data_6ZGI
# 
_entry.id   6ZGI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.333 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6ZGI         
WWPDB D_1292109487 
EMDB  EMD-11207    
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        'Furin Cleaved Spike Protein of SARS-CoV-2 in Closed Conformation' 
_pdbx_database_related.db_id          EMD-11207 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6ZGI 
_pdbx_database_status.recvd_initial_deposition_date   2020-06-18 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Wrobel, A.G.'    1 0000-0002-6680-5587 
'Benton, D.J.'    2 0000-0001-6748-9339 
'Rosenthal, P.B.' 3 0000-0002-0387-2862 
'Gamblin, S.J.'   4 0000-0001-5331-639X 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1545-9985 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            27 
_citation.language                  ? 
_citation.page_first                763 
_citation.page_last                 767 
_citation.title                     
'SARS-CoV-2 and bat RaTG13 spike glycoprotein structures inform on virus evolution and furin-cleavage effects.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41594-020-0468-7 
_citation.pdbx_database_id_PubMed   32647346 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Wrobel, A.G.'    1 0000-0002-6680-5587 
primary 'Benton, D.J.'    2 0000-0001-6748-9339 
primary 'Xu, P.'          3 ?                   
primary 'Roustan, C.'     4 ?                   
primary 'Martin, S.R.'    5 ?                   
primary 'Rosenthal, P.B.' 6 0000-0002-0387-2862 
primary 'Skehel, J.J.'    7 ?                   
primary 'Gamblin, S.J.'   8 0000-0001-5331-639X 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6ZGI 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.00 
_cell.length_a_esd                 ? 
_cell.length_b                     1.00 
_cell.length_b_esd                 ? 
_cell.length_c                     1.00 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        ? 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6ZGI 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Spike glycoprotein'                                                                      142410.078 3  ? ? ? ? 
2 branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401    27 ? ? ? ? 
3 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                                                  221.208    24 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'S glycoprotein,E2,Peplomer protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGILPSPGMPALLSLVSLLSVLLMGCVAETGMFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLH
STQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIK
VCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTP
INLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAV
DCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLY
NSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNY
NYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKK
STNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVA
VLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVAS
QSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTG
IAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDL
ICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNS
AIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVT
QQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHF
PREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDI
SGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQSGRENLYFQGGGGSGYIPEAPRDGQAYVRKDGEWVLLSTFL
GHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGILPSPGMPALLSLVSLLSVLLMGCVAETGMFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLH
STQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIK
VCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTP
INLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAV
DCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLY
NSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNY
NYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKK
STNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVA
VLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVAS
QSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTG
IAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDL
ICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNS
AIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVT
QQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHF
PREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDI
SGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQSGRENLYFQGGGGSGYIPEAPRDGQAYVRKDGEWVLLSTFL
GHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    GLY n 
1 3    ILE n 
1 4    LEU n 
1 5    PRO n 
1 6    SER n 
1 7    PRO n 
1 8    GLY n 
1 9    MET n 
1 10   PRO n 
1 11   ALA n 
1 12   LEU n 
1 13   LEU n 
1 14   SER n 
1 15   LEU n 
1 16   VAL n 
1 17   SER n 
1 18   LEU n 
1 19   LEU n 
1 20   SER n 
1 21   VAL n 
1 22   LEU n 
1 23   LEU n 
1 24   MET n 
1 25   GLY n 
1 26   CYS n 
1 27   VAL n 
1 28   ALA n 
1 29   GLU n 
1 30   THR n 
1 31   GLY n 
1 32   MET n 
1 33   PHE n 
1 34   VAL n 
1 35   PHE n 
1 36   LEU n 
1 37   VAL n 
1 38   LEU n 
1 39   LEU n 
1 40   PRO n 
1 41   LEU n 
1 42   VAL n 
1 43   SER n 
1 44   SER n 
1 45   GLN n 
1 46   CYS n 
1 47   VAL n 
1 48   ASN n 
1 49   LEU n 
1 50   THR n 
1 51   THR n 
1 52   ARG n 
1 53   THR n 
1 54   GLN n 
1 55   LEU n 
1 56   PRO n 
1 57   PRO n 
1 58   ALA n 
1 59   TYR n 
1 60   THR n 
1 61   ASN n 
1 62   SER n 
1 63   PHE n 
1 64   THR n 
1 65   ARG n 
1 66   GLY n 
1 67   VAL n 
1 68   TYR n 
1 69   TYR n 
1 70   PRO n 
1 71   ASP n 
1 72   LYS n 
1 73   VAL n 
1 74   PHE n 
1 75   ARG n 
1 76   SER n 
1 77   SER n 
1 78   VAL n 
1 79   LEU n 
1 80   HIS n 
1 81   SER n 
1 82   THR n 
1 83   GLN n 
1 84   ASP n 
1 85   LEU n 
1 86   PHE n 
1 87   LEU n 
1 88   PRO n 
1 89   PHE n 
1 90   PHE n 
1 91   SER n 
1 92   ASN n 
1 93   VAL n 
1 94   THR n 
1 95   TRP n 
1 96   PHE n 
1 97   HIS n 
1 98   ALA n 
1 99   ILE n 
1 100  HIS n 
1 101  VAL n 
1 102  SER n 
1 103  GLY n 
1 104  THR n 
1 105  ASN n 
1 106  GLY n 
1 107  THR n 
1 108  LYS n 
1 109  ARG n 
1 110  PHE n 
1 111  ASP n 
1 112  ASN n 
1 113  PRO n 
1 114  VAL n 
1 115  LEU n 
1 116  PRO n 
1 117  PHE n 
1 118  ASN n 
1 119  ASP n 
1 120  GLY n 
1 121  VAL n 
1 122  TYR n 
1 123  PHE n 
1 124  ALA n 
1 125  SER n 
1 126  THR n 
1 127  GLU n 
1 128  LYS n 
1 129  SER n 
1 130  ASN n 
1 131  ILE n 
1 132  ILE n 
1 133  ARG n 
1 134  GLY n 
1 135  TRP n 
1 136  ILE n 
1 137  PHE n 
1 138  GLY n 
1 139  THR n 
1 140  THR n 
1 141  LEU n 
1 142  ASP n 
1 143  SER n 
1 144  LYS n 
1 145  THR n 
1 146  GLN n 
1 147  SER n 
1 148  LEU n 
1 149  LEU n 
1 150  ILE n 
1 151  VAL n 
1 152  ASN n 
1 153  ASN n 
1 154  ALA n 
1 155  THR n 
1 156  ASN n 
1 157  VAL n 
1 158  VAL n 
1 159  ILE n 
1 160  LYS n 
1 161  VAL n 
1 162  CYS n 
1 163  GLU n 
1 164  PHE n 
1 165  GLN n 
1 166  PHE n 
1 167  CYS n 
1 168  ASN n 
1 169  ASP n 
1 170  PRO n 
1 171  PHE n 
1 172  LEU n 
1 173  GLY n 
1 174  VAL n 
1 175  TYR n 
1 176  TYR n 
1 177  HIS n 
1 178  LYS n 
1 179  ASN n 
1 180  ASN n 
1 181  LYS n 
1 182  SER n 
1 183  TRP n 
1 184  MET n 
1 185  GLU n 
1 186  SER n 
1 187  GLU n 
1 188  PHE n 
1 189  ARG n 
1 190  VAL n 
1 191  TYR n 
1 192  SER n 
1 193  SER n 
1 194  ALA n 
1 195  ASN n 
1 196  ASN n 
1 197  CYS n 
1 198  THR n 
1 199  PHE n 
1 200  GLU n 
1 201  TYR n 
1 202  VAL n 
1 203  SER n 
1 204  GLN n 
1 205  PRO n 
1 206  PHE n 
1 207  LEU n 
1 208  MET n 
1 209  ASP n 
1 210  LEU n 
1 211  GLU n 
1 212  GLY n 
1 213  LYS n 
1 214  GLN n 
1 215  GLY n 
1 216  ASN n 
1 217  PHE n 
1 218  LYS n 
1 219  ASN n 
1 220  LEU n 
1 221  ARG n 
1 222  GLU n 
1 223  PHE n 
1 224  VAL n 
1 225  PHE n 
1 226  LYS n 
1 227  ASN n 
1 228  ILE n 
1 229  ASP n 
1 230  GLY n 
1 231  TYR n 
1 232  PHE n 
1 233  LYS n 
1 234  ILE n 
1 235  TYR n 
1 236  SER n 
1 237  LYS n 
1 238  HIS n 
1 239  THR n 
1 240  PRO n 
1 241  ILE n 
1 242  ASN n 
1 243  LEU n 
1 244  VAL n 
1 245  ARG n 
1 246  ASP n 
1 247  LEU n 
1 248  PRO n 
1 249  GLN n 
1 250  GLY n 
1 251  PHE n 
1 252  SER n 
1 253  ALA n 
1 254  LEU n 
1 255  GLU n 
1 256  PRO n 
1 257  LEU n 
1 258  VAL n 
1 259  ASP n 
1 260  LEU n 
1 261  PRO n 
1 262  ILE n 
1 263  GLY n 
1 264  ILE n 
1 265  ASN n 
1 266  ILE n 
1 267  THR n 
1 268  ARG n 
1 269  PHE n 
1 270  GLN n 
1 271  THR n 
1 272  LEU n 
1 273  LEU n 
1 274  ALA n 
1 275  LEU n 
1 276  HIS n 
1 277  ARG n 
1 278  SER n 
1 279  TYR n 
1 280  LEU n 
1 281  THR n 
1 282  PRO n 
1 283  GLY n 
1 284  ASP n 
1 285  SER n 
1 286  SER n 
1 287  SER n 
1 288  GLY n 
1 289  TRP n 
1 290  THR n 
1 291  ALA n 
1 292  GLY n 
1 293  ALA n 
1 294  ALA n 
1 295  ALA n 
1 296  TYR n 
1 297  TYR n 
1 298  VAL n 
1 299  GLY n 
1 300  TYR n 
1 301  LEU n 
1 302  GLN n 
1 303  PRO n 
1 304  ARG n 
1 305  THR n 
1 306  PHE n 
1 307  LEU n 
1 308  LEU n 
1 309  LYS n 
1 310  TYR n 
1 311  ASN n 
1 312  GLU n 
1 313  ASN n 
1 314  GLY n 
1 315  THR n 
1 316  ILE n 
1 317  THR n 
1 318  ASP n 
1 319  ALA n 
1 320  VAL n 
1 321  ASP n 
1 322  CYS n 
1 323  ALA n 
1 324  LEU n 
1 325  ASP n 
1 326  PRO n 
1 327  LEU n 
1 328  SER n 
1 329  GLU n 
1 330  THR n 
1 331  LYS n 
1 332  CYS n 
1 333  THR n 
1 334  LEU n 
1 335  LYS n 
1 336  SER n 
1 337  PHE n 
1 338  THR n 
1 339  VAL n 
1 340  GLU n 
1 341  LYS n 
1 342  GLY n 
1 343  ILE n 
1 344  TYR n 
1 345  GLN n 
1 346  THR n 
1 347  SER n 
1 348  ASN n 
1 349  PHE n 
1 350  ARG n 
1 351  VAL n 
1 352  GLN n 
1 353  PRO n 
1 354  THR n 
1 355  GLU n 
1 356  SER n 
1 357  ILE n 
1 358  VAL n 
1 359  ARG n 
1 360  PHE n 
1 361  PRO n 
1 362  ASN n 
1 363  ILE n 
1 364  THR n 
1 365  ASN n 
1 366  LEU n 
1 367  CYS n 
1 368  PRO n 
1 369  PHE n 
1 370  GLY n 
1 371  GLU n 
1 372  VAL n 
1 373  PHE n 
1 374  ASN n 
1 375  ALA n 
1 376  THR n 
1 377  ARG n 
1 378  PHE n 
1 379  ALA n 
1 380  SER n 
1 381  VAL n 
1 382  TYR n 
1 383  ALA n 
1 384  TRP n 
1 385  ASN n 
1 386  ARG n 
1 387  LYS n 
1 388  ARG n 
1 389  ILE n 
1 390  SER n 
1 391  ASN n 
1 392  CYS n 
1 393  VAL n 
1 394  ALA n 
1 395  ASP n 
1 396  TYR n 
1 397  SER n 
1 398  VAL n 
1 399  LEU n 
1 400  TYR n 
1 401  ASN n 
1 402  SER n 
1 403  ALA n 
1 404  SER n 
1 405  PHE n 
1 406  SER n 
1 407  THR n 
1 408  PHE n 
1 409  LYS n 
1 410  CYS n 
1 411  TYR n 
1 412  GLY n 
1 413  VAL n 
1 414  SER n 
1 415  PRO n 
1 416  THR n 
1 417  LYS n 
1 418  LEU n 
1 419  ASN n 
1 420  ASP n 
1 421  LEU n 
1 422  CYS n 
1 423  PHE n 
1 424  THR n 
1 425  ASN n 
1 426  VAL n 
1 427  TYR n 
1 428  ALA n 
1 429  ASP n 
1 430  SER n 
1 431  PHE n 
1 432  VAL n 
1 433  ILE n 
1 434  ARG n 
1 435  GLY n 
1 436  ASP n 
1 437  GLU n 
1 438  VAL n 
1 439  ARG n 
1 440  GLN n 
1 441  ILE n 
1 442  ALA n 
1 443  PRO n 
1 444  GLY n 
1 445  GLN n 
1 446  THR n 
1 447  GLY n 
1 448  LYS n 
1 449  ILE n 
1 450  ALA n 
1 451  ASP n 
1 452  TYR n 
1 453  ASN n 
1 454  TYR n 
1 455  LYS n 
1 456  LEU n 
1 457  PRO n 
1 458  ASP n 
1 459  ASP n 
1 460  PHE n 
1 461  THR n 
1 462  GLY n 
1 463  CYS n 
1 464  VAL n 
1 465  ILE n 
1 466  ALA n 
1 467  TRP n 
1 468  ASN n 
1 469  SER n 
1 470  ASN n 
1 471  ASN n 
1 472  LEU n 
1 473  ASP n 
1 474  SER n 
1 475  LYS n 
1 476  VAL n 
1 477  GLY n 
1 478  GLY n 
1 479  ASN n 
1 480  TYR n 
1 481  ASN n 
1 482  TYR n 
1 483  LEU n 
1 484  TYR n 
1 485  ARG n 
1 486  LEU n 
1 487  PHE n 
1 488  ARG n 
1 489  LYS n 
1 490  SER n 
1 491  ASN n 
1 492  LEU n 
1 493  LYS n 
1 494  PRO n 
1 495  PHE n 
1 496  GLU n 
1 497  ARG n 
1 498  ASP n 
1 499  ILE n 
1 500  SER n 
1 501  THR n 
1 502  GLU n 
1 503  ILE n 
1 504  TYR n 
1 505  GLN n 
1 506  ALA n 
1 507  GLY n 
1 508  SER n 
1 509  THR n 
1 510  PRO n 
1 511  CYS n 
1 512  ASN n 
1 513  GLY n 
1 514  VAL n 
1 515  GLU n 
1 516  GLY n 
1 517  PHE n 
1 518  ASN n 
1 519  CYS n 
1 520  TYR n 
1 521  PHE n 
1 522  PRO n 
1 523  LEU n 
1 524  GLN n 
1 525  SER n 
1 526  TYR n 
1 527  GLY n 
1 528  PHE n 
1 529  GLN n 
1 530  PRO n 
1 531  THR n 
1 532  ASN n 
1 533  GLY n 
1 534  VAL n 
1 535  GLY n 
1 536  TYR n 
1 537  GLN n 
1 538  PRO n 
1 539  TYR n 
1 540  ARG n 
1 541  VAL n 
1 542  VAL n 
1 543  VAL n 
1 544  LEU n 
1 545  SER n 
1 546  PHE n 
1 547  GLU n 
1 548  LEU n 
1 549  LEU n 
1 550  HIS n 
1 551  ALA n 
1 552  PRO n 
1 553  ALA n 
1 554  THR n 
1 555  VAL n 
1 556  CYS n 
1 557  GLY n 
1 558  PRO n 
1 559  LYS n 
1 560  LYS n 
1 561  SER n 
1 562  THR n 
1 563  ASN n 
1 564  LEU n 
1 565  VAL n 
1 566  LYS n 
1 567  ASN n 
1 568  LYS n 
1 569  CYS n 
1 570  VAL n 
1 571  ASN n 
1 572  PHE n 
1 573  ASN n 
1 574  PHE n 
1 575  ASN n 
1 576  GLY n 
1 577  LEU n 
1 578  THR n 
1 579  GLY n 
1 580  THR n 
1 581  GLY n 
1 582  VAL n 
1 583  LEU n 
1 584  THR n 
1 585  GLU n 
1 586  SER n 
1 587  ASN n 
1 588  LYS n 
1 589  LYS n 
1 590  PHE n 
1 591  LEU n 
1 592  PRO n 
1 593  PHE n 
1 594  GLN n 
1 595  GLN n 
1 596  PHE n 
1 597  GLY n 
1 598  ARG n 
1 599  ASP n 
1 600  ILE n 
1 601  ALA n 
1 602  ASP n 
1 603  THR n 
1 604  THR n 
1 605  ASP n 
1 606  ALA n 
1 607  VAL n 
1 608  ARG n 
1 609  ASP n 
1 610  PRO n 
1 611  GLN n 
1 612  THR n 
1 613  LEU n 
1 614  GLU n 
1 615  ILE n 
1 616  LEU n 
1 617  ASP n 
1 618  ILE n 
1 619  THR n 
1 620  PRO n 
1 621  CYS n 
1 622  SER n 
1 623  PHE n 
1 624  GLY n 
1 625  GLY n 
1 626  VAL n 
1 627  SER n 
1 628  VAL n 
1 629  ILE n 
1 630  THR n 
1 631  PRO n 
1 632  GLY n 
1 633  THR n 
1 634  ASN n 
1 635  THR n 
1 636  SER n 
1 637  ASN n 
1 638  GLN n 
1 639  VAL n 
1 640  ALA n 
1 641  VAL n 
1 642  LEU n 
1 643  TYR n 
1 644  GLN n 
1 645  ASP n 
1 646  VAL n 
1 647  ASN n 
1 648  CYS n 
1 649  THR n 
1 650  GLU n 
1 651  VAL n 
1 652  PRO n 
1 653  VAL n 
1 654  ALA n 
1 655  ILE n 
1 656  HIS n 
1 657  ALA n 
1 658  ASP n 
1 659  GLN n 
1 660  LEU n 
1 661  THR n 
1 662  PRO n 
1 663  THR n 
1 664  TRP n 
1 665  ARG n 
1 666  VAL n 
1 667  TYR n 
1 668  SER n 
1 669  THR n 
1 670  GLY n 
1 671  SER n 
1 672  ASN n 
1 673  VAL n 
1 674  PHE n 
1 675  GLN n 
1 676  THR n 
1 677  ARG n 
1 678  ALA n 
1 679  GLY n 
1 680  CYS n 
1 681  LEU n 
1 682  ILE n 
1 683  GLY n 
1 684  ALA n 
1 685  GLU n 
1 686  HIS n 
1 687  VAL n 
1 688  ASN n 
1 689  ASN n 
1 690  SER n 
1 691  TYR n 
1 692  GLU n 
1 693  CYS n 
1 694  ASP n 
1 695  ILE n 
1 696  PRO n 
1 697  ILE n 
1 698  GLY n 
1 699  ALA n 
1 700  GLY n 
1 701  ILE n 
1 702  CYS n 
1 703  ALA n 
1 704  SER n 
1 705  TYR n 
1 706  GLN n 
1 707  THR n 
1 708  GLN n 
1 709  THR n 
1 710  ASN n 
1 711  SER n 
1 712  PRO n 
1 713  ARG n 
1 714  ARG n 
1 715  ALA n 
1 716  ARG n 
1 717  SER n 
1 718  VAL n 
1 719  ALA n 
1 720  SER n 
1 721  GLN n 
1 722  SER n 
1 723  ILE n 
1 724  ILE n 
1 725  ALA n 
1 726  TYR n 
1 727  THR n 
1 728  MET n 
1 729  SER n 
1 730  LEU n 
1 731  GLY n 
1 732  ALA n 
1 733  GLU n 
1 734  ASN n 
1 735  SER n 
1 736  VAL n 
1 737  ALA n 
1 738  TYR n 
1 739  SER n 
1 740  ASN n 
1 741  ASN n 
1 742  SER n 
1 743  ILE n 
1 744  ALA n 
1 745  ILE n 
1 746  PRO n 
1 747  THR n 
1 748  ASN n 
1 749  PHE n 
1 750  THR n 
1 751  ILE n 
1 752  SER n 
1 753  VAL n 
1 754  THR n 
1 755  THR n 
1 756  GLU n 
1 757  ILE n 
1 758  LEU n 
1 759  PRO n 
1 760  VAL n 
1 761  SER n 
1 762  MET n 
1 763  THR n 
1 764  LYS n 
1 765  THR n 
1 766  SER n 
1 767  VAL n 
1 768  ASP n 
1 769  CYS n 
1 770  THR n 
1 771  MET n 
1 772  TYR n 
1 773  ILE n 
1 774  CYS n 
1 775  GLY n 
1 776  ASP n 
1 777  SER n 
1 778  THR n 
1 779  GLU n 
1 780  CYS n 
1 781  SER n 
1 782  ASN n 
1 783  LEU n 
1 784  LEU n 
1 785  LEU n 
1 786  GLN n 
1 787  TYR n 
1 788  GLY n 
1 789  SER n 
1 790  PHE n 
1 791  CYS n 
1 792  THR n 
1 793  GLN n 
1 794  LEU n 
1 795  ASN n 
1 796  ARG n 
1 797  ALA n 
1 798  LEU n 
1 799  THR n 
1 800  GLY n 
1 801  ILE n 
1 802  ALA n 
1 803  VAL n 
1 804  GLU n 
1 805  GLN n 
1 806  ASP n 
1 807  LYS n 
1 808  ASN n 
1 809  THR n 
1 810  GLN n 
1 811  GLU n 
1 812  VAL n 
1 813  PHE n 
1 814  ALA n 
1 815  GLN n 
1 816  VAL n 
1 817  LYS n 
1 818  GLN n 
1 819  ILE n 
1 820  TYR n 
1 821  LYS n 
1 822  THR n 
1 823  PRO n 
1 824  PRO n 
1 825  ILE n 
1 826  LYS n 
1 827  ASP n 
1 828  PHE n 
1 829  GLY n 
1 830  GLY n 
1 831  PHE n 
1 832  ASN n 
1 833  PHE n 
1 834  SER n 
1 835  GLN n 
1 836  ILE n 
1 837  LEU n 
1 838  PRO n 
1 839  ASP n 
1 840  PRO n 
1 841  SER n 
1 842  LYS n 
1 843  PRO n 
1 844  SER n 
1 845  LYS n 
1 846  ARG n 
1 847  SER n 
1 848  PHE n 
1 849  ILE n 
1 850  GLU n 
1 851  ASP n 
1 852  LEU n 
1 853  LEU n 
1 854  PHE n 
1 855  ASN n 
1 856  LYS n 
1 857  VAL n 
1 858  THR n 
1 859  LEU n 
1 860  ALA n 
1 861  ASP n 
1 862  ALA n 
1 863  GLY n 
1 864  PHE n 
1 865  ILE n 
1 866  LYS n 
1 867  GLN n 
1 868  TYR n 
1 869  GLY n 
1 870  ASP n 
1 871  CYS n 
1 872  LEU n 
1 873  GLY n 
1 874  ASP n 
1 875  ILE n 
1 876  ALA n 
1 877  ALA n 
1 878  ARG n 
1 879  ASP n 
1 880  LEU n 
1 881  ILE n 
1 882  CYS n 
1 883  ALA n 
1 884  GLN n 
1 885  LYS n 
1 886  PHE n 
1 887  ASN n 
1 888  GLY n 
1 889  LEU n 
1 890  THR n 
1 891  VAL n 
1 892  LEU n 
1 893  PRO n 
1 894  PRO n 
1 895  LEU n 
1 896  LEU n 
1 897  THR n 
1 898  ASP n 
1 899  GLU n 
1 900  MET n 
1 901  ILE n 
1 902  ALA n 
1 903  GLN n 
1 904  TYR n 
1 905  THR n 
1 906  SER n 
1 907  ALA n 
1 908  LEU n 
1 909  LEU n 
1 910  ALA n 
1 911  GLY n 
1 912  THR n 
1 913  ILE n 
1 914  THR n 
1 915  SER n 
1 916  GLY n 
1 917  TRP n 
1 918  THR n 
1 919  PHE n 
1 920  GLY n 
1 921  ALA n 
1 922  GLY n 
1 923  ALA n 
1 924  ALA n 
1 925  LEU n 
1 926  GLN n 
1 927  ILE n 
1 928  PRO n 
1 929  PHE n 
1 930  ALA n 
1 931  MET n 
1 932  GLN n 
1 933  MET n 
1 934  ALA n 
1 935  TYR n 
1 936  ARG n 
1 937  PHE n 
1 938  ASN n 
1 939  GLY n 
1 940  ILE n 
1 941  GLY n 
1 942  VAL n 
1 943  THR n 
1 944  GLN n 
1 945  ASN n 
1 946  VAL n 
1 947  LEU n 
1 948  TYR n 
1 949  GLU n 
1 950  ASN n 
1 951  GLN n 
1 952  LYS n 
1 953  LEU n 
1 954  ILE n 
1 955  ALA n 
1 956  ASN n 
1 957  GLN n 
1 958  PHE n 
1 959  ASN n 
1 960  SER n 
1 961  ALA n 
1 962  ILE n 
1 963  GLY n 
1 964  LYS n 
1 965  ILE n 
1 966  GLN n 
1 967  ASP n 
1 968  SER n 
1 969  LEU n 
1 970  SER n 
1 971  SER n 
1 972  THR n 
1 973  ALA n 
1 974  SER n 
1 975  ALA n 
1 976  LEU n 
1 977  GLY n 
1 978  LYS n 
1 979  LEU n 
1 980  GLN n 
1 981  ASP n 
1 982  VAL n 
1 983  VAL n 
1 984  ASN n 
1 985  GLN n 
1 986  ASN n 
1 987  ALA n 
1 988  GLN n 
1 989  ALA n 
1 990  LEU n 
1 991  ASN n 
1 992  THR n 
1 993  LEU n 
1 994  VAL n 
1 995  LYS n 
1 996  GLN n 
1 997  LEU n 
1 998  SER n 
1 999  SER n 
1 1000 ASN n 
1 1001 PHE n 
1 1002 GLY n 
1 1003 ALA n 
1 1004 ILE n 
1 1005 SER n 
1 1006 SER n 
1 1007 VAL n 
1 1008 LEU n 
1 1009 ASN n 
1 1010 ASP n 
1 1011 ILE n 
1 1012 LEU n 
1 1013 SER n 
1 1014 ARG n 
1 1015 LEU n 
1 1016 ASP n 
1 1017 PRO n 
1 1018 PRO n 
1 1019 GLU n 
1 1020 ALA n 
1 1021 GLU n 
1 1022 VAL n 
1 1023 GLN n 
1 1024 ILE n 
1 1025 ASP n 
1 1026 ARG n 
1 1027 LEU n 
1 1028 ILE n 
1 1029 THR n 
1 1030 GLY n 
1 1031 ARG n 
1 1032 LEU n 
1 1033 GLN n 
1 1034 SER n 
1 1035 LEU n 
1 1036 GLN n 
1 1037 THR n 
1 1038 TYR n 
1 1039 VAL n 
1 1040 THR n 
1 1041 GLN n 
1 1042 GLN n 
1 1043 LEU n 
1 1044 ILE n 
1 1045 ARG n 
1 1046 ALA n 
1 1047 ALA n 
1 1048 GLU n 
1 1049 ILE n 
1 1050 ARG n 
1 1051 ALA n 
1 1052 SER n 
1 1053 ALA n 
1 1054 ASN n 
1 1055 LEU n 
1 1056 ALA n 
1 1057 ALA n 
1 1058 THR n 
1 1059 LYS n 
1 1060 MET n 
1 1061 SER n 
1 1062 GLU n 
1 1063 CYS n 
1 1064 VAL n 
1 1065 LEU n 
1 1066 GLY n 
1 1067 GLN n 
1 1068 SER n 
1 1069 LYS n 
1 1070 ARG n 
1 1071 VAL n 
1 1072 ASP n 
1 1073 PHE n 
1 1074 CYS n 
1 1075 GLY n 
1 1076 LYS n 
1 1077 GLY n 
1 1078 TYR n 
1 1079 HIS n 
1 1080 LEU n 
1 1081 MET n 
1 1082 SER n 
1 1083 PHE n 
1 1084 PRO n 
1 1085 GLN n 
1 1086 SER n 
1 1087 ALA n 
1 1088 PRO n 
1 1089 HIS n 
1 1090 GLY n 
1 1091 VAL n 
1 1092 VAL n 
1 1093 PHE n 
1 1094 LEU n 
1 1095 HIS n 
1 1096 VAL n 
1 1097 THR n 
1 1098 TYR n 
1 1099 VAL n 
1 1100 PRO n 
1 1101 ALA n 
1 1102 GLN n 
1 1103 GLU n 
1 1104 LYS n 
1 1105 ASN n 
1 1106 PHE n 
1 1107 THR n 
1 1108 THR n 
1 1109 ALA n 
1 1110 PRO n 
1 1111 ALA n 
1 1112 ILE n 
1 1113 CYS n 
1 1114 HIS n 
1 1115 ASP n 
1 1116 GLY n 
1 1117 LYS n 
1 1118 ALA n 
1 1119 HIS n 
1 1120 PHE n 
1 1121 PRO n 
1 1122 ARG n 
1 1123 GLU n 
1 1124 GLY n 
1 1125 VAL n 
1 1126 PHE n 
1 1127 VAL n 
1 1128 SER n 
1 1129 ASN n 
1 1130 GLY n 
1 1131 THR n 
1 1132 HIS n 
1 1133 TRP n 
1 1134 PHE n 
1 1135 VAL n 
1 1136 THR n 
1 1137 GLN n 
1 1138 ARG n 
1 1139 ASN n 
1 1140 PHE n 
1 1141 TYR n 
1 1142 GLU n 
1 1143 PRO n 
1 1144 GLN n 
1 1145 ILE n 
1 1146 ILE n 
1 1147 THR n 
1 1148 THR n 
1 1149 ASP n 
1 1150 ASN n 
1 1151 THR n 
1 1152 PHE n 
1 1153 VAL n 
1 1154 SER n 
1 1155 GLY n 
1 1156 ASN n 
1 1157 CYS n 
1 1158 ASP n 
1 1159 VAL n 
1 1160 VAL n 
1 1161 ILE n 
1 1162 GLY n 
1 1163 ILE n 
1 1164 VAL n 
1 1165 ASN n 
1 1166 ASN n 
1 1167 THR n 
1 1168 VAL n 
1 1169 TYR n 
1 1170 ASP n 
1 1171 PRO n 
1 1172 LEU n 
1 1173 GLN n 
1 1174 PRO n 
1 1175 GLU n 
1 1176 LEU n 
1 1177 ASP n 
1 1178 SER n 
1 1179 PHE n 
1 1180 LYS n 
1 1181 GLU n 
1 1182 GLU n 
1 1183 LEU n 
1 1184 ASP n 
1 1185 LYS n 
1 1186 TYR n 
1 1187 PHE n 
1 1188 LYS n 
1 1189 ASN n 
1 1190 HIS n 
1 1191 THR n 
1 1192 SER n 
1 1193 PRO n 
1 1194 ASP n 
1 1195 VAL n 
1 1196 ASP n 
1 1197 LEU n 
1 1198 GLY n 
1 1199 ASP n 
1 1200 ILE n 
1 1201 SER n 
1 1202 GLY n 
1 1203 ILE n 
1 1204 ASN n 
1 1205 ALA n 
1 1206 SER n 
1 1207 VAL n 
1 1208 VAL n 
1 1209 ASN n 
1 1210 ILE n 
1 1211 GLN n 
1 1212 LYS n 
1 1213 GLU n 
1 1214 ILE n 
1 1215 ASP n 
1 1216 ARG n 
1 1217 LEU n 
1 1218 ASN n 
1 1219 GLU n 
1 1220 VAL n 
1 1221 ALA n 
1 1222 LYS n 
1 1223 ASN n 
1 1224 LEU n 
1 1225 ASN n 
1 1226 GLU n 
1 1227 SER n 
1 1228 LEU n 
1 1229 ILE n 
1 1230 ASP n 
1 1231 LEU n 
1 1232 GLN n 
1 1233 GLU n 
1 1234 LEU n 
1 1235 GLY n 
1 1236 LYS n 
1 1237 TYR n 
1 1238 GLU n 
1 1239 GLN n 
1 1240 SER n 
1 1241 GLY n 
1 1242 ARG n 
1 1243 GLU n 
1 1244 ASN n 
1 1245 LEU n 
1 1246 TYR n 
1 1247 PHE n 
1 1248 GLN n 
1 1249 GLY n 
1 1250 GLY n 
1 1251 GLY n 
1 1252 GLY n 
1 1253 SER n 
1 1254 GLY n 
1 1255 TYR n 
1 1256 ILE n 
1 1257 PRO n 
1 1258 GLU n 
1 1259 ALA n 
1 1260 PRO n 
1 1261 ARG n 
1 1262 ASP n 
1 1263 GLY n 
1 1264 GLN n 
1 1265 ALA n 
1 1266 TYR n 
1 1267 VAL n 
1 1268 ARG n 
1 1269 LYS n 
1 1270 ASP n 
1 1271 GLY n 
1 1272 GLU n 
1 1273 TRP n 
1 1274 VAL n 
1 1275 LEU n 
1 1276 LEU n 
1 1277 SER n 
1 1278 THR n 
1 1279 PHE n 
1 1280 LEU n 
1 1281 GLY n 
1 1282 HIS n 
1 1283 HIS n 
1 1284 HIS n 
1 1285 HIS n 
1 1286 HIS n 
1 1287 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   1287 
_entity_src_gen.gene_src_common_name               2019-nCoV 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'S, 2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Severe acute respiratory syndrome coronavirus 2' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2697049 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SPIKE_SARS2 
_struct_ref.pdbx_db_accession          P0DTC2 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFD
NPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVY
SSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQT
LLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRV
QPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSF
VIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPC
NGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFL
PFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGS
NVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTI
SVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGF
NFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAG
TITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALN
TLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRV
DFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNT
FVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDL
QELGKYEQ
;
_struct_ref.pdbx_align_begin           1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6ZGI A 32 ? 1239 ? P0DTC2 1 ? 1208 ? 1 1208 
2 1 6ZGI B 32 ? 1239 ? P0DTC2 1 ? 1208 ? 1 1208 
3 1 6ZGI C 32 ? 1239 ? P0DTC2 1 ? 1208 ? 1 1208 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6ZGI MET A 1    ? UNP P0DTC2 ?   ?   'initiating methionine' -30  1   
1 6ZGI GLY A 2    ? UNP P0DTC2 ?   ?   'expression tag'        -29  2   
1 6ZGI ILE A 3    ? UNP P0DTC2 ?   ?   'expression tag'        -28  3   
1 6ZGI LEU A 4    ? UNP P0DTC2 ?   ?   'expression tag'        -27  4   
1 6ZGI PRO A 5    ? UNP P0DTC2 ?   ?   'expression tag'        -26  5   
1 6ZGI SER A 6    ? UNP P0DTC2 ?   ?   'expression tag'        -25  6   
1 6ZGI PRO A 7    ? UNP P0DTC2 ?   ?   'expression tag'        -24  7   
1 6ZGI GLY A 8    ? UNP P0DTC2 ?   ?   'expression tag'        -23  8   
1 6ZGI MET A 9    ? UNP P0DTC2 ?   ?   'expression tag'        -22  9   
1 6ZGI PRO A 10   ? UNP P0DTC2 ?   ?   'expression tag'        -21  10  
1 6ZGI ALA A 11   ? UNP P0DTC2 ?   ?   'expression tag'        -20  11  
1 6ZGI LEU A 12   ? UNP P0DTC2 ?   ?   'expression tag'        -19  12  
1 6ZGI LEU A 13   ? UNP P0DTC2 ?   ?   'expression tag'        -18  13  
1 6ZGI SER A 14   ? UNP P0DTC2 ?   ?   'expression tag'        -17  14  
1 6ZGI LEU A 15   ? UNP P0DTC2 ?   ?   'expression tag'        -16  15  
1 6ZGI VAL A 16   ? UNP P0DTC2 ?   ?   'expression tag'        -15  16  
1 6ZGI SER A 17   ? UNP P0DTC2 ?   ?   'expression tag'        -14  17  
1 6ZGI LEU A 18   ? UNP P0DTC2 ?   ?   'expression tag'        -13  18  
1 6ZGI LEU A 19   ? UNP P0DTC2 ?   ?   'expression tag'        -12  19  
1 6ZGI SER A 20   ? UNP P0DTC2 ?   ?   'expression tag'        -11  20  
1 6ZGI VAL A 21   ? UNP P0DTC2 ?   ?   'expression tag'        -10  21  
1 6ZGI LEU A 22   ? UNP P0DTC2 ?   ?   'expression tag'        -9   22  
1 6ZGI LEU A 23   ? UNP P0DTC2 ?   ?   'expression tag'        -8   23  
1 6ZGI MET A 24   ? UNP P0DTC2 ?   ?   'expression tag'        -7   24  
1 6ZGI GLY A 25   ? UNP P0DTC2 ?   ?   'expression tag'        -6   25  
1 6ZGI CYS A 26   ? UNP P0DTC2 ?   ?   'expression tag'        -5   26  
1 6ZGI VAL A 27   ? UNP P0DTC2 ?   ?   'expression tag'        -4   27  
1 6ZGI ALA A 28   ? UNP P0DTC2 ?   ?   'expression tag'        -3   28  
1 6ZGI GLU A 29   ? UNP P0DTC2 ?   ?   'expression tag'        -2   29  
1 6ZGI THR A 30   ? UNP P0DTC2 ?   ?   'expression tag'        -1   30  
1 6ZGI GLY A 31   ? UNP P0DTC2 ?   ?   'expression tag'        0    31  
1 6ZGI PRO A 1017 ? UNP P0DTC2 LYS 986 'engineered mutation'   986  32  
1 6ZGI PRO A 1018 ? UNP P0DTC2 VAL 987 'engineered mutation'   987  33  
1 6ZGI SER A 1240 ? UNP P0DTC2 ?   ?   'expression tag'        1209 34  
1 6ZGI GLY A 1241 ? UNP P0DTC2 ?   ?   'expression tag'        1210 35  
1 6ZGI ARG A 1242 ? UNP P0DTC2 ?   ?   'expression tag'        1211 36  
1 6ZGI GLU A 1243 ? UNP P0DTC2 ?   ?   'expression tag'        1212 37  
1 6ZGI ASN A 1244 ? UNP P0DTC2 ?   ?   'expression tag'        1213 38  
1 6ZGI LEU A 1245 ? UNP P0DTC2 ?   ?   'expression tag'        1214 39  
1 6ZGI TYR A 1246 ? UNP P0DTC2 ?   ?   'expression tag'        1215 40  
1 6ZGI PHE A 1247 ? UNP P0DTC2 ?   ?   'expression tag'        1216 41  
1 6ZGI GLN A 1248 ? UNP P0DTC2 ?   ?   'expression tag'        1217 42  
1 6ZGI GLY A 1249 ? UNP P0DTC2 ?   ?   'expression tag'        1218 43  
1 6ZGI GLY A 1250 ? UNP P0DTC2 ?   ?   'expression tag'        1219 44  
1 6ZGI GLY A 1251 ? UNP P0DTC2 ?   ?   'expression tag'        1220 45  
1 6ZGI GLY A 1252 ? UNP P0DTC2 ?   ?   'expression tag'        1221 46  
1 6ZGI SER A 1253 ? UNP P0DTC2 ?   ?   'expression tag'        1222 47  
1 6ZGI GLY A 1254 ? UNP P0DTC2 ?   ?   'expression tag'        1223 48  
1 6ZGI TYR A 1255 ? UNP P0DTC2 ?   ?   'expression tag'        1224 49  
1 6ZGI ILE A 1256 ? UNP P0DTC2 ?   ?   'expression tag'        1225 50  
1 6ZGI PRO A 1257 ? UNP P0DTC2 ?   ?   'expression tag'        1226 51  
1 6ZGI GLU A 1258 ? UNP P0DTC2 ?   ?   'expression tag'        1227 52  
1 6ZGI ALA A 1259 ? UNP P0DTC2 ?   ?   'expression tag'        1228 53  
1 6ZGI PRO A 1260 ? UNP P0DTC2 ?   ?   'expression tag'        1229 54  
1 6ZGI ARG A 1261 ? UNP P0DTC2 ?   ?   'expression tag'        1230 55  
1 6ZGI ASP A 1262 ? UNP P0DTC2 ?   ?   'expression tag'        1231 56  
1 6ZGI GLY A 1263 ? UNP P0DTC2 ?   ?   'expression tag'        1232 57  
1 6ZGI GLN A 1264 ? UNP P0DTC2 ?   ?   'expression tag'        1233 58  
1 6ZGI ALA A 1265 ? UNP P0DTC2 ?   ?   'expression tag'        1234 59  
1 6ZGI TYR A 1266 ? UNP P0DTC2 ?   ?   'expression tag'        1235 60  
1 6ZGI VAL A 1267 ? UNP P0DTC2 ?   ?   'expression tag'        1236 61  
1 6ZGI ARG A 1268 ? UNP P0DTC2 ?   ?   'expression tag'        1237 62  
1 6ZGI LYS A 1269 ? UNP P0DTC2 ?   ?   'expression tag'        1238 63  
1 6ZGI ASP A 1270 ? UNP P0DTC2 ?   ?   'expression tag'        1239 64  
1 6ZGI GLY A 1271 ? UNP P0DTC2 ?   ?   'expression tag'        1240 65  
1 6ZGI GLU A 1272 ? UNP P0DTC2 ?   ?   'expression tag'        1241 66  
1 6ZGI TRP A 1273 ? UNP P0DTC2 ?   ?   'expression tag'        1242 67  
1 6ZGI VAL A 1274 ? UNP P0DTC2 ?   ?   'expression tag'        1243 68  
1 6ZGI LEU A 1275 ? UNP P0DTC2 ?   ?   'expression tag'        1244 69  
1 6ZGI LEU A 1276 ? UNP P0DTC2 ?   ?   'expression tag'        1245 70  
1 6ZGI SER A 1277 ? UNP P0DTC2 ?   ?   'expression tag'        1246 71  
1 6ZGI THR A 1278 ? UNP P0DTC2 ?   ?   'expression tag'        1247 72  
1 6ZGI PHE A 1279 ? UNP P0DTC2 ?   ?   'expression tag'        1248 73  
1 6ZGI LEU A 1280 ? UNP P0DTC2 ?   ?   'expression tag'        1249 74  
1 6ZGI GLY A 1281 ? UNP P0DTC2 ?   ?   'expression tag'        1250 75  
1 6ZGI HIS A 1282 ? UNP P0DTC2 ?   ?   'expression tag'        1251 76  
1 6ZGI HIS A 1283 ? UNP P0DTC2 ?   ?   'expression tag'        1252 77  
1 6ZGI HIS A 1284 ? UNP P0DTC2 ?   ?   'expression tag'        1253 78  
1 6ZGI HIS A 1285 ? UNP P0DTC2 ?   ?   'expression tag'        1254 79  
1 6ZGI HIS A 1286 ? UNP P0DTC2 ?   ?   'expression tag'        1255 80  
1 6ZGI HIS A 1287 ? UNP P0DTC2 ?   ?   'expression tag'        1256 81  
2 6ZGI MET B 1    ? UNP P0DTC2 ?   ?   'initiating methionine' -30  82  
2 6ZGI GLY B 2    ? UNP P0DTC2 ?   ?   'expression tag'        -29  83  
2 6ZGI ILE B 3    ? UNP P0DTC2 ?   ?   'expression tag'        -28  84  
2 6ZGI LEU B 4    ? UNP P0DTC2 ?   ?   'expression tag'        -27  85  
2 6ZGI PRO B 5    ? UNP P0DTC2 ?   ?   'expression tag'        -26  86  
2 6ZGI SER B 6    ? UNP P0DTC2 ?   ?   'expression tag'        -25  87  
2 6ZGI PRO B 7    ? UNP P0DTC2 ?   ?   'expression tag'        -24  88  
2 6ZGI GLY B 8    ? UNP P0DTC2 ?   ?   'expression tag'        -23  89  
2 6ZGI MET B 9    ? UNP P0DTC2 ?   ?   'expression tag'        -22  90  
2 6ZGI PRO B 10   ? UNP P0DTC2 ?   ?   'expression tag'        -21  91  
2 6ZGI ALA B 11   ? UNP P0DTC2 ?   ?   'expression tag'        -20  92  
2 6ZGI LEU B 12   ? UNP P0DTC2 ?   ?   'expression tag'        -19  93  
2 6ZGI LEU B 13   ? UNP P0DTC2 ?   ?   'expression tag'        -18  94  
2 6ZGI SER B 14   ? UNP P0DTC2 ?   ?   'expression tag'        -17  95  
2 6ZGI LEU B 15   ? UNP P0DTC2 ?   ?   'expression tag'        -16  96  
2 6ZGI VAL B 16   ? UNP P0DTC2 ?   ?   'expression tag'        -15  97  
2 6ZGI SER B 17   ? UNP P0DTC2 ?   ?   'expression tag'        -14  98  
2 6ZGI LEU B 18   ? UNP P0DTC2 ?   ?   'expression tag'        -13  99  
2 6ZGI LEU B 19   ? UNP P0DTC2 ?   ?   'expression tag'        -12  100 
2 6ZGI SER B 20   ? UNP P0DTC2 ?   ?   'expression tag'        -11  101 
2 6ZGI VAL B 21   ? UNP P0DTC2 ?   ?   'expression tag'        -10  102 
2 6ZGI LEU B 22   ? UNP P0DTC2 ?   ?   'expression tag'        -9   103 
2 6ZGI LEU B 23   ? UNP P0DTC2 ?   ?   'expression tag'        -8   104 
2 6ZGI MET B 24   ? UNP P0DTC2 ?   ?   'expression tag'        -7   105 
2 6ZGI GLY B 25   ? UNP P0DTC2 ?   ?   'expression tag'        -6   106 
2 6ZGI CYS B 26   ? UNP P0DTC2 ?   ?   'expression tag'        -5   107 
2 6ZGI VAL B 27   ? UNP P0DTC2 ?   ?   'expression tag'        -4   108 
2 6ZGI ALA B 28   ? UNP P0DTC2 ?   ?   'expression tag'        -3   109 
2 6ZGI GLU B 29   ? UNP P0DTC2 ?   ?   'expression tag'        -2   110 
2 6ZGI THR B 30   ? UNP P0DTC2 ?   ?   'expression tag'        -1   111 
2 6ZGI GLY B 31   ? UNP P0DTC2 ?   ?   'expression tag'        0    112 
2 6ZGI PRO B 1017 ? UNP P0DTC2 LYS 986 'engineered mutation'   986  113 
2 6ZGI PRO B 1018 ? UNP P0DTC2 VAL 987 'engineered mutation'   987  114 
2 6ZGI SER B 1240 ? UNP P0DTC2 ?   ?   'expression tag'        1209 115 
2 6ZGI GLY B 1241 ? UNP P0DTC2 ?   ?   'expression tag'        1210 116 
2 6ZGI ARG B 1242 ? UNP P0DTC2 ?   ?   'expression tag'        1211 117 
2 6ZGI GLU B 1243 ? UNP P0DTC2 ?   ?   'expression tag'        1212 118 
2 6ZGI ASN B 1244 ? UNP P0DTC2 ?   ?   'expression tag'        1213 119 
2 6ZGI LEU B 1245 ? UNP P0DTC2 ?   ?   'expression tag'        1214 120 
2 6ZGI TYR B 1246 ? UNP P0DTC2 ?   ?   'expression tag'        1215 121 
2 6ZGI PHE B 1247 ? UNP P0DTC2 ?   ?   'expression tag'        1216 122 
2 6ZGI GLN B 1248 ? UNP P0DTC2 ?   ?   'expression tag'        1217 123 
2 6ZGI GLY B 1249 ? UNP P0DTC2 ?   ?   'expression tag'        1218 124 
2 6ZGI GLY B 1250 ? UNP P0DTC2 ?   ?   'expression tag'        1219 125 
2 6ZGI GLY B 1251 ? UNP P0DTC2 ?   ?   'expression tag'        1220 126 
2 6ZGI GLY B 1252 ? UNP P0DTC2 ?   ?   'expression tag'        1221 127 
2 6ZGI SER B 1253 ? UNP P0DTC2 ?   ?   'expression tag'        1222 128 
2 6ZGI GLY B 1254 ? UNP P0DTC2 ?   ?   'expression tag'        1223 129 
2 6ZGI TYR B 1255 ? UNP P0DTC2 ?   ?   'expression tag'        1224 130 
2 6ZGI ILE B 1256 ? UNP P0DTC2 ?   ?   'expression tag'        1225 131 
2 6ZGI PRO B 1257 ? UNP P0DTC2 ?   ?   'expression tag'        1226 132 
2 6ZGI GLU B 1258 ? UNP P0DTC2 ?   ?   'expression tag'        1227 133 
2 6ZGI ALA B 1259 ? UNP P0DTC2 ?   ?   'expression tag'        1228 134 
2 6ZGI PRO B 1260 ? UNP P0DTC2 ?   ?   'expression tag'        1229 135 
2 6ZGI ARG B 1261 ? UNP P0DTC2 ?   ?   'expression tag'        1230 136 
2 6ZGI ASP B 1262 ? UNP P0DTC2 ?   ?   'expression tag'        1231 137 
2 6ZGI GLY B 1263 ? UNP P0DTC2 ?   ?   'expression tag'        1232 138 
2 6ZGI GLN B 1264 ? UNP P0DTC2 ?   ?   'expression tag'        1233 139 
2 6ZGI ALA B 1265 ? UNP P0DTC2 ?   ?   'expression tag'        1234 140 
2 6ZGI TYR B 1266 ? UNP P0DTC2 ?   ?   'expression tag'        1235 141 
2 6ZGI VAL B 1267 ? UNP P0DTC2 ?   ?   'expression tag'        1236 142 
2 6ZGI ARG B 1268 ? UNP P0DTC2 ?   ?   'expression tag'        1237 143 
2 6ZGI LYS B 1269 ? UNP P0DTC2 ?   ?   'expression tag'        1238 144 
2 6ZGI ASP B 1270 ? UNP P0DTC2 ?   ?   'expression tag'        1239 145 
2 6ZGI GLY B 1271 ? UNP P0DTC2 ?   ?   'expression tag'        1240 146 
2 6ZGI GLU B 1272 ? UNP P0DTC2 ?   ?   'expression tag'        1241 147 
2 6ZGI TRP B 1273 ? UNP P0DTC2 ?   ?   'expression tag'        1242 148 
2 6ZGI VAL B 1274 ? UNP P0DTC2 ?   ?   'expression tag'        1243 149 
2 6ZGI LEU B 1275 ? UNP P0DTC2 ?   ?   'expression tag'        1244 150 
2 6ZGI LEU B 1276 ? UNP P0DTC2 ?   ?   'expression tag'        1245 151 
2 6ZGI SER B 1277 ? UNP P0DTC2 ?   ?   'expression tag'        1246 152 
2 6ZGI THR B 1278 ? UNP P0DTC2 ?   ?   'expression tag'        1247 153 
2 6ZGI PHE B 1279 ? UNP P0DTC2 ?   ?   'expression tag'        1248 154 
2 6ZGI LEU B 1280 ? UNP P0DTC2 ?   ?   'expression tag'        1249 155 
2 6ZGI GLY B 1281 ? UNP P0DTC2 ?   ?   'expression tag'        1250 156 
2 6ZGI HIS B 1282 ? UNP P0DTC2 ?   ?   'expression tag'        1251 157 
2 6ZGI HIS B 1283 ? UNP P0DTC2 ?   ?   'expression tag'        1252 158 
2 6ZGI HIS B 1284 ? UNP P0DTC2 ?   ?   'expression tag'        1253 159 
2 6ZGI HIS B 1285 ? UNP P0DTC2 ?   ?   'expression tag'        1254 160 
2 6ZGI HIS B 1286 ? UNP P0DTC2 ?   ?   'expression tag'        1255 161 
2 6ZGI HIS B 1287 ? UNP P0DTC2 ?   ?   'expression tag'        1256 162 
3 6ZGI MET C 1    ? UNP P0DTC2 ?   ?   'initiating methionine' -30  163 
3 6ZGI GLY C 2    ? UNP P0DTC2 ?   ?   'expression tag'        -29  164 
3 6ZGI ILE C 3    ? UNP P0DTC2 ?   ?   'expression tag'        -28  165 
3 6ZGI LEU C 4    ? UNP P0DTC2 ?   ?   'expression tag'        -27  166 
3 6ZGI PRO C 5    ? UNP P0DTC2 ?   ?   'expression tag'        -26  167 
3 6ZGI SER C 6    ? UNP P0DTC2 ?   ?   'expression tag'        -25  168 
3 6ZGI PRO C 7    ? UNP P0DTC2 ?   ?   'expression tag'        -24  169 
3 6ZGI GLY C 8    ? UNP P0DTC2 ?   ?   'expression tag'        -23  170 
3 6ZGI MET C 9    ? UNP P0DTC2 ?   ?   'expression tag'        -22  171 
3 6ZGI PRO C 10   ? UNP P0DTC2 ?   ?   'expression tag'        -21  172 
3 6ZGI ALA C 11   ? UNP P0DTC2 ?   ?   'expression tag'        -20  173 
3 6ZGI LEU C 12   ? UNP P0DTC2 ?   ?   'expression tag'        -19  174 
3 6ZGI LEU C 13   ? UNP P0DTC2 ?   ?   'expression tag'        -18  175 
3 6ZGI SER C 14   ? UNP P0DTC2 ?   ?   'expression tag'        -17  176 
3 6ZGI LEU C 15   ? UNP P0DTC2 ?   ?   'expression tag'        -16  177 
3 6ZGI VAL C 16   ? UNP P0DTC2 ?   ?   'expression tag'        -15  178 
3 6ZGI SER C 17   ? UNP P0DTC2 ?   ?   'expression tag'        -14  179 
3 6ZGI LEU C 18   ? UNP P0DTC2 ?   ?   'expression tag'        -13  180 
3 6ZGI LEU C 19   ? UNP P0DTC2 ?   ?   'expression tag'        -12  181 
3 6ZGI SER C 20   ? UNP P0DTC2 ?   ?   'expression tag'        -11  182 
3 6ZGI VAL C 21   ? UNP P0DTC2 ?   ?   'expression tag'        -10  183 
3 6ZGI LEU C 22   ? UNP P0DTC2 ?   ?   'expression tag'        -9   184 
3 6ZGI LEU C 23   ? UNP P0DTC2 ?   ?   'expression tag'        -8   185 
3 6ZGI MET C 24   ? UNP P0DTC2 ?   ?   'expression tag'        -7   186 
3 6ZGI GLY C 25   ? UNP P0DTC2 ?   ?   'expression tag'        -6   187 
3 6ZGI CYS C 26   ? UNP P0DTC2 ?   ?   'expression tag'        -5   188 
3 6ZGI VAL C 27   ? UNP P0DTC2 ?   ?   'expression tag'        -4   189 
3 6ZGI ALA C 28   ? UNP P0DTC2 ?   ?   'expression tag'        -3   190 
3 6ZGI GLU C 29   ? UNP P0DTC2 ?   ?   'expression tag'        -2   191 
3 6ZGI THR C 30   ? UNP P0DTC2 ?   ?   'expression tag'        -1   192 
3 6ZGI GLY C 31   ? UNP P0DTC2 ?   ?   'expression tag'        0    193 
3 6ZGI PRO C 1017 ? UNP P0DTC2 LYS 986 'engineered mutation'   986  194 
3 6ZGI PRO C 1018 ? UNP P0DTC2 VAL 987 'engineered mutation'   987  195 
3 6ZGI SER C 1240 ? UNP P0DTC2 ?   ?   'expression tag'        1209 196 
3 6ZGI GLY C 1241 ? UNP P0DTC2 ?   ?   'expression tag'        1210 197 
3 6ZGI ARG C 1242 ? UNP P0DTC2 ?   ?   'expression tag'        1211 198 
3 6ZGI GLU C 1243 ? UNP P0DTC2 ?   ?   'expression tag'        1212 199 
3 6ZGI ASN C 1244 ? UNP P0DTC2 ?   ?   'expression tag'        1213 200 
3 6ZGI LEU C 1245 ? UNP P0DTC2 ?   ?   'expression tag'        1214 201 
3 6ZGI TYR C 1246 ? UNP P0DTC2 ?   ?   'expression tag'        1215 202 
3 6ZGI PHE C 1247 ? UNP P0DTC2 ?   ?   'expression tag'        1216 203 
3 6ZGI GLN C 1248 ? UNP P0DTC2 ?   ?   'expression tag'        1217 204 
3 6ZGI GLY C 1249 ? UNP P0DTC2 ?   ?   'expression tag'        1218 205 
3 6ZGI GLY C 1250 ? UNP P0DTC2 ?   ?   'expression tag'        1219 206 
3 6ZGI GLY C 1251 ? UNP P0DTC2 ?   ?   'expression tag'        1220 207 
3 6ZGI GLY C 1252 ? UNP P0DTC2 ?   ?   'expression tag'        1221 208 
3 6ZGI SER C 1253 ? UNP P0DTC2 ?   ?   'expression tag'        1222 209 
3 6ZGI GLY C 1254 ? UNP P0DTC2 ?   ?   'expression tag'        1223 210 
3 6ZGI TYR C 1255 ? UNP P0DTC2 ?   ?   'expression tag'        1224 211 
3 6ZGI ILE C 1256 ? UNP P0DTC2 ?   ?   'expression tag'        1225 212 
3 6ZGI PRO C 1257 ? UNP P0DTC2 ?   ?   'expression tag'        1226 213 
3 6ZGI GLU C 1258 ? UNP P0DTC2 ?   ?   'expression tag'        1227 214 
3 6ZGI ALA C 1259 ? UNP P0DTC2 ?   ?   'expression tag'        1228 215 
3 6ZGI PRO C 1260 ? UNP P0DTC2 ?   ?   'expression tag'        1229 216 
3 6ZGI ARG C 1261 ? UNP P0DTC2 ?   ?   'expression tag'        1230 217 
3 6ZGI ASP C 1262 ? UNP P0DTC2 ?   ?   'expression tag'        1231 218 
3 6ZGI GLY C 1263 ? UNP P0DTC2 ?   ?   'expression tag'        1232 219 
3 6ZGI GLN C 1264 ? UNP P0DTC2 ?   ?   'expression tag'        1233 220 
3 6ZGI ALA C 1265 ? UNP P0DTC2 ?   ?   'expression tag'        1234 221 
3 6ZGI TYR C 1266 ? UNP P0DTC2 ?   ?   'expression tag'        1235 222 
3 6ZGI VAL C 1267 ? UNP P0DTC2 ?   ?   'expression tag'        1236 223 
3 6ZGI ARG C 1268 ? UNP P0DTC2 ?   ?   'expression tag'        1237 224 
3 6ZGI LYS C 1269 ? UNP P0DTC2 ?   ?   'expression tag'        1238 225 
3 6ZGI ASP C 1270 ? UNP P0DTC2 ?   ?   'expression tag'        1239 226 
3 6ZGI GLY C 1271 ? UNP P0DTC2 ?   ?   'expression tag'        1240 227 
3 6ZGI GLU C 1272 ? UNP P0DTC2 ?   ?   'expression tag'        1241 228 
3 6ZGI TRP C 1273 ? UNP P0DTC2 ?   ?   'expression tag'        1242 229 
3 6ZGI VAL C 1274 ? UNP P0DTC2 ?   ?   'expression tag'        1243 230 
3 6ZGI LEU C 1275 ? UNP P0DTC2 ?   ?   'expression tag'        1244 231 
3 6ZGI LEU C 1276 ? UNP P0DTC2 ?   ?   'expression tag'        1245 232 
3 6ZGI SER C 1277 ? UNP P0DTC2 ?   ?   'expression tag'        1246 233 
3 6ZGI THR C 1278 ? UNP P0DTC2 ?   ?   'expression tag'        1247 234 
3 6ZGI PHE C 1279 ? UNP P0DTC2 ?   ?   'expression tag'        1248 235 
3 6ZGI LEU C 1280 ? UNP P0DTC2 ?   ?   'expression tag'        1249 236 
3 6ZGI GLY C 1281 ? UNP P0DTC2 ?   ?   'expression tag'        1250 237 
3 6ZGI HIS C 1282 ? UNP P0DTC2 ?   ?   'expression tag'        1251 238 
3 6ZGI HIS C 1283 ? UNP P0DTC2 ?   ?   'expression tag'        1252 239 
3 6ZGI HIS C 1284 ? UNP P0DTC2 ?   ?   'expression tag'        1253 240 
3 6ZGI HIS C 1285 ? UNP P0DTC2 ?   ?   'expression tag'        1254 241 
3 6ZGI HIS C 1286 ? UNP P0DTC2 ?   ?   'expression tag'        1255 242 
3 6ZGI HIS C 1287 ? UNP P0DTC2 ?   ?   'expression tag'        1256 243 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose 
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6ZGI 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.entry_id                                 6ZGI 
_refine.pdbx_diffrn_id                           ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            . 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON MICROSCOPY' ? 0.006  ? 27552 ? f_bond_d           ? ? 
'ELECTRON MICROSCOPY' ? 0.755  ? 37494 ? f_angle_d          ? ? 
'ELECTRON MICROSCOPY' ? 12.438 ? 9945  ? f_dihedral_angle_d ? ? 
'ELECTRON MICROSCOPY' ? 0.052  ? 4458  ? f_chiral_restr     ? ? 
'ELECTRON MICROSCOPY' ? 0.005  ? 4755  ? f_plane_restr      ? ? 
# 
_struct.entry_id                     6ZGI 
_struct.title                        'Furin Cleaved Spike Protein of SARS-CoV-2 in Closed Conformation' 
_struct.pdbx_descriptor              'Spike glycoprotein' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6ZGI 
_struct_keywords.text            'SARS-CoV-2, Spike, Virus Glycoprotein, Coronavirus, VIRAL PROTEIN' 
_struct_keywords.pdbx_keywords   'VIRAL PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 2 ? 
E  N N 2 ? 
F  N N 2 ? 
G  N N 2 ? 
H  N N 2 ? 
I  N N 2 ? 
J  N N 2 ? 
K  N N 2 ? 
L  N N 2 ? 
M  N N 2 ? 
N  N N 2 ? 
O  N N 2 ? 
P  N N 2 ? 
Q  N N 2 ? 
R  N N 2 ? 
S  N N 2 ? 
T  N N 2 ? 
U  N N 2 ? 
V  N N 2 ? 
W  N N 2 ? 
X  N N 2 ? 
Y  N N 2 ? 
Z  N N 2 ? 
AA N N 2 ? 
BA N N 2 ? 
CA N N 2 ? 
DA N N 2 ? 
EA N N 3 ? 
FA N N 3 ? 
GA N N 3 ? 
HA N N 3 ? 
IA N N 3 ? 
JA N N 3 ? 
KA N N 3 ? 
LA N N 3 ? 
MA N N 3 ? 
NA N N 3 ? 
OA N N 3 ? 
PA N N 3 ? 
QA N N 3 ? 
RA N N 3 ? 
SA N N 3 ? 
TA N N 3 ? 
UA N N 3 ? 
VA N N 3 ? 
WA N N 3 ? 
XA N N 3 ? 
YA N N 3 ? 
ZA N N 3 ? 
AB N N 3 ? 
BB N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 325  ? LYS A 335  ? ASP A 294  LYS A 304  1 ? 11 
HELX_P HELX_P2  AA2 ASP A 395  ? TYR A 400  ? ASP A 364  TYR A 369  5 ? 6  
HELX_P HELX_P3  AA3 SER A 414  ? LEU A 421  ? SER A 383  LEU A 390  5 ? 8  
HELX_P HELX_P4  AA4 ASP A 436  ? ILE A 441  ? ASP A 405  ILE A 410  5 ? 6  
HELX_P HELX_P5  AA5 GLY A 447  ? ASN A 453  ? GLY A 416  ASN A 422  1 ? 7  
HELX_P HELX_P6  AA6 SER A 469  ? SER A 474  ? SER A 438  SER A 443  1 ? 6  
HELX_P HELX_P7  AA7 GLY A 533  ? TYR A 536  ? GLY A 502  TYR A 505  5 ? 4  
HELX_P HELX_P8  AA8 ASP A 768  ? CYS A 774  ? ASP A 737  CYS A 743  1 ? 7  
HELX_P HELX_P9  AA9 SER A 777  ? LEU A 785  ? SER A 746  LEU A 754  1 ? 9  
HELX_P HELX_P10 AB1 TYR A 787  ? ALA A 814  ? TYR A 756  ALA A 783  1 ? 28 
HELX_P HELX_P11 AB2 SER A 847  ? ASN A 855  ? SER A 816  ASN A 824  1 ? 9  
HELX_P HELX_P12 AB3 ASP A 879  ? PHE A 886  ? ASP A 848  PHE A 855  1 ? 8  
HELX_P HELX_P13 AB4 THR A 897  ? GLY A 916  ? THR A 866  GLY A 885  1 ? 20 
HELX_P HELX_P14 AB5 TRP A 917  ? ALA A 921  ? TRP A 886  ALA A 890  5 ? 5  
HELX_P HELX_P15 AB6 PRO A 928  ? GLY A 939  ? PRO A 897  GLY A 908  1 ? 12 
HELX_P HELX_P16 AB7 THR A 943  ? ASN A 950  ? THR A 912  ASN A 919  1 ? 8  
HELX_P HELX_P17 AB8 ASN A 950  ? SER A 970  ? ASN A 919  SER A 939  1 ? 21 
HELX_P HELX_P18 AB9 LEU A 976  ? GLN A 996  ? LEU A 945  GLN A 965  1 ? 21 
HELX_P HELX_P19 AC1 LEU A 997  ? SER A 999  ? LEU A 966  SER A 968  5 ? 3  
HELX_P HELX_P20 AC2 VAL A 1007 ? SER A 1013 ? VAL A 976  SER A 982  1 ? 7  
HELX_P HELX_P21 AC3 ASP A 1016 ? VAL A 1064 ? ASP A 985  VAL A 1033 1 ? 49 
HELX_P HELX_P22 AC4 LEU A 1172 ? ASP A 1177 ? LEU A 1141 ASP A 1146 1 ? 6  
HELX_P HELX_P23 AC5 ASP B 325  ? LYS B 335  ? ASP B 294  LYS B 304  1 ? 11 
HELX_P HELX_P24 AC6 ASP B 395  ? TYR B 400  ? ASP B 364  TYR B 369  5 ? 6  
HELX_P HELX_P25 AC7 SER B 414  ? LEU B 421  ? SER B 383  LEU B 390  5 ? 8  
HELX_P HELX_P26 AC8 ASP B 436  ? ILE B 441  ? ASP B 405  ILE B 410  5 ? 6  
HELX_P HELX_P27 AC9 GLY B 447  ? ASN B 453  ? GLY B 416  ASN B 422  1 ? 7  
HELX_P HELX_P28 AD1 SER B 469  ? SER B 474  ? SER B 438  SER B 443  1 ? 6  
HELX_P HELX_P29 AD2 GLY B 533  ? TYR B 536  ? GLY B 502  TYR B 505  5 ? 4  
HELX_P HELX_P30 AD3 ASP B 768  ? CYS B 774  ? ASP B 737  CYS B 743  1 ? 7  
HELX_P HELX_P31 AD4 SER B 777  ? LEU B 785  ? SER B 746  LEU B 754  1 ? 9  
HELX_P HELX_P32 AD5 TYR B 787  ? ALA B 814  ? TYR B 756  ALA B 783  1 ? 28 
HELX_P HELX_P33 AD6 SER B 847  ? ASN B 855  ? SER B 816  ASN B 824  1 ? 9  
HELX_P HELX_P34 AD7 ASP B 879  ? PHE B 886  ? ASP B 848  PHE B 855  1 ? 8  
HELX_P HELX_P35 AD8 THR B 897  ? GLY B 916  ? THR B 866  GLY B 885  1 ? 20 
HELX_P HELX_P36 AD9 TRP B 917  ? ALA B 921  ? TRP B 886  ALA B 890  5 ? 5  
HELX_P HELX_P37 AE1 PRO B 928  ? GLY B 939  ? PRO B 897  GLY B 908  1 ? 12 
HELX_P HELX_P38 AE2 THR B 943  ? ASN B 950  ? THR B 912  ASN B 919  1 ? 8  
HELX_P HELX_P39 AE3 ASN B 950  ? SER B 970  ? ASN B 919  SER B 939  1 ? 21 
HELX_P HELX_P40 AE4 LEU B 976  ? GLN B 996  ? LEU B 945  GLN B 965  1 ? 21 
HELX_P HELX_P41 AE5 LEU B 997  ? SER B 999  ? LEU B 966  SER B 968  5 ? 3  
HELX_P HELX_P42 AE6 VAL B 1007 ? SER B 1013 ? VAL B 976  SER B 982  1 ? 7  
HELX_P HELX_P43 AE7 ASP B 1016 ? VAL B 1064 ? ASP B 985  VAL B 1033 1 ? 49 
HELX_P HELX_P44 AE8 LEU B 1172 ? ASP B 1177 ? LEU B 1141 ASP B 1146 1 ? 6  
HELX_P HELX_P45 AE9 ASP C 325  ? LYS C 335  ? ASP C 294  LYS C 304  1 ? 11 
HELX_P HELX_P46 AF1 ASP C 395  ? TYR C 400  ? ASP C 364  TYR C 369  5 ? 6  
HELX_P HELX_P47 AF2 SER C 414  ? LEU C 421  ? SER C 383  LEU C 390  5 ? 8  
HELX_P HELX_P48 AF3 ASP C 436  ? ILE C 441  ? ASP C 405  ILE C 410  5 ? 6  
HELX_P HELX_P49 AF4 GLY C 447  ? ASN C 453  ? GLY C 416  ASN C 422  1 ? 7  
HELX_P HELX_P50 AF5 SER C 469  ? SER C 474  ? SER C 438  SER C 443  1 ? 6  
HELX_P HELX_P51 AF6 GLY C 533  ? TYR C 536  ? GLY C 502  TYR C 505  5 ? 4  
HELX_P HELX_P52 AF7 ASP C 768  ? CYS C 774  ? ASP C 737  CYS C 743  1 ? 7  
HELX_P HELX_P53 AF8 SER C 777  ? LEU C 785  ? SER C 746  LEU C 754  1 ? 9  
HELX_P HELX_P54 AF9 TYR C 787  ? ALA C 814  ? TYR C 756  ALA C 783  1 ? 28 
HELX_P HELX_P55 AG1 SER C 847  ? ASN C 855  ? SER C 816  ASN C 824  1 ? 9  
HELX_P HELX_P56 AG2 ASP C 879  ? PHE C 886  ? ASP C 848  PHE C 855  1 ? 8  
HELX_P HELX_P57 AG3 THR C 897  ? GLY C 916  ? THR C 866  GLY C 885  1 ? 20 
HELX_P HELX_P58 AG4 TRP C 917  ? ALA C 921  ? TRP C 886  ALA C 890  5 ? 5  
HELX_P HELX_P59 AG5 PRO C 928  ? GLY C 939  ? PRO C 897  GLY C 908  1 ? 12 
HELX_P HELX_P60 AG6 THR C 943  ? ASN C 950  ? THR C 912  ASN C 919  1 ? 8  
HELX_P HELX_P61 AG7 ASN C 950  ? SER C 970  ? ASN C 919  SER C 939  1 ? 21 
HELX_P HELX_P62 AG8 LEU C 976  ? GLN C 996  ? LEU C 945  GLN C 965  1 ? 21 
HELX_P HELX_P63 AG9 LEU C 997  ? SER C 999  ? LEU C 966  SER C 968  5 ? 3  
HELX_P HELX_P64 AH1 VAL C 1007 ? SER C 1013 ? VAL C 976  SER C 982  1 ? 7  
HELX_P HELX_P65 AH2 ASP C 1016 ? VAL C 1064 ? ASP C 985  VAL C 1033 1 ? 49 
HELX_P HELX_P66 AH3 LEU C 1172 ? ASP C 1177 ? LEU C 1141 ASP C 1146 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A  CYS 46   SG  ? ? ? 1_555 A  CYS 167  SG ? ? A CYS 15   A CYS 136  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf2  disulf ?    ? A  CYS 162  SG  ? ? ? 1_555 A  CYS 197  SG ? ? A CYS 131  A CYS 166  1_555 ? ? ? ? ? ? ? 2.036 ? ? 
disulf3  disulf ?    ? A  CYS 322  SG  ? ? ? 1_555 A  CYS 332  SG ? ? A CYS 291  A CYS 301  1_555 ? ? ? ? ? ? ? 2.026 ? ? 
disulf4  disulf ?    ? A  CYS 367  SG  ? ? ? 1_555 A  CYS 392  SG ? ? A CYS 336  A CYS 361  1_555 ? ? ? ? ? ? ? 2.040 ? ? 
disulf5  disulf ?    ? A  CYS 410  SG  ? ? ? 1_555 A  CYS 463  SG ? ? A CYS 379  A CYS 432  1_555 ? ? ? ? ? ? ? 2.042 ? ? 
disulf6  disulf ?    ? A  CYS 422  SG  ? ? ? 1_555 A  CYS 556  SG ? ? A CYS 391  A CYS 525  1_555 ? ? ? ? ? ? ? 2.026 ? ? 
disulf7  disulf ?    ? A  CYS 511  SG  ? ? ? 1_555 A  CYS 519  SG ? ? A CYS 480  A CYS 488  1_555 ? ? ? ? ? ? ? 2.029 ? ? 
disulf8  disulf ?    ? A  CYS 569  SG  ? ? ? 1_555 A  CYS 621  SG ? ? A CYS 538  A CYS 590  1_555 ? ? ? ? ? ? ? 2.038 ? ? 
disulf9  disulf ?    ? A  CYS 648  SG  ? ? ? 1_555 A  CYS 680  SG ? ? A CYS 617  A CYS 649  1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf10 disulf ?    ? A  CYS 693  SG  ? ? ? 1_555 A  CYS 702  SG ? ? A CYS 662  A CYS 671  1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf11 disulf ?    ? A  CYS 769  SG  ? ? ? 1_555 A  CYS 791  SG ? ? A CYS 738  A CYS 760  1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf12 disulf ?    ? A  CYS 774  SG  ? ? ? 1_555 A  CYS 780  SG ? ? A CYS 743  A CYS 749  1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf13 disulf ?    ? A  CYS 871  SG  ? ? ? 1_555 A  CYS 882  SG ? ? A CYS 840  A CYS 851  1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf14 disulf ?    ? A  CYS 1063 SG  ? ? ? 1_555 A  CYS 1074 SG ? ? A CYS 1032 A CYS 1043 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf15 disulf ?    ? A  CYS 1113 SG  ? ? ? 1_555 A  CYS 1157 SG ? ? A CYS 1082 A CYS 1126 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf16 disulf ?    ? B  CYS 46   SG  ? ? ? 1_555 B  CYS 167  SG ? ? B CYS 15   B CYS 136  1_555 ? ? ? ? ? ? ? 2.030 ? ? 
disulf17 disulf ?    ? B  CYS 162  SG  ? ? ? 1_555 B  CYS 197  SG ? ? B CYS 131  B CYS 166  1_555 ? ? ? ? ? ? ? 2.036 ? ? 
disulf18 disulf ?    ? B  CYS 322  SG  ? ? ? 1_555 B  CYS 332  SG ? ? B CYS 291  B CYS 301  1_555 ? ? ? ? ? ? ? 2.026 ? ? 
disulf19 disulf ?    ? B  CYS 367  SG  ? ? ? 1_555 B  CYS 392  SG ? ? B CYS 336  B CYS 361  1_555 ? ? ? ? ? ? ? 2.041 ? ? 
disulf20 disulf ?    ? B  CYS 410  SG  ? ? ? 1_555 B  CYS 463  SG ? ? B CYS 379  B CYS 432  1_555 ? ? ? ? ? ? ? 2.042 ? ? 
disulf21 disulf ?    ? B  CYS 422  SG  ? ? ? 1_555 B  CYS 556  SG ? ? B CYS 391  B CYS 525  1_555 ? ? ? ? ? ? ? 2.026 ? ? 
disulf22 disulf ?    ? B  CYS 511  SG  ? ? ? 1_555 B  CYS 519  SG ? ? B CYS 480  B CYS 488  1_555 ? ? ? ? ? ? ? 2.029 ? ? 
disulf23 disulf ?    ? B  CYS 569  SG  ? ? ? 1_555 B  CYS 621  SG ? ? B CYS 538  B CYS 590  1_555 ? ? ? ? ? ? ? 2.037 ? ? 
disulf24 disulf ?    ? B  CYS 648  SG  ? ? ? 1_555 B  CYS 680  SG ? ? B CYS 617  B CYS 649  1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf25 disulf ?    ? B  CYS 693  SG  ? ? ? 1_555 B  CYS 702  SG ? ? B CYS 662  B CYS 671  1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf26 disulf ?    ? B  CYS 769  SG  ? ? ? 1_555 B  CYS 791  SG ? ? B CYS 738  B CYS 760  1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf27 disulf ?    ? B  CYS 774  SG  ? ? ? 1_555 B  CYS 780  SG ? ? B CYS 743  B CYS 749  1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf28 disulf ?    ? B  CYS 871  SG  ? ? ? 1_555 B  CYS 882  SG ? ? B CYS 840  B CYS 851  1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf29 disulf ?    ? B  CYS 1063 SG  ? ? ? 1_555 B  CYS 1074 SG ? ? B CYS 1032 B CYS 1043 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf30 disulf ?    ? B  CYS 1113 SG  ? ? ? 1_555 B  CYS 1157 SG ? ? B CYS 1082 B CYS 1126 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf31 disulf ?    ? C  CYS 46   SG  ? ? ? 1_555 C  CYS 167  SG ? ? C CYS 15   C CYS 136  1_555 ? ? ? ? ? ? ? 2.030 ? ? 
disulf32 disulf ?    ? C  CYS 162  SG  ? ? ? 1_555 C  CYS 197  SG ? ? C CYS 131  C CYS 166  1_555 ? ? ? ? ? ? ? 2.036 ? ? 
disulf33 disulf ?    ? C  CYS 322  SG  ? ? ? 1_555 C  CYS 332  SG ? ? C CYS 291  C CYS 301  1_555 ? ? ? ? ? ? ? 2.026 ? ? 
disulf34 disulf ?    ? C  CYS 367  SG  ? ? ? 1_555 C  CYS 392  SG ? ? C CYS 336  C CYS 361  1_555 ? ? ? ? ? ? ? 2.040 ? ? 
disulf35 disulf ?    ? C  CYS 410  SG  ? ? ? 1_555 C  CYS 463  SG ? ? C CYS 379  C CYS 432  1_555 ? ? ? ? ? ? ? 2.042 ? ? 
disulf36 disulf ?    ? C  CYS 422  SG  ? ? ? 1_555 C  CYS 556  SG ? ? C CYS 391  C CYS 525  1_555 ? ? ? ? ? ? ? 2.026 ? ? 
disulf37 disulf ?    ? C  CYS 511  SG  ? ? ? 1_555 C  CYS 519  SG ? ? C CYS 480  C CYS 488  1_555 ? ? ? ? ? ? ? 2.029 ? ? 
disulf38 disulf ?    ? C  CYS 569  SG  ? ? ? 1_555 C  CYS 621  SG ? ? C CYS 538  C CYS 590  1_555 ? ? ? ? ? ? ? 2.038 ? ? 
disulf39 disulf ?    ? C  CYS 648  SG  ? ? ? 1_555 C  CYS 680  SG ? ? C CYS 617  C CYS 649  1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf40 disulf ?    ? C  CYS 693  SG  ? ? ? 1_555 C  CYS 702  SG ? ? C CYS 662  C CYS 671  1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf41 disulf ?    ? C  CYS 769  SG  ? ? ? 1_555 C  CYS 791  SG ? ? C CYS 738  C CYS 760  1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf42 disulf ?    ? C  CYS 774  SG  ? ? ? 1_555 C  CYS 780  SG ? ? C CYS 743  C CYS 749  1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf43 disulf ?    ? C  CYS 871  SG  ? ? ? 1_555 C  CYS 882  SG ? ? C CYS 840  C CYS 851  1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf44 disulf ?    ? C  CYS 1063 SG  ? ? ? 1_555 C  CYS 1074 SG ? ? C CYS 1032 C CYS 1043 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf45 disulf ?    ? C  CYS 1113 SG  ? ? ? 1_555 C  CYS 1157 SG ? ? C CYS 1082 C CYS 1126 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
covale1  covale one  ? A  ASN 48   ND2 ? ? ? 1_555 D  NAG .    C1 ? ? A ASN 17   D NAG 1    1_555 ? ? ? ? ? ? ? 1.440 ? 
N-Glycosylation 
covale2  covale one  ? A  ASN 92   ND2 ? ? ? 1_555 L  NAG .    C1 ? ? A ASN 61   L NAG 1    1_555 ? ? ? ? ? ? ? 1.434 ? 
N-Glycosylation 
covale3  covale one  ? A  ASN 153  ND2 ? ? ? 1_555 E  NAG .    C1 ? ? A ASN 122  E NAG 1    1_555 ? ? ? ? ? ? ? 1.439 ? 
N-Glycosylation 
covale4  covale one  ? A  ASN 180  ND2 ? ? ? 1_555 EA NAG .    C1 ? ? A ASN 149  A NAG 1305 1_555 ? ? ? ? ? ? ? 1.451 ? 
N-Glycosylation 
covale5  covale one  ? A  ASN 196  ND2 ? ? ? 1_555 F  NAG .    C1 ? ? A ASN 165  F NAG 1    1_555 ? ? ? ? ? ? ? 1.439 ? 
N-Glycosylation 
covale6  covale one  ? A  ASN 265  ND2 ? ? ? 1_555 G  NAG .    C1 ? ? A ASN 234  G NAG 1    1_555 ? ? ? ? ? ? ? 1.438 ? 
N-Glycosylation 
covale7  covale one  ? A  ASN 313  ND2 ? ? ? 1_555 FA NAG .    C1 ? ? A ASN 282  A NAG 1310 1_555 ? ? ? ? ? ? ? 1.438 ? 
N-Glycosylation 
covale8  covale one  ? A  ASN 362  ND2 ? ? ? 1_555 GA NAG .    C1 ? ? A ASN 331  A NAG 1311 1_555 ? ? ? ? ? ? ? 1.436 ? 
N-Glycosylation 
covale9  covale one  ? A  ASN 374  ND2 ? ? ? 1_555 HA NAG .    C1 ? ? A ASN 343  A NAG 1312 1_555 ? ? ? ? ? ? ? 1.440 ? 
N-Glycosylation 
covale10 covale one  ? A  ASN 647  ND2 ? ? ? 1_555 H  NAG .    C1 ? ? A ASN 616  H NAG 1    1_555 ? ? ? ? ? ? ? 1.439 ? 
N-Glycosylation 
covale11 covale one  ? A  ASN 688  ND2 ? ? ? 1_555 IA NAG .    C1 ? ? A ASN 657  A NAG 1315 1_555 ? ? ? ? ? ? ? 1.440 ? 
N-Glycosylation 
covale12 covale one  ? A  ASN 740  ND2 ? ? ? 1_555 JA NAG .    C1 ? ? A ASN 709  A NAG 1316 1_555 ? ? ? ? ? ? ? 1.436 ? 
N-Glycosylation 
covale13 covale one  ? A  ASN 748  ND2 ? ? ? 1_555 I  NAG .    C1 ? ? A ASN 717  I NAG 1    1_555 ? ? ? ? ? ? ? 1.440 ? 
N-Glycosylation 
covale14 covale one  ? A  ASN 832  ND2 ? ? ? 1_555 J  NAG .    C1 ? ? A ASN 801  J NAG 1    1_555 ? ? ? ? ? ? ? 1.434 ? 
N-Glycosylation 
covale15 covale one  ? A  ASN 1105 ND2 ? ? ? 1_555 KA NAG .    C1 ? ? A ASN 1074 A NAG 1321 1_555 ? ? ? ? ? ? ? 1.435 ? 
N-Glycosylation 
covale16 covale one  ? A  ASN 1129 ND2 ? ? ? 1_555 K  NAG .    C1 ? ? A ASN 1098 K NAG 1    1_555 ? ? ? ? ? ? ? 1.436 ? 
N-Glycosylation 
covale17 covale one  ? A  ASN 1165 ND2 ? ? ? 1_555 LA NAG .    C1 ? ? A ASN 1134 A NAG 1324 1_555 ? ? ? ? ? ? ? 1.437 ? 
N-Glycosylation 
covale18 covale one  ? B  ASN 48   ND2 ? ? ? 1_555 M  NAG .    C1 ? ? B ASN 17   M NAG 1    1_555 ? ? ? ? ? ? ? 1.440 ? 
N-Glycosylation 
covale19 covale one  ? B  ASN 92   ND2 ? ? ? 1_555 U  NAG .    C1 ? ? B ASN 61   U NAG 1    1_555 ? ? ? ? ? ? ? 1.433 ? 
N-Glycosylation 
covale20 covale one  ? B  ASN 153  ND2 ? ? ? 1_555 N  NAG .    C1 ? ? B ASN 122  N NAG 1    1_555 ? ? ? ? ? ? ? 1.439 ? 
N-Glycosylation 
covale21 covale one  ? B  ASN 180  ND2 ? ? ? 1_555 MA NAG .    C1 ? ? B ASN 149  B NAG 1305 1_555 ? ? ? ? ? ? ? 1.451 ? 
N-Glycosylation 
covale22 covale one  ? B  ASN 196  ND2 ? ? ? 1_555 O  NAG .    C1 ? ? B ASN 165  O NAG 1    1_555 ? ? ? ? ? ? ? 1.439 ? 
N-Glycosylation 
covale23 covale one  ? B  ASN 265  ND2 ? ? ? 1_555 P  NAG .    C1 ? ? B ASN 234  P NAG 1    1_555 ? ? ? ? ? ? ? 1.438 ? 
N-Glycosylation 
covale24 covale one  ? B  ASN 313  ND2 ? ? ? 1_555 NA NAG .    C1 ? ? B ASN 282  B NAG 1310 1_555 ? ? ? ? ? ? ? 1.439 ? 
N-Glycosylation 
covale25 covale one  ? B  ASN 362  ND2 ? ? ? 1_555 OA NAG .    C1 ? ? B ASN 331  B NAG 1311 1_555 ? ? ? ? ? ? ? 1.437 ? 
N-Glycosylation 
covale26 covale one  ? B  ASN 374  ND2 ? ? ? 1_555 PA NAG .    C1 ? ? B ASN 343  B NAG 1312 1_555 ? ? ? ? ? ? ? 1.440 ? 
N-Glycosylation 
covale27 covale one  ? B  ASN 647  ND2 ? ? ? 1_555 Q  NAG .    C1 ? ? B ASN 616  Q NAG 1    1_555 ? ? ? ? ? ? ? 1.439 ? 
N-Glycosylation 
covale28 covale one  ? B  ASN 688  ND2 ? ? ? 1_555 QA NAG .    C1 ? ? B ASN 657  B NAG 1315 1_555 ? ? ? ? ? ? ? 1.440 ? 
N-Glycosylation 
covale29 covale one  ? B  ASN 740  ND2 ? ? ? 1_555 RA NAG .    C1 ? ? B ASN 709  B NAG 1316 1_555 ? ? ? ? ? ? ? 1.436 ? 
N-Glycosylation 
covale30 covale one  ? B  ASN 748  ND2 ? ? ? 1_555 R  NAG .    C1 ? ? B ASN 717  R NAG 1    1_555 ? ? ? ? ? ? ? 1.440 ? 
N-Glycosylation 
covale31 covale one  ? B  ASN 832  ND2 ? ? ? 1_555 S  NAG .    C1 ? ? B ASN 801  S NAG 1    1_555 ? ? ? ? ? ? ? 1.435 ? 
N-Glycosylation 
covale32 covale one  ? B  ASN 1105 ND2 ? ? ? 1_555 SA NAG .    C1 ? ? B ASN 1074 B NAG 1321 1_555 ? ? ? ? ? ? ? 1.435 ? 
N-Glycosylation 
covale33 covale one  ? B  ASN 1129 ND2 ? ? ? 1_555 T  NAG .    C1 ? ? B ASN 1098 T NAG 1    1_555 ? ? ? ? ? ? ? 1.436 ? 
N-Glycosylation 
covale34 covale one  ? B  ASN 1165 ND2 ? ? ? 1_555 TA NAG .    C1 ? ? B ASN 1134 B NAG 1324 1_555 ? ? ? ? ? ? ? 1.436 ? 
N-Glycosylation 
covale35 covale one  ? C  ASN 48   ND2 ? ? ? 1_555 V  NAG .    C1 ? ? C ASN 17   V NAG 1    1_555 ? ? ? ? ? ? ? 1.440 ? 
N-Glycosylation 
covale36 covale one  ? C  ASN 92   ND2 ? ? ? 1_555 DA NAG .    C1 ? ? C ASN 61   d NAG 1    1_555 ? ? ? ? ? ? ? 1.433 ? 
N-Glycosylation 
covale37 covale one  ? C  ASN 153  ND2 ? ? ? 1_555 W  NAG .    C1 ? ? C ASN 122  W NAG 1    1_555 ? ? ? ? ? ? ? 1.439 ? 
N-Glycosylation 
covale38 covale one  ? C  ASN 180  ND2 ? ? ? 1_555 UA NAG .    C1 ? ? C ASN 149  C NAG 1305 1_555 ? ? ? ? ? ? ? 1.451 ? 
N-Glycosylation 
covale39 covale one  ? C  ASN 196  ND2 ? ? ? 1_555 X  NAG .    C1 ? ? C ASN 165  X NAG 1    1_555 ? ? ? ? ? ? ? 1.439 ? 
N-Glycosylation 
covale40 covale one  ? C  ASN 265  ND2 ? ? ? 1_555 Y  NAG .    C1 ? ? C ASN 234  Y NAG 1    1_555 ? ? ? ? ? ? ? 1.438 ? 
N-Glycosylation 
covale41 covale one  ? C  ASN 313  ND2 ? ? ? 1_555 VA NAG .    C1 ? ? C ASN 282  C NAG 1310 1_555 ? ? ? ? ? ? ? 1.437 ? 
N-Glycosylation 
covale42 covale one  ? C  ASN 362  ND2 ? ? ? 1_555 WA NAG .    C1 ? ? C ASN 331  C NAG 1311 1_555 ? ? ? ? ? ? ? 1.436 ? 
N-Glycosylation 
covale43 covale one  ? C  ASN 374  ND2 ? ? ? 1_555 XA NAG .    C1 ? ? C ASN 343  C NAG 1312 1_555 ? ? ? ? ? ? ? 1.439 ? 
N-Glycosylation 
covale44 covale one  ? C  ASN 647  ND2 ? ? ? 1_555 Z  NAG .    C1 ? ? C ASN 616  Z NAG 1    1_555 ? ? ? ? ? ? ? 1.439 ? 
N-Glycosylation 
covale45 covale one  ? C  ASN 688  ND2 ? ? ? 1_555 YA NAG .    C1 ? ? C ASN 657  C NAG 1315 1_555 ? ? ? ? ? ? ? 1.440 ? 
N-Glycosylation 
covale46 covale one  ? C  ASN 740  ND2 ? ? ? 1_555 ZA NAG .    C1 ? ? C ASN 709  C NAG 1316 1_555 ? ? ? ? ? ? ? 1.436 ? 
N-Glycosylation 
covale47 covale one  ? C  ASN 748  ND2 ? ? ? 1_555 AA NAG .    C1 ? ? C ASN 717  a NAG 1    1_555 ? ? ? ? ? ? ? 1.440 ? 
N-Glycosylation 
covale48 covale one  ? C  ASN 832  ND2 ? ? ? 1_555 BA NAG .    C1 ? ? C ASN 801  b NAG 1    1_555 ? ? ? ? ? ? ? 1.435 ? 
N-Glycosylation 
covale49 covale one  ? C  ASN 1105 ND2 ? ? ? 1_555 AB NAG .    C1 ? ? C ASN 1074 C NAG 1321 1_555 ? ? ? ? ? ? ? 1.435 ? 
N-Glycosylation 
covale50 covale one  ? C  ASN 1129 ND2 ? ? ? 1_555 CA NAG .    C1 ? ? C ASN 1098 c NAG 1    1_555 ? ? ? ? ? ? ? 1.436 ? 
N-Glycosylation 
covale51 covale one  ? C  ASN 1165 ND2 ? ? ? 1_555 BB NAG .    C1 ? ? C ASN 1134 C NAG 1324 1_555 ? ? ? ? ? ? ? 1.437 ? 
N-Glycosylation 
covale52 covale both ? D  NAG .    O4  ? ? ? 1_555 D  NAG .    C1 ? ? D NAG 1    D NAG 2    1_555 ? ? ? ? ? ? ? 1.441 ? ? 
covale53 covale both ? E  NAG .    O4  ? ? ? 1_555 E  NAG .    C1 ? ? E NAG 1    E NAG 2    1_555 ? ? ? ? ? ? ? 1.440 ? ? 
covale54 covale both ? F  NAG .    O4  ? ? ? 1_555 F  NAG .    C1 ? ? F NAG 1    F NAG 2    1_555 ? ? ? ? ? ? ? 1.446 ? ? 
covale55 covale both ? G  NAG .    O4  ? ? ? 1_555 G  NAG .    C1 ? ? G NAG 1    G NAG 2    1_555 ? ? ? ? ? ? ? 1.443 ? ? 
covale56 covale both ? H  NAG .    O4  ? ? ? 1_555 H  NAG .    C1 ? ? H NAG 1    H NAG 2    1_555 ? ? ? ? ? ? ? 1.445 ? ? 
covale57 covale both ? I  NAG .    O4  ? ? ? 1_555 I  NAG .    C1 ? ? I NAG 1    I NAG 2    1_555 ? ? ? ? ? ? ? 1.444 ? ? 
covale58 covale both ? J  NAG .    O4  ? ? ? 1_555 J  NAG .    C1 ? ? J NAG 1    J NAG 2    1_555 ? ? ? ? ? ? ? 1.445 ? ? 
covale59 covale both ? K  NAG .    O4  ? ? ? 1_555 K  NAG .    C1 ? ? K NAG 1    K NAG 2    1_555 ? ? ? ? ? ? ? 1.443 ? ? 
covale60 covale both ? L  NAG .    O4  ? ? ? 1_555 L  NAG .    C1 ? ? L NAG 1    L NAG 2    1_555 ? ? ? ? ? ? ? 1.439 ? ? 
covale61 covale both ? M  NAG .    O4  ? ? ? 1_555 M  NAG .    C1 ? ? M NAG 1    M NAG 2    1_555 ? ? ? ? ? ? ? 1.441 ? ? 
covale62 covale both ? N  NAG .    O4  ? ? ? 1_555 N  NAG .    C1 ? ? N NAG 1    N NAG 2    1_555 ? ? ? ? ? ? ? 1.440 ? ? 
covale63 covale both ? O  NAG .    O4  ? ? ? 1_555 O  NAG .    C1 ? ? O NAG 1    O NAG 2    1_555 ? ? ? ? ? ? ? 1.446 ? ? 
covale64 covale both ? P  NAG .    O4  ? ? ? 1_555 P  NAG .    C1 ? ? P NAG 1    P NAG 2    1_555 ? ? ? ? ? ? ? 1.443 ? ? 
covale65 covale both ? Q  NAG .    O4  ? ? ? 1_555 Q  NAG .    C1 ? ? Q NAG 1    Q NAG 2    1_555 ? ? ? ? ? ? ? 1.444 ? ? 
covale66 covale both ? R  NAG .    O4  ? ? ? 1_555 R  NAG .    C1 ? ? R NAG 1    R NAG 2    1_555 ? ? ? ? ? ? ? 1.444 ? ? 
covale67 covale both ? S  NAG .    O4  ? ? ? 1_555 S  NAG .    C1 ? ? S NAG 1    S NAG 2    1_555 ? ? ? ? ? ? ? 1.446 ? ? 
covale68 covale both ? T  NAG .    O4  ? ? ? 1_555 T  NAG .    C1 ? ? T NAG 1    T NAG 2    1_555 ? ? ? ? ? ? ? 1.443 ? ? 
covale69 covale both ? U  NAG .    O4  ? ? ? 1_555 U  NAG .    C1 ? ? U NAG 1    U NAG 2    1_555 ? ? ? ? ? ? ? 1.438 ? ? 
covale70 covale both ? V  NAG .    O4  ? ? ? 1_555 V  NAG .    C1 ? ? V NAG 1    V NAG 2    1_555 ? ? ? ? ? ? ? 1.441 ? ? 
covale71 covale both ? W  NAG .    O4  ? ? ? 1_555 W  NAG .    C1 ? ? W NAG 1    W NAG 2    1_555 ? ? ? ? ? ? ? 1.440 ? ? 
covale72 covale both ? X  NAG .    O4  ? ? ? 1_555 X  NAG .    C1 ? ? X NAG 1    X NAG 2    1_555 ? ? ? ? ? ? ? 1.446 ? ? 
covale73 covale both ? Y  NAG .    O4  ? ? ? 1_555 Y  NAG .    C1 ? ? Y NAG 1    Y NAG 2    1_555 ? ? ? ? ? ? ? 1.443 ? ? 
covale74 covale both ? Z  NAG .    O4  ? ? ? 1_555 Z  NAG .    C1 ? ? Z NAG 1    Z NAG 2    1_555 ? ? ? ? ? ? ? 1.445 ? ? 
covale75 covale both ? AA NAG .    O4  ? ? ? 1_555 AA NAG .    C1 ? ? a NAG 1    a NAG 2    1_555 ? ? ? ? ? ? ? 1.443 ? ? 
covale76 covale both ? BA NAG .    O4  ? ? ? 1_555 BA NAG .    C1 ? ? b NAG 1    b NAG 2    1_555 ? ? ? ? ? ? ? 1.446 ? ? 
covale77 covale both ? CA NAG .    O4  ? ? ? 1_555 CA NAG .    C1 ? ? c NAG 1    c NAG 2    1_555 ? ? ? ? ? ? ? 1.443 ? ? 
covale78 covale both ? DA NAG .    O4  ? ? ? 1_555 DA NAG .    C1 ? ? d NAG 1    d NAG 2    1_555 ? ? ? ? ? ? ? 1.438 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 7 ? 
AA2 ? 3 ? 
AA3 ? 6 ? 
AA4 ? 3 ? 
AA5 ? 5 ? 
AA6 ? 6 ? 
AA7 ? 5 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 4 ? 
AB2 ? 5 ? 
AB3 ? 3 ? 
AB4 ? 2 ? 
AB5 ? 4 ? 
AB6 ? 7 ? 
AB7 ? 3 ? 
AB8 ? 6 ? 
AB9 ? 3 ? 
AC1 ? 5 ? 
AC2 ? 6 ? 
AC3 ? 5 ? 
AC4 ? 2 ? 
AC5 ? 2 ? 
AC6 ? 4 ? 
AC7 ? 5 ? 
AC8 ? 3 ? 
AC9 ? 2 ? 
AD1 ? 4 ? 
AD2 ? 7 ? 
AD3 ? 3 ? 
AD4 ? 6 ? 
AD5 ? 3 ? 
AD6 ? 5 ? 
AD7 ? 6 ? 
AD8 ? 5 ? 
AD9 ? 2 ? 
AE1 ? 2 ? 
AE2 ? 4 ? 
AE3 ? 5 ? 
AE4 ? 3 ? 
AE5 ? 2 ? 
AE6 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA1 5 6 ? anti-parallel 
AA1 6 7 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
AA3 5 6 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? parallel      
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA5 4 5 ? anti-parallel 
AA6 1 2 ? parallel      
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA6 4 5 ? anti-parallel 
AA6 5 6 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA7 4 5 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? parallel      
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB2 4 5 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? parallel      
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB6 4 5 ? anti-parallel 
AB6 5 6 ? anti-parallel 
AB6 6 7 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB8 3 4 ? anti-parallel 
AB8 4 5 ? anti-parallel 
AB8 5 6 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? parallel      
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC1 3 4 ? anti-parallel 
AC1 4 5 ? anti-parallel 
AC2 1 2 ? parallel      
AC2 2 3 ? anti-parallel 
AC2 3 4 ? anti-parallel 
AC2 4 5 ? anti-parallel 
AC2 5 6 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC3 4 5 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? parallel      
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC7 3 4 ? anti-parallel 
AC7 4 5 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD1 3 4 ? parallel      
AD2 1 2 ? anti-parallel 
AD2 2 3 ? anti-parallel 
AD2 3 4 ? anti-parallel 
AD2 4 5 ? anti-parallel 
AD2 5 6 ? anti-parallel 
AD2 6 7 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD4 2 3 ? anti-parallel 
AD4 3 4 ? anti-parallel 
AD4 4 5 ? anti-parallel 
AD4 5 6 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? parallel      
AD6 1 2 ? anti-parallel 
AD6 2 3 ? anti-parallel 
AD6 3 4 ? anti-parallel 
AD6 4 5 ? anti-parallel 
AD7 1 2 ? parallel      
AD7 2 3 ? anti-parallel 
AD7 3 4 ? anti-parallel 
AD7 4 5 ? anti-parallel 
AD7 5 6 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD8 2 3 ? anti-parallel 
AD8 3 4 ? anti-parallel 
AD8 4 5 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE2 1 2 ? parallel      
AE2 2 3 ? anti-parallel 
AE2 3 4 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE3 2 3 ? anti-parallel 
AE3 3 4 ? anti-parallel 
AE3 4 5 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE4 2 3 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE6 2 3 ? anti-parallel 
AE6 3 4 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ALA A 58   ? ASN A 61   ? ALA A 27   ASN A 30   
AA1 2 ASN A 92   ? ALA A 98   ? ASN A 61   ALA A 67   
AA1 3 ALA A 294  ? TYR A 300  ? ALA A 263  TYR A 269  
AA1 4 VAL A 121  ? GLU A 127  ? VAL A 90   GLU A 96   
AA1 5 PHE A 217  ? ILE A 228  ? PHE A 186  ILE A 197  
AA1 6 TYR A 231  ? LEU A 243  ? TYR A 200  LEU A 212  
AA1 7 GLU A 255  ? PRO A 261  ? GLU A 224  PRO A 230  
AA2 1 VAL A 78   ? PHE A 86   ? VAL A 47   PHE A 55   
AA2 2 GLN A 302  ? TYR A 310  ? GLN A 271  TYR A 279  
AA2 3 ILE A 316  ? ASP A 321  ? ILE A 285  ASP A 290  
AA3 1 VAL A 114  ? PRO A 116  ? VAL A 83   PRO A 85   
AA3 2 ARG A 268  ? LEU A 272  ? ARG A 237  LEU A 241  
AA3 3 GLY A 134  ? GLY A 138  ? GLY A 103  GLY A 107  
AA3 4 SER A 147  ? ASN A 152  ? SER A 116  ASN A 121  
AA3 5 VAL A 157  ? CYS A 162  ? VAL A 126  CYS A 131  
AA3 6 PHE A 199  ? VAL A 202  ? PHE A 168  VAL A 171  
AA4 1 SER A 182  ? ALA A 194  ? SER A 151  ALA A 163  
AA4 2 PHE A 164  ? HIS A 177  ? PHE A 133  HIS A 146  
AA4 3 ALA A 274  ? ARG A 277  ? ALA A 243  ARG A 246  
AA5 1 GLY A 342  ? GLN A 345  ? GLY A 311  GLN A 314  
AA5 2 VAL A 626  ? THR A 630  ? VAL A 595  THR A 599  
AA5 3 ALA A 640  ? TYR A 643  ? ALA A 609  TYR A 612  
AA5 4 GLY A 679  ? ILE A 682  ? GLY A 648  ILE A 651  
AA5 5 VAL A 673  ? THR A 676  ? VAL A 642  THR A 645  
AA6 1 GLU A 355  ? ARG A 359  ? GLU A 324  ARG A 328  
AA6 2 VAL A 570  ? PHE A 574  ? VAL A 539  PHE A 543  
AA6 3 LEU A 577  ? GLU A 585  ? LEU A 546  GLU A 554  
AA6 4 ILE A 615  ? THR A 619  ? ILE A 584  THR A 588  
AA6 5 THR A 604  ? ARG A 608  ? THR A 573  ARG A 577  
AA6 6 PHE A 596  ? ARG A 598  ? PHE A 565  ARG A 567  
AA7 1 ASN A 385  ? ILE A 389  ? ASN A 354  ILE A 358  
AA7 2 PHE A 423  ? ARG A 434  ? PHE A 392  ARG A 403  
AA7 3 PRO A 538  ? LEU A 548  ? PRO A 507  LEU A 517  
AA7 4 GLY A 462  ? ASN A 468  ? GLY A 431  ASN A 437  
AA7 5 THR A 407  ? TYR A 411  ? THR A 376  TYR A 380  
AA8 1 LEU A 483  ? ARG A 485  ? LEU A 452  ARG A 454  
AA8 2 LEU A 523  ? SER A 525  ? LEU A 492  SER A 494  
AA9 1 TYR A 504  ? GLN A 505  ? TYR A 473  GLN A 474  
AA9 2 CYS A 519  ? TYR A 520  ? CYS A 488  TYR A 489  
AB1 1 GLU A 685  ? HIS A 686  ? GLU A 654  HIS A 655  
AB1 2 SER A 722  ? THR A 727  ? SER A 691  THR A 696  
AB1 3 ILE A 701  ? GLN A 706  ? ILE A 670  GLN A 675  
AB1 4 ILE A 695  ? GLY A 698  ? ILE A 664  GLY A 667  
AB2 1 ILE A 743  ? PRO A 746  ? ILE A 712  PRO A 715  
AB2 2 GLU A 1103 ? ALA A 1109 ? GLU A 1072 ALA A 1078 
AB2 3 VAL A 1125 ? SER A 1128 ? VAL A 1094 SER A 1097 
AB2 4 TRP A 1133 ? GLN A 1137 ? TRP A 1102 GLN A 1106 
AB2 5 PHE A 1140 ? GLN A 1144 ? PHE A 1109 GLN A 1113 
AB3 1 PHE A 749  ? PRO A 759  ? PHE A 718  PRO A 728  
AB3 2 GLY A 1090 ? PRO A 1100 ? GLY A 1059 PRO A 1069 
AB3 3 TYR A 1078 ? ALA A 1087 ? TYR A 1047 ALA A 1056 
AB4 1 LYS A 764  ? VAL A 767  ? LYS A 733  VAL A 736  
AB4 2 LEU A 889  ? LEU A 892  ? LEU A 858  LEU A 861  
AB5 1 THR A 1151 ? VAL A 1153 ? THR A 1120 VAL A 1122 
AB5 2 ALA A 1118 ? PRO A 1121 ? ALA A 1087 PRO A 1090 
AB5 3 ILE A 1112 ? CYS A 1113 ? ILE A 1081 CYS A 1082 
AB5 4 VAL A 1164 ? ASN A 1165 ? VAL A 1133 ASN A 1134 
AB6 1 ALA B 58   ? ASN B 61   ? ALA B 27   ASN B 30   
AB6 2 ASN B 92   ? ALA B 98   ? ASN B 61   ALA B 67   
AB6 3 ALA B 294  ? TYR B 300  ? ALA B 263  TYR B 269  
AB6 4 VAL B 121  ? GLU B 127  ? VAL B 90   GLU B 96   
AB6 5 PHE B 217  ? ILE B 228  ? PHE B 186  ILE B 197  
AB6 6 TYR B 231  ? LEU B 243  ? TYR B 200  LEU B 212  
AB6 7 GLU B 255  ? PRO B 261  ? GLU B 224  PRO B 230  
AB7 1 VAL B 78   ? PHE B 86   ? VAL B 47   PHE B 55   
AB7 2 GLN B 302  ? TYR B 310  ? GLN B 271  TYR B 279  
AB7 3 ILE B 316  ? ASP B 321  ? ILE B 285  ASP B 290  
AB8 1 VAL B 114  ? PRO B 116  ? VAL B 83   PRO B 85   
AB8 2 ARG B 268  ? LEU B 272  ? ARG B 237  LEU B 241  
AB8 3 GLY B 134  ? GLY B 138  ? GLY B 103  GLY B 107  
AB8 4 SER B 147  ? ASN B 152  ? SER B 116  ASN B 121  
AB8 5 VAL B 157  ? CYS B 162  ? VAL B 126  CYS B 131  
AB8 6 PHE B 199  ? VAL B 202  ? PHE B 168  VAL B 171  
AB9 1 SER B 182  ? ALA B 194  ? SER B 151  ALA B 163  
AB9 2 PHE B 164  ? HIS B 177  ? PHE B 133  HIS B 146  
AB9 3 ALA B 274  ? ARG B 277  ? ALA B 243  ARG B 246  
AC1 1 GLY B 342  ? GLN B 345  ? GLY B 311  GLN B 314  
AC1 2 VAL B 626  ? THR B 630  ? VAL B 595  THR B 599  
AC1 3 ALA B 640  ? TYR B 643  ? ALA B 609  TYR B 612  
AC1 4 GLY B 679  ? ILE B 682  ? GLY B 648  ILE B 651  
AC1 5 VAL B 673  ? THR B 676  ? VAL B 642  THR B 645  
AC2 1 GLU B 355  ? ARG B 359  ? GLU B 324  ARG B 328  
AC2 2 VAL B 570  ? PHE B 574  ? VAL B 539  PHE B 543  
AC2 3 LEU B 577  ? GLU B 585  ? LEU B 546  GLU B 554  
AC2 4 ILE B 615  ? THR B 619  ? ILE B 584  THR B 588  
AC2 5 THR B 604  ? ARG B 608  ? THR B 573  ARG B 577  
AC2 6 PHE B 596  ? ARG B 598  ? PHE B 565  ARG B 567  
AC3 1 ASN B 385  ? ILE B 389  ? ASN B 354  ILE B 358  
AC3 2 PHE B 423  ? ARG B 434  ? PHE B 392  ARG B 403  
AC3 3 PRO B 538  ? LEU B 548  ? PRO B 507  LEU B 517  
AC3 4 GLY B 462  ? ASN B 468  ? GLY B 431  ASN B 437  
AC3 5 THR B 407  ? TYR B 411  ? THR B 376  TYR B 380  
AC4 1 LEU B 483  ? ARG B 485  ? LEU B 452  ARG B 454  
AC4 2 LEU B 523  ? SER B 525  ? LEU B 492  SER B 494  
AC5 1 TYR B 504  ? GLN B 505  ? TYR B 473  GLN B 474  
AC5 2 CYS B 519  ? TYR B 520  ? CYS B 488  TYR B 489  
AC6 1 GLU B 685  ? HIS B 686  ? GLU B 654  HIS B 655  
AC6 2 SER B 722  ? THR B 727  ? SER B 691  THR B 696  
AC6 3 ILE B 701  ? GLN B 706  ? ILE B 670  GLN B 675  
AC6 4 ILE B 695  ? GLY B 698  ? ILE B 664  GLY B 667  
AC7 1 ILE B 743  ? PRO B 746  ? ILE B 712  PRO B 715  
AC7 2 GLU B 1103 ? ALA B 1109 ? GLU B 1072 ALA B 1078 
AC7 3 VAL B 1125 ? SER B 1128 ? VAL B 1094 SER B 1097 
AC7 4 TRP B 1133 ? GLN B 1137 ? TRP B 1102 GLN B 1106 
AC7 5 PHE B 1140 ? GLN B 1144 ? PHE B 1109 GLN B 1113 
AC8 1 PHE B 749  ? PRO B 759  ? PHE B 718  PRO B 728  
AC8 2 GLY B 1090 ? PRO B 1100 ? GLY B 1059 PRO B 1069 
AC8 3 TYR B 1078 ? ALA B 1087 ? TYR B 1047 ALA B 1056 
AC9 1 LYS B 764  ? VAL B 767  ? LYS B 733  VAL B 736  
AC9 2 LEU B 889  ? LEU B 892  ? LEU B 858  LEU B 861  
AD1 1 THR B 1151 ? VAL B 1153 ? THR B 1120 VAL B 1122 
AD1 2 ALA B 1118 ? PRO B 1121 ? ALA B 1087 PRO B 1090 
AD1 3 ILE B 1112 ? CYS B 1113 ? ILE B 1081 CYS B 1082 
AD1 4 VAL B 1164 ? ASN B 1165 ? VAL B 1133 ASN B 1134 
AD2 1 ALA C 58   ? ASN C 61   ? ALA C 27   ASN C 30   
AD2 2 ASN C 92   ? ALA C 98   ? ASN C 61   ALA C 67   
AD2 3 ALA C 294  ? TYR C 300  ? ALA C 263  TYR C 269  
AD2 4 VAL C 121  ? GLU C 127  ? VAL C 90   GLU C 96   
AD2 5 PHE C 217  ? ILE C 228  ? PHE C 186  ILE C 197  
AD2 6 TYR C 231  ? LEU C 243  ? TYR C 200  LEU C 212  
AD2 7 GLU C 255  ? PRO C 261  ? GLU C 224  PRO C 230  
AD3 1 VAL C 78   ? PHE C 86   ? VAL C 47   PHE C 55   
AD3 2 GLN C 302  ? TYR C 310  ? GLN C 271  TYR C 279  
AD3 3 ILE C 316  ? ASP C 321  ? ILE C 285  ASP C 290  
AD4 1 VAL C 114  ? PRO C 116  ? VAL C 83   PRO C 85   
AD4 2 ARG C 268  ? LEU C 272  ? ARG C 237  LEU C 241  
AD4 3 GLY C 134  ? GLY C 138  ? GLY C 103  GLY C 107  
AD4 4 SER C 147  ? ASN C 152  ? SER C 116  ASN C 121  
AD4 5 VAL C 157  ? CYS C 162  ? VAL C 126  CYS C 131  
AD4 6 PHE C 199  ? VAL C 202  ? PHE C 168  VAL C 171  
AD5 1 SER C 182  ? ALA C 194  ? SER C 151  ALA C 163  
AD5 2 PHE C 164  ? HIS C 177  ? PHE C 133  HIS C 146  
AD5 3 ALA C 274  ? ARG C 277  ? ALA C 243  ARG C 246  
AD6 1 GLY C 342  ? GLN C 345  ? GLY C 311  GLN C 314  
AD6 2 VAL C 626  ? THR C 630  ? VAL C 595  THR C 599  
AD6 3 ALA C 640  ? TYR C 643  ? ALA C 609  TYR C 612  
AD6 4 GLY C 679  ? ILE C 682  ? GLY C 648  ILE C 651  
AD6 5 VAL C 673  ? THR C 676  ? VAL C 642  THR C 645  
AD7 1 GLU C 355  ? ARG C 359  ? GLU C 324  ARG C 328  
AD7 2 VAL C 570  ? PHE C 574  ? VAL C 539  PHE C 543  
AD7 3 LEU C 577  ? GLU C 585  ? LEU C 546  GLU C 554  
AD7 4 ILE C 615  ? THR C 619  ? ILE C 584  THR C 588  
AD7 5 THR C 604  ? ARG C 608  ? THR C 573  ARG C 577  
AD7 6 PHE C 596  ? ARG C 598  ? PHE C 565  ARG C 567  
AD8 1 ASN C 385  ? ILE C 389  ? ASN C 354  ILE C 358  
AD8 2 PHE C 423  ? ARG C 434  ? PHE C 392  ARG C 403  
AD8 3 PRO C 538  ? LEU C 548  ? PRO C 507  LEU C 517  
AD8 4 GLY C 462  ? ASN C 468  ? GLY C 431  ASN C 437  
AD8 5 THR C 407  ? TYR C 411  ? THR C 376  TYR C 380  
AD9 1 LEU C 483  ? ARG C 485  ? LEU C 452  ARG C 454  
AD9 2 LEU C 523  ? SER C 525  ? LEU C 492  SER C 494  
AE1 1 TYR C 504  ? GLN C 505  ? TYR C 473  GLN C 474  
AE1 2 CYS C 519  ? TYR C 520  ? CYS C 488  TYR C 489  
AE2 1 GLU C 685  ? HIS C 686  ? GLU C 654  HIS C 655  
AE2 2 SER C 722  ? THR C 727  ? SER C 691  THR C 696  
AE2 3 ILE C 701  ? GLN C 706  ? ILE C 670  GLN C 675  
AE2 4 ILE C 695  ? GLY C 698  ? ILE C 664  GLY C 667  
AE3 1 ILE C 743  ? PRO C 746  ? ILE C 712  PRO C 715  
AE3 2 GLU C 1103 ? ALA C 1109 ? GLU C 1072 ALA C 1078 
AE3 3 VAL C 1125 ? SER C 1128 ? VAL C 1094 SER C 1097 
AE3 4 TRP C 1133 ? GLN C 1137 ? TRP C 1102 GLN C 1106 
AE3 5 PHE C 1140 ? GLN C 1144 ? PHE C 1109 GLN C 1113 
AE4 1 PHE C 749  ? PRO C 759  ? PHE C 718  PRO C 728  
AE4 2 GLY C 1090 ? PRO C 1100 ? GLY C 1059 PRO C 1069 
AE4 3 TYR C 1078 ? ALA C 1087 ? TYR C 1047 ALA C 1056 
AE5 1 LYS C 764  ? VAL C 767  ? LYS C 733  VAL C 736  
AE5 2 LEU C 889  ? LEU C 892  ? LEU C 858  LEU C 861  
AE6 1 THR C 1151 ? VAL C 1153 ? THR C 1120 VAL C 1122 
AE6 2 ALA C 1118 ? PRO C 1121 ? ALA C 1087 PRO C 1090 
AE6 3 ILE C 1112 ? CYS C 1113 ? ILE C 1081 CYS C 1082 
AE6 4 VAL C 1164 ? ASN C 1165 ? VAL C 1133 ASN C 1134 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ALA A 58   ? N ALA A 27   O TRP A 95   ? O TRP A 64   
AA1 2 3 N THR A 94   ? N THR A 63   O VAL A 298  ? O VAL A 267  
AA1 3 4 O GLY A 299  ? O GLY A 268  N TYR A 122  ? N TYR A 91   
AA1 4 5 N GLU A 127  ? N GLU A 96   O ASN A 219  ? O ASN A 188  
AA1 5 6 N LEU A 220  ? N LEU A 189  O THR A 239  ? O THR A 208  
AA1 6 7 N PHE A 232  ? N PHE A 201  O LEU A 260  ? O LEU A 229  
AA2 1 2 N ASP A 84   ? N ASP A 53   O ARG A 304  ? O ARG A 273  
AA2 2 3 N LYS A 309  ? N LYS A 278  O ASP A 318  ? O ASP A 287  
AA3 1 2 N LEU A 115  ? N LEU A 84   O PHE A 269  ? O PHE A 238  
AA3 2 3 N ARG A 268  ? N ARG A 237  O GLY A 138  ? O GLY A 107  
AA3 3 4 N PHE A 137  ? N PHE A 106  O LEU A 148  ? O LEU A 117  
AA3 4 5 N SER A 147  ? N SER A 116  O CYS A 162  ? O CYS A 131  
AA3 5 6 N ILE A 159  ? N ILE A 128  O TYR A 201  ? O TYR A 170  
AA4 1 2 O VAL A 190  ? O VAL A 159  N CYS A 167  ? N CYS A 136  
AA4 2 3 N TYR A 176  ? N TYR A 145  O ARG A 277  ? O ARG A 246  
AA5 1 2 N GLY A 342  ? N GLY A 311  O THR A 630  ? O THR A 599  
AA5 2 3 N ILE A 629  ? N ILE A 598  O ALA A 640  ? O ALA A 609  
AA5 3 4 N TYR A 643  ? N TYR A 612  O CYS A 680  ? O CYS A 649  
AA5 4 5 O LEU A 681  ? O LEU A 650  N PHE A 674  ? N PHE A 643  
AA6 1 2 N GLU A 355  ? N GLU A 324  O ASN A 571  ? O ASN A 540  
AA6 2 3 N VAL A 570  ? N VAL A 539  O GLY A 581  ? O GLY A 550  
AA6 3 4 N THR A 584  ? N THR A 553  O ASP A 617  ? O ASP A 586  
AA6 4 5 O LEU A 616  ? O LEU A 585  N VAL A 607  ? N VAL A 576  
AA6 5 6 O ASP A 605  ? O ASP A 574  N GLY A 597  ? N GLY A 566  
AA7 1 2 N LYS A 387  ? N LYS A 356  O ALA A 428  ? O ALA A 397  
AA7 2 3 N PHE A 431  ? N PHE A 400  O VAL A 541  ? O VAL A 510  
AA7 3 4 O LEU A 544  ? O LEU A 513  N CYS A 463  ? N CYS A 432  
AA7 4 5 O GLY A 462  ? O GLY A 431  N TYR A 411  ? N TYR A 380  
AA8 1 2 N TYR A 484  ? N TYR A 453  O GLN A 524  ? O GLN A 493  
AA9 1 2 N TYR A 504  ? N TYR A 473  O TYR A 520  ? O TYR A 489  
AB1 1 2 N GLU A 685  ? N GLU A 654  O ALA A 725  ? O ALA A 694  
AB1 2 3 O TYR A 726  ? O TYR A 695  N CYS A 702  ? N CYS A 671  
AB1 3 4 O ALA A 703  ? O ALA A 672  N ILE A 695  ? N ILE A 664  
AB2 1 2 N ILE A 743  ? N ILE A 712  O PHE A 1106 ? O PHE A 1075 
AB2 2 3 N THR A 1107 ? N THR A 1076 O SER A 1128 ? O SER A 1097 
AB2 3 4 N VAL A 1127 ? N VAL A 1096 O PHE A 1134 ? O PHE A 1103 
AB2 4 5 N VAL A 1135 ? N VAL A 1104 O GLN A 1144 ? O GLN A 1113 
AB3 1 2 N THR A 754  ? N THR A 723  O HIS A 1095 ? O HIS A 1064 
AB3 2 3 O VAL A 1096 ? O VAL A 1065 N MET A 1081 ? N MET A 1050 
AB4 1 2 N SER A 766  ? N SER A 735  O THR A 890  ? O THR A 859  
AB5 1 2 O PHE A 1152 ? O PHE A 1121 N PHE A 1120 ? N PHE A 1089 
AB5 2 3 O HIS A 1119 ? O HIS A 1088 N ILE A 1112 ? N ILE A 1081 
AB5 3 4 N CYS A 1113 ? N CYS A 1082 O VAL A 1164 ? O VAL A 1133 
AB6 1 2 N ALA B 58   ? N ALA B 27   O TRP B 95   ? O TRP B 64   
AB6 2 3 N THR B 94   ? N THR B 63   O VAL B 298  ? O VAL B 267  
AB6 3 4 O GLY B 299  ? O GLY B 268  N TYR B 122  ? N TYR B 91   
AB6 4 5 N GLU B 127  ? N GLU B 96   O ASN B 219  ? O ASN B 188  
AB6 5 6 N LEU B 220  ? N LEU B 189  O THR B 239  ? O THR B 208  
AB6 6 7 N PHE B 232  ? N PHE B 201  O LEU B 260  ? O LEU B 229  
AB7 1 2 N ASP B 84   ? N ASP B 53   O ARG B 304  ? O ARG B 273  
AB7 2 3 N LYS B 309  ? N LYS B 278  O ASP B 318  ? O ASP B 287  
AB8 1 2 N LEU B 115  ? N LEU B 84   O PHE B 269  ? O PHE B 238  
AB8 2 3 N ARG B 268  ? N ARG B 237  O GLY B 138  ? O GLY B 107  
AB8 3 4 N PHE B 137  ? N PHE B 106  O LEU B 148  ? O LEU B 117  
AB8 4 5 N SER B 147  ? N SER B 116  O CYS B 162  ? O CYS B 131  
AB8 5 6 N ILE B 159  ? N ILE B 128  O TYR B 201  ? O TYR B 170  
AB9 1 2 O VAL B 190  ? O VAL B 159  N CYS B 167  ? N CYS B 136  
AB9 2 3 N TYR B 176  ? N TYR B 145  O ARG B 277  ? O ARG B 246  
AC1 1 2 N GLY B 342  ? N GLY B 311  O THR B 630  ? O THR B 599  
AC1 2 3 N ILE B 629  ? N ILE B 598  O ALA B 640  ? O ALA B 609  
AC1 3 4 N TYR B 643  ? N TYR B 612  O CYS B 680  ? O CYS B 649  
AC1 4 5 O LEU B 681  ? O LEU B 650  N PHE B 674  ? N PHE B 643  
AC2 1 2 N GLU B 355  ? N GLU B 324  O ASN B 571  ? O ASN B 540  
AC2 2 3 N VAL B 570  ? N VAL B 539  O GLY B 581  ? O GLY B 550  
AC2 3 4 N THR B 584  ? N THR B 553  O ASP B 617  ? O ASP B 586  
AC2 4 5 O LEU B 616  ? O LEU B 585  N VAL B 607  ? N VAL B 576  
AC2 5 6 O ASP B 605  ? O ASP B 574  N GLY B 597  ? N GLY B 566  
AC3 1 2 N LYS B 387  ? N LYS B 356  O ALA B 428  ? O ALA B 397  
AC3 2 3 N PHE B 431  ? N PHE B 400  O VAL B 541  ? O VAL B 510  
AC3 3 4 O LEU B 544  ? O LEU B 513  N CYS B 463  ? N CYS B 432  
AC3 4 5 O GLY B 462  ? O GLY B 431  N TYR B 411  ? N TYR B 380  
AC4 1 2 N TYR B 484  ? N TYR B 453  O GLN B 524  ? O GLN B 493  
AC5 1 2 N TYR B 504  ? N TYR B 473  O TYR B 520  ? O TYR B 489  
AC6 1 2 N GLU B 685  ? N GLU B 654  O ALA B 725  ? O ALA B 694  
AC6 2 3 O TYR B 726  ? O TYR B 695  N CYS B 702  ? N CYS B 671  
AC6 3 4 O ALA B 703  ? O ALA B 672  N ILE B 695  ? N ILE B 664  
AC7 1 2 N ILE B 743  ? N ILE B 712  O PHE B 1106 ? O PHE B 1075 
AC7 2 3 N THR B 1107 ? N THR B 1076 O SER B 1128 ? O SER B 1097 
AC7 3 4 N VAL B 1127 ? N VAL B 1096 O PHE B 1134 ? O PHE B 1103 
AC7 4 5 N VAL B 1135 ? N VAL B 1104 O GLN B 1144 ? O GLN B 1113 
AC8 1 2 N THR B 754  ? N THR B 723  O HIS B 1095 ? O HIS B 1064 
AC8 2 3 O VAL B 1096 ? O VAL B 1065 N MET B 1081 ? N MET B 1050 
AC9 1 2 N SER B 766  ? N SER B 735  O THR B 890  ? O THR B 859  
AD1 1 2 O PHE B 1152 ? O PHE B 1121 N PHE B 1120 ? N PHE B 1089 
AD1 2 3 O HIS B 1119 ? O HIS B 1088 N ILE B 1112 ? N ILE B 1081 
AD1 3 4 N CYS B 1113 ? N CYS B 1082 O VAL B 1164 ? O VAL B 1133 
AD2 1 2 N ALA C 58   ? N ALA C 27   O TRP C 95   ? O TRP C 64   
AD2 2 3 N THR C 94   ? N THR C 63   O VAL C 298  ? O VAL C 267  
AD2 3 4 O GLY C 299  ? O GLY C 268  N TYR C 122  ? N TYR C 91   
AD2 4 5 N GLU C 127  ? N GLU C 96   O ASN C 219  ? O ASN C 188  
AD2 5 6 N LEU C 220  ? N LEU C 189  O THR C 239  ? O THR C 208  
AD2 6 7 N ILE C 234  ? N ILE C 203  O VAL C 258  ? O VAL C 227  
AD3 1 2 N ASP C 84   ? N ASP C 53   O ARG C 304  ? O ARG C 273  
AD3 2 3 N LYS C 309  ? N LYS C 278  O ASP C 318  ? O ASP C 287  
AD4 1 2 N LEU C 115  ? N LEU C 84   O PHE C 269  ? O PHE C 238  
AD4 2 3 N ARG C 268  ? N ARG C 237  O GLY C 138  ? O GLY C 107  
AD4 3 4 N PHE C 137  ? N PHE C 106  O LEU C 148  ? O LEU C 117  
AD4 4 5 N SER C 147  ? N SER C 116  O CYS C 162  ? O CYS C 131  
AD4 5 6 N ILE C 159  ? N ILE C 128  O TYR C 201  ? O TYR C 170  
AD5 1 2 O VAL C 190  ? O VAL C 159  N CYS C 167  ? N CYS C 136  
AD5 2 3 N TYR C 176  ? N TYR C 145  O ARG C 277  ? O ARG C 246  
AD6 1 2 N GLY C 342  ? N GLY C 311  O THR C 630  ? O THR C 599  
AD6 2 3 N ILE C 629  ? N ILE C 598  O ALA C 640  ? O ALA C 609  
AD6 3 4 N TYR C 643  ? N TYR C 612  O CYS C 680  ? O CYS C 649  
AD6 4 5 O LEU C 681  ? O LEU C 650  N PHE C 674  ? N PHE C 643  
AD7 1 2 N GLU C 355  ? N GLU C 324  O ASN C 571  ? O ASN C 540  
AD7 2 3 N VAL C 570  ? N VAL C 539  O GLY C 581  ? O GLY C 550  
AD7 3 4 N THR C 584  ? N THR C 553  O ASP C 617  ? O ASP C 586  
AD7 4 5 O LEU C 616  ? O LEU C 585  N VAL C 607  ? N VAL C 576  
AD7 5 6 O ASP C 605  ? O ASP C 574  N GLY C 597  ? N GLY C 566  
AD8 1 2 N LYS C 387  ? N LYS C 356  O ALA C 428  ? O ALA C 397  
AD8 2 3 N PHE C 431  ? N PHE C 400  O VAL C 541  ? O VAL C 510  
AD8 3 4 O LEU C 544  ? O LEU C 513  N CYS C 463  ? N CYS C 432  
AD8 4 5 O GLY C 462  ? O GLY C 431  N TYR C 411  ? N TYR C 380  
AD9 1 2 N TYR C 484  ? N TYR C 453  O GLN C 524  ? O GLN C 493  
AE1 1 2 N TYR C 504  ? N TYR C 473  O TYR C 520  ? O TYR C 489  
AE2 1 2 N GLU C 685  ? N GLU C 654  O ALA C 725  ? O ALA C 694  
AE2 2 3 O TYR C 726  ? O TYR C 695  N CYS C 702  ? N CYS C 671  
AE2 3 4 O ALA C 703  ? O ALA C 672  N ILE C 695  ? N ILE C 664  
AE3 1 2 N ILE C 743  ? N ILE C 712  O PHE C 1106 ? O PHE C 1075 
AE3 2 3 N THR C 1107 ? N THR C 1076 O SER C 1128 ? O SER C 1097 
AE3 3 4 N VAL C 1127 ? N VAL C 1096 O PHE C 1134 ? O PHE C 1103 
AE3 4 5 N VAL C 1135 ? N VAL C 1104 O GLN C 1144 ? O GLN C 1113 
AE4 1 2 N THR C 754  ? N THR C 723  O HIS C 1095 ? O HIS C 1064 
AE4 2 3 O VAL C 1096 ? O VAL C 1065 N MET C 1081 ? N MET C 1050 
AE5 1 2 N SER C 766  ? N SER C 735  O THR C 890  ? O THR C 859  
AE6 1 2 O PHE C 1152 ? O PHE C 1121 N PHE C 1120 ? N PHE C 1089 
AE6 2 3 O HIS C 1119 ? O HIS C 1088 N ILE C 1112 ? N ILE C 1081 
AE6 3 4 N CYS C 1113 ? N CYS C 1082 O VAL C 1164 ? O VAL C 1133 
# 
_atom_sites.entry_id                    6ZGI 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . GLN A  1 45   ? 261.049 249.588 265.428 1.00 91.51  ? 14   GLN A N   1 
ATOM   2     C CA  . GLN A  1 45   ? 260.751 251.009 265.297 1.00 91.51  ? 14   GLN A CA  1 
ATOM   3     C C   . GLN A  1 45   ? 260.546 251.380 263.837 1.00 91.51  ? 14   GLN A C   1 
ATOM   4     O O   . GLN A  1 45   ? 261.119 250.754 262.952 1.00 91.51  ? 14   GLN A O   1 
ATOM   5     C CB  . GLN A  1 45   ? 261.874 251.850 265.903 1.00 91.51  ? 14   GLN A CB  1 
ATOM   6     C CG  . GLN A  1 45   ? 262.001 251.714 267.410 1.00 91.51  ? 14   GLN A CG  1 
ATOM   7     C CD  . GLN A  1 45   ? 263.168 252.502 267.968 1.00 91.51  ? 14   GLN A CD  1 
ATOM   8     O OE1 . GLN A  1 45   ? 264.139 252.777 267.263 1.00 91.51  ? 14   GLN A OE1 1 
ATOM   9     N NE2 . GLN A  1 45   ? 263.079 252.873 269.240 1.00 91.51  ? 14   GLN A NE2 1 
ATOM   10    N N   . CYS A  1 46   ? 259.723 252.393 263.585 1.00 91.07  ? 15   CYS A N   1 
ATOM   11    C CA  . CYS A  1 46   ? 259.374 252.799 262.233 1.00 91.07  ? 15   CYS A CA  1 
ATOM   12    C C   . CYS A  1 46   ? 259.977 254.165 261.936 1.00 91.07  ? 15   CYS A C   1 
ATOM   13    O O   . CYS A  1 46   ? 259.945 255.062 262.785 1.00 91.07  ? 15   CYS A O   1 
ATOM   14    C CB  . CYS A  1 46   ? 257.855 252.865 262.054 1.00 91.07  ? 15   CYS A CB  1 
ATOM   15    S SG  . CYS A  1 46   ? 256.917 251.374 262.504 1.00 91.07  ? 15   CYS A SG  1 
ATOM   16    N N   . VAL A  1 47   ? 260.536 254.319 260.736 1.00 86.46  ? 16   VAL A N   1 
ATOM   17    C CA  . VAL A  1 47   ? 261.165 255.564 260.309 1.00 86.46  ? 16   VAL A CA  1 
ATOM   18    C C   . VAL A  1 47   ? 260.556 255.993 258.980 1.00 86.46  ? 16   VAL A C   1 
ATOM   19    O O   . VAL A  1 47   ? 260.405 255.173 258.068 1.00 86.46  ? 16   VAL A O   1 
ATOM   20    C CB  . VAL A  1 47   ? 262.696 255.429 260.199 1.00 86.46  ? 16   VAL A CB  1 
ATOM   21    C CG1 . VAL A  1 47   ? 263.296 255.195 261.562 1.00 86.46  ? 16   VAL A CG1 1 
ATOM   22    C CG2 . VAL A  1 47   ? 263.063 254.289 259.296 1.00 86.46  ? 16   VAL A CG2 1 
ATOM   23    N N   . ASN A  1 48   ? 260.166 257.262 258.882 1.00 90.54  ? 17   ASN A N   1 
ATOM   24    C CA  . ASN A  1 48   ? 259.608 257.804 257.647 1.00 90.54  ? 17   ASN A CA  1 
ATOM   25    C C   . ASN A  1 48   ? 260.737 258.304 256.752 1.00 90.54  ? 17   ASN A C   1 
ATOM   26    O O   . ASN A  1 48   ? 261.426 259.269 257.094 1.00 90.54  ? 17   ASN A O   1 
ATOM   27    C CB  . ASN A  1 48   ? 258.615 258.927 257.939 1.00 90.54  ? 17   ASN A CB  1 
ATOM   28    C CG  . ASN A  1 48   ? 257.304 258.426 258.507 1.00 90.54  ? 17   ASN A CG  1 
ATOM   29    O OD1 . ASN A  1 48   ? 256.919 257.280 258.286 1.00 90.54  ? 17   ASN A OD1 1 
ATOM   30    N ND2 . ASN A  1 48   ? 256.600 259.291 259.229 1.00 90.54  ? 17   ASN A ND2 1 
ATOM   31    N N   . LEU A  1 49   ? 260.936 257.638 255.618 1.00 85.51  ? 18   LEU A N   1 
ATOM   32    C CA  . LEU A  1 49   ? 261.994 258.013 254.687 1.00 85.51  ? 18   LEU A CA  1 
ATOM   33    C C   . LEU A  1 49   ? 261.698 259.369 254.053 1.00 85.51  ? 18   LEU A C   1 
ATOM   34    O O   . LEU A  1 49   ? 260.574 259.626 253.612 1.00 85.51  ? 18   LEU A O   1 
ATOM   35    C CB  . LEU A  1 49   ? 262.155 256.949 253.606 1.00 85.51  ? 18   LEU A CB  1 
ATOM   36    C CG  . LEU A  1 49   ? 262.658 255.591 254.088 1.00 85.51  ? 18   LEU A CG  1 
ATOM   37    C CD1 . LEU A  1 49   ? 262.754 254.629 252.922 1.00 85.51  ? 18   LEU A CD1 1 
ATOM   38    C CD2 . LEU A  1 49   ? 263.998 255.731 254.781 1.00 85.51  ? 18   LEU A CD2 1 
ATOM   39    N N   . THR A  1 50   ? 262.703 260.238 254.010 1.00 90.86  ? 19   THR A N   1 
ATOM   40    C CA  . THR A  1 50   ? 262.609 261.530 253.349 1.00 90.86  ? 19   THR A CA  1 
ATOM   41    C C   . THR A  1 50   ? 263.527 261.565 252.124 1.00 90.86  ? 19   THR A C   1 
ATOM   42    O O   . THR A  1 50   ? 264.153 260.564 251.762 1.00 90.86  ? 19   THR A O   1 
ATOM   43    C CB  . THR A  1 50   ? 262.948 262.650 254.334 1.00 90.86  ? 19   THR A CB  1 
ATOM   44    O OG1 . THR A  1 50   ? 264.253 262.426 254.880 1.00 90.86  ? 19   THR A OG1 1 
ATOM   45    C CG2 . THR A  1 50   ? 261.930 262.692 255.459 1.00 90.86  ? 19   THR A CG2 1 
ATOM   46    N N   . THR A  1 51   ? 263.609 262.740 251.490 1.00 91.44  ? 20   THR A N   1 
ATOM   47    C CA  . THR A  1 51   ? 264.484 262.975 250.335 1.00 91.44  ? 20   THR A CA  1 
ATOM   48    C C   . THR A  1 51   ? 264.182 262.018 249.182 1.00 91.44  ? 20   THR A C   1 
ATOM   49    O O   . THR A  1 51   ? 265.062 261.318 248.679 1.00 91.44  ? 20   THR A O   1 
ATOM   50    C CB  . THR A  1 51   ? 265.961 262.893 250.731 1.00 91.44  ? 20   THR A CB  1 
ATOM   51    O OG1 . THR A  1 51   ? 266.279 261.559 251.142 1.00 91.44  ? 20   THR A OG1 1 
ATOM   52    C CG2 . THR A  1 51   ? 266.257 263.851 251.870 1.00 91.44  ? 20   THR A CG2 1 
ATOM   53    N N   . ARG A  1 52   ? 262.922 261.996 248.754 1.00 84.17  ? 21   ARG A N   1 
ATOM   54    C CA  . ARG A  1 52   ? 262.487 261.147 247.651 1.00 84.17  ? 21   ARG A CA  1 
ATOM   55    C C   . ARG A  1 52   ? 261.649 261.978 246.688 1.00 84.17  ? 21   ARG A C   1 
ATOM   56    O O   . ARG A  1 52   ? 260.569 262.455 247.051 1.00 84.17  ? 21   ARG A O   1 
ATOM   57    C CB  . ARG A  1 52   ? 261.710 259.939 248.185 1.00 84.17  ? 21   ARG A CB  1 
ATOM   58    C CG  . ARG A  1 52   ? 261.064 259.063 247.135 1.00 84.17  ? 21   ARG A CG  1 
ATOM   59    C CD  . ARG A  1 52   ? 260.557 257.770 247.755 1.00 84.17  ? 21   ARG A CD  1 
ATOM   60    N NE  . ARG A  1 52   ? 259.845 258.002 249.006 1.00 84.17  ? 21   ARG A NE  1 
ATOM   61    C CZ  . ARG A  1 52   ? 259.503 257.042 249.856 1.00 84.17  ? 21   ARG A CZ  1 
ATOM   62    N NH1 . ARG A  1 52   ? 259.810 255.783 249.594 1.00 84.17  ? 21   ARG A NH1 1 
ATOM   63    N NH2 . ARG A  1 52   ? 258.858 257.339 250.973 1.00 84.17  ? 21   ARG A NH2 1 
ATOM   64    N N   . THR A  1 53   ? 262.152 262.143 245.464 1.00 86.96  ? 22   THR A N   1 
ATOM   65    C CA  . THR A  1 53   ? 261.495 262.968 244.455 1.00 86.96  ? 22   THR A CA  1 
ATOM   66    C C   . THR A  1 53   ? 260.214 262.328 243.938 1.00 86.96  ? 22   THR A C   1 
ATOM   67    O O   . THR A  1 53   ? 260.165 261.128 243.656 1.00 86.96  ? 22   THR A O   1 
ATOM   68    C CB  . THR A  1 53   ? 262.441 263.223 243.283 1.00 86.96  ? 22   THR A CB  1 
ATOM   69    O OG1 . THR A  1 53   ? 263.752 263.516 243.779 1.00 86.96  ? 22   THR A OG1 1 
ATOM   70    C CG2 . THR A  1 53   ? 261.949 264.389 242.450 1.00 86.96  ? 22   THR A CG2 1 
ATOM   71    N N   . GLN A  1 54   ? 259.171 263.146 243.810 1.00 90.34  ? 23   GLN A N   1 
ATOM   72    C CA  . GLN A  1 54   ? 257.869 262.693 243.338 1.00 90.34  ? 23   GLN A CA  1 
ATOM   73    C C   . GLN A  1 54   ? 257.747 262.904 241.831 1.00 90.34  ? 23   GLN A C   1 
ATOM   74    O O   . GLN A  1 54   ? 258.050 263.986 241.318 1.00 90.34  ? 23   GLN A O   1 
ATOM   75    C CB  . GLN A  1 54   ? 256.750 263.416 244.092 1.00 90.34  ? 23   GLN A CB  1 
ATOM   76    C CG  . GLN A  1 54   ? 256.829 264.934 244.061 1.00 90.34  ? 23   GLN A CG  1 
ATOM   77    C CD  . GLN A  1 54   ? 256.042 265.540 242.921 1.00 90.34  ? 23   GLN A CD  1 
ATOM   78    O OE1 . GLN A  1 54   ? 255.067 264.957 242.448 1.00 90.34  ? 23   GLN A OE1 1 
ATOM   79    N NE2 . GLN A  1 54   ? 256.461 266.717 242.473 1.00 90.34  ? 23   GLN A NE2 1 
ATOM   80    N N   . LEU A  1 55   ? 257.322 261.857 241.129 1.00 87.30  ? 24   LEU A N   1 
ATOM   81    C CA  . LEU A  1 55   ? 257.192 261.819 239.682 1.00 87.30  ? 24   LEU A CA  1 
ATOM   82    C C   . LEU A  1 55   ? 255.827 261.272 239.292 1.00 87.30  ? 24   LEU A C   1 
ATOM   83    O O   . LEU A  1 55   ? 255.213 260.520 240.054 1.00 87.30  ? 24   LEU A O   1 
ATOM   84    C CB  . LEU A  1 55   ? 258.287 260.950 239.048 1.00 87.30  ? 24   LEU A CB  1 
ATOM   85    C CG  . LEU A  1 55   ? 259.729 261.434 239.187 1.00 87.30  ? 24   LEU A CG  1 
ATOM   86    C CD1 . LEU A  1 55   ? 260.688 260.393 238.636 1.00 87.30  ? 24   LEU A CD1 1 
ATOM   87    C CD2 . LEU A  1 55   ? 259.912 262.760 238.474 1.00 87.30  ? 24   LEU A CD2 1 
ATOM   88    N N   . PRO A  1 56   ? 255.319 261.651 238.117 1.00 85.06  ? 25   PRO A N   1 
ATOM   89    C CA  . PRO A  1 56   ? 254.038 261.109 237.670 1.00 85.06  ? 25   PRO A CA  1 
ATOM   90    C C   . PRO A  1 56   ? 254.140 259.619 237.401 1.00 85.06  ? 25   PRO A C   1 
ATOM   91    O O   . PRO A  1 56   ? 255.222 259.105 237.071 1.00 85.06  ? 25   PRO A O   1 
ATOM   92    C CB  . PRO A  1 56   ? 253.753 261.893 236.375 1.00 85.06  ? 25   PRO A CB  1 
ATOM   93    C CG  . PRO A  1 56   ? 255.074 262.475 235.975 1.00 85.06  ? 25   PRO A CG  1 
ATOM   94    C CD  . PRO A  1 56   ? 255.784 262.748 237.255 1.00 85.06  ? 25   PRO A CD  1 
ATOM   95    N N   . PRO A  1 57   ? 253.040 258.881 237.536 1.00 79.92  ? 26   PRO A N   1 
ATOM   96    C CA  . PRO A  1 57   ? 253.089 257.430 237.330 1.00 79.92  ? 26   PRO A CA  1 
ATOM   97    C C   . PRO A  1 57   ? 253.290 257.072 235.869 1.00 79.92  ? 26   PRO A C   1 
ATOM   98    O O   . PRO A  1 57   ? 252.933 257.830 234.964 1.00 79.92  ? 26   PRO A O   1 
ATOM   99    C CB  . PRO A  1 57   ? 251.720 256.958 237.825 1.00 79.92  ? 26   PRO A CB  1 
ATOM   100   C CG  . PRO A  1 57   ? 250.832 258.134 237.595 1.00 79.92  ? 26   PRO A CG  1 
ATOM   101   C CD  . PRO A  1 57   ? 251.681 259.345 237.866 1.00 79.92  ? 26   PRO A CD  1 
ATOM   102   N N   . ALA A  1 58   ? 253.873 255.898 235.644 1.00 67.20  ? 27   ALA A N   1 
ATOM   103   C CA  . ALA A  1 58   ? 254.186 255.430 234.305 1.00 67.20  ? 27   ALA A CA  1 
ATOM   104   C C   . ALA A  1 58   ? 253.389 254.170 233.998 1.00 67.20  ? 27   ALA A C   1 
ATOM   105   O O   . ALA A  1 58   ? 253.118 253.348 234.881 1.00 67.20  ? 27   ALA A O   1 
ATOM   106   C CB  . ALA A  1 58   ? 255.682 255.154 234.153 1.00 67.20  ? 27   ALA A CB  1 
ATOM   107   N N   . TYR A  1 59   ? 253.056 254.005 232.726 1.00 65.43  ? 28   TYR A N   1 
ATOM   108   C CA  . TYR A  1 59   ? 252.262 252.883 232.261 1.00 65.43  ? 28   TYR A CA  1 
ATOM   109   C C   . TYR A  1 59   ? 252.964 252.207 231.097 1.00 65.43  ? 28   TYR A C   1 
ATOM   110   O O   . TYR A  1 59   ? 253.770 252.816 230.393 1.00 65.43  ? 28   TYR A O   1 
ATOM   111   C CB  . TYR A  1 59   ? 250.864 253.343 231.855 1.00 65.43  ? 28   TYR A CB  1 
ATOM   112   C CG  . TYR A  1 59   ? 250.173 254.095 232.960 1.00 65.43  ? 28   TYR A CG  1 
ATOM   113   C CD1 . TYR A  1 59   ? 250.064 255.473 232.926 1.00 65.43  ? 28   TYR A CD1 1 
ATOM   114   C CD2 . TYR A  1 59   ? 249.618 253.423 234.033 1.00 65.43  ? 28   TYR A CD2 1 
ATOM   115   C CE1 . TYR A  1 59   ? 249.435 256.159 233.937 1.00 65.43  ? 28   TYR A CE1 1 
ATOM   116   C CE2 . TYR A  1 59   ? 248.989 254.099 235.043 1.00 65.43  ? 28   TYR A CE2 1 
ATOM   117   C CZ  . TYR A  1 59   ? 248.898 255.465 234.992 1.00 65.43  ? 28   TYR A CZ  1 
ATOM   118   O OH  . TYR A  1 59   ? 248.265 256.143 236.006 1.00 65.43  ? 28   TYR A OH  1 
ATOM   119   N N   . THR A  1 60   ? 252.648 250.932 230.905 1.00 55.46  ? 29   THR A N   1 
ATOM   120   C CA  . THR A  1 60   ? 253.193 250.181 229.783 1.00 55.46  ? 29   THR A CA  1 
ATOM   121   C C   . THR A  1 60   ? 252.165 249.141 229.362 1.00 55.46  ? 29   THR A C   1 
ATOM   122   O O   . THR A  1 60   ? 251.052 249.095 229.891 1.00 55.46  ? 29   THR A O   1 
ATOM   123   C CB  . THR A  1 60   ? 254.559 249.572 230.132 1.00 55.46  ? 29   THR A CB  1 
ATOM   124   O OG1 . THR A  1 60   ? 254.938 248.627 229.126 1.00 55.46  ? 29   THR A OG1 1 
ATOM   125   C CG2 . THR A  1 60   ? 254.540 248.903 231.483 1.00 55.46  ? 29   THR A CG2 1 
ATOM   126   N N   . ASN A  1 61   ? 252.547 248.284 228.427 1.00 54.29  ? 30   ASN A N   1 
ATOM   127   C CA  . ASN A  1 61   ? 251.626 247.356 227.793 1.00 54.29  ? 30   ASN A CA  1 
ATOM   128   C C   . ASN A  1 61   ? 252.077 245.932 228.069 1.00 54.29  ? 30   ASN A C   1 
ATOM   129   O O   . ASN A  1 61   ? 253.274 245.634 228.033 1.00 54.29  ? 30   ASN A O   1 
ATOM   130   C CB  . ASN A  1 61   ? 251.588 247.632 226.285 1.00 54.29  ? 30   ASN A CB  1 
ATOM   131   C CG  . ASN A  1 61   ? 250.554 246.817 225.560 1.00 54.29  ? 30   ASN A CG  1 
ATOM   132   O OD1 . ASN A  1 61   ? 249.379 247.169 225.533 1.00 54.29  ? 30   ASN A OD1 1 
ATOM   133   N ND2 . ASN A  1 61   ? 250.989 245.730 224.945 1.00 54.29  ? 30   ASN A ND2 1 
ATOM   134   N N   . SER A  1 62   ? 251.119 245.055 228.365 1.00 52.66  ? 31   SER A N   1 
ATOM   135   C CA  . SER A  1 62   ? 251.423 243.638 228.564 1.00 52.66  ? 31   SER A CA  1 
ATOM   136   C C   . SER A  1 62   ? 251.236 242.859 227.266 1.00 52.66  ? 31   SER A C   1 
ATOM   137   O O   . SER A  1 62   ? 250.125 242.792 226.736 1.00 52.66  ? 31   SER A O   1 
ATOM   138   C CB  . SER A  1 62   ? 250.552 243.050 229.669 1.00 52.66  ? 31   SER A CB  1 
ATOM   139   O OG  . SER A  1 62   ? 249.181 243.197 229.366 1.00 52.66  ? 31   SER A OG  1 
ATOM   140   N N   . PHE A  1 63   ? 252.308 242.242 226.771 1.00 54.30  ? 32   PHE A N   1 
ATOM   141   C CA  . PHE A  1 63   ? 252.270 241.546 225.485 1.00 54.30  ? 32   PHE A CA  1 
ATOM   142   C C   . PHE A  1 63   ? 252.033 240.056 225.716 1.00 54.30  ? 32   PHE A C   1 
ATOM   143   O O   . PHE A  1 63   ? 252.978 239.270 225.788 1.00 54.30  ? 32   PHE A O   1 
ATOM   144   C CB  . PHE A  1 63   ? 253.564 241.753 224.709 1.00 54.30  ? 32   PHE A CB  1 
ATOM   145   C CG  . PHE A  1 63   ? 253.904 243.183 224.451 1.00 54.30  ? 32   PHE A CG  1 
ATOM   146   C CD1 . PHE A  1 63   ? 253.432 243.829 223.324 1.00 54.30  ? 32   PHE A CD1 1 
ATOM   147   C CD2 . PHE A  1 63   ? 254.749 243.865 225.306 1.00 54.30  ? 32   PHE A CD2 1 
ATOM   148   C CE1 . PHE A  1 63   ? 253.757 245.146 223.079 1.00 54.30  ? 32   PHE A CE1 1 
ATOM   149   C CE2 . PHE A  1 63   ? 255.085 245.178 225.064 1.00 54.30  ? 32   PHE A CE2 1 
ATOM   150   C CZ  . PHE A  1 63   ? 254.586 245.822 223.948 1.00 54.30  ? 32   PHE A CZ  1 
ATOM   151   N N   . THR A  1 64   ? 250.765 239.661 225.814 1.00 49.75  ? 33   THR A N   1 
ATOM   152   C CA  . THR A  1 64   ? 250.382 238.264 226.050 1.00 49.75  ? 33   THR A CA  1 
ATOM   153   C C   . THR A  1 64   ? 251.090 237.649 227.261 1.00 49.75  ? 33   THR A C   1 
ATOM   154   O O   . THR A  1 64   ? 251.636 236.548 227.196 1.00 49.75  ? 33   THR A O   1 
ATOM   155   C CB  . THR A  1 64   ? 250.633 237.415 224.803 1.00 49.75  ? 33   THR A CB  1 
ATOM   156   O OG1 . THR A  1 64   ? 252.039 237.330 224.552 1.00 49.75  ? 33   THR A OG1 1 
ATOM   157   C CG2 . THR A  1 64   ? 249.968 238.045 223.601 1.00 49.75  ? 33   THR A CG2 1 
ATOM   158   N N   . ARG A  1 65   ? 251.074 238.363 228.378 1.00 47.85  ? 34   ARG A N   1 
ATOM   159   C CA  . ARG A  1 65   ? 251.667 237.890 229.620 1.00 47.85  ? 34   ARG A CA  1 
ATOM   160   C C   . ARG A  1 65   ? 250.597 237.384 230.588 1.00 47.85  ? 34   ARG A C   1 
ATOM   161   O O   . ARG A  1 65   ? 249.399 237.613 230.410 1.00 47.85  ? 34   ARG A O   1 
ATOM   162   C CB  . ARG A  1 65   ? 252.475 239.011 230.274 1.00 47.85  ? 34   ARG A CB  1 
ATOM   163   C CG  . ARG A  1 65   ? 253.794 239.343 229.613 1.00 47.85  ? 34   ARG A CG  1 
ATOM   164   C CD  . ARG A  1 65   ? 254.864 238.400 230.102 1.00 47.85  ? 34   ARG A CD  1 
ATOM   165   N NE  . ARG A  1 65   ? 256.112 238.537 229.367 1.00 47.85  ? 34   ARG A NE  1 
ATOM   166   C CZ  . ARG A  1 65   ? 257.136 237.699 229.478 1.00 47.85  ? 34   ARG A CZ  1 
