0.00 ? 76  GLN C CB   1  
ATOM 6143   C CG   . GLN C 1 72  ? 88.681  61.500  105.936 1.00 0.00 ? 76  GLN C CG   1  
ATOM 6144   C CD   . GLN C 1 72  ? 87.678  60.376  105.807 1.00 0.00 ? 76  GLN C CD   1  
ATOM 6145   O OE1  . GLN C 1 72  ? 87.501  59.576  106.725 1.00 0.00 ? 76  GLN C OE1  1  
ATOM 6146   N NE2  . GLN C 1 72  ? 87.018  60.304  104.656 1.00 0.00 ? 76  GLN C NE2  1  
ATOM 6147   H H    . GLN C 1 72  ? 92.132  59.704  105.524 1.00 0.00 ? 76  GLN C H    1  
ATOM 6148   H HA   . GLN C 1 72  ? 91.345  61.579  107.129 1.00 0.00 ? 76  GLN C HA   1  
ATOM 6149   H HB2  . GLN C 1 72  ? 90.505  61.784  105.053 1.00 0.00 ? 76  GLN C HB2  1  
ATOM 6150   H HB3  . GLN C 1 72  ? 90.042  60.295  104.998 1.00 0.00 ? 76  GLN C HB3  1  
ATOM 6151   H HG2  . GLN C 1 72  ? 88.673  61.832  106.848 1.00 0.00 ? 76  GLN C HG2  1  
ATOM 6152   H HG3  . GLN C 1 72  ? 88.412  62.236  105.364 1.00 0.00 ? 76  GLN C HG3  1  
ATOM 6153   H HE21 . GLN C 1 72  ? 87.170  60.881  104.038 1.00 0.00 ? 76  GLN C HE21 1  
ATOM 6154   H HE22 . GLN C 1 72  ? 86.441  59.679  104.530 1.00 0.00 ? 76  GLN C HE22 1  
ATOM 6155   N N    . LYS C 1 73  ? 89.867  58.773  107.689 1.00 0.00 ? 77  LYS C N    1  
ATOM 6156   C CA   . LYS C 1 73  ? 89.261  58.031  108.782 1.00 0.00 ? 77  LYS C CA   1  
ATOM 6157   C C    . LYS C 1 73  ? 90.195  57.920  109.974 1.00 0.00 ? 77  LYS C C    1  
ATOM 6158   O O    . LYS C 1 73  ? 89.717  57.803  111.102 1.00 0.00 ? 77  LYS C O    1  
ATOM 6159   C CB   . LYS C 1 73  ? 88.841  56.632  108.331 1.00 0.00 ? 77  LYS C CB   1  
ATOM 6160   C CG   . LYS C 1 73  ? 87.667  56.609  107.380 1.00 0.00 ? 77  LYS C CG   1  
ATOM 6161   C CD   . LYS C 1 73  ? 87.190  55.191  107.161 1.00 0.00 ? 77  LYS C CD   1  
ATOM 6162   C CE   . LYS C 1 73  ? 88.057  54.492  106.147 1.00 0.00 ? 77  LYS C CE   1  
ATOM 6163   N NZ   . LYS C 1 73  ? 89.292  53.982  106.794 1.00 0.00 ? 77  LYS C NZ   1  
ATOM 6164   H H    . LYS C 1 73  ? 89.991  58.324  106.966 1.00 0.00 ? 77  LYS C H    1  
ATOM 6165   H HA   . LYS C 1 73  ? 88.474  58.527  109.055 1.00 0.00 ? 77  LYS C HA   1  
ATOM 6166   H HB2  . LYS C 1 73  ? 89.598  56.202  107.903 1.00 0.00 ? 77  LYS C HB2  1  
ATOM 6167   H HB3  . LYS C 1 73  ? 88.620  56.105  109.114 1.00 0.00 ? 77  LYS C HB3  1  
ATOM 6168   H HG2  . LYS C 1 73  ? 86.945  57.147  107.737 1.00 0.00 ? 77  LYS C HG2  1  
ATOM 6169   H HG3  . LYS C 1 73  ? 87.923  57.004  106.532 1.00 0.00 ? 77  LYS C HG3  1  
ATOM 6170   H HD2  . LYS C 1 73  ? 87.208  54.705  108.000 1.00 0.00 ? 77  LYS C HD2  1  
ATOM 6171   H HD3  . LYS C 1 73  ? 86.269  55.198  106.858 1.00 0.00 ? 77  LYS C HD3  1  
ATOM 6172   H HE2  . LYS C 1 73  ? 87.568  53.757  105.744 1.00 0.00 ? 77  LYS C HE2  1  
ATOM 6173   H HE3  . LYS C 1 73  ? 88.288  55.104  105.431 1.00 0.00 ? 77  LYS C HE3  1  
ATOM 6174   H HZ1  . LYS C 1 73  ? 89.159  53.146  107.069 1.00 0.00 ? 77  LYS C HZ1  1  
ATOM 6175   H HZ2  . LYS C 1 73  ? 89.963  53.998  106.210 1.00 0.00 ? 77  LYS C HZ2  1  
ATOM 6176   H HZ3  . LYS C 1 73  ? 89.495  54.496  107.492 1.00 0.00 ? 77  LYS C HZ3  1  
ATOM 6177   N N    . ALA C 1 74  ? 91.508  57.941  109.752 1.00 0.00 ? 78  ALA C N    1  
ATOM 6178   C CA   . ALA C 1 74  ? 92.432  58.084  110.867 1.00 0.00 ? 78  ALA C CA   1  
ATOM 6179   C C    . ALA C 1 74  ? 92.278  59.444  111.528 1.00 0.00 ? 78  ALA C C    1  
ATOM 6180   O O    . ALA C 1 74  ? 92.233  59.528  112.763 1.00 0.00 ? 78  ALA C O    1  
ATOM 6181   C CB   . ALA C 1 74  ? 93.872  57.878  110.400 1.00 0.00 ? 78  ALA C CB   1  
ATOM 6182   H H    . ALA C 1 74  ? 91.876  57.876  108.978 1.00 0.00 ? 78  ALA C H    1  
ATOM 6183   H HA   . ALA C 1 74  ? 92.220  57.403  111.524 1.00 0.00 ? 78  ALA C HA   1  
ATOM 6184   H HB1  . ALA C 1 74  ? 94.398  58.665  110.612 1.00 0.00 ? 78  ALA C HB1  1  
ATOM 6185   H HB2  . ALA C 1 74  ? 94.250  57.106  110.848 1.00 0.00 ? 78  ALA C HB2  1  
ATOM 6186   H HB3  . ALA C 1 74  ? 93.884  57.732  109.441 1.00 0.00 ? 78  ALA C HB3  1  
ATOM 6187   N N    . ILE C 1 75  ? 92.187  60.504  110.718 1.00 0.00 ? 79  ILE C N    1  
ATOM 6188   C CA   . ILE C 1 75  ? 91.882  61.834  111.242 1.00 0.00 ? 79  ILE C CA   1  
ATOM 6189   C C    . ILE C 1 75  ? 90.534  61.831  111.954 1.00 0.00 ? 79  ILE C C    1  
ATOM 6190   O O    . ILE C 1 75  ? 90.391  62.380  113.053 1.00 0.00 ? 79  ILE C O    1  
ATOM 6191   C CB   . ILE C 1 75  ? 91.922  62.870  110.102 1.00 0.00 ? 79  ILE C CB   1  
ATOM 6192   C CG1  . ILE C 1 75  ? 93.256  62.793  109.360 1.00 0.00 ? 79  ILE C CG1  1  
ATOM 6193   C CG2  . ILE C 1 75  ? 91.708  64.273  110.629 1.00 0.00 ? 79  ILE C CG2  1  
ATOM 6194   C CD1  . ILE C 1 75  ? 94.434  62.214  110.177 1.00 0.00 ? 79  ILE C CD1  1  
ATOM 6195   H H    . ILE C 1 75  ? 92.299  60.472  109.866 1.00 0.00 ? 79  ILE C H    1  
ATOM 6196   H HA   . ILE C 1 75  ? 92.554  62.082  111.896 1.00 0.00 ? 79  ILE C HA   1  
ATOM 6197   H HB   . ILE C 1 75  ? 91.203  62.662  109.486 1.00 0.00 ? 79  ILE C HB   1  
ATOM 6198   H HG12 . ILE C 1 75  ? 93.136  62.251  108.565 1.00 0.00 ? 79  ILE C HG12 1  
ATOM 6199   H HG13 . ILE C 1 75  ? 93.496  63.685  109.061 1.00 0.00 ? 79  ILE C HG13 1  
ATOM 6200   H HG21 . ILE C 1 75  ? 90.955  64.680  110.171 1.00 0.00 ? 79  ILE C HG21 1  
ATOM 6201   H HG22 . ILE C 1 75  ? 91.524  64.237  111.581 1.00 0.00 ? 79  ILE C HG22 1  
ATOM 6202   H HG23 . ILE C 1 75  ? 92.505  64.803  110.475 1.00 0.00 ? 79  ILE C HG23 1  
ATOM 6203   H HD11 . ILE C 1 75  ? 94.239  62.291  111.124 1.00 0.00 ? 79  ILE C HD11 1  
ATOM 6204   H HD12 . ILE C 1 75  ? 94.559  61.280  109.947 1.00 0.00 ? 79  ILE C HD12 1  
ATOM 6205   H HD13 . ILE C 1 75  ? 95.244  62.708  109.972 1.00 0.00 ? 79  ILE C HD13 1  
ATOM 6206   N N    . GLU C 1 76  ? 89.535  61.176  111.362 1.00 0.00 ? 80  GLU C N    1  
ATOM 6207   C CA   . GLU C 1 76  ? 88.204  61.160  111.954 1.00 0.00 ? 80  GLU C CA   1  
ATOM 6208   C C    . GLU C 1 76  ? 88.184  60.489  113.322 1.00 0.00 ? 80  GLU C C    1  
ATOM 6209   O O    . GLU C 1 76  ? 87.616  61.047  114.266 1.00 0.00 ? 80  GLU C O    1  
ATOM 6210   C CB   . GLU C 1 76  ? 87.224  60.467  111.012 1.00 0.00 ? 80  GLU C CB   1  
ATOM 6211   C CG   . GLU C 1 76  ? 86.713  61.368  109.906 1.00 0.00 ? 80  GLU C CG   1  
ATOM 6212   C CD   . GLU C 1 76  ? 85.439  62.083  110.288 1.00 0.00 ? 80  GLU C CD   1  
ATOM 6213   O OE1  . GLU C 1 76  ? 85.232  62.321  111.495 1.00 0.00 ? 80  GLU C OE1  1  
ATOM 6214   O OE2  . GLU C 1 76  ? 84.643  62.404  109.384 1.00 0.00 ? 80  GLU C OE2  1  
ATOM 6215   H H    . GLU C 1 76  ? 89.608  60.740  110.624 1.00 0.00 ? 80  GLU C H    1  
ATOM 6216   H HA   . GLU C 1 76  ? 87.934  62.082  112.087 1.00 0.00 ? 80  GLU C HA   1  
ATOM 6217   H HB2  . GLU C 1 76  ? 87.658  59.695  110.617 1.00 0.00 ? 80  GLU C HB2  1  
ATOM 6218   H HB3  . GLU C 1 76  ? 86.470  60.137  111.526 1.00 0.00 ? 80  GLU C HB3  1  
ATOM 6219   H HG2  . GLU C 1 76  ? 87.394  62.023  109.685 1.00 0.00 ? 80  GLU C HG2  1  
ATOM 6220   H HG3  . GLU C 1 76  ? 86.557  60.839  109.107 1.00 0.00 ? 80  GLU C HG3  1  
ATOM 6221   N N    . ASP C 1 77  ? 88.769  59.294  113.449 1.00 0.00 ? 81  ASP C N    1  
ATOM 6222   C CA   . ASP C 1 77  ? 88.975  58.721  114.777 1.00 0.00 ? 81  ASP C CA   1  
ATOM 6223   C C    . ASP C 1 77  ? 89.936  59.558  115.604 1.00 0.00 ? 81  ASP C C    1  
ATOM 6224   O O    . ASP C 1 77  ? 89.802  59.619  116.832 1.00 0.00 ? 81  ASP C O    1  
ATOM 6225   C CB   . ASP C 1 77  ? 89.490  57.285  114.685 1.00 0.00 ? 81  ASP C CB   1  
ATOM 6226   C CG   . ASP C 1 77  ? 88.570  56.384  113.895 1.00 0.00 ? 81  ASP C CG   1  
ATOM 6227   O OD1  . ASP C 1 77  ? 89.067  55.652  113.018 1.00 0.00 ? 81  ASP C OD1  1  
ATOM 6228   O OD2  . ASP C 1 77  ? 87.348  56.406  114.152 1.00 0.00 ? 81  ASP C OD2  1  
ATOM 6229   H H    . ASP C 1 77  ? 89.047  58.811  112.794 1.00 0.00 ? 81  ASP C H    1  
ATOM 6230   H HA   . ASP C 1 77  ? 88.112  58.717  115.219 1.00 0.00 ? 81  ASP C HA   1  
ATOM 6231   H HB2  . ASP C 1 77  ? 90.368  57.286  114.271 1.00 0.00 ? 81  ASP C HB2  1  
ATOM 6232   H HB3  . ASP C 1 77  ? 89.599  56.926  115.580 1.00 0.00 ? 81  ASP C HB3  1  
ATOM 6233   N N    . ALA C 1 78  ? 90.913  60.196  114.961 1.00 0.00 ? 82  ALA C N    1  
ATOM 6234   C CA   . ALA C 1 78  ? 91.783  61.094  115.708 1.00 0.00 ? 82  ALA C CA   1  
ATOM 6235   C C    . ALA C 1 78  ? 90.985  62.157  116.450 1.00 0.00 ? 82  ALA C C    1  
ATOM 6236   O O    . ALA C 1 78  ? 91.050  62.231  117.682 1.00 0.00 ? 82  ALA C O    1  
ATOM 6237   C CB   . ALA C 1 78  ? 92.798  61.743  114.772 1.00 0.00 ? 82  ALA C CB   1  
ATOM 6238   H H    . ALA C 1 78  ? 91.085  60.124  114.122 1.00 0.00 ? 82  ALA C H    1  
ATOM 6239   H HA   . ALA C 1 78  ? 92.256  60.567  116.370 1.00 0.00 ? 82  ALA C HA   1  
ATOM 6240   H HB1  . ALA C 1 78  ? 93.691  61.631  115.134 1.00 0.00 ? 82  ALA C HB1  1  
ATOM 6241   H HB2  . ALA C 1 78  ? 92.749  61.323  113.898 1.00 0.00 ? 82  ALA C HB2  1  
ATOM 6242   H HB3  . ALA C 1 78  ? 92.601  62.689  114.686 1.00 0.00 ? 82  ALA C HB3  1  
ATOM 6243   N N    . TYR C 1 79  ? 90.214  62.972  115.729 1.00 0.00 ? 83  TYR C N    1  
ATOM 6244   C CA   . TYR C 1 79  ? 89.516  64.081  116.367 1.00 0.00 ? 83  TYR C CA   1  
ATOM 6245   C C    . TYR C 1 79  ? 88.263  63.617  117.102 1.00 0.00 ? 83  TYR C C    1  
ATOM 6246   O O    . TYR C 1 79  ? 88.033  63.985  118.258 1.00 0.00 ? 83  TYR C O    1  
ATOM 6247   C CB   . TYR C 1 79  ? 89.144  65.137  115.327 1.00 0.00 ? 83  TYR C CB   1  
ATOM 6248   C CG   . TYR C 1 79  ? 88.507  66.357  115.937 1.00 0.00 ? 83  TYR C CG   1  
ATOM 6249   C CD1  . TYR C 1 79  ? 89.199  67.556  115.989 1.00 0.00 ? 83  TYR C CD1  1  
ATOM 6250   C CD2  . TYR C 1 79  ? 87.227  66.309  116.479 1.00 0.00 ? 83  TYR C CD2  1  
ATOM 6251   C CE1  . TYR C 1 79  ? 88.636  68.680  116.548 1.00 0.00 ? 83  TYR C CE1  1  
ATOM 6252   C CE2  . TYR C 1 79  ? 86.655  67.429  117.048 1.00 0.00 ? 83  TYR C CE2  1  
ATOM 6253   C CZ   . TYR C 1 79  ? 87.367  68.613  117.077 1.00 0.00 ? 83  TYR C CZ   1  
ATOM 6254   O OH   . TYR C 1 79  ? 86.820  69.742  117.636 1.00 0.00 ? 83  TYR C OH   1  
ATOM 6255   H H    . TYR C 1 79  ? 90.084  62.900  114.882 1.00 0.00 ? 83  TYR C H    1  
ATOM 6256   H HA   . TYR C 1 79  ? 90.118  64.466  117.023 1.00 0.00 ? 83  TYR C HA   1  
ATOM 6257   H HB2  . TYR C 1 79  ? 89.942  65.402  114.842 1.00 0.00 ? 83  TYR C HB2  1  
ATOM 6258   H HB3  . TYR C 1 79  ? 88.535  64.749  114.680 1.00 0.00 ? 83  TYR C HB3  1  
ATOM 6259   H HD1  . TYR C 1 79  ? 90.059  67.603  115.639 1.00 0.00 ? 83  TYR C HD1  1  
ATOM 6260   H HD2  . TYR C 1 79  ? 86.749  65.512  116.457 1.00 0.00 ? 83  TYR C HD2  1  
ATOM 6261   H HE1  . TYR C 1 79  ? 89.110  69.479  116.570 1.00 0.00 ? 83  TYR C HE1  1  
ATOM 6262   H HE2  . TYR C 1 79  ? 85.799  67.387  117.410 1.00 0.00 ? 83  TYR C HE2  1  
ATOM 6263   H HH   . TYR C 1 79  ? 87.173  69.883  118.385 1.00 0.00 ? 83  TYR C HH   1  
ATOM 6264   N N    . GLN C 1 80  ? 87.438  62.811  116.432 1.00 0.00 ? 84  GLN C N    1  
ATOM 6265   C CA   . GLN C 1 80  ? 86.089  62.527  116.913 1.00 0.00 ? 84  GLN C CA   1  
ATOM 6266   C C    . GLN C 1 80  ? 86.090  61.525  118.061 1.00 0.00 ? 84  GLN C C    1  
ATOM 6267   O O    . GLN C 1 80  ? 85.257  61.623  118.969 1.00 0.00 ? 84  GLN C O    1  
ATOM 6268   C CB   . GLN C 1 80  ? 85.230  62.026  115.756 1.00 0.00 ? 84  GLN C CB   1  
ATOM 6269   C CG   . GLN C 1 80  ? 84.478  63.106  115.015 1.00 0.00 ? 84  GLN C CG   1  
ATOM 6270   C CD   . GLN C 1 80  ? 82.988  62.844  114.988 1.00 0.00 ? 84  GLN C CD   1  
ATOM 6271   O OE1  . GLN C 1 80  ? 82.552  61.697  114.939 1.00 0.00 ? 84  GLN C OE1  1  
ATOM 6272   N NE2  . GLN C 1 80  ? 82.200  63.907  115.031 1.00 0.00 ? 84  GLN C NE2  1  
ATOM 6273   H H    . GLN C 1 80  ? 87.642  62.418  115.695 1.00 0.00 ? 84  GLN C H    1  
ATOM 6274   H HA   . GLN C 1 80  ? 85.714  63.351  117.261 1.00 0.00 ? 84  GLN C HA   1  
ATOM 6275   H HB2  . GLN C 1 80  ? 85.799  61.555  115.127 1.00 0.00 ? 84  GLN C HB2  1  
ATOM 6276   H HB3  . GLN C 1 80  ? 84.591  61.380  116.099 1.00 0.00 ? 84  GLN C HB3  1  
ATOM 6277   H HG2  . GLN C 1 80  ? 84.646  63.963  115.437 1.00 0.00 ? 84  GLN C HG2  1  
ATOM 6278   H HG3  . GLN C 1 80  ? 84.812  63.166  114.107 1.00 0.00 ? 84  GLN C HG3  1  
ATOM 6279   H HE21 . GLN C 1 80  ? 82.543  64.695  115.064 1.00 0.00 ? 84  GLN C HE21 1  
ATOM 6280   H HE22 . GLN C 1 80  ? 81.345  63.810  115.027 1.00 0.00 ? 84  GLN C HE22 1  
ATOM 6281   N N    . ASN C 1 81  ? 87.005  60.555  118.038 1.00 0.00 ? 85  ASN C N    1  
ATOM 6282   C CA   . ASN C 1 81  ? 87.162  59.676  119.192 1.00 0.00 ? 85  ASN C CA   1  
ATOM 6283   C C    . ASN C 1 81  ? 88.051  60.315  120.249 1.00 0.00 ? 85  ASN C C    1  
ATOM 6284   O O    . ASN C 1 81  ? 87.852  60.103  121.450 1.00 0.00 ? 85  ASN C O    1  
ATOM 6285   C CB   . ASN C 1 81  ? 87.733  58.329  118.754 1.00 0.00 ? 85  ASN C CB   1  
ATOM 6286   C CG   . ASN C 1 81  ? 87.997  57.403  119.920 1.00 0.00 ? 85  ASN C CG   1  
ATOM 6287   O OD1  . ASN C 1 81  ? 87.072  56.961  120.596 1.00 0.00 ? 85  ASN C OD1  1  
ATOM 6288   N ND2  . ASN C 1 81  ? 89.264  57.096  120.154 1.00 0.00 ? 85  ASN C ND2  1  
ATOM 6289   H H    . ASN C 1 81  ? 87.534  60.393  117.379 1.00 0.00 ? 85  ASN C H    1  
ATOM 6290   H HA   . ASN C 1 81  ? 86.287  59.531  119.585 1.00 0.00 ? 85  ASN C HA   1  
ATOM 6291   H HB2  . ASN C 1 81  ? 87.114  57.903  118.141 1.00 0.00 ? 85  ASN C HB2  1  
ATOM 6292   H HB3  . ASN C 1 81  ? 88.559  58.474  118.267 1.00 0.00 ? 85  ASN C HB3  1  
ATOM 6293   H HD21 . ASN C 1 81  ? 89.467  56.567  120.802 1.00 0.00 ? 85  ASN C HD21 1  
ATOM 6294   H HD22 . ASN C 1 81  ? 89.885  57.425  119.658 1.00 0.00 ? 85  ASN C HD22 1  
ATOM 6295   N N    . GLY C 1 82  ? 89.034  61.100  119.819 1.00 0.00 ? 86  GLY C N    1  
ATOM 6296   C CA   . GLY C 1 82  ? 89.931  61.788  120.726 1.00 0.00 ? 86  GLY C CA   1  
ATOM 6297   C C    . GLY C 1 82  ? 91.166  60.979  121.057 1.00 0.00 ? 86  GLY C C    1  
ATOM 6298   O O    . GLY C 1 82  ? 91.281  60.422  122.152 1.00 0.00 ? 86  GLY C O    1  
ATOM 6299   H H    . GLY C 1 82  ? 89.197  61.246  118.987 1.00 0.00 ? 86  GLY C H    1  
ATOM 6300   H HA2  . GLY C 1 82  ? 90.199  62.633  120.330 1.00 0.00 ? 86  GLY C HA2  1  
ATOM 6301   H HA3  . GLY C 1 82  ? 89.456  61.996  121.546 1.00 0.00 ? 86  GLY C HA3  1  
ATOM 6302   N N    . LYS C 1 83  ? 92.101  60.928  120.117 1.00 0.00 ? 87  LYS C N    1  
ATOM 6303   C CA   . LYS C 1 83  ? 93.364  60.204  120.246 1.00 0.00 ? 87  LYS C CA   1  
ATOM 6304   C C    . LYS C 1 83  ? 94.457  61.104  119.681 1.00 0.00 ? 87  LYS C C    1  
ATOM 6305   O O    . LYS C 1 83  ? 94.187  61.980  118.854 1.00 0.00 ? 87  LYS C O    1  
ATOM 6306   C CB   . LYS C 1 83  ? 93.319  58.851  119.509 1.00 0.00 ? 87  LYS C CB   1  
ATOM 6307   C CG   . LYS C 1 83  ? 93.004  58.878  118.022 1.00 0.00 ? 87  LYS C CG   1  
ATOM 6308   C CD   . LYS C 1 83  ? 94.041  58.090  117.242 1.00 0.00 ? 87  LYS C CD   1  
ATOM 6309   C CE   . LYS C 1 83  ? 93.604  56.658  117.021 1.00 0.00 ? 87  LYS C CE   1  
ATOM 6310   N NZ   . LYS C 1 83  ? 92.788  56.542  115.786 1.00 0.00 ? 87  LYS C NZ   1  
ATOM 6311   H H    . LYS C 1 83  ? 92.016  61.326  119.359 1.00 0.00 ? 87  LYS C H    1  
ATOM 6312   H HA   . LYS C 1 83  ? 93.540  59.998  121.177 1.00 0.00 ? 87  LYS C HA   1  
ATOM 6313   H HB2  . LYS C 1 83  ? 94.179  58.417  119.626 1.00 0.00 ? 87  LYS C HB2  1  
ATOM 6314   H HB3  . LYS C 1 83  ? 92.657  58.293  119.946 1.00 0.00 ? 87  LYS C HB3  1  
ATOM 6315   H HG2  . LYS C 1 83  ? 92.122  58.505  117.866 1.00 0.00 ? 87  LYS C HG2  1  
ATOM 6316   H HG3  . LYS C 1 83  ? 92.982  59.795  117.706 1.00 0.00 ? 87  LYS C HG3  1  
ATOM 6317   H HD2  . LYS C 1 83  ? 94.196  58.518  116.385 1.00 0.00 ? 87  LYS C HD2  1  
ATOM 6318   H HD3  . LYS C 1 83  ? 94.885  58.102  117.721 1.00 0.00 ? 87  LYS C HD3  1  
ATOM 6319   H HE2  . LYS C 1 83  ? 94.383  56.084  116.954 1.00 0.00 ? 87  LYS C HE2  1  
ATOM 6320   H HE3  . LYS C 1 83  ? 93.089  56.351  117.784 1.00 0.00 ? 87  LYS C HE3  1  
ATOM 6321   H HZ1  . LYS C 1 83  ? 92.110  55.984  115.930 1.00 0.00 ? 87  LYS C HZ1  1  
ATOM 6322   H HZ2  . LYS C 1 83  ? 92.470  57.343  115.563 1.00 0.00 ? 87  LYS C HZ2  1  
ATOM 6323   H HZ3  . LYS C 1 83  ? 93.293  56.230  115.124 1.00 0.00 ? 87  LYS C HZ3  1  
ATOM 6324   N N    . GLN C 1 84  ? 95.691  60.885  120.113 1.00 0.00 ? 88  GLN C N    1  
ATOM 6325   C CA   . GLN C 1 84  ? 96.868  61.483  119.500 1.00 0.00 ? 88  GLN C CA   1  
ATOM 6326   C C    . GLN C 1 84  ? 97.334  60.579  118.364 1.00 0.00 ? 88  GLN C C    1  
ATOM 6327   O O    . GLN C 1 84  ? 97.168  59.358  118.411 1.00 0.00 ? 88  GLN C O    1  
ATOM 6328   C CB   . GLN C 1 84  ? 97.974  61.699  120.534 1.00 0.00 ? 88  GLN C CB   1  
ATOM 6329   C CG   . GLN C 1 84  ? 98.657  60.417  120.949 1.00 0.00 ? 88  GLN C CG   1  
ATOM 6330   C CD   . GLN C 1 84  ? 100.159 60.473  120.788 1.00 0.00 ? 88  GLN C CD   1  
ATOM 6331   O OE1  . GLN C 1 84  ? 100.892 60.705  121.747 1.00 0.00 ? 88  GLN C OE1  1  
ATOM 6332   N NE2  . GLN C 1 84  ? 100.623 60.277  119.563 1.00 0.00 ? 88  GLN C NE2  1  
ATOM 6333   H H    . GLN C 1 84  ? 95.872  60.375  120.782 1.00 0.00 ? 88  GLN C H    1  
ATOM 6334   H HA   . GLN C 1 84  ? 96.645  62.356  119.143 1.00 0.00 ? 88  GLN C HA   1  
ATOM 6335   H HB2  . GLN C 1 84  ? 98.635  62.308  120.169 1.00 0.00 ? 88  GLN C HB2  1  
ATOM 6336   H HB3  . GLN C 1 84  ? 97.596  62.126  121.318 1.00 0.00 ? 88  GLN C HB3  1  
ATOM 6337   H HG2  . GLN C 1 84  ? 98.443  60.228  121.877 1.00 0.00 ? 88  GLN C HG2  1  
ATOM 6338   H HG3  . GLN C 1 84  ? 98.307  59.683  120.422 1.00 0.00 ? 88  GLN C HG3  1  
ATOM 6339   H HE21 . GLN C 1 84  ? 100.078 60.116  118.917 1.00 0.00 ? 88  GLN C HE21 1  
ATOM 6340   H HE22 . GLN C 1 84  ? 101.469 60.309  119.413 1.00 0.00 ? 88  GLN C HE22 1  
ATOM 6341   N N    . ILE C 1 85  ? 97.916  61.177  117.325 1.00 0.00 ? 89  ILE C N    1  
ATOM 6342   C CA   . ILE C 1 85  ? 98.410  60.400  116.195 1.00 0.00 ? 89  ILE C CA   1  
ATOM 6343   C C    . ILE C 1 85  ? 99.899  60.641  116.015 1.00 0.00 ? 89  ILE C C    1  
ATOM 6344   O O    . ILE C 1 85  ? 100.395 61.757  116.191 1.00 0.00 ? 89  ILE C O    1  
ATOM 6345   C CB   . ILE C 1 85  ? 97.666  60.723  114.884 1.00 0.00 ? 89  ILE C CB   1  
ATOM 6346   C CG1  . ILE C 1 85  ? 96.183  60.367  114.997 1.00 0.00 ? 89  ILE C CG1  1  
ATOM 6347   C CG2  . ILE C 1 85  ? 98.325  60.010  113.719 1.00 0.00 ? 89  ILE C CG2  1  
ATOM 6348   C CD1  . ILE C 1 85  ? 95.687  59.077  114.295 1.00 0.00 ? 89  ILE C CD1  1  
ATOM 6349   H H    . ILE C 1 85  ? 98.032  62.027  117.257 1.00 0.00 ? 89  ILE C H    1  
ATOM 6350   H HA   . ILE C 1 85  ? 98.246  59.465  116.396 1.00 0.00 ? 89  ILE C HA   1  
ATOM 6351   H HB   . ILE C 1 85  ? 97.721  61.677  114.719 1.00 0.00 ? 89  ILE C HB   1  
ATOM 6352   H HG12 . ILE C 1 85  ? 95.966  60.294  115.940 1.00 0.00 ? 89  ILE C HG12 1  
ATOM 6353   H HG13 . ILE C 1 85  ? 95.670  61.112  114.646 1.00 0.00 ? 89  ILE C HG13 1  
ATOM 6354   H HG21 . ILE C 1 85  ? 99.108  60.507  113.437 1.00 0.00 ? 89  ILE C HG21 1  
ATOM 6355   H HG22 . ILE C 1 85  ? 98.590  59.119  113.993 1.00 0.00 ? 89  ILE C HG22 1  
ATOM 6356   H HG23 . ILE C 1 85  ? 97.698  59.948  112.981 1.00 0.00 ? 89  ILE C HG23 1  
ATOM 6357   H HD11 . ILE C 1 85  ? 95.018  58.644  114.847 1.00 0.00 ? 89  ILE C HD11 1  
ATOM 6358   H HD12 . ILE C 1 85  ? 95.299  59.305  113.436 1.00 0.00 ? 89  ILE C HD12 1  
ATOM 6359   H HD13 . ILE C 1 85  ? 96.435  58.474  114.161 1.00 0.00 ? 89  ILE C HD13 1  
ATOM 6360   N N    . LYS C 1 86  ? 100.612 59.581  115.650 1.00 0.00 ? 90  LYS C N    1  
ATOM 6361   C CA   . LYS C 1 86  ? 102.038 59.668  115.371 1.00 0.00 ? 90  LYS C CA   1  
ATOM 6362   C C    . LYS C 1 86  ? 102.238 60.394  114.048 1.00 0.00 ? 90  LYS C C    1  
ATOM 6363   O O    . LYS C 1 86  ? 101.541 60.114  113.064 1.00 0.00 ? 90  LYS C O    1  
ATOM 6364   C CB   . LYS C 1 86  ? 102.687 58.286  115.362 1.00 0.00 ? 90  LYS C CB   1  
ATOM 6365   C CG   . LYS C 1 86  ? 102.535 57.572  116.694 1.00 0.00 ? 90  LYS C CG   1  
ATOM 6366   C CD   . LYS C 1 86  ? 102.984 56.125  116.647 1.00 0.00 ? 90  LYS C CD   1  
ATOM 6367   C CE   . LYS C 1 86  ? 101.863 55.206  116.249 1.00 0.00 ? 90  LYS C CE   1  
ATOM 6368   N NZ   . LYS C 1 86  ? 102.273 54.254  115.187 1.00 0.00 ? 90  LYS C NZ   1  
ATOM 6369   H H    . LYS C 1 86  ? 100.282 58.792  115.558 1.00 0.00 ? 90  LYS C H    1  
ATOM 6370   H HA   . LYS C 1 86  ? 102.473 60.172  116.076 1.00 0.00 ? 90  LYS C HA   1  
ATOM 6371   H HB2  . LYS C 1 86  ? 102.288 57.747  114.660 1.00 0.00 ? 90  LYS C HB2  1  
ATOM 6372   H HB3  . LYS C 1 86  ? 103.630 58.374  115.150 1.00 0.00 ? 90  LYS C HB3  1  
ATOM 6373   H HG2  . LYS C 1 86  ? 103.049 58.043  117.368 1.00 0.00 ? 90  LYS C HG2  1  
ATOM 6374   H HG3  . LYS C 1 86  ? 101.606 57.607  116.969 1.00 0.00 ? 90  LYS C HG3  1  
ATOM 6375   H HD2  . LYS C 1 86  ? 103.716 56.034  116.017 1.00 0.00 ? 90  LYS C HD2  1  
ATOM 6376   H HD3  . LYS C 1 86  ? 103.324 55.864  117.516 1.00 0.00 ? 90  LYS C HD3  1  
ATOM 6377   H HE2  . LYS C 1 86  ? 101.560 54.711  117.027 1.00 0.00 ? 90  LYS C HE2  1  
ATOM 6378   H HE3  . LYS C 1 86  ? 101.110 55.733  115.937 1.00 0.00 ? 90  LYS C HE3  1  
ATOM 6379   H HZ1  . LYS C 1 86  ? 102.853 54.650  114.640 1.00 0.00 ? 90  LYS C HZ1  1  
ATOM 6380   H HZ2  . LYS C 1 86  ? 102.657 53.542  115.559 1.00 0.00 ? 90  LYS C HZ2  1  
ATOM 6381   H HZ3  . LYS C 1 86  ? 101.558 53.997  114.725 1.00 0.00 ? 90  LYS C HZ3  1  
ATOM 6382   N N    . PHE C 1 87  ? 103.204 61.310  114.037 1.00 0.00 ? 91  PHE C N    1  
ATOM 6383   C CA   . PHE C 1 87  ? 103.379 62.314  112.995 1.00 0.00 ? 91  PHE C CA   1  
ATOM 6384   C C    . PHE C 1 87  ? 104.701 62.091  112.274 1.00 0.00 ? 91  PHE C C    1  
ATOM 6385   O O    . PHE C 1 87  ? 105.772 62.144  112.894 1.00 0.00 ? 91  PHE C O    1  
ATOM 6386   C CB   . PHE C 1 87  ? 103.330 63.714  113.603 1.00 0.00 ? 91  PHE C CB   1  
ATOM 6387   C CG   . PHE C 1 87  ? 103.099 64.801  112.605 1.00 0.00 ? 91  PHE C CG   1  
ATOM 6388   C CD1  . PHE C 1 87  ? 102.078 65.707  112.780 1.00 0.00 ? 91  PHE C CD1  1  
ATOM 6389   C CD2  . PHE C 1 87  ? 103.917 64.926  111.496 1.00 0.00 ? 91  PHE C CD2  1  
ATOM 6390   C CE1  . PHE C 1 87  ? 101.861 66.714  111.865 1.00 0.00 ? 91  PHE C CE1  1  
ATOM 6391   C CE2  . PHE C 1 87  ? 103.707 65.932  110.577 1.00 0.00 ? 91  PHE C CE2  1  
ATOM 6392   C CZ   . PHE C 1 87  ? 102.678 66.828  110.764 1.00 0.00 ? 91  PHE C CZ   1  
ATOM 6393   H H    . PHE C 1 87  ? 103.796 61.364  114.658 1.00 0.00 ? 91  PHE C H    1  
ATOM 6394   H HA   . PHE C 1 87  ? 102.658 62.231  112.352 1.00 0.00 ? 91  PHE C HA   1  
ATOM 6395   H HB2  . PHE C 1 87  ? 102.625 63.742  114.268 1.00 0.00 ? 91  PHE C HB2  1  
ATOM 6396   H HB3  . PHE C 1 87  ? 104.165 63.884  114.066 1.00 0.00 ? 91  PHE C HB3  1  
ATOM 6397   H HD1  . PHE C 1 87  ? 101.528 65.639  113.527 1.00 0.00 ? 91  PHE C HD1  1  
ATOM 6398   H HD2  . PHE C 1 87  ? 104.616 64.326  111.370 1.00 0.00 ? 91  PHE C HD2  1  
ATOM 6399   H HE1  . PHE C 1 87  ? 101.163 67.317  111.992 1.00 0.00 ? 91  PHE C HE1  1  
ATOM 6400   H HE2  . PHE C 1 87  ? 104.259 66.005  109.833 1.00 0.00 ? 91  PHE C HE2  1  
ATOM 6401   H HZ   . PHE C 1 87  ? 102.535 67.509  110.147 1.00 0.00 ? 91  PHE C HZ   1  
ATOM 6402   N N    . TRP C 1 88  ? 104.617 61.882  110.962 1.00 0.00 ? 92  TRP C N    1  
ATOM 6403   C CA   . TRP C 1 88  ? 105.764 61.632  110.097 1.00 0.00 ? 92  TRP C CA   1  
ATOM 6404   C C    . TRP C 1 88  ? 105.689 62.587  108.914 1.00 0.00 ? 92  TRP C C    1  
ATOM 6405   O O    . TRP C 1 88  ? 104.645 62.681  108.260 1.00 0.00 ? 92  TRP C O    1  
ATOM 6406   C CB   . TRP C 1 88  ? 105.760 60.189  109.589 1.00 0.00 ? 92  TRP C CB   1  
ATOM 6407   C CG   . TRP C 1 88  ? 105.472 59.121  110.602 1.00 0.00 ? 92  TRP C CG   1  
ATOM 6408   C CD1  . TRP C 1 88  ? 104.257 58.811  111.134 1.00 0.00 ? 92  TRP C CD1  1  
ATOM 6409   C CD2  . TRP C 1 88  ? 106.396 58.162  111.132 1.00 0.00 ? 92  TRP C CD2  1  
ATOM 6410   N NE1  . TRP C 1 88  ? 104.373 57.751  111.998 1.00 0.00 ? 92  TRP C NE1  1  
ATOM 6411   C CE2  . TRP C 1 88  ? 105.676 57.330  112.011 1.00 0.00 ? 92  TRP C CE2  1  
ATOM 6412   C CE3  . TRP C 1 88  ? 107.766 57.939  110.963 1.00 0.00 ? 92  TRP C CE3  1  
ATOM 6413   C CZ2  . TRP C 1 88  ? 106.277 56.294  112.720 1.00 0.00 ? 92  TRP C CZ2  1  
ATOM 6414   C CZ3  . TRP C 1 88  ? 108.361 56.910  111.669 1.00 0.00 ? 92  TRP C CZ3  1  
ATOM 6415   C CH2  . TRP C 1 88  ? 107.617 56.102  112.537 1.00 0.00 ? 92  TRP C CH2  1  
ATOM 6416   H H    . TRP C 1 88  ? 103.868 61.882  110.540 1.00 0.00 ? 92  TRP C H    1  
ATOM 6417   H HA   . TRP C 1 88  ? 106.582 61.774  110.600 1.00 0.00 ? 92  TRP C HA   1  
ATOM 6418   H HB2  . TRP C 1 88  ? 105.101 60.118  108.880 1.00 0.00 ? 92  TRP C HB2  1  
ATOM 6419   H HB3  . TRP C 1 88  ? 106.626 60.004  109.192 1.00 0.00 ? 92  TRP C HB3  1  
ATOM 6420   H HD1  . TRP C 1 88  ? 103.462 59.253  110.940 1.00 0.00 ? 92  TRP C HD1  1  
ATOM 6421   H HE1  . TRP C 1 88  ? 103.732 57.408  112.457 1.00 0.00 ? 92  TRP C HE1  1  
ATOM 6422   H HE3  . TRP C 1 88  ? 108.266 58.472  110.388 1.00 0.00 ? 92  TRP C HE3  1  
ATOM 6423   H HZ2  . TRP C 1 88  ? 105.785 55.754  113.295 1.00 0.00 ? 92  TRP C HZ2  1  
ATOM 6424   H HZ3  . TRP C 1 88  ? 109.272 56.753  111.565 1.00 0.00 ? 92  TRP C HZ3  1  
ATOM 6425   H HH2  . TRP C 1 88  ? 108.046 55.418  113.000 1.00 0.00 ? 92  TRP C HH2  1  
ATOM 6426   N N    . ARG C 1 89  ? 106.788 63.285  108.629 1.00 0.00 ? 93  ARG C N    1  
ATOM 6427   C CA   . ARG C 1 89  ? 106.892 64.108  107.421 1.00 0.00 ? 93  ARG C CA   1  
ATOM 6428   C C    . ARG C 1 89  ? 108.210 63.764  106.738 1.00 0.00 ? 93  ARG C C    1  
ATOM 6429   O O    . ARG C 1 89  ? 109.292 64.013  107.267 1.00 0.00 ? 93  ARG C O    1  
ATOM 6430   C CB   . ARG C 1 89  ? 106.808 65.594  107.742 1.00 0.00 ? 93  ARG C CB   1  
ATOM 6431   C CG   . ARG C 1 89  ? 107.897 66.032  108.700 1.00 0.00 ? 93  ARG C CG   1  
ATOM 6432   C CD   . ARG C 1 89  ? 107.983 67.520  108.871 1.00 0.00 ? 93  ARG C CD   1  
ATOM 6433   N NE   . ARG C 1 89  ? 108.573 68.118  107.683 1.00 0.00 ? 93  ARG C NE   1  
ATOM 6434   C CZ   . ARG C 1 89  ? 108.596 69.422  107.442 1.00 0.00 ? 93  ARG C CZ   1  
ATOM 6435   N NH1  . ARG C 1 89  ? 108.045 70.266  108.300 1.00 0.00 ? 93  ARG C NH1  1  
ATOM 6436   N NH2  . ARG C 1 89  ? 109.157 69.877  106.333 1.00 0.00 ? 93  ARG C NH2  1  
ATOM 6437   H H    . ARG C 1 89  ? 107.490 63.296  109.125 1.00 0.00 ? 93  ARG C H    1  
ATOM 6438   H HA   . ARG C 1 89  ? 106.147 63.917  106.830 1.00 0.00 ? 93  ARG C HA   1  
ATOM 6439   H HB2  . ARG C 1 89  ? 106.877 66.105  106.921 1.00 0.00 ? 93  ARG C HB2  1  
ATOM 6440   H HB3  . ARG C 1 89  ? 105.941 65.792  108.127 1.00 0.00 ? 93  ARG C HB3  1  
ATOM 6441   H HG2  . ARG C 1 89  ? 107.739 65.623  109.566 1.00 0.00 ? 93  ARG C HG2  1  
ATOM 6442   H HG3  . ARG C 1 89  ? 108.750 65.700  108.381 1.00 0.00 ? 93  ARG C HG3  1  
ATOM 6443   H HD2  . ARG C 1 89  ? 107.099 67.889  109.024 1.00 0.00 ? 93  ARG C HD2  1  
ATOM 6444   H HD3  . ARG C 1 89  ? 108.518 67.735  109.652 1.00 0.00 ? 93  ARG C HD3  1  
ATOM 6445   H HE   . ARG C 1 89  ? 108.929 67.593  107.101 1.00 0.00 ? 93  ARG C HE   1  
ATOM 6446   H HH11 . ARG C 1 89  ? 107.671 69.969  109.016 1.00 0.00 ? 93  ARG C HH11 1  
ATOM 6447   H HH12 . ARG C 1 89  ? 108.061 71.111  108.143 1.00 0.00 ? 93  ARG C HH12 1  
ATOM 6448   H HH21 . ARG C 1 89  ? 109.506 69.328  105.771 1.00 0.00 ? 93  ARG C HH21 1  
ATOM 6449   H HH22 . ARG C 1 89  ? 109.174 70.722  106.175 1.00 0.00 ? 93  ARG C HH22 1  
ATOM 6450   N N    . VAL C 1 90  ? 108.124 63.204  105.540 1.00 0.00 ? 94  VAL C N    1  
ATOM 6451   C CA   . VAL C 1 90  ? 109.311 62.707  104.868 1.00 0.00 ? 94  VAL C CA   1  
ATOM 6452   C C    . VAL C 1 90  ? 109.421 63.349  103.495 1.00 0.00 ? 94  VAL C C    1  
ATOM 6453   O O    . VAL C 1 90  ? 108.487 63.985  102.985 1.00 0.00 ? 94  VAL C O    1  
ATOM 6454   C CB   . VAL C 1 90  ? 109.315 61.171  104.751 1.00 0.00 ? 94  VAL C CB   1  
ATOM 6455   C CG1  . VAL C 1 90  ? 108.666 60.548  105.972 1.00 0.00 ? 94  VAL C CG1  1  
ATOM 6456   C CG2  . VAL C 1 90  ? 108.620 60.731  103.480 1.00 0.00 ? 94  VAL C CG2  1  
ATOM 6457   H H    . VAL C 1 90  ? 107.391 63.104  105.101 1.00 0.00 ? 94  VAL C H    1  
ATOM 6458   H HA   . VAL C 1 90  ? 110.083 62.948  105.406 1.00 0.00 ? 94  VAL C HA   1  
ATOM 6459   H HB   . VAL C 1 90  ? 110.235 60.866  104.708 1.00 0.00 ? 94  VAL C HB   1  
ATOM 6460   H HG11 . VAL C 1 90  ? 107.710 60.470  105.826 1.00 0.00 ? 94  VAL C HG11 1  
ATOM 6461   H HG12 . VAL C 1 90  ? 109.043 59.667  106.124 1.00 0.00 ? 94  VAL C HG12 1  
ATOM 6462   H HG13 . VAL C 1 90  ? 108.831 61.108  106.747 1.00 0.00 ? 94  VAL C HG13 1  
ATOM 6463   H HG21 . VAL C 1 90  ? 107.872 61.323  103.299 1.00 0.00 ? 94  VAL C HG21 1  
ATOM 6464   H HG22 . VAL C 1 90  ? 109.246 60.766  102.740 1.00 0.00 ? 94  VAL C HG22 1  
ATOM 6465   H HG23 . VAL C 1 90  ? 108.295 59.824  103.587 1.00 0.00 ? 94  VAL C HG23 1  
ATOM 6466   N N    . ASP C 1 91  ? 110.588 63.166  102.889 1.00 0.00 ? 95  ASP C N    1  
ATOM 6467   C CA   . ASP C 1 91  ? 110.852 63.698  101.565 1.00 0.00 ? 95  ASP C CA   1  
ATOM 6468   C C    . ASP C 1 91  ? 110.888 62.579  100.535 1.00 0.00 ? 95  ASP C C    1  
ATOM 6469   O O    . ASP C 1 91  ? 111.425 61.494  100.770 1.00 0.00 ? 95  ASP C O    1  
ATOM 6470   C CB   . ASP C 1 91  ? 112.159 64.492  101.543 1.00 0.00 ? 95  ASP C CB   1  
ATOM 6471   C CG   . ASP C 1 91  ? 112.024 65.798  100.794 1.00 0.00 ? 95  ASP C CG   1  
ATOM 6472   O OD1  . ASP C 1 91  ? 110.880 66.265  100.638 1.00 0.00 ? 95  ASP C OD1  1  
ATOM 6473   O OD2  . ASP C 1 91  ? 113.048 66.340  100.331 1.00 0.00 ? 95  ASP C OD2  1  
ATOM 6474   H H    . ASP C 1 91  ? 111.244 62.731  103.234 1.00 0.00 ? 95  ASP C H    1  
ATOM 6475   H HA   . ASP C 1 91  ? 110.129 64.303  101.337 1.00 0.00 ? 95  ASP C HA   1  
ATOM 6476   H HB2  . ASP C 1 91  ? 112.441 64.672  102.454 1.00 0.00 ? 95  ASP C HB2  1  
ATOM 6477   H HB3  . ASP C 1 91  ? 112.855 63.956  101.132 1.00 0.00 ? 95  ASP C HB3  1  
ATOM 6478   N N    . THR C 1 92  ? 110.287 62.862  99.380  1.00 0.00 ? 96  THR C N    1  
ATOM 6479   C CA   . THR C 1 92  ? 110.156 61.901  98.293  1.00 0.00 ? 96  THR C CA   1  
ATOM 6480   C C    . THR C 1 92  ? 111.489 61.589  97.622  1.00 0.00 ? 96  THR C C    1  
ATOM 6481   O O    . THR C 1 92  ? 111.683 60.469  97.144  1.00 0.00 ? 96  THR C O    1  
ATOM 6482   C CB   . THR C 1 92  ? 109.156 62.437  97.254  1.00 0.00 ? 96  THR C CB   1  
ATOM 6483   O OG1  . THR C 1 92  ? 109.605 63.719  96.798  1.00 0.00 ? 96  THR C OG1  1  
ATOM 6484   C CG2  . THR C 1 92  ? 107.758 62.635  97.836  1.00 0.00 ? 96  THR C CG2  1  
ATOM 6485   H H    . THR C 1 92  ? 109.940 63.629  99.206  1.00 0.00 ? 96  THR C H    1  
ATOM 6486   H HA   . THR C 1 92  ? 109.832 61.072  98.676  1.00 0.00 ? 96  THR C HA   1  
ATOM 6487   H HB   . THR C 1 92  ? 109.110 61.783  96.539  1.00 0.00 ? 96  THR C HB   1  
ATOM 6488   H HG1  . THR C 1 92  ? 109.714 64.229  97.456  1.00 0.00 ? 96  THR C HG1  1  
ATOM 6489   H HG21 . THR C 1 92  ? 107.425 63.159  97.091  1.00 0.00 ? 96  THR C HG21 1  
ATOM 6490   H HG22 . THR C 1 92  ? 107.422 61.786  98.165  1.00 0.00 ? 96  THR C HG22 1  
ATOM 6491   H HG23 . THR C 1 92  ? 107.799 63.271  98.566  1.00 0.00 ? 96  THR C HG23 1  
ATOM 6492   N N    . VAL C 1 93  ? 112.423 62.543  97.609  1.00 0.00 ? 97  VAL C N    1  
ATOM 6493   C CA   . VAL C 1 93  ? 113.743 62.292  97.046  1.00 0.00 ? 97  VAL C CA   1  
ATOM 6494   C C    . VAL C 1 93  ? 114.478 61.255  97.889  1.00 0.00 ? 97  VAL C C    1  
ATOM 6495   O O    . VAL C 1 93  ? 114.523 61.335  99.124  1.00 0.00 ? 97  VAL C O    1  
ATOM 6496   C CB   . VAL C 1 93  ? 114.550 63.599  96.944  1.00 0.00 ? 97  VAL C CB   1  
ATOM 6497   C CG1  . VAL C 1 93  ? 114.806 64.170  98.327  1.00 0.00 ? 97  VAL C CG1  1  
ATOM 6498   C CG2  . VAL C 1 93  ? 115.863 63.364  96.210  1.00 0.00 ? 97  VAL C CG2  1  
ATOM 6499   H H    . VAL C 1 93  ? 112.309 63.337  97.920  1.00 0.00 ? 97  VAL C H    1  
ATOM 6500   H HA   . VAL C 1 93  ? 113.641 61.940  96.148  1.00 0.00 ? 97  VAL C HA   1  
ATOM 6501   H HB   . VAL C 1 93  ? 114.031 64.242  96.436  1.00 0.00 ? 97  VAL C HB   1  
ATOM 6502   H HG11 . VAL C 1 93  ? 114.184 64.894  98.498  1.00 0.00 ? 97  VAL C HG11 1  
ATOM 6503   H HG12 . VAL C 1 93  ? 114.683 63.475  98.992  1.00 0.00 ? 97  VAL C HG12 1  
ATOM 6504   H HG13 . VAL C 1 93  ? 115.715 64.507  98.375  1.00 0.00 ? 97  VAL C HG13 1  
ATOM 6505   H HG21 . VAL C 1 93  ? 116.317 64.211  96.079  1.00 0.00 ? 97  VAL C HG21 1  
ATOM 6506   H HG22 . VAL C 1 93  ? 116.426 62.774  96.735  1.00 0.00 ? 97  VAL C HG22 1  
ATOM 6507   H HG23 . VAL C 1 93  ? 115.684 62.957  95.348  1.00 0.00 ? 97  VAL C HG23 1  
ATOM 6508   N N    . LYS C 1 94  ? 115.046 60.262  97.216  1.00 0.00 ? 98  LYS C N    1  
ATOM 6509   C CA   . LYS C 1 94  ? 115.678 59.136  97.888  1.00 0.00 ? 98  LYS C CA   1  
ATOM 6510   C C    . LYS C 1 94  ? 116.868 59.619  98.707  1.00 0.00 ? 98  LYS C C    1  
ATOM 6511   O O    . LYS C 1 94  ? 117.690 60.402  98.218  1.00 0.00 ? 98  LYS C O    1  
ATOM 6512   C CB   . LYS C 1 94  ? 116.112 58.081  96.872  1.00 0.00 ? 98  LYS C CB   1  
ATOM 6513   C CG   . LYS C 1 94  ? 116.926 56.944  97.463  1.00 0.00 ? 98  LYS C CG   1  
ATOM 6514   C CD   . LYS C 1 94  ? 116.427 55.591  96.994  1.00 0.00 ? 98  LYS C CD   1  
ATOM 6515   C CE   . LYS C 1 94  ? 115.433 55.001  97.983  1.00 0.00 ? 98  LYS C CE   1  
ATOM 6516   N NZ   . LYS C 1 94  ? 114.129 55.721  97.991  1.00 0.00 ? 98  LYS C NZ   1  
ATOM 6517   H H    . LYS C 1 94  ? 115.076 60.223  96.358  1.00 0.00 ? 98  LYS C H    1  
ATOM 6518   H HA   . LYS C 1 94  ? 115.035 58.727  98.488  1.00 0.00 ? 98  LYS C HA   1  
ATOM 6519   H HB2  . LYS C 1 94  ? 115.322 57.712  96.447  1.00 0.00 ? 98  LYS C HB2  1  
ATOM 6520   H HB3  . LYS C 1 94  ? 116.634 58.511  96.177  1.00 0.00 ? 98  LYS C HB3  1  
ATOM 6521   H HG2  . LYS C 1 94  ? 117.857 57.050  97.215  1.00 0.00 ? 98  LYS C HG2  1  
ATOM 6522   H HG3  . LYS C 1 94  ? 116.884 56.986  98.432  1.00 0.00 ? 98  LYS C HG3  1  
ATOM 6523   H HD2  . LYS C 1 94  ? 116.008 55.681  96.124  1.00 0.00 ? 98  LYS C HD2  1  
ATOM 6524   H HD3  . LYS C 1 94  ? 117.178 54.986  96.886  1.00 0.00 ? 98  LYS C HD3  1  
ATOM 6525   H HE2  . LYS C 1 94  ? 115.281 54.068  97.765  1.00 0.00 ? 98  LYS C HE2  1  
ATOM 6526   H HE3  . LYS C 1 94  ? 115.816 55.024  98.874  1.00 0.00 ? 98  LYS C HE3  1  
ATOM 6527   H HZ1  . LYS C 1 94  ? 113.732 55.626  97.200  1.00 0.00 ? 98  LYS C HZ1  1  
ATOM 6528   H HZ2  . LYS C 1 94  ? 113.607 55.382  98.627  1.00 0.00 ? 98  LYS C HZ2  1  
ATOM 6529   H HZ3  . LYS C 1 94  ? 114.268 56.586  98.150  1.00 0.00 ? 98  LYS C HZ3  1  
ATOM 6530   N N    . ASN C 1 95  ? 116.952 59.163  99.952  1.00 0.00 ? 99  ASN C N    1  
ATOM 6531   C CA   . ASN C 1 95  ? 118.122 59.406  100.778 1.00 0.00 ? 99  ASN C CA   1  
ATOM 6532   C C    . ASN C 1 95  ? 119.274 58.519  100.322 1.00 0.00 ? 99  ASN C C    1  
ATOM 6533   O O    . ASN C 1 95  ? 119.098 57.346  99.987  1.00 0.00 ? 99  ASN C O    1  
ATOM 6534   C CB   . ASN C 1 95  ? 117.802 59.162  102.251 1.00 0.00 ? 99  ASN C CB   1  
ATOM 6535   C CG   . ASN C 1 95  ? 118.478 60.162  103.162 1.00 0.00 ? 99  ASN C CG   1  
ATOM 6536   O OD1  . ASN C 1 95  ? 117.838 61.071  103.688 1.00 0.00 ? 99  ASN C OD1  1  
ATOM 6537   N ND2  . ASN C 1 95  ? 119.781 59.999  103.355 1.00 0.00 ? 99  ASN C ND2  1  
ATOM 6538   H H    . ASN C 1 95  ? 116.334 58.706  100.338 1.00 0.00 ? 99  ASN C H    1  
ATOM 6539   H HA   . ASN C 1 95  ? 118.385 60.334  100.679 1.00 0.00 ? 99  ASN C HA   1  
ATOM 6540   H HB2  . ASN C 1 95  ? 116.842 59.206  102.383 1.00 0.00 ? 99  ASN C HB2  1  
ATOM 6541   H HB3  . ASN C 1 95  ? 118.081 58.266  102.495 1.00 0.00 ? 99  ASN C HB3  1  
ATOM 6542   H HD21 . ASN C 1 95  ? 120.211 60.541  103.866 1.00 0.00 ? 99  ASN C HD21 1  
ATOM 6543   H HD22 . ASN C 1 95  ? 120.195 59.350  102.970 1.00 0.00 ? 99  ASN C HD22 1  
ATOM 6544   N N    . GLU C 1 96  ? 120.476 59.093  100.316 1.00 0.00 ? 100 GLU C N    1  
ATOM 6545   C CA   . GLU C 1 96  ? 121.655 58.382  99.844  1.00 0.00 ? 100 GLU C CA   1  
ATOM 6546   C C    . GLU C 1 96  ? 122.285 57.468  100.881 1.00 0.00 ? 100 GLU C C    1  
ATOM 6547   O O    . GLU C 1 96  ? 123.000 56.538  100.500 1.00 0.00 ? 100 GLU C O    1  
ATOM 6548   C CB   . GLU C 1 96  ? 122.704 59.379  99.332  1.00 0.00 ? 100 GLU C CB   1  
ATOM 6549   C CG   . GLU C 1 96  ? 122.835 59.392  97.812  1.00 0.00 ? 100 GLU C CG   1  
ATOM 6550   C CD   . GLU C 1 96  ? 121.680 60.073  97.105  1.00 0.00 ? 100 GLU C CD   1  
ATOM 6551   O OE1  . GLU C 1 96  ? 120.519 59.661  97.308  1.00 0.00 ? 100 GLU C OE1  1  
ATOM 6552   O OE2  . GLU C 1 96  ? 121.938 61.019  96.334  1.00 0.00 ? 100 GLU C OE2  1  
ATOM 6553   H H    . GLU C 1 96  ? 120.628 59.897  100.582 1.00 0.00 ? 100 GLU C H    1  
ATOM 6554   H HA   . GLU C 1 96  ? 121.347 57.809  99.124  1.00 0.00 ? 100 GLU C HA   1  
ATOM 6555   H HB2  . GLU C 1 96  ? 122.471 60.270  99.639  1.00 0.00 ? 100 GLU C HB2  1  
ATOM 6556   H HB3  . GLU C 1 96  ? 123.564 59.161  99.723  1.00 0.00 ? 100 GLU C HB3  1  
ATOM 6557   H HG2  . GLU C 1 96  ? 123.660 59.841  97.570  1.00 0.00 ? 100 GLU C HG2  1  
ATOM 6558   H HG3  . GLU C 1 96  ? 122.905 58.479  97.493  1.00 0.00 ? 100 GLU C HG3  1  
ATOM 6559   N N    . ASN C 1 97  ? 122.042 57.700  102.170 1.00 0.00 ? 101 ASN C N    1  
ATOM 6560   C CA   . ASN C 1 97  ? 122.429 56.714  103.173 1.00 0.00 ? 101 ASN C CA   1  
ATOM 6561   C C    . ASN C 1 97  ? 121.243 56.348  104.062 1.00 0.00 ? 101 ASN C C    1  
ATOM 6562   O O    . ASN C 1 97  ? 121.421 55.905  105.202 1.00 0.00 ? 101 ASN C O    1  
ATOM 6563   C CB   . ASN C 1 97  ? 123.629 57.225  103.982 1.00 0.00 ? 101 ASN C CB   1  
ATOM 6564   C CG   . ASN C 1 97  ? 124.953 57.045  103.264 1.00 0.00 ? 101 ASN C CG   1  
ATOM 6565   O OD1  . ASN C 1 97  ? 125.432 57.948  102.576 1.00 0.00 ? 101 ASN C OD1  1  
ATOM 6566   N ND2  . ASN C 1 97  ? 125.559 55.877  103.433 1.00 0.00 ? 101 ASN C ND2  1  
ATOM 6567   H H    . ASN C 1 97  ? 121.662 58.407  102.480 1.00 0.00 ? 101 ASN C H    1  
ATOM 6568   H HA   . ASN C 1 97  ? 122.705 55.899  102.726 1.00 0.00 ? 101 ASN C HA   1  
ATOM 6569   H HB2  . ASN C 1 97  ? 123.501 58.165  104.181 1.00 0.00 ? 101 ASN C HB2  1  
ATOM 6570   H HB3  . ASN C 1 97  ? 123.662 56.757  104.831 1.00 0.00 ? 101 ASN C HB3  1  
ATOM 6571   H HD21 . ASN C 1 97  ? 126.317 55.726  103.055 1.00 0.00 ? 101 ASN C HD21 1  
ATOM 6572   H HD22 . ASN C 1 97  ? 125.194 55.270  103.921 1.00 0.00 ? 101 ASN C HD22 1  
ATOM 6573   N N    . ASP C 1 98  ? 120.028 56.514  103.554 1.00 0.00 ? 102 ASP C N    1  
ATOM 6574   C CA   . ASP C 1 98  ? 118.841 55.970  104.189 1.00 0.00 ? 102 ASP C CA   1  
ATOM 6575   C C    . ASP C 1 98  ? 117.786 55.743  103.111 1.00 0.00 ? 102 ASP C C    1  
ATOM 6576   O O    . ASP C 1 98  ? 117.940 56.161  101.962 1.00 0.00 ? 102 ASP C O    1  
ATOM 6577   C CB   . ASP C 1 98  ? 118.334 56.903  105.289 1.00 0.00 ? 102 ASP C CB   1  
ATOM 6578   C CG   . ASP C 1 98  ? 117.282 56.258  106.170 1.00 0.00 ? 102 ASP C CG   1  
ATOM 6579   O OD1  . ASP C 1 98  ? 116.381 56.978  106.645 1.00 0.00 ? 102 ASP C OD1  1  
ATOM 6580   O OD2  . ASP C 1 98  ? 117.361 55.034  106.395 1.00 0.00 ? 102 ASP C OD2  1  
ATOM 6581   H H    . ASP C 1 98  ? 119.871 56.948  102.829 1.00 0.00 ? 102 ASP C H    1  
ATOM 6582   H HA   . ASP C 1 98  ? 119.048 55.125  104.618 1.00 0.00 ? 102 ASP C HA   1  
ATOM 6583   H HB2  . ASP C 1 98  ? 119.082 57.184  105.839 1.00 0.00 ? 102 ASP C HB2  1  
ATOM 6584   H HB3  . ASP C 1 98  ? 117.964 57.703  104.884 1.00 0.00 ? 102 ASP C HB3  1  
ATOM 6585   N N    . LYS C 1 99  ? 116.696 55.076  103.475 1.00 0.00 ? 103 LYS C N    1  
ATOM 6586   C CA   . LYS C 1 99  ? 115.554 54.951  102.584 1.00 0.00 ? 103 LYS C CA   1  
ATOM 6587   C C    . LYS C 1 99  ? 115.059 56.325  102.152 1.00 0.00 ? 103 LYS C C    1  
ATOM 6588   O O    . LYS C 1 99  ? 115.088 56.665  100.965 1.00 0.00 ? 103 LYS C O    1  
ATOM 6589   C CB   . LYS C 1 99  ? 114.435 54.177  103.282 1.00 0.00 ? 103 LYS C CB   1  
ATOM 6590   C CG   . LYS C 1 99  ? 114.780 52.733  103.580 1.00 0.00 ? 103 LYS C CG   1  
ATOM 6591   C CD   . LYS C 1 99  ? 114.945 52.520  105.070 1.00 0.00 ? 103 LYS C CD   1  
ATOM 6592   C CE   . LYS C 1 99  ? 116.395 52.291  105.441 1.00 0.00 ? 103 LYS C CE   1  
ATOM 6593   N NZ   . LYS C 1 99  ? 116.721 50.839  105.463 1.00 0.00 ? 103 LYS C NZ   1  
ATOM 6594   H H    . LYS C 1 99  ? 116.600 54.689  104.237 1.00 0.00 ? 103 LYS C H    1  
ATOM 6595   H HA   . LYS C 1 99  ? 115.828 54.464  101.792 1.00 0.00 ? 103 LYS C HA   1  
ATOM 6596   H HB2  . LYS C 1 99  ? 114.213 54.625  104.113 1.00 0.00 ? 103 LYS C HB2  1  
ATOM 6597   H HB3  . LYS C 1 99  ? 113.641 54.202  102.726 1.00 0.00 ? 103 LYS C HB3  1  
ATOM 6598   H HG2  . LYS C 1 99  ? 114.081 52.152  103.240 1.00 0.00 ? 103 LYS C HG2  1  
ATOM 6599   H HG3  . LYS C 1 99  ? 115.600 52.490  103.121 1.00 0.00 ? 103 LYS C HG3  1  
ATOM 6600   H HD2  . LYS C 1 99  ? 114.606 53.292  105.548 1.00 0.00 ? 103 LYS C HD2  1  
ATOM 6601   H HD3  . LYS C 1 99  ? 114.414 51.758  105.350 1.00 0.00 ? 103 LYS C HD3  1  
ATOM 6602   H HE2  . LYS C 1 99  ? 116.969 52.745  104.806 1.00 0.00 ? 103 LYS C HE2  1  
ATOM 6603   H HE3  . LYS C 1 99  ? 116.573 52.678  106.312 1.00 0.00 ? 103 LYS C HE3  1  
ATOM 6604   H HZ1  . LYS C 1 99  ? 116.263 50.422  104.823 1.00 0.00 ? 103 LYS C HZ1  1  
ATOM 6605   H HZ2  . LYS C 1 99  ? 117.593 50.728  105.322 1.00 0.00 ? 103 LYS C HZ2  1  
ATOM 6606   H HZ3  . LYS C 1 99  ? 116.503 50.497  106.254 1.00 0.00 ? 103 LYS C HZ3  1  
ATOM 6607   N N    . TYR C 1 100 ? 114.613 57.121  103.116 1.00 0.00 ? 104 TYR C N    1  
ATOM 6608   C CA   . TYR C 1 100 ? 114.125 58.467  102.891 1.00 0.00 ? 104 TYR C CA   1  
ATOM 6609   C C    . TYR C 1 100 ? 114.565 59.317  104.077 1.00 0.00 ? 104 TYR C C    1  
ATOM 6610   O O    . TYR C 1 100 ? 115.240 58.834  104.990 1.00 0.00 ? 104 TYR C O    1  
ATOM 6611   C CB   . TYR C 1 100 ? 112.601 58.465  102.722 1.00 0.00 ? 104 TYR C CB   1  
ATOM 6612   C CG   . TYR C 1 100 ? 112.163 58.176  101.302 1.00 0.00 ? 104 TYR C CG   1  
ATOM 6613   C CD1  . TYR C 1 100 ? 112.918 58.593  100.213 1.00 0.00 ? 104 TYR C CD1  1  
ATOM 6614   C CD2  . TYR C 1 100 ? 110.995 57.463  101.054 1.00 0.00 ? 104 TYR C CD2  1  
ATOM 6615   C CE1  . TYR C 1 100 ? 112.516 58.319  98.918  1.00 0.00 ? 104 TYR C CE1  1  
ATOM 6616   C CE2  . TYR C 1 100 ? 110.585 57.185  99.763  1.00 0.00 ? 104 TYR C CE2  1  
ATOM 6617   C CZ   . TYR C 1 100 ? 111.350 57.617  98.702  1.00 0.00 ? 104 TYR C CZ   1  
ATOM 6618   O OH   . TYR C 1 100 ? 110.947 57.344  97.417  1.00 0.00 ? 104 TYR C OH   1  
ATOM 6619   H H    . TYR C 1 100 ? 114.587 56.883  103.942 1.00 0.00 ? 104 TYR C H    1  
ATOM 6620   H HA   . TYR C 1 100 ? 114.491 58.838  102.073 1.00 0.00 ? 104 TYR C HA   1  
ATOM 6621   H HB2  . TYR C 1 100 ? 112.216 57.801  103.315 1.00 0.00 ? 104 TYR C HB2  1  
ATOM 6622   H HB3  . TYR C 1 100 ? 112.248 59.327  102.994 1.00 0.00 ? 104 TYR C HB3  1  
ATOM 6623   H HD1  . TYR C 1 100 ? 113.707 59.063  100.357 1.00 0.00 ? 104 TYR C HD1  1  
ATOM 6624   H HD2  . TYR C 1 100 ? 110.481 57.167  101.769 1.00 0.00 ? 104 TYR C HD2  1  
ATOM 6625   H HE1  . TYR C 1 100 ? 113.028 58.608  98.198  1.00 0.00 ? 104 TYR C HE1  1  
ATOM 6626   H HE2  . TYR C 1 100 ? 109.800 56.711  99.613  1.00 0.00 ? 104 TYR C HE2  1  
ATOM 6627   H HH   . TYR C 1 100 ? 110.273 57.808  97.229  1.00 0.00 ? 104 TYR C HH   1  
ATOM 6628   N N    . ASP C 1 101 ? 114.184 60.589  104.070 1.00 0.00 ? 105 ASP C N    1  
ATOM 6629   C CA   . ASP C 1 101 ? 114.510 61.477  105.177 1.00 0.00 ? 105 ASP C CA   1  
ATOM 6630   C C    . ASP C 1 101 ? 113.230 62.085  105.733 1.00 0.00 ? 105 ASP C C    1  
ATOM 6631   O O    . ASP C 1 101 ? 112.319 62.469  104.990 1.00 0.00 ? 105 ASP C O    1  
ATOM 6632   C CB   . ASP C 1 101 ? 115.519 62.552  104.758 1.00 0.00 ? 105 ASP C CB   1  
ATOM 6633   C CG   . ASP C 1 101 ? 115.123 63.252  103.484 1.00 0.00 ? 105 ASP C CG   1  
ATOM 6634   O OD1  . ASP C 1 101 ? 114.612 64.385  103.570 1.00 0.00 ? 105 ASP C OD1  1  
ATOM 6635   O OD2  . ASP C 1 101 ? 115.320 62.673  102.397 1.00 0.00 ? 105 ASP C OD2  1  
ATOM 6636   H H    . ASP C 1 101 ? 113.736 60.957  103.434 1.00 0.00 ? 105 ASP C H    1  
ATOM 6637   H HA   . ASP C 1 101 ? 114.937 60.961  105.880 1.00 0.00 ? 105 ASP C HA   1  
ATOM 6638   H HB2  . ASP C 1 101 ? 115.605 63.205  105.469 1.00 0.00 ? 105 ASP C HB2  1  
ATOM 6639   H HB3  . ASP C 1 101 ? 116.391 62.143  104.640 1.00 0.00 ? 105 ASP C HB3  1  
ATOM 6640   N N    . ALA C 1 102 ? 113.183 62.182  107.059 1.00 0.00 ? 106 ALA C N    1  
ATOM 6641   C CA   . ALA C 1 102 ? 111.926 62.405  107.751 1.00 0.00 ? 106 ALA C CA   1  
ATOM 6642   C C    . ALA C 1 102 ? 112.125 63.392  108.889 1.00 0.00 ? 106 ALA C C    1  
ATOM 6643   O O    . ALA C 1 102 ? 113.243 63.619  109.357 1.00 0.00 ? 106 ALA C O    1  
ATOM 6644   C CB   . ALA C 1 102 ? 111.366 61.087  108.301 1.00 0.00 ? 106 ALA C CB   1  
ATOM 6645   H H    . ALA C 1 102 ? 113.870 62.121  107.573 1.00 0.00 ? 106 ALA C H    1  
ATOM 6646   H HA   . ALA C 1 102 ? 111.290 62.770  107.117 1.00 0.00 ? 106 ALA C HA   1  
ATOM 6647   H HB1  . ALA C 1 102 ? 112.060 60.619  108.791 1.00 0.00 ? 106 ALA C HB1  1  
ATOM 6648   H HB2  . ALA C 1 102 ? 110.621 61.273  108.894 1.00 0.00 ? 106 ALA C HB2  1  
ATOM 6649   H HB3  . ALA C 1 102 ? 111.061 60.532  107.565 1.00 0.00 ? 106 ALA C HB3  1  
ATOM 6650   N N    . GLN C 1 103 ? 111.014 63.981  109.320 1.00 0.00 ? 107 GLN C N    1  
ATOM 6651   C CA   . GLN C 1 103 ? 110.882 64.560  110.648 1.00 0.00 ? 107 GLN C CA   1  
ATOM 6652   C C    . GLN C 1 103 ? 109.664 63.908  111.289 1.00 0.00 ? 107 GLN C C    1  
ATOM 6653   O O    . GLN C 1 103 ? 108.651 63.683  110.619 1.00 0.00 ? 107 GLN C O    1  
ATOM 6654   C CB   . GLN C 1 103 ? 110.747 66.083  110.592 1.00 0.00 ? 107 GLN C CB   1  
ATOM 6655   C CG   . GLN C 1 103 ? 110.229 66.703  111.893 1.00 0.00 ? 107 GLN C CG   1  
ATOM 6656   C CD   . GLN C 1 103 ? 110.183 68.225  111.860 1.00 0.00 ? 107 GLN C CD   1  
ATOM 6657   O OE1  . GLN C 1 103 ? 110.110 68.832  110.794 1.00 0.00 ? 107 GLN C OE1  1  
ATOM 6658   N NE2  . GLN C 1 103 ? 110.227 68.844  113.031 1.00 0.00 ? 107 GLN C NE2  1  
ATOM 6659   H H    . GLN C 1 103 ? 110.305 64.055  108.839 1.00 0.00 ? 107 GLN C H    1  
ATOM 6660   H HA   . GLN C 1 103 ? 111.677 64.392  111.177 1.00 0.00 ? 107 GLN C HA   1  
ATOM 6661   H HB2  . GLN C 1 103 ? 111.611 66.469  110.381 1.00 0.00 ? 107 GLN C HB2  1  
ATOM 6662   H HB3  . GLN C 1 103 ? 110.146 66.320  109.868 1.00 0.00 ? 107 GLN C HB3  1  
ATOM 6663   H HG2  . GLN C 1 103 ? 109.337 66.363  112.073 1.00 0.00 ? 107 GLN C HG2  1  
ATOM 6664   H HG3  . GLN C 1 103 ? 110.795 66.419  112.628 1.00 0.00 ? 107 GLN C HG3  1  
ATOM 6665   H HE21 . GLN C 1 103 ? 110.278 68.387  113.758 1.00 0.00 ? 107 GLN C HE21 1  
ATOM 6666   H HE22 . GLN C 1 103 ? 110.205 69.704  113.064 1.00 0.00 ? 107 GLN C HE22 1  
ATOM 6667   N N    . PHE C 1 104 ? 109.776 63.589  112.575 1.00 0.00 ? 108 PHE C N    1  
ATOM 6668   C CA   . PHE C 1 104 ? 108.878 62.666  113.252 1.00 0.00 ? 108 PHE C CA   1  
ATOM 6669   C C    . PHE C 1 104 ? 108.405 63.259  114.572 1.00 0.00 ? 108 PHE C C    1  
ATOM 6670   O O    . PHE C 1 104 ? 109.127 64.024  115.216 1.00 0.00 ? 108 PHE C O    1  
ATOM 6671   C CB   . PHE C 1 104 ? 109.596 61.319  113.486 1.00 0.00 ? 108 PHE C CB   1  
ATOM 6672   C CG   . PHE C 1 104 ? 108.795 60.319  114.269 1.00 0.00 ? 108 PHE C CG   1  
ATOM 6673   C CD1  . PHE C 1 104 ? 107.499 60.000  113.901 1.00 0.00 ? 108 PHE C CD1  1  
ATOM 6674   C CD2  . PHE C 1 104 ? 109.345 59.701  115.382 1.00 0.00 ? 108 PHE C CD2  1  
ATOM 6675   C CE1  . PHE C 1 104 ? 106.765 59.082  114.630 1.00 0.00 ? 108 PHE C CE1  1  
ATOM 6676   C CE2  . PHE C 1 104 ? 108.620 58.779  116.112 1.00 0.00 ? 108 PHE C CE2  1  
ATOM 6677   C CZ   . PHE C 1 104 ? 107.328 58.468  115.735 1.00 0.00 ? 108 PHE C CZ   1  
ATOM 6678   H H    . PHE C 1 104 ? 110.389 63.911  113.085 1.00 0.00 ? 108 PHE C H    1  
ATOM 6679   H HA   . PHE C 1 104 ? 108.099 62.514  112.695 1.00 0.00 ? 108 PHE C HA   1  
ATOM 6680   H HB2  . PHE C 1 104 ? 109.824 60.933  112.627 1.00 0.00 ? 108 PHE C HB2  1  
ATOM 6681   H HB3  . PHE C 1 104 ? 110.430 61.486  113.952 1.00 0.00 ? 108 PHE C HB3  1  
ATOM 6682   H HD1  . PHE C 1 104 ? 107.119 60.408  113.156 1.00 0.00 ? 108 PHE C HD1  1  
ATOM 6683   H HD2  . PHE C 1 104 ? 110.213 59.909  115.640 1.00 0.00 ? 108 PHE C HD2  1  
ATOM 6684   H HE1  . PHE C 1 104 ? 105.894 58.878  114.377 1.00 0.00 ? 108 PHE C HE1  1  
ATOM 6685   H HE2  . PHE C 1 104 ? 109.001 58.369  116.856 1.00 0.00 ? 108 PHE C HE2  1  
ATOM 6686   H HZ   . PHE C 1 104 ? 106.836 57.848  116.223 1.00 0.00 ? 108 PHE C HZ   1  
ATOM 6687   N N    . GLY C 1 105 ? 107.182 62.917  114.967 1.00 0.00 ? 109 GLY C N    1  
ATOM 6688   C CA   . GLY C 1 105 ? 106.737 63.275  116.299 1.00 0.00 ? 109 GLY C CA   1  
ATOM 6689   C C    . GLY C 1 105 ? 105.467 62.553  116.683 1.00 0.00 ? 109 GLY C C    1  
ATOM 6690   O O    . GLY C 1 105 ? 104.934 61.742  115.920 1.00 0.00 ? 109 GLY C O    1  
ATOM 6691   H H    . GLY C 1 105 ? 106.610 62.488  114.489 1.00 0.00 ? 109 GLY C H    1  
ATOM 6692   H HA2  . GLY C 1 105 ? 107.434 63.064  116.940 1.00 0.00 ? 109 GLY C HA2  1  
ATOM 6693   H HA3  . GLY C 1 105 ? 106.590 64.233  116.344 1.00 0.00 ? 109 GLY C HA3  1  
ATOM 6694   N N    . PHE C 1 106 ? 104.990 62.865  117.885 1.00 0.00 ? 110 PHE C N    1  
ATOM 6695   C CA   . PHE C 1 106 ? 103.653 62.479  118.319 1.00 0.00 ? 110 PHE C CA   1  
ATOM 6696   C C    . PHE C 1 106 ? 102.807 63.742  118.379 1.00 0.00 ? 110 PHE C C    1  
ATOM 6697   O O    . PHE C 1 106 ? 103.210 64.739  118.985 1.00 0.00 ? 110 PHE C O    1  
ATOM 6698   C CB   . PHE C 1 106 ? 103.695 61.783  119.676 1.00 0.00 ? 110 PHE C CB   1  
ATOM 6699   C CG   . PHE C 1 106 ? 104.101 60.345  119.605 1.00 0.00 ? 110 PHE C CG   1  
ATOM 6700   C CD1  . PHE C 1 106 ? 103.589 59.423  120.503 1.00 0.00 ? 110 PHE C CD1  1  
ATOM 6701   C CD2  . PHE C 1 106 ? 104.986 59.911  118.632 1.00 0.00 ? 110 PHE C CD2  1  
ATOM 6702   C CE1  . PHE C 1 106 ? 103.965 58.095  120.442 1.00 0.00 ? 110 PHE C CE1  1  
ATOM 6703   C CE2  . PHE C 1 106 ? 105.363 58.582  118.562 1.00 0.00 ? 110 PHE C CE2  1  
ATOM 6704   C CZ   . PHE C 1 106 ? 104.850 57.674  119.469 1.00 0.00 ? 110 PHE C CZ   1  
ATOM 6705   H H    . PHE C 1 106 ? 105.435 63.307  118.474 1.00 0.00 ? 110 PHE C H    1  
ATOM 6706   H HA   . PHE C 1 106 ? 103.267 61.845  117.694 1.00 0.00 ? 110 PHE C HA   1  
ATOM 6707   H HB2  . PHE C 1 106 ? 104.313 62.257  120.254 1.00 0.00 ? 110 PHE C HB2  1  
ATOM 6708   H HB3  . PHE C 1 106 ? 102.818 61.843  120.088 1.00 0.00 ? 110 PHE C HB3  1  
ATOM 6709   H HD1  . PHE C 1 106 ? 102.986 59.701  121.154 1.00 0.00 ? 110 PHE C HD1  1  
ATOM 6710   H HD2  . PHE C 1 106 ? 105.331 60.520  118.019 1.00 0.00 ? 110 PHE C HD2  1  
ATOM 6711   H HE1  . PHE C 1 106 ? 103.623 57.485  121.057 1.00 0.00 ? 110 PHE C HE1  1  
ATOM 6712   H HE2  . PHE C 1 106 ? 105.960 58.300  117.907 1.00 0.00 ? 110 PHE C HE2  1  
ATOM 6713   H HZ   . PHE C 1 106 ? 105.101 56.779  119.423 1.00 0.00 ? 110 PHE C HZ   1  
ATOM 6714   N N    . ALA C 1 107 ? 101.636 63.697  117.759 1.00 0.00 ? 111 ALA C N    1  
ATOM 6715   C CA   . ALA C 1 107 ? 100.826 64.884  117.548 1.00 0.00 ? 111 ALA C CA   1  
ATOM 6716   C C    . ALA C 1 107 ? 99.385  64.649  117.976 1.00 0.00 ? 111 ALA C C    1  
ATOM 6717   O O    . ALA C 1 107 ? 98.917  63.510  118.102 1.00 0.00 ? 111 ALA C O    1  
ATOM 6718   C CB   . ALA C 1 107 ? 100.870 65.321  116.082 1.00 0.00 ? 111 ALA C CB   1  
ATOM 6719   H H    . ALA C 1 107 ? 101.288 62.974  117.448 1.00 0.00 ? 111 ALA C H    1  
ATOM 6720   H HA   . ALA C 1 107 ? 101.198 65.592  118.097 1.00 0.00 ? 111 ALA C HA   1  
ATOM 6721   H HB1  . ALA C 1 107 ? 101.772 65.593  115.852 1.00 0.00 ? 111 ALA C HB1  1  
ATOM 6722   H HB2  . ALA C 1 107 ? 100.601 64.580  115.515 1.00 0.00 ? 111 ALA C HB2  1  
ATOM 6723   H HB3  . ALA C 1 107 ? 100.264 66.066  115.948 1.00 0.00 ? 111 ALA C HB3  1  
ATOM 6724   N N    . TYR C 1 108 ? 98.683  65.759  118.179 1.00 0.00 ? 112 TYR C N    1  
ATOM 6725   C CA   . TYR C 1 108 ? 97.326  65.757  118.712 1.00 0.00 ? 112 TYR C CA   1  
ATOM 6726   C C    . TYR C 1 108 ? 96.453  66.582  117.777 1.00 0.00 ? 112 TYR C C    1  
ATOM 6727   O O    . TYR C 1 108 ? 96.970  67.350  116.961 1.00 0.00 ? 112 TYR C O    1  
ATOM 6728   C CB   . TYR C 1 108 ? 97.307  66.325  120.129 1.00 0.00 ? 112 TYR C CB   1  
ATOM 6729   C CG   . TYR C 1 108 ? 96.309  65.661  121.032 1.00 0.00 ? 112 TYR C CG   1  
ATOM 6730   C CD1  . TYR C 1 108 ? 96.624  64.478  121.683 1.00 0.00 ? 112 TYR C CD1  1  
ATOM 6731   C CD2  . TYR C 1 108 ? 95.051  66.204  121.226 1.00 0.00 ? 112 TYR C CD2  1  
ATOM 6732   C CE1  . TYR C 1 108 ? 95.719  63.863  122.512 1.00 0.00 ? 112 TYR C CE1  1  
ATOM 6733   C CE2  . TYR C 1 108 ? 94.132  65.590  122.053 1.00 0.00 ? 112 TYR C CE2  1  
ATOM 6734   C CZ   . TYR C 1 108 ? 94.477  64.419  122.689 1.00 0.00 ? 112 TYR C CZ   1  
ATOM 6735   O OH   . TYR C 1 108 ? 93.581  63.788  123.508 1.00 0.00 ? 112 TYR C OH   1  
ATOM 6736   H H    . TYR C 1 108 ? 98.986  66.546  118.009 1.00 0.00 ? 112 TYR C H    1  
ATOM 6737   H HA   . TYR C 1 108 ? 96.985  64.851  118.762 1.00 0.00 ? 112 TYR C HA   1  
ATOM 6738   H HB2  . TYR C 1 108 ? 98.191  66.235  120.517 1.00 0.00 ? 112 TYR C HB2  1  
ATOM 6739   H HB3  . TYR C 1 108 ? 97.111  67.273  120.086 1.00 0.00 ? 112 TYR C HB3  1  
ATOM 6740   H HD1  . TYR C 1 108 ? 97.461  64.095  121.555 1.00 0.00 ? 112 TYR C HD1  1  
ATOM 6741   H HD2  . TYR C 1 108 ? 94.821  66.995  120.793 1.00 0.00 ? 112 TYR C HD2  1  
ATOM 6742   H HE1  . TYR C 1 108 ? 95.946  63.075  122.951 1.00 0.00 ? 112 TYR C HE1  1  
ATOM 6743   H HE2  . TYR C 1 108 ? 93.291  65.964  122.180 1.00 0.00 ? 112 TYR C HE2  1  
ATOM 6744   H HH   . TYR C 1 108 ? 92.801  63.912  123.219 1.00 0.00 ? 112 TYR C HH   1  
ATOM 6745   N N    . ILE C 1 109 ? 95.134  66.412  117.884 1.00 0.00 ? 113 ILE C N    1  
ATOM 6746   C CA   . ILE C 1 109 ? 94.202  67.159  117.047 1.00 0.00 ? 113 ILE C CA   1  
ATOM 6747   C C    . ILE C 1 109 ? 93.696  68.371  117.810 1.00 0.00 ? 113 ILE C C    1  
ATOM 6748   O O    . ILE C 1 109 ? 92.650  68.316  118.468 1.00 0.00 ? 113 ILE C O    1  
ATOM 6749   C CB   . ILE C 1 109 ? 93.030  66.266  116.612 1.00 0.00 ? 113 ILE C CB   1  
ATOM 6750   C CG1  . ILE C 1 109 ? 93.145  64.883  117.247 1.00 0.00 ? 113 ILE C CG1  1  
ATOM 6751   C CG2  . ILE C 1 109 ? 92.975  66.160  115.103 1.00 0.00 ? 113 ILE C CG2  1  
ATOM 6752   C CD1  . ILE C 1 109 ? 92.605  64.781  118.675 1.00 0.00 ? 113 ILE C CD1  1  
ATOM 6753   H H    . ILE C 1 109 ? 94.761  65.869  118.437 1.00 0.00 ? 113 ILE C H    1  
ATOM 6754   H HA   . ILE C 1 109 ? 94.661  67.457  116.246 1.00 0.00 ? 113 ILE C HA   1  
ATOM 6755   H HB   . ILE C 1 109 ? 92.205  66.673  116.918 1.00 0.00 ? 113 ILE C HB   1  
ATOM 6756   H HG12 . ILE C 1 109 ? 92.671  64.246  116.690 1.00 0.00 ? 113 ILE C HG12 1  
ATOM 6757   H HG13 . ILE C 1 109 ? 94.078  64.619  117.249 1.00 0.00 ? 113 ILE C HG13 1  
ATOM 6758   H HG21 . ILE C 1 109 ? 92.260  65.557  114.847 1.00 0.00 ? 113 ILE C HG21 1  
ATOM 6759   H HG22 . ILE C 1 109 ? 92.811  67.036  114.723 1.00 0.00 ? 113 ILE C HG22 1  
ATOM 6760   H HG23 . ILE C 1 109 ? 93.821  65.816  114.772 1.00 0.00 ? 113 ILE C HG23 1  
ATOM 6761   H HD11 . ILE C 1 109 ? 92.457  63.849  118.900 1.00 0.00 ? 113 ILE C HD11 1  
ATOM 6762   H HD12 . ILE C 1 109 ? 93.247  65.164  119.292 1.00 0.00 ? 113 ILE C HD12 1  
ATOM 6763   H HD13 . ILE C 1 109 ? 91.767  65.265  118.740 1.00 0.00 ? 113 ILE C HD13 1  
ATOM 6764   N N    . GLU C 1 110 ? 94.437  69.477  117.736 1.00 0.00 ? 114 GLU C N    1  
ATOM 6765   C CA   . GLU C 1 110 ? 94.002  70.700  118.395 1.00 0.00 ? 114 GLU C CA   1  
ATOM 6766   C C    . GLU C 1 110 ? 92.705  71.273  117.846 1.00 0.00 ? 114 GLU C C    1  
ATOM 6767   O O    . GLU C 1 110 ? 91.850  71.685  118.637 1.00 0.00 ? 114 GLU C O    1  
ATOM 6768   C CB   . GLU C 1 110 ? 95.100  71.776  118.331 1.00 0.00 ? 114 GLU C CB   1  
ATOM 6769   C CG   . GLU C 1 110 ? 95.379  72.423  119.676 1.00 0.00 ? 114 GLU C CG   1  
ATOM 6770   C CD   . GLU C 1 110 ? 96.659  73.232  119.728 1.00 0.00 ? 114 GLU C CD   1  
ATOM 6771   O OE1  . GLU C 1 110 ? 97.392  73.271  118.717 1.00 0.00 ? 114 GLU C OE1  1  
ATOM 6772   O OE2  . GLU C 1 110 ? 96.932  73.811  120.797 1.00 0.00 ? 114 GLU C OE2  1  
ATOM 6773   H H    . GLU C 1 110 ? 95.185  69.538  117.314 1.00 0.00 ? 114 GLU C H    1  
ATOM 6774   H HA   . GLU C 1 110 ? 93.830  70.447  119.315 1.00 0.00 ? 114 GLU C HA   1  
ATOM 6775   H HB2  . GLU C 1 110 ? 95.917  71.376  117.995 1.00 0.00 ? 114 GLU C HB2  1  
ATOM 6776   H HB3  . GLU C 1 110 ? 94.838  72.461  117.696 1.00 0.00 ? 114 GLU C HB3  1  