ATOM   167   N NH1 . ARG A  1 65   ? 257.061 236.658 230.292 1.00 47.85  ? 34   ARG A NH1 1 
ATOM   168   N NH2 . ARG A  1 65   ? 258.236 237.900 228.773 1.00 47.85  ? 34   ARG A NH2 1 
ATOM   169   N N   . GLY A  1 66   ? 251.053 236.691 231.633 1.00 42.11  ? 35   GLY A N   1 
ATOM   170   C CA  . GLY A  1 66   ? 250.183 236.318 232.735 1.00 42.11  ? 35   GLY A CA  1 
ATOM   171   C C   . GLY A  1 66   ? 249.302 235.101 232.550 1.00 42.11  ? 35   GLY A C   1 
ATOM   172   O O   . GLY A  1 66   ? 248.197 235.063 233.097 1.00 42.11  ? 35   GLY A O   1 
ATOM   173   N N   . VAL A  1 67   ? 249.742 234.110 231.786 1.00 40.20  ? 36   VAL A N   1 
ATOM   174   C CA  . VAL A  1 67   ? 248.993 232.871 231.588 1.00 40.20  ? 36   VAL A CA  1 
ATOM   175   C C   . VAL A  1 67   ? 249.508 231.820 232.561 1.00 40.20  ? 36   VAL A C   1 
ATOM   176   O O   . VAL A  1 67   ? 250.718 231.705 232.778 1.00 40.20  ? 36   VAL A O   1 
ATOM   177   C CB  . VAL A  1 67   ? 249.093 232.385 230.129 1.00 40.20  ? 36   VAL A CB  1 
ATOM   178   C CG1 . VAL A  1 67   ? 248.608 230.958 230.000 1.00 40.20  ? 36   VAL A CG1 1 
ATOM   179   C CG2 . VAL A  1 67   ? 248.302 233.287 229.218 1.00 40.20  ? 36   VAL A CG2 1 
ATOM   180   N N   . TYR A  1 68   ? 248.593 231.080 233.188 1.00 35.66  ? 37   TYR A N   1 
ATOM   181   C CA  . TYR A  1 68   ? 248.955 230.027 234.125 1.00 35.66  ? 37   TYR A CA  1 
ATOM   182   C C   . TYR A  1 68   ? 248.163 228.762 233.816 1.00 35.66  ? 37   TYR A C   1 
ATOM   183   O O   . TYR A  1 68   ? 247.187 228.785 233.066 1.00 35.66  ? 37   TYR A O   1 
ATOM   184   C CB  . TYR A  1 68   ? 248.733 230.449 235.587 1.00 35.66  ? 37   TYR A CB  1 
ATOM   185   C CG  . TYR A  1 68   ? 247.327 230.873 235.940 1.00 35.66  ? 37   TYR A CG  1 
ATOM   186   C CD1 . TYR A  1 68   ? 246.888 232.157 235.691 1.00 35.66  ? 37   TYR A CD1 1 
ATOM   187   C CD2 . TYR A  1 68   ? 246.431 229.977 236.497 1.00 35.66  ? 37   TYR A CD2 1 
ATOM   188   C CE1 . TYR A  1 68   ? 245.613 232.544 236.009 1.00 35.66  ? 37   TYR A CE1 1 
ATOM   189   C CE2 . TYR A  1 68   ? 245.155 230.353 236.813 1.00 35.66  ? 37   TYR A CE2 1 
ATOM   190   C CZ  . TYR A  1 68   ? 244.750 231.636 236.564 1.00 35.66  ? 37   TYR A CZ  1 
ATOM   191   O OH  . TYR A  1 68   ? 243.471 232.013 236.881 1.00 35.66  ? 37   TYR A OH  1 
ATOM   192   N N   . TYR A  1 69   ? 248.620 227.648 234.374 1.00 38.37  ? 38   TYR A N   1 
ATOM   193   C CA  . TYR A  1 69   ? 247.927 226.372 234.206 1.00 38.37  ? 38   TYR A CA  1 
ATOM   194   C C   . TYR A  1 69   ? 246.633 226.380 235.007 1.00 38.37  ? 38   TYR A C   1 
ATOM   195   O O   . TYR A  1 69   ? 246.681 226.525 236.234 1.00 38.37  ? 38   TYR A O   1 
ATOM   196   C CB  . TYR A  1 69   ? 248.814 225.225 234.669 1.00 38.37  ? 38   TYR A CB  1 
ATOM   197   C CG  . TYR A  1 69   ? 249.927 224.882 233.715 1.00 38.37  ? 38   TYR A CG  1 
ATOM   198   C CD1 . TYR A  1 69   ? 249.815 223.821 232.833 1.00 38.37  ? 38   TYR A CD1 1 
ATOM   199   C CD2 . TYR A  1 69   ? 251.098 225.614 233.705 1.00 38.37  ? 38   TYR A CD2 1 
ATOM   200   C CE1 . TYR A  1 69   ? 250.837 223.509 231.965 1.00 38.37  ? 38   TYR A CE1 1 
ATOM   201   C CE2 . TYR A  1 69   ? 252.117 225.310 232.845 1.00 38.37  ? 38   TYR A CE2 1 
ATOM   202   C CZ  . TYR A  1 69   ? 251.984 224.261 231.978 1.00 38.37  ? 38   TYR A CZ  1 
ATOM   203   O OH  . TYR A  1 69   ? 253.012 223.970 231.120 1.00 38.37  ? 38   TYR A OH  1 
ATOM   204   N N   . PRO A  1 70   ? 245.470 226.192 234.380 1.00 41.03  ? 39   PRO A N   1 
ATOM   205   C CA  . PRO A  1 70   ? 244.222 226.261 235.156 1.00 41.03  ? 39   PRO A CA  1 
ATOM   206   C C   . PRO A  1 70   ? 244.008 225.092 236.101 1.00 41.03  ? 39   PRO A C   1 
ATOM   207   O O   . PRO A  1 70   ? 243.566 225.308 237.235 1.00 41.03  ? 39   PRO A O   1 
ATOM   208   C CB  . PRO A  1 70   ? 243.144 226.317 234.067 1.00 41.03  ? 39   PRO A CB  1 
ATOM   209   C CG  . PRO A  1 70   ? 243.773 225.720 232.879 1.00 41.03  ? 39   PRO A CG  1 
ATOM   210   C CD  . PRO A  1 70   ? 245.217 226.072 232.937 1.00 41.03  ? 39   PRO A CD  1 
ATOM   211   N N   . ASP A  1 71   ? 244.305 223.861 235.683 1.00 43.84  ? 40   ASP A N   1 
ATOM   212   C CA  . ASP A  1 71   ? 244.130 222.711 236.564 1.00 43.84  ? 40   ASP A CA  1 
ATOM   213   C C   . ASP A  1 71   ? 245.340 221.783 236.565 1.00 43.84  ? 40   ASP A C   1 
ATOM   214   O O   . ASP A  1 71   ? 246.387 222.122 236.010 1.00 43.84  ? 40   ASP A O   1 
ATOM   215   C CB  . ASP A  1 71   ? 242.844 221.964 236.204 1.00 43.84  ? 40   ASP A CB  1 
ATOM   216   C CG  . ASP A  1 71   ? 242.850 221.421 234.800 1.00 43.84  ? 40   ASP A CG  1 
ATOM   217   O OD1 . ASP A  1 71   ? 243.671 220.539 234.494 1.00 43.84  ? 40   ASP A OD1 1 
ATOM   218   O OD2 . ASP A  1 71   ? 242.011 221.869 233.996 1.00 43.84  ? 40   ASP A OD2 1 
ATOM   219   N N   . LYS A  1 72   ? 245.204 220.602 237.169 1.00 42.59  ? 41   LYS A N   1 
ATOM   220   C CA  . LYS A  1 72   ? 246.327 219.695 237.380 1.00 42.59  ? 41   LYS A CA  1 
ATOM   221   C C   . LYS A  1 72   ? 246.208 218.388 236.599 1.00 42.59  ? 41   LYS A C   1 
ATOM   222   O O   . LYS A  1 72   ? 246.695 217.349 237.046 1.00 42.59  ? 41   LYS A O   1 
ATOM   223   C CB  . LYS A  1 72   ? 246.476 219.410 238.870 1.00 42.59  ? 41   LYS A CB  1 
ATOM   224   C CG  . LYS A  1 72   ? 246.882 220.629 239.661 1.00 42.59  ? 41   LYS A CG  1 
ATOM   225   C CD  . LYS A  1 72   ? 247.130 220.302 241.107 1.00 42.59  ? 41   LYS A CD  1 
ATOM   226   C CE  . LYS A  1 72   ? 247.601 221.526 241.853 1.00 42.59  ? 41   LYS A CE  1 
ATOM   227   N NZ  . LYS A  1 72   ? 248.086 221.168 243.205 1.00 42.59  ? 41   LYS A NZ  1 
ATOM   228   N N   . VAL A  1 73   ? 245.566 218.426 235.439 1.00 42.10  ? 42   VAL A N   1 
ATOM   229   C CA  . VAL A  1 73   ? 245.419 217.269 234.565 1.00 42.10  ? 42   VAL A CA  1 
ATOM   230   C C   . VAL A  1 73   ? 246.411 217.406 233.416 1.00 42.10  ? 42   VAL A C   1 
ATOM   231   O O   . VAL A  1 73   ? 246.541 218.486 232.829 1.00 42.10  ? 42   VAL A O   1 
ATOM   232   C CB  . VAL A  1 73   ? 243.974 217.149 234.051 1.00 42.10  ? 42   VAL A CB  1 
ATOM   233   C CG1 . VAL A  1 73   ? 243.926 216.421 232.732 1.00 42.10  ? 42   VAL A CG1 1 
ATOM   234   C CG2 . VAL A  1 73   ? 243.115 216.445 235.072 1.00 42.10  ? 42   VAL A CG2 1 
ATOM   235   N N   . PHE A  1 74   ? 247.146 216.334 233.126 1.00 41.52  ? 43   PHE A N   1 
ATOM   236   C CA  . PHE A  1 74   ? 248.062 216.337 231.991 1.00 41.52  ? 43   PHE A CA  1 
ATOM   237   C C   . PHE A  1 74   ? 247.296 216.244 230.675 1.00 41.52  ? 43   PHE A C   1 
ATOM   238   O O   . PHE A  1 74   ? 246.428 215.385 230.510 1.00 41.52  ? 43   PHE A O   1 
ATOM   239   C CB  . PHE A  1 74   ? 249.042 215.173 232.111 1.00 41.52  ? 43   PHE A CB  1 
ATOM   240   C CG  . PHE A  1 74   ? 250.010 215.059 230.965 1.00 41.52  ? 43   PHE A CG  1 
ATOM   241   C CD1 . PHE A  1 74   ? 249.725 214.272 229.868 1.00 41.52  ? 43   PHE A CD1 1 
ATOM   242   C CD2 . PHE A  1 74   ? 251.227 215.708 231.007 1.00 41.52  ? 43   PHE A CD2 1 
ATOM   243   C CE1 . PHE A  1 74   ? 250.617 214.165 228.828 1.00 41.52  ? 43   PHE A CE1 1 
ATOM   244   C CE2 . PHE A  1 74   ? 252.118 215.599 229.970 1.00 41.52  ? 43   PHE A CE2 1 
ATOM   245   C CZ  . PHE A  1 74   ? 251.811 214.824 228.884 1.00 41.52  ? 43   PHE A CZ  1 
ATOM   246   N N   . ARG A  1 75   ? 247.616 217.135 229.740 1.00 43.67  ? 44   ARG A N   1 
ATOM   247   C CA  . ARG A  1 75   ? 247.065 217.120 228.392 1.00 43.67  ? 44   ARG A CA  1 
ATOM   248   C C   . ARG A  1 75   ? 248.199 217.331 227.402 1.00 43.67  ? 44   ARG A C   1 
ATOM   249   O O   . ARG A  1 75   ? 249.174 218.019 227.701 1.00 43.67  ? 44   ARG A O   1 
ATOM   250   C CB  . ARG A  1 75   ? 246.002 218.190 228.191 1.00 43.67  ? 44   ARG A CB  1 
ATOM   251   C CG  . ARG A  1 75   ? 244.883 218.140 229.189 1.00 43.67  ? 44   ARG A CG  1 
ATOM   252   C CD  . ARG A  1 75   ? 243.938 219.295 228.999 1.00 43.67  ? 44   ARG A CD  1 
ATOM   253   N NE  . ARG A  1 75   ? 243.118 219.504 230.184 1.00 43.67  ? 44   ARG A NE  1 
ATOM   254   C CZ  . ARG A  1 75   ? 241.963 218.889 230.407 1.00 43.67  ? 44   ARG A CZ  1 
ATOM   255   N NH1 . ARG A  1 75   ? 241.483 218.034 229.515 1.00 43.67  ? 44   ARG A NH1 1 
ATOM   256   N NH2 . ARG A  1 75   ? 241.282 219.140 231.514 1.00 43.67  ? 44   ARG A NH2 1 
ATOM   257   N N   . SER A  1 76   ? 248.072 216.744 226.217 1.00 44.16  ? 45   SER A N   1 
ATOM   258   C CA  . SER A  1 76   ? 249.099 216.911 225.201 1.00 44.16  ? 45   SER A CA  1 
ATOM   259   C C   . SER A  1 76   ? 248.484 216.987 223.813 1.00 44.16  ? 45   SER A C   1 
ATOM   260   O O   . SER A  1 76   ? 247.525 216.274 223.510 1.00 44.16  ? 45   SER A O   1 
ATOM   261   C CB  . SER A  1 76   ? 250.118 215.772 225.253 1.00 44.16  ? 45   SER A CB  1 
ATOM   262   O OG  . SER A  1 76   ? 249.611 214.606 224.636 1.00 44.16  ? 45   SER A OG  1 
ATOM   263   N N   . SER A  1 77   ? 249.058 217.852 222.974 1.00 46.40  ? 46   SER A N   1 
ATOM   264   C CA  . SER A  1 77   ? 248.687 217.993 221.565 1.00 46.40  ? 46   SER A CA  1 
ATOM   265   C C   . SER A  1 77   ? 247.201 218.308 221.392 1.00 46.40  ? 46   SER A C   1 
ATOM   266   O O   . SER A  1 77   ? 246.466 217.584 220.720 1.00 46.40  ? 46   SER A O   1 
ATOM   267   C CB  . SER A  1 77   ? 249.061 216.733 220.779 1.00 46.40  ? 46   SER A CB  1 
ATOM   268   O OG  . SER A  1 77   ? 250.459 216.526 220.769 1.00 46.40  ? 46   SER A OG  1 
ATOM   269   N N   . VAL A  1 78   ? 246.760 219.410 221.998 1.00 46.14  ? 47   VAL A N   1 
ATOM   270   C CA  . VAL A  1 78   ? 245.330 219.705 222.020 1.00 46.14  ? 47   VAL A CA  1 
ATOM   271   C C   . VAL A  1 78   ? 245.109 221.205 222.171 1.00 46.14  ? 47   VAL A C   1 
ATOM   272   O O   . VAL A  1 78   ? 245.908 221.911 222.787 1.00 46.14  ? 47   VAL A O   1 
ATOM   273   C CB  . VAL A  1 78   ? 244.627 218.908 223.145 1.00 46.14  ? 47   VAL A CB  1 
ATOM   274   C CG1 . VAL A  1 78   ? 244.998 219.452 224.503 1.00 46.14  ? 47   VAL A CG1 1 
ATOM   275   C CG2 . VAL A  1 78   ? 243.125 218.899 222.951 1.00 46.14  ? 47   VAL A CG2 1 
ATOM   276   N N   . LEU A  1 79   ? 244.023 221.698 221.579 1.00 44.77  ? 48   LEU A N   1 
ATOM   277   C CA  . LEU A  1 79   ? 243.513 223.037 221.847 1.00 44.77  ? 48   LEU A CA  1 
ATOM   278   C C   . LEU A  1 79   ? 242.370 222.933 222.848 1.00 44.77  ? 48   LEU A C   1 
ATOM   279   O O   . LEU A  1 79   ? 241.401 222.207 222.608 1.00 44.77  ? 48   LEU A O   1 
ATOM   280   C CB  . LEU A  1 79   ? 243.036 223.703 220.558 1.00 44.77  ? 48   LEU A CB  1 
ATOM   281   C CG  . LEU A  1 79   ? 244.065 223.888 219.445 1.00 44.77  ? 48   LEU A CG  1 
ATOM   282   C CD1 . LEU A  1 79   ? 243.493 224.742 218.345 1.00 44.77  ? 48   LEU A CD1 1 
ATOM   283   C CD2 . LEU A  1 79   ? 245.326 224.507 219.982 1.00 44.77  ? 48   LEU A CD2 1 
ATOM   284   N N   . HIS A  1 80   ? 242.480 223.657 223.961 1.00 43.15  ? 49   HIS A N   1 
ATOM   285   C CA  . HIS A  1 80   ? 241.537 223.541 225.066 1.00 43.15  ? 49   HIS A CA  1 
ATOM   286   C C   . HIS A  1 80   ? 241.014 224.916 225.464 1.00 43.15  ? 49   HIS A C   1 
ATOM   287   O O   . HIS A  1 80   ? 241.803 225.827 225.711 1.00 43.15  ? 49   HIS A O   1 
ATOM   288   C CB  . HIS A  1 80   ? 242.226 222.855 226.251 1.00 43.15  ? 49   HIS A CB  1 
ATOM   289   C CG  . HIS A  1 80   ? 241.302 222.478 227.364 1.00 43.15  ? 49   HIS A CG  1 
ATOM   290   N ND1 . HIS A  1 80   ? 241.395 223.027 228.624 1.00 43.15  ? 49   HIS A ND1 1 
ATOM   291   C CD2 . HIS A  1 80   ? 240.278 221.596 227.412 1.00 43.15  ? 49   HIS A CD2 1 
ATOM   292   C CE1 . HIS A  1 80   ? 240.461 222.505 229.397 1.00 43.15  ? 49   HIS A CE1 1 
ATOM   293   N NE2 . HIS A  1 80   ? 239.769 221.635 228.685 1.00 43.15  ? 49   HIS A NE2 1 
ATOM   294   N N   . SER A  1 81   ? 239.694 225.068 225.539 1.00 45.03  ? 50   SER A N   1 
ATOM   295   C CA  . SER A  1 81   ? 239.082 226.317 225.979 1.00 45.03  ? 50   SER A CA  1 
ATOM   296   C C   . SER A  1 81   ? 238.780 226.275 227.470 1.00 45.03  ? 50   SER A C   1 
ATOM   297   O O   . SER A  1 81   ? 238.300 225.264 227.986 1.00 45.03  ? 50   SER A O   1 
ATOM   298   C CB  . SER A  1 81   ? 237.790 226.597 225.214 1.00 45.03  ? 50   SER A CB  1 
ATOM   299   O OG  . SER A  1 81   ? 238.047 226.940 223.868 1.00 45.03  ? 50   SER A OG  1 
ATOM   300   N N   . THR A  1 82   ? 239.031 227.391 228.156 1.00 46.56  ? 51   THR A N   1 
ATOM   301   C CA  . THR A  1 82   ? 238.765 227.465 229.587 1.00 46.56  ? 51   THR A CA  1 
ATOM   302   C C   . THR A  1 82   ? 238.389 228.887 229.978 1.00 46.56  ? 51   THR A C   1 
ATOM   303   O O   . THR A  1 82   ? 238.946 229.854 229.457 1.00 46.56  ? 51   THR A O   1 
ATOM   304   C CB  . THR A  1 82   ? 239.965 226.991 230.414 1.00 46.56  ? 51   THR A CB  1 
ATOM   305   O OG1 . THR A  1 82   ? 239.685 227.163 231.807 1.00 46.56  ? 51   THR A OG1 1 
ATOM   306   C CG2 . THR A  1 82   ? 241.189 227.784 230.074 1.00 46.56  ? 51   THR A CG2 1 
ATOM   307   N N   . GLN A  1 83   ? 237.443 228.999 230.905 1.00 45.13  ? 52   GLN A N   1 
ATOM   308   C CA  . GLN A  1 83   ? 236.947 230.271 231.414 1.00 45.13  ? 52   GLN A CA  1 
ATOM   309   C C   . GLN A  1 83   ? 237.426 230.426 232.850 1.00 45.13  ? 52   GLN A C   1 
ATOM   310   O O   . GLN A  1 83   ? 237.130 229.576 233.694 1.00 45.13  ? 52   GLN A O   1 
ATOM   311   C CB  . GLN A  1 83   ? 235.420 230.304 231.327 1.00 45.13  ? 52   GLN A CB  1 
ATOM   312   C CG  . GLN A  1 83   ? 234.768 231.675 231.319 1.00 45.13  ? 52   GLN A CG  1 
ATOM   313   C CD  . GLN A  1 83   ? 234.305 232.113 232.687 1.00 45.13  ? 52   GLN A CD  1 
ATOM   314   O OE1 . GLN A  1 83   ? 233.890 231.295 233.502 1.00 45.13  ? 52   GLN A OE1 1 
ATOM   315   N NE2 . GLN A  1 83   ? 234.348 233.412 232.937 1.00 45.13  ? 52   GLN A NE2 1 
ATOM   316   N N   . ASP A  1 84   ? 238.166 231.497 233.127 1.00 43.30  ? 53   ASP A N   1 
ATOM   317   C CA  . ASP A  1 84   ? 238.758 231.688 234.449 1.00 43.30  ? 53   ASP A CA  1 
ATOM   318   C C   . ASP A  1 84   ? 239.244 233.129 234.552 1.00 43.30  ? 53   ASP A C   1 
ATOM   319   O O   . ASP A  1 84   ? 239.069 233.925 233.628 1.00 43.30  ? 53   ASP A O   1 
ATOM   320   C CB  . ASP A  1 84   ? 239.898 230.696 234.682 1.00 43.30  ? 53   ASP A CB  1 
ATOM   321   C CG  . ASP A  1 84   ? 240.054 230.314 236.138 1.00 43.30  ? 53   ASP A CG  1 
ATOM   322   O OD1 . ASP A  1 84   ? 239.863 231.184 237.010 1.00 43.30  ? 53   ASP A OD1 1 
ATOM   323   O OD2 . ASP A  1 84   ? 240.371 229.138 236.412 1.00 43.30  ? 53   ASP A OD2 1 
ATOM   324   N N   . LEU A  1 85   ? 239.865 233.463 235.682 1.00 38.88  ? 54   LEU A N   1 
ATOM   325   C CA  . LEU A  1 85   ? 240.369 234.814 235.916 1.00 38.88  ? 54   LEU A CA  1 
ATOM   326   C C   . LEU A  1 85   ? 241.755 234.956 235.300 1.00 38.88  ? 54   LEU A C   1 
ATOM   327   O O   . LEU A  1 85   ? 242.732 234.430 235.838 1.00 38.88  ? 54   LEU A O   1 
ATOM   328   C CB  . LEU A  1 85   ? 240.422 235.116 237.410 1.00 38.88  ? 54   LEU A CB  1 
ATOM   329   C CG  . LEU A  1 85   ? 239.241 235.805 238.095 1.00 38.88  ? 54   LEU A CG  1 
ATOM   330   C CD1 . LEU A  1 85   ? 237.942 235.106 237.785 1.00 38.88  ? 54   LEU A CD1 1 
ATOM   331   C CD2 . LEU A  1 85   ? 239.462 235.878 239.587 1.00 38.88  ? 54   LEU A CD2 1 
ATOM   332   N N   . PHE A  1 86   ? 241.853 235.701 234.199 1.00 37.38  ? 55   PHE A N   1 
ATOM   333   C CA  . PHE A  1 86   ? 243.116 235.901 233.510 1.00 37.38  ? 55   PHE A CA  1 
ATOM   334   C C   . PHE A  1 86   ? 243.406 237.389 233.370 1.00 37.38  ? 55   PHE A C   1 
ATOM   335   O O   . PHE A  1 86   ? 242.514 238.230 233.487 1.00 37.38  ? 55   PHE A O   1 
ATOM   336   C CB  . PHE A  1 86   ? 243.112 235.277 232.108 1.00 37.38  ? 55   PHE A CB  1 
ATOM   337   C CG  . PHE A  1 86   ? 242.974 233.785 232.092 1.00 37.38  ? 55   PHE A CG  1 
ATOM   338   C CD1 . PHE A  1 86   ? 244.080 232.973 232.214 1.00 37.38  ? 55   PHE A CD1 1 
ATOM   339   C CD2 . PHE A  1 86   ? 241.751 233.201 231.847 1.00 37.38  ? 55   PHE A CD2 1 
ATOM   340   C CE1 . PHE A  1 86   ? 243.953 231.609 232.177 1.00 37.38  ? 55   PHE A CE1 1 
ATOM   341   C CE2 . PHE A  1 86   ? 241.623 231.840 231.798 1.00 37.38  ? 55   PHE A CE2 1 
ATOM   342   C CZ  . PHE A  1 86   ? 242.726 231.043 231.963 1.00 37.38  ? 55   PHE A CZ  1 
ATOM   343   N N   . LEU A  1 87   ? 244.673 237.704 233.124 1.00 38.95  ? 56   LEU A N   1 
ATOM   344   C CA  . LEU A  1 87   ? 245.073 239.055 232.739 1.00 38.95  ? 56   LEU A CA  1 
ATOM   345   C C   . LEU A  1 87   ? 244.839 239.248 231.245 1.00 38.95  ? 56   LEU A C   1 
ATOM   346   O O   . LEU A  1 87   ? 245.432 238.521 230.440 1.00 38.95  ? 56   LEU A O   1 
ATOM   347   C CB  . LEU A  1 87   ? 246.531 239.306 233.090 1.00 38.95  ? 56   LEU A CB  1 
ATOM   348   C CG  . LEU A  1 87   ? 247.116 240.647 232.659 1.00 38.95  ? 56   LEU A CG  1 
ATOM   349   C CD1 . LEU A  1 87   ? 246.635 241.737 233.574 1.00 38.95  ? 56   LEU A CD1 1 
ATOM   350   C CD2 . LEU A  1 87   ? 248.619 240.596 232.672 1.00 38.95  ? 56   LEU A CD2 1 
ATOM   351   N N   . PRO A  1 88   ? 243.994 240.195 230.832 1.00 40.61  ? 57   PRO A N   1 
ATOM   352   C CA  . PRO A  1 88   ? 243.675 240.341 229.406 1.00 40.61  ? 57   PRO A CA  1 
ATOM   353   C C   . PRO A  1 88   ? 244.886 240.712 228.563 1.00 40.61  ? 57   PRO A C   1 
ATOM   354   O O   . PRO A  1 88   ? 245.808 241.387 229.022 1.00 40.61  ? 57   PRO A O   1 
ATOM   355   C CB  . PRO A  1 88   ? 242.636 241.465 229.396 1.00 40.61  ? 57   PRO A CB  1 
ATOM   356   C CG  . PRO A  1 88   ? 242.084 241.483 230.758 1.00 40.61  ? 57   PRO A CG  1 
ATOM   357   C CD  . PRO A  1 88   ? 243.199 241.108 231.664 1.00 40.61  ? 57   PRO A CD  1 
ATOM   358   N N   . PHE A  1 89   ? 244.872 240.260 227.308 1.00 44.79  ? 58   PHE A N   1 
ATOM   359   C CA  . PHE A  1 89   ? 245.987 240.518 226.405 1.00 44.79  ? 58   PHE A CA  1 
ATOM   360   C C   . PHE A  1 89   ? 246.053 241.982 226.008 1.00 44.79  ? 58   PHE A C   1 
ATOM   361   O O   . PHE A  1 89   ? 245.030 242.648 225.837 1.00 44.79  ? 58   PHE A O   1 
ATOM   362   C CB  . PHE A  1 89   ? 245.898 239.675 225.132 1.00 44.79  ? 58   PHE A CB  1 
ATOM   363   C CG  . PHE A  1 89   ? 246.265 238.232 225.313 1.00 44.79  ? 58   PHE A CG  1 
ATOM   364   C CD1 . PHE A  1 89   ? 246.047 237.326 224.295 1.00 44.79  ? 58   PHE A CD1 1 
ATOM   365   C CD2 . PHE A  1 89   ? 246.846 237.784 226.479 1.00 44.79  ? 58   PHE A CD2 1 
ATOM   366   C CE1 . PHE A  1 89   ? 246.391 236.012 224.443 1.00 44.79  ? 58   PHE A CE1 1 
ATOM   367   C CE2 . PHE A  1 89   ? 247.185 236.463 226.628 1.00 44.79  ? 58   PHE A CE2 1 
ATOM   368   C CZ  . PHE A  1 89   ? 246.958 235.579 225.609 1.00 44.79  ? 58   PHE A CZ  1 
ATOM   369   N N   . PHE A  1 90   ? 247.279 242.468 225.849 1.00 48.59  ? 59   PHE A N   1 
ATOM   370   C CA  . PHE A  1 90   ? 247.567 243.854 225.500 1.00 48.59  ? 59   PHE A CA  1 
ATOM   371   C C   . PHE A  1 90   ? 246.901 244.822 226.466 1.00 48.59  ? 59   PHE A C   1 
ATOM   372   O O   . PHE A  1 90   ? 246.214 245.764 226.068 1.00 48.59  ? 59   PHE A O   1 
ATOM   373   C CB  . PHE A  1 90   ? 247.171 244.153 224.054 1.00 48.59  ? 59   PHE A CB  1 
ATOM   374   C CG  . PHE A  1 90   ? 247.739 243.181 223.066 1.00 48.59  ? 59   PHE A CG  1 
ATOM   375   C CD1 . PHE A  1 90   ? 246.950 242.194 222.509 1.00 48.59  ? 59   PHE A CD1 1 
ATOM   376   C CD2 . PHE A  1 90   ? 249.071 243.244 222.713 1.00 48.59  ? 59   PHE A CD2 1 
ATOM   377   C CE1 . PHE A  1 90   ? 247.478 241.301 221.615 1.00 48.59  ? 59   PHE A CE1 1 
ATOM   378   C CE2 . PHE A  1 90   ? 249.600 242.354 221.822 1.00 48.59  ? 59   PHE A CE2 1 
ATOM   379   C CZ  . PHE A  1 90   ? 248.805 241.382 221.271 1.00 48.59  ? 59   PHE A CZ  1 
ATOM   380   N N   . SER A  1 91   ? 247.107 244.589 227.758 1.00 50.13  ? 60   SER A N   1 
ATOM   381   C CA  . SER A  1 91   ? 246.467 245.460 228.721 1.00 50.13  ? 60   SER A CA  1 
ATOM   382   C C   . SER A  1 91   ? 247.420 246.606 229.026 1.00 50.13  ? 60   SER A C   1 
ATOM   383   O O   . SER A  1 91   ? 248.541 246.665 228.508 1.00 50.13  ? 60   SER A O   1 
ATOM   384   C CB  . SER A  1 91   ? 246.083 244.696 229.986 1.00 50.13  ? 60   SER A CB  1 
ATOM   385   O OG  . SER A  1 91   ? 245.096 243.721 229.725 1.00 50.13  ? 60   SER A OG  1 
ATOM   386   N N   . ASN A  1 92   ? 247.057 247.396 230.023 1.00 60.60  ? 61   ASN A N   1 
ATOM   387   C CA  . ASN A  1 92   ? 247.779 248.598 230.412 1.00 60.60  ? 61   ASN A CA  1 
ATOM   388   C C   . ASN A  1 92   ? 248.181 248.437 231.872 1.00 60.60  ? 61   ASN A C   1 
ATOM   389   O O   . ASN A  1 92   ? 247.353 248.607 232.770 1.00 60.60  ? 61   ASN A O   1 
ATOM   390   C CB  . ASN A  1 92   ? 246.864 249.790 230.159 1.00 60.60  ? 61   ASN A CB  1 
ATOM   391   C CG  . ASN A  1 92   ? 247.481 251.119 230.494 1.00 60.60  ? 61   ASN A CG  1 
ATOM   392   O OD1 . ASN A  1 92   ? 248.648 251.224 230.857 1.00 60.60  ? 61   ASN A OD1 1 
ATOM   393   N ND2 . ASN A  1 92   ? 246.673 252.165 230.342 1.00 60.60  ? 61   ASN A ND2 1 
ATOM   394   N N   . VAL A  1 93   ? 249.447 248.115 232.105 1.00 51.22  ? 62   VAL A N   1 
ATOM   395   C CA  . VAL A  1 93   ? 249.935 247.803 233.442 1.00 51.22  ? 62   VAL A CA  1 
ATOM   396   C C   . VAL A  1 93   ? 250.636 249.030 233.994 1.00 51.22  ? 62   VAL A C   1 
ATOM   397   O O   . VAL A  1 93   ? 251.155 249.867 233.245 1.00 51.22  ? 62   VAL A O   1 
ATOM   398   C CB  . VAL A  1 93   ? 250.856 246.568 233.444 1.00 51.22  ? 62   VAL A CB  1 
ATOM   399   C CG1 . VAL A  1 93   ? 250.073 245.344 233.043 1.00 51.22  ? 62   VAL A CG1 1 
ATOM   400   C CG2 . VAL A  1 93   ? 252.014 246.770 232.529 1.00 51.22  ? 62   VAL A CG2 1 
ATOM   401   N N   . THR A  1 94   ? 250.681 249.126 235.320 1.00 50.14  ? 63   THR A N   1 
ATOM   402   C CA  . THR A  1 94   ? 251.407 250.210 235.963 1.00 50.14  ? 63   THR A CA  1 
ATOM   403   C C   . THR A  1 94   ? 252.841 249.806 236.268 1.00 50.14  ? 63   THR A C   1 
ATOM   404   O O   . THR A  1 94   ? 253.129 248.643 236.565 1.00 50.14  ? 63   THR A O   1 
ATOM   405   C CB  . THR A  1 94   ? 250.698 250.636 237.245 1.00 50.14  ? 63   THR A CB  1 
ATOM   406   O OG1 . THR A  1 94   ? 249.296 250.753 236.987 1.00 50.14  ? 63   THR A OG1 1 
ATOM   407   C CG2 . THR A  1 94   ? 251.196 251.987 237.707 1.00 50.14  ? 63   THR A CG2 1 
ATOM   408   N N   . TRP A  1 95   ? 253.734 250.795 236.228 1.00 51.88  ? 64   TRP A N   1 
ATOM   409   C CA  . TRP A  1 95   ? 255.173 250.589 236.251 1.00 51.88  ? 64   TRP A CA  1 
ATOM   410   C C   . TRP A  1 95   ? 255.768 251.362 237.419 1.00 51.88  ? 64   TRP A C   1 
ATOM   411   O O   . TRP A  1 95   ? 255.440 252.536 237.613 1.00 51.88  ? 64   TRP A O   1 
ATOM   412   C CB  . TRP A  1 95   ? 255.755 251.088 234.924 1.00 51.88  ? 64   TRP A CB  1 
ATOM   413   C CG  . TRP A  1 95   ? 257.229 250.979 234.713 1.00 51.88  ? 64   TRP A CG  1 
ATOM   414   C CD1 . TRP A  1 95   ? 258.160 250.510 235.584 1.00 51.88  ? 64   TRP A CD1 1 
ATOM   415   C CD2 . TRP A  1 95   ? 257.946 251.399 233.549 1.00 51.88  ? 64   TRP A CD2 1 
ATOM   416   N NE1 . TRP A  1 95   ? 259.412 250.582 235.024 1.00 51.88  ? 64   TRP A NE1 1 
ATOM   417   C CE2 . TRP A  1 95   ? 259.306 251.134 233.776 1.00 51.88  ? 64   TRP A CE2 1 
ATOM   418   C CE3 . TRP A  1 95   ? 257.565 251.970 232.332 1.00 51.88  ? 64   TRP A CE3 1 
ATOM   419   C CZ2 . TRP A  1 95   ? 260.287 251.413 232.833 1.00 51.88  ? 64   TRP A CZ2 1 
ATOM   420   C CZ3 . TRP A  1 95   ? 258.539 252.248 231.399 1.00 51.88  ? 64   TRP A CZ3 1 
ATOM   421   C CH2 . TRP A  1 95   ? 259.885 251.970 231.654 1.00 51.88  ? 64   TRP A CH2 1 
ATOM   422   N N   . PHE A  1 96   ? 256.653 250.719 238.187 1.00 47.40  ? 65   PHE A N   1 
ATOM   423   C CA  . PHE A  1 96   ? 257.249 251.343 239.360 1.00 47.40  ? 65   PHE A CA  1 
ATOM   424   C C   . PHE A  1 96   ? 258.743 251.071 239.363 1.00 47.40  ? 65   PHE A C   1 
ATOM   425   O O   . PHE A  1 96   ? 259.191 249.980 238.995 1.00 47.40  ? 65   PHE A O   1 
ATOM   426   C CB  . PHE A  1 96   ? 256.648 250.848 240.683 1.00 47.40  ? 65   PHE A CB  1 
ATOM   427   C CG  . PHE A  1 96   ? 255.159 250.994 240.781 1.00 47.40  ? 65   PHE A CG  1 
ATOM   428   C CD1 . PHE A  1 96   ? 254.604 252.111 241.371 1.00 47.40  ? 65   PHE A CD1 1 
ATOM   429   C CD2 . PHE A  1 96   ? 254.318 250.014 240.303 1.00 47.40  ? 65   PHE A CD2 1 
ATOM   430   C CE1 . PHE A  1 96   ? 253.243 252.247 241.469 1.00 47.40  ? 65   PHE A CE1 1 
ATOM   431   C CE2 . PHE A  1 96   ? 252.959 250.146 240.402 1.00 47.40  ? 65   PHE A CE2 1 
ATOM   432   C CZ  . PHE A  1 96   ? 252.421 251.264 240.984 1.00 47.40  ? 65   PHE A CZ  1 
ATOM   433   N N   . HIS A  1 97   ? 259.496 252.059 239.849 1.00 60.48  ? 66   HIS A N   1 
ATOM   434   C CA  . HIS A  1 97   ? 260.949 252.076 239.802 1.00 60.48  ? 66   HIS A CA  1 
ATOM   435   C C   . HIS A  1 97   ? 261.552 252.078 241.199 1.00 60.48  ? 66   HIS A C   1 
ATOM   436   O O   . HIS A  1 97   ? 260.916 252.478 242.176 1.00 60.48  ? 66   HIS A O   1 
ATOM   437   C CB  . HIS A  1 97   ? 261.468 253.333 239.092 1.00 60.48  ? 66   HIS A CB  1 
ATOM   438   C CG  . HIS A  1 97   ? 261.067 253.441 237.657 1.00 60.48  ? 66   HIS A CG  1 
ATOM   439   N ND1 . HIS A  1 97   ? 261.807 252.893 236.633 1.00 60.48  ? 66   HIS A ND1 1 
ATOM   440   C CD2 . HIS A  1 97   ? 260.023 254.074 237.072 1.00 60.48  ? 66   HIS A CD2 1 
ATOM   441   C CE1 . HIS A  1 97   ? 261.222 253.162 235.480 1.00 60.48  ? 66   HIS A CE1 1 
ATOM   442   N NE2 . HIS A  1 97   ? 260.137 253.877 235.719 1.00 60.48  ? 66   HIS A NE2 1 
ATOM   443   N N   . ALA A  1 98   ? 262.798 251.608 241.281 1.00 67.25  ? 67   ALA A N   1 
ATOM   444   C CA  . ALA A  1 98   ? 263.692 251.900 242.404 1.00 67.25  ? 67   ALA A CA  1 
ATOM   445   C C   . ALA A  1 98   ? 265.044 252.228 241.774 1.00 67.25  ? 67   ALA A C   1 
ATOM   446   O O   . ALA A  1 98   ? 265.850 251.323 241.520 1.00 67.25  ? 67   ALA A O   1 
ATOM   447   C CB  . ALA A  1 98   ? 263.783 250.744 243.385 1.00 67.25  ? 67   ALA A CB  1 
ATOM   448   N N   . ILE A  1 99   ? 265.244 253.507 241.450 1.00 78.78  ? 68   ILE A N   1 
ATOM   449   C CA  . ILE A  1 99   ? 266.408 253.986 240.707 1.00 78.78  ? 68   ILE A CA  1 
ATOM   450   C C   . ILE A  1 99   ? 266.998 255.191 241.433 1.00 78.78  ? 68   ILE A C   1 
ATOM   451   O O   . ILE A  1 99   ? 266.328 256.220 241.570 1.00 78.78  ? 68   ILE A O   1 
ATOM   452   C CB  . ILE A  1 99   ? 266.047 254.341 239.254 1.00 78.78  ? 68   ILE A CB  1 
ATOM   453   C CG1 . ILE A  1 99   ? 267.178 255.117 238.586 1.00 78.78  ? 68   ILE A CG1 1 
ATOM   454   C CG2 . ILE A  1 99   ? 264.743 255.125 239.187 1.00 78.78  ? 68   ILE A CG2 1 
ATOM   455   C CD1 . ILE A  1 99   ? 266.893 255.448 237.139 1.00 78.78  ? 68   ILE A CD1 1 
ATOM   456   N N   . HIS A  1 100  ? 268.243 255.073 241.898 1.00 83.39  ? 69   HIS A N   1 
ATOM   457   C CA  . HIS A  1 100  ? 268.848 256.177 242.643 1.00 83.39  ? 69   HIS A CA  1 
ATOM   458   C C   . HIS A  1 100  ? 269.197 257.348 241.730 1.00 83.39  ? 69   HIS A C   1 
ATOM   459   O O   . HIS A  1 100  ? 268.656 258.449 241.877 1.00 83.39  ? 69   HIS A O   1 
ATOM   460   C CB  . HIS A  1 100  ? 270.089 255.695 243.392 1.00 83.39  ? 69   HIS A CB  1 
ATOM   461   C CG  . HIS A  1 100  ? 270.943 256.807 243.917 1.00 83.39  ? 69   HIS A CG  1 
ATOM   462   N ND1 . HIS A  1 100  ? 270.538 257.634 244.942 1.00 83.39  ? 69   HIS A ND1 1 
ATOM   463   C CD2 . HIS A  1 100  ? 272.187 257.216 243.574 1.00 83.39  ? 69   HIS A CD2 1 
ATOM   464   C CE1 . HIS A  1 100  ? 271.489 258.513 245.200 1.00 83.39  ? 69   HIS A CE1 1 
ATOM   465   N NE2 . HIS A  1 100  ? 272.501 258.280 244.385 1.00 83.39  ? 69   HIS A NE2 1 
ATOM   466   N N   . VAL A  1 101  ? 270.098 257.122 240.775 1.00 85.44  ? 70   VAL A N   1 
ATOM   467   C CA  . VAL A  1 101  ? 270.688 258.184 239.949 1.00 85.44  ? 70   VAL A CA  1 
ATOM   468   C C   . VAL A  1 101  ? 271.148 259.373 240.789 1.00 85.44  ? 70   VAL A C   1 
ATOM   469   O O   . VAL A  1 101  ? 272.244 259.901 240.591 1.00 85.44  ? 70   VAL A O   1 
ATOM   470   C CB  . VAL A  1 101  ? 269.715 258.644 238.847 1.00 85.44  ? 70   VAL A CB  1 
ATOM   471   C CG1 . VAL A  1 101  ? 270.135 259.992 238.294 1.00 85.44  ? 70   VAL A CG1 1 
ATOM   472   C CG2 . VAL A  1 101  ? 269.678 257.623 237.732 1.00 85.44  ? 70   VAL A CG2 1 
ATOM   473   N N   . THR A  1 107  ? 267.210 261.282 242.029 1.00 84.08  ? 76   THR A N   1 
ATOM   474   C CA  . THR A  1 107  ? 265.756 261.279 242.106 1.00 84.08  ? 76   THR A CA  1 
ATOM   475   C C   . THR A  1 107  ? 265.268 260.361 243.235 1.00 84.08  ? 76   THR A C   1 
ATOM   476   O O   . THR A  1 107  ? 264.221 260.601 243.834 1.00 84.08  ? 76   THR A O   1 
ATOM   477   C CB  . THR A  1 107  ? 265.146 260.844 240.765 1.00 84.08  ? 76   THR A CB  1 
ATOM   478   O OG1 . THR A  1 107  ? 265.649 259.553 240.406 1.00 84.08  ? 76   THR A OG1 1 
ATOM   479   C CG2 . THR A  1 107  ? 265.523 261.829 239.678 1.00 84.08  ? 76   THR A CG2 1 
ATOM   480   N N   . LYS A  1 108  ? 266.032 259.296 243.475 1.00 83.28  ? 77   LYS A N   1 
ATOM   481   C CA  . LYS A  1 108  ? 265.783 258.252 244.467 1.00 83.28  ? 77   LYS A CA  1 
ATOM   482   C C   . LYS A  1 108  ? 264.607 257.366 244.061 1.00 83.28  ? 77   LYS A C   1 
ATOM   483   O O   . LYS A  1 108  ? 264.780 256.166 243.828 1.00 83.28  ? 77   LYS A O   1 
ATOM   484   C CB  . LYS A  1 108  ? 265.533 258.879 245.842 1.00 83.28  ? 77   LYS A CB  1 
ATOM   485   C CG  . LYS A  1 108  ? 266.598 259.882 246.274 1.00 83.28  ? 77   LYS A CG  1 
ATOM   486   C CD  . LYS A  1 108  ? 267.999 259.326 246.171 1.00 83.28  ? 77   LYS A CD  1 
ATOM   487   C CE  . LYS A  1 108  ? 268.228 258.237 247.197 1.00 83.28  ? 77   LYS A CE  1 
ATOM   488   N NZ  . LYS A  1 108  ? 268.003 258.764 248.571 1.00 83.28  ? 77   LYS A NZ  1 
ATOM   489   N N   . ARG A  1 109  ? 263.411 257.951 243.977 1.00 78.70  ? 78   ARG A N   1 
ATOM   490   C CA  . ARG A  1 109  ? 262.219 257.287 243.438 1.00 78.70  ? 78   ARG A CA  1 
ATOM   491   C C   . ARG A  1 109  ? 261.974 255.903 244.054 1.00 78.70  ? 78   ARG A C   1 
ATOM   492   O O   . ARG A  1 109  ? 261.636 254.945 243.358 1.00 78.70  ? 78   ARG A O   1 
ATOM   493   C CB  . ARG A  1 109  ? 262.300 257.212 241.914 1.00 78.70  ? 78   ARG A CB  1 
ATOM   494   C CG  . ARG A  1 109  ? 260.948 257.108 241.254 1.00 78.70  ? 78   ARG A CG  1 
ATOM   495   C CD  . ARG A  1 109  ? 260.035 258.201 241.768 1.00 78.70  ? 78   ARG A CD  1 
ATOM   496   N NE  . ARG A  1 109  ? 258.653 257.999 241.352 1.00 78.70  ? 78   ARG A NE  1 
ATOM   497   C CZ  . ARG A  1 109  ? 257.603 258.482 242.006 1.00 78.70  ? 78   ARG A CZ  1 
ATOM   498   N NH1 . ARG A  1 109  ? 257.781 259.189 243.115 1.00 78.70  ? 78   ARG A NH1 1 
ATOM   499   N NH2 . ARG A  1 109  ? 256.376 258.250 241.560 1.00 78.70  ? 78   ARG A NH2 1 
ATOM   500   N N   . PHE A  1 110  ? 262.149 255.787 245.369 1.00 70.46  ? 79   PHE A N   1 
ATOM   501   C CA  . PHE A  1 110  ? 261.884 254.540 246.097 1.00 70.46  ? 79   PHE A CA  1 
ATOM   502   C C   . PHE A  1 110  ? 260.384 254.262 246.229 1.00 70.46  ? 79   PHE A C   1 
ATOM   503   O O   . PHE A  1 110  ? 259.776 254.454 247.283 1.00 70.46  ? 79   PHE A O   1 
ATOM   504   C CB  . PHE A  1 110  ? 262.558 254.605 247.461 1.00 70.46  ? 79   PHE A CB  1 
ATOM   505   C CG  . PHE A  1 110  ? 262.789 253.270 248.090 1.00 70.46  ? 79   PHE A CG  1 
ATOM   506   C CD1 . PHE A  1 110  ? 263.827 252.463 247.664 1.00 70.46  ? 79   PHE A CD1 1 
ATOM   507   C CD2 . PHE A  1 110  ? 261.988 252.833 249.127 1.00 70.46  ? 79   PHE A CD2 1 
ATOM   508   C CE1 . PHE A  1 110  ? 264.046 251.237 248.244 1.00 70.46  ? 79   PHE A CE1 1 
ATOM   509   C CE2 . PHE A  1 110  ? 262.204 251.609 249.711 1.00 70.46  ? 79   PHE A CE2 1 
ATOM   510   C CZ  . PHE A  1 110  ? 263.232 250.809 249.267 1.00 70.46  ? 79   PHE A CZ  1 
ATOM   511   N N   . ASP A  1 111  ? 259.774 253.798 245.137 1.00 65.43  ? 80   ASP A N   1 
ATOM   512   C CA  . ASP A  1 111  ? 258.325 253.591 245.098 1.00 65.43  ? 80   ASP A CA  1 
ATOM   513   C C   . ASP A  1 111  ? 257.879 252.396 245.940 1.00 65.43  ? 80   ASP A C   1 
ATOM   514   O O   . ASP A  1 111  ? 258.393 251.287 245.778 1.00 65.43  ? 80   ASP A O   1 
ATOM   515   C CB  . ASP A  1 111  ? 257.851 253.401 243.660 1.00 65.43  ? 80   ASP A CB  1 
ATOM   516   C CG  . ASP A  1 111  ? 258.037 254.638 242.818 1.00 65.43  ? 80   ASP A CG  1 
ATOM   517   O OD1 . ASP A  1 111  ? 258.389 255.691 243.382 1.00 65.43  ? 80   ASP A OD1 1 
ATOM   518   O OD2 . ASP A  1 111  ? 257.823 254.563 241.593 1.00 65.43  ? 80   ASP A OD2 1 
ATOM   519   N N   . ASN A  1 112  ? 256.900 252.620 246.831 1.00 56.63  ? 81   ASN A N   1 
ATOM   520   C CA  . ASN A  1 112  ? 256.187 251.540 247.514 1.00 56.63  ? 81   ASN A CA  1 
ATOM   521   C C   . ASN A  1 112  ? 254.773 251.969 247.907 1.00 56.63  ? 81   ASN A C   1 
ATOM   522   O O   . ASN A  1 112  ? 254.441 251.980 249.098 1.00 56.63  ? 81   ASN A O   1 
ATOM   523   C CB  . ASN A  1 112  ? 256.955 251.058 248.749 1.00 56.63  ? 81   ASN A CB  1 
ATOM   524   C CG  . ASN A  1 112  ? 257.330 252.182 249.692 1.00 56.63  ? 81   ASN A CG  1 
ATOM   525   O OD1 . ASN A  1 112  ? 256.858 253.307 249.562 1.00 56.63  ? 81   ASN A OD1 1 
ATOM   526   N ND2 . ASN A  1 112  ? 258.172 251.872 250.666 1.00 56.63  ? 81   ASN A ND2 1 
ATOM   527   N N   . PRO A  1 113  ? 253.910 252.308 246.952 1.00 47.63  ? 82   PRO A N   1 
ATOM   528   C CA  . PRO A  1 113  ? 252.541 252.709 247.295 1.00 47.63  ? 82   PRO A CA  1 
ATOM   529   C C   . PRO A  1 113  ? 251.699 251.542 247.788 1.00 47.63  ? 82   PRO A C   1 
ATOM   530   O O   . PRO A  1 113  ? 251.995 250.373 247.540 1.00 47.63  ? 82   PRO A O   1 
ATOM   531   C CB  . PRO A  1 113  ? 251.990 253.246 245.970 1.00 47.63  ? 82   PRO A CB  1 
ATOM   532   C CG  . PRO A  1 113  ? 253.174 253.380 245.065 1.00 47.63  ? 82   PRO A CG  1 
ATOM   533   C CD  . PRO A  1 113  ? 254.119 252.327 245.498 1.00 47.63  ? 82   PRO A CD  1 
ATOM   534   N N   . VAL A  1 114  ? 250.631 251.882 248.506 1.00 39.97  ? 83   VAL A N   1 
ATOM   535   C CA  . VAL A  1 114  ? 249.577 250.920 248.816 1.00 39.97  ? 83   VAL A CA  1 
ATOM   536   C C   . VAL A  1 114  ? 248.637 250.831 247.621 1.00 39.97  ? 83   VAL A C   1 
ATOM   537   O O   . VAL A  1 114  ? 248.081 251.843 247.184 1.00 39.97  ? 83   VAL A O   1 
ATOM   538   C CB  . VAL A  1 114  ? 248.812 251.327 250.082 1.00 39.97  ? 83   VAL A CB  1 
ATOM   539   C CG1 . VAL A  1 114  ? 247.622 250.420 250.290 1.00 39.97  ? 83   VAL A CG1 1 
ATOM   540   C CG2 . VAL A  1 114  ? 249.716 251.297 251.281 1.00 39.97  ? 83   VAL A CG2 1 
ATOM   541   N N   . LEU A  1 115  ? 248.442 249.625 247.101 1.00 38.50  ? 84   LEU A N   1 
ATOM   542   C CA  . LEU A  1 115  ? 247.654 249.427 245.899 1.00 38.50  ? 84   LEU A CA  1 
ATOM   543   C C   . LEU A  1 115  ? 246.388 248.630 246.181 1.00 38.50  ? 84   LEU A C   1 
ATOM   544   O O   . LEU A  1 115  ? 246.319 247.875 247.157 1.00 38.50  ? 84   LEU A O   1 
ATOM   545   C CB  . LEU A  1 115  ? 248.500 248.705 244.844 1.00 38.50  ? 84   LEU A CB  1 
ATOM   546   C CG  . LEU A  1 115  ? 249.900 249.288 244.669 1.00 38.50  ? 84   LEU A CG  1 
ATOM   547   C CD1 . LEU A  1 115  ? 250.739 248.447 243.742 1.00 38.50  ? 84   LEU A CD1 1 
ATOM   548   C CD2 . LEU A  1 115  ? 249.775 250.688 244.120 1.00 38.50  ? 84   LEU A CD2 1 
ATOM   549   N N   . PRO A  1 116  ? 245.362 248.780 245.346 1.00 37.18  ? 85   PRO A N   1 
ATOM   550   C CA  . PRO A  1 116  ? 244.173 247.926 245.455 1.00 37.18  ? 85   PRO A CA  1 
ATOM   551   C C   . PRO A  1 116  ? 244.466 246.478 245.089 1.00 37.18  ? 85   PRO A C   1 
ATOM   552   O O   . PRO A  1 116  ? 245.431 246.160 244.397 1.00 37.18  ? 85   PRO A O   1 
ATOM   553   C CB  . PRO A  1 116  ? 243.186 248.553 244.466 1.00 37.18  ? 85   PRO A CB  1 
ATOM   554   C CG  . PRO A  1 116  ? 243.726 249.882 244.144 1.00 37.18  ? 85   PRO A CG  1 
ATOM   555   C CD  . PRO A  1 116  ? 245.192 249.833 244.335 1.00 37.18  ? 85   PRO A CD  1 
ATOM   556   N N   . PHE A  1 117  ? 243.608 245.589 245.587 1.00 36.52  ? 86   PHE A N   1 
ATOM   557   C CA  . PHE A  1 117  ? 243.642 244.162 245.262 1.00 36.52  ? 86   PHE A CA  1 
ATOM   558   C C   . PHE A  1 117  ? 242.231 243.798 244.815 1.00 36.52  ? 86   PHE A C   1 
ATOM   559   O O   . PHE A  1 117  ? 241.418 243.354 245.627 1.00 36.52  ? 86   PHE A O   1 
ATOM   560   C CB  . PHE A  1 117  ? 244.095 243.349 246.475 1.00 36.52  ? 86   PHE A CB  1 
ATOM   561   C CG  . PHE A  1 117  ? 244.317 241.890 246.200 1.00 36.52  ? 86   PHE A CG  1 
ATOM   562   C CD1 . PHE A  1 117  ? 245.597 241.397 246.051 1.00 36.52  ? 86   PHE A CD1 1 
ATOM   563   C CD2 . PHE A  1 117  ? 243.258 241.004 246.128 1.00 36.52  ? 86   PHE A CD2 1 
ATOM   564   C CE1 . PHE A  1 117  ? 245.809 240.068 245.811 1.00 36.52  ? 86   PHE A CE1 1 
ATOM   565   C CE2 . PHE A  1 117  ? 243.474 239.669 245.886 1.00 36.52  ? 86   PHE A CE2 1 
ATOM   566   C CZ  . PHE A  1 117  ? 244.745 239.205 245.735 1.00 36.52  ? 86   PHE A CZ  1 
ATOM   567   N N   . ASN A  1 118  ? 241.921 243.986 243.534 1.00 41.15  ? 87   ASN A N   1 
ATOM   568   C CA  . ASN A  1 118  ? 240.516 243.964 243.125 1.00 41.15  ? 87   ASN A CA  1 
ATOM   569   C C   . ASN A  1 118  ? 239.965 242.541 243.060 1.00 41.15  ? 87   ASN A C   1 
ATOM   570   O O   . ASN A  1 118  ? 239.102 242.164 243.857 1.00 41.15  ? 87   ASN A O   1 
ATOM   571   C CB  . ASN A  1 118  ? 240.352 244.676 241.779 1.00 41.15  ? 87   ASN A CB  1 
ATOM   572   C CG  . ASN A  1 118  ? 240.542 246.167 241.884 1.00 41.15  ? 87   ASN A CG  1 
ATOM   573   O OD1 . ASN A  1 118  ? 241.408 246.742 241.234 1.00 41.15  ? 87   ASN A OD1 1 
ATOM   574   N ND2 . ASN A  1 118  ? 239.720 246.807 242.695 1.00 41.15  ? 87   ASN A ND2 1 
ATOM   575   N N   . ASP A  1 119  ? 240.462 241.730 242.119 1.00 43.12  ? 88   ASP A N   1 
ATOM   576   C CA  . ASP A  1 119  ? 240.057 240.333 242.012 1.00 43.12  ? 88   ASP A CA  1 
ATOM   577   C C   . ASP A  1 119  ? 241.249 239.396 241.883 1.00 43.12  ? 88   ASP A C   1 
ATOM   578   O O   . ASP A  1 119  ? 241.082 238.247 241.474 1.00 43.12  ? 88   ASP A O   1 
ATOM   579   C CB  . ASP A  1 119  ? 239.122 240.125 240.822 1.00 43.12  ? 88   ASP A CB  1 
ATOM   580   C CG  . ASP A  1 119  ? 237.740 240.664 241.071 1.00 43.12  ? 88   ASP A CG  1 
ATOM   581   O OD1 . ASP A  1 119  ? 237.329 240.709 242.247 1.00 43.12  ? 88   ASP A OD1 1 
ATOM   582   O OD2 . ASP A  1 119  ? 237.061 241.037 240.090 1.00 43.12  ? 88   ASP A OD2 1 
ATOM   583   N N   . GLY A  1 120  ? 242.439 239.851 242.233 1.00 35.40  ? 89   GLY A N   1 
ATOM   584   C CA  . GLY A  1 120  ? 243.644 239.068 242.041 1.00 35.40  ? 89   GLY A CA  1 
ATOM   585   C C   . GLY A  1 120  ? 244.608 239.911 241.242 1.00 35.40  ? 89   GLY A C   1 
ATOM   586   O O   . GLY A  1 120  ? 244.213 240.790 240.475 1.00 35.40  ? 89   GLY A O   1 
ATOM   587   N N   . VAL A  1 121  ? 245.895 239.652 241.434 1.00 32.38  ? 90   VAL A N   1 
ATOM   588   C CA  . VAL A  1 121  ? 246.940 240.535 240.934 1.00 32.38  ? 90   VAL A CA  1 
ATOM   589   C C   . VAL A  1 121  ? 247.944 239.741 240.115 1.00 32.38  ? 90   VAL A C   1 
ATOM   590   O O   . VAL A  1 121  ? 248.334 238.635 240.501 1.00 32.38  ? 90   VAL A O   1 
ATOM   591   C CB  . VAL A  1 121  ? 247.638 241.275 242.094 1.00 32.38  ? 90   VAL A CB  1 
ATOM   592   C CG1 . VAL A  1 121  ? 248.897 241.953 241.624 1.00 32.38  ? 90   VAL A CG1 1 
ATOM   593   C CG2 . VAL A  1 121  ? 246.702 242.296 242.685 1.00 32.38  ? 90   VAL A CG2 1 
ATOM   594   N N   . TYR A  1 122  ? 248.335 240.289 238.967 1.00 35.68  ? 91   TYR A N   1 
ATOM   595   C CA  . TYR A  1 122  ? 249.524 239.849 238.249 1.00 35.68  ? 91   TYR A CA  1 
ATOM   596   C C   . TYR A  1 122  ? 250.666 240.780 238.623 1.00 35.68  ? 91   TYR A C   1 
ATOM   597   O O   . TYR A  1 122  ? 250.571 241.995 238.411 1.00 35.68  ? 91   TYR A O   1 
ATOM   598   C CB  . TYR A  1 122  ? 249.304 239.848 236.738 1.00 35.68  ? 91   TYR A CB  1 
ATOM   599   C CG  . TYR A  1 122  ? 250.577 239.627 235.958 1.00 35.68  ? 91   TYR A CG  1 
ATOM   600   C CD1 . TYR A  1 122  ? 251.055 238.353 235.704 1.00 35.68  ? 91   TYR A CD1 1 
ATOM   601   C CD2 . TYR A  1 122  ? 251.300 240.702 235.467 1.00 35.68  ? 91   TYR A CD2 1 
ATOM   602   C CE1 . TYR A  1 122  ? 252.220 238.161 235.003 1.00 35.68  ? 91   TYR A CE1 1 
ATOM   603   C CE2 . TYR A  1 122  ? 252.462 240.516 234.762 1.00 35.68  ? 91   TYR A CE2 1 
ATOM   604   C CZ  . TYR A  1 122  ? 252.916 239.246 234.533 1.00 35.68  ? 91   TYR A CZ  1 
ATOM   605   O OH  . TYR A  1 122  ? 254.073 239.066 233.825 1.00 35.68  ? 91   TYR A OH  1 
ATOM   606   N N   . PHE A  1 123  ? 251.738 240.216 239.171 1.00 35.47  ? 92   PHE A N   1 
ATOM   607   C CA  . PHE A  1 123  ? 252.886 240.983 239.634 1.00 35.47  ? 92   PHE A CA  1 
ATOM   608   C C   . PHE A  1 123  ? 254.132 240.499 238.911 1.00 35.47  ? 92   PHE A C   1 
ATOM   609   O O   . PHE A  1 123  ? 254.490 239.326 239.017 1.00 35.47  ? 92   PHE A O   1 
ATOM   610   C CB  . PHE A  1 123  ? 253.051 240.835 241.146 1.00 35.47  ? 92   PHE A CB  1 
ATOM   611   C CG  . PHE A  1 123  ? 254.159 241.657 241.725 1.00 35.47  ? 92   PHE A CG  1 
ATOM   612   C CD1 . PHE A  1 123  ? 255.448 241.177 241.774 1.00 35.47  ? 92   PHE A CD1 1 
ATOM   613   C CD2 . PHE A  1 123  ? 253.900 242.908 242.242 1.00 35.47  ? 92   PHE A CD2 1 
ATOM   614   C CE1 . PHE A  1 123  ? 256.457 241.934 242.316 1.00 35.47  ? 92   PHE A CE1 1 
ATOM   615   C CE2 . PHE A  1 123  ? 254.903 243.664 242.776 1.00 35.47  ? 92   PHE A CE2 1 
ATOM   616   C CZ  . PHE A  1 123  ? 256.185 243.177 242.813 1.00 35.47  ? 92   PHE A CZ  1 
ATOM   617   N N   . ALA A  1 124  ? 254.797 241.392 238.189 1.00 39.72  ? 93   ALA A N   1 
ATOM   618   C CA  . ALA A  1 124  ? 256.031 241.040 237.501 1.00 39.72  ? 93   ALA A CA  1 
ATOM   619   C C   . ALA A  1 124  ? 257.173 241.860 238.076 1.00 39.72  ? 93   ALA A C   1 
ATOM   620   O O   . ALA A  1 124  ? 256.986 243.015 238.457 1.00 39.72  ? 93   ALA A O   1 
ATOM   621   C CB  . ALA A  1 124  ? 255.924 241.269 235.996 1.00 39.72  ? 93   ALA A CB  1 
ATOM   622   N N   . SER A  1 125  ? 258.363 241.270 238.118 1.00 45.23  ? 94   SER A N   1 
ATOM   623   C CA  . SER A  1 125  ? 259.511 241.924 238.735 1.00 45.23  ? 94   SER A CA  1 
ATOM   624   C C   . SER A  1 125  ? 260.763 241.693 237.908 1.00 45.23  ? 94   SER A C   1 
ATOM   625   O O   . SER A  1 125  ? 261.151 240.545 237.681 1.00 45.23  ? 94   SER A O   1 
ATOM   626   C CB  . SER A  1 125  ? 259.730 241.408 240.157 1.00 45.23  ? 94   SER A CB  1 
ATOM   627   O OG  . SER A  1 125  ? 260.875 242.000 240.734 1.00 45.23  ? 94   SER A OG  1 
ATOM   628   N N   . THR A  1 126  ? 261.381 242.782 237.453 1.00 53.29  ? 95   THR A N   1 
ATOM   629   C CA  . THR A  1 126  ? 262.667 242.741 236.766 1.00 53.29  ? 95   THR A CA  1 
ATOM   630   C C   . THR A  1 126  ? 263.753 243.194 237.734 1.00 53.29  ? 95   THR A C   1 
ATOM   631   O O   . THR A  1 126  ? 263.742 244.347 238.201 1.00 53.29  ? 95   THR A O   1 
ATOM   632   C CB  . THR A  1 126  ? 262.670 243.612 235.511 1.00 53.29  ? 95   THR A CB  1 
ATOM   633   O OG1 . THR A  1 126  ? 262.321 244.956 235.858 1.00 53.29  ? 95   THR A OG1 1 
ATOM   634   C CG2 . THR A  1 126  ? 261.684 243.079 234.489 1.00 53.29  ? 95   THR A CG2 1 
ATOM   635   N N   . GLU A  1 127  ? 264.674 242.280 238.045 1.00 61.42  ? 96   GLU A N   1 
ATOM   636   C CA  . GLU A  1 127  ? 265.670 242.492 239.083 1.00 61.42  ? 96   GLU A CA  1 
ATOM   637   C C   . GLU A  1 127  ? 267.029 241.965 238.656 1.00 61.42  ? 96   GLU A C   1 
ATOM   638   O O   . GLU A  1 127  ? 267.153 241.129 237.758 1.00 61.42  ? 96   GLU A O   1 
ATOM   639   C CB  . GLU A  1 127  ? 265.302 241.784 240.387 1.00 61.42  ? 96   GLU A CB  1 
ATOM   640   C CG  . GLU A  1 127  ? 264.488 242.571 241.365 1.00 61.42  ? 96   GLU A CG  1 
ATOM   641   C CD  . GLU A  1 127  ? 264.244 241.774 242.618 1.00 61.42  ? 96   GLU A CD  1 
ATOM   642   O OE1 . GLU A  1 127  ? 264.466 240.548 242.586 1.00 61.42  ? 96   GLU A OE1 1 
ATOM   643   O OE2 . GLU A  1 127  ? 263.872 242.367 243.646 1.00 61.42  ? 96   GLU A OE2 1 
ATOM   644   N N   . LYS A  1 128  ? 268.051 242.472 239.344 1.00 70.02  ? 97   LYS A N   1 
ATOM   645   C CA  . LYS A  1 128  ? 269.394 241.914 239.324 1.00 70.02  ? 97   LYS A CA  1 
ATOM   646   C C   . LYS A  1 128  ? 270.038 241.838 240.701 1.00 70.02  ? 97   LYS A C   1 
ATOM   647   O O   . LYS A  1 128  ? 271.126 241.267 240.809 1.00 70.02  ? 97   LYS A O   1 
ATOM   648   C CB  . LYS A  1 128  ? 270.298 242.728 238.390 1.00 70.02  ? 97   LYS A CB  1 
ATOM   649   C CG  . LYS A  1 128  ? 270.447 244.186 238.786 1.00 70.02  ? 97   LYS A CG  1 
ATOM   650   C CD  . LYS A  1 128  ? 271.112 244.981 237.686 1.00 70.02  ? 97   LYS A CD  1 
ATOM   651   C CE  . LYS A  1 128  ? 271.130 246.465 237.995 1.00 70.02  ? 97   LYS A CE  1 
ATOM   652   N NZ  . LYS A  1 128  ? 272.078 246.804 239.081 1.00 70.02  ? 97   LYS A NZ  1 
ATOM   653   N N   . SER A  1 129  ? 269.409 242.378 241.759 1.00 68.79  ? 98   SER A N   1 
ATOM   654   C CA  . SER A  1 129  ? 270.050 242.464 243.067 1.00 68.79  ? 98   SER A CA  1 
ATOM   655   C C   . SER A  1 129  ? 269.111 242.147 244.230 1.00 68.79  ? 98   SER A C   1 
ATOM   656   O O   . SER A  1 129  ? 269.405 242.541 245.364 1.00 68.79  ? 98   SER A O   1 
ATOM   657   C CB  . SER A  1 129  ? 270.635 243.859 243.292 1.00 68.79  ? 98   SER A CB  1 
ATOM   658   O OG  . SER A  1 129  ? 271.645 244.150 242.351 1.00 68.79  ? 98   SER A OG  1 
ATOM   659   N N   . ASN A  1 130  ? 268.000 241.446 243.988 1.00 62.31  ? 99   ASN A N   1 
ATOM   660   C CA  . ASN A  1 130  ? 267.101 240.989 245.053 1.00 62.31  ? 99   ASN A CA  1 
ATOM   661   C C   . ASN A  1 130  ? 266.564 242.155 245.885 1.00 62.31  ? 99   ASN A C   1 
ATOM   662   O O   . ASN A  1 130  ? 266.605 242.136 247.115 1.00 62.31  ? 99   ASN A O   1 
ATOM   663   C CB  . ASN A  1 130  ? 267.799 239.964 245.951 1.00 62.31  ? 99   ASN A CB  1 
ATOM   664   C CG  . ASN A  1 130  ? 268.314 238.769 245.185 1.00 62.31  ? 99   ASN A CG  1 
ATOM   665   O OD1 . ASN A  1 130  ? 267.798 238.429 244.125 1.00 62.31  ? 99   ASN A OD1 1 
ATOM   666   N ND2 . ASN A  1 130  ? 269.342 238.128 245.718 1.00 62.31  ? 99   ASN A ND2 1 
ATOM   667   N N   . ILE A  1 131  ? 266.069 243.187 245.206 1.00 58.52  ? 100  ILE A N   1 
ATOM   668   C CA  . ILE A  1 131  ? 265.500 244.327 245.920 1.00 58.52  ? 100  ILE A CA  1 
ATOM   669   C C   . ILE A  1 131  ? 264.085 244.033 246.411 1.00 58.52  ? 100  ILE A C   1 
ATOM   670   O O   . ILE A  1 131  ? 263.764 244.269 247.580 1.00 58.52  ? 100  ILE A O   1 
ATOM   671   C CB  . ILE A  1 131  ? 265.549 245.583 245.033 1.00 58.52  ? 100  ILE A CB  1 
ATOM   672   C CG1 . ILE A  1 131  ? 266.991 245.867 244.637 1.00 58.52  ? 100  ILE A CG1 1 
ATOM   673   C CG2 . ILE A  1 131  ? 264.972 246.772 245.761 1.00 58.52  ? 100  ILE A CG2 1 
ATOM   674   C CD1 . ILE A  1 131  ? 267.883 246.141 245.806 1.00 58.52  ? 100  ILE A CD1 1 
ATOM   675   N N   . ILE A  1 132  ? 263.213 243.535 245.536 1.00 52.11  ? 101  ILE A N   1 
ATOM   676   C CA  . ILE A  1 132  ? 261.834 243.253 245.932 1.00 52.11  ? 101  ILE A CA  1 
ATOM   677   C C   . ILE A  1 132  ? 261.822 242.032 246.842 1.00 52.11  ? 101  ILE A C   1 
ATOM   678   O O   . ILE A  1 132  ? 262.240 240.941 246.440 1.00 52.11  ? 101  ILE A O   1 
ATOM   679   C CB  . ILE A  1 132  ? 260.930 243.040 244.712 1.00 52.11  ? 101  ILE A CB  1 
ATOM   680   C CG1 . ILE A  1 132  ? 260.745 244.340 243.926 1.00 52.11  ? 101  ILE A CG1 1 
ATOM   681   C CG2 . ILE A  1 132  ? 259.582 242.527 245.158 1.00 52.11  ? 101  ILE A CG2 1 
ATOM   682   C CD1 . ILE A  1 132  ? 261.741 244.562 242.830 1.00 52.11  ? 101  ILE A CD1 1 
ATOM   683   N N   . ARG A  1 133  ? 261.344 242.210 248.078 1.00 50.45  ? 102  ARG A N   1 
ATOM   684   C CA  . ARG A  1 133  ? 261.472 241.172 249.090 1.00 50.45  ? 102  ARG A CA  1 
ATOM   685   C C   . ARG A  1 133  ? 260.170 240.518 249.519 1.00 50.45  ? 102  ARG A C   1 
ATOM   686   O O   . ARG A  1 133  ? 260.214 239.393 250.017 1.00 50.45  ? 102  ARG A O   1 
ATOM   687   C CB  . ARG A  1 133  ? 262.145 241.730 250.346 1.00 50.45  ? 102  ARG A CB  1 
ATOM   688   C CG  . ARG A  1 133  ? 263.601 242.026 250.165 1.00 50.45  ? 102  ARG A CG  1 
ATOM   689   C CD  . ARG A  1 133  ? 264.436 240.778 250.159 1.00 50.45  ? 102  ARG A CD  1 
ATOM   690   N NE  . ARG A  1 133  ? 265.842 241.131 250.265 1.00 50.45  ? 102  ARG A NE  1 
ATOM   691   C CZ  . ARG A  1 133  ? 266.485 241.257 251.417 1.00 50.45  ? 102  ARG A CZ  1 
ATOM   692   N NH1 . ARG A  1 133  ? 265.849 241.046 252.555 1.00 50.45  ? 102  ARG A NH1 1 
ATOM   693   N NH2 . ARG A  1 133  ? 267.762 241.591 251.435 1.00 50.45  ? 102  ARG A NH2 1 
ATOM   694   N N   . GLY A  1 134  ? 259.022 241.163 249.355 1.00 40.57  ? 103  GLY A N   1 
ATOM   695   C CA  . GLY A  1 134  ? 257.795 240.454 249.677 1.00 40.57  ? 103  GLY A CA  1 
ATOM   696   C C   . GLY A  1 134  ? 256.583 241.357 249.610 1.00 40.57  ? 103  GLY A C   1 
ATOM   697   O O   . GLY A  1 134  ? 256.604 242.390 248.947 1.00 40.57  ? 103  GLY A O   1 
ATOM   698   N N   . TRP A  1 135  ? 255.531 240.957 250.322 1.00 36.76  ? 104  TRP A N   1 
ATOM   699   C CA  . TRP A  1 135  ? 254.290 241.714 250.283 1.00 36.76  ? 104  TRP A CA  1 
ATOM   700   C C   . TRP A  1 135  ? 253.570 241.613 251.617 1.00 36.76  ? 104  TRP A C   1 
ATOM   701   O O   . TRP A  1 135  ? 253.808 240.699 252.416 1.00 36.76  ? 104  TRP A O   1 
ATOM   702   C CB  . TRP A  1 135  ? 253.355 241.221 249.175 1.00 36.76  ? 104  TRP A CB  1 
ATOM   703   C CG  . TRP A  1 135  ? 254.002 241.076 247.842 1.00 36.76  ? 104  TRP A CG  1 
ATOM   704   C CD1 . TRP A  1 135  ? 254.086 242.013 246.864 1.00 36.76  ? 104  TRP A CD1 1 
ATOM   705   C CD2 . TRP A  1 135  ? 254.669 239.913 247.342 1.00 36.76  ? 104  TRP A CD2 1 
ATOM   706   N NE1 . TRP A  1 135  ? 254.763 241.509 245.786 1.00 36.76  ? 104  TRP A NE1 1 
ATOM   707   C CE2 . TRP A  1 135  ? 255.131 240.218 246.056 1.00 36.76  ? 104  TRP A CE2 1 
ATOM   708   C CE3 . TRP A  1 135  ? 254.919 238.641 247.862 1.00 36.76  ? 104  TRP A CE3 1 
ATOM   709   C CZ2 . TRP A  1 135  ? 255.824 239.306 245.284 1.00 36.76  ? 104  TRP A CZ2 1 
ATOM   710   C CZ3 . TRP A  1 135  ? 255.605 237.738 247.093 1.00 36.76  ? 104  TRP A CZ3 1 
ATOM   711   C CH2 . TRP A  1 135  ? 256.052 238.072 245.820 1.00 36.76  ? 104  TRP A CH2 1 
ATOM   712   N N   . ILE A  1 136  ? 252.676 242.575 251.841 1.00 36.38  ? 105  ILE A N   1 
ATOM   713   C CA  . ILE A  1 136  ? 251.686 242.519 252.910 1.00 36.38  ? 105  ILE A CA  1 
ATOM   714   C C   . ILE A  1 136  ? 250.302 242.724 252.307 1.00 36.38  ? 105  ILE A C   1 
ATOM   715   O O   . ILE A  1 136  ? 250.103 243.629 251.491 1.00 36.38  ? 105  ILE A O   1 
ATOM   716   C CB  . ILE A  1 136  ? 251.972 243.559 254.010 1.00 36.38  ? 105  ILE A CB  1 
ATOM   717   C CG1 . ILE A  1 136  ? 252.068 244.961 253.427 1.00 36.38  ? 105  ILE A CG1 1 
ATOM   718   C CG2 . ILE A  1 136  ? 253.263 243.232 254.716 1.00 36.38  ? 105  ILE A CG2 1 
ATOM   719   C CD1 . ILE A  1 136  ? 252.276 246.022 254.455 1.00 36.38  ? 105  ILE A CD1 1 
ATOM   720   N N   . PHE A  1 137  ? 249.357 241.870 252.691 1.00 34.21  ? 106  PHE A N   1 
ATOM   721   C CA  . PHE A  1 137  ? 247.986 241.909 252.199 1.00 34.21  ? 106  PHE A CA  1 
ATOM   722   C C   . PHE A  1 137  ? 247.018 242.100 253.359 1.00 34.21  ? 106  PHE A C   1 
ATOM   723   O O   . PHE A  1 137  ? 247.212 241.527 254.433 1.00 34.21  ? 106  PHE A O   1 
ATOM   724   C CB  . PHE A  1 137  ? 247.619 240.618 251.443 1.00 34.21  ? 106  PHE A CB  1 
ATOM   725   C CG  . PHE A  1 137  ? 248.606 240.220 250.385 1.00 34.21  ? 106  PHE A CG  1 
ATOM   726   C CD1 . PHE A  1 137  ? 249.729 239.487 250.705 1.00 34.21  ? 106  PHE A CD1 1 
ATOM   727   C CD2 . PHE A  1 137  ? 248.398 240.559 249.066 1.00 34.21  ? 106  PHE A CD2 1 
ATOM   728   C CE1 . PHE A  1 137  ? 250.628 239.123 249.738 1.00 34.21  ? 106  PHE A CE1 1 
ATOM   729   C CE2 . PHE A  1 137  ? 249.298 240.198 248.098 1.00 34.21  ? 106  PHE A CE2 1 
ATOM   730   C CZ  . PHE A  1 137  ? 250.411 239.474 248.436 1.00 34.21  ? 106  PHE A CZ  1 
ATOM   731   N N   . GLY A  1 138  ? 245.979 242.899 253.160 1.00 38.31  ? 107  GLY A N   1 
ATOM   732   C CA  . GLY A  1 138  ? 245.042 243.123 254.245 1.00 38.31  ? 107  GLY A CA  1 
ATOM   733   C C   . GLY A  1 138  ? 243.887 244.006 253.842 1.00 38.31  ? 107  GLY A C   1 
ATOM   734   O O   . GLY A  1 138  ? 243.625 244.198 252.657 1.00 38.31  ? 107  GLY A O   1 
ATOM   735   N N   . THR A  1 139  ? 243.181 244.531 254.843 1.00 47.10  ? 108  THR A N   1 
ATOM   736   C CA  . THR A  1 139  ? 242.138 245.528 254.631 1.00 47.10  ? 108  THR A CA  1 
ATOM   737   C C   . THR A  1 139  ? 242.497 246.896 255.199 1.00 47.10  ? 108  THR A C   1 
ATOM   738   O O   . THR A  1 139  ? 242.547 247.878 254.456 1.00 47.10  ? 108  THR A O   1 
ATOM   739   C CB  . THR A  1 139  ? 240.820 245.030 255.233 1.00 47.10  ? 108  THR A CB  1 
ATOM   740   O OG1 . THR A  1 139  ? 240.300 243.970 254.426 1.00 47.10  ? 108  THR A OG1 1 
ATOM   741   C CG2 . THR A  1 139  ? 239.805 246.143 255.270 1.00 47.10  ? 108  THR A CG2 1 
ATOM   742   N N   . THR A  1 140  ? 242.751 246.991 256.505 1.00 52.43  ? 109  THR A N   1 
ATOM   743   C CA  . THR A  1 140  ? 243.077 248.264 257.133 1.00 52.43  ? 109  THR A CA  1 
ATOM   744   C C   . THR A  1 140  ? 244.534 248.376 257.541 1.00 52.43  ? 109  THR A C   1 
ATOM   745   O O   . THR A  1 140  ? 245.041 249.495 257.647 1.00 52.43  ? 109  THR A O   1 
ATOM   746   C CB  . THR A  1 140  ? 242.211 248.496 258.380 1.00 52.43  ? 109  THR A CB  1 
ATOM   747   O OG1 . THR A  1 140  ? 242.470 247.469 259.343 1.00 52.43  ? 109  THR A OG1 1 
ATOM   748   C CG2 . THR A  1 140  ? 240.741 248.486 258.024 1.00 52.43  ? 109  THR A CG2 1 
ATOM   749   N N   . LEU A  1 141  ? 245.209 247.249 257.762 1.00 52.17  ? 110  LEU A N   1 
ATOM   750   C CA  . LEU A  1 141  ? 246.634 247.212 258.081 1.00 52.17  ? 110  LEU A CA  1 
ATOM   751   C C   . LEU A  1 141  ? 246.961 247.992 259.354 1.00 52.17  ? 110  LEU A C   1 
ATOM   752   O O   . LEU A  1 141  ? 247.998 248.650 259.440 1.00 52.17  ? 110  LEU A O   1 
ATOM   753   C CB  . LEU A  1 141  ? 247.457 247.738 256.900 1.00 52.17  ? 110  LEU A CB  1 
ATOM   754   C CG  . LEU A  1 141  ? 247.148 247.175 255.505 1.00 52.17  ? 110  LEU A CG  1 
ATOM   755   C CD1 . LEU A  1 141  ? 247.714 248.072 254.426 1.00 52.17  ? 110  LEU A CD1 1 
ATOM   756   C CD2 . LEU A  1 141  ? 247.689 245.774 255.332 1.00 52.17  ? 110  LEU A CD2 1 
ATOM   757   N N   . ASP A  1 142  ? 246.073 247.930 260.358 1.00 57.03  ? 111  ASP A N   1 
ATOM   758   C CA  . ASP A  1 142  ? 246.285 248.743 261.554 1.00 57.03  ? 111  ASP A CA  1 
ATOM   759   C C   . ASP A  1 142  ? 245.900 248.026 262.847 1.00 57.03  ? 111  ASP A C   1 
ATOM   760   O O   . ASP A  1 142  ? 245.450 248.673 263.798 1.00 57.03  ? 111  ASP A O   1 
ATOM   761   C CB  . ASP A  1 142  ? 245.527 250.071 261.473 1.00 57.03  ? 111  ASP A CB  1 
ATOM   762   C CG  . ASP A  1 142  ? 244.024 249.892 261.410 1.00 57.03  ? 111  ASP A CG  1 
ATOM   763   O OD1 . ASP A  1 142  ? 243.546 248.741 261.365 1.00 57.03  ? 111  ASP A OD1 1 
ATOM   764   O OD2 . ASP A  1 142  ? 243.314 250.916 261.423 1.00 57.03  ? 111  ASP A OD2 1 
ATOM   765   N N   . SER A  1 143  ? 246.050 246.705 262.907 1.00 55.27  ? 112  SER A N   1 
ATOM   766   C CA  . SER A  1 143  ? 245.856 245.886 264.107 1.00 55.27  ? 112  SER A CA  1 
ATOM   767   C C   . SER A  1 143  ? 244.406 245.792 264.552 1.00 55.27  ? 112  SER A C   1 
ATOM   768   O O   . SER A  1 143  ? 244.129 245.123 265.549 1.00 55.27  ? 112  SER A O   1 
ATOM   769   C CB  . SER A  1 143  ? 246.682 246.373 265.305 1.00 55.27  ? 112  SER A CB  1 
ATOM   770   O OG  . SER A  1 143  ? 246.143 247.567 265.836 1.00 55.27  ? 112  SER A OG  1 
ATOM   771   N N   . LYS A  1 144  ? 243.472 246.445 263.863 1.00 57.65  ? 113  LYS A N   1 
ATOM   772   C CA  . LYS A  1 144  ? 242.060 246.205 264.125 1.00 57.65  ? 113  LYS A CA  1 
ATOM   773   C C   . LYS A  1 144  ? 241.551 244.999 263.356 1.00 57.65  ? 113  LYS A C   1 
ATOM   774   O O   . LYS A  1 144  ? 240.573 244.372 263.770 1.00 57.65  ? 113  LYS A O   1 
ATOM   775   C CB  . LYS A  1 144  ? 241.232 247.434 263.755 1.00 57.65  ? 113  LYS A CB  1 
ATOM   776   C CG  . LYS A  1 144  ? 241.476 248.651 264.617 1.00 57.65  ? 113  LYS A CG  1 
ATOM   777   C CD  . LYS A  1 144  ? 240.624 249.813 264.142 1.00 57.65  ? 113  LYS A CD  1 
ATOM   778   C CE  . LYS A  1 144  ? 240.833 251.044 265.000 1.00 57.65  ? 113  LYS A CE  1 
ATOM   779   N NZ  . LYS A  1 144  ? 240.015 252.189 264.517 1.00 57.65  ? 113  LYS A NZ  1 
ATOM   780   N N   . THR A  1 145  ? 242.189 244.674 262.239 1.00 53.28  ? 114  THR A N   1 
ATOM   781   C CA  . THR A  1 145  ? 241.863 243.520 261.421 1.00 53.28  ? 114  THR A CA  1 
ATOM   782   C C   . THR A  1 145  ? 243.102 242.645 261.270 1.00 53.28  ? 114  THR A C   1 
ATOM   783   O O   . THR A  1 145  ? 244.186 242.976 261.751 1.00 53.28  ? 114  THR A O   1 
ATOM   784   C CB  . THR A  1 145  ? 241.331 243.953 260.055 1.00 53.28  ? 114  THR A CB  1 
ATOM   785   O OG1 . THR A  1 145  ? 242.295 244.795 259.417 1.00 53.28  ? 114  THR A OG1 1 
ATOM   786   C CG2 . THR A  1 145  ? 240.032 244.714 260.209 1.00 53.28  ? 114  THR A CG2 1 
ATOM   787   N N   . GLN A  1 146  ? 242.928 241.514 260.595 1.00 48.57  ? 115  GLN A N   1 
ATOM   788   C CA  . GLN A  1 146  ? 243.991 240.541 260.392 1.00 48.57  ? 115  GLN A CA  1 
ATOM   789   C C   . GLN A  1 146  ? 244.654 240.743 259.035 1.00 48.57  ? 115  GLN A C   1 
ATOM   790   O O   . GLN A  1 146  ? 243.988 241.082 258.054 1.00 48.57  ? 115  GLN A O   1 
ATOM   791   C CB  . GLN A  1 146  ? 243.433 239.126 260.503 1.00 48.57  ? 115  GLN A CB  1 
ATOM   792   C CG  . GLN A  1 146  ? 243.293 238.652 261.931 1.00 48.57  ? 115  GLN A CG  1 
ATOM   793   C CD  . GLN A  1 146  ? 243.251 237.159 262.036 1.00 48.57  ? 115  GLN A CD  1 
ATOM   794   O OE1 . GLN A  1 146  ? 242.348 236.515 261.507 1.00 48.57  ? 115  GLN A OE1 1 
ATOM   795   N NE2 . GLN A  1 146  ? 244.222 236.589 262.734 1.00 48.57  ? 115  GLN A NE2 1 
ATOM   796   N N   . SER A  1 147  ? 245.968 240.540 258.988 1.00 44.44  ? 116  SER A N   1 
ATOM   797   C CA  . SER A  1 147  ? 246.758 240.750 257.786 1.00 44.44  ? 116  SER A CA  1 
ATOM   798   C C   . SER A  1 147  ? 247.692 239.573 257.550 1.00 44.44  ? 116  SER A C   1 
ATOM   799   O O   . SER A  1 147  ? 248.041 238.825 258.474 1.00 44.44  ? 116  SER A O   1 
ATOM   800   C CB  . SER A  1 147  ? 247.568 242.043 257.872 1.00 44.44  ? 116  SER A CB  1 
ATOM   801   O OG  . SER A  1 147  ? 246.713 243.169 257.865 1.00 44.44  ? 116  SER A OG  1 
ATOM   802   N N   . LEU A  1 148  ? 248.109 239.445 256.290 1.00 35.12  ? 117  LEU A N   1 
ATOM   803   C CA  . LEU A  1 148  ? 249.003 238.394 255.826 1.00 35.12  ? 117  LEU A CA  1 
ATOM   804   C C   . LEU A  1 148  ? 250.337 239.003 255.418 1.00 35.12  ? 117  LEU A C   1 
ATOM   805   O O   . LEU A  1 148  ? 250.377 239.947 254.626 1.00 35.12  ? 117  LEU A O   1 
ATOM   806   C CB  . LEU A  1 148  ? 248.386 237.651 254.638 1.00 35.12  ? 117  LEU A CB  1 
ATOM   807   C CG  . LEU A  1 148  ? 249.244 236.680 253.824 1.00 35.12  ? 117  LEU A CG  1 
ATOM   808   C CD1 . LEU A  1 148  ? 249.678 235.482 254.636 1.00 35.12  ? 117  LEU A CD1 1 
ATOM   809   C CD2 . LEU A  1 148  ? 248.511 236.233 252.586 1.00 35.12  ? 117  LEU A CD2 1 
ATOM   810   N N   . LEU A  1 149  ? 251.418 238.454 255.958 1.00 36.22  ? 118  LEU A N   1 
ATOM   811   C CA  . LEU A  1 149  ? 252.784 238.857 255.662 1.00 36.22  ? 118  LEU A CA  1 
ATOM   812   C C   . LEU A  1 149  ? 253.492 237.723 254.938 1.00 36.22  ? 118  LEU A C   1 
ATOM   813   O O   . LEU A  1 149  ? 253.527 236.598 255.449 1.00 36.22  ? 118  LEU A O   1 
ATOM   814   C CB  . LEU A  1 149  ? 253.527 239.203 256.949 1.00 36.22  ? 118  LEU A CB  1 
ATOM   815   C CG  . LEU A  1 149  ? 255.041 239.362 256.887 1.00 36.22  ? 118  LEU A CG  1 
ATOM   816   C CD1 . LEU A  1 149  ? 255.423 240.633 256.171 1.00 36.22  ? 118  LEU A CD1 1 
ATOM   817   C CD2 . LEU A  1 149  ? 255.623 239.328 258.275 1.00 36.22  ? 118  LEU A CD2 1 
ATOM   818   N N   . ILE A  1 150  ? 254.044 238.008 253.756 1.00 37.81  ? 119  ILE A N   1 
ATOM   819   C CA  . ILE A  1 150  ? 254.903 237.063 253.043 1.00 37.81  ? 119  ILE A CA  1 
ATOM   820   C C   . ILE A  1 150  ? 256.230 237.762 252.808 1.00 37.81  ? 119  ILE A C   1 
ATOM   821   O O   . ILE A  1 150  ? 256.317 238.668 251.970 1.00 37.81  ? 119  ILE A O   1 
ATOM   822   C CB  . ILE A  1 150  ? 254.300 236.589 251.717 1.00 37.81  ? 119  ILE A CB  1 
ATOM   823   C CG1 . ILE A  1 150  ? 252.935 235.950 251.933 1.00 37.81  ? 119  ILE A CG1 1 
ATOM   824   C CG2 . ILE A  1 150  ? 255.231 235.617 251.042 1.00 37.81  ? 119  ILE A CG2 1 
ATOM   825   C CD1 . ILE A  1 150  ? 252.251 235.578 250.662 1.00 37.81  ? 119  ILE A CD1 1 
ATOM   826   N N   . VAL A  1 151  ? 257.261 237.365 253.549 1.00 44.16  ? 120  VAL A N   1 
ATOM   827   C CA  . VAL A  1 151  ? 258.534 238.070 253.491 1.00 44.16  ? 120  VAL A CA  1 
ATOM   828   C C   . VAL A  1 151  ? 259.668 237.081 253.270 1.00 44.16  ? 120  VAL A C   1 
ATOM   829   O O   . VAL A  1 151  ? 259.596 235.914 253.669 1.00 44.16  ? 120  VAL A O   1 
ATOM   830   C CB  . VAL A  1 151  ? 258.781 238.914 254.760 1.00 44.16  ? 120  VAL A CB  1 
ATOM   831   C CG1 . VAL A  1 151  ? 259.086 238.032 255.950 1.00 44.16  ? 120  VAL A CG1 1 
ATOM   832   C CG2 . VAL A  1 151  ? 259.887 239.925 254.527 1.00 44.16  ? 120  VAL A CG2 1 
ATOM   833   N N   . ASN A  1 152  ? 260.707 237.547 252.586 1.00 52.56  ? 121  ASN A N   1 
ATOM   834   C CA  . ASN A  1 152  ? 261.942 236.795 252.408 1.00 52.56  ? 121  ASN A CA  1 
ATOM   835   C C   . ASN A  1 152  ? 263.073 237.560 253.081 1.00 52.56  ? 121  ASN A C   1 
ATOM   836   O O   . ASN A  1 152  ? 263.652 238.473 252.490 1.00 52.56  ? 121  ASN A O   1 
ATOM   837   C CB  . ASN A  1 152  ? 262.240 236.586 250.924 1.00 52.56  ? 121  ASN A CB  1 
ATOM   838   C CG  . ASN A  1 152  ? 263.454 235.705 250.675 1.00 52.56  ? 121  ASN A CG  1 
ATOM   839   O OD1 . ASN A  1 152  ? 264.381 235.654 251.474 1.00 52.56  ? 121  ASN A OD1 1 
ATOM   840   N ND2 . ASN A  1 152  ? 263.450 235.008 249.551 1.00 52.56  ? 121  ASN A ND2 1 
ATOM   841   N N   . ASN A  1 153  ? 263.392 237.186 254.312 1.00 60.89  ? 122  ASN A N   1 
ATOM   842   C CA  . ASN A  1 153  ? 264.554 237.749 254.973 1.00 60.89  ? 122  ASN A CA  1 
ATOM   843   C C   . ASN A  1 153  ? 265.785 236.953 254.543 1.00 60.89  ? 122  ASN A C   1 
ATOM   844   O O   . ASN A  1 153  ? 265.672 235.875 253.957 1.00 60.89  ? 122  ASN A O   1 
ATOM   845   C CB  . ASN A  1 153  ? 264.323 237.842 256.492 1.00 60.89  ? 122  ASN A CB  1 
ATOM   846   C CG  . ASN A  1 153  ? 264.584 236.550 257.255 1.00 60.89  ? 122  ASN A CG  1 
ATOM   847   O OD1 . ASN A  1 153  ? 265.107 235.570 256.737 1.00 60.89  ? 122  ASN A OD1 1 
ATOM   848   N ND2 . ASN A  1 153  ? 264.202 236.560 258.528 1.00 60.89  ? 122  ASN A ND2 1 
ATOM   849   N N   . ALA A  1 154  ? 266.965 237.507 254.802 1.00 65.10  ? 123  ALA A N   1 
ATOM   850   C CA  . ALA A  1 154  ? 268.210 236.911 254.324 1.00 65.10  ? 123  ALA A CA  1 
ATOM   851   C C   . ALA A  1 154  ? 268.329 235.399 254.510 1.00 65.10  ? 123  ALA A C   1 
ATOM   852   O O   . ALA A  1 154  ? 269.043 234.746 253.744 1.00 65.10  ? 123  ALA A O   1 
ATOM   853   C CB  . ALA A  1 154  ? 269.401 237.587 255.001 1.00 65.10  ? 123  ALA A CB  1 
ATOM   854   N N   . THR A  1 155  ? 267.643 234.818 255.491 1.00 63.15  ? 124  THR A N   1 
ATOM   855   C CA  . THR A  1 155  ? 267.827 233.401 255.789 1.00 63.15  ? 124  THR A CA  1 
ATOM   856   C C   . THR A  1 155  ? 266.611 232.531 255.503 1.00 63.15  ? 124  THR A C   1 
ATOM   857   O O   . THR A  1 155  ? 266.776 231.400 255.046 1.00 63.15  ? 124  THR A O   1 
ATOM   858   C CB  . THR A  1 155  ? 268.231 233.215 257.255 1.00 63.15  ? 124  THR A CB  1 
ATOM   859   O OG1 . THR A  1 155  ? 267.147 233.601 258.106 1.00 63.15  ? 124  THR A OG1 1 
ATOM   860   C CG2 . THR A  1 155  ? 269.446 234.056 257.583 1.00 63.15  ? 124  THR A CG2 1 
ATOM   861   N N   . ASN A  1 156  ? 265.392 233.006 255.759 1.00 58.64  ? 125  ASN A N   1 
ATOM   862   C CA  . ASN A  1 156  ? 264.204 232.165 255.675 1.00 58.64  ? 125  ASN A CA  1 
ATOM   863   C C   . ASN A  1 156  ? 263.124 232.850 254.851 1.00 58.64  ? 125  ASN A C   1 
ATOM   864   O O   . ASN A  1 156  ? 263.200 234.041 254.549 1.00 58.64  ? 125  ASN A O   1 
ATOM   865   C CB  . ASN A  1 156  ? 263.647 231.830 257.065 1.00 58.64  ? 125  ASN A CB  1 
ATOM   866   C CG  . ASN A  1 156  ? 264.671 231.190 257.969 1.00 58.64  ? 125  ASN A CG  1 
ATOM   867   O OD1 . ASN A  1 156  ? 265.569 231.857 258.478 1.00 58.64  ? 125  ASN A OD1 1 
ATOM   868   N ND2 . ASN A  1 156  ? 264.530 229.892 258.193 1.00 58.64  ? 125  ASN A ND2 1 
ATOM   869   N N   . VAL A  1 157  ? 262.109 232.071 254.487 1.00 51.12  ? 126  VAL A N   1 
ATOM   870   C CA  . VAL A  1 157  ? 260.856 232.576 253.937 1.00 51.12  ? 126  VAL A CA  1 
ATOM   871   C C   . VAL A  1 157  ? 259.793 232.449 255.017 1.00 51.12  ? 126  VAL A C   1 
ATOM   872   O O   . VAL A  1 157  ? 259.580 231.357 255.552 1.00 51.12  ? 126  VAL A O   1 
ATOM   873   C CB  . VAL A  1 157  ? 260.448 231.811 252.667 1.00 51.12  ? 126  VAL A CB  1 
ATOM   874   C CG1 . VAL A  1 157  ? 259.138 232.341 252.132 1.00 51.12  ? 126  VAL A CG1 1 
ATOM   875   C CG2 . VAL A  1 157  ? 261.523 231.937 251.618 1.00 51.12  ? 126  VAL A CG2 1 
ATOM   876   N N   . VAL A  1 158  ? 259.127 233.554 255.344 1.00 45.58  ? 127  VAL A N   1 
ATOM   877   C CA  . VAL A  1 158  ? 258.232 233.610 256.493 1.00 45.58  ? 127  VAL A CA  1 
ATOM   878   C C   . VAL A  1 158  ? 256.848 234.027 256.022 1.00 45.58  ? 127  VAL A C   1 
ATOM   879   O O   . VAL A  1 158  ? 256.695 235.074 255.377 1.00 45.58  ? 127  VAL A O   1 
ATOM   880   C CB  . VAL A  1 158  ? 258.752 234.577 257.565 1.00 45.58  ? 127  VAL A CB  1 
ATOM   881   C CG1 . VAL A  1 158  ? 257.706 234.786 258.633 1.00 45.58  ? 127  VAL A CG1 1 
ATOM   882   C CG2 . VAL A  1 158  ? 260.038 234.056 258.161 1.00 45.58  ? 127  VAL A CG2 1 
ATOM   883   N N   . ILE A  1 159  ? 255.845 233.209 256.334 1.00 42.74  ? 128  ILE A N   1 
ATOM   884   C CA  . ILE A  1 159  ? 254.454 233.487 255.993 1.00 42.74  ? 128  ILE A CA  1 
ATOM   885   C C   . ILE A  1 159  ? 253.654 233.490 257.287 1.00 42.74  ? 128  ILE A C   1 
ATOM   886   O O   . ILE A  1 159  ? 253.540 232.454 257.947 1.00 42.74  ? 128  ILE A O   1 
ATOM   887   C CB  . ILE A  1 159  ? 253.895 232.458 255.002 1.00 42.74  ? 128  ILE A CB  1 
ATOM   888   C CG1 . ILE A  1 159  ? 254.793 232.377 253.772 1.00 42.74  ? 128  ILE A CG1 1 
ATOM   889   C CG2 . ILE A  1 159  ? 252.488 232.815 254.606 1.00 42.74  ? 128  ILE A CG2 1 
ATOM   890   C CD1 . ILE A  1 159  ? 254.297 231.450 252.713 1.00 42.74  ? 128  ILE A CD1 1 
ATOM   891   N N   . LYS A  1 160  ? 253.089 234.637 257.643 1.00 42.13  ? 129  LYS A N   1 
ATOM   892   C CA  . LYS A  1 160  ? 252.357 234.763 258.899 1.00 42.13  ? 129  LYS A CA  1 
ATOM   893   C C   . LYS A  1 160  ? 251.023 235.467 258.704 1.00 42.13  ? 129  LYS A C   1 
ATOM   894   O O   . LYS A  1 160  ? 250.908 236.379 257.885 1.00 42.13  ? 129  LYS A O   1 
ATOM   895   C CB  . LYS A  1 160  ? 253.188 235.502 259.942 1.00 42.13  ? 129  LYS A CB  1 
ATOM   896   C CG  . LYS A  1 160  ? 254.378 234.715 260.426 1.00 42.13  ? 129  LYS A CG  1 
ATOM   897   C CD  . LYS A  1 160  ? 255.244 235.530 261.361 1.00 42.13  ? 129  LYS A CD  1 
ATOM   898   C CE  . LYS A  1 160  ? 254.512 235.873 262.639 1.00 42.13  ? 129  LYS A CE  1 
ATOM   899   N NZ  . LYS A  1 160  ? 255.407 236.570 263.597 1.00 42.13  ? 129  LYS A NZ  1 
ATOM   900   N N   . VAL A  1 161  ? 250.014 235.051 259.465 1.00 45.11  ? 130  VAL A N   1 
ATOM   901   C CA  . VAL A  1 161  ? 248.707 235.702 259.465 1.00 45.11  ? 130  VAL A CA  1 
ATOM   902   C C   . VAL A  1 161  ? 248.415 236.142 260.890 1.00 45.11  ? 130  VAL A C   1 
ATOM   903   O O   . VAL A  1 161  ? 248.113 235.308 261.749 1.00 45.11  ? 130  VAL A O   1 
ATOM   904   C CB  . VAL A  1 161  ? 247.596 234.780 258.946 1.00 45.11  ? 130  VAL A CB  1 
ATOM   905   C CG1 . VAL A  1 161  ? 246.291 235.528 258.853 1.00 45.11  ? 130  VAL A CG1 1 
ATOM   906   C CG2 . VAL A  1 161  ? 247.962 234.212 257.603 1.00 45.11  ? 130  VAL A CG2 1 
ATOM   907   N N   . CYS A  1 162  ? 248.524 237.444 261.154 1.00 52.85  ? 131  CYS A N   1 
ATOM   908   C CA  . CYS A  1 162  ? 248.377 237.949 262.519 1.00 52.85  ? 131  CYS A CA  1 
ATOM   909   C C   . CYS A  1 162  ? 247.678 239.299 262.481 1.00 52.85  ? 131  CYS A C   1 
ATOM   910   O O   . CYS A  1 162  ? 247.235 239.756 261.428 1.00 52.85  ? 131  CYS A O   1 
ATOM   911   C CB  . CYS A  1 162  ? 249.731 238.075 263.234 1.00 52.85  ? 131  CYS A CB  1 
ATOM   912   S SG  . CYS A  1 162  ? 250.831 236.637 263.148 1.00 52.85  ? 131  CYS A SG  1 
ATOM   913   N N   . GLU A  1 163  ? 247.557 239.940 263.642 1.00 55.86  ? 132  GLU A N   1 
ATOM   914   C CA  . GLU A  1 163  ? 247.068 241.318 263.721 1.00 55.86  ? 132  GLU A CA  1 
ATOM   915   C C   . GLU A  1 163  ? 248.268 242.248 263.870 1.00 55.86  ? 132  GLU A C   1 
ATOM   916   O O   . GLU A  1 163  ? 248.721 242.535 264.976 1.00 55.86  ? 132  GLU A O   1 
ATOM   917   C CB  . GLU A  1 163  ? 246.076 241.490 264.865 1.00 55.86  ? 132  GLU A CB  1 
ATOM   918   C CG  . GLU A  1 163  ? 244.996 240.432 264.908 1.00 55.86  ? 132  GLU A CG  1 
ATOM   919   C CD  . GLU A  1 163  ? 243.789 240.856 265.719 1.00 55.86  ? 132  GLU A CD  1 
ATOM   920   O OE1 . GLU A  1 163  ? 243.794 240.658 266.949 1.00 55.86  ? 132  GLU A OE1 1 
ATOM   921   O OE2 . GLU A  1 163  ? 242.829 241.387 265.127 1.00 55.86  ? 132  GLU A OE2 1 
ATOM   922   N N   . PHE A  1 164  ? 248.766 242.743 262.739 1.00 52.17  ? 133  PHE A N   1 
ATOM   923   C CA  . PHE A  1 164  ? 249.972 243.555 262.702 1.00 52.17  ? 133  PHE A CA  1 
ATOM   924   C C   . PHE A  1 164  ? 249.627 245.034 262.780 1.00 52.17  ? 133  PHE A C   1 
ATOM   925   O O   . PHE A  1 164  ? 248.650 245.486 262.180 1.00 52.17  ? 133  PHE A O   1 
ATOM   926   C CB  . PHE A  1 164  ? 250.771 243.307 261.424 1.00 52.17  ? 133  PHE A CB  1 
ATOM   927   C CG  . PHE A  1 164  ? 251.254 241.899 261.248 1.00 52.17  ? 133  PHE A CG  1 
ATOM   928   C CD1 . PHE A  1 164  ? 250.588 241.023 260.417 1.00 52.17  ? 133  PHE A CD1 1 
ATOM   929   C CD2 . PHE A  1 164  ? 252.409 241.471 261.867 1.00 52.17  ? 133  PHE A CD2 1 
ATOM   930   C CE1 . PHE A  1 164  ? 251.046 239.739 260.238 1.00 52.17  ? 133  PHE A CE1 1 
ATOM   931   C CE2 . PHE A  1 164  ? 252.870 240.188 261.687 1.00 52.17  ? 133  PHE A CE2 1 
ATOM   932   C CZ  . PHE A  1 164  ? 252.188 239.322 260.875 1.00 52.17  ? 133  PHE A CZ  1 
ATOM   933   N N   . GLN A  1 165  ? 250.438 245.787 263.518 1.00 57.94  ? 134  GLN A N   1 
ATOM   934   C CA  . GLN A  1 165  ? 250.493 247.244 263.394 1.00 57.94  ? 134  GLN A CA  1 
ATOM   935   C C   . GLN A  1 165  ? 251.660 247.562 262.468 1.00 57.94  ? 134  GLN A C   1 
ATOM   936   O O   . GLN A  1 165  ? 252.781 247.801 262.913 1.00 57.94  ? 134  GLN A O   1 
ATOM   937   C CB  . GLN A  1 165  ? 250.643 247.920 264.748 1.00 57.94  ? 134  GLN A CB  1 
ATOM   938   C CG  . GLN A  1 165  ? 250.563 249.433 264.668 1.00 57.94  ? 134  GLN A CG  1 
ATOM   939   C CD  . GLN A  1 165  ? 249.173 249.924 264.335 1.00 57.94  ? 134  GLN A CD  1 
ATOM   940   O OE1 . GLN A  1 165  ? 248.181 249.324 264.736 1.00 57.94  ? 134  GLN A OE1 1 
ATOM   941   N NE2 . GLN A  1 165  ? 249.095 251.020 263.597 1.00 57.94  ? 134  GLN A NE2 1 
ATOM   942   N N   . PHE A  1 166  ? 251.392 247.556 261.166 1.00 54.32  ? 135  PHE A N   1 
ATOM   943   C CA  . PHE A  1 166  ? 252.443 247.793 260.188 1.00 54.32  ? 135  PHE A CA  1 
ATOM   944   C C   . PHE A  1 166  ? 252.926 249.238 260.238 1.00 54.32  ? 135  PHE A C   1 
ATOM   945   O O   . PHE A  1 166  ? 252.177 250.158 260.573 1.00 54.32  ? 135  PHE A O   1 
ATOM   946   C CB  . PHE A  1 166  ? 251.938 247.479 258.783 1.00 54.32  ? 135  PHE A CB  1 
ATOM   947   C CG  . PHE A  1 166  ? 251.801 246.016 258.497 1.00 54.32  ? 135  PHE A CG  1 
ATOM   948   C CD1 . PHE A  1 166  ? 250.568 245.481 258.182 1.00 54.32  ? 135  PHE A CD1 1 
ATOM   949   C CD2 . PHE A  1 166  ? 252.885 245.171 258.579 1.00 54.32  ? 135  PHE A CD2 1 
ATOM   950   C CE1 . PHE A  1 166  ? 250.428 244.141 257.917 1.00 54.32  ? 135  PHE A CE1 1 
ATOM   951   C CE2 . PHE A  1 166  ? 252.748 243.826 258.322 1.00 54.32  ? 135  PHE A CE2 1 
ATOM   952   C CZ  . PHE A  1 166  ? 251.518 243.312 257.990 1.00 54.32  ? 135  PHE A CZ  1 
ATOM   953   N N   . CYS A  1 167  ? 254.196 249.432 259.891 1.00 70.24  ? 136  CYS A N   1 
ATOM   954   C CA  . CYS A  1 167  ? 254.740 250.771 259.747 1.00 70.24  ? 136  CYS A CA  1 
ATOM   955   C C   . CYS A  1 167  ? 254.134 251.466 258.534 1.00 70.24  ? 136  CYS A C   1 
ATOM   956   O O   . CYS A  1 167  ? 253.655 250.830 257.592 1.00 70.24  ? 136  CYS A O   1 
ATOM   957   C CB  . CYS A  1 167  ? 256.261 250.741 259.601 1.00 70.24  ? 136  CYS A CB  1 
ATOM   958   S SG  . CYS A  1 167  ? 257.202 250.059 260.983 1.00 70.24  ? 136  CYS A SG  1 
ATOM   959   N N   . ASN A  1 168  ? 254.144 252.799 258.577 1.00 75.53  ? 137  ASN A N   1 
ATOM   960   C CA  . ASN A  1 168  ? 253.667 253.584 257.443 1.00 75.53  ? 137  ASN A CA  1 
ATOM   961   C C   . ASN A  1 168  ? 254.553 253.397 256.218 1.00 75.53  ? 137  ASN A C   1 
ATOM   962   O O   . ASN A  1 168  ? 254.066 253.473 255.085 1.00 75.53  ? 137  ASN A O   1 
ATOM   963   C CB  . ASN A  1 168  ? 253.588 255.060 257.821 1.00 75.53  ? 137  ASN A CB  1 
ATOM   964   C CG  . ASN A  1 168  ? 252.767 255.865 256.837 1.00 75.53  ? 137  ASN A CG  1 
ATOM   965   O OD1 . ASN A  1 168  ? 252.096 255.309 255.971 1.00 75.53  ? 137  ASN A OD1 1 
ATOM   966   N ND2 . ASN A  1 168  ? 252.821 257.183 256.963 1.00 75.53  ? 137  ASN A ND2 1 
ATOM   967   N N   . ASP A  1 169  ? 255.847 253.147 256.423 1.00 73.83  ? 138  ASP A N   1 
ATOM   968   C CA  . ASP A  1 169  ? 256.820 252.965 255.345 1.00 73.83  ? 138  ASP A CA  1 
ATOM   969   C C   . ASP A  1 169  ? 257.670 251.743 255.661 1.00 73.83  ? 138  ASP A C   1 
ATOM   970   O O   . ASP A  1 169  ? 258.795 251.869 256.162 1.00 73.83  ? 138  ASP A O   1 
ATOM   971   C CB  . ASP A  1 169  ? 257.696 254.209 255.199 1.00 73.83  ? 138  ASP A CB  1 
ATOM   972   C CG  . ASP A  1 169  ? 258.129 254.458 253.775 1.00 73.83  ? 138  ASP A CG  1 
ATOM   973   O OD1 . ASP A  1 169  ? 258.474 253.484 253.076 1.00 73.83  ? 138  ASP A OD1 1 
ATOM   974   O OD2 . ASP A  1 169  ? 258.126 255.634 253.353 1.00 73.83  ? 138  ASP A OD2 1 
ATOM   975   N N   . PRO A  1 170  ? 257.169 250.543 255.379 1.00 66.11  ? 139  PRO A N   1 
ATOM   976   C CA  . PRO A  1 170  ? 257.921 249.333 255.715 1.00 66.11  ? 139  PRO A CA  1 
ATOM   977   C C   . PRO A  1 170  ? 259.072 249.100 254.754 1.00 66.11  ? 139  PRO A C   1 
ATOM   978   O O   . PRO A  1 170  ? 258.979 249.374 253.556 1.00 66.11  ? 139  PRO A O   1 
ATOM   979   C CB  . PRO A  1 170  ? 256.872 248.220 255.588 1.00 66.11  ? 139  PRO A CB  1 
ATOM   980   C CG  . PRO A  1 170  ? 255.564 248.912 255.341 1.00 66.11  ? 139  PRO A CG  1 
ATOM   981   C CD  . PRO A  1 170  ? 255.894 250.219 254.731 1.00 66.11  ? 139  PRO A CD  1 
ATOM   982   N N   . PHE A  1 171  ? 260.158 248.551 255.288 1.00 66.32  ? 140  PHE A N   1 
ATOM   983   C CA  . PHE A  1 171  ? 261.290 248.226 254.435 1.00 66.32  ? 140  PHE A CA  1 
ATOM   984   C C   . PHE A  1 171  ? 262.249 247.300 255.169 1.00 66.32  ? 140  PHE A C   1 
ATOM   985   O O   . PHE A  1 171  ? 262.081 246.983 256.352 1.00 66.32  ? 140  PHE A O   1 
ATOM   986   C CB  . PHE A  1 171  ? 262.018 249.484 253.939 1.00 66.32  ? 140  PHE A CB  1 
ATOM   987   C CG  . PHE A  1 171  ? 262.655 250.303 255.024 1.00 66.32  ? 140  PHE A CG  1 
ATOM   988   C CD1 . PHE A  1 171  ? 262.031 251.433 255.504 1.00 66.32  ? 140  PHE A CD1 1 
ATOM   989   C CD2 . PHE A  1 171  ? 263.891 249.962 255.538 1.00 66.32  ? 140  PHE A CD2 1 
ATOM   990   C CE1 . PHE A  1 171  ? 262.614 252.189 256.486 1.00 66.32  ? 140  PHE A CE1 1 
ATOM   991   C CE2 . PHE A  1 171  ? 264.473 250.714 256.525 1.00 66.32  ? 140  PHE A CE2 1 
ATOM   992   C CZ  . PHE A  1 171  ? 263.837 251.830 256.994 1.00 66.32  ? 140  PHE A CZ  1 
ATOM   993   N N   . LEU A  1 172  ? 263.247 246.852 254.417 1.00 65.83  ? 141  LEU A N   1 
ATOM   994   C CA  . LEU A  1 172  ? 264.337 246.023 254.888 1.00 65.83  ? 141  LEU A CA  1 
ATOM   995   C C   . LEU A  1 172  ? 265.623 246.788 254.622 1.00 65.83  ? 141  LEU A C   1 
ATOM   996   O O   . LEU A  1 172  ? 265.677 247.654 253.747 1.00 65.83  ? 141  LEU A O   1 
ATOM   997   C CB  . LEU A  1 172  ? 264.378 244.673 254.163 1.00 65.83  ? 141  LEU A CB  1 
ATOM   998   C CG  . LEU A  1 172  ? 263.315 243.605 254.411 1.00 65.83  ? 141  LEU A CG  1 
ATOM   999   C CD1 . LEU A  1 172  ? 263.153 243.392 255.876 1.00 65.83  ? 141  LEU A CD1 1 
ATOM   1000  C CD2 . LEU A  1 172  ? 261.987 243.967 253.772 1.00 65.83  ? 141  LEU A CD2 1 
ATOM   1001  N N   . GLY A  1 173  ? 266.658 246.479 255.392 1.00 74.94  ? 142  GLY A N   1 
ATOM   1002  C CA  . GLY A  1 173  ? 267.901 247.213 255.284 1.00 74.94  ? 142  GLY A CA  1 
ATOM   1003  C C   . GLY A  1 173  ? 269.116 246.334 255.108 1.00 74.94  ? 142  GLY A C   1 
ATOM   1004  O O   . GLY A  1 173  ? 269.388 245.484 255.963 1.00 74.94  ? 142  GLY A O   1 
ATOM   1005  N N   . VAL A  1 174  ? 269.892 246.610 254.062 1.00 81.63  ? 143  VAL A N   1 
ATOM   1006  C CA  . VAL A  1 174  ? 271.174 245.968 253.792 1.00 81.63  ? 143  VAL A CA  1 
ATOM   1007  C C   . VAL A  1 174  ? 272.271 247.000 254.002 1.00 81.63  ? 143  VAL A C   1 
ATOM   1008  O O   . VAL A  1 174  ? 272.185 248.119 253.485 1.00 81.63  ? 143  VAL A O   1 
ATOM   1009  C CB  . VAL A  1 174  ? 271.239 245.403 252.362 1.00 81.63  ? 143  VAL A CB  1 
ATOM   1010  C CG1 . VAL A  1 174  ? 272.613 244.846 252.081 1.00 81.63  ? 143  VAL A CG1 1 
ATOM   1011  C CG2 . VAL A  1 174  ? 270.189 244.340 252.159 1.00 81.63  ? 143  VAL A CG2 1 
ATOM   1012  N N   . TYR A  1 175  ? 273.290 246.631 254.769 1.00 93.05  ? 144  TYR A N   1 
ATOM   1013  C CA  . TYR A  1 175  ? 274.412 247.510 255.058 1.00 93.05  ? 144  TYR A CA  1 
ATOM   1014  C C   . TYR A  1 175  ? 275.673 246.962 254.407 1.00 93.05  ? 144  TYR A C   1 
ATOM   1015  O O   . TYR A  1 175  ? 275.885 245.747 254.369 1.00 93.05  ? 144  TYR A O   1 
ATOM   1016  C CB  . TYR A  1 175  ? 274.617 247.643 256.567 1.00 93.05  ? 144  TYR A CB  1 
ATOM   1017  C CG  . TYR A  1 175  ? 275.626 248.688 256.969 1.00 93.05  ? 144  TYR A CG  1 
ATOM   1018  C CD1 . TYR A  1 175  ? 275.290 250.032 256.997 1.00 93.05  ? 144  TYR A CD1 1 
ATOM   1019  C CD2 . TYR A  1 175  ? 276.915 248.330 257.331 1.00 93.05  ? 144  TYR A CD2 1 
ATOM   1020  C CE1 . TYR A  1 175  ? 276.209 250.989 257.368 1.00 93.05  ? 144  TYR A CE1 1 
ATOM   1021  C CE2 . TYR A  1 175  ? 277.840 249.279 257.704 1.00 93.05  ? 144  TYR A CE2 1 
ATOM   1022  C CZ  . TYR A  1 175  ? 277.483 250.606 257.721 1.00 93.05  ? 144  TYR A CZ  1 
ATOM   1023  O OH  . TYR A  1 175  ? 278.404 251.556 258.092 1.00 93.05  ? 144  TYR A OH  1 
ATOM   1024  N N   . TYR A  1 176  ? 276.508 247.866 253.899 1.00 98.71  ? 145  TYR A N   1 
ATOM   1025  C CA  . TYR A  1 176  ? 277.729 247.514 253.187 1.00 98.71  ? 145  TYR A CA  1 
ATOM   1026  C C   . TYR A  1 176  ? 278.939 248.035 253.947 1.00 98.71  ? 145  TYR A C   1 
ATOM   1027  O O   . TYR A  1 176  ? 279.011 249.227 254.262 1.00 98.71  ? 145  TYR A O   1 
ATOM   1028  C CB  . TYR A  1 176  ? 277.704 248.094 251.774 1.00 98.71  ? 145  TYR A CB  1 
ATOM   1029  C CG  . TYR A  1 176  ? 278.976 247.889 250.986 1.00 98.71  ? 145  TYR A CG  1 
ATOM   1030  C CD1 . TYR A  1 176  ? 279.577 248.946 250.319 1.00 98.71  ? 145  TYR A CD1 1 
ATOM   1031  C CD2 . TYR A  1 176  ? 279.575 246.642 250.907 1.00 98.71  ? 145  TYR A CD2 1 
ATOM   1032  C CE1 . TYR A  1 176  ? 280.735 248.767 249.596 1.00 98.71  ? 145  TYR A CE1 1 
ATOM   1033  C CE2 . TYR A  1 176  ? 280.735 246.453 250.185 1.00 98.71  ? 145  TYR A CE2 1 
ATOM   1034  C CZ  . TYR A  1 176  ? 281.311 247.519 249.533 1.00 98.71  ? 145  TYR A CZ  1 
ATOM   1035  O OH  . TYR A  1 176  ? 282.467 247.335 248.811 1.00 98.71  ? 145  TYR A OH  1 
ATOM   1036  N N   . HIS A  1 177  ? 279.891 247.148 254.224 1.00 104.90 ? 146  HIS A N   1 
ATOM   1037  C CA  . HIS A  1 177  ? 281.122 247.514 254.909 1.00 104.90 ? 146  HIS A CA  1 
ATOM   1038  C C   . HIS A  1 177  ? 282.244 247.697 253.898 1.00 104.90 ? 146  HIS A C   1 
ATOM   1039  O O   . HIS A  1 177  ? 282.456 246.840 253.035 1.00 104.90 ? 146  HIS A O   1 
ATOM   1040  C CB  . HIS A  1 177  ? 281.499 246.453 255.942 1.00 104.90 ? 146  HIS A CB  1 
ATOM   1041  C CG  . HIS A  1 177  ? 280.394 246.126 256.895 1.00 104.90 ? 146  HIS A CG  1 
ATOM   1042  N ND1 . HIS A  1 177  ? 279.544 245.058 256.712 1.00 104.90 ? 146  HIS A ND1 1 
ATOM   1043  C CD2 . HIS A  1 177  ? 279.992 246.736 258.035 1.00 104.90 ? 146  HIS A CD2 1 
ATOM   1044  C CE1 . HIS A  1 177  ? 278.670 245.020 257.702 1.00 104.90 ? 146  HIS A CE1 1 
ATOM   1045  N NE2 . HIS A  1 177  ? 278.919 246.027 258.518 1.00 104.90 ? 146  HIS A NE2 1 
ATOM   1046  N N   . LYS A  1 178  ? 282.958 248.817 254.009 1.00 108.85 ? 147  LYS A N   1 
ATOM   1047  C CA  . LYS A  1 178  ? 284.063 249.093 253.098 1.00 108.85 ? 147  LYS A CA  1 
ATOM   1048  C C   . LYS A  1 178  ? 285.323 248.313 253.460 1.00 108.85 ? 147  LYS A C   1 
ATOM   1049  O O   . LYS A  1 178  ? 286.008 247.793 252.573 1.00 108.85 ? 147  LYS A O   1 
ATOM   1050  C CB  . LYS A  1 178  ? 284.351 250.594 253.081 1.00 108.85 ? 147  LYS A CB  1 
ATOM   1051  C CG  . LYS A  1 178  ? 285.436 251.016 252.109 1.00 108.85 ? 147  LYS A CG  1 
ATOM   1052  C CD  . LYS A  1 178  ? 285.821 252.469 252.326 1.00 108.85 ? 147  LYS A CD  1 
ATOM   1053  C CE  . LYS A  1 178  ? 286.854 252.926 251.311 1.00 108.85 ? 147  LYS A CE  1 
ATOM   1054  N NZ  . LYS A  1 178  ? 286.280 253.008 249.940 1.00 108.85 ? 147  LYS A NZ  1 
ATOM   1055  N N   . ASN A  1 179  ? 285.647 248.229 254.755 1.00 111.98 ? 148  ASN A N   1 
ATOM   1056  C CA  . ASN A  1 179  ? 286.919 247.640 255.171 1.00 111.98 ? 148  ASN A CA  1 
ATOM   1057  C C   . ASN A  1 179  ? 287.041 246.175 254.765 1.00 111.98 ? 148  ASN A C   1 
ATOM   1058  O O   . ASN A  1 179  ? 288.097 245.750 254.283 1.00 111.98 ? 148  ASN A O   1 
ATOM   1059  C CB  . ASN A  1 179  ? 287.104 247.820 256.675 1.00 111.98 ? 148  ASN A CB  1 
ATOM   1060  C CG  . ASN A  1 179  ? 285.884 247.415 257.463 1.00 111.98 ? 148  ASN A CG  1 
ATOM   1061  O OD1 . ASN A  1 179  ? 285.052 246.639 256.996 1.00 111.98 ? 148  ASN A OD1 1 
ATOM   1062  N ND2 . ASN A  1 179  ? 285.745 247.981 258.654 1.00 111.98 ? 148  ASN A ND2 1 
ATOM   1063  N N   . ASN A  1 180  ? 285.986 245.383 254.949 1.00 112.49 ? 149  ASN A N   1 
ATOM   1064  C CA  . ASN A  1 180  ? 285.918 244.059 254.342 1.00 112.49 ? 149  ASN A CA  1 
ATOM   1065  C C   . ASN A  1 180  ? 284.679 244.002 253.460 1.00 112.49 ? 149  ASN A C   1 
ATOM   1066  O O   . ASN A  1 180  ? 283.562 244.223 253.936 1.00 112.49 ? 149  ASN A O   1 
ATOM   1067  C CB  . ASN A  1 180  ? 285.919 242.928 255.382 1.00 112.49 ? 149  ASN A CB  1 
ATOM   1068  C CG  . ASN A  1 180  ? 284.817 243.047 256.434 1.00 112.49 ? 149  ASN A CG  1 
ATOM   1069  O OD1 . ASN A  1 180  ? 284.029 243.989 256.453 1.00 112.49 ? 149  ASN A OD1 1 
ATOM   1070  N ND2 . ASN A  1 180  ? 284.769 242.045 257.316 1.00 112.49 ? 149  ASN A ND2 1 
ATOM   1071  N N   . LYS A  1 181  ? 284.878 243.726 252.176 1.00 109.57 ? 150  LYS A N   1 
ATOM   1072  C CA  . LYS A  1 181  ? 283.777 243.786 251.223 1.00 109.57 ? 150  LYS A CA  1 
ATOM   1073  C C   . LYS A  1 181  ? 282.770 242.690 251.543 1.00 109.57 ? 150  LYS A C   1 
ATOM   1074  O O   . LYS A  1 181  ? 283.048 241.503 251.352 1.00 109.57 ? 150  LYS A O   1 
ATOM   1075  C CB  . LYS A  1 181  ? 284.297 243.658 249.795 1.00 109.57 ? 150  LYS A CB  1 
ATOM   1076  C CG  . LYS A  1 181  ? 285.140 244.837 249.346 1.00 109.57 ? 150  LYS A CG  1 
ATOM   1077  C CD  . LYS A  1 181  ? 285.650 244.647 247.929 1.00 109.57 ? 150  LYS A CD  1 
ATOM   1078  C CE  . LYS A  1 181  ? 286.473 245.842 247.478 1.00 109.57 ? 150  LYS A CE  1 
ATOM   1079  N NZ  . LYS A  1 181  ? 287.002 245.666 246.098 1.00 109.57 ? 150  LYS A NZ  1 
ATOM   1080  N N   . SER A  1 182  ? 281.598 243.092 252.027 1.00 103.36 ? 151  SER A N   1 
ATOM   1081  C CA  . SER A  1 182  ? 280.567 242.157 252.445 1.00 103.36 ? 151  SER A CA  1 
ATOM   1082  C C   . SER A  1 182  ? 279.268 242.924 252.623 1.00 103.36 ? 151  SER A C   1 
ATOM   1083  O O   . SER A  1 182  ? 279.258 244.009 253.208 1.00 103.36 ? 151  SER A O   1 
ATOM   1084  C CB  . SER A  1 182  ? 280.952 241.455 253.750 1.00 103.36 ? 151  SER A CB  1 
ATOM   1085  O OG  . SER A  1 182  ? 279.926 240.577 254.170 1.00 103.36 ? 151  SER A OG  1 
ATOM   1086  N N   . TRP A  1 183  ? 278.178 242.337 252.141 1.00 94.21  ? 152  TRP A N   1 
ATOM   1087  C CA  . TRP A  1 183  ? 276.835 242.878 252.292 1.00 94.21  ? 152  TRP A CA  1 
ATOM   1088  C C   . TRP A  1 183  ? 276.053 241.984 253.241 1.00 94.21  ? 152  TRP A C   1 
ATOM   1089  O O   . TRP A  1 183  ? 275.945 240.777 253.010 1.00 94.21  ? 152  TRP A O   1 
ATOM   1090  C CB  . TRP A  1 183  ? 276.135 242.964 250.938 1.00 94.21  ? 152  TRP A CB  1 
ATOM   1091  C CG  . TRP A  1 183  ? 276.904 243.720 249.908 1.00 94.21  ? 152  TRP A CG  1 
ATOM   1092  C CD1 . TRP A  1 183  ? 278.032 243.311 249.264 1.00 94.21  ? 152  TRP A CD1 1 
ATOM   1093  C CD2 . TRP A  1 183  ? 276.575 245.001 249.365 1.00 94.21  ? 152  TRP A CD2 1 
ATOM   1094  N NE1 . TRP A  1 183  ? 278.442 244.270 248.373 1.00 94.21  ? 152  TRP A NE1 1 
ATOM   1095  C CE2 . TRP A  1 183  ? 277.560 245.317 248.413 1.00 94.21  ? 152  TRP A CE2 1 
ATOM   1096  C CE3 . TRP A  1 183  ? 275.546 245.917 249.597 1.00 94.21  ? 152  TRP A CE3 1 
ATOM   1097  C CZ2 . TRP A  1 183  ? 277.549 246.507 247.697 1.00 94.21  ? 152  TRP A CZ2 1 
ATOM   1098  C CZ3 . TRP A  1 183  ? 275.539 247.097 248.886 1.00 94.21  ? 152  TRP A CZ3 1 
ATOM   1099  C CH2 . TRP A  1 183  ? 276.531 247.381 247.947 1.00 94.21  ? 152  TRP A CH2 1 
ATOM   1100  N N   . MET A  1 184  ? 275.511 242.571 254.301 1.00 94.04  ? 153  MET A N   1 
ATOM   1101  C CA  . MET A  1 184  ? 274.746 241.813 255.275 1.00 94.04  ? 153  MET A CA  1 
ATOM   1102  C C   . MET A  1 184  ? 273.487 242.580 255.647 1.00 94.04  ? 153  MET A C   1 
ATOM   1103  O O   . MET A  1 184  ? 273.456 243.812 255.615 1.00 94.04  ? 153  MET A O   1 
ATOM   1104  C CB  . MET A  1 184  ? 275.581 241.514 256.516 1.00 94.04  ? 153  MET A CB  1 
ATOM   1105  C CG  . MET A  1 184  ? 276.031 242.747 257.254 1.00 94.04  ? 153  MET A CG  1 
ATOM   1106  S SD  . MET A  1 184  ? 276.977 242.281 258.700 1.00 94.04  ? 153  MET A SD  1 
ATOM   1107  C CE  . MET A  1 184  ? 278.322 241.445 257.877 1.00 94.04  ? 153  MET A CE  1 
ATOM   1108  N N   . GLU A  1 185  ? 272.452 241.833 256.012 1.00 80.86  ? 154  GLU A N   1 
ATOM   1109  C CA  . GLU A  1 185  ? 271.162 242.418 256.344 1.00 80.86  ? 154  GLU A CA  1 
ATOM   1110  C C   . GLU A  1 185  ? 271.170 242.938 257.773 1.00 80.86  ? 154  GLU A C   1 
ATOM   1111  O O   . GLU A  1 185  ? 271.473 242.195 258.712 1.00 80.86  ? 154  GLU A O   1 
ATOM   1112  C CB  . GLU A  1 185  ? 270.048 241.394 256.155 1.00 80.86  ? 154  GLU A CB  1 
ATOM   1113  C CG  . GLU A  1 185  ? 268.696 241.910 256.588 1.00 80.86  ? 154  GLU A CG  1 
ATOM   1114  C CD  . GLU A  1 185  ? 267.552 241.124 256.003 1.00 80.86  ? 154  GLU A CD  1 
ATOM   1115  O OE1 . GLU A  1 185  ? 267.793 240.310 255.091 1.00 80.86  ? 154  GLU A OE1 1 
ATOM   1116  O OE2 . GLU A  1 185  ? 266.409 241.317 256.463 1.00 80.86  ? 154  GLU A OE2 1 
ATOM   1117  N N   . SER A  1 186  ? 270.860 244.221 257.931 1.00 81.90  ? 155  SER A N   1 
ATOM   1118  C CA  . SER A  1 186  ? 270.854 244.885 259.227 1.00 81.90  ? 155  SER A CA  1 
ATOM   1119  C C   . SER A  1 186  ? 269.467 245.259 259.717 1.00 81.90  ? 155  SER A C   1 
ATOM   1120  O O   . SER A  1 186  ? 269.188 245.113 260.907 1.00 81.90  ? 155  SER A O   1 
ATOM   1121  C CB  . SER A  1 186  ? 271.717 246.149 259.185 1.00 81.90  ? 155  SER A CB  1 
ATOM   1122  O OG  . SER A  1 186  ? 273.081 245.827 258.994 1.00 81.90  ? 155  SER A OG  1 
ATOM   1123  N N   . GLU A  1 187  ? 268.581 245.738 258.847 1.00 77.60  ? 156  GLU A N   1 
ATOM   1124  C CA  . GLU A  1 187  ? 267.311 246.297 259.296 1.00 77.60  ? 156  GLU A CA  1 
ATOM   1125  C C   . GLU A  1 187  ? 266.117 245.458 258.858 1.00 77.60  ? 156  GLU A C   1 
ATOM   1126  O O   . GLU A  1 187  ? 266.085 244.940 257.740 1.00 77.60  ? 156  GLU A O   1 
ATOM   1127  C CB  . GLU A  1 187  ? 267.143 247.725 258.776 1.00 77.60  ? 156  GLU A CB  1 
ATOM   1128  C CG  . GLU A  1 187  ? 268.051 248.732 259.457 1.00 77.60  ? 156  GLU A CG  1 
ATOM   1129  C CD  . GLU A  1 187  ? 268.017 250.090 258.792 1.00 77.60  ? 156  GLU A CD  1 
ATOM   1130  O OE1 . GLU A  1 187  ? 268.137 250.147 257.551 1.00 77.60  ? 156  GLU A OE1 1 
ATOM   1131  O OE2 . GLU A  1 187  ? 267.879 251.101 259.509 1.00 77.60  ? 156  GLU A OE2 1 
ATOM   1132  N N   . PHE A  1 188  ? 265.120 245.372 259.742 1.00 66.26  ? 157  PHE A N   1 
ATOM   1133  C CA  . PHE A  1 188  ? 263.813 244.765 259.470 1.00 66.26  ? 157  PHE A CA  1 
ATOM   1134  C C   . PHE A  1 188  ? 262.762 245.682 260.091 1.00 66.26  ? 157  PHE A C   1 
ATOM   1135  O O   . PHE A  1 188  ? 262.412 245.521 261.263 1.00 66.26  ? 157  PHE A O   1 
ATOM   1136  C CB  . PHE A  1 188  ? 263.738 243.356 260.048 1.00 66.26  ? 157  PHE A CB  1 
ATOM   1137  C CG  . PHE A  1 188  ? 262.519 242.577 259.630 1.00 66.26  ? 157  PHE A CG  1 
ATOM   1138  C CD1 . PHE A  1 188  ? 262.594 241.630 258.631 1.00 66.26  ? 157  PHE A CD1 1 
ATOM   1139  C CD2 . PHE A  1 188  ? 261.309 242.764 260.266 1.00 66.26  ? 157  PHE A CD2 1 
ATOM   1140  C CE1 . PHE A  1 188  ? 261.480 240.915 258.252 1.00 66.26  ? 157  PHE A CE1 1 
ATOM   1141  C CE2 . PHE A  1 188  ? 260.196 242.049 259.892 1.00 66.26  ? 157  PHE A CE2 1 
ATOM   1142  C CZ  . PHE A  1 188  ? 260.282 241.125 258.887 1.00 66.26  ? 157  PHE A CZ  1 
ATOM   1143  N N   . ARG A  1 189  ? 262.255 246.643 259.319 1.00 68.49  ? 158  ARG A N   1 
ATOM   1144  C CA  . ARG A  1 189  ? 261.341 247.642 259.864 1.00 68.49  ? 158  ARG A CA  1 
ATOM   1145  C C   . ARG A  1 189  ? 260.010 247.519 259.130 1.00 68.49  ? 158  ARG A C   1 
ATOM   1146  O O   . ARG A  1 189  ? 259.745 248.242 258.170 1.00 68.49  ? 158  ARG A O   1 
ATOM   1147  C CB  . ARG A  1 189  ? 261.931 249.019 259.746 1.00 68.49  ? 158  ARG A CB  1 
ATOM   1148  C CG  . ARG A  1 189  ? 263.251 249.188 260.475 1.00 68.49  ? 158  ARG A CG  1 
ATOM   1149  C CD  . ARG A  1 189  ? 263.473 250.642 260.833 1.00 68.49  ? 158  ARG A CD  1 
ATOM   1150  N NE  . ARG A  1 189  ? 264.855 250.945 261.187 1.00 68.49  ? 158  ARG A NE  1 
ATOM   1151  C CZ  . ARG A  1 189  ? 265.446 250.561 262.312 1.00 68.49  ? 158  ARG A CZ  1 
ATOM   1152  N NH1 . ARG A  1 189  ? 264.779 249.848 263.207 1.00 68.49  ? 158  ARG A NH1 1 
ATOM   1153  N NH2 . ARG A  1 189  ? 266.708 250.889 262.543 1.00 68.49  ? 158  ARG A NH2 1 
ATOM   1154  N N   . VAL A  1 190  ? 259.169 246.589 259.588 1.00 61.43  ? 159  VAL A N   1 
ATOM   1155  C CA  . VAL A  1 190  ? 257.920 246.252 258.917 1.00 61.43  ? 159  VAL A CA  1 
ATOM   1156  C C   . VAL A  1 190  ? 256.717 246.485 259.824 1.00 61.43  ? 159  VAL A C   1 
ATOM   1157  O O   . VAL A  1 190  ? 255.734 247.109 259.418 1.00 61.43  ? 159  VAL A O   1 
ATOM   1158  C CB  . VAL A  1 190  ? 257.934 244.802 258.390 1.00 61.43  ? 159  VAL A CB  1 
ATOM   1159  C CG1 . VAL A  1 190  ? 256.607 244.474 257.736 1.00 61.43  ? 159  VAL A CG1 1 
ATOM   1160  C CG2 . VAL A  1 190  ? 259.065 244.614 257.411 1.00 61.43  ? 159  VAL A CG2 1 
ATOM   1161  N N   . TYR A  1 191  ? 256.767 245.977 261.054 1.00 58.87  ? 160  TYR A N   1 
ATOM   1162  C CA  . TYR A  1 191  ? 255.639 246.117 261.964 1.00 58.87  ? 160  TYR A CA  1 
ATOM   1163  C C   . TYR A  1 191  ? 256.138 246.426 263.367 1.00 58.87  ? 160  TYR A C   1 
ATOM   1164  O O   . TYR A  1 191  ? 257.285 246.146 263.722 1.00 58.87  ? 160  TYR A O   1 
ATOM   1165  C CB  . TYR A  1 191  ? 254.761 244.855 261.990 1.00 58.87  ? 160  TYR A CB  1 
ATOM   1166  C CG  . TYR A  1 191  ? 255.493 243.583 262.351 1.00 58.87  ? 160  TYR A CG  1 
ATOM   1167  C CD1 . TYR A  1 191  ? 255.871 242.678 261.376 1.00 58.87  ? 160  TYR A CD1 1 
ATOM   1168  C CD2 . TYR A  1 191  ? 255.803 243.285 263.665 1.00 58.87  ? 160  TYR A CD2 1 
ATOM   1169  C CE1 . TYR A  1 191  ? 256.538 241.521 261.699 1.00 58.87  ? 160  TYR A CE1 1 
ATOM   1170  C CE2 . TYR A  1 191  ? 256.474 242.133 263.994 1.00 58.87  ? 160  TYR A CE2 1 
ATOM   1171  C CZ  . TYR A  1 191  ? 256.836 241.254 263.009 1.00 58.87  ? 160  TYR A CZ  1 
ATOM   1172  O OH  . TYR A  1 191  ? 257.502 240.099 263.335 1.00 58.87  ? 160  TYR A OH  1 
ATOM   1173  N N   . SER A  1 192  ? 255.251 247.031 264.159 1.00 61.41  ? 161  SER A N   1 
ATOM   1174  C CA  . SER A  1 192  ? 255.523 247.292 265.568 1.00 61.41  ? 161  SER A CA  1 
ATOM   1175  C C   . SER A  1 192  ? 255.221 246.071 266.433 1.00 61.41  ? 161  SER A C   1 
ATOM   1176  O O   . SER A  1 192  ? 256.072 245.622 267.207 1.00 61.41  ? 161  SER A O   1 
ATOM   1177  C CB  . SER A  1 192  ? 254.715 248.498 266.041 1.00 61.41  ? 161  SER A CB  1 
ATOM   1178  O OG  . SER A  1 192  ? 254.924 249.609 265.190 1.00 61.41  ? 161  SER A OG  1 
ATOM   1179  N N   . SER A  1 193  ? 254.008 245.529 266.319 1.00 60.79  ? 162  SER A N   1 
ATOM   1180  C CA  . SER A  1 193  ? 253.554 244.419 267.144 1.00 60.79  ? 162  SER A CA  1 
ATOM   1181  C C   . SER A  1 193  ? 252.665 243.495 266.324 1.00 60.79  ? 162  SER A C   1 
ATOM   1182  O O   . SER A  1 193  ? 251.959 243.935 265.416 1.00 60.79  ? 162  SER A O   1 
ATOM   1183  C CB  . SER A  1 193  ? 252.786 244.916 268.368 1.00 60.79  ? 162  SER A CB  1 
ATOM   1184  O OG  . SER A  1 193  ? 251.737 245.784 267.980 1.00 60.79  ? 162  SER A OG  1 
ATOM   1185  N N   . ALA A  1 194  ? 252.721 242.204 266.646 1.00 59.75  ? 163  ALA A N   1 
ATOM   1186  C CA  . ALA A  1 194  ? 251.829 241.198 266.082 1.00 59.75  ? 163  ALA A CA  1 
ATOM   1187  C C   . ALA A  1 194  ? 251.246 240.375 267.219 1.00 59.75  ? 163  ALA A C   1 
ATOM   1188  O O   . ALA A  1 194  ? 251.995 239.721 267.951 1.00 59.75  ? 163  ALA A O   1 
ATOM   1189  C CB  . ALA A  1 194  ? 252.576 240.295 265.105 1.00 59.75  ? 163  ALA A CB  1 
ATOM   1190  N N   . ASN A  1 195  ? 249.921 240.400 267.372 1.00 65.94  ? 164  ASN A N   1 
ATOM   1191  C CA  . ASN A  1 195  ? 249.334 239.769 268.549 1.00 65.94  ? 164  ASN A CA  1 
ATOM   1192  C C   . ASN A  1 195  ? 248.737 238.385 268.299 1.00 65.94  ? 164  ASN A C   1 
ATOM   1193  O O   . ASN A  1 195  ? 249.339 237.380 268.689 1.00 65.94  ? 164  ASN A O   1 
ATOM   1194  C CB  . ASN A  1 195  ? 248.271 240.699 269.131 1.00 65.94  ? 164  ASN A CB  1 
ATOM   1195  C CG  . ASN A  1 195  ? 247.700 240.187 270.425 1.00 65.94  ? 164  ASN A CG  1 
ATOM   1196  O OD1 . ASN A  1 195  ? 246.550 240.459 270.754 1.00 65.94  ? 164  ASN A OD1 1 
ATOM   1197  N ND2 . ASN A  1 195  ? 248.505 239.447 271.178 1.00 65.94  ? 164  ASN A ND2 1 
ATOM   1198  N N   . ASN A  1 196  ? 247.570 238.300 267.658 1.00 62.08  ? 165  ASN A N   1 
ATOM   1199  C CA  . ASN A  1 196  ? 246.844 237.029 267.561 1.00 62.08  ? 165  ASN A CA  1 
ATOM   1200  C C   . ASN A  1 196  ? 247.196 236.339 266.252 1.00 62.08  ? 165  ASN A C   1 
ATOM   1201  O O   . ASN A  1 196  ? 246.649 236.673 265.201 1.00 62.08  ? 165  ASN A O   1 
ATOM   1202  C CB  . ASN A  1 196  ? 245.337 237.232 267.659 1.00 62.08  ? 165  ASN A CB  1 
ATOM   1203  C CG  . ASN A  1 196  ? 244.876 237.572 269.056 1.00 62.08  ? 165  ASN A CG  1 
ATOM   1204  O OD1 . ASN A  1 196  ? 245.482 237.164 270.043 1.00 62.08  ? 165  ASN A OD1 1 
ATOM   1205  N ND2 . ASN A  1 196  ? 243.777 238.305 269.143 1.00 62.08  ? 165  ASN A ND2 1 
ATOM   1206  N N   . CYS A  1 197  ? 248.075 235.348 266.307 1.00 59.58  ? 166  CYS A N   1 
ATOM   1207  C CA  . CYS A  1 197  ? 248.527 234.673 265.101 1.00 59.58  ? 166  CYS A CA  1 
ATOM   1208  C C   . CYS A  1 197  ? 247.789 233.354 264.945 1.00 59.58  ? 166  CYS A C   1 
ATOM   1209  O O   . CYS A  1 197  ? 247.790 232.524 265.859 1.00 59.58  ? 166  CYS A O   1 
ATOM   1210  C CB  . CYS A  1 197  ? 250.037 234.440 265.130 1.00 59.58  ? 166  CYS A CB  1 
ATOM   1211  S SG  . CYS A  1 197  ? 251.018 235.963 265.060 1.00 59.58  ? 166  CYS A SG  1 
ATOM   1212  N N   . THR A  1 198  ? 247.174 233.162 263.783 1.00 52.97  ? 167  THR A N   1 
ATOM   1213  C CA  . THR A  1 198  ? 246.413 231.959 263.478 1.00 52.97  ? 167  THR A CA  1 
ATOM   1214  C C   . THR A  1 198  ? 247.186 230.986 262.604 1.00 52.97  ? 167  THR A C   1 
ATOM   1215  O O   . THR A  1 198  ? 247.088 229.773 262.803 1.00 52.97  ? 167  THR A O   1 
ATOM   1216  C CB  . THR A  1 198  ? 245.090 232.318 262.798 1.00 52.97  ? 167  THR A CB  1 
ATOM   1217  O OG1 . THR A  1 198  ? 245.350 233.051 261.598 1.00 52.97  ? 167  THR A OG1 1 
ATOM   1218  C CG2 . THR A  1 198  ? 244.226 233.158 263.713 1.00 52.97  ? 167  THR A CG2 1 
ATOM   1219  N N   . PHE A  1 199  ? 247.940 231.482 261.628 1.00 49.39  ? 168  PHE A N   1 
ATOM   1220  C CA  . PHE A  1 199  ? 248.698 230.634 260.724 1.00 49.39  ? 168  PHE A CA  1 
ATOM   1221  C C   . PHE A  1 199  ? 250.130 231.146 260.652 1.00 49.39  ? 168  PHE A C   1 
ATOM   1222  O O   . PHE A  1 199  ? 250.360 232.357 260.612 1.00 49.39  ? 168  PHE A O   1 
ATOM   1223  C CB  . PHE A  1 199  ? 248.047 230.614 259.330 1.00 49.39  ? 168  PHE A CB  1 
ATOM   1224  C CG  . PHE A  1 199  ? 248.879 229.959 258.266 1.00 49.39  ? 168  PHE A CG  1 
ATOM   1225  C CD1 . PHE A  1 199  ? 248.738 228.612 258.000 1.00 49.39  ? 168  PHE A CD1 1 
ATOM   1226  C CD2 . PHE A  1 199  ? 249.782 230.689 257.518 1.00 49.39  ? 168  PHE A CD2 1 
ATOM   1227  C CE1 . PHE A  1 199  ? 249.488 228.006 257.024 1.00 49.39  ? 168  PHE A CE1 1 
ATOM   1228  C CE2 . PHE A  1 199  ? 250.538 230.083 256.544 1.00 49.39  ? 168  PHE A CE2 1 
ATOM   1229  C CZ  . PHE A  1 199  ? 250.389 228.741 256.298 1.00 49.39  ? 168  PHE A CZ  1 
ATOM   1230  N N   . GLU A  1 200  ? 251.087 230.220 260.646 1.00 51.22  ? 169  GLU A N   1 
ATOM   1231  C CA  . GLU A  1 200  ? 252.503 230.554 260.603 1.00 51.22  ? 169  GLU A CA  1 
ATOM   1232  C C   . GLU A  1 200  ? 253.256 229.486 259.827 1.00 51.22  ? 169  GLU A C   1 
ATOM   1233  O O   . GLU A  1 200  ? 252.920 228.303 259.911 1.00 51.22  ? 169  GLU A O   1 
ATOM   1234  C CB  . GLU A  1 200  ? 253.103 230.673 262.006 1.00 51.22  ? 169  GLU A CB  1 
ATOM   1235  C CG  . GLU A  1 200  ? 254.569 231.072 262.006 1.00 51.22  ? 169  GLU A CG  1 
ATOM   1236  C CD  . GLU A  1 200  ? 255.000 231.756 263.284 1.00 51.22  ? 169  GLU A CD  1 
ATOM   1237  O OE1 . GLU A  1 200  ? 254.125 232.241 264.032 1.00 51.22  ? 169  GLU A OE1 1 
ATOM   1238  O OE2 . GLU A  1 200  ? 256.220 231.809 263.540 1.00 51.22  ? 169  GLU A OE2 1 
ATOM   1239  N N   . TYR A  1 201  ? 254.270 229.906 259.075 1.00 50.71  ? 170  TYR A N   1 
ATOM   1240  C CA  . TYR A  1 201  ? 255.137 228.964 258.380 1.00 50.71  ? 170  TYR A CA  1 
ATOM   1241  C C   . TYR A  1 201  ? 256.504 229.611 258.230 1.00 50.71  ? 170  TYR A C   1 
ATOM   1242  O O   . TYR A  1 201  ? 256.595 230.779 257.837 1.00 50.71  ? 170  TYR A O   1 
ATOM   1243  C CB  . TYR A  1 201  ? 254.567 228.583 257.011 1.00 50.71  ? 170  TYR A CB  1 
ATOM   1244  C CG  . TYR A  1 201  ? 255.564 227.928 256.090 1.00 50.71  ? 170  TYR A CG  1 
ATOM   1245  C CD1 . TYR A  1 201  ? 255.863 226.582 256.219 1.00 50.71  ? 170  TYR A CD1 1 
ATOM   1246  C CD2 . TYR A  1 201  ? 256.206 228.644 255.095 1.00 50.71  ? 170  TYR A CD2 1 
ATOM   1247  C CE1 . TYR A  1 201  ? 256.768 225.968 255.387 1.00 50.71  ? 170  TYR A CE1 1 
ATOM   1248  C CE2 . TYR A  1 201  ? 257.120 228.036 254.257 1.00 50.71  ? 170  TYR A CE2 1 
ATOM   1249  C CZ  . TYR A  1 201  ? 257.393 226.696 254.409 1.00 50.71  ? 170  TYR A CZ  1 
ATOM   1250  O OH  . TYR A  1 201  ? 258.296 226.079 253.580 1.00 50.71  ? 170  TYR A OH  1 
ATOM   1251  N N   . VAL A  1 202  ? 257.556 228.850 258.535 1.00 51.49  ? 171  VAL A N   1 
ATOM   1252  C CA  . VAL A  1 202  ? 258.940 229.276 258.358 1.00 51.49  ? 171  VAL A CA  1 
ATOM   1253  C C   . VAL A  1 202  ? 259.685 228.193 257.588 1.00 51.49  ? 171  VAL A C   1 
ATOM   1254  O O   . VAL A  1 202  ? 259.618 227.013 257.949 1.00 51.49  ? 171  VAL A O   1 
ATOM   1255  C CB  . VAL A  1 202  ? 259.629 229.562 259.705 1.00 51.49  ? 171  VAL A CB  1 
ATOM   1256  C CG1 . VAL A  1 202  ? 261.078 229.917 259.490 1.00 51.49  ? 171  VAL A CG1 1 
ATOM   1257  C CG2 . VAL A  1 202  ? 258.921 230.682 260.430 1.00 51.49  ? 171  VAL A CG2 1 
ATOM   1258  N N   . SER A  1 203  ? 260.391 228.591 256.536 1.00 56.54  ? 172  SER A N   1 
ATOM   1259  C CA  . SER A  1 203  ? 261.108 227.672 255.669 1.00 56.54  ? 172  SER A CA  1 
ATOM   1260  C C   . SER A  1 203  ? 262.491 227.324 256.222 1.00 56.54  ? 172  SER A C   1 
ATOM   1261  O O   . SER A  1 203  ? 262.977 227.909 257.194 1.00 56.54  ? 172  SER A O   1 
ATOM   1262  C CB  . SER A  1 203  ? 261.249 228.264 254.273 1.00 56.54  ? 172  SER A CB  1 
ATOM   1263  O OG  . SER A  1 203  ? 261.959 227.382 253.427 1.00 56.54  ? 172  SER A OG  1 
ATOM   1264  N N   . GLN A  1 204  ? 263.118 226.335 255.585 1.00 65.24  ? 173  GLN A N   1 
ATOM   1265  C CA  . GLN A  1 204  ? 264.446 225.881 255.969 1.00 65.24  ? 173  GLN A CA  1 
ATOM   1266  C C   . GLN A  1 204  ? 265.492 226.953 255.661 1.00 65.24  ? 173  GLN A C   1 
ATOM   1267  O O   . GLN A  1 204  ? 265.349 227.713 254.700 1.00 65.24  ? 173  GLN A O   1 
ATOM   1268  C CB  . GLN A  1 204  ? 264.807 224.592 255.232 1.00 65.24  ? 173  GLN A CB  1 
ATOM   1269  C CG  . GLN A  1 204  ? 263.854 223.426 255.448 1.00 65.24  ? 173  GLN A CG  1 
ATOM   1270  C CD  . GLN A  1 204  ? 263.877 222.882 256.867 1.00 65.24  ? 173  GLN A CD  1 
ATOM   1271  O OE1 . GLN A  1 204  ? 264.694 223.289 257.693 1.00 65.24  ? 173  GLN A OE1 1 
ATOM   1272  N NE2 . GLN A  1 204  ? 262.980 221.948 257.152 1.00 65.24  ? 173  GLN A NE2 1 
ATOM   1273  N N   . PRO A  1 205  ? 266.553 227.035 256.464 1.00 65.61  ? 174  PRO A N   1 
ATOM   1274  C CA  . PRO A  1 205  ? 267.511 228.138 256.316 1.00 65.61  ? 174  PRO A CA  1 
ATOM   1275  C C   . PRO A  1 205  ? 268.316 228.047 255.027 1.00 65.61  ? 174  PRO A C   1 
ATOM   1276  O O   . PRO A  1 205  ? 268.721 226.966 254.595 1.00 65.61  ? 174  PRO A O   1 
ATOM   1277  C CB  . PRO A  1 205  ? 268.413 227.988 257.545 1.00 65.61  ? 174  PRO A CB  1 
ATOM   1278  C CG  . PRO A  1 205  ? 268.303 226.558 257.915 1.00 65.61  ? 174  PRO A CG  1 
ATOM   1279  C CD  . PRO A  1 205  ? 266.903 226.148 257.584 1.00 65.61  ? 174  PRO A CD  1 
ATOM   1280  N N   . PHE A  1 206  ? 268.526 229.208 254.407 1.00 66.22  ? 175  PHE A N   1 
ATOM   1281  C CA  . PHE A  1 206  ? 269.367 229.351 253.226 1.00 66.22  ? 175  PHE A CA  1 
ATOM   1282  C C   . PHE A  1 206  ? 270.223 230.599 253.386 1.00 66.22  ? 175  PHE A C   1 
ATOM   1283  O O   . PHE A  1 206  ? 269.972 231.443 254.249 1.00 66.22  ? 175  PHE A O   1 
ATOM   1284  C CB  . PHE A  1 206  ? 268.534 229.422 251.941 1.00 66.22  ? 175  PHE A CB  1 
ATOM   1285  C CG  . PHE A  1 206  ? 267.415 230.419 251.996 1.00 66.22  ? 175  PHE A CG  1 
ATOM   1286  C CD1 . PHE A  1 206  ? 267.662 231.771 251.860 1.00 66.22  ? 175  PHE A CD1 1 
ATOM   1287  C CD2 . PHE A  1 206  ? 266.114 230.000 252.185 1.00 66.22  ? 175  PHE A CD2 1 
ATOM   1288  C CE1 . PHE A  1 206  ? 266.637 232.681 251.914 1.00 66.22  ? 175  PHE A CE1 1 
ATOM   1289  C CE2 . PHE A  1 206  ? 265.089 230.905 252.238 1.00 66.22  ? 175  PHE A CE2 1 
ATOM   1290  C CZ  . PHE A  1 206  ? 265.351 232.248 252.102 1.00 66.22  ? 175  PHE A CZ  1 
ATOM   1291  N N   . LEU A  1 207  ? 271.248 230.710 252.550 1.00 74.60  ? 176  LEU A N   1 
ATOM   1292  C CA  . LEU A  1 207  ? 272.063 231.915 252.447 1.00 74.60  ? 176  LEU A CA  1 
ATOM   1293  C C   . LEU A  1 207  ? 271.825 232.580 251.097 1.00 74.60  ? 176  LEU A C   1 
ATOM   1294  O O   . LEU A  1 207  ? 272.003 231.946 250.052 1.00 74.60  ? 176  LEU A O   1 
ATOM   1295  C CB  . LEU A  1 207  ? 273.539 231.573 252.631 1.00 74.60  ? 176  LEU A CB  1 
ATOM   1296  C CG  . LEU A  1 207  ? 273.923 231.187 254.059 1.00 74.60  ? 176  LEU A CG  1 
ATOM   1297  C CD1 . LEU A  1 207  ? 275.379 230.762 254.139 1.00 74.60  ? 176  LEU A CD1 1 
ATOM   1298  C CD2 . LEU A  1 207  ? 273.656 232.348 254.998 1.00 74.60  ? 176  LEU A CD2 1 
ATOM   1299  N N   . MET A  1 208  ? 271.432 233.851 251.119 1.00 79.06  ? 177  MET A N   1 
ATOM   1300  C CA  . MET A  1 208  ? 271.203 234.611 249.900 1.00 79.06  ? 177  MET A CA  1 
ATOM   1301  C C   . MET A  1 208  ? 272.434 235.454 249.566 1.00 79.06  ? 177  MET A C   1 
ATOM   1302  O O   . MET A  1 208  ? 273.330 235.644 250.390 1.00 79.06  ? 177  MET A O   1 
ATOM   1303  C CB  . MET A  1 208  ? 269.955 235.490 250.063 1.00 79.06  ? 177  MET A CB  1 
ATOM   1304  C CG  . MET A  1 208  ? 269.449 236.153 248.790 1.00 79.06  ? 177  MET A CG  1 
ATOM   1305  S SD  . MET A  1 208  ? 267.862 236.975 248.990 1.00 79.06  ? 177  MET A SD  1 
ATOM   1306  C CE  . MET A  1 208  ? 266.774 235.564 248.931 1.00 79.06  ? 177  MET A CE  1 
ATOM   1307  N N   . ASP A  1 209  ? 272.470 235.961 248.331 1.00 87.36  ? 178  ASP A N   1 
ATOM   1308  C CA  . ASP A  1 209  ? 273.665 236.627 247.819 1.00 87.36  ? 178  ASP A CA  1 
ATOM   1309  C C   . ASP A  1 209  ? 273.839 238.031 248.392 1.00 87.36  ? 178  ASP A C   1 
ATOM   1310  O O   . ASP A  1 209  ? 274.852 238.328 249.033 1.00 87.36  ? 178  ASP A O   1 
ATOM   1311  C CB  . ASP A  1 209  ? 273.613 236.679 246.292 1.00 87.36  ? 178  ASP A CB  1 
ATOM   1312  C CG  . ASP A  1 209  ? 274.969 236.954 245.672 1.00 87.36  ? 178  ASP A CG  1 
ATOM   1313  O OD1 . ASP A  1 209  ? 275.952 237.100 246.428 1.00 87.36  ? 178  ASP A OD1 1 
ATOM   1314  O OD2 . ASP A  1 209  ? 275.052 237.030 244.427 1.00 87.36  ? 178  ASP A OD2 1 
ATOM   1315  N N   . LEU A  1 210  ? 272.866 238.911 248.148 1.00 86.14  ? 179  LEU A N   1 
ATOM   1316  C CA  . LEU A  1 210  ? 272.772 240.281 248.654 1.00 86.14  ? 179  LEU A CA  1 
ATOM   1317  C C   . LEU A  1 210  ? 273.772 241.240 248.013 1.00 86.14  ? 179  LEU A C   1 
ATOM   1318  O O   . LEU A  1 210  ? 273.720 242.441 248.300 1.00 86.14  ? 179  LEU A O   1 
ATOM   1319  C CB  . LEU A  1 210  ? 272.935 240.367 250.178 1.00 86.14  ? 179  LEU A CB  1 
ATOM   1320  C CG  . LEU A  1 210  ? 271.908 239.596 250.998 1.00 86.14  ? 179  LEU A CG  1 
ATOM   1321  C CD1 . LEU A  1 210  ? 272.181 239.759 252.479 1.00 86.14  ? 179  LEU A CD1 1 
ATOM   1322  C CD2 . LEU A  1 210  ? 270.512 240.051 250.646 1.00 86.14  ? 179  LEU A CD2 1 
ATOM   1323  N N   . GLU A  1 211  ? 274.674 240.764 247.160 1.00 88.94  ? 180  GLU A N   1 
ATOM   1324  C CA  . GLU A  1 211  ? 275.672 241.639 246.559 1.00 88.94  ? 180  GLU A CA  1 
ATOM   1325  C C   . GLU A  1 211  ? 275.056 242.544 245.498 1.00 88.94  ? 180  GLU A C   1 
ATOM   1326  O O   . GLU A  1 211  ? 274.242 242.108 244.681 1.00 88.94  ? 180  GLU A O   1 
ATOM   1327  C CB  . GLU A  1 211  ? 276.796 240.808 245.945 1.00 88.94  ? 180  GLU A CB  1 
ATOM   1328  C CG  . GLU A  1 211  ? 277.904 241.632 245.317 1.00 88.94  ? 180  GLU A CG  1 
ATOM   1329  C CD  . GLU A  1 211  ? 279.016 240.774 244.751 1.00 88.94  ? 180  GLU A CD  1 
ATOM   1330  O OE1 . GLU A  1 211  ? 278.908 239.532 244.833 1.00 88.94  ? 180  GLU A OE1 1 
ATOM   1331  O OE2 . GLU A  1 211  ? 280.000 241.339 244.227 1.00 88.94  ? 180  GLU A OE2 1 
ATOM   1332  N N   . GLY A  1 212  ? 275.438 243.818 245.528 1.00 86.69  ? 181  GLY A N   1 
ATOM   1333  C CA  . GLY A  1 212  ? 274.997 244.752 244.502 1.00 86.69  ? 181  GLY A CA  1 
ATOM   1334  C C   . GLY A  1 212  ? 275.663 244.458 243.167 1.00 86.69  ? 181  GLY A C   1 
ATOM   1335  O O   . GLY A  1 212  ? 276.885 244.286 243.092 1.00 86.69  ? 181  GLY A O   1 
ATOM   1336  N N   . LYS A  1 213  ? 274.864 244.402 242.106 1.00 83.86  ? 182  LYS A N   1 
ATOM   1337  C CA  . LYS A  1 213  ? 275.348 244.130 240.760 1.00 83.86  ? 182  LYS A CA  1 
ATOM   1338  C C   . LYS A  1 213  ? 275.324 245.393 239.908 1.00 83.86  ? 182  LYS A C   1 
ATOM   1339  O O   . LYS A  1 213  ? 274.675 246.387 240.244 1.00 83.86  ? 182  LYS A O   1 
ATOM   1340  C CB  . LYS A  1 213  ? 274.516 243.035 240.092 1.00 83.86  ? 182  LYS A CB  1 
ATOM   1341  C CG  . LYS A  1 213  ? 274.483 241.736 240.864 1.00 83.86  ? 182  LYS A CG  1 
ATOM   1342  C CD  . LYS A  1 213  ? 275.870 241.145 241.000 1.00 83.86  ? 182  LYS A CD  1 
ATOM   1343  C CE  . LYS A  1 213  ? 275.826 239.812 241.723 1.00 83.86  ? 182  LYS A CE  1 
ATOM   1344  N NZ  . LYS A  1 213  ? 277.183 239.222 241.879 1.00 83.86  ? 182  LYS A NZ  1 
ATOM   1345  N N   . GLN A  1 214  ? 276.053 245.341 238.788 1.00 84.41  ? 183  GLN A N   1 
ATOM   1346  C CA  . GLN A  1 214  ? 276.250 246.497 237.923 1.00 84.41  ? 183  GLN A CA  1 
ATOM   1347  C C   . GLN A  1 214  ? 275.690 246.353 236.515 1.00 84.41  ? 183  GLN A C   1 
ATOM   1348  O O   . GLN A  1 214  ? 275.435 247.377 235.872 1.00 84.41  ? 183  GLN A O   1 
ATOM   1349  C CB  . GLN A  1 214  ? 277.746 246.832 237.810 1.00 84.41  ? 183  GLN A CB  1 
ATOM   1350  C CG  . GLN A  1 214  ? 278.366 247.358 239.088 1.00 84.41  ? 183  GLN A CG  1 
ATOM   1351  C CD  . GLN A  1 214  ? 277.636 248.575 239.621 1.00 84.41  ? 183  GLN A CD  1 
ATOM   1352  O OE1 . GLN A  1 214  ? 277.377 249.527 238.886 1.00 84.41  ? 183  GLN A OE1 1 
ATOM   1353  N NE2 . GLN A  1 214  ? 277.301 248.551 240.905 1.00 84.41  ? 183  GLN A NE2 1 
ATOM   1354  N N   . GLY A  1 215  ? 275.486 245.137 236.020 1.00 80.00  ? 184  GLY A N   1 
ATOM   1355  C CA  . GLY A  1 215  ? 274.982 244.951 234.677 1.00 80.00  ? 184  GLY A CA  1 
ATOM   1356  C C   . GLY A  1 215  ? 273.533 245.386 234.530 1.00 80.00  ? 184  GLY A C   1 
ATOM   1357  O O   . GLY A  1 215  ? 272.956 246.073 235.372 1.00 80.00  ? 184  GLY A O   1 
ATOM   1358  N N   . ASN A  1 216  ? 272.946 244.989 233.404 1.00 74.01  ? 185  ASN A N   1 
ATOM   1359  C CA  . ASN A  1 216  ? 271.520 245.189 233.213 1.00 74.01  ? 185  ASN A CA  1 
ATOM   1360  C C   . ASN A  1 216  ? 270.723 244.082 233.902 1.00 74.01  ? 185  ASN A C   1 
ATOM   1361  O O   . ASN A  1 216  ? 271.275 243.103 234.410 1.00 74.01  ? 185  ASN A O   1 
ATOM   1362  C CB  . ASN A  1 216  ? 271.188 245.270 231.726 1.00 74.01  ? 185  ASN A CB  1 
ATOM   1363  C CG  . ASN A  1 216  ? 271.862 244.188 230.918 1.00 74.01  ? 185  ASN A CG  1 
ATOM   1364  O OD1 . ASN A  1 216  ? 272.512 243.300 231.467 1.00 74.01  ? 185  ASN A OD1 1 
ATOM   1365  N ND2 . ASN A  1 216  ? 271.721 244.261 229.600 1.00 74.01  ? 185  ASN A ND2 1 
ATOM   1366  N N   . PHE A  1 217  ? 269.402 244.251 233.905 1.00 66.79  ? 186  PHE A N   1 
ATOM   1367  C CA  . PHE A  1 217  ? 268.504 243.322 234.581 1.00 66.79  ? 186  PHE A CA  1 
ATOM   1368  C C   . PHE A  1 217  ? 268.651 241.902 234.051 1.00 66.79  ? 186  PHE A C   1 
ATOM   1369  O O   . PHE A  1 217  ? 268.689 241.680 232.839 1.00 66.79  ? 186  PHE A O   1 
ATOM   1370  C CB  . PHE A  1 217  ? 267.065 243.800 234.419 1.00 66.79  ? 186  PHE A CB  1 
ATOM   1371  C CG  . PHE A  1 217  ? 266.781 245.092 235.119 1.00 66.79  ? 186  PHE A CG  1 
ATOM   1372  C CD1 . PHE A  1 217  ? 267.350 245.367 236.348 1.00 66.79  ? 186  PHE A CD1 1 
ATOM   1373  C CD2 . PHE A  1 217  ? 265.957 246.039 234.544 1.00 66.79  ? 186  PHE A CD2 1 
ATOM   1374  C CE1 . PHE A  1 217  ? 267.095 246.555 236.990 1.00 66.79  ? 186  PHE A CE1 1 
ATOM   1375  C CE2 . PHE A  1 217  ? 265.702 247.228 235.183 1.00 66.79  ? 186  PHE A CE2 1 
ATOM   1376  C CZ  . PHE A  1 217  ? 266.271 247.486 236.406 1.00 66.79  ? 186  PHE A CZ  1 
ATOM   1377  N N   . LYS A  1 218  ? 268.737 240.938 234.969 1.00 63.04  ? 187  LYS A N   1 
ATOM   1378  C CA  . LYS A  1 218  ? 268.995 239.549 234.619 1.00 63.04  ? 187  LYS A CA  1 
ATOM   1379  C C   . LYS A  1 218  ? 267.907 238.560 235.023 1.00 63.04  ? 187  LYS A C   1 
ATOM   1380  O O   . LYS A  1 218  ? 268.002 237.391 234.635 1.00 63.04  ? 187  LYS A O   1 
ATOM   1381  C CB  . LYS A  1 218  ? 270.335 239.078 235.199 1.00 63.04  ? 187  LYS A CB  1 
ATOM   1382  C CG  . LYS A  1 218  ? 271.534 239.756 234.576 1.00 63.04  ? 187  LYS A CG  1 
ATOM   1383  C CD  . LYS A  1 218  ? 272.821 239.268 235.202 1.00 63.04  ? 187  LYS A CD  1 
ATOM   1384  C CE  . LYS A  1 218  ? 274.030 239.923 234.567 1.00 63.04  ? 187  LYS A CE  1 
ATOM   1385  N NZ  . LYS A  1 218  ? 275.298 239.459 235.198 1.00 63.04  ? 187  LYS A NZ  1 
ATOM   1386  N N   . ASN A  1 219  ? 266.892 238.964 235.786 1.00 57.26  ? 188  ASN A N   1 
ATOM   1387  C CA  . ASN A  1 219  ? 265.922 237.996 236.285 1.00 57.26  ? 188  ASN A CA  1 
ATOM   1388  C C   . ASN A  1 219  ? 264.521 238.579 236.230 1.00 57.26  ? 188  ASN A C   1 
ATOM   1389  O O   . ASN A  1 219  ? 264.278 239.669 236.756 1.00 57.26  ? 188  ASN A O   1 
ATOM   1390  C CB  . ASN A  1 219  ? 266.242 237.592 237.726 1.00 57.26  ? 188  ASN A CB  1 
ATOM   1391  C CG  . ASN A  1 219  ? 267.395 236.627 237.818 1.00 57.26  ? 188  ASN A CG  1 
ATOM   1392  O OD1 . ASN A  1 219  ? 268.438 236.942 238.387 1.00 57.26  ? 188  ASN A OD1 1 
ATOM   1393  N ND2 . ASN A  1 219  ? 267.219 235.442 237.253 1.00 57.26  ? 188  ASN A ND2 1 
ATOM   1394  N N   . LEU A  1 220  ? 263.601 237.846 235.606 1.00 49.06  ? 189  LEU A N   1 
ATOM   1395  C CA  . LEU A  1 220  ? 262.185 238.177 235.605 1.00 49.06  ? 189  LEU A CA  1 
ATOM   1396  C C   . LEU A  1 220  ? 261.445 237.174 236.477 1.00 49.06  ? 189  LEU A C   1 
ATOM   1397  O O   . LEU A  1 220  ? 261.584 235.964 236.288 1.00 49.06  ? 189  LEU A O   1 
ATOM   1398  C CB  . LEU A  1 220  ? 261.634 238.153 234.180 1.00 49.06  ? 189  LEU A CB  1 
ATOM   1399  C CG  . LEU A  1 220  ? 260.150 238.393 233.923 1.00 49.06  ? 189  LEU A CG  1 
ATOM   1400  C CD1 . LEU A  1 220  ? 259.754 239.803 234.304 1.00 49.06  ? 189  LEU A CD1 1 
ATOM   1401  C CD2 . LEU A  1 220  ? 259.827 238.122 232.472 1.00 49.06  ? 189  LEU A CD2 1 
ATOM   1402  N N   . ARG A  1 221  ? 260.666 237.669 237.431 1.00 46.61  ? 190  ARG A N   1 
ATOM   1403  C CA  . ARG A  1 221  ? 259.880 236.816 238.315 1.00 46.61  ? 190  ARG A CA  1 
ATOM   1404  C C   . ARG A  1 221  ? 258.418 237.221 238.242 1.00 46.61  ? 190  ARG A C   1 
ATOM   1405  O O   . ARG A  1 221  ? 258.080 238.375 238.523 1.00 46.61  ? 190  ARG A O   1 
ATOM   1406  C CB  . ARG A  1 221  ? 260.383 236.884 239.754 1.00 46.61  ? 190  ARG A CB  1 
ATOM   1407  C CG  . ARG A  1 221  ? 261.882 236.782 239.919 1.00 46.61  ? 190  ARG A CG  1 
ATOM   1408  C CD  . ARG A  1 221  ? 262.204 236.640 241.391 1.00 46.61  ? 190  ARG A CD  1 
ATOM   1409  N NE  . ARG A  1 221  ? 263.458 237.277 241.777 1.00 46.61  ? 190  ARG A NE  1 
ATOM   1410  C CZ  . ARG A  1 221  ? 264.645 236.691 241.698 1.00 46.61  ? 190  ARG A CZ  1 
ATOM   1411  N NH1 . ARG A  1 221  ? 264.741 235.454 241.238 1.00 46.61  ? 190  ARG A NH1 1 
ATOM   1412  N NH2 . ARG A  1 221  ? 265.736 237.338 242.079 1.00 46.61  ? 190  ARG A NH2 1 
ATOM   1413  N N   . GLU A  1 222  ? 257.566 236.292 237.816 1.00 40.29  ? 191  GLU A N   1 
ATOM   1414  C CA  . GLU A  1 222  ? 256.149 236.548 237.605 1.00 40.29  ? 191  GLU A CA  1 
ATOM   1415  C C   . GLU A  1 222  ? 255.321 235.779 238.622 1.00 40.29  ? 191  GLU A C   1 
ATOM   1416  O O   . GLU A  1 222  ? 255.564 234.590 238.844 1.00 40.29  ? 191  GLU A O   1 
ATOM   1417  C CB  . GLU A  1 222  ? 255.731 236.169 236.187 1.00 40.29  ? 191  GLU A CB  1 
ATOM   1418  C CG  . GLU A  1 222  ? 256.388 237.019 235.123 1.00 40.29  ? 191  GLU A CG  1 
ATOM   1419  C CD  . GLU A  1 222  ? 256.028 236.587 233.722 1.00 40.29  ? 191  GLU A CD  1 
ATOM   1420  O OE1 . GLU A  1 222  ? 255.498 235.472 233.552 1.00 40.29  ? 191  GLU A OE1 1 
ATOM   1421  O OE2 . GLU A  1 222  ? 256.265 237.370 232.783 1.00 40.29  ? 191  GLU A OE2 1 
ATOM   1422  N N   . PHE A  1 223  ? 254.354 236.459 239.241 1.00 32.95  ? 192  PHE A N   1 
ATOM   1423  C CA  . PHE A  1 223  ? 253.461 235.870 240.230 1.00 32.95  ? 192  PHE A CA  1 
ATOM   1424  C C   . PHE A  1 223  ? 252.019 236.212 239.893 1.00 32.95  ? 192  PHE A C   1 
ATOM   1425  O O   . PHE A  1 223  ? 251.730 237.281 239.352 1.00 32.95  ? 192  PHE A O   1 
ATOM   1426  C CB  . PHE A  1 223  ? 253.728 236.368 241.654 1.00 32.95  ? 192  PHE A CB  1 
ATOM   1427  C CG  . PHE A  1 223  ? 255.092 236.057 242.174 1.00 32.95  ? 192  PHE A CG  1 
ATOM   1428  C CD1 . PHE A  1 223  ? 256.146 236.917 241.950 1.00 32.95  ? 192  PHE A CD1 1 
ATOM   1429  C CD2 . PHE A  1 223  ? 255.320 234.900 242.887 1.00 32.95  ? 192  PHE A CD2 1 
ATOM   1430  C CE1 . PHE A  1 223  ? 257.396 236.633 242.435 1.00 32.95  ? 192  PHE A CE1 1 
ATOM   1431  C CE2 . PHE A  1 223  ? 256.571 234.607 243.363 1.00 32.95  ? 192  PHE A CE2 1 
ATOM   1432  C CZ  . PHE A  1 223  ? 257.610 235.475 243.137 1.00 32.95  ? 192  PHE A CZ  1 
ATOM   1433  N N   . VAL A  1 224  ? 251.112 235.300 240.232 1.00 31.12  ? 193  VAL A N   1 
ATOM   1434  C CA  . VAL A  1 224  ? 249.676 235.554 240.170 1.00 31.12  ? 193  VAL A CA  1 
ATOM   1435  C C   . VAL A  1 224  ? 249.074 235.213 241.524 1.00 31.12  ? 193  VAL A C   1 
ATOM   1436  O O   . VAL A  1 224  ? 249.302 234.115 242.050 1.00 31.12  ? 193  VAL A O   1 
ATOM   1437  C CB  . VAL A  1 224  ? 248.986 234.742 239.060 1.00 31.12  ? 193  VAL A CB  1 
ATOM   1438  C CG1 . VAL A  1 224  ? 247.486 234.803 239.224 1.00 31.12  ? 193  VAL A CG1 1 
ATOM   1439  C CG2 . VAL A  1 224  ? 249.382 235.256 237.701 1.00 31.12  ? 193  VAL A CG2 1 
ATOM   1440  N N   . PHE A  1 225  ? 248.311 236.157 242.082 1.00 32.06  ? 194  PHE A N   1 
ATOM   1441  C CA  . PHE A  1 225  ? 247.721 236.054 243.411 1.00 32.06  ? 194  PHE A CA  1 
ATOM   1442  C C   . PHE A  1 225  ? 246.201 236.062 243.314 1.00 32.06  ? 194  PHE A C   1 
ATOM   1443  O O   . PHE A  1 225  ? 245.627 236.969 242.697 1.00 32.06  ? 194  PHE A O   1 
ATOM   1444  C CB  . PHE A  1 225  ? 248.167 237.212 244.304 1.00 32.06  ? 194  PHE A CB  1 
ATOM   1445  C CG  . PHE A  1 225  ? 249.643 237.261 244.553 1.00 32.06  ? 194  PHE A CG  1 
ATOM   1446  C CD1 . PHE A  1 225  ? 250.385 238.347 244.138 1.00 32.06  ? 194  PHE A CD1 1 
ATOM   1447  C CD2 . PHE A  1 225  ? 250.291 236.222 245.181 1.00 32.06  ? 194  PHE A CD2 1 
ATOM   1448  C CE1 . PHE A  1 225  ? 251.732 238.401 244.361 1.00 32.06  ? 194  PHE A CE1 1 
ATOM   1449  C CE2 . PHE A  1 225  ? 251.642 236.277 245.403 1.00 32.06  ? 194  PHE A CE2 1 
ATOM   1450  C CZ  . PHE A  1 225  ? 252.360 237.366 244.989 1.00 32.06  ? 194  PHE A CZ  1 
ATOM   1451  N N   . LYS A  1 226  ? 245.554 235.072 243.935 1.00 33.75  ? 195  LYS A N   1 
ATOM   1452  C CA  . LYS A  1 226  ? 244.097 234.966 243.965 1.00 33.75  ? 195  LYS A CA  1 
ATOM   1453  C C   . LYS A  1 226  ? 243.631 234.690 245.390 1.00 33.75  ? 195  LYS A C   1 
ATOM   1454  O O   . LYS A  1 226  ? 244.371 234.141 246.203 1.00 33.75  ? 195  LYS A O   1 
ATOM   1455  C CB  . LYS A  1 226  ? 243.581 233.873 243.027 1.00 33.75  ? 195  LYS A CB  1 
ATOM   1456  C CG  . LYS A  1 226  ? 243.872 234.119 241.572 1.00 33.75  ? 195  LYS A CG  1 
ATOM   1457  C CD  . LYS A  1 226  ? 243.757 232.846 240.767 1.00 33.75  ? 195  LYS A CD  1 
ATOM   1458  C CE  . LYS A  1 226  ? 242.327 232.420 240.603 1.00 33.75  ? 195  LYS A CE  1 
ATOM   1459  N NZ  . LYS A  1 226  ? 242.232 231.241 239.718 1.00 33.75  ? 195  LYS A NZ  1 
ATOM   1460  N N   . ASN A  1 227  ? 242.382 235.059 245.685 1.00 36.29  ? 196  ASN A N   1 
ATOM   1461  C CA  . ASN A  1 227  ? 241.788 234.879 247.017 1.00 36.29  ? 196  ASN A CA  1 
ATOM   1462  C C   . ASN A  1 227  ? 240.364 234.349 246.861 1.00 36.29  ? 196  ASN A C   1 
ATOM   1463  O O   . ASN A  1 227  ? 239.440 235.128 246.616 1.00 36.29  ? 196  ASN A O   1 
ATOM   1464  C CB  . ASN A  1 227  ? 241.803 236.200 247.775 1.00 36.29  ? 196  ASN A CB  1 
ATOM   1465  C CG  . ASN A  1 227  ? 241.710 236.027 249.271 1.00 36.29  ? 196  ASN A CG  1 
ATOM   1466  O OD1 . ASN A  1 227  ? 242.035 234.977 249.809 1.00 36.29  ? 196  ASN A OD1 1 
ATOM   1467  N ND2 . ASN A  1 227  ? 241.272 237.071 249.954 1.00 36.29  ? 196  ASN A ND2 1 
ATOM   1468  N N   . ILE A  1 228  ? 240.177 233.036 247.013 1.00 40.98  ? 197  ILE A N   1 
ATOM   1469  C CA  . ILE A  1 228  ? 238.886 232.398 246.742 1.00 40.98  ? 197  ILE A CA  1 
ATOM   1470  C C   . ILE A  1 228  ? 238.537 231.418 247.860 1.00 40.98  ? 197  ILE A C   1 
ATOM   1471  O O   . ILE A  1 228  ? 239.306 230.492 248.137 1.00 40.98  ? 197  ILE A O   1 
ATOM   1472  C CB  . ILE A  1 228  ? 238.887 231.661 245.392 1.00 40.98  ? 197  ILE A CB  1 
ATOM   1473  C CG1 . ILE A  1 228  ? 239.130 232.636 244.244 1.00 40.98  ? 197  ILE A CG1 1 
ATOM   1474  C CG2 . ILE A  1 228  ? 237.572 230.941 245.190 1.00 40.98  ? 197  ILE A CG2 1 
ATOM   1475  C CD1 . ILE A  1 228  ? 239.297 231.963 242.913 1.00 40.98  ? 197  ILE A CD1 1 
ATOM   1476  N N   . ASP A  1 229  ? 237.369 231.609 248.479 1.00 42.54  ? 198  ASP A N   1 
ATOM   1477  C CA  . ASP A  1 229  ? 236.797 230.691 249.476 1.00 42.54  ? 198  ASP A CA  1 
ATOM   1478  C C   . ASP A  1 229  ? 237.770 230.376 250.606 1.00 42.54  ? 198  ASP A C   1 
ATOM   1479  O O   . ASP A  1 229  ? 237.927 229.227 251.019 1.00 42.54  ? 198  ASP A O   1 
ATOM   1480  C CB  . ASP A  1 229  ? 236.311 229.392 248.830 1.00 42.54  ? 198  ASP A CB  1 
ATOM   1481  C CG  . ASP A  1 229  ? 235.036 229.568 248.032 1.00 42.54  ? 198  ASP A CG  1 
ATOM   1482  O OD1 . ASP A  1 229  ? 234.335 230.583 248.223 1.00 42.54  ? 198  ASP A OD1 1 
ATOM   1483  O OD2 . ASP A  1 229  ? 234.723 228.672 247.224 1.00 42.54  ? 198  ASP A OD2 1 
ATOM   1484  N N   . GLY A  1 230  ? 238.427 231.406 251.119 1.00 40.01  ? 199  GLY A N   1 
ATOM   1485  C CA  . GLY A  1 230  ? 239.336 231.204 252.220 1.00 40.01  ? 199  GLY A CA  1 
ATOM   1486  C C   . GLY A  1 230  ? 240.702 230.701 251.831 1.00 40.01  ? 199  GLY A C   1 
ATOM   1487  O O   . GLY A  1 230  ? 241.526 230.461 252.718 1.00 40.01  ? 199  GLY A O   1 
ATOM   1488  N N   . TYR A  1 231  ? 240.964 230.506 250.543 1.00 38.28  ? 200  TYR A N   1 
ATOM   1489  C CA  . TYR A  1 231  ? 242.256 230.048 250.059 1.00 38.28  ? 200  TYR A CA  1 
ATOM   1490  C C   . TYR A  1 231  ? 242.956 231.179 249.327 1.00 38.28  ? 200  TYR A C   1 
ATOM   1491  O O   . TYR A  1 231  ? 242.374 231.794 248.432 1.00 38.28  ? 200  TYR A O   1 
ATOM   1492  C CB  . TYR A  1 231  ? 242.073 228.850 249.131 1.00 38.28  ? 200  TYR A CB  1 
ATOM   1493  C CG  . TYR A  1 231  ? 241.619 227.616 249.866 1.00 38.28  ? 200  TYR A CG  1 
ATOM   1494  C CD1 . TYR A  1 231  ? 240.290 227.227 249.829 1.00 38.28  ? 200  TYR A CD1 1 
ATOM   1495  C CD2 . TYR A  1 231  ? 242.509 226.844 250.592 1.00 38.28  ? 200  TYR A CD2 1 
ATOM   1496  C CE1 . TYR A  1 231  ? 239.855 226.113 250.499 1.00 38.28  ? 200  TYR A CE1 1 
ATOM   1497  C CE2 . TYR A  1 231  ? 242.084 225.723 251.268 1.00 38.28  ? 200  TYR A CE2 1 
ATOM   1498  C CZ  . TYR A  1 231  ? 240.753 225.362 251.216 1.00 38.28  ? 200  TYR A CZ  1 
ATOM   1499  O OH  . TYR A  1 231  ? 240.305 224.248 251.882 1.00 38.28  ? 200  TYR A OH  1 
ATOM   1500  N N   . PHE A  1 232  ? 244.199 231.443 249.703 1.00 33.32  ? 201  PHE A N   1 
ATOM   1501  C CA  . PHE A  1 232  ? 245.079 232.358 248.986 1.00 33.32  ? 201  PHE A CA  1 
ATOM   1502  C C   . PHE A  1 232  ? 245.964 231.532 248.060 1.00 33.32  ? 201  PHE A C   1 
ATOM   1503  O O   . PHE A  1 232  ? 246.799 230.752 248.525 1.00 33.32  ? 201  PHE A O   1 
ATOM   1504  C CB  . PHE A  1 232  ? 245.901 233.193 249.961 1.00 33.32  ? 201  PHE A CB  1 
ATOM   1505  C CG  . PHE A  1 232  ? 246.671 234.301 249.312 1.00 33.32  ? 201  PHE A CG  1 
ATOM   1506  C CD1 . PHE A  1 232  ? 246.063 235.506 249.027 1.00 33.32  ? 201  PHE A CD1 1 
ATOM   1507  C CD2 . PHE A  1 232  ? 248.010 234.149 249.018 1.00 33.32  ? 201  PHE A CD2 1 
ATOM   1508  C CE1 . PHE A  1 232  ? 246.767 236.522 248.435 1.00 33.32  ? 201  PHE A CE1 1 
ATOM   1509  C CE2 . PHE A  1 232  ? 248.718 235.165 248.427 1.00 33.32  ? 201  PHE A CE2 1 
ATOM   1510  C CZ  . PHE A  1 232  ? 248.096 236.352 248.135 1.00 33.32  ? 201  PHE A CZ  1 
ATOM   1511  N N   . LYS A  1 233  ? 245.770 231.687 246.757 1.00 34.39  ? 202  LYS A N   1 
ATOM   1512  C CA  . LYS A  1 233  ? 246.419 230.851 245.758 1.00 34.39  ? 202  LYS A CA  1 
ATOM   1513  C C   . LYS A  1 233  ? 247.532 231.638 245.088 1.00 34.39  ? 202  LYS A C   1 
ATOM   1514  O O   . LYS A  1 233  ? 247.320 232.782 244.668 1.00 34.39  ? 202  LYS A O   1 
ATOM   1515  C CB  . LYS A  1 233  ? 245.412 230.398 244.706 1.00 34.39  ? 202  LYS A CB  1 
ATOM   1516  C CG  . LYS A  1 233  ? 244.353 229.471 245.226 1.00 34.39  ? 202  LYS A CG  1 
ATOM   1517  C CD  . LYS A  1 233  ? 243.429 229.048 244.118 1.00 34.39  ? 202  LYS A CD  1 
ATOM   1518  C CE  . LYS A  1 233  ? 242.412 228.058 244.620 1.00 34.39  ? 202  LYS A CE  1 
ATOM   1519  N NZ  . LYS A  1 233  ? 241.492 227.644 243.531 1.00 34.39  ? 202  LYS A NZ  1 
ATOM   1520  N N   . ILE A  1 234  ? 248.699 231.010 244.956 1.00 31.72  ? 203  ILE A N   1 
ATOM   1521  C CA  . ILE A  1 234  ? 249.874 231.637 244.365 1.00 31.72  ? 203  ILE A CA  1 
ATOM   1522  C C   . ILE A  1 234  ? 250.383 230.754 243.236 1.00 31.72  ? 203  ILE A C   1 
ATOM   1523  O O   . ILE A  1 234  ? 250.675 229.569 243.461 1.00 31.72  ? 203  ILE A O   1 
ATOM   1524  C CB  . ILE A  1 234  ? 250.989 231.865 245.399 1.00 31.72  ? 203  ILE A CB  1 
ATOM   1525  C CG1 . ILE A  1 234  ? 250.454 232.613 246.614 1.00 31.72  ? 203  ILE A CG1 1 
ATOM   1526  C CG2 . ILE A  1 234  ? 252.122 232.649 244.786 1.00 31.72  ? 203  ILE A CG2 1 
ATOM   1527  C CD1 . ILE A  1 234  ? 251.456 232.757 247.728 1.00 31.72  ? 203  ILE A CD1 1 
ATOM   1528  N N   . TYR A  1 235  ? 250.514 231.343 242.041 1.00 32.09  ? 204  TYR A N   1 
ATOM   1529  C CA  . TYR A  1 235  ? 251.216 230.761 240.901 1.00 32.09  ? 204  TYR A CA  1 
ATOM   1530  C C   . TYR A  1 235  ? 252.460 231.594 240.618 1.00 32.09  ? 204  TYR A C   1 
ATOM   1531  O O   . TYR A  1 235  ? 252.468 232.802 240.857 1.00 32.09  ? 204  TYR A O   1 
ATOM   1532  C CB  . TYR A  1 235  ? 250.332 230.731 239.648 1.00 32.09  ? 204  TYR A CB  1 
ATOM   1533  C CG  . TYR A  1 235  ? 248.985 230.087 239.843 1.00 32.09  ? 204  TYR A CG  1 
ATOM   1534  C CD1 . TYR A  1 235  ? 247.931 230.793 240.394 1.00 32.09  ? 204  TYR A CD1 1 
ATOM   1535  C CD2 . TYR A  1 235  ? 248.756 228.787 239.437 1.00 32.09  ? 204  TYR A CD2 1 
ATOM   1536  C CE1 . TYR A  1 235  ? 246.705 230.212 240.574 1.00 32.09  ? 204  TYR A CE1 1 
ATOM   1537  C CE2 . TYR A  1 235  ? 247.530 228.200 239.610 1.00 32.09  ? 204  TYR A CE2 1 
ATOM   1538  C CZ  . TYR A  1 235  ? 246.511 228.917 240.184 1.00 32.09  ? 204  TYR A CZ  1 
ATOM   1539  O OH  . TYR A  1 235  ? 245.282 228.340 240.354 1.00 32.09  ? 204  TYR A OH  1 
ATOM   1540  N N   . SER A  1 236  ? 253.500 230.969 240.067 1.00 36.41  ? 205  SER A N   1 
ATOM   1541  C CA  . SER A  1 236  ? 254.731 231.716 239.836 1.00 36.41  ? 205  SER A CA  1 
ATOM   1542  C C   . SER A  1 236  ? 255.574 231.081 238.739 1.00 36.41  ? 205  SER A C   1 
ATOM   1543  O O   . SER A  1 236  ? 255.396 229.916 238.384 1.00 36.41  ? 205  SER A O   1 
ATOM   1544  C CB  . SER A  1 236  ? 255.556 231.816 241.117 1.00 36.41  ? 205  SER A CB  1 
ATOM   1545  O OG  . SER A  1 236  ? 256.107 230.559 241.456 1.00 36.41  ? 205  SER A OG  1 
ATOM   1546  N N   . LYS A  1 237  ? 256.504 231.879 238.211 1.00 44.51  ? 206  LYS A N   1 
ATOM   1547  C CA  . LYS A  1 237  ? 257.560 231.374 237.337 1.00 44.51  ? 206  LYS A CA  1 
ATOM   1548  C C   . LYS A  1 237  ? 258.744 232.336 237.313 1.00 44.51  ? 206  LYS A C   1 
ATOM   1549  O O   . LYS A  1 237  ? 258.576 233.557 237.386 1.00 44.51  ? 206  LYS A O   1 
ATOM   1550  C CB  . LYS A  1 237  ? 257.056 231.139 235.910 1.00 44.51  ? 206  LYS A CB  1 
ATOM   1551  C CG  . LYS A  1 237  ? 258.141 230.685 234.947 1.00 44.51  ? 206  LYS A CG  1 
ATOM   1552  C CD  . LYS A  1 237  ? 257.611 229.860 233.796 1.00 44.51  ? 206  LYS A CD  1 
ATOM   1553  C CE  . LYS A  1 237  ? 257.382 228.415 234.194 1.00 44.51  ? 206  LYS A CE  1 
ATOM   1554  N NZ  . LYS A  1 237  ? 258.657 227.714 234.493 1.00 44.51  ? 206  LYS A NZ  1 
ATOM   1555  N N   . HIS A  1 238  ? 259.944 231.762 237.210 1.00 53.44  ? 207  HIS A N   1 
ATOM   1556  C CA  . HIS A  1 238  ? 261.193 232.506 237.134 1.00 53.44  ? 207  HIS A CA  1 
ATOM   1557  C C   . HIS A  1 238  ? 261.781 232.343 235.737 1.00 53.44  ? 207  HIS A C   1 
ATOM   1558  O O   . HIS A  1 238  ? 261.757 231.245 235.177 1.00 53.44  ? 207  HIS A O   1 
ATOM   1559  C CB  . HIS A  1 238  ? 262.191 231.995 238.176 1.00 53.44  ? 207  HIS A CB  1 
ATOM   1560  C CG  . HIS A  1 238  ? 261.694 232.079 239.589 1.00 53.44  ? 207  HIS A CG  1 
ATOM   1561  N ND1 . HIS A  1 238  ? 261.590 233.267 240.280 1.00 53.44  ? 207  HIS A ND1 1 
ATOM   1562  C CD2 . HIS A  1 238  ? 261.287 231.111 240.445 1.00 53.44  ? 207  HIS A CD2 1 
ATOM   1563  C CE1 . HIS A  1 238  ? 261.129 233.029 241.496 1.00 53.44  ? 207  HIS A CE1 1 
ATOM   1564  N NE2 . HIS A  1 238  ? 260.937 231.729 241.621 1.00 53.44  ? 207  HIS A NE2 1 
ATOM   1565  N N   . THR A  1 239  ? 262.333 233.424 235.179 1.00 54.13  ? 208  THR A N   1 
ATOM   1566  C CA  . THR A  1 239  ? 262.883 233.396 233.826 1.00 54.13  ? 208  THR A CA  1 
ATOM   1567  C C   . THR A  1 239  ? 264.170 234.208 233.724 1.00 54.13  ? 208  THR A C   1 
ATOM   1568  O O   . THR A  1 239  ? 264.253 235.313 234.284 1.00 54.13  ? 208  THR A O   1 
ATOM   1569  C CB  . THR A  1 239  ? 261.848 233.927 232.824 1.00 54.13  ? 208  THR A CB  1 
ATOM   1570  O OG1 . THR A  1 239  ? 260.745 233.018 232.754 1.00 54.13  ? 208  THR A OG1 1 
ATOM   1571  C CG2 . THR A  1 239  ? 262.444 234.074 231.443 1.00 54.13  ? 208  THR A CG2 1 
ATOM   1572  N N   . PRO A  1 240  ? 265.191 233.690 233.041 1.00 56.02  ? 209  PRO A N   1 
ATOM   1573  C CA  . PRO A  1 240  ? 266.373 234.508 232.739 1.00 56.02  ? 209  PRO A CA  1 
ATOM   1574  C C   . PRO A  1 240  ? 266.141 235.477 231.587 1.00 56.02  ? 209  PRO A C   1 
ATOM   1575  O O   . PRO A  1 240  ? 265.598 235.113 230.542 1.00 56.02  ? 209  PRO A O   1 
ATOM   1576  C CB  . PRO A  1 240  ? 267.430 233.463 232.369 1.00 56.02  ? 209  PRO A CB  1 
ATOM   1577  C CG  . PRO A  1 240  ? 266.640 232.331 231.838 1.00 56.02  ? 209  PRO A CG  1 
ATOM   1578  C CD  . PRO A  1 240  ? 265.387 232.284 232.655 1.00 56.02  ? 209  PRO A CD  1 
ATOM   1579  N N   . ILE A  1 241  ? 266.577 236.723 231.781 1.00 61.13  ? 210  ILE A N   1 
ATOM   1580  C CA  . ILE A  1 241  ? 266.434 237.785 230.790 1.00 61.13  ? 210  ILE A CA  1 
ATOM   1581  C C   . ILE A  1 241  ? 267.733 238.576 230.730 1.00 61.13  ? 210  ILE A C   1 
ATOM   1582  O O   . ILE A  1 241  ? 268.600 238.460 231.597 1.00 61.13  ? 210  ILE A O   1 
ATOM   1583  C CB  . ILE A  1 241  ? 265.262 238.740 231.097 1.00 61.13  ? 210  ILE A CB  1 
ATOM   1584  C CG1 . ILE A  1 241  ? 265.491 239.438 232.438 1.00 61.13  ? 210  ILE A CG1 1 
ATOM   1585  C CG2 . ILE A  1 241  ? 263.937 238.006 231.057 1.00 61.13  ? 210  ILE A CG2 1 
ATOM   1586  C CD1 . ILE A  1 241  ? 264.511 240.534 232.731 1.00 61.13  ? 210  ILE A CD1 1 
ATOM   1587  N N   . ASN A  1 242  ? 267.867 239.383 229.674 1.00 69.45  ? 211  ASN A N   1 
ATOM   1588  C CA  . ASN A  1 242  ? 268.980 240.328 229.534 1.00 69.45  ? 211  ASN A CA  1 
ATOM   1589  C C   . ASN A  1 242  ? 268.430 241.588 228.860 1.00 69.45  ? 211  ASN A C   1 
ATOM   1590  O O   . ASN A  1 242  ? 268.410 241.682 227.632 1.00 69.45  ? 211  ASN A O   1 
ATOM   1591  C CB  . ASN A  1 242  ? 270.126 239.708 228.748 1.00 69.45  ? 211  ASN A CB  1 
ATOM   1592  C CG  . ASN A  1 242  ? 271.414 240.489 228.883 1.00 69.45  ? 211  ASN A CG  1 
ATOM   1593  O OD1 . ASN A  1 242  ? 271.474 241.489 229.591 1.00 69.45  ? 211  ASN A OD1 1 
ATOM   1594  N ND2 . ASN A  1 242  ? 272.460 240.023 228.215 1.00 69.45  ? 211  ASN A ND2 1 
ATOM   1595  N N   . LEU A  1 243  ? 267.989 242.554 229.665 1.00 70.08  ? 212  LEU A N   1 
ATOM   1596  C CA  . LEU A  1 243  ? 267.413 243.787 229.140 1.00 70.08  ? 212  LEU A CA  1 
ATOM   1597  C C   . LEU A  1 243  ? 267.625 244.905 230.149 1.00 70.08  ? 212  LEU A C   1 
ATOM   1598  O O   . LEU A  1 243  ? 268.110 244.679 231.258 1.00 70.08  ? 212  LEU A O   1 
ATOM   1599  C CB  . LEU A  1 243  ? 265.926 243.616 228.806 1.00 70.08  ? 212  LEU A CB  1 
ATOM   1600  C CG  . LEU A  1 243  ? 264.951 243.126 229.878 1.00 70.08  ? 212  LEU A CG  1 
ATOM   1601  C CD1 . LEU A  1 243  ? 264.457 244.244 230.771 1.00 70.08  ? 212  LEU A CD1 1 
ATOM   1602  C CD2 . LEU A  1 243  ? 263.788 242.444 229.213 1.00 70.08  ? 212  LEU A CD2 1 
ATOM   1603  N N   . VAL A  1 244  ? 267.249 246.125 229.756 1.00 74.03  ? 213  VAL A N   1 
ATOM   1604  C CA  . VAL A  1 244  ? 267.433 247.285 230.613 1.00 74.03  ? 213  VAL A CA  1 
ATOM   1605  C C   . VAL A  1 244  ? 266.119 247.918 231.068 1.00 74.03  ? 213  VAL A C   1 
ATOM   1606  O O   . VAL A  1 244  ? 266.047 248.406 232.202 1.00 74.03  ? 213  VAL A O   1 
ATOM   1607  C CB  . VAL A  1 244  ? 268.317 248.328 229.896 1.00 74.03  ? 213  VAL A CB  1 
ATOM   1608  C CG1 . VAL A  1 244  ? 268.432 249.599 230.716 1.00 74.03  ? 213  VAL A CG1 1 
ATOM   1609  C CG2 . VAL A  1 244  ? 269.687 247.751 229.602 1.00 74.03  ? 213  VAL A CG2 1 
ATOM   1610  N N   . ARG A  1 245  ? 265.078 247.916 230.241 1.00 74.36  ? 214  ARG A N   1 
ATOM   1611  C CA  . ARG A  1 245  ? 263.844 248.616 230.585 1.00 74.36  ? 214  ARG A CA  1 
ATOM   1612  C C   . ARG A  1 245  ? 262.701 248.003 229.792 1.00 74.36  ? 214  ARG A C   1 
ATOM   1613  O O   . ARG A  1 245  ? 262.924 247.238 228.851 1.00 74.36  ? 214  ARG A O   1 
ATOM   1614  C CB  . ARG A  1 245  ? 263.965 250.121 230.323 1.00 74.36  ? 214  ARG A CB  1 
ATOM   1615  C CG  . ARG A  1 245  ? 263.927 250.512 228.857 1.00 74.36  ? 214  ARG A CG  1 
ATOM   1616  C CD  . ARG A  1 245  ? 263.754 252.017 228.686 1.00 74.36  ? 214  ARG A CD  1 
ATOM   1617  N NE  . ARG A  1 245  ? 262.353 252.421 228.588 1.00 74.36  ? 214  ARG A NE  1 
ATOM   1618  C CZ  . ARG A  1 245  ? 261.586 252.222 227.521 1.00 74.36  ? 214  ARG A CZ  1 
ATOM   1619  N NH1 . ARG A  1 245  ? 262.077 251.620 226.446 1.00 74.36  ? 214  ARG A NH1 1 
ATOM   1620  N NH2 . ARG A  1 245  ? 260.324 252.626 227.526 1.00 74.36  ? 214  ARG A NH2 1 
ATOM   1621  N N   . ASP A  1 246  ? 261.465 248.345 230.192 1.00 69.14  ? 215  ASP A N   1 
ATOM   1622  C CA  . ASP A  1 246  ? 260.269 247.915 229.467 1.00 69.14  ? 215  ASP A CA  1 
ATOM   1623  C C   . ASP A  1 246  ? 260.036 246.416 229.640 1.00 69.14  ? 215  ASP A C   1 
ATOM   1624  O O   . ASP A  1 246  ? 260.927 245.611 229.367 1.00 69.14  ? 215  ASP A O   1 
ATOM   1625  C CB  . ASP A  1 246  ? 260.332 248.301 227.987 1.00 69.14  ? 215  ASP A CB  1 
ATOM   1626  C CG  . ASP A  1 246  ? 259.013 248.076 227.275 1.00 69.14  ? 215  ASP A CG  1 
ATOM   1627  O OD1 . ASP A  1 246  ? 257.975 248.023 227.966 1.00 69.14  ? 215  ASP A OD1 1 
ATOM   1628  O OD2 . ASP A  1 246  ? 259.010 247.956 226.032 1.00 69.14  ? 215  ASP A OD2 1 
ATOM   1629  N N   . LEU A  1 247  ? 258.864 246.031 230.128 1.00 59.24  ? 216  LEU A N   1 
ATOM   1630  C CA  . LEU A  1 247  ? 258.551 244.613 230.243 1.00 59.24  ? 216  LEU A CA  1 
ATOM   1631  C C   . LEU A  1 247  ? 258.638 243.938 228.875 1.00 59.24  ? 216  LEU A C   1 
ATOM   1632  O O   . LEU A  1 247  ? 258.066 244.439 227.899 1.00 59.24  ? 216  LEU A O   1 
ATOM   1633  C CB  . LEU A  1 247  ? 257.147 244.455 230.823 1.00 59.24  ? 216  LEU A CB  1 
ATOM   1634  C CG  . LEU A  1 247  ? 256.593 243.079 231.174 1.00 59.24  ? 216  LEU A CG  1 
ATOM   1635  C CD1 . LEU A  1 247  ? 257.368 242.478 232.322 1.00 59.24  ? 216  LEU A CD1 1 
ATOM   1636  C CD2 . LEU A  1 247  ? 255.128 243.211 231.532 1.00 59.24  ? 216  LEU A CD2 1 
ATOM   1637  N N   . PRO A  1 248  ? 259.329 242.806 228.772 1.00 60.25  ? 217  PRO A N   1 
ATOM   1638  C CA  . PRO A  1 248  ? 259.590 242.176 227.474 1.00 60.25  ? 217  PRO A CA  1 
ATOM   1639  C C   . PRO A  1 248  ? 258.407 241.418 226.886 1.00 60.25  ? 217  PRO A C   1 
ATOM   1640  O O   . PRO A  1 248  ? 257.389 241.166 227.529 1.00 60.25  ? 217  PRO A O   1 
ATOM   1641  C CB  . PRO A  1 248  ? 260.738 241.215 227.790 1.00 60.25  ? 217  PRO A CB  1 
ATOM   1642  C CG  . PRO A  1 248  ? 260.521 240.848 229.198 1.00 60.25  ? 217  PRO A CG  1 
ATOM   1643  C CD  . PRO A  1 248  ? 259.999 242.088 229.868 1.00 60.25  ? 217  PRO A CD  1 
ATOM   1644  N N   . GLN A  1 249  ? 258.579 241.064 225.615 1.00 59.68  ? 218  GLN A N   1 
ATOM   1645  C CA  . GLN A  1 249  ? 257.656 240.255 224.841 1.00 59.68  ? 218  GLN A CA  1 
ATOM   1646  C C   . GLN A  1 249  ? 257.813 238.792 225.240 1.00 59.68  ? 218  GLN A C   1 
ATOM   1647  O O   . GLN A  1 249  ? 258.669 238.429 226.050 1.00 59.68  ? 218  GLN A O   1 
ATOM   1648  C CB  . GLN A  1 249  ? 257.935 240.412 223.349 1.00 59.68  ? 218  GLN A CB  1 
ATOM   1649  C CG  . GLN A  1 249  ? 258.003 241.838 222.848 1.00 59.68  ? 218  GLN A CG  1 
ATOM   1650  C CD  . GLN A  1 249  ? 256.651 242.392 222.477 1.00 59.68  ? 218  GLN A CD  1 
ATOM   1651  O OE1 . GLN A  1 249  ? 256.432 243.602 222.520 1.00 59.68  ? 218  GLN A OE1 1 
ATOM   1652  N NE2 . GLN A  1 249  ? 255.738 241.511 222.085 1.00 59.68  ? 218  GLN A NE2 1 
ATOM   1653  N N   . GLY A  1 250  ? 256.990 237.934 224.656 1.00 54.92  ? 219  GLY A N   1 
ATOM   1654  C CA  . GLY A  1 250  ? 257.136 236.500 224.802 1.00 54.92  ? 219  GLY A CA  1 
ATOM   1655  C C   . GLY A  1 250  ? 255.960 235.874 225.531 1.00 54.92  ? 219  GLY A C   1 
ATOM   1656  O O   . GLY A  1 250  ? 254.991 236.533 225.907 1.00 54.92  ? 219  GLY A O   1 
ATOM   1657  N N   . PHE A  1 251  ? 256.075 234.560 225.714 1.00 48.58  ? 220  PHE A N   1 
ATOM   1658  C CA  . PHE A  1 251  ? 255.041 233.745 226.333 1.00 48.58  ? 220  PHE A CA  1 
ATOM   1659  C C   . PHE A  1 251  ? 255.671 232.758 227.302 1.00 48.58  ? 220  PHE A C   1 
ATOM   1660  O O   . PHE A  1 251  ? 256.689 232.138 226.986 1.00 48.58  ? 220  PHE A O   1 
ATOM   1661  C CB  . PHE A  1 251  ? 254.234 232.994 225.266 1.00 48.58  ? 220  PHE A CB  1 
ATOM   1662  C CG  . PHE A  1 251  ? 252.975 232.376 225.781 1.00 48.58  ? 220  PHE A CG  1 
ATOM   1663  C CD1 . PHE A  1 251  ? 251.766 233.011 225.611 1.00 48.58  ? 220  PHE A CD1 1 
ATOM   1664  C CD2 . PHE A  1 251  ? 252.998 231.155 226.419 1.00 48.58  ? 220  PHE A CD2 1 
ATOM   1665  C CE1 . PHE A  1 251  ? 250.614 232.450 226.083 1.00 48.58  ? 220  PHE A CE1 1 
ATOM   1666  C CE2 . PHE A  1 251  ? 251.848 230.595 226.893 1.00 48.58  ? 220  PHE A CE2 1 
ATOM   1667  C CZ  . PHE A  1 251  ? 250.655 231.240 226.722 1.00 48.58  ? 220  PHE A CZ  1 
ATOM   1668  N N   . SER A  1 252  ? 255.058 232.611 228.476 1.00 47.98  ? 221  SER A N   1 
ATOM   1669  C CA  . SER A  1 252  ? 255.492 231.605 229.444 1.00 47.98  ? 221  SER A CA  1 
ATOM   1670  C C   . SER A  1 252  ? 254.384 231.396 230.461 1.00 47.98  ? 221  SER A C   1 
ATOM   1671  O O   . SER A  1 252  ? 253.961 232.353 231.113 1.00 47.98  ? 221  SER A O   1 
ATOM   1672  C CB  . SER A  1 252  ? 256.781 232.035 230.140 1.00 47.98  ? 221  SER A CB  1 
ATOM   1673  O OG  . SER A  1 252  ? 257.401 230.940 230.786 1.00 47.98  ? 221  SER A OG  1 
ATOM   1674  N N   . ALA A  1 253  ? 253.901 230.158 230.576 1.00 41.75  ? 222  ALA A N   1 
ATOM   1675  C CA  . ALA A  1 253  ? 252.815 229.835 231.492 1.00 41.75  ? 222  ALA A CA  1 
ATOM   1676  C C   . ALA A  1 253  ? 253.334 229.621 232.909 1.00 41.75  ? 222  ALA A C   1 
ATOM   1677  O O   . ALA A  1 253  ? 254.373 228.990 233.117 1.00 41.75  ? 222  ALA A O   1 
ATOM   1678  C CB  . ALA A  1 253  ? 252.069 228.591 231.014 1.00 41.75  ? 222  ALA A CB  1 
ATOM   1679  N N   . LEU A  1 254  ? 252.595 230.141 233.885 1.00 36.76  ? 223  LEU A N   1 
ATOM   1680  C CA  . LEU A  1 254  ? 252.928 229.997 235.296 1.00 36.76  ? 223  LEU A CA  1 
ATOM   1681  C C   . LEU A  1 254  ? 252.381 228.688 235.859 1.00 36.76  ? 223  LEU A C   1 
ATOM   1682  O O   . LEU A  1 254  ? 251.318 228.214 235.457 1.00 36.76  ? 223  LEU A O   1 
ATOM   1683  C CB  . LEU A  1 254  ? 252.373 231.183 236.088 1.00 36.76  ? 223  LEU A CB  1 
ATOM   1684  C CG  . LEU A  1 254  ? 252.617 232.604 235.560 1.00 36.76  ? 223  LEU A CG  1 
ATOM   1685  C CD1 . LEU A  1 254  ? 252.392 233.617 236.637 1.00 36.76  ? 223  LEU A CD1 1 
ATOM   1686  C CD2 . LEU A  1 254  ? 254.003 232.777 235.006 1.00 36.76  ? 223  LEU A CD2 1 
ATOM   1687  N N   . GLU A  1 255  ? 253.106 228.116 236.821 1.00 39.46  ? 224  GLU A N   1 
ATOM   1688  C CA  . GLU A  1 255  ? 252.733 226.840 237.416 1.00 39.46  ? 224  GLU A CA  1 
ATOM   1689  C C   . GLU A  1 255  ? 252.252 227.014 238.854 1.00 39.46  ? 224  GLU A C   1 
ATOM   1690  O O   . GLU A  1 255  ? 252.660 227.957 239.537 1.00 39.46  ? 224  GLU A O   1 
ATOM   1691  C CB  . GLU A  1 255  ? 253.914 225.865 237.400 1.00 39.46  ? 224  GLU A CB  1 
ATOM   1692  C CG  . GLU A  1 255  ? 254.504 225.658 236.027 1.00 39.46  ? 224  GLU A CG  1 
ATOM   1693  C CD  . GLU A  1 255  ? 255.662 224.697 236.035 1.00 39.46  ? 224  GLU A CD  1 
ATOM   1694  O OE1 . GLU A  1 255  ? 256.192 224.413 237.126 1.00 39.46  ? 224  GLU A OE1 1 
ATOM   1695  O OE2 . GLU A  1 255  ? 256.047 224.225 234.947 1.00 39.46  ? 224  GLU A OE2 1 
ATOM   1696  N N   . PRO A  1 256  ? 251.380 226.130 239.337 1.00 36.20  ? 225  PRO A N   1 
ATOM   1697  C CA  . PRO A  1 256  ? 250.879 226.257 240.711 1.00 36.20  ? 225  PRO A CA  1 
ATOM   1698  C C   . PRO A  1 256  ? 252.005 226.195 241.728 1.00 36.20  ? 225  PRO A C   1 
ATOM   1699  O O   . PRO A  1 256  ? 252.863 225.316 241.675 1.00 36.20  ? 225  PRO A O   1 
ATOM   1700  C CB  . PRO A  1 256  ? 249.935 225.058 240.854 1.00 36.20  ? 225  PRO A CB  1 
ATOM   1701  C CG  . PRO A  1 256  ? 249.613 224.646 239.486 1.00 36.20  ? 225  PRO A CG  1 
ATOM   1702  C CD  . PRO A  1 256  ? 250.783 224.984 238.637 1.00 36.20  ? 225  PRO A CD  1 
ATOM   1703  N N   . LEU A  1 257  ? 251.989 227.130 242.671 1.00 35.44  ? 226  LEU A N   1 
ATOM   1704  C CA  . LEU A  1 257  ? 253.021 227.177 243.695 1.00 35.44  ? 226  LEU A CA  1 
ATOM   1705  C C   . LEU A  1 257  ? 252.511 226.817 245.079 1.00 35.44  ? 226  LEU A C   1 
ATOM   1706  O O   . LEU A  1 257  ? 253.065 225.916 245.713 1.00 35.44  ? 226  LEU A O   1 
ATOM   1707  C CB  . LEU A  1 257  ? 253.680 228.561 243.741 1.00 35.44  ? 226  LEU A CB  1 
ATOM   1708  C CG  . LEU A  1 257  ? 254.767 228.669 244.810 1.00 35.44  ? 226  LEU A CG  1 
ATOM   1709  C CD1 . LEU A  1 257  ? 255.953 227.800 244.468 1.00 35.44  ? 226  LEU A CD1 1 
ATOM   1710  C CD2 . LEU A  1 257  ? 255.205 230.103 244.980 1.00 35.44  ? 226  LEU A CD2 1 
ATOM   1711  N N   . VAL A  1 258  ? 251.473 227.486 245.580 1.00 36.72  ? 227  VAL A N   1 
ATOM   1712  C CA  . VAL A  1 258  ? 250.980 227.176 246.923 1.00 36.72  ? 227  VAL A CA  1 
ATOM   1713  C C   . VAL A  1 258  ? 249.535 227.617 247.074 1.00 36.72  ? 227  VAL A C   1 
ATOM   1714  O O   . VAL A  1 258  ? 249.028 228.421 246.292 1.00 36.72  ? 227  VAL A O   1 
ATOM   1715  C CB  . VAL A  1 258  ? 251.879 227.816 248.011 1.00 36.72  ? 227  VAL A CB  1 
ATOM   1716  C CG1 . VAL A  1 258  ? 251.512 229.261 248.216 1.00 36.72  ? 227  VAL A CG1 1 
ATOM   1717  C CG2 . VAL A  1 258  ? 251.797 227.031 249.308 1.00 36.72  ? 227  VAL A CG2 1 
ATOM   1718  N N   . ASP A  1 259  ? 248.866 227.079 248.097 1.00 38.63  ? 228  ASP A N   1 
ATOM   1719  C CA  . ASP A  1 259  ? 247.441 227.294 248.353 1.00 38.63  ? 228  ASP A CA  1 
ATOM   1720  C C   . ASP A  1 259  ? 247.237 227.367 249.866 1.00 38.63  ? 228  ASP A C   1 
ATOM   1721  O O   . ASP A  1 259  ? 247.120 226.334 250.530 1.00 38.63  ? 228  ASP A O   1 
ATOM   1722  C CB  . ASP A  1 259  ? 246.614 226.177 247.737 1.00 38.63  ? 228  ASP A CB  1 
ATOM   1723  C CG  . ASP A  1 259  ? 245.203 226.595 247.458 1.00 38.63  ? 228  ASP A CG  1 
ATOM   1724  O OD1 . ASP A  1 259  ? 244.665 227.392 248.246 1.00 38.63  ? 228  ASP A OD1 1 
ATOM   1725  O OD2 . ASP A  1 259  ? 244.629 226.134 246.452 1.00 38.63  ? 228  ASP A OD2 1 
ATOM   1726  N N   . LEU A  1 260  ? 247.190 228.592 250.410 1.00 37.33  ? 229  LEU A N   1 
ATOM   1727  C CA  . LEU A  1 260  ? 247.228 228.846 251.851 1.00 37.33  ? 229  LEU A CA  1 
ATOM   1728  C C   . LEU A  1 260  ? 245.814 228.984 252.402 1.00 37.33  ? 229  LEU A C   1 
ATOM   1729  O O   . LEU A  1 260  ? 245.042 229.801 251.896 1.00 37.33  ? 229  LEU A O   1 
ATOM   1730  C CB  . LEU A  1 260  ? 248.003 230.118 252.157 1.00 37.33  ? 229  LEU A CB  1 
ATOM   1731  C CG  . LEU A  1 260  ? 249.426 230.268 251.624 1.00 37.33  ? 229  LEU A CG  1 
ATOM   1732  C CD1 . LEU A  1 260  ? 249.883 231.692 251.832 1.00 37.33  ? 229  LEU A CD1 1 
ATOM   1733  C CD2 . LEU A  1 260  ? 250.386 229.293 252.260 1.00 37.33  ? 229  LEU A CD2 1 
ATOM   1734  N N   . PRO A  1 261  ? 245.430 228.230 253.425 1.00 37.08  ? 230  PRO A N   1 
ATOM   1735  C CA  . PRO A  1 261  ? 244.100 228.426 254.040 1.00 37.08  ? 230  PRO A CA  1 
ATOM   1736  C C   . PRO A  1 261  ? 244.086 229.514 255.114 1.00 37.08  ? 230  PRO A C   1 
ATOM   1737  O O   . PRO A  1 261  ? 244.128 229.262 256.316 1.00 37.08  ? 230  PRO A O   1 
ATOM   1738  C CB  . PRO A  1 261  ? 243.809 227.051 254.638 1.00 37.08  ? 230  PRO A CB  1 
ATOM   1739  C CG  . PRO A  1 261  ? 245.156 226.550 255.019 1.00 37.08  ? 230  PRO A CG  1 
ATOM   1740  C CD  . PRO A  1 261  ? 246.148 227.100 254.033 1.00 37.08  ? 230  PRO A CD  1 
ATOM   1741  N N   . ILE A  1 262  ? 244.025 230.771 254.680 1.00 36.67  ? 231  ILE A N   1 
ATOM   1742  C CA  . ILE A  1 262  ? 244.148 231.887 255.615 1.00 36.67  ? 231  ILE A CA  1 
ATOM   1743  C C   . ILE A  1 262  ? 242.790 232.373 256.111 1.00 36.67  ? 231  ILE A C   1 
ATOM   1744  O O   . ILE A  1 262  ? 242.654 232.741 257.278 1.00 36.67  ? 231  ILE A O   1 
ATOM   1745  C CB  . ILE A  1 262  ? 244.968 233.023 254.974 1.00 36.67  ? 231  ILE A CB  1 
ATOM   1746  C CG1 . ILE A  1 262  ? 244.312 233.518 253.690 1.00 36.67  ? 231  ILE A CG1 1 
ATOM   1747  C CG2 . ILE A  1 262  ? 246.380 232.566 254.704 1.00 36.67  ? 231  ILE A CG2 1 
ATOM   1748  C CD1 . ILE A  1 262  ? 244.990 234.711 253.115 1.00 36.67  ? 231  ILE A CD1 1 
ATOM   1749  N N   . GLY A  1 263  ? 241.778 232.420 255.246 1.00 36.52  ? 232  GLY A N   1 
ATOM   1750  C CA  . GLY A  1 263  ? 240.449 232.855 255.638 1.00 36.52  ? 232  GLY A CA  1 
ATOM   1751  C C   . GLY A  1 263  ? 240.296 234.302 256.061 1.00 36.52  ? 232  GLY A C   1 
ATOM   1752  O O   . GLY A  1 263  ? 239.643 234.573 257.070 1.00 36.52  ? 232  GLY A O   1 
ATOM   1753  N N   . ILE A  1 264  ? 240.874 235.246 255.318 1.00 39.40  ? 233  ILE A N   1 
ATOM   1754  C CA  . ILE A  1 264  ? 240.764 236.662 255.643 1.00 39.40  ? 233  ILE A CA  1 
ATOM   1755  C C   . ILE A  1 264  ? 240.262 237.442 254.431 1.00 39.40  ? 233  ILE A C   1 
ATOM   1756  O O   . ILE A  1 264  ? 240.177 236.929 253.317 1.00 39.40  ? 233  ILE A O   1 
ATOM   1757  C CB  . ILE A  1 264  ? 242.096 237.245 256.168 1.00 39.40  ? 233  ILE A CB  1 
ATOM   1758  C CG1 . ILE A  1 264  ? 243.150 237.303 255.072 1.00 39.40  ? 233  ILE A CG1 1 
ATOM   1759  C CG2 . ILE A  1 264  ? 242.616 236.449 257.336 1.00 39.40  ? 233  ILE A CG2 1 
ATOM   1760  C CD1 . ILE A  1 264  ? 244.366 238.083 255.480 1.00 39.40  ? 233  ILE A CD1 1 
ATOM   1761  N N   . ASN A  1 265  ? 239.911 238.702 254.684 1.00 43.12  ? 234  ASN A N   1 
ATOM   1762  C CA  . ASN A  1 265  ? 239.314 239.613 253.706 1.00 43.12  ? 234  ASN A CA  1 
ATOM   1763  C C   . ASN A  1 265  ? 240.381 240.599 253.234 1.00 43.12  ? 234  ASN A C   1 
ATOM   1764  O O   . ASN A  1 265  ? 240.564 241.666 253.817 1.00 43.12  ? 234  ASN A O   1 
ATOM   1765  C CB  . ASN A  1 265  ? 238.114 240.312 254.343 1.00 43.12  ? 234  ASN A CB  1 
ATOM   1766  C CG  . ASN A  1 265  ? 237.485 241.365 253.453 1.00 43.12  ? 234  ASN A CG  1 
ATOM   1767  O OD1 . ASN A  1 265  ? 237.762 241.452 252.262 1.00 43.12  ? 234  ASN A OD1 1 
ATOM   1768  N ND2 . ASN A  1 265  ? 236.616 242.173 254.044 1.00 43.12  ? 234  ASN A ND2 1 
ATOM   1769  N N   . ILE A  1 266  ? 241.103 240.226 252.182 1.00 39.23  ? 235  ILE A N   1 
ATOM   1770  C CA  . ILE A  1 266  ? 242.122 241.085 251.582 1.00 39.23  ? 235  ILE A CA  1 
ATOM   1771  C C   . ILE A  1 266  ? 241.465 242.119 250.675 1.00 39.23  ? 235  ILE A C   1 
ATOM   1772  O O   . ILE A  1 266  ? 240.611 241.781 249.850 1.00 39.23  ? 235  ILE A O   1 
ATOM   1773  C CB  . ILE A  1 266  ? 243.145 240.242 250.806 1.00 39.23  ? 235  ILE A CB  1 
ATOM   1774  C CG1 . ILE A  1 266  ? 244.029 239.466 251.775 1.00 39.23  ? 235  ILE A CG1 1 
ATOM   1775  C CG2 . ILE A  1 266  ? 243.997 241.115 249.939 1.00 39.23  ? 235  ILE A CG2 1 
ATOM   1776  C CD1 . ILE A  1 266  ? 244.615 238.226 251.191 1.00 39.23  ? 235  ILE A CD1 1 
ATOM   1777  N N   . THR A  1 267  ? 241.864 243.386 250.817 1.00 41.02  ? 236  THR A N   1 
ATOM   1778  C CA  . THR A  1 267  ? 241.360 244.435 249.935 1.00 41.02  ? 236  THR A CA  1 
ATOM   1779  C C   . THR A  1 267  ? 242.488 245.282 249.345 1.00 41.02  ? 236  THR A C   1 
ATOM   1780  O O   . THR A  1 267  ? 242.358 245.808 248.236 1.00 41.02  ? 236  THR A O   1 
ATOM   1781  C CB  . THR A  1 267  ? 240.372 245.323 250.707 1.00 41.02  ? 236  THR A CB  1 
ATOM   1782  O OG1 . THR A  1 267  ? 239.206 244.565 251.045 1.00 41.02  ? 236  THR A OG1 1 
ATOM   1783  C CG2 . THR A  1 267  ? 239.943 246.523 249.898 1.00 41.02  ? 236  THR A CG2 1 
ATOM   1784  N N   . ARG A  1 268  ? 243.610 245.394 250.052 1.00 38.18  ? 237  ARG A N   1 
ATOM   1785  C CA  . ARG A  1 268  ? 244.739 246.198 249.606 1.00 38.18  ? 237  ARG A CA  1 
ATOM   1786  C C   . ARG A  1 268  ? 246.030 245.433 249.851 1.00 38.18  ? 237  ARG A C   1 
ATOM   1787  O O   . ARG A  1 268  ? 246.059 244.460 250.612 1.00 38.18  ? 237  ARG A O   1 
ATOM   1788  C CB  . ARG A  1 268  ? 244.781 247.553 250.321 1.00 38.18  ? 237  ARG A CB  1 
ATOM   1789  C CG  . ARG A  1 268  ? 243.491 248.343 250.227 1.00 38.18  ? 237  ARG A CG  1 
ATOM   1790  C CD  . ARG A  1 268  ? 243.634 249.746 250.784 1.00 38.18  ? 237  ARG A CD  1 
ATOM   1791  N NE  . ARG A  1 268  ? 244.056 249.774 252.179 1.00 38.18  ? 237  ARG A NE  1 
ATOM   1792  C CZ  . ARG A  1 268  ? 244.455 250.874 252.807 1.00 38.18  ? 237  ARG A CZ  1 
ATOM   1793  N NH1 . ARG A  1 268  ? 244.494 252.025 252.158 1.00 38.18  ? 237  ARG A NH1 1 
ATOM   1794  N NH2 . ARG A  1 268  ? 244.823 250.828 254.075 1.00 38.18  ? 237  ARG A NH2 1 
ATOM   1795  N N   . PHE A  1 269  ? 247.109 245.888 249.212 1.00 35.31  ? 238  PHE A N   1 
ATOM   1796  C CA  . PHE A  1 269  ? 248.404 245.246 249.411 1.00 35.31  ? 238  PHE A CA  1 
ATOM   1797  C C   . PHE A  1 269  ? 249.533 246.245 249.205 1.00 35.31  ? 238  PHE A C   1 
ATOM   1798  O O   . PHE A  1 269  ? 249.344 247.326 248.644 1.00 35.31  ? 238  PHE A O   1 
ATOM   1799  C CB  . PHE A  1 269  ? 248.583 244.016 248.513 1.00 35.31  ? 238  PHE A CB  1 
ATOM   1800  C CG  . PHE A  1 269  ? 248.924 244.325 247.088 1.00 35.31  ? 238  PHE A CG  1 
ATOM   1801  C CD1 . PHE A  1 269  ? 250.216 244.167 246.629 1.00 35.31  ? 238  PHE A CD1 1 
ATOM   1802  C CD2 . PHE A  1 269  ? 247.948 244.706 246.193 1.00 35.31  ? 238  PHE A CD2 1 
ATOM   1803  C CE1 . PHE A  1 269  ? 250.531 244.426 245.327 1.00 35.31  ? 238  PHE A CE1 1 
ATOM   1804  C CE2 . PHE A  1 269  ? 248.263 244.962 244.887 1.00 35.31  ? 238  PHE A CE2 1 
ATOM   1805  C CZ  . PHE A  1 269  ? 249.555 244.823 244.458 1.00 35.31  ? 238  PHE A CZ  1 
ATOM   1806  N N   . GLN A  1 270  ? 250.709 245.885 249.715 1.00 38.76  ? 239  GLN A N   1 
ATOM   1807  C CA  . GLN A  1 270  ? 251.868 246.767 249.654 1.00 38.76  ? 239  GLN A CA  1 
ATOM   1808  C C   . GLN A  1 270  ? 253.155 245.962 249.553 1.00 38.76  ? 239  GLN A C   1 
ATOM   1809  O O   . GLN A  1 270  ? 253.346 244.995 250.294 1.00 38.76  ? 239  GLN A O   1 
ATOM   1810  C CB  . GLN A  1 270  ? 251.905 247.688 250.876 1.00 38.76  ? 239  GLN A CB  1 
ATOM   1811  C CG  . GLN A  1 270  ? 253.083 248.636 250.927 1.00 38.76  ? 239  GLN A CG  1 
ATOM   1812  C CD  . GLN A  1 270  ? 252.874 249.761 251.915 1.00 38.76  ? 239  GLN A CD  1 
ATOM   1813  O OE1 . GLN A  1 270  ? 252.927 250.933 251.560 1.00 38.76  ? 239  GLN A OE1 1 
ATOM   1814  N NE2 . GLN A  1 270  ? 252.600 249.409 253.155 1.00 38.76  ? 239  GLN A NE2 1 
ATOM   1815  N N   . THR A  1 271  ? 254.021 246.375 248.628 1.00 41.79  ? 240  THR A N   1 
ATOM   1816  C CA  . THR A  1 271  ? 255.283 245.701 248.337 1.00 41.79  ? 240  THR A CA  1 
ATOM   1817  C C   . THR A  1 271  ? 256.382 246.076 249.326 1.00 41.79  ? 240  THR A C   1 
ATOM   1818  O O   . THR A  1 271  ? 256.495 247.229 249.743 1.00 41.79  ? 240  THR A O   1 
ATOM   1819  C CB  . THR A  1 271  ? 255.732 246.036 246.914 1.00 41.79  ? 240  THR A CB  1 
ATOM   1820  O OG1 . THR A  1 271  ? 254.657 245.784 246.005 1.00 41.79  ? 240  THR A OG1 1 
ATOM   1821  C CG2 . THR A  1 271  ? 256.914 245.192 246.506 1.00 41.79  ? 240  THR A CG2 1 
ATOM   1822  N N   . LEU A  1 272  ? 257.197 245.090 249.692 1.00 45.22  ? 241  LEU A N   1 
ATOM   1823  C CA  . LEU A  1 272  ? 258.304 245.245 250.630 1.00 45.22  ? 241  LEU A CA  1 
ATOM   1824  C C   . LEU A  1 272  ? 259.623 245.145 249.877 1.00 45.22  ? 241  LEU A C   1 
ATOM   1825  O O   . LEU A  1 272  ? 259.939 244.084 249.316 1.00 45.22  ? 241  LEU A O   1 
ATOM   1826  C CB  . LEU A  1 272  ? 258.247 244.173 251.715 1.00 45.22  ? 241  LEU A CB  1 
ATOM   1827  C CG  . LEU A  1 272  ? 257.500 244.391 253.022 1.00 45.22  ? 241  LEU A CG  1 
ATOM   1828  C CD1 . LEU A  1 272  ? 256.045 244.635 252.778 1.00 45.22  ? 241  LEU A CD1 1 
ATOM   1829  C CD2 . LEU A  1 272  ? 257.675 243.132 253.831 1.00 45.22  ? 241  LEU A CD2 1 
ATOM   1830  N N   . LEU A  1 273  ? 260.394 246.237 249.900 1.00 53.33  ? 242  LEU A N   1 
ATOM   1831  C CA  . LEU A  1 273  ? 261.671 246.418 249.220 1.00 53.33  ? 242  LEU A CA  1 
ATOM   1832  C C   . LEU A  1 273  ? 262.795 246.522 250.247 1.00 53.33  ? 242  LEU A C   1 
ATOM   1833  O O   . LEU A  1 273  ? 262.564 246.514 251.455 1.00 53.33  ? 242  LEU A O   1 
ATOM   1834  C CB  . LEU A  1 273  ? 261.656 247.676 248.347 1.00 53.33  ? 242  LEU A CB  1 
ATOM   1835  C CG  . LEU A  1 273  ? 260.551 247.954 247.333 1.00 53.33  ? 242  LEU A CG  1 
ATOM   1836  C CD1 . LEU A  1 273  ? 260.750 249.329 246.744 1.00 53.33  ? 242  LEU A CD1 1 
ATOM   1837  C CD2 . LEU A  1 273  ? 260.552 246.924 246.249 1.00 53.33  ? 242  LEU A CD2 1 
ATOM   1838  N N   . ALA A  1 274  ? 264.030 246.623 249.755 1.00 60.31  ? 243  ALA A N   1 
ATOM   1839  C CA  . ALA A  1 274  ? 265.207 246.699 250.608 1.00 60.31  ? 243  ALA A CA  1 
ATOM   1840  C C   . ALA A  1 274  ? 266.047 247.927 250.269 1.00 60.31  ? 243  ALA A C   1 
ATOM   1841  O O   . ALA A  1 274  ? 265.980 248.470 249.166 1.00 60.31  ? 243  ALA A O   1 
ATOM   1842  C CB  . ALA A  1 274  ? 266.066 245.440 250.480 1.00 60.31  ? 243  ALA A CB  1 
ATOM   1843  N N   . LEU A  1 275  ? 266.857 248.348 251.238 1.00 72.86  ? 244  LEU A N   1 
ATOM   1844  C CA  . LEU A  1 275  ? 267.686 249.543 251.151 1.00 72.86  ? 244  LEU A CA  1 
ATOM   1845  C C   . LEU A  1 275  ? 269.154 249.160 251.226 1.00 72.86  ? 244  LEU A C   1 
ATOM   1846  O O   . LEU A  1 275  ? 269.518 248.102 251.743 1.00 72.86  ? 244  LEU A O   1 
ATOM   1847  C CB  . LEU A  1 275  ? 267.392 250.545 252.271 1.00 72.86  ? 244  LEU A CB  1 
ATOM   1848  C CG  . LEU A  1 275  ? 266.236 251.525 252.157 1.00 72.86  ? 244  LEU A CG  1 
ATOM   1849  C CD1 . LEU A  1 275  ? 264.930 250.796 252.189 1.00 72.86  ? 244  LEU A CD1 1 
ATOM   1850  C CD2 . LEU A  1 275  ? 266.315 252.496 253.308 1.00 72.86  ? 244  LEU A CD2 1 
ATOM   1851  N N   . HIS A  1 276  ? 270.001 250.043 250.713 1.00 79.78  ? 245  HIS A N   1 
ATOM   1852  C CA  . HIS A  1 276  ? 271.444 249.911 250.829 1.00 79.78  ? 245  HIS A CA  1 
ATOM   1853  C C   . HIS A  1 276  ? 271.994 251.090 251.616 1.00 79.78  ? 245  HIS A C   1 
ATOM   1854  O O   . HIS A  1 276  ? 271.641 252.240 251.344 1.00 79.78  ? 245  HIS A O   1 
ATOM   1855  C CB  . HIS A  1 276  ? 272.105 249.836 249.454 1.00 79.78  ? 245  HIS A CB  1 
ATOM   1856  C CG  . HIS A  1 276  ? 271.800 248.578 248.705 1.00 79.78  ? 245  HIS A CG  1 
ATOM   1857  N ND1 . HIS A  1 276  ? 271.012 248.558 247.577 1.00 79.78  ? 245  HIS A ND1 1 
ATOM   1858  C CD2 . HIS A  1 276  ? 272.173 247.297 248.926 1.00 79.78  ? 245  HIS A CD2 1 
ATOM   1859  C CE1 . HIS A  1 276  ? 270.914 247.318 247.133 1.00 79.78  ? 245  HIS A CE1 1 
ATOM   1860  N NE2 . HIS A  1 276  ? 271.610 246.534 247.933 1.00 79.78  ? 245  HIS A NE2 1 
ATOM   1861  N N   . ARG A  1 277  ? 272.849 250.806 252.593 1.00 89.06  ? 246  ARG A N   1 
ATOM   1862  C CA  . ARG A  1 277  ? 273.532 251.856 253.331 1.00 89.06  ? 246  ARG A CA  1 
ATOM   1863  C C   . ARG A  1 277  ? 275.017 251.543 253.367 1.00 89.06  ? 246  ARG A C   1 
ATOM   1864  O O   . ARG A  1 277  ? 275.415 250.381 253.477 1.00 89.06  ? 246  ARG A O   1 
ATOM   1865  C CB  . ARG A  1 277  ? 272.987 251.987 254.750 1.00 89.06  ? 246  ARG A CB  1 
ATOM   1866  C CG  . ARG A  1 277  ? 271.577 252.520 254.787 1.00 89.06  ? 246  ARG A CG  1 
ATOM   1867  C CD  . ARG A  1 277  ? 271.081 252.778 256.192 1.00 89.06  ? 246  ARG A CD  1 
ATOM   1868  N NE  . ARG A  1 277  ? 269.749 253.368 256.152 1.00 89.06  ? 246  ARG A NE  1 
ATOM   1869  C CZ  . ARG A  1 277  ? 269.042 253.691 257.225 1.00 89.06  ? 246  ARG A CZ  1 
ATOM   1870  N NH1 . ARG A  1 277  ? 269.545 253.485 258.430 1.00 89.06  ? 246  ARG A NH1 1 
ATOM   1871  N NH2 . ARG A  1 277  ? 267.838 254.226 257.093 1.00 89.06  ? 246  ARG A NH2 1 
ATOM   1872  N N   . SER A  1 278  ? 275.829 252.588 253.274 1.00 97.71  ? 247  SER A N   1 
ATOM   1873  C CA  . SER A  1 278  ? 277.276 252.442 253.279 1.00 97.71  ? 247  SER A CA  1 
ATOM   1874  C C   . SER A  1 278  ? 277.884 253.697 253.895 1.00 97.71  ? 247  SER A C   1 
ATOM   1875  O O   . SER A  1 278  ? 277.196 254.471 254.567 1.00 97.71  ? 247  SER A O   1 
ATOM   1876  C CB  . SER A  1 278  ? 277.780 252.165 251.853 1.00 97.71  ? 247  SER A CB  1 
ATOM   1877  O OG  . SER A  1 278  ? 277.465 253.241 250.988 1.00 97.71  ? 247  SER A OG  1 
ATOM   1878  N N   . TYR A  1 279  ? 279.179 253.897 253.661 1.00 104.97 ? 248  TYR A N   1 
ATOM   1879  C CA  . TYR A  1 279  ? 279.860 255.133 254.017 1.00 104.97 ? 248  TYR A CA  1 
ATOM   1880  C C   . TYR A  1 279  ? 279.606 256.258 253.023 1.00 104.97 ? 248  TYR A C   1 
ATOM   1881  O O   . TYR A  1 279  ? 279.909 257.414 253.336 1.00 104.97 ? 248  TYR A O   1 
ATOM   1882  C CB  . TYR A  1 279  ? 281.369 254.899 254.121 1.00 104.97 ? 248  TYR A CB  1 
ATOM   1883  C CG  . TYR A  1 279  ? 282.021 254.521 252.807 1.00 104.97 ? 248  TYR A CG  1 
ATOM   1884  C CD1 . TYR A  1 279  ? 282.796 255.435 252.108 1.00 104.97 ? 248  TYR A CD1 1 
ATOM   1885  C CD2 . TYR A  1 279  ? 281.869 253.249 252.271 1.00 104.97 ? 248  TYR A CD2 1 
ATOM   1886  C CE1 . TYR A  1 279  ? 283.393 255.096 250.909 1.00 104.97 ? 248  TYR A CE1 1 
ATOM   1887  C CE2 . TYR A  1 279  ? 282.461 252.902 251.075 1.00 104.97 ? 248  TYR A CE2 1 
ATOM   1888  C CZ  . TYR A  1 279  ? 283.222 253.828 250.398 1.00 104.97 ? 248  TYR A CZ  1 
ATOM   1889  O OH  . TYR A  1 279  ? 283.816 253.486 249.206 1.00 104.97 ? 248  TYR A OH  1 
ATOM   1890  N N   . LEU A  1 280  ? 279.063 255.957 251.845 1.00 103.34 ? 249  LEU A N   1 
ATOM   1891  C CA  . LEU A  1 280  ? 278.728 256.981 250.865 1.00 103.34 ? 249  LEU A CA  1 
ATOM   1892  C C   . LEU A  1 280  ? 277.306 257.500 251.015 1.00 103.34 ? 249  LEU A C   1 
ATOM   1893  O O   . LEU A  1 280  ? 276.851 258.278 250.171 1.00 103.34 ? 249  LEU A O   1 
ATOM   1894  C CB  . LEU A  1 280  ? 278.931 256.440 249.448 1.00 103.34 ? 249  LEU A CB  1 
ATOM   1895  C CG  . LEU A  1 280  ? 280.353 256.029 249.067 1.00 103.34 ? 249  LEU A CG  1 
ATOM   1896  C CD1 . LEU A  1 280  ? 280.359 255.296 247.736 1.00 103.34 ? 249  LEU A CD1 1 
ATOM   1897  C CD2 . LEU A  1 280  ? 281.257 257.249 249.012 1.00 103.34 ? 249  LEU A CD2 1 
ATOM   1898  N N   . THR A  1 281  ? 276.594 257.083 252.061 1.00 99.54  ? 250  THR A N   1 
ATOM   1899  C CA  . THR A  1 281  ? 275.215 257.494 252.312 1.00 99.54  ? 250  THR A CA  1 
ATOM   1900  C C   . THR A  1 281  ? 275.177 258.211 253.656 1.00 99.54  ? 250  THR A C   1 
ATOM   1901  O O   . THR A  1 281  ? 274.699 257.656 254.654 1.00 99.54  ? 250  THR A O   1 
ATOM   1902  C CB  . THR A  1 281  ? 274.254 256.308 252.301 1.00 99.54  ? 250  THR A CB  1 
ATOM   1903  O OG1 . THR A  1 281  ? 274.656 255.359 253.294 1.00 99.54  ? 250  THR A OG1 1 
ATOM   1904  C CG2 . THR A  1 281  ? 274.249 255.643 250.937 1.00 99.54  ? 250  THR A CG2 1 
ATOM   1905  N N   . PRO A  1 282  ? 275.667 259.447 253.719 1.00 103.37 ? 251  PRO A N   1 
ATOM   1906  C CA  . PRO A  1 282  ? 275.823 260.100 255.022 1.00 103.37 ? 251  PRO A CA  1 
ATOM   1907  C C   . PRO A  1 282  ? 274.549 260.792 255.470 1.00 103.37 ? 251  PRO A C   1 
ATOM   1908  O O   . PRO A  1 282  ? 273.900 261.495 254.690 1.00 103.37 ? 251  PRO A O   1 
ATOM   1909  C CB  . PRO A  1 282  ? 276.953 261.100 254.765 1.00 103.37 ? 251  PRO A CB  1 
ATOM   1910  C CG  . PRO A  1 282  ? 276.744 261.502 253.336 1.00 103.37 ? 251  PRO A CG  1 
ATOM   1911  C CD  . PRO A  1 282  ? 276.154 260.299 252.619 1.00 103.37 ? 251  PRO A CD  1 
ATOM   1912  N N   . GLY A  1 283  ? 274.185 260.593 256.727 1.00 101.48 ? 252  GLY A N   1 
ATOM   1913  C CA  . GLY A  1 283  ? 273.016 261.240 257.281 1.00 101.48 ? 252  GLY A CA  1 
ATOM   1914  C C   . GLY A  1 283  ? 272.475 260.437 258.447 1.00 101.48 ? 252  GLY A C   1 
ATOM   1915  O O   . GLY A  1 283  ? 273.139 259.546 258.976 1.00 101.48 ? 252  GLY A O   1 
ATOM   1916  N N   . ASP A  1 284  ? 271.252 260.777 258.830 1.00 97.56  ? 253  ASP A N   1 
ATOM   1917  C CA  . ASP A  1 284  ? 270.540 260.042 259.862 1.00 97.56  ? 253  ASP A CA  1 
ATOM   1918  C C   . ASP A  1 284  ? 269.789 258.871 259.230 1.00 97.56  ? 253  ASP A C   1 
ATOM   1919  O O   . ASP A  1 284  ? 270.003 258.517 258.068 1.00 97.56  ? 253  ASP A O   1 
ATOM   1920  C CB  . ASP A  1 284  ? 269.619 260.980 260.641 1.00 97.56  ? 253  ASP A CB  1 
ATOM   1921  C CG  . ASP A  1 284  ? 268.605 261.674 259.757 1.00 97.56  ? 253  ASP A CG  1 
ATOM   1922  O OD1 . ASP A  1 284  ? 268.742 261.603 258.520 1.00 97.56  ? 253  ASP A OD1 1 
ATOM   1923  O OD2 . ASP A  1 284  ? 267.667 262.295 260.301 1.00 97.56  ? 253  ASP A OD2 1 
ATOM   1924  N N   . SER A  1 285  ? 268.906 258.246 260.009 1.00 95.30  ? 254  SER A N   1 
ATOM   1925  C CA  . SER A  1 285  ? 268.142 257.105 259.514 1.00 95.30  ? 254  SER A CA  1 
ATOM   1926  C C   . SER A  1 285  ? 267.244 257.495 258.347 1.00 95.30  ? 254  SER A C   1 
ATOM   1927  O O   . SER A  1 285  ? 267.073 256.718 257.401 1.00 95.30  ? 254  SER A O   1 
ATOM   1928  C CB  . SER A  1 285  ? 267.316 256.499 260.648 1.00 95.30  ? 254  SER A CB  1 
ATOM   1929  O OG  . SER A  1 285  ? 268.123 256.246 261.783 1.00 95.30  ? 254  SER A OG  1 
ATOM   1930  N N   . SER A  1 286  ? 266.657 258.686 258.396 1.00 92.53  ? 255  SER A N   1 
ATOM   1931  C CA  . SER A  1 286  ? 265.653 259.087 257.423 1.00 92.53  ? 255  SER A CA  1 
ATOM   1932  C C   . SER A  1 286  ? 266.235 259.689 256.150 1.00 92.53  ? 255  SER A C   1 
ATOM   1933  O O   . SER A  1 286  ? 265.473 259.978 255.222 1.00 92.53  ? 255  SER A O   1 
ATOM   1934  C CB  . SER A  1 286  ? 264.689 260.093 258.057 1.00 92.53  ? 255  SER A CB  1 
ATOM   1935  O OG  . SER A  1 286  ? 263.744 260.554 257.109 1.00 92.53  ? 255  SER A OG  1 
ATOM   1936  N N   . SER A  1 287  ? 267.549 259.891 256.075 1.00 92.36  ? 256  SER A N   1 
ATOM   1937  C CA  . SER A  1 287  ? 268.159 260.496 254.897 1.00 92.36  ? 256  SER A CA  1 
ATOM   1938  C C   . SER A  1 287  ? 269.395 259.774 254.384 1.00 92.36  ? 256  SER A C   1 
ATOM   1939  O O   . SER A  1 287  ? 269.746 259.963 253.214 1.00 92.36  ? 256  SER A O   1 
ATOM   1940  C CB  . SER A  1 287  ? 268.536 261.956 255.175 1.00 92.36  ? 256  SER A CB  1 
ATOM   1941  O OG  . SER A  1 287  ? 269.703 262.029 255.971 1.00 92.36  ? 256  SER A OG  1 
ATOM   1942  N N   . GLY A  1 288  ? 270.063 258.962 255.199 1.00 90.56  ? 257  GLY A N   1 
ATOM   1943  C CA  . GLY A  1 288  ? 271.262 258.270 254.768 1.00 90.56  ? 257  GLY A CA  1 
ATOM   1944  C C   . GLY A  1 288  ? 271.016 256.919 254.129 1.00 90.56  ? 257  GLY A C   1 
ATOM   1945  O O   . GLY A  1 288  ? 271.304 255.887 254.739 1.00 90.56  ? 257  GLY A O   1 
ATOM   1946  N N   . TRP A  1 289  ? 270.491 256.906 252.905 1.00 83.47  ? 258  TRP A N   1 
ATOM   1947  C CA  . TRP A  1 289  ? 270.103 255.661 252.256 1.00 83.47  ? 258  TRP A CA  1 
ATOM   1948  C C   . TRP A  1 289  ? 270.134 255.852 250.746 1.00 83.47  ? 258  TRP A C   1 
ATOM   1949  O O   . TRP A  1 289  ? 269.710 256.894 250.240 1.00 83.47  ? 258  TRP A O   1 
ATOM   1950  C CB  . TRP A  1 289  ? 268.704 255.208 252.685 1.00 83.47  ? 258  TRP A CB  1 
ATOM   1951  C CG  . TRP A  1 289  ? 267.640 256.209 252.397 1.00 83.47  ? 258  TRP A CG  1 
ATOM   1952  C CD1 . TRP A  1 289  ? 267.304 257.282 253.154 1.00 83.47  ? 258  TRP A CD1 1 
ATOM   1953  C CD2 . TRP A  1 289  ? 266.769 256.230 251.260 1.00 83.47  ? 258  TRP A CD2 1 
ATOM   1954  N NE1 . TRP A  1 289  ? 266.277 257.975 252.563 1.00 83.47  ? 258  TRP A NE1 1 
ATOM   1955  C CE2 . TRP A  1 289  ? 265.933 257.347 251.397 1.00 83.47  ? 258  TRP A CE2 1 
ATOM   1956  C CE3 . TRP A  1 289  ? 266.617 255.412 250.140 1.00 83.47  ? 258  TRP A CE3 1 
ATOM   1957  C CZ2 . TRP A  1 289  ? 264.962 257.666 250.459 1.00 83.47  ? 258  TRP A CZ2 1 
ATOM   1958  C CZ3 . TRP A  1 289  ? 265.652 255.733 249.213 1.00 83.47  ? 258  TRP A CZ3 1 
ATOM   1959  C CH2 . TRP A  1 289  ? 264.838 256.847 249.377 1.00 83.47  ? 258  TRP A CH2 1 
ATOM   1960  N N   . THR A  1 290  ? 270.667 254.861 250.040 1.00 82.50  ? 259  THR A N   1 
ATOM   1961  C CA  . THR A  1 290  ? 270.572 254.771 248.590 1.00 82.50  ? 259  THR A CA  1 
ATOM   1962  C C   . THR A  1 290  ? 269.560 253.685 248.235 1.00 82.50  ? 259  THR A C   1 
ATOM   1963  O O   . THR A  1 290  ? 268.945 253.075 249.111 1.00 82.50  ? 259  THR A O   1 
ATOM   1964  C CB  . THR A  1 290  ? 271.946 254.512 247.968 1.00 82.50  ? 259  THR A CB  1 
ATOM   1965  O OG1 . THR A  1 290  ? 271.846 254.558 246.540 1.00 82.50  ? 259  THR A OG1 1 
ATOM   1966  C CG2 . THR A  1 290  ? 272.483 253.168 248.388 1.00 82.50  ? 259  THR A CG2 1 
ATOM   1967  N N   . ALA A  1 291  ? 269.366 253.448 246.937 1.00 78.42  ? 260  ALA A N   1 
ATOM   1968  C CA  . ALA A  1 291  ? 268.199 252.706 246.476 1.00 78.42  ? 260  ALA A CA  1 
ATOM   1969  C C   . ALA A  1 291  ? 268.533 251.341 245.886 1.00 78.42  ? 260  ALA A C   1 
ATOM   1970  O O   . ALA A  1 291  ? 268.031 250.325 246.372 1.00 78.42  ? 260  ALA A O   1 
ATOM   1971  C CB  . ALA A  1 291  ? 267.427 253.550 245.454 1.00 78.42  ? 260  ALA A CB  1 
ATOM   1972  N N   . GLY A  1 292  ? 269.359 251.280 244.846 1.00 72.17  ? 261  GLY A N   1 
ATOM   1973  C CA  . GLY A  1 292  ? 269.558 250.030 244.132 1.00 72.17  ? 261  GLY A CA  1 
ATOM   1974  C C   . GLY A  1 292  ? 268.487 249.810 243.083 1.00 72.17  ? 261  GLY A C   1 
ATOM   1975  O O   . GLY A  1 292  ? 267.297 249.836 243.404 1.00 72.17  ? 261  GLY A O   1 
ATOM   1976  N N   . ALA A  1 293  ? 268.888 249.591 241.832 1.00 65.51  ? 262  ALA A N   1 
ATOM   1977  C CA  . ALA A  1 293  ? 267.932 249.559 240.733 1.00 65.51  ? 262  ALA A CA  1 
ATOM   1978  C C   . ALA A  1 293  ? 267.046 248.321 240.780 1.00 65.51  ? 262  ALA A C   1 
ATOM   1979  O O   . ALA A  1 293  ? 267.509 247.218 241.080 1.00 65.51  ? 262  ALA A O   1 
ATOM   1980  C CB  . ALA A  1 293  ? 268.668 249.610 239.398 1.00 65.51  ? 262  ALA A CB  1 
ATOM   1981  N N   . ALA A  1 294  ? 265.767 248.510 240.460 1.00 57.93  ? 263  ALA A N   1 
ATOM   1982  C CA  . ALA A  1 294  ? 264.810 247.411 240.346 1.00 57.93  ? 263  ALA A CA  1 
ATOM   1983  C C   . ALA A  1 294  ? 263.533 247.955 239.727 1.00 57.93  ? 263  ALA A C   1 
ATOM   1984  O O   . ALA A  1 294  ? 263.271 249.157 239.798 1.00 57.93  ? 263  ALA A O   1 
ATOM   1985  C CB  . ALA A  1 294  ? 264.510 246.771 241.701 1.00 57.93  ? 263  ALA A CB  1 
ATOM   1986  N N   . ALA A  1 295  ? 262.734 247.076 239.121 1.00 48.53  ? 264  ALA A N   1 
ATOM   1987  C CA  . ALA A  1 295  ? 261.471 247.558 238.577 1.00 48.53  ? 264  ALA A CA  1 
ATOM   1988  C C   . ALA A  1 295  ? 260.384 246.513 238.763 1.00 48.53  ? 264  ALA A C   1 
ATOM   1989  O O   . ALA A  1 295  ? 260.658 245.310 238.762 1.00 48.53  ? 264  ALA A O   1 
ATOM   1990  C CB  . ALA A  1 295  ? 261.598 247.921 237.097 1.00 48.53  ? 264  ALA A CB  1 
ATOM   1991  N N   . TYR A  1 296  ? 259.145 246.974 238.932 1.00 42.47  ? 265  TYR A N   1 
ATOM   1992  C CA  . TYR A  1 296  ? 258.048 246.020 239.028 1.00 42.47  ? 265  TYR A CA  1 
ATOM   1993  C C   . TYR A  1 296  ? 256.780 246.573 238.394 1.00 42.47  ? 265  TYR A C   1 
ATOM   1994  O O   . TYR A  1 296  ? 256.576 247.787 238.308 1.00 42.47  ? 265  TYR A O   1 
ATOM   1995  C CB  . TYR A  1 296  ? 257.808 245.552 240.474 1.00 42.47  ? 265  TYR A CB  1 
ATOM   1996  C CG  . TYR A  1 296  ? 257.323 246.561 241.486 1.00 42.47  ? 265  TYR A CG  1 
ATOM   1997  C CD1 . TYR A  1 296  ? 258.219 247.234 242.299 1.00 42.47  ? 265  TYR A CD1 1 
ATOM   1998  C CD2 . TYR A  1 296  ? 255.975 246.797 241.670 1.00 42.47  ? 265  TYR A CD2 1 
ATOM   1999  C CE1 . TYR A  1 296  ? 257.789 248.130 243.237 1.00 42.47  ? 265  TYR A CE1 1 
ATOM   2000  C CE2 . TYR A  1 296  ? 255.538 247.697 242.606 1.00 42.47  ? 265  TYR A CE2 1 
ATOM   2001  C CZ  . TYR A  1 296  ? 256.450 248.359 243.387 1.00 42.47  ? 265  TYR A CZ  1 
ATOM   2002  O OH  . TYR A  1 296  ? 256.015 249.259 244.323 1.00 42.47  ? 265  TYR A OH  1 
ATOM   2003  N N   . TYR A  1 297  ? 255.934 245.653 237.937 1.00 44.14  ? 266  TYR A N   1 
ATOM   2004  C CA  . TYR A  1 297  ? 254.773 245.958 237.115 1.00 44.14  ? 266  TYR A CA  1 
ATOM   2005  C C   . TYR A  1 297  ? 253.554 245.285 237.722 1.00 44.14  ? 266  TYR A C   1 
ATOM   2006  O O   . TYR A  1 297  ? 253.630 244.129 238.151 1.00 44.14  ? 266  TYR A O   1 
ATOM   2007  C CB  . TYR A  1 297  ? 254.978 245.481 235.675 1.00 44.14  ? 266  TYR A CB  1 
ATOM   2008  C CG  . TYR A  1 297  ? 256.312 245.895 235.099 1.00 44.14  ? 266  TYR A CG  1 
ATOM   2009  C CD1 . TYR A  1 297  ? 257.450 245.144 235.339 1.00 44.14  ? 266  TYR A CD1 1 
ATOM   2010  C CD2 . TYR A  1 297  ? 256.440 247.044 234.342 1.00 44.14  ? 266  TYR A CD2 1 
ATOM   2011  C CE1 . TYR A  1 297  ? 258.666 245.520 234.841 1.00 44.14  ? 266  TYR A CE1 1 
ATOM   2012  C CE2 . TYR A  1 297  ? 257.657 247.426 233.839 1.00 44.14  ? 266  TYR A CE2 1 
ATOM   2013  C CZ  . TYR A  1 297  ? 258.765 246.658 234.089 1.00 44.14  ? 266  TYR A CZ  1 
ATOM   2014  O OH  . TYR A  1 297  ? 259.988 247.023 233.590 1.00 44.14  ? 266  TYR A OH  1 
ATOM   2015  N N   . VAL A  1 298  ? 252.426 245.991 237.728 1.00 40.62  ? 267  VAL A N   1 
ATOM   2016  C CA  . VAL A  1 298  ? 251.203 245.491 238.349 1.00 40.62  ? 267  VAL A CA  1 
ATOM   2017  C C   . VAL A  1 298  ? 250.047 245.546 237.356 1.00 40.62  ? 267  VAL A C   1 
ATOM   2018  O O   . VAL A  1 298  ? 249.829 246.576 236.703 1.00 40.62  ? 267  VAL A O   1 
ATOM   2019  C CB  . VAL A  1 298  ? 250.857 246.283 239.625 1.00 40.62  ? 267  VAL A CB  1 
ATOM   2020  C CG1 . VAL A  1 298  ? 249.608 245.737 240.279 1.00 40.62  ? 267  VAL A CG1 1 
ATOM   2021  C CG2 . VAL A  1 298  ? 252.011 246.235 240.596 1.00 40.62  ? 267  VAL A CG2 1 
ATOM   2022  N N   . GLY A  1 299  ? 249.312 244.430 237.250 1.00 35.42  ? 268  GLY A N   1 
ATOM   2023  C CA  . GLY A  1 299  ? 248.093 244.376 236.467 1.00 35.42  ? 268  GLY A CA  1 
ATOM   2024  C C   . GLY A  1 299  ? 247.008 243.629 237.220 1.00 35.42  ? 268  GLY A C   1 
ATOM   2025  O O   . GLY A  1 299  ? 247.281 242.898 238.172 1.00 35.42  ? 268  GLY A O   1 
ATOM   2026  N N   . TYR A  1 300  ? 245.769 243.783 236.753 1.00 36.64  ? 269  TYR A N   1 
ATOM   2027  C CA  . TYR A  1 300  ? 244.604 243.250 237.450 1.00 36.64  ? 269  TYR A CA  1 
ATOM   2028  C C   . TYR A  1 300  ? 243.863 242.247 236.577 1.00 36.64  ? 269  TYR A C   1 
ATOM   2029  O O   . TYR A  1 300  ? 243.666 242.475 235.381 1.00 36.64  ? 269  TYR A O   1 
ATOM   2030  C CB  . TYR A  1 300  ? 243.648 244.371 237.865 1.00 36.64  ? 269  TYR A CB  1 
ATOM   2031  C CG  . TYR A  1 300  ? 244.249 245.316 238.873 1.00 36.64  ? 269  TYR A CG  1 
ATOM   2032  C CD1 . TYR A  1 300  ? 244.501 244.908 240.170 1.00 36.64  ? 269  TYR A CD1 1 
ATOM   2033  C CD2 . TYR A  1 300  ? 244.572 246.612 238.524 1.00 36.64  ? 269  TYR A CD2 1 
ATOM   2034  C CE1 . TYR A  1 300  ? 245.058 245.758 241.084 1.00 36.64  ? 269  TYR A CE1 1 
ATOM   2035  C CE2 . TYR A  1 300  ? 245.128 247.470 239.435 1.00 36.64  ? 269  TYR A CE2 1 
ATOM   2036  C CZ  . TYR A  1 300  ? 245.370 247.037 240.711 1.00 36.64  ? 269  TYR A CZ  1 
ATOM   2037  O OH  . TYR A  1 300  ? 245.927 247.899 241.621 1.00 36.64  ? 269  TYR A OH  1 
ATOM   2038  N N   . LEU A  1 301  ? 243.437 241.147 237.190 1.00 35.69  ? 270  LEU A N   1 
ATOM   2039  C CA  . LEU A  1 301  ? 242.818 240.030 236.493 1.00 35.69  ? 270  LEU A CA  1 
ATOM   2040  C C   . LEU A  1 301  ? 241.311 240.223 236.364 1.00 35.69  ? 270  LEU A C   1 
ATOM   2041  O O   . LEU A  1 301  ? 240.661 240.796 237.240 1.00 35.69  ? 270  LEU A O   1 
ATOM   2042  C CB  . LEU A  1 301  ? 243.101 238.718 237.222 1.00 35.69  ? 270  LEU A CB  1 
ATOM   2043  C CG  . LEU A  1 301  ? 244.517 238.389 237.703 1.00 35.69  ? 270  LEU A CG  1 
ATOM   2044  C CD1 . LEU A  1 301  ? 244.460 237.218 238.657 1.00 35.69  ? 270  LEU A CD1 1 
ATOM   2045  C CD2 . LEU A  1 301  ? 245.481 238.110 236.581 1.00 35.69  ? 270  LEU A CD2 1 
ATOM   2046  N N   . GLN A  1 302  ? 240.760 239.730 235.261 1.00 39.22  ? 271  GLN A N   1 
ATOM   2047  C CA  . GLN A  1 302  ? 239.334 239.738 234.977 1.00 39.22  ? 271  GLN A CA  1 
ATOM   2048  C C   . GLN A  1 302  ? 238.887 238.359 234.526 1.00 39.22  ? 271  GLN A C   1 
ATOM   2049  O O   . GLN A  1 302  ? 239.690 237.580 234.007 1.00 39.22  ? 271  GLN A O   1 
ATOM   2050  C CB  . GLN A  1 302  ? 238.999 240.766 233.891 1.00 39.22  ? 271  GLN A CB  1 
ATOM   2051  C CG  . GLN A  1 302  ? 239.043 242.193 234.366 1.00 39.22  ? 271  GLN A CG  1 
ATOM   2052  C CD  . GLN A  1 302  ? 239.126 243.167 233.223 1.00 39.22  ? 271  GLN A CD  1 
ATOM   2053  O OE1 . GLN A  1 302  ? 239.967 244.065 233.219 1.00 39.22  ? 271  GLN A OE1 1 
ATOM   2054  N NE2 . GLN A  1 302  ? 238.253 242.998 232.239 1.00 39.22  ? 271  GLN A NE2 1 
ATOM   2055  N N   . PRO A  1 303  ? 237.606 238.027 234.691 1.00 40.61  ? 272  PRO A N   1 
ATOM   2056  C CA  . PRO A  1 303  ? 237.102 236.750 234.155 1.00 40.61  ? 272  PRO A CA  1 
ATOM   2057  C C   . PRO A  1 303  ? 237.004 236.776 232.637 1.00 40.61  ? 272  PRO A C   1 
ATOM   2058  O O   . PRO A  1 303  ? 236.253 237.564 232.062 1.00 40.61  ? 272  PRO A O   1 
ATOM   2059  C CB  . PRO A  1 303  ? 235.721 236.612 234.806 1.00 40.61  ? 272  PRO A CB  1 
ATOM   2060  C CG  . PRO A  1 303  ? 235.335 237.989 235.172 1.00 40.61  ? 272  PRO A CG  1 
ATOM   2061  C CD  . PRO A  1 303  ? 236.598 238.715 235.510 1.00 40.61  ? 272  PRO A CD  1 
ATOM   2062  N N   . ARG A  1 304  ? 237.751 235.879 231.994 1.00 41.62  ? 273  ARG A N   1 
ATOM   2063  C CA  . ARG A  1 304  ? 237.847 235.807 230.546 1.00 41.62  ? 273  ARG A CA  1 
ATOM   2064  C C   . ARG A  1 304  ? 237.844 234.347 230.118 1.00 41.62  ? 273  ARG A C   1 
ATOM   2065  O O   . ARG A  1 304  ? 238.110 233.443 230.915 1.00 41.62  ? 273  ARG A O   1 
ATOM   2066  C CB  . ARG A  1 304  ? 239.109 236.503 230.019 1.00 41.62  ? 273  ARG A CB  1 
ATOM   2067  C CG  . ARG A  1 304  ? 239.317 237.911 230.534 1.00 41.62  ? 273  ARG A CG  1 
ATOM   2068  C CD  . ARG A  1 304  ? 238.290 238.852 229.941 1.00 41.62  ? 273  ARG A CD  1 
ATOM   2069  N NE  . ARG A  1 304  ? 238.612 239.194 228.564 1.00 41.62  ? 273  ARG A NE  1 
ATOM   2070  C CZ  . ARG A  1 304  ? 238.933 240.414 228.155 1.00 41.62  ? 273  ARG A CZ  1 
ATOM   2071  N NH1 . ARG A  1 304  ? 238.968 241.415 229.017 1.00 41.62  ? 273  ARG A NH1 1 
ATOM   2072  N NH2 . ARG A  1 304  ? 239.219 240.630 226.884 1.00 41.62  ? 273  ARG A NH2 1 
ATOM   2073  N N   . THR A  1 305  ? 237.570 234.130 228.835 1.00 41.29  ? 274  THR A N   1 
ATOM   2074  C CA  . THR A  1 305  ? 237.700 232.828 228.197 1.00 41.29  ? 274  THR A CA  1 
ATOM   2075  C C   . THR A  1 305  ? 238.930 232.814 227.302 1.00 41.29  ? 274  THR A C   1 
ATOM   2076  O O   . THR A  1 305  ? 239.079 233.681 226.436 1.00 41.29  ? 274  THR A O   1 
ATOM   2077  C CB  . THR A  1 305  ? 236.458 232.493 227.371 1.00 41.29  ? 274  THR A CB  1 
ATOM   2078  O OG1 . THR A  1 305  ? 235.300 232.504 228.213 1.00 41.29  ? 274  THR A OG1 1 
ATOM   2079  C CG2 . THR A  1 305  ? 236.598 231.123 226.732 1.00 41.29  ? 274  THR A CG2 1 
ATOM   2080  N N   . PHE A  1 306  ? 239.805 231.835 227.509 1.00 40.73  ? 275  PHE A N   1 
ATOM   2081  C CA  . PHE A  1 306  ? 241.031 231.694 226.740 1.00 40.73  ? 275  PHE A CA  1 
ATOM   2082  C C   . PHE A  1 306  ? 241.031 230.354 226.018 1.00 40.73  ? 275  PHE A C   1 
ATOM   2083  O O   . PHE A  1 306  ? 240.444 229.375 226.489 1.00 40.73  ? 275  PHE A O   1 
ATOM   2084  C CB  . PHE A  1 306  ? 242.275 231.782 227.623 1.00 40.73  ? 275  PHE A CB  1 
ATOM   2085  C CG  . PHE A  1 306  ? 242.765 233.180 227.869 1.00 40.73  ? 275  PHE A CG  1 
ATOM   2086  C CD1 . PHE A  1 306  ? 244.101 233.416 228.124 1.00 40.73  ? 275  PHE A CD1 1 
ATOM   2087  C CD2 . PHE A  1 306  ? 241.893 234.246 227.892 1.00 40.73  ? 275  PHE A CD2 1 
ATOM   2088  C CE1 . PHE A  1 306  ? 244.559 234.689 228.367 1.00 40.73  ? 275  PHE A CE1 1 
ATOM   2089  C CE2 . PHE A  1 306  ? 242.349 235.523 228.142 1.00 40.73  ? 275  PHE A CE2 1 
ATOM   2090  C CZ  . PHE A  1 306  ? 243.681 235.742 228.378 1.00 40.73  ? 275  PHE A CZ  1 
ATOM   2091  N N   . LEU A  1 307  ? 241.665 230.328 224.850 1.00 42.55  ? 276  LEU A N   1 
ATOM   2092  C CA  . LEU A  1 307  ? 241.918 229.099 224.102 1.00 42.55  ? 276  LEU A CA  1 
ATOM   2093  C C   . LEU A  1 307  ? 243.407 228.791 224.201 1.00 42.55  ? 276  LEU A C   1 
ATOM   2094  O O   . LEU A  1 307  ? 244.220 229.473 223.573 1.00 42.55  ? 276  LEU A O   1 
ATOM   2095  C CB  . LEU A  1 307  ? 241.473 229.246 222.649 1.00 42.55  ? 276  LEU A CB  1 
ATOM   2096  C CG  . LEU A  1 307  ? 241.646 228.076 221.684 1.00 42.55  ? 276  LEU A CG  1 
ATOM   2097  C CD1 . LEU A  1 307  ? 240.660 226.984 221.996 1.00 42.55  ? 276  LEU A CD1 1 
ATOM   2098  C CD2 . LEU A  1 307  ? 241.473 228.544 220.261 1.00 42.55  ? 276  LEU A CD2 1 
ATOM   2099  N N   . LEU A  1 308  ? 243.763 227.778 224.987 1.00 42.15  ? 277  LEU A N   1 
ATOM   2100  C CA  . LEU A  1 308  ? 245.145 227.405 225.249 1.00 42.15  ? 277  LEU A CA  1 
ATOM   2101  C C   . LEU A  1 308  ? 245.589 226.267 224.340 1.00 42.15  ? 277  LEU A C   1 
ATOM   2102  O O   . LEU A  1 308  ? 244.794 225.407 223.959 1.00 42.15  ? 277  LEU A O   1 
ATOM   2103  C CB  . LEU A  1 308  ? 245.337 226.972 226.707 1.00 42.15  ? 277  LEU A CB  1 
ATOM   2104  C CG  . LEU A  1 308  ? 245.312 227.945 227.891 1.00 42.15  ? 277  LEU A CG  1 
ATOM   2105  C CD1 . LEU A  1 308  ? 246.311 229.064 227.703 1.00 42.15  ? 277  LEU A CD1 1 
ATOM   2106  C CD2 . LEU A  1 308  ? 243.944 228.504 228.130 1.00 42.15  ? 277  LEU A CD2 1 
ATOM   2107  N N   . LYS A  1 309  ? 246.878 226.261 224.010 1.00 45.56  ? 278  LYS A N   1 
ATOM   2108  C CA  . LYS A  1 309  ? 247.466 225.286 223.103 1.00 45.56  ? 278  LYS A CA  1 
ATOM   2109  C C   . LYS A  1 309  ? 248.477 224.434 223.855 1.00 45.56  ? 278  LYS A C   1 
ATOM   2110  O O   . LYS A  1 309  ? 249.381 224.972 224.498 1.00 45.56  ? 278  LYS A O   1 
ATOM   2111  C CB  . LYS A  1 309  ? 248.164 226.006 221.950 1.00 45.56  ? 278  LYS A CB  1 
ATOM   2112  C CG  . LYS A  1 309  ? 248.823 225.111 220.929 1.00 45.56  ? 278  LYS A CG  1 
ATOM   2113  C CD  . LYS A  1 309  ? 249.743 225.924 220.041 1.00 45.56  ? 278  LYS A CD  1 
ATOM   2114  C CE  . LYS A  1 309  ? 250.064 225.216 218.749 1.00 45.56  ? 278  LYS A CE  1 
ATOM   2115  N NZ  . LYS A  1 309  ? 248.837 224.935 217.964 1.00 45.56  ? 278  LYS A NZ  1 
ATOM   2116  N N   . TYR A  1 310  ? 248.341 223.111 223.761 1.00 45.04  ? 279  TYR A N   1 
ATOM   2117  C CA  . TYR A  1 310  ? 249.265 222.173 224.382 1.00 45.04  ? 279  TYR A CA  1 
ATOM   2118  C C   . TYR A  1 310  ? 250.015 221.453 223.272 1.00 45.04  ? 279  TYR A C   1 
ATOM   2119  O O   . TYR A  1 310  ? 249.386 220.826 222.409 1.00 45.04  ? 279  TYR A O   1 
ATOM   2120  C CB  . TYR A  1 310  ? 248.525 221.153 225.247 1.00 45.04  ? 279  TYR A CB  1 
ATOM   2121  C CG  . TYR A  1 310  ? 247.835 221.701 226.470 1.00 45.04  ? 279  TYR A CG  1 
ATOM   2122  C CD1 . TYR A  1 310  ? 248.395 221.576 227.726 1.00 45.04  ? 279  TYR A CD1 1 
ATOM   2123  C CD2 . TYR A  1 310  ? 246.595 222.302 226.369 1.00 45.04  ? 279  TYR A CD2 1 
ATOM   2124  C CE1 . TYR A  1 310  ? 247.750 222.056 228.841 1.00 45.04  ? 279  TYR A CE1 1 
ATOM   2125  C CE2 . TYR A  1 310  ? 245.946 222.788 227.476 1.00 45.04  ? 279  TYR A CE2 1 
ATOM   2126  C CZ  . TYR A  1 310  ? 246.526 222.663 228.709 1.00 45.04  ? 279  TYR A CZ  1 
ATOM   2127  O OH  . TYR A  1 310  ? 245.870 223.152 229.813 1.00 45.04  ? 279  TYR A OH  1 
ATOM   2128  N N   . ASN A  1 311  ? 251.345 221.512 223.315 1.00 49.66  ? 280  ASN A N   1 
ATOM   2129  C CA  . ASN A  1 311  ? 252.192 220.796 222.369 1.00 49.66  ? 280  ASN A CA  1 
ATOM   2130  C C   . ASN A  1 311  ? 252.299 219.327 222.786 1.00 49.66  ? 280  ASN A C   1 
ATOM   2131  O O   . ASN A  1 311  ? 251.632 218.871 223.716 1.00 49.66  ? 280  ASN A O   1 
ATOM   2132  C CB  . ASN A  1 311  ? 253.546 221.490 222.236 1.00 49.66  ? 280  ASN A CB  1 
ATOM   2133  C CG  . ASN A  1 311  ? 254.394 221.370 223.474 1.00 49.66  ? 280  ASN A CG  1 
ATOM   2134  O OD1 . ASN A  1 311  ? 253.894 221.094 224.556 1.00 49.66  ? 280  ASN A OD1 1 
ATOM   2135  N ND2 . ASN A  1 311  ? 255.687 221.609 223.327 1.00 49.66  ? 280  ASN A ND2 1 
ATOM   2136  N N   . GLU A  1 312  ? 253.135 218.560 222.087 1.00 55.63  ? 281  GLU A N   1 
ATOM   2137  C CA  . GLU A  1 312  ? 253.246 217.126 222.331 1.00 55.63  ? 281  GLU A CA  1 
ATOM   2138  C C   . GLU A  1 312  ? 254.021 216.776 223.594 1.00 55.63  ? 281  GLU A C   1 
ATOM   2139  O O   . GLU A  1 312  ? 254.129 215.589 223.915 1.00 55.63  ? 281  GLU A O   1 
ATOM   2140  C CB  . GLU A  1 312  ? 253.893 216.428 221.133 1.00 55.63  ? 281  GLU A CB  1 
ATOM   2141  C CG  . GLU A  1 312  ? 255.339 216.811 220.879 1.00 55.63  ? 281  GLU A CG  1 
ATOM   2142  C CD  . GLU A  1 312  ? 255.481 218.091 220.081 1.00 55.63  ? 281  GLU A CD  1 
ATOM   2143  O OE1 . GLU A  1 312  ? 254.499 218.854 219.984 1.00 55.63  ? 281  GLU A OE1 1 
ATOM   2144  O OE2 . GLU A  1 312  ? 256.583 218.339 219.554 1.00 55.63  ? 281  GLU A OE2 1 
ATOM   2145  N N   . ASN A  1 313  ? 254.561 217.756 224.314 1.00 55.70  ? 282  ASN A N   1 
ATOM   2146  C CA  . ASN A  1 313  ? 255.206 217.497 225.593 1.00 55.70  ? 282  ASN A CA  1 
ATOM   2147  C C   . ASN A  1 313  ? 254.345 217.898 226.781 1.00 55.70  ? 282  ASN A C   1 
ATOM   2148  O O   . ASN A  1 313  ? 254.723 217.614 227.920 1.00 55.70  ? 282  ASN A O   1 
ATOM   2149  C CB  . ASN A  1 313  ? 256.544 218.236 225.674 1.00 55.70  ? 282  ASN A CB  1 
ATOM   2150  C CG  . ASN A  1 313  ? 257.564 217.689 224.716 1.00 55.70  ? 282  ASN A CG  1 
ATOM   2151  O OD1 . ASN A  1 313  ? 257.393 216.605 224.169 1.00 55.70  ? 282  ASN A OD1 1 
ATOM   2152  N ND2 . ASN A  1 313  ? 258.633 218.437 224.499 1.00 55.70  ? 282  ASN A ND2 1 
ATOM   2153  N N   . GLY A  1 314  ? 253.206 218.538 226.545 1.00 48.42  ? 283  GLY A N   1 
ATOM   2154  C CA  . GLY A  1 314  ? 252.301 218.916 227.606 1.00 48.42  ? 283  GLY A CA  1 
ATOM   2155  C C   . GLY A  1 314  ? 252.456 220.321 228.146 1.00 48.42  ? 283  GLY A C   1 
ATOM   2156  O O   . GLY A  1 314  ? 251.912 220.611 229.216 1.00 48.42  ? 283  GLY A O   1 
ATOM   2157  N N   . THR A  1 315  ? 253.181 221.198 227.457 1.00 45.41  ? 284  THR A N   1 
ATOM   2158  C CA  . THR A  1 315  ? 253.379 222.566 227.916 1.00 45.41  ? 284  THR A CA  1 
ATOM   2159  C C   . THR A  1 315  ? 252.482 223.505 227.123 1.00 45.41  ? 284  THR A C   1 
ATOM   2160  O O   . THR A  1 315  ? 252.261 223.301 225.928 1.00 45.41  ? 284  THR A O   1 
ATOM   2161  C CB  . THR A  1 315  ? 254.838 223.004 227.775 1.00 45.41  ? 284  THR A CB  1 
ATOM   2162  O OG1 . THR A  1 315  ? 255.094 223.382 226.422 1.00 45.41  ? 284  THR A OG1 1 
ATOM   2163  C CG2 . THR A  1 315  ? 255.772 221.878 228.153 1.00 45.41  ? 284  THR A CG2 1 
ATOM   2164  N N   . ILE A  1 316  ? 251.960 224.528 227.793 1.00 42.77  ? 285  ILE A N   1 
ATOM   2165  C CA  . ILE A  1 316  ? 251.184 225.570 227.129 1.00 42.77  ? 285  ILE A CA  1 
ATOM   2166  C C   . ILE A  1 316  ? 252.145 226.494 226.391 1.00 42.77  ? 285  ILE A C   1 
ATOM   2167  O O   . ILE A  1 316  ? 252.939 227.203 227.011 1.00 42.77  ? 285  ILE A O   1 
ATOM   2168  C CB  . ILE A  1 316  ? 250.312 226.350 228.116 1.00 42.77  ? 285  ILE A CB  1 
ATOM   2169  C CG1 . ILE A  1 316  ? 249.324 225.415 228.805 1.00 42.77  ? 285  ILE A CG1 1 
ATOM   2170  C CG2 . ILE A  1 316  ? 249.575 227.448 227.396 1.00 42.77  ? 285  ILE A CG2 1 
ATOM   2171  C CD1 . ILE A  1 316  ? 248.679 226.010 230.012 1.00 42.77  ? 285  ILE A CD1 1 
ATOM   2172  N N   . THR A  1 317  ? 252.072 226.487 225.060 1.00 43.97  ? 286  THR A N   1 
ATOM   2173  C CA  . THR A  1 317  ? 252.946 227.307 224.238 1.00 43.97  ? 286  THR A CA  1 
ATOM   2174  C C   . THR A  1 317  ? 252.260 228.498 223.583 1.00 43.97  ? 286  THR A C   1 
ATOM   2175  O O   . THR A  1 317  ? 252.960 229.403 223.122 1.00 43.97  ? 286  THR A O   1 
ATOM   2176  C CB  . THR A  1 317  ? 253.606 226.448 223.151 1.00 43.97  ? 286  THR A CB  1 
ATOM   2177  O OG1 . THR A  1 317  ? 252.600 225.869 222.312 1.00 43.97  ? 286  THR A OG1 1 
ATOM   2178  C CG2 . THR A  1 317  ? 254.427 225.342 223.778 1.00 43.97  ? 286  THR A CG2 1 
ATOM   2179  N N   . ASP A  1 318  ? 250.930 228.536 223.536 1.00 47.20  ? 287  ASP A N   1 
ATOM   2180  C CA  . ASP A  1 318  ? 250.246 229.665 222.921 1.00 47.20  ? 287  ASP A CA  1 
ATOM   2181  C C   . ASP A  1 318  ? 248.830 229.766 223.469 1.00 47.20  ? 287  ASP A C   1 
ATOM   2182  O O   . ASP A  1 318  ? 248.295 228.809 224.032 1.00 47.20  ? 287  ASP A O   1 
ATOM   2183  C CB  . ASP A  1 318  ? 250.229 229.539 221.397 1.00 47.20  ? 287  ASP A CB  1 
ATOM   2184  C CG  . ASP A  1 318  ? 250.169 230.881 220.702 1.00 47.20  ? 287  ASP A CG  1 
ATOM   2185  O OD1 . ASP A  1 318  ? 250.443 231.908 221.359 1.00 47.20  ? 287  ASP A OD1 1 
ATOM   2186  O OD2 . ASP A  1 318  ? 249.870 230.908 219.492 1.00 47.20  ? 287  ASP A OD2 1 
ATOM   2187  N N   . ALA A  1 319  ? 248.234 230.947 223.304 1.00 46.69  ? 288  ALA A N   1 
ATOM   2188  C CA  . ALA A  1 319  ? 246.886 231.204 223.795 1.00 46.69  ? 288  ALA A CA  1 
ATOM   2189  C C   . ALA A  1 319  ? 246.213 232.259 222.931 1.00 46.69  ? 288  ALA A C   1 
ATOM   2190  O O   . ALA A  1 319  ? 246.873 233.078 222.289 1.00 46.69  ? 288  ALA A O   1 
ATOM   2191  C CB  . ALA A  1 319  ? 246.891 231.652 225.259 1.00 46.69  ? 288  ALA A CB  1 
ATOM   2192  N N   . VAL A  1 320  ? 244.883 232.226 222.923 1.00 44.75  ? 289  VAL A N   1 
ATOM   2193  C CA  . VAL A  1 320  ? 244.054 233.231 222.262 1.00 44.75  ? 289  VAL A CA  1 
ATOM   2194  C C   . VAL A  1 320  ? 243.079 233.799 223.284 1.00 44.75  ? 289  VAL A C   1 
ATOM   2195  O O   . VAL A  1 320  ? 242.367 233.040 223.952 1.00 44.75  ? 289  VAL A O   1 
ATOM   2196  C CB  . VAL A  1 320  ? 243.284 232.649 221.061 1.00 44.75  ? 289  VAL A CB  1 
ATOM   2197  C CG1 . VAL A  1 320  ? 242.322 233.671 220.507 1.00 44.75  ? 289  VAL A CG1 1 
ATOM   2198  C CG2 . VAL A  1 320  ? 244.234 232.208 219.979 1.00 44.75  ? 289  VAL A CG2 1 
ATOM   2199  N N   . ASP A  1 321  ? 243.058 235.126 223.412 1.00 45.68  ? 290  ASP A N   1 
ATOM   2200  C CA  . ASP A  1 321  ? 242.064 235.816 224.229 1.00 45.68  ? 290  ASP A CA  1 
ATOM   2201  C C   . ASP A  1 321  ? 240.822 235.998 223.369 1.00 45.68  ? 290  ASP A C   1 
ATOM   2202  O O   . ASP A  1 321  ? 240.804 236.829 222.458 1.00 45.68  ? 290  ASP A O   1 
ATOM   2203  C CB  . ASP A  1 321  ? 242.602 237.154 224.725 1.00 45.68  ? 290  ASP A CB  1 
ATOM   2204  C CG  . ASP A  1 321  ? 241.672 237.831 225.707 1.00 45.68  ? 290  ASP A CG  1 
ATOM   2205  O OD1 . ASP A  1 321  ? 240.556 237.325 225.928 1.00 45.68  ? 290  ASP A OD1 1 
ATOM   2206  O OD2 . ASP A  1 321  ? 242.058 238.877 226.265 1.00 45.68  ? 290  ASP A OD2 1 
ATOM   2207  N N   . CYS A  1 322  ? 239.769 235.248 223.685 1.00 50.49  ? 291  CYS A N   1 
ATOM   2208  C CA  . CYS A  1 322  ? 238.619 235.108 222.803 1.00 50.49  ? 291  CYS A CA  1 
ATOM   2209  C C   . CYS A  1 322  ? 237.728 236.340 222.744 1.00 50.49  ? 291  CYS A C   1 
ATOM   2210  O O   . CYS A  1 322  ? 236.807 236.362 221.926 1.00 50.49  ? 291  CYS A O   1 
ATOM   2211  C CB  . CYS A  1 322  ? 237.805 233.887 223.228 1.00 50.49  ? 291  CYS A CB  1 
ATOM   2212  S SG  . CYS A  1 322  ? 238.655 232.317 222.892 1.00 50.49  ? 291  CYS A SG  1 
ATOM   2213  N N   . ALA A  1 323  ? 237.957 237.353 223.576 1.00 50.21  ? 292  ALA A N   1 
ATOM   2214  C CA  . ALA A  1 323  ? 237.105 238.538 223.601 1.00 50.21  ? 292  ALA A CA  1 
ATOM   2215  C C   . ALA A  1 323  ? 237.872 239.825 223.337 1.00 50.21  ? 292  ALA A C   1 
ATOM   2216  O O   . ALA A  1 323  ? 237.355 240.910 223.616 1.00 50.21  ? 292  ALA A O   1 
ATOM   2217  C CB  . ALA A  1 323  ? 236.363 238.641 224.935 1.00 50.21  ? 292  ALA A CB  1 
ATOM   2218  N N   . LEU A  1 324  ? 239.101 239.731 222.835 1.00 49.43  ? 293  LEU A N   1 
ATOM   2219  C CA  . LEU A  1 324  ? 239.856 240.922 222.460 1.00 49.43  ? 293  LEU A CA  1 
ATOM   2220  C C   . LEU A  1 324  ? 239.282 241.565 221.199 1.00 49.43  ? 293  LEU A C   1 
ATOM   2221  O O   . LEU A  1 324  ? 238.948 242.755 221.191 1.00 49.43  ? 293  LEU A O   1 
ATOM   2222  C CB  . LEU A  1 324  ? 241.330 240.557 222.285 1.00 49.43  ? 293  LEU A CB  1 
ATOM   2223  C CG  . LEU A  1 324  ? 242.289 241.534 221.618 1.00 49.43  ? 293  LEU A CG  1 
ATOM   2224  C CD1 . LEU A  1 324  ? 242.466 242.760 222.468 1.00 49.43  ? 293  LEU A CD1 1 
ATOM   2225  C CD2 . LEU A  1 324  ? 243.624 240.859 221.411 1.00 49.43  ? 293  LEU A CD2 1 
ATOM   2226  N N   . ASP A  1 325  ? 239.158 240.793 220.127 1.00 53.49  ? 294  ASP A N   1 
ATOM   2227  C CA  . ASP A  1 325  ? 238.827 241.281 218.797 1.00 53.49  ? 294  ASP A CA  1 
ATOM   2228  C C   . ASP A  1 325  ? 237.797 240.357 218.170 1.00 53.49  ? 294  ASP A C   1 
ATOM   2229  O O   . ASP A  1 325  ? 237.642 239.209 218.600 1.00 53.49  ? 294  ASP A O   1 
ATOM   2230  C CB  . ASP A  1 325  ? 240.062 241.340 217.888 1.00 53.49  ? 294  ASP A CB  1 
ATOM   2231  C CG  . ASP A  1 325  ? 241.026 242.426 218.282 1.00 53.49  ? 294  ASP A CG  1 
ATOM   2232  O OD1 . ASP A  1 325  ? 240.594 243.392 218.938 1.00 53.49  ? 294  ASP A OD1 1 
ATOM   2233  O OD2 . ASP A  1 325  ? 242.216 242.316 217.927 1.00 53.49  ? 294  ASP A OD2 1 
ATOM   2234  N N   . PRO A  1 326  ? 237.057 240.836 217.162 1.00 49.60  ? 295  PRO A N   1 
ATOM   2235  C CA  . PRO A  1 326  ? 236.264 239.901 216.344 1.00 49.60  ? 295  PRO A CA  1 
ATOM   2236  C C   . PRO A  1 326  ? 237.099 238.834 215.655 1.00 49.60  ? 295  PRO A C   1 
ATOM   2237  O O   . PRO A  1 326  ? 236.645 237.692 215.519 1.00 49.60  ? 295  PRO A O   1 
ATOM   2238  C CB  . PRO A  1 326  ? 235.580 240.826 215.329 1.00 49.60  ? 295  PRO A CB  1 
ATOM   2239  C CG  . PRO A  1 326  ? 235.565 242.159 215.972 1.00 49.60  ? 295  PRO A CG  1 
ATOM   2240  C CD  . PRO A  1 326  ? 236.812 242.240 216.791 1.00 49.60  ? 295  PRO A CD  1 
ATOM   2241  N N   . LEU A  1 327  ? 238.304 239.179 215.193 1.00 48.08  ? 296  LEU A N   1 
ATOM   2242  C CA  . LEU A  1 327  ? 239.187 238.172 214.614 1.00 48.08  ? 296  LEU A CA  1 
ATOM   2243  C C   . LEU A  1 327  ? 239.515 237.081 215.622 1.00 48.08  ? 296  LEU A C   1 
ATOM   2244  O O   . LEU A  1 327  ? 239.455 235.888 215.306 1.00 48.08  ? 296  LEU A O   1 
ATOM   2245  C CB  . LEU A  1 327  ? 240.465 238.828 214.100 1.00 48.08  ? 296  LEU A CB  1 
ATOM   2246  C CG  . LEU A  1 327  ? 241.493 237.872 213.498 1.00 48.08  ? 296  LEU A CG  1 
ATOM   2247  C CD1 . LEU A  1 327  ? 240.956 237.217 212.245 1.00 48.08  ? 296  LEU A CD1 1 
ATOM   2248  C CD2 . LEU A  1 327  ? 242.784 238.608 213.202 1.00 48.08  ? 296  LEU A CD2 1 
ATOM   2249  N N   . SER A  1 328  ? 239.876 237.476 216.845 1.00 49.07  ? 297  SER A N   1 
ATOM   2250  C CA  . SER A  1 328  ? 240.119 236.502 217.900 1.00 49.07  ? 297  SER A CA  1 
ATOM   2251  C C   . SER A  1 328  ? 238.875 235.690 218.208 1.00 49.07  ? 297  SER A C   1 
ATOM   2252  O O   . SER A  1 328  ? 238.975 234.509 218.549 1.00 49.07  ? 297  SER A O   1 
ATOM   2253  C CB  . SER A  1 328  ? 240.615 237.206 219.155 1.00 49.07  ? 297  SER A CB  1 
ATOM   2254  O OG  . SER A  1 328  ? 241.890 237.771 218.936 1.00 49.07  ? 297  SER A OG  1 
ATOM   2255  N N   . GLU A  1 329  ? 237.695 236.294 218.081 1.00 53.24  ? 298  GLU A N   1 
ATOM   2256  C CA  . GLU A  1 329  ? 236.463 235.557 218.330 1.00 53.24  ? 298  GLU A CA  1 
ATOM   2257  C C   . GLU A  1 329  ? 236.224 234.495 217.264 1.00 53.24  ? 298  GLU A C   1 
ATOM   2258  O O   . GLU A  1 329  ? 235.770 233.389 217.574 1.00 53.24  ? 298  GLU A O   1 
ATOM   2259  C CB  . GLU A  1 329  ? 235.290 236.523 218.400 1.00 53.24  ? 298  GLU A CB  1 
ATOM   2260  C CG  . GLU A  1 329  ? 234.066 235.943 219.056 1.00 53.24  ? 298  GLU A CG  1 
ATOM   2261  C CD  . GLU A  1 329  ? 232.890 236.887 219.006 1.00 53.24  ? 298  GLU A CD  1 
ATOM   2262  O OE1 . GLU A  1 329  ? 233.117 238.112 218.921 1.00 53.24  ? 298  GLU A OE1 1 
ATOM   2263  O OE2 . GLU A  1 329  ? 231.741 236.403 219.044 1.00 53.24  ? 298  GLU A OE2 1 
ATOM   2264  N N   . THR A  1 330  ? 236.522 234.807 216.000 1.00 48.49  ? 299  THR A N   1 
ATOM   2265  C CA  . THR A  1 330  ? 236.413 233.789 214.958 1.00 48.49  ? 299  THR A CA  1 
ATOM   2266  C C   . THR A  1 330  ? 237.472 232.708 215.122 1.00 48.49  ? 299  THR A C   1 
ATOM   2267  O O   . THR A  1 330  ? 237.211 231.534 214.843 1.00 48.49  ? 299  THR A O   1 
ATOM   2268  C CB  . THR A  1 330  ? 236.511 234.421 213.574 1.00 48.49  ? 299  THR A CB  1 
ATOM   2269  O OG1 . THR A  1 330  ? 237.670 235.255 213.503 1.00 48.49  ? 299  THR A OG1 1 
ATOM   2270  C CG2 . THR A  1 330  ? 235.287 235.254 213.303 1.00 48.49  ? 299  THR A CG2 1 
ATOM   2271  N N   . LYS A  1 331  ? 238.676 233.081 215.557 1.00 46.61  ? 300  LYS A N   1 
ATOM   2272  C CA  . LYS A  1 331  ? 239.677 232.077 215.907 1.00 46.61  ? 300  LYS A CA  1 
ATOM   2273  C C   . LYS A  1 331  ? 239.149 231.146 216.988 1.00 46.61  ? 300  LYS A C   1 
ATOM   2274  O O   . LYS A  1 331  ? 239.319 229.926 216.912 1.00 46.61  ? 300  LYS A O   1 
ATOM   2275  C CB  . LYS A  1 331  ? 240.956 232.762 216.380 1.00 46.61  ? 300  LYS A CB  1 
ATOM   2276  C CG  . LYS A  1 331  ? 241.798 233.349 215.282 1.00 46.61  ? 300  LYS A CG  1 
ATOM   2277  C CD  . LYS A  1 331  ? 243.100 233.842 215.843 1.00 46.61  ? 300  LYS A CD  1 
ATOM   2278  C CE  . LYS A  1 331  ? 244.084 234.161 214.754 1.00 46.61  ? 300  LYS A CE  1 
ATOM   2279  N NZ  . LYS A  1 331  ? 244.922 235.322 215.137 1.00 46.61  ? 300  LYS A NZ  1 
ATOM   2280  N N   . CYS A  1 332  ? 238.510 231.716 218.006 1.00 51.00  ? 301  CYS A N   1 
ATOM   2281  C CA  . CYS A  1 332  ? 237.983 230.934 219.116 1.00 51.00  ? 301  CYS A CA  1 
ATOM   2282  C C   . CYS A  1 332  ? 236.863 230.010 218.658 1.00 51.00  ? 301  CYS A C   1 
ATOM   2283  O O   . CYS A  1 332  ? 236.757 228.872 219.127 1.00 51.00  ? 301  CYS A O   1 
ATOM   2284  C CB  . CYS A  1 332  ? 237.484 231.882 220.199 1.00 51.00  ? 301  CYS A CB  1 
ATOM   2285  S SG  . CYS A  1 332  ? 237.309 231.216 221.853 1.00 51.00  ? 301  CYS A SG  1 
ATOM   2286  N N   . THR A  1 333  ? 236.006 230.492 217.756 1.00 48.41  ? 302  THR A N   1 
ATOM   2287  C CA  . THR A  1 333  ? 234.891 229.681 217.276 1.00 48.41  ? 302  THR A CA  1 
ATOM   2288  C C   . THR A  1 333  ? 235.373 228.546 216.382 1.00 48.41  ? 302  THR A C   1 
ATOM   2289  O O   . THR A  1 333  ? 234.956 227.395 216.546 1.00 48.41  ? 302  THR A O   1 
ATOM   2290  C CB  . THR A  1 333  ? 233.892 230.557 216.523 1.00 48.41  ? 302  THR A CB  1 
ATOM   2291  O OG1 . THR A  1 333  ? 233.443 231.620 217.371 1.00 48.41  ? 302  THR A OG1 1 
ATOM   2292  C CG2 . THR A  1 333  ? 232.706 229.737 216.080 1.00 48.41  ? 302  THR A CG2 1 
ATOM   2293  N N   . LEU A  1 334  ? 236.250 228.849 215.422 1.00 48.36  ? 303  LEU A N   1 
ATOM   2294  C CA  . LEU A  1 334  ? 236.789 227.813 214.550 1.00 48.36  ? 303  LEU A CA  1 
ATOM   2295  C C   . LEU A  1 334  ? 237.717 226.858 215.283 1.00 48.36  ? 303  LEU A C   1 
ATOM   2296  O O   . LEU A  1 334  ? 238.068 225.815 214.723 1.00 48.36  ? 303  LEU A O   1 
ATOM   2297  C CB  . LEU A  1 334  ? 237.535 228.440 213.373 1.00 48.36  ? 303  LEU A CB  1 
ATOM   2298  C CG  . LEU A  1 334  ? 236.760 229.355 212.429 1.00 48.36  ? 303  LEU A CG  1 
ATOM   2299  C CD1 . LEU A  1 334  ? 237.715 230.013 211.460 1.00 48.36  ? 303  LEU A CD1 1 
ATOM   2300  C CD2 . LEU A  1 334  ? 235.691 228.579 211.687 1.00 48.36  ? 303  LEU A CD2 1 
ATOM   2301  N N   . LYS A  1 335  ? 238.113 227.190 216.510 1.00 48.11  ? 304  LYS A N   1 
ATOM   2302  C CA  . LYS A  1 335  ? 239.070 226.413 217.292 1.00 48.11  ? 304  LYS A CA  1 
ATOM   2303  C C   . LYS A  1 335  ? 240.348 226.152 216.508 1.00 48.11  ? 304  LYS A C   1 
ATOM   2304  O O   . LYS A  1 335  ? 240.816 225.020 216.383 1.00 48.11  ? 304  LYS A O   1 
ATOM   2305  C CB  . LYS A  1 335  ? 238.448 225.110 217.786 1.00 48.11  ? 304  LYS A CB  1 
ATOM   2306  C CG  . LYS A  1 335  ? 237.499 225.313 218.941 1.00 48.11  ? 304  LYS A CG  1 
ATOM   2307  C CD  . LYS A  1 335  ? 237.170 224.007 219.621 1.00 48.11  ? 304  LYS A CD  1 
ATOM   2308  C CE  . LYS A  1 335  ? 236.187 224.225 220.755 1.00 48.11  ? 304  LYS A CE  1 
ATOM   2309  N NZ  . LYS A  1 335  ? 236.756 225.123 221.797 1.00 48.11  ? 304  LYS A NZ  1 
ATOM   2310  N N   . SER A  1 336  ? 240.915 227.226 215.971 1.00 49.73  ? 305  SER A N   1 
ATOM   2311  C CA  . SER A  1 336  ? 242.187 227.150 215.274 1.00 49.73  ? 305  SER A CA  1 
ATOM   2312  C C   . SER A  1 336  ? 242.879 228.493 215.402 1.00 49.73  ? 305  SER A C   1 
ATOM   2313  O O   . SER A  1 336  ? 242.248 229.515 215.671 1.00 49.73  ? 305  SER A O   1 
ATOM   2314  C CB  . SER A  1 336  ? 242.005 226.772 213.802 1.00 49.73  ? 305  SER A CB  1 
ATOM   2315  O OG  . SER A  1 336  ? 241.562 227.881 213.043 1.00 49.73  ? 305  SER A OG  1 
ATOM   2316  N N   . PHE A  1 337  ? 244.188 228.484 215.193 1.00 51.01  ? 306  PHE A N   1 
ATOM   2317  C CA  . PHE A  1 337  ? 244.960 229.715 215.186 1.00 51.01  ? 306  PHE A CA  1 
ATOM   2318  C C   . PHE A  1 337  ? 245.083 230.314 213.794 1.00 51.01  ? 306  PHE A C   1 
ATOM   2319  O O   . PHE A  1 337  ? 245.635 231.408 213.652 1.00 51.01  ? 306  PHE A O   1 
ATOM   2320  C CB  . PHE A  1 337  ? 246.352 229.454 215.772 1.00 51.01  ? 306  PHE A CB  1 
ATOM   2321  C CG  . PHE A  1 337  ? 246.358 229.283 217.265 1.00 51.01  ? 306  PHE A CG  1 
ATOM   2322  C CD1 . PHE A  1 337  ? 246.923 230.236 218.085 1.00 51.01  ? 306  PHE A CD1 1 
ATOM   2323  C CD2 . PHE A  1 337  ? 245.791 228.168 217.849 1.00 51.01  ? 306  PHE A CD2 1 
ATOM   2324  C CE1 . PHE A  1 337  ? 246.927 230.073 219.452 1.00 51.01  ? 306  PHE A CE1 1 
ATOM   2325  C CE2 . PHE A  1 337  ? 245.790 228.010 219.216 1.00 51.01  ? 306  PHE A CE2 1 
ATOM   2326  C CZ  . PHE A  1 337  ? 246.357 228.963 220.014 1.00 51.01  ? 306  PHE A CZ  1 
ATOM   2327  N N   . THR A  1 338  ? 244.575 229.631 212.773 1.00 53.21  ? 307  THR A N   1 
ATOM   2328  C CA  . THR A  1 338  ? 244.652 230.080 211.390 1.00 53.21  ? 307  THR A CA  1 
ATOM   2329  C C   . THR A  1 338  ? 243.244 230.243 210.840 1.00 53.21  ? 307  THR A C   1 
ATOM   2330  O O   . THR A  1 338  ? 242.403 229.356 211.009 1.00 53.21  ? 307  THR A O   1 
ATOM   2331  C CB  . THR A  1 338  ? 245.446 229.093 210.532 1.00 53.21  ? 307  THR A CB  1 
ATOM   2332  O OG1 . THR A  1 338  ? 246.758 228.934 211.080 1.00 53.21  ? 307  THR A OG1 1 
ATOM   2333  C CG2 . THR A  1 338  ? 245.566 229.600 209.108 1.00 53.21  ? 307  THR A CG2 1 
ATOM   2334  N N   . VAL A  1 339  ? 242.994 231.371 210.181 1.00 50.45  ? 308  VAL A N   1 
ATOM   2335  C CA  . VAL A  1 339  ? 241.708 231.676 209.569 1.00 50.45  ? 308  VAL A CA  1 
ATOM   2336  C C   . VAL A  1 339  ? 241.920 231.845 208.071 1.00 50.45  ? 308  VAL A C   1 
ATOM   2337  O O   . VAL A  1 339  ? 242.830 232.565 207.648 1.00 50.45  ? 308  VAL A O   1 
ATOM   2338  C CB  . VAL A  1 339  ? 241.079 232.936 210.186 1.00 50.45  ? 308  VAL A CB  1 
ATOM   2339  C CG1 . VAL A  1 339  ? 239.743 233.223 209.553 1.00 50.45  ? 308  VAL A CG1 1 
ATOM   2340  C CG2 . VAL A  1 339  ? 240.935 232.768 211.680 1.00 50.45  ? 308  VAL A CG2 1 
ATOM   2341  N N   . GLU A  1 340  ? 241.094 231.174 207.274 1.00 49.13  ? 309  GLU A N   1 
ATOM   2342  C CA  . GLU A  1 340  ? 241.139 231.322 205.828 1.00 49.13  ? 309  GLU A CA  1 
ATOM   2343  C C   . GLU A  1 340  ? 240.345 232.543 205.371 1.00 49.13  ? 309  GLU A C   1 
ATOM   2344  O O   . GLU A  1 340  ? 239.533 233.104 206.107 1.00 49.13  ? 309  GLU A O   1 
ATOM   2345  C CB  . GLU A  1 340  ? 240.601 230.073 205.136 1.00 49.13  ? 309  GLU A CB  1 
ATOM   2346  C CG  . GLU A  1 340  ? 241.534 228.889 205.199 1.00 49.13  ? 309  GLU A CG  1 
ATOM   2347  C CD  . GLU A  1 340  ? 240.821 227.582 204.944 1.00 49.13  ? 309  GLU A CD  1 
ATOM   2348  O OE1 . GLU A  1 340  ? 239.581 227.601 204.807 1.00 49.13  ? 309  GLU A OE1 1 
ATOM   2349  O OE2 . GLU A  1 340  ? 241.500 226.536 204.881 1.00 49.13  ? 309  GLU A OE2 1 
ATOM   2350  N N   . LYS A  1 341  ? 240.602 232.952 204.132 1.00 43.73  ? 310  LYS A N   1 
ATOM   2351  C CA  . LYS A  1 341  ? 239.964 234.131 203.561 1.00 43.73  ? 310  LYS A CA  1 