ATOM 6777   H HG2  . GLU C 1 110 ? 94.634  73.001  119.905 1.00 0.00 ? 114 GLU C HG2  1  
ATOM 6778   H HG3  . GLU C 1 110 ? 95.419  71.731  120.354 1.00 0.00 ? 114 GLU C HG3  1  
ATOM 6779   N N    . SER C 1 111 ? 92.522  71.305  116.530 1.00 0.00 ? 115 SER C N    1  
ATOM 6780   C CA   . SER C 1 111 ? 91.257  71.733  115.956 1.00 0.00 ? 115 SER C CA   1  
ATOM 6781   C C    . SER C 1 111 ? 91.121  71.147  114.562 1.00 0.00 ? 115 SER C C    1  
ATOM 6782   O O    . SER C 1 111 ? 92.116  70.774  113.935 1.00 0.00 ? 115 SER C O    1  
ATOM 6783   C CB   . SER C 1 111 ? 91.142  73.261  115.902 1.00 0.00 ? 115 SER C CB   1  
ATOM 6784   O OG   . SER C 1 111 ? 89.822  73.662  115.586 1.00 0.00 ? 115 SER C OG   1  
ATOM 6785   H H    . SER C 1 111 ? 93.121  71.082  115.953 1.00 0.00 ? 115 SER C H    1  
ATOM 6786   H HA   . SER C 1 111 ? 90.539  71.412  116.524 1.00 0.00 ? 115 SER C HA   1  
ATOM 6787   H HB2  . SER C 1 111 ? 91.402  73.638  116.757 1.00 0.00 ? 115 SER C HB2  1  
ATOM 6788   H HB3  . SER C 1 111 ? 91.757  73.611  115.239 1.00 0.00 ? 115 SER C HB3  1  
ATOM 6789   H HG   . SER C 1 111 ? 89.276  73.211  116.037 1.00 0.00 ? 115 SER C HG   1  
ATOM 6790   N N    . ARG C 1 112 ? 89.880  71.073  114.092 1.00 0.00 ? 116 ARG C N    1  
ATOM 6791   C CA   . ARG C 1 112 ? 89.540  70.607  112.749 1.00 0.00 ? 116 ARG C CA   1  
ATOM 6792   C C    . ARG C 1 112 ? 88.518  71.613  112.233 1.00 0.00 ? 116 ARG C C    1  
ATOM 6793   O O    . ARG C 1 112 ? 87.744  72.197  112.996 1.00 0.00 ? 116 ARG C O    1  
ATOM 6794   C CB   . ARG C 1 112 ? 89.023  69.168  112.781 1.00 0.00 ? 116 ARG C CB   1  
ATOM 6795   C CG   . ARG C 1 112 ? 89.766  68.141  111.932 1.00 0.00 ? 116 ARG C CG   1  
ATOM 6796   C CD   . ARG C 1 112 ? 88.775  67.222  111.255 1.00 0.00 ? 116 ARG C CD   1  
ATOM 6797   N NE   . ARG C 1 112 ? 87.995  66.503  112.254 1.00 0.00 ? 116 ARG C NE   1  
ATOM 6798   C CZ   . ARG C 1 112 ? 87.506  65.279  112.087 1.00 0.00 ? 116 ARG C CZ   1  
ATOM 6799   N NH1  . ARG C 1 112 ? 87.703  64.632  110.950 1.00 0.00 ? 116 ARG C NH1  1  
ATOM 6800   N NH2  . ARG C 1 112 ? 86.803  64.710  113.054 1.00 0.00 ? 116 ARG C NH2  1  
ATOM 6801   H H    . ARG C 1 112 ? 89.192  71.299  114.556 1.00 0.00 ? 116 ARG C H    1  
ATOM 6802   H HA   . ARG C 1 112 ? 90.307  70.570  112.155 1.00 0.00 ? 116 ARG C HA   1  
ATOM 6803   H HB2  . ARG C 1 112 ? 89.038  68.863  113.702 1.00 0.00 ? 116 ARG C HB2  1  
ATOM 6804   H HB3  . ARG C 1 112 ? 88.095  69.175  112.500 1.00 0.00 ? 116 ARG C HB3  1  
ATOM 6805   H HG2  . ARG C 1 112 ? 90.308  68.592  111.266 1.00 0.00 ? 116 ARG C HG2  1  
ATOM 6806   H HG3  . ARG C 1 112 ? 90.370  67.626  112.488 1.00 0.00 ? 116 ARG C HG3  1  
ATOM 6807   H HD2  . ARG C 1 112 ? 88.185  67.736  110.682 1.00 0.00 ? 116 ARG C HD2  1  
ATOM 6808   H HD3  . ARG C 1 112 ? 89.245  66.592  110.687 1.00 0.00 ? 116 ARG C HD3  1  
ATOM 6809   H HE   . ARG C 1 112 ? 87.839  66.897  113.002 1.00 0.00 ? 116 ARG C HE   1  
ATOM 6810   H HH11 . ARG C 1 112 ? 88.149  65.003  110.315 1.00 0.00 ? 116 ARG C HH11 1  
ATOM 6811   H HH12 . ARG C 1 112 ? 87.385  63.840  110.846 1.00 0.00 ? 116 ARG C HH12 1  
ATOM 6812   H HH21 . ARG C 1 112 ? 86.662  65.133  113.789 1.00 0.00 ? 116 ARG C HH21 1  
ATOM 6813   H HH22 . ARG C 1 112 ? 86.486  63.918  112.945 1.00 0.00 ? 116 ARG C HH22 1  
ATOM 6814   N N    . GLU C 1 113 ? 88.557  71.842  110.929 1.00 0.00 ? 117 GLU C N    1  
ATOM 6815   C CA   . GLU C 1 113 ? 87.699  72.799  110.249 1.00 0.00 ? 117 GLU C CA   1  
ATOM 6816   C C    . GLU C 1 113 ? 87.195  72.129  108.983 1.00 0.00 ? 117 GLU C C    1  
ATOM 6817   O O    . GLU C 1 113 ? 87.980  71.525  108.245 1.00 0.00 ? 117 GLU C O    1  
ATOM 6818   C CB   . GLU C 1 113 ? 88.465  74.077  109.918 1.00 0.00 ? 117 GLU C CB   1  
ATOM 6819   C CG   . GLU C 1 113 ? 87.584  75.227  109.463 1.00 0.00 ? 117 GLU C CG   1  
ATOM 6820   C CD   . GLU C 1 113 ? 87.270  75.171  107.978 1.00 0.00 ? 117 GLU C CD   1  
ATOM 6821   O OE1  . GLU C 1 113 ? 88.216  75.146  107.167 1.00 0.00 ? 117 GLU C OE1  1  
ATOM 6822   O OE2  . GLU C 1 113 ? 86.073  75.143  107.622 1.00 0.00 ? 117 GLU C OE2  1  
ATOM 6823   H H    . GLU C 1 113 ? 89.100  71.435  110.400 1.00 0.00 ? 117 GLU C H    1  
ATOM 6824   H HA   . GLU C 1 113 ? 86.956  73.055  110.818 1.00 0.00 ? 117 GLU C HA   1  
ATOM 6825   H HB2  . GLU C 1 113 ? 88.964  74.355  110.702 1.00 0.00 ? 117 GLU C HB2  1  
ATOM 6826   H HB3  . GLU C 1 113 ? 89.113  73.884  109.223 1.00 0.00 ? 117 GLU C HB3  1  
ATOM 6827   H HG2  . GLU C 1 113 ? 86.754  75.212  109.966 1.00 0.00 ? 117 GLU C HG2  1  
ATOM 6828   H HG3  . GLU C 1 113 ? 88.024  76.067  109.666 1.00 0.00 ? 117 GLU C HG3  1  
ATOM 6829   N N    . TYR C 1 114 ? 85.894  72.219  108.732 1.00 0.00 ? 118 TYR C N    1  
ATOM 6830   C CA   . TYR C 1 114 ? 85.323  71.671  107.514 1.00 0.00 ? 118 TYR C CA   1  
ATOM 6831   C C    . TYR C 1 114 ? 84.531  72.722  106.758 1.00 0.00 ? 118 TYR C C    1  
ATOM 6832   O O    . TYR C 1 114 ? 83.552  73.270  107.269 1.00 0.00 ? 118 TYR C O    1  
ATOM 6833   C CB   . TYR C 1 114 ? 84.449  70.440  107.780 1.00 0.00 ? 118 TYR C CB   1  
ATOM 6834   C CG   . TYR C 1 114 ? 84.610  69.717  109.080 1.00 0.00 ? 118 TYR C CG   1  
ATOM 6835   C CD1  . TYR C 1 114 ? 85.491  68.652  109.183 1.00 0.00 ? 118 TYR C CD1  1  
ATOM 6836   C CD2  . TYR C 1 114 ? 83.857  70.060  110.187 1.00 0.00 ? 118 TYR C CD2  1  
ATOM 6837   C CE1  . TYR C 1 114 ? 85.629  67.960  110.355 1.00 0.00 ? 118 TYR C CE1  1  
ATOM 6838   C CE2  . TYR C 1 114 ? 84.000  69.388  111.364 1.00 0.00 ? 118 TYR C CE2  1  
ATOM 6839   C CZ   . TYR C 1 114 ? 84.883  68.331  111.443 1.00 0.00 ? 118 TYR C CZ   1  
ATOM 6840   O OH   . TYR C 1 114 ? 85.025  67.642  112.623 1.00 0.00 ? 118 TYR C OH   1  
ATOM 6841   H H    . TYR C 1 114 ? 85.326  72.594  109.257 1.00 0.00 ? 118 TYR C H    1  
ATOM 6842   H HA   . TYR C 1 114 ? 86.070  71.385  106.964 1.00 0.00 ? 118 TYR C HA   1  
ATOM 6843   H HB2  . TYR C 1 114 ? 83.521  70.716  107.709 1.00 0.00 ? 118 TYR C HB2  1  
ATOM 6844   H HB3  . TYR C 1 114 ? 84.611  69.804  107.067 1.00 0.00 ? 118 TYR C HB3  1  
ATOM 6845   H HD1  . TYR C 1 114 ? 85.998  68.405  108.443 1.00 0.00 ? 118 TYR C HD1  1  
ATOM 6846   H HD2  . TYR C 1 114 ? 83.245  70.758  110.128 1.00 0.00 ? 118 TYR C HD2  1  
ATOM 6847   H HE1  . TYR C 1 114 ? 86.221  67.246  110.412 1.00 0.00 ? 118 TYR C HE1  1  
ATOM 6848   H HE2  . TYR C 1 114 ? 83.505  69.640  112.110 1.00 0.00 ? 118 TYR C HE2  1  
ATOM 6849   H HH   . TYR C 1 114 ? 85.466  66.939  112.487 1.00 0.00 ? 118 TYR C HH   1  
ATOM 6850   N N    . SER C 1 115 ? 84.977  72.996  105.540 1.00 0.00 ? 119 SER C N    1  
ATOM 6851   C CA   . SER C 1 115 ? 84.318  73.940  104.658 1.00 0.00 ? 119 SER C CA   1  
ATOM 6852   C C    . SER C 1 115 ? 83.645  73.192  103.520 1.00 0.00 ? 119 SER C C    1  
ATOM 6853   O O    . SER C 1 115 ? 84.261  72.327  102.878 1.00 0.00 ? 119 SER C O    1  
ATOM 6854   C CB   . SER C 1 115 ? 85.305  74.957  104.094 1.00 0.00 ? 119 SER C CB   1  
ATOM 6855   O OG   . SER C 1 115 ? 84.898  76.270  104.436 1.00 0.00 ? 119 SER C OG   1  
ATOM 6856   H H    . SER C 1 115 ? 85.679  72.633  105.201 1.00 0.00 ? 119 SER C H    1  
ATOM 6857   H HA   . SER C 1 115 ? 83.653  74.421  105.174 1.00 0.00 ? 119 SER C HA   1  
ATOM 6858   H HB2  . SER C 1 115 ? 86.193  74.785  104.443 1.00 0.00 ? 119 SER C HB2  1  
ATOM 6859   H HB3  . SER C 1 115 ? 85.357  74.868  103.129 1.00 0.00 ? 119 SER C HB3  1  
ATOM 6860   H HG   . SER C 1 115 ? 85.276  76.823  103.929 1.00 0.00 ? 119 SER C HG   1  
ATOM 6861   N N    . ASP C 1 116 ? 82.376  73.518  103.306 1.00 0.00 ? 120 ASP C N    1  
ATOM 6862   C CA   . ASP C 1 116 ? 81.605  73.132  102.134 1.00 0.00 ? 120 ASP C CA   1  
ATOM 6863   C C    . ASP C 1 116 ? 81.253  74.427  101.412 1.00 0.00 ? 120 ASP C C    1  
ATOM 6864   O O    . ASP C 1 116 ? 80.595  75.305  101.979 1.00 0.00 ? 120 ASP C O    1  
ATOM 6865   C CB   . ASP C 1 116 ? 80.351  72.361  102.534 1.00 0.00 ? 120 ASP C CB   1  
ATOM 6866   C CG   . ASP C 1 116 ? 79.532  71.896  101.341 1.00 0.00 ? 120 ASP C CG   1  
ATOM 6867   O OD1  . ASP C 1 116 ? 80.018  71.079  100.532 1.00 0.00 ? 120 ASP C OD1  1  
ATOM 6868   O OD2  . ASP C 1 116 ? 78.393  72.379  101.196 1.00 0.00 ? 120 ASP C OD2  1  
ATOM 6869   H H    . ASP C 1 116 ? 81.923  73.989  103.865 1.00 0.00 ? 120 ASP C H    1  
ATOM 6870   H HA   . ASP C 1 116 ? 82.113  72.541  101.556 1.00 0.00 ? 120 ASP C HA   1  
ATOM 6871   H HB2  . ASP C 1 116 ? 80.608  71.591  103.065 1.00 0.00 ? 120 ASP C HB2  1  
ATOM 6872   H HB3  . ASP C 1 116 ? 79.799  72.923  103.100 1.00 0.00 ? 120 ASP C HB3  1  
ATOM 6873   N N    . GLY C 1 117 ? 81.685  74.542  100.162 1.00 0.00 ? 121 GLY C N    1  
ATOM 6874   C CA   . GLY C 1 117 ? 81.330  75.674  99.328  1.00 0.00 ? 121 GLY C CA   1  
ATOM 6875   C C    . GLY C 1 117 ? 80.559  75.241  98.102  1.00 0.00 ? 121 GLY C C    1  
ATOM 6876   O O    . GLY C 1 117 ? 80.556  74.066  97.718  1.00 0.00 ? 121 GLY C O    1  
ATOM 6877   H H    . GLY C 1 117 ? 82.191  73.964  99.777  1.00 0.00 ? 121 GLY C H    1  
ATOM 6878   H HA2  . GLY C 1 117 ? 80.798  76.302  99.842  1.00 0.00 ? 121 GLY C HA2  1  
ATOM 6879   H HA3  . GLY C 1 117 ? 82.135  76.141  99.056  1.00 0.00 ? 121 GLY C HA3  1  
ATOM 6880   N N    . VAL C 1 118 ? 79.884  76.198  97.475  1.00 0.00 ? 122 VAL C N    1  
ATOM 6881   C CA   . VAL C 1 118 ? 79.151  75.959  96.238  1.00 0.00 ? 122 VAL C CA   1  
ATOM 6882   C C    . VAL C 1 118 ? 80.103  75.739  95.069  1.00 0.00 ? 122 VAL C C    1  
ATOM 6883   O O    . VAL C 1 118 ? 79.803  74.977  94.149  1.00 0.00 ? 122 VAL C O    1  
ATOM 6884   C CB   . VAL C 1 118 ? 78.159  77.104  95.947  1.00 0.00 ? 122 VAL C CB   1  
ATOM 6885   C CG1  . VAL C 1 118 ? 77.049  77.079  96.964  1.00 0.00 ? 122 VAL C CG1  1  
ATOM 6886   C CG2  . VAL C 1 118 ? 78.876  78.431  95.977  1.00 0.00 ? 122 VAL C CG2  1  
ATOM 6887   H H    . VAL C 1 118 ? 79.840  77.010  97.757  1.00 0.00 ? 122 VAL C H    1  
ATOM 6888   H HA   . VAL C 1 118 ? 78.633  75.147  96.352  1.00 0.00 ? 122 VAL C HA   1  
ATOM 6889   H HB   . VAL C 1 118 ? 77.778  76.983  95.063  1.00 0.00 ? 122 VAL C HB   1  
ATOM 6890   H HG11 . VAL C 1 118 ? 77.093  77.879  97.511  1.00 0.00 ? 122 VAL C HG11 1  
ATOM 6891   H HG12 . VAL C 1 118 ? 76.194  77.046  96.508  1.00 0.00 ? 122 VAL C HG12 1  
ATOM 6892   H HG13 . VAL C 1 118 ? 77.145  76.297  97.529  1.00 0.00 ? 122 VAL C HG13 1  
ATOM 6893   H HG21 . VAL C 1 118 ? 78.246  79.134  96.197  1.00 0.00 ? 122 VAL C HG21 1  
ATOM 6894   H HG22 . VAL C 1 118 ? 79.578  78.405  96.646  1.00 0.00 ? 122 VAL C HG22 1  
ATOM 6895   H HG23 . VAL C 1 118 ? 79.267  78.608  95.107  1.00 0.00 ? 122 VAL C HG23 1  
ATOM 6896   N N    . GLU C 1 119 ? 81.260  76.399  95.087  1.00 0.00 ? 123 GLU C N    1  
ATOM 6897   C CA   . GLU C 1 119 ? 82.314  76.074  94.138  1.00 0.00 ? 123 GLU C CA   1  
ATOM 6898   C C    . GLU C 1 119 ? 83.341  75.116  94.703  1.00 0.00 ? 123 GLU C C    1  
ATOM 6899   O O    . GLU C 1 119 ? 83.505  75.055  95.926  1.00 0.00 ? 123 GLU C O    1  
ATOM 6900   C CB   . GLU C 1 119 ? 83.030  77.334  93.646  1.00 0.00 ? 123 GLU C CB   1  
ATOM 6901   C CG   . GLU C 1 119 ? 82.451  77.920  92.372  1.00 0.00 ? 123 GLU C CG   1  
ATOM 6902   C CD   . GLU C 1 119 ? 82.032  76.847  91.387  1.00 0.00 ? 123 GLU C CD   1  
ATOM 6903   O OE1  . GLU C 1 119 ? 82.919  76.255  90.742  1.00 0.00 ? 123 GLU C OE1  1  
ATOM 6904   O OE2  . GLU C 1 119 ? 80.821  76.573  91.277  1.00 0.00 ? 123 GLU C OE2  1  
ATOM 6905   H H    . GLU C 1 119 ? 81.450  77.033  95.636  1.00 0.00 ? 123 GLU C H    1  
ATOM 6906   H HA   . GLU C 1 119 ? 81.869  75.636  93.394  1.00 0.00 ? 123 GLU C HA   1  
ATOM 6907   H HB2  . GLU C 1 119 ? 82.996  78.007  94.344  1.00 0.00 ? 123 GLU C HB2  1  
ATOM 6908   H HB3  . GLU C 1 119 ? 83.966  77.126  93.498  1.00 0.00 ? 123 GLU C HB3  1  
ATOM 6909   H HG2  . GLU C 1 119 ? 81.684  78.472  92.591  1.00 0.00 ? 123 GLU C HG2  1  
ATOM 6910   H HG3  . GLU C 1 119 ? 83.108  78.499  91.955  1.00 0.00 ? 123 GLU C HG3  1  
ATOM 6911   N N    . GLY C 1 120 ? 84.025  74.361  93.850  1.00 0.00 ? 124 GLY C N    1  
ATOM 6912   C CA   . GLY C 1 120 ? 85.202  73.639  94.281  1.00 0.00 ? 124 GLY C CA   1  
ATOM 6913   C C    . GLY C 1 120 ? 84.769  72.383  95.001  1.00 0.00 ? 124 GLY C C    1  
ATOM 6914   O O    . GLY C 1 120 ? 83.708  71.820  94.687  1.00 0.00 ? 124 GLY C O    1  
ATOM 6915   H H    . GLY C 1 120 ? 83.821  74.256  93.022  1.00 0.00 ? 124 GLY C H    1  
ATOM 6916   H HA2  . GLY C 1 120 ? 85.756  73.414  93.516  1.00 0.00 ? 124 GLY C HA2  1  
ATOM 6917   H HA3  . GLY C 1 120 ? 85.740  74.194  94.867  1.00 0.00 ? 124 GLY C HA3  1  
ATOM 6918   N N    . ALA C 1 121 ? 85.589  71.905  95.935  1.00 0.00 ? 125 ALA C N    1  
ATOM 6919   C CA   . ALA C 1 121 ? 85.292  70.672  96.648  1.00 0.00 ? 125 ALA C CA   1  
ATOM 6920   C C    . ALA C 1 121 ? 85.614  70.816  98.133  1.00 0.00 ? 125 ALA C C    1  
ATOM 6921   O O    . ALA C 1 121 ? 86.328  71.732  98.556  1.00 0.00 ? 125 ALA C O    1  
ATOM 6922   C CB   . ALA C 1 121 ? 86.068  69.501  96.049  1.00 0.00 ? 125 ALA C CB   1  
ATOM 6923   H H    . ALA C 1 121 ? 86.325  72.284  96.169  1.00 0.00 ? 125 ALA C H    1  
ATOM 6924   H HA   . ALA C 1 121 ? 84.343  70.493  96.555  1.00 0.00 ? 125 ALA C HA   1  
ATOM 6925   H HB1  . ALA C 1 121 ? 86.575  69.808  95.281  1.00 0.00 ? 125 ALA C HB1  1  
ATOM 6926   H HB2  . ALA C 1 121 ? 86.675  69.140  96.713  1.00 0.00 ? 125 ALA C HB2  1  
ATOM 6927   H HB3  . ALA C 1 121 ? 85.447  68.810  95.771  1.00 0.00 ? 125 ALA C HB3  1  
ATOM 6928   N N    . VAL C 1 122 ? 85.052  69.898  98.926  1.00 0.00 ? 126 VAL C N    1  
ATOM 6929   C CA   . VAL C 1 122 ? 85.103  70.003  100.378 1.00 0.00 ? 126 VAL C CA   1  
ATOM 6930   C C    . VAL C 1 122 ? 86.543  70.179  100.838 1.00 0.00 ? 126 VAL C C    1  
ATOM 6931   O O    . VAL C 1 122 ? 87.468  69.543  100.314 1.00 0.00 ? 126 VAL C O    1  
ATOM 6932   C CB   . VAL C 1 122 ? 84.444  68.773  101.026 1.00 0.00 ? 126 VAL C CB   1  
ATOM 6933   C CG1  . VAL C 1 122 ? 83.078  68.542  100.426 1.00 0.00 ? 126 VAL C CG1  1  
ATOM 6934   C CG2  . VAL C 1 122 ? 85.293  67.533  100.832 1.00 0.00 ? 126 VAL C CG2  1  
ATOM 6935   H H    . VAL C 1 122 ? 84.635  69.205  98.635  1.00 0.00 ? 126 VAL C H    1  
ATOM 6936   H HA   . VAL C 1 122 ? 84.603  70.785  100.661 1.00 0.00 ? 126 VAL C HA   1  
ATOM 6937   H HB   . VAL C 1 122 ? 84.360  68.946  101.977 1.00 0.00 ? 126 VAL C HB   1  
ATOM 6938   H HG11 . VAL C 1 122 ? 82.517  68.077  101.067 1.00 0.00 ? 126 VAL C HG11 1  
ATOM 6939   H HG12 . VAL C 1 122 ? 82.674  69.396  100.203 1.00 0.00 ? 126 VAL C HG12 1  
ATOM 6940   H HG13 . VAL C 1 122 ? 83.163  68.006  99.623  1.00 0.00 ? 126 VAL C HG13 1  
ATOM 6941   H HG21 . VAL C 1 122 ? 85.339  67.317  99.887  1.00 0.00 ? 126 VAL C HG21 1  
ATOM 6942   H HG22 . VAL C 1 122 ? 86.188  67.696  101.170 1.00 0.00 ? 126 VAL C HG22 1  
ATOM 6943   H HG23 . VAL C 1 122 ? 84.897  66.790  101.314 1.00 0.00 ? 126 VAL C HG23 1  
ATOM 6944   N N    . GLU C 1 123 ? 86.752  71.099  101.774 1.00 0.00 ? 127 GLU C N    1  
ATOM 6945   C CA   . GLU C 1 123 ? 88.106  71.406  102.225 1.00 0.00 ? 127 GLU C CA   1  
ATOM 6946   C C    . GLU C 1 123 ? 88.187  71.304  103.737 1.00 0.00 ? 127 GLU C C    1  
ATOM 6947   O O    . GLU C 1 123 ? 87.373  71.891  104.455 1.00 0.00 ? 127 GLU C O    1  
ATOM 6948   C CB   . GLU C 1 123 ? 88.565  72.781  101.716 1.00 0.00 ? 127 GLU C CB   1  
ATOM 6949   C CG   . GLU C 1 123 ? 90.041  72.943  101.384 1.00 0.00 ? 127 GLU C CG   1  
ATOM 6950   C CD   . GLU C 1 123 ? 90.901  73.030  102.628 1.00 0.00 ? 127 GLU C CD   1  
ATOM 6951   O OE1  . GLU C 1 123 ? 91.996  72.431  102.631 1.00 0.00 ? 127 GLU C OE1  1  
ATOM 6952   O OE2  . GLU C 1 123 ? 90.498  73.711  103.592 1.00 0.00 ? 127 GLU C OE2  1  
ATOM 6953   H H    . GLU C 1 123 ? 86.131  71.554  102.158 1.00 0.00 ? 127 GLU C H    1  
ATOM 6954   H HA   . GLU C 1 123 ? 88.714  70.752  101.849 1.00 0.00 ? 127 GLU C HA   1  
ATOM 6955   H HB2  . GLU C 1 123 ? 88.053  72.993  100.919 1.00 0.00 ? 127 GLU C HB2  1  
ATOM 6956   H HB3  . GLU C 1 123 ? 88.333  73.443  102.386 1.00 0.00 ? 127 GLU C HB3  1  
ATOM 6957   H HG2  . GLU C 1 123 ? 90.333  72.193  100.842 1.00 0.00 ? 127 GLU C HG2  1  
ATOM 6958   H HG3  . GLU C 1 123 ? 90.165  73.743  100.851 1.00 0.00 ? 127 GLU C HG3  1  
ATOM 6959   N N    . ILE C 1 124 ? 89.160  70.540  104.216 1.00 0.00 ? 128 ILE C N    1  
ATOM 6960   C CA   . ILE C 1 124 ? 89.351  70.328  105.641 1.00 0.00 ? 128 ILE C CA   1  
ATOM 6961   C C    . ILE C 1 124 ? 90.616  71.049  106.075 1.00 0.00 ? 128 ILE C C    1  
ATOM 6962   O O    . ILE C 1 124 ? 91.685  70.871  105.478 1.00 0.00 ? 128 ILE C O    1  
ATOM 6963   C CB   . ILE C 1 124 ? 89.418  68.834  105.983 1.00 0.00 ? 128 ILE C CB   1  
ATOM 6964   C CG1  . ILE C 1 124 ? 88.334  68.072  105.225 1.00 0.00 ? 128 ILE C CG1  1  
ATOM 6965   C CG2  . ILE C 1 124 ? 89.218  68.634  107.466 1.00 0.00 ? 128 ILE C CG2  1  
ATOM 6966   C CD1  . ILE C 1 124 ? 88.521  66.557  105.185 1.00 0.00 ? 128 ILE C CD1  1  
ATOM 6967   H H    . ILE C 1 124 ? 89.729  70.128  103.720 1.00 0.00 ? 128 ILE C H    1  
ATOM 6968   H HA   . ILE C 1 124 ? 88.591  70.689  106.122 1.00 0.00 ? 128 ILE C HA   1  
ATOM 6969   H HB   . ILE C 1 124 ? 90.290  68.497  105.723 1.00 0.00 ? 128 ILE C HB   1  
ATOM 6970   H HG12 . ILE C 1 124 ? 87.474  68.267  105.632 1.00 0.00 ? 128 ILE C HG12 1  
ATOM 6971   H HG13 . ILE C 1 124 ? 88.298  68.405  104.315 1.00 0.00 ? 128 ILE C HG13 1  
ATOM 6972   H HG21 . ILE C 1 124 ? 90.028  68.270  107.856 1.00 0.00 ? 128 ILE C HG21 1  
ATOM 6973   H HG22 . ILE C 1 124 ? 89.014  69.486  107.883 1.00 0.00 ? 128 ILE C HG22 1  
ATOM 6974   H HG23 . ILE C 1 124 ? 88.484  68.018  107.614 1.00 0.00 ? 128 ILE C HG23 1  
ATOM 6975   H HD11 . ILE C 1 124 ? 89.356  66.346  104.738 1.00 0.00 ? 128 ILE C HD11 1  
ATOM 6976   H HD12 . ILE C 1 124 ? 88.543  66.209  106.090 1.00 0.00 ? 128 ILE C HD12 1  
ATOM 6977   H HD13 . ILE C 1 124 ? 87.784  66.152  104.701 1.00 0.00 ? 128 ILE C HD13 1  
ATOM 6978   N N    . SER C 1 125 ? 90.481  71.884  107.097 1.00 0.00 ? 129 SER C N    1  
ATOM 6979   C CA   . SER C 1 125 ? 91.610  72.476  107.794 1.00 0.00 ? 129 SER C CA   1  
ATOM 6980   C C    . SER C 1 125 ? 91.715  71.821  109.162 1.00 0.00 ? 129 SER C C    1  
ATOM 6981   O O    . SER C 1 125 ? 90.804  71.948  109.982 1.00 0.00 ? 129 SER C O    1  
ATOM 6982   C CB   . SER C 1 125 ? 91.427  73.987  107.939 1.00 0.00 ? 129 SER C CB   1  
ATOM 6983   O OG   . SER C 1 125 ? 92.674  74.639  108.103 1.00 0.00 ? 129 SER C OG   1  
ATOM 6984   H H    . SER C 1 125 ? 89.717  72.125  107.410 1.00 0.00 ? 129 SER C H    1  
ATOM 6985   H HA   . SER C 1 125 ? 92.424  72.328  107.287 1.00 0.00 ? 129 SER C HA   1  
ATOM 6986   H HB2  . SER C 1 125 ? 90.977  74.338  107.156 1.00 0.00 ? 129 SER C HB2  1  
ATOM 6987   H HB3  . SER C 1 125 ? 90.858  74.175  108.702 1.00 0.00 ? 129 SER C HB3  1  
ATOM 6988   H HG   . SER C 1 125 ? 92.880  75.030  107.390 1.00 0.00 ? 129 SER C HG   1  
ATOM 6989   N N    . ILE C 1 126 ? 92.806  71.102  109.402 1.00 0.00 ? 130 ILE C N    1  
ATOM 6990   C CA   . ILE C 1 126 ? 93.045  70.477  110.693 1.00 0.00 ? 130 ILE C CA   1  
ATOM 6991   C C    . ILE C 1 126 ? 94.301  71.081  111.299 1.00 0.00 ? 130 ILE C C    1  
ATOM 6992   O O    . ILE C 1 126 ? 95.352  71.149  110.647 1.00 0.00 ? 130 ILE C O    1  
ATOM 6993   C CB   . ILE C 1 126 ? 93.162  68.939  110.596 1.00 0.00 ? 130 ILE C CB   1  
ATOM 6994   C CG1  . ILE C 1 126 ? 94.599  68.509  110.319 1.00 0.00 ? 130 ILE C CG1  1  
ATOM 6995   C CG2  . ILE C 1 126 ? 92.241  68.402  109.519 1.00 0.00 ? 130 ILE C CG2  1  
ATOM 6996   C CD1  . ILE C 1 126 ? 94.806  67.001  110.172 1.00 0.00 ? 130 ILE C CD1  1  
ATOM 6997   H H    . ILE C 1 126 ? 93.425  70.965  108.822 1.00 0.00 ? 130 ILE C H    1  
ATOM 6998   H HA   . ILE C 1 126 ? 92.280  70.650  111.266 1.00 0.00 ? 130 ILE C HA   1  
ATOM 6999   H HB   . ILE C 1 126 ? 92.896  68.568  111.452 1.00 0.00 ? 130 ILE C HB   1  
ATOM 7000   H HG12 . ILE C 1 126 ? 94.902  68.944  109.506 1.00 0.00 ? 130 ILE C HG12 1  
ATOM 7001   H HG13 . ILE C 1 126 ? 95.164  68.831  111.039 1.00 0.00 ? 130 ILE C HG13 1  
ATOM 7002   H HG21 . ILE C 1 126 ? 92.685  68.454  108.658 1.00 0.00 ? 130 ILE C HG21 1  
ATOM 7003   H HG22 . ILE C 1 126 ? 92.020  67.478  109.713 1.00 0.00 ? 130 ILE C HG22 1  
ATOM 7004   H HG23 . ILE C 1 126 ? 91.428  68.931  109.495 1.00 0.00 ? 130 ILE C HG23 1  
ATOM 7005   H HD11 . ILE C 1 126 ? 94.581  66.561  111.007 1.00 0.00 ? 130 ILE C HD11 1  
ATOM 7006   H HD12 . ILE C 1 126 ? 94.236  66.663  109.465 1.00 0.00 ? 130 ILE C HD12 1  
ATOM 7007   H HD13 . ILE C 1 126 ? 95.734  66.821  109.953 1.00 0.00 ? 130 ILE C HD13 1  
ATOM 7008   N N    . SER C 1 127 ? 94.182  71.531  112.544 1.00 0.00 ? 131 SER C N    1  
ATOM 7009   C CA   . SER C 1 127 ? 95.269  72.166  113.270 1.00 0.00 ? 131 SER C CA   1  
ATOM 7010   C C    . SER C 1 127 ? 95.654  71.313  114.468 1.00 0.00 ? 131 SER C C    1  
ATOM 7011   O O    . SER C 1 127 ? 94.790  70.759  115.158 1.00 0.00 ? 131 SER C O    1  
ATOM 7012   C CB   . SER C 1 127 ? 94.873  73.567  113.733 1.00 0.00 ? 131 SER C CB   1  
ATOM 7013   O OG   . SER C 1 127 ? 95.178  74.529  112.742 1.00 0.00 ? 131 SER C OG   1  
ATOM 7014   H H    . SER C 1 127 ? 93.453  71.473  112.997 1.00 0.00 ? 131 SER C H    1  
ATOM 7015   H HA   . SER C 1 127 ? 96.030  72.248  112.673 1.00 0.00 ? 131 SER C HA   1  
ATOM 7016   H HB2  . SER C 1 127 ? 93.924  73.590  113.931 1.00 0.00 ? 131 SER C HB2  1  
ATOM 7017   H HB3  . SER C 1 127 ? 95.340  73.784  114.555 1.00 0.00 ? 131 SER C HB3  1  
ATOM 7018   H HG   . SER C 1 127 ? 94.946  74.240  111.989 1.00 0.00 ? 131 SER C HG   1  
ATOM 7019   N N    . LEU C 1 128 ? 96.953  71.231  114.722 1.00 0.00 ? 132 LEU C N    1  
ATOM 7020   C CA   . LEU C 1 128 ? 97.509  70.345  115.730 1.00 0.00 ? 132 LEU C CA   1  
ATOM 7021   C C    . LEU C 1 128 ? 98.698  71.004  116.408 1.00 0.00 ? 132 LEU C C    1  
ATOM 7022   O O    . LEU C 1 128 ? 99.435  71.769  115.784 1.00 0.00 ? 132 LEU C O    1  
ATOM 7023   C CB   . LEU C 1 128 ? 97.958  69.017  115.116 1.00 0.00 ? 132 LEU C CB   1  
ATOM 7024   C CG   . LEU C 1 128 ? 98.817  68.997  113.855 1.00 0.00 ? 132 LEU C CG   1  
ATOM 7025   C CD1  . LEU C 1 128 ? 100.289 68.783  114.148 1.00 0.00 ? 132 LEU C CD1  1  
ATOM 7026   C CD2  . LEU C 1 128 ? 98.300  67.909  112.944 1.00 0.00 ? 132 LEU C CD2  1  
ATOM 7027   H H    . LEU C 1 128 ? 97.545  71.697  114.306 1.00 0.00 ? 132 LEU C H    1  
ATOM 7028   H HA   . LEU C 1 128 ? 96.812  70.168  116.382 1.00 0.00 ? 132 LEU C HA   1  
ATOM 7029   H HB2  . LEU C 1 128 ? 98.446  68.535  115.803 1.00 0.00 ? 132 LEU C HB2  1  
ATOM 7030   H HB3  . LEU C 1 128 ? 97.156  68.505  114.925 1.00 0.00 ? 132 LEU C HB3  1  
ATOM 7031   H HG   . LEU C 1 128 ? 98.750  69.865  113.427 1.00 0.00 ? 132 LEU C HG   1  
ATOM 7032   H HD11 . LEU C 1 128 ? 100.621 68.043  113.617 1.00 0.00 ? 132 LEU C HD11 1  
ATOM 7033   H HD12 . LEU C 1 128 ? 100.784 69.587  113.925 1.00 0.00 ? 132 LEU C HD12 1  
ATOM 7034   H HD13 . LEU C 1 128 ? 100.405 68.583  115.090 1.00 0.00 ? 132 LEU C HD13 1  
ATOM 7035   H HD21 . LEU C 1 128 ? 97.332  67.945  112.914 1.00 0.00 ? 132 LEU C HD21 1  
ATOM 7036   H HD22 . LEU C 1 128 ? 98.656  68.038  112.051 1.00 0.00 ? 132 LEU C HD22 1  
ATOM 7037   H HD23 . LEU C 1 128 ? 98.581  67.044  113.282 1.00 0.00 ? 132 LEU C HD23 1  
ATOM 7038   N N    . GLN C 1 129 ? 98.881  70.701  117.686 1.00 0.00 ? 133 GLN C N    1  
ATOM 7039   C CA   . GLN C 1 129 ? 100.105 71.031  118.397 1.00 0.00 ? 133 GLN C CA   1  
ATOM 7040   C C    . GLN C 1 129 ? 100.921 69.758  118.511 1.00 0.00 ? 133 GLN C C    1  
ATOM 7041   O O    . GLN C 1 129 ? 100.381 68.659  118.341 1.00 0.00 ? 133 GLN C O    1  
ATOM 7042   C CB   . GLN C 1 129 ? 99.813  71.600  119.781 1.00 0.00 ? 133 GLN C CB   1  
ATOM 7043   C CG   . GLN C 1 129 ? 100.329 72.988  119.976 1.00 0.00 ? 133 GLN C CG   1  
ATOM 7044   C CD   . GLN C 1 129 ? 101.242 73.073  121.158 1.00 0.00 ? 133 GLN C CD   1  
ATOM 7045   O OE1  . GLN C 1 129 ? 101.034 73.888  122.050 1.00 0.00 ? 133 GLN C OE1  1  
ATOM 7046   N NE2  . GLN C 1 129 ? 102.286 72.258  121.161 1.00 0.00 ? 133 GLN C NE2  1  
ATOM 7047   H H    . GLN C 1 129 ? 98.295  70.296  118.167 1.00 0.00 ? 133 GLN C H    1  
ATOM 7048   H HA   . GLN C 1 129 ? 100.594 71.714  117.911 1.00 0.00 ? 133 GLN C HA   1  
ATOM 7049   H HB2  . GLN C 1 129 ? 98.853  71.595  119.928 1.00 0.00 ? 133 GLN C HB2  1  
ATOM 7050   H HB3  . GLN C 1 129 ? 100.205 71.019  120.451 1.00 0.00 ? 133 GLN C HB3  1  
ATOM 7051   H HG2  . GLN C 1 129 ? 100.803 73.273  119.180 1.00 0.00 ? 133 GLN C HG2  1  
ATOM 7052   H HG3  . GLN C 1 129 ? 99.585  73.598  120.096 1.00 0.00 ? 133 GLN C HG3  1  
ATOM 7053   H HE21 . GLN C 1 129 ? 102.398 71.700  120.517 1.00 0.00 ? 133 GLN C HE21 1  
ATOM 7054   H HE22 . GLN C 1 129 ? 102.852 72.287  121.808 1.00 0.00 ? 133 GLN C HE22 1  
ATOM 7055   N N    . VAL C 1 130 ? 102.214 69.895  118.770 1.00 0.00 ? 134 VAL C N    1  
ATOM 7056   C CA   . VAL C 1 130 ? 103.061 68.733  118.996 1.00 0.00 ? 134 VAL C CA   1  
ATOM 7057   C C    . VAL C 1 130 ? 104.018 69.069  120.132 1.00 0.00 ? 134 VAL C C    1  
ATOM 7058   O O    . VAL C 1 130 ? 104.209 70.243  120.474 1.00 0.00 ? 134 VAL C O    1  
ATOM 7059   C CB   . VAL C 1 130 ? 103.780 68.291  117.701 1.00 0.00 ? 134 VAL C CB   1  
ATOM 7060   C CG1  . VAL C 1 130 ? 104.679 67.101  117.920 1.00 0.00 ? 134 VAL C CG1  1  
ATOM 7061   C CG2  . VAL C 1 130 ? 102.792 68.047  116.567 1.00 0.00 ? 134 VAL C CG2  1  
ATOM 7062   H H    . VAL C 1 130 ? 102.621 70.652  118.819 1.00 0.00 ? 134 VAL C H    1  
ATOM 7063   H HA   . VAL C 1 130 ? 102.525 67.967  119.253 1.00 0.00 ? 134 VAL C HA   1  
ATOM 7064   H HB   . VAL C 1 130 ? 104.355 69.026  117.437 1.00 0.00 ? 134 VAL C HB   1  
ATOM 7065   H HG11 . VAL C 1 130 ? 105.215 66.949  117.125 1.00 0.00 ? 134 VAL C HG11 1  
ATOM 7066   H HG12 . VAL C 1 130 ? 105.263 67.271  118.675 1.00 0.00 ? 134 VAL C HG12 1  
ATOM 7067   H HG13 . VAL C 1 130 ? 104.139 66.316  118.100 1.00 0.00 ? 134 VAL C HG13 1  
ATOM 7068   H HG21 . VAL C 1 130 ? 102.259 68.845  116.425 1.00 0.00 ? 134 VAL C HG21 1  
ATOM 7069   H HG22 . VAL C 1 130 ? 103.277 67.834  115.754 1.00 0.00 ? 134 VAL C HG22 1  
ATOM 7070   H HG23 . VAL C 1 130 ? 102.210 67.306  116.798 1.00 0.00 ? 134 VAL C HG23 1  
ATOM 7071   N N    . ILE C 1 131 ? 104.557 68.030  120.770 1.00 0.00 ? 135 ILE C N    1  
ATOM 7072   C CA   . ILE C 1 131 ? 105.376 68.228  121.963 1.00 0.00 ? 135 ILE C CA   1  
ATOM 7073   C C    . ILE C 1 131 ? 106.853 68.126  121.613 1.00 0.00 ? 135 ILE C C    1  
ATOM 7074   O O    . ILE C 1 131 ? 107.694 67.798  122.459 1.00 0.00 ? 135 ILE C O    1  
ATOM 7075   C CB   . ILE C 1 131 ? 104.992 67.214  123.052 1.00 0.00 ? 135 ILE C CB   1  
ATOM 7076   C CG1  . ILE C 1 131 ? 104.814 65.820  122.446 1.00 0.00 ? 135 ILE C CG1  1  
ATOM 7077   C CG2  . ILE C 1 131 ? 103.734 67.667  123.765 1.00 0.00 ? 135 ILE C CG2  1  
ATOM 7078   C CD1  . ILE C 1 131 ? 104.871 64.605  123.414 1.00 0.00 ? 135 ILE C CD1  1  
ATOM 7079   H H    . ILE C 1 131 ? 104.460 67.210  120.530 1.00 0.00 ? 135 ILE C H    1  
ATOM 7080   H HA   . ILE C 1 131 ? 105.211 69.118  122.311 1.00 0.00 ? 135 ILE C HA   1  
ATOM 7081   H HB   . ILE C 1 131 ? 105.708 67.166  123.704 1.00 0.00 ? 135 ILE C HB   1  
ATOM 7082   H HG12 . ILE C 1 131 ? 103.959 65.798  121.989 1.00 0.00 ? 135 ILE C HG12 1  
ATOM 7083   H HG13 . ILE C 1 131 ? 105.499 65.697  121.771 1.00 0.00 ? 135 ILE C HG13 1  
ATOM 7084   H HG21 . ILE C 1 131 ? 103.358 66.924  124.263 1.00 0.00 ? 135 ILE C HG21 1  
ATOM 7085   H HG22 . ILE C 1 131 ? 103.950 68.388  124.377 1.00 0.00 ? 135 ILE C HG22 1  
ATOM 7086   H HG23 . ILE C 1 131 ? 103.087 67.980  123.114 1.00 0.00 ? 135 ILE C HG23 1  
ATOM 7087   H HD11 . ILE C 1 131 ? 104.286 64.766  124.170 1.00 0.00 ? 135 ILE C HD11 1  
ATOM 7088   H HD12 . ILE C 1 131 ? 104.582 63.805  122.947 1.00 0.00 ? 135 ILE C HD12 1  
ATOM 7089   H HD13 . ILE C 1 131 ? 105.781 64.484  123.729 1.00 0.00 ? 135 ILE C HD13 1  
ATOM 7090   N N    . GLY C 1 132 ? 107.193 68.420  120.366 1.00 0.00 ? 136 GLY C N    1  
ATOM 7091   C CA   . GLY C 1 132 ? 108.575 68.395  119.948 1.00 0.00 ? 136 GLY C CA   1  
ATOM 7092   C C    . GLY C 1 132 ? 108.793 67.441  118.798 1.00 0.00 ? 136 GLY C C    1  
ATOM 7093   O O    . GLY C 1 132 ? 108.994 66.241  119.012 1.00 0.00 ? 136 GLY C O    1  
ATOM 7094   H H    . GLY C 1 132 ? 106.634 68.637  119.749 1.00 0.00 ? 136 GLY C H    1  
ATOM 7095   H HA2  . GLY C 1 132 ? 108.850 69.288  119.684 1.00 0.00 ? 136 GLY C HA2  1  
ATOM 7096   H HA3  . GLY C 1 132 ? 109.134 68.135  120.696 1.00 0.00 ? 136 GLY C HA3  1  
ATOM 7097   N N    . GLU C 1 133 ? 108.731 67.957  117.575 1.00 0.00 ? 137 GLU C N    1  
ATOM 7098   C CA   . GLU C 1 133 ? 109.050 67.158  116.405 1.00 0.00 ? 137 GLU C CA   1  
ATOM 7099   C C    . GLU C 1 133 ? 110.558 67.101  116.188 1.00 0.00 ? 137 GLU C C    1  
ATOM 7100   O O    . GLU C 1 133 ? 111.275 68.096  116.318 1.00 0.00 ? 137 GLU C O    1  
ATOM 7101   C CB   . GLU C 1 133 ? 108.358 67.719  115.168 1.00 0.00 ? 137 GLU C CB   1  
ATOM 7102   C CG   . GLU C 1 133 ? 106.931 67.272  115.011 1.00 0.00 ? 137 GLU C CG   1  
ATOM 7103   C CD   . GLU C 1 133 ? 106.302 67.811  113.743 1.00 0.00 ? 137 GLU C CD   1  
ATOM 7104   O OE1  . GLU C 1 133 ? 106.568 67.246  112.660 1.00 0.00 ? 137 GLU C OE1  1  
ATOM 7105   O OE2  . GLU C 1 133 ? 105.551 68.800  113.821 1.00 0.00 ? 137 GLU C OE2  1  
ATOM 7106   H H    . GLU C 1 133 ? 108.504 68.769  117.404 1.00 0.00 ? 137 GLU C H    1  
ATOM 7107   H HA   . GLU C 1 133 ? 108.728 66.255  116.557 1.00 0.00 ? 137 GLU C HA   1  
ATOM 7108   H HB2  . GLU C 1 133 ? 108.381 68.688  115.207 1.00 0.00 ? 137 GLU C HB2  1  
ATOM 7109   H HB3  . GLU C 1 133 ? 108.859 67.456  114.380 1.00 0.00 ? 137 GLU C HB3  1  
ATOM 7110   H HG2  . GLU C 1 133 ? 106.896 66.302  115.000 1.00 0.00 ? 137 GLU C HG2  1  
ATOM 7111   H HG3  . GLU C 1 133 ? 106.415 67.566  115.777 1.00 0.00 ? 137 GLU C HG3  1  
ATOM 7112   N N    . LEU C 1 134 ? 111.036 65.904  115.865 1.00 0.00 ? 138 LEU C N    1  
ATOM 7113   C CA   . LEU C 1 134 ? 112.466 65.665  115.732 1.00 0.00 ? 138 LEU C CA   1  
ATOM 7114   C C    . LEU C 1 134 ? 112.740 65.230  114.303 1.00 0.00 ? 138 LEU C C    1  
ATOM 7115   O O    . LEU C 1 134 ? 111.845 64.714  113.626 1.00 0.00 ? 138 LEU C O    1  
ATOM 7116   C CB   . LEU C 1 134 ? 112.936 64.609  116.736 1.00 0.00 ? 138 LEU C CB   1  
ATOM 7117   C CG   . LEU C 1 134 ? 112.029 64.241  117.913 1.00 0.00 ? 138 LEU C CG   1  
ATOM 7118   C CD1  . LEU C 1 134 ? 112.048 62.745  118.155 1.00 0.00 ? 138 LEU C CD1  1  
ATOM 7119   C CD2  . LEU C 1 134 ? 112.464 64.982  119.170 1.00 0.00 ? 138 LEU C CD2  1  
ATOM 7120   H H    . LEU C 1 134 ? 110.545 65.215  115.717 1.00 0.00 ? 138 LEU C H    1  
ATOM 7121   H HA   . LEU C 1 134 ? 112.961 66.476  115.926 1.00 0.00 ? 138 LEU C HA   1  
ATOM 7122   H HB2  . LEU C 1 134 ? 113.117 63.795  116.241 1.00 0.00 ? 138 LEU C HB2  1  
ATOM 7123   H HB3  . LEU C 1 134 ? 113.782 64.912  117.103 1.00 0.00 ? 138 LEU C HB3  1  
ATOM 7124   H HG   . LEU C 1 134 ? 111.121 64.506  117.694 1.00 0.00 ? 138 LEU C HG   1  
ATOM 7125   H HD11 . LEU C 1 134 ? 111.798 62.561  119.073 1.00 0.00 ? 138 LEU C HD11 1  
ATOM 7126   H HD12 . LEU C 1 134 ? 111.419 62.312  117.557 1.00 0.00 ? 138 LEU C HD12 1  
ATOM 7127   H HD13 . LEU C 1 134 ? 112.940 62.402  117.988 1.00 0.00 ? 138 LEU C HD13 1  
ATOM 7128   H HD21 . LEU C 1 134 ? 112.823 65.850  118.926 1.00 0.00 ? 138 LEU C HD21 1  
ATOM 7129   H HD22 . LEU C 1 134 ? 111.701 65.102  119.756 1.00 0.00 ? 138 LEU C HD22 1  
ATOM 7130   H HD23 . LEU C 1 134 ? 113.146 64.468  119.629 1.00 0.00 ? 138 LEU C HD23 1  
ATOM 7131   N N    . LYS C 1 135 ? 113.967 65.460  113.848 1.00 0.00 ? 139 LYS C N    1  
ATOM 7132   C CA   . LYS C 1 135 ? 114.364 65.140  112.483 1.00 0.00 ? 139 LYS C CA   1  
ATOM 7133   C C    . LYS C 1 135 ? 115.135 63.827  112.481 1.00 0.00 ? 139 LYS C C    1  
ATOM 7134   O O    . LYS C 1 135 ? 115.946 63.575  113.377 1.00 0.00 ? 139 LYS C O    1  
ATOM 7135   C CB   . LYS C 1 135 ? 115.211 66.268  111.908 1.00 0.00 ? 139 LYS C CB   1  
ATOM 7136   C CG   . LYS C 1 135 ? 114.483 67.134  110.902 1.00 0.00 ? 139 LYS C CG   1  
ATOM 7137   C CD   . LYS C 1 135 ? 114.213 68.515  111.468 1.00 0.00 ? 139 LYS C CD   1  
ATOM 7138   C CE   . LYS C 1 135 ? 113.114 69.230  110.694 1.00 0.00 ? 139 LYS C CE   1  
ATOM 7139   N NZ   . LYS C 1 135 ? 113.217 70.712  110.756 1.00 0.00 ? 139 LYS C NZ   1  
ATOM 7140   H H    . LYS C 1 135 ? 114.594 65.806  114.324 1.00 0.00 ? 139 LYS C H    1  
ATOM 7141   H HA   . LYS C 1 135 ? 113.576 65.042  111.926 1.00 0.00 ? 139 LYS C HA   1  
ATOM 7142   H HB2  . LYS C 1 135 ? 115.524 66.828  112.636 1.00 0.00 ? 139 LYS C HB2  1  
ATOM 7143   H HB3  . LYS C 1 135 ? 115.996 65.887  111.485 1.00 0.00 ? 139 LYS C HB3  1  
ATOM 7144   H HG2  . LYS C 1 135 ? 115.014 67.210  110.094 1.00 0.00 ? 139 LYS C HG2  1  
ATOM 7145   H HG3  . LYS C 1 135 ? 113.646 66.713  110.654 1.00 0.00 ? 139 LYS C HG3  1  
ATOM 7146   H HD2  . LYS C 1 135 ? 113.956 68.439  112.401 1.00 0.00 ? 139 LYS C HD2  1  
ATOM 7147   H HD3  . LYS C 1 135 ? 115.026 69.043  111.440 1.00 0.00 ? 139 LYS C HD3  1  
ATOM 7148   H HE2  . LYS C 1 135 ? 113.146 68.948  109.767 1.00 0.00 ? 139 LYS C HE2  1  
ATOM 7149   H HE3  . LYS C 1 135 ? 112.252 68.957  111.044 1.00 0.00 ? 139 LYS C HE3  1  
ATOM 7150   H HZ1  . LYS C 1 135 ? 113.229 71.044  109.930 1.00 0.00 ? 139 LYS C HZ1  1  
ATOM 7151   H HZ2  . LYS C 1 135 ? 112.516 71.040  111.196 1.00 0.00 ? 139 LYS C HZ2  1  
ATOM 7152   H HZ3  . LYS C 1 135 ? 113.966 70.941  111.178 1.00 0.00 ? 139 LYS C HZ3  1  
ATOM 7153   N N    . ASN C 1 136 ? 114.892 62.989  111.476 1.00 0.00 ? 140 ASN C N    1  
ATOM 7154   C CA   . ASN C 1 136 ? 115.610 61.729  111.325 1.00 0.00 ? 140 ASN C CA   1  
ATOM 7155   C C    . ASN C 1 136 ? 115.604 61.329  109.860 1.00 0.00 ? 140 ASN C C    1  
ATOM 7156   O O    . ASN C 1 136 ? 115.222 62.126  108.998 1.00 0.00 ? 140 ASN C O    1  
ATOM 7157   C CB   . ASN C 1 136 ? 114.992 60.618  112.181 1.00 0.00 ? 140 ASN C CB   1  
ATOM 7158   C CG   . ASN C 1 136 ? 113.482 60.673  112.207 1.00 0.00 ? 140 ASN C CG   1  
ATOM 7159   O OD1  . ASN C 1 136 ? 112.889 61.354  113.040 1.00 0.00 ? 140 ASN C OD1  1  
ATOM 7160   N ND2  . ASN C 1 136 ? 112.848 59.929  111.311 1.00 0.00 ? 140 ASN C ND2  1  
ATOM 7161   H H    . ASN C 1 136 ? 114.307 63.137  110.864 1.00 0.00 ? 140 ASN C H    1  
ATOM 7162   H HA   . ASN C 1 136 ? 116.521 61.856  111.631 1.00 0.00 ? 140 ASN C HA   1  
ATOM 7163   H HB2  . ASN C 1 136 ? 115.276 59.756  111.839 1.00 0.00 ? 140 ASN C HB2  1  
ATOM 7164   H HB3  . ASN C 1 136 ? 115.330 60.688  113.088 1.00 0.00 ? 140 ASN C HB3  1  
ATOM 7165   H HD21 . ASN C 1 136 ? 111.989 59.910  111.299 1.00 0.00 ? 140 ASN C HD21 1  
ATOM 7166   H HD22 . ASN C 1 136 ? 113.297 59.465  110.744 1.00 0.00 ? 140 ASN C HD22 1  
ATOM 7167   N N    . GLY C 1 137 ? 116.035 60.102  109.582 1.00 0.00 ? 141 GLY C N    1  
ATOM 7168   C CA   . GLY C 1 137 ? 115.865 59.553  108.254 1.00 0.00 ? 141 GLY C CA   1  
ATOM 7169   C C    . GLY C 1 137 ? 114.686 58.601  108.196 1.00 0.00 ? 141 GLY C C    1  
ATOM 7170   O O    . GLY C 1 137 ? 114.425 57.832  109.121 1.00 0.00 ? 141 GLY C O    1  
ATOM 7171   H H    . GLY C 1 137 ? 116.424 59.581  110.146 1.00 0.00 ? 141 GLY C H    1  
ATOM 7172   H HA2  . GLY C 1 137 ? 115.733 60.274  107.619 1.00 0.00 ? 141 GLY C HA2  1  
ATOM 7173   H HA3  . GLY C 1 137 ? 116.674 59.086  107.989 1.00 0.00 ? 141 GLY C HA3  1  
ATOM 7174   N N    . GLU C 1 138 ? 113.965 58.655  107.082 1.00 0.00 ? 142 GLU C N    1  
ATOM 7175   C CA   . GLU C 1 138 ? 112.741 57.884  106.934 1.00 0.00 ? 142 GLU C CA   1  
ATOM 7176   C C    . GLU C 1 138 ? 113.089 56.475  106.485 1.00 0.00 ? 142 GLU C C    1  
ATOM 7177   O O    . GLU C 1 138 ? 113.812 56.286  105.503 1.00 0.00 ? 142 GLU C O    1  
ATOM 7178   C CB   . GLU C 1 138 ? 111.784 58.574  105.951 1.00 0.00 ? 142 GLU C CB   1  
ATOM 7179   C CG   . GLU C 1 138 ? 110.708 57.662  105.378 1.00 0.00 ? 142 GLU C CG   1  
ATOM 7180   C CD   . GLU C 1 138 ? 109.688 57.245  106.403 1.00 0.00 ? 142 GLU C CD   1  
ATOM 7181   O OE1  . GLU C 1 138 ? 108.558 56.916  105.999 1.00 0.00 ? 142 GLU C OE1  1  
ATOM 7182   O OE2  . GLU C 1 138 ? 110.012 57.260  107.609 1.00 0.00 ? 142 GLU C OE2  1  
ATOM 7183   H H    . GLU C 1 138 ? 114.171 59.134  106.398 1.00 0.00 ? 142 GLU C H    1  
ATOM 7184   H HA   . GLU C 1 138 ? 112.282 57.832  107.787 1.00 0.00 ? 142 GLU C HA   1  
ATOM 7185   H HB2  . GLU C 1 138 ? 111.356 59.319  106.402 1.00 0.00 ? 142 GLU C HB2  1  
ATOM 7186   H HB3  . GLU C 1 138 ? 112.302 58.945  105.220 1.00 0.00 ? 142 GLU C HB3  1  
ATOM 7187   H HG2  . GLU C 1 138 ? 110.259 58.118  104.649 1.00 0.00 ? 142 GLU C HG2  1  
ATOM 7188   H HG3  . GLU C 1 138 ? 111.125 56.871  105.003 1.00 0.00 ? 142 GLU C HG3  1  
ATOM 7189   N N    . ILE C 1 139 ? 112.564 55.489  107.210 1.00 0.00 ? 143 ILE C N    1  
ATOM 7190   C CA   . ILE C 1 139 ? 112.886 54.096  106.927 1.00 0.00 ? 143 ILE C CA   1  
ATOM 7191   C C    . ILE C 1 139 ? 111.873 53.493  105.960 1.00 0.00 ? 143 ILE C C    1  
ATOM 7192   O O    . ILE C 1 139 ? 112.252 52.819  104.996 1.00 0.00 ? 143 ILE C O    1  
ATOM 7193   C CB   . ILE C 1 139 ? 112.967 53.274  108.227 1.00 0.00 ? 143 ILE C CB   1  
ATOM 7194   C CG1  . ILE C 1 139 ? 113.301 54.176  109.417 1.00 0.00 ? 143 ILE C CG1  1  
ATOM 7195   C CG2  . ILE C 1 139 ? 114.013 52.180  108.099 1.00 0.00 ? 143 ILE C CG2  1  
ATOM 7196   C CD1  . ILE C 1 139 ? 112.108 54.823  110.095 1.00 0.00 ? 143 ILE C CD1  1  
ATOM 7197   H H    . ILE C 1 139 ? 112.022 55.607  107.867 1.00 0.00 ? 143 ILE C H    1  
ATOM 7198   H HA   . ILE C 1 139 ? 113.759 54.068  106.504 1.00 0.00 ? 143 ILE C HA   1  
ATOM 7199   H HB   . ILE C 1 139 ? 112.101 52.865  108.380 1.00 0.00 ? 143 ILE C HB   1  
ATOM 7200   H HG12 . ILE C 1 139 ? 113.783 53.652  110.076 1.00 0.00 ? 143 ILE C HG12 1  
ATOM 7201   H HG13 . ILE C 1 139 ? 113.902 54.875  109.116 1.00 0.00 ? 143 ILE C HG13 1  
ATOM 7202   H HG21 . ILE C 1 139 ? 114.713 52.472  107.493 1.00 0.00 ? 143 ILE C HG21 1  
ATOM 7203   H HG22 . ILE C 1 139 ? 114.396 51.994  108.970 1.00 0.00 ? 143 ILE C HG22 1  
ATOM 7204   H HG23 . ILE C 1 139 ? 113.599 51.376  107.750 1.00 0.00 ? 143 ILE C HG23 1  
ATOM 7205   H HD11 . ILE C 1 139 ? 112.161 54.677  111.052 1.00 0.00 ? 143 ILE C HD11 1  
ATOM 7206   H HD12 . ILE C 1 139 ? 112.109 55.776  109.912 1.00 0.00 ? 143 ILE C HD12 1  
ATOM 7207   H HD13 . ILE C 1 139 ? 111.289 54.431  109.754 1.00 0.00 ? 143 ILE C HD13 1  
ATOM 7208   N N    . ASP C 1 140 ? 110.586 53.740  106.187 1.00 0.00 ? 144 ASP C N    1  
ATOM 7209   C CA   . ASP C 1 140 ? 109.562 53.137  105.345 1.00 0.00 ? 144 ASP C CA   1  
ATOM 7210   C C    . ASP C 1 140 ? 109.301 53.989  104.111 1.00 0.00 ? 144 ASP C C    1  
ATOM 7211   O O    . ASP C 1 140 ? 108.774 55.100  104.202 1.00 0.00 ? 144 ASP C O    1  
ATOM 7212   C CB   . ASP C 1 140 ? 108.263 52.918  106.125 1.00 0.00 ? 144 ASP C CB   1  
ATOM 7213   C CG   . ASP C 1 140 ? 108.187 51.553  106.787 1.00 0.00 ? 144 ASP C CG   1  
ATOM 7214   O OD1  . ASP C 1 140 ? 109.227 50.874  106.915 1.00 0.00 ? 144 ASP C OD1  1  
ATOM 7215   O OD2  . ASP C 1 140 ? 107.077 51.167  107.205 1.00 0.00 ? 144 ASP C OD2  1  
ATOM 7216   H H    . ASP C 1 140 ? 110.289 54.247  106.815 1.00 0.00 ? 144 ASP C H    1  
ATOM 7217   H HA   . ASP C 1 140 ? 109.893 52.273  105.056 1.00 0.00 ? 144 ASP C HA   1  
ATOM 7218   H HB2  . ASP C 1 140 ? 108.181 53.605  106.805 1.00 0.00 ? 144 ASP C HB2  1  
ATOM 7219   H HB3  . ASP C 1 140 ? 107.510 53.022  105.524 1.00 0.00 ? 144 ASP C HB3  1  
ATOM 7220   N N    . THR C 1 141 ? 109.700 53.470  102.951 1.00 0.00 ? 145 THR C N    1  
ATOM 7221   C CA   . THR C 1 141 ? 109.422 54.124  101.680 1.00 0.00 ? 145 THR C CA   1  
ATOM 7222   C C    . THR C 1 141 ? 107.932 54.211  101.387 1.00 0.00 ? 145 THR C C    1  
ATOM 7223   O O    . THR C 1 141 ? 107.467 55.282  100.975 1.00 0.00 ? 145 THR C O    1  
ATOM 7224   C CB   . THR C 1 141 ? 110.122 53.413  100.515 1.00 0.00 ? 145 THR C CB   1  
ATOM 7225   O OG1  . THR C 1 141 ? 110.209 52.009  100.782 1.00 0.00 ? 145 THR C OG1  1  
ATOM 7226   C CG2  . THR C 1 141 ? 111.499 53.982  100.263 1.00 0.00 ? 145 THR C CG2  1  
ATOM 7227   H H    . THR C 1 141 ? 110.137 52.733  102.882 1.00 0.00 ? 145 THR C H    1  
ATOM 7228   H HA   . THR C 1 141 ? 109.771 55.025  101.763 1.00 0.00 ? 145 THR C HA   1  
ATOM 7229   H HB   . THR C 1 141 ? 109.593 53.556  99.715  1.00 0.00 ? 145 THR C HB   1  
ATOM 7230   H HG1  . THR C 1 141 ? 109.741 51.587  100.225 1.00 0.00 ? 145 THR C HG1  1  
ATOM 7231   H HG21 . THR C 1 141 ? 111.938 53.617  99.479  1.00 0.00 ? 145 THR C HG21 1  
ATOM 7232   H HG22 . THR C 1 141 ? 111.425 54.925  100.046 1.00 0.00 ? 145 THR C HG22 1  
ATOM 7233   H HG23 . THR C 1 141 ? 112.043 53.875  101.059 1.00 0.00 ? 145 THR C HG23 1  
ATOM 7234   N N    . LEU C 1 142 ? 107.175 53.122  101.621 1.00 0.00 ? 146 LEU C N    1  
ATOM 7235   C CA   . LEU C 1 142 ? 105.762 52.958  101.284 1.00 0.00 ? 146 LEU C CA   1  
ATOM 7236   C C    . LEU C 1 142 ? 105.559 53.246  99.801  1.00 0.00 ? 146 LEU C C    1  
ATOM 7237   O O    . LEU C 1 142 ? 104.870 54.212  99.449  1.00 0.00 ? 146 LEU C O    1  
ATOM 7238   C CB   . LEU C 1 142 ? 104.864 53.850  102.147 1.00 0.00 ? 146 LEU C CB   1  
ATOM 7239   C CG   . LEU C 1 142 ? 104.929 53.706  103.673 1.00 0.00 ? 146 LEU C CG   1  
ATOM 7240   C CD1  . LEU C 1 142 ? 104.489 55.000  104.347 1.00 0.00 ? 146 LEU C CD1  1  
ATOM 7241   C CD2  . LEU C 1 142 ? 104.160 52.502  104.218 1.00 0.00 ? 146 LEU C CD2  1  
ATOM 7242   H H    . LEU C 1 142 ? 107.500 52.425  102.003 1.00 0.00 ? 146 LEU C H    1  
ATOM 7243   H HA   . LEU C 1 142 ? 105.506 52.040  101.470 1.00 0.00 ? 146 LEU C HA   1  
ATOM 7244   H HB2  . LEU C 1 142 ? 105.070 54.772  101.929 1.00 0.00 ? 146 LEU C HB2  1  
ATOM 7245   H HB3  . LEU C 1 142 ? 103.946 53.693  101.876 1.00 0.00 ? 146 LEU C HB3  1  
ATOM 7246   H HG   . LEU C 1 142 ? 105.857 53.534  103.892 1.00 0.00 ? 146 LEU C HG   1  
ATOM 7247   H HD11 . LEU C 1 142 ? 105.218 55.640  104.325 1.00 0.00 ? 146 LEU C HD11 1  
ATOM 7248   H HD12 . LEU C 1 142 ? 103.724 55.366  103.876 1.00 0.00 ? 146 LEU C HD12 1  
ATOM 7249   H HD13 . LEU C 1 142 ? 104.246 54.819  105.268 1.00 0.00 ? 146 LEU C HD13 1  
ATOM 7250   H HD21 . LEU C 1 142 ? 103.411 52.306  103.633 1.00 0.00 ? 146 LEU C HD21 1  
ATOM 7251   H HD22 . LEU C 1 142 ? 104.749 51.733  104.259 1.00 0.00 ? 146 LEU C HD22 1  
ATOM 7252   H HD23 . LEU C 1 142 ? 103.830 52.703  105.107 1.00 0.00 ? 146 LEU C HD23 1  
ATOM 7253   N N    . PRO C 1 143 ? 106.168 52.440  98.904  1.00 0.00 ? 147 PRO C N    1  
ATOM 7254   C CA   . PRO C 1 143 ? 106.402 52.879  97.518  1.00 0.00 ? 147 PRO C CA   1  
ATOM 7255   C C    . PRO C 1 143 ? 105.153 53.034  96.665  1.00 0.00 ? 147 PRO C C    1  
ATOM 7256   O O    . PRO C 1 143 ? 105.206 53.501  95.523  1.00 0.00 ? 147 PRO C O    1  
ATOM 7257   C CB   . PRO C 1 143 ? 107.276 51.755  96.943  1.00 0.00 ? 147 PRO C CB   1  
ATOM 7258   C CG   . PRO C 1 143 ? 107.873 51.082  98.132  1.00 0.00 ? 147 PRO C CG   1  
ATOM 7259   C CD   . PRO C 1 143 ? 106.813 51.147  99.183  1.00 0.00 ? 147 PRO C CD   1  
ATOM 7260   H HA   . PRO C 1 143 ? 106.786 53.770  97.506  1.00 0.00 ? 147 PRO C HA   1  
ATOM 7261   H HB2  . PRO C 1 143 ? 106.748 51.134  96.416  1.00 0.00 ? 147 PRO C HB2  1  
ATOM 7262   H HB3  . PRO C 1 143 ? 107.963 52.109  96.358  1.00 0.00 ? 147 PRO C HB3  1  
ATOM 7263   H HG2  . PRO C 1 143 ? 108.114 50.164  97.933  1.00 0.00 ? 147 PRO C HG2  1  
ATOM 7264   H HG3  . PRO C 1 143 ? 108.682 51.532  98.421  1.00 0.00 ? 147 PRO C HG3  1  
ATOM 7265   H HD2  . PRO C 1 143 ? 106.188 50.409  99.112  1.00 0.00 ? 147 PRO C HD2  1  
ATOM 7266   H HD3  . PRO C 1 143 ? 107.189 51.116  100.077 1.00 0.00 ? 147 PRO C HD3  1  
ATOM 7267   N N    . GLU C 1 144 ? 104.018 52.645  97.239  1.00 0.00 ? 148 GLU C N    1  
ATOM 7268   C CA   . GLU C 1 144 ? 102.709 52.876  96.649  1.00 0.00 ? 148 GLU C CA   1  
ATOM 7269   C C    . GLU C 1 144 ? 102.418 54.360  96.494  1.00 0.00 ? 148 GLU C C    1  
ATOM 7270   O O    . GLU C 1 144 ? 101.812 54.767  95.498  1.00 0.00 ? 148 GLU C O    1  
ATOM 7271   C CB   . GLU C 1 144 ? 101.623 52.213  97.496  1.00 0.00 ? 148 GLU C CB   1  
ATOM 7272   C CG   . GLU C 1 144 ? 102.125 51.046  98.317  1.00 0.00 ? 148 GLU C CG   1  
ATOM 7273   C CD   . GLU C 1 144 ? 102.491 51.445  99.727  1.00 0.00 ? 148 GLU C CD   1  
ATOM 7274   O OE1  . GLU C 1 144 ? 102.071 52.534  100.174 1.00 0.00 ? 148 GLU C OE1  1  
ATOM 7275   O OE2  . GLU C 1 144 ? 103.188 50.659  100.398 1.00 0.00 ? 148 GLU C OE2  1  
ATOM 7276   H H    . GLU C 1 144 ? 103.988 52.234  97.994  1.00 0.00 ? 148 GLU C H    1  
ATOM 7277   H HA   . GLU C 1 144 ? 102.710 52.479  95.763  1.00 0.00 ? 148 GLU C HA   1  
ATOM 7278   H HB2  . GLU C 1 144 ? 101.238 52.875  98.091  1.00 0.00 ? 148 GLU C HB2  1  
ATOM 7279   H HB3  . GLU C 1 144 ? 100.910 51.906  96.914  1.00 0.00 ? 148 GLU C HB3  1  
ATOM 7280   H HG2  . GLU C 1 144 ? 101.442 50.357  98.345  1.00 0.00 ? 148 GLU C HG2  1  
ATOM 7281   H HG3  . GLU C 1 144 ? 102.900 50.658  97.882  1.00 0.00 ? 148 GLU C HG3  1  
ATOM 7282   N N    . GLU C 1 145 ? 102.838 55.174  97.460  1.00 0.00 ? 149 GLU C N    1  
ATOM 7283   C CA   . GLU C 1 145 ? 102.490 56.583  97.484  1.00 0.00 ? 149 GLU C CA   1  
ATOM 7284   C C    . GLU C 1 145 ? 103.676 57.512  97.268  1.00 0.00 ? 149 GLU C C    1  
ATOM 7285   O O    . GLU C 1 145 ? 103.711 58.204  96.246  1.00 0.00 ? 149 GLU C O    1  
ATOM 7286   C CB   . GLU C 1 145 ? 101.817 56.927  98.821  1.00 0.00 ? 149 GLU C CB   1  
ATOM 7287   C CG   . GLU C 1 145 ? 100.346 56.533  98.895  1.00 0.00 ? 149 GLU C CG   1  
ATOM 7288   C CD   . GLU C 1 145 ? 100.031 55.609  100.059 1.00 0.00 ? 149 GLU C CD   1  
ATOM 7289   O OE1  . GLU C 1 145 ? 98.850  55.261  100.256 1.00 0.00 ? 149 GLU C OE1  1  
ATOM 7290   O OE2  . GLU C 1 145 ? 100.975 55.222  100.776 1.00 0.00 ? 149 GLU C OE2  1  
ATOM 7291   H H    . GLU C 1 145 ? 103.331 54.921  98.117  1.00 0.00 ? 149 GLU C H    1  
ATOM 7292   H HA   . GLU C 1 145 ? 101.885 56.726  96.740  1.00 0.00 ? 149 GLU C HA   1  
ATOM 7293   H HB2  . GLU C 1 145 ? 102.298 56.483  99.538  1.00 0.00 ? 149 GLU C HB2  1  
ATOM 7294   H HB3  . GLU C 1 145 ? 101.895 57.882  98.976  1.00 0.00 ? 149 GLU C HB3  1  
ATOM 7295   H HG2  . GLU C 1 145 ? 99.807  57.335  98.972  1.00 0.00 ? 149 GLU C HG2  1  
ATOM 7296   H HG3  . GLU C 1 145 ? 100.092 56.097  98.067  1.00 0.00 ? 149 GLU C HG3  1  
ATOM 7297   N N    . ILE C 1 146 ? 104.637 57.557  98.182  1.00 0.00 ? 150 ILE C N    1  
ATOM 7298   C CA   . ILE C 1 146 ? 105.809 58.413  98.063  1.00 0.00 ? 150 ILE C CA   1  
ATOM 7299   C C    . ILE C 1 146 ? 106.612 58.079  96.812  1.00 0.00 ? 150 ILE C C    1  
ATOM 7300   O O    . ILE C 1 146 ? 106.899 58.952  95.994  1.00 0.00 ? 150 ILE C O    1  
ATOM 7301   C CB   . ILE C 1 146 ? 106.689 58.321  99.329  1.00 0.00 ? 150 ILE C CB   1  
ATOM 7302   C CG1  . ILE C 1 146 ? 105.899 58.783  100.551 1.00 0.00 ? 150 ILE C CG1  1  
ATOM 7303   C CG2  . ILE C 1 146 ? 107.956 59.146  99.175  1.00 0.00 ? 150 ILE C CG2  1  
ATOM 7304   C CD1  . ILE C 1 146 ? 105.371 57.652  101.392 1.00 0.00 ? 150 ILE C CD1  1  
ATOM 7305   H H    . ILE C 1 146 ? 104.626 57.084  98.900  1.00 0.00 ? 150 ILE C H    1  
ATOM 7306   H HA   . ILE C 1 146 ? 105.501 59.328  97.977  1.00 0.00 ? 150 ILE C HA   1  
ATOM 7307   H HB   . ILE C 1 146 ? 106.947 57.394  99.453  1.00 0.00 ? 150 ILE C HB   1  
ATOM 7308   H HG12 . ILE C 1 146 ? 106.467 59.346  101.100 1.00 0.00 ? 150 ILE C HG12 1  
ATOM 7309   H HG13 . ILE C 1 146 ? 105.156 59.332  100.257 1.00 0.00 ? 150 ILE C HG13 1  
ATOM 7310   H HG21 . ILE C 1 146 ? 108.340 58.987  98.298  1.00 0.00 ? 150 ILE C HG21 1  
ATOM 7311   H HG22 . ILE C 1 146 ? 107.742 60.087  99.269  1.00 0.00 ? 150 ILE C HG22 1  
ATOM 7312   H HG23 . ILE C 1 146 ? 108.595 58.889  99.858  1.00 0.00 ? 150 ILE C HG23 1  
ATOM 7313   H HD11 . ILE C 1 146 ? 105.891 56.851  101.222 1.00 0.00 ? 150 ILE C HD11 1  
ATOM 7314   H HD12 . ILE C 1 146 ? 105.440 57.887  102.331 1.00 0.00 ? 150 ILE C HD12 1  
ATOM 7315   H HD13 . ILE C 1 146 ? 104.442 57.488  101.168 1.00 0.00 ? 150 ILE C HD13 1  
ATOM 7316   N N    . VAL C 1 147 ? 106.968 56.811  96.641  1.00 0.00 ? 151 VAL C N    1  
ATOM 7317   C CA   . VAL C 1 147 ? 107.801 56.391  95.525  1.00 0.00 ? 151 VAL C CA   1  
ATOM 7318   C C    . VAL C 1 147 ? 106.977 56.538  94.251  1.00 0.00 ? 151 VAL C C    1  
ATOM 7319   O O    . VAL C 1 147 ? 107.418 57.152  93.271  1.00 0.00 ? 151 VAL C O    1  
ATOM 7320   C CB   . VAL C 1 147 ? 108.297 54.947  95.744  1.00 0.00 ? 151 VAL C CB   1  
ATOM 7321   C CG1  . VAL C 1 147 ? 108.942 54.363  94.490  1.00 0.00 ? 151 VAL C CG1  1  
ATOM 7322   C CG2  . VAL C 1 147 ? 109.256 54.897  96.926  1.00 0.00 ? 151 VAL C CG2  1  
ATOM 7323   H H    . VAL C 1 147 ? 106.734 56.174  97.169  1.00 0.00 ? 151 VAL C H    1  
ATOM 7324   H HA   . VAL C 1 147 ? 108.594 56.943  95.451  1.00 0.00 ? 151 VAL C HA   1  
ATOM 7325   H HB   . VAL C 1 147 ? 107.523 54.396  95.944  1.00 0.00 ? 151 VAL C HB   1  
ATOM 7326   H HG11 . VAL C 1 147 ? 109.507 55.033  94.075  1.00 0.00 ? 151 VAL C HG11 1  
ATOM 7327   H HG12 . VAL C 1 147 ? 109.480 53.592  94.732  1.00 0.00 ? 151 VAL C HG12 1  
ATOM 7328   H HG13 . VAL C 1 147 ? 108.251 54.092  93.867  1.00 0.00 ? 151 VAL C HG13 1  
ATOM 7329   H HG21 . VAL C 1 147 ? 108.751 54.861  97.753  1.00 0.00 ? 151 VAL C HG21 1  
ATOM 7330   H HG22 . VAL C 1 147 ? 109.816 54.109  96.855  1.00 0.00 ? 151 VAL C HG22 1  
ATOM 7331   H HG23 . VAL C 1 147 ? 109.814 55.691  96.924  1.00 0.00 ? 151 VAL C HG23 1  
ATOM 7332   N N    . ASN C 1 148 ? 105.749 56.006  94.281  1.00 0.00 ? 152 ASN C N    1  
ATOM 7333   C CA   . ASN C 1 148 ? 104.884 56.016  93.104  1.00 0.00 ? 152 ASN C CA   1  
ATOM 7334   C C    . ASN C 1 148 ? 103.761 57.039  93.246  1.00 0.00 ? 152 ASN C C    1  
ATOM 7335   O O    . ASN C 1 148 ? 102.813 56.824  94.009  1.00 0.00 ? 152 ASN C O    1  
ATOM 7336   C CB   . ASN C 1 148 ? 104.312 54.619  92.878  1.00 0.00 ? 152 ASN C CB   1  
ATOM 7337   C CG   . ASN C 1 148 ? 103.084 54.617  91.985  1.00 0.00 ? 152 ASN C CG   1  
ATOM 7338   O OD1  . ASN C 1 148 ? 102.031 54.084  92.338  1.00 0.00 ? 152 ASN C OD1  1  
ATOM 7339   N ND2  . ASN C 1 148 ? 103.217 55.224  90.814  1.00 0.00 ? 152 ASN C ND2  1  
ATOM 7340   H H    . ASN C 1 148 ? 105.402 55.635  94.975  1.00 0.00 ? 152 ASN C H    1  
ATOM 7341   H HA   . ASN C 1 148 ? 105.416 56.275  92.336  1.00 0.00 ? 152 ASN C HA   1  
ATOM 7342   H HB2  . ASN C 1 148 ? 104.994 54.056  92.480  1.00 0.00 ? 152 ASN C HB2  1  
ATOM 7343   H HB3  . ASN C 1 148 ? 104.082 54.226  93.735  1.00 0.00 ? 152 ASN C HB3  1  
ATOM 7344   H HD21 . ASN C 1 148 ? 102.553 55.256  90.268  1.00 0.00 ? 152 ASN C HD21 1  
ATOM 7345   H HD22 . ASN C 1 148 ? 103.967 55.585  90.600  1.00 0.00 ? 152 ASN C HD22 1  
ATOM 7346   N N    . VAL C 1 149 ? 103.842 58.147  92.515  1.00 0.00 ? 153 VAL C N    1  
ATOM 7347   C CA   . VAL C 1 149 ? 102.716 59.069  92.456  1.00 0.00 ? 153 VAL C CA   1  
ATOM 7348   C C    . VAL C 1 149 ? 102.440 59.384  90.984  1.00 0.00 ? 153 VAL C C    1  
ATOM 7349   O O    . VAL C 1 149 ? 103.121 60.197  90.347  1.00 0.00 ? 153 VAL C O    1  
ATOM 7350   C CB   . VAL C 1 149 ? 102.961 60.312  93.346  1.00 0.00 ? 153 VAL C CB   1  
ATOM 7351   C CG1  . VAL C 1 149 ? 104.233 61.084  92.965  1.00 0.00 ? 153 VAL C CG1  1  
ATOM 7352   C CG2  . VAL C 1 149 ? 101.742 61.229  93.346  1.00 0.00 ? 153 VAL C CG2  1  
ATOM 7353   H H    . VAL C 1 149 ? 104.529 58.379  92.052  1.00 0.00 ? 153 VAL C H    1  
ATOM 7354   H HA   . VAL C 1 149 ? 101.913 58.668  92.826  1.00 0.00 ? 153 VAL C HA   1  
ATOM 7355   H HB   . VAL C 1 149 ? 103.102 59.983  94.247  1.00 0.00 ? 153 VAL C HB   1  
ATOM 7356   H HG11 . VAL C 1 149 ? 104.029 61.716  92.259  1.00 0.00 ? 153 VAL C HG11 1  
ATOM 7357   H HG12 . VAL C 1 149 ? 104.566 61.562  93.740  1.00 0.00 ? 153 VAL C HG12 1  
ATOM 7358   H HG13 . VAL C 1 149 ? 104.909 60.461  92.656  1.00 0.00 ? 153 VAL C HG13 1  
ATOM 7359   H HG21 . VAL C 1 149 ? 101.538 61.498  92.437  1.00 0.00 ? 153 VAL C HG21 1  
ATOM 7360   H HG22 . VAL C 1 149 ? 100.982 60.758  93.722  1.00 0.00 ? 153 VAL C HG22 1  
ATOM 7361   H HG23 . VAL C 1 149 ? 101.929 62.017  93.881  1.00 0.00 ? 153 VAL C HG23 1  
ATOM 7362   N N    . SER C 1 150 ? 101.465 58.680  90.411  1.00 0.00 ? 154 SER C N    1  
ATOM 7363   C CA   . SER C 1 150 ? 101.213 58.765  88.980  1.00 0.00 ? 154 SER C CA   1  
ATOM 7364   C C    . SER C 1 150 ? 100.118 59.763  88.629  1.00 0.00 ? 154 SER C C    1  
ATOM 7365   O O    . SER C 1 150 ? 99.303  60.114  89.488  1.00 0.00 ? 154 SER C O    1  
ATOM 7366   C CB   . SER C 1 150 ? 100.847 57.369  88.454  1.00 0.00 ? 154 SER C CB   1  
ATOM 7367   O OG   . SER C 1 150 ? 100.918 57.318  87.043  1.00 0.00 ? 154 SER C OG   1  
ATOM 7368   H H    . SER C 1 150 ? 100.938 58.149  90.836  1.00 0.00 ? 154 SER C H    1  
ATOM 7369   H HA   . SER C 1 150 ? 102.024 59.086  88.556  1.00 0.00 ? 154 SER C HA   1  
ATOM 7370   H HB2  . SER C 1 150 ? 101.448 56.710  88.835  1.00 0.00 ? 154 SER C HB2  1  
ATOM 7371   H HB3  . SER C 1 150 ? 99.951  57.137  88.743  1.00 0.00 ? 154 SER C HB3  1  
ATOM 7372   H HG   . SER C 1 150 ? 100.143 57.279  86.724  1.00 0.00 ? 154 SER C HG   1  
ATOM 7373   N N    . LYS C 1 151 ? 100.075 60.237  87.390  1.00 0.00 ? 155 LYS C N    1  
ATOM 7374   C CA   . LYS C 1 151 ? 98.989  61.115  86.972  1.00 0.00 ? 155 LYS C CA   1  
ATOM 7375   C C    . LYS C 1 151 ? 97.690  60.383  86.653  1.00 0.00 ? 155 LYS C C    1  
ATOM 7376   O O    . LYS C 1 151 ? 96.689  61.042  86.357  1.00 0.00 ? 155 LYS C O    1  
ATOM 7377   C CB   . LYS C 1 151 ? 99.433  61.937  85.750  1.00 0.00 ? 155 LYS C CB   1  
ATOM 7378   C CG   . LYS C 1 151 ? 100.547 62.934  85.994  1.00 0.00 ? 155 LYS C CG   1  
ATOM 7379   C CD   . LYS C 1 151 ? 100.012 64.200  86.642  1.00 0.00 ? 155 LYS C CD   1  
ATOM 7380   C CE   . LYS C 1 151 ? 100.964 65.374  86.458  1.00 0.00 ? 155 LYS C CE   1  
ATOM 7381   N NZ   . LYS C 1 151 ? 100.384 66.455  85.616  1.00 0.00 ? 155 LYS C NZ   1  
ATOM 7382   H H    . LYS C 1 151 ? 100.658 60.064  86.781  1.00 0.00 ? 155 LYS C H    1  
ATOM 7383   H HA   . LYS C 1 151 ? 98.798  61.693  87.728  1.00 0.00 ? 155 LYS C HA   1  
ATOM 7384   H HB2  . LYS C 1 151 ? 99.718  61.323  85.055  1.00 0.00 ? 155 LYS C HB2  1  
ATOM 7385   H HB3  . LYS C 1 151 ? 98.662  62.416  85.406  1.00 0.00 ? 155 LYS C HB3  1  
ATOM 7386   H HG2  . LYS C 1 151 ? 101.222 62.535  86.565  1.00 0.00 ? 155 LYS C HG2  1  
ATOM 7387   H HG3  . LYS C 1 151 ? 100.979 63.154  85.154  1.00 0.00 ? 155 LYS C HG3  1  
ATOM 7388   H HD2  . LYS C 1 151 ? 99.149  64.420  86.259  1.00 0.00 ? 155 LYS C HD2  1  
ATOM 7389   H HD3  . LYS C 1 151 ? 99.871  64.045  87.588  1.00 0.00 ? 155 LYS C HD3  1  
ATOM 7390   H HE2  . LYS C 1 151 ? 101.198 65.735  87.327  1.00 0.00 ? 155 LYS C HE2  1  
ATOM 7391   H HE3  . LYS C 1 151 ? 101.786 65.058  86.051  1.00 0.00 ? 155 LYS C HE3  1  
ATOM 7392   H HZ1  . LYS C 1 151 ? 99.530  66.577  85.836  1.00 0.00 ? 155 LYS C HZ1  1  
ATOM 7393   H HZ2  . LYS C 1 151 ? 100.835 67.211  85.750  1.00 0.00 ? 155 LYS C HZ2  1  
ATOM 7394   H HZ3  . LYS C 1 151 ? 100.438 66.225  84.758  1.00 0.00 ? 155 LYS C HZ3  1  
ATOM 7395   N N    . GLY C 1 152 ? 97.642  59.057  86.770  1.00 0.00 ? 156 GLY C N    1  
ATOM 7396   C CA   . GLY C 1 152 ? 96.457  58.300  86.417  1.00 0.00 ? 156 GLY C CA   1  
ATOM 7397   C C    . GLY C 1 152 ? 96.474  57.805  84.985  1.00 0.00 ? 156 GLY C C    1  
ATOM 7398   O O    . GLY C 1 152 ? 95.571  57.075  84.562  1.00 0.00 ? 156 GLY C O    1  
ATOM 7399   H H    . GLY C 1 152 ? 98.296  58.577  87.056  1.00 0.00 ? 156 GLY C H    1  
ATOM 7400   H HA2  . GLY C 1 152 ? 96.374  57.540  87.015  1.00 0.00 ? 156 GLY C HA2  1  
ATOM 7401   H HA3  . GLY C 1 152 ? 95.672  58.854  86.552  1.00 0.00 ? 156 GLY C HA3  1  
ATOM 7402   N N    . GLY C 1 153 ? 97.495  58.190  84.232  1.00 0.00 ? 157 GLY C N    1  
ATOM 7403   C CA   . GLY C 1 153 ? 97.599  57.840  82.828  1.00 0.00 ? 157 GLY C CA   1  
ATOM 7404   C C    . GLY C 1 153 ? 98.064  56.403  82.643  1.00 0.00 ? 157 GLY C C    1  
ATOM 7405   O O    . GLY C 1 153 ? 98.939  55.924  83.366  1.00 0.00 ? 157 GLY C O    1  
ATOM 7406   H H    . GLY C 1 153 ? 98.150  58.665  84.525  1.00 0.00 ? 157 GLY C H    1  
ATOM 7407   H HA2  . GLY C 1 153 ? 96.737  57.959  82.400  1.00 0.00 ? 157 GLY C HA2  1  
ATOM 7408   H HA3  . GLY C 1 153 ? 98.221  58.441  82.389  1.00 0.00 ? 157 GLY C HA3  1  
ATOM 7409   N N    . TYR C 1 154 ? 97.461  55.735  81.667  1.00 0.00 ? 158 TYR C N    1  
ATOM 7410   C CA   . TYR C 1 154 ? 97.784  54.367  81.286  1.00 0.00 ? 158 TYR C CA   1  