ATOM   2352  C C   . LYS A  1 341  ? 238.450 233.976 203.494 1.00 43.73  ? 310  LYS A C   1 
ATOM   2353  O O   . LYS A  1 341  ? 237.941 232.937 203.069 1.00 43.73  ? 310  LYS A O   1 
ATOM   2354  C CB  . LYS A  1 341  ? 240.519 234.380 202.161 1.00 43.73  ? 310  LYS A CB  1 
ATOM   2355  C CG  . LYS A  1 341  ? 239.792 235.459 201.398 1.00 43.73  ? 310  LYS A CG  1 
ATOM   2356  C CD  . LYS A  1 341  ? 239.489 235.028 199.982 1.00 43.73  ? 310  LYS A CD  1 
ATOM   2357  C CE  . LYS A  1 341  ? 240.690 235.181 199.093 1.00 43.73  ? 310  LYS A CE  1 
ATOM   2358  N NZ  . LYS A  1 341  ? 240.314 234.995 197.669 1.00 43.73  ? 310  LYS A NZ  1 
ATOM   2359  N N   . GLY A  1 342  ? 237.728 235.011 203.908 1.00 37.78  ? 311  GLY A N   1 
ATOM   2360  C CA  . GLY A  1 342  ? 236.285 234.983 203.811 1.00 37.78  ? 311  GLY A CA  1 
ATOM   2361  C C   . GLY A  1 342  ? 235.615 235.970 204.748 1.00 37.78  ? 311  GLY A C   1 
ATOM   2362  O O   . GLY A  1 342  ? 236.242 236.873 205.299 1.00 37.78  ? 311  GLY A O   1 
ATOM   2363  N N   . ILE A  1 343  ? 234.301 235.788 204.869 1.00 34.21  ? 312  ILE A N   1 
ATOM   2364  C CA  . ILE A  1 343  ? 233.418 236.600 205.699 1.00 34.21  ? 312  ILE A CA  1 
ATOM   2365  C C   . ILE A  1 343  ? 232.775 235.690 206.737 1.00 34.21  ? 312  ILE A C   1 
ATOM   2366  O O   . ILE A  1 343  ? 232.237 234.634 206.389 1.00 34.21  ? 312  ILE A O   1 
ATOM   2367  C CB  . ILE A  1 343  ? 232.353 237.304 204.837 1.00 34.21  ? 312  ILE A CB  1 
ATOM   2368  C CG1 . ILE A  1 343  ? 231.230 237.889 205.688 1.00 34.21  ? 312  ILE A CG1 1 
ATOM   2369  C CG2 . ILE A  1 343  ? 231.808 236.364 203.779 1.00 34.21  ? 312  ILE A CG2 1 
ATOM   2370  C CD1 . ILE A  1 343  ? 231.341 239.354 205.909 1.00 34.21  ? 312  ILE A CD1 1 
ATOM   2371  N N   . TYR A  1 344  ? 232.828 236.093 208.006 1.00 34.85  ? 313  TYR A N   1 
ATOM   2372  C CA  . TYR A  1 344  ? 232.320 235.280 209.107 1.00 34.85  ? 313  TYR A CA  1 
ATOM   2373  C C   . TYR A  1 344  ? 231.347 236.068 209.972 1.00 34.85  ? 313  TYR A C   1 
ATOM   2374  O O   . TYR A  1 344  ? 231.598 237.229 210.298 1.00 34.85  ? 313  TYR A O   1 
ATOM   2375  C CB  . TYR A  1 344  ? 233.456 234.747 209.975 1.00 34.85  ? 313  TYR A CB  1 
ATOM   2376  C CG  . TYR A  1 344  ? 234.503 233.985 209.207 1.00 34.85  ? 313  TYR A CG  1 
ATOM   2377  C CD1 . TYR A  1 344  ? 234.406 232.616 209.056 1.00 34.85  ? 313  TYR A CD1 1 
ATOM   2378  C CD2 . TYR A  1 344  ? 235.594 234.625 208.653 1.00 34.85  ? 313  TYR A CD2 1 
ATOM   2379  C CE1 . TYR A  1 344  ? 235.344 231.912 208.360 1.00 34.85  ? 313  TYR A CE1 1 
ATOM   2380  C CE2 . TYR A  1 344  ? 236.546 233.921 207.956 1.00 34.85  ? 313  TYR A CE2 1 
ATOM   2381  C CZ  . TYR A  1 344  ? 236.413 232.565 207.814 1.00 34.85  ? 313  TYR A CZ  1 
ATOM   2382  O OH  . TYR A  1 344  ? 237.354 231.849 207.120 1.00 34.85  ? 313  TYR A OH  1 
ATOM   2383  N N   . GLN A  1 345  ? 230.238 235.426 210.347 1.00 37.19  ? 314  GLN A N   1 
ATOM   2384  C CA  . GLN A  1 345  ? 229.333 235.976 211.350 1.00 37.19  ? 314  GLN A CA  1 
ATOM   2385  C C   . GLN A  1 345  ? 229.945 235.769 212.726 1.00 37.19  ? 314  GLN A C   1 
ATOM   2386  O O   . GLN A  1 345  ? 230.333 234.651 213.071 1.00 37.19  ? 314  GLN A O   1 
ATOM   2387  C CB  . GLN A  1 345  ? 227.977 235.275 211.296 1.00 37.19  ? 314  GLN A CB  1 
ATOM   2388  C CG  . GLN A  1 345  ? 227.309 235.213 209.937 1.00 37.19  ? 314  GLN A CG  1 
ATOM   2389  C CD  . GLN A  1 345  ? 226.921 236.567 209.400 1.00 37.19  ? 314  GLN A CD  1 
ATOM   2390  O OE1 . GLN A  1 345  ? 227.287 236.931 208.284 1.00 37.19  ? 314  GLN A OE1 1 
ATOM   2391  N NE2 . GLN A  1 345  ? 226.179 237.328 210.192 1.00 37.19  ? 314  GLN A NE2 1 
ATOM   2392  N N   . THR A  1 346  ? 230.031 236.835 213.522 1.00 44.17  ? 315  THR A N   1 
ATOM   2393  C CA  . THR A  1 346  ? 230.639 236.709 214.842 1.00 44.17  ? 315  THR A CA  1 
ATOM   2394  C C   . THR A  1 346  ? 229.640 236.627 215.993 1.00 44.17  ? 315  THR A C   1 
ATOM   2395  O O   . THR A  1 346  ? 229.545 235.591 216.656 1.00 44.17  ? 315  THR A O   1 
ATOM   2396  C CB  . THR A  1 346  ? 231.599 237.882 215.072 1.00 44.17  ? 315  THR A CB  1 
ATOM   2397  O OG1 . THR A  1 346  ? 230.928 239.110 214.779 1.00 44.17  ? 315  THR A OG1 1 
ATOM   2398  C CG2 . THR A  1 346  ? 232.819 237.748 214.196 1.00 44.17  ? 315  THR A CG2 1 
ATOM   2399  N N   . SER A  1 347  ? 228.873 237.689 216.220 1.00 46.83  ? 316  SER A N   1 
ATOM   2400  C CA  . SER A  1 347  ? 228.008 237.772 217.391 1.00 46.83  ? 316  SER A CA  1 
ATOM   2401  C C   . SER A  1 347  ? 227.252 239.090 217.383 1.00 46.83  ? 316  SER A C   1 
ATOM   2402  O O   . SER A  1 347  ? 227.746 240.080 216.838 1.00 46.83  ? 316  SER A O   1 
ATOM   2403  C CB  . SER A  1 347  ? 228.825 237.651 218.678 1.00 46.83  ? 316  SER A CB  1 
ATOM   2404  O OG  . SER A  1 347  ? 227.998 237.381 219.789 1.00 46.83  ? 316  SER A OG  1 
ATOM   2405  N N   . ASN A  1 348  ? 226.079 239.138 217.999 1.00 44.79  ? 317  ASN A N   1 
ATOM   2406  C CA  . ASN A  1 348  ? 225.336 240.384 218.015 1.00 44.79  ? 317  ASN A CA  1 
ATOM   2407  C C   . ASN A  1 348  ? 226.006 241.407 218.924 1.00 44.79  ? 317  ASN A C   1 
ATOM   2408  O O   . ASN A  1 348  ? 226.679 241.061 219.894 1.00 44.79  ? 317  ASN A O   1 
ATOM   2409  C CB  . ASN A  1 348  ? 223.902 240.141 218.472 1.00 44.79  ? 317  ASN A CB  1 
ATOM   2410  C CG  . ASN A  1 348  ? 223.116 239.317 217.487 1.00 44.79  ? 317  ASN A CG  1 
ATOM   2411  O OD1 . ASN A  1 348  ? 223.674 238.502 216.762 1.00 44.79  ? 317  ASN A OD1 1 
ATOM   2412  N ND2 . ASN A  1 348  ? 221.807 239.512 217.462 1.00 44.79  ? 317  ASN A ND2 1 
ATOM   2413  N N   . PHE A  1 349  ? 225.841 242.681 218.575 1.00 46.79  ? 318  PHE A N   1 
ATOM   2414  C CA  . PHE A  1 349  ? 226.509 243.761 219.290 1.00 46.79  ? 318  PHE A CA  1 
ATOM   2415  C C   . PHE A  1 349  ? 225.955 243.850 220.708 1.00 46.79  ? 318  PHE A C   1 
ATOM   2416  O O   . PHE A  1 349  ? 224.743 243.980 220.893 1.00 46.79  ? 318  PHE A O   1 
ATOM   2417  C CB  . PHE A  1 349  ? 226.317 245.078 218.545 1.00 46.79  ? 318  PHE A CB  1 
ATOM   2418  C CG  . PHE A  1 349  ? 227.006 246.240 219.185 1.00 46.79  ? 318  PHE A CG  1 
ATOM   2419  C CD1 . PHE A  1 349  ? 226.314 247.100 220.009 1.00 46.79  ? 318  PHE A CD1 1 
ATOM   2420  C CD2 . PHE A  1 349  ? 228.343 246.480 218.953 1.00 46.79  ? 318  PHE A CD2 1 
ATOM   2421  C CE1 . PHE A  1 349  ? 226.942 248.164 220.597 1.00 46.79  ? 318  PHE A CE1 1 
ATOM   2422  C CE2 . PHE A  1 349  ? 228.972 247.545 219.540 1.00 46.79  ? 318  PHE A CE2 1 
ATOM   2423  C CZ  . PHE A  1 349  ? 228.270 248.385 220.363 1.00 46.79  ? 318  PHE A CZ  1 
ATOM   2424  N N   . ARG A  1 350  ? 226.828 243.781 221.708 1.00 51.52  ? 319  ARG A N   1 
ATOM   2425  C CA  . ARG A  1 350  ? 226.407 243.698 223.100 1.00 51.52  ? 319  ARG A CA  1 
ATOM   2426  C C   . ARG A  1 350  ? 226.839 244.929 223.884 1.00 51.52  ? 319  ARG A C   1 
ATOM   2427  O O   . ARG A  1 350  ? 227.954 245.429 223.710 1.00 51.52  ? 319  ARG A O   1 
ATOM   2428  C CB  . ARG A  1 350  ? 226.956 242.430 223.753 1.00 51.52  ? 319  ARG A CB  1 
ATOM   2429  C CG  . ARG A  1 350  ? 226.174 241.190 223.364 1.00 51.52  ? 319  ARG A CG  1 
ATOM   2430  C CD  . ARG A  1 350  ? 226.790 239.932 223.923 1.00 51.52  ? 319  ARG A CD  1 
ATOM   2431  N NE  . ARG A  1 350  ? 225.962 238.759 223.652 1.00 51.52  ? 319  ARG A NE  1 
ATOM   2432  C CZ  . ARG A  1 350  ? 225.013 238.318 224.468 1.00 51.52  ? 319  ARG A CZ  1 
ATOM   2433  N NH1 . ARG A  1 350  ? 224.774 238.950 225.607 1.00 51.52  ? 319  ARG A NH1 1 
ATOM   2434  N NH2 . ARG A  1 350  ? 224.306 237.245 224.151 1.00 51.52  ? 319  ARG A NH2 1 
ATOM   2435  N N   . VAL A  1 351  ? 225.947 245.404 224.752 1.00 51.17  ? 320  VAL A N   1 
ATOM   2436  C CA  . VAL A  1 351  ? 226.179 246.557 225.617 1.00 51.17  ? 320  VAL A CA  1 
ATOM   2437  C C   . VAL A  1 351  ? 226.093 246.090 227.065 1.00 51.17  ? 320  VAL A C   1 
ATOM   2438  O O   . VAL A  1 351  ? 225.114 245.445 227.453 1.00 51.17  ? 320  VAL A O   1 
ATOM   2439  C CB  . VAL A  1 351  ? 225.168 247.682 225.342 1.00 51.17  ? 320  VAL A CB  1 
ATOM   2440  C CG1 . VAL A  1 351  ? 225.294 248.773 226.380 1.00 51.17  ? 320  VAL A CG1 1 
ATOM   2441  C CG2 . VAL A  1 351  ? 225.361 248.234 223.952 1.00 51.17  ? 320  VAL A CG2 1 
ATOM   2442  N N   . GLN A  1 352  ? 227.114 246.411 227.861 1.00 55.08  ? 321  GLN A N   1 
ATOM   2443  C CA  . GLN A  1 352  ? 227.168 246.068 229.281 1.00 55.08  ? 321  GLN A CA  1 
ATOM   2444  C C   . GLN A  1 352  ? 226.570 247.177 230.144 1.00 55.08  ? 321  GLN A C   1 
ATOM   2445  O O   . GLN A  1 352  ? 226.740 248.359 229.839 1.00 55.08  ? 321  GLN A O   1 
ATOM   2446  C CB  . GLN A  1 352  ? 228.606 245.815 229.718 1.00 55.08  ? 321  GLN A CB  1 
ATOM   2447  C CG  . GLN A  1 352  ? 229.316 244.728 228.943 1.00 55.08  ? 321  GLN A CG  1 
ATOM   2448  C CD  . GLN A  1 352  ? 228.536 243.434 228.929 1.00 55.08  ? 321  GLN A CD  1 
ATOM   2449  O OE1 . GLN A  1 352  ? 228.173 242.924 227.870 1.00 55.08  ? 321  GLN A OE1 1 
ATOM   2450  N NE2 . GLN A  1 352  ? 228.266 242.896 230.111 1.00 55.08  ? 321  GLN A NE2 1 
ATOM   2451  N N   . PRO A  1 353  ? 225.867 246.809 231.215 1.00 54.83  ? 322  PRO A N   1 
ATOM   2452  C CA  . PRO A  1 353  ? 225.251 247.817 232.084 1.00 54.83  ? 322  PRO A CA  1 
ATOM   2453  C C   . PRO A  1 353  ? 226.273 248.609 232.883 1.00 54.83  ? 322  PRO A C   1 
ATOM   2454  O O   . PRO A  1 353  ? 227.359 248.125 233.206 1.00 54.83  ? 322  PRO A O   1 
ATOM   2455  C CB  . PRO A  1 353  ? 224.368 246.981 233.012 1.00 54.83  ? 322  PRO A CB  1 
ATOM   2456  C CG  . PRO A  1 353  ? 225.016 245.652 233.028 1.00 54.83  ? 322  PRO A CG  1 
ATOM   2457  C CD  . PRO A  1 353  ? 225.553 245.442 231.657 1.00 54.83  ? 322  PRO A CD  1 
ATOM   2458  N N   . THR A  1 354  ? 225.901 249.846 233.216 1.00 55.82  ? 323  THR A N   1 
ATOM   2459  C CA  . THR A  1 354  ? 226.755 250.737 233.992 1.00 55.82  ? 323  THR A CA  1 
ATOM   2460  C C   . THR A  1 354  ? 226.359 250.831 235.463 1.00 55.82  ? 323  THR A C   1 
ATOM   2461  O O   . THR A  1 354  ? 227.214 250.691 236.341 1.00 55.82  ? 323  THR A O   1 
ATOM   2462  C CB  . THR A  1 354  ? 226.750 252.137 233.370 1.00 55.82  ? 323  THR A CB  1 
ATOM   2463  O OG1 . THR A  1 354  ? 225.412 252.643 233.333 1.00 55.82  ? 323  THR A OG1 1 
ATOM   2464  C CG2 . THR A  1 354  ? 227.295 252.088 231.961 1.00 55.82  ? 323  THR A CG2 1 
ATOM   2465  N N   . GLU A  1 355  ? 225.079 251.054 235.751 1.00 56.59  ? 324  GLU A N   1 
ATOM   2466  C CA  . GLU A  1 355  ? 224.590 251.282 237.103 1.00 56.59  ? 324  GLU A CA  1 
ATOM   2467  C C   . GLU A  1 355  ? 223.661 250.166 237.561 1.00 56.59  ? 324  GLU A C   1 
ATOM   2468  O O   . GLU A  1 355  ? 223.244 249.304 236.785 1.00 56.59  ? 324  GLU A O   1 
ATOM   2469  C CB  . GLU A  1 355  ? 223.859 252.623 237.177 1.00 56.59  ? 324  GLU A CB  1 
ATOM   2470  C CG  . GLU A  1 355  ? 224.702 253.800 236.756 1.00 56.59  ? 324  GLU A CG  1 
ATOM   2471  C CD  . GLU A  1 355  ? 223.971 255.112 236.906 1.00 56.59  ? 324  GLU A CD  1 
ATOM   2472  O OE1 . GLU A  1 355  ? 222.786 255.085 237.289 1.00 56.59  ? 324  GLU A OE1 1 
ATOM   2473  O OE2 . GLU A  1 355  ? 224.578 256.169 236.634 1.00 56.59  ? 324  GLU A OE2 1 
ATOM   2474  N N   . SER A  1 356  ? 223.337 250.208 238.854 1.00 53.17  ? 325  SER A N   1 
ATOM   2475  C CA  . SER A  1 356  ? 222.347 249.340 239.477 1.00 53.17  ? 325  SER A CA  1 
ATOM   2476  C C   . SER A  1 356  ? 221.368 250.189 240.277 1.00 53.17  ? 325  SER A C   1 
ATOM   2477  O O   . SER A  1 356  ? 221.780 251.108 240.987 1.00 53.17  ? 325  SER A O   1 
ATOM   2478  C CB  . SER A  1 356  ? 223.014 248.314 240.395 1.00 53.17  ? 325  SER A CB  1 
ATOM   2479  O OG  . SER A  1 356  ? 223.700 247.330 239.650 1.00 53.17  ? 325  SER A OG  1 
ATOM   2480  N N   . ILE A  1 357  ? 220.074 249.890 240.165 1.00 50.27  ? 326  ILE A N   1 
ATOM   2481  C CA  . ILE A  1 357  ? 219.052 250.666 240.858 1.00 50.27  ? 326  ILE A CA  1 
ATOM   2482  C C   . ILE A  1 357  ? 218.096 249.730 241.589 1.00 50.27  ? 326  ILE A C   1 
ATOM   2483  O O   . ILE A  1 357  ? 217.853 248.597 241.162 1.00 50.27  ? 326  ILE A O   1 
ATOM   2484  C CB  . ILE A  1 357  ? 218.278 251.610 239.909 1.00 50.27  ? 326  ILE A CB  1 
ATOM   2485  C CG1 . ILE A  1 357  ? 217.347 250.837 238.984 1.00 50.27  ? 326  ILE A CG1 1 
ATOM   2486  C CG2 . ILE A  1 357  ? 219.238 252.438 239.084 1.00 50.27  ? 326  ILE A CG2 1 
ATOM   2487  C CD1 . ILE A  1 357  ? 216.432 251.731 238.202 1.00 50.27  ? 326  ILE A CD1 1 
ATOM   2488  N N   . VAL A  1 358  ? 217.565 250.213 242.713 1.00 47.88  ? 327  VAL A N   1 
ATOM   2489  C CA  . VAL A  1 358  ? 216.595 249.493 243.533 1.00 47.88  ? 327  VAL A CA  1 
ATOM   2490  C C   . VAL A  1 358  ? 215.402 250.410 243.768 1.00 47.88  ? 327  VAL A C   1 
ATOM   2491  O O   . VAL A  1 358  ? 215.579 251.570 244.148 1.00 47.88  ? 327  VAL A O   1 
ATOM   2492  C CB  . VAL A  1 358  ? 217.208 249.046 244.873 1.00 47.88  ? 327  VAL A CB  1 
ATOM   2493  C CG1 . VAL A  1 358  ? 216.136 248.514 245.800 1.00 47.88  ? 327  VAL A CG1 1 
ATOM   2494  C CG2 . VAL A  1 358  ? 218.291 248.017 244.649 1.00 47.88  ? 327  VAL A CG2 1 
ATOM   2495  N N   . ARG A  1 359  ? 214.190 249.900 243.539 1.00 49.99  ? 328  ARG A N   1 
ATOM   2496  C CA  . ARG A  1 359  ? 212.956 250.664 243.741 1.00 49.99  ? 328  ARG A CA  1 
ATOM   2497  C C   . ARG A  1 359  ? 211.954 249.830 244.538 1.00 49.99  ? 328  ARG A C   1 
ATOM   2498  O O   . ARG A  1 359  ? 211.307 248.935 243.990 1.00 49.99  ? 328  ARG A O   1 
ATOM   2499  C CB  . ARG A  1 359  ? 212.362 251.103 242.410 1.00 49.99  ? 328  ARG A CB  1 
ATOM   2500  C CG  . ARG A  1 359  ? 213.305 251.905 241.553 1.00 49.99  ? 328  ARG A CG  1 
ATOM   2501  C CD  . ARG A  1 359  ? 213.577 253.258 242.161 1.00 49.99  ? 328  ARG A CD  1 
ATOM   2502  N NE  . ARG A  1 359  ? 212.431 254.148 242.031 1.00 49.99  ? 328  ARG A NE  1 
ATOM   2503  C CZ  . ARG A  1 359  ? 212.360 255.354 242.579 1.00 49.99  ? 328  ARG A CZ  1 
ATOM   2504  N NH1 . ARG A  1 359  ? 213.370 255.808 243.305 1.00 49.99  ? 328  ARG A NH1 1 
ATOM   2505  N NH2 . ARG A  1 359  ? 211.282 256.102 242.408 1.00 49.99  ? 328  ARG A NH2 1 
ATOM   2506  N N   . PHE A  1 360  ? 211.826 250.138 245.823 1.00 49.92  ? 329  PHE A N   1 
ATOM   2507  C CA  . PHE A  1 360  ? 210.875 249.555 246.756 1.00 49.92  ? 329  PHE A CA  1 
ATOM   2508  C C   . PHE A  1 360  ? 209.871 250.604 247.225 1.00 49.92  ? 329  PHE A C   1 
ATOM   2509  O O   . PHE A  1 360  ? 210.134 251.806 247.136 1.00 49.92  ? 329  PHE A O   1 
ATOM   2510  C CB  . PHE A  1 360  ? 211.607 248.984 247.978 1.00 49.92  ? 329  PHE A CB  1 
ATOM   2511  C CG  . PHE A  1 360  ? 212.164 247.601 247.783 1.00 49.92  ? 329  PHE A CG  1 
ATOM   2512  C CD1 . PHE A  1 360  ? 212.366 247.081 246.522 1.00 49.92  ? 329  PHE A CD1 1 
ATOM   2513  C CD2 . PHE A  1 360  ? 212.483 246.821 248.876 1.00 49.92  ? 329  PHE A CD2 1 
ATOM   2514  C CE1 . PHE A  1 360  ? 212.872 245.812 246.360 1.00 49.92  ? 329  PHE A CE1 1 
ATOM   2515  C CE2 . PHE A  1 360  ? 212.988 245.560 248.719 1.00 49.92  ? 329  PHE A CE2 1 
ATOM   2516  C CZ  . PHE A  1 360  ? 213.185 245.053 247.461 1.00 49.92  ? 329  PHE A CZ  1 
ATOM   2517  N N   . PRO A  1 361  ? 208.697 250.191 247.698 1.00 53.13  ? 330  PRO A N   1 
ATOM   2518  C CA  . PRO A  1 361  ? 207.711 251.159 248.191 1.00 53.13  ? 330  PRO A CA  1 
ATOM   2519  C C   . PRO A  1 361  ? 208.163 251.826 249.483 1.00 53.13  ? 330  PRO A C   1 
ATOM   2520  O O   . PRO A  1 361  ? 209.081 251.367 250.165 1.00 53.13  ? 330  PRO A O   1 
ATOM   2521  C CB  . PRO A  1 361  ? 206.460 250.307 248.418 1.00 53.13  ? 330  PRO A CB  1 
ATOM   2522  C CG  . PRO A  1 361  ? 206.964 248.923 248.556 1.00 53.13  ? 330  PRO A CG  1 
ATOM   2523  C CD  . PRO A  1 361  ? 208.140 248.830 247.649 1.00 53.13  ? 330  PRO A CD  1 
ATOM   2524  N N   . ASN A  1 362  ? 207.505 252.937 249.816 1.00 62.16  ? 331  ASN A N   1 
ATOM   2525  C CA  . ASN A  1 362  ? 207.806 253.668 251.048 1.00 62.16  ? 331  ASN A CA  1 
ATOM   2526  C C   . ASN A  1 362  ? 207.189 252.944 252.236 1.00 62.16  ? 331  ASN A C   1 
ATOM   2527  O O   . ASN A  1 362  ? 205.992 253.075 252.501 1.00 62.16  ? 331  ASN A O   1 
ATOM   2528  C CB  . ASN A  1 362  ? 207.268 255.094 251.016 1.00 62.16  ? 331  ASN A CB  1 
ATOM   2529  C CG  . ASN A  1 362  ? 207.148 255.664 249.628 1.00 62.16  ? 331  ASN A CG  1 
ATOM   2530  O OD1 . ASN A  1 362  ? 207.359 254.981 248.629 1.00 62.16  ? 331  ASN A OD1 1 
ATOM   2531  N ND2 . ASN A  1 362  ? 206.792 256.944 249.565 1.00 62.16  ? 331  ASN A ND2 1 
ATOM   2532  N N   . ILE A  1 363  ? 208.000 252.189 252.969 1.00 58.27  ? 332  ILE A N   1 
ATOM   2533  C CA  . ILE A  1 363  ? 207.542 251.499 254.168 1.00 58.27  ? 332  ILE A CA  1 
ATOM   2534  C C   . ILE A  1 363  ? 208.455 251.925 255.307 1.00 58.27  ? 332  ILE A C   1 
ATOM   2535  O O   . ILE A  1 363  ? 209.681 251.931 255.154 1.00 58.27  ? 332  ILE A O   1 
ATOM   2536  C CB  . ILE A  1 363  ? 207.554 249.970 253.996 1.00 58.27  ? 332  ILE A CB  1 
ATOM   2537  C CG1 . ILE A  1 363  ? 206.655 249.561 252.833 1.00 58.27  ? 332  ILE A CG1 1 
ATOM   2538  C CG2 . ILE A  1 363  ? 207.062 249.306 255.254 1.00 58.27  ? 332  ILE A CG2 1 
ATOM   2539  C CD1 . ILE A  1 363  ? 205.199 249.859 253.052 1.00 58.27  ? 332  ILE A CD1 1 
ATOM   2540  N N   . THR A  1 364  ? 207.863 252.289 256.442 1.00 60.50  ? 333  THR A N   1 
ATOM   2541  C CA  . THR A  1 364  ? 208.616 252.724 257.613 1.00 60.50  ? 333  THR A CA  1 
ATOM   2542  C C   . THR A  1 364  ? 208.516 251.796 258.814 1.00 60.50  ? 333  THR A C   1 
ATOM   2543  O O   . THR A  1 364  ? 209.503 251.625 259.530 1.00 60.50  ? 333  THR A O   1 
ATOM   2544  C CB  . THR A  1 364  ? 208.166 254.129 258.028 1.00 60.50  ? 333  THR A CB  1 
ATOM   2545  O OG1 . THR A  1 364  ? 206.744 254.147 258.203 1.00 60.50  ? 333  THR A OG1 1 
ATOM   2546  C CG2 . THR A  1 364  ? 208.548 255.142 256.962 1.00 60.50  ? 333  THR A CG2 1 
ATOM   2547  N N   . ASN A  1 365  ? 207.354 251.196 259.062 1.00 58.64  ? 334  ASN A N   1 
ATOM   2548  C CA  . ASN A  1 365  ? 207.170 250.388 260.260 1.00 58.64  ? 334  ASN A CA  1 
ATOM   2549  C C   . ASN A  1 365  ? 207.876 249.043 260.160 1.00 58.64  ? 334  ASN A C   1 
ATOM   2550  O O   . ASN A  1 365  ? 208.103 248.509 259.073 1.00 58.64  ? 334  ASN A O   1 
ATOM   2551  C CB  . ASN A  1 365  ? 205.686 250.160 260.526 1.00 58.64  ? 334  ASN A CB  1 
ATOM   2552  C CG  . ASN A  1 365  ? 204.896 251.443 260.546 1.00 58.64  ? 334  ASN A CG  1 
ATOM   2553  O OD1 . ASN A  1 365  ? 205.452 252.522 260.732 1.00 58.64  ? 334  ASN A OD1 1 
ATOM   2554  N ND2 . ASN A  1 365  ? 203.589 251.335 260.359 1.00 58.64  ? 334  ASN A ND2 1 
ATOM   2555  N N   . LEU A  1 366  ? 208.222 248.501 261.322 1.00 52.36  ? 335  LEU A N   1 
ATOM   2556  C CA  . LEU A  1 366  ? 208.732 247.146 261.451 1.00 52.36  ? 335  LEU A CA  1 
ATOM   2557  C C   . LEU A  1 366  ? 207.574 246.177 261.657 1.00 52.36  ? 335  LEU A C   1 
ATOM   2558  O O   . LEU A  1 366  ? 206.551 246.526 262.250 1.00 52.36  ? 335  LEU A O   1 
ATOM   2559  C CB  . LEU A  1 366  ? 209.716 247.064 262.620 1.00 52.36  ? 335  LEU A CB  1 
ATOM   2560  C CG  . LEU A  1 366  ? 210.518 245.784 262.847 1.00 52.36  ? 335  LEU A CG  1 
ATOM   2561  C CD1 . LEU A  1 366  ? 211.575 245.625 261.781 1.00 52.36  ? 335  LEU A CD1 1 
ATOM   2562  C CD2 . LEU A  1 366  ? 211.157 245.811 264.218 1.00 52.36  ? 335  LEU A CD2 1 
ATOM   2563  N N   . CYS A  1 367  ? 207.733 244.959 261.148 1.00 51.57  ? 336  CYS A N   1 
ATOM   2564  C CA  . CYS A  1 367  ? 206.665 243.976 261.241 1.00 51.57  ? 336  CYS A CA  1 
ATOM   2565  C C   . CYS A  1 367  ? 206.432 243.559 262.692 1.00 51.57  ? 336  CYS A C   1 
ATOM   2566  O O   . CYS A  1 367  ? 207.340 243.630 263.522 1.00 51.57  ? 336  CYS A O   1 
ATOM   2567  C CB  . CYS A  1 367  ? 206.972 242.755 260.381 1.00 51.57  ? 336  CYS A CB  1 
ATOM   2568  S SG  . CYS A  1 367  ? 206.838 243.066 258.604 1.00 51.57  ? 336  CYS A SG  1 
ATOM   2569  N N   . PRO A  1 368  ? 205.208 243.135 263.028 1.00 49.87  ? 337  PRO A N   1 
ATOM   2570  C CA  . PRO A  1 368  ? 204.893 242.824 264.427 1.00 49.87  ? 337  PRO A CA  1 
ATOM   2571  C C   . PRO A  1 368  ? 205.501 241.519 264.903 1.00 49.87  ? 337  PRO A C   1 
ATOM   2572  O O   . PRO A  1 368  ? 204.767 240.578 265.210 1.00 49.87  ? 337  PRO A O   1 
ATOM   2573  C CB  . PRO A  1 368  ? 203.361 242.737 264.424 1.00 49.87  ? 337  PRO A CB  1 
ATOM   2574  C CG  . PRO A  1 368  ? 202.934 243.361 263.137 1.00 49.87  ? 337  PRO A CG  1 
ATOM   2575  C CD  . PRO A  1 368  ? 204.013 243.026 262.182 1.00 49.87  ? 337  PRO A CD  1 
ATOM   2576  N N   . PHE A  1 369  ? 206.829 241.434 264.953 1.00 48.71  ? 338  PHE A N   1 
ATOM   2577  C CA  . PHE A  1 369  ? 207.459 240.224 265.462 1.00 48.71  ? 338  PHE A CA  1 
ATOM   2578  C C   . PHE A  1 369  ? 207.179 240.002 266.939 1.00 48.71  ? 338  PHE A C   1 
ATOM   2579  O O   . PHE A  1 369  ? 207.396 238.894 267.434 1.00 48.71  ? 338  PHE A O   1 
ATOM   2580  C CB  . PHE A  1 369  ? 208.971 240.275 265.249 1.00 48.71  ? 338  PHE A CB  1 
ATOM   2581  C CG  . PHE A  1 369  ? 209.394 240.274 263.810 1.00 48.71  ? 338  PHE A CG  1 
ATOM   2582  C CD1 . PHE A  1 369  ? 209.820 241.438 263.200 1.00 48.71  ? 338  PHE A CD1 1 
ATOM   2583  C CD2 . PHE A  1 369  ? 209.396 239.101 263.077 1.00 48.71  ? 338  PHE A CD2 1 
ATOM   2584  C CE1 . PHE A  1 369  ? 210.222 241.433 261.884 1.00 48.71  ? 338  PHE A CE1 1 
ATOM   2585  C CE2 . PHE A  1 369  ? 209.801 239.095 261.760 1.00 48.71  ? 338  PHE A CE2 1 
ATOM   2586  C CZ  . PHE A  1 369  ? 210.210 240.263 261.164 1.00 48.71  ? 338  PHE A CZ  1 
ATOM   2587  N N   . GLY A  1 370  ? 206.704 241.017 267.651 1.00 50.77  ? 339  GLY A N   1 
ATOM   2588  C CA  . GLY A  1 370  ? 206.560 240.913 269.086 1.00 50.77  ? 339  GLY A CA  1 
ATOM   2589  C C   . GLY A  1 370  ? 205.221 240.397 269.561 1.00 50.77  ? 339  GLY A C   1 
ATOM   2590  O O   . GLY A  1 370  ? 205.127 239.884 270.677 1.00 50.77  ? 339  GLY A O   1 
ATOM   2591  N N   . GLU A  1 371  ? 204.174 240.518 268.746 1.00 53.39  ? 340  GLU A N   1 
ATOM   2592  C CA  . GLU A  1 371  ? 202.882 239.940 269.085 1.00 53.39  ? 340  GLU A CA  1 
ATOM   2593  C C   . GLU A  1 371  ? 202.522 238.767 268.191 1.00 53.39  ? 340  GLU A C   1 
ATOM   2594  O O   . GLU A  1 371  ? 201.369 238.328 268.197 1.00 53.39  ? 340  GLU A O   1 
ATOM   2595  C CB  . GLU A  1 371  ? 201.768 240.988 269.039 1.00 53.39  ? 340  GLU A CB  1 
ATOM   2596  C CG  . GLU A  1 371  ? 201.600 241.732 267.734 1.00 53.39  ? 340  GLU A CG  1 
ATOM   2597  C CD  . GLU A  1 371  ? 202.217 243.110 267.772 1.00 53.39  ? 340  GLU A CD  1 
ATOM   2598  O OE1 . GLU A  1 371  ? 203.117 243.339 268.605 1.00 53.39  ? 340  GLU A OE1 1 
ATOM   2599  O OE2 . GLU A  1 371  ? 201.786 243.975 266.982 1.00 53.39  ? 340  GLU A OE2 1 
ATOM   2600  N N   . VAL A  1 372  ? 203.474 238.247 267.430 1.00 44.71  ? 341  VAL A N   1 
ATOM   2601  C CA  . VAL A  1 372  ? 203.328 236.982 266.728 1.00 44.71  ? 341  VAL A CA  1 
ATOM   2602  C C   . VAL A  1 372  ? 204.153 235.884 267.388 1.00 44.71  ? 341  VAL A C   1 
ATOM   2603  O O   . VAL A  1 372  ? 203.627 234.827 267.733 1.00 44.71  ? 341  VAL A O   1 
ATOM   2604  C CB  . VAL A  1 372  ? 203.693 237.138 265.236 1.00 44.71  ? 341  VAL A CB  1 
ATOM   2605  C CG1 . VAL A  1 372  ? 203.689 235.800 264.546 1.00 44.71  ? 341  VAL A CG1 1 
ATOM   2606  C CG2 . VAL A  1 372  ? 202.716 238.071 264.566 1.00 44.71  ? 341  VAL A CG2 1 
ATOM   2607  N N   . PHE A  1 373  ? 205.451 236.117 267.566 1.00 41.93  ? 342  PHE A N   1 
ATOM   2608  C CA  . PHE A  1 373  ? 206.342 235.133 268.165 1.00 41.93  ? 342  PHE A CA  1 
ATOM   2609  C C   . PHE A  1 373  ? 206.454 235.259 269.676 1.00 41.93  ? 342  PHE A C   1 
ATOM   2610  O O   . PHE A  1 373  ? 207.031 234.372 270.310 1.00 41.93  ? 342  PHE A O   1 
ATOM   2611  C CB  . PHE A  1 373  ? 207.749 235.247 267.562 1.00 41.93  ? 342  PHE A CB  1 
ATOM   2612  C CG  . PHE A  1 373  ? 207.802 235.017 266.084 1.00 41.93  ? 342  PHE A CG  1 
ATOM   2613  C CD1 . PHE A  1 373  ? 208.004 233.753 265.579 1.00 41.93  ? 342  PHE A CD1 1 
ATOM   2614  C CD2 . PHE A  1 373  ? 207.630 236.061 265.200 1.00 41.93  ? 342  PHE A CD2 1 
ATOM   2615  C CE1 . PHE A  1 373  ? 208.047 233.537 264.224 1.00 41.93  ? 342  PHE A CE1 1 
ATOM   2616  C CE2 . PHE A  1 373  ? 207.671 235.846 263.844 1.00 41.93  ? 342  PHE A CE2 1 
ATOM   2617  C CZ  . PHE A  1 373  ? 207.884 234.587 263.357 1.00 41.93  ? 342  PHE A CZ  1 
ATOM   2618  N N   . ASN A  1 374  ? 205.919 236.318 270.271 1.00 53.79  ? 343  ASN A N   1 
ATOM   2619  C CA  . ASN A  1 374  ? 206.061 236.533 271.704 1.00 53.79  ? 343  ASN A CA  1 
ATOM   2620  C C   . ASN A  1 374  ? 204.707 236.786 272.348 1.00 53.79  ? 343  ASN A C   1 
ATOM   2621  O O   . ASN A  1 374  ? 204.583 237.557 273.300 1.00 53.79  ? 343  ASN A O   1 
ATOM   2622  C CB  . ASN A  1 374  ? 207.021 237.691 271.959 1.00 53.79  ? 343  ASN A CB  1 
ATOM   2623  C CG  . ASN A  1 374  ? 207.658 237.642 273.323 1.00 53.79  ? 343  ASN A CG  1 
ATOM   2624  O OD1 . ASN A  1 374  ? 207.616 236.624 274.008 1.00 53.79  ? 343  ASN A OD1 1 
ATOM   2625  N ND2 . ASN A  1 374  ? 208.272 238.744 273.721 1.00 53.79  ? 343  ASN A ND2 1 
ATOM   2626  N N   . ALA A  1 375  ? 203.675 236.119 271.849 1.00 49.45  ? 344  ALA A N   1 
ATOM   2627  C CA  . ALA A  1 375  ? 202.349 236.223 272.434 1.00 49.45  ? 344  ALA A CA  1 
ATOM   2628  C C   . ALA A  1 375  ? 202.260 235.443 273.737 1.00 49.45  ? 344  ALA A C   1 
ATOM   2629  O O   . ALA A  1 375  ? 202.905 234.408 273.917 1.00 49.45  ? 344  ALA A O   1 
ATOM   2630  C CB  . ALA A  1 375  ? 201.296 235.719 271.452 1.00 49.45  ? 344  ALA A CB  1 
ATOM   2631  N N   . THR A  1 376  ? 201.453 235.960 274.661 1.00 52.04  ? 345  THR A N   1 
ATOM   2632  C CA  . THR A  1 376  ? 201.331 235.335 275.972 1.00 52.04  ? 345  THR A CA  1 
ATOM   2633  C C   . THR A  1 376  ? 200.492 234.062 275.937 1.00 52.04  ? 345  THR A C   1 
ATOM   2634  O O   . THR A  1 376  ? 200.720 233.157 276.747 1.00 52.04  ? 345  THR A O   1 
ATOM   2635  C CB  . THR A  1 376  ? 200.740 236.330 276.972 1.00 52.04  ? 345  THR A CB  1 
ATOM   2636  O OG1 . THR A  1 376  ? 200.581 235.694 278.246 1.00 52.04  ? 345  THR A OG1 1 
ATOM   2637  C CG2 . THR A  1 376  ? 199.397 236.853 276.487 1.00 52.04  ? 345  THR A CG2 1 
ATOM   2638  N N   . ARG A  1 377  ? 199.519 233.973 275.030 1.00 49.59  ? 346  ARG A N   1 
ATOM   2639  C CA  . ARG A  1 377  ? 198.661 232.801 274.925 1.00 49.59  ? 346  ARG A CA  1 
ATOM   2640  C C   . ARG A  1 377  ? 198.485 232.424 273.462 1.00 49.59  ? 346  ARG A C   1 
ATOM   2641  O O   . ARG A  1 377  ? 198.180 233.285 272.634 1.00 49.59  ? 346  ARG A O   1 
ATOM   2642  C CB  . ARG A  1 377  ? 197.301 233.055 275.579 1.00 49.59  ? 346  ARG A CB  1 
ATOM   2643  C CG  . ARG A  1 377  ? 196.443 231.814 275.693 1.00 49.59  ? 346  ARG A CG  1 
ATOM   2644  C CD  . ARG A  1 377  ? 195.081 232.125 276.283 1.00 49.59  ? 346  ARG A CD  1 
ATOM   2645  N NE  . ARG A  1 377  ? 194.252 230.926 276.359 1.00 49.59  ? 346  ARG A NE  1 
ATOM   2646  C CZ  . ARG A  1 377  ? 194.254 230.083 277.385 1.00 49.59  ? 346  ARG A CZ  1 
ATOM   2647  N NH1 . ARG A  1 377  ? 195.043 230.309 278.427 1.00 49.59  ? 346  ARG A NH1 1 
ATOM   2648  N NH2 . ARG A  1 377  ? 193.469 229.014 277.370 1.00 49.59  ? 346  ARG A NH2 1 
ATOM   2649  N N   . PHE A  1 378  ? 198.691 231.150 273.147 1.00 33.47  ? 347  PHE A N   1 
ATOM   2650  C CA  . PHE A  1 378  ? 198.464 230.603 271.817 1.00 33.47  ? 347  PHE A CA  1 
ATOM   2651  C C   . PHE A  1 378  ? 197.127 229.864 271.748 1.00 33.47  ? 347  PHE A C   1 
ATOM   2652  O O   . PHE A  1 378  ? 196.482 229.592 272.760 1.00 33.47  ? 347  PHE A O   1 
ATOM   2653  C CB  . PHE A  1 378  ? 199.612 229.676 271.418 1.00 33.47  ? 347  PHE A CB  1 
ATOM   2654  C CG  . PHE A  1 378  ? 200.694 230.357 270.637 1.00 33.47  ? 347  PHE A CG  1 
ATOM   2655  C CD1 . PHE A  1 378  ? 201.157 229.819 269.457 1.00 33.47  ? 347  PHE A CD1 1 
ATOM   2656  C CD2 . PHE A  1 378  ? 201.263 231.523 271.097 1.00 33.47  ? 347  PHE A CD2 1 
ATOM   2657  C CE1 . PHE A  1 378  ? 202.152 230.441 268.748 1.00 33.47  ? 347  PHE A CE1 1 
ATOM   2658  C CE2 . PHE A  1 378  ? 202.259 232.146 270.392 1.00 33.47  ? 347  PHE A CE2 1 
ATOM   2659  C CZ  . PHE A  1 378  ? 202.702 231.605 269.217 1.00 33.47  ? 347  PHE A CZ  1 
ATOM   2660  N N   . ALA A  1 379  ? 196.703 229.568 270.524 1.00 31.29  ? 348  ALA A N   1 
ATOM   2661  C CA  . ALA A  1 379  ? 195.442 228.894 270.252 1.00 31.29  ? 348  ALA A CA  1 
ATOM   2662  C C   . ALA A  1 379  ? 195.605 227.377 270.250 1.00 31.29  ? 348  ALA A C   1 
ATOM   2663  O O   . ALA A  1 379  ? 196.712 226.845 270.179 1.00 31.29  ? 348  ALA A O   1 
ATOM   2664  C CB  . ALA A  1 379  ? 194.875 229.349 268.911 1.00 31.29  ? 348  ALA A CB  1 
ATOM   2665  N N   . SER A  1 380  ? 194.472 226.685 270.344 1.00 30.35  ? 349  SER A N   1 
ATOM   2666  C CA  . SER A  1 380  ? 194.425 225.242 270.165 1.00 30.35  ? 349  SER A CA  1 
ATOM   2667  C C   . SER A  1 380  ? 194.509 224.878 268.689 1.00 30.35  ? 349  SER A C   1 
ATOM   2668  O O   . SER A  1 380  ? 194.093 225.644 267.820 1.00 30.35  ? 349  SER A O   1 
ATOM   2669  C CB  . SER A  1 380  ? 193.139 224.681 270.760 1.00 30.35  ? 349  SER A CB  1 
ATOM   2670  O OG  . SER A  1 380  ? 192.958 225.140 272.083 1.00 30.35  ? 349  SER A OG  1 
ATOM   2671  N N   . VAL A  1 381  ? 195.047 223.689 268.407 1.00 28.56  ? 350  VAL A N   1 
ATOM   2672  C CA  . VAL A  1 381  ? 195.314 223.330 267.016 1.00 28.56  ? 350  VAL A CA  1 
ATOM   2673  C C   . VAL A  1 381  ? 194.025 223.159 266.225 1.00 28.56  ? 350  VAL A C   1 
ATOM   2674  O O   . VAL A  1 381  ? 194.013 223.366 265.008 1.00 28.56  ? 350  VAL A O   1 
ATOM   2675  C CB  . VAL A  1 381  ? 196.194 222.069 266.936 1.00 28.56  ? 350  VAL A CB  1 
ATOM   2676  C CG1 . VAL A  1 381  ? 195.441 220.854 267.414 1.00 28.56  ? 350  VAL A CG1 1 
ATOM   2677  C CG2 . VAL A  1 381  ? 196.694 221.861 265.521 1.00 28.56  ? 350  VAL A CG2 1 
ATOM   2678  N N   . TYR A  1 382  ? 192.924 222.779 266.877 1.00 32.85  ? 351  TYR A N   1 
ATOM   2679  C CA  . TYR A  1 382  ? 191.683 222.593 266.133 1.00 32.85  ? 351  TYR A CA  1 
ATOM   2680  C C   . TYR A  1 382  ? 191.059 223.933 265.750 1.00 32.85  ? 351  TYR A C   1 
ATOM   2681  O O   . TYR A  1 382  ? 190.560 224.094 264.632 1.00 32.85  ? 351  TYR A O   1 
ATOM   2682  C CB  . TYR A  1 382  ? 190.719 221.705 266.926 1.00 32.85  ? 351  TYR A CB  1 
ATOM   2683  C CG  . TYR A  1 382  ? 189.894 222.381 267.988 1.00 32.85  ? 351  TYR A CG  1 
ATOM   2684  C CD1 . TYR A  1 382  ? 190.376 222.541 269.271 1.00 32.85  ? 351  TYR A CD1 1 
ATOM   2685  C CD2 . TYR A  1 382  ? 188.601 222.797 267.721 1.00 32.85  ? 351  TYR A CD2 1 
ATOM   2686  C CE1 . TYR A  1 382  ? 189.617 223.147 270.241 1.00 32.85  ? 351  TYR A CE1 1 
ATOM   2687  C CE2 . TYR A  1 382  ? 187.833 223.398 268.689 1.00 32.85  ? 351  TYR A CE2 1 
ATOM   2688  C CZ  . TYR A  1 382  ? 188.346 223.570 269.947 1.00 32.85  ? 351  TYR A CZ  1 
ATOM   2689  O OH  . TYR A  1 382  ? 187.587 224.168 270.922 1.00 32.85  ? 351  TYR A OH  1 
ATOM   2690  N N   . ALA A  1 383  ? 191.082 224.905 266.656 1.00 31.16  ? 352  ALA A N   1 
ATOM   2691  C CA  . ALA A  1 383  ? 190.671 226.277 266.358 1.00 31.16  ? 352  ALA A CA  1 
ATOM   2692  C C   . ALA A  1 383  ? 191.878 227.195 266.167 1.00 31.16  ? 352  ALA A C   1 
ATOM   2693  O O   . ALA A  1 383  ? 192.068 228.157 266.901 1.00 31.16  ? 352  ALA A O   1 
ATOM   2694  C CB  . ALA A  1 383  ? 189.758 226.797 267.461 1.00 31.16  ? 352  ALA A CB  1 
ATOM   2695  N N   . TRP A  1 384  ? 192.685 226.903 265.152 1.00 30.17  ? 353  TRP A N   1 
ATOM   2696  C CA  . TRP A  1 384  ? 193.947 227.603 264.950 1.00 30.17  ? 353  TRP A CA  1 
ATOM   2697  C C   . TRP A  1 384  ? 193.716 229.056 264.541 1.00 30.17  ? 353  TRP A C   1 
ATOM   2698  O O   . TRP A  1 384  ? 192.669 229.415 264.001 1.00 30.17  ? 353  TRP A O   1 
ATOM   2699  C CB  . TRP A  1 384  ? 194.798 226.870 263.916 1.00 30.17  ? 353  TRP A CB  1 
ATOM   2700  C CG  . TRP A  1 384  ? 194.081 226.477 262.661 1.00 30.17  ? 353  TRP A CG  1 
ATOM   2701  C CD1 . TRP A  1 384  ? 193.388 225.328 262.455 1.00 30.17  ? 353  TRP A CD1 1 
ATOM   2702  C CD2 . TRP A  1 384  ? 193.989 227.219 261.442 1.00 30.17  ? 353  TRP A CD2 1 
ATOM   2703  N NE1 . TRP A  1 384  ? 192.874 225.300 261.189 1.00 30.17  ? 353  TRP A NE1 1 
ATOM   2704  C CE2 . TRP A  1 384  ? 193.223 226.454 260.546 1.00 30.17  ? 353  TRP A CE2 1 
ATOM   2705  C CE3 . TRP A  1 384  ? 194.472 228.459 261.021 1.00 30.17  ? 353  TRP A CE3 1 
ATOM   2706  C CZ2 . TRP A  1 384  ? 192.933 226.883 259.261 1.00 30.17  ? 353  TRP A CZ2 1 
ATOM   2707  C CZ3 . TRP A  1 384  ? 194.181 228.880 259.746 1.00 30.17  ? 353  TRP A CZ3 1 
ATOM   2708  C CH2 . TRP A  1 384  ? 193.422 228.096 258.880 1.00 30.17  ? 353  TRP A CH2 1 
ATOM   2709  N N   . ASN A  1 385  ? 194.707 229.906 264.824 1.00 30.35  ? 354  ASN A N   1 
ATOM   2710  C CA  . ASN A  1 385  ? 194.561 231.344 264.605 1.00 30.35  ? 354  ASN A CA  1 
ATOM   2711  C C   . ASN A  1 385  ? 195.215 231.800 263.306 1.00 30.35  ? 354  ASN A C   1 
ATOM   2712  O O   . ASN A  1 385  ? 196.277 231.300 262.932 1.00 30.35  ? 354  ASN A O   1 
ATOM   2713  C CB  . ASN A  1 385  ? 195.156 232.123 265.775 1.00 30.35  ? 354  ASN A CB  1 
ATOM   2714  C CG  . ASN A  1 385  ? 194.615 233.522 265.877 1.00 30.35  ? 354  ASN A CG  1 
ATOM   2715  O OD1 . ASN A  1 385  ? 193.432 233.729 266.122 1.00 30.35  ? 354  ASN A OD1 1 
ATOM   2716  N ND2 . ASN A  1 385  ? 195.485 234.498 265.696 1.00 30.35  ? 354  ASN A ND2 1 
ATOM   2717  N N   . ARG A  1 386  ? 194.588 232.777 262.642 1.00 32.31  ? 355  ARG A N   1 
ATOM   2718  C CA  . ARG A  1 386  ? 195.080 233.388 261.408 1.00 32.31  ? 355  ARG A CA  1 
ATOM   2719  C C   . ARG A  1 386  ? 195.120 234.906 261.535 1.00 32.31  ? 355  ARG A C   1 
ATOM   2720  O O   . ARG A  1 386  ? 194.128 235.520 261.934 1.00 32.31  ? 355  ARG A O   1 
ATOM   2721  C CB  . ARG A  1 386  ? 194.189 233.015 260.222 1.00 32.31  ? 355  ARG A CB  1 
ATOM   2722  C CG  . ARG A  1 386  ? 194.797 233.260 258.857 1.00 32.31  ? 355  ARG A CG  1 
ATOM   2723  C CD  . ARG A  1 386  ? 193.900 232.692 257.783 1.00 32.31  ? 355  ARG A CD  1 
ATOM   2724  N NE  . ARG A  1 386  ? 194.511 232.699 256.461 1.00 32.31  ? 355  ARG A NE  1 
ATOM   2725  C CZ  . ARG A  1 386  ? 195.147 231.666 255.921 1.00 32.31  ? 355  ARG A CZ  1 
ATOM   2726  N NH1 . ARG A  1 386  ? 195.268 230.534 256.590 1.00 32.31  ? 355  ARG A NH1 1 
ATOM   2727  N NH2 . ARG A  1 386  ? 195.664 231.767 254.708 1.00 32.31  ? 355  ARG A NH2 1 
ATOM   2728  N N   . LYS A  1 387  ? 196.262 235.510 261.197 1.00 37.15  ? 356  LYS A N   1 
ATOM   2729  C CA  . LYS A  1 387  ? 196.468 236.948 261.334 1.00 37.15  ? 356  LYS A CA  1 
ATOM   2730  C C   . LYS A  1 387  ? 197.058 237.542 260.060 1.00 37.15  ? 356  LYS A C   1 
ATOM   2731  O O   . LYS A  1 387  ? 198.037 237.019 259.525 1.00 37.15  ? 356  LYS A O   1 
ATOM   2732  C CB  . LYS A  1 387  ? 197.375 237.284 262.513 1.00 37.15  ? 356  LYS A CB  1 
ATOM   2733  C CG  . LYS A  1 387  ? 197.581 238.770 262.655 1.00 37.15  ? 356  LYS A CG  1 
ATOM   2734  C CD  . LYS A  1 387  ? 198.674 239.126 263.627 1.00 37.15  ? 356  LYS A CD  1 
ATOM   2735  C CE  . LYS A  1 387  ? 198.351 240.443 264.302 1.00 37.15  ? 356  LYS A CE  1 
ATOM   2736  N NZ  . LYS A  1 387  ? 199.559 241.123 264.826 1.00 37.15  ? 356  LYS A NZ  1 
ATOM   2737  N N   . ARG A  1 388  ? 196.450 238.626 259.584 1.00 39.16  ? 357  ARG A N   1 
ATOM   2738  C CA  . ARG A  1 388  ? 196.936 239.393 258.439 1.00 39.16  ? 357  ARG A CA  1 
ATOM   2739  C C   . ARG A  1 388  ? 198.166 240.228 258.778 1.00 39.16  ? 357  ARG A C   1 
ATOM   2740  O O   . ARG A  1 388  ? 198.253 240.811 259.860 1.00 39.16  ? 357  ARG A O   1 
ATOM   2741  C CB  . ARG A  1 388  ? 195.824 240.324 257.961 1.00 39.16  ? 357  ARG A CB  1 
ATOM   2742  C CG  . ARG A  1 388  ? 196.125 241.164 256.743 1.00 39.16  ? 357  ARG A CG  1 
ATOM   2743  C CD  . ARG A  1 388  ? 196.344 240.367 255.502 1.00 39.16  ? 357  ARG A CD  1 
ATOM   2744  N NE  . ARG A  1 388  ? 196.105 241.190 254.323 1.00 39.16  ? 357  ARG A NE  1 
ATOM   2745  C CZ  . ARG A  1 388  ? 196.244 240.762 253.076 1.00 39.16  ? 357  ARG A CZ  1 
ATOM   2746  N NH1 . ARG A  1 388  ? 196.624 239.516 252.845 1.00 39.16  ? 357  ARG A NH1 1 
ATOM   2747  N NH2 . ARG A  1 388  ? 196.007 241.578 252.061 1.00 39.16  ? 357  ARG A NH2 1 
ATOM   2748  N N   . ILE A  1 389  ? 199.118 240.309 257.844 1.00 39.96  ? 358  ILE A N   1 
ATOM   2749  C CA  . ILE A  1 389  ? 200.312 241.132 258.028 1.00 39.96  ? 358  ILE A CA  1 
ATOM   2750  C C   . ILE A  1 389  ? 200.490 242.006 256.793 1.00 39.96  ? 358  ILE A C   1 
ATOM   2751  O O   . ILE A  1 389  ? 200.487 241.498 255.668 1.00 39.96  ? 358  ILE A O   1 
ATOM   2752  C CB  . ILE A  1 389  ? 201.567 240.278 258.285 1.00 39.96  ? 358  ILE A CB  1 
ATOM   2753  C CG1 . ILE A  1 389  ? 201.377 239.427 259.540 1.00 39.96  ? 358  ILE A CG1 1 
ATOM   2754  C CG2 . ILE A  1 389  ? 202.793 241.150 258.410 1.00 39.96  ? 358  ILE A CG2 1 
ATOM   2755  C CD1 . ILE A  1 389  ? 202.417 238.384 259.726 1.00 39.96  ? 358  ILE A CD1 1 
ATOM   2756  N N   . SER A  1 390  ? 200.654 243.313 257.001 1.00 48.05  ? 359  SER A N   1 
ATOM   2757  C CA  . SER A  1 390  ? 200.822 244.247 255.893 1.00 48.05  ? 359  SER A CA  1 
ATOM   2758  C C   . SER A  1 390  ? 201.513 245.521 256.364 1.00 48.05  ? 359  SER A C   1 
ATOM   2759  O O   . SER A  1 390  ? 201.509 245.848 257.552 1.00 48.05  ? 359  SER A O   1 
ATOM   2760  C CB  . SER A  1 390  ? 199.476 244.594 255.257 1.00 48.05  ? 359  SER A CB  1 
ATOM   2761  O OG  . SER A  1 390  ? 198.577 245.089 256.231 1.00 48.05  ? 359  SER A OG  1 
ATOM   2762  N N   . ASN A  1 391  ? 202.109 246.234 255.400 1.00 51.77  ? 360  ASN A N   1 
ATOM   2763  C CA  . ASN A  1 391  ? 202.643 247.588 255.592 1.00 51.77  ? 360  ASN A CA  1 
ATOM   2764  C C   . ASN A  1 391  ? 203.775 247.644 256.617 1.00 51.77  ? 360  ASN A C   1 
ATOM   2765  O O   . ASN A  1 391  ? 203.793 248.499 257.502 1.00 51.77  ? 360  ASN A O   1 
ATOM   2766  C CB  . ASN A  1 391  ? 201.532 248.567 255.978 1.00 51.77  ? 360  ASN A CB  1 
ATOM   2767  C CG  . ASN A  1 391  ? 200.487 248.723 254.898 1.00 51.77  ? 360  ASN A CG  1 
ATOM   2768  O OD1 . ASN A  1 391  ? 200.808 248.805 253.717 1.00 51.77  ? 360  ASN A OD1 1 
ATOM   2769  N ND2 . ASN A  1 391  ? 199.226 248.783 255.301 1.00 51.77  ? 360  ASN A ND2 1 
ATOM   2770  N N   . CYS A  1 392  ? 204.724 246.719 256.505 1.00 51.76  ? 361  CYS A N   1 
ATOM   2771  C CA  . CYS A  1 392  ? 205.761 246.608 257.519 1.00 51.76  ? 361  CYS A CA  1 
ATOM   2772  C C   . CYS A  1 392  ? 207.034 246.058 256.893 1.00 51.76  ? 361  CYS A C   1 
ATOM   2773  O O   . CYS A  1 392  ? 206.981 245.251 255.967 1.00 51.76  ? 361  CYS A O   1 
ATOM   2774  C CB  . CYS A  1 392  ? 205.306 245.722 258.680 1.00 51.76  ? 361  CYS A CB  1 
ATOM   2775  S SG  . CYS A  1 392  ? 205.028 243.966 258.327 1.00 51.76  ? 361  CYS A SG  1 
ATOM   2776  N N   . VAL A  1 393  ? 208.180 246.511 257.402 1.00 51.50  ? 362  VAL A N   1 
ATOM   2777  C CA  . VAL A  1 393  ? 209.477 246.020 256.943 1.00 51.50  ? 362  VAL A CA  1 
ATOM   2778  C C   . VAL A  1 393  ? 209.784 244.692 257.625 1.00 51.50  ? 362  VAL A C   1 
ATOM   2779  O O   . VAL A  1 393  ? 209.683 244.572 258.850 1.00 51.50  ? 362  VAL A O   1 
ATOM   2780  C CB  . VAL A  1 393  ? 210.575 247.057 257.226 1.00 51.50  ? 362  VAL A CB  1 
ATOM   2781  C CG1 . VAL A  1 393  ? 211.942 246.490 256.914 1.00 51.50  ? 362  VAL A CG1 1 
ATOM   2782  C CG2 . VAL A  1 393  ? 210.332 248.314 256.431 1.00 51.50  ? 362  VAL A CG2 1 
ATOM   2783  N N   . ALA A  1 394  ? 210.193 243.698 256.836 1.00 50.87  ? 363  ALA A N   1 
ATOM   2784  C CA  . ALA A  1 394  ? 210.461 242.348 257.342 1.00 50.87  ? 363  ALA A CA  1 
ATOM   2785  C C   . ALA A  1 394  ? 211.943 242.155 257.673 1.00 50.87  ? 363  ALA A C   1 
ATOM   2786  O O   . ALA A  1 394  ? 212.665 241.392 257.033 1.00 50.87  ? 363  ALA A O   1 
ATOM   2787  C CB  . ALA A  1 394  ? 209.982 241.309 256.339 1.00 50.87  ? 363  ALA A CB  1 
ATOM   2788  N N   . ASP A  1 395  ? 212.387 242.856 258.713 1.00 51.06  ? 364  ASP A N   1 
ATOM   2789  C CA  . ASP A  1 395  ? 213.768 242.767 259.196 1.00 51.06  ? 364  ASP A CA  1 
ATOM   2790  C C   . ASP A  1 395  ? 213.828 241.743 260.324 1.00 51.06  ? 364  ASP A C   1 
ATOM   2791  O O   . ASP A  1 395  ? 213.680 242.079 261.499 1.00 51.06  ? 364  ASP A O   1 
ATOM   2792  C CB  . ASP A  1 395  ? 214.252 244.133 259.660 1.00 51.06  ? 364  ASP A CB  1 
ATOM   2793  C CG  . ASP A  1 395  ? 215.746 244.187 259.855 1.00 51.06  ? 364  ASP A CG  1 
ATOM   2794  O OD1 . ASP A  1 395  ? 216.397 243.127 259.804 1.00 51.06  ? 364  ASP A OD1 1 
ATOM   2795  O OD2 . ASP A  1 395  ? 216.274 245.295 260.066 1.00 51.06  ? 364  ASP A OD2 1 
ATOM   2796  N N   . TYR A  1 396  ? 214.077 240.476 259.980 1.00 45.50  ? 365  TYR A N   1 
ATOM   2797  C CA  . TYR A  1 396  ? 213.942 239.420 260.979 1.00 45.50  ? 365  TYR A CA  1 
ATOM   2798  C C   . TYR A  1 396  ? 215.170 239.249 261.865 1.00 45.50  ? 365  TYR A C   1 
ATOM   2799  O O   . TYR A  1 396  ? 215.114 238.464 262.817 1.00 45.50  ? 365  TYR A O   1 
ATOM   2800  C CB  . TYR A  1 396  ? 213.618 238.073 260.327 1.00 45.50  ? 365  TYR A CB  1 
ATOM   2801  C CG  . TYR A  1 396  ? 214.593 237.578 259.289 1.00 45.50  ? 365  TYR A CG  1 
ATOM   2802  C CD1 . TYR A  1 396  ? 214.407 237.840 257.942 1.00 45.50  ? 365  TYR A CD1 1 
ATOM   2803  C CD2 . TYR A  1 396  ? 215.690 236.814 259.658 1.00 45.50  ? 365  TYR A CD2 1 
ATOM   2804  C CE1 . TYR A  1 396  ? 215.298 237.367 256.997 1.00 45.50  ? 365  TYR A CE1 1 
ATOM   2805  C CE2 . TYR A  1 396  ? 216.584 236.343 258.723 1.00 45.50  ? 365  TYR A CE2 1 
ATOM   2806  C CZ  . TYR A  1 396  ? 216.384 236.622 257.396 1.00 45.50  ? 365  TYR A CZ  1 
ATOM   2807  O OH  . TYR A  1 396  ? 217.278 236.147 256.470 1.00 45.50  ? 365  TYR A OH  1 
ATOM   2808  N N   . SER A  1 397  ? 216.263 239.963 261.599 1.00 46.20  ? 366  SER A N   1 
ATOM   2809  C CA  . SER A  1 397  ? 217.438 239.866 262.457 1.00 46.20  ? 366  SER A CA  1 
ATOM   2810  C C   . SER A  1 397  ? 217.189 240.415 263.853 1.00 46.20  ? 366  SER A C   1 
ATOM   2811  O O   . SER A  1 397  ? 218.030 240.220 264.735 1.00 46.20  ? 366  SER A O   1 
ATOM   2812  C CB  . SER A  1 397  ? 218.628 240.586 261.827 1.00 46.20  ? 366  SER A CB  1 
ATOM   2813  O OG  . SER A  1 397  ? 218.415 241.981 261.774 1.00 46.20  ? 366  SER A OG  1 
ATOM   2814  N N   . VAL A  1 398  ? 216.073 241.113 264.073 1.00 47.07  ? 367  VAL A N   1 
ATOM   2815  C CA  . VAL A  1 398  ? 215.699 241.509 265.424 1.00 47.07  ? 367  VAL A CA  1 
ATOM   2816  C C   . VAL A  1 398  ? 215.310 240.311 266.279 1.00 47.07  ? 367  VAL A C   1 
ATOM   2817  O O   . VAL A  1 398  ? 215.271 240.421 267.509 1.00 47.07  ? 367  VAL A O   1 
ATOM   2818  C CB  . VAL A  1 398  ? 214.550 242.533 265.389 1.00 47.07  ? 367  VAL A CB  1 
ATOM   2819  C CG1 . VAL A  1 398  ? 214.907 243.700 264.491 1.00 47.07  ? 367  VAL A CG1 1 
ATOM   2820  C CG2 . VAL A  1 398  ? 213.264 241.878 264.938 1.00 47.07  ? 367  VAL A CG2 1 
ATOM   2821  N N   . LEU A  1 399  ? 215.017 239.164 265.665 1.00 44.58  ? 368  LEU A N   1 
ATOM   2822  C CA  . LEU A  1 399  ? 214.746 237.948 266.419 1.00 44.58  ? 368  LEU A CA  1 
ATOM   2823  C C   . LEU A  1 399  ? 215.997 237.228 266.901 1.00 44.58  ? 368  LEU A C   1 
ATOM   2824  O O   . LEU A  1 399  ? 215.871 236.294 267.696 1.00 44.58  ? 368  LEU A O   1 
ATOM   2825  C CB  . LEU A  1 399  ? 213.925 236.971 265.577 1.00 44.58  ? 368  LEU A CB  1 
ATOM   2826  C CG  . LEU A  1 399  ? 212.506 237.319 265.148 1.00 44.58  ? 368  LEU A CG  1 
ATOM   2827  C CD1 . LEU A  1 399  ? 212.043 236.322 264.110 1.00 44.58  ? 368  LEU A CD1 1 
ATOM   2828  C CD2 . LEU A  1 399  ? 211.592 237.280 266.350 1.00 44.58  ? 368  LEU A CD2 1 
ATOM   2829  N N   . TYR A  1 400  ? 217.189 237.619 266.441 1.00 42.96  ? 369  TYR A N   1 
ATOM   2830  C CA  . TYR A  1 400  ? 218.381 236.828 266.737 1.00 42.96  ? 369  TYR A CA  1 
ATOM   2831  C C   . TYR A  1 400  ? 218.689 236.786 268.228 1.00 42.96  ? 369  TYR A C   1 
ATOM   2832  O O   . TYR A  1 400  ? 219.025 235.725 268.764 1.00 42.96  ? 369  TYR A O   1 
ATOM   2833  C CB  . TYR A  1 400  ? 219.587 237.375 265.978 1.00 42.96  ? 369  TYR A CB  1 
ATOM   2834  C CG  . TYR A  1 400  ? 219.627 237.027 264.512 1.00 42.96  ? 369  TYR A CG  1 
ATOM   2835  C CD1 . TYR A  1 400  ? 218.735 236.125 263.965 1.00 42.96  ? 369  TYR A CD1 1 
ATOM   2836  C CD2 . TYR A  1 400  ? 220.578 237.586 263.680 1.00 42.96  ? 369  TYR A CD2 1 
ATOM   2837  C CE1 . TYR A  1 400  ? 218.779 235.812 262.627 1.00 42.96  ? 369  TYR A CE1 1 
ATOM   2838  C CE2 . TYR A  1 400  ? 220.630 237.274 262.348 1.00 42.96  ? 369  TYR A CE2 1 
ATOM   2839  C CZ  . TYR A  1 400  ? 219.731 236.388 261.826 1.00 42.96  ? 369  TYR A CZ  1 
ATOM   2840  O OH  . TYR A  1 400  ? 219.789 236.081 260.492 1.00 42.96  ? 369  TYR A OH  1 
ATOM   2841  N N   . ASN A  1 401  ? 218.588 237.919 268.916 1.00 49.05  ? 370  ASN A N   1 
ATOM   2842  C CA  . ASN A  1 401  ? 219.086 238.016 270.282 1.00 49.05  ? 370  ASN A CA  1 
ATOM   2843  C C   . ASN A  1 401  ? 218.072 237.593 271.337 1.00 49.05  ? 370  ASN A C   1 
ATOM   2844  O O   . ASN A  1 401  ? 218.355 237.734 272.530 1.00 49.05  ? 370  ASN A O   1 
ATOM   2845  C CB  . ASN A  1 401  ? 219.559 239.441 270.583 1.00 49.05  ? 370  ASN A CB  1 
ATOM   2846  C CG  . ASN A  1 401  ? 218.603 240.493 270.088 1.00 49.05  ? 370  ASN A CG  1 
ATOM   2847  O OD1 . ASN A  1 401  ? 217.676 240.203 269.337 1.00 49.05  ? 370  ASN A OD1 1 
ATOM   2848  N ND2 . ASN A  1 401  ? 218.822 241.732 270.509 1.00 49.05  ? 370  ASN A ND2 1 
ATOM   2849  N N   . SER A  1 402  ? 216.905 237.089 270.944 1.00 48.09  ? 371  SER A N   1 
ATOM   2850  C CA  . SER A  1 402  ? 215.924 236.673 271.942 1.00 48.09  ? 371  SER A CA  1 
ATOM   2851  C C   . SER A  1 402  ? 215.245 235.340 271.674 1.00 48.09  ? 371  SER A C   1 
ATOM   2852  O O   . SER A  1 402  ? 214.639 234.795 272.601 1.00 48.09  ? 371  SER A O   1 
ATOM   2853  C CB  . SER A  1 402  ? 214.845 237.750 272.097 1.00 48.09  ? 371  SER A CB  1 
ATOM   2854  O OG  . SER A  1 402  ? 214.072 237.875 270.917 1.00 48.09  ? 371  SER A OG  1 
ATOM   2855  N N   . ALA A  1 403  ? 215.310 234.785 270.468 1.00 40.55  ? 372  ALA A N   1 
ATOM   2856  C CA  . ALA A  1 403  ? 214.522 233.616 270.111 1.00 40.55  ? 372  ALA A CA  1 
ATOM   2857  C C   . ALA A  1 403  ? 215.409 232.548 269.496 1.00 40.55  ? 372  ALA A C   1 
ATOM   2858  O O   . ALA A  1 403  ? 216.359 232.859 268.774 1.00 40.55  ? 372  ALA A O   1 
ATOM   2859  C CB  . ALA A  1 403  ? 213.405 233.984 269.138 1.00 40.55  ? 372  ALA A CB  1 
ATOM   2860  N N   . SER A  1 404  ? 215.095 231.287 269.786 1.00 37.02  ? 373  SER A N   1 
ATOM   2861  C CA  . SER A  1 404  ? 215.793 230.147 269.206 1.00 37.02  ? 373  SER A CA  1 
ATOM   2862  C C   . SER A  1 404  ? 214.760 229.165 268.683 1.00 37.02  ? 373  SER A C   1 
ATOM   2863  O O   . SER A  1 404  ? 213.895 228.715 269.438 1.00 37.02  ? 373  SER A O   1 
ATOM   2864  C CB  . SER A  1 404  ? 216.694 229.464 270.236 1.00 37.02  ? 373  SER A CB  1 
ATOM   2865  O OG  . SER A  1 404  ? 217.822 230.261 270.543 1.00 37.02  ? 373  SER A OG  1 
ATOM   2866  N N   . PHE A  1 405  ? 214.855 228.826 267.401 1.00 32.61  ? 374  PHE A N   1 
ATOM   2867  C CA  . PHE A  1 405  ? 213.877 227.980 266.734 1.00 32.61  ? 374  PHE A CA  1 
ATOM   2868  C C   . PHE A  1 405  ? 214.490 226.623 266.438 1.00 32.61  ? 374  PHE A C   1 
ATOM   2869  O O   . PHE A  1 405  ? 215.552 226.540 265.815 1.00 32.61  ? 374  PHE A O   1 
ATOM   2870  C CB  . PHE A  1 405  ? 213.377 228.626 265.442 1.00 32.61  ? 374  PHE A CB  1 
ATOM   2871  C CG  . PHE A  1 405  ? 212.830 230.001 265.637 1.00 32.61  ? 374  PHE A CG  1 
ATOM   2872  C CD1 . PHE A  1 405  ? 211.752 230.210 266.468 1.00 32.61  ? 374  PHE A CD1 1 
ATOM   2873  C CD2 . PHE A  1 405  ? 213.396 231.083 265.001 1.00 32.61  ? 374  PHE A CD2 1 
ATOM   2874  C CE1 . PHE A  1 405  ? 211.251 231.466 266.659 1.00 32.61  ? 374  PHE A CE1 1 
ATOM   2875  C CE2 . PHE A  1 405  ? 212.895 232.344 265.189 1.00 32.61  ? 374  PHE A CE2 1 
ATOM   2876  C CZ  . PHE A  1 405  ? 211.821 232.534 266.020 1.00 32.61  ? 374  PHE A CZ  1 
ATOM   2877  N N   . SER A  1 406  ? 213.823 225.565 266.888 1.00 30.22  ? 375  SER A N   1 
ATOM   2878  C CA  . SER A  1 406  ? 214.269 224.222 266.553 1.00 30.22  ? 375  SER A CA  1 
ATOM   2879  C C   . SER A  1 406  ? 213.934 223.852 265.118 1.00 30.22  ? 375  SER A C   1 
ATOM   2880  O O   . SER A  1 406  ? 214.647 223.046 264.514 1.00 30.22  ? 375  SER A O   1 
ATOM   2881  C CB  . SER A  1 406  ? 213.661 223.205 267.520 1.00 30.22  ? 375  SER A CB  1 
ATOM   2882  O OG  . SER A  1 406  ? 212.264 223.089 267.345 1.00 30.22  ? 375  SER A OG  1 
ATOM   2883  N N   . THR A  1 407  ? 212.871 224.421 264.553 1.00 30.22  ? 376  THR A N   1 
ATOM   2884  C CA  . THR A  1 407  ? 212.475 224.126 263.180 1.00 30.22  ? 376  THR A CA  1 
ATOM   2885  C C   . THR A  1 407  ? 212.227 225.421 262.428 1.00 30.22  ? 376  THR A C   1 
ATOM   2886  O O   . THR A  1 407  ? 211.523 226.301 262.929 1.00 30.22  ? 376  THR A O   1 
ATOM   2887  C CB  . THR A  1 407  ? 211.215 223.255 263.140 1.00 30.22  ? 376  THR A CB  1 
ATOM   2888  O OG1 . THR A  1 407  ? 211.512 221.950 263.648 1.00 30.22  ? 376  THR A OG1 1 
ATOM   2889  C CG2 . THR A  1 407  ? 210.685 223.131 261.725 1.00 30.22  ? 376  THR A CG2 1 
ATOM   2890  N N   . PHE A  1 408  ? 212.786 225.522 261.223 1.00 30.26  ? 377  PHE A N   1 
ATOM   2891  C CA  . PHE A  1 408  ? 212.522 226.651 260.332 1.00 30.26  ? 377  PHE A CA  1 
ATOM   2892  C C   . PHE A  1 408  ? 212.769 226.200 258.899 1.00 30.26  ? 377  PHE A C   1 
ATOM   2893  O O   . PHE A  1 408  ? 213.924 226.046 258.498 1.00 30.26  ? 377  PHE A O   1 
ATOM   2894  C CB  . PHE A  1 408  ? 213.396 227.844 260.686 1.00 30.26  ? 377  PHE A CB  1 
ATOM   2895  C CG  . PHE A  1 408  ? 213.393 228.919 259.643 1.00 30.26  ? 377  PHE A CG  1 
ATOM   2896  C CD1 . PHE A  1 408  ? 212.222 229.543 259.269 1.00 30.26  ? 377  PHE A CD1 1 
ATOM   2897  C CD2 . PHE A  1 408  ? 214.564 229.298 259.028 1.00 30.26  ? 377  PHE A CD2 1 
ATOM   2898  C CE1 . PHE A  1 408  ? 212.223 230.519 258.307 1.00 30.26  ? 377  PHE A CE1 1 
ATOM   2899  C CE2 . PHE A  1 408  ? 214.567 230.277 258.066 1.00 30.26  ? 377  PHE A CE2 1 
ATOM   2900  C CZ  . PHE A  1 408  ? 213.395 230.884 257.704 1.00 30.26  ? 377  PHE A CZ  1 
ATOM   2901  N N   . LYS A  1 409  ? 211.697 226.006 258.128 1.00 32.15  ? 378  LYS A N   1 
ATOM   2902  C CA  . LYS A  1 409  ? 211.829 225.469 256.777 1.00 32.15  ? 378  LYS A CA  1 
ATOM   2903  C C   . LYS A  1 409  ? 210.964 226.242 255.794 1.00 32.15  ? 378  LYS A C   1 
ATOM   2904  O O   . LYS A  1 409  ? 209.790 226.487 256.067 1.00 32.15  ? 378  LYS A O   1 
ATOM   2905  C CB  . LYS A  1 409  ? 211.450 223.991 256.730 1.00 32.15  ? 378  LYS A CB  1 
ATOM   2906  C CG  . LYS A  1 409  ? 211.915 223.345 255.455 1.00 32.15  ? 378  LYS A CG  1 
ATOM   2907  C CD  . LYS A  1 409  ? 211.578 221.888 255.390 1.00 32.15  ? 378  LYS A CD  1 
ATOM   2908  C CE  . LYS A  1 409  ? 212.246 221.268 254.181 1.00 32.15  ? 378  LYS A CE  1 
ATOM   2909  N NZ  . LYS A  1 409  ? 211.887 221.990 252.932 1.00 32.15  ? 378  LYS A NZ  1 
ATOM   2910  N N   . CYS A  1 410  ? 211.530 226.601 254.642 1.00 35.80  ? 379  CYS A N   1 
ATOM   2911  C CA  . CYS A  1 410  ? 210.840 227.421 253.654 1.00 35.80  ? 379  CYS A CA  1 
ATOM   2912  C C   . CYS A  1 410  ? 210.615 226.651 252.356 1.00 35.80  ? 379  CYS A C   1 
ATOM   2913  O O   . CYS A  1 410  ? 211.492 225.922 251.892 1.00 35.80  ? 379  CYS A O   1 
ATOM   2914  C CB  . CYS A  1 410  ? 211.610 228.720 253.385 1.00 35.80  ? 379  CYS A CB  1 
ATOM   2915  S SG  . CYS A  1 410  ? 211.646 229.864 254.807 1.00 35.80  ? 379  CYS A SG  1 
ATOM   2916  N N   . TYR A  1 411  ? 209.423 226.820 251.789 1.00 32.23  ? 380  TYR A N   1 
ATOM   2917  C CA  . TYR A  1 411  ? 208.955 226.140 250.590 1.00 32.23  ? 380  TYR A CA  1 
ATOM   2918  C C   . TYR A  1 411  ? 208.691 227.166 249.500 1.00 32.23  ? 380  TYR A C   1 
ATOM   2919  O O   . TYR A  1 411  ? 207.972 228.145 249.730 1.00 32.23  ? 380  TYR A O   1 
ATOM   2920  C CB  . TYR A  1 411  ? 207.680 225.344 250.873 1.00 32.23  ? 380  TYR A CB  1 
ATOM   2921  C CG  . TYR A  1 411  ? 207.803 224.336 251.988 1.00 32.23  ? 380  TYR A CG  1 
ATOM   2922  C CD1 . TYR A  1 411  ? 208.068 223.011 251.718 1.00 32.23  ? 380  TYR A CD1 1 
ATOM   2923  C CD2 . TYR A  1 411  ? 207.674 224.717 253.312 1.00 32.23  ? 380  TYR A CD2 1 
ATOM   2924  C CE1 . TYR A  1 411  ? 208.189 222.094 252.730 1.00 32.23  ? 380  TYR A CE1 1 
ATOM   2925  C CE2 . TYR A  1 411  ? 207.798 223.806 254.329 1.00 32.23  ? 380  TYR A CE2 1 
ATOM   2926  C CZ  . TYR A  1 411  ? 208.053 222.495 254.032 1.00 32.23  ? 380  TYR A CZ  1 
ATOM   2927  O OH  . TYR A  1 411  ? 208.169 221.578 255.045 1.00 32.23  ? 380  TYR A OH  1 
ATOM   2928  N N   . GLY A  1 412  ? 209.239 226.916 248.311 1.00 35.26  ? 381  GLY A N   1 
ATOM   2929  C CA  . GLY A  1 412  ? 209.068 227.783 247.164 1.00 35.26  ? 381  GLY A CA  1 
ATOM   2930  C C   . GLY A  1 412  ? 210.005 228.964 247.097 1.00 35.26  ? 381  GLY A C   1 
ATOM   2931  O O   . GLY A  1 412  ? 209.858 229.801 246.201 1.00 35.26  ? 381  GLY A O   1 
ATOM   2932  N N   . VAL A  1 413  ? 210.970 229.054 248.010 1.00 36.97  ? 382  VAL A N   1 
ATOM   2933  C CA  . VAL A  1 413  ? 211.890 230.180 248.079 1.00 36.97  ? 382  VAL A CA  1 
ATOM   2934  C C   . VAL A  1 413  ? 213.123 229.703 248.831 1.00 36.97  ? 382  VAL A C   1 
ATOM   2935  O O   . VAL A  1 413  ? 213.045 228.794 249.659 1.00 36.97  ? 382  VAL A O   1 
ATOM   2936  C CB  . VAL A  1 413  ? 211.219 231.403 248.756 1.00 36.97  ? 382  VAL A CB  1 
ATOM   2937  C CG1 . VAL A  1 413  ? 210.761 231.055 250.154 1.00 36.97  ? 382  VAL A CG1 1 
ATOM   2938  C CG2 . VAL A  1 413  ? 212.135 232.607 248.765 1.00 36.97  ? 382  VAL A CG2 1 
ATOM   2939  N N   . SER A  1 414  ? 214.271 230.286 248.509 1.00 39.85  ? 383  SER A N   1 
ATOM   2940  C CA  . SER A  1 414  ? 215.501 230.019 249.244 1.00 39.85  ? 383  SER A CA  1 
ATOM   2941  C C   . SER A  1 414  ? 215.615 230.962 250.437 1.00 39.85  ? 383  SER A C   1 
ATOM   2942  O O   . SER A  1 414  ? 215.333 232.153 250.309 1.00 39.85  ? 383  SER A O   1 
ATOM   2943  C CB  . SER A  1 414  ? 216.712 230.190 248.342 1.00 39.85  ? 383  SER A CB  1 
ATOM   2944  O OG  . SER A  1 414  ? 216.858 229.072 247.489 1.00 39.85  ? 383  SER A OG  1 
ATOM   2945  N N   . PRO A  1 415  ? 216.017 230.463 251.610 1.00 39.57  ? 384  PRO A N   1 
ATOM   2946  C CA  . PRO A  1 415  ? 216.158 231.353 252.776 1.00 39.57  ? 384  PRO A CA  1 
ATOM   2947  C C   . PRO A  1 415  ? 217.162 232.476 252.605 1.00 39.57  ? 384  PRO A C   1 
ATOM   2948  O O   . PRO A  1 415  ? 217.058 233.483 253.313 1.00 39.57  ? 384  PRO A O   1 
ATOM   2949  C CB  . PRO A  1 415  ? 216.594 230.396 253.894 1.00 39.57  ? 384  PRO A CB  1 
ATOM   2950  C CG  . PRO A  1 415  ? 217.048 229.166 253.214 1.00 39.57  ? 384  PRO A CG  1 
ATOM   2951  C CD  . PRO A  1 415  ? 216.277 229.058 251.956 1.00 39.57  ? 384  PRO A CD  1 
ATOM   2952  N N   . THR A  1 416  ? 218.129 232.347 251.705 1.00 41.44  ? 385  THR A N   1 
ATOM   2953  C CA  . THR A  1 416  ? 219.098 233.411 251.476 1.00 41.44  ? 385  THR A CA  1 
ATOM   2954  C C   . THR A  1 416  ? 218.588 234.520 250.563 1.00 41.44  ? 385  THR A C   1 
ATOM   2955  O O   . THR A  1 416  ? 219.284 235.526 250.401 1.00 41.44  ? 385  THR A O   1 
ATOM   2956  C CB  . THR A  1 416  ? 220.392 232.824 250.915 1.00 41.44  ? 385  THR A CB  1 
ATOM   2957  O OG1 . THR A  1 416  ? 220.092 231.959 249.816 1.00 41.44  ? 385  THR A OG1 1 
ATOM   2958  C CG2 . THR A  1 416  ? 221.108 232.026 251.982 1.00 41.44  ? 385  THR A CG2 1 
ATOM   2959  N N   . LYS A  1 417  ? 217.413 234.368 249.955 1.00 41.68  ? 386  LYS A N   1 
ATOM   2960  C CA  . LYS A  1 417  ? 216.837 235.418 249.128 1.00 41.68  ? 386  LYS A CA  1 
ATOM   2961  C C   . LYS A  1 417  ? 215.783 236.250 249.844 1.00 41.68  ? 386  LYS A C   1 
ATOM   2962  O O   . LYS A  1 417  ? 215.347 237.266 249.294 1.00 41.68  ? 386  LYS A O   1 
ATOM   2963  C CB  . LYS A  1 417  ? 216.201 234.802 247.879 1.00 41.68  ? 386  LYS A CB  1 
ATOM   2964  C CG  . LYS A  1 417  ? 217.023 233.704 247.251 1.00 41.68  ? 386  LYS A CG  1 
ATOM   2965  C CD  . LYS A  1 417  ? 218.248 234.225 246.543 1.00 41.68  ? 386  LYS A CD  1 
ATOM   2966  C CE  . LYS A  1 417  ? 217.894 235.284 245.546 1.00 41.68  ? 386  LYS A CE  1 
ATOM   2967  N NZ  . LYS A  1 417  ? 219.069 235.612 244.708 1.00 41.68  ? 386  LYS A NZ  1 
ATOM   2968  N N   . LEU A  1 418  ? 215.401 235.873 251.065 1.00 41.70  ? 387  LEU A N   1 
ATOM   2969  C CA  . LEU A  1 418  ? 214.319 236.555 251.769 1.00 41.70  ? 387  LEU A CA  1 
ATOM   2970  C C   . LEU A  1 418  ? 214.577 238.048 251.922 1.00 41.70  ? 387  LEU A C   1 
ATOM   2971  O O   . LEU A  1 418  ? 213.634 238.845 251.900 1.00 41.70  ? 387  LEU A O   1 
ATOM   2972  C CB  . LEU A  1 418  ? 214.092 235.908 253.134 1.00 41.70  ? 387  LEU A CB  1 
ATOM   2973  C CG  . LEU A  1 418  ? 213.545 234.477 253.132 1.00 41.70  ? 387  LEU A CG  1 
ATOM   2974  C CD1 . LEU A  1 418  ? 213.644 233.874 254.517 1.00 41.70  ? 387  LEU A CD1 1 
ATOM   2975  C CD2 . LEU A  1 418  ? 212.123 234.413 252.623 1.00 41.70  ? 387  LEU A CD2 1 
ATOM   2976  N N   . ASN A  1 419  ? 215.837 238.445 252.098 1.00 47.61  ? 388  ASN A N   1 
ATOM   2977  C CA  . ASN A  1 419  ? 216.166 239.851 252.301 1.00 47.61  ? 388  ASN A CA  1 
ATOM   2978  C C   . ASN A  1 419  ? 215.982 240.710 251.055 1.00 47.61  ? 388  ASN A C   1 
ATOM   2979  O O   . ASN A  1 419  ? 215.960 241.938 251.177 1.00 47.61  ? 388  ASN A O   1 
ATOM   2980  C CB  . ASN A  1 419  ? 217.600 239.982 252.804 1.00 47.61  ? 388  ASN A CB  1 
ATOM   2981  C CG  . ASN A  1 419  ? 217.691 239.950 254.314 1.00 47.61  ? 388  ASN A CG  1 
ATOM   2982  O OD1 . ASN A  1 419  ? 216.689 239.774 255.003 1.00 47.61  ? 388  ASN A OD1 1 
ATOM   2983  N ND2 . ASN A  1 419  ? 218.898 240.116 254.837 1.00 47.61  ? 388  ASN A ND2 1 
ATOM   2984  N N   . ASP A  1 420  ? 215.857 240.119 249.866 1.00 47.92  ? 389  ASP A N   1 
ATOM   2985  C CA  . ASP A  1 420  ? 215.787 240.903 248.637 1.00 47.92  ? 389  ASP A CA  1 
ATOM   2986  C C   . ASP A  1 420  ? 214.416 240.888 247.977 1.00 47.92  ? 389  ASP A C   1 
ATOM   2987  O O   . ASP A  1 420  ? 214.288 241.352 246.842 1.00 47.92  ? 389  ASP A O   1 
ATOM   2988  C CB  . ASP A  1 420  ? 216.829 240.411 247.635 1.00 47.92  ? 389  ASP A CB  1 
ATOM   2989  C CG  . ASP A  1 420  ? 218.216 240.363 248.217 1.00 47.92  ? 389  ASP A CG  1 
ATOM   2990  O OD1 . ASP A  1 420  ? 218.712 241.425 248.648 1.00 47.92  ? 389  ASP A OD1 1 
ATOM   2991  O OD2 . ASP A  1 420  ? 218.818 239.269 248.232 1.00 47.92  ? 389  ASP A OD2 1 
ATOM   2992  N N   . LEU A  1 421  ? 213.390 240.394 248.655 1.00 44.92  ? 390  LEU A N   1 
ATOM   2993  C CA  . LEU A  1 421  ? 212.085 240.184 248.055 1.00 44.92  ? 390  LEU A CA  1 
ATOM   2994  C C   . LEU A  1 421  ? 211.027 241.060 248.711 1.00 44.92  ? 390  LEU A C   1 
ATOM   2995  O O   . LEU A  1 421  ? 211.221 241.609 249.796 1.00 44.92  ? 390  LEU A O   1 
ATOM   2996  C CB  . LEU A  1 421  ? 211.667 238.711 248.151 1.00 44.92  ? 390  LEU A CB  1 
ATOM   2997  C CG  . LEU A  1 421  ? 212.408 237.727 247.250 1.00 44.92  ? 390  LEU A CG  1 
ATOM   2998  C CD1 . LEU A  1 421  ? 212.127 236.306 247.669 1.00 44.92  ? 390  LEU A CD1 1 
ATOM   2999  C CD2 . LEU A  1 421  ? 211.976 237.943 245.817 1.00 44.92  ? 390  LEU A CD2 1 
ATOM   3000  N N   . CYS A  1 422  ? 209.908 241.191 248.005 1.00 45.60  ? 391  CYS A N   1 
ATOM   3001  C CA  . CYS A  1 422  ? 208.699 241.850 248.470 1.00 45.60  ? 391  CYS A CA  1 
ATOM   3002  C C   . CYS A  1 422  ? 207.590 240.805 248.463 1.00 45.60  ? 391  CYS A C   1 
ATOM   3003  O O   . CYS A  1 422  ? 207.492 240.014 247.521 1.00 45.60  ? 391  CYS A O   1 
ATOM   3004  C CB  . CYS A  1 422  ? 208.353 243.023 247.551 1.00 45.60  ? 391  CYS A CB  1 
ATOM   3005  S SG  . CYS A  1 422  ? 207.594 244.503 248.249 1.00 45.60  ? 391  CYS A SG  1 
ATOM   3006  N N   . PHE A  1 423  ? 206.746 240.803 249.497 1.00 41.15  ? 392  PHE A N   1 
ATOM   3007  C CA  . PHE A  1 423  ? 205.806 239.711 249.735 1.00 41.15  ? 392  PHE A CA  1 
ATOM   3008  C C   . PHE A  1 423  ? 204.355 240.168 249.650 1.00 41.15  ? 392  PHE A C   1 
ATOM   3009  O O   . PHE A  1 423  ? 203.994 241.230 250.161 1.00 41.15  ? 392  PHE A O   1 
ATOM   3010  C CB  . PHE A  1 423  ? 206.051 239.065 251.103 1.00 41.15  ? 392  PHE A CB  1 
ATOM   3011  C CG  . PHE A  1 423  ? 207.491 238.730 251.371 1.00 41.15  ? 392  PHE A CG  1 
ATOM   3012  C CD1 . PHE A  1 423  ? 208.006 237.503 251.002 1.00 41.15  ? 392  PHE A CD1 1 
ATOM   3013  C CD2 . PHE A  1 423  ? 208.319 239.625 252.011 1.00 41.15  ? 392  PHE A CD2 1 
ATOM   3014  C CE1 . PHE A  1 423  ? 209.318 237.190 251.242 1.00 41.15  ? 392  PHE A CE1 1 
ATOM   3015  C CE2 . PHE A  1 423  ? 209.633 239.316 252.253 1.00 41.15  ? 392  PHE A CE2 1 
ATOM   3016  C CZ  . PHE A  1 423  ? 210.130 238.095 251.872 1.00 41.15  ? 392  PHE A CZ  1 
ATOM   3017  N N   . THR A  1 424  ? 203.530 239.361 248.984 1.00 39.30  ? 393  THR A N   1 
ATOM   3018  C CA  . THR A  1 424  ? 202.122 239.659 248.755 1.00 39.30  ? 393  THR A CA  1 
ATOM   3019  C C   . THR A  1 424  ? 201.233 238.760 249.610 1.00 39.30  ? 393  THR A C   1 
ATOM   3020  O O   . THR A  1 424  ? 201.484 237.557 249.723 1.00 39.30  ? 393  THR A O   1 
ATOM   3021  C CB  . THR A  1 424  ? 201.775 239.469 247.274 1.00 39.30  ? 393  THR A CB  1 
ATOM   3022  O OG1 . THR A  1 424  ? 202.660 240.257 246.469 1.00 39.30  ? 393  THR A OG1 1 
ATOM   3023  C CG2 . THR A  1 424  ? 200.349 239.882 246.986 1.00 39.30  ? 393  THR A CG2 1 
ATOM   3024  N N   . ASN A  1 425  ? 200.185 239.342 250.194 1.00 39.79  ? 394  ASN A N   1 
ATOM   3025  C CA  . ASN A  1 425  ? 199.155 238.608 250.939 1.00 39.79  ? 394  ASN A CA  1 
ATOM   3026  C C   . ASN A  1 425  ? 199.738 237.733 252.046 1.00 39.79  ? 394  ASN A C   1 
ATOM   3027  O O   . ASN A  1 425  ? 199.569 236.514 252.063 1.00 39.79  ? 394  ASN A O   1 
ATOM   3028  C CB  . ASN A  1 425  ? 198.284 237.779 249.999 1.00 39.79  ? 394  ASN A CB  1 
ATOM   3029  C CG  . ASN A  1 425  ? 197.405 238.634 249.128 1.00 39.79  ? 394  ASN A CG  1 
ATOM   3030  O OD1 . ASN A  1 425  ? 197.466 238.566 247.902 1.00 39.79  ? 394  ASN A OD1 1 
ATOM   3031  N ND2 . ASN A  1 425  ? 196.581 239.458 249.757 1.00 39.79  ? 394  ASN A ND2 1 
ATOM   3032  N N   . VAL A  1 426  ? 200.426 238.371 252.983 1.00 35.21  ? 395  VAL A N   1 
ATOM   3033  C CA  . VAL A  1 426  ? 201.104 237.640 254.047 1.00 35.21  ? 395  VAL A CA  1 
ATOM   3034  C C   . VAL A  1 426  ? 200.124 237.333 255.175 1.00 35.21  ? 395  VAL A C   1 
ATOM   3035  O O   . VAL A  1 426  ? 199.432 238.225 255.685 1.00 35.21  ? 395  VAL A O   1 
ATOM   3036  C CB  . VAL A  1 426  ? 202.313 238.436 254.557 1.00 35.21  ? 395  VAL A CB  1 
ATOM   3037  C CG1 . VAL A  1 426  ? 202.987 237.711 255.708 1.00 35.21  ? 395  VAL A CG1 1 
ATOM   3038  C CG2 . VAL A  1 426  ? 203.283 238.678 253.431 1.00 35.21  ? 395  VAL A CG2 1 
ATOM   3039  N N   . TYR A  1 427  ? 200.117 236.072 255.610 1.00 34.53  ? 396  TYR A N   1 
ATOM   3040  C CA  . TYR A  1 427  ? 199.330 235.626 256.750 1.00 34.53  ? 396  TYR A CA  1 
ATOM   3041  C C   . TYR A  1 427  ? 200.200 234.793 257.677 1.00 34.53  ? 396  TYR A C   1 
ATOM   3042  O O   . TYR A  1 427  ? 201.129 234.112 257.234 1.00 34.53  ? 396  TYR A O   1 
ATOM   3043  C CB  . TYR A  1 427  ? 198.128 234.790 256.314 1.00 34.53  ? 396  TYR A CB  1 
ATOM   3044  C CG  . TYR A  1 427  ? 196.998 235.594 255.729 1.00 34.53  ? 396  TYR A CG  1 
ATOM   3045  C CD1 . TYR A  1 427  ? 196.752 235.587 254.368 1.00 34.53  ? 396  TYR A CD1 1 
ATOM   3046  C CD2 . TYR A  1 427  ? 196.169 236.348 256.538 1.00 34.53  ? 396  TYR A CD2 1 
ATOM   3047  C CE1 . TYR A  1 427  ? 195.727 236.316 253.833 1.00 34.53  ? 396  TYR A CE1 1 
ATOM   3048  C CE2 . TYR A  1 427  ? 195.140 237.078 256.009 1.00 34.53  ? 396  TYR A CE2 1 
ATOM   3049  C CZ  . TYR A  1 427  ? 194.925 237.060 254.656 1.00 34.53  ? 396  TYR A CZ  1 
ATOM   3050  O OH  . TYR A  1 427  ? 193.895 237.786 254.124 1.00 34.53  ? 396  TYR A OH  1 
ATOM   3051  N N   . ALA A  1 428  ? 199.867 234.830 258.968 1.00 30.61  ? 397  ALA A N   1 
ATOM   3052  C CA  . ALA A  1 428  ? 200.521 234.023 259.992 1.00 30.61  ? 397  ALA A CA  1 
ATOM   3053  C C   . ALA A  1 428  ? 199.492 233.174 260.726 1.00 30.61  ? 397  ALA A C   1 
ATOM   3054  O O   . ALA A  1 428  ? 198.518 233.706 261.263 1.00 30.61  ? 397  ALA A O   1 
ATOM   3055  C CB  . ALA A  1 428  ? 201.278 234.910 260.977 1.00 30.61  ? 397  ALA A CB  1 
ATOM   3056  N N   . ASP A  1 429  ? 199.717 231.862 260.756 1.00 30.54  ? 398  ASP A N   1 
ATOM   3057  C CA  . ASP A  1 429  ? 198.869 230.909 261.464 1.00 30.54  ? 398  ASP A CA  1 
ATOM   3058  C C   . ASP A  1 429  ? 199.592 230.436 262.715 1.00 30.54  ? 398  ASP A C   1 
ATOM   3059  O O   . ASP A  1 429  ? 200.779 230.117 262.656 1.00 30.54  ? 398  ASP A O   1 
ATOM   3060  C CB  . ASP A  1 429  ? 198.540 229.708 260.581 1.00 30.54  ? 398  ASP A CB  1 
ATOM   3061  C CG  . ASP A  1 429  ? 197.984 230.109 259.246 1.00 30.54  ? 398  ASP A CG  1 
ATOM   3062  O OD1 . ASP A  1 429  ? 197.372 231.186 259.160 1.00 30.54  ? 398  ASP A OD1 1 
ATOM   3063  O OD2 . ASP A  1 429  ? 198.162 229.353 258.275 1.00 30.54  ? 398  ASP A OD2 1 
ATOM   3064  N N   . SER A  1 430  ? 198.881 230.387 263.835 1.00 27.93  ? 399  SER A N   1 
ATOM   3065  C CA  . SER A  1 430  ? 199.477 230.039 265.120 1.00 27.93  ? 399  SER A CA  1 
ATOM   3066  C C   . SER A  1 430  ? 198.693 228.944 265.827 1.00 27.93  ? 399  SER A C   1 
ATOM   3067  O O   . SER A  1 430  ? 197.453 228.966 265.840 1.00 27.93  ? 399  SER A O   1 
ATOM   3068  C CB  . SER A  1 430  ? 199.572 231.258 266.023 1.00 27.93  ? 399  SER A CB  1 
ATOM   3069  O OG  . SER A  1 430  ? 200.411 232.236 265.443 1.00 27.93  ? 399  SER A OG  1 
ATOM   3070  N N   . PHE A  1 431  ? 199.430 227.982 266.398 1.00 25.28  ? 400  PHE A N   1 
ATOM   3071  C CA  . PHE A  1 431  ? 198.840 226.978 267.287 1.00 25.28  ? 400  PHE A CA  1 
ATOM   3072  C C   . PHE A  1 431  ? 199.938 226.321 268.126 1.00 25.28  ? 400  PHE A C   1 
ATOM   3073  O O   . PHE A  1 431  ? 201.122 226.647 268.010 1.00 25.28  ? 400  PHE A O   1 
ATOM   3074  C CB  . PHE A  1 431  ? 198.037 225.926 266.514 1.00 25.28  ? 400  PHE A CB  1 
ATOM   3075  C CG  . PHE A  1 431  ? 198.745 225.369 265.321 1.00 25.28  ? 400  PHE A CG  1 
ATOM   3076  C CD1 . PHE A  1 431  ? 199.547 224.252 265.438 1.00 25.28  ? 400  PHE A CD1 1 
ATOM   3077  C CD2 . PHE A  1 431  ? 198.593 225.947 264.081 1.00 25.28  ? 400  PHE A CD2 1 
ATOM   3078  C CE1 . PHE A  1 431  ? 200.199 223.743 264.352 1.00 25.28  ? 400  PHE A CE1 1 
ATOM   3079  C CE2 . PHE A  1 431  ? 199.245 225.440 262.995 1.00 25.28  ? 400  PHE A CE2 1 
ATOM   3080  C CZ  . PHE A  1 431  ? 200.046 224.335 263.129 1.00 25.28  ? 400  PHE A CZ  1 
ATOM   3081  N N   . VAL A  1 432  ? 199.517 225.425 269.021 1.00 27.25  ? 401  VAL A N   1 
ATOM   3082  C CA  . VAL A  1 432  ? 200.396 224.659 269.903 1.00 27.25  ? 401  VAL A CA  1 
ATOM   3083  C C   . VAL A  1 432  ? 200.101 223.180 269.696 1.00 27.25  ? 401  VAL A C   1 
ATOM   3084  O O   . VAL A  1 432  ? 198.935 222.780 269.684 1.00 27.25  ? 401  VAL A O   1 
ATOM   3085  C CB  . VAL A  1 432  ? 200.194 225.040 271.381 1.00 27.25  ? 401  VAL A CB  1 
ATOM   3086  C CG1 . VAL A  1 432  ? 200.761 223.983 272.290 1.00 27.25  ? 401  VAL A CG1 1 
ATOM   3087  C CG2 . VAL A  1 432  ? 200.834 226.364 271.676 1.00 27.25  ? 401  VAL A CG2 1 
ATOM   3088  N N   . ILE A  1 433  ? 201.148 222.367 269.539 1.00 29.28  ? 402  ILE A N   1 
ATOM   3089  C CA  . ILE A  1 433  ? 200.985 220.925 269.398 1.00 29.28  ? 402  ILE A CA  1 
ATOM   3090  C C   . ILE A  1 433  ? 201.972 220.196 270.305 1.00 29.28  ? 402  ILE A C   1 
ATOM   3091  O O   . ILE A  1 433  ? 202.789 220.801 270.988 1.00 29.28  ? 402  ILE A O   1 
ATOM   3092  C CB  . ILE A  1 433  ? 201.152 220.452 267.940 1.00 29.28  ? 402  ILE A CB  1 
ATOM   3093  C CG1 . ILE A  1 433  ? 202.358 221.121 267.297 1.00 29.28  ? 402  ILE A CG1 1 
ATOM   3094  C CG2 . ILE A  1 433  ? 199.905 220.736 267.140 1.00 29.28  ? 402  ILE A CG2 1 
ATOM   3095  C CD1 . ILE A  1 433  ? 202.731 220.517 265.989 1.00 29.28  ? 402  ILE A CD1 1 
ATOM   3096  N N   . ARG A  1 434  ? 201.844 218.875 270.333 1.00 35.75  ? 403  ARG A N   1 
ATOM   3097  C CA  . ARG A  1 434  ? 202.827 218.007 270.959 1.00 35.75  ? 403  ARG A CA  1 
ATOM   3098  C C   . ARG A  1 434  ? 204.090 217.960 270.101 1.00 35.75  ? 403  ARG A C   1 
ATOM   3099  O O   . ARG A  1 434  ? 204.044 218.180 268.891 1.00 35.75  ? 403  ARG A O   1 
ATOM   3100  C CB  . ARG A  1 434  ? 202.216 216.614 271.139 1.00 35.75  ? 403  ARG A CB  1 
ATOM   3101  C CG  . ARG A  1 434  ? 203.116 215.543 271.665 1.00 35.75  ? 403  ARG A CG  1 
ATOM   3102  C CD  . ARG A  1 434  ? 202.473 214.161 271.629 1.00 35.75  ? 403  ARG A CD  1 
ATOM   3103  N NE  . ARG A  1 434  ? 201.524 213.949 272.718 1.00 35.75  ? 403  ARG A NE  1 
ATOM   3104  C CZ  . ARG A  1 434  ? 200.247 213.617 272.555 1.00 35.75  ? 403  ARG A CZ  1 
ATOM   3105  N NH1 . ARG A  1 434  ? 199.748 213.447 271.342 1.00 35.75  ? 403  ARG A NH1 1 
ATOM   3106  N NH2 . ARG A  1 434  ? 199.467 213.447 273.611 1.00 35.75  ? 403  ARG A NH2 1 
ATOM   3107  N N   . GLY A  1 435  ? 205.229 217.679 270.732 1.00 33.12  ? 404  GLY A N   1 
ATOM   3108  C CA  . GLY A  1 435  ? 206.490 217.697 270.001 1.00 33.12  ? 404  GLY A CA  1 
ATOM   3109  C C   . GLY A  1 435  ? 206.593 216.647 268.909 1.00 33.12  ? 404  GLY A C   1 
ATOM   3110  O O   . GLY A  1 435  ? 207.018 216.946 267.787 1.00 33.12  ? 404  GLY A O   1 
ATOM   3111  N N   . ASP A  1 436  ? 206.070 215.446 269.173 1.00 37.27  ? 405  ASP A N   1 
ATOM   3112  C CA  . ASP A  1 436  ? 206.142 214.358 268.198 1.00 37.27  ? 405  ASP A CA  1 
ATOM   3113  C C   . ASP A  1 436  ? 205.421 214.699 266.908 1.00 37.27  ? 405  ASP A C   1 
ATOM   3114  O O   . ASP A  1 436  ? 205.771 214.175 265.847 1.00 37.27  ? 405  ASP A O   1 
ATOM   3115  C CB  . ASP A  1 436  ? 205.561 213.082 268.795 1.00 37.27  ? 405  ASP A CB  1 
ATOM   3116  C CG  . ASP A  1 436  ? 206.585 212.283 269.550 1.00 37.27  ? 405  ASP A CG  1 
ATOM   3117  O OD1 . ASP A  1 436  ? 207.782 212.596 269.427 1.00 37.27  ? 405  ASP A OD1 1 
ATOM   3118  O OD2 . ASP A  1 436  ? 206.199 211.342 270.273 1.00 37.27  ? 405  ASP A OD2 1 
ATOM   3119  N N   . GLU A  1 437  ? 204.404 215.544 266.977 1.00 34.35  ? 406  GLU A N   1 
ATOM   3120  C CA  . GLU A  1 437  ? 203.553 215.828 265.838 1.00 34.35  ? 406  GLU A CA  1 
ATOM   3121  C C   . GLU A  1 437  ? 204.128 216.916 264.949 1.00 34.35  ? 406  GLU A C   1 
ATOM   3122  O O   . GLU A  1 437  ? 203.543 217.206 263.901 1.00 34.35  ? 406  GLU A O   1 
ATOM   3123  C CB  . GLU A  1 437  ? 202.151 216.216 266.304 1.00 34.35  ? 406  GLU A CB  1 
ATOM   3124  C CG  . GLU A  1 437  ? 201.463 215.114 267.076 1.00 34.35  ? 406  GLU A CG  1 
ATOM   3125  C CD  . GLU A  1 437  ? 200.301 215.605 267.896 1.00 34.35  ? 406  GLU A CD  1 
ATOM   3126  O OE1 . GLU A  1 437  ? 200.240 216.815 268.177 1.00 34.35  ? 406  GLU A OE1 1 
ATOM   3127  O OE2 . GLU A  1 437  ? 199.446 214.779 268.270 1.00 34.35  ? 406  GLU A OE2 1 
ATOM   3128  N N   . VAL A  1 438  ? 205.280 217.493 265.307 1.00 29.58  ? 407  VAL A N   1 
ATOM   3129  C CA  . VAL A  1 438  ? 205.797 218.596 264.500 1.00 29.58  ? 407  VAL A CA  1 
ATOM   3130  C C   . VAL A  1 438  ? 206.165 218.127 263.099 1.00 29.58  ? 407  VAL A C   1 
ATOM   3131  O O   . VAL A  1 438  ? 206.044 218.889 262.133 1.00 29.58  ? 407  VAL A O   1 
ATOM   3132  C CB  . VAL A  1 438  ? 206.993 219.262 265.203 1.00 29.58  ? 407  VAL A CB  1 
ATOM   3133  C CG1 . VAL A  1 438  ? 207.604 220.313 264.322 1.00 29.58  ? 407  VAL A CG1 1 
ATOM   3134  C CG2 . VAL A  1 438  ? 206.544 219.903 266.489 1.00 29.58  ? 407  VAL A CG2 1 
ATOM   3135  N N   . ARG A  1 439  ? 206.603 216.878 262.951 1.00 31.74  ? 408  ARG A N   1 
ATOM   3136  C CA  . ARG A  1 439  ? 206.947 216.367 261.630 1.00 31.74  ? 408  ARG A CA  1 
ATOM   3137  C C   . ARG A  1 439  ? 205.752 216.339 260.687 1.00 31.74  ? 408  ARG A C   1 
ATOM   3138  O O   . ARG A  1 439  ? 205.944 216.222 259.474 1.00 31.74  ? 408  ARG A O   1 
ATOM   3139  C CB  . ARG A  1 439  ? 207.531 214.960 261.738 1.00 31.74  ? 408  ARG A CB  1 
ATOM   3140  C CG  . ARG A  1 439  ? 206.693 213.995 262.541 1.00 31.74  ? 408  ARG A CG  1 
ATOM   3141  C CD  . ARG A  1 439  ? 206.958 212.560 262.135 1.00 31.74  ? 408  ARG A CD  1 
ATOM   3142  N NE  . ARG A  1 439  ? 206.115 211.637 262.882 1.00 31.74  ? 408  ARG A NE  1 
ATOM   3143  C CZ  . ARG A  1 439  ? 204.988 211.118 262.419 1.00 31.74  ? 408  ARG A CZ  1 
ATOM   3144  N NH1 . ARG A  1 439  ? 204.565 211.420 261.205 1.00 31.74  ? 408  ARG A NH1 1 
ATOM   3145  N NH2 . ARG A  1 439  ? 204.279 210.296 263.170 1.00 31.74  ? 408  ARG A NH2 1 
ATOM   3146  N N   . GLN A  1 440  ? 204.527 216.419 261.212 1.00 31.38  ? 409  GLN A N   1 
ATOM   3147  C CA  . GLN A  1 440  ? 203.320 216.394 260.392 1.00 31.38  ? 409  GLN A CA  1 
ATOM   3148  C C   . GLN A  1 440  ? 202.955 217.733 259.763 1.00 31.38  ? 409  GLN A C   1 
ATOM   3149  O O   . GLN A  1 440  ? 202.065 217.764 258.910 1.00 31.38  ? 409  GLN A O   1 
ATOM   3150  C CB  . GLN A  1 440  ? 202.136 215.896 261.214 1.00 31.38  ? 409  GLN A CB  1 
ATOM   3151  C CG  . GLN A  1 440  ? 202.223 214.448 261.597 1.00 31.38  ? 409  GLN A CG  1 
ATOM   3152  C CD  . GLN A  1 440  ? 201.059 214.021 262.440 1.00 31.38  ? 409  GLN A CD  1 
ATOM   3153  O OE1 . GLN A  1 440  ? 199.930 214.405 262.173 1.00 31.38  ? 409  GLN A OE1 1 
ATOM   3154  N NE2 . GLN A  1 440  ? 201.318 213.219 263.459 1.00 31.38  ? 409  GLN A NE2 1 
ATOM   3155  N N   . ILE A  1 441  ? 203.601 218.829 260.143 1.00 29.25  ? 410  ILE A N   1 
ATOM   3156  C CA  . ILE A  1 441  ? 203.294 220.143 259.551 1.00 29.25  ? 410  ILE A CA  1 
ATOM   3157  C C   . ILE A  1 441  ? 204.188 220.284 258.324 1.00 29.25  ? 410  ILE A C   1 
ATOM   3158  O O   . ILE A  1 441  ? 205.249 220.909 258.342 1.00 29.25  ? 410  ILE A O   1 
ATOM   3159  C CB  . ILE A  1 441  ? 203.473 221.290 260.549 1.00 29.25  ? 410  ILE A CB  1 
ATOM   3160  C CG1 . ILE A  1 441  ? 202.776 220.990 261.874 1.00 29.25  ? 410  ILE A CG1 1 
ATOM   3161  C CG2 . ILE A  1 441  ? 202.888 222.556 259.978 1.00 29.25  ? 410  ILE A CG2 1 
ATOM   3162  C CD1 . ILE A  1 441  ? 201.315 220.701 261.761 1.00 29.25  ? 410  ILE A CD1 1 
ATOM   3163  N N   . ALA A  1 442  ? 203.737 219.689 257.224 1.00 31.66  ? 411  ALA A N   1 
ATOM   3164  C CA  . ALA A  1 442  ? 204.461 219.614 255.965 1.00 31.66  ? 411  ALA A CA  1 
ATOM   3165  C C   . ALA A  1 442  ? 203.492 219.169 254.878 1.00 31.66  ? 411  ALA A C   1 
ATOM   3166  O O   . ALA A  1 442  ? 202.495 218.506 255.179 1.00 31.66  ? 411  ALA A O   1 
ATOM   3167  C CB  . ALA A  1 442  ? 205.638 218.652 256.067 1.00 31.66  ? 411  ALA A CB  1 
ATOM   3168  N N   . PRO A  1 443  ? 203.726 219.527 253.617 1.00 34.53  ? 412  PRO A N   1 
ATOM   3169  C CA  . PRO A  1 443  ? 202.831 219.071 252.546 1.00 34.53  ? 412  PRO A CA  1 
ATOM   3170  C C   . PRO A  1 443  ? 202.876 217.564 252.346 1.00 34.53  ? 412  PRO A C   1 
ATOM   3171  O O   . PRO A  1 443  ? 203.933 216.937 252.423 1.00 34.53  ? 412  PRO A O   1 
ATOM   3172  C CB  . PRO A  1 443  ? 203.355 219.814 251.313 1.00 34.53  ? 412  PRO A CB  1 
ATOM   3173  C CG  . PRO A  1 443  ? 204.066 220.990 251.860 1.00 34.53  ? 412  PRO A CG  1 
ATOM   3174  C CD  . PRO A  1 443  ? 204.685 220.533 253.135 1.00 34.53  ? 412  PRO A CD  1 
ATOM   3175  N N   . GLY A  1 444  ? 201.715 216.994 252.037 1.00 37.29  ? 413  GLY A N   1 
ATOM   3176  C CA  . GLY A  1 444  ? 201.586 215.566 251.811 1.00 37.29  ? 413  GLY A CA  1 
ATOM   3177  C C   . GLY A  1 444  ? 201.910 214.664 252.983 1.00 37.29  ? 413  GLY A C   1 
ATOM   3178  O O   . GLY A  1 444  ? 202.625 213.673 252.825 1.00 37.29  ? 413  GLY A O   1 
ATOM   3179  N N   . GLN A  1 445  ? 201.384 214.988 254.159 1.00 36.84  ? 414  GLN A N   1 
ATOM   3180  C CA  . GLN A  1 445  ? 201.605 214.206 255.363 1.00 36.84  ? 414  GLN A CA  1 
ATOM   3181  C C   . GLN A  1 445  ? 200.304 213.561 255.824 1.00 36.84  ? 414  GLN A C   1 
ATOM   3182  O O   . GLN A  1 445  ? 199.206 214.014 255.492 1.00 36.84  ? 414  GLN A O   1 
ATOM   3183  C CB  . GLN A  1 445  ? 202.150 215.089 256.489 1.00 36.84  ? 414  GLN A CB  1 
ATOM   3184  C CG  . GLN A  1 445  ? 203.564 215.564 256.293 1.00 36.84  ? 414  GLN A CG  1 
ATOM   3185  C CD  . GLN A  1 445  ? 204.578 214.471 256.469 1.00 36.84  ? 414  GLN A CD  1 
ATOM   3186  O OE1 . GLN A  1 445  ? 204.554 213.737 257.452 1.00 36.84  ? 414  GLN A OE1 1 
ATOM   3187  N NE2 . GLN A  1 445  ? 205.486 214.356 255.512 1.00 36.84  ? 414  GLN A NE2 1 
ATOM   3188  N N   . THR A  1 446  ? 200.441 212.494 256.598 1.00 37.26  ? 415  THR A N   1 
ATOM   3189  C CA  . THR A  1 446  ? 199.321 211.795 257.211 1.00 37.26  ? 415  THR A CA  1 
ATOM   3190  C C   . THR A  1 446  ? 199.451 211.888 258.731 1.00 37.26  ? 415  THR A C   1 
ATOM   3191  O O   . THR A  1 446  ? 200.399 212.471 259.255 1.00 37.26  ? 415  THR A O   1 
ATOM   3192  C CB  . THR A  1 446  ? 199.256 210.346 256.717 1.00 37.26  ? 415  THR A CB  1 
ATOM   3193  O OG1 . THR A  1 446  ? 197.976 209.789 257.026 1.00 37.26  ? 415  THR A OG1 1 
ATOM   3194  C CG2 . THR A  1 446  ? 200.344 209.502 257.350 1.00 37.26  ? 415  THR A CG2 1 
ATOM   3195  N N   . GLY A  1 447  ? 198.512 211.292 259.448 1.00 34.21  ? 416  GLY A N   1 
ATOM   3196  C CA  . GLY A  1 447  ? 198.434 211.445 260.887 1.00 34.21  ? 416  GLY A CA  1 
ATOM   3197  C C   . GLY A  1 447  ? 197.231 212.275 261.299 1.00 34.21  ? 416  GLY A C   1 
ATOM   3198  O O   . GLY A  1 447  ? 196.554 212.898 260.485 1.00 34.21  ? 416  GLY A O   1 
ATOM   3199  N N   . LYS A  1 448  ? 196.956 212.262 262.605 1.00 34.26  ? 417  LYS A N   1 
ATOM   3200  C CA  . LYS A  1 448  ? 195.715 212.874 263.070 1.00 34.26  ? 417  LYS A CA  1 
ATOM   3201  C C   . LYS A  1 448  ? 195.749 214.394 262.975 1.00 34.26  ? 417  LYS A C   1 
ATOM   3202  O O   . LYS A  1 448  ? 194.711 215.012 262.721 1.00 34.26  ? 417  LYS A O   1 
ATOM   3203  C CB  . LYS A  1 448  ? 195.381 212.421 264.490 1.00 34.26  ? 417  LYS A CB  1 
ATOM   3204  C CG  . LYS A  1 448  ? 196.355 212.804 265.565 1.00 34.26  ? 417  LYS A CG  1 
ATOM   3205  C CD  . LYS A  1 448  ? 195.775 212.436 266.913 1.00 34.26  ? 417  LYS A CD  1 
ATOM   3206  C CE  . LYS A  1 448  ? 196.782 212.606 268.023 1.00 34.26  ? 417  LYS A CE  1 
ATOM   3207  N NZ  . LYS A  1 448  ? 197.237 214.014 268.129 1.00 34.26  ? 417  LYS A NZ  1 
ATOM   3208  N N   . ILE A  1 449  ? 196.917 215.015 263.149 1.00 30.05  ? 418  ILE A N   1 
ATOM   3209  C CA  . ILE A  1 449  ? 196.999 216.463 262.984 1.00 30.05  ? 418  ILE A CA  1 
ATOM   3210  C C   . ILE A  1 449  ? 196.785 216.841 261.527 1.00 30.05  ? 418  ILE A C   1 
ATOM   3211  O O   . ILE A  1 449  ? 196.073 217.801 261.220 1.00 30.05  ? 418  ILE A O   1 
ATOM   3212  C CB  . ILE A  1 449  ? 198.337 216.996 263.524 1.00 30.05  ? 418  ILE A CB  1 
ATOM   3213  C CG1 . ILE A  1 449  ? 198.452 216.727 265.021 1.00 30.05  ? 418  ILE A CG1 1 
ATOM   3214  C CG2 . ILE A  1 449  ? 198.482 218.475 263.238 1.00 30.05  ? 418  ILE A CG2 1 
ATOM   3215  C CD1 . ILE A  1 449  ? 197.277 217.212 265.815 1.00 30.05  ? 418  ILE A CD1 1 
ATOM   3216  N N   . ALA A  1 450  ? 197.402 216.107 260.609 1.00 30.97  ? 419  ALA A N   1 
ATOM   3217  C CA  . ALA A  1 450  ? 197.310 216.427 259.194 1.00 30.97  ? 419  ALA A CA  1 
ATOM   3218  C C   . ALA A  1 450  ? 196.014 215.954 258.556 1.00 30.97  ? 419  ALA A C   1 
ATOM   3219  O O   . ALA A  1 450  ? 195.750 216.309 257.405 1.00 30.97  ? 419  ALA A O   1 
ATOM   3220  C CB  . ALA A  1 450  ? 198.490 215.821 258.446 1.00 30.97  ? 419  ALA A CB  1 
ATOM   3221  N N   . ASP A  1 451  ? 195.194 215.184 259.266 1.00 36.08  ? 420  ASP A N   1 
ATOM   3222  C CA  . ASP A  1 451  ? 193.919 214.707 258.743 1.00 36.08  ? 420  ASP A CA  1 
ATOM   3223  C C   . ASP A  1 451  ? 192.708 215.383 259.357 1.00 36.08  ? 420  ASP A C   1 
ATOM   3224  O O   . ASP A  1 451  ? 191.737 215.633 258.648 1.00 36.08  ? 420  ASP A O   1 
ATOM   3225  C CB  . ASP A  1 451  ? 193.785 213.195 258.949 1.00 36.08  ? 420  ASP A CB  1 
ATOM   3226  C CG  . ASP A  1 451  ? 194.748 212.399 258.103 1.00 36.08  ? 420  ASP A CG  1 
ATOM   3227  O OD1 . ASP A  1 451  ? 195.249 212.940 257.100 1.00 36.08  ? 420  ASP A OD1 1 
ATOM   3228  O OD2 . ASP A  1 451  ? 194.990 211.220 258.430 1.00 36.08  ? 420  ASP A OD2 1 
ATOM   3229  N N   . TYR A  1 452  ? 192.713 215.674 260.657 1.00 35.64  ? 421  TYR A N   1 
ATOM   3230  C CA  . TYR A  1 452  ? 191.529 216.225 261.297 1.00 35.64  ? 421  TYR A CA  1 
ATOM   3231  C C   . TYR A  1 452  ? 191.700 217.650 261.794 1.00 35.64  ? 421  TYR A C   1 
ATOM   3232  O O   . TYR A  1 452  ? 190.696 218.288 262.120 1.00 35.64  ? 421  TYR A O   1 
ATOM   3233  C CB  . TYR A  1 452  ? 191.067 215.336 262.459 1.00 35.64  ? 421  TYR A CB  1 
ATOM   3234  C CG  . TYR A  1 452  ? 190.934 213.872 262.114 1.00 35.64  ? 421  TYR A CG  1 
ATOM   3235  C CD1 . TYR A  1 452  ? 190.523 213.470 260.856 1.00 35.64  ? 421  TYR A CD1 1 
ATOM   3236  C CD2 . TYR A  1 452  ? 191.211 212.896 263.049 1.00 35.64  ? 421  TYR A CD2 1 
ATOM   3237  C CE1 . TYR A  1 452  ? 190.403 212.142 260.539 1.00 35.64  ? 421  TYR A CE1 1 
ATOM   3238  C CE2 . TYR A  1 452  ? 191.092 211.568 262.741 1.00 35.64  ? 421  TYR A CE2 1 
ATOM   3239  C CZ  . TYR A  1 452  ? 190.690 211.196 261.485 1.00 35.64  ? 421  TYR A CZ  1 
ATOM   3240  O OH  . TYR A  1 452  ? 190.565 209.866 261.174 1.00 35.64  ? 421  TYR A OH  1 
ATOM   3241  N N   . ASN A  1 453  ? 192.923 218.171 261.858 1.00 29.55  ? 422  ASN A N   1 
ATOM   3242  C CA  . ASN A  1 453  ? 193.177 219.428 262.549 1.00 29.55  ? 422  ASN A CA  1 
ATOM   3243  C C   . ASN A  1 453  ? 193.731 220.518 261.647 1.00 29.55  ? 422  ASN A C   1 
ATOM   3244  O O   . ASN A  1 453  ? 193.200 221.632 261.646 1.00 29.55  ? 422  ASN A O   1 
ATOM   3245  C CB  . ASN A  1 453  ? 194.127 219.191 263.727 1.00 29.55  ? 422  ASN A CB  1 
ATOM   3246  C CG  . ASN A  1 453  ? 193.469 218.450 264.863 1.00 29.55  ? 422  ASN A CG  1 
ATOM   3247  O OD1 . ASN A  1 453  ? 192.850 219.052 265.728 1.00 29.55  ? 422  ASN A OD1 1 
ATOM   3248  N ND2 . ASN A  1 453  ? 193.625 217.139 264.882 1.00 29.55  ? 422  ASN A ND2 1 
ATOM   3249  N N   . TYR A  1 454  ? 194.787 220.244 260.882 1.00 27.57  ? 423  TYR A N   1 
ATOM   3250  C CA  . TYR A  1 454  ? 195.438 221.280 260.081 1.00 27.57  ? 423  TYR A CA  1 
ATOM   3251  C C   . TYR A  1 454  ? 196.108 220.646 258.872 1.00 27.57  ? 423  TYR A C   1 
ATOM   3252  O O   . TYR A  1 454  ? 196.950 219.763 259.027 1.00 27.57  ? 423  TYR A O   1 
ATOM   3253  C CB  . TYR A  1 454  ? 196.456 222.049 260.925 1.00 27.57  ? 423  TYR A CB  1 
ATOM   3254  C CG  . TYR A  1 454  ? 197.006 223.282 260.257 1.00 27.57  ? 423  TYR A CG  1 
ATOM   3255  C CD1 . TYR A  1 454  ? 198.198 223.243 259.558 1.00 27.57  ? 423  TYR A CD1 1 
ATOM   3256  C CD2 . TYR A  1 454  ? 196.331 224.481 260.318 1.00 27.57  ? 423  TYR A CD2 1 
ATOM   3257  C CE1 . TYR A  1 454  ? 198.692 224.362 258.942 1.00 27.57  ? 423  TYR A CE1 1 
ATOM   3258  C CE2 . TYR A  1 454  ? 196.821 225.597 259.712 1.00 27.57  ? 423  TYR A CE2 1 
ATOM   3259  C CZ  . TYR A  1 454  ? 197.997 225.534 259.024 1.00 27.57  ? 423  TYR A CZ  1 
ATOM   3260  O OH  . TYR A  1 454  ? 198.478 226.662 258.419 1.00 27.57  ? 423  TYR A OH  1 
ATOM   3261  N N   . LYS A  1 455  ? 195.757 221.119 257.678 1.00 30.25  ? 424  LYS A N   1 
ATOM   3262  C CA  . LYS A  1 455  ? 196.194 220.541 256.411 1.00 30.25  ? 424  LYS A CA  1 
ATOM   3263  C C   . LYS A  1 455  ? 196.856 221.611 255.554 1.00 30.25  ? 424  LYS A C   1 
ATOM   3264  O O   . LYS A  1 455  ? 196.316 222.710 255.412 1.00 30.25  ? 424  LYS A O   1 
ATOM   3265  C CB  . LYS A  1 455  ? 194.996 219.927 255.678 1.00 30.25  ? 424  LYS A CB  1 
ATOM   3266  C CG  . LYS A  1 455  ? 195.296 219.288 254.342 1.00 30.25  ? 424  LYS A CG  1 
ATOM   3267  C CD  . LYS A  1 455  ? 196.095 218.030 254.471 1.00 30.25  ? 424  LYS A CD  1 
ATOM   3268  C CE  . LYS A  1 455  ? 196.322 217.416 253.113 1.00 30.25  ? 424  LYS A CE  1 
ATOM   3269  N NZ  . LYS A  1 455  ? 197.229 216.243 253.207 1.00 30.25  ? 424  LYS A NZ  1 
ATOM   3270  N N   . LEU A  1 456  ? 198.071 221.288 254.978 1.00 31.26  ? 425  LEU A N   1 
ATOM   3271  C CA  . LEU A  1 456  ? 198.722 222.211 254.054 1.00 31.26  ? 425  LEU A CA  1 
ATOM   3272  C C   . LEU A  1 456  ? 198.478 221.814 252.598 1.00 31.26  ? 425  LEU A C   1 
ATOM   3273  O O   . LEU A  1 456  ? 198.350 220.630 252.283 1.00 31.26  ? 425  LEU A O   1 
ATOM   3274  C CB  . LEU A  1 456  ? 200.231 222.248 254.321 1.00 31.26  ? 425  LEU A CB  1 
ATOM   3275  C CG  . LEU A  1 456  ? 200.755 223.149 255.441 1.00 31.26  ? 425  LEU A CG  1 
ATOM   3276  C CD1 . LEU A  1 456  ? 202.256 223.137 255.474 1.00 31.26  ? 425  LEU A CD1 1 
ATOM   3277  C CD2 . LEU A  1 456  ? 200.253 224.558 255.283 1.00 31.26  ? 425  LEU A CD2 1 
ATOM   3278  N N   . PRO A  1 457  ? 198.446 222.782 251.685 1.00 35.42  ? 426  PRO A N   1 
ATOM   3279  C CA  . PRO A  1 457  ? 198.353 222.460 250.257 1.00 35.42  ? 426  PRO A CA  1 
ATOM   3280  C C   . PRO A  1 457  ? 199.608 221.774 249.735 1.00 35.42  ? 426  PRO A C   1 
ATOM   3281  O O   . PRO A  1 457  ? 200.702 221.914 250.282 1.00 35.42  ? 426  PRO A O   1 
ATOM   3282  C CB  . PRO A  1 457  ? 198.159 223.826 249.596 1.00 35.42  ? 426  PRO A CB  1 
ATOM   3283  C CG  . PRO A  1 457  ? 197.723 224.722 250.668 1.00 35.42  ? 426  PRO A CG  1 
ATOM   3284  C CD  . PRO A  1 457  ? 198.322 224.224 251.928 1.00 35.42  ? 426  PRO A CD  1 
ATOM   3285  N N   . ASP A  1 458  ? 199.434 221.020 248.645 1.00 43.32  ? 427  ASP A N   1 
ATOM   3286  C CA  . ASP A  1 458  ? 200.584 220.435 247.958 1.00 43.32  ? 427  ASP A CA  1 
ATOM   3287  C C   . ASP A  1 458  ? 201.507 221.505 247.386 1.00 43.32  ? 427  ASP A C   1 
ATOM   3288  O O   . ASP A  1 458  ? 202.735 221.385 247.470 1.00 43.32  ? 427  ASP A O   1 
ATOM   3289  C CB  . ASP A  1 458  ? 200.119 219.497 246.848 1.00 43.32  ? 427  ASP A CB  1 
ATOM   3290  C CG  . ASP A  1 458  ? 199.555 218.201 247.378 1.00 43.32  ? 427  ASP A CG  1 
ATOM   3291  O OD1 . ASP A  1 458  ? 200.030 217.735 248.433 1.00 43.32  ? 427  ASP A OD1 1 
ATOM   3292  O OD2 . ASP A  1 458  ? 198.634 217.649 246.742 1.00 43.32  ? 427  ASP A OD2 1 
ATOM   3293  N N   . ASP A  1 459  ? 200.941 222.545 246.783 1.00 42.56  ? 428  ASP A N   1 
ATOM   3294  C CA  . ASP A  1 459  ? 201.718 223.667 246.255 1.00 42.56  ? 428  ASP A CA  1 
ATOM   3295  C C   . ASP A  1 459  ? 201.653 224.803 247.270 1.00 42.56  ? 428  ASP A C   1 
ATOM   3296  O O   . ASP A  1 459  ? 200.758 225.646 247.238 1.00 42.56  ? 428  ASP A O   1 
ATOM   3297  C CB  . ASP A  1 459  ? 201.207 224.085 244.884 1.00 42.56  ? 428  ASP A CB  1 
ATOM   3298  C CG  . ASP A  1 459  ? 199.726 224.365 244.878 1.00 42.56  ? 428  ASP A CG  1 
ATOM   3299  O OD1 . ASP A  1 459  ? 198.978 223.582 245.502 1.00 42.56  ? 428  ASP A OD1 1 
ATOM   3300  O OD2 . ASP A  1 459  ? 199.309 225.364 244.254 1.00 42.56  ? 428  ASP A OD2 1 
ATOM   3301  N N   . PHE A  1 460  ? 202.630 224.831 248.168 1.00 34.67  ? 429  PHE A N   1 
ATOM   3302  C CA  . PHE A  1 460  ? 202.665 225.774 249.274 1.00 34.67  ? 429  PHE A CA  1 
ATOM   3303  C C   . PHE A  1 460  ? 203.910 226.639 249.143 1.00 34.67  ? 429  PHE A C   1 
ATOM   3304  O O   . PHE A  1 460  ? 205.006 226.117 248.927 1.00 34.67  ? 429  PHE A O   1 
ATOM   3305  C CB  . PHE A  1 460  ? 202.656 224.997 250.597 1.00 34.67  ? 429  PHE A CB  1 
ATOM   3306  C CG  . PHE A  1 460  ? 202.824 225.840 251.818 1.00 34.67  ? 429  PHE A CG  1 
ATOM   3307  C CD1 . PHE A  1 460  ? 201.871 226.767 252.179 1.00 34.67  ? 429  PHE A CD1 1 
ATOM   3308  C CD2 . PHE A  1 460  ? 203.935 225.685 252.619 1.00 34.67  ? 429  PHE A CD2 1 
ATOM   3309  C CE1 . PHE A  1 460  ? 202.034 227.532 253.311 1.00 34.67  ? 429  PHE A CE1 1 
ATOM   3310  C CE2 . PHE A  1 460  ? 204.099 226.444 253.740 1.00 34.67  ? 429  PHE A CE2 1 
ATOM   3311  C CZ  . PHE A  1 460  ? 203.149 227.371 254.088 1.00 34.67  ? 429  PHE A CZ  1 
ATOM   3312  N N   . THR A  1 461  ? 203.739 227.954 249.250 1.00 33.06  ? 430  THR A N   1 
ATOM   3313  C CA  . THR A  1 461  ? 204.845 228.903 249.322 1.00 33.06  ? 430  THR A CA  1 
ATOM   3314  C C   . THR A  1 461  ? 204.816 229.584 250.681 1.00 33.06  ? 430  THR A C   1 
ATOM   3315  O O   . THR A  1 461  ? 203.811 230.197 251.044 1.00 33.06  ? 430  THR A O   1 
ATOM   3316  C CB  . THR A  1 461  ? 204.768 229.939 248.197 1.00 33.06  ? 430  THR A CB  1 
ATOM   3317  O OG1 . THR A  1 461  ? 204.822 229.277 246.928 1.00 33.06  ? 430  THR A OG1 1 
ATOM   3318  C CG2 . THR A  1 461  ? 205.918 230.926 248.287 1.00 33.06  ? 430  THR A CG2 1 
ATOM   3319  N N   . GLY A  1 462  ? 205.901 229.478 251.426 1.00 32.14  ? 431  GLY A N   1 
ATOM   3320  C CA  . GLY A  1 462  ? 205.949 230.056 252.753 1.00 32.14  ? 431  GLY A CA  1 
ATOM   3321  C C   . GLY A  1 462  ? 206.850 229.245 253.658 1.00 32.14  ? 431  GLY A C   1 
ATOM   3322  O O   . GLY A  1 462  ? 207.480 228.293 253.232 1.00 32.14  ? 431  GLY A O   1 
ATOM   3323  N N   . CYS A  1 463  ? 206.871 229.621 254.933 1.00 32.55  ? 432  CYS A N   1 
ATOM   3324  C CA  . CYS A  1 463  ? 207.806 229.022 255.878 1.00 32.55  ? 432  CYS A CA  1 
ATOM   3325  C C   . CYS A  1 463  ? 207.069 228.485 257.101 1.00 32.55  ? 432  CYS A C   1 
ATOM   3326  O O   . CYS A  1 463  ? 206.041 229.018 257.512 1.00 32.55  ? 432  CYS A O   1 
ATOM   3327  C CB  . CYS A  1 463  ? 208.880 230.044 256.291 1.00 32.55  ? 432  CYS A CB  1 
ATOM   3328  S SG  . CYS A  1 463  ? 209.816 230.767 254.888 1.00 32.55  ? 432  CYS A SG  1 
ATOM   3329  N N   . VAL A  1 464  ? 207.599 227.404 257.671 1.00 27.18  ? 433  VAL A N   1 
ATOM   3330  C CA  . VAL A  1 464  ? 207.088 226.796 258.897 1.00 27.18  ? 433  VAL A CA  1 
ATOM   3331  C C   . VAL A  1 464  ? 208.140 226.932 259.990 1.00 27.18  ? 433  VAL A C   1 
ATOM   3332  O O   . VAL A  1 464  ? 209.299 226.551 259.786 1.00 27.18  ? 433  VAL A O   1 
ATOM   3333  C CB  . VAL A  1 464  ? 206.728 225.318 258.674 1.00 27.18  ? 433  VAL A CB  1 
ATOM   3334  C CG1 . VAL A  1 464  ? 206.218 224.687 259.952 1.00 27.18  ? 433  VAL A CG1 1 
ATOM   3335  C CG2 . VAL A  1 464  ? 205.723 225.188 257.567 1.00 27.18  ? 433  VAL A CG2 1 
ATOM   3336  N N   . ILE A  1 465  ? 207.742 227.467 261.147 1.00 26.95  ? 434  ILE A N   1 
ATOM   3337  C CA  . ILE A  1 465  ? 208.652 227.783 262.242 1.00 26.95  ? 434  ILE A CA  1 
ATOM   3338  C C   . ILE A  1 465  ? 208.091 227.189 263.528 1.00 26.95  ? 434  ILE A C   1 
ATOM   3339  O O   . ILE A  1 465  ? 206.923 227.415 263.856 1.00 26.95  ? 434  ILE A O   1 
ATOM   3340  C CB  . ILE A  1 465  ? 208.835 229.304 262.392 1.00 26.95  ? 434  ILE A CB  1 
ATOM   3341  C CG1 . ILE A  1 465  ? 209.311 229.913 261.080 1.00 26.95  ? 434  ILE A CG1 1 
ATOM   3342  C CG2 . ILE A  1 465  ? 209.830 229.610 263.469 1.00 26.95  ? 434  ILE A CG2 1 
ATOM   3343  C CD1 . ILE A  1 465  ? 208.891 231.331 260.879 1.00 26.95  ? 434  ILE A CD1 1 
ATOM   3344  N N   . ALA A  1 466  ? 208.915 226.439 264.260 1.00 26.72  ? 435  ALA A N   1 
ATOM   3345  C CA  . ALA A  1 466  ? 208.450 225.782 265.477 1.00 26.72  ? 435  ALA A CA  1 
ATOM   3346  C C   . ALA A  1 466  ? 209.520 225.831 266.556 1.00 26.72  ? 435  ALA A C   1 
ATOM   3347  O O   . ALA A  1 466  ? 210.702 225.617 266.268 1.00 26.72  ? 435  ALA A O   1 
ATOM   3348  C CB  . ALA A  1 466  ? 208.055 224.329 265.205 1.00 26.72  ? 435  ALA A CB  1 
ATOM   3349  N N   . TRP A  1 467  ? 209.099 226.099 267.801 1.00 27.47  ? 436  TRP A N   1 
ATOM   3350  C CA  . TRP A  1 467  ? 210.027 226.114 268.931 1.00 27.47  ? 436  TRP A CA  1 
ATOM   3351  C C   . TRP A  1 467  ? 209.396 225.530 270.193 1.00 27.47  ? 436  TRP A C   1 
ATOM   3352  O O   . TRP A  1 467  ? 208.190 225.642 270.418 1.00 27.47  ? 436  TRP A O   1 
ATOM   3353  C CB  . TRP A  1 467  ? 210.542 227.531 269.219 1.00 27.47  ? 436  TRP A CB  1 
ATOM   3354  C CG  . TRP A  1 467  ? 209.534 228.498 269.756 1.00 27.47  ? 436  TRP A CG  1 
ATOM   3355  C CD1 . TRP A  1 467  ? 209.333 228.809 271.058 1.00 27.47  ? 436  TRP A CD1 1 
ATOM   3356  C CD2 . TRP A  1 467  ? 208.605 229.291 269.008 1.00 27.47  ? 436  TRP A CD2 1 
ATOM   3357  N NE1 . TRP A  1 467  ? 208.342 229.738 271.177 1.00 27.47  ? 436  TRP A NE1 1 
ATOM   3358  C CE2 . TRP A  1 467  ? 207.875 230.050 269.930 1.00 27.47  ? 436  TRP A CE2 1 
ATOM   3359  C CE3 . TRP A  1 467  ? 208.315 229.425 267.650 1.00 27.47  ? 436  TRP A CE3 1 
ATOM   3360  C CZ2 . TRP A  1 467  ? 206.876 230.927 269.542 1.00 27.47  ? 436  TRP A CZ2 1 
ATOM   3361  C CZ3 . TRP A  1 467  ? 207.327 230.296 267.272 1.00 27.47  ? 436  TRP A CZ3 1 
ATOM   3362  C CH2 . TRP A  1 467  ? 206.618 231.034 268.211 1.00 27.47  ? 436  TRP A CH2 1 
ATOM   3363  N N   . ASN A  1 468  ? 210.234 224.894 271.011 1.00 30.40  ? 437  ASN A N   1 
ATOM   3364  C CA  . ASN A  1 468  ? 209.805 224.290 272.272 1.00 30.40  ? 437  ASN A CA  1 
ATOM   3365  C C   . ASN A  1 468  ? 209.405 225.353 273.291 1.00 30.40  ? 437  ASN A C   1 
ATOM   3366  O O   . ASN A  1 468  ? 210.124 226.333 273.494 1.00 30.40  ? 437  ASN A O   1 
ATOM   3367  C CB  . ASN A  1 468  ? 210.917 223.405 272.834 1.00 30.40  ? 437  ASN A CB  1 
ATOM   3368  C CG  . ASN A  1 468  ? 210.509 222.667 274.101 1.00 30.40  ? 437  ASN A CG  1 
ATOM   3369  O OD1 . ASN A  1 468  ? 209.851 223.212 274.977 1.00 30.40  ? 437  ASN A OD1 1 
ATOM   3370  N ND2 . ASN A  1 468  ? 210.904 221.410 274.193 1.00 30.40  ? 437  ASN A ND2 1 
ATOM   3371  N N   . SER A  1 469  ? 208.271 225.144 273.958 1.00 33.58  ? 438  SER A N   1 
ATOM   3372  C CA  . SER A  1 469  ? 207.704 226.097 274.912 1.00 33.58  ? 438  SER A CA  1 
ATOM   3373  C C   . SER A  1 469  ? 207.286 225.398 276.201 1.00 33.58  ? 438  SER A C   1 
ATOM   3374  O O   . SER A  1 469  ? 206.202 225.638 276.733 1.00 33.58  ? 438  SER A O   1 
ATOM   3375  C CB  . SER A  1 469  ? 206.524 226.850 274.311 1.00 33.58  ? 438  SER A CB  1 
ATOM   3376  O OG  . SER A  1 469  ? 205.436 225.982 274.079 1.00 33.58  ? 438  SER A OG  1 
ATOM   3377  N N   . ASN A  1 470  ? 208.152 224.527 276.726 1.00 38.32  ? 439  ASN A N   1 
ATOM   3378  C CA  . ASN A  1 470  ? 207.860 223.812 277.968 1.00 38.32  ? 439  ASN A CA  1 
ATOM   3379  C C   . ASN A  1 470  ? 207.747 224.754 279.159 1.00 38.32  ? 439  ASN A C   1 
ATOM   3380  O O   . ASN A  1 470  ? 206.960 224.507 280.079 1.00 38.32  ? 439  ASN A O   1 
ATOM   3381  C CB  . ASN A  1 470  ? 208.934 222.763 278.232 1.00 38.32  ? 439  ASN A CB  1 
ATOM   3382  C CG  . ASN A  1 470  ? 208.481 221.704 279.203 1.00 38.32  ? 439  ASN A CG  1 
ATOM   3383  O OD1 . ASN A  1 470  ? 207.322 221.305 279.202 1.00 38.32  ? 439  ASN A OD1 1 
ATOM   3384  N ND2 . ASN A  1 470  ? 209.397 221.236 280.039 1.00 38.32  ? 439  ASN A ND2 1 
ATOM   3385  N N   . ASN A  1 471  ? 208.547 225.816 279.184 1.00 45.52  ? 440  ASN A N   1 
ATOM   3386  C CA  . ASN A  1 471  ? 208.512 226.742 280.311 1.00 45.52  ? 440  ASN A CA  1 
ATOM   3387  C C   . ASN A  1 471  ? 207.183 227.480 280.388 1.00 45.52  ? 440  ASN A C   1 
ATOM   3388  O O   . ASN A  1 471  ? 206.675 227.744 281.484 1.00 45.52  ? 440  ASN A O   1 
ATOM   3389  C CB  . ASN A  1 471  ? 209.658 227.744 280.201 1.00 45.52  ? 440  ASN A CB  1 
ATOM   3390  C CG  . ASN A  1 471  ? 211.007 227.107 280.411 1.00 45.52  ? 440  ASN A CG  1 
ATOM   3391  O OD1 . ASN A  1 471  ? 212.003 227.537 279.835 1.00 45.52  ? 440  ASN A OD1 1 
ATOM   3392  N ND2 . ASN A  1 471  ? 211.052 226.077 281.246 1.00 45.52  ? 440  ASN A ND2 1 
ATOM   3393  N N   . LEU A  1 472  ? 206.604 227.818 279.238 1.00 40.88  ? 441  LEU A N   1 
ATOM   3394  C CA  . LEU A  1 472  ? 205.371 228.596 279.205 1.00 40.88  ? 441  LEU A CA  1 
ATOM   3395  C C   . LEU A  1 472  ? 204.120 227.737 279.357 1.00 40.88  ? 441  LEU A C   1 
ATOM   3396  O O   . LEU A  1 472  ? 203.180 228.141 280.048 1.00 40.88  ? 441  LEU A O   1 
ATOM   3397  C CB  . LEU A  1 472  ? 205.314 229.396 277.908 1.00 40.88  ? 441  LEU A CB  1 
ATOM   3398  C CG  . LEU A  1 472  ? 206.509 230.320 277.693 1.00 40.88  ? 441  LEU A CG  1 
ATOM   3399  C CD1 . LEU A  1 472  ? 206.432 230.980 276.344 1.00 40.88  ? 441  LEU A CD1 1 
ATOM   3400  C CD2 . LEU A  1 472  ? 206.539 231.360 278.783 1.00 40.88  ? 441  LEU A CD2 1 
ATOM   3401  N N   . ASP A  1 473  ? 204.072 226.564 278.725 1.00 38.92  ? 442  ASP A N   1 
ATOM   3402  C CA  . ASP A  1 473  ? 202.822 225.827 278.573 1.00 38.92  ? 442  ASP A CA  1 
ATOM   3403  C C   . ASP A  1 473  ? 202.754 224.557 279.416 1.00 38.92  ? 442  ASP A C   1 
ATOM   3404  O O   . ASP A  1 473  ? 201.889 223.716 279.174 1.00 38.92  ? 442  ASP A O   1 
ATOM   3405  C CB  . ASP A  1 473  ? 202.582 225.472 277.108 1.00 38.92  ? 442  ASP A CB  1 
ATOM   3406  C CG  . ASP A  1 473  ? 202.619 226.673 276.200 1.00 38.92  ? 442  ASP A CG  1 
ATOM   3407  O OD1 . ASP A  1 473  ? 203.549 226.764 275.381 1.00 38.92  ? 442  ASP A OD1 1 
ATOM   3408  O OD2 . ASP A  1 473  ? 201.717 227.526 276.295 1.00 38.92  ? 442  ASP A OD2 1 
ATOM   3409  N N   . SER A  1 474  ? 203.631 224.391 280.397 1.00 43.34  ? 443  SER A N   1 
ATOM   3410  C CA  . SER A  1 474  ? 203.578 223.239 281.287 1.00 43.34  ? 443  SER A CA  1 
ATOM   3411  C C   . SER A  1 474  ? 203.255 223.702 282.697 1.00 43.34  ? 443  SER A C   1 
ATOM   3412  O O   . SER A  1 474  ? 203.871 224.645 283.202 1.00 43.34  ? 443  SER A O   1 
ATOM   3413  C CB  . SER A  1 474  ? 204.899 222.473 281.291 1.00 43.34  ? 443  SER A CB  1 
ATOM   3414  O OG  . SER A  1 474  ? 205.095 221.782 280.076 1.00 43.34  ? 443  SER A OG  1 
ATOM   3415  N N   . LYS A  1 475  ? 202.301 223.032 283.331 1.00 53.03  ? 444  LYS A N   1 
ATOM   3416  C CA  . LYS A  1 475  ? 201.886 223.337 284.690 1.00 53.03  ? 444  LYS A CA  1 
ATOM   3417  C C   . LYS A  1 475  ? 202.105 222.097 285.546 1.00 53.03  ? 444  LYS A C   1 
ATOM   3418  O O   . LYS A  1 475  ? 201.940 220.972 285.069 1.00 53.03  ? 444  LYS A O   1 
ATOM   3419  C CB  . LYS A  1 475  ? 200.424 223.790 284.732 1.00 53.03  ? 444  LYS A CB  1 
ATOM   3420  C CG  . LYS A  1 475  ? 199.911 224.142 286.112 1.00 53.03  ? 444  LYS A CG  1 
ATOM   3421  C CD  . LYS A  1 475  ? 198.472 224.618 286.053 1.00 53.03  ? 444  LYS A CD  1 
ATOM   3422  C CE  . LYS A  1 475  ? 197.935 224.917 287.442 1.00 53.03  ? 444  LYS A CE  1 
ATOM   3423  N NZ  . LYS A  1 475  ? 197.871 223.703 288.298 1.00 53.03  ? 444  LYS A NZ  1 
ATOM   3424  N N   . VAL A  1 476  ? 202.486 222.307 286.807 1.00 58.27  ? 445  VAL A N   1 
ATOM   3425  C CA  . VAL A  1 476  ? 202.895 221.196 287.666 1.00 58.27  ? 445  VAL A CA  1 
ATOM   3426  C C   . VAL A  1 476  ? 201.758 220.195 287.849 1.00 58.27  ? 445  VAL A C   1 
ATOM   3427  O O   . VAL A  1 476  ? 201.979 218.978 287.839 1.00 58.27  ? 445  VAL A O   1 
ATOM   3428  C CB  . VAL A  1 476  ? 203.420 221.727 289.013 1.00 58.27  ? 445  VAL A CB  1 
ATOM   3429  C CG1 . VAL A  1 476  ? 202.377 222.592 289.705 1.00 58.27  ? 445  VAL A CG1 1 
ATOM   3430  C CG2 . VAL A  1 476  ? 203.841 220.575 289.907 1.00 58.27  ? 445  VAL A CG2 1 
ATOM   3431  N N   . GLY A  1 477  ? 200.530 220.682 288.022 1.00 56.47  ? 446  GLY A N   1 
ATOM   3432  C CA  . GLY A  1 477  ? 199.393 219.779 288.078 1.00 56.47  ? 446  GLY A CA  1 
ATOM   3433  C C   . GLY A  1 477  ? 199.088 219.121 286.745 1.00 56.47  ? 446  GLY A C   1 
ATOM   3434  O O   . GLY A  1 477  ? 198.712 217.947 286.694 1.00 56.47  ? 446  GLY A O   1 
ATOM   3435  N N   . GLY A  1 478  ? 199.250 219.861 285.652 1.00 52.33  ? 447  GLY A N   1 
ATOM   3436  C CA  . GLY A  1 478  ? 198.865 219.385 284.340 1.00 52.33  ? 447  GLY A CA  1 
ATOM   3437  C C   . GLY A  1 478  ? 198.059 220.439 283.614 1.00 52.33  ? 447  GLY A C   1 
ATOM   3438  O O   . GLY A  1 478  ? 197.080 220.953 284.159 1.00 52.33  ? 447  GLY A O   1 
ATOM   3439  N N   . ASN A  1 479  ? 198.467 220.791 282.399 1.00 46.39  ? 448  ASN A N   1 
ATOM   3440  C CA  . ASN A  1 479  ? 197.824 221.849 281.631 1.00 46.39  ? 448  ASN A CA  1 
ATOM   3441  C C   . ASN A  1 479  ? 196.853 221.230 280.630 1.00 46.39  ? 448  ASN A C   1 
ATOM   3442  O O   . ASN A  1 479  ? 197.274 220.573 279.673 1.00 46.39  ? 448  ASN A O   1 
ATOM   3443  C CB  . ASN A  1 479  ? 198.881 222.692 280.921 1.00 46.39  ? 448  ASN A CB  1 