ATOM 7411   C C    . TYR C 1 154 ? 97.763  54.267  79.762  1.00 0.00 ? 158 TYR C C    1  
ATOM 7412   O O    . TYR C 1 154 ? 97.053  55.023  79.093  1.00 0.00 ? 158 TYR C O    1  
ATOM 7413   C CB   . TYR C 1 154 ? 96.817  53.390  81.959  1.00 0.00 ? 158 TYR C CB   1  
ATOM 7414   C CG   . TYR C 1 154 ? 96.690  53.595  83.460  1.00 0.00 ? 158 TYR C CG   1  
ATOM 7415   C CD1  . TYR C 1 154 ? 95.461  53.886  84.043  1.00 0.00 ? 158 TYR C CD1  1  
ATOM 7416   C CD2  . TYR C 1 154 ? 97.794  53.486  84.292  1.00 0.00 ? 158 TYR C CD2  1  
ATOM 7417   C CE1  . TYR C 1 154 ? 95.337  54.065  85.402  1.00 0.00 ? 158 TYR C CE1  1  
ATOM 7418   C CE2  . TYR C 1 154 ? 97.677  53.664  85.658  1.00 0.00 ? 158 TYR C CE2  1  
ATOM 7419   C CZ   . TYR C 1 154 ? 96.446  53.954  86.204  1.00 0.00 ? 158 TYR C CZ   1  
ATOM 7420   O OH   . TYR C 1 154 ? 96.314  54.136  87.559  1.00 0.00 ? 158 TYR C OH   1  
ATOM 7421   H H    . TYR C 1 154 ? 96.830  56.077  81.193  1.00 0.00 ? 158 TYR C H    1  
ATOM 7422   H HA   . TYR C 1 154 ? 98.673  54.126  81.591  1.00 0.00 ? 158 TYR C HA   1  
ATOM 7423   H HB2  . TYR C 1 154 ? 95.941  53.481  81.552  1.00 0.00 ? 158 TYR C HB2  1  
ATOM 7424   H HB3  . TYR C 1 154 ? 97.115  52.482  81.789  1.00 0.00 ? 158 TYR C HB3  1  
ATOM 7425   H HD1  . TYR C 1 154 ? 94.708  53.961  83.503  1.00 0.00 ? 158 TYR C HD1  1  
ATOM 7426   H HD2  . TYR C 1 154 ? 98.627  53.289  83.925  1.00 0.00 ? 158 TYR C HD2  1  
ATOM 7427   H HE1  . TYR C 1 154 ? 94.507  54.259  85.774  1.00 0.00 ? 158 TYR C HE1  1  
ATOM 7428   H HE2  . TYR C 1 154 ? 98.425  53.588  86.206  1.00 0.00 ? 158 TYR C HE2  1  
ATOM 7429   H HH   . TYR C 1 154 ? 96.505  53.422  87.958  1.00 0.00 ? 158 TYR C HH   1  
ATOM 7430   N N    . ASP C 1 155 ? 98.571  53.345  79.217  1.00 0.00 ? 159 ASP C N    1  
ATOM 7431   C CA   . ASP C 1 155 ? 99.002  53.438  77.822  1.00 0.00 ? 159 ASP C CA   1  
ATOM 7432   C C    . ASP C 1 155 ? 97.880  53.467  76.789  1.00 0.00 ? 159 ASP C C    1  
ATOM 7433   O O    . ASP C 1 155 ? 97.827  54.419  76.006  1.00 0.00 ? 159 ASP C O    1  
ATOM 7434   C CB   . ASP C 1 155 ? 99.938  52.276  77.497  1.00 0.00 ? 159 ASP C CB   1  
ATOM 7435   C CG   . ASP C 1 155 ? 100.974 52.641  76.464  1.00 0.00 ? 159 ASP C CG   1  
ATOM 7436   O OD1  . ASP C 1 155 ? 101.043 51.950  75.425  1.00 0.00 ? 159 ASP C OD1  1  
ATOM 7437   O OD2  . ASP C 1 155 ? 101.723 53.613  76.692  1.00 0.00 ? 159 ASP C OD2  1  
ATOM 7438   H H    . ASP C 1 155 ? 98.876  52.661  79.640  1.00 0.00 ? 159 ASP C H    1  
ATOM 7439   H HA   . ASP C 1 155 ? 99.447  54.298  77.753  1.00 0.00 ? 159 ASP C HA   1  
ATOM 7440   H HB2  . ASP C 1 155 ? 100.384 51.986  78.309  1.00 0.00 ? 159 ASP C HB2  1  
ATOM 7441   H HB3  . ASP C 1 155 ? 99.417  51.524  77.177  1.00 0.00 ? 159 ASP C HB3  1  
ATOM 7442   N N    . PHE C 1 156 ? 96.983  52.468  76.808  1.00 0.00 ? 160 PHE C N    1  
ATOM 7443   C CA   . PHE C 1 156 ? 95.696  52.402  76.100  1.00 0.00 ? 160 PHE C CA   1  
ATOM 7444   C C    . PHE C 1 156 ? 94.697  51.629  76.952  1.00 0.00 ? 160 PHE C C    1  
ATOM 7445   O O    . PHE C 1 156 ? 95.063  50.890  77.871  1.00 0.00 ? 160 PHE C O    1  
ATOM 7446   C CB   . PHE C 1 156 ? 95.734  51.742  74.712  1.00 0.00 ? 160 PHE C CB   1  
ATOM 7447   C CG   . PHE C 1 156 ? 95.698  50.238  74.730  1.00 0.00 ? 160 PHE C CG   1  
ATOM 7448   C CD1  . PHE C 1 156 ? 96.672  49.517  75.402  1.00 0.00 ? 160 PHE C CD1  1  
ATOM 7449   C CD2  . PHE C 1 156 ? 94.747  49.544  73.995  1.00 0.00 ? 160 PHE C CD2  1  
ATOM 7450   C CE1  . PHE C 1 156 ? 96.661  48.137  75.394  1.00 0.00 ? 160 PHE C CE1  1  
ATOM 7451   C CE2  . PHE C 1 156 ? 94.730  48.165  73.983  1.00 0.00 ? 160 PHE C CE2  1  
ATOM 7452   C CZ   . PHE C 1 156 ? 95.688  47.460  74.682  1.00 0.00 ? 160 PHE C CZ   1  
ATOM 7453   H H    . PHE C 1 156 ? 97.125  51.758  77.273  1.00 0.00 ? 160 PHE C H    1  
ATOM 7454   H HA   . PHE C 1 156 ? 95.443  53.327  75.958  1.00 0.00 ? 160 PHE C HA   1  
ATOM 7455   H HB2  . PHE C 1 156 ? 94.981  52.066  74.193  1.00 0.00 ? 160 PHE C HB2  1  
ATOM 7456   H HB3  . PHE C 1 156 ? 96.539  52.029  74.253  1.00 0.00 ? 160 PHE C HB3  1  
ATOM 7457   H HD1  . PHE C 1 156 ? 97.341  49.968  75.864  1.00 0.00 ? 160 PHE C HD1  1  
ATOM 7458   H HD2  . PHE C 1 156 ? 94.114  50.015  73.505  1.00 0.00 ? 160 PHE C HD2  1  
ATOM 7459   H HE1  . PHE C 1 156 ? 97.306  47.663  75.868  1.00 0.00 ? 160 PHE C HE1  1  
ATOM 7460   H HE2  . PHE C 1 156 ? 94.073  47.711  73.506  1.00 0.00 ? 160 PHE C HE2  1  
ATOM 7461   H HZ   . PHE C 1 156 ? 95.680  46.531  74.674  1.00 0.00 ? 160 PHE C HZ   1  
ATOM 7462   N N    . GLN C 1 157 ? 93.420  51.810  76.609  1.00 0.00 ? 161 GLN C N    1  
ATOM 7463   C CA   . GLN C 1 157 ? 92.370  50.824  76.868  1.00 0.00 ? 161 GLN C CA   1  
ATOM 7464   C C    . GLN C 1 157 ? 91.425  50.895  75.676  1.00 0.00 ? 161 GLN C C    1  
ATOM 7465   O O    . GLN C 1 157 ? 90.462  51.663  75.710  1.00 0.00 ? 161 GLN C O    1  
ATOM 7466   C CB   . GLN C 1 157 ? 91.636  51.103  78.173  1.00 0.00 ? 161 GLN C CB   1  
ATOM 7467   C CG   . GLN C 1 157 ? 92.435  50.689  79.395  1.00 0.00 ? 161 GLN C CG   1  
ATOM 7468   C CD   . GLN C 1 157 ? 91.570  50.184  80.534  1.00 0.00 ? 161 GLN C CD   1  
ATOM 7469   O OE1  . GLN C 1 157 ? 90.377  50.478  80.609  1.00 0.00 ? 161 GLN C OE1  1  
ATOM 7470   N NE2  . GLN C 1 157 ? 92.177  49.425  81.437  1.00 0.00 ? 161 GLN C NE2  1  
ATOM 7471   H H    . GLN C 1 157 ? 93.136  52.520  76.214  1.00 0.00 ? 161 GLN C H    1  
ATOM 7472   H HA   . GLN C 1 157 ? 92.749  49.937  76.969  1.00 0.00 ? 161 GLN C HA   1  
ATOM 7473   H HB2  . GLN C 1 157 ? 91.433  52.049  78.230  1.00 0.00 ? 161 GLN C HB2  1  
ATOM 7474   H HB3  . GLN C 1 157 ? 90.789  50.631  78.170  1.00 0.00 ? 161 GLN C HB3  1  
ATOM 7475   H HG2  . GLN C 1 157 ? 93.064  49.996  79.143  1.00 0.00 ? 161 GLN C HG2  1  
ATOM 7476   H HG3  . GLN C 1 157 ? 92.957  51.447  79.704  1.00 0.00 ? 161 GLN C HG3  1  
ATOM 7477   H HE21 . GLN C 1 157 ? 93.013  49.240  81.352  1.00 0.00 ? 161 GLN C HE21 1  
ATOM 7478   H HE22 . GLN C 1 157 ? 91.736  49.117  82.108  1.00 0.00 ? 161 GLN C HE22 1  
ATOM 7479   N N    . GLN C 1 158 ? 91.691  50.096  74.630  1.00 0.00 ? 162 GLN C N    1  
ATOM 7480   C CA   . GLN C 1 158 ? 91.008  50.316  73.354  1.00 0.00 ? 162 GLN C CA   1  
ATOM 7481   C C    . GLN C 1 158 ? 89.991  49.225  72.997  1.00 0.00 ? 162 GLN C C    1  
ATOM 7482   O O    . GLN C 1 158 ? 89.053  49.529  72.244  1.00 0.00 ? 162 GLN C O    1  
ATOM 7483   C CB   . GLN C 1 158 ? 92.034  50.549  72.238  1.00 0.00 ? 162 GLN C CB   1  
ATOM 7484   C CG   . GLN C 1 158 ? 91.553  51.416  71.095  1.00 0.00 ? 162 GLN C CG   1  
ATOM 7485   C CD   . GLN C 1 158 ? 92.672  52.246  70.504  1.00 0.00 ? 162 GLN C CD   1  
ATOM 7486   O OE1  . GLN C 1 158 ? 93.817  51.799  70.435  1.00 0.00 ? 162 GLN C OE1  1  
ATOM 7487   N NE2  . GLN C 1 158 ? 92.351  53.458  70.074  1.00 0.00 ? 162 GLN C NE2  1  
ATOM 7488   H H    . GLN C 1 158 ? 92.247  49.440  74.640  1.00 0.00 ? 162 GLN C H    1  
ATOM 7489   H HA   . GLN C 1 158 ? 90.474  51.120  73.455  1.00 0.00 ? 162 GLN C HA   1  
ATOM 7490   H HB2  . GLN C 1 158 ? 92.826  50.956  72.624  1.00 0.00 ? 162 GLN C HB2  1  
ATOM 7491   H HB3  . GLN C 1 158 ? 92.304  49.689  71.880  1.00 0.00 ? 162 GLN C HB3  1  
ATOM 7492   H HG2  . GLN C 1 158 ? 91.166  50.856  70.405  1.00 0.00 ? 162 GLN C HG2  1  
ATOM 7493   H HG3  . GLN C 1 158 ? 90.848  52.003  71.411  1.00 0.00 ? 162 GLN C HG3  1  
ATOM 7494   H HE21 . GLN C 1 158 ? 91.540  53.736  70.138  1.00 0.00 ? 162 GLN C HE21 1  
ATOM 7495   H HE22 . GLN C 1 158 ? 92.955  53.965  69.730  1.00 0.00 ? 162 GLN C HE22 1  
ATOM 7496   N N    . PRO C 1 159 ? 90.087  47.973  73.481  1.00 0.00 ? 163 PRO C N    1  
ATOM 7497   C CA   . PRO C 1 159 ? 88.965  47.052  73.233  1.00 0.00 ? 163 PRO C CA   1  
ATOM 7498   C C    . PRO C 1 159 ? 87.765  47.291  74.130  1.00 0.00 ? 163 PRO C C    1  
ATOM 7499   O O    . PRO C 1 159 ? 86.837  46.471  74.121  1.00 0.00 ? 163 PRO C O    1  
ATOM 7500   C CB   . PRO C 1 159 ? 89.595  45.661  73.421  1.00 0.00 ? 163 PRO C CB   1  
ATOM 7501   C CG   . PRO C 1 159 ? 91.049  45.872  73.365  1.00 0.00 ? 163 PRO C CG   1  
ATOM 7502   C CD   . PRO C 1 159 ? 91.237  47.205  73.998  1.00 0.00 ? 163 PRO C CD   1  
ATOM 7503   H HA   . PRO C 1 159 ? 88.617  47.165  72.334  1.00 0.00 ? 163 PRO C HA   1  
ATOM 7504   H HB2  . PRO C 1 159 ? 89.332  45.272  74.269  1.00 0.00 ? 163 PRO C HB2  1  
ATOM 7505   H HB3  . PRO C 1 159 ? 89.304  45.050  72.726  1.00 0.00 ? 163 PRO C HB3  1  
ATOM 7506   H HG2  . PRO C 1 159 ? 91.529  45.179  73.845  1.00 0.00 ? 163 PRO C HG2  1  
ATOM 7507   H HG3  . PRO C 1 159 ? 91.375  45.862  72.451  1.00 0.00 ? 163 PRO C HG3  1  
ATOM 7508   H HD2  . PRO C 1 159 ? 91.228  47.150  74.967  1.00 0.00 ? 163 PRO C HD2  1  
ATOM 7509   H HD3  . PRO C 1 159 ? 92.083  47.609  73.746  1.00 0.00 ? 163 PRO C HD3  1  
ATOM 7510   N N    . GLY C 1 160 ? 87.762  48.360  74.921  1.00 0.00 ? 164 GLY C N    1  
ATOM 7511   C CA   . GLY C 1 160 ? 86.723  48.528  75.915  1.00 0.00 ? 164 GLY C CA   1  
ATOM 7512   C C    . GLY C 1 160 ? 86.847  47.769  77.221  1.00 0.00 ? 164 GLY C C    1  
ATOM 7513   O O    . GLY C 1 160 ? 86.287  46.675  77.333  1.00 0.00 ? 164 GLY C O    1  
ATOM 7514   H H    . GLY C 1 160 ? 88.346  48.990  74.894  1.00 0.00 ? 164 GLY C H    1  
ATOM 7515   H HA2  . GLY C 1 160 ? 86.666  49.473  76.126  1.00 0.00 ? 164 GLY C HA2  1  
ATOM 7516   H HA3  . GLY C 1 160 ? 85.879  48.277  75.507  1.00 0.00 ? 164 GLY C HA3  1  
ATOM 7517   N N    . GLN C 1 161 ? 87.585  48.293  78.204  1.00 0.00 ? 165 GLN C N    1  
ATOM 7518   C CA   . GLN C 1 161 ? 87.644  47.620  79.499  1.00 0.00 ? 165 GLN C CA   1  
ATOM 7519   C C    . GLN C 1 161 ? 86.724  48.296  80.505  1.00 0.00 ? 165 GLN C C    1  
ATOM 7520   O O    . GLN C 1 161 ? 87.196  48.896  81.479  1.00 0.00 ? 165 GLN C O    1  
ATOM 7521   C CB   . GLN C 1 161 ? 89.076  47.582  80.030  1.00 0.00 ? 165 GLN C CB   1  
ATOM 7522   C CG   . GLN C 1 161 ? 89.984  46.691  79.209  1.00 0.00 ? 165 GLN C CG   1  
ATOM 7523   C CD   . GLN C 1 161 ? 90.391  47.342  77.902  1.00 0.00 ? 165 GLN C CD   1  
ATOM 7524   O OE1  . GLN C 1 161 ? 91.307  48.161  77.862  1.00 0.00 ? 165 GLN C OE1  1  
ATOM 7525   N NE2  . GLN C 1 161 ? 89.716  46.969  76.822  1.00 0.00 ? 165 GLN C NE2  1  
ATOM 7526   H H    . GLN C 1 161 ? 88.047  49.016  78.144  1.00 0.00 ? 165 GLN C H    1  
ATOM 7527   H HA   . GLN C 1 161 ? 87.341  46.707  79.373  1.00 0.00 ? 165 GLN C HA   1  
ATOM 7528   H HB2  . GLN C 1 161 ? 89.437  48.483  80.040  1.00 0.00 ? 165 GLN C HB2  1  
ATOM 7529   H HB3  . GLN C 1 161 ? 89.068  47.270  80.948  1.00 0.00 ? 165 GLN C HB3  1  
ATOM 7530   H HG2  . GLN C 1 161 ? 90.778  46.479  79.724  1.00 0.00 ? 165 GLN C HG2  1  
ATOM 7531   H HG3  . GLN C 1 161 ? 89.532  45.853  79.026  1.00 0.00 ? 165 GLN C HG3  1  
ATOM 7532   H HE21 . GLN C 1 161 ? 89.082  46.393  76.889  1.00 0.00 ? 165 GLN C HE21 1  
ATOM 7533   H HE22 . GLN C 1 161 ? 89.914  47.303  76.054  1.00 0.00 ? 165 GLN C HE22 1  
ATOM 7534   N N    . THR C 1 162 ? 85.407  48.186  80.283  1.00 0.00 ? 166 THR C N    1  
ATOM 7535   C CA   . THR C 1 162 ? 84.339  48.687  81.165  1.00 0.00 ? 166 THR C CA   1  
ATOM 7536   C C    . THR C 1 162 ? 84.804  49.877  82.003  1.00 0.00 ? 166 THR C C    1  
ATOM 7537   O O    . THR C 1 162 ? 85.049  49.764  83.204  1.00 0.00 ? 166 THR C O    1  
ATOM 7538   C CB   . THR C 1 162 ? 83.788  47.579  82.075  1.00 0.00 ? 166 THR C CB   1  
ATOM 7539   O OG1  . THR C 1 162 ? 83.244  46.517  81.281  1.00 0.00 ? 166 THR C OG1  1  
ATOM 7540   C CG2  . THR C 1 162 ? 82.700  48.122  82.971  1.00 0.00 ? 166 THR C CG2  1  
ATOM 7541   H H    . THR C 1 162 ? 85.097  47.798  79.580  1.00 0.00 ? 166 THR C H    1  
ATOM 7542   H HA   . THR C 1 162 ? 83.623  48.989  80.586  1.00 0.00 ? 166 THR C HA   1  
ATOM 7543   H HB   . THR C 1 162 ? 84.517  47.244  82.620  1.00 0.00 ? 166 THR C HB   1  
ATOM 7544   H HG1  . THR C 1 162 ? 83.805  45.894  81.225  1.00 0.00 ? 166 THR C HG1  1  
ATOM 7545   H HG21 . THR C 1 162 ? 83.227  48.533  83.674  1.00 0.00 ? 166 THR C HG21 1  
ATOM 7546   H HG22 . THR C 1 162 ? 83.061  48.833  83.524  1.00 0.00 ? 166 THR C HG22 1  
ATOM 7547   H HG23 . THR C 1 162 ? 81.977  48.472  82.427  1.00 0.00 ? 166 THR C HG23 1  
ATOM 7548   N N    . THR C 1 163 ? 84.949  51.028  81.355  1.00 0.00 ? 167 THR C N    1  
ATOM 7549   C CA   . THR C 1 163 ? 85.637  52.136  81.993  1.00 0.00 ? 167 THR C CA   1  
ATOM 7550   C C    . THR C 1 163 ? 84.611  53.076  82.613  1.00 0.00 ? 167 THR C C    1  
ATOM 7551   O O    . THR C 1 163 ? 83.427  53.041  82.268  1.00 0.00 ? 167 THR C O    1  
ATOM 7552   C CB   . THR C 1 163 ? 86.502  52.898  80.981  1.00 0.00 ? 167 THR C CB   1  
ATOM 7553   O OG1  . THR C 1 163 ? 86.892  52.015  79.926  1.00 0.00 ? 167 THR C OG1  1  
ATOM 7554   C CG2  . THR C 1 163 ? 87.779  53.341  81.631  1.00 0.00 ? 167 THR C CG2  1  
ATOM 7555   H H    . THR C 1 163 ? 84.662  51.185  80.559  1.00 0.00 ? 167 THR C H    1  
ATOM 7556   H HA   . THR C 1 163 ? 86.220  51.786  82.685  1.00 0.00 ? 167 THR C HA   1  
ATOM 7557   H HB   . THR C 1 163 ? 85.987  53.651  80.653  1.00 0.00 ? 167 THR C HB   1  
ATOM 7558   H HG1  . THR C 1 163 ? 86.645  52.332  79.189  1.00 0.00 ? 167 THR C HG1  1  
ATOM 7559   H HG21 . THR C 1 163 ? 88.213  53.766  80.875  1.00 0.00 ? 167 THR C HG21 1  
ATOM 7560   H HG22 . THR C 1 163 ? 87.575  53.923  82.380  1.00 0.00 ? 167 THR C HG22 1  
ATOM 7561   H HG23 . THR C 1 163 ? 88.267  52.565  81.948  1.00 0.00 ? 167 THR C HG23 1  
ATOM 7562   N N    . GLY C 1 164 ? 85.076  53.912  83.541  1.00 0.00 ? 168 GLY C N    1  
ATOM 7563   C CA   . GLY C 1 164 ? 84.264  54.973  84.103  1.00 0.00 ? 168 GLY C CA   1  
ATOM 7564   C C    . GLY C 1 164 ? 85.038  56.264  84.276  1.00 0.00 ? 168 GLY C C    1  
ATOM 7565   O O    . GLY C 1 164 ? 86.016  56.503  83.563  1.00 0.00 ? 168 GLY C O    1  
ATOM 7566   H H    . GLY C 1 164 ? 85.874  53.875  83.859  1.00 0.00 ? 168 GLY C H    1  
ATOM 7567   H HA2  . GLY C 1 164 ? 83.500  55.132  83.527  1.00 0.00 ? 168 GLY C HA2  1  
ATOM 7568   H HA3  . GLY C 1 164 ? 83.917  54.690  84.963  1.00 0.00 ? 168 GLY C HA3  1  
ATOM 7569   N N    . GLU C 1 165 ? 84.607  57.101  85.223  1.00 0.00 ? 169 GLU C N    1  
ATOM 7570   C CA   . GLU C 1 165 ? 85.248  58.397  85.439  1.00 0.00 ? 169 GLU C CA   1  
ATOM 7571   C C    . GLU C 1 165 ? 86.656  58.235  86.001  1.00 0.00 ? 169 GLU C C    1  
ATOM 7572   O O    . GLU C 1 165 ? 87.493  59.134  85.872  1.00 0.00 ? 169 GLU C O    1  
ATOM 7573   C CB   . GLU C 1 165 ? 84.390  59.252  86.377  1.00 0.00 ? 169 GLU C CB   1  
ATOM 7574   C CG   . GLU C 1 165 ? 84.001  60.641  85.855  1.00 0.00 ? 169 GLU C CG   1  
ATOM 7575   C CD   . GLU C 1 165 ? 82.727  60.656  85.036  1.00 0.00 ? 169 GLU C CD   1  
ATOM 7576   O OE1  . GLU C 1 165 ? 82.610  61.525  84.149  1.00 0.00 ? 169 GLU C OE1  1  
ATOM 7577   O OE2  . GLU C 1 165 ? 81.841  59.813  85.285  1.00 0.00 ? 169 GLU C OE2  1  
ATOM 7578   H H    . GLU C 1 165 ? 83.947  56.937  85.749  1.00 0.00 ? 169 GLU C H    1  
ATOM 7579   H HA   . GLU C 1 165 ? 85.327  58.844  84.581  1.00 0.00 ? 169 GLU C HA   1  
ATOM 7580   H HB2  . GLU C 1 165 ? 83.577  58.763  86.577  1.00 0.00 ? 169 GLU C HB2  1  
ATOM 7581   H HB3  . GLU C 1 165 ? 84.868  59.362  87.213  1.00 0.00 ? 169 GLU C HB3  1  
ATOM 7582   H HG2  . GLU C 1 165 ? 83.897  61.243  86.610  1.00 0.00 ? 169 GLU C HG2  1  
ATOM 7583   H HG3  . GLU C 1 165 ? 84.727  60.988  85.314  1.00 0.00 ? 169 GLU C HG3  1  
ATOM 7584   N N    . ALA C 1 166 ? 86.923  57.096  86.650  1.00 0.00 ? 170 ALA C N    1  
ATOM 7585   C CA   . ALA C 1 166 ? 88.207  56.811  87.279  1.00 0.00 ? 170 ALA C CA   1  
ATOM 7586   C C    . ALA C 1 166 ? 89.213  56.418  86.209  1.00 0.00 ? 170 ALA C C    1  
ATOM 7587   O O    . ALA C 1 166 ? 88.822  56.005  85.113  1.00 0.00 ? 170 ALA C O    1  
ATOM 7588   C CB   . ALA C 1 166 ? 88.072  55.700  88.316  1.00 0.00 ? 170 ALA C CB   1  
ATOM 7589   H H    . ALA C 1 166 ? 86.350  56.460  86.736  1.00 0.00 ? 170 ALA C H    1  
ATOM 7590   H HA   . ALA C 1 166 ? 88.518  57.607  87.737  1.00 0.00 ? 170 ALA C HA   1  
ATOM 7591   H HB1  . ALA C 1 166 ? 88.845  55.708  88.903  1.00 0.00 ? 170 ALA C HB1  1  
ATOM 7592   H HB2  . ALA C 1 166 ? 87.267  55.841  88.839  1.00 0.00 ? 170 ALA C HB2  1  
ATOM 7593   H HB3  . ALA C 1 166 ? 88.018  54.842  87.865  1.00 0.00 ? 170 ALA C HB3  1  
ATOM 7594   N N    . PRO C 1 167 ? 90.501  56.479  86.509  1.00 0.00 ? 171 PRO C N    1  
ATOM 7595   C CA   . PRO C 1 167 ? 91.519  56.630  85.468  1.00 0.00 ? 171 PRO C CA   1  
ATOM 7596   C C    . PRO C 1 167 ? 91.930  55.299  84.850  1.00 0.00 ? 171 PRO C C    1  
ATOM 7597   O O    . PRO C 1 167 ? 92.645  55.233  83.854  1.00 0.00 ? 171 PRO C O    1  
ATOM 7598   C CB   . PRO C 1 167 ? 92.692  57.212  86.243  1.00 0.00 ? 171 PRO C CB   1  
ATOM 7599   C CG   . PRO C 1 167 ? 92.557  56.627  87.598  1.00 0.00 ? 171 PRO C CG   1  
ATOM 7600   C CD   . PRO C 1 167 ? 91.090  56.472  87.861  1.00 0.00 ? 171 PRO C CD   1  
ATOM 7601   H HA   . PRO C 1 167 ? 91.207  57.157  84.717  1.00 0.00 ? 171 PRO C HA   1  
ATOM 7602   H HB2  . PRO C 1 167 ? 93.540  56.972  85.836  1.00 0.00 ? 171 PRO C HB2  1  
ATOM 7603   H HB3  . PRO C 1 167 ? 92.654  58.180  86.270  1.00 0.00 ? 171 PRO C HB3  1  
ATOM 7604   H HG2  . PRO C 1 167 ? 93.007  55.769  87.649  1.00 0.00 ? 171 PRO C HG2  1  
ATOM 7605   H HG3  . PRO C 1 167 ? 92.966  57.202  88.263  1.00 0.00 ? 171 PRO C HG3  1  
ATOM 7606   H HD2  . PRO C 1 167 ? 90.897  55.646  88.332  1.00 0.00 ? 171 PRO C HD2  1  
ATOM 7607   H HD3  . PRO C 1 167 ? 90.745  57.196  88.406  1.00 0.00 ? 171 PRO C HD3  1  
ATOM 7608   N N    . GLY C 1 168 ? 91.458  54.225  85.483  1.00 0.00 ? 172 GLY C N    1  
ATOM 7609   C CA   . GLY C 1 168 ? 91.469  52.903  84.888  1.00 0.00 ? 172 GLY C CA   1  
ATOM 7610   C C    . GLY C 1 168 ? 90.495  51.887  85.445  1.00 0.00 ? 172 GLY C C    1  
ATOM 7611   O O    . GLY C 1 168 ? 90.745  51.316  86.510  1.00 0.00 ? 172 GLY C O    1  
ATOM 7612   H H    . GLY C 1 168 ? 91.121  54.250  86.274  1.00 0.00 ? 172 GLY C H    1  
ATOM 7613   H HA2  . GLY C 1 168 ? 91.293  52.999  83.939  1.00 0.00 ? 172 GLY C HA2  1  
ATOM 7614   H HA3  . GLY C 1 168 ? 92.365  52.541  84.976  1.00 0.00 ? 172 GLY C HA3  1  
ATOM 7615   N N    . THR C 1 169 ? 89.384  51.646  84.757  1.00 0.00 ? 173 THR C N    1  
ATOM 7616   C CA   . THR C 1 169 ? 88.508  50.544  85.120  1.00 0.00 ? 173 THR C CA   1  
ATOM 7617   C C    . THR C 1 169 ? 88.854  49.314  84.292  1.00 0.00 ? 173 THR C C    1  
ATOM 7618   O O    . THR C 1 169 ? 89.545  49.389  83.273  1.00 0.00 ? 173 THR C O    1  
ATOM 7619   C CB   . THR C 1 169 ? 87.026  50.901  84.940  1.00 0.00 ? 173 THR C CB   1  
ATOM 7620   O OG1  . THR C 1 169 ? 86.882  52.325  84.925  1.00 0.00 ? 173 THR C OG1  1  
ATOM 7621   C CG2  . THR C 1 169 ? 86.200  50.369  86.086  1.00 0.00 ? 173 THR C CG2  1  
ATOM 7622   H H    . THR C 1 169 ? 89.122  52.108  84.081  1.00 0.00 ? 173 THR C H    1  
ATOM 7623   H HA   . THR C 1 169 ? 88.648  50.355  86.061  1.00 0.00 ? 173 THR C HA   1  
ATOM 7624   H HB   . THR C 1 169 ? 86.720  50.507  84.109  1.00 0.00 ? 173 THR C HB   1  
ATOM 7625   H HG1  . THR C 1 169 ? 86.071  52.526  85.011  1.00 0.00 ? 173 THR C HG1  1  
ATOM 7626   H HG21 . THR C 1 169 ? 85.320  50.549  85.721  1.00 0.00 ? 173 THR C HG21 1  
ATOM 7627   H HG22 . THR C 1 169 ? 86.285  49.403  86.125  1.00 0.00 ? 173 THR C HG22 1  
ATOM 7628   H HG23 . THR C 1 169 ? 86.515  50.754  86.918  1.00 0.00 ? 173 THR C HG23 1  
ATOM 7629   N N    . VAL C 1 170 ? 88.364  48.173  84.762  1.00 0.00 ? 174 VAL C N    1  
ATOM 7630   C CA   . VAL C 1 170 ? 88.549  46.884  84.102  1.00 0.00 ? 174 VAL C CA   1  
ATOM 7631   C C    . VAL C 1 170 ? 87.174  46.304  83.786  1.00 0.00 ? 174 VAL C C    1  
ATOM 7632   O O    . VAL C 1 170 ? 86.162  46.830  84.275  1.00 0.00 ? 174 VAL C O    1  
ATOM 7633   C CB   . VAL C 1 170 ? 89.394  45.947  84.979  1.00 0.00 ? 174 VAL C CB   1  
ATOM 7634   C CG1  . VAL C 1 170 ? 90.598  46.691  85.508  1.00 0.00 ? 174 VAL C CG1  1  
ATOM 7635   C CG2  . VAL C 1 170 ? 88.573  45.413  86.131  1.00 0.00 ? 174 VAL C CG2  1  
ATOM 7636   H H    . VAL C 1 170 ? 87.906  48.124  85.488  1.00 0.00 ? 174 VAL C H    1  
ATOM 7637   H HA   . VAL C 1 170 ? 89.036  46.993  83.271  1.00 0.00 ? 174 VAL C HA   1  
ATOM 7638   H HB   . VAL C 1 170 ? 89.690  45.199  84.439  1.00 0.00 ? 174 VAL C HB   1  
ATOM 7639   H HG11 . VAL C 1 170 ? 90.525  46.781  86.471  1.00 0.00 ? 174 VAL C HG11 1  
ATOM 7640   H HG12 . VAL C 1 170 ? 91.405  46.199  85.290  1.00 0.00 ? 174 VAL C HG12 1  
ATOM 7641   H HG13 . VAL C 1 170 ? 90.638  47.572  85.103  1.00 0.00 ? 174 VAL C HG13 1  
ATOM 7642   H HG21 . VAL C 1 170 ? 89.164  45.125  86.844  1.00 0.00 ? 174 VAL C HG21 1  
ATOM 7643   H HG22 . VAL C 1 170 ? 87.985  46.111  86.460  1.00 0.00 ? 174 VAL C HG22 1  
ATOM 7644   H HG23 . VAL C 1 170 ? 88.042  44.660  85.828  1.00 0.00 ? 174 VAL C HG23 1  
ATOM 7645   N N    . PRO C 1 171 ? 87.074  45.249  82.951  1.00 0.00 ? 175 PRO C N    1  
ATOM 7646   C CA   . PRO C 1 171 ? 85.750  44.686  82.646  1.00 0.00 ? 175 PRO C CA   1  
ATOM 7647   C C    . PRO C 1 171 ? 85.186  43.912  83.820  1.00 0.00 ? 175 PRO C C    1  
ATOM 7648   O O    . PRO C 1 171 ? 85.683  42.829  84.145  1.00 0.00 ? 175 PRO C O    1  
ATOM 7649   C CB   . PRO C 1 171 ? 86.042  43.675  81.530  1.00 0.00 ? 175 PRO C CB   1  
ATOM 7650   C CG   . PRO C 1 171 ? 87.333  44.097  80.959  1.00 0.00 ? 175 PRO C CG   1  
ATOM 7651   C CD   . PRO C 1 171 ? 88.116  44.687  82.074  1.00 0.00 ? 175 PRO C CD   1  
ATOM 7652   H HA   . PRO C 1 171 ? 85.092  45.371  82.451  1.00 0.00 ? 175 PRO C HA   1  
ATOM 7653   H HB2  . PRO C 1 171 ? 86.091  42.771  81.879  1.00 0.00 ? 175 PRO C HB2  1  
ATOM 7654   H HB3  . PRO C 1 171 ? 85.343  43.681  80.858  1.00 0.00 ? 175 PRO C HB3  1  
ATOM 7655   H HG2  . PRO C 1 171 ? 87.801  43.343  80.570  1.00 0.00 ? 175 PRO C HG2  1  
ATOM 7656   H HG3  . PRO C 1 171 ? 87.201  44.746  80.250  1.00 0.00 ? 175 PRO C HG3  1  
ATOM 7657   H HD2  . PRO C 1 171 ? 88.649  44.017  82.532  1.00 0.00 ? 175 PRO C HD2  1  
ATOM 7658   H HD3  . PRO C 1 171 ? 88.730  45.370  81.760  1.00 0.00 ? 175 PRO C HD3  1  
ATOM 7659   N N    . ALA C 1 172 ? 84.138  44.469  84.427  1.00 0.00 ? 176 ALA C N    1  
ATOM 7660   C CA   . ALA C 1 172 ? 83.535  44.001  85.677  1.00 0.00 ? 176 ALA C CA   1  
ATOM 7661   C C    . ALA C 1 172 ? 84.539  43.959  86.825  1.00 0.00 ? 176 ALA C C    1  
ATOM 7662   O O    . ALA C 1 172 ? 85.415  44.815  86.927  1.00 0.00 ? 176 ALA C O    1  
ATOM 7663   C CB   . ALA C 1 172 ? 82.876  42.628  85.488  1.00 0.00 ? 176 ALA C CB   1  
ATOM 7664   H H    . ALA C 1 172 ? 83.741  45.161  84.108  1.00 0.00 ? 176 ALA C H    1  
ATOM 7665   H HA   . ALA C 1 172 ? 82.851  44.645  85.916  1.00 0.00 ? 176 ALA C HA   1  
ATOM 7666   H HB1  . ALA C 1 172 ? 83.065  42.068  86.257  1.00 0.00 ? 176 ALA C HB1  1  
ATOM 7667   H HB2  . ALA C 1 172 ? 81.916  42.738  85.398  1.00 0.00 ? 176 ALA C HB2  1  
ATOM 7668   H HB3  . ALA C 1 172 ? 83.228  42.207  84.688  1.00 0.00 ? 176 ALA C HB3  1  
ATOM 7669   N N    . PRO D 1 1   ? 122.689 102.923 94.853  1.00 0.00 ? 5   PRO D N    1  
ATOM 7670   C CA   . PRO D 1 1   ? 122.854 102.767 96.301  1.00 0.00 ? 5   PRO D CA   1  
ATOM 7671   C C    . PRO D 1 1   ? 123.154 101.278 96.430  1.00 0.00 ? 5   PRO D C    1  
ATOM 7672   O O    . PRO D 1 1   ? 123.671 100.673 95.492  1.00 0.00 ? 5   PRO D O    1  
ATOM 7673   C CB   . PRO D 1 1   ? 121.504 103.226 96.856  1.00 0.00 ? 5   PRO D CB   1  
ATOM 7674   C CG   . PRO D 1 1   ? 120.541 103.003 95.744  1.00 0.00 ? 5   PRO D CG   1  
ATOM 7675   C CD   . PRO D 1 1   ? 121.306 103.272 94.488  1.00 0.00 ? 5   PRO D CD   1  
ATOM 7676   H HA   . PRO D 1 1   ? 123.611 103.205 96.721  1.00 0.00 ? 5   PRO D HA   1  
ATOM 7677   H HB2  . PRO D 1 1   ? 121.256 102.717 97.644  1.00 0.00 ? 5   PRO D HB2  1  
ATOM 7678   H HB3  . PRO D 1 1   ? 121.530 104.159 97.118  1.00 0.00 ? 5   PRO D HB3  1  
ATOM 7679   H HG2  . PRO D 1 1   ? 120.199 102.096 95.756  1.00 0.00 ? 5   PRO D HG2  1  
ATOM 7680   H HG3  . PRO D 1 1   ? 119.777 103.595 95.821  1.00 0.00 ? 5   PRO D HG3  1  
ATOM 7681   H HD2  . PRO D 1 1   ? 120.984 102.733 93.749  1.00 0.00 ? 5   PRO D HD2  1  
ATOM 7682   H HD3  . PRO D 1 1   ? 121.232 104.200 94.215  1.00 0.00 ? 5   PRO D HD3  1  
ATOM 7683   N N    . ILE D 1 2   ? 122.838 100.698 97.584  1.00 0.00 ? 6   ILE D N    1  
ATOM 7684   C CA   . ILE D 1 2   ? 123.037 99.278  97.837  1.00 0.00 ? 6   ILE D CA   1  
ATOM 7685   C C    . ILE D 1 2   ? 121.884 98.525  97.193  1.00 0.00 ? 6   ILE D C    1  
ATOM 7686   O O    . ILE D 1 2   ? 120.715 98.892  97.370  1.00 0.00 ? 6   ILE D O    1  
ATOM 7687   C CB   . ILE D 1 2   ? 123.131 98.974  99.339  1.00 0.00 ? 6   ILE D CB   1  
ATOM 7688   C CG1  . ILE D 1 2   ? 124.050 99.985  100.025 1.00 0.00 ? 6   ILE D CG1  1  
ATOM 7689   C CG2  . ILE D 1 2   ? 123.652 97.574  99.564  1.00 0.00 ? 6   ILE D CG2  1  
ATOM 7690   C CD1  . ILE D 1 2   ? 123.707 100.401 101.485 1.00 0.00 ? 6   ILE D CD1  1  
ATOM 7691   H H    . ILE D 1 2   ? 122.497 101.125 98.249  1.00 0.00 ? 6   ILE D H    1  
ATOM 7692   H HA   . ILE D 1 2   ? 123.880 98.993  97.453  1.00 0.00 ? 6   ILE D HA   1  
ATOM 7693   H HB   . ILE D 1 2   ? 122.242 99.040  99.722  1.00 0.00 ? 6   ILE D HB   1  
ATOM 7694   H HG12 . ILE D 1 2   ? 124.949 99.622  100.021 1.00 0.00 ? 6   ILE D HG12 1  
ATOM 7695   H HG13 . ILE D 1 2   ? 124.066 100.789 99.482  1.00 0.00 ? 6   ILE D HG13 1  
ATOM 7696   H HG21 . ILE D 1 2   ? 123.942 97.197  98.718  1.00 0.00 ? 6   ILE D HG21 1  
ATOM 7697   H HG22 . ILE D 1 2   ? 124.403 97.604  100.178 1.00 0.00 ? 6   ILE D HG22 1  
ATOM 7698   H HG23 . ILE D 1 2   ? 122.948 97.023  99.940  1.00 0.00 ? 6   ILE D HG23 1  
ATOM 7699   H HD11 . ILE D 1 2   ? 123.073 99.770  101.861 1.00 0.00 ? 6   ILE D HD11 1  
ATOM 7700   H HD12 . ILE D 1 2   ? 124.516 100.402 102.019 1.00 0.00 ? 6   ILE D HD12 1  
ATOM 7701   H HD13 . ILE D 1 2   ? 123.318 101.289 101.486 1.00 0.00 ? 6   ILE D HD13 1  
ATOM 7702   N N    . MET D 1 3   ? 122.211 97.476  96.445  1.00 0.00 ? 7   MET D N    1  
ATOM 7703   C CA   . MET D 1 3   ? 121.226 96.694  95.720  1.00 0.00 ? 7   MET D CA   1  
ATOM 7704   C C    . MET D 1 3   ? 120.646 95.599  96.608  1.00 0.00 ? 7   MET D C    1  
ATOM 7705   O O    . MET D 1 3   ? 121.184 95.264  97.663  1.00 0.00 ? 7   MET D O    1  
ATOM 7706   C CB   . MET D 1 3   ? 121.854 96.081  94.470  1.00 0.00 ? 7   MET D CB   1  
ATOM 7707   C CG   . MET D 1 3   ? 121.361 96.667  93.156  1.00 0.00 ? 7   MET D CG   1  
ATOM 7708   S SD   . MET D 1 3   ? 120.793 98.370  93.283  1.00 0.00 ? 7   MET D SD   1  
ATOM 7709   C CE   . MET D 1 3   ? 122.344 99.258  93.398  1.00 0.00 ? 7   MET D CE   1  
ATOM 7710   H H    . MET D 1 3   ? 123.019 97.199  96.345  1.00 0.00 ? 7   MET D H    1  
ATOM 7711   H HA   . MET D 1 3   ? 120.505 97.285  95.451  1.00 0.00 ? 7   MET D HA   1  
ATOM 7712   H HB2  . MET D 1 3   ? 122.816 96.192  94.519  1.00 0.00 ? 7   MET D HB2  1  
ATOM 7713   H HB3  . MET D 1 3   ? 121.679 95.127  94.470  1.00 0.00 ? 7   MET D HB3  1  
ATOM 7714   H HG2  . MET D 1 3   ? 122.078 96.623  92.503  1.00 0.00 ? 7   MET D HG2  1  
ATOM 7715   H HG3  . MET D 1 3   ? 120.636 96.118  92.819  1.00 0.00 ? 7   MET D HG3  1  
ATOM 7716   H HE1  . MET D 1 3   ? 122.860 99.113  92.590  1.00 0.00 ? 7   MET D HE1  1  
ATOM 7717   H HE2  . MET D 1 3   ? 122.166 100.205 93.503  1.00 0.00 ? 7   MET D HE2  1  
ATOM 7718   H HE3  . MET D 1 3   ? 122.845 98.936  94.164  1.00 0.00 ? 7   MET D HE3  1  
ATOM 7719   N N    . GLY D 1 4   ? 119.533 95.023  96.151  1.00 0.00 ? 8   GLY D N    1  
ATOM 7720   C CA   . GLY D 1 4   ? 118.916 93.899  96.837  1.00 0.00 ? 8   GLY D CA   1  
ATOM 7721   C C    . GLY D 1 4   ? 119.775 92.652  96.898  1.00 0.00 ? 8   GLY D C    1  
ATOM 7722   O O    . GLY D 1 4   ? 119.692 91.910  97.882  1.00 0.00 ? 8   GLY D O    1  
ATOM 7723   H H    . GLY D 1 4   ? 119.121 95.273  95.439  1.00 0.00 ? 8   GLY D H    1  
ATOM 7724   H HA2  . GLY D 1 4   ? 118.695 94.170  97.743  1.00 0.00 ? 8   GLY D HA2  1  
ATOM 7725   H HA3  . GLY D 1 4   ? 118.082 93.682  96.394  1.00 0.00 ? 8   GLY D HA3  1  
ATOM 7726   N N    . GLN D 1 5   ? 120.582 92.405  95.870  1.00 0.00 ? 9   GLN D N    1  
ATOM 7727   C CA   . GLN D 1 5   ? 121.572 91.342  95.876  1.00 0.00 ? 9   GLN D CA   1  
ATOM 7728   C C    . GLN D 1 5   ? 122.836 91.731  96.625  1.00 0.00 ? 9   GLN D C    1  
ATOM 7729   O O    . GLN D 1 5   ? 123.600 90.847  97.026  1.00 0.00 ? 9   GLN D O    1  
ATOM 7730   C CB   . GLN D 1 5   ? 121.930 90.972  94.435  1.00 0.00 ? 9   GLN D CB   1  
ATOM 7731   C CG   . GLN D 1 5   ? 120.902 90.079  93.777  1.00 0.00 ? 9   GLN D CG   1  
ATOM 7732   C CD   . GLN D 1 5   ? 120.095 89.289  94.779  1.00 0.00 ? 9   GLN D CD   1  
ATOM 7733   O OE1  . GLN D 1 5   ? 120.513 88.222  95.225  1.00 0.00 ? 9   GLN D OE1  1  
ATOM 7734   N NE2  . GLN D 1 5   ? 118.923 89.802  95.132  1.00 0.00 ? 9   GLN D NE2  1  
ATOM 7735   H H    . GLN D 1 5   ? 120.567 92.859  95.141  1.00 0.00 ? 9   GLN D H    1  
ATOM 7736   H HA   . GLN D 1 5   ? 121.180 90.583  96.336  1.00 0.00 ? 9   GLN D HA   1  
ATOM 7737   H HB2  . GLN D 1 5   ? 122.027 91.783  93.912  1.00 0.00 ? 9   GLN D HB2  1  
ATOM 7738   H HB3  . GLN D 1 5   ? 122.791 90.524  94.427  1.00 0.00 ? 9   GLN D HB3  1  
ATOM 7739   H HG2  . GLN D 1 5   ? 120.303 90.621  93.240  1.00 0.00 ? 9   GLN D HG2  1  
ATOM 7740   H HG3  . GLN D 1 5   ? 121.349 89.467  93.172  1.00 0.00 ? 9   GLN D HG3  1  
ATOM 7741   H HE21 . GLN D 1 5   ? 118.663 90.551  94.798  1.00 0.00 ? 9   GLN D HE21 1  
ATOM 7742   H HE22 . GLN D 1 5   ? 118.423 89.386  95.694  1.00 0.00 ? 9   GLN D HE22 1  
ATOM 7743   N N    . ASP D 1 6   ? 123.055 93.029  96.839  1.00 0.00 ? 10  ASP D N    1  
ATOM 7744   C CA   . ASP D 1 6   ? 124.307 93.527  97.392  1.00 0.00 ? 10  ASP D CA   1  
ATOM 7745   C C    . ASP D 1 6   ? 124.546 93.128  98.839  1.00 0.00 ? 10  ASP D C    1  
ATOM 7746   O O    . ASP D 1 6   ? 125.676 92.771  99.171  1.00 0.00 ? 10  ASP D O    1  
ATOM 7747   C CB   . ASP D 1 6   ? 124.368 95.055  97.295  1.00 0.00 ? 10  ASP D CB   1  
ATOM 7748   C CG   . ASP D 1 6   ? 125.761 95.572  96.992  1.00 0.00 ? 10  ASP D CG   1  
ATOM 7749   O OD1  . ASP D 1 6   ? 126.602 95.602  97.915  1.00 0.00 ? 10  ASP D OD1  1  
ATOM 7750   O OD2  . ASP D 1 6   ? 126.007 95.971  95.834  1.00 0.00 ? 10  ASP D OD2  1  
ATOM 7751   H H    . ASP D 1 6   ? 122.479 93.643  96.666  1.00 0.00 ? 10  ASP D H    1  
ATOM 7752   H HA   . ASP D 1 6   ? 125.003 93.115  96.857  1.00 0.00 ? 10  ASP D HA   1  
ATOM 7753   H HB2  . ASP D 1 6   ? 123.759 95.355  96.602  1.00 0.00 ? 10  ASP D HB2  1  
ATOM 7754   H HB3  . ASP D 1 6   ? 124.060 95.440  98.130  1.00 0.00 ? 10  ASP D HB3  1  
ATOM 7755   N N    . VAL D 1 7   ? 123.546 93.201  99.712  1.00 0.00 ? 11  VAL D N    1  
ATOM 7756   C CA   . VAL D 1 7   ? 123.715 92.874  101.125 1.00 0.00 ? 11  VAL D CA   1  
ATOM 7757   C C    . VAL D 1 7   ? 123.369 91.408  101.312 1.00 0.00 ? 11  VAL D C    1  
ATOM 7758   O O    . VAL D 1 7   ? 122.218 91.010  101.096 1.00 0.00 ? 11  VAL D O    1  
ATOM 7759   C CB   . VAL D 1 7   ? 122.829 93.745  102.027 1.00 0.00 ? 11  VAL D CB   1  
ATOM 7760   C CG1  . VAL D 1 7   ? 123.108 93.437  103.487 1.00 0.00 ? 11  VAL D CG1  1  
ATOM 7761   C CG2  . VAL D 1 7   ? 123.025 95.215  101.736 1.00 0.00 ? 11  VAL D CG2  1  
ATOM 7762   H H    . VAL D 1 7   ? 122.748 93.441  99.500  1.00 0.00 ? 11  VAL D H    1  
ATOM 7763   H HA   . VAL D 1 7   ? 124.633 93.049  101.381 1.00 0.00 ? 11  VAL D HA   1  
ATOM 7764   H HB   . VAL D 1 7   ? 121.902 93.533  101.839 1.00 0.00 ? 11  VAL D HB   1  
ATOM 7765   H HG11 . VAL D 1 7   ? 122.560 94.008  104.048 1.00 0.00 ? 11  VAL D HG11 1  
ATOM 7766   H HG12 . VAL D 1 7   ? 122.896 92.508  103.668 1.00 0.00 ? 11  VAL D HG12 1  
ATOM 7767   H HG13 . VAL D 1 7   ? 124.044 93.599  103.678 1.00 0.00 ? 11  VAL D HG13 1  
ATOM 7768   H HG21 . VAL D 1 7   ? 123.969 95.399  101.618 1.00 0.00 ? 11  VAL D HG21 1  
ATOM 7769   H HG22 . VAL D 1 7   ? 122.546 95.451  100.927 1.00 0.00 ? 11  VAL D HG22 1  
ATOM 7770   H HG23 . VAL D 1 7   ? 122.684 95.740  102.477 1.00 0.00 ? 11  VAL D HG23 1  
ATOM 7771   N N    . LYS D 1 8   ? 124.350 90.604  101.718 1.00 0.00 ? 12  LYS D N    1  
ATOM 7772   C CA   . LYS D 1 8   ? 124.088 89.198  102.000 1.00 0.00 ? 12  LYS D CA   1  
ATOM 7773   C C    . LYS D 1 8   ? 124.551 88.841  103.405 1.00 0.00 ? 12  LYS D C    1  
ATOM 7774   O O    . LYS D 1 8   ? 125.403 89.510  103.996 1.00 0.00 ? 12  LYS D O    1  
ATOM 7775   C CB   . LYS D 1 8   ? 124.727 88.267  100.956 1.00 0.00 ? 12  LYS D CB   1  
ATOM 7776   C CG   . LYS D 1 8   ? 123.798 87.124  100.559 1.00 0.00 ? 12  LYS D CG   1  
ATOM 7777   C CD   . LYS D 1 8   ? 124.275 86.333  99.364  1.00 0.00 ? 12  LYS D CD   1  
ATOM 7778   C CE   . LYS D 1 8   ? 123.968 87.055  98.076  1.00 0.00 ? 12  LYS D CE   1  
ATOM 7779   N NZ   . LYS D 1 8   ? 124.777 86.503  96.959  1.00 0.00 ? 12  LYS D NZ   1  
ATOM 7780   H H    . LYS D 1 8   ? 125.166 90.851  101.835 1.00 0.00 ? 12  LYS D H    1  
ATOM 7781   H HA   . LYS D 1 8   ? 123.129 89.066  101.946 1.00 0.00 ? 12  LYS D HA   1  
ATOM 7782   H HB2  . LYS D 1 8   ? 124.960 88.781  100.167 1.00 0.00 ? 12  LYS D HB2  1  
ATOM 7783   H HB3  . LYS D 1 8   ? 125.553 87.902  101.312 1.00 0.00 ? 12  LYS D HB3  1  
ATOM 7784   H HG2  . LYS D 1 8   ? 123.698 86.523  101.314 1.00 0.00 ? 12  LYS D HG2  1  
ATOM 7785   H HG3  . LYS D 1 8   ? 122.918 87.486  100.367 1.00 0.00 ? 12  LYS D HG3  1  
ATOM 7786   H HD2  . LYS D 1 8   ? 125.230 86.181  99.434  1.00 0.00 ? 12  LYS D HD2  1  
ATOM 7787   H HD3  . LYS D 1 8   ? 123.849 85.461  99.358  1.00 0.00 ? 12  LYS D HD3  1  
ATOM 7788   H HE2  . LYS D 1 8   ? 123.024 86.972  97.870  1.00 0.00 ? 12  LYS D HE2  1  
ATOM 7789   H HE3  . LYS D 1 8   ? 124.153 88.001  98.178  1.00 0.00 ? 12  LYS D HE3  1  
ATOM 7790   H HZ1  . LYS D 1 8   ? 125.529 86.152  97.282  1.00 0.00 ? 12  LYS D HZ1  1  
ATOM 7791   H HZ2  . LYS D 1 8   ? 124.312 85.871  96.538  1.00 0.00 ? 12  LYS D HZ2  1  
ATOM 7792   H HZ3  . LYS D 1 8   ? 124.977 87.154  96.387  1.00 0.00 ? 12  LYS D HZ3  1  
ATOM 7793   N N    . TYR D 1 9   ? 123.950 87.781  103.939 1.00 0.00 ? 13  TYR D N    1  
ATOM 7794   C CA   . TYR D 1 9   ? 123.999 87.464  105.366 1.00 0.00 ? 13  TYR D CA   1  
ATOM 7795   C C    . TYR D 1 9   ? 124.621 86.082  105.540 1.00 0.00 ? 13  TYR D C    1  
ATOM 7796   O O    . TYR D 1 9   ? 124.128 85.091  104.997 1.00 0.00 ? 13  TYR D O    1  
ATOM 7797   C CB   . TYR D 1 9   ? 122.599 87.509  105.991 1.00 0.00 ? 13  TYR D CB   1  
ATOM 7798   C CG   . TYR D 1 9   ? 121.858 88.826  105.863 1.00 0.00 ? 13  TYR D CG   1  
ATOM 7799   C CD1  . TYR D 1 9   ? 121.547 89.591  106.975 1.00 0.00 ? 13  TYR D CD1  1  
ATOM 7800   C CD2  . TYR D 1 9   ? 121.447 89.287  104.622 1.00 0.00 ? 13  TYR D CD2  1  
ATOM 7801   C CE1  . TYR D 1 9   ? 120.878 90.781  106.852 1.00 0.00 ? 13  TYR D CE1  1  
ATOM 7802   C CE2  . TYR D 1 9   ? 120.762 90.475  104.496 1.00 0.00 ? 13  TYR D CE2  1  
ATOM 7803   C CZ   . TYR D 1 9   ? 120.483 91.218  105.617 1.00 0.00 ? 13  TYR D CZ   1  
ATOM 7804   O OH   . TYR D 1 9   ? 119.802 92.406  105.522 1.00 0.00 ? 13  TYR D OH   1  
ATOM 7805   H H    . TYR D 1 9   ? 123.496 87.217  103.476 1.00 0.00 ? 13  TYR D H    1  
ATOM 7806   H HA   . TYR D 1 9   ? 124.540 88.127  105.822 1.00 0.00 ? 13  TYR D HA   1  
ATOM 7807   H HB2  . TYR D 1 9   ? 122.059 86.813  105.584 1.00 0.00 ? 13  TYR D HB2  1  
ATOM 7808   H HB3  . TYR D 1 9   ? 122.678 87.292  106.933 1.00 0.00 ? 13  TYR D HB3  1  
ATOM 7809   H HD1  . TYR D 1 9   ? 121.795 89.291  107.820 1.00 0.00 ? 13  TYR D HD1  1  
ATOM 7810   H HD2  . TYR D 1 9   ? 121.637 88.786  103.862 1.00 0.00 ? 13  TYR D HD2  1  
ATOM 7811   H HE1  . TYR D 1 9   ? 120.693 91.291  107.607 1.00 0.00 ? 13  TYR D HE1  1  
ATOM 7812   H HE2  . TYR D 1 9   ? 120.491 90.771  103.657 1.00 0.00 ? 13  TYR D HE2  1  
ATOM 7813   H HH   . TYR D 1 9   ? 119.338 92.408  104.822 1.00 0.00 ? 13  TYR D HH   1  
ATOM 7814   N N    . LEU D 1 10  ? 125.702 86.017  106.309 1.00 0.00 ? 14  LEU D N    1  
ATOM 7815   C CA   . LEU D 1 10  ? 126.318 84.738  106.640 1.00 0.00 ? 14  LEU D CA   1  
ATOM 7816   C C    . LEU D 1 10  ? 126.265 84.521  108.147 1.00 0.00 ? 14  LEU D C    1  
ATOM 7817   O O    . LEU D 1 10  ? 126.323 85.481  108.923 1.00 0.00 ? 14  LEU D O    1  
ATOM 7818   C CB   . LEU D 1 10  ? 127.760 84.687  106.144 1.00 0.00 ? 14  LEU D CB   1  
ATOM 7819   C CG   . LEU D 1 10  ? 128.665 85.890  106.402 1.00 0.00 ? 14  LEU D CG   1  
ATOM 7820   C CD1  . LEU D 1 10  ? 130.022 85.428  106.890 1.00 0.00 ? 14  LEU D CD1  1  
ATOM 7821   C CD2  . LEU D 1 10  ? 128.827 86.703  105.142 1.00 0.00 ? 14  LEU D CD2  1  
ATOM 7822   H H    . LEU D 1 10  ? 126.095 86.702  106.650 1.00 0.00 ? 14  LEU D H    1  
ATOM 7823   H HA   . LEU D 1 10  ? 125.825 84.029  106.197 1.00 0.00 ? 14  LEU D HA   1  
ATOM 7824   H HB2  . LEU D 1 10  ? 128.182 83.910  106.544 1.00 0.00 ? 14  LEU D HB2  1  
ATOM 7825   H HB3  . LEU D 1 10  ? 127.738 84.535  105.187 1.00 0.00 ? 14  LEU D HB3  1  
ATOM 7826   H HG   . LEU D 1 10  ? 128.253 86.445  107.084 1.00 0.00 ? 14  LEU D HG   1  
ATOM 7827   H HD11 . LEU D 1 10  ? 130.689 85.612  106.212 1.00 0.00 ? 14  LEU D HD11 1  
ATOM 7828   H HD12 . LEU D 1 10  ? 130.251 85.900  107.705 1.00 0.00 ? 14  LEU D HD12 1  
ATOM 7829   H HD13 . LEU D 1 10  ? 129.995 84.474  107.066 1.00 0.00 ? 14  LEU D HD13 1  
ATOM 7830   H HD21 . LEU D 1 10  ? 129.167 87.583  105.366 1.00 0.00 ? 14  LEU D HD21 1  
ATOM 7831   H HD22 . LEU D 1 10  ? 129.450 86.258  104.548 1.00 0.00 ? 14  LEU D HD22 1  
ATOM 7832   H HD23 . LEU D 1 10  ? 127.968 86.792  104.701 1.00 0.00 ? 14  LEU D HD23 1  
ATOM 7833   N N    . PHE D 1 11  ? 126.159 83.263  108.560 1.00 0.00 ? 15  PHE D N    1  
ATOM 7834   C CA   . PHE D 1 11  ? 126.181 82.897  109.967 1.00 0.00 ? 15  PHE D CA   1  
ATOM 7835   C C    . PHE D 1 11  ? 127.339 81.947  110.239 1.00 0.00 ? 15  PHE D C    1  
ATOM 7836   O O    . PHE D 1 11  ? 127.676 81.090  109.417 1.00 0.00 ? 15  PHE D O    1  
ATOM 7837   C CB   . PHE D 1 11  ? 124.871 82.226  110.388 1.00 0.00 ? 15  PHE D CB   1  
ATOM 7838   C CG   . PHE D 1 11  ? 123.672 82.651  109.590 1.00 0.00 ? 15  PHE D CG   1  
ATOM 7839   C CD1  . PHE D 1 11  ? 123.145 81.845  108.592 1.00 0.00 ? 15  PHE D CD1  1  
ATOM 7840   C CD2  . PHE D 1 11  ? 123.069 83.872  109.847 1.00 0.00 ? 15  PHE D CD2  1  
ATOM 7841   C CE1  . PHE D 1 11  ? 122.039 82.248  107.875 1.00 0.00 ? 15  PHE D CE1  1  
ATOM 7842   C CE2  . PHE D 1 11  ? 121.965 84.280  109.127 1.00 0.00 ? 15  PHE D CE2  1  
ATOM 7843   C CZ   . PHE D 1 11  ? 121.451 83.466  108.139 1.00 0.00 ? 15  PHE D CZ   1  
ATOM 7844   H H    . PHE D 1 11  ? 126.073 82.594  108.027 1.00 0.00 ? 15  PHE D H    1  
ATOM 7845   H HA   . PHE D 1 11  ? 126.292 83.711  110.483 1.00 0.00 ? 15  PHE D HA   1  
ATOM 7846   H HB2  . PHE D 1 11  ? 124.973 81.264  110.311 1.00 0.00 ? 15  PHE D HB2  1  
ATOM 7847   H HB3  . PHE D 1 11  ? 124.707 82.419  111.325 1.00 0.00 ? 15  PHE D HB3  1  
ATOM 7848   H HD1  . PHE D 1 11  ? 123.542 81.025  108.406 1.00 0.00 ? 15  PHE D HD1  1  
ATOM 7849   H HD2  . PHE D 1 11  ? 123.413 84.423  110.512 1.00 0.00 ? 15  PHE D HD2  1  
ATOM 7850   H HE1  . PHE D 1 11  ? 121.690 81.698  107.212 1.00 0.00 ? 15  PHE D HE1  1  
ATOM 7851   H HE2  . PHE D 1 11  ? 121.568 85.101  109.309 1.00 0.00 ? 15  PHE D HE2  1  
ATOM 7852   H HZ   . PHE D 1 11  ? 120.708 83.740  107.652 1.00 0.00 ? 15  PHE D HZ   1  
ATOM 7853   N N    . GLN D 1 12  ? 127.947 82.103  111.412 1.00 0.00 ? 16  GLN D N    1  
ATOM 7854   C CA   . GLN D 1 12  ? 128.931 81.135  111.871 1.00 0.00 ? 16  GLN D CA   1  
ATOM 7855   C C    . GLN D 1 12  ? 128.500 80.603  113.229 1.00 0.00 ? 16  GLN D C    1  
ATOM 7856   O O    . GLN D 1 12  ? 128.230 81.377  114.154 1.00 0.00 ? 16  GLN D O    1  
ATOM 7857   C CB   . GLN D 1 12  ? 130.336 81.748  111.941 1.00 0.00 ? 16  GLN D CB   1  
ATOM 7858   C CG   . GLN D 1 12  ? 131.472 80.738  111.839 1.00 0.00 ? 16  GLN D CG   1  
ATOM 7859   C CD   . GLN D 1 12  ? 132.832 81.377  111.691 1.00 0.00 ? 16  GLN D CD   1  
ATOM 7860   O OE1  . GLN D 1 12  ? 133.718 80.832  111.040 1.00 0.00 ? 16  GLN D OE1  1  
ATOM 7861   N NE2  . GLN D 1 12  ? 133.005 82.544  112.297 1.00 0.00 ? 16  GLN D NE2  1  
ATOM 7862   H H    . GLN D 1 12  ? 127.804 82.758  111.950 1.00 0.00 ? 16  GLN D H    1  
ATOM 7863   H HA   . GLN D 1 12  ? 128.975 80.405  111.233 1.00 0.00 ? 16  GLN D HA   1  
ATOM 7864   H HB2  . GLN D 1 12  ? 130.430 82.396  111.226 1.00 0.00 ? 16  GLN D HB2  1  
ATOM 7865   H HB3  . GLN D 1 12  ? 130.423 82.232  112.777 1.00 0.00 ? 16  GLN D HB3  1  
ATOM 7866   H HG2  . GLN D 1 12  ? 131.470 80.178  112.631 1.00 0.00 ? 16  GLN D HG2  1  
ATOM 7867   H HG3  . GLN D 1 12  ? 131.312 80.155  111.080 1.00 0.00 ? 16  GLN D HG3  1  
ATOM 7868   H HE21 . GLN D 1 12  ? 132.361 82.895  112.745 1.00 0.00 ? 16  GLN D HE21 1  
ATOM 7869   H HE22 . GLN D 1 12  ? 133.761 82.949  112.242 1.00 0.00 ? 16  GLN D HE22 1  
ATOM 7870   N N    . SER D 1 13  ? 128.426 79.278  113.333 1.00 0.00 ? 17  SER D N    1  
ATOM 7871   C CA   . SER D 1 13  ? 128.043 78.623  114.574 1.00 0.00 ? 17  SER D CA   1  
ATOM 7872   C C    . SER D 1 13  ? 129.149 78.738  115.617 1.00 0.00 ? 17  SER D C    1  
ATOM 7873   O O    . SER D 1 13  ? 130.340 78.756  115.296 1.00 0.00 ? 17  SER D O    1  
ATOM 7874   C CB   . SER D 1 13  ? 127.725 77.151  114.319 1.00 0.00 ? 17  SER D CB   1  
ATOM 7875   O OG   . SER D 1 13  ? 128.810 76.498  113.693 1.00 0.00 ? 17  SER D OG   1  
ATOM 7876   H H    . SER D 1 13  ? 128.597 78.737  112.687 1.00 0.00 ? 17  SER D H    1  
ATOM 7877   H HA   . SER D 1 13  ? 127.250 79.067  114.915 1.00 0.00 ? 17  SER D HA   1  
ATOM 7878   H HB2  . SER D 1 13  ? 127.519 76.712  115.159 1.00 0.00 ? 17  SER D HB2  1  
ATOM 7879   H HB3  . SER D 1 13  ? 126.935 77.081  113.761 1.00 0.00 ? 17  SER D HB3  1  
ATOM 7880   H HG   . SER D 1 13  ? 129.491 76.551  114.183 1.00 0.00 ? 17  SER D HG   1  
ATOM 7881   N N    . ILE D 1 14  ? 128.739 78.810  116.886 1.00 0.00 ? 18  ILE D N    1  
ATOM 7882   C CA   . ILE D 1 14  ? 129.701 78.931  117.974 1.00 0.00 ? 18  ILE D CA   1  
ATOM 7883   C C    . ILE D 1 14  ? 130.489 77.647  118.182 1.00 0.00 ? 18  ILE D C    1  
ATOM 7884   O O    . ILE D 1 14  ? 131.713 77.696  118.354 1.00 0.00 ? 18  ILE D O    1  
ATOM 7885   C CB   . ILE D 1 14  ? 128.998 79.334  119.283 1.00 0.00 ? 18  ILE D CB   1  
ATOM 7886   C CG1  . ILE D 1 14  ? 127.679 78.575  119.436 1.00 0.00 ? 18  ILE D CG1  1  
ATOM 7887   C CG2  . ILE D 1 14  ? 128.768 80.836  119.329 1.00 0.00 ? 18  ILE D CG2  1  
ATOM 7888   C CD1  . ILE D 1 14  ? 127.367 78.127  120.859 1.00 0.00 ? 18  ILE D CD1  1  
ATOM 7889   H H    . ILE D 1 14  ? 127.915 78.789  117.133 1.00 0.00 ? 18  ILE D H    1  
ATOM 7890   H HA   . ILE D 1 14  ? 130.327 79.627  117.721 1.00 0.00 ? 18  ILE D HA   1  
ATOM 7891   H HB   . ILE D 1 14  ? 129.574 79.097  120.027 1.00 0.00 ? 18  ILE D HB   1  
ATOM 7892   H HG12 . ILE D 1 14  ? 126.956 79.140  119.121 1.00 0.00 ? 18  ILE D HG12 1  
ATOM 7893   H HG13 . ILE D 1 14  ? 127.700 77.794  118.860 1.00 0.00 ? 18  ILE D HG13 1  
ATOM 7894   H HG21 . ILE D 1 14  ? 128.889 81.154  120.238 1.00 0.00 ? 18  ILE D HG21 1  
ATOM 7895   H HG22 . ILE D 1 14  ? 129.404 81.278  118.745 1.00 0.00 ? 18  ILE D HG22 1  
ATOM 7896   H HG23 . ILE D 1 14  ? 127.865 81.035  119.034 1.00 0.00 ? 18  ILE D HG23 1  
ATOM 7897   H HD11 . ILE D 1 14  ? 126.907 78.839  121.329 1.00 0.00 ? 18  ILE D HD11 1  
ATOM 7898   H HD12 . ILE D 1 14  ? 126.802 77.339  120.834 1.00 0.00 ? 18  ILE D HD12 1  
ATOM 7899   H HD13 . ILE D 1 14  ? 128.194 77.917  121.321 1.00 0.00 ? 18  ILE D HD13 1  
ATOM 7900   N N    . ASP D 1 15  ? 129.824 76.494  118.169 1.00 0.00 ? 19  ASP D N    1  
ATOM 7901   C CA   . ASP D 1 15  ? 130.455 75.235  118.526 1.00 0.00 ? 19  ASP D CA   1  
ATOM 7902   C C    . ASP D 1 15  ? 131.388 74.712  117.442 1.00 0.00 ? 19  ASP D C    1  
ATOM 7903   O O    . ASP D 1 15  ? 132.304 73.942  117.749 1.00 0.00 ? 19  ASP D O    1  
ATOM 7904   C CB   . ASP D 1 15  ? 129.370 74.187  118.828 1.00 0.00 ? 19  ASP D CB   1  
ATOM 7905   C CG   . ASP D 1 15  ? 128.290 74.698  119.768 1.00 0.00 ? 19  ASP D CG   1  
ATOM 7906   O OD1  . ASP D 1 15  ? 128.618 75.166  120.878 1.00 0.00 ? 19  ASP D OD1  1  
ATOM 7907   O OD2  . ASP D 1 15  ? 127.103 74.629  119.386 1.00 0.00 ? 19  ASP D OD2  1  
ATOM 7908   H H    . ASP D 1 15  ? 128.995 76.423  117.952 1.00 0.00 ? 19  ASP D H    1  
ATOM 7909   H HA   . ASP D 1 15  ? 130.999 75.399  119.312 1.00 0.00 ? 19  ASP D HA   1  
ATOM 7910   H HB2  . ASP D 1 15  ? 128.960 73.906  117.995 1.00 0.00 ? 19  ASP D HB2  1  
ATOM 7911   H HB3  . ASP D 1 15  ? 129.786 73.403  119.218 1.00 0.00 ? 19  ASP D HB3  1  
ATOM 7912   N N    . ALA D 1 16  ? 131.192 75.112  116.186 1.00 0.00 ? 20  ALA D N    1  
ATOM 7913   C CA   . ALA D 1 16  ? 131.996 74.552  115.107 1.00 0.00 ? 20  ALA D CA   1  
ATOM 7914   C C    . ALA D 1 16  ? 133.484 74.767  115.352 1.00 0.00 ? 20  ALA D C    1  
ATOM 7915   O O    . ALA D 1 16  ? 134.281 73.831  115.210 1.00 0.00 ? 20  ALA D O    1  
ATOM 7916   C CB   . ALA D 1 16  ? 131.574 75.163  113.771 1.00 0.00 ? 20  ALA D CB   1  
ATOM 7917   H H    . ALA D 1 16  ? 130.609 75.696  115.943 1.00 0.00 ? 20  ALA D H    1  
ATOM 7918   H HA   . ALA D 1 16  ? 131.841 73.594  115.079 1.00 0.00 ? 20  ALA D HA   1  
ATOM 7919   H HB1  . ALA D 1 16  ? 131.066 75.974  113.931 1.00 0.00 ? 20  ALA D HB1  1  
ATOM 7920   H HB2  . ALA D 1 16  ? 132.363 75.375  113.249 1.00 0.00 ? 20  ALA D HB2  1  
ATOM 7921   H HB3  . ALA D 1 16  ? 131.025 74.528  113.284 1.00 0.00 ? 20  ALA D HB3  1  
ATOM 7922   N N    . ALA D 1 17  ? 133.863 75.996  115.733 1.00 0.00 ? 21  ALA D N    1  
ATOM 7923   C CA   . ALA D 1 17  ? 135.257 76.446  115.886 1.00 0.00 ? 21  ALA D CA   1  
ATOM 7924   C C    . ALA D 1 17  ? 136.049 76.293  114.588 1.00 0.00 ? 21  ALA D C    1  
ATOM 7925   O O    . ALA D 1 17  ? 137.176 75.797  114.573 1.00 0.00 ? 21  ALA D O    1  
ATOM 7926   C CB   . ALA D 1 17  ? 135.962 75.737  117.050 1.00 0.00 ? 21  ALA D CB   1  
ATOM 7927   H H    . ALA D 1 17  ? 133.293 76.613  115.917 1.00 0.00 ? 21  ALA D H    1  
ATOM 7928   H HA   . ALA D 1 17  ? 135.223 77.392  116.100 1.00 0.00 ? 21  ALA D HA   1  
ATOM 7929   H HB1  . ALA D 1 17  ? 136.716 75.228  116.710 1.00 0.00 ? 21  ALA D HB1  1  
ATOM 7930   H HB2  . ALA D 1 17  ? 136.279 76.396  117.687 1.00 0.00 ? 21  ALA D HB2  1  
ATOM 7931   H HB3  . ALA D 1 17  ? 135.339 75.136  117.488 1.00 0.00 ? 21  ALA D HB3  1  
ATOM 7932   N N    . THR D 1 18  ? 135.445 76.729  113.483 1.00 0.00 ? 22  THR D N    1  
ATOM 7933   C CA   . THR D 1 18  ? 136.054 76.660  112.162 1.00 0.00 ? 22  THR D CA   1  
ATOM 7934   C C    . THR D 1 18  ? 136.381 78.067  111.689 1.00 0.00 ? 22  THR D C    1  
ATOM 7935   O O    . THR D 1 18  ? 135.827 79.042  112.204 1.00 0.00 ? 22  THR D O    1  
ATOM 7936   C CB   . THR D 1 18  ? 135.127 75.975  111.150 1.00 0.00 ? 22  THR D CB   1  
ATOM 7937   O OG1  . THR D 1 18  ? 135.763 75.931  109.868 1.00 0.00 ? 22  THR D OG1  1  
ATOM 7938   C CG2  . THR D 1 18  ? 133.809 76.717  111.034 1.00 0.00 ? 22  THR D CG2  1  
ATOM 7939   H H    . THR D 1 18  ? 134.659 77.077  113.484 1.00 0.00 ? 22  THR D H    1  
ATOM 7940   H HA   . THR D 1 18  ? 136.865 76.131  112.227 1.00 0.00 ? 22  THR D HA   1  
ATOM 7941   H HB   . THR D 1 18  ? 134.948 75.074  111.461 1.00 0.00 ? 22  THR D HB   1  
ATOM 7942   H HG1  . THR D 1 18  ? 135.178 75.919  109.265 1.00 0.00 ? 22  THR D HG1  1  
ATOM 7943   H HG21 . THR D 1 18  ? 133.167 76.635  110.311 1.00 0.00 ? 22  THR D HG21 1  
ATOM 7944   H HG22 . THR D 1 18  ? 133.368 76.733  111.898 1.00 0.00 ? 22  THR D HG22 1  
ATOM 7945   H HG23 . THR D 1 18  ? 133.974 77.626  110.739 1.00 0.00 ? 22  THR D HG23 1  
ATOM 7946   N N    . GLY D 1 19  ? 137.268 78.166  110.704 1.00 0.00 ? 23  GLY D N    1  
ATOM 7947   C CA   . GLY D 1 19  ? 137.681 79.453  110.180 1.00 0.00 ? 23  GLY D CA   1  
ATOM 7948   C C    . GLY D 1 19  ? 136.840 79.937  109.017 1.00 0.00 ? 23  GLY D C    1  
ATOM 7949   O O    . GLY D 1 19  ? 137.361 80.555  108.085 1.00 0.00 ? 23  GLY D O    1  
ATOM 7950   H H    . GLY D 1 19  ? 137.642 77.491  110.325 1.00 0.00 ? 23  GLY D H    1  
ATOM 7951   H HA2  . GLY D 1 19  ? 137.642 80.111  110.892 1.00 0.00 ? 23  GLY D HA2  1  
ATOM 7952   H HA3  . GLY D 1 19  ? 138.607 79.395  109.898 1.00 0.00 ? 23  GLY D HA3  1  
ATOM 7953   N N    . SER D 1 20  ? 135.539 79.657  109.054 1.00 0.00 ? 24  SER D N    1  
ATOM 7954   C CA   . SER D 1 20  ? 134.658 80.038  107.958 1.00 0.00 ? 24  SER D CA   1  
ATOM 7955   C C    . SER D 1 20  ? 133.190 79.899  108.338 1.00 0.00 ? 24  SER D C    1  
ATOM 7956   O O    . SER D 1 20  ? 132.824 78.967  109.063 1.00 0.00 ? 24  SER D O    1  
ATOM 7957   C CB   . SER D 1 20  ? 134.958 79.194  106.717 1.00 0.00 ? 24  SER D CB   1  
ATOM 7958   O OG   . SER D 1 20  ? 134.276 77.955  106.769 1.00 0.00 ? 24  SER D OG   1  
ATOM 7959   H H    . SER D 1 20  ? 135.150 79.248  109.704 1.00 0.00 ? 24  SER D H    1  
ATOM 7960   H HA   . SER D 1 20  ? 134.827 80.973  107.761 1.00 0.00 ? 24  SER D HA   1  
ATOM 7961   H HB2  . SER D 1 20  ? 134.694 79.679  105.920 1.00 0.00 ? 24  SER D HB2  1  
ATOM 7962   H HB3  . SER D 1 20  ? 135.914 79.038  106.651 1.00 0.00 ? 24  SER D HB3  1  
ATOM 7963   H HG   . SER D 1 20  ? 133.735 77.905  106.129 1.00 0.00 ? 24  SER D HG   1  
ATOM 7964   N N    . ALA D 1 21  ? 132.354 80.823  107.846 1.00 0.00 ? 25  ALA D N    1  
ATOM 7965   C CA   . ALA D 1 21  ? 130.931 80.978  108.157 1.00 0.00 ? 25  ALA D CA   1  
ATOM 7966   C C    . ALA D 1 21  ? 130.032 80.517  107.013 1.00 0.00 ? 25  ALA D C    1  
ATOM 7967   O O    . ALA D 1 21  ? 130.074 81.109  105.927 1.00 0.00 ? 25  ALA D O    1  
ATOM 7968   C CB   . ALA D 1 21  ? 130.611 82.430  108.524 1.00 0.00 ? 25  ALA D CB   1  
ATOM 7969   H H    . ALA D 1 21  ? 132.625 81.415  107.283 1.00 0.00 ? 25  ALA D H    1  
ATOM 7970   H HA   . ALA D 1 21  ? 130.749 80.408  108.920 1.00 0.00 ? 25  ALA D HA   1  
ATOM 7971   H HB1  . ALA D 1 21  ? 129.728 82.660  108.195 1.00 0.00 ? 25  ALA D HB1  1  
ATOM 7972   H HB2  . ALA D 1 21  ? 130.633 82.533  109.489 1.00 0.00 ? 25  ALA D HB2  1  
ATOM 7973   H HB3  . ALA D 1 21  ? 131.269 83.019  108.123 1.00 0.00 ? 25  ALA D HB3  1  
ATOM 7974   N N    . PRO D 1 22  ? 129.222 79.454  107.195 1.00 0.00 ? 26  PRO D N    1  
ATOM 7975   C CA   . PRO D 1 22  ? 128.330 79.031  106.107 1.00 0.00 ? 26  PRO D CA   1  
ATOM 7976   C C    . PRO D 1 22  ? 127.177 79.994  105.896 1.00 0.00 ? 26  PRO D C    1  
ATOM 7977   O O    . PRO D 1 22  ? 126.521 80.413  106.855 1.00 0.00 ? 26  PRO D O    1  
ATOM 7978   C CB   . PRO D 1 22  ? 127.812 77.666  106.582 1.00 0.00 ? 26  PRO D CB   1  
ATOM 7979   C CG   . PRO D 1 22  ? 128.764 77.227  107.632 1.00 0.00 ? 26  PRO D CG   1  
ATOM 7980   C CD   . PRO D 1 22  ? 129.188 78.492  108.308 1.00 0.00 ? 26  PRO D CD   1  
ATOM 7981   H HA   . PRO D 1 22  ? 128.789 79.002  105.253 1.00 0.00 ? 26  PRO D HA   1  
ATOM 7982   H HB2  . PRO D 1 22  ? 126.911 77.737  106.934 1.00 0.00 ? 26  PRO D HB2  1  
ATOM 7983   H HB3  . PRO D 1 22  ? 127.781 77.030  105.850 1.00 0.00 ? 26  PRO D HB3  1  
ATOM 7984   H HG2  . PRO D 1 22  ? 128.343 76.616  108.256 1.00 0.00 ? 26  PRO D HG2  1  
ATOM 7985   H HG3  . PRO D 1 22  ? 129.523 76.761  107.248 1.00 0.00 ? 26  PRO D HG3  1  
ATOM 7986   H HD2  . PRO D 1 22  ? 128.561 78.760  108.998 1.00 0.00 ? 26  PRO D HD2  1  
ATOM 7987   H HD3  . PRO D 1 22  ? 130.055 78.401  108.733 1.00 0.00 ? 26  PRO D HD3  1  
ATOM 7988   N N    . LEU D 1 23  ? 126.925 80.352  104.645 1.00 0.00 ? 27  LEU D N    1  
ATOM 7989   C CA   . LEU D 1 23  ? 125.708 81.063  104.292 1.00 0.00 ? 27  LEU D CA   1  
ATOM 7990   C C    . LEU D 1 23  ? 124.874 80.187  103.370 1.00 0.00 ? 27  LEU D C    1  
ATOM 7991   O O    . LEU D 1 23  ? 125.391 79.317  102.666 1.00 0.00 ? 27  LEU D O    1  
ATOM 7992   C CB   . LEU D 1 23  ? 126.004 82.395  103.609 1.00 0.00 ? 27  LEU D CB   1  
ATOM 7993   C CG   . LEU D 1 23  ? 126.962 82.403  102.415 1.00 0.00 ? 27  LEU D CG   1  
ATOM 7994   C CD1  . LEU D 1 23  ? 126.341 83.178  101.265 1.00 0.00 ? 27  LEU D CD1  1  
ATOM 7995   C CD2  . LEU D 1 23  ? 128.332 82.972  102.764 1.00 0.00 ? 27  LEU D CD2  1  
ATOM 7996   H H    . LEU D 1 23  ? 127.450 80.192  103.983 1.00 0.00 ? 27  LEU D H    1  
ATOM 7997   H HA   . LEU D 1 23  ? 125.221 81.256  105.108 1.00 0.00 ? 27  LEU D HA   1  
ATOM 7998   H HB2  . LEU D 1 23  ? 125.160 82.770  103.313 1.00 0.00 ? 27  LEU D HB2  1  
ATOM 7999   H HB3  . LEU D 1 23  ? 126.362 82.998  104.280 1.00 0.00 ? 27  LEU D HB3  1  
ATOM 8000   H HG   . LEU D 1 23  ? 127.105 81.481  102.151 1.00 0.00 ? 27  LEU D HG   1  
ATOM 8001   H HD11 . LEU D 1 23  ? 126.842 83.008  100.452 1.00 0.00 ? 27  LEU D HD11 1  
ATOM 8002   H HD12 . LEU D 1 23  ? 125.421 82.895  101.143 1.00 0.00 ? 27  LEU D HD12 1  
ATOM 8003   H HD13 . LEU D 1 23  ? 126.362 84.127  101.465 1.00 0.00 ? 27  LEU D HD13 1  
ATOM 8004   H HD21 . LEU D 1 23  ? 128.224 83.748  103.335 1.00 0.00 ? 27  LEU D HD21 1  
ATOM 8005   H HD22 . LEU D 1 23  ? 128.853 82.298  103.228 1.00 0.00 ? 27  LEU D HD22 1  
ATOM 8006   H HD23 . LEU D 1 23  ? 128.791 83.231  101.950 1.00 0.00 ? 27  LEU D HD23 1  
ATOM 8007   N N    . PHE D 1 24  ? 123.581 80.432  103.369 1.00 0.00 ? 28  PHE D N    1  
ATOM 8008   C CA   . PHE D 1 24  ? 122.752 79.436  102.727 1.00 0.00 ? 28  PHE D CA   1  
ATOM 8009   C C    . PHE D 1 24  ? 122.236 79.954  101.386 1.00 0.00 ? 28  PHE D C    1  
ATOM 8010   O O    . PHE D 1 24  ? 121.952 81.149  101.255 1.00 0.00 ? 28  PHE D O    1  
ATOM 8011   C CB   . PHE D 1 24  ? 121.580 79.069  103.646 1.00 0.00 ? 28  PHE D CB   1  
ATOM 8012   C CG   . PHE D 1 24  ? 120.864 77.826  103.240 1.00 0.00 ? 28  PHE D CG   1  
ATOM 8013   C CD1  . PHE D 1 24  ? 121.524 76.612  103.231 1.00 0.00 ? 28  PHE D CD1  1  
ATOM 8014   C CD2  . PHE D 1 24  ? 119.535 77.862  102.876 1.00 0.00 ? 28  PHE D CD2  1  
ATOM 8015   C CE1  . PHE D 1 24  ? 120.873 75.463  102.849 1.00 0.00 ? 28  PHE D CE1  1  
ATOM 8016   C CE2  . PHE D 1 24  ? 118.874 76.710  102.493 1.00 0.00 ? 28  PHE D CE2  1  
ATOM 8017   C CZ   . PHE D 1 24  ? 119.547 75.508  102.483 1.00 0.00 ? 28  PHE D CZ   1  
ATOM 8018   H H    . PHE D 1 24  ? 123.184 81.115  103.708 1.00 0.00 ? 28  PHE D H    1  
ATOM 8019   H HA   . PHE D 1 24  ? 123.284 78.643  102.559 1.00 0.00 ? 28  PHE D HA   1  
ATOM 8020   H HB2  . PHE D 1 24  ? 121.912 78.960  104.551 1.00 0.00 ? 28  PHE D HB2  1  
ATOM 8021   H HB3  . PHE D 1 24  ? 120.950 79.805  103.662 1.00 0.00 ? 28  PHE D HB3  1  
ATOM 8022   H HD1  . PHE D 1 24  ? 122.418 76.573  103.485 1.00 0.00 ? 28  PHE D HD1  1  
ATOM 8023   H HD2  . PHE D 1 24  ? 119.077 78.671  102.887 1.00 0.00 ? 28  PHE D HD2  1  
ATOM 8024   H HE1  . PHE D 1 24  ? 121.330 74.652  102.839 1.00 0.00 ? 28  PHE D HE1  1  
ATOM 8025   H HE2  . PHE D 1 24  ? 117.979 76.746  102.244 1.00 0.00 ? 28  PHE D HE2  1  
ATOM 8026   H HZ   . PHE D 1 24  ? 119.107 74.730  102.230 1.00 0.00 ? 28  PHE D HZ   1  
ATOM 8027   N N    . PRO D 1 25  ? 122.151 79.111  100.358 1.00 0.00 ? 29  PRO D N    1  
ATOM 8028   C CA   . PRO D 1 25  ? 121.644 79.585  99.065  1.00 0.00 ? 29  PRO D CA   1  
ATOM 8029   C C    . PRO D 1 25  ? 120.135 79.753  99.060  1.00 0.00 ? 29  PRO D C    1  
ATOM 8030   O O    . PRO D 1 25  ? 119.441 79.424  100.023 1.00 0.00 ? 29  PRO D O    1  
ATOM 8031   C CB   . PRO D 1 25  ? 122.109 78.506  98.080  1.00 0.00 ? 29  PRO D CB   1  
ATOM 8032   C CG   . PRO D 1 25  ? 122.262 77.286  98.909  1.00 0.00 ? 29  PRO D CG   1  
ATOM 8033   C CD   . PRO D 1 25  ? 122.744 77.769  100.248 1.00 0.00 ? 29  PRO D CD   1  
ATOM 8034   H HA   . PRO D 1 25  ? 121.989 80.464  98.839  1.00 0.00 ? 29  PRO D HA   1  
ATOM 8035   H HB2  . PRO D 1 25  ? 121.461 78.372  97.371  1.00 0.00 ? 29  PRO D HB2  1  
ATOM 8036   H HB3  . PRO D 1 25  ? 122.947 78.752  97.656  1.00 0.00 ? 29  PRO D HB3  1  
ATOM 8037   H HG2  . PRO D 1 25  ? 121.420 76.811  98.991  1.00 0.00 ? 29  PRO D HG2  1  
ATOM 8038   H HG3  . PRO D 1 25  ? 122.897 76.670  98.511  1.00 0.00 ? 29  PRO D HG3  1  
ATOM 8039   H HD2  . PRO D 1 25  ? 122.448 77.187  100.966 1.00 0.00 ? 29  PRO D HD2  1  
ATOM 8040   H HD3  . PRO D 1 25  ? 123.712 77.801  100.290 1.00 0.00 ? 29  PRO D HD3  1  
ATOM 8041   N N    . ALA D 1 26  ? 119.644 80.273  97.930  1.00 0.00 ? 30  ALA D N    1  
ATOM 8042   C CA   . ALA D 1 26  ? 118.226 80.531  97.660  1.00 0.00 ? 30  ALA D CA   1  
ATOM 8043   C C    . ALA D 1 26  ? 117.588 81.374  98.765  1.00 0.00 ? 30  ALA D C    1  
ATOM 8044   O O    . ALA D 1 26  ? 116.665 80.946  99.458  1.00 0.00 ? 30  ALA D O    1  
ATOM 8045   C CB   . ALA D 1 26  ? 117.443 79.231  97.438  1.00 0.00 ? 30  ALA D CB   1  
ATOM 8046   H H    . ALA D 1 26  ? 120.152 80.493  97.272  1.00 0.00 ? 30  ALA D H    1  
ATOM 8047   H HA   . ALA D 1 26  ? 118.183 81.042  96.836  1.00 0.00 ? 30  ALA D HA   1  
ATOM 8048   H HB1  . ALA D 1 26  ? 117.808 78.760  96.672  1.00 0.00 ? 30  ALA D HB1  1  
ATOM 8049   H HB2  . ALA D 1 26  ? 117.517 78.671  98.225  1.00 0.00 ? 30  ALA D HB2  1  
ATOM 8050   H HB3  . ALA D 1 26  ? 116.510 79.439  97.275  1.00 0.00 ? 30  ALA D HB3  1  
ATOM 8051   N N    . TYR D 1 27  ? 118.104 82.591  98.919  1.00 0.00 ? 31  TYR D N    1  
ATOM 8052   C CA   . TYR D 1 27  ? 117.510 83.551  99.836  1.00 0.00 ? 31  TYR D CA   1  
ATOM 8053   C C    . TYR D 1 27  ? 116.225 84.135  99.261  1.00 0.00 ? 31  TYR D C    1  
ATOM 8054   O O    . TYR D 1 27  ? 116.077 84.354  98.059  1.00 0.00 ? 31  TYR D O    1  
ATOM 8055   C CB   . TYR D 1 27  ? 118.491 84.674  100.167 1.00 0.00 ? 31  TYR D CB   1  
ATOM 8056   C CG   . TYR D 1 27  ? 119.457 84.342  101.274 1.00 0.00 ? 31  TYR D CG   1  
ATOM 8057   C CD1  . TYR D 1 27  ? 120.817 84.561  101.116 1.00 0.00 ? 31  TYR D CD1  1  
ATOM 8058   C CD2  . TYR D 1 27  ? 119.011 83.807  102.476 1.00 0.00 ? 31  TYR D CD2  1  
ATOM 8059   C CE1  . TYR D 1 27  ? 121.711 84.253  102.117 1.00 0.00 ? 31  TYR D CE1  1  
ATOM 8060   C CE2  . TYR D 1 27  ? 119.899 83.505  103.491 1.00 0.00 ? 31  TYR D CE2  1  
ATOM 8061   C CZ   . TYR D 1 27  ? 121.247 83.736  103.305 1.00 0.00 ? 31  TYR D CZ   1  
ATOM 8062   O OH   . TYR D 1 27  ? 122.142 83.439  104.305 1.00 0.00 ? 31  TYR D OH   1  
ATOM 8063   H H    . TYR D 1 27  ? 118.799 82.878  98.500  1.00 0.00 ? 31  TYR D H    1  
ATOM 8064   H HA   . TYR D 1 27  ? 117.295 83.078  100.655 1.00 0.00 ? 31  TYR D HA   1  
ATOM 8065   H HB2  . TYR D 1 27  ? 118.994 84.897  99.369  1.00 0.00 ? 31  TYR D HB2  1  
ATOM 8066   H HB3  . TYR D 1 27  ? 117.989 85.466  100.416 1.00 0.00 ? 31  TYR D HB3  1  
ATOM 8067   H HD1  . TYR D 1 27  ? 121.132 84.924  100.319 1.00 0.00 ? 31  TYR D HD1  1  
ATOM 8068   H HD2  . TYR D 1 27  ? 118.102 83.651  102.600 1.00 0.00 ? 31  TYR D HD2  1  
ATOM 8069   H HE1  . TYR D 1 27  ? 122.622 84.392  101.991 1.00 0.00 ? 31  TYR D HE1  1  
ATOM 8070   H HE2  . TYR D 1 27  ? 119.591 83.149  104.294 1.00 0.00 ? 31  TYR D HE2  1  
ATOM 8071   H HH   . TYR D 1 27  ? 122.235 82.606  104.358 1.00 0.00 ? 31  TYR D HH   1  
ATOM 8072   N N    . GLN D 1 28  ? 115.281 84.390  100.153 1.00 0.00 ? 32  GLN D N    1  
ATOM 8073   C CA   . GLN D 1 28  ? 113.996 84.967  99.813  1.00 0.00 ? 32  GLN D CA   1  
ATOM 8074   C C    . GLN D 1 28  ? 114.113 86.439  100.212 1.00 0.00 ? 32  GLN D C    1  
ATOM 8075   O O    . GLN D 1 28  ? 113.995 87.320  99.353  1.00 0.00 ? 32  GLN D O    1  
ATOM 8076   C CB   . GLN D 1 28  ? 112.884 84.112  100.463 1.00 0.00 ? 32  GLN D CB   1  
ATOM 8077   C CG   . GLN D 1 28  ? 111.509 84.093  99.801  1.00 0.00 ? 32  GLN D CG   1  
ATOM 8078   C CD   . GLN D 1 28  ? 110.504 84.953  100.518 1.00 0.00 ? 32  GLN D CD   1  
ATOM 8079   O OE1  . GLN D 1 28  ? 110.572 85.118  101.734 1.00 0.00 ? 32  GLN D OE1  1  
ATOM 8080   N NE2  . GLN D 1 28  ? 109.555 85.497  99.778  1.00 0.00 ? 32  GLN D NE2  1  
ATOM 8081   H H    . GLN D 1 28  ? 115.374 84.228  100.993 1.00 0.00 ? 32  GLN D H    1  
ATOM 8082   H HA   . GLN D 1 28  ? 113.747 84.955  98.876  1.00 0.00 ? 32  GLN D HA   1  
ATOM 8083   H HB2  . GLN D 1 28  ? 113.203 83.197  100.510 1.00 0.00 ? 32  GLN D HB2  1  
ATOM 8084   H HB3  . GLN D 1 28  ? 112.769 84.420  101.376 1.00 0.00 ? 32  GLN D HB3  1  
ATOM 8085   H HG2  . GLN D 1 28  ? 111.593 84.397  98.883  1.00 0.00 ? 32  GLN D HG2  1  
ATOM 8086   H HG3  . GLN D 1 28  ? 111.184 83.180  99.769  1.00 0.00 ? 32  GLN D HG3  1  
ATOM 8087   H HE21 . GLN D 1 28  ? 109.539 85.359  98.930  1.00 0.00 ? 32  GLN D HE21 1  
ATOM 8088   H HE22 . GLN D 1 28  ? 108.952 85.988  100.145 1.00 0.00 ? 32  GLN D HE22 1  
ATOM 8089   N N    . THR D 1 29  ? 114.293 86.722  101.500 1.00 0.00 ? 33  THR D N    1  
ATOM 8090   C CA   . THR D 1 29  ? 114.394 88.096  101.960 1.00 0.00 ? 33  THR D CA   1  
ATOM 8091   C C    . THR D 1 29  ? 114.689 88.154  103.456 1.00 0.00 ? 33  THR D C    1  
ATOM 8092   O O    . THR D 1 29  ? 114.454 87.207  104.225 1.00 0.00 ? 33  THR D O    1  
ATOM 8093   C CB   . THR D 1 29  ? 113.117 88.878  101.657 1.00 0.00 ? 33  THR D CB   1  
ATOM 8094   O OG1  . THR D 1 29  ? 113.405 90.281  101.701 1.00 0.00 ? 33  THR D OG1  1  
ATOM 8095   C CG2  . THR D 1 29  ? 112.031 88.569  102.677 1.00 0.00 ? 33  THR D CG2  1  
ATOM 8096   H H    . THR D 1 29  ? 114.358 86.130  102.120 1.00 0.00 ? 33  THR D H    1  
ATOM 8097   H HA   . THR D 1 29  ? 115.131 88.505  101.479 1.00 0.00 ? 33  THR D HA   1  
ATOM 8098   H HB   . THR D 1 29  ? 112.800 88.620  100.777 1.00 0.00 ? 33  THR D HB   1  
ATOM 8099   H HG1  . THR D 1 29  ? 112.695 90.709  101.831 1.00 0.00 ? 33  THR D HG1  1  
ATOM 8100   H HG21 . THR D 1 29  ? 111.079 88.492  102.509 1.00 0.00 ? 33  THR D HG21 1  
ATOM 8101   H HG22 . THR D 1 29  ? 111.828 87.620  102.656 1.00 0.00 ? 33  THR D HG22 1  
ATOM 8102   H HG23 . THR D 1 29  ? 112.342 88.813  103.564 1.00 0.00 ? 33  THR D HG23 1  
ATOM 8103   N N    . ASP D 1 30  ? 115.214 89.303  103.860 1.00 0.00 ? 34  ASP D N    1  
ATOM 8104   C CA   . ASP D 1 30  ? 115.864 89.459  105.142 1.00 0.00 ? 34  ASP D CA   1  
ATOM 8105   C C    . ASP D 1 30  ? 115.341 90.732  105.780 1.00 0.00 ? 34  ASP D C    1  
ATOM 8106   O O    . ASP D 1 30  ? 115.512 91.835  105.253 1.00 0.00 ? 34  ASP D O    1  
ATOM 8107   C CB   . ASP D 1 30  ? 117.384 89.510  104.962 1.00 0.00 ? 34  ASP D CB   1  
ATOM 8108   C CG   . ASP D 1 30  ? 118.140 88.933  106.141 1.00 0.00 ? 34  ASP D CG   1  
ATOM 8109   O OD1  . ASP D 1 30  ? 118.364 89.662  107.129 1.00 0.00 ? 34  ASP D OD1  1  
ATOM 8110   O OD2  . ASP D 1 30  ? 118.517 87.744  106.074 1.00 0.00 ? 34  ASP D OD2  1  
ATOM 8111   H H    . ASP D 1 30  ? 115.200 90.021  103.386 1.00 0.00 ? 34  ASP D H    1  
ATOM 8112   H HA   . ASP D 1 30  ? 115.668 88.705  105.719 1.00 0.00 ? 34  ASP D HA   1  
ATOM 8113   H HB2  . ASP D 1 30  ? 117.627 89.022  104.160 1.00 0.00 ? 34  ASP D HB2  1  
ATOM 8114   H HB3  . ASP D 1 30  ? 117.658 90.431  104.828 1.00 0.00 ? 34  ASP D HB3  1  
ATOM 8115   N N    . GLY D 1 31  ? 114.690 90.575  106.920 1.00 0.00 ? 35  GLY D N    1  
ATOM 8116   C CA   . GLY D 1 31  ? 114.327 91.713  107.725 1.00 0.00 ? 35  GLY D CA   1  
ATOM 8117   C C    . GLY D 1 31  ? 115.078 91.724  109.030 1.00 0.00 ? 35  GLY D C    1  
ATOM 8118   O O    . GLY D 1 31  ? 114.980 90.784  109.826 1.00 0.00 ? 35  GLY D O    1  
ATOM 8119   H H    . GLY D 1 31  ? 114.450 89.814  107.242 1.00 0.00 ? 35  GLY D H    1  
ATOM 8120   H HA2  . GLY D 1 31  ? 114.513 92.530  107.236 1.00 0.00 ? 35  GLY D HA2  1  
ATOM 8121   H HA3  . GLY D 1 31  ? 113.373 91.698  107.899 1.00 0.00 ? 35  GLY D HA3  1  
ATOM 8122   N N    . SER D 1 32  ? 115.829 92.792  109.264 1.00 0.00 ? 36  SER D N    1  
ATOM 8123   C CA   . SER D 1 32  ? 116.502 93.023  110.536 1.00 0.00 ? 36  SER D CA   1  
ATOM 8124   C C    . SER D 1 32  ? 115.847 94.268  111.111 1.00 0.00 ? 36  SER D C    1  
ATOM 8125   O O    . SER D 1 32  ? 115.833 95.331  110.487 1.00 0.00 ? 36  SER D O    1  
ATOM 8126   C CB   . SER D 1 32  ? 117.996 93.183  110.347 1.00 0.00 ? 36  SER D CB   1  
ATOM 8127   O OG   . SER D 1 32  ? 118.540 92.042  109.711 1.00 0.00 ? 36  SER D OG   1  
ATOM 8128   H H    . SER D 1 32  ? 115.965 93.410  108.682 1.00 0.00 ? 36  SER D H    1  
ATOM 8129   H HA   . SER D 1 32  ? 116.409 92.272  111.143 1.00 0.00 ? 36  SER D HA   1  
ATOM 8130   H HB2  . SER D 1 32  ? 118.178 93.974  109.816 1.00 0.00 ? 36  SER D HB2  1  
ATOM 8131   H HB3  . SER D 1 32  ? 118.425 93.316  111.207 1.00 0.00 ? 36  SER D HB3  1  
ATOM 8132   H HG   . SER D 1 32  ? 118.712 92.224  108.908 1.00 0.00 ? 36  SER D HG   1  
ATOM 8133   N N    . VAL D 1 33  ? 115.307 94.132  112.314 1.00 0.00 ? 37  VAL D N    1  
ATOM 8134   C CA   . VAL D 1 33  ? 114.523 95.191  112.934 1.00 0.00 ? 37  VAL D CA   1  
ATOM 8135   C C    . VAL D 1 33  ? 115.124 95.486  114.307 1.00 0.00 ? 37  VAL D C    1  
ATOM 8136   O O    . VAL D 1 33  ? 115.477 94.582  115.070 1.00 0.00 ? 37  VAL D O    1  
ATOM 8137   C CB   . VAL D 1 33  ? 113.032 94.827  112.989 1.00 0.00 ? 37  VAL D CB   1  
ATOM 8138   C CG1  . VAL D 1 33  ? 112.204 96.078  112.765 1.00 0.00 ? 37  VAL D CG1  1  
ATOM 8139   C CG2  . VAL D 1 33  ? 112.648 93.861  111.888 1.00 0.00 ? 37  VAL D CG2  1  
ATOM 8140   H H    . VAL D 1 33  ? 115.384 93.423  112.795 1.00 0.00 ? 37  VAL D H    1  
ATOM 8141   H HA   . VAL D 1 33  ? 114.563 96.000  112.401 1.00 0.00 ? 37  VAL D HA   1  
ATOM 8142   H HB   . VAL D 1 33  ? 112.868 94.424  113.856 1.00 0.00 ? 37  VAL D HB   1  
ATOM 8143   H HG11 . VAL D 1 33  ? 112.264 96.343  111.834 1.00 0.00 ? 37  VAL D HG11 1  
ATOM 8144   H HG12 . VAL D 1 33  ? 111.278 95.899  112.991 1.00 0.00 ? 37  VAL D HG12 1  
ATOM 8145   H HG13 . VAL D 1 33  ? 112.542 96.794  113.326 1.00 0.00 ? 37  VAL D HG13 1  
ATOM 8146   H HG21 . VAL D 1 33  ? 113.207 94.017  111.111 1.00 0.00 ? 37  VAL D HG21 1  
ATOM 8147   H HG22 . VAL D 1 33  ? 112.774 92.950  112.198 1.00 0.00 ? 37  VAL D HG22 1  
ATOM 8148   H HG23 . VAL D 1 33  ? 111.717 93.995  111.649 1.00 0.00 ? 37  VAL D HG23 1  
ATOM 8149   N N    . SER D 1 34  ? 115.276 96.770  114.601 1.00 0.00 ? 38  SER D N    1  
ATOM 8150   C CA   . SER D 1 34  ? 116.078 97.250  115.721 1.00 0.00 ? 38  SER D CA   1  
ATOM 8151   C C    . SER D 1 34  ? 115.306 98.374  116.407 1.00 0.00 ? 38  SER D C    1  
ATOM 8152   O O    . SER D 1 34  ? 115.168 99.470  115.867 1.00 0.00 ? 38  SER D O    1  
ATOM 8153   C CB   . SER D 1 34  ? 117.442 97.725  115.225 1.00 0.00 ? 38  SER D CB   1  
ATOM 8154   O OG   . SER D 1 34  ? 117.328 98.550  114.081 1.00 0.00 ? 38  SER D OG   1  
ATOM 8155   H H    . SER D 1 34  ? 114.907 97.402  114.148 1.00 0.00 ? 38  SER D H    1  
ATOM 8156   H HA   . SER D 1 34  ? 116.240 96.536  116.358 1.00 0.00 ? 38  SER D HA   1  
ATOM 8157   H HB2  . SER D 1 34  ? 117.891 98.213  115.933 1.00 0.00 ? 38  SER D HB2  1  
ATOM 8158   H HB3  . SER D 1 34  ? 117.996 96.956  115.016 1.00 0.00 ? 38  SER D HB3  1  
ATOM 8159   H HG   . SER D 1 34  ? 117.362 98.076  113.388 1.00 0.00 ? 38  SER D HG   1  
ATOM 8160   N N    . GLY D 1 35  ? 114.807 98.096  117.607 1.00 0.00 ? 39  GLY D N    1  
ATOM 8161   C CA   . GLY D 1 35  ? 114.025 99.080  118.328 1.00 0.00 ? 39  GLY D CA   1  
ATOM 8162   C C    . GLY D 1 35  ? 114.773 99.706  119.485 1.00 0.00 ? 39  GLY D C    1  
ATOM 8163   O O    . GLY D 1 35  ? 115.211 99.005  120.401 1.00 0.00 ? 39  GLY D O    1  
ATOM 8164   H H    . GLY D 1 35  ? 114.912 97.347  118.015 1.00 0.00 ? 39  GLY D H    1  
ATOM 8165   H HA2  . GLY D 1 35  ? 113.749 99.778  117.713 1.00 0.00 ? 39  GLY D HA2  1  
ATOM 8166   H HA3  . GLY D 1 35  ? 113.217 98.660  118.661 1.00 0.00 ? 39  GLY D HA3  1  
ATOM 8167   N N    . GLU D 1 36  ? 114.926 101.026 119.456 1.00 0.00 ? 40  GLU D N    1  
ATOM 8168   C CA   . GLU D 1 36  ? 115.641 101.763 120.493 1.00 0.00 ? 40  GLU D CA   1  
ATOM 8169   C C    . GLU D 1 36  ? 114.607 102.398 121.412 1.00 0.00 ? 40  GLU D C    1  
ATOM 8170   O O    . GLU D 1 36  ? 113.960 103.383 121.042 1.00 0.00 ? 40  GLU D O    1  
ATOM 8171   C CB   . GLU D 1 36  ? 116.565 102.814 119.880 1.00 0.00 ? 40  GLU D CB   1  
ATOM 8172   C CG   . GLU D 1 36  ? 117.200 103.746 120.895 1.00 0.00 ? 40  GLU D CG   1  
ATOM 8173   C CD   . GLU D 1 36  ? 118.620 104.127 120.528 1.00 0.00 ? 40  GLU D CD   1  
ATOM 8174   O OE1  . GLU D 1 36  ? 119.294 104.772 121.354 1.00 0.00 ? 40  GLU D OE1  1  
ATOM 8175   O OE2  . GLU D 1 36  ? 119.060 103.793 119.408 1.00 0.00 ? 40  GLU D OE2  1  
ATOM 8176   H H    . GLU D 1 36  ? 114.614 101.525 118.828 1.00 0.00 ? 40  GLU D H    1  
ATOM 8177   H HA   . GLU D 1 36  ? 116.207 101.162 121.001 1.00 0.00 ? 40  GLU D HA   1  
ATOM 8178   H HB2  . GLU D 1 36  ? 117.267 102.364 119.384 1.00 0.00 ? 40  GLU D HB2  1  
ATOM 8179   H HB3  . GLU D 1 36  ? 116.060 103.342 119.242 1.00 0.00 ? 40  GLU D HB3  1  
ATOM 8180   H HG2  . GLU D 1 36  ? 116.663 104.550 120.971 1.00 0.00 ? 40  GLU D HG2  1  
ATOM 8181   H HG3  . GLU D 1 36  ? 117.198 103.321 121.766 1.00 0.00 ? 40  GLU D HG3  1  
ATOM 8182   N N    . ARG D 1 37  ? 114.456 101.838 122.606 1.00 0.00 ? 41  ARG D N    1  
ATOM 8183   C CA   . ARG D 1 37  ? 113.416 102.264 123.532 1.00 0.00 ? 41  ARG D CA   1  
ATOM 8184   C C    . ARG D 1 37  ? 113.746 103.643 124.095 1.00 0.00 ? 41  ARG D C    1  
ATOM 8185   O O    . ARG D 1 37  ? 114.904 103.974 124.361 1.00 0.00 ? 41  ARG D O    1  
ATOM 8186   C CB   . ARG D 1 37  ? 113.246 101.230 124.635 1.00 0.00 ? 41  ARG D CB   1  
ATOM 8187   C CG   . ARG D 1 37  ? 112.024 100.367 124.459 1.00 0.00 ? 41  ARG D CG   1  
ATOM 8188   C CD   . ARG D 1 37  ? 110.783 101.133 124.837 1.00 0.00 ? 41  ARG D CD   1  
ATOM 8189   N NE   . ARG D 1 37  ? 110.392 102.015 123.743 1.00 0.00 ? 41  ARG D NE   1  
ATOM 8190   C CZ   . ARG D 1 37  ? 109.748 103.169 123.895 1.00 0.00 ? 41  ARG D CZ   1  
ATOM 8191   N NH1  . ARG D 1 37  ? 109.414 103.593 125.106 1.00 0.00 ? 41  ARG D NH1  1  
ATOM 8192   N NH2  . ARG D 1 37  ? 109.441 103.903 122.834 1.00 0.00 ? 41  ARG D NH2  1  
ATOM 8193   H H    . ARG D 1 37  ? 114.953 101.201 122.902 1.00 0.00 ? 41  ARG D H    1  
ATOM 8194   H HA   . ARG D 1 37  ? 112.572 102.334 123.060 1.00 0.00 ? 41  ARG D HA   1  
ATOM 8195   H HB2  . ARG D 1 37  ? 114.033 100.664 124.664 1.00 0.00 ? 41  ARG D HB2  1  
ATOM 8196   H HB3  . ARG D 1 37  ? 113.193 101.685 125.491 1.00 0.00 ? 41  ARG D HB3  1  
ATOM 8197   H HG2  . ARG D 1 37  ? 111.960 100.071 123.537 1.00 0.00 ? 41  ARG D HG2  1  
ATOM 8198   H HG3  . ARG D 1 37  ? 112.101 99.571  125.008 1.00 0.00 ? 41  ARG D HG3  1  
ATOM 8199   H HD2  . ARG D 1 37  ? 110.062 100.517 125.040 1.00 0.00 ? 41  ARG D HD2  1  
ATOM 8200   H HD3  . ARG D 1 37  ? 110.947 101.653 125.640 1.00 0.00 ? 41  ARG D HD3  1  
ATOM 8201   H HE   . ARG D 1 37  ? 110.592 101.772 122.942 1.00 0.00 ? 41  ARG D HE   1  
ATOM 8202   H HH11 . ARG D 1 37  ? 109.613 103.121 125.797 1.00 0.00 ? 41  ARG D HH11 1  
ATOM 8203   H HH12 . ARG D 1 37  ? 108.997 104.339 125.200 1.00 0.00 ? 41  ARG D HH12 1  
ATOM 8204   H HH21 . ARG D 1 37  ? 109.658 103.633 122.047 1.00 0.00 ? 41  ARG D HH21 1  
ATOM 8205   H HH22 . ARG D 1 37  ? 109.025 104.649 122.933 1.00 0.00 ? 41  ARG D HH22 1  
ATOM 8206   N N    . GLU D 1 38  ? 112.711 104.450 124.309 1.00 0.00 ? 42  GLU D N    1  
ATOM 8207   C CA   . GLU D 1 38  ? 112.857 105.873 124.588 1.00 0.00 ? 42  GLU D CA   1  
ATOM 8208   C C    . GLU D 1 38  ? 112.115 106.198 125.878 1.00 0.00 ? 42  GLU D C    1  
ATOM 8209   O O    . GLU D 1 38  ? 111.454 105.342 126.470 1.00 0.00 ? 42  GLU D O    1  
ATOM 8210   C CB   . GLU D 1 38  ? 112.333 106.694 123.411 1.00 0.00 ? 42  GLU D CB   1  
ATOM 8211   C CG   . GLU D 1 38  ? 113.294 106.719 122.251 1.00 0.00 ? 42  GLU D CG   1  
ATOM 8212   C CD   . GLU D 1 38  ? 113.093 107.921 121.368 1.00 0.00 ? 42  GLU D CD   1  
ATOM 8213   O OE1  . GLU D 1 38  ? 113.247 107.786 120.137 1.00 0.00 ? 42  GLU D OE1  1  
ATOM 8214   O OE2  . GLU D 1 38  ? 112.759 108.994 121.906 1.00 0.00 ? 42  GLU D OE2  1  
ATOM 8215   H H    . GLU D 1 38  ? 111.894 104.181 124.297 1.00 0.00 ? 42  GLU D H    1  
ATOM 8216   H HA   . GLU D 1 38  ? 113.793 106.100 124.703 1.00 0.00 ? 42  GLU D HA   1  
ATOM 8217   H HB2  . GLU D 1 38  ? 111.485 106.326 123.117 1.00 0.00 ? 42  GLU D HB2  1  
ATOM 8218   H HB3  . GLU D 1 38  ? 112.161 107.602 123.706 1.00 0.00 ? 42  GLU D HB3  1  
ATOM 8219   H HG2  . GLU D 1 38  ? 114.204 106.716 122.588 1.00 0.00 ? 42  GLU D HG2  1  
ATOM 8220   H HG3  . GLU D 1 38  ? 113.183 105.912 121.725 1.00 0.00 ? 42  GLU D HG3  1  
ATOM 8221   N N    . LEU D 1 39  ? 112.238 107.450 126.309 1.00 0.00 ? 43  LEU D N    1  
ATOM 8222   C CA   . LEU D 1 39  ? 111.617 107.936 127.531 1.00 0.00 ? 43  LEU D CA   1  
ATOM 8223   C C    . LEU D 1 39  ? 110.100 107.914 127.403 1.00 0.00 ? 43  LEU D C    1  
ATOM 8224   O O    . LEU D 1 39  ? 109.539 108.252 126.358 1.00 0.00 ? 43  LEU D O    1  
ATOM 8225   C CB   . LEU D 1 39  ? 112.080 109.361 127.860 1.00 0.00 ? 43  LEU D CB   1  
ATOM 8226   C CG   . LEU D 1 39  ? 112.696 109.649 129.231 1.00 0.00 ? 43  LEU D CG   1  
ATOM 8227   C CD1  . LEU D 1 39  ? 111.732 109.262 130.339 1.00 0.00 ? 43  LEU D CD1  1  
ATOM 8228   C CD2  . LEU D 1 39  ? 114.005 108.900 129.390 1.00 0.00 ? 43  LEU D CD2  1  
ATOM 8229   H H    . LEU D 1 39  ? 112.693 108.049 125.891 1.00 0.00 ? 43  LEU D H    1  
ATOM 8230   H HA   . LEU D 1 39  ? 111.889 107.347 128.252 1.00 0.00 ? 43  LEU D HA   1  
ATOM 8231   H HB2  . LEU D 1 39  ? 112.731 109.620 127.188 1.00 0.00 ? 43  LEU D HB2  1  
ATOM 8232   H HB3  . LEU D 1 39  ? 111.316 109.948 127.754 1.00 0.00 ? 43  LEU D HB3  1  
ATOM 8233   H HG   . LEU D 1 39  ? 112.872 110.601 129.292 1.00 0.00 ? 43  LEU D HG   1  
ATOM 8234   H HD11 . LEU D 1 39  ? 110.977 109.870 130.338 1.00 0.00 ? 43  LEU D HD11 1  
ATOM 8235   H HD12 . LEU D 1 39  ? 111.418 108.356 130.192 1.00 0.00 ? 43  LEU D HD12 1  
ATOM 8236   H HD13 . LEU D 1 39  ? 112.186 109.312 131.195 1.00 0.00 ? 43  LEU D HD13 1  
ATOM 8237   H HD21 . LEU D 1 39  ? 114.631 109.191 128.708 1.00 0.00 ? 43  LEU D HD21 1  
ATOM 8238   H HD22 . LEU D 1 39  ? 114.377 109.081 130.267 1.00 0.00 ? 43  LEU D HD22 1  
ATOM 8239   H HD23 . LEU D 1 39  ? 113.847 107.947 129.297 1.00 0.00 ? 43  LEU D HD23 1  
ATOM 8240   N N    . PHE D 1 40  ? 109.442 107.509 128.491 1.00 0.00 ? 44  PHE D N    1  
ATOM 8241   C CA   . PHE D 1 40  ? 107.992 107.598 128.606 1.00 0.00 ? 44  PHE D CA   1  
ATOM 8242   C C    . PHE D 1 40  ? 107.566 108.949 129.156 1.00 0.00 ? 44  PHE D C    1  
ATOM 8243   O O    . PHE D 1 40  ? 108.065 109.386 130.195 1.00 0.00 ? 44  PHE D O    1  
ATOM 8244   C CB   . PHE D 1 40  ? 107.412 106.498 129.503 1.00 0.00 ? 44  PHE D CB   1  
ATOM 8245   C CG   . PHE D 1 40  ? 108.268 105.258 129.561 1.00 0.00 ? 44  PHE D CG   1  
ATOM 8246   C CD1  . PHE D 1 40  ? 108.918 104.902 130.734 1.00 0.00 ? 44  PHE D CD1  1  
ATOM 8247   C CD2  . PHE D 1 40  ? 108.416 104.445 128.447 1.00 0.00 ? 44  PHE D CD2  1  
ATOM 8248   C CE1  . PHE D 1 40  ? 109.705 103.765 130.789 1.00 0.00 ? 44  PHE D CE1  1  
ATOM 8249   C CE2  . PHE D 1 40  ? 109.197 103.306 128.500 1.00 0.00 ? 44  PHE D CE2  1  
ATOM 8250   C CZ   . PHE D 1 40  ? 109.844 102.967 129.670 1.00 0.00 ? 44  PHE D CZ   1  
ATOM 8251   H H    . PHE D 1 40  ? 109.829 107.174 129.183 1.00 0.00 ? 44  PHE D H    1  
ATOM 8252   H HA   . PHE D 1 40  ? 107.645 107.484 127.708 1.00 0.00 ? 44  PHE D HA   1  
ATOM 8253   H HB2  . PHE D 1 40  ? 107.299 106.847 130.400 1.00 0.00 ? 44  PHE D HB2  1  
ATOM 8254   H HB3  . PHE D 1 40  ? 106.530 106.258 129.178 1.00 0.00 ? 44  PHE D HB3  1  
ATOM 8255   H HD1  . PHE D 1 40  ? 108.823 105.433 131.492 1.00 0.00 ? 44  PHE D HD1  1  
ATOM 8256   H HD2  . PHE D 1 40  ? 107.984 104.668 127.655 1.00 0.00 ? 44  PHE D HD2  1  
ATOM 8257   H HE1  . PHE D 1 40  ? 110.140 103.538 131.579 1.00 0.00 ? 44  PHE D HE1  1  
ATOM 8258   H HE2  . PHE D 1 40  ? 109.287 102.769 127.748 1.00 0.00 ? 44  PHE D HE2  1  
ATOM 8259   H HZ   . PHE D 1 40  ? 110.373 102.204 129.704 1.00 0.00 ? 44  PHE D HZ   1  
ATOM 8260   N N    . ASP D 1 41  ? 106.642 109.594 128.456 1.00 0.00 ? 45  ASP D N    1  
ATOM 8261   C CA   . ASP D 1 41  ? 105.741 110.588 129.022 1.00 0.00 ? 45  ASP D CA   1  
ATOM 8262   C C    . ASP D 1 41  ? 106.538 111.864 129.284 1.00 0.00 ? 45  ASP D C    1  
ATOM 8263   O O    . ASP D 1 41  ? 107.391 111.918 130.173 1.00 0.00 ? 45  ASP D O    1  
ATOM 8264   C CB   . ASP D 1 41  ? 105.065 110.088 130.307 1.00 0.00 ? 45  ASP D CB   1  
ATOM 8265   C CG   . ASP D 1 41  ? 104.195 111.144 130.973 1.00 0.00 ? 45  ASP D CG   1  
ATOM 8266   O OD1  . ASP D 1 41  ? 103.594 111.965 130.252 1.00 0.00 ? 45  ASP D OD1  1  
ATOM 8267   O OD2  . ASP D 1 41  ? 104.143 111.176 132.220 1.00 0.00 ? 45  ASP D OD2  1  
ATOM 8268   H H    . ASP D 1 41  ? 106.519 109.462 127.615 1.00 0.00 ? 45  ASP D H    1  
ATOM 8269   H HA   . ASP D 1 41  ? 105.026 110.764 128.391 1.00 0.00 ? 45  ASP D HA   1  
ATOM 8270   H HB2  . ASP D 1 41  ? 104.522 109.312 130.100 1.00 0.00 ? 45  ASP D HB2  1  
ATOM 8271   H HB3  . ASP D 1 41  ? 105.747 109.797 130.933 1.00 0.00 ? 45  ASP D HB3  1  
ATOM 8272   N N    . GLU D 1 42  ? 106.261 112.899 128.494 1.00 0.00 ? 46  GLU D N    1  
ATOM 8273   C CA   . GLU D 1 42  ? 106.887 114.200 128.690 1.00 0.00 ? 46  GLU D CA   1  
ATOM 8274   C C    . GLU D 1 42  ? 106.485 114.865 129.995 1.00 0.00 ? 46  GLU D C    1  
ATOM 8275   O O    . GLU D 1 42  ? 107.293 115.605 130.569 1.00 0.00 ? 46  GLU D O    1  
ATOM 8276   C CB   . GLU D 1 42  ? 106.544 115.143 127.533 1.00 0.00 ? 46  GLU D CB   1  
ATOM 8277   C CG   . GLU D 1 42  ? 107.627 116.139 127.185 1.00 0.00 ? 46  GLU D CG   1  
ATOM 8278   C CD   . GLU D 1 42  ? 107.091 117.403 126.552 1.00 0.00 ? 46  GLU D CD   1  
ATOM 8279   O OE1  . GLU D 1 42  ? 105.862 117.514 126.372 1.00 0.00 ? 46  GLU D OE1  1  
ATOM 8280   O OE2  . GLU D 1 42  ? 107.903 118.302 126.255 1.00 0.00 ? 46  GLU D OE2  1  
ATOM 8281   H H    . GLU D 1 42  ? 105.709 112.866 127.835 1.00 0.00 ? 46  GLU D H    1  
ATOM 8282   H HA   . GLU D 1 42  ? 107.842 114.033 128.722 1.00 0.00 ? 46  GLU D HA   1  
ATOM 8283   H HB2  . GLU D 1 42  ? 106.346 114.612 126.746 1.00 0.00 ? 46  GLU D HB2  1  
ATOM 8284   H HB3  . GLU D 1 42  ? 105.735 115.629 127.757 1.00 0.00 ? 46  GLU D HB3  1  
ATOM 8285   H HG2  . GLU D 1 42  ? 108.118 116.370 127.989 1.00 0.00 ? 46  GLU D HG2  1  
ATOM 8286   H HG3  . GLU D 1 42  ? 108.258 115.723 126.577 1.00 0.00 ? 46  GLU D HG3  1  
ATOM 8287   N N    . GLN D 1 43  ? 105.238 114.640 130.439 1.00 0.00 ? 47  GLN D N    1  
ATOM 8288   C CA   . GLN D 1 43  ? 104.602 115.309 131.588 1.00 0.00 ? 47  GLN D CA   1  
ATOM 8289   C C    . GLN D 1 43  ? 104.276 116.772 131.279 1.00 0.00 ? 47  GLN D C    1  
ATOM 8290   O O    . GLN D 1 43  ? 104.079 117.572 132.198 1.00 0.00 ? 47  GLN D O    1  
ATOM 8291   C CB   . GLN D 1 43  ? 105.458 115.201 132.860 1.00 0.00 ? 47  GLN D CB   1  
ATOM 8292   C CG   . GLN D 1 43  ? 105.973 113.796 133.168 1.00 0.00 ? 47  GLN D CG   1  
ATOM 8293   C CD   . GLN D 1 43  ? 107.484 113.697 133.220 1.00 0.00 ? 47  GLN D CD   1  
ATOM 8294   O OE1  . GLN D 1 43  ? 108.096 112.981 132.429 1.00 0.00 ? 47  GLN D OE1  1  
ATOM 8295   N NE2  . GLN D 1 43  ? 108.095 114.421 134.150 1.00 0.00 ? 47  GLN D NE2  1  
ATOM 8296   H H    . GLN D 1 43  ? 104.718 114.068 130.062 1.00 0.00 ? 47  GLN D H    1  
ATOM 8297   H HA   . GLN D 1 43  ? 103.767 114.845 131.753 1.00 0.00 ? 47  GLN D HA   1  
ATOM 8298   H HB2  . GLN D 1 43  ? 106.218 115.799 132.775 1.00 0.00 ? 47  GLN D HB2  1  
ATOM 8299   H HB3  . GLN D 1 43  ? 104.934 115.513 133.615 1.00 0.00 ? 47  GLN D HB3  1  
ATOM 8300   H HG2  . GLN D 1 43  ? 105.608 113.507 134.019 1.00 0.00 ? 47  GLN D HG2  1  
ATOM 8301   H HG3  . GLN D 1 43  ? 105.640 113.183 132.494 1.00 0.00 ? 47  GLN D HG3  1  
ATOM 8302   H HE21 . GLN D 1 43  ? 107.634 114.911 134.686 1.00 0.00 ? 47  GLN D HE21 1  
ATOM 8303   H HE22 . GLN D 1 43  ? 108.953 114.401 134.215 1.00 0.00 ? 47  GLN D HE22 1  
ATOM 8304   N N    . THR D 1 44  ? 104.157 117.094 129.982 1.00 0.00 ? 48  THR D N    1  
ATOM 8305   C CA   . THR D 1 44  ? 104.167 118.459 129.437 1.00 0.00 ? 48  THR D CA   1  
ATOM 8306   C C    . THR D 1 44  ? 105.241 119.323 130.103 1.00 0.00 ? 48  THR D C    1  
ATOM 8307   O O    . THR D 1 44  ? 104.955 120.342 130.733 1.00 0.00 ? 48  THR D O    1  
ATOM 8308   C CB   . THR D 1 44  ? 102.786 119.119 129.533 1.00 0.00 ? 48  THR D CB   1  
ATOM 8309   O OG1  . THR D 1 44  ? 101.760 118.124 129.430 1.00 0.00 ? 48  THR D OG1  1  
ATOM 8310   C CG2  . THR D 1 44  ? 102.607 120.142 128.420 1.00 0.00 ? 48  THR D CG2  1  
ATOM 8311   H H    . THR D 1 44  ? 104.065 116.495 129.372 1.00 0.00 ? 48  THR D H    1  
ATOM 8312   H HA   . THR D 1 44  ? 104.390 118.387 128.495 1.00 0.00 ? 48  THR D HA   1  
ATOM 8313   H HB   . THR D 1 44  ? 102.721 119.567 130.390 1.00 0.00 ? 48  THR D HB   1  
ATOM 8314   H HG1  . THR D 1 44  ? 101.812 117.599 130.083 1.00 0.00 ? 48  THR D HG1  1  
ATOM 8315   H HG21 . THR D 1 44  ? 102.166 120.987 128.600 1.00 0.00 ? 48  THR D HG21 1  
ATOM 8316   H HG22 . THR D 1 44  ? 103.289 120.827 128.497 1.00 0.00 ? 48  THR D HG22 1  
ATOM 8317   H HG23 . THR D 1 44  ? 102.686 119.702 127.559 1.00 0.00 ? 48  THR D HG23 1  
ATOM 8318   N N    . LYS D 1 45  ? 106.497 118.900 129.952 1.00 0.00 ? 49  LYS D N    1  
ATOM 8319   C CA   . LYS D 1 45  ? 107.633 119.575 130.571 1.00 0.00 ? 49  LYS D CA   1  
ATOM 8320   C C    . LYS D 1 45  ? 108.545 120.170 129.506 1.00 0.00 ? 49  LYS D C    1  
ATOM 8321   O O    . LYS D 1 45  ? 108.086 120.918 128.636 1.00 0.00 ? 49  LYS D O    1  
ATOM 8322   C CB   . LYS D 1 45  ? 108.438 118.619 131.458 1.00 0.00 ? 49  LYS D CB   1  
ATOM 8323   C CG   . LYS D 1 45  ? 107.680 118.027 132.629 1.00 0.00 ? 49  LYS D CG   1  
ATOM 8324   C CD   . LYS D 1 45  ? 107.885 118.842 133.885 1.00 0.00 ? 49  LYS D CD   1  
ATOM 8325   C CE   . LYS D 1 45  ? 106.569 119.080 134.598 1.00 0.00 ? 49  LYS D CE   1  
ATOM 8326   N NZ   . LYS D 1 45  ? 105.806 117.814 134.758 1.00 0.00 ? 49  LYS D NZ   1  
ATOM 8327   H H    . LYS D 1 45  ? 106.712 118.210 129.485 1.00 0.00 ? 49  LYS D H    1  
ATOM 8328   H HA   . LYS D 1 45  ? 107.281 120.286 131.128 1.00 0.00 ? 49  LYS D HA   1  
ATOM 8329   H HB2  . LYS D 1 45  ? 108.770 117.893 130.906 1.00 0.00 ? 49  LYS D HB2  1  
ATOM 8330   H HB3  . LYS D 1 45  ? 109.212 119.092 131.799 1.00 0.00 ? 49  LYS D HB3  1  
ATOM 8331   H HG2  . LYS D 1 45  ? 106.734 117.989 132.418 1.00 0.00 ? 49  LYS D HG2  1  
ATOM 8332   H HG3  . LYS D 1 45  ? 107.974 117.116 132.780 1.00 0.00 ? 49  LYS D HG3  1  
ATOM 8333   H HD2  . LYS D 1 45  ? 108.499 118.381 134.478 1.00 0.00 ? 49  LYS D HD2  1  
ATOM 8334   H HD3  . LYS D 1 45  ? 108.293 119.693 133.660 1.00 0.00 ? 49  LYS D HD3  1  
ATOM 8335   H HE2  . LYS D 1 45  ? 106.736 119.471 135.470 1.00 0.00 ? 49  LYS D HE2  1  
ATOM 8336   H HE3  . LYS D 1 45  ? 106.038 119.719 134.098 1.00 0.00 ? 49  LYS D HE3  1  
ATOM 8337   H HZ1  . LYS D 1 45  ? 105.821 117.359 133.994 1.00 0.00 ? 49  LYS D HZ1  1  
ATOM 8338   H HZ2  . LYS D 1 45  ? 106.175 117.323 135.403 1.00 0.00 ? 49  LYS D HZ2  1  
ATOM 8339   H HZ3  . LYS D 1 45  ? 104.962 118.001 134.974 1.00 0.00 ? 49  LYS D HZ3  1  
ATOM 8340   N N    . ASN D 1 46  ? 109.843 119.851 129.578 1.00 0.00 ? 50  ASN D N    1  
ATOM 8341   C CA   . ASN D 1 46  ? 110.805 120.319 128.582 1.00 0.00 ? 50  ASN D CA   1  
ATOM 8342   C C    . ASN D 1 46  ? 111.229 119.221 127.613 1.00 0.00 ? 50  ASN D C    1  
ATOM 8343   O O    . ASN D 1 46  ? 112.215 119.395 126.891 1.00 0.00 ? 50  ASN D O    1  
ATOM 8344   C CB   . ASN D 1 46  ? 112.047 120.896 129.275 1.00 0.00 ? 50  ASN D CB   1  
ATOM 8345   C CG   . ASN D 1 46  ? 112.730 121.976 128.456 1.00 0.00 ? 50  ASN D CG   1  
ATOM 8346   O OD1  . ASN D 1 46  ? 113.628 121.694 127.666 1.00 0.00 ? 50  ASN D OD1  1  
ATOM 8347   N ND2  . ASN D 1 46  ? 112.313 123.221 128.653 1.00 0.00 ? 50  ASN D ND2  1  
ATOM 8348   H H    . ASN D 1 46  ? 110.183 119.364 130.199 1.00 0.00 ? 50  ASN D H    1  
ATOM 8349   H HA   . ASN D 1 46  ? 110.360 121.010 128.066 1.00 0.00 ? 50  ASN D HA   1  
ATOM 8350   H HB2  . ASN D 1 46  ? 111.791 121.262 130.135 1.00 0.00 ? 50  ASN D HB2  1  
ATOM 8351   H HB3  . ASN D 1 46  ? 112.677 120.180 129.447 1.00 0.00 ? 50  ASN D HB3  1  
ATOM 8352   H HD21 . ASN D 1 46  ? 112.675 123.869 128.218 1.00 0.00 ? 50  ASN D HD21 1  
ATOM 8353   H HD22 . ASN D 1 46  ? 111.682 123.379 129.215 1.00 0.00 ? 50  ASN D HD22 1  
ATOM 8354   N N    . GLY D 1 47  ? 110.514 118.102 127.580 1.00 0.00 ? 51  GLY D N    1  
ATOM 8355   C CA   . GLY D 1 47  ? 110.858 117.001 126.698 1.00 0.00 ? 51  GLY D CA   1  
ATOM 8356   C C    . GLY D 1 47  ? 111.414 115.829 127.479 1.00 0.00 ? 51  GLY D C    1  
ATOM 8357   O O    . GLY D 1 47  ? 112.626 115.625 127.565 1.00 0.00 ? 51  GLY D O    1  
ATOM 8358   H H    . GLY D 1 47  ? 109.819 117.962 128.067 1.00 0.00 ? 51  GLY D H    1  
ATOM 8359   H HA2  . GLY D 1 47  ? 110.071 116.720 126.204 1.00 0.00 ? 51  GLY D HA2  1  
ATOM 8360   H HA3  . GLY D 1 47  ? 111.511 117.296 126.045 1.00 0.00 ? 51  GLY D HA3  1  
ATOM 8361   N N    . ARG D 1 48  ? 110.510 115.043 128.061 1.00 0.00 ? 52  ARG D N    1  
ATOM 8362   C CA   . ARG D 1 48  ? 110.900 113.888 128.858 1.00 0.00 ? 52  ARG D CA   1  
ATOM 8363   C C    . ARG D 1 48  ? 110.502 112.639 128.077 1.00 0.00 ? 52  ARG D C    1  
ATOM 8364   O O    . ARG D 1 48  ? 110.257 111.570 128.645 1.00 0.00 ? 52  ARG D O    1  
ATOM 8365   C CB   . ARG D 1 48  ? 110.255 113.939 130.250 1.00 0.00 ? 52  ARG D CB   1  
ATOM 8366   C CG   . ARG D 1 48  ? 110.205 115.332 130.903 1.00 0.00 ? 52  ARG D CG   1  
ATOM 8367   C CD   . ARG D 1 48  ? 111.319 115.561 131.921 1.00 0.00 ? 52  ARG D CD   1  
ATOM 8368   N NE   . ARG D 1 48  ? 112.644 115.313 131.357 1.00 0.00 ? 52  ARG D NE   1  
ATOM 8369   C CZ   . ARG D 1 48  ? 113.347 116.216 130.678 1.00 0.00 ? 52  ARG D CZ   1  
ATOM 8370   N NH1  . ARG D 1 48  ? 112.856 117.430 130.476 1.00 0.00 ? 52  ARG D NH1  1  
ATOM 8371   N NH2  . ARG D 1 48  ? 114.543 115.904 130.198 1.00 0.00 ? 52  ARG D NH2  1  
ATOM 8372   H H    . ARG D 1 48  ? 109.661 115.163 128.003 1.00 0.00 ? 52  ARG D H    1  
ATOM 8373   H HA   . ARG D 1 48  ? 111.858 113.880 129.011 1.00 0.00 ? 52  ARG D HA   1  
ATOM 8374   H HB2  . ARG D 1 48  ? 109.350 113.597 130.182 1.00 0.00 ? 52  ARG D HB2  1  
ATOM 8375   H HB3  . ARG D 1 48  ? 110.742 113.341 130.838 1.00 0.00 ? 52  ARG D HB3  1  
ATOM 8376   H HG2  . ARG D 1 48  ? 110.262 116.009 130.211 1.00 0.00 ? 52  ARG D HG2  1  
ATOM 8377   H HG3  . ARG D 1 48  ? 109.346 115.446 131.341 1.00 0.00 ? 52  ARG D HG3  1  
ATOM 8378   H HD2  . ARG D 1 48  ? 111.273 116.474 132.246 1.00 0.00 ? 52  ARG D HD2  1  
ATOM 8379   H HD3  . ARG D 1 48  ? 111.181 114.981 132.686 1.00 0.00 ? 52  ARG D HD3  1  
ATOM 8380   H HE   . ARG D 1 48  ? 112.990 114.534 131.470 1.00 0.00 ? 52  ARG D HE   1  
ATOM 8381   H HH11 . ARG D 1 48  ? 112.081 117.638 130.784 1.00 0.00 ? 52  ARG D HH11 1  
ATOM 8382   H HH12 . ARG D 1 48  ? 113.314 118.012 130.037 1.00 0.00 ? 52  ARG D HH12 1  
ATOM 8383   H HH21 . ARG D 1 48  ? 114.867 115.118 130.325 1.00 0.00 ? 52  ARG D HH21 1  
ATOM 8384   H HH22 . ARG D 1 48  ? 114.996 116.489 129.759 1.00 0.00 ? 52  ARG D HH22 1  
ATOM 8385   N N    . ILE D 1 49  ? 110.380 112.786 126.759 1.00 0.00 ? 53  ILE D N    1  
ATOM 8386   C CA   . ILE D 1 49  ? 110.041 111.671 125.881 1.00 0.00 ? 53  ILE D CA   1  
ATOM 8387   C C    . ILE D 1 49  ? 111.107 111.516 124.802 1.00 0.00 ? 53  ILE D C    1  
ATOM 8388   O O    . ILE D 1 49  ? 110.978 110.678 123.904 1.00 0.00 ? 53  ILE D O    1  
ATOM 8389   C CB   . ILE D 1 49  ? 108.647 111.850 125.251 1.00 0.00 ? 53  ILE D CB   1  
ATOM 8390   C CG1  . ILE D 1 49  ? 108.269 113.331 125.168 1.00 0.00 ? 53  ILE D CG1  1  
ATOM 8391   C CG2  . ILE D 1 49  ? 107.606 111.079 126.044 1.00 0.00 ? 53  ILE D CG2  1  
ATOM 8392   C CD1  . ILE D 1 49  ? 107.016 113.632 124.348 1.00 0.00 ? 53  ILE D CD1  1  
ATOM 8393   H H    . ILE D 1 49  ? 110.493 113.534 126.350 1.00 0.00 ? 53  ILE D H    1  
ATOM 8394   H HA   . ILE D 1 49  ? 110.012 110.861 126.415 1.00 0.00 ? 53  ILE D HA   1  
ATOM 8395   H HB   . ILE D 1 49  ? 108.675 111.497 124.348 1.00 0.00 ? 53  ILE D HB   1  
ATOM 8396   H HG12 . ILE D 1 49  ? 108.140 113.669 126.068 1.00 0.00 ? 53  ILE D HG12 1  
ATOM 8397   H HG13 . ILE D 1 49  ? 109.015 113.820 124.786 1.00 0.00 ? 53  ILE D HG13 1  
ATOM 8398   H HG21 . ILE D 1 49  ? 108.041 110.376 126.551 1.00 0.00 ? 53  ILE D HG21 1  
ATOM 8399   H HG22 . ILE D 1 49  ? 107.151 111.682 126.653 1.00 0.00 ? 53  ILE D HG22 1  
ATOM 8400   H HG23 . ILE D 1 49  ? 106.960 110.686 125.436 1.00 0.00 ? 53  ILE D HG23 1  
ATOM 8401   H HD11 . ILE D 1 49  ? 106.288 113.868 124.944 1.00 0.00 ? 53  ILE D HD11 1  
ATOM 8402   H HD12 . ILE D 1 49  ? 107.192 114.372 123.746 1.00 0.00 ? 53  ILE D HD12 1  
ATOM 8403   H HD13 . ILE D 1 49  ? 106.769 112.848 123.833 1.00 0.00 ? 53  ILE D HD13 1  
ATOM 8404   N N    . LEU D 1 50  ? 112.162 112.333 124.880 1.00 0.00 ? 54  LEU D N    1  
ATOM 8405   C CA   . LEU D 1 50  ? 113.286 112.228 123.957 1.00 0.00 ? 54  LEU D CA   1  
ATOM 8406   C C    . LEU D 1 50  ? 114.505 111.588 124.609 1.00 0.00 ? 54  LEU D C    1  
ATOM 8407   O O    . LEU D 1 50  ? 115.626 111.797 124.135 1.00 0.00 ? 54  LEU D O    1  
ATOM 8408   C CB   . LEU D 1 50  ? 113.683 113.615 123.431 1.00 0.00 ? 54  LEU D CB   1  
ATOM 8409   C CG   . LEU D 1 50  ? 113.634 114.018 121.949 1.00 0.00 ? 54  LEU D CG   1  
ATOM 8410   C CD1  . LEU D 1 50  ? 115.027 114.213 121.371 1.00 0.00 ? 54  LEU D CD1  1  
ATOM 8411   C CD2  . LEU D 1 50  ? 112.865 112.992 121.124 1.00 0.00 ? 54  LEU D CD2  1  
ATOM 8412   H H    . LEU D 1 50  ? 112.242 112.956 125.467 1.00 0.00 ? 54  LEU D H    1  
ATOM 8413   H HA   . LEU D 1 50  ? 112.992 111.664 123.225 1.00 0.00 ? 54  LEU D HA   1  
ATOM 8414   H HB2  . LEU D 1 50  ? 113.126 114.253 123.904 1.00 0.00 ? 54  LEU D HB2  1  
ATOM 8415   H HB3  . LEU D 1 50  ? 114.596 113.764 123.722 1.00 0.00 ? 54  LEU D HB3  1  
ATOM 8416   H HG   . LEU D 1 50  ? 113.168 114.867 121.904 1.00 0.00 ? 54  LEU D HG   1  
ATOM 8417   H HD11 . LEU D 1 50  ? 115.085 115.088 120.956 1.00 0.00 ? 54  LEU D HD11 1  
ATOM 8418   H HD12 . LEU D 1 50  ? 115.684 114.146 122.080 1.00 0.00 ? 54  LEU D HD12 1  
ATOM 8419   H HD13 . LEU D 1 50  ? 115.199 113.529 120.705 1.00 0.00 ? 54  LEU D HD13 1  
ATOM 8420   H HD21 . LEU D 1 50  ? 112.472 113.427 120.352 1.00 0.00 ? 54  LEU D HD21 1  
ATOM 8421   H HD22 . LEU D 1 50  ? 113.471 112.294 120.828 1.00 0.00 ? 54  LEU D HD22 1  
ATOM 8422   H HD23 . LEU D 1 50  ? 112.163 112.601 121.667 1.00 0.00 ? 54  LEU D HD23 1  
ATOM 8423   N N    . GLY D 1 51  ? 114.301 110.815 125.678 1.00 0.00 ? 55  GLY D N    1  
ATOM 8424   C CA   . GLY D 1 51  ? 115.373 110.320 126.507 1.00 0.00 ? 55  GLY D CA   1  
ATOM 8425   C C    . GLY D 1 51  ? 115.853 108.936 126.129 1.00 0.00 ? 55  GLY D C    1  
ATOM 8426   O O    . GLY D 1 51  ? 115.164 108.176 125.445 1.00 0.00 ? 55  GLY D O    1  
ATOM 8427   H H    . GLY D 1 51  ? 113.520 110.566 125.937 1.00 0.00 ? 55  GLY D H    1  
ATOM 8428   H HA2  . GLY D 1 51  ? 116.120 110.937 126.457 1.00 0.00 ? 55  GLY D HA2  1  
ATOM 8429   H HA3  . GLY D 1 51  ? 115.077 110.308 127.431 1.00 0.00 ? 55  GLY D HA3  1  
ATOM 8430   N N    . PRO D 1 52  ? 117.059 108.582 126.575 1.00 0.00 ? 56  PRO D N    1  
ATOM 8431   C CA   . PRO D 1 52  ? 117.645 107.300 126.173 1.00 0.00 ? 56  PRO D CA   1  
ATOM 8432   C C    . PRO D 1 52  ? 117.005 106.098 126.839 1.00 0.00 ? 56  PRO D C    1  
ATOM 8433   O O    . PRO D 1 52  ? 116.420 106.198 127.922 1.00 0.00 ? 56  PRO D O    1  
ATOM 8434   C CB   . PRO D 1 52  ? 119.128 107.474 126.521 1.00 0.00 ? 56  PRO D CB   1  
ATOM 8435   C CG   . PRO D 1 52  ? 119.127 108.436 127.642 1.00 0.00 ? 56  PRO D CG   1  
ATOM 8436   C CD   . PRO D 1 52  ? 117.997 109.389 127.373 1.00 0.00 ? 56  PRO D CD   1  
ATOM 8437   H HA   . PRO D 1 52  ? 117.516 107.132 125.227 1.00 0.00 ? 56  PRO D HA   1  
ATOM 8438   H HB2  . PRO D 1 52  ? 119.533 106.631 126.779 1.00 0.00 ? 56  PRO D HB2  1  
ATOM 8439   H HB3  . PRO D 1 52  ? 119.632 107.811 125.764 1.00 0.00 ? 56  PRO D HB3  1  
ATOM 8440   H HG2  . PRO D 1 52  ? 119.002 107.980 128.489 1.00 0.00 ? 56  PRO D HG2  1  
ATOM 8441   H HG3  . PRO D 1 52  ? 119.973 108.907 127.695 1.00 0.00 ? 56  PRO D HG3  1  
ATOM 8442   H HD2  . PRO D 1 52  ? 117.590 109.703 128.195 1.00 0.00 ? 56  PRO D HD2  1  
ATOM 8443   H HD3  . PRO D 1 52  ? 118.297 110.173 126.888 1.00 0.00 ? 56  PRO D HD3  1  
ATOM 8444   N N    . GLY D 1 53  ? 117.123 104.948 126.183 1.00 0.00 ? 57  GLY D N    1  
ATOM 8445   C CA   . GLY D 1 53  ? 116.557 103.711 126.686 1.00 0.00 ? 57  GLY D CA   1  
ATOM 8446   C C    . GLY D 1 53  ? 117.293 102.538 126.084 1.00 0.00 ? 57  GLY D C    1  
ATOM 8447   O O    . GLY D 1 53  ? 118.268 102.699 125.345 1.00 0.00 ? 57  GLY D O    1  
ATOM 8448   H H    . GLY D 1 53  ? 117.534 104.867 125.433 1.00 0.00 ? 57  GLY D H    1  
ATOM 8449   H HA2  . GLY D 1 53  ? 116.623 103.684 127.654 1.00 0.00 ? 57  GLY D HA2  1  
ATOM 8450   H HA3  . GLY D 1 53  ? 115.615 103.662 126.464 1.00 0.00 ? 57  GLY D HA3  1  
ATOM 8451   N N    . SER D 1 54  ? 116.817 101.344 126.420 1.00 0.00 ? 58  SER D N    1  
ATOM 8452   C CA   . SER D 1 54  ? 117.426 100.128 125.904 1.00 0.00 ? 58  SER D CA   1  
ATOM 8453   C C    . SER D 1 54  ? 117.011 99.895  124.455 1.00 0.00 ? 58  SER D C    1  
ATOM 8454   O O    . SER D 1 54  ? 116.158 100.598 123.907 1.00 0.00 ? 58  SER D O    1  
ATOM 8455   C CB   . SER D 1 54  ? 117.033 98.929  126.765 1.00 0.00 ? 58  SER D CB   1  
ATOM 8456   O OG   . SER D 1 54  ? 118.123 98.045  126.938 1.00 0.00 ? 58  SER D OG   1  
ATOM 8457   H H    . SER D 1 54  ? 116.145 101.218 126.942 1.00 0.00 ? 58  SER D H    1  
ATOM 8458   H HA   . SER D 1 54  ? 118.390 100.230 125.936 1.00 0.00 ? 58  SER D HA   1  
ATOM 8459   H HB2  . SER D 1 54  ? 116.722 99.238  127.631 1.00 0.00 ? 58  SER D HB2  1  
ATOM 8460   H HB3  . SER D 1 54  ? 116.294 98.458  126.350 1.00 0.00 ? 58  SER D HB3  1  
ATOM 8461   H HG   . SER D 1 54  ? 117.912 97.281  126.660 1.00 0.00 ? 58  SER D HG   1  
ATOM 8462   N N    . VAL D 1 55  ? 117.632 98.901  123.832 1.00 0.00 ? 59  VAL D N    1  
ATOM 8463   C CA   . VAL D 1 55  ? 117.395 98.576  122.431 1.00 0.00 ? 59  VAL D CA   1  
ATOM 8464   C C    . VAL D 1 55  ? 116.963 97.115  122.325 1.00 0.00 ? 59  VAL D C    1  
ATOM 8465   O O    . VAL D 1 55  ? 117.588 96.218  122.905 1.00 0.00 ? 59  VAL D O    1  
ATOM 8466   C CB   . VAL D 1 55  ? 118.620 98.906  121.555 1.00 0.00 ? 59  VAL D CB   1  
ATOM 8467   C CG1  . VAL D 1 55  ? 118.673 98.067  120.269 1.00 0.00 ? 59  VAL D CG1  1  
ATOM 8468   C CG2  . VAL D 1 55  ? 118.652 100.392 121.219 1.00 0.00 ? 59  VAL D CG2  1  
ATOM 8469   H H    . VAL D 1 55  ? 118.209 98.390  124.214 1.00 0.00 ? 59  VAL D H    1  
ATOM 8470   H HA   . VAL D 1 55  ? 116.677 99.130  122.087 1.00 0.00 ? 59  VAL D HA   1  
ATOM 8471   H HB   . VAL D 1 55  ? 119.406 98.678  122.075 1.00 0.00 ? 59  VAL D HB   1  
ATOM 8472   H HG11 . VAL D 1 55  ? 117.789 97.717  120.075 1.00 0.00 ? 59  VAL D HG11 1  
ATOM 8473   H HG12 . VAL D 1 55  ? 118.969 98.623  119.532 1.00 0.00 ? 59  VAL D HG12 1  
ATOM 8474   H HG13 . VAL D 1 55  ? 119.294 97.331  120.388 1.00 0.00 ? 59  VAL D HG13 1  
ATOM 8475   H HG21 . VAL D 1 55  ? 118.220 100.539 120.363 1.00 0.00 ? 59  VAL D HG21 1  
ATOM 8476   H HG22 . VAL D 1 55  ? 118.185 100.890 121.907 1.00 0.00 ? 59  VAL D HG22 1  
ATOM 8477   H HG23 . VAL D 1 55  ? 119.574 100.693 121.171 1.00 0.00 ? 59  VAL D HG23 1  
ATOM 8478   N N    . ALA D 1 56  ? 115.851 96.888  121.634 1.00 0.00 ? 60  ALA D N    1  
ATOM 8479   C CA   . ALA D 1 56  ? 115.360 95.549  121.339 1.00 0.00 ? 60  ALA D CA   1  
ATOM 8480   C C    . ALA D 1 56  ? 115.661 95.256  119.881 1.00 0.00 ? 60  ALA D C    1  
ATOM 8481   O O    . ALA D 1 56  ? 115.119 95.912  118.987 1.00 0.00 ? 60  ALA D O    1  
ATOM 8482   C CB   . ALA D 1 56  ? 113.864 95.426  121.623 1.00 0.00 ? 60  ALA D CB   1  
ATOM 8483   H H    . ALA D 1 56  ? 115.355 97.516  121.318 1.00 0.00 ? 60  ALA D H    1  
ATOM 8484   H HA   . ALA D 1 56  ? 115.804 94.905  121.912 1.00 0.00 ? 60  ALA D HA   1  
ATOM 8485   H HB1  . ALA D 1 56  ? 113.731 94.944  122.455 1.00 0.00 ? 60  ALA D HB1  1  
ATOM 8486   H HB2  . ALA D 1 56  ? 113.474 96.311  121.696 1.00 0.00 ? 60  ALA D HB2  1  
ATOM 8487   H HB3  . ALA D 1 56  ? 113.436 94.943  120.899 1.00 0.00 ? 60  ALA D HB3  1  
ATOM 8488   N N    . ASP D 1 57  ? 116.524 94.278  119.642 1.00 0.00 ? 61  ASP D N    1  
ATOM 8489   C CA   . ASP D 1 57  ? 117.041 94.002  118.312 1.00 0.00 ? 61  ASP D CA   1  
ATOM 8490   C C    . ASP D 1 57  ? 116.666 92.580  117.933 1.00 0.00 ? 61  ASP D C    1  
ATOM 8491   O O    . ASP D 1 57  ? 117.092 91.616  118.588 1.00 0.00 ? 61  ASP D O    1  
ATOM 8492   C CB   . ASP D 1 57  ? 118.554 94.225  118.269 1.00 0.00 ? 61  ASP D CB   1  
ATOM 8493   C CG   . ASP D 1 57  ? 118.981 95.257  117.235 1.00 0.00 ? 61  ASP D CG   1  
ATOM 8494   O OD1  . ASP D 1 57  ? 119.268 96.419  117.581 1.00 0.00 ? 61  ASP D OD1  1  
ATOM 8495   O OD2  . ASP D 1 57  ? 119.062 94.883  116.048 1.00 0.00 ? 61  ASP D OD2  1  
ATOM 8496   H H    . ASP D 1 57  ? 116.828 93.753  120.252 1.00 0.00 ? 61  ASP D H    1  
ATOM 8497   H HA   . ASP D 1 57  ? 116.648 94.611  117.667 1.00 0.00 ? 61  ASP D HA   1  
ATOM 8498   H HB2  . ASP D 1 57  ? 118.858 94.509  119.145 1.00 0.00 ? 61  ASP D HB2  1  
ATOM 8499   H HB3  . ASP D 1 57  ? 118.993 93.381  118.076 1.00 0.00 ? 61  ASP D HB3  1  
ATOM 8500   N N    . SER D 1 58  ? 115.871 92.461  116.877 1.00 0.00 ? 62  SER D N    1  
ATOM 8501   C CA   . SER D 1 58  ? 115.368 91.194  116.379 1.00 0.00 ? 62  SER D CA   1  
ATOM 8502   C C    . SER D 1 58  ? 115.317 91.214  114.861 1.00 0.00 ? 62  SER D C    1  
ATOM 8503   O O    . SER D 1 58  ? 115.064 92.247  114.235 1.00 0.00 ? 62  SER D O    1  
ATOM 8504   C CB   . SER D 1 58  ? 113.973 90.907  116.941 1.00 0.00 ? 62  SER D CB   1  
ATOM 8505   O OG   . SER D 1 58  ? 113.007 91.754  116.349 1.00 0.00 ? 62  SER D OG   1  
ATOM 8506   H H    . SER D 1 58  ? 115.602 93.137  116.418 1.00 0.00 ? 62  SER D H    1  
ATOM 8507   H HA   . SER D 1 58  ? 115.969 90.491  116.671 1.00 0.00 ? 62  SER D HA   1  
ATOM 8508   H HB2  . SER D 1 58  ? 113.739 89.980  116.778 1.00 0.00 ? 62  SER D HB2  1  
ATOM 8509   H HB3  . SER D 1 58  ? 113.974 91.035  117.903 1.00 0.00 ? 62  SER D HB3  1  
ATOM 8510   H HG   . SER D 1 58  ? 113.223 91.914  115.554 1.00 0.00 ? 62  SER D HG   1  
ATOM 8511   N N    . GLY D 1 59  ? 115.559 90.050  114.273 1.00 0.00 ? 63  GLY D N    1  
ATOM 8512   C CA   . GLY D 1 59  ? 115.466 89.901  112.839 1.00 0.00 ? 63  GLY D CA   1  
ATOM 8513   C C    . GLY D 1 59  ? 114.813 88.599  112.443 1.00 0.00 ? 63  GLY D C    1  
ATOM 8514   O O    . GLY D 1 59  ? 114.817 87.634  113.211 1.00 0.00 ? 63  GLY D O    1  
ATOM 8515   H H    . GLY D 1 59  ? 115.781 89.333  114.694 1.00 0.00 ? 63  GLY D H    1  
ATOM 8516   H HA2  . GLY D 1 59  ? 114.957 90.641  112.472 1.00 0.00 ? 63  GLY D HA2  1  
ATOM 8517   H HA3  . GLY D 1 59  ? 116.354 89.947  112.452 1.00 0.00 ? 63  GLY D HA3  1  
ATOM 8518   N N    . GLU D 1 60  ? 114.241 88.557  111.248 1.00 0.00 ? 64  GLU D N    1  
ATOM 8519   C CA   . GLU D 1 60  ? 113.673 87.332  110.696 1.00 0.00 ? 64  GLU D CA   1  
ATOM 8520   C C    . GLU D 1 60  ? 114.379 87.053  109.380 1.00 0.00 ? 64  GLU D C    1  
ATOM 8521   O O    . GLU D 1 60  ? 114.834 87.976  108.699 1.00 0.00 ? 64  GLU D O    1  
ATOM 8522   C CB   . GLU D 1 60  ? 112.165 87.459  110.512 1.00 0.00 ? 64  GLU D CB   1  
ATOM 8523   C CG   . GLU D 1 60  ? 111.759 88.497  109.485 1.00 0.00 ? 64  GLU D CG   1  
ATOM 8524   C CD   . GLU D 1 60  ? 111.352 87.875  108.160 1.00 0.00 ? 64  GLU D CD   1  
ATOM 8525   O OE1  . GLU D 1 60  ? 110.327 87.164  108.123 1.00 0.00 ? 64  GLU D OE1  1  
ATOM 8526   O OE2  . GLU D 1 60  ? 112.055 88.102  107.153 1.00 0.00 ? 64  GLU D OE2  1  
ATOM 8527   H H    . GLU D 1 60  ? 114.170 89.240  110.730 1.00 0.00 ? 64  GLU D H    1  
ATOM 8528   H HA   . GLU D 1 60  ? 113.808 86.590  111.307 1.00 0.00 ? 64  GLU D HA   1  
ATOM 8529   H HB2  . GLU D 1 60  ? 111.807 86.597  110.247 1.00 0.00 ? 64  GLU D HB2  1  
ATOM 8530   H HB3  . GLU D 1 60  ? 111.762 87.684  111.364 1.00 0.00 ? 64  GLU D HB3  1  
ATOM 8531   H HG2  . GLU D 1 60  ? 111.020 89.020  109.834 1.00 0.00 ? 64  GLU D HG2  1  
ATOM 8532   H HG3  . GLU D 1 60  ? 112.496 89.110  109.340 1.00 0.00 ? 64  GLU D HG3  1  
ATOM 8533   N N    . VAL D 1 61  ? 114.470 85.779  109.019 1.00 0.00 ? 65  VAL D N    1  
ATOM 8534   C CA   . VAL D 1 61  ? 115.161 85.362  107.806 1.00 0.00 ? 65  VAL D CA   1  
ATOM 8535   C C    . VAL D 1 61  ? 114.274 84.377  107.065 1.00 0.00 ? 65  VAL D C    1  
ATOM 8536   O O    . VAL D 1 61  ? 113.866 83.357  107.629 1.00 0.00 ? 65  VAL D O    1  
ATOM 8537   C CB   . VAL D 1 61  ? 116.525 84.736  108.133 1.00 0.00 ? 65  VAL D CB   1  
ATOM 8538   C CG1  . VAL D 1 61  ? 117.270 84.385  106.860 1.00 0.00 ? 65  VAL D CG1  1  
ATOM 8539   C CG2  . VAL D 1 61  ? 117.335 85.674  108.998 1.00 0.00 ? 65  VAL D CG2  1  
ATOM 8540   H H    . VAL D 1 61  ? 114.133 85.131  109.472 1.00 0.00 ? 65  VAL D H    1  
ATOM 8541   H HA   . VAL D 1 61  ? 115.331 86.135  107.246 1.00 0.00 ? 65  VAL D HA   1  
ATOM 8542   H HB   . VAL D 1 61  ? 116.382 83.914  108.628 1.00 0.00 ? 65  VAL D HB   1  
ATOM 8543   H HG11 . VAL D 1 61  ? 117.441 85.194  106.351 1.00 0.00 ? 65  VAL D HG11 1  
ATOM 8544   H HG12 . VAL D 1 61  ? 118.113 83.960  107.084 1.00 0.00 ? 65  VAL D HG12 1  
ATOM 8545   H HG13 . VAL D 1 61  ? 116.734 83.777  106.328 1.00 0.00 ? 65  VAL D HG13 1  
ATOM 8546   H HG21 . VAL D 1 61  ? 116.817 86.474  109.180 1.00 0.00 ? 65  VAL D HG21 1  
ATOM 8547   H HG22 . VAL D 1 61  ? 117.555 85.235  109.834 1.00 0.00 ? 65  VAL D HG22 1  
ATOM 8548   H HG23 . VAL D 1 61  ? 118.152 85.917  108.535 1.00 0.00 ? 65  VAL D HG23 1  
ATOM 8549   N N    . THR D 1 62  ? 113.962 84.675  105.811 1.00 0.00 ? 66  THR D N    1  
ATOM 8550   C CA   . THR D 1 62  ? 113.212 83.741  104.989 1.00 0.00 ? 66  THR D CA   1  
ATOM 8551   C C    . THR D 1 62  ? 114.093 83.226  103.862 1.00 0.00 ? 66  THR D C    1  
ATOM 8552   O O    . THR D 1 62  ? 114.886 83.977  103.290 1.00 0.00 ? 66  THR D O    1  
ATOM 8553   C CB   . THR D 1 62  ? 111.961 84.396  104.421 1.00 0.00 ? 66  THR D CB   1  
ATOM 8554   O OG1  . THR D 1 62  ? 112.343 85.541  103.655 1.00 0.00 ? 66  THR D OG1  1  
ATOM 8555   C CG2  . THR D 1 62  ? 111.039 84.843  105.537 1.00 0.00 ? 66  THR D CG2  1  
ATOM 8556   H H    . THR D 1 62  ? 114.173 85.411  105.419 1.00 0.00 ? 66  THR D H    1  
ATOM 8557   H HA   . THR D 1 62  ? 112.935 82.996  105.546 1.00 0.00 ? 66  THR D HA   1  
ATOM 8558   H HB   . THR D 1 62  ? 111.497 83.751  103.864 1.00 0.00 ? 66  THR D HB   1  
ATOM 8559   H HG1  . THR D 1 62  ? 111.907 86.210  103.915 1.00 0.00 ? 66  THR D HG1  1  
ATOM 8560   H HG21 . THR D 1 62  ? 111.069 83.884  105.400 1.00 0.00 ? 66  THR D HG21 1  
ATOM 8561   H HG22 . THR D 1 62  ? 110.776 84.075  106.068 1.00 0.00 ? 66  THR D HG22 1  
ATOM 8562   H HG23 . THR D 1 62  ? 111.500 85.484  106.101 1.00 0.00 ? 66  THR D HG23 1  
ATOM 8563   N N    . TYR D 1 63  ? 113.961 81.935  103.560 1.00 0.00 ? 67  TYR D N    1  
ATOM 8564   C CA   . TYR D 1 63  ? 114.681 81.333  102.438 1.00 0.00 ? 67  TYR D CA   1  
ATOM 8565   C C    . TYR D 1 63  ? 113.970 80.050  102.023 1.00 0.00 ? 67  TYR D C    1  
ATOM 8566   O O    . TYR D 1 63  ? 113.068 79.568  102.715 1.00 0.00 ? 67  TYR D O    1  
ATOM 8567   C CB   . TYR D 1 63  ? 116.155 81.082  102.783 1.00 0.00 ? 67  TYR D CB   1  
ATOM 8568   C CG   . TYR D 1 63  ? 116.424 80.207  103.987 1.00 0.00 ? 67  TYR D CG   1  
ATOM 8569   C CD1  . TYR D 1 63  ? 116.397 80.733  105.267 1.00 0.00 ? 67  TYR D CD1  1  
ATOM 8570   C CD2  . TYR D 1 63  ? 116.746 78.865  103.838 1.00 0.00 ? 67  TYR D CD2  1  
ATOM 8571   C CE1  . TYR D 1 63  ? 116.663 79.942  106.361 1.00 0.00 ? 67  TYR D CE1  1  
ATOM 8572   C CE2  . TYR D 1 63  ? 117.011 78.069  104.924 1.00 0.00 ? 67  TYR D CE2  1  
ATOM 8573   C CZ   . TYR D 1 63  ? 116.970 78.611  106.181 1.00 0.00 ? 67  TYR D CZ   1  
ATOM 8574   O OH   . TYR D 1 63  ? 117.233 77.810  107.266 1.00 0.00 ? 67  TYR D OH   1  
ATOM 8575   H H    . TYR D 1 63  ? 113.458 81.389  103.994 1.00 0.00 ? 67  TYR D H    1  
ATOM 8576   H HA   . TYR D 1 63  ? 114.679 81.951  101.690 1.00 0.00 ? 67  TYR D HA   1  
ATOM 8577   H HB2  . TYR D 1 63  ? 116.583 80.678  102.012 1.00 0.00 ? 67  TYR D HB2  1  
ATOM 8578   H HB3  . TYR D 1 63  ? 116.584 81.940  102.929 1.00 0.00 ? 67  TYR D HB3  1  
ATOM 8579   H HD1  . TYR D 1 63  ? 116.198 81.633  105.389 1.00 0.00 ? 67  TYR D HD1  1  
ATOM 8580   H HD2  . TYR D 1 63  ? 116.782 78.498  102.984 1.00 0.00 ? 67  TYR D HD2  1  
ATOM 8581   H HE1  . TYR D 1 63  ? 116.635 80.303  107.218 1.00 0.00 ? 67  TYR D HE1  1  
ATOM 8582   H HE2  . TYR D 1 63  ? 117.216 77.169  104.808 1.00 0.00 ? 67  TYR D HE2  1  
ATOM 8583   H HH   . TYR D 1 63  ? 117.674 78.244  107.835 1.00 0.00 ? 67  TYR D HH   1  
ATOM 8584   N N    . TYR D 1 64  ? 114.371 79.502  100.876 1.00 0.00 ? 68  TYR D N    1  
ATOM 8585   C CA   . TYR D 1 64  ? 113.873 78.223  100.381 1.00 0.00 ? 68  TYR D CA   1  
ATOM 8586   C C    . TYR D 1 64  ? 114.887 77.141  100.713 1.00 0.00 ? 68  TYR D C    1  
ATOM 8587   O O    . TYR D 1 64  ? 116.029 77.194  100.250 1.00 0.00 ? 68  TYR D O    1  
ATOM 8588   C CB   . TYR D 1 64  ? 113.634 78.241  98.869  1.00 0.00 ? 68  TYR D CB   1  
ATOM 8589   C CG   . TYR D 1 64  ? 112.858 79.424  98.344  1.00 0.00 ? 68  TYR D CG   1  
ATOM 8590   C CD1  . TYR D 1 64  ? 113.500 80.561  97.878  1.00 0.00 ? 68  TYR D CD1  1  
ATOM 8591   C CD2  . TYR D 1 64  ? 111.475 79.413  98.351  1.00 0.00 ? 68  TYR D CD2  1  
ATOM 8592   C CE1  . TYR D 1 64  ? 112.783 81.640  97.404  1.00 0.00 ? 68  TYR D CE1  1  
ATOM 8593   C CE2  . TYR D 1 64  ? 110.752 80.492  97.893  1.00 0.00 ? 68  TYR D CE2  1  
ATOM 8594   C CZ   . TYR D 1 64  ? 111.413 81.599  97.414  1.00 0.00 ? 68  TYR D CZ   1  
ATOM 8595   O OH   . TYR D 1 64  ? 110.696 82.674  96.951  1.00 0.00 ? 68  TYR D OH   1  
ATOM 8596   H H    . TYR D 1 64  ? 114.948 79.870  100.357 1.00 0.00 ? 68  TYR D H    1  
ATOM 8597   H HA   . TYR D 1 64  ? 113.022 78.048  100.812 1.00 0.00 ? 68  TYR D HA   1  
ATOM 8598   H HB2  . TYR D 1 64  ? 114.494 78.214  98.422  1.00 0.00 ? 68  TYR D HB2  1  
ATOM 8599   H HB3  . TYR D 1 64  ? 113.162 77.430  98.624  1.00 0.00 ? 68  TYR D HB3  1  
ATOM 8600   H HD1  . TYR D 1 64  ? 114.430 80.597  97.885  1.00 0.00 ? 68  TYR D HD1  1  
ATOM 8601   H HD2  . TYR D 1 64  ? 111.025 78.665  98.670  1.00 0.00 ? 68  TYR D HD2  1  
ATOM 8602   H HE1  . TYR D 1 64  ? 113.227 82.390  97.080  1.00 0.00 ? 68  TYR D HE1  1  
ATOM 8603   H HE2  . TYR D 1 64  ? 109.822 80.472  97.907  1.00 0.00 ? 68  TYR D HE2  1  
ATOM 8604   H HH   . TYR D 1 64  ? 110.584 83.226  97.574  1.00 0.00 ? 68  TYR D HH   1  
ATOM 8605   N N    . GLY D 1 65  ? 114.462 76.148  101.490 1.00 0.00 ? 69  GLY D N    1  
ATOM 8606   C CA   . GLY D 1 65  ? 115.366 75.110  101.943 1.00 0.00 ? 69  GLY D CA   1  
ATOM 8607   C C    . GLY D 1 65  ? 115.830 74.153  100.866 1.00 0.00 ? 69  GLY D C    1  
ATOM 8608   O O    . GLY D 1 65  ? 115.018 73.621  100.105 1.00 0.00 ? 69  GLY D O    1  
ATOM 8609   H H    . GLY D 1 65  ? 113.652 76.062  101.764 1.00 0.00 ? 69  GLY D H    1  
ATOM 8610   H HA2  . GLY D 1 65  ? 116.145 75.529  102.343 1.00 0.00 ? 69  GLY D HA2  1  
ATOM 8611   H HA3  . GLY D 1 65  ? 114.928 74.600  102.643 1.00 0.00 ? 69  GLY D HA3  1  
ATOM 8612   N N    . LYS D 1 66  ? 117.138 73.927  100.792 1.00 0.00 ? 70  LYS D N    1  
ATOM 8613   C CA   . LYS D 1 66  ? 117.689 72.942  99.878  1.00 0.00 ? 70  LYS D CA   1  
ATOM 8614   C C    . LYS D 1 66  ? 117.833 71.603  100.604 1.00 0.00 ? 70  LYS D C    1  
ATOM 8615   O O    . LYS D 1 66  ? 117.963 71.547  101.829 1.00 0.00 ? 70  LYS D O    1  
ATOM 8616   C CB   . LYS D 1 66  ? 119.031 73.436  99.322  1.00 0.00 ? 70  LYS D CB   1  
ATOM 8617   C CG   . LYS D 1 66  ? 119.063 74.891  98.857  1.00 0.00 ? 70  LYS D CG   1  
ATOM 8618   C CD   . LYS D 1 66  ? 119.831 75.057  97.556  1.00 0.00 ? 70  LYS D CD   1  
ATOM 8619   C CE   . LYS D 1 66  ? 119.593 76.427  96.941  1.00 0.00 ? 70  LYS D CE   1  
ATOM 8620   N NZ   . LYS D 1 66  ? 118.699 76.353  95.754  1.00 0.00 ? 70  LYS D NZ   1  
ATOM 8621   H H    . LYS D 1 66  ? 117.725 74.338  101.268 1.00 0.00 ? 70  LYS D H    1  
ATOM 8622   H HA   . LYS D 1 66  ? 117.090 72.814  99.125  1.00 0.00 ? 70  LYS D HA   1  
ATOM 8623   H HB2  . LYS D 1 66  ? 119.708 73.318  100.006 1.00 0.00 ? 70  LYS D HB2  1  
ATOM 8624   H HB3  . LYS D 1 66  ? 119.281 72.870  98.575  1.00 0.00 ? 70  LYS D HB3  1  
ATOM 8625   H HG2  . LYS D 1 66  ? 118.156 75.212  98.739  1.00 0.00 ? 70  LYS D HG2  1  
ATOM 8626   H HG3  . LYS D 1 66  ? 119.472 75.440  99.545  1.00 0.00 ? 70  LYS D HG3  1  
ATOM 8627   H HD2  . LYS D 1 66  ? 120.779 74.935  97.720  1.00 0.00 ? 70  LYS D HD2  1  
ATOM 8628   H HD3  . LYS D 1 66  ? 119.560 74.368  96.929  1.00 0.00 ? 70  LYS D HD3  1  
ATOM 8629   H HE2  . LYS D 1 66  ? 119.200 77.015  97.605  1.00 0.00 ? 70  LYS D HE2  1  
ATOM 8630   H HE3  . LYS D 1 66  ? 120.442 76.817  96.682  1.00 0.00 ? 70  LYS D HE3  1  
ATOM 8631   H HZ1  . LYS D 1 66  ? 117.850 76.383  96.019  1.00 0.00 ? 70  LYS D HZ1  1  
ATOM 8632   H HZ2  . LYS D 1 66  ? 118.866 77.039  95.213  1.00 0.00 ? 70  LYS D HZ2  1  
ATOM 8633   H HZ3  . LYS D 1 66  ? 118.846 75.590  95.319  1.00 0.00 ? 70  LYS D HZ3  1  
ATOM 8634   N N    . ARG D 1 67  ? 117.794 70.512  99.832  1.00 0.00 ? 71  ARG D N    1  
ATOM 8635   C CA   . ARG D 1 67  ? 117.762 69.168  100.400 1.00 0.00 ? 71  ARG D CA   1  
ATOM 8636   C C    . ARG D 1 67  ? 118.778 68.958  101.519 1.00 0.00 ? 71  ARG D C    1  
ATOM 8637   O O    . ARG D 1 67  ? 118.399 68.475  102.591 1.00 0.00 ? 71  ARG D O    1  
ATOM 8638   C CB   . ARG D 1 67  ? 117.993 68.137  99.297  1.00 0.00 ? 71  ARG D CB   1  
ATOM 8639   C CG   . ARG D 1 67  ? 119.123 68.495  98.349  1.00 0.00 ? 71  ARG D CG   1  
ATOM 8640   C CD   . ARG D 1 67  ? 118.638 68.569  96.915  1.00 0.00 ? 71  ARG D CD   1  
ATOM 8641   N NE   . ARG D 1 67  ? 118.656 69.938  96.409  1.00 0.00 ? 71  ARG D NE   1  
ATOM 8642   C CZ   . ARG D 1 67  ? 119.329 70.327  95.332  1.00 0.00 ? 71  ARG D CZ   1  
ATOM 8643   N NH1  . ARG D 1 67  ? 119.285 71.594  94.944  1.00 0.00 ? 71  ARG D NH1  1  
ATOM 8644   N NH2  . ARG D 1 67  ? 120.048 69.453  94.642  1.00 0.00 ? 71  ARG D NH2  1  
ATOM 8645   H H    . ARG D 1 67  ? 117.785 70.533  98.972  1.00 0.00 ? 71  ARG D H    1  
ATOM 8646   H HA   . ARG D 1 67  ? 116.884 69.054  100.797 1.00 0.00 ? 71  ARG D HA   1  
ATOM 8647   H HB2  . ARG D 1 67  ? 118.184 67.278  99.704  1.00 0.00 ? 71  ARG D HB2  1  
ATOM 8648   H HB3  . ARG D 1 67  ? 117.174 68.034  98.787  1.00 0.00 ? 71  ARG D HB3  1  
ATOM 8649   H HG2  . ARG D 1 67  ? 119.506 69.348  98.607  1.00 0.00 ? 71  ARG D HG2  1  
ATOM 8650   H HG3  . ARG D 1 67  ? 119.830 67.834  98.420  1.00 0.00 ? 71  ARG D HG3  1  
ATOM 8651   H HD2  . ARG D 1 67  ? 119.197 68.009  96.355  1.00 0.00 ? 71  ARG D HD2  1  
ATOM 8652   H HD3  . ARG D 1 67  ? 117.736 68.215  96.860  1.00 0.00 ? 71  ARG D HD3  1  
ATOM 8653   H HE   . ARG D 1 67  ? 118.202 70.530  96.835  1.00 0.00 ? 71  ARG D HE   1  
ATOM 8654   H HH11 . ARG D 1 67  ? 118.820 72.164  95.390  1.00 0.00 ? 71  ARG D HH11 1  
ATOM 8655   H HH12 . ARG D 1 67  ? 119.721 71.846  94.248  1.00 0.00 ? 71  ARG D HH12 1  
ATOM 8656   H HH21 . ARG D 1 67  ? 120.080 68.630  94.892  1.00 0.00 ? 71  ARG D HH21 1  
ATOM 8657   H HH22 . ARG D 1 67  ? 120.483 69.708  93.946  1.00 0.00 ? 71  ARG D HH22 1  
ATOM 8658   N N    . GLY D 1 68  ? 120.042 69.297  101.307 1.00 0.00 ? 72  GLY D N    1  
ATOM 8659   C CA   . GLY D 1 68  ? 121.056 69.198  102.341 1.00 0.00 ? 72  GLY D CA   1  
ATOM 8660   C C    . GLY D 1 68  ? 122.227 70.101  102.012 1.00 0.00 ? 72  GLY D C    1  
ATOM 8661   O O    . GLY D 1 68  ? 123.099 69.754  101.212 1.00 0.00 ? 72  GLY D O    1  
ATOM 8662   H H    . GLY D 1 68  ? 120.336 69.593  100.555 1.00 0.00 ? 72  GLY D H    1  
ATOM 8663   H HA2  . GLY D 1 68  ? 120.678 69.447  103.199 1.00 0.00 ? 72  GLY D HA2  1  
ATOM 8664   H HA3  . GLY D 1 68  ? 121.359 68.279  102.420 1.00 0.00 ? 72  GLY D HA3  1  
ATOM 8665   N N    . ASP D 1 69  ? 122.231 71.277  102.655 1.00 0.00 ? 73  ASP D N    1  
ATOM 8666   C CA   . ASP D 1 69  ? 123.353 72.223  102.679 1.00 0.00 ? 73  ASP D CA   1  
ATOM 8667   C C    . ASP D 1 69  ? 123.567 72.787  104.090 1.00 0.00 ? 73  ASP D C    1  
ATOM 8668   O O    . ASP D 1 69  ? 122.662 72.848  104.919 1.00 0.00 ? 73  ASP D O    1  
ATOM 8669   C CB   . ASP D 1 69  ? 123.157 73.332  101.638 1.00 0.00 ? 73  ASP D CB   1  
ATOM 8670   C CG   . ASP D 1 69  ? 123.888 73.053  100.338 1.00 0.00 ? 73  ASP D CG   1  
ATOM 8671   O OD1  . ASP D 1 69  ? 124.971 72.431  100.370 1.00 0.00 ? 73  ASP D OD1  1  
ATOM 8672   O OD2  . ASP D 1 69  ? 123.368 73.445  99.274  1.00 0.00 ? 73  ASP D OD2  1  
ATOM 8673   H H    . ASP D 1 69  ? 121.552 71.555  103.105 1.00 0.00 ? 73  ASP D H    1  
ATOM 8674   H HA   . ASP D 1 69  ? 124.162 71.743  102.439 1.00 0.00 ? 73  ASP D HA   1  
ATOM 8675   H HB2  . ASP D 1 69  ? 122.210 73.435  101.456 1.00 0.00 ? 73  ASP D HB2  1  
ATOM 8676   H HB3  . ASP D 1 69  ? 123.469 74.174  102.005 1.00 0.00 ? 73  ASP D HB3  1  
ATOM 8677   N N    . ALA D 1 70  ? 124.804 73.219  104.331 1.00 0.00 ? 74  ALA D N    1  
ATOM 8678   C CA   . ALA D 1 70  ? 125.415 73.332  105.655 1.00 0.00 ? 74  ALA D CA   1  
ATOM 8679   C C    . ALA D 1 70  ? 124.959 74.487  106.547 1.00 0.00 ? 74  ALA D C    1  