ATOM   3444  C CG  . ASN A  1 479  ? 198.328 223.975 280.354 1.00 46.39  ? 448  ASN A CG  1 
ATOM   3445  O OD1 . ASN A  1 479  ? 197.129 224.102 280.134 1.00 46.39  ? 448  ASN A OD1 1 
ATOM   3446  N ND2 . ASN A  1 479  ? 199.203 224.939 280.112 1.00 46.39  ? 448  ASN A ND2 1 
ATOM   3447  N N   . TYR A  1 480  ? 195.554 221.447 280.844 1.00 49.01  ? 449  TYR A N   1 
ATOM   3448  C CA  . TYR A  1 480  ? 194.513 220.860 280.009 1.00 49.01  ? 449  TYR A CA  1 
ATOM   3449  C C   . TYR A  1 480  ? 193.763 221.906 279.191 1.00 49.01  ? 449  TYR A C   1 
ATOM   3450  O O   . TYR A  1 480  ? 192.640 221.654 278.749 1.00 49.01  ? 449  TYR A O   1 
ATOM   3451  C CB  . TYR A  1 480  ? 193.536 220.041 280.851 1.00 49.01  ? 449  TYR A CB  1 
ATOM   3452  C CG  . TYR A  1 480  ? 194.190 218.956 281.671 1.00 49.01  ? 449  TYR A CG  1 
ATOM   3453  C CD1 . TYR A  1 480  ? 194.504 217.734 281.100 1.00 49.01  ? 449  TYR A CD1 1 
ATOM   3454  C CD2 . TYR A  1 480  ? 194.491 219.147 283.009 1.00 49.01  ? 449  TYR A CD2 1 
ATOM   3455  C CE1 . TYR A  1 480  ? 195.102 216.737 281.829 1.00 49.01  ? 449  TYR A CE1 1 
ATOM   3456  C CE2 . TYR A  1 480  ? 195.090 218.148 283.750 1.00 49.01  ? 449  TYR A CE2 1 
ATOM   3457  C CZ  . TYR A  1 480  ? 195.393 216.946 283.152 1.00 49.01  ? 449  TYR A CZ  1 
ATOM   3458  O OH  . TYR A  1 480  ? 195.991 215.943 283.875 1.00 49.01  ? 449  TYR A OH  1 
ATOM   3459  N N   . ASN A  1 481  ? 194.362 223.080 278.991 1.00 45.42  ? 450  ASN A N   1 
ATOM   3460  C CA  . ASN A  1 481  ? 193.734 224.122 278.186 1.00 45.42  ? 450  ASN A CA  1 
ATOM   3461  C C   . ASN A  1 481  ? 193.775 223.816 276.694 1.00 45.42  ? 450  ASN A C   1 
ATOM   3462  O O   . ASN A  1 481  ? 192.930 224.312 275.944 1.00 45.42  ? 450  ASN A O   1 
ATOM   3463  C CB  . ASN A  1 481  ? 194.401 225.466 278.463 1.00 45.42  ? 450  ASN A CB  1 
ATOM   3464  C CG  . ASN A  1 481  ? 194.293 225.876 279.910 1.00 45.42  ? 450  ASN A CG  1 
ATOM   3465  O OD1 . ASN A  1 481  ? 193.492 225.327 280.661 1.00 45.42  ? 450  ASN A OD1 1 
ATOM   3466  N ND2 . ASN A  1 481  ? 195.113 226.836 280.316 1.00 45.42  ? 450  ASN A ND2 1 
ATOM   3467  N N   . TYR A  1 482  ? 194.753 223.038 276.238 1.00 38.71  ? 451  TYR A N   1 
ATOM   3468  C CA  . TYR A  1 482  ? 194.946 222.785 274.815 1.00 38.71  ? 451  TYR A CA  1 
ATOM   3469  C C   . TYR A  1 482  ? 194.218 221.515 274.385 1.00 38.71  ? 451  TYR A C   1 
ATOM   3470  O O   . TYR A  1 482  ? 194.329 220.480 275.045 1.00 38.71  ? 451  TYR A O   1 
ATOM   3471  C CB  . TYR A  1 482  ? 196.439 222.674 274.515 1.00 38.71  ? 451  TYR A CB  1 
ATOM   3472  C CG  . TYR A  1 482  ? 197.178 223.976 274.694 1.00 38.71  ? 451  TYR A CG  1 
ATOM   3473  C CD1 . TYR A  1 482  ? 198.000 224.183 275.788 1.00 38.71  ? 451  TYR A CD1 1 
ATOM   3474  C CD2 . TYR A  1 482  ? 197.030 225.010 273.787 1.00 38.71  ? 451  TYR A CD2 1 
ATOM   3475  C CE1 . TYR A  1 482  ? 198.665 225.372 275.962 1.00 38.71  ? 451  TYR A CE1 1 
ATOM   3476  C CE2 . TYR A  1 482  ? 197.691 226.202 273.955 1.00 38.71  ? 451  TYR A CE2 1 
ATOM   3477  C CZ  . TYR A  1 482  ? 198.505 226.379 275.041 1.00 38.71  ? 451  TYR A CZ  1 
ATOM   3478  O OH  . TYR A  1 482  ? 199.166 227.570 275.204 1.00 38.71  ? 451  TYR A OH  1 
ATOM   3479  N N   . LEU A  1 483  ? 193.478 221.592 273.277 1.00 35.65  ? 452  LEU A N   1 
ATOM   3480  C CA  . LEU A  1 483  ? 192.646 220.488 272.814 1.00 35.65  ? 452  LEU A CA  1 
ATOM   3481  C C   . LEU A  1 483  ? 192.986 220.119 271.376 1.00 35.65  ? 452  LEU A C   1 
ATOM   3482  O O   . LEU A  1 483  ? 193.602 220.894 270.644 1.00 35.65  ? 452  LEU A O   1 
ATOM   3483  C CB  . LEU A  1 483  ? 191.152 220.831 272.897 1.00 35.65  ? 452  LEU A CB  1 
ATOM   3484  C CG  . LEU A  1 483  ? 190.469 220.980 274.253 1.00 35.65  ? 452  LEU A CG  1 
ATOM   3485  C CD1 . LEU A  1 483  ? 190.745 222.322 274.852 1.00 35.65  ? 452  LEU A CD1 1 
ATOM   3486  C CD2 . LEU A  1 483  ? 188.991 220.792 274.084 1.00 35.65  ? 452  LEU A CD2 1 
ATOM   3487  N N   . TYR A  1 484  ? 192.565 218.920 270.974 1.00 37.54  ? 453  TYR A N   1 
ATOM   3488  C CA  . TYR A  1 484  ? 192.710 218.462 269.599 1.00 37.54  ? 453  TYR A CA  1 
ATOM   3489  C C   . TYR A  1 484  ? 191.553 217.540 269.238 1.00 37.54  ? 453  TYR A C   1 
ATOM   3490  O O   . TYR A  1 484  ? 190.950 216.904 270.104 1.00 37.54  ? 453  TYR A O   1 
ATOM   3491  C CB  . TYR A  1 484  ? 194.051 217.762 269.363 1.00 37.54  ? 453  TYR A CB  1 
ATOM   3492  C CG  . TYR A  1 484  ? 194.290 216.519 270.180 1.00 37.54  ? 453  TYR A CG  1 
ATOM   3493  C CD1 . TYR A  1 484  ? 194.866 216.594 271.434 1.00 37.54  ? 453  TYR A CD1 1 
ATOM   3494  C CD2 . TYR A  1 484  ? 193.965 215.270 269.689 1.00 37.54  ? 453  TYR A CD2 1 
ATOM   3495  C CE1 . TYR A  1 484  ? 195.096 215.468 272.176 1.00 37.54  ? 453  TYR A CE1 1 
ATOM   3496  C CE2 . TYR A  1 484  ? 194.183 214.138 270.431 1.00 37.54  ? 453  TYR A CE2 1 
ATOM   3497  C CZ  . TYR A  1 484  ? 194.754 214.244 271.671 1.00 37.54  ? 453  TYR A CZ  1 
ATOM   3498  O OH  . TYR A  1 484  ? 194.982 213.114 272.414 1.00 37.54  ? 453  TYR A OH  1 
ATOM   3499  N N   . ARG A  1 485  ? 191.254 217.470 267.943 1.00 37.48  ? 454  ARG A N   1 
ATOM   3500  C CA  . ARG A  1 485  ? 190.213 216.592 267.420 1.00 37.48  ? 454  ARG A CA  1 
ATOM   3501  C C   . ARG A  1 485  ? 190.758 215.198 267.147 1.00 37.48  ? 454  ARG A C   1 
ATOM   3502  O O   . ARG A  1 485  ? 191.815 215.046 266.528 1.00 37.48  ? 454  ARG A O   1 
ATOM   3503  C CB  . ARG A  1 485  ? 189.628 217.175 266.138 1.00 37.48  ? 454  ARG A CB  1 
ATOM   3504  C CG  . ARG A  1 485  ? 188.503 216.375 265.535 1.00 37.48  ? 454  ARG A CG  1 
ATOM   3505  C CD  . ARG A  1 485  ? 187.933 217.112 264.350 1.00 37.48  ? 454  ARG A CD  1 
ATOM   3506  N NE  . ARG A  1 485  ? 187.502 218.445 264.743 1.00 37.48  ? 454  ARG A NE  1 
ATOM   3507  C CZ  . ARG A  1 485  ? 186.299 218.724 265.222 1.00 37.48  ? 454  ARG A CZ  1 
ATOM   3508  N NH1 . ARG A  1 485  ? 185.397 217.768 265.350 1.00 37.48  ? 454  ARG A NH1 1 
ATOM   3509  N NH2 . ARG A  1 485  ? 185.995 219.960 265.567 1.00 37.48  ? 454  ARG A NH2 1 
ATOM   3510  N N   . LEU A  1 486  ? 190.013 214.182 267.577 1.00 41.98  ? 455  LEU A N   1 
ATOM   3511  C CA  . LEU A  1 486  ? 190.430 212.795 267.435 1.00 41.98  ? 455  LEU A CA  1 
ATOM   3512  C C   . LEU A  1 486  ? 189.587 211.981 266.466 1.00 41.98  ? 455  LEU A C   1 
ATOM   3513  O O   . LEU A  1 486  ? 190.103 211.038 265.871 1.00 41.98  ? 455  LEU A O   1 
ATOM   3514  C CB  . LEU A  1 486  ? 190.406 212.103 268.803 1.00 41.98  ? 455  LEU A CB  1 
ATOM   3515  C CG  . LEU A  1 486  ? 190.952 210.680 268.922 1.00 41.98  ? 455  LEU A CG  1 
ATOM   3516  C CD1 . LEU A  1 486  ? 192.348 210.572 268.349 1.00 41.98  ? 455  LEU A CD1 1 
ATOM   3517  C CD2 . LEU A  1 486  ? 190.931 210.234 270.363 1.00 41.98  ? 455  LEU A CD2 1 
ATOM   3518  N N   . PHE A  1 487  ? 188.317 212.329 266.273 1.00 45.92  ? 456  PHE A N   1 
ATOM   3519  C CA  . PHE A  1 487  ? 187.417 211.575 265.411 1.00 45.92  ? 456  PHE A CA  1 
ATOM   3520  C C   . PHE A  1 487  ? 186.803 212.494 264.368 1.00 45.92  ? 456  PHE A C   1 
ATOM   3521  O O   . PHE A  1 487  ? 186.328 213.580 264.703 1.00 45.92  ? 456  PHE A O   1 
ATOM   3522  C CB  . PHE A  1 487  ? 186.299 210.927 266.228 1.00 45.92  ? 456  PHE A CB  1 
ATOM   3523  C CG  . PHE A  1 487  ? 186.774 209.940 267.250 1.00 45.92  ? 456  PHE A CG  1 
ATOM   3524  C CD1 . PHE A  1 487  ? 186.701 210.237 268.595 1.00 45.92  ? 456  PHE A CD1 1 
ATOM   3525  C CD2 . PHE A  1 487  ? 187.292 208.720 266.870 1.00 45.92  ? 456  PHE A CD2 1 
ATOM   3526  C CE1 . PHE A  1 487  ? 187.134 209.337 269.538 1.00 45.92  ? 456  PHE A CE1 1 
ATOM   3527  C CE2 . PHE A  1 487  ? 187.722 207.819 267.812 1.00 45.92  ? 456  PHE A CE2 1 
ATOM   3528  C CZ  . PHE A  1 487  ? 187.644 208.129 269.146 1.00 45.92  ? 456  PHE A CZ  1 
ATOM   3529  N N   . ARG A  1 488  ? 186.808 212.062 263.109 1.00 43.42  ? 457  ARG A N   1 
ATOM   3530  C CA  . ARG A  1 488  ? 186.176 212.817 262.035 1.00 43.42  ? 457  ARG A CA  1 
ATOM   3531  C C   . ARG A  1 488  ? 185.778 211.883 260.904 1.00 43.42  ? 457  ARG A C   1 
ATOM   3532  O O   . ARG A  1 488  ? 186.501 210.937 260.592 1.00 43.42  ? 457  ARG A O   1 
ATOM   3533  C CB  . ARG A  1 488  ? 187.089 213.921 261.501 1.00 43.42  ? 457  ARG A CB  1 
ATOM   3534  C CG  . ARG A  1 488  ? 186.334 215.066 260.876 1.00 43.42  ? 457  ARG A CG  1 
ATOM   3535  C CD  . ARG A  1 488  ? 187.247 216.181 260.455 1.00 43.42  ? 457  ARG A CD  1 
ATOM   3536  N NE  . ARG A  1 488  ? 186.494 217.333 259.979 1.00 43.42  ? 457  ARG A NE  1 
ATOM   3537  C CZ  . ARG A  1 488  ? 186.023 217.457 258.746 1.00 43.42  ? 457  ARG A CZ  1 
ATOM   3538  N NH1 . ARG A  1 488  ? 186.231 216.507 257.854 1.00 43.42  ? 457  ARG A NH1 1 
ATOM   3539  N NH2 . ARG A  1 488  ? 185.346 218.536 258.401 1.00 43.42  ? 457  ARG A NH2 1 
ATOM   3540  N N   . LYS A  1 489  ? 184.605 212.140 260.319 1.00 49.86  ? 458  LYS A N   1 
ATOM   3541  C CA  . LYS A  1 489  ? 184.109 211.294 259.235 1.00 49.86  ? 458  LYS A CA  1 
ATOM   3542  C C   . LYS A  1 489  ? 185.069 211.259 258.053 1.00 49.86  ? 458  LYS A C   1 
ATOM   3543  O O   . LYS A  1 489  ? 185.338 210.189 257.497 1.00 49.86  ? 458  LYS A O   1 
ATOM   3544  C CB  . LYS A  1 489  ? 182.734 211.771 258.774 1.00 49.86  ? 458  LYS A CB  1 
ATOM   3545  C CG  . LYS A  1 489  ? 181.602 211.437 259.722 1.00 49.86  ? 458  LYS A CG  1 
ATOM   3546  C CD  . LYS A  1 489  ? 180.267 211.861 259.135 1.00 49.86  ? 458  LYS A CD  1 
ATOM   3547  C CE  . LYS A  1 489  ? 179.116 211.495 260.050 1.00 49.86  ? 458  LYS A CE  1 
ATOM   3548  N NZ  . LYS A  1 489  ? 177.809 211.917 259.482 1.00 49.86  ? 458  LYS A NZ  1 
ATOM   3549  N N   . SER A  1 490  ? 185.589 212.413 257.647 1.00 46.61  ? 459  SER A N   1 
ATOM   3550  C CA  . SER A  1 490  ? 186.455 212.501 256.482 1.00 46.61  ? 459  SER A CA  1 
ATOM   3551  C C   . SER A  1 490  ? 187.626 213.424 256.780 1.00 46.61  ? 459  SER A C   1 
ATOM   3552  O O   . SER A  1 490  ? 187.613 214.179 257.752 1.00 46.61  ? 459  SER A O   1 
ATOM   3553  C CB  . SER A  1 490  ? 185.675 212.990 255.261 1.00 46.61  ? 459  SER A CB  1 
ATOM   3554  O OG  . SER A  1 490  ? 185.230 214.319 255.454 1.00 46.61  ? 459  SER A OG  1 
ATOM   3555  N N   . ASN A  1 491  ? 188.647 213.351 255.931 1.00 40.57  ? 460  ASN A N   1 
ATOM   3556  C CA  . ASN A  1 491  ? 189.787 214.246 256.051 1.00 40.57  ? 460  ASN A CA  1 
ATOM   3557  C C   . ASN A  1 491  ? 189.426 215.679 255.672 1.00 40.57  ? 460  ASN A C   1 
ATOM   3558  O O   . ASN A  1 491  ? 188.520 215.927 254.876 1.00 40.57  ? 460  ASN A O   1 
ATOM   3559  C CB  . ASN A  1 491  ? 190.925 213.758 255.163 1.00 40.57  ? 460  ASN A CB  1 
ATOM   3560  C CG  . ASN A  1 491  ? 191.459 212.418 255.591 1.00 40.57  ? 460  ASN A CG  1 
ATOM   3561  O OD1 . ASN A  1 491  ? 190.920 211.783 256.493 1.00 40.57  ? 460  ASN A OD1 1 
ATOM   3562  N ND2 . ASN A  1 491  ? 192.522 211.975 254.944 1.00 40.57  ? 460  ASN A ND2 1 
ATOM   3563  N N   . LEU A  1 492  ? 190.156 216.625 256.259 1.00 36.75  ? 461  LEU A N   1 
ATOM   3564  C CA  . LEU A  1 492  ? 189.988 218.039 255.958 1.00 36.75  ? 461  LEU A CA  1 
ATOM   3565  C C   . LEU A  1 492  ? 190.589 218.409 254.607 1.00 36.75  ? 461  LEU A C   1 
ATOM   3566  O O   . LEU A  1 492  ? 191.507 217.756 254.109 1.00 36.75  ? 461  LEU A O   1 
ATOM   3567  C CB  . LEU A  1 492  ? 190.636 218.897 257.043 1.00 36.75  ? 461  LEU A CB  1 
ATOM   3568  C CG  . LEU A  1 492  ? 189.871 219.173 258.332 1.00 36.75  ? 461  LEU A CG  1 
ATOM   3569  C CD1 . LEU A  1 492  ? 190.757 219.937 259.258 1.00 36.75  ? 461  LEU A CD1 1 
ATOM   3570  C CD2 . LEU A  1 492  ? 188.642 219.975 258.046 1.00 36.75  ? 461  LEU A CD2 1 
ATOM   3571  N N   . LYS A  1 493  ? 190.047 219.466 254.010 1.00 36.37  ? 462  LYS A N   1 
ATOM   3572  C CA  . LYS A  1 493  ? 190.647 220.141 252.869 1.00 36.37  ? 462  LYS A CA  1 
ATOM   3573  C C   . LYS A  1 493  ? 191.741 221.099 253.330 1.00 36.37  ? 462  LYS A C   1 
ATOM   3574  O O   . LYS A  1 493  ? 191.787 221.482 254.499 1.00 36.37  ? 462  LYS A O   1 
ATOM   3575  C CB  . LYS A  1 493  ? 189.586 220.893 252.080 1.00 36.37  ? 462  LYS A CB  1 
ATOM   3576  C CG  . LYS A  1 493  ? 188.620 219.994 251.360 1.00 36.37  ? 462  LYS A CG  1 
ATOM   3577  C CD  . LYS A  1 493  ? 189.320 219.279 250.231 1.00 36.37  ? 462  LYS A CD  1 
ATOM   3578  C CE  . LYS A  1 493  ? 188.326 218.597 249.321 1.00 36.37  ? 462  LYS A CE  1 
ATOM   3579  N NZ  . LYS A  1 493  ? 187.470 219.587 248.617 1.00 36.37  ? 462  LYS A NZ  1 
ATOM   3580  N N   . PRO A  1 494  ? 192.647 221.492 252.435 1.00 32.65  ? 463  PRO A N   1 
ATOM   3581  C CA  . PRO A  1 494  ? 193.699 222.437 252.822 1.00 32.65  ? 463  PRO A CA  1 
ATOM   3582  C C   . PRO A  1 494  ? 193.139 223.753 253.342 1.00 32.65  ? 463  PRO A C   1 
ATOM   3583  O O   . PRO A  1 494  ? 192.199 224.316 252.784 1.00 32.65  ? 463  PRO A O   1 
ATOM   3584  C CB  . PRO A  1 494  ? 194.477 222.636 251.521 1.00 32.65  ? 463  PRO A CB  1 
ATOM   3585  C CG  . PRO A  1 494  ? 194.301 221.376 250.812 1.00 32.65  ? 463  PRO A CG  1 
ATOM   3586  C CD  . PRO A  1 494  ? 192.911 220.917 251.108 1.00 32.65  ? 463  PRO A CD  1 
ATOM   3587  N N   . PHE A  1 495  ? 193.757 224.243 254.416 1.00 33.14  ? 464  PHE A N   1 
ATOM   3588  C CA  . PHE A  1 495  ? 193.402 225.504 255.071 1.00 33.14  ? 464  PHE A CA  1 
ATOM   3589  C C   . PHE A  1 495  ? 191.924 225.567 255.453 1.00 33.14  ? 464  PHE A C   1 
ATOM   3590  O O   . PHE A  1 495  ? 191.264 226.592 255.289 1.00 33.14  ? 464  PHE A O   1 
ATOM   3591  C CB  . PHE A  1 495  ? 193.783 226.699 254.205 1.00 33.14  ? 464  PHE A CB  1 
ATOM   3592  C CG  . PHE A  1 495  ? 195.255 226.954 254.141 1.00 33.14  ? 464  PHE A CG  1 
ATOM   3593  C CD1 . PHE A  1 495  ? 196.047 226.794 255.257 1.00 33.14  ? 464  PHE A CD1 1 
ATOM   3594  C CD2 . PHE A  1 495  ? 195.842 227.386 252.971 1.00 33.14  ? 464  PHE A CD2 1 
ATOM   3595  C CE1 . PHE A  1 495  ? 197.398 227.033 255.198 1.00 33.14  ? 464  PHE A CE1 1 
ATOM   3596  C CE2 . PHE A  1 495  ? 197.193 227.627 252.910 1.00 33.14  ? 464  PHE A CE2 1 
ATOM   3597  C CZ  . PHE A  1 495  ? 197.970 227.453 254.023 1.00 33.14  ? 464  PHE A CZ  1 
ATOM   3598  N N   . GLU A  1 496  ? 191.409 224.473 256.004 1.00 36.72  ? 465  GLU A N   1 
ATOM   3599  C CA  . GLU A  1 496  ? 190.033 224.394 256.471 1.00 36.72  ? 465  GLU A CA  1 
ATOM   3600  C C   . GLU A  1 496  ? 190.011 224.221 257.982 1.00 36.72  ? 465  GLU A C   1 
ATOM   3601  O O   . GLU A  1 496  ? 190.859 223.524 258.544 1.00 36.72  ? 465  GLU A O   1 
ATOM   3602  C CB  . GLU A  1 496  ? 189.278 223.244 255.802 1.00 36.72  ? 465  GLU A CB  1 
ATOM   3603  C CG  . GLU A  1 496  ? 187.821 223.167 256.226 1.00 36.72  ? 465  GLU A CG  1 
ATOM   3604  C CD  . GLU A  1 496  ? 187.080 221.985 255.646 1.00 36.72  ? 465  GLU A CD  1 
ATOM   3605  O OE1 . GLU A  1 496  ? 187.689 221.196 254.899 1.00 36.72  ? 465  GLU A OE1 1 
ATOM   3606  O OE2 . GLU A  1 496  ? 185.884 221.837 255.961 1.00 36.72  ? 465  GLU A OE2 1 
ATOM   3607  N N   . ARG A  1 497  ? 189.048 224.866 258.638 1.00 33.23  ? 466  ARG A N   1 
ATOM   3608  C CA  . ARG A  1 497  ? 188.920 224.847 260.091 1.00 33.23  ? 466  ARG A CA  1 
ATOM   3609  C C   . ARG A  1 497  ? 187.572 224.268 260.489 1.00 33.23  ? 466  ARG A C   1 
ATOM   3610  O O   . ARG A  1 497  ? 186.529 224.807 260.111 1.00 33.23  ? 466  ARG A O   1 
ATOM   3611  C CB  . ARG A  1 497  ? 189.056 226.257 260.664 1.00 33.23  ? 466  ARG A CB  1 
ATOM   3612  C CG  . ARG A  1 497  ? 189.265 226.304 262.159 1.00 33.23  ? 466  ARG A CG  1 
ATOM   3613  C CD  . ARG A  1 497  ? 189.161 227.713 262.729 1.00 33.23  ? 466  ARG A CD  1 
ATOM   3614  N NE  . ARG A  1 497  ? 190.182 228.623 262.227 1.00 33.23  ? 466  ARG A NE  1 
ATOM   3615  C CZ  . ARG A  1 497  ? 190.028 229.435 261.191 1.00 33.23  ? 466  ARG A CZ  1 
ATOM   3616  N NH1 . ARG A  1 497  ? 188.886 229.461 260.530 1.00 33.23  ? 466  ARG A NH1 1 
ATOM   3617  N NH2 . ARG A  1 497  ? 191.021 230.223 260.819 1.00 33.23  ? 466  ARG A NH2 1 
ATOM   3618  N N   . ASP A  1 498  ? 187.592 223.172 261.241 1.00 39.77  ? 467  ASP A N   1 
ATOM   3619  C CA  . ASP A  1 498  ? 186.383 222.532 261.745 1.00 39.77  ? 467  ASP A CA  1 
ATOM   3620  C C   . ASP A  1 498  ? 186.343 222.696 263.259 1.00 39.77  ? 467  ASP A C   1 
ATOM   3621  O O   . ASP A  1 498  ? 187.221 222.185 263.957 1.00 39.77  ? 467  ASP A O   1 
ATOM   3622  C CB  . ASP A  1 498  ? 186.364 221.055 261.353 1.00 39.77  ? 467  ASP A CB  1 
ATOM   3623  C CG  . ASP A  1 498  ? 185.078 220.362 261.733 1.00 39.77  ? 467  ASP A CG  1 
ATOM   3624  O OD1 . ASP A  1 498  ? 184.102 221.051 262.083 1.00 39.77  ? 467  ASP A OD1 1 
ATOM   3625  O OD2 . ASP A  1 498  ? 185.035 219.119 261.660 1.00 39.77  ? 467  ASP A OD2 1 
ATOM   3626  N N   . ILE A  1 499  ? 185.329 223.398 263.769 1.00 43.93  ? 468  ILE A N   1 
ATOM   3627  C CA  . ILE A  1 499  ? 185.249 223.679 265.196 1.00 43.93  ? 468  ILE A CA  1 
ATOM   3628  C C   . ILE A  1 499  ? 183.990 223.105 265.838 1.00 43.93  ? 468  ILE A C   1 
ATOM   3629  O O   . ILE A  1 499  ? 183.646 223.490 266.954 1.00 43.93  ? 468  ILE A O   1 
ATOM   3630  C CB  . ILE A  1 499  ? 185.353 225.188 265.487 1.00 43.93  ? 468  ILE A CB  1 
ATOM   3631  C CG1 . ILE A  1 499  ? 184.183 225.946 264.873 1.00 43.93  ? 468  ILE A CG1 1 
ATOM   3632  C CG2 . ILE A  1 499  ? 186.655 225.740 264.954 1.00 43.93  ? 468  ILE A CG2 1 
ATOM   3633  C CD1 . ILE A  1 499  ? 184.075 227.371 265.360 1.00 43.93  ? 468  ILE A CD1 1 
ATOM   3634  N N   . SER A  1 500  ? 183.288 222.201 265.161 1.00 49.31  ? 469  SER A N   1 
ATOM   3635  C CA  . SER A  1 500  ? 182.064 221.657 265.727 1.00 49.31  ? 469  SER A CA  1 
ATOM   3636  C C   . SER A  1 500  ? 182.369 220.692 266.870 1.00 49.31  ? 469  SER A C   1 
ATOM   3637  O O   . SER A  1 500  ? 183.451 220.106 266.954 1.00 49.31  ? 469  SER A O   1 
ATOM   3638  C CB  . SER A  1 500  ? 181.241 220.956 264.650 1.00 49.31  ? 469  SER A CB  1 
ATOM   3639  O OG  . SER A  1 500  ? 181.856 219.750 264.243 1.00 49.31  ? 469  SER A OG  1 
ATOM   3640  N N   . THR A  1 501  ? 181.388 220.534 267.770 1.00 57.83  ? 470  THR A N   1 
ATOM   3641  C CA  . THR A  1 501  ? 181.440 219.550 268.859 1.00 57.83  ? 470  THR A CA  1 
ATOM   3642  C C   . THR A  1 501  ? 180.150 218.733 268.843 1.00 57.83  ? 470  THR A C   1 
ATOM   3643  O O   . THR A  1 501  ? 179.214 219.017 269.591 1.00 57.83  ? 470  THR A O   1 
ATOM   3644  C CB  . THR A  1 501  ? 181.647 220.227 270.203 1.00 57.83  ? 470  THR A CB  1 
ATOM   3645  O OG1 . THR A  1 501  ? 180.564 221.128 270.454 1.00 57.83  ? 470  THR A OG1 1 
ATOM   3646  C CG2 . THR A  1 501  ? 182.944 221.000 270.213 1.00 57.83  ? 470  THR A CG2 1 
ATOM   3647  N N   . GLU A  1 502  ? 180.113 217.705 268.005 1.00 63.00  ? 471  GLU A N   1 
ATOM   3648  C CA  . GLU A  1 502  ? 178.972 216.811 267.895 1.00 63.00  ? 471  GLU A CA  1 
ATOM   3649  C C   . GLU A  1 502  ? 179.421 215.400 268.230 1.00 63.00  ? 471  GLU A C   1 
ATOM   3650  O O   . GLU A  1 502  ? 180.552 215.014 267.920 1.00 63.00  ? 471  GLU A O   1 
ATOM   3651  C CB  . GLU A  1 502  ? 178.370 216.835 266.488 1.00 63.00  ? 471  GLU A CB  1 
ATOM   3652  C CG  . GLU A  1 502  ? 177.835 218.184 266.052 1.00 63.00  ? 471  GLU A CG  1 
ATOM   3653  C CD  . GLU A  1 502  ? 176.765 218.719 266.975 1.00 63.00  ? 471  GLU A CD  1 
ATOM   3654  O OE1 . GLU A  1 502  ? 175.926 217.920 267.441 1.00 63.00  ? 471  GLU A OE1 1 
ATOM   3655  O OE2 . GLU A  1 502  ? 176.766 219.938 267.242 1.00 63.00  ? 471  GLU A OE2 1 
ATOM   3656  N N   . ILE A  1 503  ? 178.538 214.633 268.871 1.00 65.58  ? 472  ILE A N   1 
ATOM   3657  C CA  . ILE A  1 503  ? 178.904 213.289 269.291 1.00 65.58  ? 472  ILE A CA  1 
ATOM   3658  C C   . ILE A  1 503  ? 179.187 212.447 268.059 1.00 65.58  ? 472  ILE A C   1 
ATOM   3659  O O   . ILE A  1 503  ? 178.355 212.338 267.151 1.00 65.58  ? 472  ILE A O   1 
ATOM   3660  C CB  . ILE A  1 503  ? 177.793 212.684 270.159 1.00 65.58  ? 472  ILE A CB  1 
ATOM   3661  C CG1 . ILE A  1 503  ? 177.566 213.551 271.392 1.00 65.58  ? 472  ILE A CG1 1 
ATOM   3662  C CG2 . ILE A  1 503  ? 178.137 211.275 270.571 1.00 65.58  ? 472  ILE A CG2 1 
ATOM   3663  C CD1 . ILE A  1 503  ? 178.795 213.720 272.233 1.00 65.58  ? 472  ILE A CD1 1 
ATOM   3664  N N   . TYR A  1 504  ? 180.371 211.848 268.026 1.00 64.29  ? 473  TYR A N   1 
ATOM   3665  C CA  . TYR A  1 504  ? 180.795 211.034 266.898 1.00 64.29  ? 473  TYR A CA  1 
ATOM   3666  C C   . TYR A  1 504  ? 180.207 209.634 266.994 1.00 64.29  ? 473  TYR A C   1 
ATOM   3667  O O   . TYR A  1 504  ? 180.310 208.976 268.032 1.00 64.29  ? 473  TYR A O   1 
ATOM   3668  C CB  . TYR A  1 504  ? 182.321 210.978 266.854 1.00 64.29  ? 473  TYR A CB  1 
ATOM   3669  C CG  . TYR A  1 504  ? 182.892 210.095 265.779 1.00 64.29  ? 473  TYR A CG  1 
ATOM   3670  C CD1 . TYR A  1 504  ? 182.927 210.510 264.463 1.00 64.29  ? 473  TYR A CD1 1 
ATOM   3671  C CD2 . TYR A  1 504  ? 183.417 208.853 266.085 1.00 64.29  ? 473  TYR A CD2 1 
ATOM   3672  C CE1 . TYR A  1 504  ? 183.447 209.710 263.483 1.00 64.29  ? 473  TYR A CE1 1 
ATOM   3673  C CE2 . TYR A  1 504  ? 183.948 208.051 265.110 1.00 64.29  ? 473  TYR A CE2 1 
ATOM   3674  C CZ  . TYR A  1 504  ? 183.958 208.484 263.811 1.00 64.29  ? 473  TYR A CZ  1 
ATOM   3675  O OH  . TYR A  1 504  ? 184.486 207.685 262.830 1.00 64.29  ? 473  TYR A OH  1 
ATOM   3676  N N   . GLN A  1 505  ? 179.596 209.179 265.904 1.00 77.69  ? 474  GLN A N   1 
ATOM   3677  C CA  . GLN A  1 505  ? 178.963 207.867 265.849 1.00 77.69  ? 474  GLN A CA  1 
ATOM   3678  C C   . GLN A  1 505  ? 179.963 206.865 265.287 1.00 77.69  ? 474  GLN A C   1 
ATOM   3679  O O   . GLN A  1 505  ? 180.236 206.857 264.083 1.00 77.69  ? 474  GLN A O   1 
ATOM   3680  C CB  . GLN A  1 505  ? 177.702 207.923 264.994 1.00 77.69  ? 474  GLN A CB  1 
ATOM   3681  C CG  . GLN A  1 505  ? 176.865 206.666 265.051 1.00 77.69  ? 474  GLN A CG  1 
ATOM   3682  C CD  . GLN A  1 505  ? 175.708 206.701 264.080 1.00 77.69  ? 474  GLN A CD  1 
ATOM   3683  O OE1 . GLN A  1 505  ? 175.521 207.675 263.353 1.00 77.69  ? 474  GLN A OE1 1 
ATOM   3684  N NE2 . GLN A  1 505  ? 174.934 205.625 264.046 1.00 77.69  ? 474  GLN A NE2 1 
ATOM   3685  N N   . ALA A  1 506  ? 180.506 206.015 266.161 1.00 79.61  ? 475  ALA A N   1 
ATOM   3686  C CA  . ALA A  1 506  ? 181.538 205.071 265.741 1.00 79.61  ? 475  ALA A CA  1 
ATOM   3687  C C   . ALA A  1 506  ? 180.974 203.943 264.885 1.00 79.61  ? 475  ALA A C   1 
ATOM   3688  O O   . ALA A  1 506  ? 181.633 203.487 263.943 1.00 79.61  ? 475  ALA A O   1 
ATOM   3689  C CB  . ALA A  1 506  ? 182.252 204.503 266.966 1.00 79.61  ? 475  ALA A CB  1 
ATOM   3690  N N   . GLY A  1 507  ? 179.767 203.479 265.189 1.00 88.31  ? 476  GLY A N   1 
ATOM   3691  C CA  . GLY A  1 507  ? 179.151 202.385 264.460 1.00 88.31  ? 476  GLY A CA  1 
ATOM   3692  C C   . GLY A  1 507  ? 177.732 202.723 264.047 1.00 88.31  ? 476  GLY A C   1 
ATOM   3693  O O   . GLY A  1 507  ? 177.411 203.859 263.703 1.00 88.31  ? 476  GLY A O   1 
ATOM   3694  N N   . SER A  1 508  ? 176.877 201.705 264.069 1.00 94.06  ? 477  SER A N   1 
ATOM   3695  C CA  . SER A  1 508  ? 175.453 201.894 263.833 1.00 94.06  ? 477  SER A CA  1 
ATOM   3696  C C   . SER A  1 508  ? 174.791 202.318 265.143 1.00 94.06  ? 477  SER A C   1 
ATOM   3697  O O   . SER A  1 508  ? 175.464 202.710 266.100 1.00 94.06  ? 477  SER A O   1 
ATOM   3698  C CB  . SER A  1 508  ? 174.837 200.622 263.258 1.00 94.06  ? 477  SER A CB  1 
ATOM   3699  O OG  . SER A  1 508  ? 175.282 200.399 261.932 1.00 94.06  ? 477  SER A OG  1 
ATOM   3700  N N   . THR A  1 509  ? 173.453 202.248 265.199 1.00 95.19  ? 478  THR A N   1 
ATOM   3701  C CA  . THR A  1 509  ? 172.692 202.598 266.396 1.00 95.19  ? 478  THR A CA  1 
ATOM   3702  C C   . THR A  1 509  ? 172.950 204.053 266.764 1.00 95.19  ? 478  THR A C   1 
ATOM   3703  O O   . THR A  1 509  ? 173.730 204.324 267.684 1.00 95.19  ? 478  THR A O   1 
ATOM   3704  C CB  . THR A  1 509  ? 173.030 201.681 267.576 1.00 95.19  ? 478  THR A CB  1 
ATOM   3705  O OG1 . THR A  1 509  ? 174.357 201.961 268.042 1.00 95.19  ? 478  THR A OG1 1 
ATOM   3706  C CG2 . THR A  1 509  ? 172.937 200.220 267.163 1.00 95.19  ? 478  THR A CG2 1 
ATOM   3707  N N   . PRO A  1 510  ? 172.345 205.013 266.037 1.00 93.43  ? 479  PRO A N   1 
ATOM   3708  C CA  . PRO A  1 510  ? 172.647 206.440 266.247 1.00 93.43  ? 479  PRO A CA  1 
ATOM   3709  C C   . PRO A  1 510  ? 172.689 206.881 267.702 1.00 93.43  ? 479  PRO A C   1 
ATOM   3710  O O   . PRO A  1 510  ? 172.055 206.272 268.570 1.00 93.43  ? 479  PRO A O   1 
ATOM   3711  C CB  . PRO A  1 510  ? 171.509 207.140 265.495 1.00 93.43  ? 479  PRO A CB  1 
ATOM   3712  C CG  . PRO A  1 510  ? 171.147 206.183 264.417 1.00 93.43  ? 479  PRO A CG  1 
ATOM   3713  C CD  . PRO A  1 510  ? 171.300 204.815 265.019 1.00 93.43  ? 479  PRO A CD  1 
ATOM   3714  N N   . CYS A  1 511  ? 173.410 207.971 267.969 1.00 91.32  ? 480  CYS A N   1 
ATOM   3715  C CA  . CYS A  1 511  ? 173.714 208.357 269.340 1.00 91.32  ? 480  CYS A CA  1 
ATOM   3716  C C   . CYS A  1 511  ? 172.658 209.257 269.959 1.00 91.32  ? 480  CYS A C   1 
ATOM   3717  O O   . CYS A  1 511  ? 172.473 209.222 271.181 1.00 91.32  ? 480  CYS A O   1 
ATOM   3718  C CB  . CYS A  1 511  ? 175.068 209.073 269.391 1.00 91.32  ? 480  CYS A CB  1 
ATOM   3719  S SG  . CYS A  1 511  ? 176.414 208.213 268.549 1.00 91.32  ? 480  CYS A SG  1 
ATOM   3720  N N   . ASN A  1 512  ? 171.954 210.048 269.151 1.00 92.91  ? 481  ASN A N   1 
ATOM   3721  C CA  . ASN A  1 512  ? 171.084 211.112 269.650 1.00 92.91  ? 481  ASN A CA  1 
ATOM   3722  C C   . ASN A  1 512  ? 171.807 211.990 270.672 1.00 92.91  ? 481  ASN A C   1 
ATOM   3723  O O   . ASN A  1 512  ? 171.263 212.344 271.719 1.00 92.91  ? 481  ASN A O   1 
ATOM   3724  C CB  . ASN A  1 512  ? 169.798 210.532 270.239 1.00 92.91  ? 481  ASN A CB  1 
ATOM   3725  C CG  . ASN A  1 512  ? 168.941 209.850 269.196 1.00 92.91  ? 481  ASN A CG  1 
ATOM   3726  O OD1 . ASN A  1 512  ? 169.415 209.513 268.112 1.00 92.91  ? 481  ASN A OD1 1 
ATOM   3727  N ND2 . ASN A  1 512  ? 167.670 209.642 269.518 1.00 92.91  ? 481  ASN A ND2 1 
ATOM   3728  N N   . GLY A  1 513  ? 173.042 212.362 270.338 1.00 88.23  ? 482  GLY A N   1 
ATOM   3729  C CA  . GLY A  1 513  ? 173.892 213.155 271.208 1.00 88.23  ? 482  GLY A CA  1 
ATOM   3730  C C   . GLY A  1 513  ? 173.877 212.778 272.676 1.00 88.23  ? 482  GLY A C   1 
ATOM   3731  O O   . GLY A  1 513  ? 173.653 213.633 273.538 1.00 88.23  ? 482  GLY A O   1 
ATOM   3732  N N   . VAL A  1 514  ? 174.116 211.503 272.978 1.00 87.14  ? 483  VAL A N   1 
ATOM   3733  C CA  . VAL A  1 514  ? 174.060 211.020 274.350 1.00 87.14  ? 483  VAL A CA  1 
ATOM   3734  C C   . VAL A  1 514  ? 175.417 210.558 274.877 1.00 87.14  ? 483  VAL A C   1 
ATOM   3735  O O   . VAL A  1 514  ? 175.577 210.455 276.104 1.00 87.14  ? 483  VAL A O   1 
ATOM   3736  C CB  . VAL A  1 514  ? 173.017 209.893 274.505 1.00 87.14  ? 483  VAL A CB  1 
ATOM   3737  C CG1 . VAL A  1 514  ? 173.611 208.549 274.112 1.00 87.14  ? 483  VAL A CG1 1 
ATOM   3738  C CG2 . VAL A  1 514  ? 172.471 209.860 275.925 1.00 87.14  ? 483  VAL A CG2 1 
ATOM   3739  N N   . GLU A  1 515  ? 176.389 210.273 274.007 1.00 80.42  ? 484  GLU A N   1 
ATOM   3740  C CA  . GLU A  1 515  ? 177.722 209.817 274.407 1.00 80.42  ? 484  GLU A CA  1 
ATOM   3741  C C   . GLU A  1 515  ? 177.644 208.489 275.167 1.00 80.42  ? 484  GLU A C   1 
ATOM   3742  O O   . GLU A  1 515  ? 177.907 208.400 276.366 1.00 80.42  ? 484  GLU A O   1 
ATOM   3743  C CB  . GLU A  1 515  ? 178.447 210.882 275.238 1.00 80.42  ? 484  GLU A CB  1 
ATOM   3744  C CG  . GLU A  1 515  ? 179.936 210.632 275.398 1.00 80.42  ? 484  GLU A CG  1 
ATOM   3745  C CD  . GLU A  1 515  ? 180.646 211.759 276.122 1.00 80.42  ? 484  GLU A CD  1 
ATOM   3746  O OE1 . GLU A  1 515  ? 179.982 212.758 276.467 1.00 80.42  ? 484  GLU A OE1 1 
ATOM   3747  O OE2 . GLU A  1 515  ? 181.870 211.644 276.348 1.00 80.42  ? 484  GLU A OE2 1 
ATOM   3748  N N   . GLY A  1 516  ? 177.263 207.453 274.427 1.00 83.50  ? 485  GLY A N   1 
ATOM   3749  C CA  . GLY A  1 516  ? 177.223 206.118 274.990 1.00 83.50  ? 485  GLY A CA  1 
ATOM   3750  C C   . GLY A  1 516  ? 178.318 205.205 274.478 1.00 83.50  ? 485  GLY A C   1 
ATOM   3751  O O   . GLY A  1 516  ? 179.426 205.657 274.176 1.00 83.50  ? 485  GLY A O   1 
ATOM   3752  N N   . PHE A  1 517  ? 178.020 203.912 274.387 1.00 84.59  ? 486  PHE A N   1 
ATOM   3753  C CA  . PHE A  1 517  ? 178.967 202.952 273.836 1.00 84.59  ? 486  PHE A CA  1 
ATOM   3754  C C   . PHE A  1 517  ? 179.073 203.122 272.325 1.00 84.59  ? 486  PHE A C   1 
ATOM   3755  O O   . PHE A  1 517  ? 178.057 203.147 271.623 1.00 84.59  ? 486  PHE A O   1 
ATOM   3756  C CB  . PHE A  1 517  ? 178.527 201.533 274.197 1.00 84.59  ? 486  PHE A CB  1 
ATOM   3757  C CG  . PHE A  1 517  ? 179.319 200.454 273.519 1.00 84.59  ? 486  PHE A CG  1 
ATOM   3758  C CD1 . PHE A  1 517  ? 180.586 200.124 273.965 1.00 84.59  ? 486  PHE A CD1 1 
ATOM   3759  C CD2 . PHE A  1 517  ? 178.784 199.751 272.453 1.00 84.59  ? 486  PHE A CD2 1 
ATOM   3760  C CE1 . PHE A  1 517  ? 181.313 199.125 273.349 1.00 84.59  ? 486  PHE A CE1 1 
ATOM   3761  C CE2 . PHE A  1 517  ? 179.506 198.752 271.833 1.00 84.59  ? 486  PHE A CE2 1 
ATOM   3762  C CZ  . PHE A  1 517  ? 180.772 198.438 272.282 1.00 84.59  ? 486  PHE A CZ  1 
ATOM   3763  N N   . ASN A  1 518  ? 180.306 203.243 271.826 1.00 81.25  ? 487  ASN A N   1 
ATOM   3764  C CA  . ASN A  1 518  ? 180.565 203.555 270.417 1.00 81.25  ? 487  ASN A CA  1 
ATOM   3765  C C   . ASN A  1 518  ? 179.931 204.883 270.005 1.00 81.25  ? 487  ASN A C   1 
ATOM   3766  O O   . ASN A  1 518  ? 179.413 205.026 268.896 1.00 81.25  ? 487  ASN A O   1 
ATOM   3767  C CB  . ASN A  1 518  ? 180.112 202.421 269.496 1.00 81.25  ? 487  ASN A CB  1 
ATOM   3768  C CG  . ASN A  1 518  ? 181.017 201.213 269.581 1.00 81.25  ? 487  ASN A CG  1 
ATOM   3769  O OD1 . ASN A  1 518  ? 181.959 201.187 270.369 1.00 81.25  ? 487  ASN A OD1 1 
ATOM   3770  N ND2 . ASN A  1 518  ? 180.743 200.208 268.760 1.00 81.25  ? 487  ASN A ND2 1 
ATOM   3771  N N   . CYS A  1 519  ? 179.975 205.859 270.908 1.00 78.03  ? 488  CYS A N   1 
ATOM   3772  C CA  . CYS A  1 519  ? 179.507 207.216 270.630 1.00 78.03  ? 488  CYS A CA  1 
ATOM   3773  C C   . CYS A  1 519  ? 180.366 208.150 271.468 1.00 78.03  ? 488  CYS A C   1 
ATOM   3774  O O   . CYS A  1 519  ? 180.247 208.157 272.695 1.00 78.03  ? 488  CYS A O   1 
ATOM   3775  C CB  . CYS A  1 519  ? 178.029 207.374 270.974 1.00 78.03  ? 488  CYS A CB  1 
ATOM   3776  S SG  . CYS A  1 519  ? 176.874 206.666 269.779 1.00 78.03  ? 488  CYS A SG  1 
ATOM   3777  N N   . TYR A  1 520  ? 181.230 208.926 270.820 1.00 67.45  ? 489  TYR A N   1 
ATOM   3778  C CA  . TYR A  1 520  ? 182.319 209.598 271.510 1.00 67.45  ? 489  TYR A CA  1 
ATOM   3779  C C   . TYR A  1 520  ? 182.182 211.112 271.429 1.00 67.45  ? 489  TYR A C   1 
ATOM   3780  O O   . TYR A  1 520  ? 181.518 211.653 270.544 1.00 67.45  ? 489  TYR A O   1 
ATOM   3781  C CB  . TYR A  1 520  ? 183.663 209.197 270.903 1.00 67.45  ? 489  TYR A CB  1 
ATOM   3782  C CG  . TYR A  1 520  ? 183.952 207.723 270.988 1.00 67.45  ? 489  TYR A CG  1 
ATOM   3783  C CD1 . TYR A  1 520  ? 184.175 207.106 272.206 1.00 67.45  ? 489  TYR A CD1 1 
ATOM   3784  C CD2 . TYR A  1 520  ? 183.991 206.945 269.843 1.00 67.45  ? 489  TYR A CD2 1 
ATOM   3785  C CE1 . TYR A  1 520  ? 184.433 205.759 272.281 1.00 67.45  ? 489  TYR A CE1 1 
ATOM   3786  C CE2 . TYR A  1 520  ? 184.250 205.601 269.907 1.00 67.45  ? 489  TYR A CE2 1 
ATOM   3787  C CZ  . TYR A  1 520  ? 184.469 205.010 271.127 1.00 67.45  ? 489  TYR A CZ  1 
ATOM   3788  O OH  . TYR A  1 520  ? 184.730 203.662 271.193 1.00 67.45  ? 489  TYR A OH  1 
ATOM   3789  N N   . PHE A  1 521  ? 182.839 211.789 272.368 1.00 55.80  ? 490  PHE A N   1 
ATOM   3790  C CA  . PHE A  1 521  ? 183.051 213.228 272.285 1.00 55.80  ? 490  PHE A CA  1 
ATOM   3791  C C   . PHE A  1 521  ? 184.319 213.479 271.479 1.00 55.80  ? 490  PHE A C   1 
ATOM   3792  O O   . PHE A  1 521  ? 185.386 212.983 271.860 1.00 55.80  ? 490  PHE A O   1 
ATOM   3793  C CB  . PHE A  1 521  ? 183.161 213.830 273.675 1.00 55.80  ? 490  PHE A CB  1 
ATOM   3794  C CG  . PHE A  1 521  ? 183.136 215.328 273.696 1.00 55.80  ? 490  PHE A CG  1 
ATOM   3795  C CD1 . PHE A  1 521  ? 184.307 216.052 273.796 1.00 55.80  ? 490  PHE A CD1 1 
ATOM   3796  C CD2 . PHE A  1 521  ? 181.944 216.013 273.594 1.00 55.80  ? 490  PHE A CD2 1 
ATOM   3797  C CE1 . PHE A  1 521  ? 184.285 217.429 273.812 1.00 55.80  ? 490  PHE A CE1 1 
ATOM   3798  C CE2 . PHE A  1 521  ? 181.919 217.389 273.607 1.00 55.80  ? 490  PHE A CE2 1 
ATOM   3799  C CZ  . PHE A  1 521  ? 183.091 218.096 273.715 1.00 55.80  ? 490  PHE A CZ  1 
ATOM   3800  N N   . PRO A  1 522  ? 184.254 214.217 270.369 1.00 48.16  ? 491  PRO A N   1 
ATOM   3801  C CA  . PRO A  1 522  ? 185.397 214.242 269.445 1.00 48.16  ? 491  PRO A CA  1 
ATOM   3802  C C   . PRO A  1 522  ? 186.639 214.945 269.965 1.00 48.16  ? 491  PRO A C   1 
ATOM   3803  O O   . PRO A  1 522  ? 187.747 214.531 269.608 1.00 48.16  ? 491  PRO A O   1 
ATOM   3804  C CB  . PRO A  1 522  ? 184.824 214.957 268.218 1.00 48.16  ? 491  PRO A CB  1 
ATOM   3805  C CG  . PRO A  1 522  ? 183.768 215.830 268.772 1.00 48.16  ? 491  PRO A CG  1 
ATOM   3806  C CD  . PRO A  1 522  ? 183.153 215.074 269.905 1.00 48.16  ? 491  PRO A CD  1 
ATOM   3807  N N   . LEU A  1 523  ? 186.512 215.981 270.787 1.00 43.85  ? 492  LEU A N   1 
ATOM   3808  C CA  . LEU A  1 523  ? 187.676 216.732 271.237 1.00 43.85  ? 492  LEU A CA  1 
ATOM   3809  C C   . LEU A  1 523  ? 188.271 216.142 272.506 1.00 43.85  ? 492  LEU A C   1 
ATOM   3810  O O   . LEU A  1 523  ? 187.546 215.731 273.413 1.00 43.85  ? 492  LEU A O   1 
ATOM   3811  C CB  . LEU A  1 523  ? 187.299 218.191 271.481 1.00 43.85  ? 492  LEU A CB  1 
ATOM   3812  C CG  . LEU A  1 523  ? 186.767 218.931 270.262 1.00 43.85  ? 492  LEU A CG  1 
ATOM   3813  C CD1 . LEU A  1 523  ? 186.516 220.367 270.608 1.00 43.85  ? 492  LEU A CD1 1 
ATOM   3814  C CD2 . LEU A  1 523  ? 187.747 218.836 269.128 1.00 43.85  ? 492  LEU A CD2 1 
ATOM   3815  N N   . GLN A  1 524  ? 189.600 216.105 272.562 1.00 43.77  ? 493  GLN A N   1 
ATOM   3816  C CA  . GLN A  1 524  ? 190.319 215.556 273.699 1.00 43.77  ? 493  GLN A CA  1 
ATOM   3817  C C   . GLN A  1 524  ? 191.406 216.546 274.102 1.00 43.77  ? 493  GLN A C   1 
ATOM   3818  O O   . GLN A  1 524  ? 191.847 217.369 273.301 1.00 43.77  ? 493  GLN A O   1 
ATOM   3819  C CB  . GLN A  1 524  ? 190.880 214.162 273.392 1.00 43.77  ? 493  GLN A CB  1 
ATOM   3820  C CG  . GLN A  1 524  ? 191.487 213.473 274.596 1.00 43.77  ? 493  GLN A CG  1 
ATOM   3821  C CD  . GLN A  1 524  ? 191.855 212.039 274.328 1.00 43.77  ? 493  GLN A CD  1 
ATOM   3822  O OE1 . GLN A  1 524  ? 191.576 211.507 273.259 1.00 43.77  ? 493  GLN A OE1 1 
ATOM   3823  N NE2 . GLN A  1 524  ? 192.485 211.400 275.303 1.00 43.77  ? 493  GLN A NE2 1 
ATOM   3824  N N   . SER A  1 525  ? 191.840 216.463 275.353 1.00 40.78  ? 494  SER A N   1 
ATOM   3825  C CA  . SER A  1 525  ? 192.775 217.419 275.930 1.00 40.78  ? 494  SER A CA  1 
ATOM   3826  C C   . SER A  1 525  ? 194.194 216.869 276.030 1.00 40.78  ? 494  SER A C   1 
ATOM   3827  O O   . SER A  1 525  ? 194.397 215.702 276.370 1.00 40.78  ? 494  SER A O   1 
ATOM   3828  C CB  . SER A  1 525  ? 192.295 217.843 277.314 1.00 40.78  ? 494  SER A CB  1 
ATOM   3829  O OG  . SER A  1 525  ? 193.220 218.719 277.918 1.00 40.78  ? 494  SER A OG  1 
ATOM   3830  N N   . TYR A  1 526  ? 195.172 217.719 275.714 1.00 37.90  ? 495  TYR A N   1 
ATOM   3831  C CA  . TYR A  1 526  ? 196.568 217.425 276.015 1.00 37.90  ? 495  TYR A CA  1 
ATOM   3832  C C   . TYR A  1 526  ? 196.842 217.550 277.509 1.00 37.90  ? 495  TYR A C   1 
ATOM   3833  O O   . TYR A  1 526  ? 196.332 218.451 278.178 1.00 37.90  ? 495  TYR A O   1 
ATOM   3834  C CB  . TYR A  1 526  ? 197.491 218.390 275.277 1.00 37.90  ? 495  TYR A CB  1 
ATOM   3835  C CG  . TYR A  1 526  ? 197.691 218.158 273.803 1.00 37.90  ? 495  TYR A CG  1 
ATOM   3836  C CD1 . TYR A  1 526  ? 197.292 219.101 272.876 1.00 37.90  ? 495  TYR A CD1 1 
ATOM   3837  C CD2 . TYR A  1 526  ? 198.353 217.040 273.347 1.00 37.90  ? 495  TYR A CD2 1 
ATOM   3838  C CE1 . TYR A  1 526  ? 197.504 218.913 271.537 1.00 37.90  ? 495  TYR A CE1 1 
ATOM   3839  C CE2 . TYR A  1 526  ? 198.566 216.841 272.012 1.00 37.90  ? 495  TYR A CE2 1 
ATOM   3840  C CZ  . TYR A  1 526  ? 198.147 217.781 271.111 1.00 37.90  ? 495  TYR A CZ  1 
ATOM   3841  O OH  . TYR A  1 526  ? 198.361 217.578 269.774 1.00 37.90  ? 495  TYR A OH  1 
ATOM   3842  N N   . GLY A  1 527  ? 197.679 216.659 278.025 1.00 41.24  ? 496  GLY A N   1 
ATOM   3843  C CA  . GLY A  1 527  ? 198.193 216.791 279.373 1.00 41.24  ? 496  GLY A CA  1 
ATOM   3844  C C   . GLY A  1 527  ? 199.651 217.197 279.400 1.00 41.24  ? 496  GLY A C   1 
ATOM   3845  O O   . GLY A  1 527  ? 200.527 216.357 279.188 1.00 41.24  ? 496  GLY A O   1 
ATOM   3846  N N   . PHE A  1 528  ? 199.935 218.462 279.678 1.00 38.45  ? 497  PHE A N   1 
ATOM   3847  C CA  . PHE A  1 528  ? 201.289 218.994 279.586 1.00 38.45  ? 497  PHE A CA  1 
ATOM   3848  C C   . PHE A  1 528  ? 201.837 219.168 280.996 1.00 38.45  ? 497  PHE A C   1 
ATOM   3849  O O   . PHE A  1 528  ? 201.319 219.974 281.773 1.00 38.45  ? 497  PHE A O   1 
ATOM   3850  C CB  . PHE A  1 528  ? 201.311 220.322 278.834 1.00 38.45  ? 497  PHE A CB  1 
ATOM   3851  C CG  . PHE A  1 528  ? 201.215 220.180 277.345 1.00 38.45  ? 497  PHE A CG  1 
ATOM   3852  C CD1 . PHE A  1 528  ? 200.426 221.039 276.614 1.00 38.45  ? 497  PHE A CD1 1 
ATOM   3853  C CD2 . PHE A  1 528  ? 201.851 219.152 276.686 1.00 38.45  ? 497  PHE A CD2 1 
ATOM   3854  C CE1 . PHE A  1 528  ? 200.319 220.911 275.256 1.00 38.45  ? 497  PHE A CE1 1 
ATOM   3855  C CE2 . PHE A  1 528  ? 201.733 219.018 275.325 1.00 38.45  ? 497  PHE A CE2 1 
ATOM   3856  C CZ  . PHE A  1 528  ? 200.967 219.899 274.613 1.00 38.45  ? 497  PHE A CZ  1 
ATOM   3857  N N   . GLN A  1 529  ? 202.873 218.407 281.326 1.00 48.29  ? 498  GLN A N   1 
ATOM   3858  C CA  . GLN A  1 529  ? 203.493 218.440 282.639 1.00 48.29  ? 498  GLN A CA  1 
ATOM   3859  C C   . GLN A  1 529  ? 204.983 218.695 282.490 1.00 48.29  ? 498  GLN A C   1 
ATOM   3860  O O   . GLN A  1 529  ? 205.584 218.308 281.486 1.00 48.29  ? 498  GLN A O   1 
ATOM   3861  C CB  . GLN A  1 529  ? 203.278 217.122 283.391 1.00 48.29  ? 498  GLN A CB  1 
ATOM   3862  C CG  . GLN A  1 529  ? 201.862 216.617 283.341 1.00 48.29  ? 498  GLN A CG  1 
ATOM   3863  C CD  . GLN A  1 529  ? 201.599 215.533 284.349 1.00 48.29  ? 498  GLN A CD  1 
ATOM   3864  O OE1 . GLN A  1 529  ? 202.165 214.446 284.266 1.00 48.29  ? 498  GLN A OE1 1 
ATOM   3865  N NE2 . GLN A  1 529  ? 200.742 215.820 285.317 1.00 48.29  ? 498  GLN A NE2 1 
ATOM   3866  N N   . PRO A  1 530  ? 205.598 219.370 283.462 1.00 49.95  ? 499  PRO A N   1 
ATOM   3867  C CA  . PRO A  1 530  ? 207.021 219.706 283.322 1.00 49.95  ? 499  PRO A CA  1 
ATOM   3868  C C   . PRO A  1 530  ? 207.915 218.494 283.153 1.00 49.95  ? 499  PRO A C   1 
ATOM   3869  O O   . PRO A  1 530  ? 208.935 218.582 282.460 1.00 49.95  ? 499  PRO A O   1 
ATOM   3870  C CB  . PRO A  1 530  ? 207.330 220.474 284.614 1.00 49.95  ? 499  PRO A CB  1 
ATOM   3871  C CG  . PRO A  1 530  ? 206.220 220.155 285.539 1.00 49.95  ? 499  PRO A CG  1 
ATOM   3872  C CD  . PRO A  1 530  ? 205.021 219.920 284.697 1.00 49.95  ? 499  PRO A CD  1 
ATOM   3873  N N   . THR A  1 531  ? 207.568 217.364 283.761 1.00 50.25  ? 500  THR A N   1 
ATOM   3874  C CA  . THR A  1 531  ? 208.339 216.133 283.605 1.00 50.25  ? 500  THR A CA  1 
ATOM   3875  C C   . THR A  1 531  ? 207.643 215.205 282.611 1.00 50.25  ? 500  THR A C   1 
ATOM   3876  O O   . THR A  1 531  ? 207.035 214.198 282.966 1.00 50.25  ? 500  THR A O   1 
ATOM   3877  C CB  . THR A  1 531  ? 208.528 215.455 284.956 1.00 50.25  ? 500  THR A CB  1 
ATOM   3878  O OG1 . THR A  1 531  ? 207.250 215.056 285.466 1.00 50.25  ? 500  THR A OG1 1 
ATOM   3879  C CG2 . THR A  1 531  ? 209.182 216.402 285.938 1.00 50.25  ? 500  THR A CG2 1 
ATOM   3880  N N   . ASN A  1 532  ? 207.752 215.568 281.338 1.00 45.40  ? 501  ASN A N   1 
ATOM   3881  C CA  . ASN A  1 532  ? 207.422 214.681 280.237 1.00 45.40  ? 501  ASN A CA  1 
ATOM   3882  C C   . ASN A  1 532  ? 208.672 214.448 279.404 1.00 45.40  ? 501  ASN A C   1 
ATOM   3883  O O   . ASN A  1 532  ? 209.652 215.189 279.500 1.00 45.40  ? 501  ASN A O   1 
ATOM   3884  C CB  . ASN A  1 532  ? 206.333 215.266 279.328 1.00 45.40  ? 501  ASN A CB  1 
ATOM   3885  C CG  . ASN A  1 532  ? 204.940 215.062 279.866 1.00 45.40  ? 501  ASN A CG  1 
ATOM   3886  O OD1 . ASN A  1 532  ? 204.054 215.882 279.642 1.00 45.40  ? 501  ASN A OD1 1 
ATOM   3887  N ND2 . ASN A  1 532  ? 204.737 213.973 280.587 1.00 45.40  ? 501  ASN A ND2 1 
ATOM   3888  N N   . GLY A  1 533  ? 208.637 213.401 278.590 1.00 40.23  ? 502  GLY A N   1 
ATOM   3889  C CA  . GLY A  1 533  ? 209.656 213.236 277.581 1.00 40.23  ? 502  GLY A CA  1 
ATOM   3890  C C   . GLY A  1 533  ? 209.577 214.326 276.534 1.00 40.23  ? 502  GLY A C   1 
ATOM   3891  O O   . GLY A  1 533  ? 208.558 214.990 276.376 1.00 40.23  ? 502  GLY A O   1 
ATOM   3892  N N   . VAL A  1 534  ? 210.674 214.512 275.797 1.00 38.18  ? 503  VAL A N   1 
ATOM   3893  C CA  . VAL A  1 534  ? 210.723 215.610 274.836 1.00 38.18  ? 503  VAL A CA  1 
ATOM   3894  C C   . VAL A  1 534  ? 209.649 215.431 273.776 1.00 38.18  ? 503  VAL A C   1 
ATOM   3895  O O   . VAL A  1 534  ? 209.157 216.406 273.200 1.00 38.18  ? 503  VAL A O   1 
ATOM   3896  C CB  . VAL A  1 534  ? 212.126 215.715 274.212 1.00 38.18  ? 503  VAL A CB  1 
ATOM   3897  C CG1 . VAL A  1 534  ? 212.288 217.038 273.493 1.00 38.18  ? 503  VAL A CG1 1 
ATOM   3898  C CG2 . VAL A  1 534  ? 213.183 215.572 275.283 1.00 38.18  ? 503  VAL A CG2 1 
ATOM   3899  N N   . GLY A  1 535  ? 209.283 214.186 273.489 1.00 39.11  ? 504  GLY A N   1 
ATOM   3900  C CA  . GLY A  1 535  ? 208.234 213.926 272.525 1.00 39.11  ? 504  GLY A CA  1 
ATOM   3901  C C   . GLY A  1 535  ? 206.882 214.444 272.966 1.00 39.11  ? 504  GLY A C   1 
ATOM   3902  O O   . GLY A  1 535  ? 206.048 214.789 272.131 1.00 39.11  ? 504  GLY A O   1 
ATOM   3903  N N   . TYR A  1 536  ? 206.628 214.459 274.273 1.00 40.95  ? 505  TYR A N   1 
ATOM   3904  C CA  . TYR A  1 536  ? 205.342 214.859 274.826 1.00 40.95  ? 505  TYR A CA  1 
ATOM   3905  C C   . TYR A  1 536  ? 205.306 216.297 275.320 1.00 40.95  ? 505  TYR A C   1 
ATOM   3906  O O   . TYR A  1 536  ? 204.297 216.706 275.895 1.00 40.95  ? 505  TYR A O   1 
ATOM   3907  C CB  . TYR A  1 536  ? 204.940 213.918 275.968 1.00 40.95  ? 505  TYR A CB  1 
ATOM   3908  C CG  . TYR A  1 536  ? 204.522 212.545 275.501 1.00 40.95  ? 505  TYR A CG  1 
ATOM   3909  C CD1 . TYR A  1 536  ? 203.356 212.371 274.776 1.00 40.95  ? 505  TYR A CD1 1 
ATOM   3910  C CD2 . TYR A  1 536  ? 205.288 211.427 275.778 1.00 40.95  ? 505  TYR A CD2 1 
ATOM   3911  C CE1 . TYR A  1 536  ? 202.962 211.128 274.339 1.00 40.95  ? 505  TYR A CE1 1 
ATOM   3912  C CE2 . TYR A  1 536  ? 204.899 210.171 275.341 1.00 40.95  ? 505  TYR A CE2 1 
ATOM   3913  C CZ  . TYR A  1 536  ? 203.733 210.032 274.623 1.00 40.95  ? 505  TYR A CZ  1 
ATOM   3914  O OH  . TYR A  1 536  ? 203.330 208.794 274.184 1.00 40.95  ? 505  TYR A OH  1 
ATOM   3915  N N   . GLN A  1 537  ? 206.371 217.064 275.133 1.00 36.68  ? 506  GLN A N   1 
ATOM   3916  C CA  . GLN A  1 537  ? 206.378 218.448 275.572 1.00 36.68  ? 506  GLN A CA  1 
ATOM   3917  C C   . GLN A  1 537  ? 205.683 219.347 274.550 1.00 36.68  ? 506  GLN A C   1 
ATOM   3918  O O   . GLN A  1 537  ? 205.594 219.005 273.371 1.00 36.68  ? 506  GLN A O   1 
ATOM   3919  C CB  . GLN A  1 537  ? 207.810 218.892 275.826 1.00 36.68  ? 506  GLN A CB  1 
ATOM   3920  C CG  . GLN A  1 537  ? 208.432 218.181 277.005 1.00 36.68  ? 506  GLN A CG  1 
ATOM   3921  C CD  . GLN A  1 537  ? 209.860 218.589 277.249 1.00 36.68  ? 506  GLN A CD  1 
ATOM   3922  O OE1 . GLN A  1 537  ? 210.299 219.643 276.805 1.00 36.68  ? 506  GLN A OE1 1 
ATOM   3923  N NE2 . GLN A  1 537  ? 210.589 217.765 277.982 1.00 36.68  ? 506  GLN A NE2 1 
ATOM   3924  N N   . PRO A  1 538  ? 205.187 220.508 274.980 1.00 32.38  ? 507  PRO A N   1 
ATOM   3925  C CA  . PRO A  1 538  ? 204.525 221.425 274.046 1.00 32.38  ? 507  PRO A CA  1 
ATOM   3926  C C   . PRO A  1 538  ? 205.481 222.136 273.101 1.00 32.38  ? 507  PRO A C   1 
ATOM   3927  O O   . PRO A  1 538  ? 206.617 222.456 273.449 1.00 32.38  ? 507  PRO A O   1 
ATOM   3928  C CB  . PRO A  1 538  ? 203.832 222.421 274.979 1.00 32.38  ? 507  PRO A CB  1 
ATOM   3929  C CG  . PRO A  1 538  ? 204.645 222.395 276.207 1.00 32.38  ? 507  PRO A CG  1 
ATOM   3930  C CD  . PRO A  1 538  ? 205.097 220.990 276.367 1.00 32.38  ? 507  PRO A CD  1 
ATOM   3931  N N   . TYR A  1 539  ? 204.985 222.409 271.895 1.00 29.60  ? 508  TYR A N   1 
ATOM   3932  C CA  . TYR A  1 539  ? 205.705 223.163 270.879 1.00 29.60  ? 508  TYR A CA  1 
ATOM   3933  C C   . TYR A  1 539  ? 204.782 224.222 270.299 1.00 29.60  ? 508  TYR A C   1 
ATOM   3934  O O   . TYR A  1 539  ? 203.625 223.932 269.982 1.00 29.60  ? 508  TYR A O   1 
ATOM   3935  C CB  . TYR A  1 539  ? 206.213 222.236 269.776 1.00 29.60  ? 508  TYR A CB  1 
ATOM   3936  C CG  . TYR A  1 539  ? 207.575 221.657 270.053 1.00 29.60  ? 508  TYR A CG  1 
ATOM   3937  C CD1 . TYR A  1 539  ? 208.681 222.068 269.336 1.00 29.60  ? 508  TYR A CD1 1 
ATOM   3938  C CD2 . TYR A  1 539  ? 207.762 220.725 271.056 1.00 29.60  ? 508  TYR A CD2 1 
ATOM   3939  C CE1 . TYR A  1 539  ? 209.918 221.554 269.592 1.00 29.60  ? 508  TYR A CE1 1 
ATOM   3940  C CE2 . TYR A  1 539  ? 208.995 220.207 271.319 1.00 29.60  ? 508  TYR A CE2 1 
ATOM   3941  C CZ  . TYR A  1 539  ? 210.071 220.626 270.584 1.00 29.60  ? 508  TYR A CZ  1 
ATOM   3942  O OH  . TYR A  1 539  ? 211.314 220.104 270.844 1.00 29.60  ? 508  TYR A OH  1 
ATOM   3943  N N   . ARG A  1 540  ? 205.293 225.443 270.163 1.00 28.15  ? 509  ARG A N   1 
ATOM   3944  C CA  . ARG A  1 540  ? 204.584 226.533 269.509 1.00 28.15  ? 509  ARG A CA  1 
ATOM   3945  C C   . ARG A  1 540  ? 204.948 226.601 268.030 1.00 28.15  ? 509  ARG A C   1 
ATOM   3946  O O   . ARG A  1 540  ? 206.133 226.555 267.681 1.00 28.15  ? 509  ARG A O   1 
ATOM   3947  C CB  . ARG A  1 540  ? 204.915 227.847 270.209 1.00 28.15  ? 509  ARG A CB  1 
ATOM   3948  C CG  . ARG A  1 540  ? 204.032 228.128 271.397 1.00 28.15  ? 509  ARG A CG  1 
ATOM   3949  C CD  . ARG A  1 540  ? 204.518 229.279 272.238 1.00 28.15  ? 509  ARG A CD  1 
ATOM   3950  N NE  . ARG A  1 540  ? 203.658 229.444 273.403 1.00 28.15  ? 509  ARG A NE  1 
ATOM   3951  C CZ  . ARG A  1 540  ? 203.486 230.582 274.063 1.00 28.15  ? 509  ARG A CZ  1 
ATOM   3952  N NH1 . ARG A  1 540  ? 204.131 231.674 273.690 1.00 28.15  ? 509  ARG A NH1 1 
ATOM   3953  N NH2 . ARG A  1 540  ? 202.675 230.622 275.107 1.00 28.15  ? 509  ARG A NH2 1 
ATOM   3954  N N   . VAL A  1 541  ? 203.933 226.696 267.162 1.00 24.75  ? 510  VAL A N   1 
ATOM   3955  C CA  . VAL A  1 541  ? 204.116 226.628 265.716 1.00 24.75  ? 510  VAL A CA  1 
ATOM   3956  C C   . VAL A  1 541  ? 203.472 227.839 265.053 1.00 24.75  ? 510  VAL A C   1 
ATOM   3957  O O   . VAL A  1 541  ? 202.298 228.147 265.311 1.00 24.75  ? 510  VAL A O   1 
ATOM   3958  C CB  . VAL A  1 541  ? 203.521 225.337 265.124 1.00 24.75  ? 510  VAL A CB  1 
ATOM   3959  C CG1 . VAL A  1 541  ? 203.781 225.263 263.635 1.00 24.75  ? 510  VAL A CG1 1 
ATOM   3960  C CG2 . VAL A  1 541  ? 204.076 224.121 265.821 1.00 24.75  ? 510  VAL A CG2 1 
ATOM   3961  N N   . VAL A  1 542  ? 204.239 228.500 264.178 1.00 26.27  ? 511  VAL A N   1 
ATOM   3962  C CA  . VAL A  1 542  ? 203.788 229.598 263.328 1.00 26.27  ? 511  VAL A CA  1 
ATOM   3963  C C   . VAL A  1 542  ? 204.049 229.212 261.875 1.00 26.27  ? 511  VAL A C   1 
ATOM   3964  O O   . VAL A  1 542  ? 205.163 228.808 261.524 1.00 26.27  ? 511  VAL A O   1 
ATOM   3965  C CB  . VAL A  1 542  ? 204.516 230.911 263.670 1.00 26.27  ? 511  VAL A CB  1 
ATOM   3966  C CG1 . VAL A  1 542  ? 204.172 231.989 262.675 1.00 26.27  ? 511  VAL A CG1 1 
ATOM   3967  C CG2 . VAL A  1 542  ? 204.188 231.359 265.074 1.00 26.27  ? 511  VAL A CG2 1 
ATOM   3968  N N   . VAL A  1 543  ? 203.033 229.348 261.030 1.00 27.00  ? 512  VAL A N   1 
ATOM   3969  C CA  . VAL A  1 543  ? 203.154 229.119 259.592 1.00 27.00  ? 512  VAL A CA  1 
ATOM   3970  C C   . VAL A  1 543  ? 202.934 230.443 258.868 1.00 27.00  ? 512  VAL A C   1 
ATOM   3971  O O   . VAL A  1 543  ? 201.878 231.065 259.014 1.00 27.00  ? 512  VAL A O   1 
ATOM   3972  C CB  . VAL A  1 543  ? 202.171 228.047 259.103 1.00 27.00  ? 512  VAL A CB  1 
ATOM   3973  C CG1 . VAL A  1 543  ? 202.338 227.816 257.625 1.00 27.00  ? 512  VAL A CG1 1 
ATOM   3974  C CG2 . VAL A  1 543  ? 202.378 226.762 259.860 1.00 27.00  ? 512  VAL A CG2 1 
ATOM   3975  N N   . LEU A  1 544  ? 203.926 230.878 258.095 1.00 28.50  ? 513  LEU A N   1 
ATOM   3976  C CA  . LEU A  1 544  ? 203.838 232.097 257.303 1.00 28.50  ? 513  LEU A CA  1 
ATOM   3977  C C   . LEU A  1 544  ? 203.542 231.741 255.855 1.00 28.50  ? 513  LEU A C   1 
ATOM   3978  O O   . LEU A  1 544  ? 204.256 230.932 255.256 1.00 28.50  ? 513  LEU A O   1 
ATOM   3979  C CB  . LEU A  1 544  ? 205.135 232.898 257.378 1.00 28.50  ? 513  LEU A CB  1 
ATOM   3980  C CG  . LEU A  1 544  ? 205.643 233.364 258.738 1.00 28.50  ? 513  LEU A CG  1 
ATOM   3981  C CD1 . LEU A  1 544  ? 206.971 234.040 258.552 1.00 28.50  ? 513  LEU A CD1 1 
ATOM   3982  C CD2 . LEU A  1 544  ? 204.668 234.303 259.393 1.00 28.50  ? 513  LEU A CD2 1 
ATOM   3983  N N   . SER A  1 545  ? 202.493 232.350 255.304 1.00 32.47  ? 514  SER A N   1 
ATOM   3984  C CA  . SER A  1 545  ? 202.020 232.103 253.947 1.00 32.47  ? 514  SER A CA  1 
ATOM   3985  C C   . SER A  1 545  ? 202.011 233.396 253.142 1.00 32.47  ? 514  SER A C   1 
ATOM   3986  O O   . SER A  1 545  ? 201.495 234.413 253.614 1.00 32.47  ? 514  SER A O   1 
ATOM   3987  C CB  . SER A  1 545  ? 200.618 231.496 253.989 1.00 32.47  ? 514  SER A CB  1 
ATOM   3988  O OG  . SER A  1 545  ? 199.955 231.646 252.753 1.00 32.47  ? 514  SER A OG  1 
ATOM   3989  N N   . PHE A  1 546  ? 202.581 233.363 251.933 1.00 33.53  ? 515  PHE A N   1 
ATOM   3990  C CA  . PHE A  1 546  ? 202.666 234.554 251.092 1.00 33.53  ? 515  PHE A CA  1 
ATOM   3991  C C   . PHE A  1 546  ? 202.760 234.165 249.617 1.00 33.53  ? 515  PHE A C   1 
ATOM   3992  O O   . PHE A  1 546  ? 202.738 232.987 249.258 1.00 33.53  ? 515  PHE A O   1 
ATOM   3993  C CB  . PHE A  1 546  ? 203.841 235.444 251.519 1.00 33.53  ? 515  PHE A CB  1 
ATOM   3994  C CG  . PHE A  1 546  ? 205.135 234.706 251.727 1.00 33.53  ? 515  PHE A CG  1 
ATOM   3995  C CD1 . PHE A  1 546  ? 205.643 234.531 253.002 1.00 33.53  ? 515  PHE A CD1 1 
ATOM   3996  C CD2 . PHE A  1 546  ? 205.855 234.213 250.658 1.00 33.53  ? 515  PHE A CD2 1 
ATOM   3997  C CE1 . PHE A  1 546  ? 206.825 233.867 253.203 1.00 33.53  ? 515  PHE A CE1 1 
ATOM   3998  C CE2 . PHE A  1 546  ? 207.038 233.550 250.858 1.00 33.53  ? 515  PHE A CE2 1 
ATOM   3999  C CZ  . PHE A  1 546  ? 207.523 233.378 252.130 1.00 33.53  ? 515  PHE A CZ  1 
ATOM   4000  N N   . GLU A  1 547  ? 202.810 235.190 248.758 1.00 40.29  ? 516  GLU A N   1 
ATOM   4001  C CA  . GLU A  1 547  ? 202.968 235.064 247.311 1.00 40.29  ? 516  GLU A CA  1 
ATOM   4002  C C   . GLU A  1 547  ? 204.091 235.978 246.833 1.00 40.29  ? 516  GLU A C   1 
ATOM   4003  O O   . GLU A  1 547  ? 204.401 236.984 247.475 1.00 40.29  ? 516  GLU A O   1 
ATOM   4004  C CB  . GLU A  1 547  ? 201.685 235.408 246.568 1.00 40.29  ? 516  GLU A CB  1 
ATOM   4005  C CG  . GLU A  1 547  ? 200.649 234.315 246.603 1.00 40.29  ? 516  GLU A CG  1 
ATOM   4006  C CD  . GLU A  1 547  ? 199.241 234.846 246.469 1.00 40.29  ? 516  GLU A CD  1 
ATOM   4007  O OE1 . GLU A  1 547  ? 199.075 236.081 246.429 1.00 40.29  ? 516  GLU A OE1 1 
ATOM   4008  O OE2 . GLU A  1 547  ? 198.300 234.029 246.410 1.00 40.29  ? 516  GLU A OE2 1 
ATOM   4009  N N   . LEU A  1 548  ? 204.699 235.635 245.695 1.00 40.93  ? 517  LEU A N   1 
ATOM   4010  C CA  . LEU A  1 548  ? 205.883 236.335 245.200 1.00 40.93  ? 517  LEU A CA  1 
ATOM   4011  C C   . LEU A  1 548  ? 205.736 236.761 243.743 1.00 40.93  ? 517  LEU A C   1 
ATOM   4012  O O   . LEU A  1 548  ? 205.359 235.957 242.887 1.00 40.93  ? 517  LEU A O   1 
ATOM   4013  C CB  . LEU A  1 548  ? 207.135 235.461 245.350 1.00 40.93  ? 517  LEU A CB  1 
ATOM   4014  C CG  . LEU A  1 548  ? 207.608 235.079 246.752 1.00 40.93  ? 517  LEU A CG  1 
ATOM   4015  C CD1 . LEU A  1 548  ? 208.914 234.334 246.688 1.00 40.93  ? 517  LEU A CD1 1 
ATOM   4016  C CD2 . LEU A  1 548  ? 207.767 236.315 247.602 1.00 40.93  ? 517  LEU A CD2 1 
ATOM   4017  N N   . LEU A  1 549  ? 206.066 238.030 243.477 1.00 44.54  ? 518  LEU A N   1 
ATOM   4018  C CA  . LEU A  1 549  ? 206.370 238.556 242.137 1.00 44.54  ? 518  LEU A CA  1 
ATOM   4019  C C   . LEU A  1 549  ? 205.221 238.454 241.132 1.00 44.54  ? 518  LEU A C   1 
ATOM   4020  O O   . LEU A  1 549  ? 205.446 238.236 239.942 1.00 44.54  ? 518  LEU A O   1 
ATOM   4021  C CB  . LEU A  1 549  ? 207.620 237.885 241.564 1.00 44.54  ? 518  LEU A CB  1 
ATOM   4022  C CG  . LEU A  1 549  ? 208.887 237.972 242.410 1.00 44.54  ? 518  LEU A CG  1 
ATOM   4023  C CD1 . LEU A  1 549  ? 210.003 237.139 241.800 1.00 44.54  ? 518  LEU A CD1 1 
ATOM   4024  C CD2 . LEU A  1 549  ? 209.297 239.415 242.572 1.00 44.54  ? 518  LEU A CD2 1 
ATOM   4025  N N   . HIS A  1 550  ? 203.996 238.628 241.583 1.00 47.97  ? 519  HIS A N   1 
ATOM   4026  C CA  . HIS A  1 550  ? 202.912 238.639 240.600 1.00 47.97  ? 519  HIS A CA  1 
ATOM   4027  C C   . HIS A  1 550  ? 201.982 239.836 240.729 1.00 47.97  ? 519  HIS A C   1 
ATOM   4028  O O   . HIS A  1 550  ? 201.499 240.339 239.713 1.00 47.97  ? 519  HIS A O   1 
ATOM   4029  C CB  . HIS A  1 550  ? 202.090 237.348 240.680 1.00 47.97  ? 519  HIS A CB  1 
ATOM   4030  C CG  . HIS A  1 550  ? 202.793 236.154 240.120 1.00 47.97  ? 519  HIS A CG  1 
ATOM   4031  N ND1 . HIS A  1 550  ? 203.110 236.040 238.785 1.00 47.97  ? 519  HIS A ND1 1 
ATOM   4032  C CD2 . HIS A  1 550  ? 203.238 235.021 240.711 1.00 47.97  ? 519  HIS A CD2 1 
ATOM   4033  C CE1 . HIS A  1 550  ? 203.728 234.892 238.577 1.00 47.97  ? 519  HIS A CE1 1 
ATOM   4034  N NE2 . HIS A  1 550  ? 203.816 234.253 239.730 1.00 47.97  ? 519  HIS A NE2 1 
ATOM   4035  N N   . ALA A  1 551  ? 201.729 240.305 241.940 1.00 43.09  ? 520  ALA A N   1 
ATOM   4036  C CA  . ALA A  1 551  ? 200.769 241.347 242.260 1.00 43.09  ? 520  ALA A CA  1 
ATOM   4037  C C   . ALA A  1 551  ? 201.471 242.413 243.082 1.00 43.09  ? 520  ALA A C   1 
ATOM   4038  O O   . ALA A  1 551  ? 202.586 242.192 243.565 1.00 43.09  ? 520  ALA A O   1 
ATOM   4039  C CB  . ALA A  1 551  ? 199.573 240.768 243.029 1.00 43.09  ? 520  ALA A CB  1 
ATOM   4040  N N   . PRO A  1 552  ? 200.875 243.598 243.224 1.00 41.74  ? 521  PRO A N   1 
ATOM   4041  C CA  . PRO A  1 552  ? 201.486 244.616 244.088 1.00 41.74  ? 521  PRO A CA  1 
ATOM   4042  C C   . PRO A  1 552  ? 201.650 244.118 245.516 1.00 41.74  ? 521  PRO A C   1 
ATOM   4043  O O   . PRO A  1 552  ? 200.788 243.426 246.060 1.00 41.74  ? 521  PRO A O   1 
ATOM   4044  C CB  . PRO A  1 552  ? 200.503 245.788 244.008 1.00 41.74  ? 521  PRO A CB  1 
ATOM   4045  C CG  . PRO A  1 552  ? 199.265 245.225 243.416 1.00 41.74  ? 521  PRO A CG  1 
ATOM   4046  C CD  . PRO A  1 552  ? 199.702 244.131 242.519 1.00 41.74  ? 521  PRO A CD  1 
ATOM   4047  N N   . ALA A  1 553  ? 202.773 244.492 246.125 1.00 44.26  ? 522  ALA A N   1 
ATOM   4048  C CA  . ALA A  1 553  ? 203.171 244.000 247.432 1.00 44.26  ? 522  ALA A CA  1 
ATOM   4049  C C   . ALA A  1 553  ? 203.350 245.160 248.396 1.00 44.26  ? 522  ALA A C   1 
ATOM   4050  O O   . ALA A  1 553  ? 203.528 246.310 247.991 1.00 44.26  ? 522  ALA A O   1 
ATOM   4051  C CB  . ALA A  1 553  ? 204.468 243.195 247.349 1.00 44.26  ? 522  ALA A CB  1 
ATOM   4052  N N   . THR A  1 554  ? 203.313 244.842 249.688 1.00 49.05  ? 523  THR A N   1 
ATOM   4053  C CA  . THR A  1 554  ? 203.424 245.862 250.716 1.00 49.05  ? 523  THR A CA  1 
ATOM   4054  C C   . THR A  1 554  ? 204.364 245.544 251.874 1.00 49.05  ? 523  THR A C   1 
ATOM   4055  O O   . THR A  1 554  ? 204.578 246.428 252.708 1.00 49.05  ? 523  THR A O   1 
ATOM   4056  C CB  . THR A  1 554  ? 202.033 246.187 251.281 1.00 49.05  ? 523  THR A CB  1 
ATOM   4057  O OG1 . THR A  1 554  ? 202.115 247.332 252.131 1.00 49.05  ? 523  THR A OG1 1 
ATOM   4058  C CG2 . THR A  1 554  ? 201.483 245.021 252.061 1.00 49.05  ? 523  THR A CG2 1 
ATOM   4059  N N   . VAL A  1 555  ? 204.915 244.333 251.977 1.00 48.34  ? 524  VAL A N   1 
ATOM   4060  C CA  . VAL A  1 555  ? 205.786 244.028 253.111 1.00 48.34  ? 524  VAL A CA  1 
ATOM   4061  C C   . VAL A  1 555  ? 207.234 244.422 252.831 1.00 48.34  ? 524  VAL A C   1 
ATOM   4062  O O   . VAL A  1 555  ? 207.776 245.297 253.510 1.00 48.34  ? 524  VAL A O   1 
ATOM   4063  C CB  . VAL A  1 555  ? 205.662 242.553 253.517 1.00 48.34  ? 524  VAL A CB  1 
ATOM   4064  C CG1 . VAL A  1 555  ? 206.676 242.221 254.575 1.00 48.34  ? 524  VAL A CG1 1 
ATOM   4065  C CG2 . VAL A  1 555  ? 204.281 242.308 254.057 1.00 48.34  ? 524  VAL A CG2 1 
ATOM   4066  N N   . CYS A  1 556  ? 207.873 243.805 251.835 1.00 50.70  ? 525  CYS A N   1 
ATOM   4067  C CA  . CYS A  1 556  ? 209.135 244.335 251.312 1.00 50.70  ? 525  CYS A CA  1 
ATOM   4068  C C   . CYS A  1 556  ? 210.276 244.451 252.317 1.00 50.70  ? 525  CYS A C   1 
ATOM   4069  O O   . CYS A  1 556  ? 210.450 245.507 252.928 1.00 50.70  ? 525  CYS A O   1 
ATOM   4070  C CB  . CYS A  1 556  ? 208.911 245.702 250.671 1.00 50.70  ? 525  CYS A CB  1 
ATOM   4071  S SG  . CYS A  1 556  ? 209.117 245.679 248.883 1.00 50.70  ? 525  CYS A SG  1 
ATOM   4072  N N   . GLY A  1 557  ? 211.043 243.379 252.510 1.00 51.55  ? 526  GLY A N   1 
ATOM   4073  C CA  . GLY A  1 557  ? 212.130 243.347 253.467 1.00 51.55  ? 526  GLY A CA  1 
ATOM   4074  C C   . GLY A  1 557  ? 213.161 244.461 253.353 1.00 51.55  ? 526  GLY A C   1 
ATOM   4075  O O   . GLY A  1 557  ? 213.145 245.271 252.424 1.00 51.55  ? 526  GLY A O   1 
ATOM   4076  N N   . PRO A  1 558  ? 214.105 244.498 254.306 1.00 53.39  ? 527  PRO A N   1 
ATOM   4077  C CA  . PRO A  1 558  ? 215.047 245.624 254.403 1.00 53.39  ? 527  PRO A CA  1 
ATOM   4078  C C   . PRO A  1 558  ? 216.049 245.758 253.270 1.00 53.39  ? 527  PRO A C   1 
ATOM   4079  O O   . PRO A  1 558  ? 216.972 244.948 253.153 1.00 53.39  ? 527  PRO A O   1 
ATOM   4080  C CB  . PRO A  1 558  ? 215.779 245.333 255.716 1.00 53.39  ? 527  PRO A CB  1 
ATOM   4081  C CG  . PRO A  1 558  ? 215.756 243.853 255.809 1.00 53.39  ? 527  PRO A CG  1 
ATOM   4082  C CD  . PRO A  1 558  ? 214.415 243.445 255.286 1.00 53.39  ? 527  PRO A CD  1 
ATOM   4083  N N   . LYS A  1 559  ? 215.902 246.793 252.447 1.00 53.45  ? 528  LYS A N   1 
ATOM   4084  C CA  . LYS A  1 559  ? 216.871 247.052 251.392 1.00 53.45  ? 528  LYS A CA  1 
ATOM   4085  C C   . LYS A  1 559  ? 216.672 248.485 250.922 1.00 53.45  ? 528  LYS A C   1 
ATOM   4086  O O   . LYS A  1 559  ? 215.538 248.897 250.661 1.00 53.45  ? 528  LYS A O   1 
ATOM   4087  C CB  . LYS A  1 559  ? 216.694 246.046 250.250 1.00 53.45  ? 528  LYS A CB  1 
ATOM   4088  C CG  . LYS A  1 559  ? 217.781 246.054 249.208 1.00 53.45  ? 528  LYS A CG  1 
ATOM   4089  C CD  . LYS A  1 559  ? 217.655 244.842 248.314 1.00 53.45  ? 528  LYS A CD  1 
ATOM   4090  C CE  . LYS A  1 559  ? 218.713 244.839 247.233 1.00 53.45  ? 528  LYS A CE  1 
ATOM   4091  N NZ  . LYS A  1 559  ? 220.082 244.779 247.810 1.00 53.45  ? 528  LYS A NZ  1 
ATOM   4092  N N   . LYS A  1 560  ? 217.765 249.234 250.809 1.00 56.89  ? 529  LYS A N   1 
ATOM   4093  C CA  . LYS A  1 560  ? 217.684 250.662 250.529 1.00 56.89  ? 529  LYS A CA  1 
ATOM   4094  C C   . LYS A  1 560  ? 217.451 250.936 249.049 1.00 56.89  ? 529  LYS A C   1 
ATOM   4095  O O   . LYS A  1 560  ? 218.056 250.304 248.180 1.00 56.89  ? 529  LYS A O   1 
ATOM   4096  C CB  . LYS A  1 560  ? 218.950 251.377 250.998 1.00 56.89  ? 529  LYS A CB  1 
ATOM   4097  C CG  . LYS A  1 560  ? 219.209 251.269 252.488 1.00 56.89  ? 529  LYS A CG  1 
ATOM   4098  C CD  . LYS A  1 560  ? 220.500 251.974 252.865 1.00 56.89  ? 529  LYS A CD  1 
ATOM   4099  C CE  . LYS A  1 560  ? 220.768 251.889 254.359 1.00 56.89  ? 529  LYS A CE  1 
ATOM   4100  N NZ  . LYS A  1 560  ? 221.031 250.494 254.806 1.00 56.89  ? 529  LYS A NZ  1 
ATOM   4101  N N   . SER A  1 561  ? 216.577 251.897 248.774 1.00 52.00  ? 530  SER A N   1 
ATOM   4102  C CA  . SER A  1 561  ? 216.225 252.298 247.420 1.00 52.00  ? 530  SER A CA  1 
ATOM   4103  C C   . SER A  1 561  ? 217.162 253.387 246.909 1.00 52.00  ? 530  SER A C   1 
ATOM   4104  O O   . SER A  1 561  ? 217.664 254.212 247.673 1.00 52.00  ? 530  SER A O   1 
ATOM   4105  C CB  . SER A  1 561  ? 214.781 252.798 247.362 1.00 52.00  ? 530  SER A CB  1 
ATOM   4106  O OG  . SER A  1 561  ? 213.858 251.731 247.482 1.00 52.00  ? 530  SER A OG  1 
ATOM   4107  N N   . THR A  1 562  ? 217.396 253.377 245.601 1.00 52.55  ? 531  THR A N   1 
ATOM   4108  C CA  . THR A  1 562  ? 218.245 254.347 244.930 1.00 52.55  ? 531  THR A CA  1 
ATOM   4109  C C   . THR A  1 562  ? 217.383 255.272 244.068 1.00 52.55  ? 531  THR A C   1 
ATOM   4110  O O   . THR A  1 562  ? 216.150 255.237 244.121 1.00 52.55  ? 531  THR A O   1 
ATOM   4111  C CB  . THR A  1 562  ? 219.309 253.636 244.089 1.00 52.55  ? 531  THR A CB  1 
ATOM   4112  O OG1 . THR A  1 562  ? 218.713 253.154 242.883 1.00 52.55  ? 531  THR A OG1 1 
ATOM   4113  C CG2 . THR A  1 562  ? 219.894 252.463 244.836 1.00 52.55  ? 531  THR A CG2 1 
ATOM   4114  N N   . ASN A  1 563  ? 218.037 256.124 243.285 1.00 57.04  ? 532  ASN A N   1 
ATOM   4115  C CA  . ASN A  1 563  ? 217.338 257.006 242.364 1.00 57.04  ? 532  ASN A CA  1 
ATOM   4116  C C   . ASN A  1 563  ? 216.992 256.281 241.067 1.00 57.04  ? 532  ASN A C   1 
ATOM   4117  O O   . ASN A  1 563  ? 217.595 255.267 240.709 1.00 57.04  ? 532  ASN A O   1 
ATOM   4118  C CB  . ASN A  1 563  ? 218.177 258.244 242.055 1.00 57.04  ? 532  ASN A CB  1 
ATOM   4119  C CG  . ASN A  1 563  ? 218.054 259.308 243.120 1.00 57.04  ? 532  ASN A CG  1 
ATOM   4120  O OD1 . ASN A  1 563  ? 217.052 260.017 243.190 1.00 57.04  ? 532  ASN A OD1 1 
ATOM   4121  N ND2 . ASN A  1 563  ? 219.076 259.428 243.956 1.00 57.04  ? 532  ASN A ND2 1 
ATOM   4122  N N   . LEU A  1 564  ? 215.998 256.815 240.363 1.00 56.04  ? 533  LEU A N   1 
ATOM   4123  C CA  . LEU A  1 564  ? 215.556 256.259 239.090 1.00 56.04  ? 533  LEU A CA  1 
ATOM   4124  C C   . LEU A  1 564  ? 216.296 256.938 237.944 1.00 56.04  ? 533  LEU A C   1 
ATOM   4125  O O   . LEU A  1 564  ? 216.207 258.159 237.779 1.00 56.04  ? 533  LEU A O   1 
ATOM   4126  C CB  . LEU A  1 564  ? 214.050 256.447 238.927 1.00 56.04  ? 533  LEU A CB  1 
ATOM   4127  C CG  . LEU A  1 564  ? 213.385 255.897 237.669 1.00 56.04  ? 533  LEU A CG  1 
ATOM   4128  C CD1 . LEU A  1 564  ? 213.484 254.387 237.638 1.00 56.04  ? 533  LEU A CD1 1 
ATOM   4129  C CD2 . LEU A  1 564  ? 211.939 256.343 237.605 1.00 56.04  ? 533  LEU A CD2 1 
ATOM   4130  N N   . VAL A  1 565  ? 217.030 256.152 237.160 1.00 56.48  ? 534  VAL A N   1 
ATOM   4131  C CA  . VAL A  1 565  ? 217.792 256.649 236.021 1.00 56.48  ? 534  VAL A CA  1 
ATOM   4132  C C   . VAL A  1 565  ? 217.250 256.013 234.747 1.00 56.48  ? 534  VAL A C   1 
ATOM   4133  O O   . VAL A  1 565  ? 216.987 254.807 234.707 1.00 56.48  ? 534  VAL A O   1 
ATOM   4134  C CB  . VAL A  1 565  ? 219.303 256.381 236.192 1.00 56.48  ? 534  VAL A CB  1 
ATOM   4135  C CG1 . VAL A  1 565  ? 219.563 254.918 236.446 1.00 56.48  ? 534  VAL A CG1 1 
ATOM   4136  C CG2 . VAL A  1 565  ? 220.064 256.837 234.964 1.00 56.48  ? 534  VAL A CG2 1 
ATOM   4137  N N   . LYS A  1 566  ? 217.065 256.830 233.713 1.00 54.49  ? 535  LYS A N   1 
ATOM   4138  C CA  . LYS A  1 566  ? 216.381 256.420 232.496 1.00 54.49  ? 535  LYS A CA  1 
ATOM   4139  C C   . LYS A  1 566  ? 217.297 256.533 231.283 1.00 54.49  ? 535  LYS A C   1 
ATOM   4140  O O   . LYS A  1 566  ? 218.304 257.247 231.295 1.00 54.49  ? 535  LYS A O   1 
ATOM   4141  C CB  . LYS A  1 566  ? 215.112 257.240 232.245 1.00 54.49  ? 535  LYS A CB  1 
ATOM   4142  C CG  . LYS A  1 566  ? 214.058 257.115 233.308 1.00 54.49  ? 535  LYS A CG  1 
ATOM   4143  C CD  . LYS A  1 566  ? 212.932 258.082 233.040 1.00 54.49  ? 535  LYS A CD  1 
ATOM   4144  C CE  . LYS A  1 566  ? 211.914 258.066 234.157 1.00 54.49  ? 535  LYS A CE  1 
ATOM   4145  N NZ  . LYS A  1 566  ? 210.840 259.064 233.928 1.00 54.49  ? 535  LYS A NZ  1 
ATOM   4146  N N   . ASN A  1 567  ? 216.926 255.799 230.233 1.00 50.80  ? 536  ASN A N   1 
ATOM   4147  C CA  . ASN A  1 567  ? 217.591 255.817 228.933 1.00 50.80  ? 536  ASN A CA  1 
ATOM   4148  C C   . ASN A  1 567  ? 219.026 255.303 228.977 1.00 50.80  ? 536  ASN A C   1 
ATOM   4149  O O   . ASN A  1 567  ? 219.835 255.645 228.111 1.00 50.80  ? 536  ASN A O   1 
ATOM   4150  C CB  . ASN A  1 567  ? 217.548 257.218 228.318 1.00 50.80  ? 536  ASN A CB  1 
ATOM   4151  C CG  . ASN A  1 567  ? 216.136 257.698 228.071 1.00 50.80  ? 536  ASN A CG  1 
ATOM   4152  O OD1 . ASN A  1 567  ? 215.532 257.378 227.051 1.00 50.80  ? 536  ASN A OD1 1 
ATOM   4153  N ND2 . ASN A  1 567  ? 215.605 258.475 229.000 1.00 50.80  ? 536  ASN A ND2 1 
ATOM   4154  N N   . LYS A  1 568  ? 219.367 254.484 229.966 1.00 53.53  ? 537  LYS A N   1 
ATOM   4155  C CA  . LYS A  1 568  ? 220.676 253.854 230.041 1.00 53.53  ? 537  LYS A CA  1 
ATOM   4156  C C   . LYS A  1 568  ? 220.477 252.391 230.401 1.00 53.53  ? 537  LYS A C   1 
ATOM   4157  O O   . LYS A  1 568  ? 219.528 252.048 231.107 1.00 53.53  ? 537  LYS A O   1 
ATOM   4158  C CB  . LYS A  1 568  ? 221.571 254.531 231.085 1.00 53.53  ? 537  LYS A CB  1 
ATOM   4159  C CG  . LYS A  1 568  ? 221.971 255.950 230.734 1.00 53.53  ? 537  LYS A CG  1 
ATOM   4160  C CD  . LYS A  1 568  ? 222.760 256.596 231.855 1.00 53.53  ? 537  LYS A CD  1 
ATOM   4161  C CE  . LYS A  1 568  ? 224.068 255.868 232.101 1.00 53.53  ? 537  LYS A CE  1 
ATOM   4162  N NZ  . LYS A  1 568  ? 224.854 256.499 233.199 1.00 53.53  ? 537  LYS A NZ  1 
ATOM   4163  N N   . CYS A  1 569  ? 221.368 251.526 229.918 1.00 52.53  ? 538  CYS A N   1 
ATOM   4164  C CA  . CYS A  1 569  ? 221.289 250.124 230.312 1.00 52.53  ? 538  CYS A CA  1 
ATOM   4165  C C   . CYS A  1 569  ? 221.749 250.012 231.760 1.00 52.53  ? 538  CYS A C   1 
ATOM   4166  O O   . CYS A  1 569  ? 222.890 250.353 232.087 1.00 52.53  ? 538  CYS A O   1 
ATOM   4167  C CB  . CYS A  1 569  ? 222.127 249.239 229.387 1.00 52.53  ? 538  CYS A CB  1 
ATOM   4168  S SG  . CYS A  1 569  ? 221.633 247.477 229.428 1.00 52.53  ? 538  CYS A SG  1 
ATOM   4169  N N   . VAL A  1 570  ? 220.863 249.524 232.624 1.00 48.94  ? 539  VAL A N   1 
ATOM   4170  C CA  . VAL A  1 570  ? 221.090 249.479 234.063 1.00 48.94  ? 539  VAL A CA  1 
ATOM   4171  C C   . VAL A  1 570  ? 220.488 248.210 234.639 1.00 48.94  ? 539  VAL A C   1 
ATOM   4172  O O   . VAL A  1 570  ? 219.466 247.719 234.142 1.00 48.94  ? 539  VAL A O   1 
ATOM   4173  C CB  . VAL A  1 570  ? 220.487 250.700 234.792 1.00 48.94  ? 539  VAL A CB  1 
ATOM   4174  C CG1 . VAL A  1 570  ? 221.266 251.963 234.492 1.00 48.94  ? 539  VAL A CG1 1 
ATOM   4175  C CG2 . VAL A  1 570  ? 219.031 250.868 234.432 1.00 48.94  ? 539  VAL A CG2 1 
ATOM   4176  N N   . ASN A  1 571  ? 221.230 247.583 235.549 1.00 47.41  ? 540  ASN A N   1 
ATOM   4177  C CA  . ASN A  1 571  ? 220.671 246.506 236.352 1.00 47.41  ? 540  ASN A CA  1 
ATOM   4178  C C   . ASN A  1 571  ? 219.598 247.110 237.250 1.00 47.41  ? 540  ASN A C   1 
ATOM   4179  O O   . ASN A  1 571  ? 219.789 248.188 237.815 1.00 47.41  ? 540  ASN A O   1 
ATOM   4180  C CB  . ASN A  1 571  ? 221.749 245.843 237.205 1.00 47.41  ? 540  ASN A CB  1 
ATOM   4181  C CG  . ASN A  1 571  ? 222.805 245.141 236.385 1.00 47.41  ? 540  ASN A CG  1 
ATOM   4182  O OD1 . ASN A  1 571  ? 223.992 245.417 236.525 1.00 47.41  ? 540  ASN A OD1 1 
ATOM   4183  N ND2 . ASN A  1 571  ? 222.386 244.204 235.551 1.00 47.41  ? 540  ASN A ND2 1 
ATOM   4184  N N   . PHE A  1 572  ? 218.474 246.422 237.406 1.00 44.09  ? 541  PHE A N   1 
ATOM   4185  C CA  . PHE A  1 572  ? 217.366 246.993 238.159 1.00 44.09  ? 541  PHE A CA  1 
ATOM   4186  C C   . PHE A  1 572  ? 216.723 245.947 239.054 1.00 44.09  ? 541  PHE A C   1 
ATOM   4187  O O   . PHE A  1 572  ? 216.756 244.747 238.768 1.00 44.09  ? 541  PHE A O   1 
ATOM   4188  C CB  . PHE A  1 572  ? 216.317 247.649 237.235 1.00 44.09  ? 541  PHE A CB  1 
ATOM   4189  C CG  . PHE A  1 572  ? 215.668 246.711 236.255 1.00 44.09  ? 541  PHE A CG  1 
ATOM   4190  C CD1 . PHE A  1 572  ? 215.921 246.839 234.907 1.00 44.09  ? 541  PHE A CD1 1 
ATOM   4191  C CD2 . PHE A  1 572  ? 214.773 245.741 236.666 1.00 44.09  ? 541  PHE A CD2 1 
ATOM   4192  C CE1 . PHE A  1 572  ? 215.331 245.996 233.998 1.00 44.09  ? 541  PHE A CE1 1 
ATOM   4193  C CE2 . PHE A  1 572  ? 214.185 244.893 235.761 1.00 44.09  ? 541  PHE A CE2 1 
ATOM   4194  C CZ  . PHE A  1 572  ? 214.462 245.024 234.426 1.00 44.09  ? 541  PHE A CZ  1 
ATOM   4195  N N   . ASN A  1 573  ? 216.162 246.436 240.159 1.00 43.93  ? 542  ASN A N   1 
ATOM   4196  C CA  . ASN A  1 573  ? 215.384 245.640 241.102 1.00 43.93  ? 542  ASN A CA  1 
ATOM   4197  C C   . ASN A  1 573  ? 214.089 246.397 241.370 1.00 43.93  ? 542  ASN A C   1 
ATOM   4198  O O   . ASN A  1 573  ? 214.121 247.507 241.905 1.00 43.93  ? 542  ASN A O   1 
ATOM   4199  C CB  . ASN A  1 573  ? 216.177 245.419 242.389 1.00 43.93  ? 542  ASN A CB  1 
ATOM   4200  C CG  . ASN A  1 573  ? 215.581 244.363 243.274 1.00 43.93  ? 542  ASN A CG  1 
ATOM   4201  O OD1 . ASN A  1 573  ? 214.479 243.892 243.041 1.00 43.93  ? 542  ASN A OD1 1 
ATOM   4202  N ND2 . ASN A  1 573  ? 216.322 243.966 244.292 1.00 43.93  ? 542  ASN A ND2 1 
ATOM   4203  N N   . PHE A  1 574  ? 212.960 245.835 240.939 1.00 44.19  ? 543  PHE A N   1 
ATOM   4204  C CA  . PHE A  1 574  ? 211.634 246.399 241.192 1.00 44.19  ? 543  PHE A CA  1 
ATOM   4205  C C   . PHE A  1 574  ? 210.828 245.419 242.031 1.00 44.19  ? 543  PHE A C   1 
ATOM   4206  O O   . PHE A  1 574  ? 210.402 244.377 241.524 1.00 44.19  ? 543  PHE A O   1 
ATOM   4207  C CB  . PHE A  1 574  ? 210.891 246.693 239.889 1.00 44.19  ? 543  PHE A CB  1 
ATOM   4208  C CG  . PHE A  1 574  ? 211.355 247.925 239.174 1.00 44.19  ? 543  PHE A CG  1 
ATOM   4209  C CD1 . PHE A  1 574  ? 210.731 249.135 239.386 1.00 44.19  ? 543  PHE A CD1 1 
ATOM   4210  C CD2 . PHE A  1 574  ? 212.387 247.865 238.261 1.00 44.19  ? 543  PHE A CD2 1 
ATOM   4211  C CE1 . PHE A  1 574  ? 211.142 250.260 238.721 1.00 44.19  ? 543  PHE A CE1 1 
ATOM   4212  C CE2 . PHE A  1 574  ? 212.801 248.991 237.596 1.00 44.19  ? 543  PHE A CE2 1 
ATOM   4213  C CZ  . PHE A  1 574  ? 212.178 250.187 237.827 1.00 44.19  ? 543  PHE A CZ  1 
ATOM   4214  N N   . ASN A  1 575  ? 210.591 245.760 243.296 1.00 45.97  ? 544  ASN A N   1 
ATOM   4215  C CA  . ASN A  1 575  ? 209.798 244.919 244.196 1.00 45.97  ? 544  ASN A CA  1 
ATOM   4216  C C   . ASN A  1 575  ? 210.289 243.475 244.214 1.00 45.97  ? 544  ASN A C   1 
ATOM   4217  O O   . ASN A  1 575  ? 209.504 242.529 244.263 1.00 45.97  ? 544  ASN A O   1 
ATOM   4218  C CB  . ASN A  1 575  ? 208.318 244.979 243.832 1.00 45.97  ? 544  ASN A CB  1 
ATOM   4219  C CG  . ASN A  1 575  ? 207.668 246.257 244.276 1.00 45.97  ? 544  ASN A CG  1 
ATOM   4220  O OD1 . ASN A  1 575  ? 208.340 247.248 244.524 1.00 45.97  ? 544  ASN A OD1 1 
ATOM   4221  N ND2 . ASN A  1 575  ? 206.350 246.244 244.383 1.00 45.97  ? 544  ASN A ND2 1 
ATOM   4222  N N   . GLY A  1 576  ? 211.604 243.304 244.185 1.00 44.62  ? 545  GLY A N   1 
ATOM   4223  C CA  . GLY A  1 576  ? 212.208 241.996 244.217 1.00 44.62  ? 545  GLY A CA  1 
ATOM   4224  C C   . GLY A  1 576  ? 212.463 241.361 242.870 1.00 44.62  ? 545  GLY A C   1 
ATOM   4225  O O   . GLY A  1 576  ? 213.172 240.350 242.812 1.00 44.62  ? 545  GLY A O   1 
ATOM   4226  N N   . LEU A  1 577  ? 211.915 241.903 241.788 1.00 43.28  ? 546  LEU A N   1 
ATOM   4227  C CA  . LEU A  1 577  ? 212.128 241.348 240.458 1.00 43.28  ? 546  LEU A CA  1 
ATOM   4228  C C   . LEU A  1 577  ? 213.337 242.026 239.824 1.00 43.28  ? 546  LEU A C   1 
ATOM   4229  O O   . LEU A  1 577  ? 213.351 243.249 239.660 1.00 43.28  ? 546  LEU A O   1 
ATOM   4230  C CB  . LEU A  1 577  ? 210.883 241.505 239.590 1.00 43.28  ? 546  LEU A CB  1 
ATOM   4231  C CG  . LEU A  1 577  ? 210.952 240.842 238.215 1.00 43.28  ? 546  LEU A CG  1 
ATOM   4232  C CD1 . LEU A  1 577  ? 209.649 240.162 237.901 1.00 43.28  ? 546  LEU A CD1 1 
ATOM   4233  C CD2 . LEU A  1 577  ? 211.252 241.868 237.142 1.00 43.28  ? 546  LEU A CD2 1 
ATOM   4234  N N   . THR A  1 578  ? 214.347 241.235 239.480 1.00 43.35  ? 547  THR A N   1 
ATOM   4235  C CA  . THR A  1 578  ? 215.637 241.743 239.043 1.00 43.35  ? 547  THR A CA  1 
ATOM   4236  C C   . THR A  1 578  ? 215.822 241.526 237.548 1.00 43.35  ? 547  THR A C   1 
ATOM   4237  O O   . THR A  1 578  ? 215.304 240.568 236.972 1.00 43.35  ? 547  THR A O   1 
ATOM   4238  C CB  . THR A  1 578  ? 216.786 241.073 239.796 1.00 43.35  ? 547  THR A CB  1 
ATOM   4239  O OG1 . THR A  1 578  ? 216.780 239.670 239.523 1.00 43.35  ? 547  THR A OG1 1 
ATOM   4240  C CG2 . THR A  1 578  ? 216.645 241.290 241.283 1.00 43.35  ? 547  THR A CG2 1 
ATOM   4241  N N   . GLY A  1 579  ? 216.569 242.429 236.927 1.00 44.90  ? 548  GLY A N   1 
ATOM   4242  C CA  . GLY A  1 579  ? 216.836 242.296 235.510 1.00 44.90  ? 548  GLY A CA  1 
ATOM   4243  C C   . GLY A  1 579  ? 217.827 243.331 235.034 1.00 44.90  ? 548  GLY A C   1 
ATOM   4244  O O   . GLY A  1 579  ? 218.453 244.029 235.828 1.00 44.90  ? 548  GLY A O   1 
ATOM   4245  N N   . THR A  1 580  ? 217.980 243.404 233.716 1.00 46.88  ? 549  THR A N   1 
ATOM   4246  C CA  . THR A  1 580  ? 218.851 244.375 233.068 1.00 46.88  ? 549  THR A CA  1 
ATOM   4247  C C   . THR A  1 580  ? 218.105 245.017 231.912 1.00 46.88  ? 549  THR A C   1 
ATOM   4248  O O   . THR A  1 580  ? 217.341 244.344 231.217 1.00 46.88  ? 549  THR A O   1 
ATOM   4249  C CB  . THR A  1 580  ? 220.134 243.730 232.542 1.00 46.88  ? 549  THR A CB  1 
ATOM   4250  O OG1 . THR A  1 580  ? 220.616 242.769 233.487 1.00 46.88  ? 549  THR A OG1 1 
ATOM   4251  C CG2 . THR A  1 580  ? 221.196 244.783 232.308 1.00 46.88  ? 549  THR A CG2 1 
ATOM   4252  N N   . GLY A  1 581  ? 218.332 246.304 231.682 1.00 45.79  ? 550  GLY A N   1 
ATOM   4253  C CA  . GLY A  1 581  ? 217.775 246.874 230.469 1.00 45.79  ? 550  GLY A CA  1 
ATOM   4254  C C   . GLY A  1 581  ? 217.689 248.384 230.537 1.00 45.79  ? 550  GLY A C   1 
ATOM   4255  O O   . GLY A  1 581  ? 218.307 249.014 231.386 1.00 45.79  ? 550  GLY A O   1 
ATOM   4256  N N   . VAL A  1 582  ? 216.904 248.936 229.615 1.00 48.39  ? 551  VAL A N   1 
ATOM   4257  C CA  . VAL A  1 582  ? 216.721 250.374 229.467 1.00 48.39  ? 551  VAL A CA  1 
ATOM   4258  C C   . VAL A  1 582  ? 215.279 250.707 229.808 1.00 48.39  ? 551  VAL A C   1 
ATOM   4259  O O   . VAL A  1 582  ? 214.353 250.058 229.307 1.00 48.39  ? 551  VAL A O   1 
ATOM   4260  C CB  . VAL A  1 582  ? 217.051 250.826 228.033 1.00 48.39  ? 551  VAL A CB  1 
ATOM   4261  C CG1 . VAL A  1 582  ? 216.677 252.275 227.821 1.00 48.39  ? 551  VAL A CG1 1 
ATOM   4262  C CG2 . VAL A  1 582  ? 218.506 250.596 227.724 1.00 48.39  ? 551  VAL A CG2 1 
ATOM   4263  N N   . LEU A  1 583  ? 215.090 251.715 230.656 1.00 50.44  ? 552  LEU A N   1 
ATOM   4264  C CA  . LEU A  1 583  ? 213.772 252.122 231.117 1.00 50.44  ? 552  LEU A CA  1 
ATOM   4265  C C   . LEU A  1 583  ? 213.345 253.382 230.379 1.00 50.44  ? 552  LEU A C   1 
ATOM   4266  O O   . LEU A  1 583  ? 214.123 254.333 230.273 1.00 50.44  ? 552  LEU A O   1 
ATOM   4267  C CB  . LEU A  1 583  ? 213.788 252.364 232.626 1.00 50.44  ? 552  LEU A CB  1 
ATOM   4268  C CG  . LEU A  1 583  ? 214.379 251.247 233.495 1.00 50.44  ? 552  LEU A CG  1 
ATOM   4269  C CD1 . LEU A  1 583  ? 214.430 251.672 234.941 1.00 50.44  ? 552  LEU A CD1 1 
ATOM   4270  C CD2 . LEU A  1 583  ? 213.591 249.966 233.355 1.00 50.44  ? 552  LEU A CD2 1 
ATOM   4271  N N   . THR A  1 584  ? 212.118 253.386 229.865 1.00 54.04  ? 553  THR A N   1 
ATOM   4272  C CA  . THR A  1 584  ? 211.577 254.539 229.154 1.00 54.04  ? 553  THR A CA  1 
ATOM   4273  C C   . THR A  1 584  ? 210.151 254.810 229.610 1.00 54.04  ? 553  THR A C   1 
ATOM   4274  O O   . THR A  1 584  ? 209.493 253.945 230.184 1.00 54.04  ? 553  THR A O   1 
ATOM   4275  C CB  . THR A  1 584  ? 211.613 254.347 227.630 1.00 54.04  ? 553  THR A CB  1 
ATOM   4276  O OG1 . THR A  1 584  ? 211.117 253.048 227.292 1.00 54.04  ? 553  THR A OG1 1 
ATOM   4277  C CG2 . THR A  1 584  ? 213.028 254.496 227.104 1.00 54.04  ? 553  THR A CG2 1 
ATOM   4278  N N   . GLU A  1 585  ? 209.679 256.030 229.372 1.00 59.52  ? 554  GLU A N   1 
ATOM   4279  C CA  . GLU A  1 585  ? 208.294 256.362 229.686 1.00 59.52  ? 554  GLU A CA  1 
ATOM   4280  C C   . GLU A  1 585  ? 207.333 255.654 228.737 1.00 59.52  ? 554  GLU A C   1 
ATOM   4281  O O   . GLU A  1 585  ? 207.590 255.539 227.537 1.00 59.52  ? 554  GLU A O   1 
ATOM   4282  C CB  . GLU A  1 585  ? 208.075 257.870 229.636 1.00 59.52  ? 554  GLU A CB  1 
ATOM   4283  C CG  . GLU A  1 585  ? 208.863 258.629 230.683 1.00 59.52  ? 554  GLU A CG  1 
ATOM   4284  C CD  . GLU A  1 585  ? 208.647 260.125 230.606 1.00 59.52  ? 554  GLU A CD  1 
ATOM   4285  O OE1 . GLU A  1 585  ? 207.922 260.577 229.695 1.00 59.52  ? 554  GLU A OE1 1 
ATOM   4286  O OE2 . GLU A  1 585  ? 209.205 260.851 231.455 1.00 59.52  ? 554  GLU A OE2 1 
ATOM   4287  N N   . SER A  1 586  ? 206.218 255.182 229.287 1.00 55.51  ? 555  SER A N   1 
ATOM   4288  C CA  . SER A  1 586  ? 205.265 254.330 228.591 1.00 55.51  ? 555  SER A CA  1 
ATOM   4289  C C   . SER A  1 586  ? 203.901 254.999 228.505 1.00 55.51  ? 555  SER A C   1 
ATOM   4290  O O   . SER A  1 586  ? 203.507 255.760 229.392 1.00 55.51  ? 555  SER A O   1 
ATOM   4291  C CB  . SER A  1 586  ? 205.123 252.979 229.283 1.00 55.51  ? 555  SER A CB  1 
ATOM   4292  O OG  . SER A  1 586  ? 204.131 252.194 228.652 1.00 55.51  ? 555  SER A OG  1 
ATOM   4293  N N   . ASN A  1 587  ? 203.182 254.705 227.423 1.00 58.81  ? 556  ASN A N   1 
ATOM   4294  C CA  . ASN A  1 587  ? 201.810 255.161 227.240 1.00 58.81  ? 556  ASN A CA  1 
ATOM   4295  C C   . ASN A  1 587  ? 200.766 254.161 227.724 1.00 58.81  ? 556  ASN A C   1 
ATOM   4296  O O   . ASN A  1 587  ? 199.572 254.464 227.670 1.00 58.81  ? 556  ASN A O   1 
ATOM   4297  C CB  . ASN A  1 587  ? 201.554 255.473 225.765 1.00 58.81  ? 556  ASN A CB  1 
ATOM   4298  C CG  . ASN A  1 587  ? 202.100 256.818 225.353 1.00 58.81  ? 556  ASN A CG  1 
ATOM   4299  O OD1 . ASN A  1 587  ? 201.571 257.860 225.737 1.00 58.81  ? 556  ASN A OD1 1 
ATOM   4300  N ND2 . ASN A  1 587  ? 203.161 256.805 224.558 1.00 58.81  ? 556  ASN A ND2 1 
ATOM   4301  N N   . LYS A  1 588  ? 201.178 252.975 228.164 1.00 52.23  ? 557  LYS A N   1 
ATOM   4302  C CA  . LYS A  1 588  ? 200.235 251.994 228.682 1.00 52.23  ? 557  LYS A CA  1 
ATOM   4303  C C   . LYS A  1 588  ? 199.566 252.508 229.951 1.00 52.23  ? 557  LYS A C   1 
ATOM   4304  O O   . LYS A  1 588  ? 200.163 253.243 230.739 1.00 52.23  ? 557  LYS A O   1 
ATOM   4305  C CB  . LYS A  1 588  ? 200.944 250.677 228.975 1.00 52.23  ? 557  LYS A CB  1 
ATOM   4306  C CG  . LYS A  1 588  ? 201.376 249.924 227.752 1.00 52.23  ? 557  LYS A CG  1 
ATOM   4307  C CD  . LYS A  1 588  ? 202.518 249.002 228.080 1.00 52.23  ? 557  LYS A CD  1 
ATOM   4308  C CE  . LYS A  1 588  ? 202.876 248.131 226.902 1.00 52.23  ? 557  LYS A CE  1 
ATOM   4309  N NZ  . LYS A  1 588  ? 204.093 247.336 227.183 1.00 52.23  ? 557  LYS A NZ  1 
ATOM   4310  N N   . LYS A  1 589  ? 198.304 252.130 230.138 1.00 53.38  ? 558  LYS A N   1 
ATOM   4311  C CA  . LYS A  1 589  ? 197.535 252.492 231.325 1.00 53.38  ? 558  LYS A CA  1 
ATOM   4312  C C   . LYS A  1 589  ? 197.117 251.205 232.022 1.00 53.38  ? 558  LYS A C   1 
ATOM   4313  O O   . LYS A  1 589  ? 196.308 250.442 231.485 1.00 53.38  ? 558  LYS A O   1 
ATOM   4314  C CB  . LYS A  1 589  ? 196.313 253.330 230.958 1.00 53.38  ? 558  LYS A CB  1 
ATOM   4315  C CG  . LYS A  1 589  ? 196.622 254.572 230.144 1.00 53.38  ? 558  LYS A CG  1 
ATOM   4316  C CD  . LYS A  1 589  ? 197.490 255.548 230.909 1.00 53.38  ? 558  LYS A CD  1 
ATOM   4317  C CE  . LYS A  1 589  ? 197.869 256.730 230.035 1.00 53.38  ? 558  LYS A CE  1 
ATOM   4318  N NZ  . LYS A  1 589  ? 198.814 257.652 230.719 1.00 53.38  ? 558  LYS A NZ  1 
ATOM   4319  N N   . PHE A  1 590  ? 197.644 250.971 233.219 1.00 46.96  ? 559  PHE A N   1 
ATOM   4320  C CA  . PHE A  1 590  ? 197.298 249.782 233.982 1.00 46.96  ? 559  PHE A CA  1 
ATOM   4321  C C   . PHE A  1 590  ? 196.046 250.008 234.815 1.00 46.96  ? 559  PHE A C   1 
ATOM   4322  O O   . PHE A  1 590  ? 195.824 251.102 235.340 1.00 46.96  ? 559  PHE A O   1 
ATOM   4323  C CB  . PHE A  1 590  ? 198.435 249.369 234.918 1.00 46.96  ? 559  PHE A CB  1 
ATOM   4324  C CG  . PHE A  1 590  ? 199.639 248.809 234.225 1.00 46.96  ? 559  PHE A CG  1 
ATOM   4325  C CD1 . PHE A  1 590  ? 200.679 248.285 234.964 1.00 46.96  ? 559  PHE A CD1 1 
ATOM   4326  C CD2 . PHE A  1 590  ? 199.737 248.800 232.851 1.00 46.96  ? 559  PHE A CD2 1 
ATOM   4327  C CE1 . PHE A  1 590  ? 201.779 247.766 234.352 1.00 46.96  ? 559  PHE A CE1 1 
ATOM   4328  C CE2 . PHE A  1 590  ? 200.844 248.280 232.237 1.00 46.96  ? 559  PHE A CE2 1 
ATOM   4329  C CZ  . PHE A  1 590  ? 201.864 247.763 232.989 1.00 46.96  ? 559  PHE A CZ  1 
ATOM   4330  N N   . LEU A  1 591  ? 195.224 248.968 234.924 1.00 46.14  ? 560  LEU A N   1 
ATOM   4331  C CA  . LEU A  1 591  ? 194.159 248.966 235.905 1.00 46.14  ? 560  LEU A CA  1 
ATOM   4332  C C   . LEU A  1 591  ? 194.768 248.890 237.302 1.00 46.14  ? 560  LEU A C   1 
ATOM   4333  O O   . LEU A  1 591  ? 195.888 248.409 237.471 1.00 46.14  ? 560  LEU A O   1 
ATOM   4334  C CB  . LEU A  1 591  ? 193.210 247.801 235.653 1.00 46.14  ? 560  LEU A CB  1 
ATOM   4335  C CG  . LEU A  1 591  ? 192.514 247.890 234.297 1.00 46.14  ? 560  LEU A CG  1 
ATOM   4336  C CD1 . LEU A  1 591  ? 191.885 246.568 233.910 1.00 46.14  ? 560  LEU A CD1 1 
ATOM   4337  C CD2 . LEU A  1 591  ? 191.477 248.992 234.318 1.00 46.14  ? 560  LEU A CD2 1 
ATOM   4338  N N   . PRO A  1 592  ? 194.057 249.372 238.322 1.00 45.39  ? 561  PRO A N   1 
ATOM   4339  C CA  . PRO A  1 592  ? 194.689 249.524 239.643 1.00 45.39  ? 561  PRO A CA  1 
ATOM   4340  C C   . PRO A  1 592  ? 195.205 248.237 240.271 1.00 45.39  ? 561  PRO A C   1 
ATOM   4341  O O   . PRO A  1 592  ? 196.070 248.313 241.151 1.00 45.39  ? 561  PRO A O   1 
ATOM   4342  C CB  . PRO A  1 592  ? 193.575 250.150 240.493 1.00 45.39  ? 561  PRO A CB  1 
ATOM   4343  C CG  . PRO A  1 592  ? 192.319 249.912 239.730 1.00 45.39  ? 561  PRO A CG  1 
ATOM   4344  C CD  . PRO A  1 592  ? 192.707 249.953 238.298 1.00 45.39  ? 561  PRO A CD  1 
ATOM   4345  N N   . PHE A  1 593  ? 194.710 247.064 239.875 1.00 42.81  ? 562  PHE A N   1 
ATOM   4346  C CA  . PHE A  1 593  ? 195.094 245.831 240.552 1.00 42.81  ? 562  PHE A CA  1 
ATOM   4347  C C   . PHE A  1 593  ? 196.284 245.112 239.924 1.00 42.81  ? 562  PHE A C   1 
ATOM   4348  O O   . PHE A  1 593  ? 196.616 244.010 240.370 1.00 42.81  ? 562  PHE A O   1 
ATOM   4349  C CB  . PHE A  1 593  ? 193.901 244.869 240.636 1.00 42.81  ? 562  PHE A CB  1 
ATOM   4350  C CG  . PHE A  1 593  ? 193.297 244.507 239.308 1.00 42.81  ? 562  PHE A CG  1 
ATOM   4351  C CD1 . PHE A  1 593  ? 192.281 245.266 238.763 1.00 42.81  ? 562  PHE A CD1 1 
ATOM   4352  C CD2 . PHE A  1 593  ? 193.722 243.383 238.623 1.00 42.81  ? 562  PHE A CD2 1 
ATOM   4353  C CE1 . PHE A  1 593  ? 191.724 244.927 237.550 1.00 42.81  ? 562  PHE A CE1 1 
ATOM   4354  C CE2 . PHE A  1 593  ? 193.164 243.041 237.413 1.00 42.81  ? 562  PHE A CE2 1 
ATOM   4355  C CZ  . PHE A  1 593  ? 192.165 243.814 236.877 1.00 42.81  ? 562  PHE A CZ  1 
ATOM   4356  N N   . GLN A  1 594  ? 196.954 245.695 238.934 1.00 42.65  ? 563  GLN A N   1 
ATOM   4357  C CA  . GLN A  1 594  ? 198.062 245.015 238.277 1.00 42.65  ? 563  GLN A CA  1 
ATOM   4358  C C   . GLN A  1 594  ? 199.353 245.819 238.375 1.00 42.65  ? 563  GLN A C   1 
ATOM   4359  O O   . GLN A  1 594  ? 199.336 247.049 238.470 1.00 42.65  ? 563  GLN A O   1 
ATOM   4360  C CB  . GLN A  1 594  ? 197.703 244.684 236.828 1.00 42.65  ? 563  GLN A CB  1 
ATOM   4361  C CG  . GLN A  1 594  ? 196.958 245.753 236.089 1.00 42.65  ? 563  GLN A CG  1 
ATOM   4362  C CD  . GLN A  1 594  ? 196.192 245.190 234.916 1.00 42.65  ? 563  GLN A CD  1 
ATOM   4363  O OE1 . GLN A  1 594  ? 195.594 245.923 234.139 1.00 42.65  ? 563  GLN A OE1 1 
ATOM   4364  N NE2 . GLN A  1 594  ? 196.179 243.877 234.804 1.00 42.65  ? 563  GLN A NE2 1 
ATOM   4365  N N   . GLN A  1 595  ? 200.479 245.097 238.353 1.00 43.31  ? 564  GLN A N   1 
ATOM   4366  C CA  . GLN A  1 595  ? 201.806 245.638 238.625 1.00 43.31  ? 564  GLN A CA  1 
ATOM   4367  C C   . GLN A  1 595  ? 202.819 245.407 237.509 1.00 43.31  ? 564  GLN A C   1 
ATOM   4368  O O   . GLN A  1 595  ? 203.690 246.251 237.310 1.00 43.31  ? 564  GLN A O   1 
ATOM   4369  C CB  . GLN A  1 595  ? 202.347 245.030 239.932 1.00 43.31  ? 564  GLN A CB  1 
ATOM   4370  C CG  . GLN A  1 595  ? 203.727 245.479 240.384 1.00 43.31  ? 564  GLN A CG  1 
ATOM   4371  C CD  . GLN A  1 595  ? 203.712 246.823 241.075 1.00 43.31  ? 564  GLN A CD  1 
ATOM   4372  O OE1 . GLN A  1 595  ? 202.787 247.137 241.814 1.00 43.31  ? 564  GLN A OE1 1 
ATOM   4373  N NE2 . GLN A  1 595  ? 204.753 247.612 240.860 1.00 43.31  ? 564  GLN A NE2 1 
ATOM   4374  N N   . PHE A  1 596  ? 202.734 244.296 236.775 1.00 44.56  ? 565  PHE A N   1 
ATOM   4375  C CA  . PHE A  1 596  ? 203.697 243.967 235.731 1.00 44.56  ? 565  PHE A CA  1 
ATOM   4376  C C   . PHE A  1 596  ? 202.962 243.705 234.424 1.00 44.56  ? 565  PHE A C   1 
ATOM   4377  O O   . PHE A  1 596  ? 201.792 243.323 234.419 1.00 44.56  ? 565  PHE A O   1 
ATOM   4378  C CB  . PHE A  1 596  ? 204.537 242.718 236.082 1.00 44.56  ? 565  PHE A CB  1 
ATOM   4379  C CG  . PHE A  1 596  ? 205.310 242.826 237.370 1.00 44.56  ? 565  PHE A CG  1 
ATOM   4380  C CD1 . PHE A  1 596  ? 204.895 242.152 238.502 1.00 44.56  ? 565  PHE A CD1 1 
ATOM   4381  C CD2 . PHE A  1 596  ? 206.475 243.569 237.435 1.00 44.56  ? 565  PHE A CD2 1 
ATOM   4382  C CE1 . PHE A  1 596  ? 205.605 242.244 239.676 1.00 44.56  ? 565  PHE A CE1 1 
ATOM   4383  C CE2 . PHE A  1 596  ? 207.187 243.659 238.610 1.00 44.56  ? 565  PHE A CE2 1 
ATOM   4384  C CZ  . PHE A  1 596  ? 206.751 242.994 239.730 1.00 44.56  ? 565  PHE A CZ  1 
ATOM   4385  N N   . GLY A  1 597  ? 203.655 243.936 233.319 1.00 46.51  ? 566  GLY A N   1 
ATOM   4386  C CA  . GLY A  1 597  ? 203.139 243.628 231.991 1.00 46.51  ? 566  GLY A CA  1 
ATOM   4387  C C   . GLY A  1 597  ? 204.050 242.663 231.260 1.00 46.51  ? 566  GLY A C   1 
ATOM   4388  O O   . GLY A  1 597  ? 205.270 242.789 231.331 1.00 46.51  ? 566  GLY A O   1 
ATOM   4389  N N   . ARG A  1 598  ? 203.455 241.706 230.549 1.00 51.56  ? 567  ARG A N   1 
ATOM   4390  C CA  . ARG A  1 598  ? 204.217 240.667 229.869 1.00 51.56  ? 567  ARG A CA  1 
ATOM   4391  C C   . ARG A  1 598  ? 203.775 240.551 228.418 1.00 51.56  ? 567  ARG A C   1 
ATOM   4392  O O   . ARG A  1 598  ? 202.603 240.738 228.092 1.00 51.56  ? 567  ARG A O   1 
ATOM   4393  C CB  . ARG A  1 598  ? 204.061 239.320 230.566 1.00 51.56  ? 567  ARG A CB  1 
ATOM   4394  C CG  . ARG A  1 598  ? 204.330 239.401 232.040 1.00 51.56  ? 567  ARG A CG  1 
ATOM   4395  C CD  . ARG A  1 598  ? 204.653 238.067 232.652 1.00 51.56  ? 567  ARG A CD  1 
ATOM   4396  N NE  . ARG A  1 598  ? 205.005 238.240 234.054 1.00 51.56  ? 567  ARG A NE  1 
ATOM   4397  C CZ  . ARG A  1 598  ? 204.774 237.335 234.997 1.00 51.56  ? 567  ARG A CZ  1 
ATOM   4398  N NH1 . ARG A  1 598  ? 204.191 236.186 234.685 1.00 51.56  ? 567  ARG A NH1 1 
ATOM   4399  N NH2 . ARG A  1 598  ? 205.117 237.585 236.253 1.00 51.56  ? 567  ARG A NH2 1 
ATOM   4400  N N   . ASP A  1 599  ? 204.736 240.252 227.548 1.00 54.61  ? 568  ASP A N   1 
ATOM   4401  C CA  . ASP A  1 599  ? 204.510 240.163 226.111 1.00 54.61  ? 568  ASP A CA  1 
ATOM   4402  C C   . ASP A  1 599  ? 204.217 238.719 225.689 1.00 54.61  ? 568  ASP A C   1 
ATOM   4403  O O   . ASP A  1 599  ? 203.907 237.859 226.516 1.00 54.61  ? 568  ASP A O   1 
ATOM   4404  C CB  . ASP A  1 599  ? 205.705 240.761 225.367 1.00 54.61  ? 568  ASP A CB  1 
ATOM   4405  C CG  . ASP A  1 599  ? 206.992 240.039 225.665 1.00 54.61  ? 568  ASP A CG  1 
ATOM   4406  O OD1 . ASP A  1 599  ? 206.960 239.079 226.455 1.00 54.61  ? 568  ASP A OD1 1 
ATOM   4407  O OD2 . ASP A  1 599  ? 208.039 240.434 225.117 1.00 54.61  ? 568  ASP A OD2 1 
ATOM   4408  N N   . ILE A  1 600  ? 204.319 238.448 224.384 1.00 54.50  ? 569  ILE A N   1 
ATOM   4409  C CA  . ILE A  1 600  ? 203.968 237.141 223.834 1.00 54.50  ? 569  ILE A CA  1 
ATOM   4410  C C   . ILE A  1 600  ? 204.954 236.074 224.294 1.00 54.50  ? 569  ILE A C   1 
ATOM   4411  O O   . ILE A  1 600  ? 204.570 234.929 224.553 1.00 54.50  ? 569  ILE A O   1 
ATOM   4412  C CB  . ILE A  1 600  ? 203.889 237.216 222.298 1.00 54.50  ? 569  ILE A CB  1 
ATOM   4413  C CG1 . ILE A  1 600  ? 203.546 235.852 221.706 1.00 54.50  ? 569  ILE A CG1 1 
ATOM   4414  C CG2 . ILE A  1 600  ? 205.192 237.731 221.710 1.00 54.50  ? 569  ILE A CG2 1 
ATOM   4415  C CD1 . ILE A  1 600  ? 202.183 235.347 222.096 1.00 54.50  ? 569  ILE A CD1 1 
ATOM   4416  N N   . ALA A  1 601  ? 206.233 236.425 224.404 1.00 54.24  ? 570  ALA A N   1 
ATOM   4417  C CA  . ALA A  1 601  ? 207.255 235.490 224.852 1.00 54.24  ? 570  ALA A CA  1 
ATOM   4418  C C   . ALA A  1 601  ? 207.250 235.298 226.359 1.00 54.24  ? 570  ALA A C   1 
ATOM   4419  O O   . ALA A  1 601  ? 208.111 234.579 226.873 1.00 54.24  ? 570  ALA A O   1 
ATOM   4420  C CB  . ALA A  1 601  ? 208.638 235.959 224.398 1.00 54.24  ? 570  ALA A CB  1 
ATOM   4421  N N   . ASP A  1 602  ? 206.336 235.960 227.069 1.00 54.44  ? 571  ASP A N   1 
ATOM   4422  C CA  . ASP A  1 602  ? 206.070 235.878 228.504 1.00 54.44  ? 571  ASP A CA  1 
ATOM   4423  C C   . ASP A  1 602  ? 207.078 236.659 229.344 1.00 54.44  ? 571  ASP A C   1 
ATOM   4424  O O   . ASP A  1 602  ? 206.978 236.629 230.571 1.00 54.44  ? 571  ASP A O   1 
ATOM   4425  C CB  . ASP A  1 602  ? 206.031 234.422 228.998 1.00 54.44  ? 571  ASP A CB  1 
ATOM   4426  C CG  . ASP A  1 602  ? 205.147 234.234 230.205 1.00 54.44  ? 571  ASP A CG  1 
ATOM   4427  O OD1 . ASP A  1 602  ? 203.919 234.103 230.021 1.00 54.44  ? 571  ASP A OD1 1 
ATOM   4428  O OD2 . ASP A  1 602  ? 205.676 234.208 231.334 1.00 54.44  ? 571  ASP A OD2 1 
ATOM   4429  N N   . THR A  1 603  ? 208.035 237.355 228.738 1.00 51.03  ? 572  THR A N   1 
ATOM   4430  C CA  . THR A  1 603  ? 208.975 238.172 229.491 1.00 51.03  ? 572  THR A CA  1 
ATOM   4431  C C   . THR A  1 603  ? 208.364 239.519 229.869 1.00 51.03  ? 572  THR A C   1 
ATOM   4432  O O   . THR A  1 603  ? 207.514 240.061 229.162 1.00 51.03  ? 572  THR A O   1 
ATOM   4433  C CB  . THR A  1 603  ? 210.266 238.373 228.699 1.00 51.03  ? 572  THR A CB  1 
ATOM   4434  O OG1 . THR A  1 603  ? 211.156 239.210 229.444 1.00 51.03  ? 572  THR A OG1 1 
ATOM   4435  C CG2 . THR A  1 603  ? 209.985 239.013 227.357 1.00 51.03  ? 572  THR A CG2 1 
ATOM   4436  N N   . THR A  1 604  ? 208.806 240.053 231.006 1.00 48.15  ? 573  THR A N   1 
ATOM   4437  C CA  . THR A  1 604  ? 208.267 241.294 231.554 1.00 48.15  ? 573  THR A CA  1 
ATOM   4438  C C   . THR A  1 604  ? 208.809 242.500 230.796 1.00 48.15  ? 573  THR A C   1 
ATOM   4439  O O   . THR A  1 604  ? 210.025 242.699 230.729 1.00 48.15  ? 573  THR A O   1 
ATOM   4440  C CB  . THR A  1 604  ? 208.610 241.415 233.035 1.00 48.15  ? 573  THR A CB  1 
ATOM   4441  O OG1 . THR A  1 604  ? 208.095 240.283 233.743 1.00 48.15  ? 573  THR A OG1 1 
ATOM   4442  C CG2 . THR A  1 604  ? 208.033 242.689 233.610 1.00 48.15  ? 573  THR A CG2 1 
ATOM   4443  N N   . ASP A  1 605  ? 207.912 243.296 230.215 1.00 49.61  ? 574  ASP A N   1 
ATOM   4444  C CA  . ASP A  1 605  ? 208.313 244.451 229.426 1.00 49.61  ? 574  ASP A CA  1 
ATOM   4445  C C   . ASP A  1 605  ? 207.756 245.780 229.923 1.00 49.61  ? 574  ASP A C   1 
ATOM   4446  O O   . ASP A  1 605  ? 208.116 246.822 229.370 1.00 49.61  ? 574  ASP A O   1 
ATOM   4447  C CB  . ASP A  1 605  ? 207.922 244.248 227.958 1.00 49.61  ? 574  ASP A CB  1 
ATOM   4448  C CG  . ASP A  1 605  ? 206.442 244.017 227.775 1.00 49.61  ? 574  ASP A CG  1 
ATOM   4449  O OD1 . ASP A  1 605  ? 205.722 243.954 228.788 1.00 49.61  ? 574  ASP A OD1 1 
ATOM   4450  O OD2 . ASP A  1 605  ? 205.994 243.901 226.618 1.00 49.61  ? 574  ASP A OD2 1 
ATOM   4451  N N   . ALA A  1 606  ? 206.919 245.788 230.957 1.00 46.71  ? 575  ALA A N   1 
ATOM   4452  C CA  . ALA A  1 606  ? 206.417 247.023 231.545 1.00 46.71  ? 575  ALA A CA  1 
ATOM   4453  C C   . ALA A  1 606  ? 206.308 246.847 233.052 1.00 46.71  ? 575  ALA A C   1 
ATOM   4454  O O   . ALA A  1 606  ? 206.132 245.733 233.545 1.00 46.71  ? 575  ALA A O   1 
ATOM   4455  C CB  . ALA A  1 606  ? 205.066 247.428 230.955 1.00 46.71  ? 575  ALA A CB  1 
ATOM   4456  N N   . VAL A  1 607  ? 206.418 247.952 233.784 1.00 45.19  ? 576  VAL A N   1 
ATOM   4457  C CA  . VAL A  1 607  ? 206.374 247.895 235.245 1.00 45.19  ? 576  VAL A CA  1 
ATOM   4458  C C   . VAL A  1 607  ? 205.841 249.214 235.785 1.00 45.19  ? 576  VAL A C   1 
ATOM   4459  O O   . VAL A  1 607  ? 206.153 250.284 235.262 1.00 45.19  ? 576  VAL A O   1 
ATOM   4460  C CB  . VAL A  1 607  ? 207.757 247.565 235.848 1.00 45.19  ? 576  VAL A CB  1 
ATOM   4461  C CG1 . VAL A  1 607  ? 208.777 248.625 235.493 1.00 45.19  ? 576  VAL A CG1 1 
ATOM   4462  C CG2 . VAL A  1 607  ? 207.661 247.385 237.343 1.00 45.19  ? 576  VAL A CG2 1 
ATOM   4463  N N   . ARG A  1 608  ? 204.996 249.134 236.809 1.00 47.30  ? 577  ARG A N   1 
ATOM   4464  C CA  . ARG A  1 608  ? 204.598 250.325 237.547 1.00 47.30  ? 577  ARG A CA  1 
ATOM   4465  C C   . ARG A  1 608  ? 205.655 250.665 238.592 1.00 47.30  ? 577  ARG A C   1 
ATOM   4466  O O   . ARG A  1 608  ? 206.094 249.792 239.344 1.00 47.30  ? 577  ARG A O   1 
ATOM   4467  C CB  . ARG A  1 608  ? 203.256 250.106 238.244 1.00 47.30  ? 577  ARG A CB  1 
ATOM   4468  C CG  . ARG A  1 608  ? 202.671 251.369 238.850 1.00 47.30  ? 577  ARG A CG  1 
ATOM   4469  C CD  . ARG A  1 608  ? 201.546 251.082 239.832 1.00 47.30  ? 577  ARG A CD  1 
ATOM   4470  N NE  . ARG A  1 608  ? 200.389 250.425 239.238 1.00 47.30  ? 577  ARG A NE  1 
ATOM   4471  C CZ  . ARG A  1 608  ? 199.428 251.058 238.577 1.00 47.30  ? 577  ARG A CZ  1 
ATOM   4472  N NH1 . ARG A  1 608  ? 199.486 252.369 238.410 1.00 47.30  ? 577  ARG A NH1 1 
ATOM   4473  N NH2 . ARG A  1 608  ? 198.409 250.376 238.078 1.00 47.30  ? 577  ARG A NH2 1 
ATOM   4474  N N   . ASP A  1 609  ? 206.072 251.922 238.629 1.00 51.72  ? 578  ASP A N   1 
ATOM   4475  C CA  . ASP A  1 609  ? 207.029 252.357 239.641 1.00 51.72  ? 578  ASP A CA  1 
ATOM   4476  C C   . ASP A  1 609  ? 206.358 252.391 241.012 1.00 51.72  ? 578  ASP A C   1 
ATOM   4477  O O   . ASP A  1 609  ? 205.315 253.031 241.168 1.00 51.72  ? 578  ASP A O   1 
ATOM   4478  C CB  . ASP A  1 609  ? 207.579 253.734 239.277 1.00 51.72  ? 578  ASP A CB  1 
ATOM   4479  C CG  . ASP A  1 609  ? 208.855 254.066 240.011 1.00 51.72  ? 578  ASP A CG  1 
ATOM   4480  O OD1 . ASP A  1 609  ? 209.883 253.426 239.729 1.00 51.72  ? 578  ASP A OD1 1 
ATOM   4481  O OD2 . ASP A  1 609  ? 208.839 254.977 240.859 1.00 51.72  ? 578  ASP A OD2 1 
ATOM   4482  N N   . PRO A  1 610  ? 206.920 251.731 242.029 1.00 50.91  ? 579  PRO A N   1 
ATOM   4483  C CA  . PRO A  1 610  ? 206.270 251.720 243.349 1.00 50.91  ? 579  PRO A CA  1 
ATOM   4484  C C   . PRO A  1 610  ? 206.322 253.040 244.104 1.00 50.91  ? 579  PRO A C   1 
ATOM   4485  O O   . PRO A  1 610  ? 205.634 253.164 245.122 1.00 50.91  ? 579  PRO A O   1 
ATOM   4486  C CB  . PRO A  1 610  ? 207.028 250.622 244.097 1.00 50.91  ? 579  PRO A CB  1 
ATOM   4487  C CG  . PRO A  1 610  ? 208.337 250.563 243.439 1.00 50.91  ? 579  PRO A CG  1 
ATOM   4488  C CD  . PRO A  1 610  ? 208.102 250.856 241.997 1.00 50.91  ? 579  PRO A CD  1 
ATOM   4489  N N   . GLN A  1 611  ? 207.097 254.026 243.652 1.00 55.75  ? 580  GLN A N   1 
ATOM   4490  C CA  . GLN A  1 611  ? 207.154 255.332 244.306 1.00 55.75  ? 580  GLN A CA  1 
ATOM   4491  C C   . GLN A  1 611  ? 206.281 256.366 243.606 1.00 55.75  ? 580  GLN A C   1 
ATOM   4492  O O   . GLN A  1 611  ? 205.384 256.944 244.223 1.00 55.75  ? 580  GLN A O   1 
ATOM   4493  C CB  . GLN A  1 611  ? 208.602 255.827 244.355 1.00 55.75  ? 580  GLN A CB  1 
ATOM   4494  C CG  . GLN A  1 611  ? 209.588 254.887 245.016 1.00 55.75  ? 580  GLN A CG  1 
ATOM   4495  C CD  . GLN A  1 611  ? 209.885 255.279 246.438 1.00 55.75  ? 580  GLN A CD  1 
ATOM   4496  O OE1 . GLN A  1 611  ? 210.370 254.477 247.227 1.00 55.75  ? 580  GLN A OE1 1 
ATOM   4497  N NE2 . GLN A  1 611  ? 209.593 256.523 246.777 1.00 55.75  ? 580  GLN A NE2 1 
ATOM   4498  N N   . THR A  1 612  ? 206.548 256.631 242.330 1.00 55.35  ? 581  THR A N   1 
ATOM   4499  C CA  . THR A  1 612  ? 205.844 257.666 241.586 1.00 55.35  ? 581  THR A CA  1 
ATOM   4500  C C   . THR A  1 612  ? 204.618 257.140 240.851 1.00 55.35  ? 581  THR A C   1 
ATOM   4501  O O   . THR A  1 612  ? 203.876 257.940 240.272 1.00 55.35  ? 581  THR A O   1 
ATOM   4502  C CB  . THR A  1 612  ? 206.786 258.343 240.587 1.00 55.35  ? 581  THR A CB  1 
ATOM   4503  O OG1 . THR A  1 612  ? 207.218 257.390 239.612 1.00 55.35  ? 581  THR A OG1 1 
ATOM   4504  C CG2 . THR A  1 612  ? 207.993 258.910 241.299 1.00 55.35  ? 581  THR A CG2 1 
ATOM   4505  N N   . LEU A  1 613  ? 204.385 255.826 240.876 1.00 53.84  ? 582  LEU A N   1 
ATOM   4506  C CA  . LEU A  1 613  ? 203.201 255.198 240.286 1.00 53.84  ? 582  LEU A CA  1 
ATOM   4507  C C   . LEU A  1 613  ? 203.086 255.446 238.783 1.00 53.84  ? 582  LEU A C   1 
ATOM   4508  O O   . LEU A  1 613  ? 201.981 255.535 238.244 1.00 53.84  ? 582  LEU A O   1 
ATOM   4509  C CB  . LEU A  1 613  ? 201.921 255.644 240.997 1.00 53.84  ? 582  LEU A CB  1 
ATOM   4510  C CG  . LEU A  1 613  ? 201.442 254.813 242.187 1.00 53.84  ? 582  LEU A CG  1 
ATOM   4511  C CD1 . LEU A  1 613  ? 202.542 254.594 243.195 1.00 53.84  ? 582  LEU A CD1 1 
ATOM   4512  C CD2 . LEU A  1 613  ? 200.255 255.483 242.841 1.00 53.84  ? 582  LEU A CD2 1 
ATOM   4513  N N   . GLU A  1 614  ? 204.214 255.544 238.090 1.00 55.16  ? 583  GLU A N   1 
ATOM   4514  C CA  . GLU A  1 614  ? 204.229 255.737 236.649 1.00 55.16  ? 583  GLU A CA  1 
ATOM   4515  C C   . GLU A  1 614  ? 204.673 254.462 235.946 1.00 55.16  ? 583  GLU A C   1 
ATOM   4516  O O   . GLU A  1 614  ? 205.490 253.697 236.462 1.00 55.16  ? 583  GLU A O   1 
ATOM   4517  C CB  . GLU A  1 614  ? 205.144 256.899 236.263 1.00 55.16  ? 583  GLU A CB  1 
ATOM   4518  C CG  . GLU A  1 614  ? 206.598 256.664 236.567 1.00 55.16  ? 583  GLU A CG  1 
ATOM   4519  C CD  . GLU A  1 614  ? 207.488 257.703 235.936 1.00 55.16  ? 583  GLU A CD  1 
ATOM   4520  O OE1 . GLU A  1 614  ? 206.976 258.514 235.139 1.00 55.16  ? 583  GLU A OE1 1 
ATOM   4521  O OE2 . GLU A  1 614  ? 208.698 257.717 236.243 1.00 55.16  ? 583  GLU A OE2 1 
ATOM   4522  N N   . ILE A  1 615  ? 204.106 254.232 234.768 1.00 50.41  ? 584  ILE A N   1 
ATOM   4523  C CA  . ILE A  1 615  ? 204.380 253.025 233.997 1.00 50.41  ? 584  ILE A CA  1 
ATOM   4524  C C   . ILE A  1 615  ? 205.648 253.229 233.176 1.00 50.41  ? 584  ILE A C   1 
ATOM   4525  O O   . ILE A  1 615  ? 205.834 254.275 232.548 1.00 50.41  ? 584  ILE A O   1 
ATOM   4526  C CB  . ILE A  1 615  ? 203.187 252.682 233.092 1.00 50.41  ? 584  ILE A CB  1 
ATOM   4527  C CG1 . ILE A  1 615  ? 201.907 252.543 233.917 1.00 50.41  ? 584  ILE A CG1 1 
ATOM   4528  C CG2 . ILE A  1 615  ? 203.448 251.397 232.340 1.00 50.41  ? 584  ILE A CG2 1 
ATOM   4529  C CD1 . ILE A  1 615  ? 202.009 251.606 235.068 1.00 50.41  ? 584  ILE A CD1 1 
ATOM   4530  N N   . LEU A  1 616  ? 206.526 252.228 233.181 1.00 50.60  ? 585  LEU A N   1 
ATOM   4531  C CA  . LEU A  1 616  ? 207.800 252.277 232.481 1.00 50.60  ? 585  LEU A CA  1 
ATOM   4532  C C   . LEU A  1 616  ? 207.931 251.063 231.575 1.00 50.60  ? 585  LEU A C   1 
ATOM   4533  O O   . LEU A  1 616  ? 207.576 249.948 231.967 1.00 50.60  ? 585  LEU A O   1 
ATOM   4534  C CB  . LEU A  1 616  ? 208.979 252.299 233.458 1.00 50.60  ? 585  LEU A CB  1 
ATOM   4535  C CG  . LEU A  1 616  ? 209.118 253.476 234.414 1.00 50.60  ? 585  LEU A CG  1 