ATOM 8680   O O    . ALA D 1 70  ? 124.921 74.322  107.769 1.00 0.00 ? 74  ALA D O    1  
ATOM 8681   C CB   . ALA D 1 70  ? 126.937 73.423  105.503 1.00 0.00 ? 74  ALA D CB   1  
ATOM 8682   H H    . ALA D 1 70  ? 125.333 73.465  103.699 1.00 0.00 ? 74  ALA D H    1  
ATOM 8683   H HA   . ALA D 1 70  ? 125.114 72.531  106.112 1.00 0.00 ? 74  ALA D HA   1  
ATOM 8684   H HB1  . ALA D 1 70  ? 127.186 74.334  105.279 1.00 0.00 ? 74  ALA D HB1  1  
ATOM 8685   H HB2  . ALA D 1 70  ? 127.361 73.167  106.336 1.00 0.00 ? 74  ALA D HB2  1  
ATOM 8686   H HB3  . ALA D 1 70  ? 127.227 72.826  104.796 1.00 0.00 ? 74  ALA D HB3  1  
ATOM 8687   N N    . GLY D 1 71  ? 124.694 75.671  105.982 1.00 0.00 ? 75  GLY D N    1  
ATOM 8688   C CA   . GLY D 1 71  ? 124.019 76.712  106.745 1.00 0.00 ? 75  GLY D CA   1  
ATOM 8689   C C    . GLY D 1 71  ? 122.629 76.304  107.199 1.00 0.00 ? 75  GLY D C    1  
ATOM 8690   O O    . GLY D 1 71  ? 122.228 76.576  108.337 1.00 0.00 ? 75  GLY D O    1  
ATOM 8691   H H    . GLY D 1 71  ? 124.894 75.883  105.174 1.00 0.00 ? 75  GLY D H    1  
ATOM 8692   H HA2  . GLY D 1 71  ? 124.555 76.937  107.522 1.00 0.00 ? 75  GLY D HA2  1  
ATOM 8693   H HA3  . GLY D 1 71  ? 123.955 77.514  106.203 1.00 0.00 ? 75  GLY D HA3  1  
ATOM 8694   N N    . GLN D 1 72  ? 121.883 75.618  106.327 1.00 0.00 ? 76  GLN D N    1  
ATOM 8695   C CA   . GLN D 1 72  ? 120.621 75.024  106.750 1.00 0.00 ? 76  GLN D CA   1  
ATOM 8696   C C    . GLN D 1 72  ? 120.823 73.978  107.836 1.00 0.00 ? 76  GLN D C    1  
ATOM 8697   O O    . GLN D 1 72  ? 120.118 74.016  108.849 1.00 0.00 ? 76  GLN D O    1  
ATOM 8698   C CB   . GLN D 1 72  ? 119.882 74.407  105.560 1.00 0.00 ? 76  GLN D CB   1  
ATOM 8699   C CG   . GLN D 1 72  ? 118.811 73.397  105.929 1.00 0.00 ? 76  GLN D CG   1  
ATOM 8700   C CD   . GLN D 1 72  ? 119.283 71.965  105.794 1.00 0.00 ? 76  GLN D CD   1  
ATOM 8701   O OE1  . GLN D 1 72  ? 119.893 71.411  106.707 1.00 0.00 ? 76  GLN D OE1  1  
ATOM 8702   N NE2  . GLN D 1 72  ? 119.010 71.361  104.643 1.00 0.00 ? 76  GLN D NE2  1  
ATOM 8703   H H    . GLN D 1 72  ? 122.089 75.488  105.502 1.00 0.00 ? 76  GLN D H    1  
ATOM 8704   H HA   . GLN D 1 72  ? 120.081 75.741  107.119 1.00 0.00 ? 76  GLN D HA   1  
ATOM 8705   H HB2  . GLN D 1 72  ? 119.472 75.119  105.045 1.00 0.00 ? 76  GLN D HB2  1  
ATOM 8706   H HB3  . GLN D 1 72  ? 120.530 73.974  104.982 1.00 0.00 ? 76  GLN D HB3  1  
ATOM 8707   H HG2  . GLN D 1 72  ? 118.525 73.553  106.842 1.00 0.00 ? 76  GLN D HG2  1  
ATOM 8708   H HG3  . GLN D 1 72  ? 118.036 73.532  105.361 1.00 0.00 ? 76  GLN D HG3  1  
ATOM 8709   H HE21 . GLN D 1 72  ? 118.581 71.781  104.028 1.00 0.00 ? 76  GLN D HE21 1  
ATOM 8710   H HE22 . GLN D 1 72  ? 119.261 70.548  104.514 1.00 0.00 ? 76  GLN D HE22 1  
ATOM 8711   N N    . LYS D 1 73  ? 121.776 73.057  107.665 1.00 0.00 ? 77  LYS D N    1  
ATOM 8712   C CA   . LYS D 1 73  ? 122.122 72.159  108.754 1.00 0.00 ? 77  LYS D CA   1  
ATOM 8713   C C    . LYS D 1 73  ? 122.691 72.910  109.944 1.00 0.00 ? 77  LYS D C    1  
ATOM 8714   O O    . LYS D 1 73  ? 122.560 72.436  111.072 1.00 0.00 ? 77  LYS D O    1  
ATOM 8715   C CB   . LYS D 1 73  ? 123.121 71.098  108.295 1.00 0.00 ? 77  LYS D CB   1  
ATOM 8716   C CG   . LYS D 1 73  ? 122.550 70.071  107.346 1.00 0.00 ? 77  LYS D CG   1  
ATOM 8717   C CD   . LYS D 1 73  ? 123.537 68.949  107.119 1.00 0.00 ? 77  LYS D CD   1  
ATOM 8718   C CE   . LYS D 1 73  ? 124.571 69.352  106.099 1.00 0.00 ? 77  LYS D CE   1  
ATOM 8719   N NZ   . LYS D 1 73  ? 125.633 70.166  106.743 1.00 0.00 ? 77  LYS D NZ   1  
ATOM 8720   H H    . LYS D 1 73  ? 122.223 72.942  106.939 1.00 0.00 ? 77  LYS D H    1  
ATOM 8721   H HA   . LYS D 1 73  ? 121.300 71.725  109.030 1.00 0.00 ? 77  LYS D HA   1  
ATOM 8722   H HB2  . LYS D 1 73  ? 123.870 71.539  107.864 1.00 0.00 ? 77  LYS D HB2  1  
ATOM 8723   H HB3  . LYS D 1 73  ? 123.471 70.641  109.075 1.00 0.00 ? 77  LYS D HB3  1  
ATOM 8724   H HG2  . LYS D 1 73  ? 121.724 69.713  107.706 1.00 0.00 ? 77  LYS D HG2  1  
ATOM 8725   H HG3  . LYS D 1 73  ? 122.330 70.492  106.499 1.00 0.00 ? 77  LYS D HG3  1  
ATOM 8726   H HD2  . LYS D 1 73  ? 123.972 68.720  107.955 1.00 0.00 ? 77  LYS D HD2  1  
ATOM 8727   H HD3  . LYS D 1 73  ? 123.069 68.156  106.816 1.00 0.00 ? 77  LYS D HD3  1  
ATOM 8728   H HE2  . LYS D 1 73  ? 124.961 68.563  105.693 1.00 0.00 ? 77  LYS D HE2  1  
ATOM 8729   H HE3  . LYS D 1 73  ? 124.152 69.860  105.386 1.00 0.00 ? 77  LYS D HE3  1  
ATOM 8730   H HZ1  . LYS D 1 73  ? 126.292 69.634  107.013 1.00 0.00 ? 77  LYS D HZ1  1  
ATOM 8731   H HZ2  . LYS D 1 73  ? 125.951 70.757  106.157 1.00 0.00 ? 77  LYS D HZ2  1  
ATOM 8732   H HZ3  . LYS D 1 73  ? 125.293 70.597  107.444 1.00 0.00 ? 77  LYS D HZ3  1  
ATOM 8733   N N    . ALA D 1 74  ? 123.328 74.059  109.721 1.00 0.00 ? 78  ALA D N    1  
ATOM 8734   C CA   . ALA D 1 74  ? 123.672 74.929  110.836 1.00 0.00 ? 78  ALA D CA   1  
ATOM 8735   C C    . ALA D 1 74  ? 122.420 75.473  111.505 1.00 0.00 ? 78  ALA D C    1  
ATOM 8736   O O    . ALA D 1 74  ? 122.332 75.473  112.741 1.00 0.00 ? 78  ALA D O    1  
ATOM 8737   C CB   . ALA D 1 74  ? 124.567 76.074  110.366 1.00 0.00 ? 78  ALA D CB   1  
ATOM 8738   H H    . ALA D 1 74  ? 123.564 74.346  108.946 1.00 0.00 ? 78  ALA D H    1  
ATOM 8739   H HA   . ALA D 1 74  ? 124.159 74.403  111.489 1.00 0.00 ? 78  ALA D HA   1  
ATOM 8740   H HB1  . ALA D 1 74  ? 124.150 76.922  110.582 1.00 0.00 ? 78  ALA D HB1  1  
ATOM 8741   H HB2  . ALA D 1 74  ? 125.428 76.014  110.809 1.00 0.00 ? 78  ALA D HB2  1  
ATOM 8742   H HB3  . ALA D 1 74  ? 124.695 76.012  109.406 1.00 0.00 ? 78  ALA D HB3  1  
ATOM 8743   N N    . ILE D 1 75  ? 121.453 75.925  110.701 1.00 0.00 ? 79  ILE D N    1  
ATOM 8744   C CA   . ILE D 1 75  ? 120.151 76.325  111.233 1.00 0.00 ? 79  ILE D CA   1  
ATOM 8745   C C    . ILE D 1 75  ? 119.484 75.154  111.946 1.00 0.00 ? 79  ILE D C    1  
ATOM 8746   O O    . ILE D 1 75  ? 118.943 75.302  113.049 1.00 0.00 ? 79  ILE D O    1  
ATOM 8747   C CB   . ILE D 1 75  ? 119.267 76.880  110.099 1.00 0.00 ? 79  ILE D CB   1  
ATOM 8748   C CG1  . ILE D 1 75  ? 119.997 77.998  109.355 1.00 0.00 ? 79  ILE D CG1  1  
ATOM 8749   C CG2  . ILE D 1 75  ? 117.948 77.394  110.635 1.00 0.00 ? 79  ILE D CG2  1  
ATOM 8750   C CD1  . ILE D 1 75  ? 121.091 78.728  110.167 1.00 0.00 ? 79  ILE D CD1  1  
ATOM 8751   H H    . ILE D 1 75  ? 121.532 76.008  109.849 1.00 0.00 ? 79  ILE D H    1  
ATOM 8752   H HA   . ILE D 1 75  ? 120.276 77.030  111.887 1.00 0.00 ? 79  ILE D HA   1  
ATOM 8753   H HB   . ILE D 1 75  ? 119.084 76.154  109.483 1.00 0.00 ? 79  ILE D HB   1  
ATOM 8754   H HG12 . ILE D 1 75  ? 120.402 77.625  108.557 1.00 0.00 ? 79  ILE D HG12 1  
ATOM 8755   H HG13 . ILE D 1 75  ? 119.342 78.652  109.061 1.00 0.00 ? 79  ILE D HG13 1  
ATOM 8756   H HG21 . ILE D 1 75  ? 117.217 76.947  110.180 1.00 0.00 ? 79  ILE D HG21 1  
ATOM 8757   H HG22 . ILE D 1 75  ? 117.892 77.215  111.586 1.00 0.00 ? 79  ILE D HG22 1  
ATOM 8758   H HG23 . ILE D 1 75  ? 117.886 78.350  110.482 1.00 0.00 ? 79  ILE D HG23 1  
ATOM 8759   H HD11 . ILE D 1 75  ? 120.932 78.595  111.115 1.00 0.00 ? 79  ILE D HD11 1  
ATOM 8760   H HD12 . ILE D 1 75  ? 121.961 78.370  109.932 1.00 0.00 ? 79  ILE D HD12 1  
ATOM 8761   H HD13 . ILE D 1 75  ? 121.067 79.676  109.965 1.00 0.00 ? 79  ILE D HD13 1  
ATOM 8762   N N    . GLU D 1 76  ? 119.549 73.963  111.351 1.00 0.00 ? 80  GLU D N    1  
ATOM 8763   C CA   . GLU D 1 76  ? 118.901 72.800  111.945 1.00 0.00 ? 80  GLU D CA   1  
ATOM 8764   C C    . GLU D 1 76  ? 119.480 72.445  113.309 1.00 0.00 ? 80  GLU D C    1  
ATOM 8765   O O    . GLU D 1 76  ? 118.717 72.231  114.257 1.00 0.00 ? 80  GLU D O    1  
ATOM 8766   C CB   . GLU D 1 76  ? 119.006 71.608  111.000 1.00 0.00 ? 80  GLU D CB   1  
ATOM 8767   C CG   . GLU D 1 76  ? 117.964 71.618  109.899 1.00 0.00 ? 80  GLU D CG   1  
ATOM 8768   C CD   . GLU D 1 76  ? 116.710 70.870  110.287 1.00 0.00 ? 80  GLU D CD   1  
ATOM 8769   O OE1  . GLU D 1 76  ? 116.408 70.808  111.495 1.00 0.00 ? 80  GLU D OE1  1  
ATOM 8770   O OE2  . GLU D 1 76  ? 116.029 70.343  109.386 1.00 0.00 ? 80  GLU D OE2  1  
ATOM 8771   H H    . GLU D 1 76  ? 119.959 73.810  110.611 1.00 0.00 ? 80  GLU D H    1  
ATOM 8772   H HA   . GLU D 1 76  ? 117.968 73.027  112.083 1.00 0.00 ? 80  GLU D HA   1  
ATOM 8773   H HB2  . GLU D 1 76  ? 119.889 71.598  110.600 1.00 0.00 ? 80  GLU D HB2  1  
ATOM 8774   H HB3  . GLU D 1 76  ? 118.917 70.789  111.513 1.00 0.00 ? 80  GLU D HB3  1  
ATOM 8775   H HG2  . GLU D 1 76  ? 117.736 72.535  109.682 1.00 0.00 ? 80  GLU D HG2  1  
ATOM 8776   H HG3  . GLU D 1 76  ? 118.340 71.220  109.098 1.00 0.00 ? 80  GLU D HG3  1  
ATOM 8777   N N    . ASP D 1 77  ? 120.807 72.355  113.429 1.00 0.00 ? 81  ASP D N    1  
ATOM 8778   C CA   . ASP D 1 77  ? 121.414 72.244  114.753 1.00 0.00 ? 81  ASP D CA   1  
ATOM 8779   C C    . ASP D 1 77  ? 121.174 73.493  115.584 1.00 0.00 ? 81  ASP D C    1  
ATOM 8780   O O    . ASP D 1 77  ? 121.060 73.405  116.812 1.00 0.00 ? 81  ASP D O    1  
ATOM 8781   C CB   . ASP D 1 77  ? 122.915 71.973  114.652 1.00 0.00 ? 81  ASP D CB   1  
ATOM 8782   C CG   . ASP D 1 77  ? 123.231 70.727  113.858 1.00 0.00 ? 81  ASP D CG   1  
ATOM 8783   O OD1  . ASP D 1 77  ? 124.108 70.794  112.976 1.00 0.00 ? 81  ASP D OD1  1  
ATOM 8784   O OD2  . ASP D 1 77  ? 122.603 69.679  114.116 1.00 0.00 ? 81  ASP D OD2  1  
ATOM 8785   H H    . ASP D 1 77  ? 121.361 72.356  112.771 1.00 0.00 ? 81  ASP D H    1  
ATOM 8786   H HA   . ASP D 1 77  ? 120.989 71.494  115.196 1.00 0.00 ? 81  ASP D HA   1  
ATOM 8787   H HB2  . ASP D 1 77  ? 123.350 72.735  114.238 1.00 0.00 ? 81  ASP D HB2  1  
ATOM 8788   H HB3  . ASP D 1 77  ? 123.285 71.886  115.545 1.00 0.00 ? 81  ASP D HB3  1  
ATOM 8789   N N    . ALA D 1 78  ? 121.106 74.660  114.944 1.00 0.00 ? 82  ALA D N    1  
ATOM 8790   C CA   . ALA D 1 78  ? 120.767 75.860  115.694 1.00 0.00 ? 82  ALA D CA   1  
ATOM 8791   C C    . ALA D 1 78  ? 119.451 75.699  116.443 1.00 0.00 ? 82  ALA D C    1  
ATOM 8792   O O    . ALA D 1 78  ? 119.427 75.790  117.676 1.00 0.00 ? 82  ALA D O    1  
ATOM 8793   C CB   . ALA D 1 78  ? 120.707 77.066  114.761 1.00 0.00 ? 82  ALA D CB   1  
ATOM 8794   H H    . ALA D 1 78  ? 121.249 74.775  114.103 1.00 0.00 ? 82  ALA D H    1  
ATOM 8795   H HA   . ALA D 1 78  ? 121.464 76.006  116.354 1.00 0.00 ? 82  ALA D HA   1  
ATOM 8796   H HB1  . ALA D 1 78  ? 121.252 77.783  115.122 1.00 0.00 ? 82  ALA D HB1  1  
ATOM 8797   H HB2  . ALA D 1 78  ? 121.041 76.815  113.885 1.00 0.00 ? 82  ALA D HB2  1  
ATOM 8798   H HB3  . ALA D 1 78  ? 119.788 77.368  114.681 1.00 0.00 ? 82  ALA D HB3  1  
ATOM 8799   N N    . TYR D 1 79  ? 118.356 75.440  115.728 1.00 0.00 ? 83  TYR D N    1  
ATOM 8800   C CA   . TYR D 1 79  ? 117.050 75.388  116.373 1.00 0.00 ? 83  TYR D CA   1  
ATOM 8801   C C    . TYR D 1 79  ? 116.830 74.070  117.107 1.00 0.00 ? 83  TYR D C    1  
ATOM 8802   O O    . TYR D 1 79  ? 116.403 74.052  118.265 1.00 0.00 ? 83  TYR D O    1  
ATOM 8803   C CB   . TYR D 1 79  ? 115.944 75.596  115.340 1.00 0.00 ? 83  TYR D CB   1  
ATOM 8804   C CG   . TYR D 1 79  ? 114.572 75.653  115.958 1.00 0.00 ? 83  TYR D CG   1  
ATOM 8805   C CD1  . TYR D 1 79  ? 113.879 76.851  116.016 1.00 0.00 ? 83  TYR D CD1  1  
ATOM 8806   C CD2  . TYR D 1 79  ? 113.977 74.518  116.501 1.00 0.00 ? 83  TYR D CD2  1  
ATOM 8807   C CE1  . TYR D 1 79  ? 112.629 76.924  116.582 1.00 0.00 ? 83  TYR D CE1  1  
ATOM 8808   C CE2  . TYR D 1 79  ? 112.725 74.582  117.077 1.00 0.00 ? 83  TYR D CE2  1  
ATOM 8809   C CZ   . TYR D 1 79  ? 112.055 75.790  117.111 1.00 0.00 ? 83  TYR D CZ   1  
ATOM 8810   O OH   . TYR D 1 79  ? 110.807 75.879  117.678 1.00 0.00 ? 83  TYR D OH   1  
ATOM 8811   H H    . TYR D 1 79  ? 118.349 75.293  114.881 1.00 0.00 ? 83  TYR D H    1  
ATOM 8812   H HA   . TYR D 1 79  ? 117.022 76.101  117.031 1.00 0.00 ? 83  TYR D HA   1  
ATOM 8813   H HB2  . TYR D 1 79  ? 116.111 76.421  114.856 1.00 0.00 ? 83  TYR D HB2  1  
ATOM 8814   H HB3  . TYR D 1 79  ? 115.973 74.876  114.691 1.00 0.00 ? 83  TYR D HB3  1  
ATOM 8815   H HD1  . TYR D 1 79  ? 114.268 77.620  115.665 1.00 0.00 ? 83  TYR D HD1  1  
ATOM 8816   H HD2  . TYR D 1 79  ? 114.429 73.706  116.474 1.00 0.00 ? 83  TYR D HD2  1  
ATOM 8817   H HE1  . TYR D 1 79  ? 112.173 77.734  116.608 1.00 0.00 ? 83  TYR D HE1  1  
ATOM 8818   H HE2  . TYR D 1 79  ? 112.335 73.819  117.439 1.00 0.00 ? 83  TYR D HE2  1  
ATOM 8819   H HH   . TYR D 1 79  ? 110.866 76.254  118.427 1.00 0.00 ? 83  TYR D HH   1  
ATOM 8820   N N    . GLN D 1 80  ? 117.112 72.953  116.433 1.00 0.00 ? 84  GLN D N    1  
ATOM 8821   C CA   . GLN D 1 80  ? 116.687 71.643  116.914 1.00 0.00 ? 84  GLN D CA   1  
ATOM 8822   C C    . GLN D 1 80  ? 117.562 71.140  118.056 1.00 0.00 ? 84  GLN D C    1  
ATOM 8823   O O    . GLN D 1 80  ? 117.066 70.465  118.965 1.00 0.00 ? 84  GLN D O    1  
ATOM 8824   C CB   . GLN D 1 80  ? 116.685 70.650  115.754 1.00 0.00 ? 84  GLN D CB   1  
ATOM 8825   C CG   . GLN D 1 80  ? 115.370 70.539  115.021 1.00 0.00 ? 84  GLN D CG   1  
ATOM 8826   C CD   . GLN D 1 80  ? 114.852 69.119  114.993 1.00 0.00 ? 84  GLN D CD   1  
ATOM 8827   O OE1  . GLN D 1 80  ? 115.628 68.167  114.939 1.00 0.00 ? 84  GLN D OE1  1  
ATOM 8828   N NE2  . GLN D 1 80  ? 113.537 68.967  115.044 1.00 0.00 ? 84  GLN D NE2  1  
ATOM 8829   H H    . GLN D 1 80  ? 117.551 72.936  115.693 1.00 0.00 ? 84  GLN D H    1  
ATOM 8830   H HA   . GLN D 1 80  ? 115.788 71.728  117.267 1.00 0.00 ? 84  GLN D HA   1  
ATOM 8831   H HB2  . GLN D 1 80  ? 117.374 70.908  115.122 1.00 0.00 ? 84  GLN D HB2  1  
ATOM 8832   H HB3  . GLN D 1 80  ? 116.927 69.774  116.094 1.00 0.00 ? 84  GLN D HB3  1  
ATOM 8833   H HG2  . GLN D 1 80  ? 114.714 71.113  115.447 1.00 0.00 ? 84  GLN D HG2  1  
ATOM 8834   H HG3  . GLN D 1 80  ? 115.480 70.861  114.113 1.00 0.00 ? 84  GLN D HG3  1  
ATOM 8835   H HE21 . GLN D 1 80  ? 113.026 69.658  115.081 1.00 0.00 ? 84  GLN D HE21 1  
ATOM 8836   H HE22 . GLN D 1 80  ? 113.195 68.178  115.040 1.00 0.00 ? 84  GLN D HE22 1  
ATOM 8837   N N    . ASN D 1 81  ? 118.859 71.448  118.026 1.00 0.00 ? 85  ASN D N    1  
ATOM 8838   C CA   . ASN D 1 81  ? 119.706 71.142  119.175 1.00 0.00 ? 85  ASN D CA   1  
ATOM 8839   C C    . ASN D 1 81  ? 119.602 72.230  120.235 1.00 0.00 ? 85  ASN D C    1  
ATOM 8840   O O    . ASN D 1 81  ? 119.693 71.949  121.435 1.00 0.00 ? 85  ASN D O    1  
ATOM 8841   C CB   . ASN D 1 81  ? 121.155 70.964  118.729 1.00 0.00 ? 85  ASN D CB   1  
ATOM 8842   C CG   . ASN D 1 81  ? 122.095 70.728  119.889 1.00 0.00 ? 85  ASN D CG   1  
ATOM 8843   O OD1  . ASN D 1 81  ? 122.020 69.705  120.564 1.00 0.00 ? 85  ASN D OD1  1  
ATOM 8844   N ND2  . ASN D 1 81  ? 122.996 71.672  120.120 1.00 0.00 ? 85  ASN D ND2  1  
ATOM 8845   H H    . ASN D 1 81  ? 119.260 71.826  117.366 1.00 0.00 ? 85  ASN D H    1  
ATOM 8846   H HA   . ASN D 1 81  ? 119.396 70.311  119.568 1.00 0.00 ? 85  ASN D HA   1  
ATOM 8847   H HB2  . ASN D 1 81  ? 121.211 70.217  118.114 1.00 0.00 ? 85  ASN D HB2  1  
ATOM 8848   H HB3  . ASN D 1 81  ? 121.439 71.753  118.242 1.00 0.00 ? 85  ASN D HB3  1  
ATOM 8849   H HD21 . ASN D 1 81  ? 123.558 71.582  120.764 1.00 0.00 ? 85  ASN D HD21 1  
ATOM 8850   H HD22 . ASN D 1 81  ? 123.018 72.375  119.626 1.00 0.00 ? 85  ASN D HD22 1  
ATOM 8851   N N    . GLY D 1 82  ? 119.411 73.474  119.808 1.00 0.00 ? 86  GLY D N    1  
ATOM 8852   C CA   . GLY D 1 82  ? 119.268 74.593  120.718 1.00 0.00 ? 86  GLY D CA   1  
ATOM 8853   C C    . GLY D 1 82  ? 120.588 75.258  121.044 1.00 0.00 ? 86  GLY D C    1  
ATOM 8854   O O    . GLY D 1 82  ? 121.133 75.077  122.135 1.00 0.00 ? 86  GLY D O    1  
ATOM 8855   H H    . GLY D 1 82  ? 119.361 73.690  118.977 1.00 0.00 ? 86  GLY D H    1  
ATOM 8856   H HA2  . GLY D 1 82  ? 118.668 75.248  120.327 1.00 0.00 ? 86  GLY D HA2  1  
ATOM 8857   H HA3  . GLY D 1 82  ? 118.855 74.284  121.540 1.00 0.00 ? 86  GLY D HA3  1  
ATOM 8858   N N    . LYS D 1 83  ? 121.094 76.044  120.102 1.00 0.00 ? 87  LYS D N    1  
ATOM 8859   C CA   . LYS D 1 83  ? 122.353 76.777  120.226 1.00 0.00 ? 87  LYS D CA   1  
ATOM 8860   C C    . LYS D 1 83  ? 122.116 78.174  119.665 1.00 0.00 ? 87  LYS D C    1  
ATOM 8861   O O    . LYS D 1 83  ? 121.218 78.379  118.843 1.00 0.00 ? 87  LYS D O    1  
ATOM 8862   C CB   . LYS D 1 83  ? 123.498 76.063  119.481 1.00 0.00 ? 87  LYS D CB   1  
ATOM 8863   C CG   . LYS D 1 83  ? 123.309 75.806  117.994 1.00 0.00 ? 87  LYS D CG   1  
ATOM 8864   C CD   . LYS D 1 83  ? 124.506 76.312  117.209 1.00 0.00 ? 87  LYS D CD   1  
ATOM 8865   C CE   . LYS D 1 83  ? 125.526 75.218  116.980 1.00 0.00 ? 87  LYS D CE   1  
ATOM 8866   N NZ   . LYS D 1 83  ? 125.212 74.456  115.746 1.00 0.00 ? 87  LYS D NZ   1  
ATOM 8867   H H    . LYS D 1 83  ? 120.703 76.171  119.346 1.00 0.00 ? 87  LYS D H    1  
ATOM 8868   H HA   . LYS D 1 83  ? 122.624 76.824  121.156 1.00 0.00 ? 87  LYS D HA   1  
ATOM 8869   H HB2  . LYS D 1 83  ? 124.304 76.590  119.595 1.00 0.00 ? 87  LYS D HB2  1  
ATOM 8870   H HB3  . LYS D 1 83  ? 123.653 75.209  119.916 1.00 0.00 ? 87  LYS D HB3  1  
ATOM 8871   H HG2  . LYS D 1 83  ? 123.191 74.856  117.837 1.00 0.00 ? 87  LYS D HG2  1  
ATOM 8872   H HG3  . LYS D 1 83  ? 122.502 76.246  117.684 1.00 0.00 ? 87  LYS D HG3  1  
ATOM 8873   H HD2  . LYS D 1 83  ? 124.208 76.662  116.354 1.00 0.00 ? 87  LYS D HD2  1  
ATOM 8874   H HD3  . LYS D 1 83  ? 124.920 77.048  117.687 1.00 0.00 ? 87  LYS D HD3  1  
ATOM 8875   H HE2  . LYS D 1 83  ? 126.413 75.606  116.909 1.00 0.00 ? 87  LYS D HE2  1  
ATOM 8876   H HE3  . LYS D 1 83  ? 125.540 74.618  117.742 1.00 0.00 ? 87  LYS D HE3  1  
ATOM 8877   H HZ1  . LYS D 1 83  ? 125.358 73.589  115.887 1.00 0.00 ? 87  LYS D HZ1  1  
ATOM 8878   H HZ2  . LYS D 1 83  ? 124.358 74.582  115.527 1.00 0.00 ? 87  LYS D HZ2  1  
ATOM 8879   H HZ3  . LYS D 1 83  ? 125.732 74.739  115.081 1.00 0.00 ? 87  LYS D HZ3  1  
ATOM 8880   N N    . GLN D 1 84  ? 122.926 79.132  120.094 1.00 0.00 ? 88  GLN D N    1  
ATOM 8881   C CA   . GLN D 1 84  ? 122.992 80.452  119.483 1.00 0.00 ? 88  GLN D CA   1  
ATOM 8882   C C    . GLN D 1 84  ? 124.002 80.406  118.343 1.00 0.00 ? 88  GLN D C    1  
ATOM 8883   O O    . GLN D 1 84  ? 124.977 79.652  118.382 1.00 0.00 ? 88  GLN D O    1  
ATOM 8884   C CB   . GLN D 1 84  ? 123.364 81.515  120.517 1.00 0.00 ? 88  GLN D CB   1  
ATOM 8885   C CG   . GLN D 1 84  ? 124.817 81.466  120.925 1.00 0.00 ? 88  GLN D CG   1  
ATOM 8886   C CD   . GLN D 1 84  ? 125.518 82.795  120.762 1.00 0.00 ? 88  GLN D CD   1  
ATOM 8887   O OE1  . GLN D 1 84  ? 125.689 83.544  121.722 1.00 0.00 ? 88  GLN D OE1  1  
ATOM 8888   N NE2  . GLN D 1 84  ? 125.914 83.102  119.536 1.00 0.00 ? 88  GLN D NE2  1  
ATOM 8889   H H    . GLN D 1 84  ? 123.461 79.033  120.760 1.00 0.00 ? 88  GLN D H    1  
ATOM 8890   H HA   . GLN D 1 84  ? 122.122 80.696  119.131 1.00 0.00 ? 88  GLN D HA   1  
ATOM 8891   H HB2  . GLN D 1 84  ? 123.165 82.393  120.156 1.00 0.00 ? 88  GLN D HB2  1  
ATOM 8892   H HB3  . GLN D 1 84  ? 122.809 81.400  121.305 1.00 0.00 ? 88  GLN D HB3  1  
ATOM 8893   H HG2  . GLN D 1 84  ? 124.880 81.184  121.851 1.00 0.00 ? 88  GLN D HG2  1  
ATOM 8894   H HG3  . GLN D 1 84  ? 125.275 80.797  120.394 1.00 0.00 ? 88  GLN D HG3  1  
ATOM 8895   H HE21 . GLN D 1 84  ? 125.777 82.551  118.890 1.00 0.00 ? 88  GLN D HE21 1  
ATOM 8896   H HE22 . GLN D 1 84  ? 126.307 83.851  119.385 1.00 0.00 ? 88  GLN D HE22 1  
ATOM 8897   N N    . ILE D 1 85  ? 123.768 81.211  117.306 1.00 0.00 ? 89  ILE D N    1  
ATOM 8898   C CA   . ILE D 1 85  ? 124.682 81.253  116.171 1.00 0.00 ? 89  ILE D CA   1  
ATOM 8899   C C    . ILE D 1 85  ? 125.217 82.664  115.991 1.00 0.00 ? 89  ILE D C    1  
ATOM 8900   O O    . ILE D 1 85  ? 124.499 83.650  116.173 1.00 0.00 ? 89  ILE D O    1  
ATOM 8901   C CB   . ILE D 1 85  ? 124.024 80.772  114.862 1.00 0.00 ? 89  ILE D CB   1  
ATOM 8902   C CG1  . ILE D 1 85  ? 123.591 79.309  114.975 1.00 0.00 ? 89  ILE D CG1  1  
ATOM 8903   C CG2  . ILE D 1 85  ? 124.964 80.989  113.693 1.00 0.00 ? 89  ILE D CG2  1  
ATOM 8904   C CD1  . ILE D 1 85  ? 124.457 78.237  114.266 1.00 0.00 ? 89  ILE D CD1  1  
ATOM 8905   H H    . ILE D 1 85  ? 123.090 81.736  117.243 1.00 0.00 ? 89  ILE D H    1  
ATOM 8906   H HA   . ILE D 1 85  ? 125.411 80.644  116.367 1.00 0.00 ? 89  ILE D HA   1  
ATOM 8907   H HB   . ILE D 1 85  ? 123.223 81.297  114.703 1.00 0.00 ? 89  ILE D HB   1  
ATOM 8908   H HG12 . ILE D 1 85  ? 123.552 79.083  115.918 1.00 0.00 ? 89  ILE D HG12 1  
ATOM 8909   H HG13 . ILE D 1 85  ? 122.688 79.239  114.628 1.00 0.00 ? 89  ILE D HG13 1  
ATOM 8910   H HG21 . ILE D 1 85  ? 124.923 81.917  113.413 1.00 0.00 ? 89  ILE D HG21 1  
ATOM 8911   H HG22 . ILE D 1 85  ? 125.870 80.773  113.961 1.00 0.00 ? 89  ILE D HG22 1  
ATOM 8912   H HG23 . ILE D 1 85  ? 124.700 80.417  112.955 1.00 0.00 ? 89  ILE D HG23 1  
ATOM 8913   H HD11 . ILE D 1 85  ? 124.501 77.440  114.817 1.00 0.00 ? 89  ILE D HD11 1  
ATOM 8914   H HD12 . ILE D 1 85  ? 124.061 78.016  113.408 1.00 0.00 ? 89  ILE D HD12 1  
ATOM 8915   H HD13 . ILE D 1 85  ? 125.353 78.584  114.128 1.00 0.00 ? 89  ILE D HD13 1  
ATOM 8916   N N    . LYS D 1 86  ? 126.490 82.752  115.619 1.00 0.00 ? 90  LYS D N    1  
ATOM 8917   C CA   . LYS D 1 86  ? 127.125 84.031  115.339 1.00 0.00 ? 90  LYS D CA   1  
ATOM 8918   C C    . LYS D 1 86  ? 126.589 84.570  114.020 1.00 0.00 ? 90  LYS D C    1  
ATOM 8919   O O    . LYS D 1 86  ? 126.477 83.828  113.035 1.00 0.00 ? 90  LYS D O    1  
ATOM 8920   C CB   . LYS D 1 86  ? 128.647 83.903  115.321 1.00 0.00 ? 90  LYS D CB   1  
ATOM 8921   C CG   . LYS D 1 86  ? 129.196 83.412  116.649 1.00 0.00 ? 90  LYS D CG   1  
ATOM 8922   C CD   . LYS D 1 86  ? 130.674 83.078  116.593 1.00 0.00 ? 90  LYS D CD   1  
ATOM 8923   C CE   . LYS D 1 86  ? 130.907 81.648  116.192 1.00 0.00 ? 90  LYS D CE   1  
ATOM 8924   N NZ   . LYS D 1 86  ? 131.931 81.530  115.124 1.00 0.00 ? 90  LYS D NZ   1  
ATOM 8925   H H    . LYS D 1 86  ? 127.008 82.072  115.523 1.00 0.00 ? 90  LYS D H    1  
ATOM 8926   H HA   . LYS D 1 86  ? 126.910 84.659  116.047 1.00 0.00 ? 90  LYS D HA   1  
ATOM 8927   H HB2  . LYS D 1 86  ? 128.910 83.290  114.617 1.00 0.00 ? 90  LYS D HB2  1  
ATOM 8928   H HB3  . LYS D 1 86  ? 129.040 84.764  115.109 1.00 0.00 ? 90  LYS D HB3  1  
ATOM 8929   H HG2  . LYS D 1 86  ? 129.049 84.091  117.325 1.00 0.00 ? 90  LYS D HG2  1  
ATOM 8930   H HG3  . LYS D 1 86  ? 128.703 82.624  116.926 1.00 0.00 ? 90  LYS D HG3  1  
ATOM 8931   H HD2  . LYS D 1 86  ? 131.115 83.668  115.962 1.00 0.00 ? 90  LYS D HD2  1  
ATOM 8932   H HD3  . LYS D 1 86  ? 131.075 83.240  117.461 1.00 0.00 ? 90  LYS D HD3  1  
ATOM 8933   H HE2  . LYS D 1 86  ? 131.188 81.137  116.967 1.00 0.00 ? 90  LYS D HE2  1  
ATOM 8934   H HE3  . LYS D 1 86  ? 130.073 81.260  115.884 1.00 0.00 ? 90  LYS D HE3  1  
ATOM 8935   H HZ1  . LYS D 1 86  ? 131.874 82.231  114.578 1.00 0.00 ? 90  LYS D HZ1  1  
ATOM 8936   H HZ2  . LYS D 1 86  ? 132.742 81.506  115.491 1.00 0.00 ? 90  LYS D HZ2  1  
ATOM 8937   H HZ3  . LYS D 1 86  ? 131.793 80.783  114.661 1.00 0.00 ? 90  LYS D HZ3  1  
ATOM 8938   N N    . PHE D 1 87  ? 126.278 85.865  114.013 1.00 0.00 ? 91  PHE D N    1  
ATOM 8939   C CA   . PHE D 1 87  ? 125.490 86.520  112.977 1.00 0.00 ? 91  PHE D CA   1  
ATOM 8940   C C    . PHE D 1 87  ? 126.340 87.555  112.253 1.00 0.00 ? 91  PHE D C    1  
ATOM 8941   O O    . PHE D 1 87  ? 126.833 88.508  112.872 1.00 0.00 ? 91  PHE D O    1  
ATOM 8942   C CB   . PHE D 1 87  ? 124.257 87.175  113.593 1.00 0.00 ? 91  PHE D CB   1  
ATOM 8943   C CG   . PHE D 1 87  ? 123.194 87.521  112.601 1.00 0.00 ? 91  PHE D CG   1  
ATOM 8944   C CD1  . PHE D 1 87  ? 121.900 87.089  112.783 1.00 0.00 ? 91  PHE D CD1  1  
ATOM 8945   C CD2  . PHE D 1 87  ? 123.488 88.294  111.493 1.00 0.00 ? 91  PHE D CD2  1  
ATOM 8946   C CE1  . PHE D 1 87  ? 120.914 87.406  111.874 1.00 0.00 ? 91  PHE D CE1  1  
ATOM 8947   C CE2  . PHE D 1 87  ? 122.507 88.616  110.580 1.00 0.00 ? 91  PHE D CE2  1  
ATOM 8948   C CZ   . PHE D 1 87  ? 121.218 88.172  110.773 1.00 0.00 ? 91  PHE D CZ   1  
ATOM 8949   H H    . PHE D 1 87  ? 126.531 86.403  114.635 1.00 0.00 ? 91  PHE D H    1  
ATOM 8950   H HA   . PHE D 1 87  ? 125.198 85.855  112.334 1.00 0.00 ? 91  PHE D HA   1  
ATOM 8951   H HB2  . PHE D 1 87  ? 123.883 86.578  114.259 1.00 0.00 ? 91  PHE D HB2  1  
ATOM 8952   H HB3  . PHE D 1 87  ? 124.529 87.983  114.056 1.00 0.00 ? 91  PHE D HB3  1  
ATOM 8953   H HD1  . PHE D 1 87  ? 121.688 86.577  113.530 1.00 0.00 ? 91  PHE D HD1  1  
ATOM 8954   H HD2  . PHE D 1 87  ? 124.357 88.600  111.363 1.00 0.00 ? 91  PHE D HD2  1  
ATOM 8955   H HE1  . PHE D 1 87  ? 120.044 87.102  112.005 1.00 0.00 ? 91  PHE D HE1  1  
ATOM 8956   H HE2  . PHE D 1 87  ? 122.716 89.133  109.835 1.00 0.00 ? 91  PHE D HE2  1  
ATOM 8957   H HZ   . PHE D 1 87  ? 120.553 88.390  110.160 1.00 0.00 ? 91  PHE D HZ   1  
ATOM 8958   N N    . TRP D 1 88  ? 126.472 87.381  110.940 1.00 0.00 ? 92  TRP D N    1  
ATOM 8959   C CA   . TRP D 1 88  ? 127.257 88.251  110.073 1.00 0.00 ? 92  TRP D CA   1  
ATOM 8960   C C    . TRP D 1 88  ? 126.386 88.665  108.895 1.00 0.00 ? 92  TRP D C    1  
ATOM 8961   O O    . TRP D 1 88  ? 125.779 87.810  108.243 1.00 0.00 ? 92  TRP D O    1  
ATOM 8962   C CB   . TRP D 1 88  ? 128.502 87.527  109.556 1.00 0.00 ? 92  TRP D CB   1  
ATOM 8963   C CG   . TRP D 1 88  ? 129.289 86.742  110.563 1.00 0.00 ? 92  TRP D CG   1  
ATOM 8964   C CD1  . TRP D 1 88  ? 128.953 85.533  111.095 1.00 0.00 ? 92  TRP D CD1  1  
ATOM 8965   C CD2  . TRP D 1 88  ? 130.584 87.062  111.087 1.00 0.00 ? 92  TRP D CD2  1  
ATOM 8966   N NE1  . TRP D 1 88  ? 129.933 85.103  111.952 1.00 0.00 ? 92  TRP D NE1  1  
ATOM 8967   C CE2  . TRP D 1 88  ? 130.950 86.021  111.962 1.00 0.00 ? 92  TRP D CE2  1  
ATOM 8968   C CE3  . TRP D 1 88  ? 131.460 88.137  110.915 1.00 0.00 ? 92  TRP D CE3  1  
ATOM 8969   C CZ2  . TRP D 1 88  ? 132.151 86.022  112.664 1.00 0.00 ? 92  TRP D CZ2  1  
ATOM 8970   C CZ3  . TRP D 1 88  ? 132.653 88.137  111.615 1.00 0.00 ? 92  TRP D CZ3  1  
ATOM 8971   C CH2  . TRP D 1 88  ? 132.987 87.087  112.479 1.00 0.00 ? 92  TRP D CH2  1  
ATOM 8972   H H    . TRP D 1 88  ? 126.095 86.733  110.519 1.00 0.00 ? 92  TRP D H    1  
ATOM 8973   H HA   . TRP D 1 88  ? 127.546 89.029  110.576 1.00 0.00 ? 92  TRP D HA   1  
ATOM 8974   H HB2  . TRP D 1 88  ? 128.230 86.923  108.847 1.00 0.00 ? 92  TRP D HB2  1  
ATOM 8975   H HB3  . TRP D 1 88  ? 129.092 88.185  109.157 1.00 0.00 ? 92  TRP D HB3  1  
ATOM 8976   H HD1  . TRP D 1 88  ? 128.172 85.067  110.905 1.00 0.00 ? 92  TRP D HD1  1  
ATOM 8977   H HE1  . TRP D 1 88  ? 129.913 84.375  112.410 1.00 0.00 ? 92  TRP D HE1  1  
ATOM 8978   H HE3  . TRP D 1 88  ? 131.246 88.838  110.343 1.00 0.00 ? 92  TRP D HE3  1  
ATOM 8979   H HZ2  . TRP D 1 88  ? 132.377 85.325  113.237 1.00 0.00 ? 92  TRP D HZ2  1  
ATOM 8980   H HZ3  . TRP D 1 88  ? 133.244 88.848  111.509 1.00 0.00 ? 92  TRP D HZ3  1  
ATOM 8981   H HH2  . TRP D 1 88  ? 133.795 87.116  112.938 1.00 0.00 ? 92  TRP D HH2  1  
ATOM 8982   N N    . ARG D 1 89  ? 126.329 89.966  108.613 1.00 0.00 ? 93  ARG D N    1  
ATOM 8983   C CA   . ARG D 1 89  ? 125.662 90.470  107.410 1.00 0.00 ? 93  ARG D CA   1  
ATOM 8984   C C    . ARG D 1 89  ? 126.614 91.441  106.723 1.00 0.00 ? 93  ARG D C    1  
ATOM 8985   O O    . ARG D 1 89  ? 126.942 92.502  107.253 1.00 0.00 ? 93  ARG D O    1  
ATOM 8986   C CB   . ARG D 1 89  ? 124.334 91.140  107.740 1.00 0.00 ? 93  ARG D CB   1  
ATOM 8987   C CG   . ARG D 1 89  ? 124.504 92.299  108.699 1.00 0.00 ? 93  ARG D CG   1  
ATOM 8988   C CD   . ARG D 1 89  ? 123.258 93.117  108.879 1.00 0.00 ? 93  ARG D CD   1  
ATOM 8989   N NE   . ARG D 1 89  ? 123.030 93.930  107.693 1.00 0.00 ? 93  ARG D NE   1  
ATOM 8990   C CZ   . ARG D 1 89  ? 121.910 94.602  107.460 1.00 0.00 ? 93  ARG D CZ   1  
ATOM 8991   N NH1  . ARG D 1 89  ? 120.908 94.545  108.324 1.00 0.00 ? 93  ARG D NH1  1  
ATOM 8992   N NH2  . ARG D 1 89  ? 121.790 95.318  106.353 1.00 0.00 ? 93  ARG D NH2  1  
ATOM 8993   H H    . ARG D 1 89  ? 126.673 90.579  109.108 1.00 0.00 ? 93  ARG D H    1  
ATOM 8994   H HA   . ARG D 1 89  ? 125.451 89.731  106.818 1.00 0.00 ? 93  ARG D HA   1  
ATOM 8995   H HB2  . ARG D 1 89  ? 123.921 91.456  106.921 1.00 0.00 ? 93  ARG D HB2  1  
ATOM 8996   H HB3  . ARG D 1 89  ? 123.731 90.487  108.127 1.00 0.00 ? 93  ARG D HB3  1  
ATOM 8997   H HG2  . ARG D 1 89  ? 124.784 91.957  109.562 1.00 0.00 ? 93  ARG D HG2  1  
ATOM 8998   H HG3  . ARG D 1 89  ? 125.216 92.874  108.377 1.00 0.00 ? 93  ARG D HG3  1  
ATOM 8999   H HD2  . ARG D 1 89  ? 122.499 92.536  109.035 1.00 0.00 ? 93  ARG D HD2  1  
ATOM 9000   H HD3  . ARG D 1 89  ? 123.345 93.687  109.660 1.00 0.00 ? 93  ARG D HD3  1  
ATOM 9001   H HE   . ARG D 1 89  ? 123.658 93.977  107.108 1.00 0.00 ? 93  ARG D HE   1  
ATOM 9002   H HH11 . ARG D 1 89  ? 120.982 94.071  109.038 1.00 0.00 ? 93  ARG D HH11 1  
ATOM 9003   H HH12 . ARG D 1 89  ? 120.183 94.981  108.171 1.00 0.00 ? 93  ARG D HH12 1  
ATOM 9004   H HH21 . ARG D 1 89  ? 122.437 95.347  105.787 1.00 0.00 ? 93  ARG D HH21 1  
ATOM 9005   H HH22 . ARG D 1 89  ? 121.065 95.755  106.199 1.00 0.00 ? 93  ARG D HH22 1  
ATOM 9006   N N    . VAL D 1 90  ? 127.049 91.089  105.522 1.00 0.00 ? 94  VAL D N    1  
ATOM 9007   C CA   . VAL D 1 90  ? 128.070 91.871  104.847 1.00 0.00 ? 94  VAL D CA   1  
ATOM 9008   C C    . VAL D 1 90  ? 127.561 92.290  103.477 1.00 0.00 ? 94  VAL D C    1  
ATOM 9009   O O    . VAL D 1 90  ? 126.541 91.799  102.972 1.00 0.00 ? 94  VAL D O    1  
ATOM 9010   C CB   . VAL D 1 90  ? 129.401 91.107  104.721 1.00 0.00 ? 94  VAL D CB   1  
ATOM 9011   C CG1  . VAL D 1 90  ? 129.623 90.231  105.939 1.00 0.00 ? 94  VAL D CG1  1  
ATOM 9012   C CG2  . VAL D 1 90  ? 129.428 90.288  103.448 1.00 0.00 ? 94  VAL D CG2  1  
ATOM 9013   H H    . VAL D 1 90  ? 126.768 90.405  105.083 1.00 0.00 ? 94  VAL D H    1  
ATOM 9014   H HA   . VAL D 1 90  ? 128.250 92.658  105.385 1.00 0.00 ? 94  VAL D HA   1  
ATOM 9015   H HB   . VAL D 1 90  ? 130.125 91.751  104.675 1.00 0.00 ? 94  VAL D HB   1  
ATOM 9016   H HG11 . VAL D 1 90  ? 129.212 89.365  105.793 1.00 0.00 ? 94  VAL D HG11 1  
ATOM 9017   H HG12 . VAL D 1 90  ? 130.575 90.117  106.086 1.00 0.00 ? 94  VAL D HG12 1  
ATOM 9018   H HG13 . VAL D 1 90  ? 129.225 90.652  106.717 1.00 0.00 ? 94  VAL D HG13 1  
ATOM 9019   H HG21 . VAL D 1 90  ? 128.541 89.935  103.270 1.00 0.00 ? 94  VAL D HG21 1  
ATOM 9020   H HG22 . VAL D 1 90  ? 129.707 90.849  102.708 1.00 0.00 ? 94  VAL D HG22 1  
ATOM 9021   H HG23 . VAL D 1 90  ? 130.052 89.553  103.549 1.00 0.00 ? 94  VAL D HG23 1  
ATOM 9022   N N    . ASP D 1 91  ? 128.299 93.210  102.869 1.00 0.00 ? 95  ASP D N    1  
ATOM 9023   C CA   . ASP D 1 91  ? 127.963 93.707  101.548 1.00 0.00 ? 95  ASP D CA   1  
ATOM 9024   C C    . ASP D 1 91  ? 128.944 93.181  100.511 1.00 0.00 ? 95  ASP D C    1  
ATOM 9025   O O    . ASP D 1 91  ? 130.154 93.104  100.739 1.00 0.00 ? 95  ASP D O    1  
ATOM 9026   C CB   . ASP D 1 91  ? 127.928 95.237  101.529 1.00 0.00 ? 95  ASP D CB   1  
ATOM 9027   C CG   . ASP D 1 91  ? 126.725 95.773  100.787 1.00 0.00 ? 95  ASP D CG   1  
ATOM 9028   O OD1  . ASP D 1 91  ? 125.748 95.017  100.635 1.00 0.00 ? 95  ASP D OD1  1  
ATOM 9029   O OD2  . ASP D 1 91  ? 126.765 96.932  100.326 1.00 0.00 ? 95  ASP D OD2  1  
ATOM 9030   H H    . ASP D 1 91  ? 129.006 93.560  103.211 1.00 0.00 ? 95  ASP D H    1  
ATOM 9031   H HA   . ASP D 1 91  ? 127.076 93.384  101.324 1.00 0.00 ? 95  ASP D HA   1  
ATOM 9032   H HB2  . ASP D 1 91  ? 127.919 95.569  102.440 1.00 0.00 ? 95  ASP D HB2  1  
ATOM 9033   H HB3  . ASP D 1 91  ? 128.738 95.572  101.114 1.00 0.00 ? 95  ASP D HB3  1  
ATOM 9034   N N    . THR D 1 92  ? 128.393 92.805  99.358  1.00 0.00 ? 96  THR D N    1  
ATOM 9035   C CA   . THR D 1 92  ? 129.154 92.214  98.266  1.00 0.00 ? 96  THR D CA   1  
ATOM 9036   C C    . THR D 1 92  ? 130.087 93.213  97.592  1.00 0.00 ? 96  THR D C    1  
ATOM 9037   O O    . THR D 1 92  ? 131.151 92.822  97.107  1.00 0.00 ? 96  THR D O    1  
ATOM 9038   C CB   . THR D 1 92  ? 128.184 91.617  97.231  1.00 0.00 ? 96  THR D CB   1  
ATOM 9039   O OG1  . THR D 1 92  ? 127.296 92.648  96.782  1.00 0.00 ? 96  THR D OG1  1  
ATOM 9040   C CG2  . THR D 1 92  ? 127.317 90.504  97.815  1.00 0.00 ? 96  THR D CG2  1  
ATOM 9041   H H    . THR D 1 92  ? 127.555 92.887  99.189  1.00 0.00 ? 96  THR D H    1  
ATOM 9042   H HA   . THR D 1 92  ? 129.712 91.517  98.644  1.00 0.00 ? 96  THR D HA   1  
ATOM 9043   H HB   . THR D 1 92  ? 128.723 91.251  96.512  1.00 0.00 ? 96  THR D HB   1  
ATOM 9044   H HG1  . THR D 1 92  ? 126.912 92.995  97.443  1.00 0.00 ? 96  THR D HG1  1  
ATOM 9045   H HG21 . THR D 1 92  ? 126.693 90.479  97.074  1.00 0.00 ? 96  THR D HG21 1  
ATOM 9046   H HG22 . THR D 1 92  ? 127.886 89.788  98.140  1.00 0.00 ? 96  THR D HG22 1  
ATOM 9047   H HG23 . THR D 1 92  ? 126.791 90.856  98.550  1.00 0.00 ? 96  THR D HG23 1  
ATOM 9048   N N    . VAL D 1 93  ? 129.727 94.499  97.583  1.00 0.00 ? 97  VAL D N    1  
ATOM 9049   C CA   . VAL D 1 93  ? 130.601 95.518  97.018  1.00 0.00 ? 97  VAL D CA   1  
ATOM 9050   C C    . VAL D 1 93  ? 131.870 95.634  97.854  1.00 0.00 ? 97  VAL D C    1  
ATOM 9051   O O    . VAL D 1 93  ? 131.831 95.711  99.089  1.00 0.00 ? 97  VAL D O    1  
ATOM 9052   C CB   . VAL D 1 93  ? 129.871 96.871  96.922  1.00 0.00 ? 97  VAL D CB   1  
ATOM 9053   C CG1  . VAL D 1 93  ? 129.512 97.375  98.308  1.00 0.00 ? 97  VAL D CG1  1  
ATOM 9054   C CG2  . VAL D 1 93  ? 130.727 97.892  96.186  1.00 0.00 ? 97  VAL D CG2  1  
ATOM 9055   H H    . VAL D 1 93  ? 128.984 94.796  97.899  1.00 0.00 ? 97  VAL D H    1  
ATOM 9056   H HA   . VAL D 1 93  ? 130.849 95.255  96.117  1.00 0.00 ? 97  VAL D HA   1  
ATOM 9057   H HB   . VAL D 1 93  ? 129.052 96.743  96.419  1.00 0.00 ? 97  VAL D HB   1  
ATOM 9058   H HG11 . VAL D 1 93  ? 128.575 97.197  98.484  1.00 0.00 ? 97  VAL D HG11 1  
ATOM 9059   H HG12 . VAL D 1 93  ? 130.056 96.919  98.970  1.00 0.00 ? 97  VAL D HG12 1  
ATOM 9060   H HG13 . VAL D 1 93  ? 129.675 98.330  98.357  1.00 0.00 ? 97  VAL D HG13 1  
ATOM 9061   H HG21 . VAL D 1 93  ? 130.219 98.709  96.059  1.00 0.00 ? 97  VAL D HG21 1  
ATOM 9062   H HG22 . VAL D 1 93  ? 131.523 98.084  96.706  1.00 0.00 ? 97  VAL D HG22 1  
ATOM 9063   H HG23 . VAL D 1 93  ? 130.985 97.535  95.322  1.00 0.00 ? 97  VAL D HG23 1  
ATOM 9064   N N    . LYS D 1 94  ? 133.011 95.632  97.175  1.00 0.00 ? 98  LYS D N    1  
ATOM 9065   C CA   . LYS D 1 94  ? 134.306 95.615  97.839  1.00 0.00 ? 98  LYS D CA   1  
ATOM 9066   C C    . LYS D 1 94  ? 134.486 96.886  98.660  1.00 0.00 ? 98  LYS D C    1  
ATOM 9067   O O    . LYS D 1 94  ? 134.216 97.990  98.175  1.00 0.00 ? 98  LYS D O    1  
ATOM 9068   C CB   . LYS D 1 94  ? 135.431 95.466  96.817  1.00 0.00 ? 98  LYS D CB   1  
ATOM 9069   C CG   . LYS D 1 94  ? 136.826 95.601  97.401  1.00 0.00 ? 98  LYS D CG   1  
ATOM 9070   C CD   . LYS D 1 94  ? 137.746 94.494  96.924  1.00 0.00 ? 98  LYS D CD   1  
ATOM 9071   C CE   . LYS D 1 94  ? 137.766 93.336  97.911  1.00 0.00 ? 98  LYS D CE   1  
ATOM 9072   N NZ   . LYS D 1 94  ? 136.491 92.567  97.924  1.00 0.00 ? 98  LYS D NZ   1  
ATOM 9073   H H    . LYS D 1 94  ? 133.055 95.640  96.316  1.00 0.00 ? 98  LYS D H    1  
ATOM 9074   H HA   . LYS D 1 94  ? 134.342 94.853  98.438  1.00 0.00 ? 98  LYS D HA   1  
ATOM 9075   H HB2  . LYS D 1 94  ? 135.353 94.598  96.390  1.00 0.00 ? 98  LYS D HB2  1  
ATOM 9076   H HB3  . LYS D 1 94  ? 135.316 96.134  96.124  1.00 0.00 ? 98  LYS D HB3  1  
ATOM 9077   H HG2  . LYS D 1 94  ? 137.198 96.461  97.152  1.00 0.00 ? 98  LYS D HG2  1  
ATOM 9078   H HG3  . LYS D 1 94  ? 136.774 95.584  98.369  1.00 0.00 ? 98  LYS D HG3  1  
ATOM 9079   H HD2  . LYS D 1 94  ? 137.454 94.179  96.055  1.00 0.00 ? 98  LYS D HD2  1  
ATOM 9080   H HD3  . LYS D 1 94  ? 138.644 94.842  96.812  1.00 0.00 ? 98  LYS D HD3  1  
ATOM 9081   H HE2  . LYS D 1 94  ? 138.496 92.739  97.687  1.00 0.00 ? 98  LYS D HE2  1  
ATOM 9082   H HE3  . LYS D 1 94  ? 137.941 93.678  98.801  1.00 0.00 ? 98  LYS D HE3  1  
ATOM 9083   H HZ1  . LYS D 1 94  ? 136.370 92.177  97.133  1.00 0.00 ? 98  LYS D HZ1  1  
ATOM 9084   H HZ2  . LYS D 1 94  ? 136.527 91.944  98.559  1.00 0.00 ? 98  LYS D HZ2  1  
ATOM 9085   H HZ3  . LYS D 1 94  ? 135.812 93.119  98.088  1.00 0.00 ? 98  LYS D HZ3  1  
ATOM 9086   N N    . ASN D 1 95  ? 134.930 96.728  99.902  1.00 0.00 ? 99  ASN D N    1  
ATOM 9087   C CA   . ASN D 1 95  ? 135.309 97.861  100.728 1.00 0.00 ? 99  ASN D CA   1  
ATOM 9088   C C    . ASN D 1 95  ? 136.651 98.417  100.266 1.00 0.00 ? 99  ASN D C    1  
ATOM 9089   O O    . ASN D 1 95  ? 137.577 97.679  99.925  1.00 0.00 ? 99  ASN D O    1  
ATOM 9090   C CB   . ASN D 1 95  ? 135.369 97.459  102.200 1.00 0.00 ? 99  ASN D CB   1  
ATOM 9091   C CG   . ASN D 1 95  ? 134.846 98.542  103.117 1.00 0.00 ? 99  ASN D CG   1  
ATOM 9092   O OD1  . ASN D 1 95  ? 133.742 98.442  103.648 1.00 0.00 ? 99  ASN D OD1  1  
ATOM 9093   N ND2  . ASN D 1 95  ? 135.639 99.589  103.307 1.00 0.00 ? 99  ASN D ND2  1  
ATOM 9094   H H    . ASN D 1 95  ? 135.020 95.963  100.286 1.00 0.00 ? 99  ASN D H    1  
ATOM 9095   H HA   . ASN D 1 95  ? 134.636 98.553  100.635 1.00 0.00 ? 99  ASN D HA   1  
ATOM 9096   H HB2  . ASN D 1 95  ? 134.851 96.649  102.333 1.00 0.00 ? 99  ASN D HB2  1  
ATOM 9097   H HB3  . ASN D 1 95  ? 136.286 97.253  102.439 1.00 0.00 ? 99  ASN D HB3  1  
ATOM 9098   H HD21 . ASN D 1 95  ? 135.387 100.232 103.820 1.00 0.00 ? 99  ASN D HD21 1  
ATOM 9099   H HD22 . ASN D 1 95  ? 136.405 99.624  102.918 1.00 0.00 ? 99  ASN D HD22 1  
ATOM 9100   N N    . GLU D 1 96  ? 136.754 99.745  100.262 1.00 0.00 ? 100 GLU D N    1  
ATOM 9101   C CA   . GLU D 1 96  ? 137.956 100.412 99.785  1.00 0.00 ? 100 GLU D CA   1  
ATOM 9102   C C    . GLU D 1 96  ? 139.069 100.499 100.816 1.00 0.00 ? 100 GLU D C    1  
ATOM 9103   O O    . GLU D 1 96  ? 140.230 100.654 100.429 1.00 0.00 ? 100 GLU D O    1  
ATOM 9104   C CB   . GLU D 1 96  ? 137.615 101.819 99.278  1.00 0.00 ? 100 GLU D CB   1  
ATOM 9105   C CG   . GLU D 1 96  ? 137.660 101.943 97.757  1.00 0.00 ? 100 GLU D CG   1  
ATOM 9106   C CD   . GLU D 1 96  ? 136.489 101.284 97.056  1.00 0.00 ? 100 GLU D CD   1  
ATOM 9107   O OE1  . GLU D 1 96  ? 136.267 100.072 97.258  1.00 0.00 ? 100 GLU D OE1  1  
ATOM 9108   O OE2  . GLU D 1 96  ? 135.794 101.981 96.290  1.00 0.00 ? 100 GLU D OE2  1  
ATOM 9109   H H    . GLU D 1 96  ? 136.135 100.277 100.533 1.00 0.00 ? 100 GLU D H    1  
ATOM 9110   H HA   . GLU D 1 96  ? 138.295 99.860  99.062  1.00 0.00 ? 100 GLU D HA   1  
ATOM 9111   H HB2  . GLU D 1 96  ? 136.728 102.062 99.590  1.00 0.00 ? 100 GLU D HB2  1  
ATOM 9112   H HB3  . GLU D 1 96  ? 138.235 102.455 99.666  1.00 0.00 ? 100 GLU D HB3  1  
ATOM 9113   H HG2  . GLU D 1 96  ? 137.682 102.883 97.518  1.00 0.00 ? 100 GLU D HG2  1  
ATOM 9114   H HG3  . GLU D 1 96  ? 138.485 101.547 97.433  1.00 0.00 ? 100 GLU D HG3  1  
ATOM 9115   N N    . ASN D 1 97  ? 138.754 100.401 102.107 1.00 0.00 ? 101 ASN D N    1  
ATOM 9116   C CA   . ASN D 1 97  ? 139.806 100.242 103.104 1.00 0.00 ? 101 ASN D CA   1  
ATOM 9117   C C    . ASN D 1 97  ? 139.536 99.030  103.992 1.00 0.00 ? 101 ASN D C    1  
ATOM 9118   O O    . ASN D 1 97  ? 140.015 98.961  105.129 1.00 0.00 ? 101 ASN D O    1  
ATOM 9119   C CB   . ASN D 1 97  ? 139.968 101.535 103.914 1.00 0.00 ? 101 ASN D CB   1  
ATOM 9120   C CG   . ASN D 1 97  ? 140.781 102.594 103.194 1.00 0.00 ? 101 ASN D CG   1  
ATOM 9121   O OD1  . ASN D 1 97  ? 140.235 103.461 102.510 1.00 0.00 ? 101 ASN D OD1  1  
ATOM 9122   N ND2  . ASN D 1 97  ? 142.097 102.534 103.356 1.00 0.00 ? 101 ASN D ND2  1  
ATOM 9123   H H    . ASN D 1 97  ? 137.953 100.425 102.421 1.00 0.00 ? 101 ASN D H    1  
ATOM 9124   H HA   . ASN D 1 97  ? 140.648 100.075 102.651 1.00 0.00 ? 101 ASN D HA   1  
ATOM 9125   H HB2  . ASN D 1 97  ? 139.091 101.894 104.119 1.00 0.00 ? 101 ASN D HB2  1  
ATOM 9126   H HB3  . ASN D 1 97  ? 140.395 101.328 104.760 1.00 0.00 ? 101 ASN D HB3  1  
ATOM 9127   H HD21 . ASN D 1 97  ? 142.604 103.116 102.976 1.00 0.00 ? 101 ASN D HD21 1  
ATOM 9128   H HD22 . ASN D 1 97  ? 142.443 101.914 103.840 1.00 0.00 ? 101 ASN D HD22 1  
ATOM 9129   N N    . ASP D 1 98  ? 138.782 98.061  103.486 1.00 0.00 ? 102 ASP D N    1  
ATOM 9130   C CA   . ASP D 1 98  ? 138.663 96.760  104.118 1.00 0.00 ? 102 ASP D CA   1  
ATOM 9131   C C    . ASP D 1 98  ? 138.327 95.735  103.041 1.00 0.00 ? 102 ASP D C    1  
ATOM 9132   O O    . ASP D 1 98  ? 138.036 96.079  101.894 1.00 0.00 ? 102 ASP D O    1  
ATOM 9133   C CB   . ASP D 1 98  ? 137.608 96.785  105.225 1.00 0.00 ? 102 ASP D CB   1  
ATOM 9134   C CG   . ASP D 1 98  ? 137.646 95.550  106.103 1.00 0.00 ? 102 ASP D CG   1  
ATOM 9135   O OD1  . ASP D 1 98  ? 136.574 95.128  106.584 1.00 0.00 ? 102 ASP D OD1  1  
ATOM 9136   O OD2  . ASP D 1 98  ? 138.747 95.005  106.321 1.00 0.00 ? 102 ASP D OD2  1  
ATOM 9137   H H    . ASP D 1 98  ? 138.323 98.144  102.763 1.00 0.00 ? 102 ASP D H    1  
ATOM 9138   H HA   . ASP D 1 98  ? 139.501 96.517  104.542 1.00 0.00 ? 102 ASP D HA   1  
ATOM 9139   H HB2  . ASP D 1 98  ? 137.741 97.572  105.775 1.00 0.00 ? 102 ASP D HB2  1  
ATOM 9140   H HB3  . ASP D 1 98  ? 136.728 96.865  104.825 1.00 0.00 ? 102 ASP D HB3  1  
ATOM 9141   N N    . LYS D 1 99  ? 138.362 94.457  103.402 1.00 0.00 ? 103 LYS D N    1  
ATOM 9142   C CA   . LYS D 1 99  ? 137.894 93.407  102.512 1.00 0.00 ? 103 LYS D CA   1  
ATOM 9143   C C    . LYS D 1 99  ? 136.455 93.665  102.088 1.00 0.00 ? 103 LYS D C    1  
ATOM 9144   O O    . LYS D 1 99  ? 136.168 93.863  100.903 1.00 0.00 ? 103 LYS D O    1  
ATOM 9145   C CB   . LYS D 1 99  ? 138.010 92.050  103.206 1.00 0.00 ? 103 LYS D CB   1  
ATOM 9146   C CG   . LYS D 1 99  ? 139.435 91.626  103.495 1.00 0.00 ? 103 LYS D CG   1  
ATOM 9147   C CD   . LYS D 1 99  ? 139.710 91.659  104.984 1.00 0.00 ? 103 LYS D CD   1  
ATOM 9148   C CE   . LYS D 1 99  ? 140.635 92.800  105.352 1.00 0.00 ? 103 LYS D CE   1  
ATOM 9149   N NZ   . LYS D 1 99  ? 142.055 92.357  105.365 1.00 0.00 ? 103 LYS D NZ   1  
ATOM 9150   H H    . LYS D 1 99  ? 138.654 94.179  104.162 1.00 0.00 ? 103 LYS D H    1  
ATOM 9151   H HA   . LYS D 1 99  ? 138.449 93.402  101.716 1.00 0.00 ? 103 LYS D HA   1  
ATOM 9152   H HB2  . LYS D 1 99  ? 137.516 92.079  104.040 1.00 0.00 ? 103 LYS D HB2  1  
ATOM 9153   H HB3  . LYS D 1 99  ? 137.588 91.375  102.651 1.00 0.00 ? 103 LYS D HB3  1  
ATOM 9154   H HG2  . LYS D 1 99  ? 139.587 90.731  103.153 1.00 0.00 ? 103 LYS D HG2  1  
ATOM 9155   H HG3  . LYS D 1 99  ? 140.052 92.216  103.034 1.00 0.00 ? 103 LYS D HG3  1  
ATOM 9156   H HD2  . LYS D 1 99  ? 138.874 91.751  105.467 1.00 0.00 ? 103 LYS D HD2  1  
ATOM 9157   H HD3  . LYS D 1 99  ? 140.106 90.818  105.260 1.00 0.00 ? 103 LYS D HD3  1  
ATOM 9158   H HE2  . LYS D 1 99  ? 140.525 93.526  104.719 1.00 0.00 ? 103 LYS D HE2  1  
ATOM 9159   H HE3  . LYS D 1 99  ? 140.393 93.146  106.225 1.00 0.00 ? 103 LYS D HE3  1  
ATOM 9160   H HZ1  . LYS D 1 99  ? 142.184 91.753  104.723 1.00 0.00 ? 103 LYS D HZ1  1  
ATOM 9161   H HZ2  . LYS D 1 99  ? 142.586 93.057  105.223 1.00 0.00 ? 103 LYS D HZ2  1  
ATOM 9162   H HZ3  . LYS D 1 99  ? 142.247 91.996  106.155 1.00 0.00 ? 103 LYS D HZ3  1  
ATOM 9163   N N    . TYR D 1 100 ? 135.547 93.675  103.057 1.00 0.00 ? 104 TYR D N    1  
ATOM 9164   C CA   . TYR D 1 100 ? 134.136 93.926  102.840 1.00 0.00 ? 104 TYR D CA   1  
ATOM 9165   C C    . TYR D 1 100 ? 133.627 94.729  104.030 1.00 0.00 ? 104 TYR D C    1  
ATOM 9166   O O    . TYR D 1 100 ? 134.388 95.071  104.940 1.00 0.00 ? 104 TYR D O    1  
ATOM 9167   C CB   . TYR D 1 100 ? 133.376 92.605  102.672 1.00 0.00 ? 104 TYR D CB   1  
ATOM 9168   C CG   . TYR D 1 100 ? 133.400 92.083  101.251 1.00 0.00 ? 104 TYR D CG   1  
ATOM 9169   C CD1  . TYR D 1 100 ? 133.410 92.949  100.164 1.00 0.00 ? 104 TYR D CD1  1  
ATOM 9170   C CD2  . TYR D 1 100 ? 133.433 90.717  101.000 1.00 0.00 ? 104 TYR D CD2  1  
ATOM 9171   C CE1  . TYR D 1 100 ? 133.439 92.466  98.868  1.00 0.00 ? 104 TYR D CE1  1  
ATOM 9172   C CE2  . TYR D 1 100 ? 133.461 90.225  99.708  1.00 0.00 ? 104 TYR D CE2  1  
ATOM 9173   C CZ   . TYR D 1 100 ? 133.463 91.105  98.649  1.00 0.00 ? 104 TYR D CZ   1  
ATOM 9174   O OH   . TYR D 1 100 ? 133.492 90.622  97.363  1.00 0.00 ? 104 TYR D OH   1  
ATOM 9175   H H    . TYR D 1 100 ? 135.745 93.533  103.882 1.00 0.00 ? 104 TYR D H    1  
ATOM 9176   H HA   . TYR D 1 100 ? 133.994 94.430  102.024 1.00 0.00 ? 104 TYR D HA   1  
ATOM 9177   H HB2  . TYR D 1 100 ? 133.762 91.938  103.262 1.00 0.00 ? 104 TYR D HB2  1  
ATOM 9178   H HB3  . TYR D 1 100 ? 132.454 92.730  102.950 1.00 0.00 ? 104 TYR D HB3  1  
ATOM 9179   H HD1  . TYR D 1 100 ? 133.398 93.867  100.310 1.00 0.00 ? 104 TYR D HD1  1  
ATOM 9180   H HD2  . TYR D 1 100 ? 133.435 90.122  101.714 1.00 0.00 ? 104 TYR D HD2  1  
ATOM 9181   H HE1  . TYR D 1 100 ? 133.441 93.056  98.149  1.00 0.00 ? 104 TYR D HE1  1  
ATOM 9182   H HE2  . TYR D 1 100 ? 133.478 89.308  99.556  1.00 0.00 ? 104 TYR D HE2  1  
ATOM 9183   H HH   . TYR D 1 100 ? 132.751 90.271  97.179  1.00 0.00 ? 104 TYR D HH   1  
ATOM 9184   N N    . ASP D 1 101 ? 132.334 95.035  104.031 1.00 0.00 ? 105 ASP D N    1  
ATOM 9185   C CA   . ASP D 1 101 ? 131.735 95.758  105.143 1.00 0.00 ? 105 ASP D CA   1  
ATOM 9186   C C    . ASP D 1 101 ? 130.572 94.953  105.704 1.00 0.00 ? 105 ASP D C    1  
ATOM 9187   O O    . ASP D 1 101 ? 129.780 94.357  104.964 1.00 0.00 ? 105 ASP D O    1  
ATOM 9188   C CB   . ASP D 1 101 ? 131.306 97.170  104.729 1.00 0.00 ? 105 ASP D CB   1  
ATOM 9189   C CG   . ASP D 1 101 ? 130.494 97.180  103.459 1.00 0.00 ? 105 ASP D CG   1  
ATOM 9190   O OD1  . ASP D 1 101 ? 129.258 97.303  103.553 1.00 0.00 ? 105 ASP D OD1  1  
ATOM 9191   O OD2  . ASP D 1 101 ? 131.088 97.064  102.369 1.00 0.00 ? 105 ASP D OD2  1  
ATOM 9192   H H    . ASP D 1 101 ? 131.788 94.832  103.398 1.00 0.00 ? 105 ASP D H    1  
ATOM 9193   H HA   . ASP D 1 101 ? 132.399 95.869  105.842 1.00 0.00 ? 105 ASP D HA   1  
ATOM 9194   H HB2  . ASP D 1 101 ? 130.786 97.570  105.444 1.00 0.00 ? 105 ASP D HB2  1  
ATOM 9195   H HB3  . ASP D 1 101 ? 132.095 97.722  104.608 1.00 0.00 ? 105 ASP D HB3  1  
ATOM 9196   N N    . ALA D 1 102 ? 130.472 94.958  107.030 1.00 0.00 ? 106 ALA D N    1  
ATOM 9197   C CA   . ALA D 1 102 ? 129.654 93.979  107.725 1.00 0.00 ? 106 ALA D CA   1  
ATOM 9198   C C    . ALA D 1 102 ? 128.904 94.642  108.868 1.00 0.00 ? 106 ALA D C    1  
ATOM 9199   O O    . ALA D 1 102 ? 129.269 95.724  109.336 1.00 0.00 ? 106 ALA D O    1  
ATOM 9200   C CB   . ALA D 1 102 ? 130.519 92.834  108.267 1.00 0.00 ? 106 ALA D CB   1  
ATOM 9201   H H    . ALA D 1 102 ? 130.871 95.521  107.543 1.00 0.00 ? 106 ALA D H    1  
ATOM 9202   H HA   . ALA D 1 102 ? 129.016 93.612  107.094 1.00 0.00 ? 106 ALA D HA   1  
ATOM 9203   H HB1  . ALA D 1 102 ? 131.273 93.201  108.755 1.00 0.00 ? 106 ALA D HB1  1  
ATOM 9204   H HB2  . ALA D 1 102 ? 129.989 92.281  108.862 1.00 0.00 ? 106 ALA D HB2  1  
ATOM 9205   H HB3  . ALA D 1 102 ? 130.843 92.294  107.529 1.00 0.00 ? 106 ALA D HB3  1  
ATOM 9206   N N    . GLN D 1 103 ? 127.842 93.974  109.304 1.00 0.00 ? 107 GLN D N    1  
ATOM 9207   C CA   . GLN D 1 103 ? 127.281 94.146  110.636 1.00 0.00 ? 107 GLN D CA   1  
ATOM 9208   C C    . GLN D 1 103 ? 127.241 92.764  111.274 1.00 0.00 ? 107 GLN D C    1  
ATOM 9209   O O    . GLN D 1 103 ? 126.925 91.775  110.604 1.00 0.00 ? 107 GLN D O    1  
ATOM 9210   C CB   . GLN D 1 103 ? 125.895 94.790  110.588 1.00 0.00 ? 107 GLN D CB   1  
ATOM 9211   C CG   . GLN D 1 103 ? 125.105 94.648  111.893 1.00 0.00 ? 107 GLN D CG   1  
ATOM 9212   C CD   . GLN D 1 103 ? 123.764 95.370  111.869 1.00 0.00 ? 107 GLN D CD   1  
ATOM 9213   O OE1  . GLN D 1 103 ? 123.196 95.612  110.807 1.00 0.00 ? 107 GLN D OE1  1  
ATOM 9214   N NE2  . GLN D 1 103 ? 123.256 95.715  113.044 1.00 0.00 ? 107 GLN D NE2  1  
ATOM 9215   H H    . GLN D 1 103 ? 127.421 93.397  108.824 1.00 0.00 ? 107 GLN D H    1  
ATOM 9216   H HA   . GLN D 1 103 ? 127.827 94.749  111.162 1.00 0.00 ? 107 GLN D HA   1  
ATOM 9217   H HB2  . GLN D 1 103 ? 125.991 95.732  110.379 1.00 0.00 ? 107 GLN D HB2  1  
ATOM 9218   H HB3  . GLN D 1 103 ? 125.385 94.390  109.866 1.00 0.00 ? 107 GLN D HB3  1  
ATOM 9219   H HG2  . GLN D 1 103 ? 124.956 93.706  112.073 1.00 0.00 ? 107 GLN D HG2  1  
ATOM 9220   H HG3  . GLN D 1 103 ? 125.638 94.995  112.626 1.00 0.00 ? 107 GLN D HG3  1  
ATOM 9221   H HE21 . GLN D 1 103 ? 123.682 95.529  113.768 1.00 0.00 ? 107 GLN D HE21 1  
ATOM 9222   H HE22 . GLN D 1 103 ? 122.501 96.125  113.081 1.00 0.00 ? 107 GLN D HE22 1  
ATOM 9223   N N    . PHE D 1 104 ? 127.580 92.699  112.557 1.00 0.00 ? 108 PHE D N    1  
ATOM 9224   C CA   . PHE D 1 104 ? 127.934 91.458  113.231 1.00 0.00 ? 108 PHE D CA   1  
ATOM 9225   C C    . PHE D 1 104 ? 127.192 91.342  114.554 1.00 0.00 ? 108 PHE D C    1  
ATOM 9226   O O    . PHE D 1 104 ? 126.894 92.348  115.202 1.00 0.00 ? 108 PHE D O    1  
ATOM 9227   C CB   . PHE D 1 104 ? 129.461 91.406  113.456 1.00 0.00 ? 108 PHE D CB   1  
ATOM 9228   C CG   . PHE D 1 104 ? 129.932 90.212  114.234 1.00 0.00 ? 108 PHE D CG   1  
ATOM 9229   C CD1  . PHE D 1 104 ? 129.558 88.931  113.865 1.00 0.00 ? 108 PHE D CD1  1  
ATOM 9230   C CD2  . PHE D 1 104 ? 130.748 90.376  115.343 1.00 0.00 ? 108 PHE D CD2  1  
ATOM 9231   C CE1  . PHE D 1 104 ? 129.991 87.835  114.590 1.00 0.00 ? 108 PHE D CE1  1  
ATOM 9232   C CE2  . PHE D 1 104 ? 131.188 89.286  116.069 1.00 0.00 ? 108 PHE D CE2  1  
ATOM 9233   C CZ   . PHE D 1 104 ? 130.809 88.013  115.691 1.00 0.00 ? 108 PHE D CZ   1  
ATOM 9234   H H    . PHE D 1 104 ? 127.610 93.390  113.069 1.00 0.00 ? 108 PHE D H    1  
ATOM 9235   H HA   . PHE D 1 104 ? 127.674 90.709  112.673 1.00 0.00 ? 108 PHE D HA   1  
ATOM 9236   H HB2  . PHE D 1 104 ? 129.905 91.412  112.594 1.00 0.00 ? 108 PHE D HB2  1  
ATOM 9237   H HB3  . PHE D 1 104 ? 129.737 92.211  113.922 1.00 0.00 ? 108 PHE D HB3  1  
ATOM 9238   H HD1  . PHE D 1 104 ? 129.011 88.806  113.123 1.00 0.00 ? 108 PHE D HD1  1  
ATOM 9239   H HD2  . PHE D 1 104 ? 131.003 91.232  115.601 1.00 0.00 ? 108 PHE D HD2  1  
ATOM 9240   H HE1  . PHE D 1 104 ? 129.731 86.979  114.336 1.00 0.00 ? 108 PHE D HE1  1  
ATOM 9241   H HE2  . PHE D 1 104 ? 131.738 89.410  116.809 1.00 0.00 ? 108 PHE D HE2  1  
ATOM 9242   H HZ   . PHE D 1 104 ? 131.104 87.276  116.176 1.00 0.00 ? 108 PHE D HZ   1  
ATOM 9243   N N    . GLY D 1 105 ? 126.879 90.111  114.949 1.00 0.00 ? 109 GLY D N    1  
ATOM 9244   C CA   . GLY D 1 105 ? 126.354 89.902  116.283 1.00 0.00 ? 109 GLY D CA   1  
ATOM 9245   C C    . GLY D 1 105 ? 126.347 88.441  116.664 1.00 0.00 ? 109 GLY D C    1  
ATOM 9246   O O    . GLY D 1 105 ? 126.779 87.575  115.897 1.00 0.00 ? 109 GLY D O    1  
ATOM 9247   H H    . GLY D 1 105 ? 126.962 89.403  114.468 1.00 0.00 ? 109 GLY D H    1  
ATOM 9248   H HA2  . GLY D 1 105 ? 126.888 90.399  116.922 1.00 0.00 ? 109 GLY D HA2  1  
ATOM 9249   H HA3  . GLY D 1 105 ? 125.451 90.253  116.334 1.00 0.00 ? 109 GLY D HA3  1  
ATOM 9250   N N    . PHE D 1 106 ? 125.845 88.181  117.869 1.00 0.00 ? 110 PHE D N    1  
ATOM 9251   C CA   . PHE D 1 106 ? 125.514 86.829  118.302 1.00 0.00 ? 110 PHE D CA   1  
ATOM 9252   C C    . PHE D 1 106 ? 123.998 86.727  118.369 1.00 0.00 ? 110 PHE D C    1  
ATOM 9253   O O    . PHE D 1 106 ? 123.338 87.573  118.981 1.00 0.00 ? 110 PHE D O    1  
ATOM 9254   C CB   . PHE D 1 106 ? 126.145 86.515  119.654 1.00 0.00 ? 110 PHE D CB   1  
ATOM 9255   C CG   . PHE D 1 106 ? 127.593 86.148  119.575 1.00 0.00 ? 110 PHE D CG   1  
ATOM 9256   C CD1  . PHE D 1 106 ? 128.140 85.242  120.468 1.00 0.00 ? 110 PHE D CD1  1  
ATOM 9257   C CD2  . PHE D 1 106 ? 128.406 86.700  118.598 1.00 0.00 ? 110 PHE D CD2  1  
ATOM 9258   C CE1  . PHE D 1 106 ? 129.479 84.904  120.399 1.00 0.00 ? 110 PHE D CE1  1  
ATOM 9259   C CE2  . PHE D 1 106 ? 129.745 86.362  118.521 1.00 0.00 ? 110 PHE D CE2  1  
ATOM 9260   C CZ   . PHE D 1 106 ? 130.280 85.462  119.422 1.00 0.00 ? 110 PHE D CZ   1  
ATOM 9261   H H    . PHE D 1 106 ? 125.688 88.786  118.459 1.00 0.00 ? 110 PHE D H    1  
ATOM 9262   H HA   . PHE D 1 106 ? 125.867 86.179  117.673 1.00 0.00 ? 110 PHE D HA   1  
ATOM 9263   H HB2  . PHE D 1 106 ? 126.046 87.286  120.235 1.00 0.00 ? 110 PHE D HB2  1  
ATOM 9264   H HB3  . PHE D 1 106 ? 125.657 85.785  120.068 1.00 0.00 ? 110 PHE D HB3  1  
ATOM 9265   H HD1  . PHE D 1 106 ? 127.602 84.858  121.121 1.00 0.00 ? 110 PHE D HD1  1  
ATOM 9266   H HD2  . PHE D 1 106 ? 128.047 87.304  117.988 1.00 0.00 ? 110 PHE D HD2  1  
ATOM 9267   H HE1  . PHE D 1 106 ? 129.839 84.302  121.010 1.00 0.00 ? 110 PHE D HE1  1  
ATOM 9268   H HE2  . PHE D 1 106 ? 130.284 86.740  117.864 1.00 0.00 ? 110 PHE D HE2  1  
ATOM 9269   H HZ   . PHE D 1 106 ? 131.180 85.232  119.371 1.00 0.00 ? 110 PHE D HZ   1  
ATOM 9270   N N    . ALA D 1 107 ? 123.447 85.692  117.750 1.00 0.00 ? 111 ALA D N    1  
ATOM 9271   C CA   . ALA D 1 107 ? 122.014 85.584  117.547 1.00 0.00 ? 111 ALA D CA   1  
ATOM 9272   C C    . ALA D 1 107 ? 121.499 84.217  117.975 1.00 0.00 ? 111 ALA D C    1  
ATOM 9273   O O    . ALA D 1 107 ? 122.252 83.243  118.096 1.00 0.00 ? 111 ALA D O    1  
ATOM 9274   C CB   . ALA D 1 107 ? 121.649 85.843  116.084 1.00 0.00 ? 111 ALA D CB   1  
ATOM 9275   H H    . ALA D 1 107 ? 123.898 85.030  117.436 1.00 0.00 ? 111 ALA D H    1  
ATOM 9276   H HA   . ALA D 1 107 ? 121.589 86.258  118.100 1.00 0.00 ? 111 ALA D HA   1  
ATOM 9277   H HB1  . ALA D 1 107 ? 121.863 86.761  115.854 1.00 0.00 ? 111 ALA D HB1  1  
ATOM 9278   H HB2  . ALA D 1 107 ? 122.153 85.241  115.513 1.00 0.00 ? 111 ALA D HB2  1  
ATOM 9279   H HB3  . ALA D 1 107 ? 120.699 85.690  115.954 1.00 0.00 ? 111 ALA D HB3  1  
ATOM 9280   N N    . TYR D 1 108 ? 120.187 84.163  118.186 1.00 0.00 ? 112 TYR D N    1  
ATOM 9281   C CA   . TYR D 1 108 ? 119.515 82.986  118.719 1.00 0.00 ? 112 TYR D CA   1  
ATOM 9282   C C    . TYR D 1 108 ? 118.358 82.644  117.790 1.00 0.00 ? 112 TYR D C    1  
ATOM 9283   O O    . TYR D 1 108 ? 117.947 83.477  116.978 1.00 0.00 ? 112 TYR D O    1  
ATOM 9284   C CB   . TYR D 1 108 ? 119.021 83.250  120.140 1.00 0.00 ? 112 TYR D CB   1  
ATOM 9285   C CG   . TYR D 1 108 ? 119.103 82.052  121.041 1.00 0.00 ? 112 TYR D CG   1  
ATOM 9286   C CD1  . TYR D 1 108 ? 120.288 81.732  121.684 1.00 0.00 ? 112 TYR D CD1  1  
ATOM 9287   C CD2  . TYR D 1 108 ? 118.004 81.233  121.239 1.00 0.00 ? 112 TYR D CD2  1  
ATOM 9288   C CE1  . TYR D 1 108 ? 120.373 80.640  122.510 1.00 0.00 ? 112 TYR D CE1  1  
ATOM 9289   C CE2  . TYR D 1 108 ? 118.081 80.130  122.063 1.00 0.00 ? 112 TYR D CE2  1  
ATOM 9290   C CZ   . TYR D 1 108 ? 119.272 79.841  122.692 1.00 0.00 ? 112 TYR D CZ   1  
ATOM 9291   O OH   . TYR D 1 108 ? 119.375 78.748  123.508 1.00 0.00 ? 112 TYR D OH   1  
ATOM 9292   H H    . TYR D 1 108 ? 119.657 84.819  118.020 1.00 0.00 ? 112 TYR D H    1  
ATOM 9293   H HA   . TYR D 1 108 ? 120.129 82.238  118.765 1.00 0.00 ? 112 TYR D HA   1  
ATOM 9294   H HB2  . TYR D 1 108 ? 119.543 83.971  120.526 1.00 0.00 ? 112 TYR D HB2  1  
ATOM 9295   H HB3  . TYR D 1 108 ? 118.101 83.554  120.103 1.00 0.00 ? 112 TYR D HB3  1  
ATOM 9296   H HD1  . TYR D 1 108 ? 121.038 82.267  121.553 1.00 0.00 ? 112 TYR D HD1  1  
ATOM 9297   H HD2  . TYR D 1 108 ? 117.202 81.431  120.811 1.00 0.00 ? 112 TYR D HD2  1  
ATOM 9298   H HE1  . TYR D 1 108 ? 121.171 80.442  122.944 1.00 0.00 ? 112 TYR D HE1  1  
ATOM 9299   H HE2  . TYR D 1 108 ? 117.338 79.587  122.193 1.00 0.00 ? 112 TYR D HE2  1  
ATOM 9300   H HH   . TYR D 1 108 ? 118.876 78.136  123.221 1.00 0.00 ? 112 TYR D HH   1  
ATOM 9301   N N    . ILE D 1 109 ? 117.847 81.416  117.898 1.00 0.00 ? 113 ILE D N    1  
ATOM 9302   C CA   . ILE D 1 109 ? 116.730 80.983  117.066 1.00 0.00 ? 113 ILE D CA   1  
ATOM 9303   C C    . ILE D 1 109 ? 115.432 81.150  117.837 1.00 0.00 ? 113 ILE D C    1  
ATOM 9304   O O    . ILE D 1 109 ? 114.960 80.215  118.496 1.00 0.00 ? 113 ILE D O    1  
ATOM 9305   C CB   . ILE D 1 109 ? 116.916 79.524  116.627 1.00 0.00 ? 113 ILE D CB   1  
ATOM 9306   C CG1  . ILE D 1 109 ? 118.174 78.930  117.255 1.00 0.00 ? 113 ILE D CG1  1  
ATOM 9307   C CG2  . ILE D 1 109 ? 116.972 79.426  115.118 1.00 0.00 ? 113 ILE D CG2  1  
ATOM 9308   C CD1  . ILE D 1 109 ? 118.000 78.409  118.682 1.00 0.00 ? 113 ILE D CD1  1  
ATOM 9309   H H    . ILE D 1 109 ? 118.134 80.820  118.448 1.00 0.00 ? 113 ILE D H    1  
ATOM 9310   H HA   . ILE D 1 109 ? 116.697 81.532  116.266 1.00 0.00 ? 113 ILE D HA   1  
ATOM 9311   H HB   . ILE D 1 109 ? 116.152 79.012  116.937 1.00 0.00 ? 113 ILE D HB   1  
ATOM 9312   H HG12 . ILE D 1 109 ? 118.486 78.203  116.694 1.00 0.00 ? 113 ILE D HG12 1  
ATOM 9313   H HG13 . ILE D 1 109 ? 118.869 79.607  117.253 1.00 0.00 ? 113 ILE D HG13 1  