ATOM   4536  C CD1 . LEU A  1 616  ? 210.212 253.197 235.409 1.00 50.60  ? 585  LEU A CD1 1 
ATOM   4537  C CD2 . LEU A  1 616  ? 209.415 254.735 233.645 1.00 50.60  ? 585  LEU A CD2 1 
ATOM   4538  N N   . ASP A  1 617  ? 208.457 251.283 230.374 1.00 53.73  ? 586  ASP A N   1 
ATOM   4539  C CA  . ASP A  1 617  ? 208.785 250.209 229.452 1.00 53.73  ? 586  ASP A CA  1 
ATOM   4540  C C   . ASP A  1 617  ? 210.232 249.788 229.637 1.00 53.73  ? 586  ASP A C   1 
ATOM   4541  O O   . ASP A  1 617  ? 211.106 250.611 229.924 1.00 53.73  ? 586  ASP A O   1 
ATOM   4542  C CB  . ASP A  1 617  ? 208.589 250.646 228.001 1.00 53.73  ? 586  ASP A CB  1 
ATOM   4543  C CG  . ASP A  1 617  ? 207.141 250.821 227.627 1.00 53.73  ? 586  ASP A CG  1 
ATOM   4544  O OD1 . ASP A  1 617  ? 206.271 250.257 228.314 1.00 53.73  ? 586  ASP A OD1 1 
ATOM   4545  O OD2 . ASP A  1 617  ? 206.868 251.533 226.640 1.00 53.73  ? 586  ASP A OD2 1 
ATOM   4546  N N   . ILE A  1 618  ? 210.481 248.500 229.428 1.00 48.60  ? 587  ILE A N   1 
ATOM   4547  C CA  . ILE A  1 618  ? 211.793 247.892 229.600 1.00 48.60  ? 587  ILE A CA  1 
ATOM   4548  C C   . ILE A  1 618  ? 212.233 247.336 228.256 1.00 48.60  ? 587  ILE A C   1 
ATOM   4549  O O   . ILE A  1 618  ? 211.485 246.586 227.618 1.00 48.60  ? 587  ILE A O   1 
ATOM   4550  C CB  . ILE A  1 618  ? 211.774 246.782 230.665 1.00 48.60  ? 587  ILE A CB  1 
ATOM   4551  C CG1 . ILE A  1 618  ? 211.179 247.294 231.973 1.00 48.60  ? 587  ILE A CG1 1 
ATOM   4552  C CG2 . ILE A  1 618  ? 213.166 246.244 230.889 1.00 48.60  ? 587  ILE A CG2 1 
ATOM   4553  C CD1 . ILE A  1 618  ? 210.971 246.217 233.003 1.00 48.60  ? 587  ILE A CD1 1 
ATOM   4554  N N   . THR A  1 619  ? 213.439 247.699 227.824 1.00 49.23  ? 588  THR A N   1 
ATOM   4555  C CA  . THR A  1 619  ? 213.936 247.224 226.543 1.00 49.23  ? 588  THR A CA  1 
ATOM   4556  C C   . THR A  1 619  ? 215.315 246.604 226.728 1.00 49.23  ? 588  THR A C   1 
ATOM   4557  O O   . THR A  1 619  ? 216.124 247.121 227.502 1.00 49.23  ? 588  THR A O   1 
ATOM   4558  C CB  . THR A  1 619  ? 214.005 248.382 225.532 1.00 49.23  ? 588  THR A CB  1 
ATOM   4559  O OG1 . THR A  1 619  ? 212.697 248.931 225.341 1.00 49.23  ? 588  THR A OG1 1 
ATOM   4560  C CG2 . THR A  1 619  ? 214.521 247.909 224.196 1.00 49.23  ? 588  THR A CG2 1 
ATOM   4561  N N   . PRO A  1 620  ? 215.608 245.491 226.053 1.00 49.24  ? 589  PRO A N   1 
ATOM   4562  C CA  . PRO A  1 620  ? 216.977 244.963 226.071 1.00 49.24  ? 589  PRO A CA  1 
ATOM   4563  C C   . PRO A  1 620  ? 217.946 245.941 225.429 1.00 49.24  ? 589  PRO A C   1 
ATOM   4564  O O   . PRO A  1 620  ? 217.575 246.742 224.571 1.00 49.24  ? 589  PRO A O   1 
ATOM   4565  C CB  . PRO A  1 620  ? 216.870 243.664 225.267 1.00 49.24  ? 589  PRO A CB  1 
ATOM   4566  C CG  . PRO A  1 620  ? 215.433 243.312 225.299 1.00 49.24  ? 589  PRO A CG  1 
ATOM   4567  C CD  . PRO A  1 620  ? 214.687 244.600 225.331 1.00 49.24  ? 589  PRO A CD  1 
ATOM   4568  N N   . CYS A  1 621  ? 219.204 245.885 225.860 1.00 55.10  ? 590  CYS A N   1 
ATOM   4569  C CA  . CYS A  1 621  ? 220.221 246.778 225.322 1.00 55.10  ? 590  CYS A CA  1 
ATOM   4570  C C   . CYS A  1 621  ? 221.259 246.069 224.454 1.00 55.10  ? 590  CYS A C   1 
ATOM   4571  O O   . CYS A  1 621  ? 222.277 246.678 224.118 1.00 55.10  ? 590  CYS A O   1 
ATOM   4572  C CB  . CYS A  1 621  ? 220.888 247.563 226.462 1.00 55.10  ? 590  CYS A CB  1 
ATOM   4573  S SG  . CYS A  1 621  ? 222.015 246.692 227.587 1.00 55.10  ? 590  CYS A SG  1 
ATOM   4574  N N   . SER A  1 622  ? 221.024 244.817 224.063 1.00 51.56  ? 591  SER A N   1 
ATOM   4575  C CA  . SER A  1 622  ? 221.892 244.094 223.134 1.00 51.56  ? 591  SER A CA  1 
ATOM   4576  C C   . SER A  1 622  ? 221.137 243.811 221.839 1.00 51.56  ? 591  SER A C   1 
ATOM   4577  O O   . SER A  1 622  ? 220.145 243.076 221.847 1.00 51.56  ? 591  SER A O   1 
ATOM   4578  C CB  . SER A  1 622  ? 222.386 242.792 223.757 1.00 51.56  ? 591  SER A CB  1 
ATOM   4579  O OG  . SER A  1 622  ? 223.228 243.053 224.863 1.00 51.56  ? 591  SER A OG  1 
ATOM   4580  N N   . PHE A  1 623  ? 221.613 244.381 220.732 1.00 47.19  ? 592  PHE A N   1 
ATOM   4581  C CA  . PHE A  1 623  ? 220.892 244.331 219.466 1.00 47.19  ? 592  PHE A CA  1 
ATOM   4582  C C   . PHE A  1 623  ? 221.866 244.547 218.312 1.00 47.19  ? 592  PHE A C   1 
ATOM   4583  O O   . PHE A  1 623  ? 222.785 245.359 218.421 1.00 47.19  ? 592  PHE A O   1 
ATOM   4584  C CB  . PHE A  1 623  ? 219.776 245.389 219.496 1.00 47.19  ? 592  PHE A CB  1 
ATOM   4585  C CG  . PHE A  1 623  ? 218.976 245.514 218.229 1.00 47.19  ? 592  PHE A CG  1 
ATOM   4586  C CD1 . PHE A  1 623  ? 219.448 246.249 217.157 1.00 47.19  ? 592  PHE A CD1 1 
ATOM   4587  C CD2 . PHE A  1 623  ? 217.732 244.929 218.128 1.00 47.19  ? 592  PHE A CD2 1 
ATOM   4588  C CE1 . PHE A  1 623  ? 218.706 246.378 216.011 1.00 47.19  ? 592  PHE A CE1 1 
ATOM   4589  C CE2 . PHE A  1 623  ? 216.988 245.058 216.980 1.00 47.19  ? 592  PHE A CE2 1 
ATOM   4590  C CZ  . PHE A  1 623  ? 217.478 245.781 215.923 1.00 47.19  ? 592  PHE A CZ  1 
ATOM   4591  N N   . GLY A  1 624  ? 221.652 243.836 217.213 1.00 44.72  ? 593  GLY A N   1 
ATOM   4592  C CA  . GLY A  1 624  ? 222.358 244.099 215.965 1.00 44.72  ? 593  GLY A CA  1 
ATOM   4593  C C   . GLY A  1 624  ? 223.428 243.083 215.599 1.00 44.72  ? 593  GLY A C   1 
ATOM   4594  O O   . GLY A  1 624  ? 224.244 242.683 216.433 1.00 44.72  ? 593  GLY A O   1 
ATOM   4595  N N   . GLY A  1 625  ? 223.448 242.692 214.324 1.00 41.85  ? 594  GLY A N   1 
ATOM   4596  C CA  . GLY A  1 625  ? 224.391 241.698 213.831 1.00 41.85  ? 594  GLY A CA  1 
ATOM   4597  C C   . GLY A  1 625  ? 225.713 242.267 213.333 1.00 41.85  ? 594  GLY A C   1 
ATOM   4598  O O   . GLY A  1 625  ? 225.778 243.379 212.824 1.00 41.85  ? 594  GLY A O   1 
ATOM   4599  N N   . VAL A  1 626  ? 226.781 241.480 213.505 1.00 38.89  ? 595  VAL A N   1 
ATOM   4600  C CA  . VAL A  1 626  ? 228.149 241.872 213.173 1.00 38.89  ? 595  VAL A CA  1 
ATOM   4601  C C   . VAL A  1 626  ? 228.796 240.783 212.319 1.00 38.89  ? 595  VAL A C   1 
ATOM   4602  O O   . VAL A  1 626  ? 228.541 239.593 212.524 1.00 38.89  ? 595  VAL A O   1 
ATOM   4603  C CB  . VAL A  1 626  ? 228.981 242.127 214.450 1.00 38.89  ? 595  VAL A CB  1 
ATOM   4604  C CG1 . VAL A  1 626  ? 230.383 242.576 214.106 1.00 38.89  ? 595  VAL A CG1 1 
ATOM   4605  C CG2 . VAL A  1 626  ? 228.311 243.159 215.325 1.00 38.89  ? 595  VAL A CG2 1 
ATOM   4606  N N   . SER A  1 627  ? 229.633 241.190 211.355 1.00 36.15  ? 596  SER A N   1 
ATOM   4607  C CA  . SER A  1 627  ? 230.406 240.263 210.531 1.00 36.15  ? 596  SER A CA  1 
ATOM   4608  C C   . SER A  1 627  ? 231.828 240.784 210.380 1.00 36.15  ? 596  SER A C   1 
ATOM   4609  O O   . SER A  1 627  ? 232.064 241.990 210.441 1.00 36.15  ? 596  SER A O   1 
ATOM   4610  C CB  . SER A  1 627  ? 229.787 240.073 209.145 1.00 36.15  ? 596  SER A CB  1 
ATOM   4611  O OG  . SER A  1 627  ? 228.520 239.455 209.226 1.00 36.15  ? 596  SER A OG  1 
ATOM   4612  N N   . VAL A  1 628  ? 232.775 239.875 210.151 1.00 33.99  ? 597  VAL A N   1 
ATOM   4613  C CA  . VAL A  1 628  ? 234.182 240.236 209.981 1.00 33.99  ? 597  VAL A CA  1 
ATOM   4614  C C   . VAL A  1 628  ? 234.709 239.665 208.665 1.00 33.99  ? 597  VAL A C   1 
ATOM   4615  O O   . VAL A  1 628  ? 234.444 238.505 208.333 1.00 33.99  ? 597  VAL A O   1 
ATOM   4616  C CB  . VAL A  1 628  ? 235.033 239.763 211.178 1.00 33.99  ? 597  VAL A CB  1 
ATOM   4617  C CG1 . VAL A  1 628  ? 234.976 238.264 211.330 1.00 33.99  ? 597  VAL A CG1 1 
ATOM   4618  C CG2 . VAL A  1 628  ? 236.464 240.248 211.069 1.00 33.99  ? 597  VAL A CG2 1 
ATOM   4619  N N   . ILE A  1 629  ? 235.442 240.488 207.916 1.00 35.77  ? 598  ILE A N   1 
ATOM   4620  C CA  . ILE A  1 629  ? 236.023 240.132 206.623 1.00 35.77  ? 598  ILE A CA  1 
ATOM   4621  C C   . ILE A  1 629  ? 237.531 240.034 206.791 1.00 35.77  ? 598  ILE A C   1 
ATOM   4622  O O   . ILE A  1 629  ? 238.177 241.001 207.218 1.00 35.77  ? 598  ILE A O   1 
ATOM   4623  C CB  . ILE A  1 629  ? 235.685 241.170 205.541 1.00 35.77  ? 598  ILE A CB  1 
ATOM   4624  C CG1 . ILE A  1 629  ? 234.178 241.307 205.336 1.00 35.77  ? 598  ILE A CG1 1 
ATOM   4625  C CG2 . ILE A  1 629  ? 236.377 240.839 204.243 1.00 35.77  ? 598  ILE A CG2 1 
ATOM   4626  C CD1 . ILE A  1 629  ? 233.539 242.412 206.123 1.00 35.77  ? 598  ILE A CD1 1 
ATOM   4627  N N   . THR A  1 630  ? 238.097 238.879 206.427 1.00 42.15  ? 599  THR A N   1 
ATOM   4628  C CA  . THR A  1 630  ? 239.530 238.657 206.543 1.00 42.15  ? 599  THR A CA  1 
ATOM   4629  C C   . THR A  1 630  ? 240.118 238.094 205.254 1.00 42.15  ? 599  THR A C   1 
ATOM   4630  O O   . THR A  1 630  ? 239.505 237.231 204.614 1.00 42.15  ? 599  THR A O   1 
ATOM   4631  C CB  . THR A  1 630  ? 239.840 237.711 207.715 1.00 42.15  ? 599  THR A CB  1 
ATOM   4632  O OG1 . THR A  1 630  ? 241.235 237.395 207.727 1.00 42.15  ? 599  THR A OG1 1 
ATOM   4633  C CG2 . THR A  1 630  ? 239.038 236.436 207.619 1.00 42.15  ? 599  THR A CG2 1 
ATOM   4634  N N   . PRO A  1 631  ? 241.295 238.572 204.840 1.00 46.59  ? 600  PRO A N   1 
ATOM   4635  C CA  . PRO A  1 631  ? 241.989 237.984 203.689 1.00 46.59  ? 600  PRO A CA  1 
ATOM   4636  C C   . PRO A  1 631  ? 242.754 236.705 203.992 1.00 46.59  ? 600  PRO A C   1 
ATOM   4637  O O   . PRO A  1 631  ? 243.433 236.188 203.098 1.00 46.59  ? 600  PRO A O   1 
ATOM   4638  C CB  . PRO A  1 631  ? 242.951 239.101 203.275 1.00 46.59  ? 600  PRO A CB  1 
ATOM   4639  C CG  . PRO A  1 631  ? 243.248 239.806 204.528 1.00 46.59  ? 600  PRO A CG  1 
ATOM   4640  C CD  . PRO A  1 631  ? 241.984 239.775 205.336 1.00 46.59  ? 600  PRO A CD  1 
ATOM   4641  N N   . GLY A  1 632  ? 242.668 236.182 205.210 1.00 50.84  ? 601  GLY A N   1 
ATOM   4642  C CA  . GLY A  1 632  ? 243.466 235.049 205.635 1.00 50.84  ? 601  GLY A CA  1 
ATOM   4643  C C   . GLY A  1 632  ? 244.521 235.448 206.641 1.00 50.84  ? 601  GLY A C   1 
ATOM   4644  O O   . GLY A  1 632  ? 245.257 236.412 206.423 1.00 50.84  ? 601  GLY A O   1 
ATOM   4645  N N   . THR A  1 633  ? 244.606 234.713 207.751 1.00 53.78  ? 602  THR A N   1 
ATOM   4646  C CA  . THR A  1 633  ? 245.631 234.993 208.751 1.00 53.78  ? 602  THR A CA  1 
ATOM   4647  C C   . THR A  1 633  ? 247.027 234.728 208.207 1.00 53.78  ? 602  THR A C   1 
ATOM   4648  O O   . THR A  1 633  ? 247.994 235.367 208.637 1.00 53.78  ? 602  THR A O   1 
ATOM   4649  C CB  . THR A  1 633  ? 245.364 234.159 210.005 1.00 53.78  ? 602  THR A CB  1 
ATOM   4650  O OG1 . THR A  1 633  ? 244.089 234.518 210.547 1.00 53.78  ? 602  THR A OG1 1 
ATOM   4651  C CG2 . THR A  1 633  ? 246.414 234.408 211.064 1.00 53.78  ? 602  THR A CG2 1 
ATOM   4652  N N   . ASN A  1 634  ? 247.149 233.805 207.254 1.00 58.90  ? 603  ASN A N   1 
ATOM   4653  C CA  . ASN A  1 634  ? 248.434 233.557 206.613 1.00 58.90  ? 603  ASN A CA  1 
ATOM   4654  C C   . ASN A  1 634  ? 248.953 234.801 205.904 1.00 58.90  ? 603  ASN A C   1 
ATOM   4655  O O   . ASN A  1 634  ? 250.152 235.094 205.946 1.00 58.90  ? 603  ASN A O   1 
ATOM   4656  C CB  . ASN A  1 634  ? 248.296 232.396 205.632 1.00 58.90  ? 603  ASN A CB  1 
ATOM   4657  C CG  . ASN A  1 634  ? 249.604 232.015 204.997 1.00 58.90  ? 603  ASN A CG  1 
ATOM   4658  O OD1 . ASN A  1 634  ? 249.803 232.210 203.800 1.00 58.90  ? 603  ASN A OD1 1 
ATOM   4659  N ND2 . ASN A  1 634  ? 250.504 231.450 205.791 1.00 58.90  ? 603  ASN A ND2 1 
ATOM   4660  N N   . THR A  1 635  ? 248.065 235.538 205.231 1.00 56.88  ? 604  THR A N   1 
ATOM   4661  C CA  . THR A  1 635  ? 248.485 236.706 204.465 1.00 56.88  ? 604  THR A CA  1 
ATOM   4662  C C   . THR A  1 635  ? 248.691 237.932 205.350 1.00 56.88  ? 604  THR A C   1 
ATOM   4663  O O   . THR A  1 635  ? 249.710 238.620 205.236 1.00 56.88  ? 604  THR A O   1 
ATOM   4664  C CB  . THR A  1 635  ? 247.456 237.011 203.378 1.00 56.88  ? 604  THR A CB  1 
ATOM   4665  O OG1 . THR A  1 635  ? 247.406 235.921 202.451 1.00 56.88  ? 604  THR A OG1 1 
ATOM   4666  C CG2 . THR A  1 635  ? 247.832 238.272 202.637 1.00 56.88  ? 604  THR A CG2 1 
ATOM   4667  N N   . SER A  1 636  ? 247.744 238.214 206.242 1.00 55.93  ? 605  SER A N   1 
ATOM   4668  C CA  . SER A  1 636  ? 247.766 239.461 206.998 1.00 55.93  ? 605  SER A CA  1 
ATOM   4669  C C   . SER A  1 636  ? 246.872 239.336 208.224 1.00 55.93  ? 605  SER A C   1 
ATOM   4670  O O   . SER A  1 636  ? 246.074 238.406 208.348 1.00 55.93  ? 605  SER A O   1 
ATOM   4671  C CB  . SER A  1 636  ? 247.320 240.638 206.133 1.00 55.93  ? 605  SER A CB  1 
ATOM   4672  O OG  . SER A  1 636  ? 247.235 241.814 206.909 1.00 55.93  ? 605  SER A OG  1 
ATOM   4673  N N   . ASN A  1 637  ? 247.011 240.310 209.126 1.00 56.58  ? 606  ASN A N   1 
ATOM   4674  C CA  . ASN A  1 637  ? 246.153 240.443 210.299 1.00 56.58  ? 606  ASN A CA  1 
ATOM   4675  C C   . ASN A  1 637  ? 245.126 241.561 210.176 1.00 56.58  ? 606  ASN A C   1 
ATOM   4676  O O   . ASN A  1 637  ? 244.267 241.687 211.051 1.00 56.58  ? 606  ASN A O   1 
ATOM   4677  C CB  . ASN A  1 637  ? 246.999 240.675 211.554 1.00 56.58  ? 606  ASN A CB  1 
ATOM   4678  C CG  . ASN A  1 637  ? 247.717 239.423 212.010 1.00 56.58  ? 606  ASN A CG  1 
ATOM   4679  O OD1 . ASN A  1 637  ? 247.278 238.308 211.735 1.00 56.58  ? 606  ASN A OD1 1 
ATOM   4680  N ND2 . ASN A  1 637  ? 248.825 239.601 212.717 1.00 56.58  ? 606  ASN A ND2 1 
ATOM   4681  N N   . GLN A  1 638  ? 245.225 242.390 209.143 1.00 51.86  ? 607  GLN A N   1 
ATOM   4682  C CA  . GLN A  1 638  ? 244.254 243.445 208.896 1.00 51.86  ? 607  GLN A CA  1 
ATOM   4683  C C   . GLN A  1 638  ? 242.888 242.846 208.563 1.00 51.86  ? 607  GLN A C   1 
ATOM   4684  O O   . GLN A  1 638  ? 242.791 241.873 207.812 1.00 51.86  ? 607  GLN A O   1 
ATOM   4685  C CB  . GLN A  1 638  ? 244.763 244.309 207.746 1.00 51.86  ? 607  GLN A CB  1 
ATOM   4686  C CG  . GLN A  1 638  ? 244.100 245.640 207.561 1.00 51.86  ? 607  GLN A CG  1 
ATOM   4687  C CD  . GLN A  1 638  ? 244.534 246.293 206.270 1.00 51.86  ? 607  GLN A CD  1 
ATOM   4688  O OE1 . GLN A  1 638  ? 245.702 246.221 205.892 1.00 51.86  ? 607  GLN A OE1 1 
ATOM   4689  N NE2 . GLN A  1 638  ? 243.598 246.935 205.586 1.00 51.86  ? 607  GLN A NE2 1 
ATOM   4690  N N   . VAL A  1 639  ? 241.823 243.425 209.131 1.00 41.92  ? 608  VAL A N   1 
ATOM   4691  C CA  . VAL A  1 639  ? 240.458 242.953 208.913 1.00 41.92  ? 608  VAL A CA  1 
ATOM   4692  C C   . VAL A  1 639  ? 239.517 244.132 208.696 1.00 41.92  ? 608  VAL A C   1 
ATOM   4693  O O   . VAL A  1 639  ? 239.841 245.279 209.006 1.00 41.92  ? 608  VAL A O   1 
ATOM   4694  C CB  . VAL A  1 639  ? 239.937 242.088 210.081 1.00 41.92  ? 608  VAL A CB  1 
ATOM   4695  C CG1 . VAL A  1 639  ? 240.785 240.857 210.256 1.00 41.92  ? 608  VAL A CG1 1 
ATOM   4696  C CG2 . VAL A  1 639  ? 239.914 242.890 211.350 1.00 41.92  ? 608  VAL A CG2 1 
ATOM   4697  N N   . ALA A  1 640  ? 238.337 243.835 208.146 1.00 35.58  ? 609  ALA A N   1 
ATOM   4698  C CA  . ALA A  1 640  ? 237.245 244.798 208.054 1.00 35.58  ? 609  ALA A CA  1 
ATOM   4699  C C   . ALA A  1 640  ? 236.038 244.291 208.833 1.00 35.58  ? 609  ALA A C   1 
ATOM   4700  O O   . ALA A  1 640  ? 235.869 243.088 209.010 1.00 35.58  ? 609  ALA A O   1 
ATOM   4701  C CB  . ALA A  1 640  ? 236.853 245.056 206.602 1.00 35.58  ? 609  ALA A CB  1 
ATOM   4702  N N   . VAL A  1 641  ? 235.213 245.203 209.344 1.00 33.78  ? 610  VAL A N   1 
ATOM   4703  C CA  . VAL A  1 641  ? 234.033 244.829 210.124 1.00 33.78  ? 610  VAL A CA  1 
ATOM   4704  C C   . VAL A  1 641  ? 232.787 245.449 209.504 1.00 33.78  ? 610  VAL A C   1 
ATOM   4705  O O   . VAL A  1 641  ? 232.779 246.639 209.174 1.00 33.78  ? 610  VAL A O   1 
ATOM   4706  C CB  . VAL A  1 641  ? 234.165 245.239 211.602 1.00 33.78  ? 610  VAL A CB  1 
ATOM   4707  C CG1 . VAL A  1 641  ? 233.008 244.701 212.393 1.00 33.78  ? 610  VAL A CG1 1 
ATOM   4708  C CG2 . VAL A  1 641  ? 235.444 244.703 212.186 1.00 33.78  ? 610  VAL A CG2 1 
ATOM   4709  N N   . LEU A  1 642  ? 231.740 244.641 209.345 1.00 34.86  ? 611  LEU A N   1 
ATOM   4710  C CA  . LEU A  1 642  ? 230.445 245.080 208.839 1.00 34.86  ? 611  LEU A CA  1 
ATOM   4711  C C   . LEU A  1 642  ? 229.415 245.039 209.962 1.00 34.86  ? 611  LEU A C   1 
ATOM   4712  O O   . LEU A  1 642  ? 229.224 243.994 210.594 1.00 34.86  ? 611  LEU A O   1 
ATOM   4713  C CB  . LEU A  1 642  ? 229.997 244.201 207.671 1.00 34.86  ? 611  LEU A CB  1 
ATOM   4714  C CG  . LEU A  1 642  ? 228.639 244.444 207.012 1.00 34.86  ? 611  LEU A CG  1 
ATOM   4715  C CD1 . LEU A  1 642  ? 228.663 245.678 206.157 1.00 34.86  ? 611  LEU A CD1 1 
ATOM   4716  C CD2 . LEU A  1 642  ? 228.258 243.251 206.180 1.00 34.86  ? 611  LEU A CD2 1 
ATOM   4717  N N   . TYR A  1 643  ? 228.761 246.173 210.210 1.00 39.08  ? 612  TYR A N   1 
ATOM   4718  C CA  . TYR A  1 643  ? 227.675 246.282 211.178 1.00 39.08  ? 612  TYR A CA  1 
ATOM   4719  C C   . TYR A  1 643  ? 226.373 246.364 210.395 1.00 39.08  ? 612  TYR A C   1 
ATOM   4720  O O   . TYR A  1 643  ? 226.106 247.363 209.724 1.00 39.08  ? 612  TYR A O   1 
ATOM   4721  C CB  . TYR A  1 643  ? 227.856 247.495 212.085 1.00 39.08  ? 612  TYR A CB  1 
ATOM   4722  C CG  . TYR A  1 643  ? 229.178 247.515 212.802 1.00 39.08  ? 612  TYR A CG  1 
ATOM   4723  C CD1 . TYR A  1 643  ? 230.285 248.116 212.240 1.00 39.08  ? 612  TYR A CD1 1 
ATOM   4724  C CD2 . TYR A  1 643  ? 229.323 246.903 214.035 1.00 39.08  ? 612  TYR A CD2 1 
ATOM   4725  C CE1 . TYR A  1 643  ? 231.490 248.119 212.888 1.00 39.08  ? 612  TYR A CE1 1 
ATOM   4726  C CE2 . TYR A  1 643  ? 230.523 246.901 214.687 1.00 39.08  ? 612  TYR A CE2 1 
ATOM   4727  C CZ  . TYR A  1 643  ? 231.601 247.513 214.112 1.00 39.08  ? 612  TYR A CZ  1 
ATOM   4728  O OH  . TYR A  1 643  ? 232.805 247.519 214.766 1.00 39.08  ? 612  TYR A OH  1 
ATOM   4729  N N   . GLN A  1 644  ? 225.569 245.308 210.485 1.00 41.63  ? 613  GLN A N   1 
ATOM   4730  C CA  . GLN A  1 644  ? 224.423 245.118 209.610 1.00 41.63  ? 613  GLN A CA  1 
ATOM   4731  C C   . GLN A  1 644  ? 223.215 245.975 209.961 1.00 41.63  ? 613  GLN A C   1 
ATOM   4732  O O   . GLN A  1 644  ? 222.309 246.098 209.132 1.00 41.63  ? 613  GLN A O   1 
ATOM   4733  C CB  . GLN A  1 644  ? 224.063 243.635 209.587 1.00 41.63  ? 613  GLN A CB  1 
ATOM   4734  C CG  . GLN A  1 644  ? 225.303 242.770 209.361 1.00 41.63  ? 613  GLN A CG  1 
ATOM   4735  C CD  . GLN A  1 644  ? 225.089 241.305 209.648 1.00 41.63  ? 613  GLN A CD  1 
ATOM   4736  O OE1 . GLN A  1 644  ? 225.911 240.469 209.283 1.00 41.63  ? 613  GLN A OE1 1 
ATOM   4737  N NE2 . GLN A  1 644  ? 223.982 240.982 210.297 1.00 41.63  ? 613  GLN A NE2 1 
ATOM   4738  N N   . ASP A  1 645  ? 223.158 246.547 211.158 1.00 46.06  ? 614  ASP A N   1 
ATOM   4739  C CA  . ASP A  1 645  ? 222.005 247.323 211.603 1.00 46.06  ? 614  ASP A CA  1 
ATOM   4740  C C   . ASP A  1 645  ? 222.433 248.702 212.081 1.00 46.06  ? 614  ASP A C   1 
ATOM   4741  O O   . ASP A  1 645  ? 221.876 249.248 213.033 1.00 46.06  ? 614  ASP A O   1 
ATOM   4742  C CB  . ASP A  1 645  ? 221.235 246.594 212.701 1.00 46.06  ? 614  ASP A CB  1 
ATOM   4743  C CG  . ASP A  1 645  ? 220.757 245.221 212.276 1.00 46.06  ? 614  ASP A CG  1 
ATOM   4744  O OD1 . ASP A  1 645  ? 219.915 245.135 211.361 1.00 46.06  ? 614  ASP A OD1 1 
ATOM   4745  O OD2 . ASP A  1 645  ? 221.202 244.222 212.872 1.00 46.06  ? 614  ASP A OD2 1 
ATOM   4746  N N   . VAL A  1 646  ? 223.430 249.290 211.426 1.00 48.22  ? 615  VAL A N   1 
ATOM   4747  C CA  . VAL A  1 646  ? 223.911 250.633 211.729 1.00 48.22  ? 615  VAL A CA  1 
ATOM   4748  C C   . VAL A  1 646  ? 223.938 251.433 210.437 1.00 48.22  ? 615  VAL A C   1 
ATOM   4749  O O   . VAL A  1 646  ? 224.436 250.950 209.417 1.00 48.22  ? 615  VAL A O   1 
ATOM   4750  C CB  . VAL A  1 646  ? 225.309 250.611 212.377 1.00 48.22  ? 615  VAL A CB  1 
ATOM   4751  C CG1 . VAL A  1 646  ? 225.881 252.009 212.473 1.00 48.22  ? 615  VAL A CG1 1 
ATOM   4752  C CG2 . VAL A  1 646  ? 225.249 249.988 213.746 1.00 48.22  ? 615  VAL A CG2 1 
ATOM   4753  N N   . ASN A  1 647  ? 223.387 252.645 210.473 1.00 58.34  ? 616  ASN A N   1 
ATOM   4754  C CA  . ASN A  1 647  ? 223.456 253.577 209.352 1.00 58.34  ? 616  ASN A CA  1 
ATOM   4755  C C   . ASN A  1 647  ? 224.431 254.693 209.708 1.00 58.34  ? 616  ASN A C   1 
ATOM   4756  O O   . ASN A  1 647  ? 224.136 255.535 210.559 1.00 58.34  ? 616  ASN A O   1 
ATOM   4757  C CB  . ASN A  1 647  ? 222.071 254.132 209.023 1.00 58.34  ? 616  ASN A CB  1 
ATOM   4758  C CG  . ASN A  1 647  ? 222.072 255.039 207.808 1.00 58.34  ? 616  ASN A CG  1 
ATOM   4759  O OD1 . ASN A  1 647  ? 223.117 255.487 207.348 1.00 58.34  ? 616  ASN A OD1 1 
ATOM   4760  N ND2 . ASN A  1 647  ? 220.893 255.309 207.278 1.00 58.34  ? 616  ASN A ND2 1 
ATOM   4761  N N   . CYS A  1 648  ? 225.578 254.706 209.039 1.00 60.35  ? 617  CYS A N   1 
ATOM   4762  C CA  . CYS A  1 648  ? 226.657 255.636 209.345 1.00 60.35  ? 617  CYS A CA  1 
ATOM   4763  C C   . CYS A  1 648  ? 226.554 256.886 208.485 1.00 60.35  ? 617  CYS A C   1 
ATOM   4764  O O   . CYS A  1 648  ? 225.753 257.776 208.757 1.00 60.35  ? 617  CYS A O   1 
ATOM   4765  C CB  . CYS A  1 648  ? 228.019 254.975 209.130 1.00 60.35  ? 617  CYS A CB  1 
ATOM   4766  S SG  . CYS A  1 648  ? 228.448 253.643 210.277 1.00 60.35  ? 617  CYS A SG  1 
ATOM   4767  N N   . TRP A  1 664  ? 227.152 256.024 217.917 1.00 58.77  ? 633  TRP A N   1 
ATOM   4768  C CA  . TRP A  1 664  ? 227.365 254.940 216.968 1.00 58.77  ? 633  TRP A CA  1 
ATOM   4769  C C   . TRP A  1 664  ? 227.637 253.637 217.693 1.00 58.77  ? 633  TRP A C   1 
ATOM   4770  O O   . TRP A  1 664  ? 228.587 253.533 218.463 1.00 58.77  ? 633  TRP A O   1 
ATOM   4771  C CB  . TRP A  1 664  ? 228.524 255.271 216.034 1.00 58.77  ? 633  TRP A CB  1 
ATOM   4772  C CG  . TRP A  1 664  ? 228.121 256.085 214.859 1.00 58.77  ? 633  TRP A CG  1 
ATOM   4773  C CD1 . TRP A  1 664  ? 226.884 256.587 214.597 1.00 58.77  ? 633  TRP A CD1 1 
ATOM   4774  C CD2 . TRP A  1 664  ? 228.968 256.528 213.796 1.00 58.77  ? 633  TRP A CD2 1 
ATOM   4775  N NE1 . TRP A  1 664  ? 226.901 257.301 213.426 1.00 58.77  ? 633  TRP A NE1 1 
ATOM   4776  C CE2 . TRP A  1 664  ? 228.172 257.282 212.916 1.00 58.77  ? 633  TRP A CE2 1 
ATOM   4777  C CE3 . TRP A  1 664  ? 230.321 256.352 213.498 1.00 58.77  ? 633  TRP A CE3 1 
ATOM   4778  C CZ2 . TRP A  1 664  ? 228.685 257.861 211.762 1.00 58.77  ? 633  TRP A CZ2 1 
ATOM   4779  C CZ3 . TRP A  1 664  ? 230.826 256.926 212.355 1.00 58.77  ? 633  TRP A CZ3 1 
ATOM   4780  C CH2 . TRP A  1 664  ? 230.012 257.671 211.499 1.00 58.77  ? 633  TRP A CH2 1 
ATOM   4781  N N   . ARG A  1 665  ? 226.786 252.644 217.453 1.00 48.96  ? 634  ARG A N   1 
ATOM   4782  C CA  . ARG A  1 665  ? 226.935 251.329 218.070 1.00 48.96  ? 634  ARG A CA  1 
ATOM   4783  C C   . ARG A  1 665  ? 227.965 250.522 217.280 1.00 48.96  ? 634  ARG A C   1 
ATOM   4784  O O   . ARG A  1 665  ? 227.647 249.583 216.549 1.00 48.96  ? 634  ARG A O   1 
ATOM   4785  C CB  . ARG A  1 665  ? 225.591 250.620 218.136 1.00 48.96  ? 634  ARG A CB  1 
ATOM   4786  C CG  . ARG A  1 665  ? 224.620 251.229 219.127 1.00 48.96  ? 634  ARG A CG  1 
ATOM   4787  C CD  . ARG A  1 665  ? 223.217 250.700 218.928 1.00 48.96  ? 634  ARG A CD  1 
ATOM   4788  N NE  . ARG A  1 665  ? 223.067 249.327 219.400 1.00 48.96  ? 634  ARG A NE  1 
ATOM   4789  C CZ  . ARG A  1 665  ? 222.760 248.998 220.650 1.00 48.96  ? 634  ARG A CZ  1 
ATOM   4790  N NH1 . ARG A  1 665  ? 222.582 249.943 221.557 1.00 48.96  ? 634  ARG A NH1 1 
ATOM   4791  N NH2 . ARG A  1 665  ? 222.642 247.724 220.992 1.00 48.96  ? 634  ARG A NH2 1 
ATOM   4792  N N   . VAL A  1 666  ? 229.231 250.906 217.447 1.00 47.01  ? 635  VAL A N   1 
ATOM   4793  C CA  . VAL A  1 666  ? 230.353 250.231 216.807 1.00 47.01  ? 635  VAL A CA  1 
ATOM   4794  C C   . VAL A  1 666  ? 231.449 250.019 217.842 1.00 47.01  ? 635  VAL A C   1 
ATOM   4795  O O   . VAL A  1 666  ? 231.536 250.743 218.837 1.00 47.01  ? 635  VAL A O   1 
ATOM   4796  C CB  . VAL A  1 666  ? 230.905 251.017 215.596 1.00 47.01  ? 635  VAL A CB  1 
ATOM   4797  C CG1 . VAL A  1 666  ? 229.824 251.249 214.561 1.00 47.01  ? 635  VAL A CG1 1 
ATOM   4798  C CG2 . VAL A  1 666  ? 231.520 252.326 216.042 1.00 47.01  ? 635  VAL A CG2 1 
ATOM   4799  N N   . TYR A  1 667  ? 232.287 249.005 217.606 1.00 48.72  ? 636  TYR A N   1 
ATOM   4800  C CA  . TYR A  1 667  ? 233.382 248.721 218.529 1.00 48.72  ? 636  TYR A CA  1 
ATOM   4801  C C   . TYR A  1 667  ? 234.485 249.767 218.427 1.00 48.72  ? 636  TYR A C   1 
ATOM   4802  O O   . TYR A  1 667  ? 235.115 250.112 219.433 1.00 48.72  ? 636  TYR A O   1 
ATOM   4803  C CB  . TYR A  1 667  ? 233.949 247.327 218.265 1.00 48.72  ? 636  TYR A CB  1 
ATOM   4804  C CG  . TYR A  1 667  ? 233.009 246.203 218.621 1.00 48.72  ? 636  TYR A CG  1 
ATOM   4805  C CD1 . TYR A  1 667  ? 232.726 245.198 217.710 1.00 48.72  ? 636  TYR A CD1 1 
ATOM   4806  C CD2 . TYR A  1 667  ? 232.385 246.160 219.857 1.00 48.72  ? 636  TYR A CD2 1 
ATOM   4807  C CE1 . TYR A  1 667  ? 231.860 244.175 218.024 1.00 48.72  ? 636  TYR A CE1 1 
ATOM   4808  C CE2 . TYR A  1 667  ? 231.516 245.139 220.181 1.00 48.72  ? 636  TYR A CE2 1 
ATOM   4809  C CZ  . TYR A  1 667  ? 231.256 244.152 219.260 1.00 48.72  ? 636  TYR A CZ  1 
ATOM   4810  O OH  . TYR A  1 667  ? 230.394 243.132 219.581 1.00 48.72  ? 636  TYR A OH  1 
ATOM   4811  N N   . SER A  1 668  ? 234.746 250.265 217.223 1.00 55.82  ? 637  SER A N   1 
ATOM   4812  C CA  . SER A  1 668  ? 235.721 251.323 217.006 1.00 55.82  ? 637  SER A CA  1 
ATOM   4813  C C   . SER A  1 668  ? 235.380 251.992 215.687 1.00 55.82  ? 637  SER A C   1 
ATOM   4814  O O   . SER A  1 668  ? 234.881 251.343 214.766 1.00 55.82  ? 637  SER A O   1 
ATOM   4815  C CB  . SER A  1 668  ? 237.157 250.793 216.983 1.00 55.82  ? 637  SER A CB  1 
ATOM   4816  O OG  . SER A  1 668  ? 237.416 250.084 215.787 1.00 55.82  ? 637  SER A OG  1 
ATOM   4817  N N   . THR A  1 669  ? 235.654 253.291 215.600 1.00 62.23  ? 638  THR A N   1 
ATOM   4818  C CA  . THR A  1 669  ? 235.308 254.025 214.389 1.00 62.23  ? 638  THR A CA  1 
ATOM   4819  C C   . THR A  1 669  ? 236.434 254.048 213.361 1.00 62.23  ? 638  THR A C   1 
ATOM   4820  O O   . THR A  1 669  ? 236.174 253.867 212.168 1.00 62.23  ? 638  THR A O   1 
ATOM   4821  C CB  . THR A  1 669  ? 234.875 255.453 214.741 1.00 62.23  ? 638  THR A CB  1 
ATOM   4822  O OG1 . THR A  1 669  ? 234.566 256.171 213.540 1.00 62.23  ? 638  THR A OG1 1 
ATOM   4823  C CG2 . THR A  1 669  ? 235.958 256.190 215.519 1.00 62.23  ? 638  THR A CG2 1 
ATOM   4824  N N   . GLY A  1 670  ? 237.675 254.249 213.794 1.00 64.41  ? 639  GLY A N   1 
ATOM   4825  C CA  . GLY A  1 670  ? 238.796 254.263 212.866 1.00 64.41  ? 639  GLY A CA  1 
ATOM   4826  C C   . GLY A  1 670  ? 238.608 255.258 211.739 1.00 64.41  ? 639  GLY A C   1 
ATOM   4827  O O   . GLY A  1 670  ? 238.344 256.446 211.962 1.00 64.41  ? 639  GLY A O   1 
ATOM   4828  N N   . SER A  1 671  ? 238.736 254.770 210.509 1.00 61.68  ? 640  SER A N   1 
ATOM   4829  C CA  . SER A  1 671  ? 238.456 255.550 209.310 1.00 61.68  ? 640  SER A CA  1 
ATOM   4830  C C   . SER A  1 671  ? 237.891 254.604 208.256 1.00 61.68  ? 640  SER A C   1 
ATOM   4831  O O   . SER A  1 671  ? 237.616 253.434 208.538 1.00 61.68  ? 640  SER A O   1 
ATOM   4832  C CB  . SER A  1 671  ? 239.714 256.282 208.829 1.00 61.68  ? 640  SER A CB  1 
ATOM   4833  O OG  . SER A  1 671  ? 240.655 255.374 208.286 1.00 61.68  ? 640  SER A OG  1 
ATOM   4834  N N   . ASN A  1 672  ? 237.716 255.114 207.035 1.00 55.17  ? 641  ASN A N   1 
ATOM   4835  C CA  . ASN A  1 672  ? 237.176 254.324 205.929 1.00 55.17  ? 641  ASN A CA  1 
ATOM   4836  C C   . ASN A  1 672  ? 235.783 253.796 206.269 1.00 55.17  ? 641  ASN A C   1 
ATOM   4837  O O   . ASN A  1 672  ? 235.468 252.624 206.068 1.00 55.17  ? 641  ASN A O   1 
ATOM   4838  C CB  . ASN A  1 672  ? 238.123 253.184 205.545 1.00 55.17  ? 641  ASN A CB  1 
ATOM   4839  C CG  . ASN A  1 672  ? 239.401 253.678 204.909 1.00 55.17  ? 641  ASN A CG  1 
ATOM   4840  O OD1 . ASN A  1 672  ? 240.459 253.071 205.063 1.00 55.17  ? 641  ASN A OD1 1 
ATOM   4841  N ND2 . ASN A  1 672  ? 239.306 254.773 204.169 1.00 55.17  ? 641  ASN A ND2 1 
ATOM   4842  N N   . VAL A  1 673  ? 234.947 254.680 206.800 1.00 50.53  ? 642  VAL A N   1 
ATOM   4843  C CA  . VAL A  1 673  ? 233.556 254.351 207.087 1.00 50.53  ? 642  VAL A CA  1 
ATOM   4844  C C   . VAL A  1 673  ? 232.735 254.505 205.814 1.00 50.53  ? 642  VAL A C   1 
ATOM   4845  O O   . VAL A  1 673  ? 232.619 255.605 205.268 1.00 50.53  ? 642  VAL A O   1 
ATOM   4846  C CB  . VAL A  1 673  ? 233.005 255.246 208.204 1.00 50.53  ? 642  VAL A CB  1 
ATOM   4847  C CG1 . VAL A  1 673  ? 231.522 255.026 208.364 1.00 50.53  ? 642  VAL A CG1 1 
ATOM   4848  C CG2 . VAL A  1 673  ? 233.742 254.977 209.505 1.00 50.53  ? 642  VAL A CG2 1 
ATOM   4849  N N   . PHE A  1 674  ? 232.165 253.400 205.336 1.00 47.85  ? 643  PHE A N   1 
ATOM   4850  C CA  . PHE A  1 674  ? 231.477 253.360 204.053 1.00 47.85  ? 643  PHE A CA  1 
ATOM   4851  C C   . PHE A  1 674  ? 230.115 252.708 204.247 1.00 47.85  ? 643  PHE A C   1 
ATOM   4852  O O   . PHE A  1 674  ? 230.017 251.638 204.850 1.00 47.85  ? 643  PHE A O   1 
ATOM   4853  C CB  . PHE A  1 674  ? 232.330 252.622 203.014 1.00 47.85  ? 643  PHE A CB  1 
ATOM   4854  C CG  . PHE A  1 674  ? 231.611 252.306 201.742 1.00 47.85  ? 643  PHE A CG  1 
ATOM   4855  C CD1 . PHE A  1 674  ? 230.925 253.288 201.052 1.00 47.85  ? 643  PHE A CD1 1 
ATOM   4856  C CD2 . PHE A  1 674  ? 231.673 251.037 201.203 1.00 47.85  ? 643  PHE A CD2 1 
ATOM   4857  C CE1 . PHE A  1 674  ? 230.270 252.996 199.877 1.00 47.85  ? 643  PHE A CE1 1 
ATOM   4858  C CE2 . PHE A  1 674  ? 231.030 250.742 200.025 1.00 47.85  ? 643  PHE A CE2 1 
ATOM   4859  C CZ  . PHE A  1 674  ? 230.323 251.721 199.362 1.00 47.85  ? 643  PHE A CZ  1 
ATOM   4860  N N   . GLN A  1 675  ? 229.070 253.332 203.719 1.00 48.41  ? 644  GLN A N   1 
ATOM   4861  C CA  . GLN A  1 675  ? 227.706 252.863 203.918 1.00 48.41  ? 644  GLN A CA  1 
ATOM   4862  C C   . GLN A  1 675  ? 227.225 252.091 202.698 1.00 48.41  ? 644  GLN A C   1 
ATOM   4863  O O   . GLN A  1 675  ? 227.264 252.606 201.578 1.00 48.41  ? 644  GLN A O   1 
ATOM   4864  C CB  . GLN A  1 675  ? 226.778 254.048 204.188 1.00 48.41  ? 644  GLN A CB  1 
ATOM   4865  C CG  . GLN A  1 675  ? 225.335 253.688 204.500 1.00 48.41  ? 644  GLN A CG  1 
ATOM   4866  C CD  . GLN A  1 675  ? 225.171 252.946 205.797 1.00 48.41  ? 644  GLN A CD  1 
ATOM   4867  O OE1 . GLN A  1 675  ? 225.991 253.061 206.698 1.00 48.41  ? 644  GLN A OE1 1 
ATOM   4868  N NE2 . GLN A  1 675  ? 224.102 252.178 205.901 1.00 48.41  ? 644  GLN A NE2 1 
ATOM   4869  N N   . THR A  1 676  ? 226.758 250.865 202.923 1.00 46.62  ? 645  THR A N   1 
ATOM   4870  C CA  . THR A  1 676  ? 226.163 250.017 201.907 1.00 46.62  ? 645  THR A CA  1 
ATOM   4871  C C   . THR A  1 676  ? 224.776 249.608 202.381 1.00 46.62  ? 645  THR A C   1 
ATOM   4872  O O   . THR A  1 676  ? 224.443 249.721 203.563 1.00 46.62  ? 645  THR A O   1 
ATOM   4873  C CB  . THR A  1 676  ? 227.023 248.771 201.648 1.00 46.62  ? 645  THR A CB  1 
ATOM   4874  O OG1 . THR A  1 676  ? 226.802 247.810 202.686 1.00 46.62  ? 645  THR A OG1 1 
ATOM   4875  C CG2 . THR A  1 676  ? 228.494 249.119 201.637 1.00 46.62  ? 645  THR A CG2 1 
ATOM   4876  N N   . ARG A  1 677  ? 223.971 249.079 201.458 1.00 50.29  ? 646  ARG A N   1 
ATOM   4877  C CA  . ARG A  1 677  ? 222.683 248.529 201.858 1.00 50.29  ? 646  ARG A CA  1 
ATOM   4878  C C   . ARG A  1 677  ? 222.806 247.271 202.703 1.00 50.29  ? 646  ARG A C   1 
ATOM   4879  O O   . ARG A  1 677  ? 221.811 246.848 203.297 1.00 50.29  ? 646  ARG A O   1 
ATOM   4880  C CB  . ARG A  1 677  ? 221.823 248.240 200.630 1.00 50.29  ? 646  ARG A CB  1 
ATOM   4881  C CG  . ARG A  1 677  ? 221.041 249.440 200.148 1.00 50.29  ? 646  ARG A CG  1 
ATOM   4882  C CD  . ARG A  1 677  ? 220.159 249.101 198.966 1.00 50.29  ? 646  ARG A CD  1 
ATOM   4883  N NE  . ARG A  1 677  ? 220.927 248.836 197.757 1.00 50.29  ? 646  ARG A NE  1 
ATOM   4884  C CZ  . ARG A  1 677  ? 220.400 248.364 196.634 1.00 50.29  ? 646  ARG A CZ  1 
ATOM   4885  N NH1 . ARG A  1 677  ? 219.104 248.101 196.570 1.00 50.29  ? 646  ARG A NH1 1 
ATOM   4886  N NH2 . ARG A  1 677  ? 221.167 248.153 195.576 1.00 50.29  ? 646  ARG A NH2 1 
ATOM   4887  N N   . ALA A  1 678  ? 223.985 246.658 202.761 1.00 45.67  ? 647  ALA A N   1 
ATOM   4888  C CA  . ALA A  1 678  ? 224.224 245.580 203.707 1.00 45.67  ? 647  ALA A CA  1 
ATOM   4889  C C   . ALA A  1 678  ? 224.565 246.082 205.105 1.00 45.67  ? 647  ALA A C   1 
ATOM   4890  O O   . ALA A  1 678  ? 224.499 245.299 206.055 1.00 45.67  ? 647  ALA A O   1 
ATOM   4891  C CB  . ALA A  1 678  ? 225.338 244.670 203.193 1.00 45.67  ? 647  ALA A CB  1 
ATOM   4892  N N   . GLY A  1 679  ? 224.923 247.356 205.257 1.00 44.60  ? 648  GLY A N   1 
ATOM   4893  C CA  . GLY A  1 679  ? 225.218 247.921 206.555 1.00 44.60  ? 648  GLY A CA  1 
ATOM   4894  C C   . GLY A  1 679  ? 226.381 248.885 206.472 1.00 44.60  ? 648  GLY A C   1 
ATOM   4895  O O   . GLY A  1 679  ? 226.746 249.347 205.396 1.00 44.60  ? 648  GLY A O   1 
ATOM   4896  N N   . CYS A  1 680  ? 226.962 249.198 207.627 1.00 43.46  ? 649  CYS A N   1 
ATOM   4897  C CA  . CYS A  1 680  ? 228.124 250.075 207.696 1.00 43.46  ? 649  CYS A CA  1 
ATOM   4898  C C   . CYS A  1 680  ? 229.405 249.253 207.715 1.00 43.46  ? 649  CYS A C   1 
ATOM   4899  O O   . CYS A  1 680  ? 229.580 248.387 208.573 1.00 43.46  ? 649  CYS A O   1 
ATOM   4900  C CB  . CYS A  1 680  ? 228.038 250.965 208.937 1.00 43.46  ? 649  CYS A CB  1 
ATOM   4901  S SG  . CYS A  1 680  ? 229.323 252.218 209.122 1.00 43.46  ? 649  CYS A SG  1 
ATOM   4902  N N   . LEU A  1 681  ? 230.304 249.535 206.780 1.00 38.69  ? 650  LEU A N   1 
ATOM   4903  C CA  . LEU A  1 681  ? 231.553 248.810 206.630 1.00 38.69  ? 650  LEU A CA  1 
ATOM   4904  C C   . LEU A  1 681  ? 232.700 249.702 207.086 1.00 38.69  ? 650  LEU A C   1 
ATOM   4905  O O   . LEU A  1 681  ? 232.842 250.833 206.608 1.00 38.69  ? 650  LEU A O   1 
ATOM   4906  C CB  . LEU A  1 681  ? 231.746 248.376 205.177 1.00 38.69  ? 650  LEU A CB  1 
ATOM   4907  C CG  . LEU A  1 681  ? 232.923 247.473 204.820 1.00 38.69  ? 650  LEU A CG  1 
ATOM   4908  C CD1 . LEU A  1 681  ? 232.947 246.263 205.713 1.00 38.69  ? 650  LEU A CD1 1 
ATOM   4909  C CD2 . LEU A  1 681  ? 232.834 247.057 203.381 1.00 38.69  ? 650  LEU A CD2 1 
ATOM   4910  N N   . ILE A  1 682  ? 233.508 249.204 208.017 1.00 41.05  ? 651  ILE A N   1 
ATOM   4911  C CA  . ILE A  1 682  ? 234.589 249.973 208.614 1.00 41.05  ? 651  ILE A CA  1 
ATOM   4912  C C   . ILE A  1 682  ? 235.882 249.196 208.427 1.00 41.05  ? 651  ILE A C   1 
ATOM   4913  O O   . ILE A  1 682  ? 235.965 248.016 208.790 1.00 41.05  ? 651  ILE A O   1 
ATOM   4914  C CB  . ILE A  1 682  ? 234.331 250.266 210.102 1.00 41.05  ? 651  ILE A CB  1 
ATOM   4915  C CG1 . ILE A  1 682  ? 233.115 251.174 210.255 1.00 41.05  ? 651  ILE A CG1 1 
ATOM   4916  C CG2 . ILE A  1 682  ? 235.532 250.940 210.723 1.00 41.05  ? 651  ILE A CG2 1 
ATOM   4917  C CD1 . ILE A  1 682  ? 232.799 251.525 211.672 1.00 41.05  ? 651  ILE A CD1 1 
ATOM   4918  N N   . GLY A  1 683  ? 236.888 249.861 207.867 1.00 43.23  ? 652  GLY A N   1 
ATOM   4919  C CA  . GLY A  1 683  ? 238.167 249.248 207.602 1.00 43.23  ? 652  GLY A CA  1 
ATOM   4920  C C   . GLY A  1 683  ? 238.425 248.884 206.159 1.00 43.23  ? 652  GLY A C   1 
ATOM   4921  O O   . GLY A  1 683  ? 239.386 248.159 205.889 1.00 43.23  ? 652  GLY A O   1 
ATOM   4922  N N   . ALA A  1 684  ? 237.609 249.368 205.225 1.00 47.83  ? 653  ALA A N   1 
ATOM   4923  C CA  . ALA A  1 684  ? 237.754 249.053 203.813 1.00 47.83  ? 653  ALA A CA  1 
ATOM   4924  C C   . ALA A  1 684  ? 237.670 250.325 202.988 1.00 47.83  ? 653  ALA A C   1 
ATOM   4925  O O   . ALA A  1 684  ? 236.866 251.213 203.278 1.00 47.83  ? 653  ALA A O   1 
ATOM   4926  C CB  . ALA A  1 684  ? 236.683 248.069 203.352 1.00 47.83  ? 653  ALA A CB  1 
ATOM   4927  N N   . GLU A  1 685  ? 238.489 250.388 201.944 1.00 53.04  ? 654  GLU A N   1 
ATOM   4928  C CA  . GLU A  1 685  ? 238.515 251.508 201.014 1.00 53.04  ? 654  GLU A CA  1 
ATOM   4929  C C   . GLU A  1 685  ? 237.575 251.272 199.840 1.00 53.04  ? 654  GLU A C   1 
ATOM   4930  O O   . GLU A  1 685  ? 237.559 250.184 199.261 1.00 53.04  ? 654  GLU A O   1 
ATOM   4931  C CB  . GLU A  1 685  ? 239.935 251.721 200.497 1.00 53.04  ? 654  GLU A CB  1 
ATOM   4932  C CG  . GLU A  1 685  ? 240.083 252.902 199.574 1.00 53.04  ? 654  GLU A CG  1 
ATOM   4933  C CD  . GLU A  1 685  ? 241.510 253.100 199.123 1.00 53.04  ? 654  GLU A CD  1 
ATOM   4934  O OE1 . GLU A  1 685  ? 242.369 252.283 199.510 1.00 53.04  ? 654  GLU A OE1 1 
ATOM   4935  O OE2 . GLU A  1 685  ? 241.769 254.059 198.365 1.00 53.04  ? 654  GLU A OE2 1 
ATOM   4936  N N   . HIS A  1 686  ? 236.793 252.288 199.493 1.00 54.08  ? 655  HIS A N   1 
ATOM   4937  C CA  . HIS A  1 686  ? 235.807 252.179 198.428 1.00 54.08  ? 655  HIS A CA  1 
ATOM   4938  C C   . HIS A  1 686  ? 236.413 252.696 197.131 1.00 54.08  ? 655  HIS A C   1 
ATOM   4939  O O   . HIS A  1 686  ? 236.949 253.807 197.093 1.00 54.08  ? 655  HIS A O   1 
ATOM   4940  C CB  . HIS A  1 686  ? 234.552 252.975 198.780 1.00 54.08  ? 655  HIS A CB  1 
ATOM   4941  C CG  . HIS A  1 686  ? 233.538 253.028 197.683 1.00 54.08  ? 655  HIS A CG  1 
ATOM   4942  N ND1 . HIS A  1 686  ? 232.979 251.898 197.129 1.00 54.08  ? 655  HIS A ND1 1 
ATOM   4943  C CD2 . HIS A  1 686  ? 232.972 254.078 197.043 1.00 54.08  ? 655  HIS A CD2 1 
ATOM   4944  C CE1 . HIS A  1 686  ? 232.118 252.248 196.191 1.00 54.08  ? 655  HIS A CE1 1 
ATOM   4945  N NE2 . HIS A  1 686  ? 232.095 253.566 196.120 1.00 54.08  ? 655  HIS A NE2 1 
ATOM   4946  N N   . VAL A  1 687  ? 236.324 251.896 196.069 1.00 56.70  ? 656  VAL A N   1 
ATOM   4947  C CA  . VAL A  1 687  ? 236.873 252.262 194.772 1.00 56.70  ? 656  VAL A CA  1 
ATOM   4948  C C   . VAL A  1 687  ? 235.745 252.329 193.751 1.00 56.70  ? 656  VAL A C   1 
ATOM   4949  O O   . VAL A  1 687  ? 234.685 251.723 193.916 1.00 56.70  ? 656  VAL A O   1 
ATOM   4950  C CB  . VAL A  1 687  ? 237.968 251.285 194.306 1.00 56.70  ? 656  VAL A CB  1 
ATOM   4951  C CG1 . VAL A  1 687  ? 239.096 251.249 195.306 1.00 56.70  ? 656  VAL A CG1 1 
ATOM   4952  C CG2 . VAL A  1 687  ? 237.395 249.903 194.109 1.00 56.70  ? 656  VAL A CG2 1 
ATOM   4953  N N   . ASN A  1 688  ? 235.981 253.098 192.690 1.00 70.84  ? 657  ASN A N   1 
ATOM   4954  C CA  . ASN A  1 688  ? 234.984 253.344 191.657 1.00 70.84  ? 657  ASN A CA  1 
ATOM   4955  C C   . ASN A  1 688  ? 235.086 252.367 190.496 1.00 70.84  ? 657  ASN A C   1 
ATOM   4956  O O   . ASN A  1 688  ? 234.378 252.532 189.499 1.00 70.84  ? 657  ASN A O   1 
ATOM   4957  C CB  . ASN A  1 688  ? 235.110 254.771 191.127 1.00 70.84  ? 657  ASN A CB  1 
ATOM   4958  C CG  . ASN A  1 688  ? 234.554 255.796 192.081 1.00 70.84  ? 657  ASN A CG  1 
ATOM   4959  O OD1 . ASN A  1 688  ? 234.143 255.470 193.192 1.00 70.84  ? 657  ASN A OD1 1 
ATOM   4960  N ND2 . ASN A  1 688  ? 234.540 257.052 191.652 1.00 70.84  ? 657  ASN A ND2 1 
ATOM   4961  N N   . ASN A  1 689  ? 235.949 251.366 190.598 1.00 62.81  ? 658  ASN A N   1 
ATOM   4962  C CA  . ASN A  1 689  ? 236.066 250.333 189.581 1.00 62.81  ? 658  ASN A CA  1 
ATOM   4963  C C   . ASN A  1 689  ? 234.951 249.305 189.754 1.00 62.81  ? 658  ASN A C   1 
ATOM   4964  O O   . ASN A  1 689  ? 234.034 249.469 190.562 1.00 62.81  ? 658  ASN A O   1 
ATOM   4965  C CB  . ASN A  1 689  ? 237.443 249.686 189.655 1.00 62.81  ? 658  ASN A CB  1 
ATOM   4966  C CG  . ASN A  1 689  ? 238.543 250.605 189.183 1.00 62.81  ? 658  ASN A CG  1 
ATOM   4967  O OD1 . ASN A  1 689  ? 239.722 250.353 189.423 1.00 62.81  ? 658  ASN A OD1 1 
ATOM   4968  N ND2 . ASN A  1 689  ? 238.164 251.679 188.504 1.00 62.81  ? 658  ASN A ND2 1 
ATOM   4969  N N   . SER A  1 690  ? 235.020 248.225 188.979 1.00 59.16  ? 659  SER A N   1 
ATOM   4970  C CA  . SER A  1 690  ? 234.063 247.128 189.090 1.00 59.16  ? 659  SER A CA  1 
ATOM   4971  C C   . SER A  1 690  ? 234.786 245.868 188.627 1.00 59.16  ? 659  SER A C   1 
ATOM   4972  O O   . SER A  1 690  ? 234.956 245.659 187.423 1.00 59.16  ? 659  SER A O   1 
ATOM   4973  C CB  . SER A  1 690  ? 232.814 247.389 188.264 1.00 59.16  ? 659  SER A CB  1 
ATOM   4974  O OG  . SER A  1 690  ? 232.136 248.545 188.715 1.00 59.16  ? 659  SER A OG  1 
ATOM   4975  N N   . TYR A  1 691  ? 235.225 245.055 189.577 1.00 55.71  ? 660  TYR A N   1 
ATOM   4976  C CA  . TYR A  1 691  ? 235.944 243.835 189.267 1.00 55.71  ? 660  TYR A CA  1 
ATOM   4977  C C   . TYR A  1 691  ? 235.005 242.646 189.430 1.00 55.71  ? 660  TYR A C   1 
ATOM   4978  O O   . TYR A  1 691  ? 233.821 242.795 189.729 1.00 55.71  ? 660  TYR A O   1 
ATOM   4979  C CB  . TYR A  1 691  ? 237.167 243.701 190.174 1.00 55.71  ? 660  TYR A CB  1 
ATOM   4980  C CG  . TYR A  1 691  ? 238.059 244.916 190.182 1.00 55.71  ? 660  TYR A CG  1 
ATOM   4981  C CD1 . TYR A  1 691  ? 238.879 245.210 189.107 1.00 55.71  ? 660  TYR A CD1 1 
ATOM   4982  C CD2 . TYR A  1 691  ? 238.065 245.782 191.260 1.00 55.71  ? 660  TYR A CD2 1 
ATOM   4983  C CE1 . TYR A  1 691  ? 239.687 246.324 189.115 1.00 55.71  ? 660  TYR A CE1 1 
ATOM   4984  C CE2 . TYR A  1 691  ? 238.867 246.894 191.276 1.00 55.71  ? 660  TYR A CE2 1 
ATOM   4985  C CZ  . TYR A  1 691  ? 239.676 247.162 190.203 1.00 55.71  ? 660  TYR A CZ  1 
ATOM   4986  O OH  . TYR A  1 691  ? 240.478 248.275 190.220 1.00 55.71  ? 660  TYR A OH  1 
ATOM   4987  N N   . GLU A  1 692  ? 235.538 241.450 189.221 1.00 57.99  ? 661  GLU A N   1 
ATOM   4988  C CA  . GLU A  1 692  ? 234.800 240.254 189.582 1.00 57.99  ? 661  GLU A CA  1 
ATOM   4989  C C   . GLU A  1 692  ? 234.798 240.082 191.097 1.00 57.99  ? 661  GLU A C   1 
ATOM   4990  O O   . GLU A  1 692  ? 235.670 240.590 191.805 1.00 57.99  ? 661  GLU A O   1 
ATOM   4991  C CB  . GLU A  1 692  ? 235.401 239.028 188.904 1.00 57.99  ? 661  GLU A CB  1 
ATOM   4992  C CG  . GLU A  1 692  ? 235.197 239.007 187.406 1.00 57.99  ? 661  GLU A CG  1 
ATOM   4993  C CD  . GLU A  1 692  ? 235.558 237.676 186.791 1.00 57.99  ? 661  GLU A CD  1 
ATOM   4994  O OE1 . GLU A  1 692  ? 235.780 236.711 187.552 1.00 57.99  ? 661  GLU A OE1 1 
ATOM   4995  O OE2 . GLU A  1 692  ? 235.622 237.593 185.548 1.00 57.99  ? 661  GLU A OE2 1 
ATOM   4996  N N   . CYS A  1 693  ? 233.806 239.352 191.596 1.00 55.42  ? 662  CYS A N   1 
ATOM   4997  C CA  . CYS A  1 693  ? 233.618 239.244 193.038 1.00 55.42  ? 662  CYS A CA  1 
ATOM   4998  C C   . CYS A  1 693  ? 234.664 238.313 193.636 1.00 55.42  ? 662  CYS A C   1 
ATOM   4999  O O   . CYS A  1 693  ? 234.800 237.165 193.204 1.00 55.42  ? 662  CYS A O   1 
ATOM   5000  C CB  . CYS A  1 693  ? 232.213 238.750 193.362 1.00 55.42  ? 662  CYS A CB  1 
ATOM   5001  S SG  . CYS A  1 693  ? 231.721 239.017 195.082 1.00 55.42  ? 662  CYS A SG  1 
ATOM   5002  N N   . ASP A  1 694  ? 235.410 238.810 194.625 1.00 49.56  ? 663  ASP A N   1 
ATOM   5003  C CA  . ASP A  1 694  ? 236.354 237.989 195.377 1.00 49.56  ? 663  ASP A CA  1 
ATOM   5004  C C   . ASP A  1 694  ? 235.725 237.470 196.667 1.00 49.56  ? 663  ASP A C   1 
ATOM   5005  O O   . ASP A  1 694  ? 235.562 236.260 196.836 1.00 49.56  ? 663  ASP A O   1 
ATOM   5006  C CB  . ASP A  1 694  ? 237.626 238.792 195.671 1.00 49.56  ? 663  ASP A CB  1 
ATOM   5007  C CG  . ASP A  1 694  ? 238.752 237.933 196.206 1.00 49.56  ? 663  ASP A CG  1 
ATOM   5008  O OD1 . ASP A  1 694  ? 238.517 236.743 196.497 1.00 49.56  ? 663  ASP A OD1 1 
ATOM   5009  O OD2 . ASP A  1 694  ? 239.880 238.448 196.337 1.00 49.56  ? 663  ASP A OD2 1 
ATOM   5010  N N   . ILE A  1 695  ? 235.351 238.364 197.573 1.00 43.20  ? 664  ILE A N   1 
ATOM   5011  C CA  . ILE A  1 695  ? 234.668 238.008 198.809 1.00 43.20  ? 664  ILE A CA  1 
ATOM   5012  C C   . ILE A  1 695  ? 233.309 238.692 198.778 1.00 43.20  ? 664  ILE A C   1 
ATOM   5013  O O   . ILE A  1 695  ? 233.240 239.922 198.737 1.00 43.20  ? 664  ILE A O   1 
ATOM   5014  C CB  . ILE A  1 695  ? 235.445 238.418 200.073 1.00 43.20  ? 664  ILE A CB  1 
ATOM   5015  C CG1 . ILE A  1 695  ? 236.860 237.844 200.075 1.00 43.20  ? 664  ILE A CG1 1 
ATOM   5016  C CG2 . ILE A  1 695  ? 234.691 238.017 201.317 1.00 43.20  ? 664  ILE A CG2 1 
ATOM   5017  C CD1 . ILE A  1 695  ? 237.845 238.669 200.859 1.00 43.20  ? 664  ILE A CD1 1 
ATOM   5018  N N   . PRO A  1 696  ? 232.205 237.950 198.773 1.00 41.01  ? 665  PRO A N   1 
ATOM   5019  C CA  . PRO A  1 696  ? 230.889 238.594 198.738 1.00 41.01  ? 665  PRO A CA  1 
ATOM   5020  C C   . PRO A  1 696  ? 230.540 239.243 200.068 1.00 41.01  ? 665  PRO A C   1 
ATOM   5021  O O   . PRO A  1 696  ? 230.602 238.607 201.120 1.00 41.01  ? 665  PRO A O   1 
ATOM   5022  C CB  . PRO A  1 696  ? 229.946 237.435 198.413 1.00 41.01  ? 665  PRO A CB  1 
ATOM   5023  C CG  . PRO A  1 696  ? 230.644 236.242 198.936 1.00 41.01  ? 665  PRO A CG  1 
ATOM   5024  C CD  . PRO A  1 696  ? 232.101 236.483 198.725 1.00 41.01  ? 665  PRO A CD  1 
ATOM   5025  N N   . ILE A  1 697  ? 230.164 240.516 200.010 1.00 40.18  ? 666  ILE A N   1 
ATOM   5026  C CA  . ILE A  1 697  ? 229.652 241.236 201.167 1.00 40.18  ? 666  ILE A CA  1 
ATOM   5027  C C   . ILE A  1 697  ? 228.133 241.305 201.143 1.00 40.18  ? 666  ILE A C   1 
ATOM   5028  O O   . ILE A  1 697  ? 227.487 241.152 202.178 1.00 40.18  ? 666  ILE A O   1 
ATOM   5029  C CB  . ILE A  1 697  ? 230.267 242.649 201.260 1.00 40.18  ? 666  ILE A CB  1 
ATOM   5030  C CG1 . ILE A  1 697  ? 231.790 242.590 201.223 1.00 40.18  ? 666  ILE A CG1 1 
ATOM   5031  C CG2 . ILE A  1 697  ? 229.792 243.359 202.506 1.00 40.18  ? 666  ILE A CG2 1 
ATOM   5032  C CD1 . ILE A  1 697  ? 232.376 241.682 202.242 1.00 40.18  ? 666  ILE A CD1 1 
ATOM   5033  N N   . GLY A  1 698  ? 227.550 241.531 199.969 1.00 38.86  ? 667  GLY A N   1 
ATOM   5034  C CA  . GLY A  1 698  ? 226.105 241.532 199.870 1.00 38.86  ? 667  GLY A CA  1 
ATOM   5035  C C   . GLY A  1 698  ? 225.536 242.775 199.224 1.00 38.86  ? 667  GLY A C   1 
ATOM   5036  O O   . GLY A  1 698  ? 226.211 243.804 199.149 1.00 38.86  ? 667  GLY A O   1 
ATOM   5037  N N   . ALA A  1 699  ? 224.305 242.674 198.722 1.00 40.51  ? 668  ALA A N   1 
ATOM   5038  C CA  . ALA A  1 699  ? 223.621 243.778 198.046 1.00 40.51  ? 668  ALA A CA  1 
ATOM   5039  C C   . ALA A  1 699  ? 224.453 244.329 196.891 1.00 40.51  ? 668  ALA A C   1 
ATOM   5040  O O   . ALA A  1 699  ? 224.449 245.527 196.609 1.00 40.51  ? 668  ALA A O   1 
ATOM   5041  C CB  . ALA A  1 699  ? 223.254 244.884 199.031 1.00 40.51  ? 668  ALA A CB  1 
ATOM   5042  N N   . GLY A  1 700  ? 225.148 243.438 196.197 1.00 39.76  ? 669  GLY A N   1 
ATOM   5043  C CA  . GLY A  1 700  ? 225.989 243.793 195.079 1.00 39.76  ? 669  GLY A CA  1 
ATOM   5044  C C   . GLY A  1 700  ? 227.404 244.203 195.418 1.00 39.76  ? 669  GLY A C   1 
ATOM   5045  O O   . GLY A  1 700  ? 228.187 244.459 194.499 1.00 39.76  ? 669  GLY A O   1 
ATOM   5046  N N   . ILE A  1 701  ? 227.752 244.307 196.699 1.00 40.16  ? 670  ILE A N   1 
ATOM   5047  C CA  . ILE A  1 701  ? 229.060 244.790 197.133 1.00 40.16  ? 670  ILE A CA  1 
ATOM   5048  C C   . ILE A  1 701  ? 229.968 243.595 197.391 1.00 40.16  ? 670  ILE A C   1 
ATOM   5049  O O   . ILE A  1 701  ? 229.551 242.614 198.024 1.00 40.16  ? 670  ILE A O   1 
ATOM   5050  C CB  . ILE A  1 701  ? 228.943 245.675 198.387 1.00 40.16  ? 670  ILE A CB  1 
ATOM   5051  C CG1 . ILE A  1 701  ? 228.034 246.868 198.120 1.00 40.16  ? 670  ILE A CG1 1 
ATOM   5052  C CG2 . ILE A  1 701  ? 230.305 246.170 198.811 1.00 40.16  ? 670  ILE A CG2 1 
ATOM   5053  C CD1 . ILE A  1 701  ? 228.412 247.646 196.908 1.00 40.16  ? 670  ILE A CD1 1 
ATOM   5054  N N   . CYS A  1 702  ? 231.211 243.677 196.910 1.00 46.11  ? 671  CYS A N   1 
ATOM   5055  C CA  . CYS A  1 702  ? 232.227 242.651 197.109 1.00 46.11  ? 671  CYS A CA  1 
ATOM   5056  C C   . CYS A  1 702  ? 233.492 243.308 197.646 1.00 46.11  ? 671  CYS A C   1 
ATOM   5057  O O   . CYS A  1 702  ? 233.648 244.528 197.588 1.00 46.11  ? 671  CYS A O   1 
ATOM   5058  C CB  . CYS A  1 702  ? 232.536 241.882 195.814 1.00 46.11  ? 671  CYS A CB  1 
ATOM   5059  S SG  . CYS A  1 702  ? 231.137 240.965 195.126 1.00 46.11  ? 671  CYS A SG  1 
ATOM   5060  N N   . ALA A  1 703  ? 234.403 242.490 198.171 1.00 45.43  ? 672  ALA A N   1 
ATOM   5061  C CA  . ALA A  1 703  ? 235.629 242.997 198.773 1.00 45.43  ? 672  ALA A CA  1 
ATOM   5062  C C   . ALA A  1 703  ? 236.817 242.173 198.303 1.00 45.43  ? 672  ALA A C   1 
ATOM   5063  O O   . ALA A  1 703  ? 236.680 241.012 197.923 1.00 45.43  ? 672  ALA A O   1 
ATOM   5064  C CB  . ALA A  1 703  ? 235.557 242.975 200.300 1.00 45.43  ? 672  ALA A CB  1 
ATOM   5065  N N   . SER A  1 704  ? 237.997 242.785 198.355 1.00 51.03  ? 673  SER A N   1 
ATOM   5066  C CA  . SER A  1 704  ? 239.222 242.112 197.949 1.00 51.03  ? 673  SER A CA  1 
ATOM   5067  C C   . SER A  1 704  ? 240.414 242.742 198.657 1.00 51.03  ? 673  SER A C   1 
ATOM   5068  O O   . SER A  1 704  ? 240.301 243.783 199.301 1.00 51.03  ? 673  SER A O   1 
ATOM   5069  C CB  . SER A  1 704  ? 239.396 242.166 196.431 1.00 51.03  ? 673  SER A CB  1 
ATOM   5070  O OG  . SER A  1 704  ? 240.551 241.462 196.023 1.00 51.03  ? 673  SER A OG  1 
ATOM   5071  N N   . TYR A  1 705  ? 241.566 242.089 198.534 1.00 56.77  ? 674  TYR A N   1 
ATOM   5072  C CA  . TYR A  1 705  ? 242.826 242.550 199.114 1.00 56.77  ? 674  TYR A CA  1 
ATOM   5073  C C   . TYR A  1 705  ? 243.788 242.904 197.989 1.00 56.77  ? 674  TYR A C   1 
ATOM   5074  O O   . TYR A  1 705  ? 244.338 242.012 197.335 1.00 56.77  ? 674  TYR A O   1 
ATOM   5075  C CB  . TYR A  1 705  ? 243.416 241.466 200.009 1.00 56.77  ? 674  TYR A CB  1 
ATOM   5076  C CG  . TYR A  1 705  ? 244.590 241.890 200.856 1.00 56.77  ? 674  TYR A CG  1 
ATOM   5077  C CD1 . TYR A  1 705  ? 245.815 241.257 200.733 1.00 56.77  ? 674  TYR A CD1 1 
ATOM   5078  C CD2 . TYR A  1 705  ? 244.473 242.905 201.787 1.00 56.77  ? 674  TYR A CD2 1 
ATOM   5079  C CE1 . TYR A  1 705  ? 246.888 241.627 201.505 1.00 56.77  ? 674  TYR A CE1 1 
ATOM   5080  C CE2 . TYR A  1 705  ? 245.544 243.282 202.564 1.00 56.77  ? 674  TYR A CE2 1 
ATOM   5081  C CZ  . TYR A  1 705  ? 246.748 242.638 202.418 1.00 56.77  ? 674  TYR A CZ  1 
ATOM   5082  O OH  . TYR A  1 705  ? 247.820 243.008 203.191 1.00 56.77  ? 674  TYR A OH  1 
ATOM   5083  N N   . GLN A  1 706  ? 244.003 244.200 197.769 1.00 63.06  ? 675  GLN A N   1 
ATOM   5084  C CA  . GLN A  1 706  ? 244.767 244.642 196.608 1.00 63.06  ? 675  GLN A CA  1 
ATOM   5085  C C   . GLN A  1 706  ? 245.906 245.575 196.988 1.00 63.06  ? 675  GLN A C   1 
ATOM   5086  O O   . GLN A  1 706  ? 246.191 245.774 198.171 1.00 63.06  ? 675  GLN A O   1 
ATOM   5087  C CB  . GLN A  1 706  ? 243.858 245.338 195.593 1.00 63.06  ? 675  GLN A CB  1 
ATOM   5088  C CG  . GLN A  1 706  ? 242.744 244.474 195.036 1.00 63.06  ? 675  GLN A CG  1 
ATOM   5089  C CD  . GLN A  1 706  ? 243.255 243.206 194.395 1.00 63.06  ? 675  GLN A CD  1 
ATOM   5090  O OE1 . GLN A  1 706  ? 242.842 242.107 194.755 1.00 63.06  ? 675  GLN A OE1 1 
ATOM   5091  N NE2 . GLN A  1 706  ? 244.159 243.351 193.435 1.00 63.06  ? 675  GLN A NE2 1 
ATOM   5092  N N   . THR A  1 707  ? 246.570 246.136 195.982 1.00 71.45  ? 676  THR A N   1 
ATOM   5093  C CA  . THR A  1 707  ? 247.711 247.023 196.188 1.00 71.45  ? 676  THR A CA  1 
ATOM   5094  C C   . THR A  1 707  ? 247.261 248.481 196.238 1.00 71.45  ? 676  THR A C   1 
ATOM   5095  O O   . THR A  1 707  ? 247.780 249.280 197.018 1.00 71.45  ? 676  THR A O   1 
ATOM   5096  C CB  . THR A  1 707  ? 248.771 246.853 195.080 1.00 71.45  ? 676  THR A CB  1 
ATOM   5097  O OG1 . THR A  1 707  ? 249.178 245.481 195.013 1.00 71.45  ? 676  THR A OG1 1 
ATOM   5098  C CG2 . THR A  1 707  ? 249.987 247.717 195.362 1.00 71.45  ? 676  THR A CG2 1 
ATOM   5099  N N   . SER A  1 720  ? 251.372 248.910 201.531 1.00 71.93  ? 689  SER A N   1 
ATOM   5100  C CA  . SER A  1 720  ? 250.598 249.380 200.389 1.00 71.93  ? 689  SER A CA  1 
ATOM   5101  C C   . SER A  1 720  ? 249.318 248.569 200.227 1.00 71.93  ? 689  SER A C   1 
ATOM   5102  O O   . SER A  1 720  ? 248.288 249.099 199.818 1.00 71.93  ? 689  SER A O   1 
ATOM   5103  C CB  . SER A  1 720  ? 251.433 249.308 199.111 1.00 71.93  ? 689  SER A CB  1 
ATOM   5104  O OG  . SER A  1 720  ? 252.620 250.071 199.235 1.00 71.93  ? 689  SER A OG  1 
ATOM   5105  N N   . GLN A  1 721  ? 249.399 247.278 200.540 1.00 66.78  ? 690  GLN A N   1 
ATOM   5106  C CA  . GLN A  1 721  ? 248.247 246.396 200.420 1.00 66.78  ? 690  GLN A CA  1 
ATOM   5107  C C   . GLN A  1 721  ? 247.129 246.848 201.354 1.00 66.78  ? 690  GLN A C   1 
ATOM   5108  O O   . GLN A  1 721  ? 247.380 247.301 202.473 1.00 66.78  ? 690  GLN A O   1 
ATOM   5109  C CB  . GLN A  1 721  ? 248.651 244.959 200.744 1.00 66.78  ? 690  GLN A CB  1 
ATOM   5110  C CG  . GLN A  1 721  ? 249.752 244.386 199.866 1.00 66.78  ? 690  GLN A CG  1 
ATOM   5111  C CD  . GLN A  1 721  ? 249.346 244.253 198.414 1.00 66.78  ? 690  GLN A CD  1 
ATOM   5112  O OE1 . GLN A  1 721  ? 249.824 244.991 197.555 1.00 66.78  ? 690  GLN A OE1 1 
ATOM   5113  N NE2 . GLN A  1 721  ? 248.467 243.302 198.130 1.00 66.78  ? 690  GLN A NE2 1 
ATOM   5114  N N   . SER A  1 722  ? 245.887 246.721 200.891 1.00 59.47  ? 691  SER A N   1 
ATOM   5115  C CA  . SER A  1 722  ? 244.745 247.146 201.687 1.00 59.47  ? 691  SER A CA  1 
ATOM   5116  C C   . SER A  1 722  ? 243.498 246.411 201.220 1.00 59.47  ? 691  SER A C   1 
ATOM   5117  O O   . SER A  1 722  ? 243.457 245.852 200.121 1.00 59.47  ? 691  SER A O   1 
ATOM   5118  C CB  . SER A  1 722  ? 244.527 248.656 201.582 1.00 59.47  ? 691  SER A CB  1 
ATOM   5119  O OG  . SER A  1 722  ? 245.628 249.369 202.108 1.00 59.47  ? 691  SER A OG  1 
ATOM   5120  N N   . ILE A  1 723  ? 242.480 246.422 202.076 1.00 50.48  ? 692  ILE A N   1 
ATOM   5121  C CA  . ILE A  1 723  ? 241.177 245.874 201.720 1.00 50.48  ? 692  ILE A CA  1 
ATOM   5122  C C   . ILE A  1 723  ? 240.383 246.938 200.978 1.00 50.48  ? 692  ILE A C   1 
ATOM   5123  O O   . ILE A  1 723  ? 240.213 248.057 201.470 1.00 50.48  ? 692  ILE A O   1 
ATOM   5124  C CB  . ILE A  1 723  ? 240.431 245.381 202.968 1.00 50.48  ? 692  ILE A CB  1 
ATOM   5125  C CG1 . ILE A  1 723  ? 241.289 244.375 203.728 1.00 50.48  ? 692  ILE A CG1 1 
ATOM   5126  C CG2 . ILE A  1 723  ? 239.116 244.744 202.592 1.00 50.48  ? 692  ILE A CG2 1 
ATOM   5127  C CD1 . ILE A  1 723  ? 240.796 244.089 205.101 1.00 50.48  ? 692  ILE A CD1 1 
ATOM   5128  N N   . ILE A  1 724  ? 239.895 246.589 199.793 1.00 48.85  ? 693  ILE A N   1 
ATOM   5129  C CA  . ILE A  1 724  ? 239.072 247.468 198.977 1.00 48.85  ? 693  ILE A CA  1 
ATOM   5130  C C   . ILE A  1 724  ? 237.691 246.853 198.812 1.00 48.85  ? 693  ILE A C   1 
ATOM   5131  O O   . ILE A  1 724  ? 237.535 245.629 198.776 1.00 48.85  ? 693  ILE A O   1 
ATOM   5132  C CB  . ILE A  1 724  ? 239.720 247.751 197.603 1.00 48.85  ? 693  ILE A CB  1 
ATOM   5133  C CG1 . ILE A  1 724  ? 239.792 246.480 196.759 1.00 48.85  ? 693  ILE A CG1 1 
ATOM   5134  C CG2 . ILE A  1 724  ? 241.105 248.330 197.780 1.00 48.85  ? 693  ILE A CG2 1 
ATOM   5135  C CD1 . ILE A  1 724  ? 239.817 246.738 195.280 1.00 48.85  ? 693  ILE A CD1 1 
ATOM   5136  N N   . ALA A  1 725  ? 236.681 247.716 198.728 1.00 46.31  ? 694  ALA A N   1 
ATOM   5137  C CA  . ALA A  1 725  ? 235.292 247.312 198.558 1.00 46.31  ? 694  ALA A CA  1 
ATOM   5138  C C   . ALA A  1 725  ? 234.737 247.971 197.305 1.00 46.31  ? 694  ALA A C   1 
ATOM   5139  O O   . ALA A  1 725  ? 234.887 249.181 197.124 1.00 46.31  ? 694  ALA A O   1 
ATOM   5140  C CB  . ALA A  1 725  ? 234.457 247.701 199.774 1.00 46.31  ? 694  ALA A CB  1 
ATOM   5141  N N   . TYR A  1 726  ? 234.091 247.182 196.448 1.00 46.95  ? 695  TYR A N   1 
ATOM   5142  C CA  . TYR A  1 726  ? 233.625 247.667 195.155 1.00 46.95  ? 695  TYR A CA  1 
ATOM   5143  C C   . TYR A  1 726  ? 232.290 247.024 194.805 1.00 46.95  ? 695  TYR A C   1 
ATOM   5144  O O   . TYR A  1 726  ? 231.770 246.178 195.534 1.00 46.95  ? 695  TYR A O   1 
ATOM   5145  C CB  . TYR A  1 726  ? 234.650 247.375 194.056 1.00 46.95  ? 695  TYR A CB  1 
ATOM   5146  C CG  . TYR A  1 726  ? 235.108 245.939 194.045 1.00 46.95  ? 695  TYR A CG  1 
ATOM   5147  C CD1 . TYR A  1 726  ? 234.478 244.996 193.257 1.00 46.95  ? 695  TYR A CD1 1 
ATOM   5148  C CD2 . TYR A  1 726  ? 236.173 245.528 194.824 1.00 46.95  ? 695  TYR A CD2 1 
ATOM   5149  C CE1 . TYR A  1 726  ? 234.890 243.694 193.253 1.00 46.95  ? 695  TYR A CE1 1 
ATOM   5150  C CE2 . TYR A  1 726  ? 236.591 244.230 194.821 1.00 46.95  ? 695  TYR A CE2 1 
ATOM   5151  C CZ  . TYR A  1 726  ? 235.946 243.318 194.035 1.00 46.95  ? 695  TYR A CZ  1 
ATOM   5152  O OH  . TYR A  1 726  ? 236.355 242.014 194.024 1.00 46.95  ? 695  TYR A OH  1 
ATOM   5153  N N   . THR A  1 727  ? 231.733 247.450 193.674 1.00 47.90  ? 696  THR A N   1 
ATOM   5154  C CA  . THR A  1 727  ? 230.525 246.873 193.100 1.00 47.90  ? 696  THR A CA  1 
ATOM   5155  C C   . THR A  1 727  ? 230.910 245.877 192.017 1.00 47.90  ? 696  THR A C   1 
ATOM   5156  O O   . THR A  1 727  ? 231.685 246.207 191.115 1.00 47.90  ? 696  THR A O   1 
ATOM   5157  C CB  . THR A  1 727  ? 229.625 247.958 192.509 1.00 47.90  ? 696  THR A CB  1 
ATOM   5158  O OG1 . THR A  1 727  ? 229.211 248.858 193.541 1.00 47.90  ? 696  THR A OG1 1 
ATOM   5159  C CG2 . THR A  1 727  ? 228.403 247.345 191.878 1.00 47.90  ? 696  THR A CG2 1 
ATOM   5160  N N   . MET A  1 728  ? 230.380 244.663 192.110 1.00 50.16  ? 697  MET A N   1 
ATOM   5161  C CA  . MET A  1 728  ? 230.789 243.596 191.209 1.00 50.16  ? 697  MET A CA  1 
ATOM   5162  C C   . MET A  1 728  ? 230.254 243.842 189.803 1.00 50.16  ? 697  MET A C   1 
ATOM   5163  O O   . MET A  1 728  ? 229.138 244.332 189.621 1.00 50.16  ? 697  MET A O   1 
ATOM   5164  C CB  . MET A  1 728  ? 230.319 242.248 191.738 1.00 50.16  ? 697  MET A CB  1 
ATOM   5165  C CG  . MET A  1 728  ? 228.826 242.110 191.826 1.00 50.16  ? 697  MET A CG  1 
ATOM   5166  S SD  . MET A  1 728  ? 228.365 240.684 192.803 1.00 50.16  ? 697  MET A SD  1 
ATOM   5167  C CE  . MET A  1 728  ? 228.503 239.388 191.583 1.00 50.16  ? 697  MET A CE  1 
ATOM   5168  N N   . SER A  1 729  ? 231.070 243.517 188.806 1.00 50.22  ? 698  SER A N   1 
ATOM   5169  C CA  . SER A  1 729  ? 230.676 243.629 187.411 1.00 50.22  ? 698  SER A CA  1 
ATOM   5170  C C   . SER A  1 729  ? 230.016 242.348 186.921 1.00 50.22  ? 698  SER A C   1 
ATOM   5171  O O   . SER A  1 729  ? 230.363 241.242 187.342 1.00 50.22  ? 698  SER A O   1 
ATOM   5172  C CB  . SER A  1 729  ? 231.883 243.945 186.531 1.00 50.22  ? 698  SER A CB  1 
ATOM   5173  O OG  . SER A  1 729  ? 232.689 242.799 186.359 1.00 50.22  ? 698  SER A OG  1 
ATOM   5174  N N   . LEU A  1 730  ? 229.044 242.514 186.024 1.00 45.79  ? 699  LEU A N   1 
ATOM   5175  C CA  . LEU A  1 730  ? 228.295 241.388 185.488 1.00 45.79  ? 699  LEU A CA  1 
ATOM   5176  C C   . LEU A  1 730  ? 228.900 240.813 184.214 1.00 45.79  ? 699  LEU A C   1 
ATOM   5177  O O   . LEU A  1 730  ? 228.574 239.680 183.852 1.00 45.79  ? 699  LEU A O   1 
ATOM   5178  C CB  . LEU A  1 730  ? 226.849 241.814 185.225 1.00 45.79  ? 699  LEU A CB  1 
ATOM   5179  C CG  . LEU A  1 730  ? 226.080 242.354 186.433 1.00 45.79  ? 699  LEU A CG  1 
ATOM   5180  C CD1 . LEU A  1 730  ? 224.609 242.454 186.121 1.00 45.79  ? 699  LEU A CD1 1 
ATOM   5181  C CD2 . LEU A  1 730  ? 226.305 241.478 187.651 1.00 45.79  ? 699  LEU A CD2 1 
ATOM   5182  N N   . GLY A  1 731  ? 229.755 241.555 183.533 1.00 49.93  ? 700  GLY A N   1 
ATOM   5183  C CA  . GLY A  1 731  ? 230.415 241.066 182.339 1.00 49.93  ? 700  GLY A CA  1 
ATOM   5184  C C   . GLY A  1 731  ? 230.630 242.190 181.347 1.00 49.93  ? 700  GLY A C   1 
ATOM   5185  O O   . GLY A  1 731  ? 230.288 243.342 181.591 1.00 49.93  ? 700  GLY A O   1 
ATOM   5186  N N   . ALA A  1 732  ? 231.213 241.823 180.210 1.00 55.34  ? 701  ALA A N   1 
ATOM   5187  C CA  . ALA A  1 732  ? 231.431 242.779 179.136 1.00 55.34  ? 701  ALA A CA  1 
ATOM   5188  C C   . ALA A  1 732  ? 230.122 243.094 178.421 1.00 55.34  ? 701  ALA A C   1 
ATOM   5189  O O   . ALA A  1 732  ? 229.220 242.258 178.338 1.00 55.34  ? 701  ALA A O   1 
ATOM   5190  C CB  . ALA A  1 732  ? 232.454 242.237 178.143 1.00 55.34  ? 701  ALA A CB  1 
ATOM   5191  N N   . GLU A  1 733  ? 230.018 244.314 177.906 1.00 58.96  ? 702  GLU A N   1 
ATOM   5192  C CA  . GLU A  1 733  ? 228.835 244.763 177.180 1.00 58.96  ? 702  GLU A CA  1 
ATOM   5193  C C   . GLU A  1 733  ? 229.157 244.925 175.698 1.00 58.96  ? 702  GLU A C   1 
ATOM   5194  O O   . GLU A  1 733  ? 230.002 245.747 175.334 1.00 58.96  ? 702  GLU A O   1 
ATOM   5195  C CB  . GLU A  1 733  ? 228.303 246.068 177.768 1.00 58.96  ? 702  GLU A CB  1 
ATOM   5196  C CG  . GLU A  1 733  ? 227.072 246.593 177.061 1.00 58.96  ? 702  GLU A CG  1 
ATOM   5197  C CD  . GLU A  1 733  ? 226.388 247.698 177.832 1.00 58.96  ? 702  GLU A CD  1 
ATOM   5198  O OE1 . GLU A  1 733  ? 226.314 247.594 179.073 1.00 58.96  ? 702  GLU A OE1 1 
ATOM   5199  O OE2 . GLU A  1 733  ? 225.932 248.674 177.201 1.00 58.96  ? 702  GLU A OE2 1 
ATOM   5200  N N   . ASN A  1 734  ? 228.494 244.141 174.849 1.00 54.89  ? 703  ASN A N   1 
ATOM   5201  C CA  . ASN A  1 734  ? 228.642 244.250 173.402 1.00 54.89  ? 703  ASN A CA  1 
ATOM   5202  C C   . ASN A  1 734  ? 227.280 244.221 172.719 1.00 54.89  ? 703  ASN A C   1 
ATOM   5203  O O   . ASN A  1 734  ? 226.396 243.454 173.103 1.00 54.89  ? 703  ASN A O   1 
ATOM   5204  C CB  . ASN A  1 734  ? 229.608 243.174 172.845 1.00 54.89  ? 703  ASN A CB  1 
ATOM   5205  C CG  . ASN A  1 734  ? 229.125 241.749 173.041 1.00 54.89  ? 703  ASN A CG  1 
ATOM   5206  O OD1 . ASN A  1 734  ? 227.940 241.452 173.003 1.00 54.89  ? 703  ASN A OD1 1 
ATOM   5207  N ND2 . ASN A  1 734  ? 230.073 240.846 173.228 1.00 54.89  ? 703  ASN A ND2 1 
ATOM   5208  N N   . SER A  1 735  ? 227.092 245.112 171.750 1.00 53.37  ? 704  SER A N   1 
ATOM   5209  C CA  . SER A  1 735  ? 225.832 245.252 171.032 1.00 53.37  ? 704  SER A CA  1 
ATOM   5210  C C   . SER A  1 735  ? 225.882 244.555 169.678 1.00 53.37  ? 704  SER A C   1 
ATOM   5211  O O   . SER A  1 735  ? 226.861 244.682 168.940 1.00 53.37  ? 704  SER A O   1 
ATOM   5212  C CB  . SER A  1 735  ? 225.501 246.732 170.836 1.00 53.37  ? 704  SER A CB  1 
ATOM   5213  O OG  . SER A  1 735  ? 224.301 246.906 170.109 1.00 53.37  ? 704  SER A OG  1 
ATOM   5214  N N   . VAL A  1 736  ? 224.808 243.828 169.351 1.00 48.42  ? 705  VAL A N   1 
ATOM   5215  C CA  . VAL A  1 736  ? 224.722 243.089 168.093 1.00 48.42  ? 705  VAL A CA  1 
ATOM   5216  C C   . VAL A  1 736  ? 224.285 244.031 166.979 1.00 48.42  ? 705  VAL A C   1 
ATOM   5217  O O   . VAL A  1 736  ? 223.378 244.852 167.156 1.00 48.42  ? 705  VAL A O   1 
ATOM   5218  C CB  . VAL A  1 736  ? 223.763 241.895 168.235 1.00 48.42  ? 705  VAL A CB  1 
ATOM   5219  C CG1 . VAL A  1 736  ? 223.848 240.995 167.016 1.00 48.42  ? 705  VAL A CG1 1 
ATOM   5220  C CG2 . VAL A  1 736  ? 224.079 241.117 169.491 1.00 48.42  ? 705  VAL A CG2 1 
ATOM   5221  N N   . ALA A  1 737  ? 224.912 243.888 165.810 1.00 46.20  ? 706  ALA A N   1 
ATOM   5222  C CA  . ALA A  1 737  ? 224.661 244.757 164.658 1.00 46.20  ? 706  ALA A CA  1 
ATOM   5223  C C   . ALA A  1 737  ? 223.480 244.254 163.834 1.00 46.20  ? 706  ALA A C   1 
ATOM   5224  O O   . ALA A  1 737  ? 223.629 243.652 162.771 1.00 46.20  ? 706  ALA A O   1 
ATOM   5225  C CB  . ALA A  1 737  ? 225.917 244.867 163.807 1.00 46.20  ? 706  ALA A CB  1 
ATOM   5226  N N   . TYR A  1 738  ? 222.281 244.523 164.333 1.00 44.47  ? 707  TYR A N   1 
ATOM   5227  C CA  . TYR A  1 738  ? 221.063 244.012 163.726 1.00 44.47  ? 707  TYR A CA  1 
ATOM   5228  C C   . TYR A  1 738  ? 220.546 244.925 162.620 1.00 44.47  ? 707  TYR A C   1 
ATOM   5229  O O   . TYR A  1 738  ? 220.506 246.147 162.772 1.00 44.47  ? 707  TYR A O   1 
ATOM   5230  C CB  . TYR A  1 738  ? 219.980 243.832 164.790 1.00 44.47  ? 707  TYR A CB  1 
ATOM   5231  C CG  . TYR A  1 738  ? 218.663 243.337 164.248 1.00 44.47  ? 707  TYR A CG  1 
ATOM   5232  C CD1 . TYR A  1 738  ? 218.413 241.985 164.096 1.00 44.47  ? 707  TYR A CD1 1 
ATOM   5233  C CD2 . TYR A  1 738  ? 217.657 244.226 163.917 1.00 44.47  ? 707  TYR A CD2 1 
ATOM   5234  C CE1 . TYR A  1 738  ? 217.209 241.540 163.610 1.00 44.47  ? 707  TYR A CE1 1 
ATOM   5235  C CE2 . TYR A  1 738  ? 216.452 243.789 163.435 1.00 44.47  ? 707  TYR A CE2 1 
ATOM   5236  C CZ  . TYR A  1 738  ? 216.232 242.448 163.282 1.00 44.47  ? 707  TYR A CZ  1 
ATOM   5237  O OH  . TYR A  1 738  ? 215.029 242.016 162.792 1.00 44.47  ? 707  TYR A OH  1 
ATOM   5238  N N   . SER A  1 739  ? 220.152 244.312 161.504 1.00 47.08  ? 708  SER A N   1 
ATOM   5239  C CA  . SER A  1 739  ? 219.499 244.990 160.395 1.00 47.08  ? 708  SER A CA  1 
ATOM   5240  C C   . SER A  1 739  ? 218.473 244.026 159.826 1.00 47.08  ? 708  SER A C   1 
ATOM   5241  O O   . SER A  1 739  ? 218.419 242.859 160.215 1.00 47.08  ? 708  SER A O   1 
ATOM   5242  C CB  . SER A  1 739  ? 220.491 245.422 159.312 1.00 47.08  ? 708  SER A CB  1 
ATOM   5243  O OG  . SER A  1 739  ? 221.388 246.400 159.798 1.00 47.08  ? 708  SER A OG  1 
ATOM   5244  N N   . ASN A  1 740  ? 217.664 244.495 158.882 1.00 52.69  ? 709  ASN A N   1 
ATOM   5245  C CA  . ASN A  1 740  ? 216.609 243.644 158.357 1.00 52.69  ? 709  ASN A CA  1 
ATOM   5246  C C   . ASN A  1 740  ? 216.994 242.938 157.064 1.00 52.69  ? 709  ASN A C   1 
ATOM   5247  O O   . ASN A  1 740  ? 216.164 242.224 156.498 1.00 52.69  ? 709  ASN A O   1 
ATOM   5248  C CB  . ASN A  1 740  ? 215.318 244.441 158.162 1.00 52.69  ? 709  ASN A CB  1 
ATOM   5249  C CG  . ASN A  1 740  ? 215.450 245.543 157.145 1.00 52.69  ? 709  ASN A CG  1 
ATOM   5250  O OD1 . ASN A  1 740  ? 216.507 246.143 156.977 1.00 52.69  ? 709  ASN A OD1 1 
ATOM   5251  N ND2 . ASN A  1 740  ? 214.355 245.814 156.454 1.00 52.69  ? 709  ASN A ND2 1 
ATOM   5252  N N   . ASN A  1 741  ? 218.213 243.126 156.574 1.00 46.11  ? 710  ASN A N   1 
ATOM   5253  C CA  . ASN A  1 741  ? 218.681 242.412 155.397 1.00 46.11  ? 710  ASN A CA  1 
ATOM   5254  C C   . ASN A  1 741  ? 220.175 242.158 155.568 1.00 46.11  ? 710  ASN A C   1 
ATOM   5255  O O   . ASN A  1 741  ? 221.001 242.560 154.760 1.00 46.11  ? 710  ASN A O   1 
ATOM   5256  C CB  . ASN A  1 741  ? 218.394 243.187 154.114 1.00 46.11  ? 710  ASN A CB  1 
ATOM   5257  C CG  . ASN A  1 741  ? 218.928 244.592 154.154 1.00 46.11  ? 710  ASN A CG  1 
ATOM   5258  O OD1 . ASN A  1 741  ? 219.000 245.209 155.209 1.00 46.11  ? 710  ASN A OD1 1 
ATOM   5259  N ND2 . ASN A  1 741  ? 219.318 245.106 152.998 1.00 46.11  ? 710  ASN A ND2 1 
ATOM   5260  N N   . SER A  1 742  ? 220.545 241.463 156.637 1.00 39.90  ? 711  SER A N   1 
ATOM   5261  C CA  . SER A  1 742  ? 221.953 241.284 156.955 1.00 39.90  ? 711  SER A CA  1 
ATOM   5262  C C   . SER A  1 742  ? 222.102 240.041 157.813 1.00 39.90  ? 711  SER A C   1 
ATOM   5263  O O   . SER A  1 742  ? 221.445 239.924 158.848 1.00 39.90  ? 711  SER A O   1 
ATOM   5264  C CB  . SER A  1 742  ? 222.506 242.510 157.683 1.00 39.90  ? 711  SER A CB  1 
ATOM   5265  O OG  . SER A  1 742  ? 223.905 242.412 157.867 1.00 39.90  ? 711  SER A OG  1 
ATOM   5266  N N   . ILE A  1 743  ? 222.960 239.121 157.374 1.00 37.50  ? 712  ILE A N   1 
ATOM   5267  C CA  . ILE A  1 743  ? 223.198 237.854 158.047 1.00 37.50  ? 712  ILE A CA  1 
ATOM   5268  C C   . ILE A  1 743  ? 224.703 237.674 158.210 1.00 37.50  ? 712  ILE A C   1 
ATOM   5269  O O   . ILE A  1 743  ? 225.501 238.271 157.489 1.00 37.50  ? 712  ILE A O   1 
ATOM   5270  C CB  . ILE A  1 743  ? 222.566 236.680 157.266 1.00 37.50  ? 712  ILE A CB  1 
ATOM   5271  C CG1 . ILE A  1 743  ? 222.404 235.443 158.145 1.00 37.50  ? 712  ILE A CG1 1 
ATOM   5272  C CG2 . ILE A  1 743  ? 223.355 236.374 156.017 1.00 37.50  ? 712  ILE A CG2 1 
ATOM   5273  C CD1 . ILE A  1 743  ? 221.511 234.413 157.548 1.00 37.50  ? 712  ILE A CD1 1 
ATOM   5274  N N   . ALA A  1 744  ? 225.089 236.844 159.176 1.00 37.83  ? 713  ALA A N   1 
ATOM   5275  C CA  . ALA A  1 744  ? 226.493 236.554 159.451 1.00 37.83  ? 713  ALA A CA  1 
ATOM   5276  C C   . ALA A  1 744  ? 226.695 235.048 159.440 1.00 37.83  ? 713  ALA A C   1 
ATOM   5277  O O   . ALA A  1 744  ? 226.051 234.332 160.212 1.00 37.83  ? 713  ALA A O   1 
ATOM   5278  C CB  . ALA A  1 744  ? 226.928 237.142 160.792 1.00 37.83  ? 713  ALA A CB  1 
ATOM   5279  N N   . ILE A  1 745  ? 227.584 234.571 158.574 1.00 39.40  ? 714  ILE A N   1 
ATOM   5280  C CA  . ILE A  1 745  ? 227.806 233.144 158.365 1.00 39.40  ? 714  ILE A CA  1 
ATOM   5281  C C   . ILE A  1 745  ? 229.224 232.816 158.809 1.00 39.40  ? 714  ILE A C   1 
ATOM   5282  O O   . ILE A  1 745  ? 230.158 233.516 158.418 1.00 39.40  ? 714  ILE A O   1 
ATOM   5283  C CB  . ILE A  1 745  ? 227.601 232.725 156.898 1.00 39.40  ? 714  ILE A CB  1 
ATOM   5284  C CG1 . ILE A  1 745  ? 226.325 233.328 156.319 1.00 39.40  ? 714  ILE A CG1 1 
ATOM   5285  C CG2 . ILE A  1 745  ? 227.526 231.228 156.788 1.00 39.40  ? 714  ILE A CG2 1 
ATOM   5286  C CD1 . ILE A  1 745  ? 225.076 232.811 156.945 1.00 39.40  ? 714  ILE A CD1 1 
ATOM   5287  N N   . PRO A  1 746  ? 229.432 231.790 159.633 1.00 38.94  ? 715  PRO A N   1 
ATOM   5288  C CA  . PRO A  1 746  ? 230.797 231.356 159.957 1.00 38.94  ? 715  PRO A CA  1 
ATOM   5289  C C   . PRO A  1 746  ? 231.526 230.734 158.777 1.00 38.94  ? 715  PRO A C   1 
ATOM   5290  O O   . PRO A  1 746  ? 230.928 230.098 157.910 1.00 38.94  ? 715  PRO A O   1 
ATOM   5291  C CB  . PRO A  1 746  ? 230.585 230.330 161.072 1.00 38.94  ? 715  PRO A CB  1 
ATOM   5292  C CG  . PRO A  1 746  ? 229.194 229.890 160.931 1.00 38.94  ? 715  PRO A CG  1 
ATOM   5293  C CD  . PRO A  1 746  ? 228.425 231.049 160.405 1.00 38.94  ? 715  PRO A CD  1 
ATOM   5294  N N   . THR A  1 747  ? 232.847 230.933 158.751 1.00 41.58  ? 716  THR A N   1 
ATOM   5295  C CA  . THR A  1 747  ? 233.693 230.413 157.686 1.00 41.58  ? 716  THR A CA  1 
ATOM   5296  C C   . THR A  1 747  ? 234.677 229.334 158.129 1.00 41.58  ? 716  THR A C   1 
ATOM   5297  O O   . THR A  1 747  ? 235.125 228.556 157.283 1.00 41.58  ? 716  THR A O   1 
ATOM   5298  C CB  . THR A  1 747  ? 234.471 231.553 157.011 1.00 41.58  ? 716  THR A CB  1 
ATOM   5299  O OG1 . THR A  1 747  ? 235.305 232.208 157.970 1.00 41.58  ? 716  THR A OG1 1 
ATOM   5300  C CG2 . THR A  1 747  ? 233.517 232.565 156.411 1.00 41.58  ? 716  THR A CG2 1 
ATOM   5301  N N   . ASN A  1 748  ? 235.039 229.277 159.410 1.00 44.99  ? 717  ASN A N   1 
ATOM   5302  C CA  . ASN A  1 748  ? 235.909 228.249 159.970 1.00 44.99  ? 717  ASN A CA  1 
ATOM   5303  C C   . ASN A  1 748  ? 235.248 227.652 161.208 1.00 44.99  ? 717  ASN A C   1 
ATOM   5304  O O   . ASN A  1 748  ? 234.200 228.121 161.655 1.00 44.99  ? 717  ASN A O   1 
ATOM   5305  C CB  . ASN A  1 748  ? 237.271 228.851 160.334 1.00 44.99  ? 717  ASN A CB  1 
ATOM   5306  C CG  . ASN A  1 748  ? 238.410 227.867 160.241 1.00 44.99  ? 717  ASN A CG  1 
ATOM   5307  O OD1 . ASN A  1 748  ? 238.222 226.662 160.353 1.00 44.99  ? 717  ASN A OD1 1 
ATOM   5308  N ND2 . ASN A  1 748  ? 239.618 228.392 160.066 1.00 44.99  ? 717  ASN A ND2 1 
ATOM   5309  N N   . PHE A  1 749  ? 235.842 226.593 161.765 1.00 36.51  ? 718  PHE A N   1 
ATOM   5310  C CA  . PHE A  1 749  ? 235.346 226.022 163.012 1.00 36.51  ? 718  PHE A CA  1 
ATOM   5311  C C   . PHE A  1 749  ? 236.477 225.762 164.004 1.00 36.51  ? 718  PHE A C   1 
ATOM   5312  O O   . PHE A  1 749  ? 237.660 225.912 163.696 1.00 36.51  ? 718  PHE A O   1 
ATOM   5313  C CB  . PHE A  1 749  ? 234.559 224.737 162.745 1.00 36.51  ? 718  PHE A CB  1 
ATOM   5314  C CG  . PHE A  1 749  ? 235.271 223.763 161.862 1.00 36.51  ? 718  PHE A CG  1 
ATOM   5315  C CD1 . PHE A  1 749  ? 234.945 223.664 160.526 1.00 36.51  ? 718  PHE A CD1 1 
ATOM   5316  C CD2 . PHE A  1 749  ? 236.231 222.920 162.372 1.00 36.51  ? 718  PHE A CD2 1 
ATOM   5317  C CE1 . PHE A  1 749  ? 235.585 222.777 159.714 1.00 36.51  ? 718  PHE A CE1 1 
ATOM   5318  C CE2 . PHE A  1 749  ? 236.873 222.027 161.563 1.00 36.51  ? 718  PHE A CE2 1 
ATOM   5319  C CZ  . PHE A  1 749  ? 236.549 221.954 160.232 1.00 36.51  ? 718  PHE A CZ  1 
ATOM   5320  N N   . THR A  1 750  ? 236.080 225.365 165.214 1.00 33.80  ? 719  THR A N   1 
ATOM   5321  C CA  . THR A  1 750  ? 236.959 224.962 166.304 1.00 33.80  ? 719  THR A CA  1 
ATOM   5322  C C   . THR A  1 750  ? 236.408 223.688 166.936 1.00 33.80  ? 719  THR A C   1 
ATOM   5323  O O   . THR A  1 750  ? 235.192 223.544 167.085 1.00 33.80  ? 719  THR A O   1 
ATOM   5324  C CB  . THR A  1 750  ? 237.090 226.065 167.357 1.00 33.80  ? 719  THR A CB  1 
ATOM   5325  O OG1 . THR A  1 750  ? 237.553 227.264 166.733 1.00 33.80  ? 719  THR A OG1 1 
ATOM   5326  C CG2 . THR A  1 750  ? 238.090 225.672 168.421 1.00 33.80  ? 719  THR A CG2 1 
ATOM   5327  N N   . ILE A  1 751  ? 237.288 222.760 167.297 1.00 31.59  ? 720  ILE A N   1 
ATOM   5328  C CA  . ILE A  1 751  ? 236.915 221.544 168.018 1.00 31.59  ? 720  ILE A CA  1 
ATOM   5329  C C   . ILE A  1 751  ? 237.383 221.685 169.459 1.00 31.59  ? 720  ILE A C   1 
ATOM   5330  O O   . ILE A  1 751  ? 238.588 221.800 169.709 1.00 31.59  ? 720  ILE A O   1 
ATOM   5331  C CB  . ILE A  1 751  ? 237.523 220.288 167.375 1.00 31.59  ? 720  ILE A CB  1 
ATOM   5332  C CG1 . ILE A  1 751  ? 237.075 220.146 165.925 1.00 31.59  ? 720  ILE A CG1 1 
ATOM   5333  C CG2 . ILE A  1 751  ? 237.159 219.056 168.166 1.00 31.59  ? 720  ILE A CG2 1 
ATOM   5334  C CD1 . ILE A  1 751  ? 235.594 220.044 165.763 1.00 31.59  ? 720  ILE A CD1 1 
ATOM   5335  N N   . SER A  1 752  ? 236.449 221.676 170.414 1.00 29.47  ? 721  SER A N   1 
ATOM   5336  C CA  . SER A  1 752  ? 236.790 221.954 171.806 1.00 29.47  ? 721  SER A CA  1 
ATOM   5337  C C   . SER A  1 752  ? 236.417 220.778 172.699 1.00 29.47  ? 721  SER A C   1 
ATOM   5338  O O   . SER A  1 752  ? 235.341 220.194 172.557 1.00 29.47  ? 721  SER A O   1 
ATOM   5339  C CB  . SER A  1 752  ? 236.089 223.212 172.307 1.00 29.47  ? 721  SER A CB  1 
ATOM   5340  O OG  . SER A  1 752  ? 234.687 223.053 172.281 1.00 29.47  ? 721  SER A OG  1 
ATOM   5341  N N   . VAL A  1 753  ? 237.311 220.448 173.630 1.00 27.55  ? 722  VAL A N   1 
ATOM   5342  C CA  . VAL A  1 753  ? 237.103 219.399 174.626 1.00 27.55  ? 722  VAL A CA  1 
ATOM   5343  C C   . VAL A  1 753  ? 237.035 220.030 176.012 1.00 27.55  ? 722  VAL A C   1 
ATOM   5344  O O   . VAL A  1 753  ? 237.972 220.718 176.432 1.00 27.55  ? 722  VAL A O   1 
ATOM   5345  C CB  . VAL A  1 753  ? 238.213 218.342 174.564 1.00 27.55  ? 722  VAL A CB  1 
ATOM   5346  C CG1 . VAL A  1 753  ? 237.977 217.275 175.602 1.00 27.55  ? 722  VAL A CG1 1 
ATOM   5347  C CG2 . VAL A  1 753  ? 238.283 217.738 173.178 1.00 27.55  ? 722  VAL A CG2 1 
ATOM   5348  N N   . THR A  1 754  ? 235.934 219.795 176.724 1.00 27.00  ? 723  THR A N   1 
ATOM   5349  C CA  . THR A  1 754  ? 235.752 220.303 178.079 1.00 27.00  ? 723  THR A CA  1 
ATOM   5350  C C   . THR A  1 754  ? 235.432 219.170 179.053 1.00 27.00  ? 723  THR A C   1 
ATOM   5351  O O   . THR A  1 754  ? 235.030 218.080 178.654 1.00 27.00  ? 723  THR A O   1 
ATOM   5352  C CB  . THR A  1 754  ? 234.655 221.369 178.122 1.00 27.00  ? 723  THR A CB  1 
ATOM   5353  O OG1 . THR A  1 754  ? 234.485 221.822 179.467 1.00 27.00  ? 723  THR A OG1 1 
ATOM   5354  C CG2 . THR A  1 754  ? 233.345 220.817 177.614 1.00 27.00  ? 723  THR A CG2 1 
ATOM   5355  N N   . THR A  1 755  ? 235.627 219.430 180.348 1.00 27.01  ? 724  THR A N   1 
ATOM   5356  C CA  . THR A  1 755  ? 235.473 218.424 181.396 1.00 27.01  ? 724  THR A CA  1 
ATOM   5357  C C   . THR A  1 755  ? 234.312 218.752 182.329 1.00 27.01  ? 724  THR A C   1 
ATOM   5358  O O   . THR A  1 755  ? 234.040 219.923 182.605 1.00 27.01  ? 724  THR A O   1 
ATOM   5359  C CB  . THR A  1 755  ? 236.746 218.291 182.228 1.00 27.01  ? 724  THR A CB  1 
ATOM   5360  O OG1 . THR A  1 755  ? 236.992 219.518 182.918 1.00 27.01  ? 724  THR A OG1 1 
ATOM   5361  C CG2 . THR A  1 755  ? 237.921 217.992 181.342 1.00 27.01  ? 724  THR A CG2 1 
ATOM   5362  N N   . GLU A  1 756  ? 233.620 217.711 182.800 1.00 25.33  ? 725  GLU A N   1 
ATOM   5363  C CA  . GLU A  1 756  ? 232.580 217.845 183.818 1.00 25.33  ? 725  GLU A CA  1 
ATOM   5364  C C   . GLU A  1 756  ? 232.752 216.809 184.923 1.00 25.33  ? 725  GLU A C   1 
ATOM   5365  O O   . GLU A  1 756  ? 232.918 215.625 184.634 1.00 25.33  ? 725  GLU A O   1 
ATOM   5366  C CB  . GLU A  1 756  ? 231.189 217.699 183.214 1.00 25.33  ? 725  GLU A CB  1 
ATOM   5367  C CG  . GLU A  1 756  ? 230.097 217.913 184.230 1.00 25.33  ? 725  GLU A CG  1 
ATOM   5368  C CD  . GLU A  1 756  ? 228.719 217.823 183.639 1.00 25.33  ? 725  GLU A CD  1 
ATOM   5369  O OE1 . GLU A  1 756  ? 228.605 217.542 182.432 1.00 25.33  ? 725  GLU A OE1 1 
ATOM   5370  O OE2 . GLU A  1 756  ? 227.749 218.059 184.383 1.00 25.33  ? 725  GLU A OE2 1 
ATOM   5371  N N   . ILE A  1 757  ? 232.677 217.249 186.184 1.00 24.85  ? 726  ILE A N   1 
ATOM   5372  C CA  . ILE A  1 757  ? 232.932 216.411 187.358 1.00 24.85  ? 726  ILE A CA  1 
ATOM   5373  C C   . ILE A  1 757  ? 231.620 216.176 188.098 1.00 24.85  ? 726  ILE A C   1 
ATOM   5374  O O   . ILE A  1 757  ? 230.880 217.129 188.362 1.00 24.85  ? 726  ILE A O   1 
ATOM   5375  C CB  . ILE A  1 757  ? 233.949 217.063 188.309 1.00 24.85  ? 726  ILE A CB  1 
ATOM   5376  C CG1 . ILE A  1 757  ? 235.071 217.759 187.541 1.00 24.85  ? 726  ILE A CG1 1 
ATOM   5377  C CG2 . ILE A  1 757  ? 234.516 216.035 189.259 1.00 24.85  ? 726  ILE A CG2 1 
ATOM   5378  C CD1 . ILE A  1 757  ? 235.986 216.847 186.812 1.00 24.85  ? 726  ILE A CD1 1 
ATOM   5379  N N   . LEU A  1 758  ? 231.330 214.911 188.445 1.00 24.02  ? 727  LEU A N   1 
ATOM   5380  C CA  . LEU A  1 758  ? 230.096 214.571 189.183 1.00 24.02  ? 727  LEU A CA  1 
ATOM   5381  C C   . LEU A  1 758  ? 230.347 213.582 190.321 1.00 24.02  ? 727  LEU A C   1 
ATOM   5382  O O   . LEU A  1 758  ? 230.984 212.538 190.098 1.00 24.02  ? 727  LEU A O   1 
ATOM   5383  C CB  . LEU A  1 758  ? 229.042 214.019 188.222 1.00 24.02  ? 727  LEU A CB  1 
ATOM   5384  C CG  . LEU A  1 758  ? 228.233 215.090 187.485 1.00 24.02  ? 727  LEU A CG  1 
ATOM   5385  C CD1 . LEU A  1 758  ? 227.471 214.518 186.318 1.00 24.02  ? 727  LEU A CD1 1 
ATOM   5386  C CD2 . LEU A  1 758  ? 227.290 215.784 188.436 1.00 24.02  ? 727  LEU A CD2 1 
ATOM   5387  N N   . PRO A  1 759  ? 229.860 213.867 191.535 1.00 23.91  ? 728  PRO A N   1 
ATOM   5388  C CA  . PRO A  1 759  ? 229.904 212.878 192.627 1.00 23.91  ? 728  PRO A CA  1 
ATOM   5389  C C   . PRO A  1 759  ? 228.868 211.769 192.489 1.00 23.91  ? 728  PRO A C   1 
ATOM   5390  O O   . PRO A  1 759  ? 227.746 211.994 192.035 1.00 23.91  ? 728  PRO A O   1 
ATOM   5391  C CB  . PRO A  1 759  ? 229.615 213.720 193.878 1.00 23.91  ? 728  PRO A CB  1 
ATOM   5392  C CG  . PRO A  1 759  ? 229.752 215.127 193.464 1.00 23.91  ? 728  PRO A CG  1 
ATOM   5393  C CD  . PRO A  1 759  ? 229.435 215.189 192.017 1.00 23.91  ? 728  PRO A CD  1 
ATOM   5394  N N   . VAL A  1 760  ? 229.253 210.556 192.890 1.00 24.94  ? 729  VAL A N   1 
ATOM   5395  C CA  . VAL A  1 760  ? 228.398 209.390 192.684 1.00 24.94  ? 729  VAL A CA  1 
ATOM   5396  C C   . VAL A  1 760  ? 228.097 208.647 193.986 1.00 24.94  ? 729  VAL A C   1 
ATOM   5397  O O   . VAL A  1 760  ? 227.020 208.061 194.137 1.00 24.94  ? 729  VAL A O   1 
ATOM   5398  C CB  . VAL A  1 760  ? 229.028 208.449 191.638 1.00 24.94  ? 729  VAL A CB  1 
ATOM   5399  C CG1 . VAL A  1 760  ? 228.347 207.108 191.623 1.00 24.94  ? 729  VAL A CG1 1 
ATOM   5400  C CG2 . VAL A  1 760  ? 228.934 209.070 190.270 1.00 24.94  ? 729  VAL A CG2 1 
ATOM   5401  N N   . SER A  1 761  ? 229.009 208.692 194.955 1.00 27.62  ? 730  SER A N   1 
ATOM   5402  C CA  . SER A  1 761  ? 228.828 207.908 196.171 1.00 27.62  ? 730  SER A CA  1 
ATOM   5403  C C   . SER A  1 761  ? 229.526 208.582 197.342 1.00 27.62  ? 730  SER A C   1 
ATOM   5404  O O   . SER A  1 761  ? 230.351 209.479 197.168 1.00 27.62  ? 730  SER A O   1 
ATOM   5405  C CB  . SER A  1 761  ? 229.342 206.477 196.000 1.00 27.62  ? 730  SER A CB  1 
ATOM   5406  O OG  . SER A  1 761  ? 230.745 206.418 196.123 1.00 27.62  ? 730  SER A OG  1 
ATOM   5407  N N   . MET A  1 762  ? 229.172 208.139 198.546 1.00 29.78  ? 731  MET A N   1 
ATOM   5408  C CA  . MET A  1 762  ? 229.741 208.652 199.781 1.00 29.78  ? 731  MET A CA  1 
ATOM   5409  C C   . MET A  1 762  ? 230.184 207.492 200.667 1.00 29.78  ? 731  MET A C   1 
ATOM   5410  O O   . MET A  1 762  ? 229.957 206.320 200.366 1.00 29.78  ? 731  MET A O   1 
ATOM   5411  C CB  . MET A  1 762  ? 228.741 209.559 200.507 1.00 29.78  ? 731  MET A CB  1 
ATOM   5412  C CG  . MET A  1 762  ? 227.416 208.897 200.804 1.00 29.78  ? 731  MET A CG  1 
ATOM   5413  S SD  . MET A  1 762  ? 226.116 210.019 201.346 1.00 29.78  ? 731  MET A SD  1 
ATOM   5414  C CE  . MET A  1 762  ? 226.521 210.260 203.061 1.00 29.78  ? 731  MET A CE  1 
ATOM   5415  N N   . THR A  1 763  ? 230.839 207.839 201.770 1.00 31.75  ? 732  THR A N   1 
ATOM   5416  C CA  . THR A  1 763  ? 231.351 206.846 202.703 1.00 31.75  ? 732  THR A CA  1 
ATOM   5417  C C   . THR A  1 763  ? 230.222 206.124 203.433 1.00 31.75  ? 732  THR A C   1 
ATOM   5418  O O   . THR A  1 763  ? 229.244 206.739 203.864 1.00 31.75  ? 732  THR A O   1 
ATOM   5419  C CB  . THR A  1 763  ? 232.299 207.515 203.693 1.00 31.75  ? 732  THR A CB  1 
ATOM   5420  O OG1 . THR A  1 763  ? 233.484 207.917 203.000 1.00 31.75  ? 732  THR A OG1 1 
ATOM   5421  C CG2 . THR A  1 763  ? 232.697 206.565 204.787 1.00 31.75  ? 732  THR A CG2 1 
ATOM   5422  N N   . LYS A  1 764  ? 230.366 204.805 203.560 1.00 31.10  ? 733  LYS A N   1 
ATOM   5423  C CA  . LYS A  1 764  ? 229.438 203.970 204.310 1.00 31.10  ? 733  LYS A CA  1 
ATOM   5424  C C   . LYS A  1 764  ? 229.927 203.808 205.743 1.00 31.10  ? 733  LYS A C   1 
ATOM   5425  O O   . LYS A  1 764  ? 231.090 203.470 205.967 1.00 31.10  ? 733  LYS A O   1 
ATOM   5426  C CB  . LYS A  1 764  ? 229.320 202.605 203.642 1.00 31.10  ? 733  LYS A CB  1 
ATOM   5427  C CG  . LYS A  1 764  ? 228.942 202.661 202.189 1.00 31.10  ? 733  LYS A CG  1 
ATOM   5428  C CD  . LYS A  1 764  ? 228.612 201.287 201.676 1.00 31.10  ? 733  LYS A CD  1 
ATOM   5429  C CE  . LYS A  1 764  ? 229.819 200.386 201.706 1.00 31.10  ? 733  LYS A CE  1 
ATOM   5430  N NZ  . LYS A  1 764  ? 229.509 199.026 201.200 1.00 31.10  ? 733  LYS A NZ  1 
ATOM   5431  N N   . THR A  1 765  ? 229.034 204.016 206.708 1.00 30.80  ? 734  THR A N   1 
ATOM   5432  C CA  . THR A  1 765  ? 229.390 204.010 208.121 1.00 30.80  ? 734  THR A CA  1 
ATOM   5433  C C   . THR A  1 765  ? 228.430 203.138 208.919 1.00 30.80  ? 734  THR A C   1 
ATOM   5434  O O   . THR A  1 765  ? 227.287 202.914 208.519 1.00 30.80  ? 734  THR A O   1 
ATOM   5435  C CB  . THR A  1 765  ? 229.411 205.427 208.716 1.00 30.80  ? 734  THR A CB  1 
ATOM   5436  O OG1 . THR A  1 765  ? 228.205 206.115 208.370 1.00 30.80  ? 734  THR A OG1 1 
ATOM   5437  C CG2 . THR A  1 765  ? 230.597 206.206 208.183 1.00 30.80  ? 734  THR A CG2 1 
ATOM   5438  N N   . SER A  1 766  ? 228.926 202.633 210.047 1.00 32.71  ? 735  SER A N   1 
ATOM   5439  C CA  . SER A  1 766  ? 228.141 201.869 211.004 1.00 32.71  ? 735  SER A CA  1 
ATOM   5440  C C   . SER A  1 766  ? 228.522 202.297 212.415 1.00 32.71  ? 735  SER A C   1 
ATOM   5441  O O   . SER A  1 766  ? 229.647 202.737 212.662 1.00 32.71  ? 735  SER A O   1 
ATOM   5442  C CB  . SER A  1 766  ? 228.371 200.364 210.830 1.00 32.71  ? 735  SER A CB  1 
ATOM   5443  O OG  . SER A  1 766  ? 227.385 199.609 211.503 1.00 32.71  ? 735  SER A OG  1 
ATOM   5444  N N   . VAL A  1 767  ? 227.573 202.163 213.340 1.00 34.17  ? 736  VAL A N   1 
ATOM   5445  C CA  . VAL A  1 767  ? 227.744 202.604 214.721 1.00 34.17  ? 736  VAL A CA  1 
ATOM   5446  C C   . VAL A  1 767  ? 227.384 201.452 215.650 1.00 34.17  ? 736  VAL A C   1 
ATOM   5447  O O   . VAL A  1 767  ? 226.338 200.819 215.482 1.00 34.17  ? 736  VAL A O   1 
ATOM   5448  C CB  . VAL A  1 767  ? 226.890 203.846 215.038 1.00 34.17  ? 736  VAL A CB  1 
ATOM   5449  C CG1 . VAL A  1 767  ? 226.910 204.140 216.517 1.00 34.17  ? 736  VAL A CG1 1 
ATOM   5450  C CG2 . VAL A  1 767  ? 227.393 205.050 214.262 1.00 34.17  ? 736  VAL A CG2 1 
ATOM   5451  N N   . ASP A  1 768  ? 228.243 201.190 216.633 1.00 38.51  ? 737  ASP A N   1 
ATOM   5452  C CA  . ASP A  1 768  ? 227.908 200.339 217.772 1.00 38.51  ? 737  ASP A CA  1 
ATOM   5453  C C   . ASP A  1 768  ? 227.390 201.219 218.904 1.00 38.51  ? 737  ASP A C   1 
ATOM   5454  O O   . ASP A  1 768  ? 228.157 201.940 219.545 1.00 38.51  ? 737  ASP A O   1 
ATOM   5455  C CB  . ASP A  1 768  ? 229.121 199.525 218.211 1.00 38.51  ? 737  ASP A CB  1 
ATOM   5456  C CG  . ASP A  1 768  ? 228.764 198.401 219.162 1.00 38.51  ? 737  ASP A CG  1 
ATOM   5457  O OD1 . ASP A  1 768  ? 228.090 198.651 220.177 1.00 38.51  ? 737  ASP A OD1 1 
ATOM   5458  O OD2 . ASP A  1 768  ? 229.167 197.256 218.897 1.00 38.51  ? 737  ASP A OD2 1 
ATOM   5459  N N   . CYS A  1 769  ? 226.079 201.158 219.132 1.00 40.46  ? 738  CYS A N   1 
ATOM   5460  C CA  . CYS A  1 769  ? 225.395 202.078 220.036 1.00 40.46  ? 738  CYS A CA  1 
ATOM   5461  C C   . CYS A  1 769  ? 225.896 201.946 221.474 1.00 40.46  ? 738  CYS A C   1 
ATOM   5462  O O   . CYS A  1 769  ? 226.178 202.948 222.145 1.00 40.46  ? 738  CYS A O   1 
ATOM   5463  C CB  . CYS A  1 769  ? 223.896 201.794 219.959 1.00 40.46  ? 738  CYS A CB  1 
ATOM   5464  S SG  . CYS A  1 769  ? 222.756 203.163 220.110 1.00 40.46  ? 738  CYS A SG  1 
ATOM   5465  N N   . THR A  1 770  ? 226.017 200.710 221.963 1.00 39.78  ? 739  THR A N   1 
ATOM   5466  C CA  . THR A  1 770  ? 226.469 200.486 223.334 1.00 39.78  ? 739  THR A CA  1 
ATOM   5467  C C   . THR A  1 770  ? 227.918 200.905 223.527 1.00 39.78  ? 739  THR A C   1 
ATOM   5468  O O   . THR A  1 770  ? 228.275 201.446 224.576 1.00 39.78  ? 739  THR A O   1 
ATOM   5469  C CB  . THR A  1 770  ? 226.302 199.012 223.698 1.00 39.78  ? 739  THR A CB  1 
ATOM   5470  O OG1 . THR A  1 770  ? 224.968 198.594 223.400 1.00 39.78  ? 739  THR A OG1 1 
ATOM   5471  C CG2 . THR A  1 770  ? 226.564 198.791 225.171 1.00 39.78  ? 739  THR A CG2 1 
ATOM   5472  N N   . MET A  1 771  ? 228.768 200.654 222.532 1.00 39.62  ? 740  MET A N   1 
ATOM   5473  C CA  . MET A  1 771  ? 230.165 201.065 222.617 1.00 39.62  ? 740  MET A CA  1 
ATOM   5474  C C   . MET A  1 771  ? 230.294 202.578 222.731 1.00 39.62  ? 740  MET A C   1 
ATOM   5475  O O   . MET A  1 771  ? 231.146 203.080 223.469 1.00 39.62  ? 740  MET A O   1 
ATOM   5476  C CB  . MET A  1 771  ? 230.926 200.553 221.398 1.00 39.62  ? 740  MET A CB  1 
ATOM   5477  C CG  . MET A  1 771  ? 232.432 200.584 221.533 1.00 39.62  ? 740  MET A CG  1 
ATOM   5478  S SD  . MET A  1 771  ? 233.088 199.367 222.674 1.00 39.62  ? 740  MET A SD  1 
ATOM   5479  C CE  . MET A  1 771  ? 232.814 197.868 221.745 1.00 39.62  ? 740  MET A CE  1 
ATOM   5480  N N   . TYR A  1 772  ? 229.461 203.323 222.002 1.00 29.27  ? 741  TYR A N   1 
ATOM   5481  C CA  . TYR A  1 772  ? 229.528 204.780 222.057 1.00 29.27  ? 741  TYR A CA  1 
ATOM   5482  C C   . TYR A  1 772  ? 228.957 205.324 223.357 1.00 29.27  ? 741  TYR A C   1 
ATOM   5483  O O   . TYR A  1 772  ? 229.549 206.219 223.969 1.00 29.27  ? 741  TYR A O   1 
ATOM   5484  C CB  . TYR A  1 772  ? 228.796 205.380 220.856 1.00 29.27  ? 741  TYR A CB  1 
ATOM   5485  C CG  . TYR A  1 772  ? 228.794 206.893 220.812 1.00 29.27  ? 741  TYR A CG  1 
ATOM   5486  C CD1 . TYR A  1 772  ? 227.722 207.615 221.307 1.00 29.27  ? 741  TYR A CD1 1 
ATOM   5487  C CD2 . TYR A  1 772  ? 229.862 207.599 220.285 1.00 29.27  ? 741  TYR A CD2 1 
ATOM   5488  C CE1 . TYR A  1 772  ? 227.709 208.985 221.274 1.00 29.27  ? 741  TYR A CE1 1 
ATOM   5489  C CE2 . TYR A  1 772  ? 229.855 208.974 220.256 1.00 29.27  ? 741  TYR A CE2 1 
ATOM   5490  C CZ  . TYR A  1 772  ? 228.774 209.658 220.757 1.00 29.27  ? 741  TYR A CZ  1 
ATOM   5491  O OH  . TYR A  1 772  ? 228.749 211.026 220.731 1.00 29.27  ? 741  TYR A OH  1 
ATOM   5492  N N   . ILE A  1 773  ? 227.816 204.804 223.806 1.00 32.37  ? 742  ILE A N   1 
ATOM   5493  C CA  . ILE A  1 773  ? 227.156 205.442 224.940 1.00 32.37  ? 742  ILE A CA  1 
ATOM   5494  C C   . ILE A  1 773  ? 227.772 204.998 226.259 1.00 32.37  ? 742  ILE A C   1 
ATOM   5495  O O   . ILE A  1 773  ? 227.979 205.816 227.160 1.00 32.37  ? 742  ILE A O   1 
ATOM   5496  C CB  . ILE A  1 773  ? 225.640 205.189 224.898 1.00 32.37  ? 742  ILE A CB  1 
ATOM   5497  C CG1 . ILE A  1 773  ? 225.039 205.872 223.675 1.00 32.37  ? 742  ILE A CG1 1 
ATOM   5498  C CG2 . ILE A  1 773  ? 224.986 205.743 226.132 1.00 32.37  ? 742  ILE A CG2 1 
ATOM   5499  C CD1 . ILE A  1 773  ? 223.602 205.562 223.450 1.00 32.37  ? 742  ILE A CD1 1 
ATOM   5500  N N   . CYS A  1 774  ? 228.088 203.709 226.403 1.00 41.37  ? 743  CYS A N   1 
ATOM   5501  C CA  . CYS A  1 774  ? 228.509 203.180 227.692 1.00 41.37  ? 743  CYS A CA  1 
ATOM   5502  C C   . CYS A  1 774  ? 229.968 202.762 227.775 1.00 41.37  ? 743  CYS A C   1 
ATOM   5503  O O   . CYS A  1 774  ? 230.498 202.689 228.885 1.00 41.37  ? 743  CYS A O   1 
ATOM   5504  C CB  . CYS A  1 774  ? 227.637 201.983 228.087 1.00 41.37  ? 743  CYS A CB  1 
ATOM   5505  S SG  . CYS A  1 774  ? 225.922 202.393 228.412 1.00 41.37  ? 743  CYS A SG  1 
ATOM   5506  N N   . GLY A  1 775  ? 230.630 202.494 226.661 1.00 46.12  ? 744  GLY A N   1 
ATOM   5507  C CA  . GLY A  1 775  ? 231.954 201.893 226.749 1.00 46.12  ? 744  GLY A CA  1 
ATOM   5508  C C   . GLY A  1 775  ? 231.906 200.481 227.301 1.00 46.12  ? 744  GLY A C   1 
ATOM   5509  O O   . GLY A  1 775  ? 231.169 199.621 226.809 1.00 46.12  ? 744  GLY A O   1 
ATOM   5510  N N   . ASP A  1 776  ? 232.710 200.229 228.336 1.00 53.74  ? 745  ASP A N   1 
ATOM   5511  C CA  . ASP A  1 776  ? 232.815 198.910 228.947 1.00 53.74  ? 745  ASP A CA  1 
ATOM   5512  C C   . ASP A  1 776  ? 232.171 198.859 230.325 1.00 53.74  ? 745  ASP A C   1 
ATOM   5513  O O   . ASP A  1 776  ? 232.495 197.977 231.124 1.00 53.74  ? 745  ASP A O   1 
ATOM   5514  C CB  . ASP A  1 776  ? 234.282 198.490 229.060 1.00 53.74  ? 745  ASP A CB  1 
ATOM   5515  C CG  . ASP A  1 776  ? 234.845 197.959 227.761 1.00 53.74  ? 745  ASP A CG  1 
ATOM   5516  O OD1 . ASP A  1 776  ? 234.061 197.717 226.819 1.00 53.74  ? 745  ASP A OD1 1 
ATOM   5517  O OD2 . ASP A  1 776  ? 236.078 197.782 227.683 1.00 53.74  ? 745  ASP A OD2 1 
ATOM   5518  N N   . SER A  1 777  ? 231.259 199.777 230.615 1.00 52.41  ? 746  SER A N   1 
ATOM   5519  C CA  . SER A  1 777  ? 230.568 199.807 231.894 1.00 52.41  ? 746  SER A CA  1 
ATOM   5520  C C   . SER A  1 777  ? 229.351 198.891 231.834 1.00 52.41  ? 746  SER A C   1 
ATOM   5521  O O   . SER A  1 777  ? 228.443 199.112 231.028 1.00 52.41  ? 746  SER A O   1 
ATOM   5522  C CB  . SER A  1 777  ? 230.164 201.235 232.245 1.00 52.41  ? 746  SER A CB  1 
ATOM   5523  O OG  . SER A  1 777  ? 229.334 201.254 233.388 1.00 52.41  ? 746  SER A OG  1 
ATOM   5524  N N   . THR A  1 778  ? 229.343 197.858 232.678 1.00 53.00  ? 747  THR A N   1 
ATOM   5525  C CA  . THR A  1 778  ? 228.211 196.937 232.730 1.00 53.00  ? 747  THR A CA  1 
ATOM   5526  C C   . THR A  1 778  ? 226.958 197.612 233.277 1.00 53.00  ? 747  THR A C   1 
ATOM   5527  O O   . THR A  1 778  ? 225.847 197.378 232.783 1.00 53.00  ? 747  THR A O   1 
ATOM   5528  C CB  . THR A  1 778  ? 228.581 195.723 233.581 1.00 53.00  ? 747  THR A CB  1 
ATOM   5529  O OG1 . THR A  1 778  ? 229.544 194.926 232.884 1.00 53.00  ? 747  THR A OG1 1 
ATOM   5530  C CG2 . THR A  1 778  ? 227.361 194.878 233.877 1.00 53.00  ? 747  THR A CG2 1 
ATOM   5531  N N   . GLU A  1 779  ? 227.122 198.460 234.293 1.00 56.15  ? 748  GLU A N   1 
ATOM   5532  C CA  . GLU A  1 779  ? 225.986 199.149 234.894 1.00 56.15  ? 748  GLU A CA  1 
ATOM   5533  C C   . GLU A  1 779  ? 225.297 200.072 233.899 1.00 56.15  ? 748  GLU A C   1 
ATOM   5534  O O   . GLU A  1 779  ? 224.061 200.128 233.841 1.00 56.15  ? 748  GLU A O   1 
ATOM   5535  C CB  . GLU A  1 779  ? 226.463 199.930 236.113 1.00 56.15  ? 748  GLU A CB  1 
ATOM   5536  C CG  . GLU A  1 779  ? 227.053 199.035 237.189 1.00 56.15  ? 748  GLU A CG  1 
ATOM   5537  C CD  . GLU A  1 779  ? 227.370 199.777 238.467 1.00 56.15  ? 748  GLU A CD  1 
ATOM   5538  O OE1 . GLU A  1 779  ? 227.227 201.013 238.487 1.00 56.15  ? 748  GLU A OE1 1 
ATOM   5539  O OE2 . GLU A  1 779  ? 227.760 199.123 239.457 1.00 56.15  ? 748  GLU A OE2 1 
ATOM   5540  N N   . CYS A  1 780  ? 226.076 200.808 233.107 1.00 48.89  ? 749  CYS A N   1 
ATOM   5541  C CA  . CYS A  1 780  ? 225.477 201.668 232.097 1.00 48.89  ? 749  CYS A CA  1 
ATOM   5542  C C   . CYS A  1 780  ? 224.719 200.855 231.059 1.00 48.89  ? 749  CYS A C   1 
ATOM   5543  O O   . CYS A  1 780  ? 223.679 201.292 230.568 1.00 48.89  ? 749  CYS A O   1 
ATOM   5544  C CB  . CYS A  1 780  ? 226.552 202.522 231.428 1.00 48.89  ? 749  CYS A CB  1 
ATOM   5545  S SG  . CYS A  1 780  ? 225.997 203.590 230.056 1.00 48.89  ? 749  CYS A SG  1 
ATOM   5546  N N   . SER A  1 781  ? 225.222 199.671 230.703 1.00 49.00  ? 750  SER A N   1 
ATOM   5547  C CA  . SER A  1 781  ? 224.512 198.842 229.734 1.00 49.00  ? 750  SER A CA  1 
ATOM   5548  C C   . SER A  1 781  ? 223.194 198.327 230.296 1.00 49.00  ? 750  SER A C   1 
ATOM   5549  O O   . SER A  1 781  ? 222.172 198.310 229.594 1.00 49.00  ? 750  SER A O   1 
ATOM   5550  C CB  . SER A  1 781  ? 225.393 197.675 229.301 1.00 49.00  ? 750  SER A CB  1 
ATOM   5551  O OG  . SER A  1 781  ? 226.635 198.135 228.807 1.00 49.00  ? 750  SER A OG  1 
ATOM   5552  N N   . ASN A  1 782  ? 223.194 197.914 231.563 1.00 49.20  ? 751  ASN A N   1 
ATOM   5553  C CA  . ASN A  1 782  ? 221.947 197.495 232.191 1.00 49.20  ? 751  ASN A CA  1 
ATOM   5554  C C   . ASN A  1 782  ? 220.950 198.644 232.264 1.00 49.20  ? 751  ASN A C   1 
ATOM   5555  O O   . ASN A  1 782  ? 219.741 198.432 232.136 1.00 49.20  ? 751  ASN A O   1 
ATOM   5556  C CB  . ASN A  1 782  ? 222.221 196.924 233.579 1.00 49.20  ? 751  ASN A CB  1 
ATOM   5557  C CG  . ASN A  1 782  ? 223.009 195.636 233.527 1.00 49.20  ? 751  ASN A CG  1 
ATOM   5558  O OD1 . ASN A  1 782  ? 223.817 195.352 234.406 1.00 49.20  ? 751  ASN A OD1 1 
ATOM   5559  N ND2 . ASN A  1 782  ? 222.796 194.858 232.477 1.00 49.20  ? 751  ASN A ND2 1 
ATOM   5560  N N   . LEU A  1 783  ? 221.435 199.866 232.479 1.00 47.62  ? 752  LEU A N   1 
ATOM   5561  C CA  . LEU A  1 783  ? 220.541 201.020 232.463 1.00 47.62  ? 752  LEU A CA  1 
ATOM   5562  C C   . LEU A  1 783  ? 220.045 201.334 231.053 1.00 47.62  ? 752  LEU A C   1 
ATOM   5563  O O   . LEU A  1 783  ? 218.896 201.746 230.870 1.00 47.62  ? 752  LEU A O   1 
ATOM   5564  C CB  . LEU A  1 783  ? 221.251 202.230 233.063 1.00 47.62  ? 752  LEU A CB  1 
ATOM   5565  C CG  . LEU A  1 783  ? 221.347 202.284 234.584 1.00 47.62  ? 752  LEU A CG  1 
ATOM   5566  C CD1 . LEU A  1 783  ? 221.852 203.638 235.025 1.00 47.62  ? 752  LEU A CD1 1 
ATOM   5567  C CD2 . LEU A  1 783  ? 219.997 202.001 235.198 1.00 47.62  ? 752  LEU A CD2 1 
ATOM   5568  N N   . LEU A  1 784  ? 220.902 201.156 230.048 1.00 44.95  ? 753  LEU A N   1 
ATOM   5569  C CA  . LEU A  1 784  ? 220.592 201.475 228.659 1.00 44.95  ? 753  LEU A CA  1 
ATOM   5570  C C   . LEU A  1 784  ? 219.663 200.462 228.007 1.00 44.95  ? 753  LEU A C   1 
ATOM   5571  O O   . LEU A  1 784  ? 219.058 200.774 226.978 1.00 44.95  ? 753  LEU A O   1 
ATOM   5572  C CB  . LEU A  1 784  ? 221.889 201.586 227.854 1.00 44.95  ? 753  LEU A CB  1 
ATOM   5573  C CG  . LEU A  1 784  ? 221.802 201.961 226.376 1.00 44.95  ? 753  LEU A CG  1 
ATOM   5574  C CD1 . LEU A  1 784  ? 221.262 203.366 226.213 1.00 44.95  ? 753  LEU A CD1 1 
ATOM   5575  C CD2 . LEU A  1 784  ? 223.148 201.830 225.707 1.00 44.95  ? 753  LEU A CD2 1 
ATOM   5576  N N   . LEU A  1 785  ? 219.520 199.270 228.588 1.00 47.24  ? 754  LEU A N   1 
ATOM   5577  C CA  . LEU A  1 785  ? 218.605 198.270 228.035 1.00 47.24  ? 754  LEU A CA  1 
ATOM   5578  C C   . LEU A  1 785  ? 217.180 198.783 227.829 1.00 47.24  ? 754  LEU A C   1 
ATOM   5579  O O   . LEU A  1 785  ? 216.402 198.138 227.121 1.00 47.24  ? 754  LEU A O   1 
ATOM   5580  C CB  . LEU A  1 785  ? 218.565 197.032 228.930 1.00 47.24  ? 754  LEU A CB  1 
ATOM   5581  C CG  . LEU A  1 785  ? 219.596 195.945 228.624 1.00 47.24  ? 754  LEU A CG  1 
ATOM   5582  C CD1 . LEU A  1 785  ? 219.488 194.809 229.617 1.00 47.24  ? 754  LEU A CD1 1 
ATOM   5583  C CD2 . LEU A  1 785  ? 219.414 195.433 227.213 1.00 47.24  ? 754  LEU A CD2 1 
ATOM   5584  N N   . GLN A  1 786  ? 216.814 199.916 228.428 1.00 49.10  ? 755  GLN A N   1 
ATOM   5585  C CA  . GLN A  1 786  ? 215.503 200.527 228.223 1.00 49.10  ? 755  GLN A CA  1 
ATOM   5586  C C   . GLN A  1 786  ? 215.361 201.284 226.903 1.00 49.10  ? 755  GLN A C   1 
ATOM   5587  O O   . GLN A  1 786  ? 214.248 201.709 226.581 1.00 49.10  ? 755  GLN A O   1 
ATOM   5588  C CB  . GLN A  1 786  ? 215.185 201.505 229.359 1.00 49.10  ? 755  GLN A CB  1 
ATOM   5589  C CG  . GLN A  1 786  ? 214.586 200.885 230.602 1.00 49.10  ? 755  GLN A CG  1 
ATOM   5590  C CD  . GLN A  1 786  ? 215.533 199.940 231.305 1.00 49.10  ? 755  GLN A CD  1 
ATOM   5591  O OE1 . GLN A  1 786  ? 215.332 198.728 231.303 1.00 49.10  ? 755  GLN A OE1 1 
ATOM   5592  N NE2 . GLN A  1 786  ? 216.570 200.491 231.916 1.00 49.10  ? 755  GLN A NE2 1 
ATOM   5593  N N   . TYR A  1 787  ? 216.437 201.479 226.138 1.00 46.26  ? 756  TYR A N   1 
ATOM   5594  C CA  . TYR A  1 787  ? 216.386 202.271 224.912 1.00 46.26  ? 756  TYR A CA  1 
ATOM   5595  C C   . TYR A  1 787  ? 216.818 201.497 223.663 1.00 46.26  ? 756  TYR A C   1 
ATOM   5596  O O   . TYR A  1 787  ? 217.323 202.098 222.713 1.00 46.26  ? 756  TYR A O   1 
ATOM   5597  C CB  . TYR A  1 787  ? 217.273 203.506 225.058 1.00 46.26  ? 756  TYR A CB  1 
ATOM   5598  C CG  . TYR A  1 787  ? 217.030 204.393 226.266 1.00 46.26  ? 756  TYR A CG  1 
ATOM   5599  C CD1 . TYR A  1 787  ? 217.539 204.053 227.512 1.00 46.26  ? 756  TYR A CD1 1 
ATOM   5600  C CD2 . TYR A  1 787  ? 216.385 205.615 226.141 1.00 46.26  ? 756  TYR A CD2 1 
ATOM   5601  C CE1 . TYR A  1 787  ? 217.354 204.867 228.605 1.00 46.26  ? 756  TYR A CE1 1 
ATOM   5602  C CE2 . TYR A  1 787  ? 216.207 206.442 227.231 1.00 46.26  ? 756  TYR A CE2 1 
ATOM   5603  C CZ  . TYR A  1 787  ? 216.691 206.059 228.459 1.00 46.26  ? 756  TYR A CZ  1 
ATOM   5604  O OH  . TYR A  1 787  ? 216.524 206.871 229.549 1.00 46.26  ? 756  TYR A OH  1 
ATOM   5605  N N   . GLY A  1 788  ? 216.663 200.170 223.647 1.00 48.44  ? 757  GLY A N   1 
ATOM   5606  C CA  . GLY A  1 788  ? 217.188 199.381 222.537 1.00 48.44  ? 757  GLY A CA  1 
ATOM   5607  C C   . GLY A  1 788  ? 216.521 199.635 221.196 1.00 48.44  ? 757  GLY A C   1 
ATOM   5608  O O   . GLY A  1 788  ? 217.157 199.493 220.140 1.00 48.44  ? 757  GLY A O   1 
ATOM   5609  N N   . SER A  1 789  ? 215.236 199.997 221.211 1.00 46.49  ? 758  SER A N   1 
ATOM   5610  C CA  . SER A  1 789  ? 214.516 200.245 219.967 1.00 46.49  ? 758  SER A CA  1 
ATOM   5611  C C   . SER A  1 789  ? 215.135 201.390 219.182 1.00 46.49  ? 758  SER A C   1 
ATOM   5612  O O   . SER A  1 789  ? 215.193 201.348 217.947 1.00 46.49  ? 758  SER A O   1 
ATOM   5613  C CB  . SER A  1 789  ? 213.048 200.538 220.264 1.00 46.49  ? 758  SER A CB  1 
ATOM   5614  O OG  . SER A  1 789  ? 212.409 201.089 219.129 1.00 46.49  ? 758  SER A OG  1 
ATOM   5615  N N   . PHE A  1 790  ? 215.603 202.425 219.880 1.00 45.55  ? 759  PHE A N   1 
ATOM   5616  C CA  . PHE A  1 790  ? 216.165 203.584 219.199 1.00 45.55  ? 759  PHE A CA  1 
ATOM   5617  C C   . PHE A  1 790  ? 217.480 203.243 218.509 1.00 45.55  ? 759  PHE A C   1 
ATOM   5618  O O   . PHE A  1 790  ? 217.731 203.694 217.384 1.00 45.55  ? 759  PHE A O   1 
ATOM   5619  C CB  . PHE A  1 790  ? 216.325 204.728 220.196 1.00 45.55  ? 759  PHE A CB  1 
ATOM   5620  C CG  . PHE A  1 790  ? 215.045 205.086 220.900 1.00 45.55  ? 759  PHE A CG  1 
ATOM   5621  C CD1 . PHE A  1 790  ? 214.141 205.954 220.315 1.00 45.55  ? 759  PHE A CD1 1 
ATOM   5622  C CD2 . PHE A  1 790  ? 214.731 204.535 222.127 1.00 45.55  ? 759  PHE A CD2 1 
ATOM   5623  C CE1 . PHE A  1 790  ? 212.958 206.277 220.949 1.00 45.55  ? 759  PHE A CE1 1 
ATOM   5624  C CE2 . PHE A  1 790  ? 213.546 204.852 222.764 1.00 45.55  ? 759  PHE A CE2 1 
ATOM   5625  C CZ  . PHE A  1 790  ? 212.661 205.724 222.173 1.00 45.55  ? 759  PHE A CZ  1 
ATOM   5626  N N   . CYS A  1 791  ? 218.321 202.430 219.152 1.00 43.54  ? 760  CYS A N   1 
ATOM   5627  C CA  . CYS A  1 791  ? 219.561 201.990 218.517 1.00 43.54  ? 760  CYS A CA  1 
ATOM   5628  C C   . CYS A  1 791  ? 219.291 201.100 217.311 1.00 43.54  ? 760  CYS A C   1 
ATOM   5629  O O   . CYS A  1 791  ? 219.955 201.231 216.271 1.00 43.54  ? 760  CYS A O   1 
ATOM   5630  C CB  . CYS A  1 791  ? 220.437 201.260 219.531 1.00 43.54  ? 760  CYS A CB  1 
ATOM   5631  S SG  . CYS A  1 791  ? 221.096 202.281 220.886 1.00 43.54  ? 760  CYS A SG  1 
ATOM   5632  N N   . THR A  1 792  ? 218.292 200.218 217.410 1.00 38.11  ? 761  THR A N   1 
ATOM   5633  C CA  . THR A  1 792  ? 217.924 199.397 216.258 1.00 38.11  ? 761  THR A CA  1 
ATOM   5634  C C   . THR A  1 792  ? 217.426 200.250 215.094 1.00 38.11  ? 761  THR A C   1 
ATOM   5635  O O   . THR A  1 792  ? 217.761 199.996 213.929 1.00 38.11  ? 761  THR A O   1 
ATOM   5636  C CB  . THR A  1 792  ? 216.867 198.383 216.682 1.00 38.11  ? 761  THR A CB  1 
ATOM   5637  O OG1 . THR A  1 792  ? 217.466 197.419 217.553 1.00 38.11  ? 761  THR A OG1 1 
ATOM   5638  C CG2 . THR A  1 792  ? 216.288 197.671 215.484 1.00 38.11  ? 761  THR A CG2 1 
ATOM   5639  N N   . GLN A  1 793  ? 216.642 201.280 215.396 1.00 37.72  ? 762  GLN A N   1 
ATOM   5640  C CA  . GLN A  1 793  ? 216.124 202.177 214.370 1.00 37.72  ? 762  GLN A CA  1 
ATOM   5641  C C   . GLN A  1 793  ? 217.245 202.959 213.682 1.00 37.72  ? 762  GLN A C   1 
ATOM   5642  O O   . GLN A  1 793  ? 217.264 203.091 212.444 1.00 37.72  ? 762  GLN A O   1 
ATOM   5643  C CB  . GLN A  1 793  ? 215.107 203.106 215.022 1.00 37.72  ? 762  GLN A CB  1 
ATOM   5644  C CG  . GLN A  1 793  ? 214.256 203.923 214.090 1.00 37.72  ? 762  GLN A CG  1 
ATOM   5645  C CD  . GLN A  1 793  ? 213.319 204.828 214.853 1.00 37.72  ? 762  GLN A CD  1 
ATOM   5646  O OE1 . GLN A  1 793  ? 213.437 204.969 216.068 1.00 37.72  ? 762  GLN A OE1 1 
ATOM   5647  N NE2 . GLN A  1 793  ? 212.372 205.437 214.149 1.00 37.72  ? 762  GLN A NE2 1 
ATOM   5648  N N   . LEU A  1 794  ? 218.205 203.458 214.469 1.00 32.26  ? 763  LEU A N   1 
ATOM   5649  C CA  . LEU A  1 794  ? 219.350 204.163 213.900 1.00 32.26  ? 763  LEU A CA  1 
ATOM   5650  C C   . LEU A  1 794  ? 220.147 203.266 212.965 1.00 32.26  ? 763  LEU A C   1 
ATOM   5651  O O   . LEU A  1 794  ? 220.552 203.687 211.868 1.00 32.26  ? 763  LEU A O   1 
ATOM   5652  C CB  . LEU A  1 794  ? 220.269 204.651 215.017 1.00 32.26  ? 763  LEU A CB  1 
ATOM   5653  C CG  . LEU A  1 794  ? 219.857 205.723 216.020 1.00 32.26  ? 763  LEU A CG  1 
ATOM   5654  C CD1 . LEU A  1 794  ? 220.956 205.898 217.042 1.00 32.26  ? 763  LEU A CD1 1 
ATOM   5655  C CD2 . LEU A  1 794  ? 219.526 207.033 215.349 1.00 32.26  ? 763  LEU A CD2 1 
ATOM   5656  N N   . ASN A  1 795  ? 220.393 202.025 213.383 1.00 32.59  ? 764  ASN A N   1 
ATOM   5657  C CA  . ASN A  1 795  ? 221.151 201.127 212.525 1.00 32.59  ? 764  ASN A CA  1 
ATOM   5658  C C   . ASN A  1 795  ? 220.397 200.771 211.249 1.00 32.59  ? 764  ASN A C   1 
ATOM   5659  O O   . ASN A  1 795  ? 221.024 200.612 210.193 1.00 32.59  ? 764  ASN A O   1 
ATOM   5660  C CB  . ASN A  1 795  ? 221.547 199.889 213.314 1.00 32.59  ? 764  ASN A CB  1 
ATOM   5661  C CG  . ASN A  1 795  ? 222.774 200.128 214.156 1.00 32.59  ? 764  ASN A CG  1 
ATOM   5662  O OD1 . ASN A  1 795  ? 223.618 200.943 213.808 1.00 32.59  ? 764  ASN A OD1 1 
ATOM   5663  N ND2 . ASN A  1 795  ? 222.872 199.433 215.278 1.00 32.59  ? 764  ASN A ND2 1 
ATOM   5664  N N   . ARG A  1 796  ? 219.068 200.645 211.307 1.00 32.78  ? 765  ARG A N   1 
ATOM   5665  C CA  . ARG A  1 796  ? 218.321 200.420 210.071 1.00 32.78  ? 765  ARG A CA  1 
ATOM   5666  C C   . ARG A  1 796  ? 218.524 201.564 209.087 1.00 32.78  ? 765  ARG A C   1 
ATOM   5667  O O   . ARG A  1 796  ? 218.750 201.339 207.887 1.00 32.78  ? 765  ARG A O   1 
ATOM   5668  C CB  . ARG A  1 796  ? 216.830 200.220 210.332 1.00 32.78  ? 765  ARG A CB  1 
ATOM   5669  C CG  . ARG A  1 796  ? 216.464 198.893 210.947 1.00 32.78  ? 765  ARG A CG  1 
ATOM   5670  C CD  . ARG A  1 796  ? 215.009 198.557 210.647 1.00 32.78  ? 765  ARG A CD  1 
ATOM   5671  N NE  . ARG A  1 796  ? 214.060 199.563 211.113 1.00 32.78  ? 765  ARG A NE  1 
ATOM   5672  C CZ  . ARG A  1 796  ? 213.445 199.530 212.290 1.00 32.78  ? 765  ARG A CZ  1 
ATOM   5673  N NH1 . ARG A  1 796  ? 213.671 198.537 213.135 1.00 32.78  ? 765  ARG A NH1 1 
ATOM   5674  N NH2 . ARG A  1 796  ? 212.600 200.497 212.619 1.00 32.78  ? 765  ARG A NH2 1 
ATOM   5675  N N   . ALA A  1 797  ? 218.438 202.806 209.574 1.00 27.67  ? 766  ALA A N   1 
ATOM   5676  C CA  . ALA A  1 797  ? 218.644 203.940 208.674 1.00 27.67  ? 766  ALA A CA  1 
ATOM   5677  C C   . ALA A  1 797  ? 220.039 203.937 208.048 1.00 27.67  ? 766  ALA A C   1 
ATOM   5678  O O   . ALA A  1 797  ? 220.191 204.152 206.830 1.00 27.67  ? 766  ALA A O   1 
ATOM   5679  C CB  . ALA A  1 797  ? 218.412 205.240 209.434 1.00 27.67  ? 766  ALA A CB  1 
ATOM   5680  N N   . LEU A  1 798  ? 221.069 203.656 208.848 1.00 26.10  ? 767  LEU A N   1 
ATOM   5681  C CA  . LEU A  1 798  ? 222.422 203.659 208.294 1.00 26.10  ? 767  LEU A CA  1 
ATOM   5682  C C   . LEU A  1 798  ? 222.628 202.551 207.261 1.00 26.10  ? 767  LEU A C   1 
ATOM   5683  O O   . LEU A  1 798  ? 223.295 202.768 206.240 1.00 26.10  ? 767  LEU A O   1 
ATOM   5684  C CB  . LEU A  1 798  ? 223.451 203.557 209.414 1.00 26.10  ? 767  LEU A CB  1 
ATOM   5685  C CG  . LEU A  1 798  ? 223.701 204.830 210.217 1.00 26.10  ? 767  LEU A CG  1 
ATOM   5686  C CD1 . LEU A  1 798  ? 224.766 204.594 211.258 1.00 26.10  ? 767  LEU A CD1 1 
ATOM   5687  C CD2 . LEU A  1 798  ? 224.080 205.980 209.309 1.00 26.10  ? 767  LEU A CD2 1 
ATOM   5688  N N   . THR A  1 799  ? 222.083 201.351 207.501 1.00 28.96  ? 768  THR A N   1 
ATOM   5689  C CA  . THR A  1 799  ? 222.241 200.285 206.509 1.00 28.96  ? 768  THR A CA  1 
ATOM   5690  C C   . THR A  1 799  ? 221.489 200.581 205.218 1.00 28.96  ? 768  THR A C   1 
ATOM   5691  O O   . THR A  1 799  ? 221.960 200.214 204.130 1.00 28.96  ? 768  THR A O   1 
ATOM   5692  C CB  . THR A  1 799  ? 221.794 198.936 207.062 1.00 28.96  ? 768  THR A CB  1 
ATOM   5693  O OG1 . THR A  1 799  ? 220.401 198.982 207.370 1.00 28.96  ? 768  THR A OG1 1 
ATOM   5694  C CG2 . THR A  1 799  ? 222.572 198.587 208.306 1.00 28.96  ? 768  THR A CG2 1 
ATOM   5695  N N   . GLY A  1 800  ? 220.330 201.237 205.305 1.00 27.29  ? 769  GLY A N   1 
ATOM   5696  C CA  . GLY A  1 800  ? 219.677 201.694 204.086 1.00 27.29  ? 769  GLY A CA  1 
ATOM   5697  C C   . GLY A  1 800  ? 220.558 202.612 203.261 1.00 27.29  ? 769  GLY A C   1 
ATOM   5698  O O   . GLY A  1 800  ? 220.711 202.426 202.046 1.00 27.29  ? 769  GLY A O   1 
ATOM   5699  N N   . ILE A  1 801  ? 221.188 203.589 203.918 1.00 25.37  ? 770  ILE A N   1 
ATOM   5700  C CA  . ILE A  1 801  ? 222.095 204.485 203.199 1.00 25.37  ? 770  ILE A CA  1 
ATOM   5701  C C   . ILE A  1 801  ? 223.220 203.688 202.541 1.00 25.37  ? 770  ILE A C   1 
ATOM   5702  O O   . ILE A  1 801  ? 223.582 203.914 201.372 1.00 25.37  ? 770  ILE A O   1 
ATOM   5703  C CB  . ILE A  1 801  ? 222.656 205.561 204.145 1.00 25.37  ? 770  ILE A CB  1 
ATOM   5704  C CG1 . ILE A  1 801  ? 221.537 206.356 204.808 1.00 25.37  ? 770  ILE A CG1 1 
ATOM   5705  C CG2 . ILE A  1 801  ? 223.596 206.492 203.409 1.00 25.37  ? 770  ILE A CG2 1 
ATOM   5706  C CD1 . ILE A  1 801  ? 222.037 207.299 205.849 1.00 25.37  ? 770  ILE A CD1 1 
ATOM   5707  N N   . ALA A  1 802  ? 223.792 202.743 203.291 1.00 26.70  ? 771  ALA A N   1 
ATOM   5708  C CA  . ALA A  1 802  ? 224.951 202.003 202.806 1.00 26.70  ? 771  ALA A CA  1 
ATOM   5709  C C   . ALA A  1 802  ? 224.628 201.171 201.572 1.00 26.70  ? 771  ALA A C   1 
ATOM   5710  O O   . ALA A  1 802  ? 225.441 201.097 200.646 1.00 26.70  ? 771  ALA A O   1 
ATOM   5711  C CB  . ALA A  1 802  ? 225.503 201.114 203.915 1.00 26.70  ? 771  ALA A CB  1 
ATOM   5712  N N   . VAL A  1 803  ? 223.469 200.509 201.538 1.00 28.69  ? 772  VAL A N   1 
ATOM   5713  C CA  . VAL A  1 803  ? 223.160 199.752 200.319 1.00 28.69  ? 772  VAL A CA  1 
ATOM   5714  C C   . VAL A  1 803  ? 222.819 200.684 199.154 1.00 28.69  ? 772  VAL A C   1 
ATOM   5715  O O   . VAL A  1 803  ? 223.113 200.369 197.982 1.00 28.69  ? 772  VAL A O   1 
ATOM   5716  C CB  . VAL A  1 803  ? 222.042 198.722 200.569 1.00 28.69  ? 772  VAL A CB  1 
ATOM   5717  C CG1 . VAL A  1 803  ? 222.411 197.826 201.727 1.00 28.69  ? 772  VAL A CG1 1 
ATOM   5718  C CG2 . VAL A  1 803  ? 220.706 199.398 200.801 1.00 28.69  ? 772  VAL A CG2 1 
ATOM   5719  N N   . GLU A  1 804  ? 222.226 201.850 199.441 1.00 30.27  ? 773  GLU A N   1 
ATOM   5720  C CA  . GLU A  1 804  ? 221.939 202.792 198.363 1.00 30.27  ? 773  GLU A CA  1 
ATOM   5721  C C   . GLU A  1 804  ? 223.208 203.252 197.655 1.00 30.27  ? 773  GLU A C   1 
ATOM   5722  O O   . GLU A  1 804  ? 223.183 203.502 196.445 1.00 30.27  ? 773  GLU A O   1 
ATOM   5723  C CB  . GLU A  1 804  ? 221.172 203.993 198.912 1.00 30.27  ? 773  GLU A CB  1 
ATOM   5724  C CG  . GLU A  1 804  ? 220.538 204.887 197.857 1.00 30.27  ? 773  GLU A CG  1 
ATOM   5725  C CD  . GLU A  1 804  ? 219.352 204.245 197.163 1.00 30.27  ? 773  GLU A CD  1 
ATOM   5726  O OE1 . GLU A  1 804  ? 218.812 203.252 197.691 1.00 30.27  ? 773  GLU A OE1 1 
ATOM   5727  O OE2 . GLU A  1 804  ? 218.959 204.731 196.081 1.00 30.27  ? 773  GLU A OE2 1 
ATOM   5728  N N   . GLN A  1 805  ? 224.317 203.392 198.388 1.00 28.17  ? 774  GLN A N   1 
ATOM   5729  C CA  . GLN A  1 805  ? 225.559 203.838 197.746 1.00 28.17  ? 774  GLN A CA  1 
ATOM   5730  C C   . GLN A  1 805  ? 226.038 202.867 196.663 1.00 28.17  ? 774  GLN A C   1 
ATOM   5731  O O   . GLN A  1 805  ? 226.424 203.285 195.554 1.00 28.17  ? 774  GLN A O   1 
ATOM   5732  C CB  . GLN A  1 805  ? 226.640 204.040 198.802 1.00 28.17  ? 774  GLN A CB  1 
ATOM   5733  C CG  . GLN A  1 805  ? 226.282 205.098 199.817 1.00 28.17  ? 774  GLN A CG  1 
ATOM   5734  C CD  . GLN A  1 805  ? 225.718 206.346 199.179 1.00 28.17  ? 774  GLN A CD  1 
ATOM   5735  O OE1 . GLN A  1 805  ? 226.361 206.967 198.345 1.00 28.17  ? 774  GLN A OE1 1 
ATOM   5736  N NE2 . GLN A  1 805  ? 224.498 206.701 199.543 1.00 28.17  ? 774  GLN A NE2 1 
ATOM   5737  N N   . ASP A  1 806  ? 226.015 201.567 196.958 1.00 30.62  ? 775  ASP A N   1 
ATOM   5738  C CA  . ASP A  1 806  ? 226.403 200.580 195.956 1.00 30.62  ? 775  ASP A CA  1 
ATOM   5739  C C   . ASP A  1 806  ? 225.429 200.564 194.792 1.00 30.62  ? 775  ASP A C   1 
ATOM   5740  O O   . ASP A  1 806  ? 225.838 200.383 193.638 1.00 30.62  ? 775  ASP A O   1 
ATOM   5741  C CB  . ASP A  1 806  ? 226.525 199.193 196.579 1.00 30.62  ? 775  ASP A CB  1 
ATOM   5742  C CG  . ASP A  1 806  ? 227.563 199.135 197.674 1.00 30.62  ? 775  ASP A CG  1 
ATOM   5743  O OD1 . ASP A  1 806  ? 227.246 198.646 198.774 1.00 30.62  ? 775  ASP A OD1 1 
ATOM   5744  O OD2 . ASP A  1 806  ? 228.701 199.586 197.438 1.00 30.62  ? 775  ASP A OD2 1 
ATOM   5745  N N   . LYS A  1 807  ? 224.138 200.764 195.067 1.00 29.70  ? 776  LYS A N   1 
ATOM   5746  C CA  . LYS A  1 807  ? 223.192 200.837 193.958 1.00 29.70  ? 776  LYS A CA  1 
ATOM   5747  C C   . LYS A  1 807  ? 223.500 202.014 193.038 1.00 29.70  ? 776  LYS A C   1 
ATOM   5748  O O   . LYS A  1 807  ? 223.386 201.897 191.812 1.00 29.70  ? 776  LYS A O   1 
ATOM   5749  C CB  . LYS A  1 807  ? 221.763 200.929 194.480 1.00 29.70  ? 776  LYS A CB  1 
ATOM   5750  C CG  . LYS A  1 807  ? 220.742 200.826 193.379 1.00 29.70  ? 776  LYS A CG  1 
ATOM   5751  C CD  . LYS A  1 807  ? 219.330 200.865 193.896 1.00 29.70  ? 776  LYS A CD  1 
ATOM   5752  C CE  . LYS A  1 807  ? 218.359 200.745 192.742 1.00 29.70  ? 776  LYS A CE  1 
ATOM   5753  N NZ  . LYS A  1 807  ? 216.950 200.696 193.200 1.00 29.70  ? 776  LYS A NZ  1 
ATOM   5754  N N   . ASN A  1 808  ? 223.894 203.157 193.608 1.00 27.37  ? 777  ASN A N   1 
ATOM   5755  C CA  . ASN A  1 808  ? 224.277 204.311 192.794 1.00 27.37  ? 777  ASN A CA  1 
ATOM   5756  C C   . ASN A  1 808  ? 225.445 203.991 191.874 1.00 27.37  ? 777  ASN A C   1 
ATOM   5757  O O   . ASN A  1 808  ? 225.412 204.291 190.670 1.00 27.37  ? 777  ASN A O   1 
ATOM   5758  C CB  . ASN A  1 808  ? 224.660 205.497 193.678 1.00 27.37  ? 777  ASN A CB  1 
ATOM   5759  C CG  . ASN A  1 808  ? 223.507 206.050 194.447 1.00 27.37  ? 777  ASN A CG  1 
ATOM   5760  O OD1 . ASN A  1 808  ? 222.357 205.896 194.056 1.00 27.37  ? 777  ASN A OD1 1 
ATOM   5761  N ND2 . ASN A  1 808  ? 223.808 206.756 195.525 1.00 27.37  ? 777  ASN A ND2 1 
ATOM   5762  N N   . THR A  1 809  ? 226.503 203.400 192.429 1.00 29.57  ? 778  THR A N   1 
ATOM   5763  C CA  . THR A  1 809  ? 227.666 203.099 191.595 1.00 29.57  ? 778  THR A CA  1 
ATOM   5764  C C   . THR A  1 809  ? 227.314 202.106 190.491 1.00 29.57  ? 778  THR A C   1 
ATOM   5765  O O   . THR A  1 809  ? 227.727 202.272 189.334 1.00 29.57  ? 778  THR A O   1 
ATOM   5766  C CB  . THR A  1 809  ? 228.808 202.573 192.459 1.00 29.57  ? 778  THR A CB  1 
ATOM   5767  O OG1 . THR A  1 809  ? 229.286 203.627 193.298 1.00 29.57  ? 778  THR A OG1 1 
ATOM   5768  C CG2 . THR A  1 809  ? 229.949 202.087 191.598 1.00 29.57  ? 778  THR A CG2 1 
ATOM   5769  N N   . GLN A  1 810  ? 226.513 201.092 190.821 1.00 33.72  ? 779  GLN A N   1 
ATOM   5770  C CA  . GLN A  1 810  ? 226.066 200.132 189.816 1.00 33.72  ? 779  GLN A CA  1 
ATOM   5771  C C   . GLN A  1 810  ? 225.294 200.818 188.699 1.00 33.72  ? 779  GLN A C   1 
ATOM   5772  O O   . GLN A  1 810  ? 225.482 200.505 187.520 1.00 33.72  ? 779  GLN A O   1 
ATOM   5773  C CB  . GLN A  1 810  ? 225.199 199.064 190.473 1.00 33.72  ? 779  GLN A CB  1 
ATOM   5774  C CG  . GLN A  1 810  ? 224.798 197.937 189.555 1.00 33.72  ? 779  GLN A CG  1 
ATOM   5775  C CD  . GLN A  1 810  ? 224.076 196.827 190.288 1.00 33.72  ? 779  GLN A CD  1 
ATOM   5776  O OE1 . GLN A  1 810  ? 223.949 196.854 191.512 1.00 33.72  ? 779  GLN A OE1 1 
ATOM   5777  N NE2 . GLN A  1 810  ? 223.590 195.845 189.541 1.00 33.72  ? 779  GLN A NE2 1 
ATOM   5778  N N   . GLU A  1 811  ? 224.399 201.740 189.052 1.00 30.79  ? 780  GLU A N   1 
ATOM   5779  C CA  . GLU A  1 811  ? 223.578 202.401 188.044 1.00 30.79  ? 780  GLU A CA  1 
ATOM   5780  C C   . GLU A  1 811  ? 224.397 203.301 187.132 1.00 30.79  ? 780  GLU A C   1 
ATOM   5781  O O   . GLU A  1 811  ? 224.066 203.440 185.953 1.00 30.79  ? 780  GLU A O   1 
ATOM   5782  C CB  . GLU A  1 811  ? 222.493 203.223 188.725 1.00 30.79  ? 780  GLU A CB  1 
ATOM   5783  C CG  . GLU A  1 811  ? 221.204 202.484 188.948 1.00 30.79  ? 780  GLU A CG  1 
ATOM   5784  C CD  . GLU A  1 811  ? 220.324 203.170 189.970 1.00 30.79  ? 780  GLU A CD  1 
ATOM   5785  O OE1 . GLU A  1 811  ? 220.735 204.221 190.506 1.00 30.79  ? 780  GLU A OE1 1 
ATOM   5786  O OE2 . GLU A  1 811  ? 219.219 202.657 190.239 1.00 30.79  ? 780  GLU A OE2 1 
ATOM   5787  N N   . VAL A  1 812  ? 225.470 203.907 187.637 1.00 25.78  ? 781  VAL A N   1 
ATOM   5788  C CA  . VAL A  1 812  ? 226.264 204.774 186.766 1.00 25.78  ? 781  VAL A CA  1 
ATOM   5789  C C   . VAL A  1 812  ? 227.184 203.958 185.860 1.00 25.78  ? 781  VAL A C   1 
ATOM   5790  O O   . VAL A  1 812  ? 227.212 204.165 184.644 1.00 25.78  ? 781  VAL A O   1 
ATOM   5791  C CB  . VAL A  1 812  ? 227.062 205.804 187.585 1.00 25.78  ? 781  VAL A CB  1 
ATOM   5792  C CG1 . VAL A  1 812  ? 227.954 206.617 186.669 1.00 25.78  ? 781  VAL A CG1 1 
ATOM   5793  C CG2 . VAL A  1 812  ? 226.141 206.708 188.351 1.00 25.78  ? 781  VAL A CG2 1 
ATOM   5794  N N   . PHE A  1 813  ? 227.941 203.011 186.419 1.00 28.42  ? 782  PHE A N   1 
ATOM   5795  C CA  . PHE A  1 813  ? 229.042 202.405 185.669 1.00 28.42  ? 782  PHE A CA  1 
ATOM   5796  C C   . PHE A  1 813  ? 228.730 201.065 185.016 1.00 28.42  ? 782  PHE A C   1 
ATOM   5797  O O   . PHE A  1 813  ? 229.404 200.706 184.047 1.00 28.42  ? 782  PHE A O   1 
ATOM   5798  C CB  . PHE A  1 813  ? 230.269 202.235 186.571 1.00 28.42  ? 782  PHE A CB  1 
ATOM   5799  C CG  . PHE A  1 813  ? 230.946 203.525 186.913 1.00 28.42  ? 782  PHE A CG  1 
ATOM   5800  C CD1 . PHE A  1 813  ? 231.691 204.197 185.966 1.00 28.42  ? 782  PHE A CD1 1 
ATOM   5801  C CD2 . PHE A  1 813  ? 230.808 204.085 188.165 1.00 28.42  ? 782  PHE A CD2 1 
ATOM   5802  C CE1 . PHE A  1 813  ? 232.301 205.381 186.271 1.00 28.42  ? 782  PHE A CE1 1 
ATOM   5803  C CE2 . PHE A  1 813  ? 231.417 205.273 188.469 1.00 28.42  ? 782  PHE A CE2 1 
ATOM   5804  C CZ  . PHE A  1 813  ? 232.161 205.921 187.522 1.00 28.42  ? 782  PHE A CZ  1 
ATOM   5805  N N   . ALA A  1 814  ? 227.738 200.321 185.492 1.00 34.20  ? 783  ALA A N   1 
ATOM   5806  C CA  . ALA A  1 814  ? 227.517 198.945 185.051 1.00 34.20  ? 783  ALA A CA  1 
ATOM   5807  C C   . ALA A  1 814  ? 226.384 198.819 184.047 1.00 34.20  ? 783  ALA A C   1 
ATOM   5808  O O   . ALA A  1 814  ? 225.619 197.856 184.094 1.00 34.20  ? 783  ALA A O   1 
ATOM   5809  C CB  . ALA A  1 814  ? 227.266 198.042 186.252 1.00 34.20  ? 783  ALA A CB  1 
ATOM   5810  N N   . GLN A  1 815  ? 226.242 199.782 183.135 1.00 37.33  ? 784  GLN A N   1 
ATOM   5811  C CA  . GLN A  1 815  ? 225.159 199.724 182.157 1.00 37.33  ? 784  GLN A CA  1 
ATOM   5812  C C   . GLN A  1 815  ? 225.303 198.529 181.220 1.00 37.33  ? 784  GLN A C   1 
ATOM   5813  O O   . GLN A  1 815  ? 224.364 197.742 181.057 1.00 37.33  ? 784  GLN A O   1 
ATOM   5814  C CB  . GLN A  1 815  ? 225.115 201.018 181.350 1.00 37.33  ? 784  GLN A CB  1 
ATOM   5815  C CG  . GLN A  1 815  ? 225.207 202.274 182.178 1.00 37.33  ? 784  GLN A CG  1 
ATOM   5816  C CD  . GLN A  1 815  ? 224.589 203.455 181.480 1.00 37.33  ? 784  GLN A CD  1 
ATOM   5817  O OE1 . GLN A  1 815  ? 224.879 203.719 180.317 1.00 37.33  ? 784  GLN A OE1 1 
ATOM   5818  N NE2 . GLN A  1 815  ? 223.731 204.177 182.185 1.00 37.33  ? 784  GLN A NE2 1 
ATOM   5819  N N   . VAL A  1 816  ? 226.461 198.382 180.583 1.00 46.65  ? 785  VAL A N   1 
ATOM   5820  C CA  . VAL A  1 816  ? 226.697 197.300 179.631 1.00 46.65  ? 785  VAL A CA  1 
ATOM   5821  C C   . VAL A  1 816  ? 227.387 196.132 180.321 1.00 46.65  ? 785  VAL A C   1 
ATOM   5822  O O   . VAL A  1 816  ? 228.248 196.323 181.188 1.00 46.65  ? 785  VAL A O   1 
ATOM   5823  C CB  . VAL A  1 816  ? 227.517 197.790 178.423 1.00 46.65  ? 785  VAL A CB  1 
ATOM   5824  C CG1 . VAL A  1 816  ? 226.798 198.935 177.737 1.00 46.65  ? 785  VAL A CG1 1 
ATOM   5825  C CG2 . VAL A  1 816  ? 228.915 198.212 178.848 1.00 46.65  ? 785  VAL A CG2 1 
ATOM   5826  N N   . LYS A  1 817  ? 226.988 194.913 179.956 1.00 52.66  ? 786  LYS A N   1 
ATOM   5827  C CA  . LYS A  1 817  ? 227.542 193.699 180.540 1.00 52.66  ? 786  LYS A CA  1 
ATOM   5828  C C   . LYS A  1 817  ? 228.457 192.950 179.582 1.00 52.66  ? 786  LYS A C   1 
ATOM   5829  O O   . LYS A  1 817  ? 228.833 191.810 179.865 1.00 52.66  ? 786  LYS A O   1 
ATOM   5830  C CB  . LYS A  1 817  ? 226.424 192.773 181.022 1.00 52.66  ? 786  LYS A CB  1 
ATOM   5831  C CG  . LYS A  1 817  ? 225.571 193.342 182.139 1.00 52.66  ? 786  LYS A CG  1 
ATOM   5832  C CD  . LYS A  1 817  ? 226.426 193.578 183.374 1.00 52.66  ? 786  LYS A CD  1 
ATOM   5833  C CE  . LYS A  1 817  ? 225.596 194.037 184.551 1.00 52.66  ? 786  LYS A CE  1 
ATOM   5834  N NZ  . LYS A  1 817  ? 226.437 194.221 185.763 1.00 52.66  ? 786  LYS A NZ  1 
ATOM   5835  N N   . GLN A  1 818  ? 228.805 193.555 178.452 1.00 51.63  ? 787  GLN A N   1 
ATOM   5836  C CA  . GLN A  1 818  ? 229.812 193.033 177.538 1.00 51.63  ? 787  GLN A CA  1 
ATOM   5837  C C   . GLN A  1 818  ? 231.097 193.820 177.746 1.00 51.63  ? 787  GLN A C   1 
ATOM   5838  O O   . GLN A  1 818  ? 231.098 195.046 177.612 1.00 51.63  ? 787  GLN A O   1 
ATOM   5839  C CB  . GLN A  1 818  ? 229.338 193.135 176.091 1.00 51.63  ? 787  GLN A CB  1 
ATOM   5840  C CG  . GLN A  1 818  ? 228.103 192.310 175.805 1.00 51.63  ? 787  GLN A CG  1 
ATOM   5841  C CD  . GLN A  1 818  ? 228.426 190.851 175.606 1.00 51.63  ? 787  GLN A CD  1 
ATOM   5842  O OE1 . GLN A  1 818  ? 229.589 190.477 175.472 1.00 51.63  ? 787  GLN A OE1 1 
ATOM   5843  N NE2 . GLN A  1 818  ? 227.400 190.013 175.589 1.00 51.63  ? 787  GLN A NE2 1 
ATOM   5844  N N   . ILE A  1 819  ? 232.181 193.126 178.079 1.00 47.68  ? 788  ILE A N   1 
ATOM   5845  C CA  . ILE A  1 819  ? 233.461 193.782 178.355 1.00 47.68  ? 788  ILE A CA  1 
ATOM   5846  C C   . ILE A  1 819  ? 234.250 193.810 177.050 1.00 47.68  ? 788  ILE A C   1 
ATOM   5847  O O   . ILE A  1 819  ? 234.992 192.888 176.729 1.00 47.68  ? 788  ILE A O   1 
ATOM   5848  C CB  . ILE A  1 819  ? 234.225 193.088 179.478 1.00 47.68  ? 788  ILE A CB  1 
ATOM   5849  C CG1 . ILE A  1 819  ? 233.379 193.022 180.748 1.00 47.68  ? 788  ILE A CG1 1 
ATOM   5850  C CG2 . ILE A  1 819  ? 235.507 193.827 179.780 1.00 47.68  ? 788  ILE A CG2 1 
ATOM   5851  C CD1 . ILE A  1 819  ? 233.003 194.376 181.302 1.00 47.68  ? 788  ILE A CD1 1 
ATOM   5852  N N   . TYR A  1 820  ? 234.093 194.888 176.288 1.00 45.74  ? 789  TYR A N   1 
ATOM   5853  C CA  . TYR A  1 820  ? 234.790 195.000 175.015 1.00 45.74  ? 789  TYR A CA  1 
ATOM   5854  C C   . TYR A  1 820  ? 236.277 195.259 175.228 1.00 45.74  ? 789  TYR A C   1 
ATOM   5855  O O   . TYR A  1 820  ? 236.694 195.864 176.216 1.00 45.74  ? 789  TYR A O   1 
ATOM   5856  C CB  . TYR A  1 820  ? 234.180 196.100 174.149 1.00 45.74  ? 789  TYR A CB  1 
ATOM   5857  C CG  . TYR A  1 820  ? 232.713 195.903 173.861 1.00 45.74  ? 789  TYR A CG  1 
ATOM   5858  C CD1 . TYR A  1 820  ? 232.306 195.084 172.824 1.00 45.74  ? 789  TYR A CD1 1 
ATOM   5859  C CD2 . TYR A  1 820  ? 231.739 196.538 174.610 1.00 45.74  ? 789  TYR A CD2 1 
ATOM   5860  C CE1 . TYR A  1 820  ? 230.979 194.896 172.544 1.00 45.74  ? 789  TYR A CE1 1 
ATOM   5861  C CE2 . TYR A  1 820  ? 230.405 196.350 174.337 1.00 45.74  ? 789  TYR A CE2 1 
ATOM   5862  C CZ  . TYR A  1 820  ? 230.034 195.527 173.302 1.00 45.74  ? 789  TYR A CZ  1 
ATOM   5863  O OH  . TYR A  1 820  ? 228.707 195.326 173.014 1.00 45.74  ? 789  TYR A OH  1 
ATOM   5864  N N   . LYS A  1 821  ? 237.074 194.810 174.265 1.00 54.61  ? 790  LYS A N   1 
ATOM   5865  C CA  . LYS A  1 821  ? 238.512 195.031 174.245 1.00 54.61  ? 790  LYS A CA  1 
ATOM   5866  C C   . LYS A  1 821  ? 238.890 195.932 173.080 1.00 54.61  ? 790  LYS A C   1 
ATOM   5867  O O   . LYS A  1 821  ? 238.327 195.821 171.987 1.00 54.61  ? 790  LYS A O   1 
ATOM   5868  C CB  . LYS A  1 821  ? 239.266 193.705 174.128 1.00 54.61  ? 790  LYS A CB  1 
ATOM   5869  C CG  . LYS A  1 821  ? 238.996 192.725 175.246 1.00 54.61  ? 790  LYS A CG  1 
ATOM   5870  C CD  . LYS A  1 821  ? 239.318 193.320 176.602 1.00 54.61  ? 790  LYS A CD  1 
ATOM   5871  C CE  . LYS A  1 821  ? 240.800 193.637 176.715 1.00 54.61  ? 790  LYS A CE  1 
ATOM   5872  N NZ  . LYS A  1 821  ? 241.153 194.236 178.027 1.00 54.61  ? 790  LYS A NZ  1 
ATOM   5873  N N   . THR A  1 822  ? 239.829 196.839 173.326 1.00 62.06  ? 791  THR A N   1 
ATOM   5874  C CA  . THR A  1 822  ? 240.285 197.725 172.270 1.00 62.06  ? 791  THR A CA  1 
ATOM   5875  C C   . THR A  1 822  ? 241.149 196.953 171.271 1.00 62.06  ? 791  THR A C   1 
ATOM   5876  O O   . THR A  1 822  ? 241.862 196.019 171.646 1.00 62.06  ? 791  THR A O   1 
ATOM   5877  C CB  . THR A  1 822  ? 241.065 198.897 172.863 1.00 62.06  ? 791  THR A CB  1 
ATOM   5878  O OG1 . THR A  1 822  ? 241.482 199.781 171.818 1.00 62.06  ? 791  THR A OG1 1 
ATOM   5879  C CG2 . THR A  1 822  ? 242.281 198.410 173.637 1.00 62.06  ? 791  THR A CG2 1 
ATOM   5880  N N   . PRO A  1 823  ? 241.082 197.305 169.985 1.00 67.24  ? 792  PRO A N   1 
ATOM   5881  C CA  . PRO A  1 823  ? 241.822 196.540 168.986 1.00 67.24  ? 792  PRO A CA  1 
ATOM   5882  C C   . PRO A  1 823  ? 243.314 196.772 169.120 1.00 67.24  ? 792  PRO A C   1 
ATOM   5883  O O   . PRO A  1 823  ? 243.753 197.840 169.581 1.00 67.24  ? 792  PRO A O   1 
ATOM   5884  C CB  . PRO A  1 823  ? 241.285 197.091 167.652 1.00 67.24  ? 792  PRO A CB  1 
ATOM   5885  C CG  . PRO A  1 823  ? 240.871 198.472 167.977 1.00 67.24  ? 792  PRO A CG  1 
ATOM   5886  C CD  . PRO A  1 823  ? 240.318 198.406 169.375 1.00 67.24  ? 792  PRO A CD  1 
ATOM   5887  N N   . PRO A  1 824  ? 244.138 195.793 168.743 1.00 69.89  ? 793  PRO A N   1 
ATOM   5888  C CA  . PRO A  1 824  ? 245.590 196.032 168.747 1.00 69.89  ? 793  PRO A CA  1 
ATOM   5889  C C   . PRO A  1 824  ? 246.022 197.119 167.779 1.00 69.89  ? 793  PRO A C   1 
ATOM   5890  O O   . PRO A  1 824  ? 246.928 197.900 168.094 1.00 69.89  ? 793  PRO A O   1 
ATOM   5891  C CB  . PRO A  1 824  ? 246.167 194.663 168.362 1.00 69.89  ? 793  PRO A CB  1 
ATOM   5892  C CG  . PRO A  1 824  ? 245.060 193.971 167.648 1.00 69.89  ? 793  PRO A CG  1 
ATOM   5893  C CD  . PRO A  1 824  ? 243.799 194.432 168.301 1.00 69.89  ? 793  PRO A CD  1 
ATOM   5894  N N   . ILE A  1 825  ? 245.396 197.193 166.608 1.00 71.35  ? 794  ILE A N   1 
ATOM   5895  C CA  . ILE A  1 825  ? 245.766 198.172 165.591 1.00 71.35  ? 794  ILE A CA  1 
ATOM   5896  C C   . ILE A  1 825  ? 245.059 199.488 165.890 1.00 71.35  ? 794  ILE A C   1 
ATOM   5897  O O   . ILE A  1 825  ? 243.826 199.561 165.871 1.00 71.35  ? 794  ILE A O   1 
ATOM   5898  C CB  . ILE A  1 825  ? 245.428 197.667 164.184 1.00 71.35  ? 794  ILE A CB  1 
ATOM   5899  C CG1 . ILE A  1 825  ? 246.005 196.267 163.976 1.00 71.35  ? 794  ILE A CG1 1 
ATOM   5900  C CG2 . ILE A  1 825  ? 245.964 198.628 163.138 1.00 71.35  ? 794  ILE A CG2 1 
ATOM   5901  C CD1 . ILE A  1 825  ? 247.505 196.251 163.779 1.00 71.35  ? 794  ILE A CD1 1 
ATOM   5902  N N   . LYS A  1 826  ? 245.841 200.536 166.145 1.00 65.92  ? 795  LYS A N   1 
ATOM   5903  C CA  . LYS A  1 826  ? 245.297 201.847 166.487 1.00 65.92  ? 795  LYS A CA  1 
ATOM   5904  C C   . LYS A  1 826  ? 245.305 202.713 165.230 1.00 65.92  ? 795  LYS A C   1 
ATOM   5905  O O   . LYS A  1 826  ? 246.124 203.614 165.060 1.00 65.92  ? 795  LYS A O   1 
ATOM   5906  C CB  . LYS A  1 826  ? 246.110 202.477 167.612 1.00 65.92  ? 795  LYS A CB  1 
ATOM   5907  C CG  . LYS A  1 826  ? 246.226 201.612 168.854 1.00 65.92  ? 795  LYS A CG  1 
ATOM   5908  C CD  . LYS A  1 826  ? 244.887 201.061 169.293 1.00 65.92  ? 795  LYS A CD  1 
ATOM   5909  C CE  . LYS A  1 826  ? 244.922 200.665 170.755 1.00 65.92  ? 795  LYS A CE  1 
ATOM   5910  N NZ  . LYS A  1 826  ? 245.312 199.238 170.934 1.00 65.92  ? 795  LYS A NZ  1 
ATOM   5911  N N   . ASP A  1 827  ? 244.361 202.425 164.337 1.00 60.43  ? 796  ASP A N   1 
ATOM   5912  C CA  . ASP A  1 827  ? 244.197 203.141 163.073 1.00 60.43  ? 796  ASP A CA  1 
ATOM   5913  C C   . ASP A  1 827  ? 242.834 203.825 163.086 1.00 60.43  ? 796  ASP A C   1 
ATOM   5914  O O   . ASP A  1 827  ? 241.856 203.286 162.566 1.00 60.43  ? 796  ASP A O   1 
ATOM   5915  C CB  . ASP A  1 827  ? 244.337 202.173 161.890 1.00 60.43  ? 796  ASP A CB  1 
ATOM   5916  C CG  . ASP A  1 827  ? 244.270 202.873 160.544 1.00 60.43  ? 796  ASP A CG  1 
ATOM   5917  O OD1 . ASP A  1 827  ? 244.134 204.113 160.508 1.00 60.43  ? 796  ASP A OD1 1 
ATOM   5918  O OD2 . ASP A  1 827  ? 244.358 202.178 159.512 1.00 60.43  ? 796  ASP A OD2 1 
ATOM   5919  N N   . PHE A  1 828  ? 242.769 205.015 163.677 1.00 47.78  ? 797  PHE A N   1 
ATOM   5920  C CA  . PHE A  1 828  ? 241.509 205.726 163.847 1.00 47.78  ? 797  PHE A CA  1 
ATOM   5921  C C   . PHE A  1 828  ? 241.464 207.010 163.029 1.00 47.78  ? 797  PHE A C   1 
ATOM   5922  O O   . PHE A  1 828  ? 240.880 208.010 163.445 1.00 47.78  ? 797  PHE A O   1 
ATOM   5923  C CB  . PHE A  1 828  ? 241.252 206.022 165.320 1.00 47.78  ? 797  PHE A CB  1 
ATOM   5924  C CG  . PHE A  1 828  ? 241.223 204.800 166.183 1.00 47.78  ? 797  PHE A CG  1 
ATOM   5925  C CD1 . PHE A  1 828  ? 240.243 203.845 166.013 1.00 47.78  ? 797  PHE A CD1 1 
ATOM   5926  C CD2 . PHE A  1 828  ? 242.166 204.610 167.168 1.00 47.78  ? 797  PHE A CD2 1 
ATOM   5927  C CE1 . PHE A  1 828  ? 240.212 202.725 166.801 1.00 47.78  ? 797  PHE A CE1 1 
ATOM   5928  C CE2 . PHE A  1 828  ? 242.135 203.489 167.958 1.00 47.78  ? 797  PHE A CE2 1 
ATOM   5929  C CZ  . PHE A  1 828  ? 241.158 202.547 167.773 1.00 47.78  ? 797  PHE A CZ  1 
ATOM   5930  N N   . GLY A  1 829  ? 242.082 206.998 161.854 1.00 43.45  ? 798  GLY A N   1 
ATOM   5931  C CA  . GLY A  1 829  ? 242.024 208.147 160.976 1.00 43.45  ? 798  GLY A CA  1 
ATOM   5932  C C   . GLY A  1 829  ? 242.846 209.336 161.405 1.00 43.45  ? 798  GLY A C   1 
ATOM   5933  O O   . GLY A  1 829  ? 242.584 210.448 160.946 1.00 43.45  ? 798  GLY A O   1 
ATOM   5934  N N   . GLY A  1 830  ? 243.837 209.140 162.269 1.00 41.22  ? 799  GLY A N   1 
ATOM   5935  C CA  . GLY A  1 830  ? 244.666 210.226 162.742 1.00 41.22  ? 799  GLY A CA  1 
ATOM   5936  C C   . GLY A  1 830  ? 244.288 210.768 164.100 1.00 41.22  ? 799  GLY A C   1 
ATOM   5937  O O   . GLY A  1 830  ? 244.944 211.698 164.580 1.00 41.22  ? 799  GLY A O   1 
ATOM   5938  N N   . PHE A  1 831  ? 243.253 210.221 164.730 1.00 41.48  ? 800  PHE A N   1 
ATOM   5939  C CA  . PHE A  1 831  ? 242.885 210.564 166.095 1.00 41.48  ? 800  PHE A CA  1 
ATOM   5940  C C   . PHE A  1 831  ? 243.676 209.688 167.058 1.00 41.48  ? 800  PHE A C   1 
ATOM   5941  O O   . PHE A  1 831  ? 243.768 208.472 166.870 1.00 41.48  ? 800  PHE A O   1 
ATOM   5942  C CB  . PHE A  1 831  ? 241.380 210.406 166.305 1.00 41.48  ? 800  PHE A CB  1 
ATOM   5943  C CG  . PHE A  1 831  ? 240.551 211.352 165.478 1.00 41.48  ? 800  PHE A CG  1 
ATOM   5944  C CD1 . PHE A  1 831  ? 240.395 211.162 164.120 1.00 41.48  ? 800  PHE A CD1 1 
ATOM   5945  C CD2 . PHE A  1 831  ? 239.941 212.444 166.061 1.00 41.48  ? 800  PHE A CD2 1 
ATOM   5946  C CE1 . PHE A  1 831  ? 239.637 212.034 163.363 1.00 41.48  ? 800  PHE A CE1 1 
ATOM   5947  C CE2 . PHE A  1 831  ? 239.187 213.316 165.310 1.00 41.48  ? 800  PHE A CE2 1 
ATOM   5948  C CZ  . PHE A  1 831  ? 239.035 213.110 163.961 1.00 41.48  ? 800  PHE A CZ  1 
ATOM   5949  N N   . ASN A  1 832  ? 244.241 210.308 168.083 1.00 48.13  ? 801  ASN A N   1 
ATOM   5950  C CA  . ASN A  1 832  ? 245.123 209.652 169.042 1.00 48.13  ? 801  ASN A CA  1 
ATOM   5951  C C   . ASN A  1 832  ? 244.486 209.625 170.428 1.00 48.13  ? 801  ASN A C   1 
ATOM   5952  O O   . ASN A  1 832  ? 244.509 210.625 171.149 1.00 48.13  ? 801  ASN A O   1 
ATOM   5953  C CB  . ASN A  1 832  ? 246.451 210.398 169.051 1.00 48.13  ? 801  ASN A CB  1 
ATOM   5954  C CG  . ASN A  1 832  ? 247.549 209.652 169.746 1.00 48.13  ? 801  ASN A CG  1 
ATOM   5955  O OD1 . ASN A  1 832  ? 247.408 208.487 170.104 1.00 48.13  ? 801  ASN A OD1 1 
ATOM   5956  N ND2 . ASN A  1 832  ? 248.669 210.329 169.939 1.00 48.13  ? 801  ASN A ND2 1 
ATOM   5957  N N   . PHE A  1 833  ? 243.913 208.477 170.803 1.00 42.72  ? 802  PHE A N   1 
ATOM   5958  C CA  . PHE A  1 833  ? 243.283 208.310 172.107 1.00 42.72  ? 802  PHE A CA  1 
ATOM   5959  C C   . PHE A  1 833  ? 244.205 207.652 173.127 1.00 42.72  ? 802  PHE A C   1 
ATOM   5960  O O   . PHE A  1 833  ? 243.721 206.995 174.053 1.00 42.72  ? 802  PHE A O   1 
ATOM   5961  C CB  . PHE A  1 833  ? 241.995 207.489 171.998 1.00 42.72  ? 802  PHE A CB  1 
ATOM   5962  C CG  . PHE A  1 833  ? 241.079 207.916 170.892 1.00 42.72  ? 802  PHE A CG  1 
ATOM   5963  C CD1 . PHE A  1 833  ? 241.143 207.316 169.654 1.00 42.72  ? 802  PHE A CD1 1 
ATOM   5964  C CD2 . PHE A  1 833  ? 240.151 208.910 171.094 1.00 42.72  ? 802  PHE A CD2 1 
ATOM   5965  C CE1 . PHE A  1 833  ? 240.306 207.703 168.647 1.00 42.72  ? 802  PHE A CE1 1 
ATOM   5966  C CE2 . PHE A  1 833  ? 239.314 209.295 170.086 1.00 42.72  ? 802  PHE A CE2 1 
ATOM   5967  C CZ  . PHE A  1 833  ? 239.393 208.693 168.865 1.00 42.72  ? 802  PHE A CZ  1 
ATOM   5968  N N   . SER A  1 834  ? 245.524 207.787 172.971 1.00 49.03  ? 803  SER A N   1 
ATOM   5969  C CA  . SER A  1 834  ? 246.433 207.068 173.861 1.00 49.03  ? 803  SER A CA  1 
ATOM   5970  C C   . SER A  1 834  ? 246.331 207.564 175.298 1.00 49.03  ? 803  SER A C   1 
ATOM   5971  O O   . SER A  1 834  ? 246.622 206.811 176.234 1.00 49.03  ? 803  SER A O   1 
ATOM   5972  C CB  . SER A  1 834  ? 247.872 207.192 173.372 1.00 49.03  ? 803  SER A CB  1 
ATOM   5973  O OG  . SER A  1 834  ? 248.254 208.549 173.287 1.00 49.03  ? 803  SER A OG  1 
ATOM   5974  N N   . GLN A  1 835  ? 245.936 208.822 175.493 1.00 47.87  ? 804  GLN A N   1 
ATOM   5975  C CA  . GLN A  1 835  ? 245.896 209.418 176.821 1.00 47.87  ? 804  GLN A CA  1 
ATOM   5976  C C   . GLN A  1 835  ? 244.711 208.957 177.655 1.00 47.87  ? 804  GLN A C   1 
ATOM   5977  O O   . GLN A  1 835  ? 244.728 209.133 178.875 1.00 47.87  ? 804  GLN A O   1 
ATOM   5978  C CB  . GLN A  1 835  ? 245.848 210.939 176.699 1.00 47.87  ? 804  GLN A CB  1 
ATOM   5979  C CG  . GLN A  1 835  ? 247.133 211.579 176.209 1.00 47.87  ? 804  GLN A CG  1 
ATOM   5980  C CD  . GLN A  1 835  ? 248.317 211.270 177.094 1.00 47.87  ? 804  GLN A CD  1 
ATOM   5981  O OE1 . GLN A  1 835  ? 248.570 211.975 178.068 1.00 47.87  ? 804  GLN A OE1 1 
ATOM   5982  N NE2 . GLN A  1 835  ? 249.058 210.220 176.757 1.00 47.87  ? 804  GLN A NE2 1 
ATOM   5983  N N   . ILE A  1 836  ? 243.680 208.396 177.032 1.00 41.93  ? 805  ILE A N   1 
ATOM   5984  C CA  . ILE A  1 836  ? 242.498 207.922 177.738 1.00 41.93  ? 805  ILE A CA  1 
ATOM   5985  C C   . ILE A  1 836  ? 242.302 206.416 177.641 1.00 41.93  ? 805  ILE A C   1 
ATOM   5986  O O   . ILE A  1 836  ? 241.340 205.897 178.209 1.00 41.93  ? 805  ILE A O   1 
ATOM   5987  C CB  . ILE A  1 836  ? 241.236 208.666 177.257 1.00 41.93  ? 805  ILE A CB  1 
ATOM   5988  C CG1 . ILE A  1 836  ? 241.028 208.454 175.764 1.00 41.93  ? 805  ILE A CG1 1 
ATOM   5989  C CG2 . ILE A  1 836  ? 241.348 210.143 177.548 1.00 41.93  ? 805  ILE A CG2 1 
ATOM   5990  C CD1 . ILE A  1 836  ? 239.771 209.072 175.242 1.00 41.93  ? 805  ILE A CD1 1 
ATOM   5991  N N   . LEU A  1 837  ? 243.174 205.701 176.947 1.00 47.53  ? 806  LEU A N   1 
ATOM   5992  C CA  . LEU A  1 837  ? 243.124 204.246 176.938 1.00 47.53  ? 806  LEU A CA  1 
ATOM   5993  C C   . LEU A  1 837  ? 244.028 203.664 178.022 1.00 47.53  ? 806  LEU A C   1 
ATOM   5994  O O   . LEU A  1 837  ? 245.036 204.273 178.389 1.00 47.53  ? 806  LEU A O   1 
ATOM   5995  C CB  . LEU A  1 837  ? 243.539 203.705 175.574 1.00 47.53  ? 806  LEU A CB  1 
ATOM   5996  C CG  . LEU A  1 837  ? 242.535 203.857 174.434 1.00 47.53  ? 806  LEU A CG  1 
ATOM   5997  C CD1 . LEU A  1 837  ? 243.034 203.147 173.192 1.00 47.53  ? 806  LEU A CD1 1 
ATOM   5998  C CD2 . LEU A  1 837  ? 241.183 203.318 174.847 1.00 47.53  ? 806  LEU A CD2 1 
ATOM   5999  N N   . PRO A  1 838  ? 243.685 202.489 178.553 1.00 55.19  ? 807  PRO A N   1 
ATOM   6000  C CA  . PRO A  1 838  ? 244.443 201.935 179.683 1.00 55.19  ? 807  PRO A CA  1 
ATOM   6001  C C   . PRO A  1 838  ? 245.893 201.634 179.342 1.00 55.19  ? 807  PRO A C   1 
ATOM   6002  O O   . PRO A  1 838  ? 246.206 201.106 178.273 1.00 55.19  ? 807  PRO A O   1 
ATOM   6003  C CB  . PRO A  1 838  ? 243.680 200.650 180.022 1.00 55.19  ? 807  PRO A CB  1 
ATOM   6004  C CG  . PRO A  1 838  ? 242.350 200.824 179.425 1.00 55.19  ? 807  PRO A CG  1 
ATOM   6005  C CD  . PRO A  1 838  ? 242.545 201.635 178.196 1.00 55.19  ? 807  PRO A CD  1 
ATOM   6006  N N   . ASP A  1 839  ? 246.777 201.994 180.267 1.00 67.05  ? 808  ASP A N   1 
ATOM   6007  C CA  . ASP A  1 839  ? 248.194 201.654 180.173 1.00 67.05  ? 808  ASP A CA  1 
ATOM   6008  C C   . ASP A  1 839  ? 248.417 200.212 180.609 1.00 67.05  ? 808  ASP A C   1 
ATOM   6009  O O   . ASP A  1 839  ? 248.168 199.885 181.776 1.00 67.05  ? 808  ASP A O   1 
ATOM   6010  C CB  . ASP A  1 839  ? 249.031 202.583 181.037 1.00 67.05  ? 808  ASP A CB  1 
ATOM   6011  C CG  . ASP A  1 839  ? 248.923 204.022 180.611 1.00 67.05  ? 808  ASP A CG  1 
ATOM   6012  O OD1 . ASP A  1 839  ? 247.931 204.364 179.937 1.00 67.05  ? 808  ASP A OD1 1 
ATOM   6013  O OD2 . ASP A  1 839  ? 249.826 204.813 180.955 1.00 67.05  ? 808  ASP A OD2 1 
ATOM   6014  N N   . PRO A  1 840  ? 248.879 199.326 179.726 1.00 73.44  ? 809  PRO A N   1 
ATOM   6015  C CA  . PRO A  1 840  ? 248.978 197.903 180.067 1.00 73.44  ? 809  PRO A CA  1 
ATOM   6016  C C   . PRO A  1 840  ? 250.205 197.534 180.885 1.00 73.44  ? 809  PRO A C   1 
ATOM   6017  O O   . PRO A  1 840  ? 250.515 196.344 180.992 1.00 73.44  ? 809  PRO A O   1 
ATOM   6018  C CB  . PRO A  1 840  ? 249.026 197.220 178.687 1.00 73.44  ? 809  PRO A CB  1 
ATOM   6019  C CG  . PRO A  1 840  ? 248.874 198.323 177.656 1.00 73.44  ? 809  PRO A CG  1 
ATOM   6020  C CD  . PRO A  1 840  ? 249.265 199.585 178.332 1.00 73.44  ? 809  PRO A CD  1 
ATOM   6021  N N   . SER A  1 841  ? 250.908 198.506 181.465 1.00 79.97  ? 810  SER A N   1 
ATOM   6022  C CA  . SER A  1 841  ? 252.135 198.251 182.207 1.00 79.97  ? 810  SER A CA  1 
ATOM   6023  C C   . SER A  1 841  ? 252.059 198.612 183.682 1.00 79.97  ? 810  SER A C   1 
ATOM   6024  O O   . SER A  1 841  ? 252.767 197.999 184.483 1.00 79.97  ? 810  SER A O   1 
ATOM   6025  C CB  . SER A  1 841  ? 253.308 199.019 181.579 1.00 79.97  ? 810  SER A CB  1 
ATOM   6026  O OG  . SER A  1 841  ? 253.060 200.414 181.575 1.00 79.97  ? 810  SER A OG  1 
ATOM   6027  N N   . LYS A  1 842  ? 251.232 199.579 184.065 1.00 82.22  ? 811  LYS A N   1 
ATOM   6028  C CA  . LYS A  1 842  ? 251.062 199.891 185.472 1.00 82.22  ? 811  LYS A CA  1 
ATOM   6029  C C   . LYS A  1 842  ? 250.296 198.774 186.175 1.00 82.22  ? 811  LYS A C   1 
ATOM   6030  O O   . LYS A  1 842  ? 249.565 198.014 185.536 1.00 82.22  ? 811  LYS A O   1 
ATOM   6031  C CB  . LYS A  1 842  ? 250.313 201.212 185.634 1.00 82.22  ? 811  LYS A CB  1 
ATOM   6032  C CG  . LYS A  1 842  ? 251.016 202.408 185.029 1.00 82.22  ? 811  LYS A CG  1 
ATOM   6033  C CD  . LYS A  1 842  ? 252.337 202.679 185.728 1.00 82.22  ? 811  LYS A CD  1 
ATOM   6034  C CE  . LYS A  1 842  ? 253.009 203.923 185.171 1.00 82.22  ? 811  LYS A CE  1 
ATOM   6035  N NZ  . LYS A  1 842  ? 254.317 204.188 185.830 1.00 82.22  ? 811  LYS A NZ  1 
ATOM   6036  N N   . PRO A  1 843  ? 250.471 198.637 187.499 1.00 81.11  ? 812  PRO A N   1 
ATOM   6037  C CA  . PRO A  1 843  ? 249.736 197.598 188.233 1.00 81.11  ? 812  PRO A CA  1 
ATOM   6038  C C   . PRO A  1 843  ? 248.238 197.767 188.054 1.00 81.11  ? 812  PRO A C   1 
ATOM   6039  O O   . PRO A  1 843  ? 247.553 196.870 187.553 1.00 81.11  ? 812  PRO A O   1 
ATOM   6040  C CB  . PRO A  1 843  ? 250.167 197.818 189.687 1.00 81.11  ? 812  PRO A CB  1 
ATOM   6041  C CG  . PRO A  1 843  ? 251.501 198.474 189.583 1.00 81.11  ? 812  PRO A CG  1 
ATOM   6042  C CD  . PRO A  1 843  ? 251.430 199.347 188.363 1.00 81.11  ? 812  PRO A CD  1 
ATOM   6043  N N   . SER A  1 844  ? 247.725 198.923 188.466 1.00 73.11  ? 813  SER A N   1 
ATOM   6044  C CA  . SER A  1 844  ? 246.368 199.304 188.113 1.00 73.11  ? 813  SER A CA  1 
ATOM   6045  C C   . SER A  1 844  ? 246.305 199.619 186.625 1.00 73.11  ? 813  SER A C   1 
ATOM   6046  O O   . SER A  1 844  ? 247.094 200.420 186.116 1.00 73.11  ? 813  SER A O   1 
ATOM   6047  C CB  . SER A  1 844  ? 245.931 200.513 188.932 1.00 73.11  ? 813  SER A CB  1 
ATOM   6048  O OG  . SER A  1 844  ? 246.818 201.600 188.726 1.00 73.11  ? 813  SER A OG  1 
ATOM   6049  N N   . LYS A  1 845  ? 245.369 198.984 185.923 1.00 68.82  ? 814  LYS A N   1 
ATOM   6050  C CA  . LYS A  1 845  ? 245.181 199.215 184.492 1.00 68.82  ? 814  LYS A CA  1 
ATOM   6051  C C   . LYS A  1 845  ? 244.373 200.497 184.284 1.00 68.82  ? 814  LYS A C   1 
ATOM   6052  O O   . LYS A  1 845  ? 243.237 200.496 183.805 1.00 68.82  ? 814  LYS A O   1 
ATOM   6053  C CB  . LYS A  1 845  ? 244.515 198.012 183.843 1.00 68.82  ? 814  LYS A CB  1 
ATOM   6054  C CG  . LYS A  1 845  ? 245.383 196.766 183.831 1.00 68.82  ? 814  LYS A CG  1 
ATOM   6055  C CD  . LYS A  1 845  ? 244.656 195.594 183.194 1.00 68.82  ? 814  LYS A CD  1 
ATOM   6056  C CE  . LYS A  1 845  ? 245.530 194.353 183.159 1.00 68.82  ? 814  LYS A CE  1 
ATOM   6057  N NZ  . LYS A  1 845  ? 244.818 193.193 182.558 1.00 68.82  ? 814  LYS A NZ  1 
ATOM   6058  N N   . ARG A  1 846  ? 244.991 201.615 184.647 1.00 54.31  ? 815  ARG A N   1 
ATOM   6059  C CA  . ARG A  1 846  ? 244.359 202.917 184.536 1.00 54.31  ? 815  ARG A CA  1 
ATOM   6060  C C   . ARG A  1 846  ? 245.029 203.731 183.441 1.00 54.31  ? 815  ARG A C   1 
ATOM   6061  O O   . ARG A  1 846  ? 246.228 203.601 183.190 1.00 54.31  ? 815  ARG A O   1 
ATOM   6062  C CB  . ARG A  1 846  ? 244.438 203.691 185.852 1.00 54.31  ? 815  ARG A CB  1 
ATOM   6063  C CG  . ARG A  1 846  ? 243.385 203.320 186.861 1.00 54.31  ? 815  ARG A CG  1 
ATOM   6064  C CD  . ARG A  1 846  ? 243.187 204.441 187.858 1.00 54.31  ? 815  ARG A CD  1 
ATOM   6065  N NE  . ARG A  1 846  ? 244.347 204.635 188.720 1.00 54.31  ? 815  ARG A NE  1 
ATOM   6066  C CZ  . ARG A  1 846  ? 244.409 204.243 189.987 1.00 54.31  ? 815  ARG A CZ  1 
ATOM   6067  N NH1 . ARG A  1 846  ? 243.371 203.641 190.548 1.00 54.31  ? 815  ARG A NH1 1 
ATOM   6068  N NH2 . ARG A  1 846  ? 245.507 204.461 190.694 1.00 54.31  ? 815  ARG A NH2 1 
ATOM   6069  N N   . SER A  1 847  ? 244.237 204.584 182.802 1.00 47.24  ? 816  SER A N   1 
ATOM   6070  C CA  . SER A  1 847  ? 244.753 205.520 181.825 1.00 47.24  ? 816  SER A CA  1 
ATOM   6071  C C   . SER A  1 847  ? 245.611 206.581 182.510 1.00 47.24  ? 816  SER A C   1 
ATOM   6072  O O   . SER A  1 847  ? 245.653 206.694 183.735 1.00 47.24  ? 816  SER A O   1 
ATOM   6073  C CB  . SER A  1 847  ? 243.605 206.160 181.052 1.00 47.24  ? 816  SER A CB  1 
ATOM   6074  O OG  . SER A  1 847  ? 242.953 207.147 181.827 1.00 47.24  ? 816  SER A OG  1 
ATOM   6075  N N   . PHE A  1 848  ? 246.331 207.346 181.693 1.00 46.91  ? 817  PHE A N   1 
ATOM   6076  C CA  . PHE A  1 848  ? 247.183 208.408 182.217 1.00 46.91  ? 817  PHE A CA  1 
ATOM   6077  C C   . PHE A  1 848  ? 246.366 209.475 182.945 1.00 46.91  ? 817  PHE A C   1 
ATOM   6078  O O   . PHE A  1 848  ? 246.727 209.908 184.049 1.00 46.91  ? 817  PHE A O   1 
ATOM   6079  C CB  . PHE A  1 848  ? 247.977 209.002 181.054 1.00 46.91  ? 817  PHE A CB  1 
ATOM   6080  C CG  . PHE A  1 848  ? 248.942 210.079 181.442 1.00 46.91  ? 817  PHE A CG  1 
ATOM   6081  C CD1 . PHE A  1 848  ? 250.222 209.760 181.849 1.00 46.91  ? 817  PHE A CD1 1 
ATOM   6082  C CD2 . PHE A  1 848  ? 248.589 211.409 181.354 1.00 46.91  ? 817  PHE A CD2 1 
ATOM   6083  C CE1 . PHE A  1 848  ? 251.117 210.746 182.192 1.00 46.91  ? 817  PHE A CE1 1 
ATOM   6084  C CE2 . PHE A  1 848  ? 249.481 212.396 181.697 1.00 46.91  ? 817  PHE A CE2 1 
ATOM   6085  C CZ  . PHE A  1 848  ? 250.745 212.065 182.116 1.00 46.91  ? 817  PHE A CZ  1 
ATOM   6086  N N   . ILE A  1 849  ? 245.244 209.889 182.353 1.00 43.91  ? 818  ILE A N   1 
ATOM   6087  C CA  . ILE A  1 849  ? 244.394 210.912 182.955 1.00 43.91  ? 818  ILE A CA  1 
ATOM   6088  C C   . ILE A  1 849  ? 243.744 210.401 184.238 1.00 43.91  ? 818  ILE A C   1 
ATOM   6089  O O   . ILE A  1 849  ? 243.592 211.152 185.207 1.00 43.91  ? 818  ILE A O   1 
ATOM   6090  C CB  . ILE A  1 849  ? 243.362 211.413 181.931 1.00 43.91  ? 818  ILE A CB  1 
ATOM   6091  C CG1 . ILE A  1 849  ? 244.059 212.288 180.893 1.00 43.91  ? 818  ILE A CG1 1 
ATOM   6092  C CG2 . ILE A  1 849  ? 242.273 212.218 182.604 1.00 43.91  ? 818  ILE A CG2 1 
ATOM   6093  C CD1 . ILE A  1 849  ? 243.133 212.881 179.881 1.00 43.91  ? 818  ILE A CD1 1 
ATOM   6094  N N   . GLU A  1 850  ? 243.342 209.129 184.270 1.00 44.08  ? 819  GLU A N   1 
ATOM   6095  C CA  . GLU A  1 850  ? 242.777 208.581 185.500 1.00 44.08  ? 819  GLU A CA  1 
ATOM   6096  C C   . GLU A  1 850  ? 243.812 208.571 186.618 1.00 44.08  ? 819  GLU A C   1 
ATOM   6097  O O   . GLU A  1 850  ? 243.484 208.843 187.778 1.00 44.08  ? 819  GLU A O   1 
ATOM   6098  C CB  . GLU A  1 850  ? 242.233 207.172 185.271 1.00 44.08  ? 819  GLU A CB  1 
ATOM   6099  C CG  . GLU A  1 850  ? 240.881 207.105 184.582 1.00 44.08  ? 819  GLU A CG  1 
ATOM   6100  C CD  . GLU A  1 850  ? 240.479 205.684 184.217 1.00 44.08  ? 819  GLU A CD  1 
ATOM   6101  O OE1 . GLU A  1 850  ? 241.342 204.791 184.261 1.00 44.08  ? 819  GLU A OE1 1 
ATOM   6102  O OE2 . GLU A  1 850  ? 239.299 205.450 183.898 1.00 44.08  ? 819  GLU A OE2 1 
ATOM   6103  N N   . ASP A  1 851  ? 245.066 208.252 186.291 1.00 49.09  ? 820  ASP A N   1 
ATOM   6104  C CA  . ASP A  1 851  ? 246.134 208.321 187.282 1.00 49.09  ? 820  ASP A CA  1 
ATOM   6105  C C   . ASP A  1 851  ? 246.332 209.740 187.792 1.00 49.09  ? 820  ASP A C   1 
ATOM   6106  O O   . ASP A  1 851  ? 246.562 209.947 188.987 1.00 49.09  ? 820  ASP A O   1 
ATOM   6107  C CB  . ASP A  1 851  ? 247.441 207.793 186.697 1.00 49.09  ? 820  ASP A CB  1 
ATOM   6108  C CG  . ASP A  1 851  ? 247.489 206.290 186.647 1.00 49.09  ? 820  ASP A CG  1 
ATOM   6109  O OD1 . ASP A  1 851  ? 246.784 205.653 187.455 1.00 49.09  ? 820  ASP A OD1 1 
ATOM   6110  O OD2 . ASP A  1 851  ? 248.245 205.741 185.818 1.00 49.09  ? 820  ASP A OD2 1 
ATOM   6111  N N   . LEU A  1 852  ? 246.255 210.733 186.905 1.00 46.83  ? 821  LEU A N   1 
ATOM   6112  C CA  . LEU A  1 852  ? 246.352 212.117 187.365 1.00 46.83  ? 821  LEU A CA  1 
ATOM   6113  C C   . LEU A  1 852  ? 245.192 212.487 188.278 1.00 46.83  ? 821  LEU A C   1 
ATOM   6114  O O   . LEU A  1 852  ? 245.377 213.201 189.268 1.00 46.83  ? 821  LEU A O   1 
ATOM   6115  C CB  . LEU A  1 852  ? 246.406 213.068 186.173 1.00 46.83  ? 821  LEU A CB  1 
ATOM   6116  C CG  . LEU A  1 852  ? 247.777 213.523 185.687 1.00 46.83  ? 821  LEU A CG  1 
ATOM   6117  C CD1 . LEU A  1 852  ? 248.631 212.341 185.290 1.00 46.83  ? 821  LEU A CD1 1 
ATOM   6118  C CD2 . LEU A  1 852  ? 247.600 214.469 184.522 1.00 46.83  ? 821  LEU A CD2 1 
ATOM   6119  N N   . LEU A  1 853  ? 243.982 212.046 187.940 1.00 44.24  ? 822  LEU A N   1 
ATOM   6120  C CA  . LEU A  1 853  ? 242.811 212.386 188.745 1.00 44.24  ? 822  LEU A CA  1 
ATOM   6121  C C   . LEU A  1 853  ? 242.861 211.737 190.120 1.00 44.24  ? 822  LEU A C   1 
ATOM   6122  O O   . LEU A  1 853  ? 242.498 212.360 191.122 1.00 44.24  ? 822  LEU A O   1 
ATOM   6123  C CB  . LEU A  1 853  ? 241.535 211.962 188.021 1.00 44.24  ? 822  LEU A CB  1 
ATOM   6124  C CG  . LEU A  1 853  ? 241.100 212.772 186.807 1.00 44.24  ? 822  LEU A CG  1 
ATOM   6125  C CD1 . LEU A  1 853  ? 239.930 212.092 186.131 1.00 44.24  ? 822  LEU A CD1 1 
ATOM   6126  C CD2 . LEU A  1 853  ? 240.730 214.171 187.231 1.00 44.24  ? 822  LEU A CD2 1 
ATOM   6127  N N   . PHE A  1 854  ? 243.305 210.485 190.185 1.00 45.69  ? 823  PHE A N   1 
ATOM   6128  C CA  A PHE A  1 854  ? 243.333 209.791 191.464 0.50 45.69  ? 823  PHE A CA  1 
ATOM   6129  C CA  B PHE A  1 854  ? 243.387 209.741 191.437 0.50 45.69  ? 823  PHE A CA  1 
ATOM   6130  C C   . PHE A  1 854  ? 244.366 210.348 192.430 1.00 45.69  ? 823  PHE A C   1 
ATOM   6131  O O   . PHE A  1 854  ? 244.259 210.089 193.631 1.00 45.69  ? 823  PHE A O   1 
ATOM   6132  C CB  A PHE A  1 854  ? 243.557 208.299 191.244 0.50 45.69  ? 823  PHE A CB  1 
ATOM   6133  C CB  B PHE A  1 854  ? 243.795 208.302 191.136 0.50 45.69  ? 823  PHE A CB  1 
ATOM   6134  C CG  A PHE A  1 854  ? 242.281 207.518 191.150 0.50 45.69  ? 823  PHE A CG  1 
ATOM   6135  C CG  B PHE A  1 854  ? 243.282 207.304 192.120 0.50 45.69  ? 823  PHE A CG  1 
ATOM   6136  C CD1 A PHE A  1 854  ? 241.726 206.937 192.274 0.50 45.69  ? 823  PHE A CD1 1 
ATOM   6137  C CD1 B PHE A  1 854  ? 241.938 206.973 192.148 0.50 45.69  ? 823  PHE A CD1 1 
ATOM   6138  C CD2 A PHE A  1 854  ? 241.620 207.391 189.942 0.50 45.69  ? 823  PHE A CD2 1 
ATOM   6139  C CD2 B PHE A  1 854  ? 244.141 206.687 193.014 0.50 45.69  ? 823  PHE A CD2 1 
ATOM   6140  C CE1 A PHE A  1 854  ? 240.547 206.231 192.191 0.50 45.69  ? 823  PHE A CE1 1 
ATOM   6141  C CE1 B PHE A  1 854  ? 241.460 206.047 193.050 0.50 45.69  ? 823  PHE A CE1 1 
ATOM   6142  C CE2 A PHE A  1 854  ? 240.443 206.685 189.854 0.50 45.69  ? 823  PHE A CE2 1 
ATOM   6143  C CE2 B PHE A  1 854  ? 243.669 205.761 193.922 0.50 45.69  ? 823  PHE A CE2 1 
ATOM   6144  C CZ  A PHE A  1 854  ? 239.905 206.104 190.981 0.50 45.69  ? 823  PHE A CZ  1 
ATOM   6145  C CZ  B PHE A  1 854  ? 242.328 205.440 193.941 0.50 45.69  ? 823  PHE A CZ  1 
ATOM   6146  N N   . ASN A  1 855  ? 245.336 211.117 191.958 1.00 49.74  ? 824  ASN A N   1 
ATOM   6147  C CA  . ASN A  1 855  ? 246.313 211.728 192.847 1.00 49.74  ? 824  ASN A CA  1 
ATOM   6148  C C   . ASN A  1 855  ? 245.912 213.121 193.313 1.00 49.74  ? 824  ASN A C   1 
ATOM   6149  O O   . ASN A  1 855  ? 246.691 213.766 194.019 1.00 49.74  ? 824  ASN A O   1 
ATOM   6150  C CB  . ASN A  1 855  ? 247.677 211.790 192.162 1.00 49.74  ? 824  ASN A CB  1 
ATOM   6151  C CG  . ASN A  1 855  ? 248.418 210.477 192.235 1.00 49.74  ? 824  ASN A CG  1 
ATOM   6152  O OD1 . ASN A  1 855  ? 247.987 209.476 191.671 1.00 49.74  ? 824  ASN A OD1 1 
ATOM   6153  N ND2 . ASN A  1 855  ? 249.538 210.471 192.942 1.00 49.74  ? 824  ASN A ND2 1 
ATOM   6154  N N   . LYS A  1 856  ? 244.728 213.602 192.942 1.00 52.08  ? 825  LYS A N   1 
ATOM   6155  C CA  . LYS A  1 856  ? 244.268 214.913 193.365 1.00 52.08  ? 825  LYS A CA  1 
ATOM   6156  C C   . LYS A  1 856  ? 243.197 214.870 194.444 1.00 52.08  ? 825  LYS A C   1 
ATOM   6157  O O   . LYS A  1 856  ? 242.830 215.927 194.965 1.00 52.08  ? 825  LYS A O   1 
ATOM   6158  C CB  . LYS A  1 856  ? 243.734 215.697 192.161 1.00 52.08  ? 825  LYS A CB  1 
ATOM   6159  C CG  . LYS A  1 856  ? 244.787 215.987 191.114 1.00 52.08  ? 825  LYS A CG  1 
ATOM   6160  C CD  . LYS A  1 856  ? 244.233 216.858 190.010 1.00 52.08  ? 825  LYS A CD  1 
ATOM   6161  C CE  . LYS A  1 856  ? 243.996 218.270 190.500 1.00 52.08  ? 825  LYS A CE  1 
ATOM   6162  N NZ  . LYS A  1 856  ? 245.275 218.950 190.829 1.00 52.08  ? 825  LYS A NZ  1 
ATOM   6163  N N   . VAL A  1 857  ? 242.685 213.694 194.791 1.00 52.33  ? 826  VAL A N   1 
ATOM   6164  C CA  . VAL A  1 857  ? 241.765 213.529 195.910 1.00 52.33  ? 826  VAL A CA  1 
ATOM   6165  C C   . VAL A  1 857  ? 242.422 212.595 196.914 1.00 52.33  ? 826  VAL A C   1 
ATOM   6166  O O   . VAL A  1 857  ? 242.793 211.466 196.569 1.00 52.33  ? 826  VAL A O   1 
ATOM   6167  C CB  . VAL A  1 857  ? 240.402 212.990 195.456 1.00 52.33  ? 826  VAL A CB  1 
ATOM   6168  C CG1 . VAL A  1 857  ? 239.492 212.792 196.644 1.00 52.33  ? 826  VAL A CG1 1 
ATOM   6169  C CG2 . VAL A  1 857  ? 239.770 213.940 194.471 1.00 52.33  ? 826  VAL A CG2 1 
ATOM   6170  N N   . THR A  1 858  ? 242.572 213.065 198.150 1.00 58.25  ? 827  THR A N   1 
ATOM   6171  C CA  . THR A  1 858  ? 243.246 212.322 199.210 1.00 58.25  ? 827  THR A CA  1 
ATOM   6172  C C   . THR A  1 858  ? 242.213 211.718 200.157 1.00 58.25  ? 827  THR A C   1 
ATOM   6173  O O   . THR A  1 858  ? 241.566 212.442 200.920 1.00 58.25  ? 827  THR A O   1 
ATOM   6174  C CB  . THR A  1 858  ? 244.213 213.224 199.972 1.00 58.25  ? 827  THR A CB  1 
ATOM   6175  O OG1 . THR A  1 858  ? 243.496 214.326 200.538 1.00 58.25  ? 827  THR A OG1 1 
ATOM   6176  C CG2 . THR A  1 858  ? 245.280 213.760 199.037 1.00 58.25  ? 827  THR A CG2 1 
ATOM   6177  N N   . LEU A  1 859  ? 242.056 210.398 200.106 1.00 65.27  ? 828  LEU A N   1 
ATOM   6178  C CA  . LEU A  1 859  ? 241.123 209.722 200.996 1.00 65.27  ? 828  LEU A CA  1 
ATOM   6179  C C   . LEU A  1 859  ? 241.594 209.835 202.442 1.00 65.27  ? 828  LEU A C   1 
ATOM   6180  O O   . LEU A  1 859  ? 242.792 209.904 202.726 1.00 65.27  ? 828  LEU A O   1 
ATOM   6181  C CB  . LEU A  1 859  ? 240.965 208.253 200.603 1.00 65.27  ? 828  LEU A CB  1 
ATOM   6182  C CG  . LEU A  1 859  ? 239.873 207.890 199.590 1.00 65.27  ? 828  LEU A CG  1 
ATOM   6183  C CD1 . LEU A  1 859  ? 238.499 208.190 200.156 1.00 65.27  ? 828  LEU A CD1 1 
ATOM   6184  C CD2 . LEU A  1 859  ? 240.068 208.618 198.271 1.00 65.27  ? 828  LEU A CD2 1 
ATOM   6185  N N   . ALA A  1 860  ? 240.627 209.863 203.363 1.00 70.92  ? 829  ALA A N   1 
ATOM   6186  C CA  . ALA A  1 860  ? 240.950 209.978 204.783 1.00 70.92  ? 829  ALA A CA  1 
ATOM   6187  C C   . ALA A  1 860  ? 241.783 208.802 205.281 1.00 70.92  ? 829  ALA A C   1 
ATOM   6188  O O   . ALA A  1 860  ? 242.739 208.992 206.041 1.00 70.92  ? 829  ALA A O   1 
ATOM   6189  C CB  . ALA A  1 860  ? 239.666 210.108 205.600 1.00 70.92  ? 829  ALA A CB  1 
ATOM   6190  N N   . ASP A  1 861  ? 241.441 207.582 204.873 1.00 77.01  ? 830  ASP A N   1 
ATOM   6191  C CA  . ASP A  1 861  ? 242.215 206.409 205.261 1.00 77.01  ? 830  ASP A CA  1 
ATOM   6192  C C   . ASP A  1 861  ? 242.366 205.471 204.075 1.00 77.01  ? 830  ASP A C   1 
ATOM   6193  O O   . ASP A  1 861  ? 241.382 205.156 203.400 1.00 77.01  ? 830  ASP A O   1 
ATOM   6194  C CB  . ASP A  1 861  ? 241.557 205.671 206.433 1.00 77.01  ? 830  ASP A CB  1 
ATOM   6195  C CG  . ASP A  1 861  ? 242.361 204.465 206.891 1.00 77.01  ? 830  ASP A CG  1 
ATOM   6196  O OD1 . ASP A  1 861  ? 243.575 204.409 206.599 1.00 77.01  ? 830  ASP A OD1 1 
ATOM   6197  O OD2 . ASP A  1 861  ? 241.780 203.571 207.542 1.00 77.01  ? 830  ASP A OD2 1 
ATOM   6198  N N   . ALA A  1 862  ? 243.595 205.022 203.834 1.00 77.95  ? 831  ALA A N   1 
ATOM   6199  C CA  . ALA A  1 862  ? 243.888 204.041 202.798 1.00 77.95  ? 831  ALA A CA  1 
ATOM   6200  C C   . ALA A  1 862  ? 243.914 202.652 203.426 1.00 77.95  ? 831  ALA A C   1 
ATOM   6201  O O   . ALA A  1 862  ? 244.740 202.378 204.303 1.00 77.95  ? 831  ALA A O   1 
ATOM   6202  C CB  . ALA A  1 862  ? 245.219 204.350 202.114 1.00 77.95  ? 831  ALA A CB  1 
ATOM   6203  N N   . GLY A  1 863  ? 243.012 201.789 202.980 1.00 71.68  ? 832  GLY A N   1 
ATOM   6204  C CA  . GLY A  1 863  ? 242.859 200.461 203.534 1.00 71.68  ? 832  GLY A CA  1 
ATOM   6205  C C   . GLY A  1 863  ? 241.818 200.415 204.639 1.00 71.68  ? 832  GLY A C   1 
ATOM   6206  O O   . GLY A  1 863  ? 241.521 201.408 205.301 1.00 71.68  ? 832  GLY A O   1 
ATOM   6207  N N   . PHE A  1 864  ? 241.255 199.224 204.837 1.00 60.13  ? 833  PHE A N   1 
ATOM   6208  C CA  . PHE A  1 864  ? 240.221 199.019 205.845 1.00 60.13  ? 833  PHE A CA  1 
ATOM   6209  C C   . PHE A  1 864  ? 240.594 197.988 206.904 1.00 60.13  ? 833  PHE A C   1 
ATOM   6210  O O   . PHE A  1 864  ? 239.712 197.536 207.643 1.00 60.13  ? 833  PHE A O   1 
ATOM   6211  C CB  . PHE A  1 864  ? 238.902 198.635 205.174 1.00 60.13  ? 833  PHE A CB  1 
ATOM   6212  C CG  . PHE A  1 864  ? 238.316 199.730 204.334 1.00 60.13  ? 833  PHE A CG  1 
ATOM   6213  C CD1 . PHE A  1 864  ? 238.630 199.835 202.990 1.00 60.13  ? 833  PHE A CD1 1 
ATOM   6214  C CD2 . PHE A  1 864  ? 237.476 200.675 204.893 1.00 60.13  ? 833  PHE A CD2 1 
ATOM   6215  C CE1 . PHE A  1 864  ? 238.098 200.847 202.215 1.00 60.13  ? 833  PHE A CE1 1 
ATOM   6216  C CE2 . PHE A  1 864  ? 236.945 201.688 204.124 1.00 60.13  ? 833  PHE A CE2 1 
ATOM   6217  C CZ  . PHE A  1 864  ? 237.255 201.774 202.784 1.00 60.13  ? 833  PHE A CZ  1 
ATOM   6218  N N   . ILE A  1 865  ? 241.862 197.611 207.012 1.00 59.16  ? 834  ILE A N   1 
ATOM   6219  C CA  . ILE A  1 865  ? 242.328 196.695 208.053 1.00 59.16  ? 834  ILE A CA  1 
ATOM   6220  C C   . ILE A  1 865  ? 243.304 197.462 208.935 1.00 59.16  ? 834  ILE A C   1 
ATOM   6221  O O   . ILE A  1 865  ? 244.495 197.572 208.634 1.00 59.16  ? 834  ILE A O   1 
ATOM   6222  C CB  . ILE A  1 865  ? 242.975 195.430 207.488 1.00 59.16  ? 834  ILE A CB  1 
ATOM   6223  C CG1 . ILE A  1 865  ? 242.140 194.848 206.353 1.00 59.16  ? 834  ILE A CG1 1 
ATOM   6224  C CG2 . ILE A  1 865  ? 243.146 194.405 208.584 1.00 59.16  ? 834  ILE A CG2 1 
ATOM   6225  C CD1 . ILE A  1 865  ? 240.855 194.231 206.809 1.00 59.16  ? 834  ILE A CD1 1 
ATOM   6226  N N   . LYS A  1 866  ? 242.794 198.006 210.035 1.00 60.52  ? 835  LYS A N   1 
ATOM   6227  C CA  . LYS A  1 866  ? 243.611 198.605 211.084 1.00 60.52  ? 835  LYS A CA  1 
ATOM   6228  C C   . LYS A  1 866  ? 243.502 197.683 212.289 1.00 60.52  ? 835  LYS A C   1 
ATOM   6229  O O   . LYS A  1 866  ? 242.442 197.594 212.914 1.00 60.52  ? 835  LYS A O   1 
ATOM   6230  C CB  . LYS A  1 866  ? 243.140 200.019 211.412 1.00 60.52  ? 835  LYS A CB  1 
ATOM   6231  C CG  . LYS A  1 866  ? 244.082 200.790 212.314 1.00 60.52  ? 835  LYS A CG  1 
ATOM   6232  C CD  . LYS A  1 866  ? 243.718 202.255 212.366 1.00 60.52  ? 835  LYS A CD  1 
ATOM   6233  C CE  . LYS A  1 866  ? 243.810 202.891 210.997 1.00 60.52  ? 835  LYS A CE  1 
ATOM   6234  N NZ  . LYS A  1 866  ? 245.189 202.782 210.449 1.00 60.52  ? 835  LYS A NZ  1 
ATOM   6235  N N   . GLN A  1 867  ? 244.595 197.004 212.611 1.00 59.53  ? 836  GLN A N   1 
ATOM   6236  C CA  . GLN A  1 867  ? 244.568 195.980 213.638 1.00 59.53  ? 836  GLN A CA  1 
ATOM   6237  C C   . GLN A  1 867  ? 244.675 196.594 215.028 1.00 59.53  ? 836  GLN A C   1 
ATOM   6238  O O   . GLN A  1 867  ? 245.137 197.721 215.207 1.00 59.53  ? 836  GLN A O   1 
ATOM   6239  C CB  . GLN A  1 867  ? 245.682 194.965 213.398 1.00 59.53  ? 836  GLN A CB  1 
ATOM   6240  C CG  . GLN A  1 867  ? 245.498 194.192 212.106 1.00 59.53  ? 836  GLN A CG  1 
ATOM   6241  C CD  . GLN A  1 867  ? 246.491 193.072 211.942 1.00 59.53  ? 836  GLN A CD  1 
ATOM   6242  O OE1 . GLN A  1 867  ? 246.262 191.956 212.396 1.00 59.53  ? 836  GLN A OE1 1 
ATOM   6243  N NE2 . GLN A  1 867  ? 247.603 193.361 211.286 1.00 59.53  ? 836  GLN A NE2 1 
ATOM   6244  N N   . TYR A  1 868  ? 244.220 195.827 216.021 1.00 57.51  ? 837  TYR A N   1 
ATOM   6245  C CA  . TYR A  1 868  ? 244.251 196.287 217.406 1.00 57.51  ? 837  TYR A CA  1 
ATOM   6246  C C   . TYR A  1 868  ? 245.678 196.534 217.872 1.00 57.51  ? 837  TYR A C   1 
ATOM   6247  O O   . TYR A  1 868  ? 245.954 197.526 218.554 1.00 57.51  ? 837  TYR A O   1 
ATOM   6248  C CB  . TYR A  1 868  ? 243.566 195.261 218.304 1.00 57.51  ? 837  TYR A CB  1 
ATOM   6249  C CG  . TYR A  1 868  ? 243.614 195.569 219.782 1.00 57.51  ? 837  TYR A CG  1 
ATOM   6250  C CD1 . TYR A  1 868  ? 244.374 194.803 220.648 1.00 57.51  ? 837  TYR A CD1 1 
ATOM   6251  C CD2 . TYR A  1 868  ? 242.849 196.588 220.318 1.00 57.51  ? 837  TYR A CD2 1 
ATOM   6252  C CE1 . TYR A  1 868  ? 244.400 195.071 221.997 1.00 57.51  ? 837  TYR A CE1 1 
ATOM   6253  C CE2 . TYR A  1 868  ? 242.867 196.859 221.664 1.00 57.51  ? 837  TYR A CE2 1 
ATOM   6254  C CZ  . TYR A  1 868  ? 243.643 196.098 222.498 1.00 57.51  ? 837  TYR A CZ  1 
ATOM   6255  O OH  . TYR A  1 868  ? 243.666 196.364 223.844 1.00 57.51  ? 837  TYR A OH  1 
ATOM   6256  N N   . GLY A  1 869  ? 246.598 195.640 217.519 1.00 62.47  ? 838  GLY A N   1 
ATOM   6257  C CA  . GLY A  1 869  ? 247.992 195.823 217.867 1.00 62.47  ? 838  GLY A CA  1 
ATOM   6258  C C   . GLY A  1 869  ? 248.650 197.001 217.181 1.00 62.47  ? 838  GLY A C   1 
ATOM   6259  O O   . GLY A  1 869  ? 249.687 197.477 217.653 1.00 62.47  ? 838  GLY A O   1 
ATOM   6260  N N   . ASP A  1 870  ? 248.084 197.467 216.065 1.00 67.83  ? 839  ASP A N   1 
ATOM   6261  C CA  . ASP A  1 870  ? 248.680 198.596 215.359 1.00 67.83  ? 839  ASP A CA  1 
ATOM   6262  C C   . ASP A  1 870  ? 248.597 199.880 216.173 1.00 67.83  ? 839  ASP A C   1 
ATOM   6263  O O   . ASP A  1 870  ? 249.547 200.670 216.183 1.00 67.83  ? 839  ASP A O   1 
ATOM   6264  C CB  . ASP A  1 870  ? 248.004 198.784 214.002 1.00 67.83  ? 839  ASP A CB  1 
ATOM   6265  C CG  . ASP A  1 870  ? 248.344 197.681 213.027 1.00 67.83  ? 839  ASP A CG  1 
ATOM   6266  O OD1 . ASP A  1 870  ? 249.233 196.863 213.339 1.00 67.83  ? 839  ASP A OD1 1 
ATOM   6267  O OD2 . ASP A  1 870  ? 247.735 197.639 211.940 1.00 67.83  ? 839  ASP A OD2 1 
ATOM   6268  N N   . CYS A  1 871  ? 247.479 200.122 216.851 1.00 68.99  ? 840  CYS A N   1 
ATOM   6269  C CA  . CYS A  1 871  ? 247.344 201.292 217.720 1.00 68.99  ? 840  CYS A CA  1 
ATOM   6270  C C   . CYS A  1 871  ? 247.041 200.816 219.136 1.00 68.99  ? 840  CYS A C   1 
ATOM   6271  O O   . CYS A  1 871  ? 245.883 200.638 219.520 1.00 68.99  ? 840  CYS A O   1 
ATOM   6272  C CB  . CYS A  1 871  ? 246.299 202.271 217.196 1.00 68.99  ? 840  CYS A CB  1 
ATOM   6273  S SG  . CYS A  1 871  ? 244.613 201.697 216.941 1.00 68.99  ? 840  CYS A SG  1 
ATOM   6274  N N   . LEU A  1 872  ? 248.103 200.619 219.913 1.00 67.32  ? 841  LEU A N   1 
ATOM   6275  C CA  . LEU A  1 872  ? 248.005 200.232 221.312 1.00 67.32  ? 841  LEU A CA  1 
ATOM   6276  C C   . LEU A  1 872  ? 248.886 201.158 222.136 1.00 67.32  ? 841  LEU A C   1 
ATOM   6277  O O   . LEU A  1 872  ? 250.103 201.205 221.929 1.00 67.32  ? 841  LEU A O   1 
ATOM   6278  C CB  . LEU A  1 872  ? 248.424 198.772 221.502 1.00 67.32  ? 841  LEU A CB  1 
ATOM   6279  C CG  . LEU A  1 872  ? 248.007 198.100 222.804 1.00 67.32  ? 841  LEU A CG  1 
ATOM   6280  C CD1 . LEU A  1 872  ? 246.515 198.118 222.916 1.00 67.32  ? 841  LEU A CD1 1 
ATOM   6281  C CD2 . LEU A  1 872  ? 248.515 196.681 222.848 1.00 67.32  ? 841  LEU A CD2 1 
ATOM   6282  N N   . GLY A  1 873  ? 248.272 201.895 223.058 1.00 70.84  ? 842  GLY A N   1 
ATOM   6283  C CA  . GLY A  1 873  ? 248.990 202.808 223.924 1.00 70.84  ? 842  GLY A CA  1 
ATOM   6284  C C   . GLY A  1 873  ? 248.987 204.234 223.422 1.00 70.84  ? 842  GLY A C   1 
ATOM   6285  O O   . GLY A  1 873  ? 247.938 204.879 223.376 1.00 70.84  ? 842  GLY A O   1 
ATOM   6286  N N   . ASP A  1 874  ? 250.165 204.743 223.056 1.00 76.86  ? 843  ASP A N   1 
ATOM   6287  C CA  . ASP A  1 874  ? 250.281 206.145 222.668 1.00 76.86  ? 843  ASP A CA  1 
ATOM   6288  C C   . ASP A  1 874  ? 249.504 206.420 221.389 1.00 76.86  ? 843  ASP A C   1 
ATOM   6289  O O   . ASP A  1 874  ? 248.844 207.458 221.265 1.00 76.86  ? 843  ASP A O   1 
ATOM   6290  C CB  . ASP A  1 874  ? 251.756 206.514 222.496 1.00 76.86  ? 843  ASP A CB  1 
ATOM   6291  C CG  . ASP A  1 874  ? 251.956 207.875 221.842 1.00 76.86  ? 843  ASP A CG  1 
ATOM   6292  O OD1 . ASP A  1 874  ? 251.121 208.779 222.052 1.00 76.86  ? 843  ASP A OD1 1 
ATOM   6293  O OD2 . ASP A  1 874  ? 252.955 208.038 221.111 1.00 76.86  ? 843  ASP A OD2 1 
ATOM   6294  N N   . ILE A  1 875  ? 249.589 205.501 220.426 1.00 75.26  ? 844  ILE A N   1 
ATOM   6295  C CA  . ILE A  1 875  ? 249.033 205.724 219.095 1.00 75.26  ? 844  ILE A CA  1 
ATOM   6296  C C   . ILE A  1 875  ? 247.530 205.971 219.160 1.00 75.26  ? 844  ILE A C   1 
ATOM   6297  O O   . ILE A  1 875  ? 246.988 206.783 218.402 1.00 75.26  ? 844  ILE A O   1 
ATOM   6298  C CB  . ILE A  1 875  ? 249.378 204.535 218.185 1.00 75.26  ? 844  ILE A CB  1 
ATOM   6299  C CG1 . ILE A  1 875  ? 250.871 204.226 218.295 1.00 75.26  ? 844  ILE A CG1 1 
ATOM   6300  C CG2 . ILE A  1 875  ? 249.002 204.843 216.750 1.00 75.26  ? 844  ILE A CG2 1 
ATOM   6301  C CD1 . ILE A  1 875  ? 251.277 202.915 217.676 1.00 75.26  ? 844  ILE A CD1 1 
ATOM   6302  N N   . ALA A  1 876  ? 246.834 205.270 220.051 1.00 76.64  ? 845  ALA A N   1 
ATOM   6303  C CA  . ALA A  1 876  ? 245.427 205.558 220.293 1.00 76.64  ? 845  ALA A CA  1 
ATOM   6304  C C   . ALA A  1 876  ? 245.241 206.971 220.832 1.00 76.64  ? 845  ALA A C   1 
ATOM   6305  O O   . ALA A  1 876  ? 246.099 207.509 221.538 1.00 76.64  ? 845  ALA A O   1 
ATOM   6306  C CB  . ALA A  1 876  ? 244.843 204.545 221.277 1.00 76.64  ? 845  ALA A CB  1 
ATOM   6307  N N   . ALA A  1 877  ? 244.119 207.586 220.446 1.00 75.01  ? 846  ALA A N   1 
ATOM   6308  C CA  . ALA A  1 877  ? 243.683 208.904 220.908 1.00 75.01  ? 846  ALA A CA  1 
ATOM   6309  C C   . ALA A  1 877  ? 244.509 210.021 220.278 1.00 75.01  ? 846  ALA A C   1 
ATOM   6310  O O   . ALA A  1 877  ? 244.163 211.200 220.401 1.00 75.01  ? 846  ALA A O   1 
ATOM   6311  C CB  . ALA A  1 877  ? 243.726 209.002 222.437 1.00 75.01  ? 846  ALA A CB  1 
ATOM   6312  N N   . ARG A  1 878  ? 245.592 209.658 219.594 1.00 74.29  ? 847  ARG A N   1 
ATOM   6313  C CA  . ARG A  1 878  ? 246.357 210.564 218.746 1.00 74.29  ? 847  ARG A CA  1 
ATOM   6314  C C   . ARG A  1 878  ? 245.952 210.440 217.284 1.00 74.29  ? 847  ARG A C   1 
ATOM   6315  O O   . ARG A  1 878  ? 245.670 211.445 216.626 1.00 74.29  ? 847  ARG A O   1 
ATOM   6316  C CB  . ARG A  1 878  ? 247.855 210.293 218.910 1.00 74.29  ? 847  ARG A CB  1 
ATOM   6317  C CG  . ARG A  1 878  ? 248.743 211.194 218.085 1.00 74.29  ? 847  ARG A CG  1 
ATOM   6318  C CD  . ARG A  1 878  ? 250.203 210.900 218.360 1.00 74.29  ? 847  ARG A CD  1 
ATOM   6319  N NE  . ARG A  1 878  ? 250.565 209.552 217.942 1.00 74.29  ? 847  ARG A NE  1 
ATOM   6320  C CZ  . ARG A  1 878  ? 250.881 209.219 216.697 1.00 74.29  ? 847  ARG A CZ  1 
ATOM   6321  N NH1 . ARG A  1 878  ? 250.881 210.139 215.743 1.00 74.29  ? 847  ARG A NH1 1 
ATOM   6322  N NH2 . ARG A  1 878  ? 251.199 207.966 216.404 1.00 74.29  ? 847  ARG A NH2 1 
ATOM   6323  N N   . ASP A  1 879  ? 245.936 209.220 216.762 1.00 64.66  ? 848  ASP A N   1 
ATOM   6324  C CA  . ASP A  1 879  ? 245.454 208.967 215.415 1.00 64.66  ? 848  ASP A CA  1 
ATOM   6325  C C   . ASP A  1 879  ? 243.932 208.995 215.455 1.00 64.66  ? 848  ASP A C   1 
ATOM   6326  O O   . ASP A  1 879  ? 243.319 208.384 216.335 1.00 64.66  ? 848  ASP A O   1 
ATOM   6327  C CB  . ASP A  1 879  ? 245.976 207.631 214.893 1.00 64.66  ? 848  ASP A CB  1 
ATOM   6328  C CG  . ASP A  1 879  ? 245.288 207.196 213.622 1.00 64.66  ? 848  ASP A CG  1 
ATOM   6329  O OD1 . ASP A  1 879  ? 245.182 208.023 212.693 1.00 64.66  ? 848  ASP A OD1 1 
ATOM   6330  O OD2 . ASP A  1 879  ? 244.871 206.023 213.540 1.00 64.66  ? 848  ASP A OD2 1 
ATOM   6331  N N   . LEU A  1 880  ? 243.321 209.715 214.516 1.00 53.81  ? 849  LEU A N   1 
ATOM   6332  C CA  . LEU A  1 880  ? 241.887 209.965 214.600 1.00 53.81  ? 849  LEU A CA  1 
ATOM   6333  C C   . LEU A  1 880  ? 241.061 208.727 214.263 1.00 53.81  ? 849  LEU A C   1 
ATOM   6334  O O   . LEU A  1 880  ? 239.966 208.550 214.811 1.00 53.81  ? 849  LEU A O   1 
ATOM   6335  C CB  . LEU A  1 880  ? 241.528 211.121 213.669 1.00 53.81  ? 849  LEU A CB  1 
ATOM   6336  C CG  . LEU A  1 880  ? 241.477 212.532 214.262 1.00 53.81  ? 849  LEU A CG  1 
ATOM   6337  C CD1 . LEU A  1 880  ? 242.741 212.863 215.003 1.00 53.81  ? 849  LEU A CD1 1 
ATOM   6338  C CD2 . LEU A  1 880  ? 241.272 213.540 213.153 1.00 53.81  ? 849  LEU A CD2 1 
ATOM   6339  N N   . ILE A  1 881  ? 241.565 207.853 213.392 1.00 52.61  ? 850  ILE A N   1 
ATOM   6340  C CA  . ILE A  1 881  ? 240.806 206.661 213.029 1.00 52.61  ? 850  ILE A CA  1 
ATOM   6341  C C   . ILE A  1 881  ? 240.667 205.723 214.223 1.00 52.61  ? 850  ILE A C   1 
ATOM   6342  O O   . ILE A  1 881  ? 239.592 205.168 214.468 1.00 52.61  ? 850  ILE A O   1 
ATOM   6343  C CB  . ILE A  1 881  ? 241.453 205.953 211.826 1.00 52.61  ? 850  ILE A CB  1 
ATOM   6344  C CG1 . ILE A  1 881  ? 241.625 206.926 210.667 1.00 52.61  ? 850  ILE A CG1 1 
ATOM   6345  C CG2 . ILE A  1 881  ? 240.599 204.788 211.379 1.00 52.61  ? 850  ILE A CG2 1 
ATOM   6346  C CD1 . ILE A  1 881  ? 240.331 207.500 210.167 1.00 52.61  ? 850  ILE A CD1 1 
ATOM   6347  N N   . CYS A  1 882  ? 241.745 205.521 214.980 1.00 54.90  ? 851  CYS A N   1 
ATOM   6348  C CA  . CYS A  1 882  ? 241.658 204.657 216.153 1.00 54.90  ? 851  CYS A CA  1 
ATOM   6349  C C   . CYS A  1 882  ? 240.784 205.269 217.241 1.00 54.90  ? 851  CYS A C   1 
ATOM   6350  O O   . CYS A  1 882  ? 240.079 204.546 217.954 1.00 54.90  ? 851  CYS A O   1 
ATOM   6351  C CB  . CYS A  1 882  ? 243.060 204.351 216.678 1.00 54.90  ? 851  CYS A CB  1 
ATOM   6352  S SG  . CYS A  1 882  ? 243.899 203.113 215.670 1.00 54.90  ? 851  CYS A SG  1 
ATOM   6353  N N   . ALA A  1 883  ? 240.831 206.591 217.401 1.00 47.18  ? 852  ALA A N   1 
ATOM   6354  C CA  . ALA A  1 883  ? 239.919 207.249 218.329 1.00 47.18  ? 852  ALA A CA  1 
ATOM   6355  C C   . ALA A  1 883  ? 238.468 207.017 217.934 1.00 47.18  ? 852  ALA A C   1 
ATOM   6356  O O   . ALA A  1 883  ? 237.605 206.844 218.798 1.00 47.18  ? 852  ALA A O   1 
ATOM   6357  C CB  . ALA A  1 883  ? 240.220 208.743 218.396 1.00 47.18  ? 852  ALA A CB  1 
ATOM   6358  N N   . GLN A  1 884  ? 238.172 207.038 216.632 1.00 41.99  ? 853  GLN A N   1 
ATOM   6359  C CA  . GLN A  1 884  ? 236.827 206.699 216.182 1.00 41.99  ? 853  GLN A CA  1 
ATOM   6360  C C   . GLN A  1 884  ? 236.489 205.245 216.480 1.00 41.99  ? 853  GLN A C   1 
ATOM   6361  O O   . GLN A  1 884  ? 235.385 204.940 216.940 1.00 41.99  ? 853  GLN A O   1 
ATOM   6362  C CB  . GLN A  1 884  ? 236.682 206.977 214.689 1.00 41.99  ? 853  GLN A CB  1 
ATOM   6363  C CG  . GLN A  1 884  ? 236.798 208.432 214.314 1.00 41.99  ? 853  GLN A CG  1 
ATOM   6364  C CD  . GLN A  1 884  ? 236.862 208.628 212.823 1.00 41.99  ? 853  GLN A CD  1 
ATOM   6365  O OE1 . GLN A  1 884  ? 237.062 207.678 212.074 1.00 41.99  ? 853  GLN A OE1 1 
ATOM   6366  N NE2 . GLN A  1 884  ? 236.741 209.870 212.385 1.00 41.99  ? 853  GLN A NE2 1 
ATOM   6367  N N   . LYS A  1 885  ? 237.425 204.332 216.218 1.00 44.01  ? 854  LYS A N   1 
ATOM   6368  C CA  . LYS A  1 885  ? 237.139 202.904 216.301 1.00 44.01  ? 854  LYS A CA  1 
ATOM   6369  C C   . LYS A  1 885  ? 237.035 202.396 217.729 1.00 44.01  ? 854  LYS A C   1 
ATOM   6370  O O   . LYS A  1 885  ? 236.388 201.370 217.955 1.00 44.01  ? 854  LYS A O   1 
ATOM   6371  C CB  . LYS A  1 885  ? 238.200 202.104 215.555 1.00 44.01  ? 854  LYS A CB  1 
ATOM   6372  C CG  . LYS A  1 885  ? 238.241 202.370 214.073 1.00 44.01  ? 854  LYS A CG  1 
ATOM   6373  C CD  . LYS A  1 885  ? 239.195 201.423 213.382 1.00 44.01  ? 854  LYS A CD  1 
ATOM   6374  C CE  . LYS A  1 885  ? 238.636 200.022 213.346 1.00 44.01  ? 854  LYS A CE  1 
ATOM   6375  N NZ  . LYS A  1 885  ? 237.338 199.958 212.631 1.00 44.01  ? 854  LYS A NZ  1 
ATOM   6376  N N   . PHE A  1 886  ? 237.663 203.062 218.692 1.00 43.83  ? 855  PHE A N   1 
ATOM   6377  C CA  . PHE A  1 886  ? 237.452 202.693 220.086 1.00 43.83  ? 855  PHE A CA  1 
ATOM   6378  C C   . PHE A  1 886  ? 236.110 203.160 220.629 1.00 43.83  ? 855  PHE A C   1 
ATOM   6379  O O   . PHE A  1 886  ? 235.779 202.825 221.769 1.00 43.83  ? 855  PHE A O   1 
ATOM   6380  C CB  . PHE A  1 886  ? 238.562 203.254 220.978 1.00 43.83  ? 855  PHE A CB  1 
ATOM   6381  C CG  . PHE A  1 886  ? 239.836 202.465 220.937 1.00 43.83  ? 855  PHE A CG  1 
ATOM   6382  C CD1 . PHE A  1 886  ? 239.863 201.152 221.370 1.00 43.83  ? 855  PHE A CD1 1 
ATOM   6383  C CD2 . PHE A  1 886  ? 241.013 203.045 220.508 1.00 43.83  ? 855  PHE A CD2 1 
ATOM   6384  C CE1 . PHE A  1 886  ? 241.028 200.427 221.343 1.00 43.83  ? 855  PHE A CE1 1 
ATOM   6385  C CE2 . PHE A  1 886  ? 242.182 202.325 220.485 1.00 43.83  ? 855  PHE A CE2 1 
ATOM   6386  C CZ  . PHE A  1 886  ? 242.190 201.015 220.906 1.00 43.83  ? 855  PHE A CZ  1 
ATOM   6387  N N   . ASN A  1 887  ? 235.321 203.895 219.844 1.00 36.04  ? 856  ASN A N   1 
ATOM   6388  C CA  . ASN A  1 887  ? 233.991 204.335 220.252 1.00 36.04  ? 856  ASN A CA  1 
ATOM   6389  C C   . ASN A  1 887  ? 232.885 203.806 219.346 1.00 36.04  ? 856  ASN A C   1 
ATOM   6390  O O   . ASN A  1 887  ? 231.809 204.398 219.292 1.00 36.04  ? 856  ASN A O   1 
ATOM   6391  C CB  . ASN A  1 887  ? 233.927 205.861 220.315 1.00 36.04  ? 856  ASN A CB  1 
ATOM   6392  C CG  . ASN A  1 887  ? 234.884 206.443 221.330 1.00 36.04  ? 856  ASN A CG  1 
ATOM   6393  O OD1 . ASN A  1 887  ? 235.836 207.132 220.984 1.00 36.04  ? 856  ASN A OD1 1 
ATOM   6394  N ND2 . ASN A  1 887  ? 234.618 206.186 222.599 1.00 36.04  ? 856  ASN A ND2 1 
ATOM   6395  N N   . GLY A  1 888  ? 233.123 202.711 218.630 1.00 35.52  ? 857  GLY A N   1 
ATOM   6396  C CA  . GLY A  1 888  ? 232.074 202.058 217.875 1.00 35.52  ? 857  GLY A CA  1 
ATOM   6397  C C   . GLY A  1 888  ? 231.791 202.585 216.487 1.00 35.52  ? 857  GLY A C   1 
ATOM   6398  O O   . GLY A  1 888  ? 230.789 202.180 215.894 1.00 35.52  ? 857  GLY A O   1 
ATOM   6399  N N   . LEU A  1 889  ? 232.620 203.472 215.947 1.00 32.88  ? 858  LEU A N   1 
ATOM   6400  C CA  . LEU A  1 889  ? 232.350 204.126 214.669 1.00 32.88  ? 858  LEU A CA  1 
ATOM   6401  C C   . LEU A  1 889  ? 233.203 203.475 213.583 1.00 32.88  ? 858  LEU A C   1 
ATOM   6402  O O   . LEU A  1 889  ? 234.417 203.687 213.542 1.00 32.88  ? 858  LEU A O   1 
ATOM   6403  C CB  . LEU A  1 889  ? 232.649 205.619 214.773 1.00 32.88  ? 858  LEU A CB  1 
ATOM   6404  C CG  . LEU A  1 889  ? 232.054 206.400 215.950 1.00 32.88  ? 858  LEU A CG  1 
ATOM   6405  C CD1 . LEU A  1 889  ? 232.441 207.857 215.873 1.00 32.88  ? 858  LEU A CD1 1 
ATOM   6406  C CD2 . LEU A  1 889  ? 230.546 206.252 216.025 1.00 32.88  ? 858  LEU A CD2 1 
ATOM   6407  N N   . THR A  1 890  ? 232.580 202.701 212.690 1.00 35.79  ? 859  THR A N   1 
ATOM   6408  C CA  . THR A  1 890  ? 233.326 201.971 211.672 1.00 35.79  ? 859  THR A CA  1 
ATOM   6409  C C   . THR A  1 890  ? 232.920 202.401 210.267 1.00 35.79  ? 859  THR A C   1 
ATOM   6410  O O   . THR A  1 890  ? 231.783 202.805 210.029 1.00 35.79  ? 859  THR A O   1 
ATOM   6411  C CB  . THR A  1 890  ? 233.134 200.454 211.807 1.00 35.79  ? 859  THR A CB  1 
ATOM   6412  O OG1 . THR A  1 890  ? 231.770 200.113 211.548 1.00 35.79  ? 859  THR A OG1 1 
ATOM   6413  C CG2 . THR A  1 890  ? 233.502 199.992 213.207 1.00 35.79  ? 859  THR A CG2 1 
ATOM   6414  N N   . VAL A  1 891  ? 233.872 202.295 209.340 1.00 34.77  ? 860  VAL A N   1 
ATOM   6415  C CA  . VAL A  1 891  ? 233.688 202.604 207.924 1.00 34.77  ? 860  VAL A CA  1 
ATOM   6416  C C   . VAL A  1 891  ? 233.727 201.305 207.127 1.00 34.77  ? 860  VAL A C   1 
ATOM   6417  O O   . VAL A  1 891  ? 234.662 200.510 207.274 1.00 34.77  ? 860  VAL A O   1 
ATOM   6418  C CB  . VAL A  1 891  ? 234.755 203.592 207.426 1.00 34.77  ? 860  VAL A CB  1 
ATOM   6419  C CG1 . VAL A  1 891  ? 234.686 203.736 205.930 1.00 34.77  ? 860  VAL A CG1 1 
ATOM   6420  C CG2 . VAL A  1 891  ? 234.582 204.931 208.099 1.00 34.77  ? 860  VAL A CG2 1 
ATOM   6421  N N   . LEU A  1 892  ? 232.718 201.085 206.291 1.00 35.19  ? 861  LEU A N   1 
ATOM   6422  C CA  . LEU A  1 892  ? 232.598 199.853 205.517 1.00 35.19  ? 861  LEU A CA  1 
ATOM   6423  C C   . LEU A  1 892  ? 233.143 200.024 204.101 1.00 35.19  ? 861  LEU A C   1 
ATOM   6424  O O   . LEU A  1 892  ? 232.959 201.079 203.490 1.00 35.19  ? 861  LEU A O   1 
ATOM   6425  C CB  . LEU A  1 892  ? 231.133 199.428 205.448 1.00 35.19  ? 861  LEU A CB  1 
ATOM   6426  C CG  . LEU A  1 892  ? 230.497 199.071 206.792 1.00 35.19  ? 861  LEU A CG  1 
ATOM   6427  C CD1 . LEU A  1 892  ? 228.993 199.052 206.683 1.00 35.19  ? 861  LEU A CD1 1 
ATOM   6428  C CD2 . LEU A  1 892  ? 231.008 197.735 207.289 1.00 35.19  ? 861  LEU A CD2 1 
ATOM   6429  N N   . PRO A  1 893  ? 233.812 199.013 203.548 1.00 38.66  ? 862  PRO A N   1 
ATOM   6430  C CA  . PRO A  1 893  ? 234.401 199.141 202.202 1.00 38.66  ? 862  PRO A CA  1 
ATOM   6431  C C   . PRO A  1 893  ? 233.352 199.020 201.113 1.00 38.66  ? 862  PRO A C   1 
ATOM   6432  O O   . PRO A  1 893  ? 232.360 198.293 201.271 1.00 38.66  ? 862  PRO A O   1 
ATOM   6433  C CB  . PRO A  1 893  ? 235.390 197.971 202.146 1.00 38.66  ? 862  PRO A CB  1 
ATOM   6434  C CG  . PRO A  1 893  ? 234.807 196.967 203.057 1.00 38.66  ? 862  PRO A CG  1 
ATOM   6435  C CD  . PRO A  1 893  ? 234.157 197.727 204.173 1.00 38.66  ? 862  PRO A CD  1 
ATOM   6436  N N   . PRO A  1 894  ? 233.543 199.697 199.983 1.00 35.14  ? 863  PRO A N   1 
ATOM   6437  C CA  . PRO A  1 894  ? 232.620 199.538 198.855 1.00 35.14  ? 863  PRO A CA  1 
ATOM   6438  C C   . PRO A  1 894  ? 232.715 198.171 198.189 1.00 35.14  ? 863  PRO A C   1 
ATOM   6439  O O   . PRO A  1 894  ? 233.707 197.450 198.301 1.00 35.14  ? 863  PRO A O   1 
ATOM   6440  C CB  . PRO A  1 894  ? 233.039 200.652 197.895 1.00 35.14  ? 863  PRO A CB  1 
ATOM   6441  C CG  . PRO A  1 894  ? 234.380 201.043 198.315 1.00 35.14  ? 863  PRO A CG  1 
ATOM   6442  C CD  . PRO A  1 894  ? 234.476 200.810 199.770 1.00 35.14  ? 863  PRO A CD  1 
ATOM   6443  N N   . LEU A  1 895  ? 231.639 197.832 197.478 1.00 36.60  ? 864  LEU A N   1 
ATOM   6444  C CA  . LEU A  1 895  ? 231.508 196.523 196.846 1.00 36.60  ? 864  LEU A CA  1 
ATOM   6445  C C   . LEU A  1 895  ? 232.436 196.380 195.646 1.00 36.60  ? 864  LEU A C   1 
ATOM   6446  O O   . LEU A  1 895  ? 233.098 195.350 195.482 1.00 36.60  ? 864  LEU A O   1 
ATOM   6447  C CB  . LEU A  1 895  ? 230.052 196.311 196.437 1.00 36.60  ? 864  LEU A CB  1 
ATOM   6448  C CG  . LEU A  1 895  ? 229.474 194.941 196.101 1.00 36.60  ? 864  LEU A CG  1 
ATOM   6449  C CD1 . LEU A  1 895  ? 227.979 195.002 196.246 1.00 36.60  ? 864  LEU A CD1 1 
ATOM   6450  C CD2 . LEU A  1 895  ? 229.799 194.576 194.699 1.00 36.60  ? 864  LEU A CD2 1 
ATOM   6451  N N   . LEU A  1 896  ? 232.472 197.386 194.777 1.00 37.53  ? 865  LEU A N   1 
ATOM   6452  C CA  . LEU A  1 896  ? 233.362 197.384 193.624 1.00 37.53  ? 865  LEU A CA  1 
ATOM   6453  C C   . LEU A  1 896  ? 234.662 198.096 193.956 1.00 37.53  ? 865  LEU A C   1 
ATOM   6454  O O   . LEU A  1 896  ? 234.650 199.198 194.506 1.00 37.53  ? 865  LEU A O   1 
ATOM   6455  C CB  . LEU A  1 896  ? 232.701 198.069 192.427 1.00 37.53  ? 865  LEU A CB  1 
ATOM   6456  C CG  . LEU A  1 896  ? 231.437 197.477 191.810 1.00 37.53  ? 865  LEU A CG  1 
ATOM   6457  C CD1 . LEU A  1 896  ? 230.964 198.334 190.665 1.00 37.53  ? 865  LEU A CD1 1 
ATOM   6458  C CD2 . LEU A  1 896  ? 231.721 196.090 191.311 1.00 37.53  ? 865  LEU A CD2 1 
ATOM   6459  N N   . THR A  1 897  ? 235.778 197.473 193.598 1.00 41.14  ? 866  THR A N   1 
ATOM   6460  C CA  . THR A  1 897  ? 237.076 198.099 193.765 1.00 41.14  ? 866  THR A CA  1 
ATOM   6461  C C   . THR A  1 897  ? 237.320 199.109 192.644 1.00 41.14  ? 866  THR A C   1 
ATOM   6462  O O   . THR A  1 897  ? 236.538 199.232 191.702 1.00 41.14  ? 866  THR A O   1 
ATOM   6463  C CB  . THR A  1 897  ? 238.175 197.040 193.820 1.00 41.14  ? 866  THR A CB  1 
ATOM   6464  O OG1 . THR A  1 897  ? 238.171 196.275 192.613 1.00 41.14  ? 866  THR A OG1 1 
ATOM   6465  C CG2 . THR A  1 897  ? 237.943 196.109 194.980 1.00 41.14  ? 866  THR A CG2 1 
ATOM   6466  N N   . ASP A  1 898  ? 238.428 199.844 192.757 1.00 44.19  ? 867  ASP A N   1 
ATOM   6467  C CA  . ASP A  1 898  ? 238.818 200.784 191.710 1.00 44.19  ? 867  ASP A CA  1 
ATOM   6468  C C   . ASP A  1 898  ? 239.128 200.089 190.390 1.00 44.19  ? 867  ASP A C   1 
ATOM   6469  O O   . ASP A  1 898  ? 238.847 200.636 189.315 1.00 44.19  ? 867  ASP A O   1 
ATOM   6470  C CB  . ASP A  1 898  ? 240.029 201.593 192.164 1.00 44.19  ? 867  ASP A CB  1 
ATOM   6471  C CG  . ASP A  1 898  ? 239.687 202.595 193.242 1.00 44.19  ? 867  ASP A CG  1 
ATOM   6472  O OD1 . ASP A  1 898  ? 238.614 203.228 193.154 1.00 44.19  ? 867  ASP A OD1 1 
ATOM   6473  O OD2 . ASP A  1 898  ? 240.494 202.751 194.181 1.00 44.19  ? 867  ASP A OD2 1 
ATOM   6474  N N   . GLU A  1 899  ? 239.694 198.886 190.449 1.00 43.49  ? 868  GLU A N   1 
ATOM   6475  C CA  . GLU A  1 899  ? 240.057 198.174 189.230 1.00 43.49  ? 868  GLU A CA  1 
ATOM   6476  C C   . GLU A  1 899  ? 238.830 197.764 188.425 1.00 43.49  ? 868  GLU A C   1 
ATOM   6477  O O   . GLU A  1 899  ? 238.846 197.829 187.190 1.00 43.49  ? 868  GLU A O   1 
ATOM   6478  C CB  . GLU A  1 899  ? 240.908 196.951 189.576 1.00 43.49  ? 868  GLU A CB  1 
ATOM   6479  C CG  . GLU A  1 899  ? 242.268 197.274 190.194 1.00 43.49  ? 868  GLU A CG  1 
ATOM   6480  C CD  . GLU A  1 899  ? 242.196 197.666 191.666 1.00 43.49  ? 868  GLU A CD  1 
ATOM   6481  O OE1 . GLU A  1 899  ? 241.094 197.633 192.248 1.00 43.49  ? 868  GLU A OE1 1 
ATOM   6482  O OE2 . GLU A  1 899  ? 243.244 198.021 192.243 1.00 43.49  ? 868  GLU A OE2 1 
ATOM   6483  N N   . MET A  1 900  ? 237.754 197.351 189.093 1.00 40.10  ? 869  MET A N   1 
ATOM   6484  C CA  . MET A  1 900  ? 236.536 196.994 188.371 1.00 40.10  ? 869  MET A CA  1 
ATOM   6485  C C   . MET A  1 900  ? 235.914 198.198 187.669 1.00 40.10  ? 869  MET A C   1 
ATOM   6486  O O   . MET A  1 900  ? 235.432 198.083 186.533 1.00 40.10  ? 869  MET A O   1 
ATOM   6487  C CB  . MET A  1 900  ? 235.540 196.357 189.333 1.00 40.10  ? 869  MET A CB  1 
ATOM   6488  C CG  . MET A  1 900  ? 236.057 195.094 189.993 1.00 40.10  ? 869  MET A CG  1 
ATOM   6489  S SD  . MET A  1 900  ? 235.006 194.485 191.321 1.00 40.10  ? 869  MET A SD  1 
ATOM   6490  C CE  . MET A  1 900  ? 235.499 192.771 191.351 1.00 40.10  ? 869  MET A CE  1 
ATOM   6491  N N   . ILE A  1 901  ? 235.911 199.360 188.320 1.00 34.62  ? 870  ILE A N   1 
ATOM   6492  C CA  . ILE A  1 901  ? 235.349 200.553 187.695 1.00 34.62  ? 870  ILE A CA  1 
ATOM   6493  C C   . ILE A  1 901  ? 236.211 201.003 186.519 1.00 34.62  ? 870  ILE A C   1 
ATOM   6494  O O   . ILE A  1 901  ? 235.697 201.472 185.492 1.00 34.62  ? 870  ILE A O   1 
ATOM   6495  C CB  . ILE A  1 901  ? 235.154 201.661 188.744 1.00 34.62  ? 870  ILE A CB  1 
ATOM   6496  C CG1 . ILE A  1 901  ? 234.105 201.235 189.768 1.00 34.62  ? 870  ILE A CG1 1 
ATOM   6497  C CG2 . ILE A  1 901  ? 234.723 202.943 188.094 1.00 34.62  ? 870  ILE A CG2 1 
ATOM   6498  C CD1 . ILE A  1 901  ? 234.251 201.892 191.104 1.00 34.62  ? 870  ILE A CD1 1 
ATOM   6499  N N   . ALA A  1 902  ? 237.534 200.873 186.645 1.00 33.98  ? 871  ALA A N   1 
ATOM   6500  C CA  . ALA A  1 902  ? 238.406 201.157 185.509 1.00 33.98  ? 871  ALA A CA  1 
ATOM   6501  C C   . ALA A  1 902  ? 238.124 200.209 184.350 1.00 33.98  ? 871  ALA A C   1 
ATOM   6502  O O   . ALA A  1 902  ? 238.151 200.617 183.183 1.00 33.98  ? 871  ALA A O   1 
ATOM   6503  C CB  . ALA A  1 902  ? 239.868 201.078 185.935 1.00 33.98  ? 871  ALA A CB  1 
ATOM   6504  N N   . GLN A  1 903  ? 237.854 198.935 184.651 1.00 35.74  ? 872  GLN A N   1 
ATOM   6505  C CA  . GLN A  1 903  ? 237.479 197.990 183.603 1.00 35.74  ? 872  GLN A CA  1 
ATOM   6506  C C   . GLN A  1 903  ? 236.196 198.412 182.901 1.00 35.74  ? 872  GLN A C   1 
ATOM   6507  O O   . GLN A  1 903  ? 236.104 198.353 181.667 1.00 35.74  ? 872  GLN A O   1 
ATOM   6508  C CB  . GLN A  1 903  ? 237.288 196.599 184.200 1.00 35.74  ? 872  GLN A CB  1 
ATOM   6509  C CG  . GLN A  1 903  ? 238.532 195.758 184.284 1.00 35.74  ? 872  GLN A CG  1 
ATOM   6510  C CD  . GLN A  1 903  ? 238.238 194.358 184.775 1.00 35.74  ? 872  GLN A CD  1 
ATOM   6511  O OE1 . GLN A  1 903  ? 238.605 193.985 185.889 1.00 35.74  ? 872  GLN A OE1 1 
ATOM   6512  N NE2 . GLN A  1 903  ? 237.566 193.574 183.947 1.00 35.74  ? 872  GLN A NE2 1 
ATOM   6513  N N   . TYR A  1 904  ? 235.194 198.839 183.670 1.00 33.43  ? 873  TYR A N   1 
ATOM   6514  C CA  . TYR A  1 904  ? 233.942 199.292 183.068 1.00 33.43  ? 873  TYR A CA  1 
ATOM   6515  C C   . TYR A  1 904  ? 234.150 200.495 182.153 1.00 33.43  ? 873  TYR A C   1 
ATOM   6516  O O   . TYR A  1 904  ? 233.623 200.532 181.033 1.00 33.43  ? 873  TYR A O   1 
ATOM   6517  C CB  . TYR A  1 904  ? 232.934 199.631 184.159 1.00 33.43  ? 873  TYR A CB  1 
ATOM   6518  C CG  . TYR A  1 904  ? 232.143 198.456 184.672 1.00 33.43  ? 873  TYR A CG  1 
ATOM   6519  C CD1 . TYR A  1 904  ? 231.590 197.533 183.805 1.00 33.43  ? 873  TYR A CD1 1 
ATOM   6520  C CD2 . TYR A  1 904  ? 231.925 198.289 186.026 1.00 33.43  ? 873  TYR A CD2 1 
ATOM   6521  C CE1 . TYR A  1 904  ? 230.859 196.472 184.272 1.00 33.43  ? 873  TYR A CE1 1 
ATOM   6522  C CE2 . TYR A  1 904  ? 231.195 197.232 186.498 1.00 33.43  ? 873  TYR A CE2 1 
ATOM   6523  C CZ  . TYR A  1 904  ? 230.666 196.327 185.618 1.00 33.43  ? 873  TYR A CZ  1 
ATOM   6524  O OH  . TYR A  1 904  ? 229.934 195.269 186.091 1.00 33.43  ? 873  TYR A OH  1 
ATOM   6525  N N   . THR A  1 905  ? 234.926 201.486 182.603 1.00 31.97  ? 874  THR A N   1 
ATOM   6526  C CA  . THR A  1 905  ? 235.152 202.662 181.763 1.00 31.97  ? 874  THR A CA  1 
ATOM   6527  C C   . THR A  1 905  ? 235.930 202.313 180.500 1.00 31.97  ? 874  THR A C   1 
ATOM   6528  O O   . THR A  1 905  ? 235.653 202.860 179.426 1.00 31.97  ? 874  THR A O   1 
ATOM   6529  C CB  . THR A  1 905  ? 235.862 203.766 182.540 1.00 31.97  ? 874  THR A CB  1 
ATOM   6530  O OG1 . THR A  1 905  ? 237.132 203.301 182.994 1.00 31.97  ? 874  THR A OG1 1 
ATOM   6531  C CG2 . THR A  1 905  ? 235.030 204.201 183.716 1.00 31.97  ? 874  THR A CG2 1 
ATOM   6532  N N   . SER A  1 906  ? 236.917 201.421 180.602 1.00 33.25  ? 875  SER A N   1 
ATOM   6533  C CA  . SER A  1 906  ? 237.663 201.036 179.408 1.00 33.25  ? 875  SER A CA  1 
ATOM   6534  C C   . SER A  1 906  ? 236.780 200.284 178.420 1.00 33.25  ? 875  SER A C   1 
ATOM   6535  O O   . SER A  1 906  ? 236.921 200.449 177.202 1.00 33.25  ? 875  SER A O   1 
ATOM   6536  C CB  . SER A  1 906  ? 238.870 200.192 179.794 1.00 33.25  ? 875  SER A CB  1 
ATOM   6537  O OG  . SER A  1 906  ? 238.466 198.937 180.298 1.00 33.25  ? 875  SER A OG  1 
ATOM   6538  N N   . ALA A  1 907  ? 235.849 199.468 178.923 1.00 32.71  ? 876  ALA A N   1 
ATOM   6539  C CA  . ALA A  1 907  ? 234.898 198.806 178.036 1.00 32.71  ? 876  ALA A CA  1 
ATOM   6540  C C   . ALA A  1 907  ? 234.015 199.817 177.320 1.00 32.71  ? 876  ALA A C   1 
ATOM   6541  O O   . ALA A  1 907  ? 233.766 199.692 176.114 1.00 32.71  ? 876  ALA A O   1 
ATOM   6542  C CB  . ALA A  1 907  ? 234.042 197.817 178.824 1.00 32.71  ? 876  ALA A CB  1 
ATOM   6543  N N   . LEU A  1 908  ? 233.540 200.833 178.044 1.00 30.66  ? 877  LEU A N   1 
ATOM   6544  C CA  . LEU A  1 908  ? 232.728 201.870 177.409 1.00 30.66  ? 877  LEU A CA  1 
ATOM   6545  C C   . LEU A  1 908  ? 233.508 202.608 176.326 1.00 30.66  ? 877  LEU A C   1 
ATOM   6546  O O   . LEU A  1 908  ? 232.982 202.863 175.235 1.00 30.66  ? 877  LEU A O   1 
ATOM   6547  C CB  . LEU A  1 908  ? 232.207 202.847 178.462 1.00 30.66  ? 877  LEU A CB  1 
ATOM   6548  C CG  . LEU A  1 908  ? 231.050 202.356 179.333 1.00 30.66  ? 877  LEU A CG  1 
ATOM   6549  C CD1 . LEU A  1 908  ? 230.967 203.152 180.615 1.00 30.66  ? 877  LEU A CD1 1 
ATOM   6550  C CD2 . LEU A  1 908  ? 229.748 202.448 178.585 1.00 30.66  ? 877  LEU A CD2 1 
ATOM   6551  N N   . LEU A  1 909  ? 234.772 202.936 176.598 1.00 31.49  ? 878  LEU A N   1 
ATOM   6552  C CA  . LEU A  1 909  ? 235.581 203.653 175.615 1.00 31.49  ? 878  LEU A CA  1 
ATOM   6553  C C   . LEU A  1 909  ? 235.817 202.818 174.363 1.00 31.49  ? 878  LEU A C   1 
ATOM   6554  O O   . LEU A  1 909  ? 235.708 203.321 173.236 1.00 31.49  ? 878  LEU A O   1 
ATOM   6555  C CB  . LEU A  1 909  ? 236.920 204.058 176.222 1.00 31.49  ? 878  LEU A CB  1 
ATOM   6556  C CG  . LEU A  1 909  ? 237.149 205.549 176.403 1.00 31.49  ? 878  LEU A CG  1 
ATOM   6557  C CD1 . LEU A  1 909  ? 236.547 206.041 177.692 1.00 31.49  ? 878  LEU A CD1 1 
ATOM   6558  C CD2 . LEU A  1 909  ? 238.615 205.849 176.333 1.00 31.49  ? 878  LEU A CD2 1 
ATOM   6559  N N   . ALA A  1 910  ? 236.183 201.546 174.538 1.00 33.11  ? 879  ALA A N   1 
ATOM   6560  C CA  . ALA A  1 910  ? 236.420 200.698 173.377 1.00 33.11  ? 879  ALA A CA  1 
ATOM   6561  C C   . ALA A  1 910  ? 235.153 200.539 172.553 1.00 33.11  ? 879  ALA A C   1 
ATOM   6562  O O   . ALA A  1 910  ? 235.196 200.577 171.316 1.00 33.11  ? 879  ALA A O   1 
ATOM   6563  C CB  . ALA A  1 910  ? 236.953 199.340 173.817 1.00 33.11  ? 879  ALA A CB  1 
ATOM   6564  N N   . GLY A  1 911  ? 234.009 200.383 173.221 1.00 33.02  ? 880  GLY A N   1 
ATOM   6565  C CA  . GLY A  1 911  ? 232.752 200.313 172.499 1.00 33.02  ? 880  GLY A CA  1 
ATOM   6566  C C   . GLY A  1 911  ? 232.482 201.552 171.670 1.00 33.02  ? 880  GLY A C   1 
ATOM   6567  O O   . GLY A  1 911  ? 232.110 201.460 170.498 1.00 33.02  ? 880  GLY A O   1 
ATOM   6568  N N   . THR A  1 912  ? 232.686 202.734 172.260 1.00 33.30  ? 881  THR A N   1 
ATOM   6569  C CA  . THR A  1 912  ? 232.348 203.952 171.532 1.00 33.30  ? 881  THR A CA  1 
ATOM   6570  C C   . THR A  1 912  ? 233.286 204.182 170.358 1.00 33.30  ? 881  THR A C   1 
ATOM   6571  O O   . THR A  1 912  ? 232.854 204.663 169.307 1.00 33.30  ? 881  THR A O   1 
ATOM   6572  C CB  . THR A  1 912  ? 232.357 205.167 172.455 1.00 33.30  ? 881  THR A CB  1 
ATOM   6573  O OG1 . THR A  1 912  ? 233.650 205.320 173.042 1.00 33.30  ? 881  THR A OG1 1 
ATOM   6574  C CG2 . THR A  1 912  ? 231.334 205.009 173.543 1.00 33.30  ? 881  THR A CG2 1 
ATOM   6575  N N   . ILE A  1 913  ? 234.578 203.877 170.507 1.00 34.37  ? 882  ILE A N   1 
ATOM   6576  C CA  . ILE A  1 913  ? 235.480 204.197 169.402 1.00 34.37  ? 882  ILE A CA  1 
ATOM   6577  C C   . ILE A  1 913  ? 235.556 203.089 168.361 1.00 34.37  ? 882  ILE A C   1 
ATOM   6578  O O   . ILE A  1 913  ? 236.092 203.326 167.270 1.00 34.37  ? 882  ILE A O   1 
ATOM   6579  C CB  . ILE A  1 913  ? 236.920 204.521 169.852 1.00 34.37  ? 882  ILE A CB  1 
ATOM   6580  C CG1 . ILE A  1 913  ? 237.634 203.270 170.339 1.00 34.37  ? 882  ILE A CG1 1 
ATOM   6581  C CG2 . ILE A  1 913  ? 236.921 205.571 170.939 1.00 34.37  ? 882  ILE A CG2 1 
ATOM   6582  C CD1 . ILE A  1 913  ? 239.087 203.486 170.599 1.00 34.37  ? 882  ILE A CD1 1 
ATOM   6583  N N   . THR A  1 914  ? 235.026 201.894 168.638 1.00 35.91  ? 883  THR A N   1 
ATOM   6584  C CA  . THR A  1 914  ? 234.974 200.880 167.592 1.00 35.91  ? 883  THR A CA  1 
ATOM   6585  C C   . THR A  1 914  ? 233.605 200.689 166.949 1.00 35.91  ? 883  THR A C   1 
ATOM   6586  O O   . THR A  1 914  ? 233.546 200.199 165.820 1.00 35.91  ? 883  THR A O   1 
ATOM   6587  C CB  . THR A  1 914  ? 235.470 199.528 168.120 1.00 35.91  ? 883  THR A CB  1 
ATOM   6588  O OG1 . THR A  1 914  ? 234.855 199.242 169.378 1.00 35.91  ? 883  THR A OG1 1 
ATOM   6589  C CG2 . THR A  1 914  ? 236.970 199.536 168.279 1.00 35.91  ? 883  THR A CG2 1 
ATOM   6590  N N   . SER A  1 915  ? 232.502 201.053 167.610 1.00 36.03  ? 884  SER A N   1 
ATOM   6591  C CA  . SER A  1 915  ? 231.185 200.750 167.062 1.00 36.03  ? 884  SER A CA  1 
ATOM   6592  C C   . SER A  1 915  ? 230.234 201.940 167.053 1.00 36.03  ? 884  SER A C   1 
ATOM   6593  O O   . SER A  1 915  ? 229.048 201.761 166.768 1.00 36.03  ? 884  SER A O   1 
ATOM   6594  C CB  . SER A  1 915  ? 230.543 199.589 167.822 1.00 36.03  ? 884  SER A CB  1 
ATOM   6595  O OG  . SER A  1 915  ? 230.446 199.882 169.199 1.00 36.03  ? 884  SER A OG  1 
ATOM   6596  N N   . GLY A  1 916  ? 230.713 203.136 167.358 1.00 36.98  ? 885  GLY A N   1 
ATOM   6597  C CA  . GLY A  1 916  ? 229.844 204.302 167.371 1.00 36.98  ? 885  GLY A CA  1 
ATOM   6598  C C   . GLY A  1 916  ? 228.812 204.215 168.475 1.00 36.98  ? 885  GLY A C   1 
ATOM   6599  O O   . GLY A  1 916  ? 229.139 203.975 169.640 1.00 36.98  ? 885  GLY A O   1 
ATOM   6600  N N   . TRP A  1 917  ? 227.547 204.422 168.120 1.00 38.71  ? 886  TRP A N   1 
ATOM   6601  C CA  . TRP A  1 917  ? 226.456 204.373 169.084 1.00 38.71  ? 886  TRP A CA  1 
ATOM   6602  C C   . TRP A  1 917  ? 225.609 203.115 168.963 1.00 38.71  ? 886  TRP A C   1 
ATOM   6603  O O   . TRP A  1 917  ? 224.571 203.015 169.621 1.00 38.71  ? 886  TRP A O   1 
ATOM   6604  C CB  . TRP A  1 917  ? 225.570 205.613 168.944 1.00 38.71  ? 886  TRP A CB  1 
ATOM   6605  C CG  . TRP A  1 917  ? 224.982 205.818 167.574 1.00 38.71  ? 886  TRP A CG  1 
ATOM   6606  C CD1 . TRP A  1 917  ? 224.255 204.923 166.849 1.00 38.71  ? 886  TRP A CD1 1 
ATOM   6607  C CD2 . TRP A  1 917  ? 225.030 207.018 166.793 1.00 38.71  ? 886  TRP A CD2 1 
ATOM   6608  N NE1 . TRP A  1 917  ? 223.874 205.478 165.654 1.00 38.71  ? 886  TRP A NE1 1 
ATOM   6609  C CE2 . TRP A  1 917  ? 224.334 206.766 165.597 1.00 38.71  ? 886  TRP A CE2 1 
ATOM   6610  C CE3 . TRP A  1 917  ? 225.599 208.278 166.987 1.00 38.71  ? 886  TRP A CE3 1 
ATOM   6611  C CZ2 . TRP A  1 917  ? 224.197 207.724 164.597 1.00 38.71  ? 886  TRP A CZ2 1 
ATOM   6612  C CZ3 . TRP A  1 917  ? 225.462 209.230 165.992 1.00 38.71  ? 886  TRP A CZ3 1 
ATOM   6613  C CH2 . TRP A  1 917  ? 224.767 208.948 164.814 1.00 38.71  ? 886  TRP A CH2 1 
ATOM   6614  N N   . THR A  1 918  ? 226.023 202.152 168.141 1.00 37.47  ? 887  THR A N   1 
ATOM   6615  C CA  . THR A  1 918  ? 225.201 200.967 167.930 1.00 37.47  ? 887  THR A CA  1 
ATOM   6616  C C   . THR A  1 918  ? 225.225 200.023 169.121 1.00 37.47  ? 887  THR A C   1 
ATOM   6617  O O   . THR A  1 918  ? 224.238 199.326 169.367 1.00 37.47  ? 887  THR A O   1 
ATOM   6618  C CB  . THR A  1 918  ? 225.652 200.228 166.677 1.00 37.47  ? 887  THR A CB  1 
ATOM   6619  O OG1 . THR A  1 918  ? 227.023 199.858 166.820 1.00 37.47  ? 887  THR A OG1 1 
ATOM   6620  C CG2 . THR A  1 918  ? 225.507 201.111 165.462 1.00 37.47  ? 887  THR A CG2 1 
ATOM   6621  N N   . PHE A  1 919  ? 226.332 199.973 169.863 1.00 36.64  ? 888  PHE A N   1 
ATOM   6622  C CA  . PHE A  1 919  ? 226.444 199.024 170.965 1.00 36.64  ? 888  PHE A CA  1 
ATOM   6623  C C   . PHE A  1 919  ? 225.540 199.365 172.142 1.00 36.64  ? 888  PHE A C   1 
ATOM   6624  O O   . PHE A  1 919  ? 225.306 198.500 172.991 1.00 36.64  ? 888  PHE A O   1 
ATOM   6625  C CB  . PHE A  1 919  ? 227.898 198.933 171.431 1.00 36.64  ? 888  PHE A CB  1 
ATOM   6626  C CG  . PHE A  1 919  ? 228.316 200.042 172.347 1.00 36.64  ? 888  PHE A CG  1 
ATOM   6627  C CD1 . PHE A  1 919  ? 228.493 201.325 171.874 1.00 36.64  ? 888  PHE A CD1 1 
ATOM   6628  C CD2 . PHE A  1 919  ? 228.546 199.791 173.682 1.00 36.64  ? 888  PHE A CD2 1 
ATOM   6629  C CE1 . PHE A  1 919  ? 228.871 202.336 172.718 1.00 36.64  ? 888  PHE A CE1 1 
ATOM   6630  C CE2 . PHE A  1 919  ? 228.929 200.795 174.526 1.00 36.64  ? 888  PHE A CE2 1 
ATOM   6631  C CZ  . PHE A  1 919  ? 229.093 202.071 174.045 1.00 36.64  ? 888  PHE A CZ  1 
ATOM   6632  N N   . GLY A  1 920  ? 225.011 200.585 172.208 1.00 38.58  ? 889  GLY A N   1 
ATOM   6633  C CA  . GLY A  1 920  ? 224.055 200.920 173.244 1.00 38.58  ? 889  GLY A CA  1 
ATOM   6634  C C   . GLY A  1 920  ? 222.624 200.543 172.945 1.00 38.58  ? 889  GLY A C   1 
ATOM   6635  O O   . GLY A  1 920  ? 221.786 200.586 173.848 1.00 38.58  ? 889  GLY A O   1 
ATOM   6636  N N   . ALA A  1 921  ? 222.324 200.180 171.698 1.00 40.69  ? 890  ALA A N   1 
ATOM   6637  C CA  . ALA A  1 921  ? 220.990 199.771 171.292 1.00 40.69  ? 890  ALA A CA  1 
ATOM   6638  C C   . ALA A  1 921  ? 220.860 198.281 171.029 1.00 40.69  ? 890  ALA A C   1 
ATOM   6639  O O   . ALA A  1 921  ? 219.735 197.791 170.906 1.00 40.69  ? 890  ALA A O   1 
ATOM   6640  C CB  . ALA A  1 921  ? 220.564 200.536 170.033 1.00 40.69  ? 890  ALA A CB  1 
ATOM   6641  N N   . GLY A  1 922  ? 221.966 197.554 170.934 1.00 44.14  ? 891  GLY A N   1 
ATOM   6642  C CA  . GLY A  1 922  ? 221.915 196.141 170.623 1.00 44.14  ? 891  GLY A CA  1 
ATOM   6643  C C   . GLY A  1 922  ? 223.292 195.530 170.477 1.00 44.14  ? 891  GLY A C   1 
ATOM   6644  O O   . GLY A  1 922  ? 224.159 195.741 171.327 1.00 44.14  ? 891  GLY A O   1 
ATOM   6645  N N   . ALA A  1 923  ? 223.507 194.766 169.413 1.00 43.23  ? 892  ALA A N   1 
ATOM   6646  C CA  . ALA A  1 923  ? 224.829 194.229 169.143 1.00 43.23  ? 892  ALA A CA  1 
ATOM   6647  C C   . ALA A  1 923  ? 225.721 195.309 168.548 1.00 43.23  ? 892  ALA A C   1 
ATOM   6648  O O   . ALA A  1 923  ? 225.261 196.186 167.815 1.00 43.23  ? 892  ALA A O   1 
ATOM   6649  C CB  . ALA A  1 923  ? 224.741 193.037 168.192 1.00 43.23  ? 892  ALA A CB  1 
ATOM   6650  N N   . ALA A  1 924  ? 227.004 195.253 168.887 1.00 41.78  ? 893  ALA A N   1 
ATOM   6651  C CA  . ALA A  1 924  ? 227.946 196.231 168.365 1.00 41.78  ? 893  ALA A CA  1 
ATOM   6652  C C   . ALA A  1 924  ? 228.239 195.973 166.894 1.00 41.78  ? 893  ALA A C   1 
ATOM   6653  O O   . ALA A  1 924  ? 228.600 194.858 166.510 1.00 41.78  ? 893  ALA A O   1 
ATOM   6654  C CB  . ALA A  1 924  ? 229.239 196.194 169.171 1.00 41.78  ? 893  ALA A CB  1 
ATOM   6655  N N   . LEU A  1 925  ? 228.086 197.007 166.071 1.00 38.04  ? 894  LEU A N   1 
ATOM   6656  C CA  . LEU A  1 925  ? 228.343 196.935 164.638 1.00 38.04  ? 894  LEU A CA  1 
ATOM   6657  C C   . LEU A  1 925  ? 229.559 197.795 164.322 1.00 38.04  ? 894  LEU A C   1 
ATOM   6658  O O   . LEU A  1 925  ? 229.533 199.005 164.549 1.00 38.04  ? 894  LEU A O   1 
ATOM   6659  C CB  . LEU A  1 925  ? 227.130 197.409 163.840 1.00 38.04  ? 894  LEU A CB  1 
ATOM   6660  C CG  . LEU A  1 925  ? 225.746 196.856 164.187 1.00 38.04  ? 894  LEU A CG  1 
ATOM   6661  C CD1 . LEU A  1 925  ? 224.698 197.530 163.345 1.00 38.04  ? 894  LEU A CD1 1 
ATOM   6662  C CD2 . LEU A  1 925  ? 225.683 195.374 163.972 1.00 38.04  ? 894  LEU A CD2 1 
ATOM   6663  N N   . GLN A  1 926  ? 230.615 197.184 163.797 1.00 38.04  ? 895  GLN A N   1 
ATOM   6664  C CA  . GLN A  1 926  ? 231.844 197.932 163.576 1.00 38.04  ? 895  GLN A CA  1 
ATOM   6665  C C   . GLN A  1 926  ? 231.701 198.884 162.395 1.00 38.04  ? 895  GLN A C   1 
ATOM   6666  O O   . GLN A  1 926  ? 230.957 198.629 161.448 1.00 38.04  ? 895  GLN A O   1 
ATOM   6667  C CB  . GLN A  1 926  ? 233.036 196.994 163.370 1.00 38.04  ? 895  GLN A CB  1 
ATOM   6668  C CG  . GLN A  1 926  ? 233.233 196.408 161.978 1.00 38.04  ? 895  GLN A CG  1 
ATOM   6669  C CD  . GLN A  1 926  ? 232.540 195.081 161.787 1.00 38.04  ? 895  GLN A CD  1 
ATOM   6670  O OE1 . GLN A  1 926  ? 231.786 194.635 162.643 1.00 38.04  ? 895  GLN A OE1 1 
ATOM   6671  N NE2 . GLN A  1 926  ? 232.810 194.432 160.667 1.00 38.04  ? 895  GLN A NE2 1 
ATOM   6672  N N   . ILE A  1 927  ? 232.413 200.005 162.469 1.00 37.09  ? 896  ILE A N   1 
ATOM   6673  C CA  . ILE A  1 927  ? 232.372 201.031 161.430 1.00 37.09  ? 896  ILE A CA  1 
ATOM   6674  C C   . ILE A  1 927  ? 233.676 201.819 161.492 1.00 37.09  ? 896  ILE A C   1 
ATOM   6675  O O   . ILE A  1 927  ? 234.199 202.044 162.592 1.00 37.09  ? 896  ILE A O   1 
ATOM   6676  C CB  . ILE A  1 927  ? 231.142 201.939 161.604 1.00 37.09  ? 896  ILE A CB  1 
ATOM   6677  C CG1 . ILE A  1 927  ? 231.017 202.944 160.458 1.00 37.09  ? 896  ILE A CG1 1 
ATOM   6678  C CG2 . ILE A  1 927  ? 231.183 202.664 162.932 1.00 37.09  ? 896  ILE A CG2 1 
ATOM   6679  C CD1 . ILE A  1 927  ? 229.769 203.771 160.512 1.00 37.09  ? 896  ILE A CD1 1 
ATOM   6680  N N   . PRO A  1 928  ? 234.247 202.242 160.361 1.00 34.16  ? 897  PRO A N   1 
ATOM   6681  C CA  . PRO A  1 928  ? 235.444 203.086 160.415 1.00 34.16  ? 897  PRO A CA  1 
ATOM   6682  C C   . PRO A  1 928  ? 235.186 204.385 161.161 1.00 34.16  ? 897  PRO A C   1 
ATOM   6683  O O   . PRO A  1 928  ? 234.088 204.938 161.128 1.00 34.16  ? 897  PRO A O   1 
ATOM   6684  C CB  . PRO A  1 928  ? 235.761 203.339 158.941 1.00 34.16  ? 897  PRO A CB  1 
ATOM   6685  C CG  . PRO A  1 928  ? 235.170 202.204 158.243 1.00 34.16  ? 897  PRO A CG  1 
ATOM   6686  C CD  . PRO A  1 928  ? 233.951 201.806 158.990 1.00 34.16  ? 897  PRO A CD  1 
ATOM   6687  N N   . PHE A  1 929  ? 236.221 204.867 161.854 1.00 32.35  ? 898  PHE A N   1 
ATOM   6688  C CA  . PHE A  1 929  ? 236.036 205.986 162.772 1.00 32.35  ? 898  PHE A CA  1 
ATOM   6689  C C   . PHE A  1 929  ? 235.751 207.290 162.033 1.00 32.35  ? 898  PHE A C   1 
ATOM   6690  O O   . PHE A  1 929  ? 234.967 208.120 162.508 1.00 32.35  ? 898  PHE A O   1 
ATOM   6691  C CB  . PHE A  1 929  ? 237.249 206.139 163.685 1.00 32.35  ? 898  PHE A CB  1 
ATOM   6692  C CG  . PHE A  1 929  ? 237.079 207.205 164.725 1.00 32.35  ? 898  PHE A CG  1 
ATOM   6693  C CD1 . PHE A  1 929  ? 236.270 206.988 165.823 1.00 32.35  ? 898  PHE A CD1 1 
ATOM   6694  C CD2 . PHE A  1 929  ? 237.700 208.427 164.598 1.00 32.35  ? 898  PHE A CD2 1 
ATOM   6695  C CE1 . PHE A  1 929  ? 236.098 207.961 166.773 1.00 32.35  ? 898  PHE A CE1 1 
ATOM   6696  C CE2 . PHE A  1 929  ? 237.526 209.399 165.551 1.00 32.35  ? 898  PHE A CE2 1 
ATOM   6697  C CZ  . PHE A  1 929  ? 236.726 209.163 166.636 1.00 32.35  ? 898  PHE A CZ  1 
ATOM   6698  N N   . ALA A  1 930  ? 236.370 207.490 160.869 1.00 33.16  ? 899  ALA A N   1 
ATOM   6699  C CA  . ALA A  1 930  ? 236.101 208.692 160.086 1.00 33.16  ? 899  ALA A CA  1 
ATOM   6700  C C   . ALA A  1 930  ? 234.667 208.728 159.572 1.00 33.16  ? 899  ALA A C   1 
ATOM   6701  O O   . ALA A  1 930  ? 234.055 209.798 159.502 1.00 33.16  ? 899  ALA A O   1 
ATOM   6702  C CB  . ALA A  1 930  ? 237.091 208.790 158.932 1.00 33.16  ? 899  ALA A CB  1 
ATOM   6703  N N   . MET A  1 931  ? 234.113 207.580 159.191 1.00 33.93  ? 900  MET A N   1 
ATOM   6704  C CA  . MET A  1 931  ? 232.730 207.559 158.729 1.00 33.93  ? 900  MET A CA  1 
ATOM   6705  C C   . MET A  1 931  ? 231.761 207.846 159.874 1.00 33.93  ? 900  MET A C   1 
ATOM   6706  O O   . MET A  1 931  ? 230.733 208.509 159.680 1.00 33.93  ? 900  MET A O   1 
ATOM   6707  C CB  . MET A  1 931  ? 232.432 206.221 158.064 1.00 33.93  ? 900  MET A CB  1 
ATOM   6708  C CG  . MET A  1 931  ? 233.269 205.991 156.820 1.00 33.93  ? 900  MET A CG  1 
ATOM   6709  S SD  . MET A  1 931  ? 232.803 204.515 155.921 1.00 33.93  ? 900  MET A SD  1 
ATOM   6710  C CE  . MET A  1 931  ? 231.119 204.920 155.516 1.00 33.93  ? 900  MET A CE  1 
ATOM   6711  N N   . GLN A  1 932  ? 232.085 207.384 161.080 1.00 31.23  ? 901  GLN A N   1 
ATOM   6712  C CA  . GLN A  1 932  ? 231.309 207.769 162.252 1.00 31.23  ? 901  GLN A CA  1 
ATOM   6713  C C   . GLN A  1 932  ? 231.400 209.266 162.515 1.00 31.23  ? 901  GLN A C   1 
ATOM   6714  O O   . GLN A  1 932  ? 230.404 209.908 162.874 1.00 31.23  ? 901  GLN A O   1 
ATOM   6715  C CB  . GLN A  1 932  ? 231.785 206.977 163.463 1.00 31.23  ? 901  GLN A CB  1 
ATOM   6716  C CG  . GLN A  1 932  ? 231.367 207.575 164.773 1.00 31.23  ? 901  GLN A CG  1 
ATOM   6717  C CD  . GLN A  1 932  ? 232.037 206.920 165.943 1.00 31.23  ? 901  GLN A CD  1 
ATOM   6718  O OE1 . GLN A  1 932  ? 231.811 207.298 167.085 1.00 31.23  ? 901  GLN A OE1 1 
ATOM   6719  N NE2 . GLN A  1 932  ? 232.856 205.920 165.671 1.00 31.23  ? 901  GLN A NE2 1 
ATOM   6720  N N   . MET A  1 933  ? 232.588 209.843 162.349 1.00 32.33  ? 902  MET A N   1 