ATOM 9314   H HG21 . ILE D 1 109 ? 117.135 78.505  114.859 1.00 0.00 ? 113 ILE D HG21 1  
ATOM 9315   H HG22 . ILE D 1 109 ? 116.128 79.722  114.743 1.00 0.00 ? 113 ILE D HG22 1  
ATOM 9316   H HG23 . ILE D 1 109 ? 117.690 79.987  114.784 1.00 0.00 ? 113 ILE D HG23 1  
ATOM 9317   H HD11 . ILE D 1 109 ? 118.735 77.814  118.901 1.00 0.00 ? 113 ILE D HD11 1  
ATOM 9318   H HD12 . ILE D 1 109 ? 117.993 79.155  119.301 1.00 0.00 ? 113 ILE D HD12 1  
ATOM 9319   H HD13 . ILE D 1 109 ? 117.163 77.925  118.750 1.00 0.00 ? 113 ILE D HD13 1  
ATOM 9320   N N    . GLU D 1 110 ? 114.843 82.345  117.768 1.00 0.00 ? 114 GLU D N    1  
ATOM 9321   C CA   . GLU D 1 110 ? 113.570 82.577  118.435 1.00 0.00 ? 114 GLU D CA   1  
ATOM 9322   C C    . GLU D 1 110 ? 112.422 81.741  117.890 1.00 0.00 ? 114 GLU D C    1  
ATOM 9323   O O    . GLU D 1 110 ? 111.643 81.205  118.685 1.00 0.00 ? 114 GLU D O    1  
ATOM 9324   C CB   . GLU D 1 110 ? 113.187 84.067  118.376 1.00 0.00 ? 114 GLU D CB   1  
ATOM 9325   C CG   . GLU D 1 110 ? 112.772 84.629  119.724 1.00 0.00 ? 114 GLU D CG   1  
ATOM 9326   C CD   . GLU D 1 110 ? 112.712 86.141  119.779 1.00 0.00 ? 114 GLU D CD   1  
ATOM 9327   O OE1  . GLU D 1 110 ? 113.039 86.798  118.768 1.00 0.00 ? 114 GLU D OE1  1  
ATOM 9328   O OE2  . GLU D 1 110 ? 112.353 86.666  120.852 1.00 0.00 ? 114 GLU D OE2  1  
ATOM 9329   H H    . GLU D 1 110 ? 115.162 83.023  117.346 1.00 0.00 ? 114 GLU D H    1  
ATOM 9330   H HA   . GLU D 1 110 ? 113.708 82.300  119.354 1.00 0.00 ? 114 GLU D HA   1  
ATOM 9331   H HB2  . GLU D 1 110 ? 113.940 84.575  118.036 1.00 0.00 ? 114 GLU D HB2  1  
ATOM 9332   H HB3  . GLU D 1 110 ? 112.459 84.183  117.745 1.00 0.00 ? 114 GLU D HB3  1  
ATOM 9333   H HG2  . GLU D 1 110 ? 111.901 84.272  119.957 1.00 0.00 ? 114 GLU D HG2  1  
ATOM 9334   H HG3  . GLU D 1 110 ? 113.396 84.316  120.398 1.00 0.00 ? 114 GLU D HG3  1  
ATOM 9335   N N    . SER D 1 111 ? 112.296 81.602  116.575 1.00 0.00 ? 115 SER D N    1  
ATOM 9336   C CA   . SER D 1 111 ? 111.290 80.722  116.004 1.00 0.00 ? 115 SER D CA   1  
ATOM 9337   C C    . SER D 1 111 ? 111.722 80.313  114.607 1.00 0.00 ? 115 SER D C    1  
ATOM 9338   O O    . SER D 1 111 ? 112.539 80.990  113.977 1.00 0.00 ? 115 SER D O    1  
ATOM 9339   C CB   . SER D 1 111 ? 109.909 81.385  115.959 1.00 0.00 ? 115 SER D CB   1  
ATOM 9340   O OG   . SER D 1 111 ? 108.900 80.443  115.647 1.00 0.00 ? 115 SER D OG   1  
ATOM 9341   H H    . SER D 1 111 ? 112.786 82.010  115.996 1.00 0.00 ? 115 SER D H    1  
ATOM 9342   H HA   . SER D 1 111 ? 111.213 79.938  116.571 1.00 0.00 ? 115 SER D HA   1  
ATOM 9343   H HB2  . SER D 1 111 ? 109.717 81.797  116.816 1.00 0.00 ? 115 SER D HB2  1  
ATOM 9344   H HB3  . SER D 1 111 ? 109.909 82.094  115.298 1.00 0.00 ? 115 SER D HB3  1  
ATOM 9345   H HG   . SER D 1 111 ? 109.021 79.744  116.096 1.00 0.00 ? 115 SER D HG   1  
ATOM 9346   N N    . ARG D 1 112 ? 111.163 79.202  114.138 1.00 0.00 ? 116 ARG D N    1  
ATOM 9347   C CA   . ARG D 1 112 ? 111.390 78.678  112.793 1.00 0.00 ? 116 ARG D CA   1  
ATOM 9348   C C    . ARG D 1 112 ? 110.005 78.296  112.284 1.00 0.00 ? 116 ARG D C    1  
ATOM 9349   O O    . ARG D 1 112 ? 109.117 77.916  113.051 1.00 0.00 ? 116 ARG D O    1  
ATOM 9350   C CB   . ARG D 1 112 ? 112.379 77.510  112.817 1.00 0.00 ? 116 ARG D CB   1  
ATOM 9351   C CG   . ARG D 1 112 ? 113.634 77.643  111.961 1.00 0.00 ? 116 ARG D CG   1  
ATOM 9352   C CD   . ARG D 1 112 ? 113.932 76.326  111.281 1.00 0.00 ? 116 ARG D CD   1  
ATOM 9353   N NE   . ARG D 1 112 ? 114.170 75.289  112.276 1.00 0.00 ? 116 ARG D NE   1  
ATOM 9354   C CZ   . ARG D 1 112 ? 114.985 74.255  112.102 1.00 0.00 ? 116 ARG D CZ   1  
ATOM 9355   N NH1  . ARG D 1 112 ? 115.637 74.104  110.962 1.00 0.00 ? 116 ARG D NH1  1  
ATOM 9356   N NH2  . ARG D 1 112 ? 115.131 73.359  113.066 1.00 0.00 ? 116 ARG D NH2  1  
ATOM 9357   H H    . ARG D 1 112 ? 110.627 78.718  114.605 1.00 0.00 ? 116 ARG D H    1  
ATOM 9358   H HA   . ARG D 1 112 ? 111.802 79.324  112.198 1.00 0.00 ? 116 ARG D HA   1  
ATOM 9359   H HB2  . ARG D 1 112 ? 112.655 77.370  113.737 1.00 0.00 ? 116 ARG D HB2  1  
ATOM 9360   H HB3  . ARG D 1 112 ? 111.907 76.711  112.537 1.00 0.00 ? 116 ARG D HB3  1  
ATOM 9361   H HG2  . ARG D 1 112 ? 113.511 78.339  111.298 1.00 0.00 ? 116 ARG D HG2  1  
ATOM 9362   H HG3  . ARG D 1 112 ? 114.386 77.908  112.514 1.00 0.00 ? 116 ARG D HG3  1  
ATOM 9363   H HD2  . ARG D 1 112 ? 113.188 76.073  110.711 1.00 0.00 ? 116 ARG D HD2  1  
ATOM 9364   H HD3  . ARG D 1 112 ? 114.709 76.419  110.708 1.00 0.00 ? 116 ARG D HD3  1  
ATOM 9365   H HE   . ARG D 1 112 ? 113.755 75.350  113.026 1.00 0.00 ? 116 ARG D HE   1  
ATOM 9366   H HH11 . ARG D 1 112 ? 115.535 74.677  110.328 1.00 0.00 ? 116 ARG D HH11 1  
ATOM 9367   H HH12 . ARG D 1 112 ? 116.164 73.433  110.853 1.00 0.00 ? 116 ARG D HH12 1  
ATOM 9368   H HH21 . ARG D 1 112 ? 114.699 73.447  113.804 1.00 0.00 ? 116 ARG D HH21 1  
ATOM 9369   H HH22 . ARG D 1 112 ? 115.659 72.689  112.954 1.00 0.00 ? 116 ARG D HH22 1  
ATOM 9370   N N    . GLU D 1 113 ? 109.819 78.447  110.981 1.00 0.00 ? 117 GLU D N    1  
ATOM 9371   C CA   . GLU D 1 113 ? 108.557 78.183  110.307 1.00 0.00 ? 117 GLU D CA   1  
ATOM 9372   C C    . GLU D 1 113 ? 108.879 77.415  109.038 1.00 0.00 ? 117 GLU D C    1  
ATOM 9373   O O    . GLU D 1 113 ? 109.790 77.794  108.296 1.00 0.00 ? 117 GLU D O    1  
ATOM 9374   C CB   . GLU D 1 113 ? 107.831 79.486  109.983 1.00 0.00 ? 117 GLU D CB   1  
ATOM 9375   C CG   . GLU D 1 113 ? 106.392 79.298  109.536 1.00 0.00 ? 117 GLU D CG   1  
ATOM 9376   C CD   . GLU D 1 113 ? 106.276 79.002  108.051 1.00 0.00 ? 117 GLU D CD   1  
ATOM 9377   O OE1  . GLU D 1 113 ? 106.766 79.810  107.238 1.00 0.00 ? 117 GLU D OE1  1  
ATOM 9378   O OE2  . GLU D 1 113 ? 105.700 77.952  107.695 1.00 0.00 ? 117 GLU D OE2  1  
ATOM 9379   H H    . GLU D 1 113 ? 110.440 78.715  110.450 1.00 0.00 ? 117 GLU D H    1  
ATOM 9380   H HA   . GLU D 1 113 ? 107.968 77.667  110.879 1.00 0.00 ? 117 GLU D HA   1  
ATOM 9381   H HB2  . GLU D 1 113 ? 107.844 80.055  110.768 1.00 0.00 ? 117 GLU D HB2  1  
ATOM 9382   H HB3  . GLU D 1 113 ? 108.319 79.952  109.287 1.00 0.00 ? 117 GLU D HB3  1  
ATOM 9383   H HG2  . GLU D 1 113 ? 105.993 78.571  110.040 1.00 0.00 ? 117 GLU D HG2  1  
ATOM 9384   H HG3  . GLU D 1 113 ? 105.886 80.099  109.743 1.00 0.00 ? 117 GLU D HG3  1  
ATOM 9385   N N    . TYR D 1 114 ? 108.150 76.333  108.789 1.00 0.00 ? 118 TYR D N    1  
ATOM 9386   C CA   . TYR D 1 114 ? 108.332 75.567  107.568 1.00 0.00 ? 118 TYR D CA   1  
ATOM 9387   C C    . TYR D 1 114 ? 107.022 75.408  106.820 1.00 0.00 ? 118 TYR D C    1  
ATOM 9388   O O    . TYR D 1 114 ? 106.060 74.832  107.335 1.00 0.00 ? 118 TYR D O    1  
ATOM 9389   C CB   . TYR D 1 114 ? 108.963 74.194  107.828 1.00 0.00 ? 118 TYR D CB   1  
ATOM 9390   C CG   . TYR D 1 114 ? 109.677 73.970  109.124 1.00 0.00 ? 118 TYR D CG   1  
ATOM 9391   C CD1  . TYR D 1 114 ? 111.040 74.201  109.219 1.00 0.00 ? 118 TYR D CD1  1  
ATOM 9392   C CD2  . TYR D 1 114 ? 109.009 73.486  110.234 1.00 0.00 ? 118 TYR D CD2  1  
ATOM 9393   C CE1  . TYR D 1 114 ? 111.715 73.972  110.387 1.00 0.00 ? 118 TYR D CE1  1  
ATOM 9394   C CE2  . TYR D 1 114 ? 109.670 73.272  111.407 1.00 0.00 ? 118 TYR D CE2  1  
ATOM 9395   C CZ   . TYR D 1 114 ? 111.027 73.509  111.478 1.00 0.00 ? 118 TYR D CZ   1  
ATOM 9396   O OH   . TYR D 1 114 ? 111.701 73.285  112.655 1.00 0.00 ? 118 TYR D OH   1  
ATOM 9397   H H    . TYR D 1 114 ? 107.544 76.027  109.317 1.00 0.00 ? 118 TYR D H    1  
ATOM 9398   H HA   . TYR D 1 114 ? 108.950 76.072  107.016 1.00 0.00 ? 118 TYR D HA   1  
ATOM 9399   H HB2  . TYR D 1 114 ? 108.260 73.528  107.760 1.00 0.00 ? 118 TYR D HB2  1  
ATOM 9400   H HB3  . TYR D 1 114 ? 109.591 74.018  107.111 1.00 0.00 ? 118 TYR D HB3  1  
ATOM 9401   H HD1  . TYR D 1 114 ? 111.503 74.517  108.477 1.00 0.00 ? 118 TYR D HD1  1  
ATOM 9402   H HD2  . TYR D 1 114 ? 108.099 73.306  110.179 1.00 0.00 ? 118 TYR D HD2  1  
ATOM 9403   H HE1  . TYR D 1 114 ? 112.630 74.128  110.440 1.00 0.00 ? 118 TYR D HE1  1  
ATOM 9404   H HE2  . TYR D 1 114 ? 109.208 72.968  112.154 1.00 0.00 ? 118 TYR D HE2  1  
ATOM 9405   H HH   . TYR D 1 114 ? 112.529 73.316  112.514 1.00 0.00 ? 118 TYR D HH   1  
ATOM 9406   N N    . SER D 1 115 ? 107.001 75.933  105.602 1.00 0.00 ? 119 SER D N    1  
ATOM 9407   C CA   . SER D 1 115 ? 105.849 75.836  104.726 1.00 0.00 ? 119 SER D CA   1  
ATOM 9408   C C    . SER D 1 115 ? 106.154 74.882  103.585 1.00 0.00 ? 119 SER D C    1  
ATOM 9409   O O    . SER D 1 115 ? 107.207 74.984  102.937 1.00 0.00 ? 119 SER D O    1  
ATOM 9410   C CB   . SER D 1 115 ? 105.458 77.200  104.167 1.00 0.00 ? 119 SER D CB   1  
ATOM 9411   O OG   . SER D 1 115 ? 104.119 77.503  104.517 1.00 0.00 ? 119 SER D OG   1  
ATOM 9412   H H    . SER D 1 115 ? 107.664 76.360  105.260 1.00 0.00 ? 119 SER D H    1  
ATOM 9413   H HA   . SER D 1 115 ? 105.103 75.499  105.246 1.00 0.00 ? 119 SER D HA   1  
ATOM 9414   H HB2  . SER D 1 115 ? 106.053 77.883  104.515 1.00 0.00 ? 119 SER D HB2  1  
ATOM 9415   H HB3  . SER D 1 115 ? 105.556 77.203  103.202 1.00 0.00 ? 119 SER D HB3  1  
ATOM 9416   H HG   . SER D 1 115 ? 103.827 78.108  104.013 1.00 0.00 ? 119 SER D HG   1  
ATOM 9417   N N    . ASP D 1 116 ? 105.237 73.946  103.375 1.00 0.00 ? 120 ASP D N    1  
ATOM 9418   C CA   . ASP D 1 116 ? 105.179 73.088  102.200 1.00 0.00 ? 120 ASP D CA   1  
ATOM 9419   C C    . ASP D 1 116 ? 103.877 73.431  101.487 1.00 0.00 ? 120 ASP D C    1  
ATOM 9420   O O    . ASP D 1 116 ? 102.792 73.298  102.059 1.00 0.00 ? 120 ASP D O    1  
ATOM 9421   C CB   . ASP D 1 116 ? 105.223 71.615  102.598 1.00 0.00 ? 120 ASP D CB   1  
ATOM 9422   C CG   . ASP D 1 116 ? 105.210 70.676  101.403 1.00 0.00 ? 120 ASP D CG   1  
ATOM 9423   O OD1  . ASP D 1 116 ? 106.155 70.690  100.588 1.00 0.00 ? 120 ASP D OD1  1  
ATOM 9424   O OD2  . ASP D 1 116 ? 104.222 69.931  101.261 1.00 0.00 ? 120 ASP D OD2  1  
ATOM 9425   H H    . ASP D 1 116 ? 104.605 73.787  103.937 1.00 0.00 ? 120 ASP D H    1  
ATOM 9426   H HA   . ASP D 1 116 ? 105.941 73.233  101.619 1.00 0.00 ? 120 ASP D HA   1  
ATOM 9427   H HB2  . ASP D 1 116 ? 106.021 71.451  103.124 1.00 0.00 ? 120 ASP D HB2  1  
ATOM 9428   H HB3  . ASP D 1 116 ? 104.463 71.417  103.167 1.00 0.00 ? 120 ASP D HB3  1  
ATOM 9429   N N    . GLY D 1 117 ? 103.987 73.865  100.237 1.00 0.00 ? 121 GLY D N    1  
ATOM 9430   C CA   . GLY D 1 117 ? 102.825 74.125  99.409  1.00 0.00 ? 121 GLY D CA   1  
ATOM 9431   C C    . GLY D 1 117 ? 102.807 73.243  98.182  1.00 0.00 ? 121 GLY D C    1  
ATOM 9432   O O    . GLY D 1 117 ? 103.822 72.654  97.791  1.00 0.00 ? 121 GLY D O    1  
ATOM 9433   H H    . GLY D 1 117 ? 104.739 74.015  99.848  1.00 0.00 ? 121 GLY D H    1  
ATOM 9434   H HA2  . GLY D 1 117 ? 102.018 73.977  99.927  1.00 0.00 ? 121 GLY D HA2  1  
ATOM 9435   H HA3  . GLY D 1 117 ? 102.821 75.057  99.139  1.00 0.00 ? 121 GLY D HA3  1  
ATOM 9436   N N    . VAL D 1 118 ? 101.638 73.139  97.561  1.00 0.00 ? 122 VAL D N    1  
ATOM 9437   C CA   . VAL D 1 118 ? 101.472 72.386  96.323  1.00 0.00 ? 122 VAL D CA   1  
ATOM 9438   C C    . VAL D 1 118 ? 102.131 73.103  95.152  1.00 0.00 ? 122 VAL D C    1  
ATOM 9439   O O    . VAL D 1 118 ? 102.637 72.464  94.229  1.00 0.00 ? 122 VAL D O    1  
ATOM 9440   C CB   . VAL D 1 118 ? 99.982  72.100  96.040  1.00 0.00 ? 122 VAL D CB   1  
ATOM 9441   C CG1  . VAL D 1 118 ? 99.455  71.124  97.058  1.00 0.00 ? 122 VAL D CG1  1  
ATOM 9442   C CG2  . VAL D 1 118 ? 99.192  73.384  96.077  1.00 0.00 ? 122 VAL D CG2  1  
ATOM 9443   H H    . VAL D 1 118 ? 100.914 73.505  97.848  1.00 0.00 ? 122 VAL D H    1  
ATOM 9444   H HA   . VAL D 1 118 ? 101.917 71.532  96.434  1.00 0.00 ? 122 VAL D HA   1  
ATOM 9445   H HB   . VAL D 1 118 ? 99.892  71.711  95.156  1.00 0.00 ? 122 VAL D HB   1  
ATOM 9446   H HG11 . VAL D 1 118 ? 98.788  71.561  97.610  1.00 0.00 ? 122 VAL D HG11 1  
ATOM 9447   H HG12 . VAL D 1 118 ? 99.054  70.367  96.603  1.00 0.00 ? 122 VAL D HG12 1  
ATOM 9448   H HG13 . VAL D 1 118 ? 100.184 70.815  97.619  1.00 0.00 ? 122 VAL D HG13 1  
ATOM 9449   H HG21 . VAL D 1 118 ? 98.269  73.189  96.302  1.00 0.00 ? 122 VAL D HG21 1  
ATOM 9450   H HG22 . VAL D 1 118 ? 99.569  73.977  96.745  1.00 0.00 ? 122 VAL D HG22 1  
ATOM 9451   H HG23 . VAL D 1 118 ? 99.229  73.812  95.208  1.00 0.00 ? 122 VAL D HG23 1  
ATOM 9452   N N    . GLU D 1 119 ? 102.138 74.435  95.173  1.00 0.00 ? 123 GLU D N    1  
ATOM 9453   C CA   . GLU D 1 119 ? 102.941 75.187  94.221  1.00 0.00 ? 123 GLU D CA   1  
ATOM 9454   C C    . GLU D 1 119 ? 104.288 75.597  94.780  1.00 0.00 ? 123 GLU D C    1  
ATOM 9455   O O    . GLU D 1 119 ? 104.428 75.706  96.002  1.00 0.00 ? 123 GLU D O    1  
ATOM 9456   C CB   . GLU D 1 119 ? 102.205 76.438  93.735  1.00 0.00 ? 123 GLU D CB   1  
ATOM 9457   C CG   . GLU D 1 119 ? 101.401 76.232  92.465  1.00 0.00 ? 123 GLU D CG   1  
ATOM 9458   C CD   . GLU D 1 119 ? 102.115 75.335  91.474  1.00 0.00 ? 123 GLU D CD   1  
ATOM 9459   O OE1  . GLU D 1 119 ? 103.068 75.809  90.826  1.00 0.00 ? 123 GLU D OE1  1  
ATOM 9460   O OE2  . GLU D 1 119 ? 101.747 74.149  91.365  1.00 0.00 ? 123 GLU D OE2  1  
ATOM 9461   H H    . GLU D 1 119 ? 101.687 74.916  95.726  1.00 0.00 ? 123 GLU D H    1  
ATOM 9462   H HA   . GLU D 1 119 ? 103.094 74.585  93.475  1.00 0.00 ? 123 GLU D HA   1  
ATOM 9463   H HB2  . GLU D 1 119 ? 101.609 76.744  94.437  1.00 0.00 ? 123 GLU D HB2  1  
ATOM 9464   H HB3  . GLU D 1 119 ? 102.852 77.145  93.586  1.00 0.00 ? 123 GLU D HB3  1  
ATOM 9465   H HG2  . GLU D 1 119 ? 100.541 75.844  92.689  1.00 0.00 ? 123 GLU D HG2  1  
ATOM 9466   H HG3  . GLU D 1 119 ? 101.226 77.092  92.052  1.00 0.00 ? 123 GLU D HG3  1  
ATOM 9467   N N    . GLY D 1 120 ? 105.279 75.814  93.922  1.00 0.00 ? 124 GLY D N    1  
ATOM 9468   C CA   . GLY D 1 120 ? 106.494 76.472  94.347  1.00 0.00 ? 124 GLY D CA   1  
ATOM 9469   C C    . GLY D 1 120 ? 107.370 75.468  95.060  1.00 0.00 ? 124 GLY D C    1  
ATOM 9470   O O    . GLY D 1 120 ? 107.326 74.268  94.744  1.00 0.00 ? 124 GLY D O    1  
ATOM 9471   H H    . GLY D 1 120 ? 105.263 75.587  93.093  1.00 0.00 ? 124 GLY D H    1  
ATOM 9472   H HA2  . GLY D 1 120 ? 106.961 76.841  93.581  1.00 0.00 ? 124 GLY D HA2  1  
ATOM 9473   H HA3  . GLY D 1 120 ? 106.286 77.214  94.935  1.00 0.00 ? 124 GLY D HA3  1  
ATOM 9474   N N    . ALA D 1 121 ? 108.199 75.938  95.991  1.00 0.00 ? 125 ALA D N    1  
ATOM 9475   C CA   . ALA D 1 121 ? 109.122 75.063  96.697  1.00 0.00 ? 125 ALA D CA   1  
ATOM 9476   C C    . ALA D 1 121 ? 109.167 75.410  98.183  1.00 0.00 ? 125 ALA D C    1  
ATOM 9477   O O    . ALA D 1 121 ? 108.732 76.486  98.610  1.00 0.00 ? 125 ALA D O    1  
ATOM 9478   C CB   . ALA D 1 121 ? 110.521 75.151  96.090  1.00 0.00 ? 125 ALA D CB   1  
ATOM 9479   H H    . ALA D 1 121 ? 108.239 76.764  96.226  1.00 0.00 ? 125 ALA D H    1  
ATOM 9480   H HA   . ALA D 1 121 ? 108.803 74.152  96.603  1.00 0.00 ? 125 ALA D HA   1  
ATOM 9481   H HB1  . ALA D 1 121 ? 110.505 75.744  95.324  1.00 0.00 ? 125 ALA D HB1  1  
ATOM 9482   H HB2  . ALA D 1 121 ? 111.140 75.495  96.752  1.00 0.00 ? 125 ALA D HB2  1  
ATOM 9483   H HB3  . ALA D 1 121 ? 110.808 74.268  95.808  1.00 0.00 ? 125 ALA D HB3  1  
ATOM 9484   N N    . VAL D 1 122 ? 109.685 74.464  98.970  1.00 0.00 ? 126 VAL D N    1  
ATOM 9485   C CA   . VAL D 1 122 ? 109.628 74.557  100.423 1.00 0.00 ? 126 VAL D CA   1  
ATOM 9486   C C    . VAL D 1 122 ? 110.197 75.891  100.883 1.00 0.00 ? 126 VAL D C    1  
ATOM 9487   O O    . VAL D 1 122 ? 111.208 76.376  100.354 1.00 0.00 ? 126 VAL D O    1  
ATOM 9488   C CB   . VAL D 1 122 ? 110.367 73.370  101.065 1.00 0.00 ? 126 VAL D CB   1  
ATOM 9489   C CG1  . VAL D 1 122 ? 109.881 72.073  100.465 1.00 0.00 ? 126 VAL D CG1  1  
ATOM 9490   C CG2  . VAL D 1 122 ? 111.865 73.486  100.862 1.00 0.00 ? 126 VAL D CG2  1  
ATOM 9491   H H    . VAL D 1 122 ? 110.076 73.756  98.676  1.00 0.00 ? 126 VAL D H    1  
ATOM 9492   H HA   . VAL D 1 122 ? 108.702 74.514  100.711 1.00 0.00 ? 126 VAL D HA   1  
ATOM 9493   H HB   . VAL D 1 122 ? 110.181 73.382  102.017 1.00 0.00 ? 126 VAL D HB   1  
ATOM 9494   H HG11 . VAL D 1 122 ? 110.007 71.353  101.104 1.00 0.00 ? 126 VAL D HG11 1  
ATOM 9495   H HG12 . VAL D 1 122 ? 108.939 72.150  100.247 1.00 0.00 ? 126 VAL D HG12 1  
ATOM 9496   H HG13 . VAL D 1 122 ? 110.384 71.880  99.658  1.00 0.00 ? 126 VAL D HG13 1  
ATOM 9497   H HG21 . VAL D 1 122 ? 112.070 73.420  99.916  1.00 0.00 ? 126 VAL D HG21 1  
ATOM 9498   H HG22 . VAL D 1 122 ? 112.172 74.342  101.200 1.00 0.00 ? 126 VAL D HG22 1  
ATOM 9499   H HG23 . VAL D 1 122 ? 112.313 72.771  101.340 1.00 0.00 ? 126 VAL D HG23 1  
ATOM 9500   N N    . GLU D 1 123 ? 109.510 76.531  101.824 1.00 0.00 ? 127 GLU D N    1  
ATOM 9501   C CA   . GLU D 1 123 ? 109.923 77.855  102.275 1.00 0.00 ? 127 GLU D CA   1  
ATOM 9502   C C    . GLU D 1 123 ? 110.061 77.872  103.787 1.00 0.00 ? 127 GLU D C    1  
ATOM 9503   O O    . GLU D 1 123 ? 109.149 77.458  104.509 1.00 0.00 ? 127 GLU D O    1  
ATOM 9504   C CB   . GLU D 1 123 ? 108.959 78.941  101.773 1.00 0.00 ? 127 GLU D CB   1  
ATOM 9505   C CG   . GLU D 1 123 ? 109.555 80.301  101.441 1.00 0.00 ? 127 GLU D CG   1  
ATOM 9506   C CD   . GLU D 1 123 ? 109.916 81.087  102.684 1.00 0.00 ? 127 GLU D CD   1  
ATOM 9507   O OE1  . GLU D 1 123 ? 110.982 81.736  102.683 1.00 0.00 ? 127 GLU D OE1  1  
ATOM 9508   O OE2  . GLU D 1 123 ? 109.129 81.077  103.653 1.00 0.00 ? 127 GLU D OE2  1  
ATOM 9509   H H    . GLU D 1 123 ? 108.808 76.219  102.211 1.00 0.00 ? 127 GLU D H    1  
ATOM 9510   H HA   . GLU D 1 123 ? 110.792 78.057  101.894 1.00 0.00 ? 127 GLU D HA   1  
ATOM 9511   H HB2  . GLU D 1 123 ? 108.515 78.606  100.979 1.00 0.00 ? 127 GLU D HB2  1  
ATOM 9512   H HB3  . GLU D 1 123 ? 108.274 79.070  102.447 1.00 0.00 ? 127 GLU D HB3  1  
ATOM 9513   H HG2  . GLU D 1 123 ? 110.347 80.181  100.894 1.00 0.00 ? 127 GLU D HG2  1  
ATOM 9514   H HG3  . GLU D 1 123 ? 108.920 80.809  100.912 1.00 0.00 ? 127 GLU D HG3  1  
ATOM 9515   N N    . ILE D 1 124 ? 111.211 78.331  104.260 1.00 0.00 ? 128 ILE D N    1  
ATOM 9516   C CA   . ILE D 1 124 ? 111.498 78.389  105.683 1.00 0.00 ? 128 ILE D CA   1  
ATOM 9517   C C    . ILE D 1 124 ? 111.508 79.844  106.120 1.00 0.00 ? 128 ILE D C    1  
ATOM 9518   O O    . ILE D 1 124 ? 112.193 80.682  105.521 1.00 0.00 ? 128 ILE D O    1  
ATOM 9519   C CB   . ILE D 1 124 ? 112.828 77.699  106.016 1.00 0.00 ? 128 ILE D CB   1  
ATOM 9520   C CG1  . ILE D 1 124 ? 112.942 76.381  105.256 1.00 0.00 ? 128 ILE D CG1  1  
ATOM 9521   C CG2  . ILE D 1 124 ? 112.909 77.423  107.499 1.00 0.00 ? 128 ILE D CG2  1  
ATOM 9522   C CD1  . ILE D 1 124 ? 114.347 75.786  105.207 1.00 0.00 ? 128 ILE D CD1  1  
ATOM 9523   H H    . ILE D 1 124 ? 111.850 78.620  103.761 1.00 0.00 ? 128 ILE D H    1  
ATOM 9524   H HA   . ILE D 1 124 ? 110.808 77.910  106.168 1.00 0.00 ? 128 ILE D HA   1  
ATOM 9525   H HB   . ILE D 1 124 ? 113.554 78.287  105.754 1.00 0.00 ? 128 ILE D HB   1  
ATOM 9526   H HG12 . ILE D 1 124 ? 112.345 75.733  105.665 1.00 0.00 ? 128 ILE D HG12 1  
ATOM 9527   H HG13 . ILE D 1 124 ? 112.631 76.518  104.347 1.00 0.00 ? 128 ILE D HG13 1  
ATOM 9528   H HG21 . ILE D 1 124 ? 113.631 77.942  107.886 1.00 0.00 ? 128 ILE D HG21 1  
ATOM 9529   H HG22 . ILE D 1 124 ? 112.072 77.671  107.921 1.00 0.00 ? 128 ILE D HG22 1  
ATOM 9530   H HG23 . ILE D 1 124 ? 113.077 76.480  107.644 1.00 0.00 ? 128 ILE D HG23 1  
ATOM 9531   H HD11 . ILE D 1 124 ? 114.945 76.404  104.757 1.00 0.00 ? 128 ILE D HD11 1  
ATOM 9532   H HD12 . ILE D 1 124 ? 114.664 75.630  106.110 1.00 0.00 ? 128 ILE D HD12 1  
ATOM 9533   H HD13 . ILE D 1 124 ? 114.327 74.947  104.721 1.00 0.00 ? 128 ILE D HD13 1  
ATOM 9534   N N    . SER D 1 125 ? 110.723 80.142  107.148 1.00 0.00 ? 129 SER D N    1  
ATOM 9535   C CA   . SER D 1 125 ? 110.778 81.414  107.847 1.00 0.00 ? 129 SER D CA   1  
ATOM 9536   C C    . SER D 1 125 ? 111.405 81.176  109.211 1.00 0.00 ? 129 SER D C    1  
ATOM 9537   O O    . SER D 1 125 ? 110.845 80.448  110.032 1.00 0.00 ? 129 SER D O    1  
ATOM 9538   C CB   . SER D 1 125 ? 109.379 82.011  108.001 1.00 0.00 ? 129 SER D CB   1  
ATOM 9539   O OG   . SER D 1 125 ? 109.438 83.416  108.167 1.00 0.00 ? 129 SER D OG   1  
ATOM 9540   H H    . SER D 1 125 ? 110.134 79.600  107.462 1.00 0.00 ? 129 SER D H    1  
ATOM 9541   H HA   . SER D 1 125 ? 111.311 82.046  107.338 1.00 0.00 ? 129 SER D HA   1  
ATOM 9542   H HB2  . SER D 1 125 ? 108.846 81.797  107.220 1.00 0.00 ? 129 SER D HB2  1  
ATOM 9543   H HB3  . SER D 1 125 ? 108.936 81.611  108.765 1.00 0.00 ? 129 SER D HB3  1  
ATOM 9544   H HG   . SER D 1 125 ? 109.199 83.792  107.456 1.00 0.00 ? 129 SER D HG   1  
ATOM 9545   N N    . ILE D 1 126 ? 112.574 81.760  109.445 1.00 0.00 ? 130 ILE D N    1  
ATOM 9546   C CA   . ILE D 1 126 ? 113.243 81.652  110.733 1.00 0.00 ? 130 ILE D CA   1  
ATOM 9547   C C    . ILE D 1 126 ? 113.351 83.041  111.340 1.00 0.00 ? 130 ILE D C    1  
ATOM 9548   O O    . ILE D 1 126 ? 113.813 83.986  110.688 1.00 0.00 ? 130 ILE D O    1  
ATOM 9549   C CB   . ILE D 1 126 ? 114.633 80.986  110.626 1.00 0.00 ? 130 ILE D CB   1  
ATOM 9550   C CG1  . ILE D 1 126 ? 115.722 82.016  110.345 1.00 0.00 ? 130 ILE D CG1  1  
ATOM 9551   C CG2  . ILE D 1 126 ? 114.632 79.922  109.547 1.00 0.00 ? 130 ILE D CG2  1  
ATOM 9552   C CD1  . ILE D 1 126 ? 117.131 81.442  110.190 1.00 0.00 ? 130 ILE D CD1  1  
ATOM 9553   H H    . ILE D 1 126 ? 113.000 82.229  108.864 1.00 0.00 ? 130 ILE D H    1  
ATOM 9554   H HA   . ILE D 1 126 ? 112.714 81.075  111.307 1.00 0.00 ? 130 ILE D HA   1  
ATOM 9555   H HB   . ILE D 1 126 ? 114.826 80.569  111.480 1.00 0.00 ? 130 ILE D HB   1  
ATOM 9556   H HG12 . ILE D 1 126 ? 115.492 82.497  109.534 1.00 0.00 ? 130 ILE D HG12 1  
ATOM 9557   H HG13 . ILE D 1 126 ? 115.729 82.664  111.067 1.00 0.00 ? 130 ILE D HG13 1  
ATOM 9558   H HG21 . ILE D 1 126 ? 114.804 80.334  108.686 1.00 0.00 ? 130 ILE D HG21 1  
ATOM 9559   H HG22 . ILE D 1 126 ? 115.323 79.268  109.736 1.00 0.00 ? 130 ILE D HG22 1  
ATOM 9560   H HG23 . ILE D 1 126 ? 113.767 79.481  109.528 1.00 0.00 ? 130 ILE D HG23 1  
ATOM 9561   H HD11 . ILE D 1 126 ? 117.404 81.025  111.022 1.00 0.00 ? 130 ILE D HD11 1  
ATOM 9562   H HD12 . ILE D 1 126 ? 117.134 80.781  109.481 1.00 0.00 ? 130 ILE D HD12 1  
ATOM 9563   H HD13 . ILE D 1 126 ? 117.749 82.156  109.969 1.00 0.00 ? 130 ILE D HD13 1  
ATOM 9564   N N    . SER D 1 127 ? 112.908 83.161  112.588 1.00 0.00 ? 131 SER D N    1  
ATOM 9565   C CA   . SER D 1 127 ? 112.905 84.418  113.317 1.00 0.00 ? 131 SER D CA   1  
ATOM 9566   C C    . SER D 1 127 ? 113.844 84.323  114.510 1.00 0.00 ? 131 SER D C    1  
ATOM 9567   O O    . SER D 1 127 ? 113.895 83.295  115.197 1.00 0.00 ? 131 SER D O    1  
ATOM 9568   C CB   . SER D 1 127 ? 111.497 84.775  113.788 1.00 0.00 ? 131 SER D CB   1  
ATOM 9569   O OG   . SER D 1 127 ? 110.810 85.521  112.803 1.00 0.00 ? 131 SER D OG   1  
ATOM 9570   H H    . SER D 1 127 ? 112.596 82.499  113.042 1.00 0.00 ? 131 SER D H    1  
ATOM 9571   H HA   . SER D 1 127 ? 113.212 85.119  112.720 1.00 0.00 ? 131 SER D HA   1  
ATOM 9572   H HB2  . SER D 1 127 ? 111.004 83.963  113.987 1.00 0.00 ? 131 SER D HB2  1  
ATOM 9573   H HB3  . SER D 1 127 ? 111.546 85.286  114.611 1.00 0.00 ? 131 SER D HB3  1  
ATOM 9574   H HG   . SER D 1 127 ? 110.941 85.177  112.048 1.00 0.00 ? 131 SER D HG   1  
ATOM 9575   N N    . LEU D 1 128 ? 114.565 85.407  114.762 1.00 0.00 ? 132 LEU D N    1  
ATOM 9576   C CA   . LEU D 1 128 ? 115.615 85.443  115.764 1.00 0.00 ? 132 LEU D CA   1  
ATOM 9577   C C    . LEU D 1 128 ? 115.642 86.801  116.444 1.00 0.00 ? 132 LEU D C    1  
ATOM 9578   O O    . LEU D 1 128 ? 115.345 87.823  115.824 1.00 0.00 ? 132 LEU D O    1  
ATOM 9579   C CB   . LEU D 1 128 ? 116.987 85.170  115.143 1.00 0.00 ? 132 LEU D CB   1  
ATOM 9580   C CG   . LEU D 1 128 ? 117.427 85.906  113.880 1.00 0.00 ? 132 LEU D CG   1  
ATOM 9581   C CD1  . LEU D 1 128 ? 118.349 87.074  114.171 1.00 0.00 ? 132 LEU D CD1  1  
ATOM 9582   C CD2  . LEU D 1 128 ? 118.106 84.917  112.964 1.00 0.00 ? 132 LEU D CD2  1  
ATOM 9583   H H    . LEU D 1 128 ? 114.455 86.153  114.348 1.00 0.00 ? 132 LEU D H    1  
ATOM 9584   H HA   . LEU D 1 128 ? 115.424 84.750  116.416 1.00 0.00 ? 132 LEU D HA   1  
ATOM 9585   H HB2  . LEU D 1 128 ? 117.652 85.350  115.825 1.00 0.00 ? 132 LEU D HB2  1  
ATOM 9586   H HB3  . LEU D 1 128 ? 117.029 84.220  114.949 1.00 0.00 ? 132 LEU D HB3  1  
ATOM 9587   H HG   . LEU D 1 128 ? 116.639 86.283  113.458 1.00 0.00 ? 132 LEU D HG   1  
ATOM 9588   H HD11 . LEU D 1 128 ? 119.153 86.992  113.635 1.00 0.00 ? 132 LEU D HD11 1  
ATOM 9589   H HD12 . LEU D 1 128 ? 117.898 87.904  113.952 1.00 0.00 ? 132 LEU D HD12 1  
ATOM 9590   H HD13 . LEU D 1 128 ? 118.586 87.073  115.111 1.00 0.00 ? 132 LEU D HD13 1  
ATOM 9591   H HD21 . LEU D 1 128 ? 117.590 84.096  112.935 1.00 0.00 ? 132 LEU D HD21 1  
ATOM 9592   H HD22 . LEU D 1 128 ? 118.167 85.291  112.071 1.00 0.00 ? 132 LEU D HD22 1  
ATOM 9593   H HD23 . LEU D 1 128 ? 118.997 84.727  113.296 1.00 0.00 ? 132 LEU D HD23 1  
ATOM 9594   N N    . GLN D 1 129 ? 116.004 86.806  117.720 1.00 0.00 ? 133 GLN D N    1  
ATOM 9595   C CA   . GLN D 1 129 ? 116.333 88.030  118.432 1.00 0.00 ? 133 GLN D CA   1  
ATOM 9596   C C    . GLN D 1 129 ? 117.844 88.099  118.538 1.00 0.00 ? 133 GLN D C    1  
ATOM 9597   O O    . GLN D 1 129 ? 118.526 87.083  118.363 1.00 0.00 ? 133 GLN D O    1  
ATOM 9598   C CB   . GLN D 1 129 ? 115.702 88.057  119.820 1.00 0.00 ? 133 GLN D CB   1  
ATOM 9599   C CG   . GLN D 1 129 ? 114.759 89.198  120.023 1.00 0.00 ? 133 GLN D CG   1  
ATOM 9600   C CD   . GLN D 1 129 ? 115.148 90.029  121.205 1.00 0.00 ? 133 GLN D CD   1  
ATOM 9601   O OE1  . GLN D 1 129 ? 114.343 90.254  122.101 1.00 0.00 ? 133 GLN D OE1  1  
ATOM 9602   N NE2  . GLN D 1 129 ? 116.376 90.526  121.202 1.00 0.00 ? 133 GLN D NE2  1  
ATOM 9603   H H    . GLN D 1 129 ? 116.064 86.095  118.200 1.00 0.00 ? 133 GLN D H    1  
ATOM 9604   H HA   . GLN D 1 129 ? 115.984 88.795  117.950 1.00 0.00 ? 133 GLN D HA   1  
ATOM 9605   H HB2  . GLN D 1 129 ? 115.227 87.224  119.968 1.00 0.00 ? 133 GLN D HB2  1  
ATOM 9606   H HB3  . GLN D 1 129 ? 116.405 88.106  120.487 1.00 0.00 ? 133 GLN D HB3  1  
ATOM 9607   H HG2  . GLN D 1 129 ? 114.745 89.753  119.227 1.00 0.00 ? 133 GLN D HG2  1  
ATOM 9608   H HG3  . GLN D 1 129 ? 113.859 88.858  120.147 1.00 0.00 ? 133 GLN D HG3  1  
ATOM 9609   H HE21 . GLN D 1 129 ? 116.912 90.345  120.554 1.00 0.00 ? 133 GLN D HE21 1  
ATOM 9610   H HE22 . GLN D 1 129 ? 116.637 91.030  121.847 1.00 0.00 ? 133 GLN D HE22 1  
ATOM 9611   N N    . VAL D 1 130 ? 118.373 89.288  118.797 1.00 0.00 ? 134 VAL D N    1  
ATOM 9612   C CA   . VAL D 1 130 ? 119.804 89.440  119.015 1.00 0.00 ? 134 VAL D CA   1  
ATOM 9613   C C    . VAL D 1 130 ? 119.998 90.435  120.152 1.00 0.00 ? 134 VAL D C    1  
ATOM 9614   O O    . VAL D 1 130 ? 119.079 91.186  120.501 1.00 0.00 ? 134 VAL D O    1  
ATOM 9615   C CB   . VAL D 1 130 ? 120.540 89.845  117.717 1.00 0.00 ? 134 VAL D CB   1  
ATOM 9616   C CG1  . VAL D 1 130 ? 122.021 90.028  117.928 1.00 0.00 ? 134 VAL D CG1  1  
ATOM 9617   C CG2  . VAL D 1 130 ? 120.251 88.869  116.582 1.00 0.00 ? 134 VAL D CG2  1  
ATOM 9618   H H    . VAL D 1 130 ? 117.922 90.018  118.849 1.00 0.00 ? 134 VAL D H    1  
ATOM 9619   H HA   . VAL D 1 130 ? 120.201 88.593  119.268 1.00 0.00 ? 134 VAL D HA   1  
ATOM 9620   H HB   . VAL D 1 130 ? 120.189 90.710  117.457 1.00 0.00 ? 134 VAL D HB   1  
ATOM 9621   H HG11 . VAL D 1 130 ? 122.415 90.419  117.132 1.00 0.00 ? 134 VAL D HG11 1  
ATOM 9622   H HG12 . VAL D 1 130 ? 122.170 90.618  118.684 1.00 0.00 ? 134 VAL D HG12 1  
ATOM 9623   H HG13 . VAL D 1 130 ? 122.432 89.167  118.104 1.00 0.00 ? 134 VAL D HG13 1  
ATOM 9624   H HG21 . VAL D 1 130 ? 119.292 88.806  116.446 1.00 0.00 ? 134 VAL D HG21 1  
ATOM 9625   H HG22 . VAL D 1 130 ? 120.673 89.185  115.768 1.00 0.00 ? 134 VAL D HG22 1  
ATOM 9626   H HG23 . VAL D 1 130 ? 120.603 87.994  116.810 1.00 0.00 ? 134 VAL D HG23 1  
ATOM 9627   N N    . ILE D 1 131 ? 121.171 90.381  120.784 1.00 0.00 ? 135 ILE D N    1  
ATOM 9628   C CA   . ILE D 1 131 ? 121.415 91.187  121.977 1.00 0.00 ? 135 ILE D CA   1  
ATOM 9629   C C    . ILE D 1 131 ? 122.240 92.416  121.624 1.00 0.00 ? 135 ILE D C    1  
ATOM 9630   O O    . ILE D 1 131 ? 122.948 92.978  122.468 1.00 0.00 ? 135 ILE D O    1  
ATOM 9631   C CB   . ILE D 1 131 ? 122.107 90.346  123.060 1.00 0.00 ? 135 ILE D CB   1  
ATOM 9632   C CG1  . ILE D 1 131 ? 123.223 89.496  122.446 1.00 0.00 ? 135 ILE D CG1  1  
ATOM 9633   C CG2  . ILE D 1 131 ? 121.090 89.481  123.778 1.00 0.00 ? 135 ILE D CG2  1  
ATOM 9634   C CD1  . ILE D 1 131 ? 124.309 88.936  123.407 1.00 0.00 ? 135 ILE D CD1  1  
ATOM 9635   H H    . ILE D 1 131 ? 121.832 89.888  120.539 1.00 0.00 ? 135 ILE D H    1  
ATOM 9636   H HA   . ILE D 1 131 ? 120.564 91.489  122.330 1.00 0.00 ? 135 ILE D HA   1  
ATOM 9637   H HB   . ILE D 1 131 ? 122.511 90.941  123.712 1.00 0.00 ? 135 ILE D HB   1  
ATOM 9638   H HG12 . ILE D 1 131 ? 122.811 88.745  121.990 1.00 0.00 ? 135 ILE D HG12 1  
ATOM 9639   H HG13 . ILE D 1 131 ? 123.668 90.029  121.770 1.00 0.00 ? 135 ILE D HG13 1  
ATOM 9640   H HG21 . ILE D 1 131 ? 121.549 88.783  124.271 1.00 0.00 ? 135 ILE D HG21 1  
ATOM 9641   H HG22 . ILE D 1 131 ? 120.576 90.027  124.393 1.00 0.00 ? 135 ILE D HG22 1  
ATOM 9642   H HG23 . ILE D 1 131 ? 120.492 89.078  123.128 1.00 0.00 ? 135 ILE D HG23 1  
ATOM 9643   H HD11 . ILE D 1 131 ? 123.882 88.509  124.165 1.00 0.00 ? 135 ILE D HD11 1  
ATOM 9644   H HD12 . ILE D 1 131 ? 124.855 88.287  122.936 1.00 0.00 ? 135 ILE D HD12 1  
ATOM 9645   H HD13 . ILE D 1 131 ? 124.870 89.663  123.721 1.00 0.00 ? 135 ILE D HD13 1  
ATOM 9646   N N    . GLY D 1 132 ? 122.148 92.860  120.379 1.00 0.00 ? 136 GLY D N    1  
ATOM 9647   C CA   . GLY D 1 132 ? 122.857 94.045  119.959 1.00 0.00 ? 136 GLY D CA   1  
ATOM 9648   C C    . GLY D 1 132 ? 123.787 93.760  118.804 1.00 0.00 ? 136 GLY D C    1  
ATOM 9649   O O    . GLY D 1 132 ? 124.928 93.333  119.011 1.00 0.00 ? 136 GLY D O    1  
ATOM 9650   H H    . GLY D 1 132 ? 121.677 92.485  119.764 1.00 0.00 ? 136 GLY D H    1  
ATOM 9651   H HA2  . GLY D 1 132 ? 122.220 94.730  119.701 1.00 0.00 ? 136 GLY D HA2  1  
ATOM 9652   H HA3  . GLY D 1 132 ? 123.367 94.399  120.705 1.00 0.00 ? 136 GLY D HA3  1  
ATOM 9653   N N    . GLU D 1 133 ? 123.302 93.966  117.584 1.00 0.00 ? 137 GLU D N    1  
ATOM 9654   C CA   . GLU D 1 133 ? 124.148 93.846  116.409 1.00 0.00 ? 137 GLU D CA   1  
ATOM 9655   C C    . GLU D 1 133 ? 124.949 95.124  116.191 1.00 0.00 ? 137 GLU D C    1  
ATOM 9656   O O    . GLU D 1 133 ? 124.446 96.242  116.325 1.00 0.00 ? 137 GLU D O    1  
ATOM 9657   C CB   . GLU D 1 133 ? 123.308 93.530  115.176 1.00 0.00 ? 137 GLU D CB   1  
ATOM 9658   C CG   . GLU D 1 133 ? 122.982 92.070  115.017 1.00 0.00 ? 137 GLU D CG   1  
ATOM 9659   C CD   . GLU D 1 133 ? 122.193 91.797  113.753 1.00 0.00 ? 137 GLU D CD   1  
ATOM 9660   O OE1  . GLU D 1 133 ? 122.810 91.748  112.667 1.00 0.00 ? 137 GLU D OE1  1  
ATOM 9661   O OE2  . GLU D 1 133 ? 120.963 91.641  113.838 1.00 0.00 ? 137 GLU D OE2  1  
ATOM 9662   H H    . GLU D 1 133 ? 122.484 94.176  117.418 1.00 0.00 ? 137 GLU D H    1  
ATOM 9663   H HA   . GLU D 1 133 ? 124.769 93.115  116.557 1.00 0.00 ? 137 GLU D HA   1  
ATOM 9664   H HB2  . GLU D 1 133 ? 122.481 94.033  115.220 1.00 0.00 ? 137 GLU D HB2  1  
ATOM 9665   H HB3  . GLU D 1 133 ? 123.783 93.833  114.386 1.00 0.00 ? 137 GLU D HB3  1  
ATOM 9666   H HG2  . GLU D 1 133 ? 123.805 91.555  115.001 1.00 0.00 ? 137 GLU D HG2  1  
ATOM 9667   H HG3  . GLU D 1 133 ? 122.474 91.768  115.786 1.00 0.00 ? 137 GLU D HG3  1  
ATOM 9668   N N    . LEU D 1 134 ? 126.222 94.941  115.859 1.00 0.00 ? 138 LEU D N    1  
ATOM 9669   C CA   . LEU D 1 134 ? 127.144 96.060  115.724 1.00 0.00 ? 138 LEU D CA   1  
ATOM 9670   C C    . LEU D 1 134 ? 127.649 96.082  114.293 1.00 0.00 ? 138 LEU D C    1  
ATOM 9671   O O    . LEU D 1 134 ? 127.645 95.052  113.613 1.00 0.00 ? 138 LEU D O    1  
ATOM 9672   C CB   . LEU D 1 134 ? 128.299 95.938  116.722 1.00 0.00 ? 138 LEU D CB   1  
ATOM 9673   C CG   . LEU D 1 134 ? 128.170 94.965  117.898 1.00 0.00 ? 138 LEU D CG   1  
ATOM 9674   C CD1  . LEU D 1 134 ? 129.478 94.234  118.130 1.00 0.00 ? 138 LEU D CD1  1  
ATOM 9675   C CD2  . LEU D 1 134 ? 127.753 95.710  119.158 1.00 0.00 ? 138 LEU D CD2  1  
ATOM 9676   H H    . LEU D 1 134 ? 126.574 94.171  115.708 1.00 0.00 ? 138 LEU D H    1  
ATOM 9677   H HA   . LEU D 1 134 ? 126.690 96.894  115.922 1.00 0.00 ? 138 LEU D HA   1  
ATOM 9678   H HB2  . LEU D 1 134 ? 129.092 95.688  116.221 1.00 0.00 ? 138 LEU D HB2  1  
ATOM 9679   H HB3  . LEU D 1 134 ? 128.461 96.820  117.089 1.00 0.00 ? 138 LEU D HB3  1  
ATOM 9680   H HG   . LEU D 1 134 ? 127.487 94.312  117.681 1.00 0.00 ? 138 LEU D HG   1  
ATOM 9681   H HD11 . LEU D 1 134 ? 129.517 93.924  119.048 1.00 0.00 ? 138 LEU D HD11 1  
ATOM 9682   H HD12 . LEU D 1 134 ? 129.535 93.474  117.531 1.00 0.00 ? 138 LEU D HD12 1  
ATOM 9683   H HD13 . LEU D 1 134 ? 130.220 94.835  117.961 1.00 0.00 ? 138 LEU D HD13 1  
ATOM 9684   H HD21 . LEU D 1 134 ? 127.179 96.456  118.919 1.00 0.00 ? 138 LEU D HD21 1  
ATOM 9685   H HD22 . LEU D 1 134 ? 127.271 95.108  119.745 1.00 0.00 ? 138 LEU D HD22 1  
ATOM 9686   H HD23 . LEU D 1 134 ? 128.542 96.043  119.614 1.00 0.00 ? 138 LEU D HD23 1  
ATOM 9687   N N    . LYS D 1 135 ? 128.061 97.261  113.837 1.00 0.00 ? 139 LYS D N    1  
ATOM 9688   C CA   . LYS D 1 135 ? 128.529 97.448  112.470 1.00 0.00 ? 139 LYS D CA   1  
ATOM 9689   C C    . LYS D 1 135 ? 130.052 97.459  112.460 1.00 0.00 ? 139 LYS D C    1  
ATOM 9690   O O    . LYS D 1 135 ? 130.680 98.035  113.353 1.00 0.00 ? 139 LYS D O    1  
ATOM 9691   C CB   . LYS D 1 135 ? 127.972 98.746  111.901 1.00 0.00 ? 139 LYS D CB   1  
ATOM 9692   C CG   . LYS D 1 135 ? 126.853 98.551  110.901 1.00 0.00 ? 139 LYS D CG   1  
ATOM 9693   C CD   . LYS D 1 135 ? 125.524 99.006  111.475 1.00 0.00 ? 139 LYS D CD   1  
ATOM 9694   C CE   . LYS D 1 135 ? 124.352 98.413  110.706 1.00 0.00 ? 139 LYS D CE   1  
ATOM 9695   N NZ   . LYS D 1 135 ? 123.120 99.243  110.776 1.00 0.00 ? 139 LYS D NZ   1  
ATOM 9696   H H    . LYS D 1 135 ? 128.078 97.977  114.315 1.00 0.00 ? 139 LYS D H    1  
ATOM 9697   H HA   . LYS D 1 135 ? 128.217 96.718  111.913 1.00 0.00 ? 139 LYS D HA   1  
ATOM 9698   H HB2  . LYS D 1 135 ? 127.647 99.296  112.632 1.00 0.00 ? 139 LYS D HB2  1  
ATOM 9699   H HB3  . LYS D 1 135 ? 128.692 99.237  111.475 1.00 0.00 ? 139 LYS D HB3  1  
ATOM 9700   H HG2  . LYS D 1 135 ? 127.047 99.050  110.092 1.00 0.00 ? 139 LYS D HG2  1  
ATOM 9701   H HG3  . LYS D 1 135 ? 126.798 97.615  110.651 1.00 0.00 ? 139 LYS D HG3  1  
ATOM 9702   H HD2  . LYS D 1 135 ? 125.467 98.744  112.408 1.00 0.00 ? 139 LYS D HD2  1  
ATOM 9703   H HD3  . LYS D 1 135 ? 125.473 99.974  111.449 1.00 0.00 ? 139 LYS D HD3  1  
ATOM 9704   H HE2  . LYS D 1 135 ? 124.607 98.301  109.777 1.00 0.00 ? 139 LYS D HE2  1  
ATOM 9705   H HE3  . LYS D 1 135 ? 124.159 97.529  111.055 1.00 0.00 ? 139 LYS D HE3  1  
ATOM 9706   H HZ1  . LYS D 1 135 ? 122.834 99.421  109.952 1.00 0.00 ? 139 LYS D HZ1  1  
ATOM 9707   H HZ2  . LYS D 1 135 ? 122.488 98.799  111.220 1.00 0.00 ? 139 LYS D HZ2  1  
ATOM 9708   H HZ3  . LYS D 1 135 ? 123.298 100.005 111.199 1.00 0.00 ? 139 LYS D HZ3  1  
ATOM 9709   N N    . ASN D 1 136 ? 130.651 96.833  111.451 1.00 0.00 ? 140 ASN D N    1  
ATOM 9710   C CA   . ASN D 1 136 ? 132.099 96.825  111.291 1.00 0.00 ? 140 ASN D CA   1  
ATOM 9711   C C    . ASN D 1 136 ? 132.435 96.623  109.824 1.00 0.00 ? 140 ASN D C    1  
ATOM 9712   O O    . ASN D 1 136 ? 131.549 96.692  108.967 1.00 0.00 ? 140 ASN D O    1  
ATOM 9713   C CB   . ASN D 1 136 ? 132.758 95.733  112.141 1.00 0.00 ? 140 ASN D CB   1  
ATOM 9714   C CG   . ASN D 1 136 ? 131.956 94.452  112.169 1.00 0.00 ? 140 ASN D CG   1  
ATOM 9715   O OD1  . ASN D 1 136 ? 131.075 94.278  113.007 1.00 0.00 ? 140 ASN D OD1  1  
ATOM 9716   N ND2  . ASN D 1 136 ? 132.279 93.533  111.270 1.00 0.00 ? 140 ASN D ND2  1  
ATOM 9717   H H    . ASN D 1 136 ? 130.227 96.401  110.839 1.00 0.00 ? 140 ASN D H    1  
ATOM 9718   H HA   . ASN D 1 136 ? 132.447 97.677  111.597 1.00 0.00 ? 140 ASN D HA   1  
ATOM 9719   H HB2  . ASN D 1 136 ? 133.645 95.549  111.794 1.00 0.00 ? 140 ASN D HB2  1  
ATOM 9720   H HB3  . ASN D 1 136 ? 132.871 96.059  113.048 1.00 0.00 ? 140 ASN D HB3  1  
ATOM 9721   H HD21 . ASN D 1 136 ? 131.865 92.780  111.259 1.00 0.00 ? 140 ASN D HD21 1  
ATOM 9722   H HD22 . ASN D 1 136 ? 132.902 93.691  110.699 1.00 0.00 ? 140 ASN D HD22 1  
ATOM 9723   N N    . GLY D 1 137 ? 133.712 96.384  109.539 1.00 0.00 ? 141 GLY D N    1  
ATOM 9724   C CA   . GLY D 1 137 ? 134.095 95.965  108.208 1.00 0.00 ? 141 GLY D CA   1  
ATOM 9725   C C    . GLY D 1 137 ? 134.331 94.468  108.145 1.00 0.00 ? 141 GLY D C    1  
ATOM 9726   O O    . GLY D 1 137 ? 134.871 93.856  109.066 1.00 0.00 ? 141 GLY D O    1  
ATOM 9727   H H    . GLY D 1 137 ? 134.361 96.459  110.099 1.00 0.00 ? 141 GLY D H    1  
ATOM 9728   H HA2  . GLY D 1 137 ? 133.401 96.212  107.577 1.00 0.00 ? 141 GLY D HA2  1  
ATOM 9729   H HA3  . GLY D 1 137 ? 134.902 96.433  107.939 1.00 0.00 ? 141 GLY D HA3  1  
ATOM 9730   N N    . GLU D 1 138 ? 133.917 93.873  107.032 1.00 0.00 ? 142 GLU D N    1  
ATOM 9731   C CA   . GLU D 1 138 ? 133.972 92.427  106.881 1.00 0.00 ? 142 GLU D CA   1  
ATOM 9732   C C    . GLU D 1 138 ? 135.365 92.026  106.423 1.00 0.00 ? 142 GLU D C    1  
ATOM 9733   O O    . GLU D 1 138 ? 135.884 92.559  105.439 1.00 0.00 ? 142 GLU D O    1  
ATOM 9734   C CB   . GLU D 1 138 ? 132.891 91.945  105.903 1.00 0.00 ? 142 GLU D CB   1  
ATOM 9735   C CG   . GLU D 1 138 ? 133.140 90.558  105.326 1.00 0.00 ? 142 GLU D CG   1  
ATOM 9736   C CD   . GLU D 1 138 ? 132.998 89.465  106.350 1.00 0.00 ? 142 GLU D CD   1  
ATOM 9737   O OE1  . GLU D 1 138 ? 132.715 88.322  105.945 1.00 0.00 ? 142 GLU D OE1  1  
ATOM 9738   O OE2  . GLU D 1 138 ? 133.153 89.751  107.555 1.00 0.00 ? 142 GLU D OE2  1  
ATOM 9739   H H    . GLU D 1 138 ? 133.601 94.292  106.351 1.00 0.00 ? 142 GLU D H    1  
ATOM 9740   H HA   . GLU D 1 138 ? 133.793 92.002  107.735 1.00 0.00 ? 142 GLU D HA   1  
ATOM 9741   H HB2  . GLU D 1 138 ? 132.035 91.946  106.359 1.00 0.00 ? 142 GLU D HB2  1  
ATOM 9742   H HB3  . GLU D 1 138 ? 132.824 92.581  105.174 1.00 0.00 ? 142 GLU D HB3  1  
ATOM 9743   H HG2  . GLU D 1 138 ? 132.517 90.398  104.600 1.00 0.00 ? 142 GLU D HG2  1  
ATOM 9744   H HG3  . GLU D 1 138 ? 134.031 90.526  104.946 1.00 0.00 ? 142 GLU D HG3  1  
ATOM 9745   N N    . ILE D 1 139 ? 135.960 91.077  107.143 1.00 0.00 ? 143 ILE D N    1  
ATOM 9746   C CA   . ILE D 1 139 ? 137.326 90.660  106.852 1.00 0.00 ? 143 ILE D CA   1  
ATOM 9747   C C    . ILE D 1 139 ? 137.337 89.483  105.883 1.00 0.00 ? 143 ILE D C    1  
ATOM 9748   O O    . ILE D 1 139 ? 138.104 89.476  104.914 1.00 0.00 ? 143 ILE D O    1  
ATOM 9749   C CB   . ILE D 1 139 ? 138.086 90.317  108.148 1.00 0.00 ? 143 ILE D CB   1  
ATOM 9750   C CG1  . ILE D 1 139 ? 137.478 91.054  109.342 1.00 0.00 ? 143 ILE D CG1  1  
ATOM 9751   C CG2  . ILE D 1 139 ? 139.555 90.676  108.012 1.00 0.00 ? 143 ILE D CG2  1  
ATOM 9752   C CD1  . ILE D 1 139 ? 136.324 90.343  110.025 1.00 0.00 ? 143 ILE D CD1  1  
ATOM 9753   H H    . ILE D 1 139 ? 135.591 90.665  107.801 1.00 0.00 ? 143 ILE D H    1  
ATOM 9754   H HA   . ILE D 1 139 ? 137.784 91.403  106.428 1.00 0.00 ? 143 ILE D HA   1  
ATOM 9755   H HB   . ILE D 1 139 ? 138.008 89.362  108.299 1.00 0.00 ? 143 ILE D HB   1  
ATOM 9756   H HG12 . ILE D 1 139 ? 138.176 91.209  109.997 1.00 0.00 ? 143 ILE D HG12 1  
ATOM 9757   H HG13 . ILE D 1 139 ? 137.171 91.925  109.044 1.00 0.00 ? 143 ILE D HG13 1  
ATOM 9758   H HG21 . ILE D 1 139 ? 139.649 91.430  107.407 1.00 0.00 ? 143 ILE D HG21 1  
ATOM 9759   H HG22 . ILE D 1 139 ? 139.912 90.914  108.881 1.00 0.00 ? 143 ILE D HG22 1  
ATOM 9760   H HG23 . ILE D 1 139 ? 140.043 89.916  107.659 1.00 0.00 ? 143 ILE D HG23 1  
ATOM 9761   H HD11 . ILE D 1 139 ? 136.483 90.314  110.981 1.00 0.00 ? 143 ILE D HD11 1  
ATOM 9762   H HD12 . ILE D 1 139 ? 135.499 90.821  109.847 1.00 0.00 ? 143 ILE D HD12 1  
ATOM 9763   H HD13 . ILE D 1 139 ? 136.253 89.438  109.682 1.00 0.00 ? 143 ILE D HD13 1  
ATOM 9764   N N    . ASP D 1 140 ? 136.481 88.491  106.113 1.00 0.00 ? 144 ASP D N    1  
ATOM 9765   C CA   . ASP D 1 140 ? 136.487 87.305  105.268 1.00 0.00 ? 144 ASP D CA   1  
ATOM 9766   C C    . ASP D 1 140 ? 135.611 87.507  104.039 1.00 0.00 ? 144 ASP D C    1  
ATOM 9767   O O    . ASP D 1 140 ? 134.386 87.606  104.137 1.00 0.00 ? 144 ASP D O    1  
ATOM 9768   C CB   . ASP D 1 140 ? 136.032 86.069  106.048 1.00 0.00 ? 144 ASP D CB   1  
ATOM 9769   C CG   . ASP D 1 140 ? 137.180 85.320  106.702 1.00 0.00 ? 144 ASP D CG   1  
ATOM 9770   O OD1  . ASP D 1 140 ? 138.288 85.881  106.825 1.00 0.00 ? 144 ASP D OD1  1  
ATOM 9771   O OD2  . ASP D 1 140 ? 136.962 84.164  107.119 1.00 0.00 ? 144 ASP D OD2  1  
ATOM 9772   H H    . ASP D 1 140 ? 135.897 88.486  106.744 1.00 0.00 ? 144 ASP D H    1  
ATOM 9773   H HA   . ASP D 1 140 ? 137.399 87.160  104.973 1.00 0.00 ? 144 ASP D HA   1  
ATOM 9774   H HB2  . ASP D 1 140 ? 135.399 86.340  106.732 1.00 0.00 ? 144 ASP D HB2  1  
ATOM 9775   H HB3  . ASP D 1 140 ? 135.562 85.469  105.448 1.00 0.00 ? 144 ASP D HB3  1  
ATOM 9776   N N    . THR D 1 141 ? 136.254 87.595  102.876 1.00 0.00 ? 145 THR D N    1  
ATOM 9777   C CA   . THR D 1 141 ? 135.541 87.684  101.609 1.00 0.00 ? 145 THR D CA   1  
ATOM 9778   C C    . THR D 1 141 ? 134.720 86.437  101.317 1.00 0.00 ? 145 THR D C    1  
ATOM 9779   O O    . THR D 1 141 ? 133.558 86.571  100.912 1.00 0.00 ? 145 THR D O    1  
ATOM 9780   C CB   . THR D 1 141 ? 136.501 87.937  100.439 1.00 0.00 ? 145 THR D CB   1  
ATOM 9781   O OG1  . THR D 1 141 ? 137.762 87.310  100.698 1.00 0.00 ? 145 THR D OG1  1  
ATOM 9782   C CG2  . THR D 1 141 ? 136.695 89.415  100.189 1.00 0.00 ? 145 THR D CG2  1  
ATOM 9783   H H    . THR D 1 141 ? 137.111 87.606  102.802 1.00 0.00 ? 145 THR D H    1  
ATOM 9784   H HA   . THR D 1 141 ? 134.936 88.437  101.696 1.00 0.00 ? 145 THR D HA   1  
ATOM 9785   H HB   . THR D 1 141 ? 136.108 87.552  99.640  1.00 0.00 ? 145 THR D HB   1  
ATOM 9786   H HG1  . THR D 1 141 ? 137.891 86.696  100.139 1.00 0.00 ? 145 THR D HG1  1  
ATOM 9787   H HG21 . THR D 1 141 ? 137.226 89.614  99.402  1.00 0.00 ? 145 THR D HG21 1  
ATOM 9788   H HG22 . THR D 1 141 ? 135.840 89.822  99.978  1.00 0.00 ? 145 THR D HG22 1  
ATOM 9789   H HG23 . THR D 1 141 ? 137.064 89.831  100.983 1.00 0.00 ? 145 THR D HG23 1  
ATOM 9790   N N    . LEU D 1 142 ? 135.286 85.238  101.546 1.00 0.00 ? 146 LEU D N    1  
ATOM 9791   C CA   . LEU D 1 142 ? 134.721 83.932  101.210 1.00 0.00 ? 146 LEU D CA   1  
ATOM 9792   C C    . LEU D 1 142 ? 134.361 83.903  99.729  1.00 0.00 ? 146 LEU D C    1  
ATOM 9793   O O    . LEU D 1 142 ? 133.178 83.790  99.383  1.00 0.00 ? 146 LEU D O    1  
ATOM 9794   C CB   . LEU D 1 142 ? 133.504 83.598  102.079 1.00 0.00 ? 146 LEU D CB   1  
ATOM 9795   C CG   . LEU D 1 142 ? 133.669 83.579  103.604 1.00 0.00 ? 146 LEU D CG   1  
ATOM 9796   C CD1  . LEU D 1 142 ? 132.333 83.844  104.286 1.00 0.00 ? 146 LEU D CD1  1  
ATOM 9797   C CD2  . LEU D 1 142 ? 134.331 82.311  104.142 1.00 0.00 ? 146 LEU D CD2  1  
ATOM 9798   H H    . LEU D 1 142 ? 136.055 85.169  101.924 1.00 0.00 ? 146 LEU D H    1  
ATOM 9799   H HA   . LEU D 1 142 ? 135.389 83.252  101.390 1.00 0.00 ? 146 LEU D HA   1  
ATOM 9800   H HB2  . LEU D 1 142 ? 132.806 84.238  101.866 1.00 0.00 ? 146 LEU D HB2  1  
ATOM 9801   H HB3  . LEU D 1 142 ? 133.180 82.725  101.807 1.00 0.00 ? 146 LEU D HB3  1  
ATOM 9802   H HG   . LEU D 1 142 ? 134.284 84.297  103.821 1.00 0.00 ? 146 LEU D HG   1  
ATOM 9803   H HD11 . LEU D 1 142 ? 132.142 84.795  104.267 1.00 0.00 ? 146 LEU D HD11 1  
ATOM 9804   H HD12 . LEU D 1 142 ? 131.630 83.365  103.818 1.00 0.00 ? 146 LEU D HD12 1  
ATOM 9805   H HD13 . LEU D 1 142 ? 132.373 83.541  105.206 1.00 0.00 ? 146 LEU D HD13 1  
ATOM 9806   H HD21 . LEU D 1 142 ? 134.124 81.565  103.558 1.00 0.00 ? 146 LEU D HD21 1  
ATOM 9807   H HD22 . LEU D 1 142 ? 135.292 82.436  104.178 1.00 0.00 ? 146 LEU D HD22 1  
ATOM 9808   H HD23 . LEU D 1 142 ? 133.997 82.124  105.033 1.00 0.00 ? 146 LEU D HD23 1  
ATOM 9809   N N    . PRO D 1 143 ? 135.359 84.030  98.827  1.00 0.00 ? 147 PRO D N    1  
ATOM 9810   C CA   . PRO D 1 143 ? 135.088 84.454  97.442  1.00 0.00 ? 147 PRO D CA   1  
ATOM 9811   C C    . PRO D 1 143 ? 134.324 83.452  96.592  1.00 0.00 ? 147 PRO D C    1  
ATOM 9812   O O    . PRO D 1 143 ? 133.941 83.733  95.453  1.00 0.00 ? 147 PRO D O    1  
ATOM 9813   C CB   . PRO D 1 143 ? 136.495 84.651  96.861  1.00 0.00 ? 147 PRO D CB   1  
ATOM 9814   C CG   . PRO D 1 143 ? 137.383 84.829  98.045  1.00 0.00 ? 147 PRO D CG   1  
ATOM 9815   C CD   . PRO D 1 143 ? 136.802 83.942  99.097  1.00 0.00 ? 147 PRO D CD   1  
ATOM 9816   H HA   . PRO D 1 143 ? 134.508 85.232  97.435  1.00 0.00 ? 147 PRO D HA   1  
ATOM 9817   H HB2  . PRO D 1 143 ? 136.766 83.884  96.331  1.00 0.00 ? 147 PRO D HB2  1  
ATOM 9818   H HB3  . PRO D 1 143 ? 136.529 85.424  96.277  1.00 0.00 ? 147 PRO D HB3  1  
ATOM 9819   H HG2  . PRO D 1 143 ? 138.297 84.580  97.840  1.00 0.00 ? 147 PRO D HG2  1  
ATOM 9820   H HG3  . PRO D 1 143 ? 137.399 85.754  98.336  1.00 0.00 ? 147 PRO D HG3  1  
ATOM 9821   H HD2  . PRO D 1 143 ? 137.129 83.032  99.023  1.00 0.00 ? 147 PRO D HD2  1  
ATOM 9822   H HD3  . PRO D 1 143 ? 137.022 84.250  99.991  1.00 0.00 ? 147 PRO D HD3  1  
ATOM 9823   N N    . GLU D 1 144 ? 134.097 82.273  97.165  1.00 0.00 ? 148 GLU D N    1  
ATOM 9824   C CA   . GLU D 1 144 ? 133.240 81.255  96.577  1.00 0.00 ? 148 GLU D CA   1  
ATOM 9825   C C    . GLU D 1 144 ? 131.809 81.746  96.431  1.00 0.00 ? 148 GLU D C    1  
ATOM 9826   O O    . GLU D 1 144 ? 131.147 81.426  95.438  1.00 0.00 ? 148 GLU D O    1  
ATOM 9827   C CB   . GLU D 1 144 ? 133.276 79.982  97.422  1.00 0.00 ? 148 GLU D CB   1  
ATOM 9828   C CG   . GLU D 1 144 ? 134.543 79.832  98.235  1.00 0.00 ? 148 GLU D CG   1  
ATOM 9829   C CD   . GLU D 1 144 ? 134.387 80.346  99.647  1.00 0.00 ? 148 GLU D CD   1  
ATOM 9830   O OE1  . GLU D 1 144 ? 133.237 80.525  100.101 1.00 0.00 ? 148 GLU D OE1  1  
ATOM 9831   O OE2  . GLU D 1 144 ? 135.420 80.555  100.313 1.00 0.00 ? 148 GLU D OE2  1  
ATOM 9832   H H    . GLU D 1 144 ? 134.443 82.040  97.917  1.00 0.00 ? 148 GLU D H    1  
ATOM 9833   H HA   . GLU D 1 144 ? 133.580 81.060  95.689  1.00 0.00 ? 148 GLU D HA   1  
ATOM 9834   H HB2  . GLU D 1 144 ? 132.514 79.978  98.021  1.00 0.00 ? 148 GLU D HB2  1  
ATOM 9835   H HB3  . GLU D 1 144 ? 133.183 79.213  96.839  1.00 0.00 ? 148 GLU D HB3  1  
ATOM 9836   H HG2  . GLU D 1 144 ? 134.798 78.896  98.261  1.00 0.00 ? 148 GLU D HG2  1  
ATOM 9837   H HG3  . GLU D 1 144 ? 135.263 80.310  97.797  1.00 0.00 ? 148 GLU D HG3  1  
ATOM 9838   N N    . GLU D 1 145 ? 131.319 82.514  97.401  1.00 0.00 ? 149 GLU D N    1  
ATOM 9839   C CA   . GLU D 1 145 ? 129.925 82.917  97.434  1.00 0.00 ? 149 GLU D CA   1  
ATOM 9840   C C    . GLU D 1 145 ? 129.711 84.409  97.222  1.00 0.00 ? 149 GLU D C    1  
ATOM 9841   O O    . GLU D 1 145 ? 129.124 84.788  96.205  1.00 0.00 ? 149 GLU D O    1  
ATOM 9842   C CB   . GLU D 1 145 ? 129.298 82.503  98.774  1.00 0.00 ? 149 GLU D CB   1  
ATOM 9843   C CG   . GLU D 1 145 ? 128.905 81.032  98.847  1.00 0.00 ? 149 GLU D CG   1  
ATOM 9844   C CD   . GLU D 1 145 ? 129.554 80.295  100.006 1.00 0.00 ? 149 GLU D CD   1  
ATOM 9845   O OE1  . GLU D 1 145 ? 129.266 79.098  100.202 1.00 0.00 ? 149 GLU D OE1  1  
ATOM 9846   O OE2  . GLU D 1 145 ? 130.364 80.918  100.719 1.00 0.00 ? 149 GLU D OE2  1  
ATOM 9847   H H    . GLU D 1 145 ? 131.788 82.813  98.057  1.00 0.00 ? 149 GLU D H    1  
ATOM 9848   H HA   . GLU D 1 145 ? 129.494 82.466  96.691  1.00 0.00 ? 149 GLU D HA   1  
ATOM 9849   H HB2  . GLU D 1 145 ? 129.927 82.697  99.487  1.00 0.00 ? 149 GLU D HB2  1  
ATOM 9850   H HB3  . GLU D 1 145 ? 128.511 83.047  98.934  1.00 0.00 ? 149 GLU D HB3  1  
ATOM 9851   H HG2  . GLU D 1 145 ? 127.940 80.965  98.929  1.00 0.00 ? 149 GLU D HG2  1  
ATOM 9852   H HG3  . GLU D 1 145 ? 129.150 80.596  98.017  1.00 0.00 ? 149 GLU D HG3  1  
ATOM 9853   N N    . ILE D 1 146 ? 130.157 85.262  98.136  1.00 0.00 ? 150 ILE D N    1  
ATOM 9854   C CA   . ILE D 1 146 ? 130.001 86.705  98.020  1.00 0.00 ? 150 ILE D CA   1  
ATOM 9855   C C    . ILE D 1 146 ? 130.685 87.236  96.767  1.00 0.00 ? 150 ILE D C    1  
ATOM 9856   O O    . ILE D 1 146 ? 130.067 87.923  95.953  1.00 0.00 ? 150 ILE D O    1  
ATOM 9857   C CB   . ILE D 1 146 ? 130.528 87.418  99.285  1.00 0.00 ? 150 ILE D CB   1  
ATOM 9858   C CG1  . ILE D 1 146 ? 129.740 86.963  100.511 1.00 0.00 ? 150 ILE D CG1  1  
ATOM 9859   C CG2  . ILE D 1 146 ? 130.446 88.929  99.134  1.00 0.00 ? 150 ILE D CG2  1  
ATOM 9860   C CD1  . ILE D 1 146 ? 130.460 85.939  101.346 1.00 0.00 ? 150 ILE D CD1  1  
ATOM 9861   H H    . ILE D 1 146 ? 130.566 85.015  98.851  1.00 0.00 ? 150 ILE D H    1  
ATOM 9862   H HA   . ILE D 1 146 ? 129.054 86.896  97.940  1.00 0.00 ? 150 ILE D HA   1  
ATOM 9863   H HB   . ILE D 1 146 ? 131.460 87.179  99.403  1.00 0.00 ? 150 ILE D HB   1  
ATOM 9864   H HG12 . ILE D 1 146 ? 129.539 87.735  101.062 1.00 0.00 ? 150 ILE D HG12 1  
ATOM 9865   H HG13 . ILE D 1 146 ? 128.891 86.594  100.221 1.00 0.00 ? 150 ILE D HG13 1  
ATOM 9866   H HG21 . ILE D 1 146 ? 130.770 89.184  98.256  1.00 0.00 ? 150 ILE D HG21 1  
ATOM 9867   H HG22 . ILE D 1 146 ? 129.524 89.214  99.234  1.00 0.00 ? 150 ILE D HG22 1  
ATOM 9868   H HG23 . ILE D 1 146 ? 130.991 89.352  99.815  1.00 0.00 ? 150 ILE D HG23 1  
ATOM 9869   H HD11 . ILE D 1 146 ? 131.413 85.989  101.170 1.00 0.00 ? 150 ILE D HD11 1  
ATOM 9870   H HD12 . ILE D 1 146 ? 130.296 86.115  102.286 1.00 0.00 ? 150 ILE D HD12 1  
ATOM 9871   H HD13 . ILE D 1 146 ? 130.136 85.053  101.121 1.00 0.00 ? 150 ILE D HD13 1  
ATOM 9872   N N    . VAL D 1 147 ? 131.960 86.911  96.588  1.00 0.00 ? 151 VAL D N    1  
ATOM 9873   C CA   . VAL D 1 147 ? 132.734 87.425  95.468  1.00 0.00 ? 151 VAL D CA   1  
ATOM 9874   C C    . VAL D 1 147 ? 132.188 86.787  94.196  1.00 0.00 ? 151 VAL D C    1  
ATOM 9875   O O    . VAL D 1 147 ? 131.871 87.478  93.220  1.00 0.00 ? 151 VAL D O    1  
ATOM 9876   C CB   . VAL D 1 147 ? 134.234 87.133  95.679  1.00 0.00 ? 151 VAL D CB   1  
ATOM 9877   C CG1  . VAL D 1 147 ? 135.055 87.403  94.421  1.00 0.00 ? 151 VAL D CG1  1  
ATOM 9878   C CG2  . VAL D 1 147 ? 134.763 87.936  96.859  1.00 0.00 ? 151 VAL D CG2  1  
ATOM 9879   H H    . VAL D 1 147 ? 132.398 86.389  97.112  1.00 0.00 ? 151 VAL D H    1  
ATOM 9880   H HA   . VAL D 1 147 ? 132.652 88.388  95.397  1.00 0.00 ? 151 VAL D HA   1  
ATOM 9881   H HB   . VAL D 1 147 ? 134.325 86.187  95.876  1.00 0.00 ? 151 VAL D HB   1  
ATOM 9882   H HG11 . VAL D 1 147 ? 134.755 88.228  94.009  1.00 0.00 ? 151 VAL D HG11 1  
ATOM 9883   H HG12 . VAL D 1 147 ? 135.993 87.482  94.658  1.00 0.00 ? 151 VAL D HG12 1  
ATOM 9884   H HG13 . VAL D 1 147 ? 134.941 86.670  93.797  1.00 0.00 ? 151 VAL D HG13 1  
ATOM 9885   H HG21 . VAL D 1 147 ? 134.546 87.479  97.687  1.00 0.00 ? 151 VAL D HG21 1  
ATOM 9886   H HG22 . VAL D 1 147 ? 135.725 88.027  96.783  1.00 0.00 ? 151 VAL D HG22 1  
ATOM 9887   H HG23 . VAL D 1 147 ? 134.354 88.816  96.862  1.00 0.00 ? 151 VAL D HG23 1  
ATOM 9888   N N    . ASN D 1 148 ? 132.035 85.458  94.225  1.00 0.00 ? 152 ASN D N    1  
ATOM 9889   C CA   . ASN D 1 148 ? 131.588 84.716  93.049  1.00 0.00 ? 152 ASN D CA   1  
ATOM 9890   C C    . ASN D 1 148 ? 130.142 84.254  93.198  1.00 0.00 ? 152 ASN D C    1  
ATOM 9891   O O    . ASN D 1 148 ? 129.858 83.324  93.961  1.00 0.00 ? 152 ASN D O    1  
ATOM 9892   C CB   . ASN D 1 148 ? 132.511 83.522  92.815  1.00 0.00 ? 152 ASN D CB   1  
ATOM 9893   C CG   . ASN D 1 148 ? 131.894 82.460  91.923  1.00 0.00 ? 152 ASN D CG   1  
ATOM 9894   O OD1  . ASN D 1 148 ? 131.832 81.281  92.274  1.00 0.00 ? 152 ASN D OD1  1  
ATOM 9895   N ND2  . ASN D 1 148 ? 131.429 82.881  90.756  1.00 0.00 ? 152 ASN D ND2  1  
ATOM 9896   H H    . ASN D 1 148 ? 132.187 84.971  94.917  1.00 0.00 ? 152 ASN D H    1  
ATOM 9897   H HA   . ASN D 1 148 ? 131.626 85.308  92.281  1.00 0.00 ? 152 ASN D HA   1  
ATOM 9898   H HB2  . ASN D 1 148 ? 133.337 83.833  92.414  1.00 0.00 ? 152 ASN D HB2  1  
ATOM 9899   H HB3  . ASN D 1 148 ? 132.742 83.126  93.670  1.00 0.00 ? 152 ASN D HB3  1  
ATOM 9900   H HD21 . ASN D 1 148 ? 131.066 82.323  90.210  1.00 0.00 ? 152 ASN D HD21 1  
ATOM 9901   H HD22 . ASN D 1 148 ? 131.489 83.712  90.543  1.00 0.00 ? 152 ASN D HD22 1  
ATOM 9902   N N    . VAL D 1 149 ? 129.219 84.879  92.473  1.00 0.00 ? 153 VAL D N    1  
ATOM 9903   C CA   . VAL D 1 149 ? 127.856 84.365  92.420  1.00 0.00 ? 153 VAL D CA   1  
ATOM 9904   C C    . VAL D 1 149 ? 127.437 84.286  90.951  1.00 0.00 ? 153 VAL D C    1  
ATOM 9905   O O    . VAL D 1 149 ? 127.071 85.283  90.317  1.00 0.00 ? 153 VAL D O    1  
ATOM 9906   C CB   . VAL D 1 149 ? 126.907 85.197  93.317  1.00 0.00 ? 153 VAL D CB   1  
ATOM 9907   C CG1  . VAL D 1 149 ? 126.872 86.685  92.939  1.00 0.00 ? 153 VAL D CG1  1  
ATOM 9908   C CG2  . VAL D 1 149 ? 125.503 84.599  93.324  1.00 0.00 ? 153 VAL D CG2  1  
ATOM 9909   H H    . VAL D 1 149 ? 129.358 85.591  92.011  1.00 0.00 ? 153 VAL D H    1  
ATOM 9910   H HA   . VAL D 1 149 ? 127.805 83.469  92.788  1.00 0.00 ? 153 VAL D HA   1  
ATOM 9911   H HB   . VAL D 1 149 ? 127.268 85.153  94.216  1.00 0.00 ? 153 VAL D HB   1  
ATOM 9912   H HG11 . VAL D 1 149 ? 126.219 86.825  92.237  1.00 0.00 ? 153 VAL D HG11 1  
ATOM 9913   H HG12 . VAL D 1 149 ? 126.628 87.211  93.717  1.00 0.00 ? 153 VAL D HG12 1  
ATOM 9914   H HG13 . VAL D 1 149 ? 127.748 86.960  92.626  1.00 0.00 ? 153 VAL D HG13 1  
ATOM 9915   H HG21 . VAL D 1 149 ? 125.164 84.559  92.416  1.00 0.00 ? 153 VAL D HG21 1  
ATOM 9916   H HG22 . VAL D 1 149 ? 125.534 83.704  93.698  1.00 0.00 ? 153 VAL D HG22 1  
ATOM 9917   H HG23 . VAL D 1 149 ? 124.918 85.154  93.863  1.00 0.00 ? 153 VAL D HG23 1  
ATOM 9918   N N    . SER D 1 150 ? 127.557 83.091  90.374  1.00 0.00 ? 154 SER D N    1  
ATOM 9919   C CA   . SER D 1 150 ? 127.350 82.918  88.944  1.00 0.00 ? 154 SER D CA   1  
ATOM 9920   C C    . SER D 1 150 ? 125.936 82.469  88.600  1.00 0.00 ? 154 SER D C    1  
ATOM 9921   O O    . SER D 1 150 ? 125.230 81.937  89.462  1.00 0.00 ? 154 SER D O    1  
ATOM 9922   C CB   . SER D 1 150 ? 128.373 81.905  88.411  1.00 0.00 ? 154 SER D CB   1  
ATOM 9923   O OG   . SER D 1 150 ? 128.445 81.944  86.999  1.00 0.00 ? 154 SER D OG   1  
ATOM 9924   H H    . SER D 1 150 ? 127.756 82.369  90.796  1.00 0.00 ? 154 SER D H    1  
ATOM 9925   H HA   . SER D 1 150 ? 127.474 83.782  88.521  1.00 0.00 ? 154 SER D HA   1  
ATOM 9926   H HB2  . SER D 1 150 ? 129.246 82.095  88.787  1.00 0.00 ? 154 SER D HB2  1  
ATOM 9927   H HB3  . SER D 1 150 ? 128.128 81.012  88.699  1.00 0.00 ? 154 SER D HB3  1  
ATOM 9928   H HG   . SER D 1 150 ? 128.089 81.253  86.681  1.00 0.00 ? 154 SER D HG   1  
ATOM 9929   N N    . LYS D 1 151 ? 125.498 82.671  87.363  1.00 0.00 ? 155 LYS D N    1  
ATOM 9930   C CA   . LYS D 1 151 ? 124.192 82.171  86.952  1.00 0.00 ? 155 LYS D CA   1  
ATOM 9931   C C    . LYS D 1 151 ? 124.175 80.680  86.630  1.00 0.00 ? 155 LYS D C    1  
ATOM 9932   O O    . LYS D 1 151 ? 123.102 80.143  86.338  1.00 0.00 ? 155 LYS D O    1  
ATOM 9933   C CB   . LYS D 1 151 ? 123.695 82.968  85.734  1.00 0.00 ? 155 LYS D CB   1  
ATOM 9934   C CG   . LYS D 1 151 ? 123.389 84.431  85.983  1.00 0.00 ? 155 LYS D CG   1  
ATOM 9935   C CD   . LYS D 1 151 ? 122.029 84.599  86.639  1.00 0.00 ? 155 LYS D CD   1  
ATOM 9936   C CE   . LYS D 1 151 ? 121.487 86.010  86.460  1.00 0.00 ? 155 LYS D CE   1  
ATOM 9937   N NZ   . LYS D 1 151 ? 120.256 86.050  85.625  1.00 0.00 ? 155 LYS D NZ   1  
ATOM 9938   H H    . LYS D 1 151 ? 125.935 83.091  86.753  1.00 0.00 ? 155 LYS D H    1  
ATOM 9939   H HA   . LYS D 1 151 ? 123.600 82.293  87.711  1.00 0.00 ? 155 LYS D HA   1  
ATOM 9940   H HB2  . LYS D 1 151 ? 124.366 82.910  85.036  1.00 0.00 ? 155 LYS D HB2  1  
ATOM 9941   H HB3  . LYS D 1 151 ? 122.893 82.540  85.394  1.00 0.00 ? 155 LYS D HB3  1  
ATOM 9942   H HG2  . LYS D 1 151 ? 124.075 84.815  86.551  1.00 0.00 ? 155 LYS D HG2  1  
ATOM 9943   H HG3  . LYS D 1 151 ? 123.410 84.916  85.144  1.00 0.00 ? 155 LYS D HG3  1  
ATOM 9944   H HD2  . LYS D 1 151 ? 121.405 83.962  86.258  1.00 0.00 ? 155 LYS D HD2  1  
ATOM 9945   H HD3  . LYS D 1 151 ? 122.098 84.397  87.584  1.00 0.00 ? 155 LYS D HD3  1  
ATOM 9946   H HE2  . LYS D 1 151 ? 121.295 86.391  87.331  1.00 0.00 ? 155 LYS D HE2  1  
ATOM 9947   H HE3  . LYS D 1 151 ? 122.169 86.565  86.051  1.00 0.00 ? 155 LYS D HE3  1  
ATOM 9948   H HZ1  . LYS D 1 151 ? 119.725 85.370  85.847  1.00 0.00 ? 155 LYS D HZ1  1  
ATOM 9949   H HZ2  . LYS D 1 151 ? 119.828 86.818  85.763  1.00 0.00 ? 155 LYS D HZ2  1  
ATOM 9950   H HZ3  . LYS D 1 151 ? 120.478 85.984  84.766  1.00 0.00 ? 155 LYS D HZ3  1  
ATOM 9951   N N    . GLY D 1 152 ? 125.300 79.975  86.740  1.00 0.00 ? 156 GLY D N    1  
ATOM 9952   C CA   . GLY D 1 152 ? 125.362 78.571  86.383  1.00 0.00 ? 156 GLY D CA   1  
ATOM 9953   C C    . GLY D 1 152 ? 125.791 78.342  84.948  1.00 0.00 ? 156 GLY D C    1  
ATOM 9954   O O    . GLY D 1 152 ? 125.970 77.196  84.522  1.00 0.00 ? 156 GLY D O    1  
ATOM 9955   H H    . GLY D 1 152 ? 126.044 80.301  87.022  1.00 0.00 ? 156 GLY D H    1  
ATOM 9956   H HA2  . GLY D 1 152 ? 125.982 78.118  86.977  1.00 0.00 ? 156 GLY D HA2  1  
ATOM 9957   H HA3  . GLY D 1 152 ? 124.490 78.168  86.522  1.00 0.00 ? 156 GLY D HA3  1  
ATOM 9958   N N    . GLY D 1 153 ? 125.964 79.420  84.197  1.00 0.00 ? 157 GLY D N    1  
ATOM 9959   C CA   . GLY D 1 153 ? 126.311 79.338  82.790  1.00 0.00 ? 157 GLY D CA   1  
ATOM 9960   C C    . GLY D 1 153 ? 127.787 79.024  82.597  1.00 0.00 ? 157 GLY D C    1  
ATOM 9961   O O    . GLY D 1 153 ? 128.643 79.540  83.316  1.00 0.00 ? 157 GLY D O    1  
ATOM 9962   H H    . GLY D 1 153 ? 125.881 80.224  84.492  1.00 0.00 ? 157 GLY D H    1  
ATOM 9963   H HA2  . GLY D 1 153 ? 125.775 78.652  82.364  1.00 0.00 ? 157 GLY D HA2  1  
ATOM 9964   H HA3  . GLY D 1 153 ? 126.099 80.178  82.354  1.00 0.00 ? 157 GLY D HA3  1  
ATOM 9965   N N    . TYR D 1 154 ? 128.059 78.168  81.618  1.00 0.00 ? 158 TYR D N    1  
ATOM 9966   C CA   . TYR D 1 154 ? 129.403 77.766  81.229  1.00 0.00 ? 158 TYR D CA   1  
ATOM 9967   C C    . TYR D 1 154 ? 129.471 77.701  79.704  1.00 0.00 ? 158 TYR D C    1  
ATOM 9968   O O    . TYR D 1 154 ? 128.458 77.465  79.040  1.00 0.00 ? 158 TYR D O    1  
ATOM 9969   C CB   . TYR D 1 154 ? 129.770 76.439  81.897  1.00 0.00 ? 158 TYR D CB   1  
ATOM 9970   C CG   . TYR D 1 154 ? 129.537 76.428  83.399  1.00 0.00 ? 158 TYR D CG   1  
ATOM 9971   C CD1  . TYR D 1 154 ? 128.674 75.508  83.985  1.00 0.00 ? 158 TYR D CD1  1  
ATOM 9972   C CD2  . TYR D 1 154 ? 130.188 77.328  84.229  1.00 0.00 ? 158 TYR D CD2  1  
ATOM 9973   C CE1  . TYR D 1 154 ? 128.464 75.487  85.345  1.00 0.00 ? 158 TYR D CE1  1  
ATOM 9974   C CE2  . TYR D 1 154 ? 129.983 77.313  85.597  1.00 0.00 ? 158 TYR D CE2  1  
ATOM 9975   C CZ   . TYR D 1 154 ? 129.119 76.391  86.145  1.00 0.00 ? 158 TYR D CZ   1  
ATOM 9976   O OH   . TYR D 1 154 ? 128.903 76.364  87.501  1.00 0.00 ? 158 TYR D OH   1  
ATOM 9977   H H    . TYR D 1 154 ? 127.444 77.794  81.147  1.00 0.00 ? 158 TYR D H    1  
ATOM 9978   H HA   . TYR D 1 154 ? 130.058 78.415  81.531  1.00 0.00 ? 158 TYR D HA   1  
ATOM 9979   H HB2  . TYR D 1 154 ? 129.251 75.726  81.491  1.00 0.00 ? 158 TYR D HB2  1  
ATOM 9980   H HB3  . TYR D 1 154 ? 130.704 76.244  81.721  1.00 0.00 ? 158 TYR D HB3  1  
ATOM 9981   H HD1  . TYR D 1 154 ? 128.229 74.894  83.446  1.00 0.00 ? 158 TYR D HD1  1  
ATOM 9982   H HD2  . TYR D 1 154 ? 130.772 77.952  83.861  1.00 0.00 ? 158 TYR D HD2  1  
ATOM 9983   H HE1  . TYR D 1 154 ? 127.884 74.865  85.719  1.00 0.00 ? 158 TYR D HE1  1  
ATOM 9984   H HE2  . TYR D 1 154 ? 130.425 77.922  86.143  1.00 0.00 ? 158 TYR D HE2  1  
ATOM 9985   H HH   . TYR D 1 154 ? 129.619 76.172  87.896  1.00 0.00 ? 158 TYR D HH   1  
ATOM 9986   N N    . ASP D 1 155 ? 130.670 77.940  79.153  1.00 0.00 ? 159 ASP D N    1  
ATOM 9987   C CA   . ASP D 1 155 ? 130.797 78.364  77.757  1.00 0.00 ? 159 ASP D CA   1  
ATOM 9988   C C    . ASP D 1 155 ? 130.206 77.408  76.726  1.00 0.00 ? 159 ASP D C    1  
ATOM 9989   O O    . ASP D 1 155 ? 129.351 77.839  75.948  1.00 0.00 ? 159 ASP D O    1  
ATOM 9990   C CB   . ASP D 1 155 ? 132.270 78.594  77.425  1.00 0.00 ? 159 ASP D CB   1  
ATOM 9991   C CG   . ASP D 1 155 ? 132.466 79.676  76.393  1.00 0.00 ? 159 ASP D CG   1  
ATOM 9992   O OD1  . ASP D 1 155 ? 133.093 79.392  75.351  1.00 0.00 ? 159 ASP D OD1  1  
ATOM 9993   O OD2  . ASP D 1 155 ? 132.000 80.810  76.626  1.00 0.00 ? 159 ASP D OD2  1  
ATOM 9994   H H    . ASP D 1 155 ? 131.417 77.863  79.572  1.00 0.00 ? 159 ASP D H    1  
ATOM 9995   H HA   . ASP D 1 155 ? 130.275 79.179  77.693  1.00 0.00 ? 159 ASP D HA   1  
ATOM 9996   H HB2  . ASP D 1 155 ? 132.748 78.834  78.235  1.00 0.00 ? 159 ASP D HB2  1  
ATOM 9997   H HB3  . ASP D 1 155 ? 132.659 77.767  77.101  1.00 0.00 ? 159 ASP D HB3  1  
ATOM 9998   N N    . PHE D 1 156 ? 130.623 76.132  76.741  1.00 0.00 ? 160 PHE D N    1  
ATOM 9999   C CA   . PHE D 1 156 ? 130.033 74.986  76.034  1.00 0.00 ? 160 PHE D CA   1  
ATOM 10000  C C    . PHE D 1 156 ? 130.208 73.732  76.882  1.00 0.00 ? 160 PHE D C    1  
ATOM 10001  O O    . PHE D 1 156 ? 131.036 73.678  77.796  1.00 0.00 ? 160 PHE D O    1  
ATOM 10002  C CB   . PHE D 1 156 ? 130.616 74.692  74.641  1.00 0.00 ? 160 PHE D CB   1  
ATOM 10003  C CG   . PHE D 1 156 ? 131.901 73.909  74.650  1.00 0.00 ? 160 PHE D CG   1  
ATOM 10004  C CD1  . PHE D 1 156 ? 133.016 74.391  75.317  1.00 0.00 ? 160 PHE D CD1  1  
ATOM 10005  C CD2  . PHE D 1 156 ? 132.023 72.740  73.913  1.00 0.00 ? 160 PHE D CD2  1  
ATOM 10006  C CE1  . PHE D 1 156 ? 134.206 73.691  75.302  1.00 0.00 ? 160 PHE D CE1  1  
ATOM 10007  C CE2  . PHE D 1 156 ? 133.208 72.035  73.893  1.00 0.00 ? 160 PHE D CE2  1  
ATOM 10008  C CZ   . PHE D 1 156 ? 134.302 72.512  74.587  1.00 0.00 ? 160 PHE D CZ   1  
ATOM 10009  H H    . PHE D 1 156 ? 131.312 75.899  77.201  1.00 0.00 ? 160 PHE D H    1  
ATOM 10010  H HA   . PHE D 1 156 ? 129.105 75.229  75.897  1.00 0.00 ? 160 PHE D HA   1  
ATOM 10011  H HB2  . PHE D 1 156 ? 129.957 74.202  74.125  1.00 0.00 ? 160 PHE D HB2  1  
ATOM 10012  H HB3  . PHE D 1 156 ? 130.767 75.533  74.183  1.00 0.00 ? 160 PHE D HB3  1  
ATOM 10013  H HD1  . PHE D 1 156 ? 132.962 75.195  75.781  1.00 0.00 ? 160 PHE D HD1  1  
ATOM 10014  H HD2  . PHE D 1 156 ? 131.296 72.427  73.426  1.00 0.00 ? 160 PHE D HD2  1  
ATOM 10015  H HE1  . PHE D 1 156 ? 134.941 74.012  75.772  1.00 0.00 ? 160 PHE D HE1  1  
ATOM 10016  H HE2  . PHE D 1 156 ? 133.271 71.241  73.414  1.00 0.00 ? 160 PHE D HE2  1  
ATOM 10017  H HZ   . PHE D 1 156 ? 135.103 72.040  74.573  1.00 0.00 ? 160 PHE D HZ   1  
ATOM 10018  N N    . GLN D 1 157 ? 129.411 72.718  76.541  1.00 0.00 ? 161 GLN D N    1  
ATOM 10019  C CA   . GLN D 1 157 ? 129.742 71.315  76.795  1.00 0.00 ? 161 GLN D CA   1  
ATOM 10020  C C    . GLN D 1 157 ? 129.202 70.534  75.605  1.00 0.00 ? 161 GLN D C    1  
ATOM 10021  O O    . GLN D 1 157 ? 128.056 70.084  75.644  1.00 0.00 ? 161 GLN D O    1  
ATOM 10022  C CB   . GLN D 1 157 ? 129.141 70.816  78.103  1.00 0.00 ? 161 GLN D CB   1  
ATOM 10023  C CG   . GLN D 1 157 ? 129.905 71.299  79.322  1.00 0.00 ? 161 GLN D CG   1  
ATOM 10024  C CD   . GLN D 1 157 ? 129.916 70.294  80.459  1.00 0.00 ? 161 GLN D CD   1  
ATOM 10025  O OE1  . GLN D 1 157 ? 129.066 69.408  80.536  1.00 0.00 ? 161 GLN D OE1  1  
ATOM 10026  N NE2  . GLN D 1 157 ? 130.883 70.439  81.357  1.00 0.00 ? 161 GLN D NE2  1  
ATOM 10027  H H    . GLN D 1 157 ? 128.652 72.827  76.151  1.00 0.00 ? 161 GLN D H    1  
ATOM 10028  H HA   . GLN D 1 157 ? 130.700 71.199  76.891  1.00 0.00 ? 161 GLN D HA   1  
ATOM 10029  H HB2  . GLN D 1 157 ? 128.220 71.113  78.165  1.00 0.00 ? 161 GLN D HB2  1  
ATOM 10030  H HB3  . GLN D 1 157 ? 129.127 69.846  78.098  1.00 0.00 ? 161 GLN D HB3  1  
ATOM 10031  H HG2  . GLN D 1 157 ? 130.819 71.497  79.065  1.00 0.00 ? 161 GLN D HG2  1  
ATOM 10032  H HG3  . GLN D 1 157 ? 129.512 72.128  79.635  1.00 0.00 ? 161 GLN D HG3  1  
ATOM 10033  H HE21 . GLN D 1 157 ? 131.460 71.071  81.269  1.00 0.00 ? 161 GLN D HE21 1  
ATOM 10034  H HE22 . GLN D 1 157 ? 130.932 69.902  82.027  1.00 0.00 ? 161 GLN D HE22 1  
ATOM 10035  N N    . GLN D 1 158 ? 130.021 70.367  74.554  1.00 0.00 ? 162 GLN D N    1  
ATOM 10036  C CA   . GLN D 1 158 ? 129.482 69.888  73.280  1.00 0.00 ? 162 GLN D CA   1  
ATOM 10037  C C    . GLN D 1 158 ? 129.917 68.463  72.918  1.00 0.00 ? 162 GLN D C    1  
ATOM 10038  O O    . GLN D 1 158 ? 129.181 67.803  72.167  1.00 0.00 ? 162 GLN D O    1  
ATOM 10039  C CB   . GLN D 1 158 ? 129.787 70.895  72.164  1.00 0.00 ? 162 GLN D CB   1  
ATOM 10040  C CG   . GLN D 1 158 ? 128.789 70.914  71.027  1.00 0.00 ? 162 GLN D CG   1  
ATOM 10041  C CD   . GLN D 1 158 ? 128.627 72.300  70.439  1.00 0.00 ? 162 GLN D CD   1  
ATOM 10042  O OE1  . GLN D 1 158 ? 129.585 73.067  70.367  1.00 0.00 ? 162 GLN D OE1  1  
ATOM 10043  N NE2  . GLN D 1 158 ? 127.414 72.628  70.017  1.00 0.00 ? 162 GLN D NE2  1  
ATOM 10044  H H    . GLN D 1 158 ? 130.867 70.521  74.560  1.00 0.00 ? 162 GLN D H    1  
ATOM 10045  H HA   . GLN D 1 158 ? 128.519 69.827  73.387  1.00 0.00 ? 162 GLN D HA   1  
ATOM 10046  H HB2  . GLN D 1 158 ? 129.832 71.784  72.552  1.00 0.00 ? 162 GLN D HB2  1  
ATOM 10047  H HB3  . GLN D 1 158 ? 130.665 70.700  71.802  1.00 0.00 ? 162 GLN D HB3  1  
ATOM 10048  H HG2  . GLN D 1 158 ? 129.077 70.301  70.334  1.00 0.00 ? 162 GLN D HG2  1  
ATOM 10049  H HG3  . GLN D 1 158 ? 127.930 70.596  71.347  1.00 0.00 ? 162 GLN D HG3  1  
ATOM 10050  H HE21 . GLN D 1 158 ? 126.768 72.065  70.084  1.00 0.00 ? 162 GLN D HE21 1  
ATOM 10051  H HE22 . GLN D 1 158 ? 127.274 73.405  69.675  1.00 0.00 ? 162 GLN D HE22 1  
ATOM 10052  N N    . PRO D 1 159 ? 131.052 67.919  73.394  1.00 0.00 ? 163 PRO D N    1  
ATOM 10053  C CA   . PRO D 1 159 ? 131.288 66.487  73.142  1.00 0.00 ? 163 PRO D CA   1  
ATOM 10054  C C    . PRO D 1 159 ? 130.486 65.565  74.042  1.00 0.00 ? 163 PRO D C    1  
ATOM 10055  O O    . PRO D 1 159 ? 130.733 64.352  74.029  1.00 0.00 ? 163 PRO D O    1  
ATOM 10056  C CB   . PRO D 1 159 ? 132.808 66.338  73.322  1.00 0.00 ? 163 PRO D CB   1  
ATOM 10057  C CG   . PRO D 1 159 ? 133.352 67.703  73.265  1.00 0.00 ? 163 PRO D CG   1  
ATOM 10058  C CD   . PRO D 1 159 ? 132.295 68.531  73.906  1.00 0.00 ? 163 PRO D CD   1  
ATOM 10059  H HA   . PRO D 1 159 ? 131.011 66.244  72.245  1.00 0.00 ? 163 PRO D HA   1  
ATOM 10060  H HB2  . PRO D 1 159 ? 133.019 65.913  74.168  1.00 0.00 ? 163 PRO D HB2  1  
ATOM 10061  H HB3  . PRO D 1 159 ? 133.189 65.782  72.624  1.00 0.00 ? 163 PRO D HB3  1  
ATOM 10062  H HG2  . PRO D 1 159 ? 134.195 67.771  73.741  1.00 0.00 ? 163 PRO D HG2  1  
ATOM 10063  H HG3  . PRO D 1 159 ? 133.518 67.982  72.351  1.00 0.00 ? 163 PRO D HG3  1  
ATOM 10064  H HD2  . PRO D 1 159 ? 132.343 68.493  74.875  1.00 0.00 ? 163 PRO D HD2  1  
ATOM 10065  H HD3  . PRO D 1 159 ? 132.366 69.465  73.655  1.00 0.00 ? 163 PRO D HD3  1  
ATOM 10066  N N    . GLY D 1 160 ? 129.563 66.095  74.839  1.00 0.00 ? 164 GLY D N    1  
ATOM 10067  C CA   . GLY D 1 160 ? 128.904 65.278  75.835  1.00 0.00 ? 164 GLY D CA   1  
ATOM 10068  C C    . GLY D 1 160 ? 129.630 65.004  77.137  1.00 0.00 ? 164 GLY D C    1  
ATOM 10069  O O    . GLY D 1 160 ? 130.299 63.971  77.243  1.00 0.00 ? 164 GLY D O    1  
ATOM 10070  H H    . GLY D 1 160 ? 129.309 66.917  74.815  1.00 0.00 ? 164 GLY D H    1  
ATOM 10071  H HA2  . GLY D 1 160 ? 128.058 65.700  76.052  1.00 0.00 ? 164 GLY D HA2  1  
ATOM 10072  H HA3  . GLY D 1 160 ? 128.697 64.422  75.426  1.00 0.00 ? 164 GLY D HA3  1  
ATOM 10073  N N    . GLN D 1 161 ? 129.551 65.903  78.122  1.00 0.00 ? 165 GLN D N    1  
ATOM 10074  C CA   . GLN D 1 161 ? 130.170 65.615  79.413  1.00 0.00 ? 165 GLN D CA   1  
ATOM 10075  C C    . GLN D 1 161 ? 129.130 65.154  80.423  1.00 0.00 ? 165 GLN D C    1  
ATOM 10076  O O    . GLN D 1 161 ? 128.852 65.860  81.401  1.00 0.00 ? 165 GLN D O    1  
ATOM 10077  C CB   . GLN D 1 161 ? 130.922 66.835  79.942  1.00 0.00 ? 165 GLN D CB   1  
ATOM 10078  C CG   . GLN D 1 161 ? 132.142 67.178  79.115  1.00 0.00 ? 165 GLN D CG   1  
ATOM 10079  C CD   . GLN D 1 161 ? 131.775 67.858  77.811  1.00 0.00 ? 165 GLN D CD   1  
ATOM 10080  O OE1  . GLN D 1 161 ? 131.523 69.061  77.775  1.00 0.00 ? 165 GLN D OE1  1  
ATOM 10081  N NE2  . GLN D 1 161 ? 131.755 67.089  76.730  1.00 0.00 ? 165 GLN D NE2  1  
ATOM 10082  H H    . GLN D 1 161 ? 129.154 66.664  78.065  1.00 0.00 ? 165 GLN D H    1  
ATOM 10083  H HA   . GLN D 1 161 ? 130.808 64.896  79.282  1.00 0.00 ? 165 GLN D HA   1  
ATOM 10084  H HB2  . GLN D 1 161 ? 130.322 67.597  79.957  1.00 0.00 ? 165 GLN D HB2  1  
ATOM 10085  H HB3  . GLN D 1 161 ? 131.193 66.671  80.859  1.00 0.00 ? 165 GLN D HB3  1  
ATOM 10086  H HG2  . GLN D 1 161 ? 132.726 67.759  79.628  1.00 0.00 ? 165 GLN D HG2  1  
ATOM 10087  H HG3  . GLN D 1 161 ? 132.641 66.368  78.927  1.00 0.00 ? 165 GLN D HG3  1  
ATOM 10088  H HE21 . GLN D 1 161 ? 131.937 66.252  76.794  1.00 0.00 ? 165 GLN D HE21 1  
ATOM 10089  H HE22 . GLN D 1 161 ? 131.560 67.429  75.964  1.00 0.00 ? 165 GLN D HE22 1  
ATOM 10090  N N    . THR D 1 162 ? 128.566 63.958  80.202  1.00 0.00 ? 166 THR D N    1  
ATOM 10091  C CA   . THR D 1 162 ? 127.604 63.282  81.088  1.00 0.00 ? 166 THR D CA   1  
ATOM 10092  C C    . THR D 1 162 ? 126.810 64.277  81.932  1.00 0.00 ? 166 THR D C    1  
ATOM 10093  O O    . THR D 1 162 ? 127.037 64.431  83.133  1.00 0.00 ? 166 THR D O    1  
ATOM 10094  C CB   . THR D 1 162 ? 128.292 62.249  81.992  1.00 0.00 ? 166 THR D CB   1  
ATOM 10095  O OG1  . THR D 1 162 ? 128.936 61.249  81.193  1.00 0.00 ? 166 THR D OG1  1  
ATOM 10096  C CG2  . THR D 1 162 ? 127.283 61.576  82.893  1.00 0.00 ? 166 THR D CG2  1  
ATOM 10097  H H    . THR D 1 162 ? 128.743 63.497  79.498  1.00 0.00 ? 166 THR D H    1  
ATOM 10098  H HA   . THR D 1 162 ? 126.981 62.813  80.511  1.00 0.00 ? 166 THR D HA   1  
ATOM 10099  H HB   . THR D 1 162 ? 128.950 62.712  82.534  1.00 0.00 ? 166 THR D HB   1  
ATOM 10100  H HG1  . THR D 1 162 ? 129.756 61.423  81.133  1.00 0.00 ? 166 THR D HG1  1  
ATOM 10101  H HG21 . THR D 1 162 ? 127.195 62.237  83.597  1.00 0.00 ? 166 THR D HG21 1  
ATOM 10102  H HG22 . THR D 1 162 ? 126.851 62.243  83.449  1.00 0.00 ? 166 THR D HG22 1  
ATOM 10103  H HG23 . THR D 1 162 ? 126.617 61.126  82.352  1.00 0.00 ? 166 THR D HG23 1  
ATOM 10104  N N    . THR D 1 163 ? 125.882 64.980  81.291  1.00 0.00 ? 167 THR D N    1  
ATOM 10105  C CA   . THR D 1 163 ? 125.269 66.128  81.935  1.00 0.00 ? 167 THR D CA   1  
ATOM 10106  C C    . THR D 1 163 ? 123.946 65.707  82.562  1.00 0.00 ? 167 THR D C    1  
ATOM 10107  O O    . THR D 1 163 ? 123.383 64.665  82.218  1.00 0.00 ? 167 THR D O    1  
ATOM 10108  C CB   . THR D 1 163 ? 125.036 67.260  80.926  1.00 0.00 ? 167 THR D CB   1  
ATOM 10109  O OG1  . THR D 1 163 ? 125.990 67.158  79.866  1.00 0.00 ? 167 THR D OG1  1  
ATOM 10110  C CG2  . THR D 1 163 ? 125.294 68.586  81.578  1.00 0.00 ? 167 THR D CG2  1  
ATOM 10111  H H    . THR D 1 163 ? 125.598 64.811  80.497  1.00 0.00 ? 167 THR D H    1  
ATOM 10112  H HA   . THR D 1 163 ? 125.867 66.457  82.624  1.00 0.00 ? 167 THR D HA   1  
ATOM 10113  H HB   . THR D 1 163 ? 124.125 67.191  80.603  1.00 0.00 ? 167 THR D HB   1  
ATOM 10114  H HG1  . THR D 1 163 ? 125.587 67.105  79.131  1.00 0.00 ? 167 THR D HG1  1  
ATOM 10115  H HG21 . THR D 1 163 ? 125.139 69.176  80.823  1.00 0.00 ? 167 THR D HG21 1  
ATOM 10116  H HG22 . THR D 1 163 ? 124.692 68.699  82.330  1.00 0.00 ? 167 THR D HG22 1  
ATOM 10117  H HG23 . THR D 1 163 ? 126.211 68.620  81.890  1.00 0.00 ? 167 THR D HG23 1  
ATOM 10118  N N    . GLY D 1 164 ? 123.459 66.526  83.494  1.00 0.00 ? 168 GLY D N    1  
ATOM 10119  C CA   . GLY D 1 164 ? 122.137 66.353  84.063  1.00 0.00 ? 168 GLY D CA   1  
ATOM 10120  C C    . GLY D 1 164 ? 121.407 67.667  84.242  1.00 0.00 ? 168 GLY D C    1  
ATOM 10121  O O    . GLY D 1 164 ? 121.685 68.635  83.530  1.00 0.00 ? 168 GLY D O    1  
ATOM 10122  H H    . GLY D 1 164 ? 123.892 67.199  83.810  1.00 0.00 ? 168 GLY D H    1  
ATOM 10123  H HA2  . GLY D 1 164 ? 121.615 65.771  83.488  1.00 0.00 ? 168 GLY D HA2  1  
ATOM 10124  H HA3  . GLY D 1 164 ? 122.214 65.909  84.922  1.00 0.00 ? 168 GLY D HA3  1  
ATOM 10125  N N    . GLU D 1 165 ? 120.472 67.711  85.194  1.00 0.00 ? 169 GLU D N    1  
ATOM 10126  C CA   . GLU D 1 165 ? 119.671 68.913  85.417  1.00 0.00 ? 169 GLU D CA   1  
ATOM 10127  C C    . GLU D 1 165 ? 120.518 70.050  85.977  1.00 0.00 ? 169 GLU D C    1  
ATOM 10128  O O    . GLU D 1 165 ? 120.157 71.224  85.852  1.00 0.00 ? 169 GLU D O    1  
ATOM 10129  C CB   . GLU D 1 165 ? 118.506 68.595  86.361  1.00 0.00 ? 169 GLU D CB   1  
ATOM 10130  C CG   . GLU D 1 165 ? 117.106 68.953  85.848  1.00 0.00 ? 169 GLU D CG   1  
ATOM 10131  C CD   . GLU D 1 165 ? 116.452 67.859  85.030  1.00 0.00 ? 169 GLU D CD   1  
ATOM 10132  O OE1  . GLU D 1 165 ? 115.636 68.194  84.148  1.00 0.00 ? 169 GLU D OE1  1  
ATOM 10133  O OE2  . GLU D 1 165 ? 116.741 66.669  85.275  1.00 0.00 ? 169 GLU D OE2  1  
ATOM 10134  H H    . GLU D 1 165 ? 120.286 67.056  85.720  1.00 0.00 ? 169 GLU D H    1  
ATOM 10135  H HA   . GLU D 1 165 ? 119.318 69.206  84.562  1.00 0.00 ? 169 GLU D HA   1  
ATOM 10136  H HB2  . GLU D 1 165 ? 118.525 67.646  86.559  1.00 0.00 ? 169 GLU D HB2  1  
ATOM 10137  H HB3  . GLU D 1 165 ? 118.655 69.063  87.197  1.00 0.00 ? 169 GLU D HB3  1  
ATOM 10138  H HG2  . GLU D 1 165 ? 116.537 69.162  86.606  1.00 0.00 ? 169 GLU D HG2  1  
ATOM 10139  H HG3  . GLU D 1 165 ? 117.166 69.757  85.308  1.00 0.00 ? 169 GLU D HG3  1  
ATOM 10140  N N    . ALA D 1 166 ? 121.641 69.711  86.619  1.00 0.00 ? 170 ALA D N    1  
ATOM 10141  C CA   . ALA D 1 166 ? 122.533 70.680  87.245  1.00 0.00 ? 170 ALA D CA   1  
ATOM 10142  C C    . ALA D 1 166 ? 123.370 71.357  86.172  1.00 0.00 ? 170 ALA D C    1  
ATOM 10143  O O    . ALA D 1 166 ? 123.527 70.814  85.074  1.00 0.00 ? 170 ALA D O    1  
ATOM 10144  C CB   . ALA D 1 166 ? 123.434 70.005  88.275  1.00 0.00 ? 170 ALA D CB   1  
ATOM 10145  H H    . ALA D 1 166 ? 121.906 68.897  86.702  1.00 0.00 ? 170 ALA D H    1  
ATOM 10146  H HA   . ALA D 1 166 ? 122.002 71.346  87.708  1.00 0.00 ? 170 ALA D HA   1  
ATOM 10147  H HB1  . ALA D 1 166 ? 123.816 70.678  88.862  1.00 0.00 ? 170 ALA D HB1  1  
ATOM 10148  H HB2  . ALA D 1 166 ? 122.912 69.377  88.800  1.00 0.00 ? 170 ALA D HB2  1  
ATOM 10149  H HB3  . ALA D 1 166 ? 124.148 69.531  87.820  1.00 0.00 ? 170 ALA D HB3  1  
ATOM 10150  N N    . PRO D 1 167 ? 123.963 72.502  86.471  1.00 0.00 ? 171 PRO D N    1  
ATOM 10151  C CA   . PRO D 1 167 ? 124.335 73.461  85.430  1.00 0.00 ? 171 PRO D CA   1  
ATOM 10152  C C    . PRO D 1 167 ? 125.690 73.153  84.804  1.00 0.00 ? 171 PRO D C    1  
ATOM 10153  O O    . PRO D 1 167 ? 126.099 73.742  83.807  1.00 0.00 ? 171 PRO D O    1  
ATOM 10154  C CB   . PRO D 1 167 ? 124.422 74.767  86.207  1.00 0.00 ? 171 PRO D CB   1  
ATOM 10155  C CG   . PRO D 1 167 ? 124.868 74.355  87.559  1.00 0.00 ? 171 PRO D CG   1  
ATOM 10156  C CD   . PRO D 1 167 ? 124.271 73.006  87.822  1.00 0.00 ? 171 PRO D CD   1  
ATOM 10157  H HA   . PRO D 1 167 ? 123.718 73.456  84.682  1.00 0.00 ? 171 PRO D HA   1  
ATOM 10158  H HB2  . PRO D 1 167 ? 125.050 75.382  85.798  1.00 0.00 ? 171 PRO D HB2  1  
ATOM 10159  H HB3  . PRO D 1 167 ? 123.564 75.217  86.239  1.00 0.00 ? 171 PRO D HB3  1  
ATOM 10160  H HG2  . PRO D 1 167 ? 125.836 74.316  87.604  1.00 0.00 ? 171 PRO D HG2  1  
ATOM 10161  H HG3  . PRO D 1 167 ? 124.578 74.995  88.227  1.00 0.00 ? 171 PRO D HG3  1  
ATOM 10162  H HD2  . PRO D 1 167 ? 124.892 72.425  88.288  1.00 0.00 ? 171 PRO D HD2  1  
ATOM 10163  H HD3  . PRO D 1 167 ? 123.474 73.068  88.372  1.00 0.00 ? 171 PRO D HD3  1  
ATOM 10164  N N    . GLY D 1 168 ? 126.388 72.207  85.431  1.00 0.00 ? 172 GLY D N    1  
ATOM 10165  C CA   . GLY D 1 168 ? 127.535 71.557  84.829  1.00 0.00 ? 172 GLY D CA   1  
ATOM 10166  C C    . GLY D 1 168 ? 127.932 70.204  85.380  1.00 0.00 ? 172 GLY D C    1  
ATOM 10167  O O    . GLY D 1 168 ? 128.557 70.134  86.442  1.00 0.00 ? 172 GLY D O    1  
ATOM 10168  H H    . GLY D 1 168 ? 126.202 71.926  86.222  1.00 0.00 ? 172 GLY D H    1  
ATOM 10169  H HA2  . GLY D 1 168 ? 127.359 71.455  83.880  1.00 0.00 ? 172 GLY D HA2  1  
ATOM 10170  H HA3  . GLY D 1 168 ? 128.297 72.152  84.914  1.00 0.00 ? 172 GLY D HA3  1  
ATOM 10171  N N    . THR D 1 169 ? 127.581 69.123  84.693  1.00 0.00 ? 173 THR D N    1  
ATOM 10172  C CA   . THR D 1 169 ? 128.100 67.813  85.049  1.00 0.00 ? 173 THR D CA   1  
ATOM 10173  C C    . THR D 1 169 ? 129.334 67.500  84.214  1.00 0.00 ? 173 THR D C    1  
ATOM 10174  O O    . THR D 1 169 ? 129.609 68.138  83.195  1.00 0.00 ? 173 THR D O    1  
ATOM 10175  C CB   . THR D 1 169 ? 127.049 66.708  84.874  1.00 0.00 ? 173 THR D CB   1  
ATOM 10176  O OG1  . THR D 1 169 ? 125.743 67.295  84.866  1.00 0.00 ? 173 THR D OG1  1  
ATOM 10177  C CG2  . THR D 1 169 ? 127.104 65.725  86.017  1.00 0.00 ? 173 THR D CG2  1  
ATOM 10178  H H    . THR D 1 169 ? 127.046 69.129  84.019  1.00 0.00 ? 173 THR D H    1  
ATOM 10179  H HA   . THR D 1 169 ? 128.339 67.838  85.989  1.00 0.00 ? 173 THR D HA   1  
ATOM 10180  H HB   . THR D 1 169 ? 127.233 66.248  84.040  1.00 0.00 ? 173 THR D HB   1  
ATOM 10181  H HG1  . THR D 1 169 ? 125.165 66.692  84.955  1.00 0.00 ? 173 THR D HG1  1  
ATOM 10182  H HG21 . THR D 1 169 ? 126.506 65.053  85.654  1.00 0.00 ? 173 THR D HG21 1  
ATOM 10183  H HG22 . THR D 1 169 ? 127.983 65.315  86.050  1.00 0.00 ? 173 THR D HG22 1  
ATOM 10184  H HG23 . THR D 1 169 ? 126.932 66.188  86.851  1.00 0.00 ? 173 THR D HG23 1  
ATOM 10185  N N    . VAL D 1 170 ? 130.080 66.504  84.678  1.00 0.00 ? 174 VAL D N    1  
ATOM 10186  C CA   . VAL D 1 170 ? 131.285 66.021  84.011  1.00 0.00 ? 174 VAL D CA   1  
ATOM 10187  C C    . VAL D 1 170 ? 131.099 64.541  83.693  1.00 0.00 ? 174 VAL D C    1  
ATOM 10188  O O    . VAL D 1 170 ? 130.140 63.927  84.186  1.00 0.00 ? 174 VAL D O    1  
ATOM 10189  C CB   . VAL D 1 170 ? 132.524 66.284  84.882  1.00 0.00 ? 174 VAL D CB   1  
ATOM 10190  C CG1  . VAL D 1 170 ? 132.484 67.697  85.414  1.00 0.00 ? 174 VAL D CG1  1  
ATOM 10191  C CG2  . VAL D 1 170 ? 132.582 65.303  86.031  1.00 0.00 ? 174 VAL D CG2  1  
ATOM 10192  H H    . VAL D 1 170 ? 129.897 66.082  85.404  1.00 0.00 ? 174 VAL D H    1  
ATOM 10193  H HA   . VAL D 1 170 ? 131.429 66.499  83.180  1.00 0.00 ? 174 VAL D HA   1  
ATOM 10194  H HB   . VAL D 1 170 ? 133.317 66.168  84.336  1.00 0.00 ? 174 VAL D HB   1  
ATOM 10195  H HG11 . VAL D 1 170 ? 132.374 67.677  86.377  1.00 0.00 ? 174 VAL D HG11 1  
ATOM 10196  H HG12 . VAL D 1 170 ? 133.312 68.150  85.192  1.00 0.00 ? 174 VAL D HG12 1  
ATOM 10197  H HG13 . VAL D 1 170 ? 131.739 68.173  85.014  1.00 0.00 ? 174 VAL D HG13 1  
ATOM 10198  H HG21 . VAL D 1 170 ? 133.131 65.670  86.742  1.00 0.00 ? 174 VAL D HG21 1  
ATOM 10199  H HG22 . VAL D 1 170 ? 131.686 65.142  86.365  1.00 0.00 ? 174 VAL D HG22 1  
ATOM 10200  H HG23 . VAL D 1 170 ? 132.968 64.467  85.724  1.00 0.00 ? 174 VAL D HG23 1  
ATOM 10201  N N    . PRO D 1 171 ? 131.958 63.929  82.852  1.00 0.00 ? 175 PRO D N    1  
ATOM 10202  C CA   . PRO D 1 171 ? 131.783 62.502  82.545  1.00 0.00 ? 175 PRO D CA   1  
ATOM 10203  C C    . PRO D 1 171 ? 132.177 61.624  83.715  1.00 0.00 ? 175 PRO D C    1  
ATOM 10204  O O    . PRO D 1 171 ? 133.365 61.512  84.033  1.00 0.00 ? 175 PRO D O    1  
ATOM 10205  C CB   . PRO D 1 171 ? 132.798 62.251  81.422  1.00 0.00 ? 175 PRO D CB   1  
ATOM 10206  C CG   . PRO D 1 171 ? 133.074 63.582  80.853  1.00 0.00 ? 175 PRO D CG   1  
ATOM 10207  C CD   . PRO D 1 171 ? 132.961 64.553  81.970  1.00 0.00 ? 175 PRO D CD   1  
ATOM 10208  H HA   . PRO D 1 171 ? 130.859 62.274  82.354  1.00 0.00 ? 175 PRO D HA   1  
ATOM 10209  H HB2  . PRO D 1 171 ? 133.607 61.842  81.766  1.00 0.00 ? 175 PRO D HB2  1  
ATOM 10210  H HB3  . PRO D 1 171 ? 132.439 61.650  80.751  1.00 0.00 ? 175 PRO D HB3  1  
ATOM 10211  H HG2  . PRO D 1 171 ? 133.959 63.611  80.459  1.00 0.00 ? 175 PRO D HG2  1  
ATOM 10212  H HG3  . PRO D 1 171 ? 132.442 63.793  80.147  1.00 0.00 ? 175 PRO D HG3  1  
ATOM 10213  H HD2  . PRO D 1 171 ? 133.809 64.679  82.424  1.00 0.00 ? 175 PRO D HD2  1  
ATOM 10214  H HD3  . PRO D 1 171 ? 132.674 65.426  81.660  1.00 0.00 ? 175 PRO D HD3  1  
ATOM 10215  N N    . ALA D 1 172 ? 131.175 60.993  84.327  1.00 0.00 ? 176 ALA D N    1  
ATOM 10216  C CA   . ALA D 1 172 ? 131.285 60.234  85.574  1.00 0.00 ? 176 ALA D CA   1  
ATOM 10217  C C    . ALA D 1 172 ? 131.830 61.081  86.721  1.00 0.00 ? 176 ALA D C    1  
ATOM 10218  O O    . ALA D 1 172 ? 131.526 62.268  86.827  1.00 0.00 ? 176 ALA D O    1  
ATOM 10219  C CB   . ALA D 1 172 ? 132.144 58.978  85.377  1.00 0.00 ? 176 ALA D CB   1  
ATOM 10220  H H    . ALA D 1 172 ? 130.375 60.996  84.012  1.00 0.00 ? 176 ALA D H    1  
ATOM 10221  H HA   . ALA D 1 172 ? 130.387 59.963  85.818  1.00 0.00 ? 176 ALA D HA   1  
ATOM 10222  H HB1  . ALA D 1 172 ? 132.728 58.861  86.144  1.00 0.00 ? 176 ALA D HB1  1  
ATOM 10223  H HB2  . ALA D 1 172 ? 131.569 58.202  85.289  1.00 0.00 ? 176 ALA D HB2  1  
ATOM 10224  H HB3  . ALA D 1 172 ? 132.680 59.074  84.575  1.00 0.00 ? 176 ALA D HB3  1  
ATOM 10225  N N    . PRO E 1 1   ? 99.964  123.434 94.810  1.00 0.00 ? 5   PRO E N    1  
ATOM 10226  C CA   . PRO E 1 1   ? 100.178 123.501 96.258  1.00 0.00 ? 5   PRO E CA   1  
ATOM 10227  C C    . PRO E 1 1   ? 101.618 123.018 96.391  1.00 0.00 ? 5   PRO E C    1  
ATOM 10228  O O    . PRO E 1 1   ? 102.401 123.163 95.453  1.00 0.00 ? 5   PRO E O    1  
ATOM 10229  C CB   . PRO E 1 1   ? 99.106  122.561 96.813  1.00 0.00 ? 5   PRO E CB   1  
ATOM 10230  C CG   . PRO E 1 1   ? 98.821  121.614 95.701  1.00 0.00 ? 5   PRO E CG   1  
ATOM 10231  C CD   . PRO E 1 1   ? 98.971  122.409 94.444  1.00 0.00 ? 5   PRO E CD   1  
ATOM 10232  H HA   . PRO E 1 1   ? 100.176 124.376 96.677  1.00 0.00 ? 5   PRO E HA   1  
ATOM 10233  H HB2  . PRO E 1 1   ? 99.422  122.093 97.602  1.00 0.00 ? 5   PRO E HB2  1  
ATOM 10234  H HB3  . PRO E 1 1   ? 98.310  123.050 97.073  1.00 0.00 ? 5   PRO E HB3  1  
ATOM 10235  H HG2  . PRO E 1 1   ? 99.436  120.864 95.716  1.00 0.00 ? 5   PRO E HG2  1  
ATOM 10236  H HG3  . PRO E 1 1   ? 97.926  121.247 95.777  1.00 0.00 ? 5   PRO E HG3  1  
ATOM 10237  H HD2  . PRO E 1 1   ? 99.279  121.859 93.707  1.00 0.00 ? 5   PRO E HD2  1  
ATOM 10238  H HD3  . PRO E 1 1   ? 98.130  122.807 94.170  1.00 0.00 ? 5   PRO E HD3  1  
ATOM 10239  N N    . ILE E 1 2   ? 101.961 122.456 97.546  1.00 0.00 ? 6   ILE E N    1  
ATOM 10240  C CA   . ILE E 1 2   ? 103.290 121.921 97.802  1.00 0.00 ? 6   ILE E CA   1  
ATOM 10241  C C    . ILE E 1 2   ? 103.369 120.545 97.160  1.00 0.00 ? 6   ILE E C    1  
ATOM 10242  O O    . ILE E 1 2   ? 102.467 119.716 97.336  1.00 0.00 ? 6   ILE E O    1  
ATOM 10243  C CB   . ILE E 1 2   ? 103.598 121.853 99.305  1.00 0.00 ? 6   ILE E CB   1  
ATOM 10244  C CG1  . ILE E 1 2   ? 103.179 123.155 99.987  1.00 0.00 ? 6   ILE E CG1  1  
ATOM 10245  C CG2  . ILE E 1 2   ? 105.071 121.607 99.532  1.00 0.00 ? 6   ILE E CG2  1  
ATOM 10246  C CD1  . ILE E 1 2   ? 102.645 123.067 101.447 1.00 0.00 ? 6   ILE E CD1  1  
ATOM 10247  H H    . ILE E 1 2   ? 101.420 122.375 98.210  1.00 0.00 ? 6   ILE E H    1  
ATOM 10248  H HA   . ILE E 1 2   ? 103.959 122.509 97.418  1.00 0.00 ? 6   ILE E HA   1  
ATOM 10249  H HB   . ILE E 1 2   ? 103.096 121.116 99.687  1.00 0.00 ? 6   ILE E HB   1  
ATOM 10250  H HG12 . ILE E 1 2   ? 103.942 123.753 99.985  1.00 0.00 ? 6   ILE E HG12 1  
ATOM 10251  H HG13 . ILE E 1 2   ? 102.492 123.569 99.443  1.00 0.00 ? 6   ILE E HG13 1  
ATOM 10252  H HG21 . ILE E 1 2   ? 105.544 121.668 98.687  1.00 0.00 ? 6   ILE E HG21 1  
ATOM 10253  H HG22 . ILE E 1 2   ? 105.419 122.273 100.146 1.00 0.00 ? 6   ILE E HG22 1  
ATOM 10254  H HG23 . ILE E 1 2   ? 105.196 120.722 99.910  1.00 0.00 ? 6   ILE E HG23 1  
ATOM 10255  H HD11 . ILE E 1 2   ? 102.875 122.203 101.824 1.00 0.00 ? 6   ILE E HD11 1  
ATOM 10256  H HD12 . ILE E 1 2   ? 103.047 123.770 101.981 1.00 0.00 ? 6   ILE E HD12 1  
ATOM 10257  H HD13 . ILE E 1 2   ? 101.681 123.173 101.446 1.00 0.00 ? 6   ILE E HD13 1  
ATOM 10258  N N    . MET E 1 3   ? 104.442 120.304 96.414  1.00 0.00 ? 7   MET E N    1  
ATOM 10259  C CA   . MET E 1 3   ? 104.630 119.059 95.691  1.00 0.00 ? 7   MET E CA   1  
ATOM 10260  C C    . MET E 1 3   ? 105.287 118.011 96.582  1.00 0.00 ? 7   MET E C    1  
ATOM 10261  O O    . MET E 1 3   ? 105.845 118.312 97.638  1.00 0.00 ? 7   MET E O    1  
ATOM 10262  C CB   . MET E 1 3   ? 105.476 119.295 94.443  1.00 0.00 ? 7   MET E CB   1  
ATOM 10263  C CG   . MET E 1 3   ? 104.725 119.159 93.127  1.00 0.00 ? 7   MET E CG   1  
ATOM 10264  S SD   . MET E 1 3   ? 102.966 119.516 93.251  1.00 0.00 ? 7   MET E SD   1  
ATOM 10265  C CE   . MET E 1 3   ? 102.970 121.303 93.363  1.00 0.00 ? 7   MET E CE   1  
ATOM 10266  H H    . MET E 1 3   ? 105.085 120.866 96.314  1.00 0.00 ? 7   MET E H    1  
ATOM 10267  H HA   . MET E 1 3   ? 103.758 118.729 95.422  1.00 0.00 ? 7   MET E HA   1  
ATOM 10268  H HB2  . MET E 1 3   ? 105.860 120.184 94.491  1.00 0.00 ? 7   MET E HB2  1  
ATOM 10269  H HB3  . MET E 1 3   ? 106.216 118.667 94.445  1.00 0.00 ? 7   MET E HB3  1  
ATOM 10270  H HG2  . MET E 1 3   ? 105.122 119.757 92.475  1.00 0.00 ? 7   MET E HG2  1  
ATOM 10271  H HG3  . MET E 1 3   ? 104.839 118.256 92.792  1.00 0.00 ? 7   MET E HG3  1  
ATOM 10272  H HE1  . MET E 1 3   ? 103.354 121.677 92.555  1.00 0.00 ? 7   MET E HE1  1  
ATOM 10273  H HE2  . MET E 1 3   ? 102.060 121.622 93.466  1.00 0.00 ? 7   MET E HE2  1  
ATOM 10274  H HE3  . MET E 1 3   ? 103.497 121.579 94.129  1.00 0.00 ? 7   MET E HE3  1  
ATOM 10275  N N    . GLY E 1 4   ? 105.233 116.759 96.127  1.00 0.00 ? 8   GLY E N    1  
ATOM 10276  C CA   . GLY E 1 4   ? 105.897 115.665 96.816  1.00 0.00 ? 8   GLY E CA   1  
ATOM 10277  C C    . GLY E 1 4   ? 107.406 115.786 96.879  1.00 0.00 ? 8   GLY E C    1  
ATOM 10278  O O    . GLY E 1 4   ? 108.006 115.346 97.865  1.00 0.00 ? 8   GLY E O    1  
ATOM 10279  H H    . GLY E 1 4   ? 104.811 116.525 95.415  1.00 0.00 ? 8   GLY E H    1  
ATOM 10280  H HA2  . GLY E 1 4   ? 105.551 115.609 97.721  1.00 0.00 ? 8   GLY E HA2  1  
ATOM 10281  H HA3  . GLY E 1 4   ? 105.670 114.833 96.373  1.00 0.00 ? 8   GLY E HA3  1  
ATOM 10282  N N    . GLN E 1 5   ? 108.025 116.361 95.852  1.00 0.00 ? 9   GLN E N    1  
ATOM 10283  C CA   . GLN E 1 5   ? 109.440 116.688 95.859  1.00 0.00 ? 9   GLN E CA   1  
ATOM 10284  C C    . GLN E 1 5   ? 109.732 117.979 96.607  1.00 0.00 ? 9   GLN E C    1  
ATOM 10285  O O    . GLN E 1 5   ? 110.879 118.201 97.010  1.00 0.00 ? 9   GLN E O    1  
ATOM 10286  C CB   . GLN E 1 5   ? 109.942 116.812 94.419  1.00 0.00 ? 9   GLN E CB   1  
ATOM 10287  C CG   . GLN E 1 5   ? 110.204 115.474 93.763  1.00 0.00 ? 9   GLN E CG   1  
ATOM 10288  C CD   . GLN E 1 5   ? 110.484 114.382 94.767  1.00 0.00 ? 9   GLN E CD   1  
ATOM 10289  O OE1  . GLN E 1 5   ? 111.617 114.213 95.216  1.00 0.00 ? 9   GLN E OE1  1  
ATOM 10290  N NE2  . GLN E 1 5   ? 109.454 113.623 95.120  1.00 0.00 ? 9   GLN E NE2  1  
ATOM 10291  H H    . GLN E 1 5   ? 107.625 116.573 95.121  1.00 0.00 ? 9   GLN E H    1  
ATOM 10292  H HA   . GLN E 1 5   ? 109.902 115.971 96.321  1.00 0.00 ? 9   GLN E HA   1  
ATOM 10293  H HB2  . GLN E 1 5   ? 109.288 117.300 93.895  1.00 0.00 ? 9   GLN E HB2  1  
ATOM 10294  H HB3  . GLN E 1 5   ? 110.760 117.334 94.412  1.00 0.00 ? 9   GLN E HB3  1  
ATOM 10295  H HG2  . GLN E 1 5   ? 109.436 115.225 93.226  1.00 0.00 ? 9   GLN E HG2  1  
ATOM 10296  H HG3  . GLN E 1 5   ? 110.959 115.556 93.160  1.00 0.00 ? 9   GLN E HG3  1  
ATOM 10297  H HE21 . GLN E 1 5   ? 108.676 113.771 94.784  1.00 0.00 ? 9   GLN E HE21 1  
ATOM 10298  H HE22 . GLN E 1 5   ? 109.564 112.983 95.684  1.00 0.00 ? 9   GLN E HE22 1  
ATOM 10299  N N    . ASP E 1 6   ? 108.717 118.817 96.818  1.00 0.00 ? 10  ASP E N    1  
ATOM 10300  C CA   . ASP E 1 6   ? 108.908 120.151 97.369  1.00 0.00 ? 10  ASP E CA   1  
ATOM 10301  C C    . ASP E 1 6   ? 109.371 120.161 98.817  1.00 0.00 ? 10  ASP E C    1  
ATOM 10302  O O    . ASP E 1 6   ? 110.244 120.963 99.150  1.00 0.00 ? 10  ASP E O    1  
ATOM 10303  C CB   . ASP E 1 6   ? 107.615 120.967 97.268  1.00 0.00 ? 10  ASP E CB   1  
ATOM 10304  C CG   . ASP E 1 6   ? 107.862 122.431 96.964  1.00 0.00 ? 10  ASP E CG   1  
ATOM 10305  O OD1  . ASP E 1 6   ? 108.255 123.176 97.887  1.00 0.00 ? 10  ASP E OD1  1  
ATOM 10306  O OD2  . ASP E 1 6   ? 107.641 122.841 95.805  1.00 0.00 ? 10  ASP E OD2  1  
ATOM 10307  H H    . ASP E 1 6   ? 107.897 118.624 96.644  1.00 0.00 ? 10  ASP E H    1  
ATOM 10308  H HA   . ASP E 1 6   ? 109.614 120.548 96.835  1.00 0.00 ? 10  ASP E HA   1  
ATOM 10309  H HB2  . ASP E 1 6   ? 107.052 120.588 96.575  1.00 0.00 ? 10  ASP E HB2  1  
ATOM 10310  H HB3  . ASP E 1 6   ? 107.126 120.893 98.103  1.00 0.00 ? 10  ASP E HB3  1  
ATOM 10311  N N    . VAL E 1 7   ? 108.807 119.332 99.690  1.00 0.00 ? 11  VAL E N    1  
ATOM 10312  C CA   . VAL E 1 7   ? 109.172 119.318 101.104 1.00 0.00 ? 11  VAL E CA   1  
ATOM 10313  C C    . VAL E 1 7   ? 110.270 118.287 101.294 1.00 0.00 ? 11  VAL E C    1  
ATOM 10314  O O    . VAL E 1 7   ? 110.041 117.091 101.080 1.00 0.00 ? 11  VAL E O    1  
ATOM 10315  C CB   . VAL E 1 7   ? 107.975 118.986 102.005 1.00 0.00 ? 11  VAL E CB   1  
ATOM 10316  C CG1  . VAL E 1 7   ? 108.377 119.076 103.465 1.00 0.00 ? 11  VAL E CG1  1  
ATOM 10317  C CG2  . VAL E 1 7   ? 106.799 119.889 101.710 1.00 0.00 ? 11  VAL E CG2  1  
ATOM 10318  H H    . VAL E 1 7   ? 108.201 118.760 99.479  1.00 0.00 ? 11  VAL E H    1  
ATOM 10319  H HA   . VAL E 1 7   ? 109.479 120.202 101.359 1.00 0.00 ? 11  VAL E HA   1  
ATOM 10320  H HB   . VAL E 1 7   ? 107.696 118.077 101.817 1.00 0.00 ? 11  VAL E HB   1  
ATOM 10321  H HG11 . VAL E 1 7   ? 107.608 118.888 104.025 1.00 0.00 ? 11  VAL E HG11 1  
ATOM 10322  H HG12 . VAL E 1 7   ? 109.077 118.430 103.648 1.00 0.00 ? 11  VAL E HG12 1  
ATOM 10323  H HG13 . VAL E 1 7   ? 108.704 119.969 103.655 1.00 0.00 ? 11  VAL E HG13 1  
ATOM 10324  H HG21 . VAL E 1 7   ? 107.111 120.799 101.592 1.00 0.00 ? 11  VAL E HG21 1  
ATOM 10325  H HG22 . VAL E 1 7   ? 106.357 119.591 100.900 1.00 0.00 ? 11  VAL E HG22 1  
ATOM 10326  H HG23 . VAL E 1 7   ? 106.172 119.856 102.450 1.00 0.00 ? 11  VAL E HG23 1  
ATOM 10327  N N    . LYS E 1 8   ? 111.456 118.737 101.702 1.00 0.00 ? 12  LYS E N    1  
ATOM 10328  C CA   . LYS E 1 8   ? 112.543 117.809 101.987 1.00 0.00 ? 12  LYS E CA   1  
ATOM 10329  C C    . LYS E 1 8   ? 113.080 118.034 103.392 1.00 0.00 ? 12  LYS E C    1  
ATOM 10330  O O    . LYS E 1 8   ? 112.925 119.107 103.982 1.00 0.00 ? 12  LYS E O    1  
ATOM 10331  C CB   . LYS E 1 8   ? 113.670 117.896 100.945 1.00 0.00 ? 12  LYS E CB   1  
ATOM 10332  C CG   . LYS E 1 8   ? 114.198 116.519 100.551 1.00 0.00 ? 12  LYS E CG   1  
ATOM 10333  C CD   . LYS E 1 8   ? 115.124 116.537 99.357  1.00 0.00 ? 12  LYS E CD   1  
ATOM 10334  C CE   . LYS E 1 8   ? 114.347 116.629 98.068  1.00 0.00 ? 12  LYS E CE   1  
ATOM 10335  N NZ   . LYS E 1 8   ? 115.231 117.053 96.952  1.00 0.00 ? 12  LYS E NZ   1  
ATOM 10336  H H    . LYS E 1 8   ? 111.649 119.567 101.818 1.00 0.00 ? 12  LYS E H    1  
ATOM 10337  H HA   . LYS E 1 8   ? 112.179 116.912 101.934 1.00 0.00 ? 12  LYS E HA   1  
ATOM 10338  H HB2  . LYS E 1 8   ? 113.343 118.353 100.154 1.00 0.00 ? 12  LYS E HB2  1  
ATOM 10339  H HB3  . LYS E 1 8   ? 114.398 118.430 101.302 1.00 0.00 ? 12  LYS E HB3  1  
ATOM 10340  H HG2  . LYS E 1 8   ? 114.668 116.135 101.307 1.00 0.00 ? 12  LYS E HG2  1  
ATOM 10341  H HG3  . LYS E 1 8   ? 113.446 115.938 100.358 1.00 0.00 ? 12  LYS E HG3  1  
ATOM 10342  H HD2  . LYS E 1 8   ? 115.731 117.289 99.427  1.00 0.00 ? 12  LYS E HD2  1  
ATOM 10343  H HD3  . LYS E 1 8   ? 115.667 115.733 99.353  1.00 0.00 ? 12  LYS E HD3  1  
ATOM 10344  H HE2  . LYS E 1 8   ? 113.948 115.769 97.862  1.00 0.00 ? 12  LYS E HE2  1  
ATOM 10345  H HE3  . LYS E 1 8   ? 113.619 117.262 98.168  1.00 0.00 ? 12  LYS E HE3  1  
ATOM 10346  H HZ1  . LYS E 1 8   ? 115.910 117.530 97.275  1.00 0.00 ? 12  LYS E HZ1  1  
ATOM 10347  H HZ2  . LYS E 1 8   ? 115.547 116.334 96.533  1.00 0.00 ? 12  LYS E HZ2  1  
ATOM 10348  H HZ3  . LYS E 1 8   ? 114.768 117.550 96.378  1.00 0.00 ? 12  LYS E HZ3  1  
ATOM 10349  N N    . TYR E 1 9   ? 113.698 116.985 103.930 1.00 0.00 ? 13  TYR E N    1  
ATOM 10350  C CA   . TYR E 1 9   ? 113.995 116.871 105.357 1.00 0.00 ? 13  TYR E CA   1  
ATOM 10351  C C    . TYR E 1 9   ? 115.503 116.720 105.534 1.00 0.00 ? 13  TYR E C    1  
ATOM 10352  O O    . TYR E 1 9   ? 116.117 115.798 104.994 1.00 0.00 ? 13  TYR E O    1  
ATOM 10353  C CB   . TYR E 1 9   ? 113.257 115.681 105.982 1.00 0.00 ? 13  TYR E CB   1  
ATOM 10354  C CG   . TYR E 1 9   ? 111.746 115.696 105.852 1.00 0.00 ? 13  TYR E CG   1  
ATOM 10355  C CD1  . TYR E 1 9   ? 110.926 115.809 106.962 1.00 0.00 ? 13  TYR E CD1  1  
ATOM 10356  C CD2  . TYR E 1 9   ? 111.144 115.568 104.610 1.00 0.00 ? 13  TYR E CD2  1  
ATOM 10357  C CE1  . TYR E 1 9   ? 109.561 115.824 106.837 1.00 0.00 ? 13  TYR E CE1  1  
ATOM 10358  C CE2  . TYR E 1 9   ? 109.773 115.567 104.481 1.00 0.00 ? 13  TYR E CE2  1  
ATOM 10359  C CZ   . TYR E 1 9   ? 108.988 115.698 105.602 1.00 0.00 ? 13  TYR E CZ   1  
ATOM 10360  O OH   . TYR E 1 9   ? 107.618 115.700 105.504 1.00 0.00 ? 13  TYR E OH   1  
ATOM 10361  H H    . TYR E 1 9   ? 113.961 116.309 103.468 1.00 0.00 ? 13  TYR E H    1  
ATOM 10362  H HA   . TYR E 1 9   ? 113.690 117.671 105.811 1.00 0.00 ? 13  TYR E HA   1  
ATOM 10363  H HB2  . TYR E 1 9   ? 113.591 114.866 105.577 1.00 0.00 ? 13  TYR E HB2  1  
ATOM 10364  H HB3  . TYR E 1 9   ? 113.483 115.643 106.925 1.00 0.00 ? 13  TYR E HB3  1  
ATOM 10365  H HD1  . TYR E 1 9   ? 111.308 115.876 107.808 1.00 0.00 ? 13  TYR E HD1  1  
ATOM 10366  H HD2  . TYR E 1 9   ? 111.674 115.482 103.851 1.00 0.00 ? 13  TYR E HD2  1  
ATOM 10367  H HE1  . TYR E 1 9   ? 109.025 115.919 107.591 1.00 0.00 ? 13  TYR E HE1  1  
ATOM 10368  H HE2  . TYR E 1 9   ? 109.382 115.479 103.643 1.00 0.00 ? 13  TYR E HE2  1  
ATOM 10369  H HH   . TYR E 1 9   ? 107.386 115.298 104.804 1.00 0.00 ? 13  TYR E HH   1  
ATOM 10370  N N    . LEU E 1 10  ? 116.098 117.626 106.302 1.00 0.00 ? 14  LEU E N    1  
ATOM 10371  C CA   . LEU E 1 10  ? 117.512 117.523 106.636 1.00 0.00 ? 14  LEU E CA   1  
ATOM 10372  C C    . LEU E 1 10  ? 117.672 117.370 108.143 1.00 0.00 ? 14  LEU E C    1  
ATOM 10373  O O    . LEU E 1 10  ? 116.867 117.901 108.918 1.00 0.00 ? 14  LEU E O    1  
ATOM 10374  C CB   . LEU E 1 10  ? 118.278 118.746 106.140 1.00 0.00 ? 14  LEU E CB   1  
ATOM 10375  C CG   . LEU E 1 10  ? 117.686 120.131 106.395 1.00 0.00 ? 14  LEU E CG   1  
ATOM 10376  C CD1  . LEU E 1 10  ? 118.763 121.077 106.883 1.00 0.00 ? 14  LEU E CD1  1  
ATOM 10377  C CD2  . LEU E 1 10  ? 117.064 120.675 105.133 1.00 0.00 ? 14  LEU E CD2  1  
ATOM 10378  H H    . LEU E 1 10  ? 115.699 118.309 106.641 1.00 0.00 ? 14  LEU E H    1  
ATOM 10379  H HA   . LEU E 1 10  ? 117.882 116.741 106.195 1.00 0.00 ? 14  LEU E HA   1  
ATOM 10380  H HB2  . LEU E 1 10  ? 119.161 118.725 106.542 1.00 0.00 ? 14  LEU E HB2  1  
ATOM 10381  H HB3  . LEU E 1 10  ? 118.400 118.650 105.183 1.00 0.00 ? 14  LEU E HB3  1  
ATOM 10382  H HG   . LEU E 1 10  ? 116.999 120.052 107.075 1.00 0.00 ? 14  LEU E HG   1  
ATOM 10383  H HD11 . LEU E 1 10  ? 118.937 121.746 106.204 1.00 0.00 ? 14  LEU E HD11 1  
ATOM 10384  H HD12 . LEU E 1 10  ? 118.466 121.512 107.697 1.00 0.00 ? 14  LEU E HD12 1  
ATOM 10385  H HD13 . LEU E 1 10  ? 119.576 120.578 107.061 1.00 0.00 ? 14  LEU E HD13 1  
ATOM 10386  H HD21 . LEU E 1 10  ? 116.471 121.409 105.355 1.00 0.00 ? 14  LEU E HD21 1  
ATOM 10387  H HD22 . LEU E 1 10  ? 117.762 120.992 104.539 1.00 0.00 ? 14  LEU E HD22 1  
ATOM 10388  H HD23 . LEU E 1 10  ? 116.560 119.974 104.692 1.00 0.00 ? 14  LEU E HD23 1  
ATOM 10389  N N    . PHE E 1 11  ? 118.709 116.652 108.559 1.00 0.00 ? 15  PHE E N    1  
ATOM 10390  C CA   . PHE E 1 11  ? 119.034 116.490 109.967 1.00 0.00 ? 15  PHE E CA   1  
ATOM 10391  C C    . PHE E 1 11  ? 120.435 117.020 110.241 1.00 0.00 ? 15  PHE E C    1  
ATOM 10392  O O    . PHE E 1 11  ? 121.347 116.883 109.421 1.00 0.00 ? 15  PHE E O    1  
ATOM 10393  C CB   . PHE E 1 11  ? 118.961 115.021 110.391 1.00 0.00 ? 15  PHE E CB   1  
ATOM 10394  C CG   . PHE E 1 11  ? 117.996 114.192 109.592 1.00 0.00 ? 15  PHE E CG   1  
ATOM 10395  C CD1  . PHE E 1 11  ? 118.433 113.332 108.597 1.00 0.00 ? 15  PHE E CD1  1  
ATOM 10396  C CD2  . PHE E 1 11  ? 116.637 114.280 109.846 1.00 0.00 ? 15  PHE E CD2  1  
ATOM 10397  C CE1  . PHE E 1 11  ? 117.533 112.574 107.878 1.00 0.00 ? 15  PHE E CE1  1  
ATOM 10398  C CE2  . PHE E 1 11  ? 115.733 113.525 109.126 1.00 0.00 ? 15  PHE E CE2  1  
ATOM 10399  C CZ   . PHE E 1 11  ? 116.184 112.673 108.141 1.00 0.00 ? 15  PHE E CZ   1  
ATOM 10400  H H    . PHE E 1 11  ? 119.246 116.242 108.028 1.00 0.00 ? 15  PHE E H    1  
ATOM 10401  H HA   . PHE E 1 11  ? 118.384 116.993 110.481 1.00 0.00 ? 15  PHE E HA   1  
ATOM 10402  H HB2  . PHE E 1 11  ? 119.846 114.629 110.315 1.00 0.00 ? 15  PHE E HB2  1  
ATOM 10403  H HB3  . PHE E 1 11  ? 118.710 114.977 111.327 1.00 0.00 ? 15  PHE E HB3  1  
ATOM 10404  H HD1  . PHE E 1 11  ? 119.342 113.267 108.412 1.00 0.00 ? 15  PHE E HD1  1  
ATOM 10405  H HD2  . PHE E 1 11  ? 116.329 114.854 110.510 1.00 0.00 ? 15  PHE E HD2  1  
ATOM 10406  H HE1  . PHE E 1 11  ? 117.837 111.996 107.217 1.00 0.00 ? 15  PHE E HE1  1  
ATOM 10407  H HE2  . PHE E 1 11  ? 114.823 113.591 109.306 1.00 0.00 ? 15  PHE E HE2  1  
ATOM 10408  H HZ   . PHE E 1 11  ? 115.576 112.165 107.653 1.00 0.00 ? 15  PHE E HZ   1  
ATOM 10409  N N    . GLN E 1 12  ? 120.600 117.627 111.413 1.00 0.00 ? 16  GLN E N    1  
ATOM 10410  C CA   . GLN E 1 12  ? 121.930 117.997 111.874 1.00 0.00 ? 16  GLN E CA   1  
ATOM 10411  C C    . GLN E 1 12  ? 122.173 117.360 113.234 1.00 0.00 ? 16  GLN E C    1  
ATOM 10412  O O    . GLN E 1 12  ? 121.366 117.514 114.156 1.00 0.00 ? 16  GLN E O    1  
ATOM 10413  C CB   . GLN E 1 12  ? 122.100 119.521 111.942 1.00 0.00 ? 16  GLN E CB   1  
ATOM 10414  C CG   . GLN E 1 12  ? 123.542 120.001 111.842 1.00 0.00 ? 16  GLN E CG   1  
ATOM 10415  C CD   . GLN E 1 12  ? 123.667 121.499 111.692 1.00 0.00 ? 16  GLN E CD   1  
ATOM 10416  O OE1  . GLN E 1 12  ? 124.582 121.994 111.042 1.00 0.00 ? 16  GLN E OE1  1  
ATOM 10417  N NE2  . GLN E 1 12  ? 122.741 122.231 112.295 1.00 0.00 ? 16  GLN E NE2  1  
ATOM 10418  H H    . GLN E 1 12  ? 119.961 117.830 111.950 1.00 0.00 ? 16  GLN E H    1  
ATOM 10419  H HA   . GLN E 1 12  ? 122.585 117.670 111.238 1.00 0.00 ? 16  GLN E HA   1  
ATOM 10420  H HB2  . GLN E 1 12  ? 121.586 119.924 111.226 1.00 0.00 ? 16  GLN E HB2  1  
ATOM 10421  H HB3  . GLN E 1 12  ? 121.722 119.839 112.777 1.00 0.00 ? 16  GLN E HB3  1  
ATOM 10422  H HG2  . GLN E 1 12  ? 124.025 119.721 112.635 1.00 0.00 ? 16  GLN E HG2  1  
ATOM 10423  H HG3  . GLN E 1 12  ? 123.968 119.570 111.084 1.00 0.00 ? 16  GLN E HG3  1  
ATOM 10424  H HE21 . GLN E 1 12  ? 122.114 121.849 112.743 1.00 0.00 ? 16  GLN E HE21 1  
ATOM 10425  H HE22 . GLN E 1 12  ? 122.768 123.089 112.239 1.00 0.00 ? 16  GLN E HE22 1  
ATOM 10426  N N    . SER E 1 13  ? 123.285 116.635 113.340 1.00 0.00 ? 17  SER E N    1  
ATOM 10427  C CA   . SER E 1 13  ? 123.659 115.978 114.583 1.00 0.00 ? 17  SER E CA   1  
ATOM 10428  C C    . SER E 1 13  ? 124.109 116.996 115.626 1.00 0.00 ? 17  SER E C    1  
ATOM 10429  O O    . SER E 1 13  ? 124.689 118.036 115.304 1.00 0.00 ? 17  SER E O    1  
ATOM 10430  C CB   . SER E 1 13  ? 124.776 114.968 114.332 1.00 0.00 ? 17  SER E CB   1  
ATOM 10431  O OG   . SER E 1 13  ? 125.885 115.581 113.707 1.00 0.00 ? 17  SER E OG   1  
ATOM 10432  H H    . SER E 1 13  ? 123.840 116.512 112.695 1.00 0.00 ? 17  SER E H    1  
ATOM 10433  H HA   . SER E 1 13  ? 122.878 115.514 114.923 1.00 0.00 ? 17  SER E HA   1  
ATOM 10434  H HB2  . SER E 1 13  ? 125.053 114.571 115.173 1.00 0.00 ? 17  SER E HB2  1  
ATOM 10435  H HB3  . SER E 1 13  ? 124.444 114.247 113.774 1.00 0.00 ? 17  SER E HB3  1  
ATOM 10436  H HG   . SER E 1 13  ? 126.178 116.198 114.196 1.00 0.00 ? 17  SER E HG   1  
ATOM 10437  N N    . ILE E 1 14  ? 123.841 116.678 116.894 1.00 0.00 ? 18  ILE E N    1  
ATOM 10438  C CA   . ILE E 1 14  ? 124.214 117.574 117.981 1.00 0.00 ? 18  ILE E CA   1  
ATOM 10439  C C    . ILE E 1 14  ? 125.719 117.617 118.192 1.00 0.00 ? 18  ILE E C    1  
ATOM 10440  O O    . ILE E 1 14  ? 126.287 118.702 118.363 1.00 0.00 ? 18  ILE E O    1  
ATOM 10441  C CB   . ILE E 1 14  ? 123.511 117.168 119.290 1.00 0.00 ? 18  ILE E CB   1  
ATOM 10442  C CG1  . ILE E 1 14  ? 123.510 115.646 119.445 1.00 0.00 ? 18  ILE E CG1  1  
ATOM 10443  C CG2  . ILE E 1 14  ? 122.095 117.718 119.333 1.00 0.00 ? 18  ILE E CG2  1  
ATOM 10444  C CD1  . ILE E 1 14  ? 123.741 115.154 120.870 1.00 0.00 ? 18  ILE E CD1  1  
ATOM 10445  H H    . ILE E 1 14  ? 123.447 115.954 117.141 1.00 0.00 ? 18  ILE E H    1  
ATOM 10446  H HA   . ILE E 1 14  ? 123.923 118.464 117.727 1.00 0.00 ? 18  ILE E HA   1  
ATOM 10447  H HB   . ILE E 1 14  ? 124.003 117.549 120.035 1.00 0.00 ? 18  ILE E HB   1  
ATOM 10448  H HG12 . ILE E 1 14  ? 122.661 115.302 119.130 1.00 0.00 ? 18  ILE E HG12 1  
ATOM 10449  H HG13 . ILE E 1 14  ? 124.199 115.274 118.871 1.00 0.00 ? 18  ILE E HG13 1  
ATOM 10450  H HG21 . ILE E 1 14  ? 121.878 117.983 120.241 1.00 0.00 ? 18  ILE E HG21 1  
ATOM 10451  H HG22 . ILE E 1 14  ? 122.030 118.489 118.748 1.00 0.00 ? 18  ILE E HG22 1  
ATOM 10452  H HG23 . ILE E 1 14  ? 121.473 117.035 119.037 1.00 0.00 ? 18  ILE E HG23 1  
ATOM 10453  H HD11 . ILE E 1 14  ? 122.893 115.112 121.338 1.00 0.00 ? 18  ILE E HD11 1  
ATOM 10454  H HD12 . ILE E 1 14  ? 124.142 114.271 120.846 1.00 0.00 ? 18  ILE E HD12 1  
ATOM 10455  H HD13 . ILE E 1 14  ? 124.335 115.767 121.331 1.00 0.00 ? 18  ILE E HD13 1  
ATOM 10456  N N    . ASP E 1 15  ? 126.387 116.465 118.182 1.00 0.00 ? 19  ASP E N    1  
ATOM 10457  C CA   . ASP E 1 15  ? 127.792 116.384 118.542 1.00 0.00 ? 19  ASP E CA   1  
ATOM 10458  C C    . ASP E 1 15  ? 128.713 116.930 117.458 1.00 0.00 ? 19  ASP E C    1  
ATOM 10459  O O    . ASP E 1 15  ? 129.837 117.339 117.767 1.00 0.00 ? 19  ASP E O    1  
ATOM 10460  C CB   . ASP E 1 15  ? 128.158 114.922 118.846 1.00 0.00 ? 19  ASP E CB   1  
ATOM 10461  C CG   . ASP E 1 15  ? 127.175 114.242 119.786 1.00 0.00 ? 19  ASP E CG   1  
ATOM 10462  O OD1  . ASP E 1 15  ? 126.931 114.761 120.895 1.00 0.00 ? 19  ASP E OD1  1  
ATOM 10463  O OD2  . ASP E 1 15  ? 126.643 113.178 119.405 1.00 0.00 ? 19  ASP E OD2  1  
ATOM 10464  H H    . ASP E 1 15  ? 126.035 115.711 117.965 1.00 0.00 ? 19  ASP E H    1  
ATOM 10465  H HA   . ASP E 1 15  ? 127.920 116.938 119.327 1.00 0.00 ? 19  ASP E HA   1  
ATOM 10466  H HB2  . ASP E 1 15  ? 128.199 114.424 118.014 1.00 0.00 ? 19  ASP E HB2  1  
ATOM 10467  H HB3  . ASP E 1 15  ? 129.045 114.891 119.238 1.00 0.00 ? 19  ASP E HB3  1  
ATOM 10468  N N    . ALA E 1 16  ? 128.270 116.957 116.202 1.00 0.00 ? 20  ALA E N    1  
ATOM 10469  C CA   . ALA E 1 16  ? 129.159 117.373 115.123 1.00 0.00 ? 20  ALA E CA   1  
ATOM 10470  C C    . ALA E 1 16  ? 129.715 118.771 115.367 1.00 0.00 ? 20  ALA E C    1  
ATOM 10471  O O    . ALA E 1 16  ? 130.923 118.994 115.227 1.00 0.00 ? 20  ALA E O    1  
ATOM 10472  C CB   . ALA E 1 16  ? 128.421 117.311 113.787 1.00 0.00 ? 20  ALA E CB   1  
ATOM 10473  H H    . ALA E 1 16  ? 127.474 116.743 115.958 1.00 0.00 ? 20  ALA E H    1  
ATOM 10474  H HA   . ALA E 1 16  ? 129.911 116.761 115.098 1.00 0.00 ? 20  ALA E HA   1  
ATOM 10475  H HB1  . ALA E 1 16  ? 127.465 117.275 113.945 1.00 0.00 ? 20  ALA E HB1  1  
ATOM 10476  H HB2  . ALA E 1 16  ? 128.632 118.099 113.263 1.00 0.00 ? 20  ALA E HB2  1  
ATOM 10477  H HB3  . ALA E 1 16  ? 128.698 116.518 113.301 1.00 0.00 ? 20  ALA E HB3  1  
ATOM 10478  N N    . ALA E 1 17  ? 128.838 119.713 115.746 1.00 0.00 ? 21  ALA E N    1  
ATOM 10479  C CA   . ALA E 1 17  ? 129.143 121.146 115.897 1.00 0.00 ? 21  ALA E CA   1  
ATOM 10480  C C    . ALA E 1 17  ? 129.673 121.754 114.598 1.00 0.00 ? 21  ALA E C    1  
ATOM 10481  O O    . ALA E 1 17  ? 130.666 122.483 114.585 1.00 0.00 ? 21  ALA E O    1  
ATOM 10482  C CB   . ALA E 1 17  ? 130.108 121.405 117.061 1.00 0.00 ? 21  ALA E CB   1  
ATOM 10483  H H    . ALA E 1 17  ? 128.018 119.527 115.928 1.00 0.00 ? 21  ALA E H    1  
ATOM 10484  H HA   . ALA E 1 17  ? 128.306 121.589 116.108 1.00 0.00 ? 21  ALA E HA   1  
ATOM 10485  H HB1  . ALA E 1 17  ? 130.925 121.803 116.722 1.00 0.00 ? 21  ALA E HB1  1  
ATOM 10486  H HB2  . ALA E 1 17  ? 129.694 122.009 117.697 1.00 0.00 ? 21  ALA E HB2  1  
ATOM 10487  H HB3  . ALA E 1 17  ? 130.316 120.566 117.501 1.00 0.00 ? 21  ALA E HB3  1  
ATOM 10488  N N    . THR E 1 18  ? 128.996 121.446 113.493 1.00 0.00 ? 22  THR E N    1  
ATOM 10489  C CA   . THR E 1 18  ? 129.362 121.937 112.172 1.00 0.00 ? 22  THR E CA   1  
ATOM 10490  C C    . THR E 1 18  ? 128.307 122.922 111.696 1.00 0.00 ? 22  THR E C    1  
ATOM 10491  O O    . THR E 1 18  ? 127.184 122.929 112.209 1.00 0.00 ? 22  THR E O    1  
ATOM 10492  C CB   . THR E 1 18  ? 129.494 120.791 111.162 1.00 0.00 ? 22  THR E CB   1  
ATOM 10493  O OG1  . THR E 1 18  ? 129.852 121.318 109.879 1.00 0.00 ? 22  THR E OG1  1  
ATOM 10494  C CG2  . THR E 1 18  ? 128.194 120.019 111.044 1.00 0.00 ? 22  THR E CG2  1  
ATOM 10495  H H    . THR E 1 18  ? 128.302 120.938 113.494 1.00 0.00 ? 22  THR E H    1  
ATOM 10496  H HA   . THR E 1 18  ? 130.225 122.376 112.237 1.00 0.00 ? 22  THR E HA   1  
ATOM 10497  H HB   . THR E 1 18  ? 130.185 120.187 111.475 1.00 0.00 ? 22  THR E HB   1  
ATOM 10498  H HG1  . THR E 1 18  ? 129.572 120.805 109.277 1.00 0.00 ? 22  THR E HG1  1  
ATOM 10499  H HG21 . THR E 1 18  ? 127.946 119.420 110.323 1.00 0.00 ? 22  THR E HG21 1  
ATOM 10500  H HG22 . THR E 1 18  ? 127.959 119.646 111.909 1.00 0.00 ? 22  THR E HG22 1  
ATOM 10501  H HG23 . THR E 1 18  ? 127.489 120.615 110.748 1.00 0.00 ? 22  THR E HG23 1  
ATOM 10502  N N    . GLY E 1 19  ? 128.665 123.738 110.710 1.00 0.00 ? 23  GLY E N    1  
ATOM 10503  C CA   . GLY E 1 19  ? 127.757 124.738 110.183 1.00 0.00 ? 23  GLY E CA   1  
ATOM 10504  C C    . GLY E 1 19  ? 126.920 124.249 109.019 1.00 0.00 ? 23  GLY E C    1  
ATOM 10505  O O    . GLY E 1 19  ? 126.645 125.007 108.085 1.00 0.00 ? 23  GLY E O    1  
ATOM 10506  H H    . GLY E 1 19  ? 129.437 123.725 110.332 1.00 0.00 ? 23  GLY E H    1  
ATOM 10507  H HA2  . GLY E 1 19  ? 127.166 125.034 110.894 1.00 0.00 ? 23  GLY E HA2  1  
ATOM 10508  H HA3  . GLY E 1 19  ? 128.269 125.512 109.900 1.00 0.00 ? 23  GLY E HA3  1  
ATOM 10509  N N    . SER E 1 20  ? 126.513 122.982 109.058 1.00 0.00 ? 24  SER E N    1  
ATOM 10510  C CA   . SER E 1 20  ? 125.745 122.407 107.961 1.00 0.00 ? 24  SER E CA   1  
ATOM 10511  C C    . SER E 1 20  ? 125.132 121.066 108.342 1.00 0.00 ? 24  SER E C    1  
ATOM 10512  O O    . SER E 1 20  ? 125.756 120.285 109.069 1.00 0.00 ? 24  SER E O    1  
ATOM 10513  C CB   . SER E 1 20  ? 126.628 122.244 106.722 1.00 0.00 ? 24  SER E CB   1  
ATOM 10514  O OG   . SER E 1 20  ? 127.362 121.034 106.777 1.00 0.00 ? 24  SER E OG   1  
ATOM 10515  H H    . SER E 1 20  ? 126.672 122.442 109.708 1.00 0.00 ? 24  SER E H    1  
ATOM 10516  H HA   . SER E 1 20  ? 125.019 123.020 107.761 1.00 0.00 ? 24  SER E HA   1  
ATOM 10517  H HB2  . SER E 1 20  ? 126.077 122.256 105.924 1.00 0.00 ? 24  SER E HB2  1  
ATOM 10518  H HB3  . SER E 1 20  ? 127.240 122.994 106.655 1.00 0.00 ? 24  SER E HB3  1  
ATOM 10519  H HG   . SER E 1 20  ? 127.136 120.540 106.137 1.00 0.00 ? 24  SER E HG   1  
ATOM 10520  N N    . ALA E 1 21  ? 123.915 120.801 107.848 1.00 0.00 ? 25  ALA E N    1  
ATOM 10521  C CA   . ALA E 1 21  ? 123.070 119.647 108.159 1.00 0.00 ? 25  ALA E CA   1  
ATOM 10522  C C    . ALA E 1 21  ? 123.023 118.635 107.017 1.00 0.00 ? 25  ALA E C    1  
ATOM 10523  O O    . ALA E 1 21  ? 122.533 118.966 105.930 1.00 0.00 ? 25  ALA E O    1  
ATOM 10524  C CB   . ALA E 1 21  ? 121.652 120.094 108.524 1.00 0.00 ? 25  ALA E CB   1  
ATOM 10525  H H    . ALA E 1 21  ? 123.539 121.331 107.284 1.00 0.00 ? 25  ALA E H    1  
ATOM 10526  H HA   . ALA E 1 21  ? 123.473 119.205 108.924 1.00 0.00 ? 25  ALA E HA   1  
ATOM 10527  H HB1  . ALA E 1 21  ? 121.012 119.444 108.195 1.00 0.00 ? 25  ALA E HB1  1  
ATOM 10528  H HB2  . ALA E 1 21  ? 121.572 120.166 109.488 1.00 0.00 ? 25  ALA E HB2  1  
ATOM 10529  H HB3  . ALA E 1 21  ? 121.471 120.957 108.120 1.00 0.00 ? 25  ALA E HB3  1  
ATOM 10530  N N    . PRO E 1 22  ? 123.540 117.403 107.202 1.00 0.00 ? 26  PRO E N    1  
ATOM 10531  C CA   . PRO E 1 22  ? 123.463 116.418 106.116 1.00 0.00 ? 26  PRO E CA   1  
ATOM 10532  C C    . PRO E 1 22  ? 122.054 115.898 105.903 1.00 0.00 ? 26  PRO E C    1  
ATOM 10533  O O    . PRO E 1 22  ? 121.362 115.540 106.861 1.00 0.00 ? 26  PRO E O    1  
ATOM 10534  C CB   . PRO E 1 22  ? 124.387 115.288 106.593 1.00 0.00 ? 26  PRO E CB   1  
ATOM 10535  C CG   . PRO E 1 22  ? 125.241 115.896 107.643 1.00 0.00 ? 26  PRO E CG   1  
ATOM 10536  C CD   . PRO E 1 22  ? 124.355 116.895 108.317 1.00 0.00 ? 26  PRO E CD   1  
ATOM 10537  H HA   . PRO E 1 22  ? 123.719 116.800 105.261 1.00 0.00 ? 26  PRO E HA   1  
ATOM 10538  H HB2  . PRO E 1 22  ? 123.875 114.543 106.946 1.00 0.00 ? 26  PRO E HB2  1  
ATOM 10539  H HB3  . PRO E 1 22  ? 124.924 114.943 105.863 1.00 0.00 ? 26  PRO E HB3  1  
ATOM 10540  H HG2  . PRO E 1 22  ? 125.559 115.227 108.270 1.00 0.00 ? 26  PRO E HG2  1  
ATOM 10541  H HG3  . PRO E 1 22  ? 126.024 116.320 107.260 1.00 0.00 ? 26  PRO E HG3  1  
ATOM 10542  H HD2  . PRO E 1 22  ? 123.808 116.487 109.007 1.00 0.00 ? 26  PRO E HD2  1  
ATOM 10543  H HD3  . PRO E 1 22  ? 124.866 117.602 108.741 1.00 0.00 ? 26  PRO E HD3  1  
ATOM 10544  N N    . LEU E 1 23  ? 121.619 115.857 104.651 1.00 0.00 ? 27  LEU E N    1  
ATOM 10545  C CA   . LEU E 1 23  ? 120.397 115.156 104.297 1.00 0.00 ? 27  LEU E CA   1  
ATOM 10546  C C    . LEU E 1 23  ? 120.742 113.996 103.377 1.00 0.00 ? 27  LEU E C    1  
ATOM 10547  O O    . LEU E 1 23  ? 121.755 114.008 102.675 1.00 0.00 ? 27  LEU E O    1  
ATOM 10548  C CB   . LEU E 1 23  ? 119.391 116.077 103.611 1.00 0.00 ? 27  LEU E CB   1  
ATOM 10549  C CG   . LEU E 1 23  ? 119.865 116.909 102.416 1.00 0.00 ? 27  LEU E CG   1  
ATOM 10550  C CD1  . LEU E 1 23  ? 118.885 116.756 101.265 1.00 0.00 ? 27  LEU E CD1  1  
ATOM 10551  C CD2  . LEU E 1 23  ? 120.055 118.381 102.763 1.00 0.00 ? 27  LEU E CD2  1  
ATOM 10552  H H    . LEU E 1 23  ? 122.021 116.231 103.989 1.00 0.00 ? 27  LEU E H    1  
ATOM 10553  H HA   . LEU E 1 23  ? 119.986 114.832 105.113 1.00 0.00 ? 27  LEU E HA   1  
ATOM 10554  H HB2  . LEU E 1 23  ? 118.646 115.532 103.314 1.00 0.00 ? 27  LEU E HB2  1  
ATOM 10555  H HB3  . LEU E 1 23  ? 119.046 116.689 104.280 1.00 0.00 ? 27  LEU E HB3  1  
ATOM 10556  H HG   . LEU E 1 23  ? 120.736 116.572 102.154 1.00 0.00 ? 27  LEU E HG   1  
ATOM 10557  H HD11 . LEU E 1 23  ? 119.284 117.104 100.452 1.00 0.00 ? 27  LEU E HD11 1  
ATOM 10558  H HD12 . LEU E 1 23  ? 118.672 115.817 101.143 1.00 0.00 ? 27  LEU E HD12 1  
ATOM 10559  H HD13 . LEU E 1 23  ? 118.073 117.248 101.462 1.00 0.00 ? 27  LEU E HD13 1  
ATOM 10560  H HD21 . LEU E 1 23  ? 119.327 118.676 103.333 1.00 0.00 ? 27  LEU E HD21 1  
ATOM 10561  H HD22 . LEU E 1 23  ? 120.898 118.497 103.228 1.00 0.00 ? 27  LEU E HD22 1  
ATOM 10562  H HD23 . LEU E 1 23  ? 120.061 118.907 101.949 1.00 0.00 ? 27  LEU E HD23 1  
ATOM 10563  N N    . PHE E 1 24  ? 119.884 112.997 103.377 1.00 0.00 ? 28  PHE E N    1  
ATOM 10564  C CA   . PHE E 1 24  ? 120.334 111.780 102.736 1.00 0.00 ? 28  PHE E CA   1  
ATOM 10565  C C    . PHE E 1 24  ? 119.631 111.589 101.394 1.00 0.00 ? 28  PHE E C    1  
ATOM 10566  O O    . PHE E 1 24  ? 118.454 111.940 101.262 1.00 0.00 ? 28  PHE E O    1  
ATOM 10567  C CB   . PHE E 1 24  ? 120.067 110.583 103.657 1.00 0.00 ? 28  PHE E CB   1  
ATOM 10568  C CG   . PHE E 1 24  ? 120.786 109.342 103.254 1.00 0.00 ? 28  PHE E CG   1  
ATOM 10569  C CD1  . PHE E 1 24  ? 122.168 109.309 103.248 1.00 0.00 ? 28  PHE E CD1  1  
ATOM 10570  C CD2  . PHE E 1 24  ? 120.093 108.207 102.891 1.00 0.00 ? 28  PHE E CD2  1  
ATOM 10571  C CE1  . PHE E 1 24  ? 122.840 108.170 102.869 1.00 0.00 ? 28  PHE E CE1  1  
ATOM 10572  C CE2  . PHE E 1 24  ? 120.763 107.060 102.511 1.00 0.00 ? 28  PHE E CE2  1  
ATOM 10573  C CZ   . PHE E 1 24  ? 122.140 107.043 102.504 1.00 0.00 ? 28  PHE E CZ   1  
ATOM 10574  H H    . PHE E 1 24  ? 119.093 112.994 103.714 1.00 0.00 ? 28  PHE E H    1  
ATOM 10575  H HA   . PHE E 1 24  ? 121.288 111.845 102.571 1.00 0.00 ? 28  PHE E HA   1  
ATOM 10576  H HB2  . PHE E 1 24  ? 120.325 110.818 104.562 1.00 0.00 ? 28  PHE E HB2  1  
ATOM 10577  H HB3  . PHE E 1 24  ? 119.114 110.404 103.672 1.00 0.00 ? 28  PHE E HB3  1  
ATOM 10578  H HD1  . PHE E 1 24  ? 122.648 110.064 103.502 1.00 0.00 ? 28  PHE E HD1  1  
ATOM 10579  H HD2  . PHE E 1 24  ? 119.163 108.214 102.901 1.00 0.00 ? 28  PHE E HD2  1  
ATOM 10580  H HE1  . PHE E 1 24  ? 123.771 108.162 102.860 1.00 0.00 ? 28  PHE E HE1  1  
ATOM 10581  H HE2  . PHE E 1 24  ? 120.285 106.301 102.262 1.00 0.00 ? 28  PHE E HE2  1  
ATOM 10582  H HZ   . PHE E 1 24  ? 122.595 106.272 102.253 1.00 0.00 ? 28  PHE E HZ   1  
ATOM 10583  N N    . PRO E 1 25  ? 120.321 111.094 100.369 1.00 0.00 ? 29  PRO E N    1  
ATOM 10584  C CA   . PRO E 1 25  ? 119.659 110.890 99.075  1.00 0.00 ? 29  PRO E CA   1  
ATOM 10585  C C    . PRO E 1 25  ? 118.760 109.665 99.070  1.00 0.00 ? 29  PRO E C    1  
ATOM 10586  O O    . PRO E 1 25  ? 118.698 108.901 100.034 1.00 0.00 ? 29  PRO E O    1  
ATOM 10587  C CB   . PRO E 1 25  ? 120.828 110.753 98.092  1.00 0.00 ? 29  PRO E CB   1  
ATOM 10588  C CG   . PRO E 1 25  ? 121.960 110.277 98.924  1.00 0.00 ? 29  PRO E CG   1  
ATOM 10589  C CD   . PRO E 1 25  ? 121.780 110.938 100.262 1.00 0.00 ? 29  PRO E CD   1  
ATOM 10590  H HA   . PRO E 1 25  ? 119.070 111.626 98.846  1.00 0.00 ? 29  PRO E HA   1  
ATOM 10591  H HB2  . PRO E 1 25  ? 120.622 110.122 97.384  1.00 0.00 ? 29  PRO E HB2  1  
ATOM 10592  H HB3  . PRO E 1 25  ? 121.033 111.600 97.667  1.00 0.00 ? 29  PRO E HB3  1  
ATOM 10593  H HG2  . PRO E 1 25  ? 121.952 109.311 99.007  1.00 0.00 ? 29  PRO E HG2  1  
ATOM 10594  H HG3  . PRO E 1 25  ? 122.812 110.519 98.527  1.00 0.00 ? 29  PRO E HG3  1  
ATOM 10595  H HD2  . PRO E 1 25  ? 122.135 110.393 100.981 1.00 0.00 ? 29  PRO E HD2  1  
ATOM 10596  H HD3  . PRO E 1 25  ? 122.235 111.793 100.303 1.00 0.00 ? 29  PRO E HD3  1  
ATOM 10597  N N    . ALA E 1 26  ? 118.067 109.498 97.939  1.00 0.00 ? 30  ALA E N    1  
ATOM 10598  C CA   . ALA E 1 26  ? 117.136 108.397 97.669  1.00 0.00 ? 30  ALA E CA   1  
ATOM 10599  C C    . ALA E 1 26  ? 116.086 108.266 98.773  1.00 0.00 ? 30  ALA E C    1  
ATOM 10600  O O    . ALA E 1 26  ? 115.995 107.254 99.467  1.00 0.00 ? 30  ALA E O    1  
ATOM 10601  C CB   . ALA E 1 26  ? 117.873 107.070 97.450  1.00 0.00 ? 30  ALA E CB   1  
ATOM 10602  H H    . ALA E 1 26  ? 118.131 110.047 97.281  1.00 0.00 ? 30  ALA E H    1  
ATOM 10603  H HA   . ALA E 1 26  ? 116.673 108.614 96.845  1.00 0.00 ? 30  ALA E HA   1  
ATOM 10604  H HB1  . ALA E 1 26  ? 118.464 107.150 96.686  1.00 0.00 ? 30  ALA E HB1  1  
ATOM 10605  H HB2  . ALA E 1 26  ? 118.393 106.855 98.239  1.00 0.00 ? 30  ALA E HB2  1  
ATOM 10606  H HB3  . ALA E 1 26  ? 117.227 106.364 97.288  1.00 0.00 ? 30  ALA E HB3  1  
ATOM 10607  N N    . TYR E 1 27  ? 115.288 109.321 98.924  1.00 0.00 ? 31  TYR E N    1  
ATOM 10608  C CA   . TYR E 1 27  ? 114.158 109.287 99.839  1.00 0.00 ? 31  TYR E CA   1  
ATOM 10609  C C    . TYR E 1 27  ? 113.012 108.464 99.264  1.00 0.00 ? 31  TYR E C    1  
ATOM 10610  O O    . TYR E 1 27  ? 112.751 108.443 98.061  1.00 0.00 ? 31  TYR E O    1  
ATOM 10611  C CB   . TYR E 1 27  ? 113.674 110.698 100.167 1.00 0.00 ? 31  TYR E CB   1  
ATOM 10612  C CG   . TYR E 1 27  ? 114.441 111.371 101.274 1.00 0.00 ? 31  TYR E CG   1  
ATOM 10613  C CD1  . TYR E 1 27  ? 114.930 112.659 101.115 1.00 0.00 ? 31  TYR E CD1  1  
ATOM 10614  C CD2  . TYR E 1 27  ? 114.680 110.719 102.478 1.00 0.00 ? 31  TYR E CD2  1  
ATOM 10615  C CE1  . TYR E 1 27  ? 115.642 113.281 102.117 1.00 0.00 ? 31  TYR E CE1  1  
ATOM 10616  C CE2  . TYR E 1 27  ? 115.383 111.340 103.493 1.00 0.00 ? 31  TYR E CE2  1  
ATOM 10617  C CZ   . TYR E 1 27  ? 115.856 112.623 103.306 1.00 0.00 ? 31  TYR E CZ   1  
ATOM 10618  O OH   . TYR E 1 27  ? 116.559 113.252 104.306 1.00 0.00 ? 31  TYR E OH   1  
ATOM 10619  H H    . TYR E 1 27  ? 115.387 110.066 98.504  1.00 0.00 ? 31  TYR E H    1  
ATOM 10620  H HA   . TYR E 1 27  ? 114.460 108.866 100.659 1.00 0.00 ? 31  TYR E HA   1  
ATOM 10621  H HB2  . TYR E 1 27  ? 113.733 111.244 99.368  1.00 0.00 ? 31  TYR E HB2  1  
ATOM 10622  H HB3  . TYR E 1 27  ? 112.737 110.659 100.414 1.00 0.00 ? 31  TYR E HB3  1  
ATOM 10623  H HD1  . TYR E 1 27  ? 114.774 113.111 100.318 1.00 0.00 ? 31  TYR E HD1  1  
ATOM 10624  H HD2  . TYR E 1 27  ? 114.362 109.854 102.603 1.00 0.00 ? 31  TYR E HD2  1  
ATOM 10625  H HE1  . TYR E 1 27  ? 115.976 114.140 101.990 1.00 0.00 ? 31  TYR E HE1  1  
ATOM 10626  H HE2  . TYR E 1 27  ? 115.537 110.896 104.297 1.00 0.00 ? 31  TYR E HE2  1  
ATOM 10627  H HH   . TYR E 1 27  ? 117.327 112.917 104.361 1.00 0.00 ? 31  TYR E HH   1  
ATOM 10628  N N    . GLN E 1 28  ? 112.318 107.774 100.155 1.00 0.00 ? 32  GLN E N    1  
ATOM 10629  C CA   . GLN E 1 28  ? 111.177 106.948 99.814  1.00 0.00 ? 32  GLN E CA   1  
ATOM 10630  C C    . GLN E 1 28  ? 109.959 107.784 100.210 1.00 0.00 ? 32  GLN E C    1  
ATOM 10631  O O    . GLN E 1 28  ? 109.139 108.120 99.349  1.00 0.00 ? 32  GLN E O    1  
ATOM 10632  C CB   . GLN E 1 28  ? 111.362 105.559 100.467 1.00 0.00 ? 32  GLN E CB   1  
ATOM 10633  C CG   . GLN E 1 28  ? 110.694 104.357 99.806  1.00 0.00 ? 32  GLN E CG   1  
ATOM 10634  C CD   . GLN E 1 28  ? 109.446 103.916 100.521 1.00 0.00 ? 32  GLN E CD   1  
ATOM 10635  O OE1  . GLN E 1 28  ? 109.335 104.059 101.737 1.00 0.00 ? 32  GLN E OE1  1  
ATOM 10636  N NE2  . GLN E 1 28  ? 108.502 103.363 99.780  1.00 0.00 ? 32  GLN E NE2  1  
ATOM 10637  H H    . GLN E 1 28  ? 112.503 107.775 100.995 1.00 0.00 ? 32  GLN E H    1  
ATOM 10638  H HA   . GLN E 1 28  ? 111.065 106.724 98.877  1.00 0.00 ? 32  GLN E HA   1  
ATOM 10639  H HB2  . GLN E 1 28  ? 112.314 105.379 100.516 1.00 0.00 ? 32  GLN E HB2  1  
ATOM 10640  H HB3  . GLN E 1 28  ? 111.036 105.614 101.379 1.00 0.00 ? 32  GLN E HB3  1  
ATOM 10641  H HG2  . GLN E 1 28  ? 110.474 104.580 98.887  1.00 0.00 ? 32  GLN E HG2  1  
ATOM 10642  H HG3  . GLN E 1 28  ? 111.323 103.619 99.776  1.00 0.00 ? 32  GLN E HG3  1  
ATOM 10643  H HE21 . GLN E 1 28  ? 108.616 103.279 98.932  1.00 0.00 ? 32  GLN E HE21 1  
ATOM 10644  H HE22 . GLN E 1 28  ? 107.775 103.087 100.146 1.00 0.00 ? 32  GLN E HE22 1  
ATOM 10645  N N    . THR E 1 29  ? 109.802 108.084 101.497 1.00 0.00 ? 33  THR E N    1  
ATOM 10646  C CA   . THR E 1 29  ? 108.661 108.858 101.954 1.00 0.00 ? 33  THR E CA   1  
ATOM 10647  C C    . THR E 1 29  ? 108.755 109.145 103.450 1.00 0.00 ? 33  THR E C    1  
ATOM 10648  O O    . THR E 1 29  ? 109.457 108.470 104.221 1.00 0.00 ? 33  THR E O    1  
ATOM 10649  C CB   . THR E 1 29  ? 107.346 108.140 101.649 1.00 0.00 ? 33  THR E CB   1  
ATOM 10650  O OG1  . THR E 1 29  ? 106.274 109.091 101.691 1.00 0.00 ? 33  THR E OG1  1  
ATOM 10651  C CG2  . THR E 1 29  ? 107.071 107.047 102.671 1.00 0.00 ? 33  THR E CG2  1  
ATOM 10652  H H    . THR E 1 29  ? 110.346 107.846 102.119 1.00 0.00 ? 33  THR E H    1  
ATOM 10653  H HA   . THR E 1 29  ? 108.674 109.699 101.471 1.00 0.00 ? 33  THR E HA   1  
ATOM 10654  H HB   . THR E 1 29  ? 107.413 107.736 100.771 1.00 0.00 ? 33  THR E HB   1  
ATOM 10655  H HG1  . THR E 1 29  ? 105.549 108.689 101.820 1.00 0.00 ? 33  THR E HG1  1  
ATOM 10656  H HG21 . THR E 1 29  ? 106.662 106.183 102.504 1.00 0.00 ? 33  THR E HG21 1  
ATOM 10657  H HG22 . THR E 1 29  ? 107.791 106.397 102.652 1.00 0.00 ? 33  THR E HG22 1  
ATOM 10658  H HG23 . THR E 1 29  ? 107.013 107.439 103.557 1.00 0.00 ? 33  THR E HG23 1  
ATOM 10659  N N    . ASP E 1 30  ? 108.021 110.173 103.851 1.00 0.00 ? 34  ASP E N    1  
ATOM 10660  C CA   . ASP E 1 30  ? 108.207 110.816 105.133 1.00 0.00 ? 34  ASP E CA   1  
ATOM 10661  C C    . ASP E 1 30  ? 106.842 111.000 105.768 1.00 0.00 ? 34  ASP E C    1  
ATOM 10662  O O    . ASP E 1 30  ? 105.973 111.697 105.238 1.00 0.00 ? 34  ASP E O    1  
ATOM 10663  C CB   . ASP E 1 30  ? 108.923 112.159 104.951 1.00 0.00 ? 34  ASP E CB   1  
ATOM 10664  C CG   . ASP E 1 30  ? 109.797 112.528 106.132 1.00 0.00 ? 34  ASP E CG   1  
ATOM 10665  O OD1  . ASP E 1 30  ? 109.276 113.087 107.118 1.00 0.00 ? 34  ASP E OD1  1  
ATOM 10666  O OD2  . ASP E 1 30  ? 111.016 112.262 106.067 1.00 0.00 ? 34  ASP E OD2  1  
ATOM 10667  H H    . ASP E 1 30  ? 107.392 110.519 103.376 1.00 0.00 ? 34  ASP E H    1  
ATOM 10668  H HA   . ASP E 1 30  ? 108.763 110.271 105.712 1.00 0.00 ? 34  ASP E HA   1  
ATOM 10669  H HB2  . ASP E 1 30  ? 109.468 112.124 104.150 1.00 0.00 ? 34  ASP E HB2  1  
ATOM 10670  H HB3  . ASP E 1 30  ? 108.262 112.856 104.815 1.00 0.00 ? 34  ASP E HB3  1  
ATOM 10671  N N    . GLY E 1 31  ? 106.652 110.358 106.909 1.00 0.00 ? 35  GLY E N    1  
ATOM 10672  C CA   . GLY E 1 31  ? 105.483 110.613 107.711 1.00 0.00 ? 35  GLY E CA   1  
ATOM 10673  C C    . GLY E 1 31  ? 105.846 111.272 109.016 1.00 0.00 ? 35  GLY E C    1  
ATOM 10674  O O    . GLY E 1 31  ? 106.610 110.719 109.813 1.00 0.00 ? 35  GLY E O    1  
ATOM 10675  H H    . GLY E 1 31  ? 107.191 109.771 107.232 1.00 0.00 ? 35  GLY E H    1  
ATOM 10676  H HA2  . GLY E 1 31  ? 104.869 111.181 107.220 1.00 0.00 ? 35  GLY E HA2  1  
ATOM 10677  H HA3  . GLY E 1 31  ? 105.020 109.779 107.886 1.00 0.00 ? 35  GLY E HA3  1  
ATOM 10678  N N    . SER E 1 32  ? 105.295 112.456 109.247 1.00 0.00 ? 36  SER E N    1  
ATOM 10679  C CA   . SER E 1 32  ? 105.428 113.156 110.518 1.00 0.00 ? 36  SER E CA   1  
ATOM 10680  C C    . SER E 1 32  ? 104.021 113.210 111.090 1.00 0.00 ? 36  SER E C    1  
ATOM 10681  O O    . SER E 1 32  ? 103.094 113.727 110.464 1.00 0.00 ? 36  SER E O    1  
ATOM 10682  C CB   . SER E 1 32  ? 106.035 114.531 110.328 1.00 0.00 ? 36  SER E CB   1  
ATOM 10683  O OG   . SER E 1 32  ? 107.297 114.431 109.694 1.00 0.00 ? 36  SER E OG   1  
ATOM 10684  H H    . SER E 1 32  ? 104.828 112.881 108.663 1.00 0.00 ? 36  SER E H    1  
ATOM 10685  H HA   . SER E 1 32  ? 106.032 112.702 111.126 1.00 0.00 ? 36  SER E HA   1  
ATOM 10686  H HB2  . SER E 1 32  ? 105.441 115.081 109.795 1.00 0.00 ? 36  SER E HB2  1  
ATOM 10687  H HB3  . SER E 1 32  ? 106.133 114.969 111.188 1.00 0.00 ? 36  SER E HB3  1  
ATOM 10688  H HG   . SER E 1 32  ? 107.226 114.670 108.891 1.00 0.00 ? 36  SER E HG   1  
ATOM 10689  N N    . VAL E 1 33  ? 103.868 112.676 112.294 1.00 0.00 ? 37  VAL E N    1  
ATOM 10690  C CA   . VAL E 1 33  ? 102.558 112.526 112.913 1.00 0.00 ? 37  VAL E CA   1  
ATOM 10691  C C    . VAL E 1 33  ? 102.600 113.197 114.284 1.00 0.00 ? 37  VAL E C    1  
ATOM 10692  O O    . VAL E 1 33  ? 103.558 113.053 115.049 1.00 0.00 ? 37  VAL E O    1  
ATOM 10693  C CB   . VAL E 1 33  ? 102.129 111.053 112.969 1.00 0.00 ? 37  VAL E CB   1  
ATOM 10694  C CG1  . VAL E 1 33  ? 100.633 110.959 112.742 1.00 0.00 ? 37  VAL E CG1  1  
ATOM 10695  C CG2  . VAL E 1 33  ? 102.777 110.236 111.870 1.00 0.00 ? 37  VAL E CG2  1  
ATOM 10696  H H    . VAL E 1 33  ? 104.519 112.390 112.777 1.00 0.00 ? 37  VAL E H    1  
ATOM 10697  H HA   . VAL E 1 33  ? 101.878 112.964 112.377 1.00 0.00 ? 37  VAL E HA   1  
ATOM 10698  H HB   . VAL E 1 33  ? 102.395 110.711 113.836 1.00 0.00 ? 37  VAL E HB   1  
ATOM 10699  H HG11 . VAL E 1 33  ? 100.434 111.141 111.810 1.00 0.00 ? 37  VAL E HG11 1  
ATOM 10700  H HG12 . VAL E 1 33  ? 100.325 110.068 112.969 1.00 0.00 ? 37  VAL E HG12 1  
ATOM 10701  H HG13 . VAL E 1 33  ? 100.179 111.610 113.302 1.00 0.00 ? 37  VAL E HG13 1  
ATOM 10702  H HG21 . VAL E 1 33  ? 102.921 110.797 111.092 1.00 0.00 ? 37  VAL E HG21 1  
ATOM 10703  H HG22 . VAL E 1 33  ? 103.628 109.891 112.182 1.00 0.00 ? 37  VAL E HG22 1  
ATOM 10704  H HG23 . VAL E 1 33  ? 102.196 109.496 111.631 1.00 0.00 ? 37  VAL E HG23 1  
ATOM 10705  N N    . SER E 1 34  ? 101.562 113.969 114.576 1.00 0.00 ? 38  SER E N    1  
ATOM 10706  C CA   . SER E 1 34  ? 101.545 114.906 115.693 1.00 0.00 ? 38  SER E CA   1  
ATOM 10707  C C    . SER E 1 34  ? 100.184 114.799 116.378 1.00 0.00 ? 38  SER E C    1  
ATOM 10708  O O    . SER E 1 34  ? 99.166  115.225 115.835 1.00 0.00 ? 38  SER E O    1  
ATOM 10709  C CB   . SER E 1 34  ? 101.815 116.324 115.196 1.00 0.00 ? 38  SER E CB   1  
ATOM 10710  O OG   . SER E 1 34  ? 101.044 116.636 114.050 1.00 0.00 ? 38  SER E OG   1  
ATOM 10711  H H    . SER E 1 34  ? 100.832 113.964 114.120 1.00 0.00 ? 38  SER E H    1  
ATOM 10712  H HA   . SER E 1 34  ? 102.243 114.691 116.332 1.00 0.00 ? 38  SER E HA   1  
ATOM 10713  H HB2  . SER E 1 34  ? 101.614 116.958 115.902 1.00 0.00 ? 38  SER E HB2  1  
ATOM 10714  H HB3  . SER E 1 34  ? 102.757 116.420 114.988 1.00 0.00 ? 38  SER E HB3  1  
ATOM 10715  H HG   . SER E 1 34  ? 101.473 116.427 113.358 1.00 0.00 ? 38  SER E HG   1  
ATOM 10716  N N    . GLY E 1 35  ? 100.174 114.230 117.578 1.00 0.00 ? 39  GLY E N    1  
ATOM 10717  C CA   . GLY E 1 35  ? 98.930  114.044 118.297 1.00 0.00 ? 39  GLY E CA   1  
ATOM 10718  C C    . GLY E 1 35  ? 98.759  115.006 119.452 1.00 0.00 ? 39  GLY E C    1  
ATOM 10719  O O    . GLY E 1 35  ? 99.583  115.037 120.371 1.00 0.00 ? 39  GLY E O    1  
ATOM 10720  H H    . GLY E 1 35  ? 100.874 113.947 117.988 1.00 0.00 ? 39  GLY E H    1  
ATOM 10721  H HA2  . GLY E 1 35  ? 98.188  114.152 117.681 1.00 0.00 ? 39  GLY E HA2  1  
ATOM 10722  H HA3  . GLY E 1 35  ? 98.890  113.135 118.632 1.00 0.00 ? 39  GLY E HA3  1  
ATOM 10723  N N    . GLU E 1 36  ? 97.690  115.797 119.421 1.00 0.00 ? 40  GLU E N    1  
ATOM 10724  C CA   . GLU E 1 36  ? 97.407  116.786 120.455 1.00 0.00 ? 40  GLU E CA   1  
ATOM 10725  C C    . GLU E 1 36  ? 96.339  116.208 121.374 1.00 0.00 ? 40  GLU E C    1  
ATOM 10726  O O    . GLU E 1 36  ? 95.164  116.138 121.002 1.00 0.00 ? 40  GLU E O    1  
ATOM 10727  C CB   . GLU E 1 36  ? 96.958  118.110 119.840 1.00 0.00 ? 40  GLU E CB   1  
ATOM 10728  C CG   . GLU E 1 36  ? 96.466  119.128 120.852 1.00 0.00 ? 40  GLU E CG   1  
ATOM 10729  C CD   . GLU E 1 36  ? 96.845  120.547 120.484 1.00 0.00 ? 40  GLU E CD   1  
ATOM 10730  O OE1  . GLU E 1 36  ? 96.621  121.455 121.308 1.00 0.00 ? 40  GLU E OE1  1  
ATOM 10731  O OE2  . GLU E 1 36  ? 97.356  120.760 119.364 1.00 0.00 ? 40  GLU E OE2  1  
ATOM 10732  H H    . GLU E 1 36  ? 97.104  115.775 118.791 1.00 0.00 ? 40  GLU E H    1  
ATOM 10733  H HA   . GLU E 1 36  ? 98.210  116.978 120.965 1.00 0.00 ? 40  GLU E HA   1  
ATOM 10734  H HB2  . GLU E 1 36  ? 97.699  118.493 119.345 1.00 0.00 ? 40  GLU E HB2  1  
ATOM 10735  H HB3  . GLU E 1 36  ? 96.250  117.935 119.201 1.00 0.00 ? 40  GLU E HB3  1  
ATOM 10736  H HG2  . GLU E 1 36  ? 95.501  119.064 120.927 1.00 0.00 ? 40  GLU E HG2  1  
ATOM 10737  H HG3  . GLU E 1 36  ? 96.832  118.915 121.725 1.00 0.00 ? 40  GLU E HG3  1  
ATOM 10738  N N    . ARG E 1 37  ? 96.747  115.800 122.569 1.00 0.00 ? 41  ARG E N    1  
ATOM 10739  C CA   . ARG E 1 37  ? 95.858  115.113 123.495 1.00 0.00 ? 41  ARG E CA   1  
ATOM 10740  C C    . ARG E 1 37  ? 94.826  116.088 124.054 1.00 0.00 ? 41  ARG E C    1  
ATOM 10741  O O    . ARG E 1 37  ? 95.117  117.257 124.319 1.00 0.00 ? 41  ARG E O    1  
ATOM 10742  C CB   . ARG E 1 37  ? 96.667  114.451 124.600 1.00 0.00 ? 41  ARG E CB   1  
ATOM 10743  C CG   . ARG E 1 37  ? 96.805  112.961 124.426 1.00 0.00 ? 41  ARG E CG   1  
ATOM 10744  C CD   . ARG E 1 37  ? 95.522  112.269 124.804 1.00 0.00 ? 41  ARG E CD   1  
ATOM 10745  N NE   . ARG E 1 37  ? 94.564  112.368 123.707 1.00 0.00 ? 41  ARG E NE   1  
ATOM 10746  C CZ   . ARG E 1 37  ? 93.242  112.386 123.858 1.00 0.00 ? 41  ARG E CZ   1  
ATOM 10747  N NH1  . ARG E 1 37  ? 92.706  112.309 125.067 1.00 0.00 ? 41  ARG E NH1  1  
ATOM 10748  N NH2  . ARG E 1 37  ? 92.455  112.485 122.794 1.00 0.00 ? 41  ARG E NH2  1  
ATOM 10749  H H    . ARG E 1 37  ? 97.547  115.913 122.866 1.00 0.00 ? 41  ARG E H    1  
ATOM 10750  H HA   . ARG E 1 37  ? 95.376  114.415 123.023 1.00 0.00 ? 41  ARG E HA   1  
ATOM 10751  H HB2  . ARG E 1 37  ? 97.550  114.851 124.629 1.00 0.00 ? 41  ARG E HB2  1  
ATOM 10752  H HB3  . ARG E 1 37  ? 96.245  114.633 125.455 1.00 0.00 ? 41  ARG E HB3  1  
ATOM 10753  H HG2  . ARG E 1 37  ? 97.032  112.757 123.506 1.00 0.00 ? 41  ARG E HG2  1  
ATOM 10754  H HG3  . ARG E 1 37  ? 97.532  112.631 124.977 1.00 0.00 ? 41  ARG E HG3  1  
ATOM 10755  H HD2  . ARG E 1 37  ? 95.696  111.337 125.008 1.00 0.00 ? 41  ARG E HD2  1  
ATOM 10756  H HD3  . ARG E 1 37  ? 95.151  112.671 125.605 1.00 0.00 ? 41  ARG E HD3  1  
ATOM 10757  H HE   . ARG E 1 37  ? 94.876  112.419 122.907 1.00 0.00 ? 41  ARG E HE   1  
ATOM 10758  H HH11 . ARG E 1 37  ? 93.213  112.248 125.759 1.00 0.00 ? 41  ARG E HH11 1  
ATOM 10759  H HH12 . ARG E 1 37  ? 91.852  112.321 125.160 1.00 0.00 ? 41  ARG E HH12 1  
ATOM 10760  H HH21 . ARG E 1 37  ? 92.799  112.537 122.008 1.00 0.00 ? 41  ARG E HH21 1  
ATOM 10761  H HH22 . ARG E 1 37  ? 91.600  112.496 122.892 1.00 0.00 ? 41  ARG E HH22 1  
ATOM 10762  N N    . GLU E 1 38  ? 93.610  115.593 124.267 1.00 0.00 ? 42  GLU E N    1  
ATOM 10763  C CA   . GLU E 1 38  ? 92.449  116.430 124.543 1.00 0.00 ? 42  GLU E CA   1  
ATOM 10764  C C    . GLU E 1 38  ? 91.795  115.952 125.832 1.00 0.00 ? 42  GLU E C    1  
ATOM 10765  O O    . GLU E 1 38  ? 92.206  114.952 126.427 1.00 0.00 ? 42  GLU E O    1  
ATOM 10766  C CB   . GLU E 1 38  ? 91.478  116.384 123.365 1.00 0.00 ? 42  GLU E CB   1  
ATOM 10767  C CG   . GLU E 1 38  ? 91.938  117.228 122.204 1.00 0.00 ? 42  GLU E CG   1  
ATOM 10768  C CD   . GLU E 1 38  ? 90.798  117.652 121.318 1.00 0.00 ? 42  GLU E CD   1  
ATOM 10769  O OE1  . GLU E 1 38  ? 90.994  117.716 120.087 1.00 0.00 ? 42  GLU E OE1  1  
ATOM 10770  O OE2  . GLU E 1 38  ? 89.700  117.899 121.854 1.00 0.00 ? 42  GLU E OE2  1  
ATOM 10771  H H    . GLU E 1 38  ? 93.435  114.752 124.256 1.00 0.00 ? 42  GLU E H    1  
ATOM 10772  H HA   . GLU E 1 38  ? 92.720  117.355 124.657 1.00 0.00 ? 42  GLU E HA   1  
ATOM 10773  H HB2  . GLU E 1 38  ? 91.374  115.465 123.071 1.00 0.00 ? 42  GLU E HB2  1  
ATOM 10774  H HB3  . GLU E 1 38  ? 90.605  116.689 123.657 1.00 0.00 ? 42  GLU E HB3  1  
ATOM 10775  H HG2  . GLU E 1 38  ? 92.394  118.015 122.540 1.00 0.00 ? 42  GLU E HG2  1  
ATOM 10776  H HG3  . GLU E 1 38  ? 92.583  116.728 121.679 1.00 0.00 ? 42  GLU E HG3  1  
ATOM 10777  N N    . LEU E 1 39  ? 90.771  116.684 126.261 1.00 0.00 ? 43  LEU E N    1  
ATOM 10778  C CA   . LEU E 1 39  ? 90.037  116.390 127.481 1.00 0.00 ? 43  LEU E CA   1  
ATOM 10779  C C    . LEU E 1 39  ? 89.300  115.064 127.355 1.00 0.00 ? 43  LEU E C    1  
ATOM 10780  O O    . LEU E 1 39  ? 88.729  114.744 126.309 1.00 0.00 ? 43  LEU E O    1  
ATOM 10781  C CB   . LEU E 1 39  ? 89.033  117.503 127.807 1.00 0.00 ? 43  LEU E CB   1  
ATOM 10782  C CG   . LEU E 1 39  ? 89.088  118.183 129.177 1.00 0.00 ? 43  LEU E CG   1  
ATOM 10783  C CD1  . LEU E 1 39  ? 88.941  117.156 130.286 1.00 0.00 ? 43  LEU E CD1  1  
ATOM 10784  C CD2  . LEU E 1 39  ? 90.391  118.943 129.338 1.00 0.00 ? 43  LEU E CD2  1  
ATOM 10785  H H    . LEU E 1 39  ? 90.480  117.376 125.841 1.00 0.00 ? 43  LEU E H    1  
ATOM 10786  H HA   . LEU E 1 39  ? 90.683  116.333 128.204 1.00 0.00 ? 43  LEU E HA   1  
ATOM 10787  H HB2  . LEU E 1 39  ? 89.135  118.195 127.134 1.00 0.00 ? 43  LEU E HB2  1  
ATOM 10788  H HB3  . LEU E 1 39  ? 88.143  117.133 127.700 1.00 0.00 ? 43  LEU E HB3  1  
ATOM 10789  H HG   . LEU E 1 39  ? 88.351  118.811 129.236 1.00 0.00 ? 43  LEU E HG   1  
ATOM 10790  H HD11 . LEU E 1 39  ? 88.037  116.805 130.285 1.00 0.00 ? 43  LEU E HD11 1  
ATOM 10791  H HD12 . LEU E 1 39  ? 89.569  116.431 130.142 1.00 0.00 ? 43  LEU E HD12 1  
ATOM 10792  H HD13 . LEU E 1 39  ? 89.123  117.575 131.142 1.00 0.00 ? 43  LEU E HD13 1  
ATOM 10793  H HD21 . LEU E 1 39  ? 90.452  119.630 128.655 1.00 0.00 ? 43  LEU E HD21 1  
ATOM 10794  H HD22 . LEU E 1 39  ? 90.418  119.357 130.214 1.00 0.00 ? 43  LEU E HD22 1  
ATOM 10795  H HD23 . LEU E 1 39  ? 91.137  118.331 129.247 1.00 0.00 ? 43  LEU E HD23 1  
ATOM 10796  N N    . PHE E 1 40  ? 89.321  114.294 128.444 1.00 0.00 ? 44  PHE E N    1  
ATOM 10797  C CA   . PHE E 1 40  ? 88.520  113.082 128.559 1.00 0.00 ? 44  PHE E CA   1  
ATOM 10798  C C    . PHE E 1 40  ? 87.136  113.387 129.106 1.00 0.00 ? 44  PHE E C    1  
ATOM 10799  O O    . PHE E 1 40  ? 87.004  114.039 130.144 1.00 0.00 ? 44  PHE E O    1  
ATOM 10800  C CB   . PHE E 1 40  ? 89.182  112.031 129.458 1.00 0.00 ? 44  PHE E CB   1  
ATOM 10801  C CG   . PHE E 1 40  ? 90.684  112.155 129.519 1.00 0.00 ? 44  PHE E CG   1  
ATOM 10802  C CD1  . PHE E 1 40  ? 91.315  112.542 130.693 1.00 0.00 ? 44  PHE E CD1  1  
ATOM 10803  C CD2  . PHE E 1 40  ? 91.465  111.875 128.407 1.00 0.00 ? 44  PHE E CD2  1  
ATOM 10804  C CE1  . PHE E 1 40  ? 92.693  112.657 130.750 1.00 0.00 ? 44  PHE E CE1  1  
ATOM 10805  C CE2  . PHE E 1 40  ? 92.841  111.984 128.462 1.00 0.00 ? 44  PHE E CE2  1  
ATOM 10806  C CZ   . PHE E 1 40  ? 93.455  112.378 129.632 1.00 0.00 ? 44  PHE E CZ   1  
ATOM 10807  H H    . PHE E 1 40  ? 89.803  114.462 129.136 1.00 0.00 ? 44  PHE E H    1  
ATOM 10808  H HA   . PHE E 1 40  ? 88.447  112.722 127.662 1.00 0.00 ? 44  PHE E HA   1  
ATOM 10809  H HB2  . PHE E 1 40  ? 88.821  112.109 130.355 1.00 0.00 ? 44  PHE E HB2  1  
ATOM 10810  H HB3  . PHE E 1 40  ? 88.950  111.146 129.135 1.00 0.00 ? 44  PHE E HB3  1  
ATOM 10811  H HD1  . PHE E 1 40  ? 90.806  112.726 131.449 1.00 0.00 ? 44  PHE E HD1  1  
ATOM 10812  H HD2  . PHE E 1 40  ? 91.057  111.611 127.615 1.00 0.00 ? 44  PHE E HD2  1  
ATOM 10813  H HE1  . PHE E 1 40  ? 93.105  112.921 131.540 1.00 0.00 ? 44  PHE E HE1  1  
ATOM 10814  H HE2  . PHE E 1 40  ? 93.353  111.792 127.711 1.00 0.00 ? 44  PHE E HE2  1  
ATOM 10815  H HZ   . PHE E 1 40  ? 94.381  112.455 129.669 1.00 0.00 ? 44  PHE E HZ   1  
ATOM 10816  N N    . ASP E 1 41  ? 86.117  112.907 128.405 1.00 0.00 ? 45  ASP E N    1  
ATOM 10817  C CA   . ASP E 1 41  ? 84.804  112.623 128.969 1.00 0.00 ? 45  ASP E CA   1  
ATOM 10818  C C    . ASP E 1 41  ? 84.096  113.951 129.228 1.00 0.00 ? 45  ASP E C    1  
ATOM 10819  O O    . ASP E 1 41  ? 84.474  114.719 130.117 1.00 0.00 ? 45  ASP E O    1  
ATOM 10820  C CB   . ASP E 1 41  ? 84.899  111.790 130.256 1.00 0.00 ? 45  ASP E CB   1  
ATOM 10821  C CG   . ASP E 1 41  ? 83.548  111.564 130.919 1.00 0.00 ? 45  ASP E CG   1  
ATOM 10822  O OD1  . ASP E 1 41  ? 82.538  111.452 130.197 1.00 0.00 ? 45  ASP E OD1  1  
ATOM 10823  O OD2  . ASP E 1 41  ? 83.493  111.537 132.167 1.00 0.00 ? 45  ASP E OD2  1  
ATOM 10824  H H    . ASP E 1 41  ? 86.171  112.733 127.564 1.00 0.00 ? 45  ASP E H    1  
ATOM 10825  H HA   . ASP E 1 41  ? 84.296  112.090 128.338 1.00 0.00 ? 45  ASP E HA   1  
ATOM 10826  H HB2  . ASP E 1 41  ? 85.300  110.931 130.051 1.00 0.00 ? 45  ASP E HB2  1  
ATOM 10827  H HB3  . ASP E 1 41  ? 85.490  112.237 130.882 1.00 0.00 ? 45  ASP E HB3  1  
ATOM 10828  N N    . GLU E 1 42  ? 83.062  114.226 128.436 1.00 0.00 ? 46  GLU E N    1  
ATOM 10829  C CA   . GLU E 1 42  ? 82.246  115.418 128.629 1.00 0.00 ? 46  GLU E CA   1  
ATOM 10830  C C    . GLU E 1 42  ? 81.468  115.404 129.933 1.00 0.00 ? 46  GLU E C    1  
ATOM 10831  O O    . GLU E 1 42  ? 81.229  116.474 130.504 1.00 0.00 ? 46  GLU E O    1  
ATOM 10832  C CB   . GLU E 1 42  ? 81.260  115.590 127.470 1.00 0.00 ? 46  GLU E CB   1  
ATOM 10833  C CG   . GLU E 1 42  ? 80.938  117.025 127.119 1.00 0.00 ? 46  GLU E CG   1  
ATOM 10834  C CD   . GLU E 1 42  ? 79.576  117.190 126.484 1.00 0.00 ? 46  GLU E CD   1  
ATOM 10835  O OE1  . GLU E 1 42  ? 78.868  116.180 126.304 1.00 0.00 ? 46  GLU E OE1  1  
ATOM 10836  O OE2  . GLU E 1 42  ? 79.203  118.342 126.184 1.00 0.00 ? 46  GLU E OE2  1  
ATOM 10837  H H    . GLU E 1 42  ? 82.817  113.731 127.777 1.00 0.00 ? 46  GLU E H    1  
ATOM 10838  H HA   . GLU E 1 42  ? 82.868  116.163 128.660 1.00 0.00 ? 46  GLU E HA   1  
ATOM 10839  H HB2  . GLU E 1 42  ? 81.624  115.152 126.684 1.00 0.00 ? 46  GLU E HB2  1  
ATOM 10840  H HB3  . GLU E 1 42  ? 80.435  115.132 127.693 1.00 0.00 ? 46  GLU E HB3  1  
ATOM 10841  H HG2  . GLU E 1 42  ? 80.982  117.567 127.922 1.00 0.00 ? 46  GLU E HG2  1  
ATOM 10842  H HG3  . GLU E 1 42  ? 81.615  117.364 126.512 1.00 0.00 ? 46  GLU E HG3  1  
ATOM 10843  N N    . GLN E 1 43  ? 81.040  114.211 130.378 1.00 0.00 ? 47  GLN E N    1  
ATOM 10844  C CA   . GLN E 1 43  ? 80.140  113.996 131.525 1.00 0.00 ? 47  GLN E CA   1  
ATOM 10845  C C    . GLN E 1 43  ? 78.711  114.443 131.213 1.00 0.00 ? 47  GLN E C    1  
ATOM 10846  O O    . GLN E 1 43  ? 77.918  114.673 132.130 1.00 0.00 ? 47  GLN E O    1  
ATOM 10847  C CB   . GLN E 1 43  ? 80.659  114.686 132.797 1.00 0.00 ? 47  GLN E CB   1  
ATOM 10848  C CG   . GLN E 1 43  ? 82.133  114.431 133.108 1.00 0.00 ? 47  GLN E CG   1  
ATOM 10849  C CD   . GLN E 1 43  ? 82.973  115.692 133.159 1.00 0.00 ? 47  GLN E CD   1  
ATOM 10850  O OE1  . GLN E 1 43  ? 83.900  115.863 132.370 1.00 0.00 ? 47  GLN E OE1  1  
ATOM 10851  N NE2  . GLN E 1 43  ? 82.649  116.584 134.087 1.00 0.00 ? 47  GLN E NE2  1  
ATOM 10852  H H    . GLN E 1 43  ? 81.277  113.475 130.002 1.00 0.00 ? 47  GLN E H    1  
ATOM 10853  H HA   . GLN E 1 43  ? 80.126  113.041 131.692 1.00 0.00 ? 47  GLN E HA   1  
ATOM 10854  H HB2  . GLN E 1 43  ? 80.520  115.643 132.711 1.00 0.00 ? 47  GLN E HB2  1  
ATOM 10855  H HB3  . GLN E 1 43  ? 80.126  114.389 133.552 1.00 0.00 ? 47  GLN E HB3  1  
ATOM 10856  H HG2  . GLN E 1 43  ? 82.200  113.972 133.960 1.00 0.00 ? 47  GLN E HG2  1  
ATOM 10857  H HG3  . GLN E 1 43  ? 82.499  113.836 132.435 1.00 0.00 ? 47  GLN E HG3  1  
ATOM 10858  H HE21 . GLN E 1 43  ? 81.993  116.429 134.623 1.00 0.00 ? 47  GLN E HE21 1  
ATOM 10859  H HE22 . GLN E 1 43  ? 83.094  117.317 134.153 1.00 0.00 ? 47  GLN E HE22 1  
ATOM 10860  N N    . THR E 1 44  ? 78.375  114.498 129.916 1.00 0.00 ? 48  THR E N    1  
ATOM 10861  C CA   . THR E 1 44  ? 77.198  115.187 129.367 1.00 0.00 ? 48  THR E CA   1  
ATOM 10862  C C    . THR E 1 44  ? 76.984  116.550 130.031 1.00 0.00 ? 48  THR E C    1  
ATOM 10863  O O    . THR E 1 44  ? 75.957  116.812 130.658 1.00 0.00 ? 48  THR E O    1  
ATOM 10864  C CB   . THR E 1 44  ? 75.937  114.320 129.462 1.00 0.00 ? 48  THR E CB   1  
ATOM 10865  O OG1  . THR E 1 44  ? 76.287  112.935 129.362 1.00 0.00 ? 48  THR E OG1  1  
ATOM 10866  C CG2  . THR E 1 44  ? 74.963  114.673 128.348 1.00 0.00 ? 48  THR E CG2  1  
ATOM 10867  H H    . THR E 1 44  ? 78.849  114.118 129.307 1.00 0.00 ? 48  THR E H    1  
ATOM 10868  H HA   . THR E 1 44  ? 77.372  115.344 128.426 1.00 0.00 ? 48  THR E HA   1  
ATOM 10869  H HB   . THR E 1 44  ? 75.514  114.489 130.318 1.00 0.00 ? 48  THR E HB   1  
ATOM 10870  H HG1  . THR E 1 44  ? 76.766  112.719 130.016 1.00 0.00 ? 48  THR E HG1  1  
ATOM 10871  H HG21 . THR E 1 44  ? 74.010  114.713 128.526 1.00 0.00 ? 48  THR E HG21 1  
ATOM 10872  H HG22 . THR E 1 44  ? 74.709  115.607 128.423 1.00 0.00 ? 48  THR E HG22 1  
ATOM 10873  H HG23 . THR E 1 44  ? 75.385  114.521 127.488 1.00 0.00 ? 48  THR E HG23 1  
ATOM 10874  N N    . LYS E 1 45  ? 77.977  117.427 129.880 1.00 0.00 ? 49  LYS E N    1  
ATOM 10875  C CA   . LYS E 1 45  ? 77.958  118.750 130.497 1.00 0.00 ? 49  LYS E CA   1  
ATOM 10876  C C    . LYS E 1 45  ? 77.899  119.835 129.430 1.00 0.00 ? 49  LYS E C    1  
ATOM 10877  O O    . LYS E 1 45  ? 77.023  119.810 128.559 1.00 0.00 ? 49  LYS E O    1  
ATOM 10878  C CB   . LYS E 1 45  ? 79.187  118.972 131.386 1.00 0.00 ? 49  LYS E CB   1  
ATOM 10879  C CG   . LYS E 1 45  ? 79.319  118.021 132.559 1.00 0.00 ? 49  LYS E CG   1  
ATOM 10880  C CD   . LYS E 1 45  ? 78.713  118.608 133.813 1.00 0.00 ? 49  LYS E CD   1  
ATOM 10881  C CE   . LYS E 1 45  ? 77.849  117.587 134.526 1.00 0.00 ? 49  LYS E CE   1  
ATOM 10882  N NZ   . LYS E 1 45  ? 78.565  116.294 134.689 1.00 0.00 ? 49  LYS E NZ   1  
ATOM 10883  H H    . LYS E 1 45  ? 78.683  117.269 129.414 1.00 0.00 ? 49  LYS E H    1  
ATOM 10884  H HA   . LYS E 1 45  ? 77.165  118.801 131.053 1.00 0.00 ? 49  LYS E HA   1  
ATOM 10885  H HB2  . LYS E 1 45  ? 79.982  118.896 130.836 1.00 0.00 ? 49  LYS E HB2  1  
ATOM 10886  H HB3  . LYS E 1 45  ? 79.162  119.879 131.725 1.00 0.00 ? 49  LYS E HB3  1  
ATOM 10887  H HG2  . LYS E 1 45  ? 78.881  117.182 132.348 1.00 0.00 ? 49  LYS E HG2  1  
ATOM 10888  H HG3  . LYS E 1 45  ? 80.256  117.821 132.712 1.00 0.00 ? 49  LYS E HG3  1  
ATOM 10889  H HD2  . LYS E 1 45  ? 79.418  118.910 134.406 1.00 0.00 ? 49  LYS E HD2  1  
ATOM 10890  H HD3  . LYS E 1 45  ? 78.180  119.385 133.586 1.00 0.00 ? 49  LYS E HD3  1  
ATOM 10891  H HE2  . LYS E 1 45  ? 77.592  117.928 135.397 1.00 0.00 ? 49  LYS E HE2  1  
ATOM 10892  H HE3  . LYS E 1 45  ? 77.032  117.445 134.025 1.00 0.00 ? 49  LYS E HE3  1  
ATOM 10893  H HZ1  . LYS E 1 45  ? 78.969  116.079 133.926 1.00 0.00 ? 49  LYS E HZ1  1  
ATOM 10894  H HZ2  . LYS E 1 45  ? 79.173  116.370 135.335 1.00 0.00 ? 49  LYS E HZ2  1  
ATOM 10895  H HZ3  . LYS E 1 45  ? 77.982  115.657 134.905 1.00 0.00 ? 49  LYS E HZ3  1  
ATOM 10896  N N    . ASN E 1 46  ? 78.823  120.801 129.502 1.00 0.00 ? 50  ASN E N    1  
ATOM 10897  C CA   . ASN E 1 46  ? 78.899  121.867 128.505 1.00 0.00 ? 50  ASN E CA   1  
ATOM 10898  C C    . ASN E 1 46  ? 80.064  121.684 127.539 1.00 0.00 ? 50  ASN E C    1  
ATOM 10899  O O    . ASN E 1 46  ? 80.407  122.625 126.815 1.00 0.00 ? 50  ASN E O    1  
ATOM 10900  C CB   . ASN E 1 46  ? 79.018  123.232 129.196 1.00 0.00 ? 50  ASN E CB   1  
ATOM 10901  C CG   . ASN E 1 46  ? 78.424  124.362 128.375 1.00 0.00 ? 50  ASN E CG   1  
ATOM 10902  O OD1  . ASN E 1 46  ? 79.118  124.998 127.585 1.00 0.00 ? 50  ASN E OD1  1  
ATOM 10903  N ND2  . ASN E 1 46  ? 77.137  124.622 128.568 1.00 0.00 ? 50  ASN E ND2  1  
ATOM 10904  H H    . ASN E 1 46  ? 79.414  120.854 130.124 1.00 0.00 ? 50  ASN E H    1  
ATOM 10905  H HA   . ASN E 1 46  ? 78.079  121.825 127.988 1.00 0.00 ? 50  ASN E HA   1  
ATOM 10906  H HB2  . ASN E 1 46  ? 78.572  123.195 130.056 1.00 0.00 ? 50  ASN E HB2  1  
ATOM 10907  H HB3  . ASN E 1 46  ? 79.953  123.421 129.370 1.00 0.00 ? 50  ASN E HB3  1  
ATOM 10908  H HD21 . ASN E 1 46  ? 76.757  125.258 128.132 1.00 0.00 ? 50  ASN E HD21 1  
ATOM 10909  H HD22 . ASN E 1 46  ? 76.684  124.155 129.130 1.00 0.00 ? 50  ASN E HD22 1  
ATOM 10910  N N    . GLY E 1 47  ? 80.678  120.507 127.508 1.00 0.00 ? 51  GLY E N    1  
ATOM 10911  C CA   . GLY E 1 47  ? 81.805  120.254 126.628 1.00 0.00 ? 51  GLY E CA   1  
ATOM 10912  C C    . GLY E 1 47  ? 83.096  120.152 127.412 1.00 0.00 ? 51  GLY E C    1  
ATOM 10913  O O    . GLY E 1 47  ? 83.878  121.102 127.498 1.00 0.00 ? 51  GLY E O    1  
ATOM 10914  H H    . GLY E 1 47  ? 80.451  119.836 127.996 1.00 0.00 ? 51  GLY E H    1  
ATOM 10915  H HA2  . GLY E 1 47  ? 81.656  119.431 126.136 1.00 0.00 ? 51  GLY E HA2  1  
ATOM 10916  H HA3  . GLY E 1 47  ? 81.876  120.966 125.974 1.00 0.00 ? 51  GLY E HA3  1  
ATOM 10917  N N    . ARG E 1 48  ? 83.326  118.978 127.996 1.00 0.00 ? 52  ARG E N    1  
ATOM 10918  C CA   . ARG E 1 48  ? 84.520  118.741 128.795 1.00 0.00 ? 52  ARG E CA   1  
ATOM 10919  C C    . ARG E 1 48  ? 85.405  117.772 128.018 1.00 0.00 ? 52  ARG E C    1  
ATOM 10920  O O    . ARG E 1 48  ? 86.208  117.027 128.588 1.00 0.00 ? 52  ARG E O    1  
ATOM 10921  C CB   . ARG E 1 48  ? 84.151  118.209 130.187 1.00 0.00 ? 52  ARG E CB   1  
ATOM 10922  C CG   . ARG E 1 48  ? 82.918  118.861 130.837 1.00 0.00 ? 52  ARG E CG   1  
ATOM 10923  C CD   . ARG E 1 48  ? 83.273  119.943 131.854 1.00 0.00 ? 52  ARG E CD   1  
ATOM 10924  N NE   . ARG E 1 48  ? 84.151  120.966 131.290 1.00 0.00 ? 52  ARG E NE   1  
ATOM 10925  C CZ   . ARG E 1 48  ? 83.720  122.026 130.609 1.00 0.00 ? 52  ARG E CZ   1  
ATOM 10926  N NH1  . ARG E 1 48  ? 82.423  122.206 130.404 1.00 0.00 ? 52  ARG E NH1  1  
ATOM 10927  N NH2  . ARG E 1 48  ? 84.588  122.906 130.129 1.00 0.00 ? 52  ARG E NH2  1  
ATOM 10928  H H    . ARG E 1 48  ? 82.798  118.302 127.938 1.00 0.00 ? 52  ARG E H    1  
ATOM 10929  H HA   . ARG E 1 48  ? 85.004  119.567 128.948 1.00 0.00 ? 52  ARG E HA   1  
ATOM 10930  H HB2  . ARG E 1 48  ? 83.996  117.254 130.121 1.00 0.00 ? 52  ARG E HB2  1  
ATOM 10931  H HB3  . ARG E 1 48  ? 84.912  118.334 130.777 1.00 0.00 ? 52  ARG E HB3  1  
ATOM 10932  H HG2  . ARG E 1 48  ? 82.361  119.248 130.144 1.00 0.00 ? 52  ARG E HG2  1  
ATOM 10933  H HG3  . ARG E 1 48  ? 82.390  118.175 131.276 1.00 0.00 ? 52  ARG E HG3  1  
ATOM 10934  H HD2  . ARG E 1 48  ? 82.459  120.360 132.178 1.00 0.00 ? 52  ARG E HD2  1  
ATOM 10935  H HD3  . ARG E 1 48  ? 83.706  119.535 132.621 1.00 0.00 ? 52  ARG E HD3  1  
ATOM 10936  H HE   . ARG E 1 48  ? 84.998  120.878 131.406 1.00 0.00 ? 52  ARG E HE   1  
ATOM 10937  H HH11 . ARG E 1 48  ? 81.856  121.638 130.713 1.00 0.00 ? 52  ARG E HH11 1  
ATOM 10938  H HH12 . ARG E 1 48  ? 82.148  122.892 129.964 1.00 0.00 ? 52  ARG E HH12 1  
ATOM 10939  H HH21 . ARG E 1 48  ? 85.431  122.794 130.258 1.00 0.00 ? 52  ARG E HH21 1  
ATOM 10940  H HH22 . ARG E 1 48  ? 84.308  123.590 129.689 1.00 0.00 ? 52  ARG E HH22 1  
ATOM 10941  N N    . ILE E 1 49  ? 85.219  117.737 126.699 1.00 0.00 ? 53  ILE E N    1  
ATOM 10942  C CA   . ILE E 1 49  ? 86.017  116.885 125.824 1.00 0.00 ? 53  ILE E CA   1  
ATOM 10943  C C    . ILE E 1 49  ? 86.685  117.731 124.745 1.00 0.00 ? 53  ILE E C    1  
ATOM 10944  O O    . ILE E 1 49  ? 87.348  117.199 123.849 1.00 0.00 ? 53  ILE E O    1  
ATOM 10945  C CB   . ILE E 1 49  ? 85.167  115.765 125.194 1.00 0.00 ? 53  ILE E CB   1  
ATOM 10946  C CG1  . ILE E 1 49  ? 83.695  116.177 125.108 1.00 0.00 ? 53  ILE E CG1  1  
ATOM 10947  C CG2  . ILE E 1 49  ? 85.315  114.480 125.990 1.00 0.00 ? 53  ILE E CG2  1  
ATOM 10948  C CD1  . ILE E 1 49  ? 82.810  115.240 124.288 1.00 0.00 ? 53  ILE E CD1  1  
ATOM 10949  H H    . ILE E 1 49  ? 84.627  118.207 126.289 1.00 0.00 ? 53  ILE E H    1  
ATOM 10950  H HA   . ILE E 1 49  ? 86.704  116.457 126.360 1.00 0.00 ? 53  ILE E HA   1  
ATOM 10951  H HB   . ILE E 1 49  ? 85.489  115.612 124.292 1.00 0.00 ? 53  ILE E HB   1  
ATOM 10952  H HG12 . ILE E 1 49  ? 83.336  116.235 126.007 1.00 0.00 ? 53  ILE E HG12 1  
ATOM 10953  H HG13 . ILE E 1 49  ? 83.644  117.067 124.724 1.00 0.00 ? 53  ILE E HG13 1  
ATOM 10954  H HG21 . ILE E 1 49  ? 86.140  114.507 126.498 1.00 0.00 ? 53  ILE E HG21 1  
ATOM 10955  H HG22 . ILE E 1 49  ? 84.564  114.387 126.598 1.00 0.00 ? 53  ILE E HG22 1  
ATOM 10956  H HG23 . ILE E 1 49  ? 85.335  113.723 125.383 1.00 0.00 ? 53  ILE E HG23 1  
ATOM 10957  H HD11 . ILE E 1 49  ? 82.242  114.727 124.884 1.00 0.00 ? 53  ILE E HD11 1  
ATOM 10958  H HD12 . ILE E 1 49  ? 82.258  115.761 123.684 1.00 0.00 ? 53  ILE E HD12 1  
ATOM 10959  H HD13 . ILE E 1 49  ? 83.368  114.635 123.774 1.00 0.00 ? 53  ILE E HD13 1  
ATOM 10960  N N    . LEU E 1 50  ? 86.504  119.052 124.820 1.00 0.00 ? 54  LEU E N    1  
ATOM 10961  C CA   . LEU E 1 50  ? 87.157  119.972 123.897 1.00 0.00 ? 54  LEU E CA   1  
ATOM 10962  C C    . LEU E 1 50  ? 88.319  120.710 124.550 1.00 0.00 ? 54  LEU E C    1  
ATOM 10963  O O    . LEU E 1 50  ? 88.698  121.786 124.075 1.00 0.00 ? 54  LEU E O    1  
ATOM 10964  C CB   . LEU E 1 50  ? 86.154  121.007 123.368 1.00 0.00 ? 54  LEU E CB   1  
ATOM 10965  C CG   . LEU E 1 50  ? 85.783  121.164 121.885 1.00 0.00 ? 54  LEU E CG   1  
ATOM 10966  C CD1  . LEU E 1 50  ? 86.310  122.467 121.305 1.00 0.00 ? 54  LEU E CD1  1  
ATOM 10967  C CD2  . LEU E 1 50  ? 86.290  119.985 121.063 1.00 0.00 ? 54  LEU E CD2  1  
ATOM 10968  H H    . LEU E 1 50  ? 86.002  119.433 125.406 1.00 0.00 ? 54  LEU E H    1  
ATOM 10969  H HA   . LEU E 1 50  ? 87.501  119.435 123.167 1.00 0.00 ? 54  LEU E HA   1  
ATOM 10970  H HB2  . LEU E 1 50  ? 85.322  120.844 123.840 1.00 0.00 ? 54  LEU E HB2  1  
ATOM 10971  H HB3  . LEU E 1 50  ? 86.480  121.874 123.658 1.00 0.00 ? 54  LEU E HB3  1  
ATOM 10972  H HG   . LEU E 1 50  ? 84.815  121.184 121.839 1.00 0.00 ? 54  LEU E HG   1  
ATOM 10973  H HD11 . LEU E 1 50  ? 85.582  122.954 120.889 1.00 0.00 ? 54  LEU E HD11 1  
ATOM 10974  H HD12 . LEU E 1 50  ? 86.695  123.005 122.015 1.00 0.00 ? 54  LEU E HD12 1  
ATOM 10975  H HD13 . LEU E 1 50  ? 86.990  122.275 120.642 1.00 0.00 ? 54  LEU E HD13 1  
ATOM 10976  H HD21 . LEU E 1 50  ? 85.718  119.860 120.290 1.00 0.00 ? 54  LEU E HD21 1  
ATOM 10977  H HD22 . LEU E 1 50  ? 87.197  120.161 120.768 1.00 0.00 ? 54  LEU E HD22 1  
ATOM 10978  H HD23 . LEU E 1 50  ? 86.277  119.182 121.607 1.00 0.00 ? 54  LEU E HD23 1  
ATOM 10979  N N    . GLY E 1 51  ? 88.885  120.150 125.620 1.00 0.00 ? 55  GLY E N    1  
ATOM 10980  C CA   . GLY E 1 51  ? 89.848  120.833 126.451 1.00 0.00 ? 55  GLY E CA   1  
ATOM 10981  C C    . GLY E 1 51  ? 91.287  120.558 126.075 1.00 0.00 ? 55  GLY E C    1  
ATOM 10982  O O    . GLY E 1 51  ? 91.603  119.580 125.393 1.00 0.00 ? 55  GLY E O    1  
ATOM 10983  H H    . GLY E 1 51  ? 88.711  119.349 125.880 1.00 0.00 ? 55  GLY E H    1  
ATOM 10984  H HA2  . GLY E 1 51  ? 89.686  121.788 126.399 1.00 0.00 ? 55  GLY E HA2  1  
ATOM 10985  H HA3  . GLY E 1 51  ? 89.708  120.572 127.374 1.00 0.00 ? 55  GLY E HA3  1  
ATOM 10986  N N    . PRO E 1 52  ? 92.195  121.427 126.522 1.00 0.00 ? 56  PRO E N    1  
ATOM 10987  C CA   . PRO E 1 52  ? 93.599  121.294 126.122 1.00 0.00 ? 56  PRO E CA   1  
ATOM 10988  C C    . PRO E 1 52  ? 94.320  120.141 126.791 1.00 0.00 ? 56  PRO E C    1  
ATOM 10989  O O    . PRO E 1 52  ? 93.939  119.686 127.874 1.00 0.00 ? 56  PRO E O    1  
ATOM 10990  C CB   . PRO E 1 52  ? 94.188  122.666 126.469 1.00 0.00 ? 56  PRO E CB   1  
ATOM 10991  C CG   . PRO E 1 52  ? 93.352  123.147 127.588 1.00 0.00 ? 56  PRO E CG   1  
ATOM 10992  C CD   . PRO E 1 52  ? 91.962  122.643 127.317 1.00 0.00 ? 56  PRO E CD   1  
ATOM 10993  H HA   . PRO E 1 52  ? 93.682  121.097 125.177 1.00 0.00 ? 56  PRO E HA   1  
ATOM 10994  H HB2  . PRO E 1 52  ? 95.120  122.597 126.728 1.00 0.00 ? 56  PRO E HB2  1  
ATOM 10995  H HB3  . PRO E 1 52  ? 94.148  123.271 125.711 1.00 0.00 ? 56  PRO E HB3  1  
ATOM 10996  H HG2  . PRO E 1 52  ? 93.683  122.814 128.436 1.00 0.00 ? 56  PRO E HG2  1  
ATOM 10997  H HG3  . PRO E 1 52  ? 93.365  124.116 127.639 1.00 0.00 ? 56  PRO E HG3  1  
ATOM 10998  H HD2  . PRO E 1 52  ? 91.486  122.449 128.139 1.00 0.00 ? 56  PRO E HD2  1  
ATOM 10999  H HD3  . PRO E 1 52  ? 91.433  123.294 126.830 1.00 0.00 ? 56  PRO E HD3  1  
ATOM 11000  N N    . GLY E 1 53  ? 95.377  119.668 126.138 1.00 0.00 ? 57  GLY E N    1  
ATOM 11001  C CA   . GLY E 1 53  ? 96.166  118.562 126.644 1.00 0.00 ? 57  GLY E CA   1  
ATOM 11002  C C    . GLY E 1 53  ? 97.550  118.614 126.044 1.00 0.00 ? 57  GLY E C    1  
ATOM 11003  O O    . GLY E 1 53  ? 97.898  119.537 125.305 1.00 0.00 ? 57  GLY E O    1  
ATOM 11004  H H    . GLY E 1 53  ? 95.654  119.983 125.388 1.00 0.00 ? 57  GLY E H    1  
ATOM 11005  H HA2  . GLY E 1 53  ? 96.220  118.606 127.612 1.00 0.00 ? 57  GLY E HA2  1  
ATOM 11006  H HA3  . GLY E 1 53  ? 95.738  117.720 126.423 1.00 0.00 ? 57  GLY E HA3  1  
ATOM 11007  N N    . SER E 1 54  ? 98.347  117.605 126.383 1.00 0.00 ? 58  SER E N    1  
ATOM 11008  C CA   . SER E 1 54  ? 99.706  117.526 125.869 1.00 0.00 ? 58  SER E CA   1  
ATOM 11009  C C    . SER E 1 54  ? 99.703  117.047 124.421 1.00 0.00 ? 58  SER E C    1  
ATOM 11010  O O    . SER E 1 54  ? 98.669  116.658 123.872 1.00 0.00 ? 58  SER E O    1  
ATOM 11011  C CB   . SER E 1 54  ? 100.547 116.588 126.733 1.00 0.00 ? 58  SER E CB   1  
ATOM 11012  O OG   . SER E 1 54  ? 101.857 117.092 126.908 1.00 0.00 ? 58  SER E OG   1  
ATOM 11013  H H    . SER E 1 54  ? 98.120  116.961 126.906 1.00 0.00 ? 58  SER E H    1  
ATOM 11014  H HA   . SER E 1 54  ? 100.098 118.412 125.901 1.00 0.00 ? 58  SER E HA   1  
ATOM 11015  H HB2  . SER E 1 54  ? 100.123 116.474 127.598 1.00 0.00 ? 58  SER E HB2  1  
ATOM 11016  H HB3  . SER E 1 54  ? 100.587 115.712 126.320 1.00 0.00 ? 58  SER E HB3  1  
ATOM 11017  H HG   . SER E 1 54  ? 102.414 116.527 126.631 1.00 0.00 ? 58  SER E HG   1  
ATOM 11018  N N    . VAL E 1 55  ? 100.875 117.089 123.800 1.00 0.00 ? 59  VAL E N    1  
ATOM 11019  C CA   . VAL E 1 55  ? 101.041 116.719 122.400 1.00 0.00 ? 59  VAL E CA   1  
ATOM 11020  C C    . VAL E 1 55  ? 102.091 115.615 122.298 1.00 0.00 ? 59  VAL E C    1  
ATOM 11021  O O    . VAL E 1 55  ? 103.180 115.710 122.879 1.00 0.00 ? 59  VAL E O    1  
ATOM 11022  C CB   . VAL E 1 55  ? 101.368 117.944 121.523 1.00 0.00 ? 59  VAL E CB   1  
ATOM 11023  C CG1  . VAL E 1 55  ? 102.123 117.569 120.239 1.00 0.00 ? 59  VAL E CG1  1  
ATOM 11024  C CG2  . VAL E 1 55  ? 100.097 118.713 121.183 1.00 0.00 ? 59  VAL E CG2  1  
ATOM 11025  H H    . VAL E 1 55  ? 101.605 117.335 124.184 1.00 0.00 ? 59  VAL E H    1  
ATOM 11026  H HA   . VAL E 1 55  ? 100.203 116.372 122.055 1.00 0.00 ? 59  VAL E HA   1  
ATOM 11027  H HB   . VAL E 1 55  ? 101.957 118.512 122.043 1.00 0.00 ? 59  VAL E HB   1  
ATOM 11028  H HG11 . VAL E 1 55  ? 101.986 116.628 120.046 1.00 0.00 ? 59  VAL E HG11 1  
ATOM 11029  H HG12 . VAL E 1 55  ? 101.790 118.102 119.500 1.00 0.00 ? 59  VAL E HG12 1  
ATOM 11030  H HG13 . VAL E 1 55  ? 103.071 117.740 120.359 1.00 0.00 ? 59  VAL E HG13 1  
ATOM 11031  H HG21 . VAL E 1 55  ? 99.755  118.411 120.328 1.00 0.00 ? 59  VAL E HG21 1  
ATOM 11032  H HG22 . VAL E 1 55  ? 99.431  118.557 121.870 1.00 0.00 ? 59  VAL E HG22 1  
ATOM 11033  H HG23 . VAL E 1 55  ? 100.296 119.661 121.135 1.00 0.00 ? 59  VAL E HG23 1  
ATOM 11034  N N    . ALA E 1 56  ? 101.735 114.538 121.607 1.00 0.00 ? 60  ALA E N    1  
ATOM 11035  C CA   . ALA E 1 56  ? 102.650 113.444 121.316 1.00 0.00 ? 60  ALA E CA   1  
ATOM 11036  C C    . ALA E 1 56  ? 103.058 113.556 119.859 1.00 0.00 ? 60  ALA E C    1  
ATOM 11037  O O    . ALA E 1 56  ? 102.219 113.412 118.963 1.00 0.00 ? 60  ALA E O    1  
ATOM 11038  C CB   . ALA E 1 56  ? 102.010 112.085 121.601 1.00 0.00 ? 60  ALA E CB   1  
ATOM 11039  H H    . ALA E 1 56  ? 100.944 114.421 121.291 1.00 0.00 ? 60  ALA E H    1  
ATOM 11040  H HA   . ALA E 1 56  ? 103.429 113.507 121.890 1.00 0.00 ? 60  ALA E HA   1  
ATOM 11041  H HB1  . ALA E 1 56  ? 102.360 111.731 122.434 1.00 0.00 ? 60  ALA E HB1  1  
ATOM 11042  H HB2  . ALA E 1 56  ? 101.048 112.189 121.672 1.00 0.00 ? 60  ALA E HB2  1  
ATOM 11043  H HB3  . ALA E 1 56  ? 102.217 111.473 120.878 1.00 0.00 ? 60  ALA E HB3  1  
ATOM 11044  N N    . ASP E 1 57  ? 104.336 113.815 119.622 1.00 0.00 ? 61  ASP E N    1  
ATOM 11045  C CA   . ASP E 1 57  ? 104.835 114.123 118.291 1.00 0.00 ? 61  ASP E CA   1  
ATOM 11046  C C    . ASP E 1 57  ? 105.882 113.089 117.916 1.00 0.00 ? 61  ASP E C    1  
ATOM 11047  O O    . ASP E 1 57  ? 106.928 112.977 118.573 1.00 0.00 ? 61  ASP E O    1  
ATOM 11048  C CB   . ASP E 1 57  ? 105.397 115.545 118.247 1.00 0.00 ? 61  ASP E CB   1  
ATOM 11049  C CG   . ASP E 1 57  ? 104.718 116.429 117.211 1.00 0.00 ? 61  ASP E CG   1  
ATOM 11050  O OD1  . ASP E 1 57  ? 103.853 117.258 117.554 1.00 0.00 ? 61  ASP E OD1  1  
ATOM 11051  O OD2  . ASP E 1 57  ? 105.084 116.311 116.025 1.00 0.00 ? 61  ASP E OD2  1  
ATOM 11052  H H    . ASP E 1 57  ? 104.942 113.818 120.232 1.00 0.00 ? 61  ASP E H    1  
ATOM 11053  H HA   . ASP E 1 57  ? 104.112 114.086 117.645 1.00 0.00 ? 61  ASP E HA   1  
ATOM 11054  H HB2  . ASP E 1 57  ? 105.301 115.952 119.123 1.00 0.00 ? 61  ASP E HB2  1  
ATOM 11055  H HB3  . ASP E 1 57  ? 106.347 115.505 118.056 1.00 0.00 ? 61  ASP E HB3  1  
ATOM 11056  N N    . SER E 1 58  ? 105.589 112.338 116.860 1.00 0.00 ? 62  SER E N    1  
ATOM 11057  C CA   . SER E 1 58  ? 106.437 111.269 116.366 1.00 0.00 ? 62  SER E CA   1  
ATOM 11058  C C    . SER E 1 58  ? 106.397 111.233 114.847 1.00 0.00 ? 62  SER E C    1  
ATOM 11059  O O    . SER E 1 58  ? 105.377 111.529 114.220 1.00 0.00 ? 62  SER E O    1  
ATOM 11060  C CB   . SER E 1 58  ? 105.989 109.918 116.929 1.00 0.00 ? 62  SER E CB   1  
ATOM 11061  O OG   . SER E 1 58  ? 104.774 109.503 116.336 1.00 0.00 ? 62  SER E OG   1  
ATOM 11062  H H    . SER E 1 58  ? 104.870 112.442 116.400 1.00 0.00 ? 62  SER E H    1  
ATOM 11063  H HA   . SER E 1 58  ? 107.346 111.440 116.659 1.00 0.00 ? 62  SER E HA   1  
ATOM 11064  H HB2  . SER E 1 58  ? 106.676 109.253 116.769 1.00 0.00 ? 62  SER E HB2  1  
ATOM 11065  H HB3  . SER E 1 58  ? 105.877 109.984 117.891 1.00 0.00 ? 62  SER E HB3  1  
ATOM 11066  H HG   . SER E 1 58  ? 104.745 109.769 115.540 1.00 0.00 ? 62  SER E HG   1  
ATOM 11067  N N    . GLY E 1 59  ? 107.528 110.861 114.262 1.00 0.00 ? 63  GLY E N    1  
ATOM 11068  C CA   . GLY E 1 59  ? 107.612 110.704 112.829 1.00 0.00 ? 63  GLY E CA   1  
ATOM 11069  C C    . GLY E 1 59  ? 108.416 109.487 112.435 1.00 0.00 ? 63  GLY E C    1  
ATOM 11070  O O    . GLY E 1 59  ? 109.253 109.011 113.206 1.00 0.00 ? 63  GLY E O    1  
ATOM 11071  H H    . GLY E 1 59  ? 108.259 110.696 114.684 1.00 0.00 ? 63  GLY E H    1  
ATOM 11072  H HA2  . GLY E 1 59  ? 106.718 110.632 112.460 1.00 0.00 ? 63  GLY E HA2  1  
ATOM 11073  H HA3  . GLY E 1 59  ? 108.016 111.496 112.441 1.00 0.00 ? 63  GLY E HA3  1  
ATOM 11074  N N    . GLU E 1 60  ? 108.169 108.969 111.241 1.00 0.00 ? 64  GLU E N    1  
ATOM 11075  C CA   . GLU E 1 60  ? 108.948 107.864 110.692 1.00 0.00 ? 64  GLU E CA   1  
ATOM 11076  C C    . GLU E 1 60  ? 109.544 108.336 109.376 1.00 0.00 ? 64  GLU E C    1  
ATOM 11077  O O    . GLU E 1 60  ? 108.973 109.189 108.694 1.00 0.00 ? 64  GLU E O    1  
ATOM 11078  C CB   . GLU E 1 60  ? 108.086 106.621 110.508 1.00 0.00 ? 64  GLU E CB   1  
ATOM 11079  C CG   . GLU E 1 60  ? 106.985 106.785 109.480 1.00 0.00 ? 64  GLU E CG   1  
ATOM 11080  C CD   . GLU E 1 60  ? 107.323 106.121 108.156 1.00 0.00 ? 64  GLU E CD   1  
ATOM 11081  O OE1  . GLU E 1 60  ? 107.429 104.877 108.121 1.00 0.00 ? 64  GLU E OE1  1  
ATOM 11082  O OE2  . GLU E 1 60  ? 107.480 106.841 107.148 1.00 0.00 ? 64  GLU E OE2  1  
ATOM 11083  H H    . GLU E 1 60  ? 107.543 109.248 110.721 1.00 0.00 ? 64  GLU E H    1  
ATOM 11084  H HA   . GLU E 1 60  ? 109.657 107.612 111.304 1.00 0.00 ? 64  GLU E HA   1  
ATOM 11085  H HB2  . GLU E 1 60  ? 108.655 105.880 110.246 1.00 0.00 ? 64  GLU E HB2  1  
ATOM 11086  H HB3  . GLU E 1 60  ? 107.688 106.385 111.360 1.00 0.00 ? 64  GLU E HB3  1  
ATOM 11087  H HG2  . GLU E 1 60  ? 106.163 106.407 109.827 1.00 0.00 ? 64  GLU E HG2  1  
ATOM 11088  H HG3  . GLU E 1 60  ? 106.822 107.730 109.332 1.00 0.00 ? 64  GLU E HG3  1  
ATOM 11089  N N    . VAL E 1 61  ? 110.694 107.778 109.018 1.00 0.00 ? 65  VAL E N    1  
ATOM 11090  C CA   . VAL E 1 61  ? 111.403 108.166 107.806 1.00 0.00 ? 65  VAL E CA   1  
ATOM 11091  C C    . VAL E 1 61  ? 111.815 106.906 107.068 1.00 0.00 ? 65  VAL E C    1  
ATOM 11092  O O    . VAL E 1 61  ? 112.495 106.044 107.634 1.00 0.00 ? 65  VAL E O    1  
ATOM 11093  C CB   . VAL E 1 61  ? 112.626 109.037 108.134 1.00 0.00 ? 65  VAL E CB   1  
ATOM 11094  C CG1  . VAL E 1 61  ? 113.303 109.506 106.861 1.00 0.00 ? 65  VAL E CG1  1  
ATOM 11095  C CG2  . VAL E 1 61  ? 112.215 110.208 108.996 1.00 0.00 ? 65  VAL E CG2  1  
ATOM 11096  H H    . VAL E 1 61  ? 111.087 107.163 109.472 1.00 0.00 ? 65  VAL E H    1  
ATOM 11097  H HA   . VAL E 1 61  ? 110.818 108.699 107.244 1.00 0.00 ? 65  VAL E HA   1  
ATOM 11098  H HB   . VAL E 1 61  ? 113.265 108.504 108.630 1.00 0.00 ? 65  VAL E HB   1  
ATOM 11099  H HG11 . VAL E 1 61  ? 112.689 110.056 106.351 1.00 0.00 ? 65  VAL E HG11 1  
ATOM 11100  H HG12 . VAL E 1 61  ? 114.091 110.024 107.085 1.00 0.00 ? 65  VAL E HG12 1  
ATOM 11101  H HG13 . VAL E 1 61  ? 113.564 108.737 106.331 1.00 0.00 ? 65  VAL E HG13 1  
ATOM 11102  H HG21 . VAL E 1 61  ? 111.263 110.159 109.176 1.00 0.00 ? 65  VAL E HG21 1  
ATOM 11103  H HG22 . VAL E 1 61  ? 112.704 110.181 109.833 1.00 0.00 ? 65  VAL E HG22 1  
ATOM 11104  H HG23 . VAL E 1 61  ? 112.413 111.037 108.532 1.00 0.00 ? 65  VAL E HG23 1  
ATOM 11105  N N    . THR E 1 62  ? 111.403 106.782 105.813 1.00 0.00 ? 66  THR E N    1  
ATOM 11106  C CA   . THR E 1 62  ? 111.840 105.665 104.994 1.00 0.00 ? 66  THR E CA   1  
ATOM 11107  C C    . THR E 1 62  ? 112.728 106.169 103.868 1.00 0.00 ? 66  THR E C    1  
ATOM 11108  O O    . THR E 1 62  ? 112.473 107.231 103.293 1.00 0.00 ? 66  THR E O    1  
ATOM 11109  C CB   . THR E 1 62  ? 110.649 104.907 104.424 1.00 0.00 ? 66  THR E CB   1  
ATOM 11110  O OG1  . THR E 1 62  ? 109.849 105.808 103.656 1.00 0.00 ? 66  THR E OG1  1  
ATOM 11111  C CG2  . THR E 1 62  ? 109.799 104.332 105.540 1.00 0.00 ? 66  THR E CG2  1  
ATOM 11112  H H    . THR E 1 62  ? 110.872 107.332 105.419 1.00 0.00 ? 66  THR E H    1  
ATOM 11113  H HA   . THR E 1 62  ? 112.346 105.054 105.552 1.00 0.00 ? 66  THR E HA   1  
ATOM 11114  H HB   . THR E 1 62  ? 110.977 104.182 103.870 1.00 0.00 ? 66  THR E HB   1  
ATOM 11115  H HG1  . THR E 1 62  ? 109.051 105.764 103.915 1.00 0.00 ? 66  THR E HG1  1  
ATOM 11116  H HG21 . THR E 1 62  ? 110.646 103.880 105.406 1.00 0.00 ? 66  THR E HG21 1  
ATOM 11117  H HG22 . THR E 1 62  ? 110.333 103.722 106.072 1.00 0.00 ? 66  THR E HG22 1  
ATOM 11118  H HG23 . THR E 1 62  ? 109.473 105.053 106.102 1.00 0.00 ? 66  THR E HG23 1  
ATOM 11119  N N    . TYR E 1 63  ? 113.781 105.411 103.569 1.00 0.00 ? 67  TYR E N    1  
ATOM 11120  C CA   . TYR E 1 63  ? 114.664 105.733 102.447 1.00 0.00 ? 67  TYR E CA   1  
ATOM 11121  C C    . TYR E 1 63  ? 115.422 104.475 102.036 1.00 0.00 ? 67  TYR E C    1  
ATOM 11122  O O    . TYR E 1 63  ? 115.388 103.455 102.729 1.00 0.00 ? 67  TYR E O    1  
ATOM 11123  C CB   . TYR E 1 63  ? 115.616 106.885 102.792 1.00 0.00 ? 67  TYR E CB   1  
ATOM 11124  C CG   . TYR E 1 63  ? 116.506 106.683 103.998 1.00 0.00 ? 67  TYR E CG   1  
ATOM 11125  C CD1  . TYR E 1 63  ? 116.036 106.925 105.277 1.00 0.00 ? 67  TYR E CD1  1  
ATOM 11126  C CD2  . TYR E 1 63  ? 117.830 106.293 103.851 1.00 0.00 ? 67  TYR E CD2  1  
ATOM 11127  C CE1  . TYR E 1 63  ? 116.851 106.762 106.373 1.00 0.00 ? 67  TYR E CE1  1  
ATOM 11128  C CE2  . TYR E 1 63  ? 118.651 106.127 104.940 1.00 0.00 ? 67  TYR E CE2  1  
ATOM 11129  C CZ   . TYR E 1 63  ? 118.159 106.363 106.196 1.00 0.00 ? 67  TYR E CZ   1  
ATOM 11130  O OH   . TYR E 1 63  ? 118.982 106.193 107.282 1.00 0.00 ? 67  TYR E OH   1  
ATOM 11131  H H    . TYR E 1 63  ? 114.002 104.703 104.004 1.00 0.00 ? 67  TYR E H    1  
ATOM 11132  H HA   . TYR E 1 63  ? 114.129 106.038 101.697 1.00 0.00 ? 67  TYR E HA   1  
ATOM 11133  H HB2  . TYR E 1 63  ? 116.182 107.053 102.022 1.00 0.00 ? 67  TYR E HB2  1  
ATOM 11134  H HB3  . TYR E 1 63  ? 115.087 107.685 102.935 1.00 0.00 ? 67  TYR E HB3  1  
ATOM 11135  H HD1  . TYR E 1 63  ? 115.156 107.201 105.397 1.00 0.00 ? 67  TYR E HD1  1  
ATOM 11136  H HD2  . TYR E 1 63  ? 118.168 106.140 102.999 1.00 0.00 ? 67  TYR E HD2  1  
ATOM 11137  H HE1  . TYR E 1 63  ? 116.523 106.919 107.228 1.00 0.00 ? 67  TYR E HE1  1  
ATOM 11138  H HE2  . TYR E 1 63  ? 119.533 105.856 104.825 1.00 0.00 ? 67  TYR E HE2  1  
ATOM 11139  H HH   . TYR E 1 63  ? 118.825 106.793 107.849 1.00 0.00 ? 67  TYR E HH   1  
ATOM 11140  N N    . TYR E 1 64  ? 116.099 104.547 100.889 1.00 0.00 ? 68  TYR E N    1  
ATOM 11141  C CA   . TYR E 1 64  ? 116.959 103.477 100.398 1.00 0.00 ? 68  TYR E CA   1  
ATOM 11142  C C    . TYR E 1 64  ? 118.403 103.816 100.732 1.00 0.00 ? 68  TYR E C    1  
ATOM 11143  O O    . TYR E 1 64  ? 118.927 104.832 100.268 1.00 0.00 ? 68  TYR E O    1  
ATOM 11144  C CB   . TYR E 1 64  ? 116.827 103.277 98.886  1.00 0.00 ? 68  TYR E CB   1  
ATOM 11145  C CG   . TYR E 1 64  ? 115.416 103.194 98.358  1.00 0.00 ? 68  TYR E CG   1  
ATOM 11146  C CD1  . TYR E 1 64  ? 114.751 104.317 97.890  1.00 0.00 ? 68  TYR E CD1  1  
ATOM 11147  C CD2  . TYR E 1 64  ? 114.735 101.990 98.366  1.00 0.00 ? 68  TYR E CD2  1  
ATOM 11148  C CE1  . TYR E 1 64  ? 113.460 104.233 97.413  1.00 0.00 ? 68  TYR E CE1  1  
ATOM 11149  C CE2  . TYR E 1 64  ? 113.440 101.901 97.906  1.00 0.00 ? 68  TYR E CE2  1  
ATOM 11150  C CZ   . TYR E 1 64  ? 112.812 103.025 97.424  1.00 0.00 ? 68  TYR E CZ   1  
ATOM 11151  O OH   . TYR E 1 64  ? 111.523 102.940 96.959  1.00 0.00 ? 68  TYR E OH   1  
ATOM 11152  H H    . TYR E 1 64  ? 116.069 105.231 100.369 1.00 0.00 ? 68  TYR E H    1  
ATOM 11153  H HA   . TYR E 1 64  ? 116.686 102.653 100.829 1.00 0.00 ? 68  TYR E HA   1  
ATOM 11154  H HB2  . TYR E 1 64  ? 117.281 104.008 98.439  1.00 0.00 ? 68  TYR E HB2  1  
ATOM 11155  H HB3  . TYR E 1 64  ? 117.295 102.462 98.643  1.00 0.00 ? 68  TYR E HB3  1  
ATOM 11156  H HD1  . TYR E 1 64  ? 115.184 105.140 97.897  1.00 0.00 ? 68  TYR E HD1  1  
ATOM 11157  H HD2  . TYR E 1 64  ? 115.159 101.227 98.687  1.00 0.00 ? 68  TYR E HD2  1  
ATOM 11158  H HE1  . TYR E 1 64  ? 113.032 104.992 97.087  1.00 0.00 ? 68  TYR E HE1  1  
ATOM 11159  H HE2  . TYR E 1 64  ? 112.993 101.085 97.921  1.00 0.00 ? 68  TYR E HE2  1  
ATOM 11160  H HH   . TYR E 1 64  ? 110.988 103.119 97.581  1.00 0.00 ? 68  TYR E HH   1  
ATOM 11161  N N    . GLY E 1 65  ? 119.049 102.954 101.511 1.00 0.00 ? 69  GLY E N    1  
ATOM 11162  C CA   . GLY E 1 65  ? 120.400 103.220 101.966 1.00 0.00 ? 69  GLY E CA   1  
ATOM 11163  C C    . GLY E 1 65  ? 121.462 103.144 100.891 1.00 0.00 ? 69  GLY E C    1  
ATOM 11164  O O    . GLY E 1 65  ? 121.519 102.173 100.132 1.00 0.00 ? 69  GLY E O    1  
ATOM 11165  H H    . GLY E 1 65  ? 118.719 102.209 101.786 1.00 0.00 ? 69  GLY E H    1  
ATOM 11166  H HA2  . GLY E 1 65  ? 120.424 104.105 102.365 1.00 0.00 ? 69  GLY E HA2  1  
ATOM 11167  H HA3  . GLY E 1 65  ? 120.622 102.587 102.667 1.00 0.00 ? 69  GLY E HA3  1  
ATOM 11168  N N    . LYS E 1 66  ? 122.311 104.164 100.817 1.00 0.00 ? 70  LYS E N    1  
ATOM 11169  C CA   . LYS E 1 66  ? 123.441 104.148 99.904  1.00 0.00 ? 70  LYS E CA   1  
ATOM 11170  C C    . LYS E 1 66  ? 124.672 103.606 100.634 1.00 0.00 ? 70  LYS E C    1  
ATOM 11171  O O    . LYS E 1 66  ? 124.783 103.692 101.859 1.00 0.00 ? 70  LYS E O    1  
ATOM 11172  C CB   . LYS E 1 66  ? 123.683 105.557 99.347  1.00 0.00 ? 70  LYS E CB   1  
ATOM 11173  C CG   . LYS E 1 66  ? 122.440 106.310 98.879  1.00 0.00 ? 70  LYS E CG   1  
ATOM 11174  C CD   . LYS E 1 66  ? 122.681 107.056 97.577  1.00 0.00 ? 70  LYS E CD   1  
ATOM 11175  C CE   . LYS E 1 66  ? 121.376 107.532 96.959  1.00 0.00 ? 70  LYS E CE   1  
ATOM 11176  N NZ   . LYS E 1 66  ? 120.997 106.719 95.772  1.00 0.00 ? 70  LYS E NZ   1  
ATOM 11177  H H    . LYS E 1 66  ? 122.247 104.878 101.292 1.00 0.00 ? 70  LYS E H    1  
ATOM 11178  H HA   . LYS E 1 66  ? 123.254 103.564 99.153  1.00 0.00 ? 70  LYS E HA   1  
ATOM 11179  H HB2  . LYS E 1 66  ? 124.122 106.086 100.031 1.00 0.00 ? 70  LYS E HB2  1  
ATOM 11180  H HB3  . LYS E 1 66  ? 124.300 105.490 98.601  1.00 0.00 ? 70  LYS E HB3  1  
ATOM 11181  H HG2  . LYS E 1 66  ? 121.709 105.683 98.761  1.00 0.00 ? 70  LYS E HG2  1  
ATOM 11182  H HG3  . LYS E 1 66  ? 122.167 106.939 99.565  1.00 0.00 ? 70  LYS E HG3  1  
ATOM 11183  H HD2  . LYS E 1 66  ? 123.259 107.817 97.741  1.00 0.00 ? 70  LYS E HD2  1  
ATOM 11184  H HD3  . LYS E 1 66  ? 123.144 106.477 96.951  1.00 0.00 ? 70  LYS E HD3  1  
ATOM 11185  H HE2  . LYS E 1 66  ? 120.669 107.487 97.622  1.00 0.00 ? 70  LYS E HE2  1  
ATOM 11186  H HE3  . LYS E 1 66  ? 121.462 108.463 96.699  1.00 0.00 ? 70  LYS E HE3  1  
ATOM 11187  H HZ1  . LYS E 1 66  ? 120.546 105.999 96.038  1.00 0.00 ? 70  LYS E HZ1  1  
ATOM 11188  H HZ2  . LYS E 1 66  ? 120.486 107.206 95.230  1.00 0.00 ? 70  LYS E HZ2  1  
ATOM 11189  H HZ3  . LYS E 1 66  ? 121.731 106.465 95.339  1.00 0.00 ? 70  LYS E HZ3  1  
ATOM 11190  N N    . ARG E 1 67  ? 125.599 103.027 99.864  1.00 0.00 ? 71  ARG E N    1  
ATOM 11191  C CA   . ARG E 1 67  ? 126.748 102.329 100.436 1.00 0.00 ? 71  ARG E CA   1  
ATOM 11192  C C    . ARG E 1 67  ? 127.435 103.106 101.554 1.00 0.00 ? 71  ARG E C    1  
ATOM 11193  O O    . ARG E 1 67  ? 127.662 102.539 102.627 1.00 0.00 ? 71  ARG E O    1  
ATOM 11194  C CB   . ARG E 1 67  ? 127.758 102.013 99.335  1.00 0.00 ? 71  ARG E CB   1  
ATOM 11195  C CG   . ARG E 1 67  ? 128.013 103.170 98.385  1.00 0.00 ? 71  ARG E CG   1  
ATOM 11196  C CD   . ARG E 1 67  ? 127.710 102.784 96.951  1.00 0.00 ? 71  ARG E CD   1  
ATOM 11197  N NE   . ARG E 1 67  ? 126.533 103.482 96.442  1.00 0.00 ? 71  ARG E NE   1  
ATOM 11198  C CZ   . ARG E 1 67  ? 126.533 104.258 95.364  1.00 0.00 ? 71  ARG E CZ   1  
ATOM 11199  N NH1  . ARG E 1 67  ? 125.414 104.851 94.974  1.00 0.00 ? 71  ARG E NH1  1  
ATOM 11200  N NH2  . ARG E 1 67  ? 127.651 104.444 94.676  1.00 0.00 ? 71  ARG E NH2  1  
ATOM 11201  H H    . ARG E 1 67  ? 125.578 103.028 99.004  1.00 0.00 ? 71  ARG E H    1  
ATOM 11202  H HA   . ARG E 1 67  ? 126.407 101.513 100.833 1.00 0.00 ? 71  ARG E HA   1  
ATOM 11203  H HB2  . ARG E 1 67  ? 128.597 101.750 99.743  1.00 0.00 ? 71  ARG E HB2  1  
ATOM 11204  H HB3  . ARG E 1 67  ? 127.440 101.251 98.825  1.00 0.00 ? 71  ARG E HB3  1  
ATOM 11205  H HG2  . ARG E 1 67  ? 127.465 103.928 98.641  1.00 0.00 ? 71  ARG E HG2  1  
ATOM 11206  H HG3  . ARG E 1 67  ? 128.938 103.452 98.458  1.00 0.00 ? 71  ARG E HG3  1  
ATOM 11207  H HD2  . ARG E 1 67  ? 128.475 102.988 96.392  1.00 0.00 ? 71  ARG E HD2  1  
ATOM 11208  H HD3  . ARG E 1 67  ? 127.567 101.826 96.897  1.00 0.00 ? 71  ARG E HD3  1  
ATOM 11209  H HE   . ARG E 1 67  ? 125.792 103.385 96.867  1.00 0.00 ? 71  ARG E HE   1  
ATOM 11210  H HH11 . ARG E 1 67  ? 124.687 104.733 95.418  1.00 0.00 ? 71  ARG E HH11 1  
ATOM 11211  H HH12 . ARG E 1 67  ? 125.414 105.353 94.276  1.00 0.00 ? 71  ARG E HH12 1  
ATOM 11212  H HH21 . ARG E 1 67  ? 128.379 104.061 94.927  1.00 0.00 ? 71  ARG E HH21 1  
ATOM 11213  H HH22 . ARG E 1 67  ? 127.648 104.947 93.979  1.00 0.00 ? 71  ARG E HH22 1  
ATOM 11214  N N    . GLY E 1 68  ? 127.771 104.371 101.340 1.00 0.00 ? 72  GLY E N    1  
ATOM 11215  C CA   . GLY E 1 68  ? 128.362 105.202 102.375 1.00 0.00 ? 72  GLY E CA   1  
ATOM 11216  C C    . GLY E 1 68  ? 128.164 106.666 102.043 1.00 0.00 ? 72  GLY E C