ATOM   6721  C CA  . MET A  1 933  ? 232.741 211.281 162.533 1.00 32.33  ? 902  MET A CA  1 
ATOM   6722  C C   . MET A  1 933  ? 231.912 212.051 161.509 1.00 32.33  ? 902  MET A C   1 
ATOM   6723  O O   . MET A  1 933  ? 231.343 213.104 161.820 1.00 32.33  ? 902  MET A O   1 
ATOM   6724  C CB  . MET A  1 933  ? 234.218 211.652 162.435 1.00 32.33  ? 902  MET A CB  1 
ATOM   6725  C CG  . MET A  1 933  ? 234.641 212.847 163.254 1.00 32.33  ? 902  MET A CG  1 
ATOM   6726  S SD  . MET A  1 933  ? 234.658 212.522 165.019 1.00 32.33  ? 902  MET A SD  1 
ATOM   6727  C CE  . MET A  1 933  ? 233.492 213.742 165.593 1.00 32.33  ? 902  MET A CE  1 
ATOM   6728  N N   . ALA A  1 934  ? 231.849 211.548 160.274 1.00 30.43  ? 903  ALA A N   1 
ATOM   6729  C CA  . ALA A  1 934  ? 231.007 212.168 159.254 1.00 30.43  ? 903  ALA A CA  1 
ATOM   6730  C C   . ALA A  1 934  ? 229.529 212.087 159.619 1.00 30.43  ? 903  ALA A C   1 
ATOM   6731  O O   . ALA A  1 934  ? 228.775 213.041 159.402 1.00 30.43  ? 903  ALA A O   1 
ATOM   6732  C CB  . ALA A  1 934  ? 231.258 211.501 157.906 1.00 30.43  ? 903  ALA A CB  1 
ATOM   6733  N N   . TYR A  1 935  ? 229.093 210.954 160.171 1.00 33.90  ? 904  TYR A N   1 
ATOM   6734  C CA  . TYR A  1 935  ? 227.719 210.854 160.663 1.00 33.90  ? 904  TYR A CA  1 
ATOM   6735  C C   . TYR A  1 935  ? 227.440 211.889 161.746 1.00 33.90  ? 904  TYR A C   1 
ATOM   6736  O O   . TYR A  1 935  ? 226.383 212.535 161.756 1.00 33.90  ? 904  TYR A O   1 
ATOM   6737  C CB  . TYR A  1 935  ? 227.447 209.458 161.217 1.00 33.90  ? 904  TYR A CB  1 
ATOM   6738  C CG  . TYR A  1 935  ? 227.294 208.360 160.195 1.00 33.90  ? 904  TYR A CG  1 
ATOM   6739  C CD1 . TYR A  1 935  ? 227.650 208.552 158.870 1.00 33.90  ? 904  TYR A CD1 1 
ATOM   6740  C CD2 . TYR A  1 935  ? 226.789 207.121 160.564 1.00 33.90  ? 904  TYR A CD2 1 
ATOM   6741  C CE1 . TYR A  1 935  ? 227.508 207.542 157.943 1.00 33.90  ? 904  TYR A CE1 1 
ATOM   6742  C CE2 . TYR A  1 935  ? 226.640 206.111 159.645 1.00 33.90  ? 904  TYR A CE2 1 
ATOM   6743  C CZ  . TYR A  1 935  ? 227.003 206.327 158.338 1.00 33.90  ? 904  TYR A CZ  1 
ATOM   6744  O OH  . TYR A  1 935  ? 226.858 205.324 157.415 1.00 33.90  ? 904  TYR A OH  1 
ATOM   6745  N N   . ARG A  1 936  ? 228.377 212.063 162.673 1.00 28.48  ? 905  ARG A N   1 
ATOM   6746  C CA  . ARG A  1 936  ? 228.147 213.040 163.727 1.00 28.48  ? 905  ARG A CA  1 
ATOM   6747  C C   . ARG A  1 936  ? 228.139 214.466 163.192 1.00 28.48  ? 905  ARG A C   1 
ATOM   6748  O O   . ARG A  1 936  ? 227.407 215.308 163.717 1.00 28.48  ? 905  ARG A O   1 
ATOM   6749  C CB  . ARG A  1 936  ? 229.190 212.864 164.825 1.00 28.48  ? 905  ARG A CB  1 
ATOM   6750  C CG  . ARG A  1 936  ? 229.079 211.514 165.492 1.00 28.48  ? 905  ARG A CG  1 
ATOM   6751  C CD  . ARG A  1 936  ? 229.898 211.402 166.739 1.00 28.48  ? 905  ARG A CD  1 
ATOM   6752  N NE  . ARG A  1 936  ? 229.941 210.026 167.223 1.00 28.48  ? 905  ARG A NE  1 
ATOM   6753  C CZ  . ARG A  1 936  ? 229.243 209.566 168.254 1.00 28.48  ? 905  ARG A CZ  1 
ATOM   6754  N NH1 . ARG A  1 936  ? 228.427 210.365 168.916 1.00 28.48  ? 905  ARG A NH1 1 
ATOM   6755  N NH2 . ARG A  1 936  ? 229.357 208.301 168.619 1.00 28.48  ? 905  ARG A NH2 1 
ATOM   6756  N N   . PHE A  1 937  ? 228.948 214.771 162.173 1.00 29.27  ? 906  PHE A N   1 
ATOM   6757  C CA  . PHE A  1 937  ? 228.827 216.075 161.521 1.00 29.27  ? 906  PHE A CA  1 
ATOM   6758  C C   . PHE A  1 937  ? 227.462 216.248 160.866 1.00 29.27  ? 906  PHE A C   1 
ATOM   6759  O O   . PHE A  1 937  ? 226.879 217.333 160.911 1.00 29.27  ? 906  PHE A O   1 
ATOM   6760  C CB  . PHE A  1 937  ? 229.935 216.264 160.490 1.00 29.27  ? 906  PHE A CB  1 
ATOM   6761  C CG  . PHE A  1 937  ? 231.133 216.985 161.015 1.00 29.27  ? 906  PHE A CG  1 
ATOM   6762  C CD1 . PHE A  1 937  ? 231.780 216.545 162.147 1.00 29.27  ? 906  PHE A CD1 1 
ATOM   6763  C CD2 . PHE A  1 937  ? 231.617 218.103 160.372 1.00 29.27  ? 906  PHE A CD2 1 
ATOM   6764  C CE1 . PHE A  1 937  ? 232.878 217.204 162.627 1.00 29.27  ? 906  PHE A CE1 1 
ATOM   6765  C CE2 . PHE A  1 937  ? 232.715 218.765 160.850 1.00 29.27  ? 906  PHE A CE2 1 
ATOM   6766  C CZ  . PHE A  1 937  ? 233.347 218.312 161.978 1.00 29.27  ? 906  PHE A CZ  1 
ATOM   6767  N N   . ASN A  1 938  ? 226.941 215.188 160.240 1.00 32.23  ? 907  ASN A N   1 
ATOM   6768  C CA  . ASN A  1 938  ? 225.575 215.224 159.719 1.00 32.23  ? 907  ASN A CA  1 
ATOM   6769  C C   . ASN A  1 938  ? 224.561 215.519 160.809 1.00 32.23  ? 907  ASN A C   1 
ATOM   6770  O O   . ASN A  1 938  ? 223.503 216.093 160.536 1.00 32.23  ? 907  ASN A O   1 
ATOM   6771  C CB  . ASN A  1 938  ? 225.210 213.899 159.056 1.00 32.23  ? 907  ASN A CB  1 
ATOM   6772  C CG  . ASN A  1 938  ? 225.412 213.918 157.571 1.00 32.23  ? 907  ASN A CG  1 
ATOM   6773  O OD1 . ASN A  1 938  ? 225.236 214.943 156.922 1.00 32.23  ? 907  ASN A OD1 1 
ATOM   6774  N ND2 . ASN A  1 938  ? 225.756 212.771 157.014 1.00 32.23  ? 907  ASN A ND2 1 
ATOM   6775  N N   . GLY A  1 939  ? 224.864 215.138 162.039 1.00 28.70  ? 908  GLY A N   1 
ATOM   6776  C CA  . GLY A  1 939  ? 223.887 215.304 163.094 1.00 28.70  ? 908  GLY A CA  1 
ATOM   6777  C C   . GLY A  1 939  ? 223.817 216.673 163.728 1.00 28.70  ? 908  GLY A C   1 
ATOM   6778  O O   . GLY A  1 939  ? 222.938 216.906 164.560 1.00 28.70  ? 908  GLY A O   1 
ATOM   6779  N N   . ILE A  1 940  ? 224.700 217.597 163.353 1.00 28.74  ? 909  ILE A N   1 
ATOM   6780  C CA  . ILE A  1 940  ? 224.623 218.985 163.787 1.00 28.74  ? 909  ILE A CA  1 
ATOM   6781  C C   . ILE A  1 940  ? 224.306 219.923 162.630 1.00 28.74  ? 909  ILE A C   1 
ATOM   6782  O O   . ILE A  1 940  ? 224.296 221.143 162.814 1.00 28.74  ? 909  ILE A O   1 
ATOM   6783  C CB  . ILE A  1 940  ? 225.909 219.429 164.501 1.00 28.74  ? 909  ILE A CB  1 
ATOM   6784  C CG1 . ILE A  1 940  ? 227.107 219.345 163.555 1.00 28.74  ? 909  ILE A CG1 1 
ATOM   6785  C CG2 . ILE A  1 940  ? 226.148 218.587 165.733 1.00 28.74  ? 909  ILE A CG2 1 
ATOM   6786  C CD1 . ILE A  1 940  ? 228.377 219.911 164.127 1.00 28.74  ? 909  ILE A CD1 1 
ATOM   6787  N N   . GLY A  1 941  ? 224.031 219.388 161.446 1.00 28.60  ? 910  GLY A N   1 
ATOM   6788  C CA  . GLY A  1 941  ? 223.676 220.211 160.310 1.00 28.60  ? 910  GLY A CA  1 
ATOM   6789  C C   . GLY A  1 941  ? 224.802 220.656 159.407 1.00 28.60  ? 910  GLY A C   1 
ATOM   6790  O O   . GLY A  1 941  ? 224.679 221.699 158.760 1.00 28.60  ? 910  GLY A O   1 
ATOM   6791  N N   . VAL A  1 942  ? 225.888 219.894 159.324 1.00 29.32  ? 911  VAL A N   1 
ATOM   6792  C CA  . VAL A  1 942  ? 227.032 220.200 158.472 1.00 29.32  ? 911  VAL A CA  1 
ATOM   6793  C C   . VAL A  1 942  ? 227.234 219.015 157.540 1.00 29.32  ? 911  VAL A C   1 
ATOM   6794  O O   . VAL A  1 942  ? 227.239 217.866 157.991 1.00 29.32  ? 911  VAL A O   1 
ATOM   6795  C CB  . VAL A  1 942  ? 228.303 220.484 159.291 1.00 29.32  ? 911  VAL A CB  1 
ATOM   6796  C CG1 . VAL A  1 942  ? 229.431 220.881 158.381 1.00 29.32  ? 911  VAL A CG1 1 
ATOM   6797  C CG2 . VAL A  1 942  ? 228.049 221.579 160.301 1.00 29.32  ? 911  VAL A CG2 1 
ATOM   6798  N N   . THR A  1 943  ? 227.385 219.283 156.248 1.00 33.97  ? 912  THR A N   1 
ATOM   6799  C CA  . THR A  1 943  ? 227.514 218.197 155.289 1.00 33.97  ? 912  THR A CA  1 
ATOM   6800  C C   . THR A  1 943  ? 228.816 217.419 155.486 1.00 33.97  ? 912  THR A C   1 
ATOM   6801  O O   . THR A  1 943  ? 229.781 217.901 156.080 1.00 33.97  ? 912  THR A O   1 
ATOM   6802  C CB  . THR A  1 943  ? 227.437 218.733 153.860 1.00 33.97  ? 912  THR A CB  1 
ATOM   6803  O OG1 . THR A  1 943  ? 228.466 219.702 153.651 1.00 33.97  ? 912  THR A OG1 1 
ATOM   6804  C CG2 . THR A  1 943  ? 226.101 219.386 153.617 1.00 33.97  ? 912  THR A CG2 1 
ATOM   6805  N N   . GLN A  1 944  ? 228.819 216.185 154.971 1.00 36.65  ? 913  GLN A N   1 
ATOM   6806  C CA  . GLN A  1 944  ? 229.931 215.258 155.167 1.00 36.65  ? 913  GLN A CA  1 
ATOM   6807  C C   . GLN A  1 944  ? 231.212 215.738 154.508 1.00 36.65  ? 913  GLN A C   1 
ATOM   6808  O O   . GLN A  1 944  ? 232.312 215.478 155.017 1.00 36.65  ? 913  GLN A O   1 
ATOM   6809  C CB  . GLN A  1 944  ? 229.568 213.896 154.596 1.00 36.65  ? 913  GLN A CB  1 
ATOM   6810  C CG  . GLN A  1 944  ? 228.512 213.154 155.351 1.00 36.65  ? 913  GLN A CG  1 
ATOM   6811  C CD  . GLN A  1 944  ? 228.097 211.897 154.632 1.00 36.65  ? 913  GLN A CD  1 
ATOM   6812  O OE1 . GLN A  1 944  ? 228.427 211.705 153.465 1.00 36.65  ? 913  GLN A OE1 1 
ATOM   6813  N NE2 . GLN A  1 944  ? 227.372 211.029 155.324 1.00 36.65  ? 913  GLN A NE2 1 
ATOM   6814  N N   . ASN A  1 945  ? 231.101 216.401 153.358 1.00 38.05  ? 914  ASN A N   1 
ATOM   6815  C CA  . ASN A  1 945  ? 232.300 216.788 152.629 1.00 38.05  ? 914  ASN A CA  1 
ATOM   6816  C C   . ASN A  1 945  ? 233.150 217.746 153.446 1.00 38.05  ? 914  ASN A C   1 
ATOM   6817  O O   . ASN A  1 945  ? 234.370 217.795 153.266 1.00 38.05  ? 914  ASN A O   1 
ATOM   6818  C CB  . ASN A  1 945  ? 231.924 217.391 151.276 1.00 38.05  ? 914  ASN A CB  1 
ATOM   6819  C CG  . ASN A  1 945  ? 231.024 218.594 151.399 1.00 38.05  ? 914  ASN A CG  1 
ATOM   6820  O OD1 . ASN A  1 945  ? 229.818 218.460 151.571 1.00 38.05  ? 914  ASN A OD1 1 
ATOM   6821  N ND2 . ASN A  1 945  ? 231.602 219.778 151.297 1.00 38.05  ? 914  ASN A ND2 1 
ATOM   6822  N N   . VAL A  1 946  ? 232.533 218.497 154.358 1.00 35.69  ? 915  VAL A N   1 
ATOM   6823  C CA  . VAL A  1 946  ? 233.296 219.373 155.240 1.00 35.69  ? 915  VAL A CA  1 
ATOM   6824  C C   . VAL A  1 946  ? 234.264 218.560 156.088 1.00 35.69  ? 915  VAL A C   1 
ATOM   6825  O O   . VAL A  1 946  ? 235.445 218.901 156.208 1.00 35.69  ? 915  VAL A O   1 
ATOM   6826  C CB  . VAL A  1 946  ? 232.350 220.217 156.110 1.00 35.69  ? 915  VAL A CB  1 
ATOM   6827  C CG1 . VAL A  1 946  ? 233.138 221.190 156.947 1.00 35.69  ? 915  VAL A CG1 1 
ATOM   6828  C CG2 . VAL A  1 946  ? 231.393 220.973 155.229 1.00 35.69  ? 915  VAL A CG2 1 
ATOM   6829  N N   . LEU A  1 947  ? 233.776 217.491 156.715 1.00 34.95  ? 916  LEU A N   1 
ATOM   6830  C CA  . LEU A  1 947  ? 234.669 216.611 157.461 1.00 34.95  ? 916  LEU A CA  1 
ATOM   6831  C C   . LEU A  1 947  ? 235.712 215.960 156.563 1.00 34.95  ? 916  LEU A C   1 
ATOM   6832  O O   . LEU A  1 947  ? 236.908 215.982 156.871 1.00 34.95  ? 916  LEU A O   1 
ATOM   6833  C CB  . LEU A  1 947  ? 233.882 215.533 158.198 1.00 34.95  ? 916  LEU A CB  1 
ATOM   6834  C CG  . LEU A  1 947  ? 234.879 214.545 158.805 1.00 34.95  ? 916  LEU A CG  1 
ATOM   6835  C CD1 . LEU A  1 947  ? 235.050 214.778 160.280 1.00 34.95  ? 916  LEU A CD1 1 
ATOM   6836  C CD2 . LEU A  1 947  ? 234.470 213.121 158.535 1.00 34.95  ? 916  LEU A CD2 1 
ATOM   6837  N N   . TYR A  1 948  ? 235.284 215.387 155.437 1.00 37.02  ? 917  TYR A N   1 
ATOM   6838  C CA  . TYR A  1 948  ? 236.224 214.597 154.644 1.00 37.02  ? 917  TYR A CA  1 
ATOM   6839  C C   . TYR A  1 948  ? 237.336 215.443 154.037 1.00 37.02  ? 917  TYR A C   1 
ATOM   6840  O O   . TYR A  1 948  ? 238.458 214.954 153.872 1.00 37.02  ? 917  TYR A O   1 
ATOM   6841  C CB  . TYR A  1 948  ? 235.486 213.831 153.552 1.00 37.02  ? 917  TYR A CB  1 
ATOM   6842  C CG  . TYR A  1 948  ? 234.736 212.624 154.065 1.00 37.02  ? 917  TYR A CG  1 
ATOM   6843  C CD1 . TYR A  1 948  ? 235.383 211.620 154.769 1.00 37.02  ? 917  TYR A CD1 1 
ATOM   6844  C CD2 . TYR A  1 948  ? 233.383 212.482 153.830 1.00 37.02  ? 917  TYR A CD2 1 
ATOM   6845  C CE1 . TYR A  1 948  ? 234.696 210.526 155.231 1.00 37.02  ? 917  TYR A CE1 1 
ATOM   6846  C CE2 . TYR A  1 948  ? 232.695 211.392 154.286 1.00 37.02  ? 917  TYR A CE2 1 
ATOM   6847  C CZ  . TYR A  1 948  ? 233.351 210.419 154.984 1.00 37.02  ? 917  TYR A CZ  1 
ATOM   6848  O OH  . TYR A  1 948  ? 232.640 209.335 155.425 1.00 37.02  ? 917  TYR A OH  1 
ATOM   6849  N N   . GLU A  1 949  ? 237.050 216.697 153.693 1.00 41.76  ? 918  GLU A N   1 
ATOM   6850  C CA  . GLU A  1 949  ? 238.067 217.601 153.162 1.00 41.76  ? 918  GLU A CA  1 
ATOM   6851  C C   . GLU A  1 949  ? 239.005 218.153 154.234 1.00 41.76  ? 918  GLU A C   1 
ATOM   6852  O O   . GLU A  1 949  ? 240.172 218.429 153.939 1.00 41.76  ? 918  GLU A O   1 
ATOM   6853  C CB  . GLU A  1 949  ? 237.387 218.723 152.389 1.00 41.76  ? 918  GLU A CB  1 
ATOM   6854  C CG  . GLU A  1 949  ? 236.655 218.210 151.166 1.00 41.76  ? 918  GLU A CG  1 
ATOM   6855  C CD  . GLU A  1 949  ? 235.729 219.238 150.566 1.00 41.76  ? 918  GLU A CD  1 
ATOM   6856  O OE1 . GLU A  1 949  ? 235.547 220.304 151.186 1.00 41.76  ? 918  GLU A OE1 1 
ATOM   6857  O OE2 . GLU A  1 949  ? 235.182 218.980 149.475 1.00 41.76  ? 918  GLU A OE2 1 
ATOM   6858  N N   . ASN A  1 950  ? 238.515 218.365 155.455 1.00 39.21  ? 919  ASN A N   1 
ATOM   6859  C CA  . ASN A  1 950  ? 239.274 218.976 156.542 1.00 39.21  ? 919  ASN A CA  1 
ATOM   6860  C C   . ASN A  1 950  ? 239.731 217.968 157.596 1.00 39.21  ? 919  ASN A C   1 
ATOM   6861  O O   . ASN A  1 950  ? 239.932 218.344 158.750 1.00 39.21  ? 919  ASN A O   1 
ATOM   6862  C CB  . ASN A  1 950  ? 238.441 220.065 157.212 1.00 39.21  ? 919  ASN A CB  1 
ATOM   6863  C CG  . ASN A  1 950  ? 238.034 221.151 156.258 1.00 39.21  ? 919  ASN A CG  1 
ATOM   6864  O OD1 . ASN A  1 950  ? 236.860 221.294 155.932 1.00 39.21  ? 919  ASN A OD1 1 
ATOM   6865  N ND2 . ASN A  1 950  ? 238.999 221.937 155.812 1.00 39.21  ? 919  ASN A ND2 1 
ATOM   6866  N N   . GLN A  1 951  ? 239.883 216.695 157.230 1.00 39.76  ? 920  GLN A N   1 
ATOM   6867  C CA  . GLN A  1 951  ? 240.130 215.644 158.218 1.00 39.76  ? 920  GLN A CA  1 
ATOM   6868  C C   . GLN A  1 951  ? 241.402 215.877 159.030 1.00 39.76  ? 920  GLN A C   1 
ATOM   6869  O O   . GLN A  1 951  ? 241.401 215.701 160.255 1.00 39.76  ? 920  GLN A O   1 
ATOM   6870  C CB  . GLN A  1 951  ? 240.187 214.288 157.523 1.00 39.76  ? 920  GLN A CB  1 
ATOM   6871  C CG  . GLN A  1 951  ? 240.386 213.128 158.463 1.00 39.76  ? 920  GLN A CG  1 
ATOM   6872  C CD  . GLN A  1 951  ? 240.242 211.793 157.774 1.00 39.76  ? 920  GLN A CD  1 
ATOM   6873  O OE1 . GLN A  1 951  ? 239.695 211.704 156.679 1.00 39.76  ? 920  GLN A OE1 1 
ATOM   6874  N NE2 . GLN A  1 951  ? 240.732 210.745 158.413 1.00 39.76  ? 920  GLN A NE2 1 
ATOM   6875  N N   . LYS A  1 952  ? 242.499 216.260 158.374 1.00 44.49  ? 921  LYS A N   1 
ATOM   6876  C CA  . LYS A  1 952  ? 243.755 216.477 159.092 1.00 44.49  ? 921  LYS A CA  1 
ATOM   6877  C C   . LYS A  1 952  ? 243.655 217.615 160.101 1.00 44.49  ? 921  LYS A C   1 
ATOM   6878  O O   . LYS A  1 952  ? 244.140 217.491 161.232 1.00 44.49  ? 921  LYS A O   1 
ATOM   6879  C CB  . LYS A  1 952  ? 244.883 216.770 158.107 1.00 44.49  ? 921  LYS A CB  1 
ATOM   6880  C CG  . LYS A  1 952  ? 245.665 215.565 157.641 1.00 44.49  ? 921  LYS A CG  1 
ATOM   6881  C CD  . LYS A  1 952  ? 245.356 215.235 156.197 1.00 44.49  ? 921  LYS A CD  1 
ATOM   6882  C CE  . LYS A  1 952  ? 246.260 214.128 155.684 1.00 44.49  ? 921  LYS A CE  1 
ATOM   6883  N NZ  . LYS A  1 952  ? 246.019 213.829 154.248 1.00 44.49  ? 921  LYS A NZ  1 
ATOM   6884  N N   . LEU A  1 953  ? 243.032 218.727 159.715 1.00 42.87  ? 922  LEU A N   1 
ATOM   6885  C CA  . LEU A  1 953  ? 242.856 219.842 160.641 1.00 42.87  ? 922  LEU A CA  1 
ATOM   6886  C C   . LEU A  1 953  ? 242.037 219.439 161.861 1.00 42.87  ? 922  LEU A C   1 
ATOM   6887  O O   . LEU A  1 953  ? 242.378 219.796 162.995 1.00 42.87  ? 922  LEU A O   1 
ATOM   6888  C CB  . LEU A  1 953  ? 242.195 221.005 159.903 1.00 42.87  ? 922  LEU A CB  1 
ATOM   6889  C CG  . LEU A  1 953  ? 241.848 222.288 160.649 1.00 42.87  ? 922  LEU A CG  1 
ATOM   6890  C CD1 . LEU A  1 953  ? 243.075 223.146 160.818 1.00 42.87  ? 922  LEU A CD1 1 
ATOM   6891  C CD2 . LEU A  1 953  ? 240.763 223.048 159.905 1.00 42.87  ? 922  LEU A CD2 1 
ATOM   6892  N N   . ILE A  1 954  ? 240.974 218.667 161.649 1.00 39.20  ? 923  ILE A N   1 
ATOM   6893  C CA  . ILE A  1 954  ? 240.110 218.248 162.746 1.00 39.20  ? 923  ILE A CA  1 
ATOM   6894  C C   . ILE A  1 954  ? 240.852 217.312 163.689 1.00 39.20  ? 923  ILE A C   1 
ATOM   6895  O O   . ILE A  1 954  ? 240.747 217.430 164.918 1.00 39.20  ? 923  ILE A O   1 
ATOM   6896  C CB  . ILE A  1 954  ? 238.834 217.603 162.184 1.00 39.20  ? 923  ILE A CB  1 
ATOM   6897  C CG1 . ILE A  1 954  ? 238.084 218.612 161.324 1.00 39.20  ? 923  ILE A CG1 1 
ATOM   6898  C CG2 . ILE A  1 954  ? 237.945 217.111 163.305 1.00 39.20  ? 923  ILE A CG2 1 
ATOM   6899  C CD1 . ILE A  1 954  ? 236.960 218.017 160.553 1.00 39.20  ? 923  ILE A CD1 1 
ATOM   6900  N N   . ALA A  1 955  ? 241.610 216.365 163.133 1.00 39.11  ? 924  ALA A N   1 
ATOM   6901  C CA  . ALA A  1 955  ? 242.378 215.455 163.974 1.00 39.11  ? 924  ALA A CA  1 
ATOM   6902  C C   . ALA A  1 955  ? 243.424 216.199 164.793 1.00 39.11  ? 924  ALA A C   1 
ATOM   6903  O O   . ALA A  1 955  ? 243.607 215.919 165.986 1.00 39.11  ? 924  ALA A O   1 
ATOM   6904  C CB  . ALA A  1 955  ? 243.036 214.383 163.111 1.00 39.11  ? 924  ALA A CB  1 
ATOM   6905  N N   . ASN A  1 956  ? 244.113 217.160 164.175 1.00 39.30  ? 925  ASN A N   1 
ATOM   6906  C CA  . ASN A  1 956  ? 245.103 217.940 164.909 1.00 39.30  ? 925  ASN A CA  1 
ATOM   6907  C C   . ASN A  1 956  ? 244.463 218.738 166.035 1.00 39.30  ? 925  ASN A C   1 
ATOM   6908  O O   . ASN A  1 956  ? 245.012 218.815 167.140 1.00 39.30  ? 925  ASN A O   1 
ATOM   6909  C CB  . ASN A  1 956  ? 245.837 218.875 163.953 1.00 39.30  ? 925  ASN A CB  1 
ATOM   6910  C CG  . ASN A  1 956  ? 246.821 218.150 163.074 1.00 39.30  ? 925  ASN A CG  1 
ATOM   6911  O OD1 . ASN A  1 956  ? 247.368 218.723 162.137 1.00 39.30  ? 925  ASN A OD1 1 
ATOM   6912  N ND2 . ASN A  1 956  ? 247.044 216.877 163.361 1.00 39.30  ? 925  ASN A ND2 1 
ATOM   6913  N N   . GLN A  1 957  ? 243.302 219.343 165.777 1.00 38.84  ? 926  GLN A N   1 
ATOM   6914  C CA  . GLN A  1 957  ? 242.616 220.092 166.826 1.00 38.84  ? 926  GLN A CA  1 
ATOM   6915  C C   . GLN A  1 957  ? 242.200 219.192 167.985 1.00 38.84  ? 926  GLN A C   1 
ATOM   6916  O O   . GLN A  1 957  ? 242.342 219.571 169.154 1.00 38.84  ? 926  GLN A O   1 
ATOM   6917  C CB  . GLN A  1 957  ? 241.407 220.817 166.243 1.00 38.84  ? 926  GLN A CB  1 
ATOM   6918  C CG  . GLN A  1 957  ? 241.770 221.961 165.326 1.00 38.84  ? 926  GLN A CG  1 
ATOM   6919  C CD  . GLN A  1 957  ? 240.562 222.702 164.811 1.00 38.84  ? 926  GLN A CD  1 
ATOM   6920  O OE1 . GLN A  1 957  ? 239.431 222.296 165.042 1.00 38.84  ? 926  GLN A OE1 1 
ATOM   6921  N NE2 . GLN A  1 957  ? 240.797 223.791 164.100 1.00 38.84  ? 926  GLN A NE2 1 
ATOM   6922  N N   . PHE A  1 958  ? 241.692 217.996 167.686 1.00 39.42  ? 927  PHE A N   1 
ATOM   6923  C CA  . PHE A  1 958  ? 241.326 217.070 168.755 1.00 39.42  ? 927  PHE A CA  1 
ATOM   6924  C C   . PHE A  1 958  ? 242.537 216.678 169.600 1.00 39.42  ? 927  PHE A C   1 
ATOM   6925  O O   . PHE A  1 958  ? 242.475 216.678 170.840 1.00 39.42  ? 927  PHE A O   1 
ATOM   6926  C CB  . PHE A  1 958  ? 240.660 215.831 168.161 1.00 39.42  ? 927  PHE A CB  1 
ATOM   6927  C CG  . PHE A  1 958  ? 240.429 214.733 169.157 1.00 39.42  ? 927  PHE A CG  1 
ATOM   6928  C CD1 . PHE A  1 958  ? 239.420 214.834 170.096 1.00 39.42  ? 927  PHE A CD1 1 
ATOM   6929  C CD2 . PHE A  1 958  ? 241.234 213.606 169.167 1.00 39.42  ? 927  PHE A CD2 1 
ATOM   6930  C CE1 . PHE A  1 958  ? 239.215 213.832 171.012 1.00 39.42  ? 927  PHE A CE1 1 
ATOM   6931  C CE2 . PHE A  1 958  ? 241.029 212.605 170.085 1.00 39.42  ? 927  PHE A CE2 1 
ATOM   6932  C CZ  . PHE A  1 958  ? 240.020 212.718 171.006 1.00 39.42  ? 927  PHE A CZ  1 
ATOM   6933  N N   . ASN A  1 959  ? 243.656 216.349 168.946 1.00 40.43  ? 928  ASN A N   1 
ATOM   6934  C CA  . ASN A  1 959  ? 244.846 215.944 169.691 1.00 40.43  ? 928  ASN A CA  1 
ATOM   6935  C C   . ASN A  1 959  ? 245.375 217.082 170.555 1.00 40.43  ? 928  ASN A C   1 
ATOM   6936  O O   . ASN A  1 959  ? 245.778 216.866 171.708 1.00 40.43  ? 928  ASN A O   1 
ATOM   6937  C CB  . ASN A  1 959  ? 245.929 215.457 168.732 1.00 40.43  ? 928  ASN A CB  1 
ATOM   6938  C CG  . ASN A  1 959  ? 245.497 214.255 167.934 1.00 40.43  ? 928  ASN A CG  1 
ATOM   6939  O OD1 . ASN A  1 959  ? 244.596 213.529 168.330 1.00 40.43  ? 928  ASN A OD1 1 
ATOM   6940  N ND2 . ASN A  1 959  ? 246.147 214.032 166.806 1.00 40.43  ? 928  ASN A ND2 1 
ATOM   6941  N N   . SER A  1 960  ? 245.376 218.305 170.018 1.00 41.05  ? 929  SER A N   1 
ATOM   6942  C CA  . SER A  1 960  ? 245.815 219.457 170.798 1.00 41.05  ? 929  SER A CA  1 
ATOM   6943  C C   . SER A  1 960  ? 244.912 219.705 172.002 1.00 41.05  ? 929  SER A C   1 
ATOM   6944  O O   . SER A  1 960  ? 245.396 220.051 173.086 1.00 41.05  ? 929  SER A O   1 
ATOM   6945  C CB  . SER A  1 960  ? 245.872 220.690 169.906 1.00 41.05  ? 929  SER A CB  1 
ATOM   6946  O OG  . SER A  1 960  ? 246.315 221.812 170.639 1.00 41.05  ? 929  SER A OG  1 
ATOM   6947  N N   . ALA A  1 961  ? 243.595 219.554 171.833 1.00 40.99  ? 930  ALA A N   1 
ATOM   6948  C CA  . ALA A  1 961  ? 242.692 219.772 172.960 1.00 40.99  ? 930  ALA A CA  1 
ATOM   6949  C C   . ALA A  1 961  ? 242.908 218.738 174.061 1.00 40.99  ? 930  ALA A C   1 
ATOM   6950  O O   . ALA A  1 961  ? 242.872 219.073 175.254 1.00 40.99  ? 930  ALA A O   1 
ATOM   6951  C CB  . ALA A  1 961  ? 241.245 219.760 172.479 1.00 40.99  ? 930  ALA A CB  1 
ATOM   6952  N N   . ILE A  1 962  ? 243.125 217.474 173.686 1.00 42.61  ? 931  ILE A N   1 
ATOM   6953  C CA  . ILE A  1 962  ? 243.415 216.459 174.699 1.00 42.61  ? 931  ILE A CA  1 
ATOM   6954  C C   . ILE A  1 962  ? 244.720 216.778 175.422 1.00 42.61  ? 931  ILE A C   1 
ATOM   6955  O O   . ILE A  1 962  ? 244.830 216.615 176.647 1.00 42.61  ? 931  ILE A O   1 
ATOM   6956  C CB  . ILE A  1 962  ? 243.448 215.055 174.072 1.00 42.61  ? 931  ILE A CB  1 
ATOM   6957  C CG1 . ILE A  1 962  ? 242.080 214.681 173.515 1.00 42.61  ? 931  ILE A CG1 1 
ATOM   6958  C CG2 . ILE A  1 962  ? 243.849 214.031 175.102 1.00 42.61  ? 931  ILE A CG2 1 
ATOM   6959  C CD1 . ILE A  1 962  ? 240.992 214.637 174.563 1.00 42.61  ? 931  ILE A CD1 1 
ATOM   6960  N N   . GLY A  1 963  ? 245.735 217.225 174.677 1.00 46.39  ? 932  GLY A N   1 
ATOM   6961  C CA  . GLY A  1 963  ? 246.976 217.626 175.322 1.00 46.39  ? 932  GLY A CA  1 
ATOM   6962  C C   . GLY A  1 963  ? 246.794 218.765 176.307 1.00 46.39  ? 932  GLY A C   1 
ATOM   6963  O O   . GLY A  1 963  ? 247.407 218.776 177.377 1.00 46.39  ? 932  GLY A O   1 
ATOM   6964  N N   . LYS A  1 964  ? 245.955 219.743 175.958 1.00 47.11  ? 933  LYS A N   1 
ATOM   6965  C CA  . LYS A  1 964  ? 245.673 220.835 176.887 1.00 47.11  ? 933  LYS A CA  1 
ATOM   6966  C C   . LYS A  1 964  ? 244.985 220.330 178.148 1.00 47.11  ? 933  LYS A C   1 
ATOM   6967  O O   . LYS A  1 964  ? 245.284 220.798 179.251 1.00 47.11  ? 933  LYS A O   1 
ATOM   6968  C CB  . LYS A  1 964  ? 244.833 221.915 176.214 1.00 47.11  ? 933  LYS A CB  1 
ATOM   6969  C CG  . LYS A  1 964  ? 245.549 222.659 175.113 1.00 47.11  ? 933  LYS A CG  1 
ATOM   6970  C CD  . LYS A  1 964  ? 244.635 223.695 174.486 1.00 47.11  ? 933  LYS A CD  1 
ATOM   6971  C CE  . LYS A  1 964  ? 245.346 224.470 173.392 1.00 47.11  ? 933  LYS A CE  1 
ATOM   6972  N NZ  . LYS A  1 964  ? 244.453 225.471 172.754 1.00 47.11  ? 933  LYS A NZ  1 
ATOM   6973  N N   . ILE A  1 965  ? 244.040 219.395 178.008 1.00 46.98  ? 934  ILE A N   1 
ATOM   6974  C CA  . ILE A  1 965  ? 243.404 218.808 179.191 1.00 46.98  ? 934  ILE A CA  1 
ATOM   6975  C C   . ILE A  1 965  ? 244.457 218.182 180.098 1.00 46.98  ? 934  ILE A C   1 
ATOM   6976  O O   . ILE A  1 965  ? 244.496 218.432 181.314 1.00 46.98  ? 934  ILE A O   1 
ATOM   6977  C CB  . ILE A  1 965  ? 242.341 217.771 178.787 1.00 46.98  ? 934  ILE A CB  1 
ATOM   6978  C CG1 . ILE A  1 965  ? 241.151 218.430 178.092 1.00 46.98  ? 934  ILE A CG1 1 
ATOM   6979  C CG2 . ILE A  1 965  ? 241.865 217.011 180.006 1.00 46.98  ? 934  ILE A CG2 1 
ATOM   6980  C CD1 . ILE A  1 965  ? 240.362 219.336 178.979 1.00 46.98  ? 934  ILE A CD1 1 
ATOM   6981  N N   . GLN A  1 966  ? 245.333 217.363 179.511 1.00 56.90  ? 935  GLN A N   1 
ATOM   6982  C CA  . GLN A  1 966  ? 246.376 216.701 180.290 1.00 56.90  ? 935  GLN A CA  1 
ATOM   6983  C C   . GLN A  1 966  ? 247.245 217.720 181.017 1.00 56.90  ? 935  GLN A C   1 
ATOM   6984  O O   . GLN A  1 966  ? 247.494 217.593 182.220 1.00 56.90  ? 935  GLN A O   1 
ATOM   6985  C CB  . GLN A  1 966  ? 247.241 215.825 179.388 1.00 56.90  ? 935  GLN A CB  1 
ATOM   6986  C CG  . GLN A  1 966  ? 248.537 215.399 180.052 1.00 56.90  ? 935  GLN A CG  1 
ATOM   6987  C CD  . GLN A  1 966  ? 249.636 215.084 179.059 1.00 56.90  ? 935  GLN A CD  1 
ATOM   6988  O OE1 . GLN A  1 966  ? 250.136 213.964 179.004 1.00 56.90  ? 935  GLN A OE1 1 
ATOM   6989  N NE2 . GLN A  1 966  ? 250.028 216.079 178.276 1.00 56.90  ? 935  GLN A NE2 1 
ATOM   6990  N N   . ASP A  1 967  ? 247.724 218.737 180.299 1.00 59.73  ? 936  ASP A N   1 
ATOM   6991  C CA  . ASP A  1 967  ? 248.609 219.717 180.917 1.00 59.73  ? 936  ASP A CA  1 
ATOM   6992  C C   . ASP A  1 967  ? 247.891 220.603 181.924 1.00 59.73  ? 936  ASP A C   1 
ATOM   6993  O O   . ASP A  1 967  ? 248.549 221.202 182.778 1.00 59.73  ? 936  ASP A O   1 
ATOM   6994  C CB  . ASP A  1 967  ? 249.262 220.600 179.851 1.00 59.73  ? 936  ASP A CB  1 
ATOM   6995  C CG  . ASP A  1 967  ? 250.338 219.877 179.067 1.00 59.73  ? 936  ASP A CG  1 
ATOM   6996  O OD1 . ASP A  1 967  ? 250.028 219.308 178.001 1.00 59.73  ? 936  ASP A OD1 1 
ATOM   6997  O OD2 . ASP A  1 967  ? 251.502 219.884 179.518 1.00 59.73  ? 936  ASP A OD2 1 
ATOM   6998  N N   . SER A  1 968  ? 246.564 220.708 181.847 1.00 58.20  ? 937  SER A N   1 
ATOM   6999  C CA  . SER A  1 968  ? 245.824 221.435 182.869 1.00 58.20  ? 937  SER A CA  1 
ATOM   7000  C C   . SER A  1 968  ? 245.528 220.603 184.106 1.00 58.20  ? 937  SER A C   1 
ATOM   7001  O O   . SER A  1 968  ? 245.262 221.180 185.165 1.00 58.20  ? 937  SER A O   1 
ATOM   7002  C CB  . SER A  1 968  ? 244.509 221.961 182.293 1.00 58.20  ? 937  SER A CB  1 
ATOM   7003  O OG  . SER A  1 968  ? 243.728 222.586 183.295 1.00 58.20  ? 937  SER A OG  1 
ATOM   7004  N N   . LEU A  1 969  ? 245.555 219.270 184.014 1.00 59.21  ? 938  LEU A N   1 
ATOM   7005  C CA  . LEU A  1 969  ? 245.331 218.494 185.235 1.00 59.21  ? 938  LEU A CA  1 
ATOM   7006  C C   . LEU A  1 969  ? 246.594 218.333 186.073 1.00 59.21  ? 938  LEU A C   1 
ATOM   7007  O O   . LEU A  1 969  ? 246.505 218.264 187.303 1.00 59.21  ? 938  LEU A O   1 
ATOM   7008  C CB  . LEU A  1 969  ? 244.747 217.117 184.914 1.00 59.21  ? 938  LEU A CB  1 
ATOM   7009  C CG  . LEU A  1 969  ? 243.260 217.084 184.561 1.00 59.21  ? 938  LEU A CG  1 
ATOM   7010  C CD1 . LEU A  1 969  ? 242.814 215.676 184.225 1.00 59.21  ? 938  LEU A CD1 1 
ATOM   7011  C CD2 . LEU A  1 969  ? 242.437 217.651 185.704 1.00 59.21  ? 938  LEU A CD2 1 
ATOM   7012  N N   . SER A  1 970  ? 247.765 218.266 185.444 1.00 63.38  ? 939  SER A N   1 
ATOM   7013  C CA  . SER A  1 970  ? 249.033 218.188 186.171 1.00 63.38  ? 939  SER A CA  1 
ATOM   7014  C C   . SER A  1 970  ? 249.545 219.584 186.530 1.00 63.38  ? 939  SER A C   1 
ATOM   7015  O O   . SER A  1 970  ? 250.624 220.011 186.122 1.00 63.38  ? 939  SER A O   1 
ATOM   7016  C CB  . SER A  1 970  ? 250.062 217.412 185.358 1.00 63.38  ? 939  SER A CB  1 
ATOM   7017  O OG  . SER A  1 970  ? 250.072 217.842 184.011 1.00 63.38  ? 939  SER A OG  1 
ATOM   7018  N N   . SER A  1 971  ? 248.743 220.296 187.313 1.00 66.35  ? 940  SER A N   1 
ATOM   7019  C CA  . SER A  1 971  ? 249.077 221.658 187.709 1.00 66.35  ? 940  SER A CA  1 
ATOM   7020  C C   . SER A  1 971  ? 248.295 222.076 188.949 1.00 66.35  ? 940  SER A C   1 
ATOM   7021  O O   . SER A  1 971  ? 248.796 221.985 190.069 1.00 66.35  ? 940  SER A O   1 
ATOM   7022  C CB  . SER A  1 971  ? 248.801 222.629 186.561 1.00 66.35  ? 940  SER A CB  1 
ATOM   7023  O OG  . SER A  1 971  ? 249.289 223.924 186.860 1.00 66.35  ? 940  SER A OG  1 
ATOM   7024  N N   . ALA A  1 975  ? 240.451 221.964 191.671 1.00 59.50  ? 944  ALA A N   1 
ATOM   7025  C CA  . ALA A  1 975  ? 240.047 221.334 190.419 1.00 59.50  ? 944  ALA A CA  1 
ATOM   7026  C C   . ALA A  1 975  ? 238.998 220.253 190.663 1.00 59.50  ? 944  ALA A C   1 
ATOM   7027  O O   . ALA A  1 975  ? 238.048 220.112 189.891 1.00 59.50  ? 944  ALA A O   1 
ATOM   7028  C CB  . ALA A  1 975  ? 241.253 220.749 189.707 1.00 59.50  ? 944  ALA A CB  1 
ATOM   7029  N N   . LEU A  1 976  ? 239.167 219.497 191.747 1.00 49.30  ? 945  LEU A N   1 
ATOM   7030  C CA  . LEU A  1 976  ? 238.202 218.467 192.107 1.00 49.30  ? 945  LEU A CA  1 
ATOM   7031  C C   . LEU A  1 976  ? 237.600 218.748 193.477 1.00 49.30  ? 945  LEU A C   1 
ATOM   7032  O O   . LEU A  1 976  ? 237.539 217.857 194.327 1.00 49.30  ? 945  LEU A O   1 
ATOM   7033  C CB  . LEU A  1 976  ? 238.861 217.087 192.088 1.00 49.30  ? 945  LEU A CB  1 
ATOM   7034  C CG  . LEU A  1 976  ? 239.356 216.574 190.734 1.00 49.30  ? 945  LEU A CG  1 
ATOM   7035  C CD1 . LEU A  1 976  ? 240.110 215.271 190.894 1.00 49.30  ? 945  LEU A CD1 1 
ATOM   7036  C CD2 . LEU A  1 976  ? 238.209 216.393 189.774 1.00 49.30  ? 945  LEU A CD2 1 
ATOM   7037  N N   . GLY A  1 977  ? 237.173 219.990 193.704 1.00 46.43  ? 946  GLY A N   1 
ATOM   7038  C CA  . GLY A  1 977  ? 236.590 220.346 194.988 1.00 46.43  ? 946  GLY A CA  1 
ATOM   7039  C C   . GLY A  1 977  ? 235.285 219.628 195.274 1.00 46.43  ? 946  GLY A C   1 
ATOM   7040  O O   . GLY A  1 977  ? 235.003 219.266 196.420 1.00 46.43  ? 946  GLY A O   1 
ATOM   7041  N N   . LYS A  1 978  ? 234.475 219.407 194.235 1.00 42.44  ? 947  LYS A N   1 
ATOM   7042  C CA  . LYS A  1 978  ? 233.215 218.688 194.400 1.00 42.44  ? 947  LYS A CA  1 
ATOM   7043  C C   . LYS A  1 978  ? 233.419 217.289 194.953 1.00 42.44  ? 947  LYS A C   1 
ATOM   7044  O O   . LYS A  1 978  ? 232.526 216.750 195.612 1.00 42.44  ? 947  LYS A O   1 
ATOM   7045  C CB  . LYS A  1 978  ? 232.476 218.613 193.065 1.00 42.44  ? 947  LYS A CB  1 
ATOM   7046  C CG  . LYS A  1 978  ? 231.845 219.914 192.632 1.00 42.44  ? 947  LYS A CG  1 
ATOM   7047  C CD  . LYS A  1 978  ? 231.037 219.733 191.364 1.00 42.44  ? 947  LYS A CD  1 
ATOM   7048  C CE  . LYS A  1 978  ? 230.386 221.037 190.945 1.00 42.44  ? 947  LYS A CE  1 
ATOM   7049  N NZ  . LYS A  1 978  ? 229.334 221.463 191.906 1.00 42.44  ? 947  LYS A NZ  1 
ATOM   7050  N N   . LEU A  1 979  ? 234.565 216.676 194.686 1.00 40.10  ? 948  LEU A N   1 
ATOM   7051  C CA  . LEU A  1 979  ? 234.823 215.331 195.168 1.00 40.10  ? 948  LEU A CA  1 
ATOM   7052  C C   . LEU A  1 979  ? 235.579 215.315 196.485 1.00 40.10  ? 948  LEU A C   1 
ATOM   7053  O O   . LEU A  1 979  ? 235.493 214.328 197.222 1.00 40.10  ? 948  LEU A O   1 
ATOM   7054  C CB  . LEU A  1 979  ? 235.619 214.550 194.121 1.00 40.10  ? 948  LEU A CB  1 
ATOM   7055  C CG  . LEU A  1 979  ? 234.928 214.227 192.799 1.00 40.10  ? 948  LEU A CG  1 
ATOM   7056  C CD1 . LEU A  1 979  ? 235.759 213.258 192.010 1.00 40.10  ? 948  LEU A CD1 1 
ATOM   7057  C CD2 . LEU A  1 979  ? 233.561 213.649 193.044 1.00 40.10  ? 948  LEU A CD2 1 
ATOM   7058  N N   . GLN A  1 980  ? 236.317 216.380 196.794 1.00 42.01  ? 949  GLN A N   1 
ATOM   7059  C CA  . GLN A  1 980  ? 237.012 216.484 198.069 1.00 42.01  ? 949  GLN A CA  1 
ATOM   7060  C C   . GLN A  1 980  ? 236.082 216.897 199.204 1.00 42.01  ? 949  GLN A C   1 
ATOM   7061  O O   . GLN A  1 980  ? 236.296 216.496 200.356 1.00 42.01  ? 949  GLN A O   1 
ATOM   7062  C CB  . GLN A  1 980  ? 238.166 217.478 197.939 1.00 42.01  ? 949  GLN A CB  1 
ATOM   7063  C CG  . GLN A  1 980  ? 239.095 217.550 199.137 1.00 42.01  ? 949  GLN A CG  1 
ATOM   7064  C CD  . GLN A  1 980  ? 239.863 216.264 199.352 1.00 42.01  ? 949  GLN A CD  1 
ATOM   7065  O OE1 . GLN A  1 980  ? 240.675 215.874 198.521 1.00 42.01  ? 949  GLN A OE1 1 
ATOM   7066  N NE2 . GLN A  1 980  ? 239.617 215.602 200.471 1.00 42.01  ? 949  GLN A NE2 1 
ATOM   7067  N N   . ASP A  1 981  ? 235.030 217.663 198.906 1.00 43.00  ? 950  ASP A N   1 
ATOM   7068  C CA  . ASP A  1 981  ? 234.155 218.120 199.981 1.00 43.00  ? 950  ASP A CA  1 
ATOM   7069  C C   . ASP A  1 981  ? 233.321 216.991 200.569 1.00 43.00  ? 950  ASP A C   1 
ATOM   7070  O O   . ASP A  1 981  ? 232.960 217.052 201.746 1.00 43.00  ? 950  ASP A O   1 
ATOM   7071  C CB  . ASP A  1 981  ? 233.258 219.259 199.499 1.00 43.00  ? 950  ASP A CB  1 
ATOM   7072  C CG  . ASP A  1 981  ? 232.380 218.872 198.329 1.00 43.00  ? 950  ASP A CG  1 
ATOM   7073  O OD1 . ASP A  1 981  ? 232.091 217.672 198.150 1.00 43.00  ? 950  ASP A OD1 1 
ATOM   7074  O OD2 . ASP A  1 981  ? 231.967 219.782 197.580 1.00 43.00  ? 950  ASP A OD2 1 
ATOM   7075  N N   . VAL A  1 982  ? 233.013 215.957 199.788 1.00 38.92  ? 951  VAL A N   1 
ATOM   7076  C CA  . VAL A  1 982  ? 232.303 214.799 200.331 1.00 38.92  ? 951  VAL A CA  1 
ATOM   7077  C C   . VAL A  1 982  ? 233.151 214.101 201.390 1.00 38.92  ? 951  VAL A C   1 
ATOM   7078  O O   . VAL A  1 982  ? 232.676 213.776 202.492 1.00 38.92  ? 951  VAL A O   1 
ATOM   7079  C CB  . VAL A  1 982  ? 231.924 213.838 199.189 1.00 38.92  ? 951  VAL A CB  1 
ATOM   7080  C CG1 . VAL A  1 982  ? 231.310 212.567 199.729 1.00 38.92  ? 951  VAL A CG1 1 
ATOM   7081  C CG2 . VAL A  1 982  ? 230.983 214.520 198.221 1.00 38.92  ? 951  VAL A CG2 1 
ATOM   7082  N N   . VAL A  1 983  ? 234.432 213.895 201.080 1.00 38.86  ? 952  VAL A N   1 
ATOM   7083  C CA  . VAL A  1 983  ? 235.369 213.303 202.029 1.00 38.86  ? 952  VAL A CA  1 
ATOM   7084  C C   . VAL A  1 983  ? 235.480 214.164 203.278 1.00 38.86  ? 952  VAL A C   1 
ATOM   7085  O O   . VAL A  1 983  ? 235.428 213.665 204.413 1.00 38.86  ? 952  VAL A O   1 
ATOM   7086  C CB  . VAL A  1 983  ? 236.743 213.122 201.359 1.00 38.86  ? 952  VAL A CB  1 
ATOM   7087  C CG1 . VAL A  1 983  ? 237.729 212.486 202.313 1.00 38.86  ? 952  VAL A CG1 1 
ATOM   7088  C CG2 . VAL A  1 983  ? 236.617 212.319 200.086 1.00 38.86  ? 952  VAL A CG2 1 
ATOM   7089  N N   . ASN A  1 984  ? 235.616 215.477 203.085 1.00 36.81  ? 953  ASN A N   1 
ATOM   7090  C CA  . ASN A  1 984  ? 235.763 216.375 204.223 1.00 36.81  ? 953  ASN A CA  1 
ATOM   7091  C C   . ASN A  1 984  ? 234.526 216.364 205.111 1.00 36.81  ? 953  ASN A C   1 
ATOM   7092  O O   . ASN A  1 984  ? 234.640 216.370 206.341 1.00 36.81  ? 953  ASN A O   1 
ATOM   7093  C CB  . ASN A  1 984  ? 236.062 217.785 203.728 1.00 36.81  ? 953  ASN A CB  1 
ATOM   7094  C CG  . ASN A  1 984  ? 237.449 217.911 203.145 1.00 36.81  ? 953  ASN A CG  1 
ATOM   7095  O OD1 . ASN A  1 984  ? 238.201 216.943 203.091 1.00 36.81  ? 953  ASN A OD1 1 
ATOM   7096  N ND2 . ASN A  1 984  ? 237.792 219.106 202.690 1.00 36.81  ? 953  ASN A ND2 1 
ATOM   7097  N N   . GLN A  1 985  ? 233.335 216.332 204.512 1.00 37.30  ? 954  GLN A N   1 
ATOM   7098  C CA  . GLN A  1 985  ? 232.111 216.338 205.306 1.00 37.30  ? 954  GLN A CA  1 
ATOM   7099  C C   . GLN A  1 985  ? 231.960 215.061 206.122 1.00 37.30  ? 954  GLN A C   1 
ATOM   7100  O O   . GLN A  1 985  ? 231.610 215.117 207.308 1.00 37.30  ? 954  GLN A O   1 
ATOM   7101  C CB  . GLN A  1 985  ? 230.896 216.551 204.409 1.00 37.30  ? 954  GLN A CB  1 
ATOM   7102  C CG  . GLN A  1 985  ? 230.736 217.981 203.938 1.00 37.30  ? 954  GLN A CG  1 
ATOM   7103  C CD  . GLN A  1 985  ? 229.714 218.118 202.833 1.00 37.30  ? 954  GLN A CD  1 
ATOM   7104  O OE1 . GLN A  1 985  ? 229.782 217.431 201.816 1.00 37.30  ? 954  GLN A OE1 1 
ATOM   7105  N NE2 . GLN A  1 985  ? 228.758 219.017 203.026 1.00 37.30  ? 954  GLN A NE2 1 
ATOM   7106  N N   . ASN A  1 986  ? 232.215 213.900 205.512 1.00 35.85  ? 955  ASN A N   1 
ATOM   7107  C CA  . ASN A  1 986  ? 232.110 212.652 206.268 1.00 35.85  ? 955  ASN A CA  1 
ATOM   7108  C C   . ASN A  1 986  ? 233.115 212.613 207.420 1.00 35.85  ? 955  ASN A C   1 
ATOM   7109  O O   . ASN A  1 986  ? 232.768 212.254 208.562 1.00 35.85  ? 955  ASN A O   1 
ATOM   7110  C CB  . ASN A  1 986  ? 232.312 211.463 205.329 1.00 35.85  ? 955  ASN A CB  1 
ATOM   7111  C CG  . ASN A  1 986  ? 231.299 211.433 204.193 1.00 35.85  ? 955  ASN A CG  1 
ATOM   7112  O OD1 . ASN A  1 986  ? 230.131 211.773 204.373 1.00 35.85  ? 955  ASN A OD1 1 
ATOM   7113  N ND2 . ASN A  1 986  ? 231.748 211.022 203.015 1.00 35.85  ? 955  ASN A ND2 1 
ATOM   7114  N N   . ALA A  1 987  ? 234.365 213.002 207.147 1.00 33.49  ? 956  ALA A N   1 
ATOM   7115  C CA  . ALA A  1 987  ? 235.380 212.999 208.196 1.00 33.49  ? 956  ALA A CA  1 
ATOM   7116  C C   . ALA A  1 987  ? 235.004 213.940 209.330 1.00 33.49  ? 956  ALA A C   1 
ATOM   7117  O O   . ALA A  1 987  ? 235.154 213.601 210.513 1.00 33.49  ? 956  ALA A O   1 
ATOM   7118  C CB  . ALA A  1 987  ? 236.734 213.384 207.612 1.00 33.49  ? 956  ALA A CB  1 
ATOM   7119  N N   . GLN A  1 988  ? 234.514 215.131 208.984 1.00 35.95  ? 957  GLN A N   1 
ATOM   7120  C CA  . GLN A  1 988  ? 234.149 216.119 209.987 1.00 35.95  ? 957  GLN A CA  1 
ATOM   7121  C C   . GLN A  1 988  ? 232.995 215.638 210.853 1.00 35.95  ? 957  GLN A C   1 
ATOM   7122  O O   . GLN A  1 988  ? 232.988 215.868 212.066 1.00 35.95  ? 957  GLN A O   1 
ATOM   7123  C CB  . GLN A  1 988  ? 233.803 217.433 209.297 1.00 35.95  ? 957  GLN A CB  1 
ATOM   7124  C CG  . GLN A  1 988  ? 233.270 218.500 210.213 1.00 35.95  ? 957  GLN A CG  1 
ATOM   7125  C CD  . GLN A  1 988  ? 233.492 219.885 209.654 1.00 35.95  ? 957  GLN A CD  1 
ATOM   7126  O OE1 . GLN A  1 988  ? 232.802 220.310 208.727 1.00 35.95  ? 957  GLN A OE1 1 
ATOM   7127  N NE2 . GLN A  1 988  ? 234.464 220.599 210.209 1.00 35.95  ? 957  GLN A NE2 1 
ATOM   7128  N N   . ALA A  1 989  ? 232.013 214.959 210.257 1.00 31.86  ? 958  ALA A N   1 
ATOM   7129  C CA  . ALA A  1 989  ? 230.903 214.449 211.055 1.00 31.86  ? 958  ALA A CA  1 
ATOM   7130  C C   . ALA A  1 989  ? 231.367 213.402 212.062 1.00 31.86  ? 958  ALA A C   1 
ATOM   7131  O O   . ALA A  1 989  ? 230.954 213.428 213.232 1.00 31.86  ? 958  ALA A O   1 
ATOM   7132  C CB  . ALA A  1 989  ? 229.830 213.872 210.139 1.00 31.86  ? 958  ALA A CB  1 
ATOM   7133  N N   . LEU A  1 990  ? 232.228 212.471 211.637 1.00 30.97  ? 959  LEU A N   1 
ATOM   7134  C CA  . LEU A  1 990  ? 232.705 211.465 212.590 1.00 30.97  ? 959  LEU A CA  1 
ATOM   7135  C C   . LEU A  1 990  ? 233.556 212.082 213.702 1.00 30.97  ? 959  LEU A C   1 
ATOM   7136  O O   . LEU A  1 990  ? 233.439 211.696 214.877 1.00 30.97  ? 959  LEU A O   1 
ATOM   7137  C CB  . LEU A  1 990  ? 233.483 210.371 211.863 1.00 30.97  ? 959  LEU A CB  1 
ATOM   7138  C CG  . LEU A  1 990  ? 232.662 209.365 211.063 1.00 30.97  ? 959  LEU A CG  1 
ATOM   7139  C CD1 . LEU A  1 990  ? 233.551 208.288 210.502 1.00 30.97  ? 959  LEU A CD1 1 
ATOM   7140  C CD2 . LEU A  1 990  ? 231.605 208.755 211.950 1.00 30.97  ? 959  LEU A CD2 1 
ATOM   7141  N N   . ASN A  1 991  ? 234.399 213.060 213.369 1.00 33.96  ? 960  ASN A N   1 
ATOM   7142  C CA  . ASN A  1 991  ? 235.204 213.674 214.419 1.00 33.96  ? 960  ASN A CA  1 
ATOM   7143  C C   . ASN A  1 991  ? 234.366 214.528 215.361 1.00 33.96  ? 960  ASN A C   1 
ATOM   7144  O O   . ASN A  1 991  ? 234.687 214.629 216.550 1.00 33.96  ? 960  ASN A O   1 
ATOM   7145  C CB  . ASN A  1 991  ? 236.331 214.502 213.810 1.00 33.96  ? 960  ASN A CB  1 
ATOM   7146  C CG  . ASN A  1 991  ? 237.393 213.643 213.163 1.00 33.96  ? 960  ASN A CG  1 
ATOM   7147  O OD1 . ASN A  1 991  ? 237.848 212.659 213.739 1.00 33.96  ? 960  ASN A OD1 1 
ATOM   7148  N ND2 . ASN A  1 991  ? 237.810 214.025 211.968 1.00 33.96  ? 960  ASN A ND2 1 
ATOM   7149  N N   . THR A  1 992  ? 233.296 215.148 214.864 1.00 31.76  ? 961  THR A N   1 
ATOM   7150  C CA  . THR A  1 992  ? 232.392 215.877 215.748 1.00 31.76  ? 961  THR A CA  1 
ATOM   7151  C C   . THR A  1 992  ? 231.680 214.937 216.711 1.00 31.76  ? 961  THR A C   1 
ATOM   7152  O O   . THR A  1 992  ? 231.518 215.259 217.896 1.00 31.76  ? 961  THR A O   1 
ATOM   7153  C CB  . THR A  1 992  ? 231.382 216.673 214.925 1.00 31.76  ? 961  THR A CB  1 
ATOM   7154  O OG1 . THR A  1 992  ? 232.052 217.743 214.256 1.00 31.76  ? 961  THR A OG1 1 
ATOM   7155  C CG2 . THR A  1 992  ? 230.319 217.262 215.812 1.00 31.76  ? 961  THR A CG2 1 
ATOM   7156  N N   . LEU A  1 993  ? 231.267 213.760 216.234 1.00 28.33  ? 962  LEU A N   1 
ATOM   7157  C CA  . LEU A  1 993  ? 230.695 212.778 217.151 1.00 28.33  ? 962  LEU A CA  1 
ATOM   7158  C C   . LEU A  1 993  ? 231.683 212.376 218.235 1.00 28.33  ? 962  LEU A C   1 
ATOM   7159  O O   . LEU A  1 993  ? 231.307 212.245 219.405 1.00 28.33  ? 962  LEU A O   1 
ATOM   7160  C CB  . LEU A  1 993  ? 230.245 211.527 216.400 1.00 28.33  ? 962  LEU A CB  1 
ATOM   7161  C CG  . LEU A  1 993  ? 228.787 211.319 216.010 1.00 28.33  ? 962  LEU A CG  1 
ATOM   7162  C CD1 . LEU A  1 993  ? 228.642 209.930 215.462 1.00 28.33  ? 962  LEU A CD1 1 
ATOM   7163  C CD2 . LEU A  1 993  ? 227.861 211.510 217.185 1.00 28.33  ? 962  LEU A CD2 1 
ATOM   7164  N N   . VAL A  1 994  ? 232.951 212.184 217.876 1.00 32.72  ? 963  VAL A N   1 
ATOM   7165  C CA  . VAL A  1 994  ? 233.938 211.832 218.898 1.00 32.72  ? 963  VAL A CA  1 
ATOM   7166  C C   . VAL A  1 994  ? 234.157 212.973 219.890 1.00 32.72  ? 963  VAL A C   1 
ATOM   7167  O O   . VAL A  1 994  ? 234.321 212.739 221.091 1.00 32.72  ? 963  VAL A O   1 
ATOM   7168  C CB  . VAL A  1 994  ? 235.252 211.387 218.237 1.00 32.72  ? 963  VAL A CB  1 
ATOM   7169  C CG1 . VAL A  1 994  ? 236.319 211.168 219.280 1.00 32.72  ? 963  VAL A CG1 1 
ATOM   7170  C CG2 . VAL A  1 994  ? 235.024 210.108 217.475 1.00 32.72  ? 963  VAL A CG2 1 
ATOM   7171  N N   . LYS A  1 995  ? 234.163 214.220 219.417 1.00 36.77  ? 964  LYS A N   1 
ATOM   7172  C CA  . LYS A  1 995  ? 234.389 215.346 220.325 1.00 36.77  ? 964  LYS A CA  1 
ATOM   7173  C C   . LYS A  1 995  ? 233.217 215.600 221.264 1.00 36.77  ? 964  LYS A C   1 
ATOM   7174  O O   . LYS A  1 995  ? 233.424 216.064 222.388 1.00 36.77  ? 964  LYS A O   1 
ATOM   7175  C CB  . LYS A  1 995  ? 234.701 216.614 219.538 1.00 36.77  ? 964  LYS A CB  1 
ATOM   7176  C CG  . LYS A  1 995  ? 236.103 216.656 218.983 1.00 36.77  ? 964  LYS A CG  1 
ATOM   7177  C CD  . LYS A  1 995  ? 236.362 217.950 218.250 1.00 36.77  ? 964  LYS A CD  1 
ATOM   7178  C CE  . LYS A  1 995  ? 237.782 217.997 217.717 1.00 36.77  ? 964  LYS A CE  1 
ATOM   7179  N NZ  . LYS A  1 995  ? 238.019 216.958 216.679 1.00 36.77  ? 964  LYS A NZ  1 
ATOM   7180  N N   . GLN A  1 996  ? 231.999 215.321 220.837 1.00 36.14  ? 965  GLN A N   1 
ATOM   7181  C CA  . GLN A  1 996  ? 230.829 215.585 221.694 1.00 36.14  ? 965  GLN A CA  1 
ATOM   7182  C C   . GLN A  1 996  ? 230.713 214.658 222.906 1.00 36.14  ? 965  GLN A C   1 
ATOM   7183  O O   . GLN A  1 996  ? 229.684 214.705 223.572 1.00 36.14  ? 965  GLN A O   1 
ATOM   7184  C CB  . GLN A  1 996  ? 229.557 215.520 220.857 1.00 36.14  ? 965  GLN A CB  1 
ATOM   7185  C CG  . GLN A  1 996  ? 229.340 216.774 220.052 1.00 36.14  ? 965  GLN A CG  1 
ATOM   7186  C CD  . GLN A  1 996  ? 228.286 216.617 218.998 1.00 36.14  ? 965  GLN A CD  1 
ATOM   7187  O OE1 . GLN A  1 996  ? 227.846 215.513 218.704 1.00 36.14  ? 965  GLN A OE1 1 
ATOM   7188  N NE2 . GLN A  1 996  ? 227.881 217.727 218.404 1.00 36.14  ? 965  GLN A NE2 1 
ATOM   7189  N N   . LEU A  1 997  ? 231.680 213.797 223.201 1.00 32.96  ? 966  LEU A N   1 
ATOM   7190  C CA  . LEU A  1 997  ? 231.639 212.924 224.367 1.00 32.96  ? 966  LEU A CA  1 
ATOM   7191  C C   . LEU A  1 997  ? 232.121 213.604 225.640 1.00 32.96  ? 966  LEU A C   1 
ATOM   7192  O O   . LEU A  1 997  ? 232.115 212.968 226.697 1.00 32.96  ? 966  LEU A O   1 
ATOM   7193  C CB  . LEU A  1 997  ? 232.463 211.661 224.122 1.00 32.96  ? 966  LEU A CB  1 
ATOM   7194  C CG  . LEU A  1 997  ? 231.770 210.546 223.352 1.00 32.96  ? 966  LEU A CG  1 
ATOM   7195  C CD1 . LEU A  1 997  ? 232.766 209.496 222.965 1.00 32.96  ? 966  LEU A CD1 1 
ATOM   7196  C CD2 . LEU A  1 997  ? 230.690 209.950 224.206 1.00 32.96  ? 966  LEU A CD2 1 
ATOM   7197  N N   . SER A  1 998  ? 232.541 214.865 225.571 1.00 37.61  ? 967  SER A N   1 
ATOM   7198  C CA  . SER A  1 998  ? 233.001 215.607 226.736 1.00 37.61  ? 967  SER A CA  1 
ATOM   7199  C C   . SER A  1 998  ? 231.952 216.552 227.309 1.00 37.61  ? 967  SER A C   1 
ATOM   7200  O O   . SER A  1 998  ? 232.289 217.400 228.139 1.00 37.61  ? 967  SER A O   1 
ATOM   7201  C CB  . SER A  1 998  ? 234.252 216.399 226.381 1.00 37.61  ? 967  SER A CB  1 
ATOM   7202  O OG  . SER A  1 998  ? 233.931 217.451 225.493 1.00 37.61  ? 967  SER A OG  1 
ATOM   7203  N N   . SER A  1 999  ? 230.703 216.443 226.874 1.00 38.35  ? 968  SER A N   1 
ATOM   7204  C CA  . SER A  1 999  ? 229.618 217.255 227.403 1.00 38.35  ? 968  SER A CA  1 
ATOM   7205  C C   . SER A  1 999  ? 229.019 216.621 228.653 1.00 38.35  ? 968  SER A C   1 
ATOM   7206  O O   . SER A  1 999  ? 228.805 215.408 228.703 1.00 38.35  ? 968  SER A O   1 
ATOM   7207  C CB  . SER A  1 999  ? 228.536 217.431 226.344 1.00 38.35  ? 968  SER A CB  1 
ATOM   7208  O OG  . SER A  1 999  ? 229.067 218.024 225.180 1.00 38.35  ? 968  SER A OG  1 
ATOM   7209  N N   . ASN A  1 1000 ? 228.762 217.448 229.672 1.00 39.16  ? 969  ASN A N   1 
ATOM   7210  C CA  . ASN A  1 1000 ? 228.136 216.960 230.898 1.00 39.16  ? 969  ASN A CA  1 
ATOM   7211  C C   . ASN A  1 1000 ? 226.637 216.740 230.741 1.00 39.16  ? 969  ASN A C   1 
ATOM   7212  O O   . ASN A  1 1000 ? 226.080 215.848 231.387 1.00 39.16  ? 969  ASN A O   1 
ATOM   7213  C CB  . ASN A  1 1000 ? 228.374 217.934 232.050 1.00 39.16  ? 969  ASN A CB  1 
ATOM   7214  C CG  . ASN A  1 1000 ? 229.829 218.207 232.292 1.00 39.16  ? 969  ASN A CG  1 
ATOM   7215  O OD1 . ASN A  1 1000 ? 230.287 219.335 232.164 1.00 39.16  ? 969  ASN A OD1 1 
ATOM   7216  N ND2 . ASN A  1 1000 ? 230.563 217.183 232.677 1.00 39.16  ? 969  ASN A ND2 1 
ATOM   7217  N N   . PHE A  1 1001 ? 225.973 217.546 229.911 1.00 36.45  ? 970  PHE A N   1 
ATOM   7218  C CA  . PHE A  1 1001 ? 224.515 217.548 229.787 1.00 36.45  ? 970  PHE A CA  1 
ATOM   7219  C C   . PHE A  1 1001 ? 223.819 217.799 231.121 1.00 36.45  ? 970  PHE A C   1 
ATOM   7220  O O   . PHE A  1 1001 ? 222.725 217.289 231.362 1.00 36.45  ? 970  PHE A O   1 
ATOM   7221  C CB  . PHE A  1 1001 ? 223.980 216.253 229.166 1.00 36.45  ? 970  PHE A CB  1 
ATOM   7222  C CG  . PHE A  1 1001 ? 224.523 215.951 227.800 1.00 36.45  ? 970  PHE A CG  1 
ATOM   7223  C CD1 . PHE A  1 1001 ? 225.384 214.891 227.600 1.00 36.45  ? 970  PHE A CD1 1 
ATOM   7224  C CD2 . PHE A  1 1001 ? 224.159 216.720 226.715 1.00 36.45  ? 970  PHE A CD2 1 
ATOM   7225  C CE1 . PHE A  1 1001 ? 225.870 214.612 226.355 1.00 36.45  ? 970  PHE A CE1 1 
ATOM   7226  C CE2 . PHE A  1 1001 ? 224.646 216.446 225.470 1.00 36.45  ? 970  PHE A CE2 1 
ATOM   7227  C CZ  . PHE A  1 1001 ? 225.503 215.391 225.289 1.00 36.45  ? 970  PHE A CZ  1 
ATOM   7228  N N   . GLY A  1 1002 ? 224.424 218.593 231.996 1.00 39.86  ? 971  GLY A N   1 
ATOM   7229  C CA  . GLY A  1 1002 ? 223.831 218.831 233.295 1.00 39.86  ? 971  GLY A CA  1 
ATOM   7230  C C   . GLY A  1 1002 ? 224.108 217.792 234.357 1.00 39.86  ? 971  GLY A C   1 
ATOM   7231  O O   . GLY A  1 1002 ? 223.379 217.737 235.350 1.00 39.86  ? 971  GLY A O   1 
ATOM   7232  N N   . ALA A  1 1003 ? 225.132 216.964 234.187 1.00 40.17  ? 972  ALA A N   1 
ATOM   7233  C CA  . ALA A  1 1003 ? 225.536 216.001 235.199 1.00 40.17  ? 972  ALA A CA  1 
ATOM   7234  C C   . ALA A  1 1003 ? 226.791 216.493 235.912 1.00 40.17  ? 972  ALA A C   1 
ATOM   7235  O O   . ALA A  1 1003 ? 227.393 217.497 235.534 1.00 40.17  ? 972  ALA A O   1 
ATOM   7236  C CB  . ALA A  1 1003 ? 225.774 214.627 234.569 1.00 40.17  ? 972  ALA A CB  1 
ATOM   7237  N N   . ILE A  1 1004 ? 227.171 215.783 236.976 1.00 42.65  ? 973  ILE A N   1 
ATOM   7238  C CA  . ILE A  1 1004 ? 228.328 216.208 237.760 1.00 42.65  ? 973  ILE A CA  1 
ATOM   7239  C C   . ILE A  1 1004 ? 229.602 216.137 236.927 1.00 42.65  ? 973  ILE A C   1 
ATOM   7240  O O   . ILE A  1 1004 ? 230.453 217.031 236.994 1.00 42.65  ? 973  ILE A O   1 
ATOM   7241  C CB  . ILE A  1 1004 ? 228.441 215.389 239.060 1.00 42.65  ? 973  ILE A CB  1 
ATOM   7242  C CG1 . ILE A  1 1004 ? 228.429 213.889 238.783 1.00 42.65  ? 973  ILE A CG1 1 
ATOM   7243  C CG2 . ILE A  1 1004 ? 227.303 215.738 239.994 1.00 42.65  ? 973  ILE A CG2 1 
ATOM   7244  C CD1 . ILE A  1 1004 ? 228.676 213.059 240.012 1.00 42.65  ? 973  ILE A CD1 1 
ATOM   7245  N N   . SER A  1 1005 ? 229.764 215.072 236.146 1.00 41.26  ? 974  SER A N   1 
ATOM   7246  C CA  . SER A  1 1005 ? 230.905 214.918 235.258 1.00 41.26  ? 974  SER A CA  1 
ATOM   7247  C C   . SER A  1 1005 ? 230.445 214.226 233.986 1.00 41.26  ? 974  SER A C   1 
ATOM   7248  O O   . SER A  1 1005 ? 229.328 213.720 233.899 1.00 41.26  ? 974  SER A O   1 
ATOM   7249  C CB  . SER A  1 1005 ? 232.048 214.135 235.913 1.00 41.26  ? 974  SER A CB  1 
ATOM   7250  O OG  . SER A  1 1005 ? 231.555 213.052 236.669 1.00 41.26  ? 974  SER A OG  1 
ATOM   7251  N N   . SER A  1 1006 ? 231.320 214.218 232.988 1.00 39.67  ? 975  SER A N   1 
ATOM   7252  C CA  . SER A  1 1006 ? 231.080 213.508 231.742 1.00 39.67  ? 975  SER A CA  1 
ATOM   7253  C C   . SER A  1 1006 ? 231.738 212.138 231.699 1.00 39.67  ? 975  SER A C   1 
ATOM   7254  O O   . SER A  1 1006 ? 231.623 211.448 230.685 1.00 39.67  ? 975  SER A O   1 
ATOM   7255  C CB  . SER A  1 1006 ? 231.558 214.346 230.556 1.00 39.67  ? 975  SER A CB  1 
ATOM   7256  O OG  . SER A  1 1006 ? 232.912 214.719 230.705 1.00 39.67  ? 975  SER A OG  1 
ATOM   7257  N N   . VAL A  1 1007 ? 232.418 211.726 232.762 1.00 40.77  ? 976  VAL A N   1 
ATOM   7258  C CA  . VAL A  1 1007 ? 233.127 210.452 232.800 1.00 40.77  ? 976  VAL A CA  1 
ATOM   7259  C C   . VAL A  1 1007 ? 232.301 209.470 233.617 1.00 40.77  ? 976  VAL A C   1 
ATOM   7260  O O   . VAL A  1 1007 ? 231.961 209.745 234.772 1.00 40.77  ? 976  VAL A O   1 
ATOM   7261  C CB  . VAL A  1 1007 ? 234.532 210.617 233.396 1.00 40.77  ? 976  VAL A CB  1 
ATOM   7262  C CG1 . VAL A  1 1007 ? 235.243 209.285 233.461 1.00 40.77  ? 976  VAL A CG1 1 
ATOM   7263  C CG2 . VAL A  1 1007 ? 235.334 211.609 232.590 1.00 40.77  ? 976  VAL A CG2 1 
ATOM   7264  N N   . LEU A  1 1008 ? 231.958 208.330 233.013 1.00 40.81  ? 977  LEU A N   1 
ATOM   7265  C CA  . LEU A  1 1008 ? 231.160 207.333 233.717 1.00 40.81  ? 977  LEU A CA  1 
ATOM   7266  C C   . LEU A  1 1008 ? 231.930 206.729 234.880 1.00 40.81  ? 977  LEU A C   1 
ATOM   7267  O O   . LEU A  1 1008 ? 231.351 206.458 235.934 1.00 40.81  ? 977  LEU A O   1 
ATOM   7268  C CB  . LEU A  1 1008 ? 230.710 206.239 232.755 1.00 40.81  ? 977  LEU A CB  1 
ATOM   7269  C CG  . LEU A  1 1008 ? 229.518 206.560 231.865 1.00 40.81  ? 977  LEU A CG  1 
ATOM   7270  C CD1 . LEU A  1 1008 ? 229.295 205.438 230.894 1.00 40.81  ? 977  LEU A CD1 1 
ATOM   7271  C CD2 . LEU A  1 1008 ? 228.291 206.767 232.707 1.00 40.81  ? 977  LEU A CD2 1 
ATOM   7272  N N   . ASN A  1 1009 ? 233.221 206.457 234.690 1.00 45.66  ? 978  ASN A N   1 
ATOM   7273  C CA  . ASN A  1 1009 ? 234.006 205.842 235.755 1.00 45.66  ? 978  ASN A CA  1 
ATOM   7274  C C   . ASN A  1 1009 ? 234.165 206.777 236.942 1.00 45.66  ? 978  ASN A C   1 
ATOM   7275  O O   . ASN A  1 1009 ? 234.268 206.316 238.082 1.00 45.66  ? 978  ASN A O   1 
ATOM   7276  C CB  . ASN A  1 1009 ? 235.378 205.425 235.237 1.00 45.66  ? 978  ASN A CB  1 
ATOM   7277  C CG  . ASN A  1 1009 ? 235.313 204.236 234.318 1.00 45.66  ? 978  ASN A CG  1 
ATOM   7278  O OD1 . ASN A  1 1009 ? 234.425 203.395 234.433 1.00 45.66  ? 978  ASN A OD1 1 
ATOM   7279  N ND2 . ASN A  1 1009 ? 236.257 204.156 233.394 1.00 45.66  ? 978  ASN A ND2 1 
ATOM   7280  N N   . ASP A  1 1010 ? 234.231 208.084 236.691 1.00 45.35  ? 979  ASP A N   1 
ATOM   7281  C CA  . ASP A  1 1010 ? 234.297 209.045 237.782 1.00 45.35  ? 979  ASP A CA  1 
ATOM   7282  C C   . ASP A  1 1010 ? 233.006 209.062 238.587 1.00 45.35  ? 979  ASP A C   1 
ATOM   7283  O O   . ASP A  1 1010 ? 233.035 209.227 239.807 1.00 45.35  ? 979  ASP A O   1 
ATOM   7284  C CB  . ASP A  1 1010 ? 234.592 210.431 237.217 1.00 45.35  ? 979  ASP A CB  1 
ATOM   7285  C CG  . ASP A  1 1010 ? 234.807 211.465 238.291 1.00 45.35  ? 979  ASP A CG  1 
ATOM   7286  O OD1 . ASP A  1 1010 ? 235.926 211.527 238.837 1.00 45.35  ? 979  ASP A OD1 1 
ATOM   7287  O OD2 . ASP A  1 1010 ? 233.859 212.217 238.597 1.00 45.35  ? 979  ASP A OD2 1 
ATOM   7288  N N   . ILE A  1 1011 ? 231.861 208.934 237.915 1.00 43.43  ? 980  ILE A N   1 
ATOM   7289  C CA  . ILE A  1 1011 ? 230.577 208.916 238.608 1.00 43.43  ? 980  ILE A CA  1 
ATOM   7290  C C   . ILE A  1 1011 ? 230.368 207.603 239.359 1.00 43.43  ? 980  ILE A C   1 
ATOM   7291  O O   . ILE A  1 1011 ? 229.851 207.594 240.479 1.00 43.43  ? 980  ILE A O   1 
ATOM   7292  C CB  . ILE A  1 1011 ? 229.436 209.182 237.610 1.00 43.43  ? 980  ILE A CB  1 
ATOM   7293  C CG1 . ILE A  1 1011 ? 229.628 210.539 236.935 1.00 43.43  ? 980  ILE A CG1 1 
ATOM   7294  C CG2 . ILE A  1 1011 ? 228.093 209.130 238.307 1.00 43.43  ? 980  ILE A CG2 1 
ATOM   7295  C CD1 . ILE A  1 1011 ? 228.545 210.897 235.946 1.00 43.43  ? 980  ILE A CD1 1 
ATOM   7296  N N   . LEU A  1 1012 ? 230.745 206.474 238.749 1.00 44.21  ? 981  LEU A N   1 
ATOM   7297  C CA  . LEU A  1 1012 ? 230.477 205.166 239.346 1.00 44.21  ? 981  LEU A CA  1 
ATOM   7298  C C   . LEU A  1 1012 ? 231.269 204.943 240.625 1.00 44.21  ? 981  LEU A C   1 
ATOM   7299  O O   . LEU A  1 1012 ? 230.751 204.364 241.584 1.00 44.21  ? 981  LEU A O   1 
ATOM   7300  C CB  . LEU A  1 1012 ? 230.768 204.058 238.339 1.00 44.21  ? 981  LEU A CB  1 
ATOM   7301  C CG  . LEU A  1 1012 ? 229.761 203.900 237.204 1.00 44.21  ? 981  LEU A CG  1 
ATOM   7302  C CD1 . LEU A  1 1012 ? 230.052 202.661 236.401 1.00 44.21  ? 981  LEU A CD1 1 
ATOM   7303  C CD2 . LEU A  1 1012 ? 228.378 203.818 237.784 1.00 44.21  ? 981  LEU A CD2 1 
ATOM   7304  N N   . SER A  1 1013 ? 232.522 205.371 240.659 1.00 43.83  ? 982  SER A N   1 
ATOM   7305  C CA  . SER A  1 1013 ? 233.185 205.568 241.933 1.00 43.83  ? 982  SER A CA  1 
ATOM   7306  C C   . SER A  1 1013 ? 232.691 206.875 242.527 1.00 43.83  ? 982  SER A C   1 
ATOM   7307  O O   . SER A  1 1013 ? 232.243 207.760 241.803 1.00 43.83  ? 982  SER A O   1 
ATOM   7308  C CB  . SER A  1 1013 ? 234.701 205.574 241.756 1.00 43.83  ? 982  SER A CB  1 
ATOM   7309  O OG  . SER A  1 1013 ? 235.098 206.489 240.756 1.00 43.83  ? 982  SER A OG  1 
ATOM   7310  N N   . ARG A  1 1014 ? 232.718 206.972 243.852 1.00 43.04  ? 983  ARG A N   1 
ATOM   7311  C CA  . ARG A  1 1014 ? 232.263 208.107 244.650 1.00 43.04  ? 983  ARG A CA  1 
ATOM   7312  C C   . ARG A  1 1014 ? 230.733 208.201 244.760 1.00 43.04  ? 983  ARG A C   1 
ATOM   7313  O O   . ARG A  1 1014 ? 230.250 209.013 245.540 1.00 43.04  ? 983  ARG A O   1 
ATOM   7314  C CB  . ARG A  1 1014 ? 232.818 209.460 244.151 1.00 43.04  ? 983  ARG A CB  1 
ATOM   7315  C CG  . ARG A  1 1014 ? 231.870 210.263 243.280 1.00 43.04  ? 983  ARG A CG  1 
ATOM   7316  C CD  . ARG A  1 1014 ? 232.562 211.393 242.549 1.00 43.04  ? 983  ARG A CD  1 
ATOM   7317  N NE  . ARG A  1 1014 ? 232.530 212.657 243.267 1.00 43.04  ? 983  ARG A NE  1 
ATOM   7318  C CZ  . ARG A  1 1014 ? 233.242 213.722 242.916 1.00 43.04  ? 983  ARG A CZ  1 
ATOM   7319  N NH1 . ARG A  1 1014 ? 234.039 213.664 241.859 1.00 43.04  ? 983  ARG A NH1 1 
ATOM   7320  N NH2 . ARG A  1 1014 ? 233.161 214.842 243.619 1.00 43.04  ? 983  ARG A NH2 1 
ATOM   7321  N N   . LEU A  1 1015 ? 229.956 207.388 244.046 1.00 43.52  ? 984  LEU A N   1 
ATOM   7322  C CA  . LEU A  1 1015 ? 228.502 207.421 244.169 1.00 43.52  ? 984  LEU A CA  1 
ATOM   7323  C C   . LEU A  1 1015 ? 227.931 206.011 244.144 1.00 43.52  ? 984  LEU A C   1 
ATOM   7324  O O   . LEU A  1 1015 ? 228.406 205.154 243.396 1.00 43.52  ? 984  LEU A O   1 
ATOM   7325  C CB  . LEU A  1 1015 ? 227.845 208.245 243.056 1.00 43.52  ? 984  LEU A CB  1 
ATOM   7326  C CG  . LEU A  1 1015 ? 227.907 209.771 243.116 1.00 43.52  ? 984  LEU A CG  1 
ATOM   7327  C CD1 . LEU A  1 1015 ? 227.077 210.359 241.998 1.00 43.52  ? 984  LEU A CD1 1 
ATOM   7328  C CD2 . LEU A  1 1015 ? 227.441 210.292 244.452 1.00 43.52  ? 984  LEU A CD2 1 
ATOM   7329  N N   . ASP A  1 1016 ? 226.913 205.778 244.974 1.00 50.69  ? 985  ASP A N   1 
ATOM   7330  C CA  . ASP A  1 1016 ? 226.216 204.501 245.030 1.00 50.69  ? 985  ASP A CA  1 
ATOM   7331  C C   . ASP A  1 1016 ? 225.137 204.411 243.949 1.00 50.69  ? 985  ASP A C   1 
ATOM   7332  O O   . ASP A  1 1016 ? 224.738 205.427 243.378 1.00 50.69  ? 985  ASP A O   1 
ATOM   7333  C CB  . ASP A  1 1016 ? 225.631 204.292 246.430 1.00 50.69  ? 985  ASP A CB  1 
ATOM   7334  C CG  . ASP A  1 1016 ? 224.613 205.350 246.826 1.00 50.69  ? 985  ASP A CG  1 
ATOM   7335  O OD1 . ASP A  1 1016 ? 224.075 206.059 245.956 1.00 50.69  ? 985  ASP A OD1 1 
ATOM   7336  O OD2 . ASP A  1 1016 ? 224.341 205.469 248.039 1.00 50.69  ? 985  ASP A OD2 1 
ATOM   7337  N N   . PRO A  1 1017 ? 224.668 203.201 243.635 1.00 53.45  ? 986  PRO A N   1 
ATOM   7338  C CA  . PRO A  1 1017 ? 223.780 203.007 242.470 1.00 53.45  ? 986  PRO A CA  1 
ATOM   7339  C C   . PRO A  1 1017 ? 222.561 203.919 242.460 1.00 53.45  ? 986  PRO A C   1 
ATOM   7340  O O   . PRO A  1 1017 ? 222.258 204.510 241.411 1.00 53.45  ? 986  PRO A O   1 
ATOM   7341  C CB  . PRO A  1 1017 ? 223.377 201.531 242.583 1.00 53.45  ? 986  PRO A CB  1 
ATOM   7342  C CG  . PRO A  1 1017 ? 224.511 200.897 243.254 1.00 53.45  ? 986  PRO A CG  1 
ATOM   7343  C CD  . PRO A  1 1017 ? 225.100 201.907 244.194 1.00 53.45  ? 986  PRO A CD  1 
ATOM   7344  N N   . PRO A  1 1018 ? 221.821 204.067 243.568 1.00 50.49  ? 987  PRO A N   1 
ATOM   7345  C CA  . PRO A  1 1018 ? 220.624 204.923 243.500 1.00 50.49  ? 987  PRO A CA  1 
ATOM   7346  C C   . PRO A  1 1018 ? 220.912 206.371 243.154 1.00 50.49  ? 987  PRO A C   1 
ATOM   7347  O O   . PRO A  1 1018 ? 220.081 207.011 242.501 1.00 50.49  ? 987  PRO A O   1 
ATOM   7348  C CB  . PRO A  1 1018 ? 220.017 204.790 244.902 1.00 50.49  ? 987  PRO A CB  1 
ATOM   7349  C CG  . PRO A  1 1018 ? 221.137 204.410 245.756 1.00 50.49  ? 987  PRO A CG  1 
ATOM   7350  C CD  . PRO A  1 1018 ? 221.965 203.495 244.918 1.00 50.49  ? 987  PRO A CD  1 
ATOM   7351  N N   . GLU A  1 1019 ? 222.046 206.919 243.581 1.00 49.87  ? 988  GLU A N   1 
ATOM   7352  C CA  . GLU A  1 1019 ? 222.393 208.287 243.222 1.00 49.87  ? 988  GLU A CA  1 
ATOM   7353  C C   . GLU A  1 1019 ? 223.173 208.390 241.920 1.00 49.87  ? 988  GLU A C   1 
ATOM   7354  O O   . GLU A  1 1019 ? 223.118 209.431 241.258 1.00 49.87  ? 988  GLU A O   1 
ATOM   7355  C CB  . GLU A  1 1019 ? 223.216 208.930 244.336 1.00 49.87  ? 988  GLU A CB  1 
ATOM   7356  C CG  . GLU A  1 1019 ? 222.468 209.155 245.619 1.00 49.87  ? 988  GLU A CG  1 
ATOM   7357  C CD  . GLU A  1 1019 ? 223.300 209.903 246.632 1.00 49.87  ? 988  GLU A CD  1 
ATOM   7358  O OE1 . GLU A  1 1019 ? 224.530 209.981 246.444 1.00 49.87  ? 988  GLU A OE1 1 
ATOM   7359  O OE2 . GLU A  1 1019 ? 222.725 210.427 247.607 1.00 49.87  ? 988  GLU A OE2 1 
ATOM   7360  N N   . ALA A  1 1020 ? 223.891 207.337 241.532 1.00 48.00  ? 989  ALA A N   1 
ATOM   7361  C CA  . ALA A  1 1020 ? 224.586 207.327 240.253 1.00 48.00  ? 989  ALA A CA  1 
ATOM   7362  C C   . ALA A  1 1020 ? 223.639 207.148 239.078 1.00 48.00  ? 989  ALA A C   1 
ATOM   7363  O O   . ALA A  1 1020 ? 223.974 207.552 237.955 1.00 48.00  ? 989  ALA A O   1 
ATOM   7364  C CB  . ALA A  1 1020 ? 225.646 206.228 240.245 1.00 48.00  ? 989  ALA A CB  1 
ATOM   7365  N N   . GLU A  1 1021 ? 222.465 206.564 239.319 1.00 48.98  ? 990  GLU A N   1 
ATOM   7366  C CA  . GLU A  1 1021 ? 221.531 206.277 238.238 1.00 48.98  ? 990  GLU A CA  1 
ATOM   7367  C C   . GLU A  1 1021 ? 221.035 207.546 237.557 1.00 48.98  ? 990  GLU A C   1 
ATOM   7368  O O   . GLU A  1 1021 ? 220.905 207.580 236.330 1.00 48.98  ? 990  GLU A O   1 
ATOM   7369  C CB  . GLU A  1 1021 ? 220.363 205.468 238.791 1.00 48.98  ? 990  GLU A CB  1 
ATOM   7370  C CG  . GLU A  1 1021 ? 219.261 205.186 237.807 1.00 48.98  ? 990  GLU A CG  1 
ATOM   7371  C CD  . GLU A  1 1021 ? 218.156 204.350 238.415 1.00 48.98  ? 990  GLU A CD  1 
ATOM   7372  O OE1 . GLU A  1 1021 ? 217.923 204.468 239.636 1.00 48.98  ? 990  GLU A OE1 1 
ATOM   7373  O OE2 . GLU A  1 1021 ? 217.517 203.578 237.671 1.00 48.98  ? 990  GLU A OE2 1 
ATOM   7374  N N   . VAL A  1 1022 ? 220.779 208.609 238.320 1.00 44.76  ? 991  VAL A N   1 
ATOM   7375  C CA  . VAL A  1 1022 ? 220.233 209.824 237.717 1.00 44.76  ? 991  VAL A CA  1 
ATOM   7376  C C   . VAL A  1 1022 ? 221.271 210.520 236.833 1.00 44.76  ? 991  VAL A C   1 
ATOM   7377  O O   . VAL A  1 1022 ? 220.955 210.994 235.730 1.00 44.76  ? 991  VAL A O   1 
ATOM   7378  C CB  . VAL A  1 1022 ? 219.667 210.756 238.810 1.00 44.76  ? 991  VAL A CB  1 
ATOM   7379  C CG1 . VAL A  1 1022 ? 218.776 209.975 239.757 1.00 44.76  ? 991  VAL A CG1 1 
ATOM   7380  C CG2 . VAL A  1 1022 ? 220.759 211.450 239.592 1.00 44.76  ? 991  VAL A CG2 1 
ATOM   7381  N N   . GLN A  1 1023 ? 222.530 210.557 237.274 1.00 41.23  ? 992  GLN A N   1 
ATOM   7382  C CA  . GLN A  1 1023 ? 223.590 211.137 236.455 1.00 41.23  ? 992  GLN A CA  1 
ATOM   7383  C C   . GLN A  1 1023 ? 223.817 210.325 235.186 1.00 41.23  ? 992  GLN A C   1 
ATOM   7384  O O   . GLN A  1 1023 ? 223.956 210.888 234.085 1.00 41.23  ? 992  GLN A O   1 
ATOM   7385  C CB  . GLN A  1 1023 ? 224.872 211.223 237.279 1.00 41.23  ? 992  GLN A CB  1 
ATOM   7386  C CG  . GLN A  1 1023 ? 224.678 211.742 238.701 1.00 41.23  ? 992  GLN A CG  1 
ATOM   7387  C CD  . GLN A  1 1023 ? 224.222 213.179 238.779 1.00 41.23  ? 992  GLN A CD  1 
ATOM   7388  O OE1 . GLN A  1 1023 ? 224.300 213.922 237.813 1.00 41.23  ? 992  GLN A OE1 1 
ATOM   7389  N NE2 . GLN A  1 1023 ? 223.728 213.572 239.940 1.00 41.23  ? 992  GLN A NE2 1 
ATOM   7390  N N   . ILE A  1 1024 ? 223.869 208.997 235.318 1.00 39.49  ? 993  ILE A N   1 
ATOM   7391  C CA  . ILE A  1 1024 ? 224.060 208.160 234.141 1.00 39.49  ? 993  ILE A CA  1 
ATOM   7392  C C   . ILE A  1 1024 ? 222.905 208.345 233.170 1.00 39.49  ? 993  ILE A C   1 
ATOM   7393  O O   . ILE A  1 1024 ? 223.095 208.339 231.951 1.00 39.49  ? 993  ILE A O   1 
ATOM   7394  C CB  . ILE A  1 1024 ? 224.227 206.689 234.553 1.00 39.49  ? 993  ILE A CB  1 
ATOM   7395  C CG1 . ILE A  1 1024 ? 225.499 206.508 235.375 1.00 39.49  ? 993  ILE A CG1 1 
ATOM   7396  C CG2 . ILE A  1 1024 ? 224.273 205.796 233.337 1.00 39.49  ? 993  ILE A CG2 1 
ATOM   7397  C CD1 . ILE A  1 1024 ? 225.647 205.128 235.926 1.00 39.49  ? 993  ILE A CD1 1 
ATOM   7398  N N   . ASP A  1 1025 ? 221.690 208.506 233.694 1.00 40.67  ? 994  ASP A N   1 
ATOM   7399  C CA  . ASP A  1 1025 ? 220.525 208.702 232.839 1.00 40.67  ? 994  ASP A CA  1 
ATOM   7400  C C   . ASP A  1 1025 ? 220.622 210.003 232.048 1.00 40.67  ? 994  ASP A C   1 
ATOM   7401  O O   . ASP A  1 1025 ? 220.308 210.036 230.848 1.00 40.67  ? 994  ASP A O   1 
ATOM   7402  C CB  . ASP A  1 1025 ? 219.268 208.663 233.699 1.00 40.67  ? 994  ASP A CB  1 
ATOM   7403  C CG  . ASP A  1 1025 ? 217.994 208.735 232.892 1.00 40.67  ? 994  ASP A CG  1 
ATOM   7404  O OD1 . ASP A  1 1025 ? 218.049 208.785 231.646 1.00 40.67  ? 994  ASP A OD1 1 
ATOM   7405  O OD2 . ASP A  1 1025 ? 216.917 208.736 233.520 1.00 40.67  ? 994  ASP A OD2 1 
ATOM   7406  N N   . ARG A  1 1026 ? 221.078 211.083 232.691 1.00 37.62  ? 995  ARG A N   1 
ATOM   7407  C CA  . ARG A  1 1026 ? 221.298 212.332 231.956 1.00 37.62  ? 995  ARG A CA  1 
ATOM   7408  C C   . ARG A  1 1026 ? 222.293 212.139 230.817 1.00 37.62  ? 995  ARG A C   1 
ATOM   7409  O O   . ARG A  1 1026 ? 222.055 212.573 229.676 1.00 37.62  ? 995  ARG A O   1 
ATOM   7410  C CB  . ARG A  1 1026 ? 221.794 213.429 232.894 1.00 37.62  ? 995  ARG A CB  1 
ATOM   7411  C CG  . ARG A  1 1026 ? 220.790 213.900 233.914 1.00 37.62  ? 995  ARG A CG  1 
ATOM   7412  C CD  . ARG A  1 1026 ? 221.281 215.172 234.569 1.00 37.62  ? 995  ARG A CD  1 
ATOM   7413  N NE  . ARG A  1 1026 ? 220.328 215.712 235.530 1.00 37.62  ? 995  ARG A NE  1 
ATOM   7414  C CZ  . ARG A  1 1026 ? 220.459 215.609 236.847 1.00 37.62  ? 995  ARG A CZ  1 
ATOM   7415  N NH1 . ARG A  1 1026 ? 221.513 214.999 237.360 1.00 37.62  ? 995  ARG A NH1 1 
ATOM   7416  N NH2 . ARG A  1 1026 ? 219.545 216.131 237.650 1.00 37.62  ? 995  ARG A NH2 1 
ATOM   7417  N N   . LEU A  1 1027 ? 223.416 211.477 231.108 1.00 33.55  ? 996  LEU A N   1 
ATOM   7418  C CA  . LEU A  1 1027 ? 224.420 211.256 230.069 1.00 33.55  ? 996  LEU A CA  1 
ATOM   7419  C C   . LEU A  1 1027 ? 223.866 210.410 228.923 1.00 33.55  ? 996  LEU A C   1 
ATOM   7420  O O   . LEU A  1 1027 ? 224.144 210.677 227.745 1.00 33.55  ? 996  LEU A O   1 
ATOM   7421  C CB  . LEU A  1 1027 ? 225.652 210.584 230.669 1.00 33.55  ? 996  LEU A CB  1 
ATOM   7422  C CG  . LEU A  1 1027 ? 226.618 211.438 231.483 1.00 33.55  ? 996  LEU A CG  1 
ATOM   7423  C CD1 . LEU A  1 1027 ? 227.649 210.536 232.120 1.00 33.55  ? 996  LEU A CD1 1 
ATOM   7424  C CD2 . LEU A  1 1027 ? 227.271 212.507 230.644 1.00 33.55  ? 996  LEU A CD2 1 
ATOM   7425  N N   . ILE A  1 1028 ? 223.067 209.395 229.251 1.00 33.94  ? 997  ILE A N   1 
ATOM   7426  C CA  . ILE A  1 1028 ? 222.510 208.508 228.235 1.00 33.94  ? 997  ILE A CA  1 
ATOM   7427  C C   . ILE A  1 1028 ? 221.593 209.277 227.293 1.00 33.94  ? 997  ILE A C   1 
ATOM   7428  O O   . ILE A  1 1028 ? 221.665 209.129 226.063 1.00 33.94  ? 997  ILE A O   1 
ATOM   7429  C CB  . ILE A  1 1028 ? 221.759 207.347 228.910 1.00 33.94  ? 997  ILE A CB  1 
ATOM   7430  C CG1 . ILE A  1 1028 ? 222.735 206.331 229.488 1.00 33.94  ? 997  ILE A CG1 1 
ATOM   7431  C CG2 . ILE A  1 1028 ? 220.857 206.651 227.919 1.00 33.94  ? 997  ILE A CG2 1 
ATOM   7432  C CD1 . ILE A  1 1028 ? 222.058 205.140 230.094 1.00 33.94  ? 997  ILE A CD1 1 
ATOM   7433  N N   . THR A  1 1029 ? 220.714 210.111 227.854 1.00 32.29  ? 998  THR A N   1 
ATOM   7434  C CA  . THR A  1 1029 ? 219.823 210.910 227.015 1.00 32.29  ? 998  THR A CA  1 
ATOM   7435  C C   . THR A  1 1029 ? 220.600 211.836 226.081 1.00 32.29  ? 998  THR A C   1 
ATOM   7436  O O   . THR A  1 1029 ? 220.299 211.917 224.878 1.00 32.29  ? 998  THR A O   1 
ATOM   7437  C CB  . THR A  1 1029 ? 218.867 211.710 227.896 1.00 32.29  ? 998  THR A CB  1 
ATOM   7438  O OG1 . THR A  1 1029 ? 218.179 210.821 228.778 1.00 32.29  ? 998  THR A OG1 1 
ATOM   7439  C CG2 . THR A  1 1029 ? 217.847 212.441 227.061 1.00 32.29  ? 998  THR A CG2 1 
ATOM   7440  N N   . GLY A  1 1030 ? 221.637 212.501 226.598 1.00 28.83  ? 999  GLY A N   1 
ATOM   7441  C CA  . GLY A  1 1030 ? 222.416 213.392 225.746 1.00 28.83  ? 999  GLY A CA  1 
ATOM   7442  C C   . GLY A  1 1030 ? 223.110 212.678 224.599 1.00 28.83  ? 999  GLY A C   1 
ATOM   7443  O O   . GLY A  1 1030 ? 223.115 213.156 223.456 1.00 28.83  ? 999  GLY A O   1 
ATOM   7444  N N   . ARG A  1 1031 ? 223.679 211.509 224.875 1.00 27.05  ? 1000 ARG A N   1 
ATOM   7445  C CA  . ARG A  1 1031 ? 224.436 210.818 223.840 1.00 27.05  ? 1000 ARG A CA  1 
ATOM   7446  C C   . ARG A  1 1031 ? 223.532 210.167 222.798 1.00 27.05  ? 1000 ARG A C   1 
ATOM   7447  O O   . ARG A  1 1031 ? 223.881 210.137 221.604 1.00 27.05  ? 1000 ARG A O   1 
ATOM   7448  C CB  . ARG A  1 1031 ? 225.363 209.797 224.492 1.00 27.05  ? 1000 ARG A CB  1 
ATOM   7449  C CG  . ARG A  1 1031 ? 226.344 210.449 225.440 1.00 27.05  ? 1000 ARG A CG  1 
ATOM   7450  C CD  . ARG A  1 1031 ? 227.375 209.504 225.988 1.00 27.05  ? 1000 ARG A CD  1 
ATOM   7451  N NE  . ARG A  1 1031 ? 228.313 210.209 226.856 1.00 27.05  ? 1000 ARG A NE  1 
ATOM   7452  C CZ  . ARG A  1 1031 ? 229.127 209.617 227.720 1.00 27.05  ? 1000 ARG A CZ  1 
ATOM   7453  N NH1 . ARG A  1 1031 ? 229.129 208.302 227.841 1.00 27.05  ? 1000 ARG A NH1 1 
ATOM   7454  N NH2 . ARG A  1 1031 ? 229.944 210.341 228.463 1.00 27.05  ? 1000 ARG A NH2 1 
ATOM   7455  N N   . LEU A  1 1032 ? 222.342 209.715 223.200 1.00 29.05  ? 1001 LEU A N   1 
ATOM   7456  C CA  . LEU A  1 1032 ? 221.360 209.284 222.210 1.00 29.05  ? 1001 LEU A CA  1 
ATOM   7457  C C   . LEU A  1 1032 ? 220.932 210.429 221.303 1.00 29.05  ? 1001 LEU A C   1 
ATOM   7458  O O   . LEU A  1 1032 ? 220.754 210.235 220.093 1.00 29.05  ? 1001 LEU A O   1 
ATOM   7459  C CB  . LEU A  1 1032 ? 220.135 208.699 222.906 1.00 29.05  ? 1001 LEU A CB  1 
ATOM   7460  C CG  . LEU A  1 1032 ? 220.106 207.224 223.277 1.00 29.05  ? 1001 LEU A CG  1 
ATOM   7461  C CD1 . LEU A  1 1032 ? 218.840 206.928 224.032 1.00 29.05  ? 1001 LEU A CD1 1 
ATOM   7462  C CD2 . LEU A  1 1032 ? 220.189 206.367 222.032 1.00 29.05  ? 1001 LEU A CD2 1 
ATOM   7463  N N   . GLN A  1 1033 ? 220.767 211.632 221.855 1.00 30.16  ? 1002 GLN A N   1 
ATOM   7464  C CA  . GLN A  1 1033 ? 220.439 212.766 220.993 1.00 30.16  ? 1002 GLN A CA  1 
ATOM   7465  C C   . GLN A  1 1033 ? 221.547 213.061 219.983 1.00 30.16  ? 1002 GLN A C   1 
ATOM   7466  O O   . GLN A  1 1033 ? 221.265 213.388 218.820 1.00 30.16  ? 1002 GLN A O   1 
ATOM   7467  C CB  . GLN A  1 1033 ? 220.125 213.998 221.829 1.00 30.16  ? 1002 GLN A CB  1 
ATOM   7468  C CG  . GLN A  1 1033 ? 219.639 215.155 220.986 1.00 30.16  ? 1002 GLN A CG  1 
ATOM   7469  C CD  . GLN A  1 1033 ? 219.166 216.316 221.814 1.00 30.16  ? 1002 GLN A CD  1 
ATOM   7470  O OE1 . GLN A  1 1033 ? 219.113 216.233 223.040 1.00 30.16  ? 1002 GLN A OE1 1 
ATOM   7471  N NE2 . GLN A  1 1033 ? 218.810 217.414 221.151 1.00 30.16  ? 1002 GLN A NE2 1 
ATOM   7472  N N   . SER A  1 1034 ? 222.813 212.972 220.406 1.00 25.50  ? 1003 SER A N   1 
ATOM   7473  C CA  . SER A  1 1034 ? 223.910 213.204 219.459 1.00 25.50  ? 1003 SER A CA  1 
ATOM   7474  C C   . SER A  1 1034 ? 223.871 212.202 218.307 1.00 25.50  ? 1003 SER A C   1 
ATOM   7475  O O   . SER A  1 1034 ? 224.030 212.573 217.131 1.00 25.50  ? 1003 SER A O   1 
ATOM   7476  C CB  . SER A  1 1034 ? 225.258 213.134 220.171 1.00 25.50  ? 1003 SER A CB  1 
ATOM   7477  O OG  . SER A  1 1034 ? 225.314 214.024 221.261 1.00 25.50  ? 1003 SER A OG  1 
ATOM   7478  N N   . LEU A  1 1035 ? 223.681 210.920 218.623 1.00 24.71  ? 1004 LEU A N   1 
ATOM   7479  C CA  . LEU A  1 1035 ? 223.589 209.924 217.555 1.00 24.71  ? 1004 LEU A CA  1 
ATOM   7480  C C   . LEU A  1 1035 ? 222.408 210.185 216.618 1.00 24.71  ? 1004 LEU A C   1 
ATOM   7481  O O   . LEU A  1 1035 ? 222.530 210.036 215.393 1.00 24.71  ? 1004 LEU A O   1 
ATOM   7482  C CB  . LEU A  1 1035 ? 223.502 208.519 218.141 1.00 24.71  ? 1004 LEU A CB  1 
ATOM   7483  C CG  . LEU A  1 1035 ? 224.765 207.953 218.772 1.00 24.71  ? 1004 LEU A CG  1 
ATOM   7484  C CD1 . LEU A  1 1035 ? 224.542 206.514 219.119 1.00 24.71  ? 1004 LEU A CD1 1 
ATOM   7485  C CD2 . LEU A  1 1035 ? 225.897 208.072 217.779 1.00 24.71  ? 1004 LEU A CD2 1 
ATOM   7486  N N   . GLN A  1 1036 ? 221.259 210.581 217.170 1.00 25.24  ? 1005 GLN A N   1 
ATOM   7487  C CA  . GLN A  1 1036 ? 220.098 210.881 216.334 1.00 25.24  ? 1005 GLN A CA  1 
ATOM   7488  C C   . GLN A  1 1036 ? 220.369 212.021 215.360 1.00 25.24  ? 1005 GLN A C   1 
ATOM   7489  O O   . GLN A  1 1036 ? 220.009 211.937 214.175 1.00 25.24  ? 1005 GLN A O   1 
ATOM   7490  C CB  . GLN A  1 1036 ? 218.904 211.215 217.226 1.00 25.24  ? 1005 GLN A CB  1 
ATOM   7491  C CG  . GLN A  1 1036 ? 217.597 211.444 216.494 1.00 25.24  ? 1005 GLN A CG  1 
ATOM   7492  C CD  . GLN A  1 1036 ? 217.087 210.196 215.796 1.00 25.24  ? 1005 GLN A CD  1 
ATOM   7493  O OE1 . GLN A  1 1036 ? 217.073 210.118 214.569 1.00 25.24  ? 1005 GLN A OE1 1 
ATOM   7494  N NE2 . GLN A  1 1036 ? 216.681 209.206 216.579 1.00 25.24  ? 1005 GLN A NE2 1 
ATOM   7495  N N   . THR A  1 1037 ? 221.001 213.094 215.836 1.00 23.50  ? 1006 THR A N   1 
ATOM   7496  C CA  . THR A  1 1037 ? 221.321 214.212 214.951 1.00 23.50  ? 1006 THR A CA  1 
ATOM   7497  C C   . THR A  1 1037 ? 222.262 213.787 213.831 1.00 23.50  ? 1006 THR A C   1 
ATOM   7498  O O   . THR A  1 1037 ? 222.069 214.162 212.660 1.00 23.50  ? 1006 THR A O   1 
ATOM   7499  C CB  . THR A  1 1037 ? 221.942 215.349 215.756 1.00 23.50  ? 1006 THR A CB  1 
ATOM   7500  O OG1 . THR A  1 1037 ? 220.968 215.882 216.655 1.00 23.50  ? 1006 THR A OG1 1 
ATOM   7501  C CG2 . THR A  1 1037 ? 222.406 216.451 214.839 1.00 23.50  ? 1006 THR A CG2 1 
ATOM   7502  N N   . TYR A  1 1038 ? 223.281 212.993 214.167 1.00 21.16  ? 1007 TYR A N   1 
ATOM   7503  C CA  . TYR A  1 1038 ? 224.195 212.502 213.139 1.00 21.16  ? 1007 TYR A CA  1 
ATOM   7504  C C   . TYR A  1 1038 ? 223.453 211.724 212.056 1.00 21.16  ? 1007 TYR A C   1 
ATOM   7505  O O   . TYR A  1 1038 ? 223.668 211.943 210.855 1.00 21.16  ? 1007 TYR A O   1 
ATOM   7506  C CB  . TYR A  1 1038 ? 225.285 211.648 213.783 1.00 21.16  ? 1007 TYR A CB  1 
ATOM   7507  C CG  . TYR A  1 1038 ? 226.146 210.910 212.793 1.00 21.16  ? 1007 TYR A CG  1 
ATOM   7508  C CD1 . TYR A  1 1038 ? 227.177 211.555 212.134 1.00 21.16  ? 1007 TYR A CD1 1 
ATOM   7509  C CD2 . TYR A  1 1038 ? 225.950 209.565 212.539 1.00 21.16  ? 1007 TYR A CD2 1 
ATOM   7510  C CE1 . TYR A  1 1038 ? 227.963 210.894 211.237 1.00 21.16  ? 1007 TYR A CE1 1 
ATOM   7511  C CE2 . TYR A  1 1038 ? 226.737 208.897 211.635 1.00 21.16  ? 1007 TYR A CE2 1 
ATOM   7512  C CZ  . TYR A  1 1038 ? 227.743 209.569 210.993 1.00 21.16  ? 1007 TYR A CZ  1 
ATOM   7513  O OH  . TYR A  1 1038 ? 228.535 208.916 210.092 1.00 21.16  ? 1007 TYR A OH  1 
ATOM   7514  N N   . VAL A  1 1039 ? 222.568 210.812 212.459 1.00 20.43  ? 1008 VAL A N   1 
ATOM   7515  C CA  . VAL A  1 1039 ? 221.890 209.971 211.475 1.00 20.43  ? 1008 VAL A CA  1 
ATOM   7516  C C   . VAL A  1 1039 ? 220.961 210.794 210.584 1.00 20.43  ? 1008 VAL A C   1 
ATOM   7517  O O   . VAL A  1 1039 ? 220.873 210.556 209.369 1.00 20.43  ? 1008 VAL A O   1 
ATOM   7518  C CB  . VAL A  1 1039 ? 221.139 208.830 212.181 1.00 20.43  ? 1008 VAL A CB  1 
ATOM   7519  C CG1 . VAL A  1 1039 ? 220.360 208.021 211.183 1.00 20.43  ? 1008 VAL A CG1 1 
ATOM   7520  C CG2 . VAL A  1 1039 ? 222.118 207.938 212.891 1.00 20.43  ? 1008 VAL A CG2 1 
ATOM   7521  N N   . THR A  1 1040 ? 220.279 211.790 211.152 1.00 21.72  ? 1009 THR A N   1 
ATOM   7522  C CA  . THR A  1 1040 ? 219.400 212.628 210.336 1.00 21.72  ? 1009 THR A CA  1 
ATOM   7523  C C   . THR A  1 1040 ? 220.177 213.399 209.267 1.00 21.72  ? 1009 THR A C   1 
ATOM   7524  O O   . THR A  1 1040 ? 219.777 213.444 208.088 1.00 21.72  ? 1009 THR A O   1 
ATOM   7525  C CB  . THR A  1 1040 ? 218.628 213.590 211.236 1.00 21.72  ? 1009 THR A CB  1 
ATOM   7526  O OG1 . THR A  1 1040 ? 217.711 212.849 212.044 1.00 21.72  ? 1009 THR A OG1 1 
ATOM   7527  C CG2 . THR A  1 1040 ? 217.837 214.568 210.401 1.00 21.72  ? 1009 THR A CG2 1 
ATOM   7528  N N   . GLN A  1 1041 ? 221.305 214.001 209.650 1.00 23.04  ? 1010 GLN A N   1 
ATOM   7529  C CA  . GLN A  1 1041 ? 222.048 214.756 208.644 1.00 23.04  ? 1010 GLN A CA  1 
ATOM   7530  C C   . GLN A  1 1041 ? 222.679 213.847 207.594 1.00 23.04  ? 1010 GLN A C   1 
ATOM   7531  O O   . GLN A  1 1041 ? 222.783 214.231 206.419 1.00 23.04  ? 1010 GLN A O   1 
ATOM   7532  C CB  . GLN A  1 1041 ? 223.096 215.637 209.315 1.00 23.04  ? 1010 GLN A CB  1 
ATOM   7533  C CG  . GLN A  1 1041 ? 222.489 216.823 210.047 1.00 23.04  ? 1010 GLN A CG  1 
ATOM   7534  C CD  . GLN A  1 1041 ? 223.519 217.652 210.776 1.00 23.04  ? 1010 GLN A CD  1 
ATOM   7535  O OE1 . GLN A  1 1041 ? 224.660 217.228 210.952 1.00 23.04  ? 1010 GLN A OE1 1 
ATOM   7536  N NE2 . GLN A  1 1041 ? 223.124 218.841 211.209 1.00 23.04  ? 1010 GLN A NE2 1 
ATOM   7537  N N   . GLN A  1 1042 ? 223.048 212.624 207.978 1.00 21.32  ? 1011 GLN A N   1 
ATOM   7538  C CA  . GLN A  1 1042 ? 223.497 211.645 206.992 1.00 21.32  ? 1011 GLN A CA  1 
ATOM   7539  C C   . GLN A  1 1042 ? 222.405 211.296 205.990 1.00 21.32  ? 1011 GLN A C   1 
ATOM   7540  O O   . GLN A  1 1042 ? 222.680 211.147 204.795 1.00 21.32  ? 1011 GLN A O   1 
ATOM   7541  C CB  . GLN A  1 1042 ? 223.983 210.385 207.703 1.00 21.32  ? 1011 GLN A CB  1 
ATOM   7542  C CG  . GLN A  1 1042 ? 225.351 210.516 208.293 1.00 21.32  ? 1011 GLN A CG  1 
ATOM   7543  C CD  . GLN A  1 1042 ? 226.381 210.881 207.261 1.00 21.32  ? 1011 GLN A CD  1 
ATOM   7544  O OE1 . GLN A  1 1042 ? 226.875 212.006 207.221 1.00 21.32  ? 1011 GLN A OE1 1 
ATOM   7545  N NE2 . GLN A  1 1042 ? 226.717 209.926 206.416 1.00 21.32  ? 1011 GLN A NE2 1 
ATOM   7546  N N   . LEU A  1 1043 ? 221.157 211.187 206.446 1.00 19.31  ? 1012 LEU A N   1 
ATOM   7547  C CA  . LEU A  1 1043 ? 220.061 210.900 205.519 1.00 19.31  ? 1012 LEU A CA  1 
ATOM   7548  C C   . LEU A  1 1043 ? 219.881 212.016 204.495 1.00 19.31  ? 1012 LEU A C   1 
ATOM   7549  O O   . LEU A  1 1043 ? 219.712 211.756 203.293 1.00 19.31  ? 1012 LEU A O   1 
ATOM   7550  C CB  . LEU A  1 1043 ? 218.767 210.667 206.295 1.00 19.31  ? 1012 LEU A CB  1 
ATOM   7551  C CG  . LEU A  1 1043 ? 218.603 209.303 206.967 1.00 19.31  ? 1012 LEU A CG  1 
ATOM   7552  C CD1 . LEU A  1 1043 ? 217.547 209.357 208.039 1.00 19.31  ? 1012 LEU A CD1 1 
ATOM   7553  C CD2 . LEU A  1 1043 ? 218.271 208.229 205.963 1.00 19.31  ? 1012 LEU A CD2 1 
ATOM   7554  N N   . ILE A  1 1044 ? 219.912 213.270 204.949 1.00 20.37  ? 1013 ILE A N   1 
ATOM   7555  C CA  . ILE A  1 1044 ? 219.728 214.389 204.016 1.00 20.37  ? 1013 ILE A CA  1 
ATOM   7556  C C   . ILE A  1 1044 ? 220.870 214.455 202.991 1.00 20.37  ? 1013 ILE A C   1 
ATOM   7557  O O   . ILE A  1 1044 ? 220.640 214.635 201.776 1.00 20.37  ? 1013 ILE A O   1 
ATOM   7558  C CB  . ILE A  1 1044 ? 219.576 215.701 204.806 1.00 20.37  ? 1013 ILE A CB  1 
ATOM   7559  C CG1 . ILE A  1 1044 ? 218.274 215.680 205.603 1.00 20.37  ? 1013 ILE A CG1 1 
ATOM   7560  C CG2 . ILE A  1 1044 ? 219.576 216.892 203.887 1.00 20.37  ? 1013 ILE A CG2 1 
ATOM   7561  C CD1 . ILE A  1 1044 ? 218.151 216.776 206.611 1.00 20.37  ? 1013 ILE A CD1 1 
ATOM   7562  N N   . ARG A  1 1045 ? 222.110 214.247 203.445 1.00 23.42  ? 1014 ARG A N   1 
ATOM   7563  C CA  . ARG A  1 1045 ? 223.238 214.224 202.513 1.00 23.42  ? 1014 ARG A CA  1 
ATOM   7564  C C   . ARG A  1 1045 ? 223.131 213.081 201.511 1.00 23.42  ? 1014 ARG A C   1 
ATOM   7565  O O   . ARG A  1 1045 ? 223.484 213.239 200.333 1.00 23.42  ? 1014 ARG A O   1 
ATOM   7566  C CB  . ARG A  1 1045 ? 224.550 214.122 203.281 1.00 23.42  ? 1014 ARG A CB  1 
ATOM   7567  C CG  . ARG A  1 1045 ? 225.001 215.420 203.877 1.00 23.42  ? 1014 ARG A CG  1 
ATOM   7568  C CD  . ARG A  1 1045 ? 226.236 215.228 204.705 1.00 23.42  ? 1014 ARG A CD  1 
ATOM   7569  N NE  . ARG A  1 1045 ? 226.625 216.462 205.370 1.00 23.42  ? 1014 ARG A NE  1 
ATOM   7570  C CZ  . ARG A  1 1045 ? 227.294 216.500 206.513 1.00 23.42  ? 1014 ARG A CZ  1 
ATOM   7571  N NH1 . ARG A  1 1045 ? 227.655 215.368 207.098 1.00 23.42  ? 1014 ARG A NH1 1 
ATOM   7572  N NH2 . ARG A  1 1045 ? 227.612 217.661 207.065 1.00 23.42  ? 1014 ARG A NH2 1 
ATOM   7573  N N   . ALA A  1 1046 ? 222.665 211.914 201.959 1.00 20.56  ? 1015 ALA A N   1 
ATOM   7574  C CA  . ALA A  1 1046 ? 222.511 210.783 201.050 1.00 20.56  ? 1015 ALA A CA  1 
ATOM   7575  C C   . ALA A  1 1046 ? 221.486 211.081 199.969 1.00 20.56  ? 1015 ALA A C   1 
ATOM   7576  O O   . ALA A  1 1046 ? 221.645 210.655 198.820 1.00 20.56  ? 1015 ALA A O   1 
ATOM   7577  C CB  . ALA A  1 1046 ? 222.110 209.537 201.832 1.00 20.56  ? 1015 ALA A CB  1 
ATOM   7578  N N   . ALA A  1 1047 ? 220.417 211.798 200.319 1.00 21.09  ? 1016 ALA A N   1 
ATOM   7579  C CA  . ALA A  1 1047 ? 219.444 212.187 199.300 1.00 21.09  ? 1016 ALA A CA  1 
ATOM   7580  C C   . ALA A  1 1047 ? 220.074 213.078 198.232 1.00 21.09  ? 1016 ALA A C   1 
ATOM   7581  O O   . ALA A  1 1047 ? 219.838 212.892 197.024 1.00 21.09  ? 1016 ALA A O   1 
ATOM   7582  C CB  . ALA A  1 1047 ? 218.262 212.892 199.953 1.00 21.09  ? 1016 ALA A CB  1 
ATOM   7583  N N   . GLU A  1 1048 ? 220.907 214.032 198.654 1.00 23.27  ? 1017 GLU A N   1 
ATOM   7584  C CA  . GLU A  1 1048 ? 221.581 214.883 197.669 1.00 23.27  ? 1017 GLU A CA  1 
ATOM   7585  C C   . GLU A  1 1048 ? 222.519 214.091 196.753 1.00 23.27  ? 1017 GLU A C   1 
ATOM   7586  O O   . GLU A  1 1048 ? 222.545 214.309 195.529 1.00 23.27  ? 1017 GLU A O   1 
ATOM   7587  C CB  . GLU A  1 1048 ? 222.353 215.979 198.389 1.00 23.27  ? 1017 GLU A CB  1 
ATOM   7588  C CG  . GLU A  1 1048 ? 223.105 216.893 197.472 1.00 23.27  ? 1017 GLU A CG  1 
ATOM   7589  C CD  . GLU A  1 1048 ? 223.876 217.939 198.230 1.00 23.27  ? 1017 GLU A CD  1 
ATOM   7590  O OE1 . GLU A  1 1048 ? 223.786 217.947 199.476 1.00 23.27  ? 1017 GLU A OE1 1 
ATOM   7591  O OE2 . GLU A  1 1048 ? 224.562 218.756 197.583 1.00 23.27  ? 1017 GLU A OE2 1 
ATOM   7592  N N   . ILE A  1 1049 ? 223.296 213.166 197.322 1.00 22.25  ? 1018 ILE A N   1 
ATOM   7593  C CA  . ILE A  1 1049 ? 224.181 212.337 196.497 1.00 22.25  ? 1018 ILE A CA  1 
ATOM   7594  C C   . ILE A  1 1049 ? 223.381 211.472 195.535 1.00 22.25  ? 1018 ILE A C   1 
ATOM   7595  O O   . ILE A  1 1049 ? 223.823 211.207 194.410 1.00 22.25  ? 1018 ILE A O   1 
ATOM   7596  C CB  . ILE A  1 1049 ? 225.114 211.484 197.375 1.00 22.25  ? 1018 ILE A CB  1 
ATOM   7597  C CG1 . ILE A  1 1049 ? 225.968 212.371 198.270 1.00 22.25  ? 1018 ILE A CG1 1 
ATOM   7598  C CG2 . ILE A  1 1049 ? 226.024 210.646 196.521 1.00 22.25  ? 1018 ILE A CG2 1 
ATOM   7599  C CD1 . ILE A  1 1049 ? 227.105 213.031 197.525 1.00 22.25  ? 1018 ILE A CD1 1 
ATOM   7600  N N   . ARG A  1 1050 ? 222.195 211.025 195.946 1.00 22.01  ? 1019 ARG A N   1 
ATOM   7601  C CA  A ARG A  1 1050 ? 221.383 210.211 195.050 0.50 22.01  ? 1019 ARG A CA  1 
ATOM   7602  C CA  B ARG A  1 1050 ? 221.353 210.218 195.069 0.50 22.01  ? 1019 ARG A CA  1 
ATOM   7603  C C   . ARG A  1 1050 ? 220.904 211.013 193.852 1.00 22.01  ? 1019 ARG A C   1 
ATOM   7604  O O   . ARG A  1 1050 ? 220.910 210.505 192.723 1.00 22.01  ? 1019 ARG A O   1 
ATOM   7605  C CB  A ARG A  1 1050 ? 220.184 209.626 195.786 0.50 22.01  ? 1019 ARG A CB  1 
ATOM   7606  C CB  B ARG A  1 1050 ? 220.147 209.719 195.865 0.50 22.01  ? 1019 ARG A CB  1 
ATOM   7607  C CG  A ARG A  1 1050 ? 219.494 208.549 194.987 0.50 22.01  ? 1019 ARG A CG  1 
ATOM   7608  C CG  B ARG A  1 1050 ? 219.148 208.887 195.109 0.50 22.01  ? 1019 ARG A CG  1 
ATOM   7609  C CD  A ARG A  1 1050 ? 218.236 208.037 195.641 0.50 22.01  ? 1019 ARG A CD  1 
ATOM   7610  C CD  B ARG A  1 1050 ? 219.787 207.686 194.475 0.50 22.01  ? 1019 ARG A CD  1 
ATOM   7611  N NE  A ARG A  1 1050 ? 217.424 209.097 196.228 0.50 22.01  ? 1019 ARG A NE  1 
ATOM   7612  N NE  B ARG A  1 1050 ? 218.837 206.952 193.648 0.50 22.01  ? 1019 ARG A NE  1 
ATOM   7613  C CZ  A ARG A  1 1050 ? 217.205 209.239 197.531 0.50 22.01  ? 1019 ARG A CZ  1 
ATOM   7614  C CZ  B ARG A  1 1050 ? 219.164 205.948 192.843 0.50 22.01  ? 1019 ARG A CZ  1 
ATOM   7615  N NH1 A ARG A  1 1050 ? 217.742 208.390 198.396 0.50 22.01  ? 1019 ARG A NH1 1 
ATOM   7616  N NH1 B ARG A  1 1050 ? 220.426 205.551 192.750 0.50 22.01  ? 1019 ARG A NH1 1 
ATOM   7617  N NH2 A ARG A  1 1050 ? 216.448 210.232 197.968 0.50 22.01  ? 1019 ARG A NH2 1 
ATOM   7618  N NH2 B ARG A  1 1050 ? 218.226 205.342 192.127 0.50 22.01  ? 1019 ARG A NH2 1 
ATOM   7619  N N   . ALA A  1 1051 ? 220.505 212.267 194.065 1.00 18.92  ? 1020 ALA A N   1 
ATOM   7620  C CA  . ALA A  1 1051 ? 220.139 213.102 192.921 1.00 18.92  ? 1020 ALA A CA  1 
ATOM   7621  C C   . ALA A  1 1051 ? 221.320 213.312 191.972 1.00 18.92  ? 1020 ALA A C   1 
ATOM   7622  O O   . ALA A  1 1051 ? 221.166 213.238 190.739 1.00 18.92  ? 1020 ALA A O   1 
ATOM   7623  C CB  . ALA A  1 1051 ? 219.596 214.442 193.405 1.00 18.92  ? 1020 ALA A CB  1 
ATOM   7624  N N   . SER A  1 1052 ? 222.512 213.549 192.526 1.00 18.33  ? 1021 SER A N   1 
ATOM   7625  C CA  . SER A  1 1052 ? 223.686 213.729 191.671 1.00 18.33  ? 1021 SER A CA  1 
ATOM   7626  C C   . SER A  1 1052 ? 223.999 212.473 190.860 1.00 18.33  ? 1021 SER A C   1 
ATOM   7627  O O   . SER A  1 1052 ? 224.368 212.554 189.680 1.00 18.33  ? 1021 SER A O   1 
ATOM   7628  C CB  . SER A  1 1052 ? 224.891 214.130 192.515 1.00 18.33  ? 1021 SER A CB  1 
ATOM   7629  O OG  . SER A  1 1052 ? 226.031 214.298 191.702 1.00 18.33  ? 1021 SER A OG  1 
ATOM   7630  N N   . ALA A  1 1053 ? 223.837 211.299 191.467 1.00 18.78  ? 1022 ALA A N   1 
ATOM   7631  C CA  . ALA A  1 1053 ? 224.134 210.058 190.761 1.00 18.78  ? 1022 ALA A CA  1 
ATOM   7632  C C   . ALA A  1 1053 ? 223.099 209.743 189.688 1.00 18.78  ? 1022 ALA A C   1 
ATOM   7633  O O   . ALA A  1 1053 ? 223.444 209.177 188.643 1.00 18.78  ? 1022 ALA A O   1 
ATOM   7634  C CB  . ALA A  1 1053 ? 224.228 208.906 191.754 1.00 18.78  ? 1022 ALA A CB  1 
ATOM   7635  N N   . ASN A  1 1054 ? 221.832 210.092 189.917 1.00 19.46  ? 1023 ASN A N   1 
ATOM   7636  C CA  . ASN A  1 1054 ? 220.840 209.962 188.853 1.00 19.46  ? 1023 ASN A CA  1 
ATOM   7637  C C   . ASN A  1 1054 ? 221.190 210.842 187.659 1.00 19.46  ? 1023 ASN A C   1 
ATOM   7638  O O   . ASN A  1 1054 ? 221.068 210.414 186.501 1.00 19.46  ? 1023 ASN A O   1 
ATOM   7639  C CB  . ASN A  1 1054 ? 219.453 210.316 189.380 1.00 19.46  ? 1023 ASN A CB  1 
ATOM   7640  C CG  . ASN A  1 1054 ? 218.857 209.226 190.236 1.00 19.46  ? 1023 ASN A CG  1 
ATOM   7641  O OD1 . ASN A  1 1054 ? 218.195 209.502 191.230 1.00 19.46  ? 1023 ASN A OD1 1 
ATOM   7642  N ND2 . ASN A  1 1054 ? 219.089 207.982 189.858 1.00 19.46  ? 1023 ASN A ND2 1 
ATOM   7643  N N   . LEU A  1 1055 ? 221.627 212.079 187.920 1.00 17.56  ? 1024 LEU A N   1 
ATOM   7644  C CA  . LEU A  1 1055 ? 222.059 212.945 186.824 1.00 17.56  ? 1024 LEU A CA  1 
ATOM   7645  C C   . LEU A  1 1055 ? 223.245 212.355 186.067 1.00 17.56  ? 1024 LEU A C   1 
ATOM   7646  O O   . LEU A  1 1055 ? 223.295 212.412 184.833 1.00 17.56  ? 1024 LEU A O   1 
ATOM   7647  C CB  . LEU A  1 1055 ? 222.405 214.330 187.359 1.00 17.56  ? 1024 LEU A CB  1 
ATOM   7648  C CG  . LEU A  1 1055 ? 222.756 215.379 186.310 1.00 17.56  ? 1024 LEU A CG  1 
ATOM   7649  C CD1 . LEU A  1 1055 ? 221.579 215.600 185.400 1.00 17.56  ? 1024 LEU A CD1 1 
ATOM   7650  C CD2 . LEU A  1 1055 ? 223.165 216.667 186.968 1.00 17.56  ? 1024 LEU A CD2 1 
ATOM   7651  N N   . ALA A  1 1056 ? 224.204 211.771 186.789 1.00 17.51  ? 1025 ALA A N   1 
ATOM   7652  C CA  . ALA A  1 1056 ? 225.365 211.167 186.138 1.00 17.51  ? 1025 ALA A CA  1 
ATOM   7653  C C   . ALA A  1 1056 ? 224.975 209.978 185.265 1.00 17.51  ? 1025 ALA A C   1 
ATOM   7654  O O   . ALA A  1 1056 ? 225.531 209.789 184.177 1.00 17.51  ? 1025 ALA A O   1 
ATOM   7655  C CB  . ALA A  1 1056 ? 226.392 210.745 187.183 1.00 17.51  ? 1025 ALA A CB  1 
ATOM   7656  N N   . ALA A  1 1057 ? 224.039 209.151 185.730 1.00 18.45  ? 1026 ALA A N   1 
ATOM   7657  C CA  . ALA A  1 1057 ? 223.562 208.041 184.908 1.00 18.45  ? 1026 ALA A CA  1 
ATOM   7658  C C   . ALA A  1 1057 ? 222.874 208.537 183.641 1.00 18.45  ? 1026 ALA A C   1 
ATOM   7659  O O   . ALA A  1 1057 ? 223.057 207.966 182.557 1.00 18.45  ? 1026 ALA A O   1 
ATOM   7660  C CB  . ALA A  1 1057 ? 222.625 207.152 185.715 1.00 18.45  ? 1026 ALA A CB  1 
ATOM   7661  N N   . THR A  1 1058 ? 222.066 209.593 183.755 1.00 20.27  ? 1027 THR A N   1 
ATOM   7662  C CA  . THR A  1 1058 ? 221.424 210.152 182.567 1.00 20.27  ? 1027 THR A CA  1 
ATOM   7663  C C   . THR A  1 1058 ? 222.450 210.689 181.574 1.00 20.27  ? 1027 THR A C   1 
ATOM   7664  O O   . THR A  1 1058 ? 222.314 210.491 180.359 1.00 20.27  ? 1027 THR A O   1 
ATOM   7665  C CB  . THR A  1 1058 ? 220.448 211.253 182.969 1.00 20.27  ? 1027 THR A CB  1 
ATOM   7666  O OG1 . THR A  1 1058 ? 219.401 210.692 183.763 1.00 20.27  ? 1027 THR A OG1 1 
ATOM   7667  C CG2 . THR A  1 1058 ? 219.843 211.889 181.755 1.00 20.27  ? 1027 THR A CG2 1 
ATOM   7668  N N   . LYS A  1 1059 ? 223.489 211.365 182.070 1.00 20.65  ? 1028 LYS A N   1 
ATOM   7669  C CA  . LYS A  1 1059 ? 224.552 211.834 181.183 1.00 20.65  ? 1028 LYS A CA  1 
ATOM   7670  C C   . LYS A  1 1059 ? 225.268 210.677 180.504 1.00 20.65  ? 1028 LYS A C   1 
ATOM   7671  O O   . LYS A  1 1059 ? 225.581 210.750 179.313 1.00 20.65  ? 1028 LYS A O   1 
ATOM   7672  C CB  . LYS A  1 1059 ? 225.553 212.683 181.958 1.00 20.65  ? 1028 LYS A CB  1 
ATOM   7673  C CG  . LYS A  1 1059 ? 224.996 213.975 182.476 1.00 20.65  ? 1028 LYS A CG  1 
ATOM   7674  C CD  . LYS A  1 1059 ? 225.730 215.149 181.902 1.00 20.65  ? 1028 LYS A CD  1 
ATOM   7675  C CE  . LYS A  1 1059 ? 225.601 216.350 182.796 1.00 20.65  ? 1028 LYS A CE  1 
ATOM   7676  N NZ  . LYS A  1 1059 ? 224.259 216.966 182.727 1.00 20.65  ? 1028 LYS A NZ  1 
ATOM   7677  N N   . MET A  1 1060 ? 225.551 209.605 181.241 1.00 23.44  ? 1029 MET A N   1 
ATOM   7678  C CA  . MET A  1 1060 ? 226.209 208.454 180.631 1.00 23.44  ? 1029 MET A CA  1 
ATOM   7679  C C   . MET A  1 1060 ? 225.360 207.860 179.516 1.00 23.44  ? 1029 MET A C   1 
ATOM   7680  O O   . MET A  1 1060 ? 225.885 207.457 178.475 1.00 23.44  ? 1029 MET A O   1 
ATOM   7681  C CB  . MET A  1 1060 ? 226.512 207.399 181.689 1.00 23.44  ? 1029 MET A CB  1 
ATOM   7682  C CG  . MET A  1 1060 ? 227.307 206.211 181.183 1.00 23.44  ? 1029 MET A CG  1 
ATOM   7683  S SD  . MET A  1 1060 ? 229.051 206.572 180.981 1.00 23.44  ? 1029 MET A SD  1 
ATOM   7684  C CE  . MET A  1 1060 ? 229.614 206.519 182.672 1.00 23.44  ? 1029 MET A CE  1 
ATOM   7685  N N   . SER A  1 1061 ? 224.046 207.767 179.727 1.00 24.97  ? 1030 SER A N   1 
ATOM   7686  C CA  . SER A  1 1061 ? 223.183 207.215 178.685 1.00 24.97  ? 1030 SER A CA  1 
ATOM   7687  C C   . SER A  1 1061 ? 223.102 208.120 177.461 1.00 24.97  ? 1030 SER A C   1 
ATOM   7688  O O   . SER A  1 1061 ? 223.151 207.638 176.328 1.00 24.97  ? 1030 SER A O   1 
ATOM   7689  C CB  . SER A  1 1061 ? 221.782 206.972 179.235 1.00 24.97  ? 1030 SER A CB  1 
ATOM   7690  O OG  . SER A  1 1061 ? 221.790 205.965 180.225 1.00 24.97  ? 1030 SER A OG  1 
ATOM   7691  N N   . GLU A  1 1062 ? 222.960 209.430 177.659 1.00 24.89  ? 1031 GLU A N   1 
ATOM   7692  C CA  . GLU A  1 1062 ? 222.584 210.306 176.554 1.00 24.89  ? 1031 GLU A CA  1 
ATOM   7693  C C   . GLU A  1 1062 ? 223.742 211.033 175.881 1.00 24.89  ? 1031 GLU A C   1 
ATOM   7694  O O   . GLU A  1 1062 ? 223.583 211.478 174.743 1.00 24.89  ? 1031 GLU A O   1 
ATOM   7695  C CB  . GLU A  1 1062 ? 221.542 211.319 177.034 1.00 24.89  ? 1031 GLU A CB  1 
ATOM   7696  C CG  . GLU A  1 1062 ? 220.282 210.642 177.536 1.00 24.89  ? 1031 GLU A CG  1 
ATOM   7697  C CD  . GLU A  1 1062 ? 219.177 211.602 177.870 1.00 24.89  ? 1031 GLU A CD  1 
ATOM   7698  O OE1 . GLU A  1 1062 ? 219.303 212.798 177.549 1.00 24.89  ? 1031 GLU A OE1 1 
ATOM   7699  O OE2 . GLU A  1 1062 ? 218.178 211.160 178.463 1.00 24.89  ? 1031 GLU A OE2 1 
ATOM   7700  N N   . CYS A  1 1063 ? 224.896 211.161 176.530 1.00 23.14  ? 1032 CYS A N   1 
ATOM   7701  C CA  . CYS A  1 1063 ? 226.050 211.813 175.926 1.00 23.14  ? 1032 CYS A CA  1 
ATOM   7702  C C   . CYS A  1 1063 ? 227.097 210.829 175.425 1.00 23.14  ? 1032 CYS A C   1 
ATOM   7703  O O   . CYS A  1 1063 ? 227.734 211.095 174.406 1.00 23.14  ? 1032 CYS A O   1 
ATOM   7704  C CB  . CYS A  1 1063 ? 226.717 212.785 176.908 1.00 23.14  ? 1032 CYS A CB  1 
ATOM   7705  S SG  . CYS A  1 1063 ? 225.705 214.066 177.702 1.00 23.14  ? 1032 CYS A SG  1 
ATOM   7706  N N   . VAL A  1 1064 ? 227.269 209.692 176.092 1.00 22.85  ? 1033 VAL A N   1 
ATOM   7707  C CA  . VAL A  1 1064 ? 228.291 208.722 175.713 1.00 22.85  ? 1033 VAL A CA  1 
ATOM   7708  C C   . VAL A  1 1064 ? 227.731 207.655 174.782 1.00 22.85  ? 1033 VAL A C   1 
ATOM   7709  O O   . VAL A  1 1064 ? 228.381 207.275 173.806 1.00 22.85  ? 1033 VAL A O   1 
ATOM   7710  C CB  . VAL A  1 1064 ? 228.900 208.091 176.981 1.00 22.85  ? 1033 VAL A CB  1 
ATOM   7711  C CG1 . VAL A  1 1064 ? 229.874 206.995 176.620 1.00 22.85  ? 1033 VAL A CG1 1 
ATOM   7712  C CG2 . VAL A  1 1064 ? 229.584 209.134 177.822 1.00 22.85  ? 1033 VAL A CG2 1 
ATOM   7713  N N   . LEU A  1 1065 ? 226.530 207.160 175.053 1.00 25.42  ? 1034 LEU A N   1 
ATOM   7714  C CA  . LEU A  1 1065 ? 225.893 206.138 174.236 1.00 25.42  ? 1034 LEU A CA  1 
ATOM   7715  C C   . LEU A  1 1065 ? 225.057 206.721 173.103 1.00 25.42  ? 1034 LEU A C   1 
ATOM   7716  O O   . LEU A  1 1065 ? 224.342 205.973 172.434 1.00 25.42  ? 1034 LEU A O   1 
ATOM   7717  C CB  . LEU A  1 1065 ? 225.032 205.225 175.110 1.00 25.42  ? 1034 LEU A CB  1 
ATOM   7718  C CG  . LEU A  1 1065 ? 225.627 203.928 175.666 1.00 25.42  ? 1034 LEU A CG  1 
ATOM   7719  C CD1 . LEU A  1 1065 ? 226.963 204.163 176.311 1.00 25.42  ? 1034 LEU A CD1 1 
ATOM   7720  C CD2 . LEU A  1 1065 ? 224.678 203.309 176.670 1.00 25.42  ? 1034 LEU A CD2 1 
ATOM   7721  N N   . GLY A  1 1066 ? 225.107 208.031 172.890 1.00 24.43  ? 1035 GLY A N   1 
ATOM   7722  C CA  . GLY A  1 1066 ? 224.397 208.646 171.785 1.00 24.43  ? 1035 GLY A CA  1 
ATOM   7723  C C   . GLY A  1 1066 ? 224.875 210.065 171.586 1.00 24.43  ? 1035 GLY A C   1 
ATOM   7724  O O   . GLY A  1 1066 ? 225.814 210.523 172.239 1.00 24.43  ? 1035 GLY A O   1 
ATOM   7725  N N   . GLN A  1 1067 ? 224.224 210.759 170.658 1.00 26.33  ? 1036 GLN A N   1 
ATOM   7726  C CA  . GLN A  1 1067 ? 224.487 212.167 170.389 1.00 26.33  ? 1036 GLN A CA  1 
ATOM   7727  C C   . GLN A  1 1067 ? 223.268 212.981 170.801 1.00 26.33  ? 1036 GLN A C   1 
ATOM   7728  O O   . GLN A  1 1067 ? 222.161 212.724 170.324 1.00 26.33  ? 1036 GLN A O   1 
ATOM   7729  C CB  . GLN A  1 1067 ? 224.822 212.389 168.918 1.00 26.33  ? 1036 GLN A CB  1 
ATOM   7730  C CG  . GLN A  1 1067 ? 225.173 213.817 168.585 1.00 26.33  ? 1036 GLN A CG  1 
ATOM   7731  C CD  . GLN A  1 1067 ? 225.596 213.991 167.153 1.00 26.33  ? 1036 GLN A CD  1 
ATOM   7732  O OE1 . GLN A  1 1067 ? 226.205 214.992 166.795 1.00 26.33  ? 1036 GLN A OE1 1 
ATOM   7733  N NE2 . GLN A  1 1067 ? 225.272 213.020 166.321 1.00 26.33  ? 1036 GLN A NE2 1 
ATOM   7734  N N   . SER A  1 1068 ? 223.473 213.954 171.683 1.00 24.22  ? 1037 SER A N   1 
ATOM   7735  C CA  . SER A  1 1068 ? 222.386 214.698 172.303 1.00 24.22  ? 1037 SER A CA  1 
ATOM   7736  C C   . SER A  1 1068 ? 222.150 216.023 171.592 1.00 24.22  ? 1037 SER A C   1 
ATOM   7737  O O   . SER A  1 1068 ? 223.098 216.735 171.256 1.00 24.22  ? 1037 SER A O   1 
ATOM   7738  C CB  . SER A  1 1068 ? 222.703 214.952 173.773 1.00 24.22  ? 1037 SER A CB  1 
ATOM   7739  O OG  . SER A  1 1068 ? 221.555 215.348 174.485 1.00 24.22  ? 1037 SER A OG  1 
ATOM   7740  N N   . LYS A  1 1069 ? 220.877 216.345 171.357 1.00 26.59  ? 1038 LYS A N   1 
ATOM   7741  C CA  . LYS A  1 1069 ? 220.477 217.608 170.751 1.00 26.59  ? 1038 LYS A CA  1 
ATOM   7742  C C   . LYS A  1 1069 ? 219.935 218.630 171.741 1.00 26.59  ? 1038 LYS A C   1 
ATOM   7743  O O   . LYS A  1 1069 ? 219.579 219.733 171.325 1.00 26.59  ? 1038 LYS A O   1 
ATOM   7744  C CB  . LYS A  1 1069 ? 219.443 217.373 169.652 1.00 26.59  ? 1038 LYS A CB  1 
ATOM   7745  C CG  . LYS A  1 1069 ? 220.048 216.881 168.354 1.00 26.59  ? 1038 LYS A CG  1 
ATOM   7746  C CD  . LYS A  1 1069 ? 219.001 216.715 167.276 1.00 26.59  ? 1038 LYS A CD  1 
ATOM   7747  C CE  . LYS A  1 1069 ? 218.329 218.041 166.955 1.00 26.59  ? 1038 LYS A CE  1 
ATOM   7748  N NZ  . LYS A  1 1069 ? 219.282 219.053 166.418 1.00 26.59  ? 1038 LYS A NZ  1 
ATOM   7749  N N   . ARG A  1 1070 ? 219.848 218.303 173.025 1.00 23.87  ? 1039 ARG A N   1 
ATOM   7750  C CA  . ARG A  1 1070 ? 219.406 219.283 174.005 1.00 23.87  ? 1039 ARG A CA  1 
ATOM   7751  C C   . ARG A  1 1070 ? 220.557 220.194 174.409 1.00 23.87  ? 1039 ARG A C   1 
ATOM   7752  O O   . ARG A  1 1070 ? 221.681 219.744 174.630 1.00 23.87  ? 1039 ARG A O   1 
ATOM   7753  C CB  . ARG A  1 1070 ? 218.789 218.596 175.223 1.00 23.87  ? 1039 ARG A CB  1 
ATOM   7754  C CG  . ARG A  1 1070 ? 219.289 217.215 175.488 1.00 23.87  ? 1039 ARG A CG  1 
ATOM   7755  C CD  . ARG A  1 1070 ? 218.378 216.459 176.441 1.00 23.87  ? 1039 ARG A CD  1 
ATOM   7756  N NE  . ARG A  1 1070 ? 218.136 217.178 177.680 1.00 23.87  ? 1039 ARG A NE  1 
ATOM   7757  C CZ  . ARG A  1 1070 ? 217.976 216.590 178.856 1.00 23.87  ? 1039 ARG A CZ  1 
ATOM   7758  N NH1 . ARG A  1 1070 ? 218.078 215.276 178.951 1.00 23.87  ? 1039 ARG A NH1 1 
ATOM   7759  N NH2 . ARG A  1 1070 ? 217.759 217.314 179.942 1.00 23.87  ? 1039 ARG A NH2 1 
ATOM   7760  N N   . VAL A  1 1071 ? 220.256 221.490 174.494 1.00 25.86  ? 1040 VAL A N   1 
ATOM   7761  C CA  . VAL A  1 1071 ? 221.281 222.523 174.555 1.00 25.86  ? 1040 VAL A CA  1 
ATOM   7762  C C   . VAL A  1 1071 ? 221.938 222.537 175.927 1.00 25.86  ? 1040 VAL A C   1 
ATOM   7763  O O   . VAL A  1 1071 ? 221.259 222.540 176.960 1.00 25.86  ? 1040 VAL A O   1 
ATOM   7764  C CB  . VAL A  1 1071 ? 220.664 223.889 174.225 1.00 25.86  ? 1040 VAL A CB  1 
ATOM   7765  C CG1 . VAL A  1 1071 ? 221.671 225.002 174.417 1.00 25.86  ? 1040 VAL A CG1 1 
ATOM   7766  C CG2 . VAL A  1 1071 ? 220.117 223.897 172.819 1.00 25.86  ? 1040 VAL A CG2 1 
ATOM   7767  N N   . ASP A  1 1072 ? 223.271 222.513 175.937 1.00 29.74  ? 1041 ASP A N   1 
ATOM   7768  C CA  . ASP A  1 1072 ? 224.126 222.623 177.116 1.00 29.74  ? 1041 ASP A CA  1 
ATOM   7769  C C   . ASP A  1 1072 ? 224.073 221.407 178.026 1.00 29.74  ? 1041 ASP A C   1 
ATOM   7770  O O   . ASP A  1 1072 ? 224.594 221.465 179.141 1.00 29.74  ? 1041 ASP A O   1 
ATOM   7771  C CB  . ASP A  1 1072 ? 223.816 223.874 177.942 1.00 29.74  ? 1041 ASP A CB  1 
ATOM   7772  C CG  . ASP A  1 1072 ? 224.287 225.146 177.274 1.00 29.74  ? 1041 ASP A CG  1 
ATOM   7773  O OD1 . ASP A  1 1072 ? 225.062 225.056 176.301 1.00 29.74  ? 1041 ASP A OD1 1 
ATOM   7774  O OD2 . ASP A  1 1072 ? 223.894 226.238 177.731 1.00 29.74  ? 1041 ASP A OD2 1 
ATOM   7775  N N   . PHE A  1 1073 ? 223.454 220.310 177.599 1.00 24.71  ? 1042 PHE A N   1 
ATOM   7776  C CA  . PHE A  1 1073 ? 223.469 219.117 178.436 1.00 24.71  ? 1042 PHE A CA  1 
ATOM   7777  C C   . PHE A  1 1073 ? 224.822 218.428 178.385 1.00 24.71  ? 1042 PHE A C   1 
ATOM   7778  O O   . PHE A  1 1073 ? 225.301 217.920 179.403 1.00 24.71  ? 1042 PHE A O   1 
ATOM   7779  C CB  . PHE A  1 1073 ? 222.363 218.158 177.997 1.00 24.71  ? 1042 PHE A CB  1 
ATOM   7780  C CG  . PHE A  1 1073 ? 222.076 217.073 178.986 1.00 24.71  ? 1042 PHE A CG  1 
ATOM   7781  C CD1 . PHE A  1 1073 ? 222.104 215.748 178.603 1.00 24.71  ? 1042 PHE A CD1 1 
ATOM   7782  C CD2 . PHE A  1 1073 ? 221.774 217.374 180.295 1.00 24.71  ? 1042 PHE A CD2 1 
ATOM   7783  C CE1 . PHE A  1 1073 ? 221.847 214.751 179.507 1.00 24.71  ? 1042 PHE A CE1 1 
ATOM   7784  C CE2 . PHE A  1 1073 ? 221.508 216.377 181.199 1.00 24.71  ? 1042 PHE A CE2 1 
ATOM   7785  C CZ  . PHE A  1 1073 ? 221.543 215.067 180.805 1.00 24.71  ? 1042 PHE A CZ  1 
ATOM   7786  N N   . CYS A  1 1074 ? 225.458 218.413 177.218 1.00 26.82  ? 1043 CYS A N   1 
ATOM   7787  C CA  . CYS A  1 1074 ? 226.725 217.720 177.064 1.00 26.82  ? 1043 CYS A CA  1 
ATOM   7788  C C   . CYS A  1 1074 ? 227.804 218.705 176.628 1.00 26.82  ? 1043 CYS A C   1 
ATOM   7789  O O   . CYS A  1 1074 ? 228.532 218.444 175.669 1.00 26.82  ? 1043 CYS A O   1 
ATOM   7790  C CB  . CYS A  1 1074 ? 226.602 216.574 176.056 1.00 26.82  ? 1043 CYS A CB  1 
ATOM   7791  S SG  . CYS A  1 1074 ? 225.217 215.407 176.256 1.00 26.82  ? 1043 CYS A SG  1 
ATOM   7792  N N   . GLY A  1 1075 ? 227.901 219.843 177.298 1.00 29.87  ? 1044 GLY A N   1 
ATOM   7793  C CA  . GLY A  1 1075 ? 228.926 220.833 177.028 1.00 29.87  ? 1044 GLY A CA  1 
ATOM   7794  C C   . GLY A  1 1075 ? 228.377 222.062 176.322 1.00 29.87  ? 1044 GLY A C   1 
ATOM   7795  O O   . GLY A  1 1075 ? 227.186 222.177 176.034 1.00 29.87  ? 1044 GLY A O   1 
ATOM   7796  N N   . LYS A  1 1076 ? 229.294 222.977 176.017 1.00 36.23  ? 1045 LYS A N   1 
ATOM   7797  C CA  . LYS A  1 1076 ? 228.974 224.242 175.364 1.00 36.23  ? 1045 LYS A CA  1 
ATOM   7798  C C   . LYS A  1 1076 ? 229.356 224.181 173.888 1.00 36.23  ? 1045 LYS A C   1 
ATOM   7799  O O   . LYS A  1 1076 ? 230.535 224.033 173.555 1.00 36.23  ? 1045 LYS A O   1 
ATOM   7800  C CB  . LYS A  1 1076 ? 229.695 225.392 176.061 1.00 36.23  ? 1045 LYS A CB  1 
ATOM   7801  C CG  . LYS A  1 1076 ? 229.375 226.759 175.506 1.00 36.23  ? 1045 LYS A CG  1 
ATOM   7802  C CD  . LYS A  1 1076 ? 230.097 227.834 176.290 1.00 36.23  ? 1045 LYS A CD  1 
ATOM   7803  C CE  . LYS A  1 1076 ? 229.808 229.216 175.731 1.00 36.23  ? 1045 LYS A CE  1 
ATOM   7804  N NZ  . LYS A  1 1076 ? 230.518 230.273 176.503 1.00 36.23  ? 1045 LYS A NZ  1 
ATOM   7805  N N   . GLY A  1 1077 ? 228.371 224.330 173.016 1.00 31.42  ? 1046 GLY A N   1 
ATOM   7806  C CA  . GLY A  1 1077 ? 228.541 224.115 171.594 1.00 31.42  ? 1046 GLY A CA  1 
ATOM   7807  C C   . GLY A  1 1077 ? 227.719 222.927 171.126 1.00 31.42  ? 1046 GLY A C   1 
ATOM   7808  O O   . GLY A  1 1077 ? 227.001 222.287 171.893 1.00 31.42  ? 1046 GLY A O   1 
ATOM   7809  N N   . TYR A  1 1078 ? 227.840 222.635 169.837 1.00 28.89  ? 1047 TYR A N   1 
ATOM   7810  C CA  . TYR A  1 1078 ? 227.137 221.505 169.245 1.00 28.89  ? 1047 TYR A CA  1 
ATOM   7811  C C   . TYR A  1 1078 ? 227.835 220.201 169.610 1.00 28.89  ? 1047 TYR A C   1 
ATOM   7812  O O   . TYR A  1 1078 ? 228.993 219.985 169.245 1.00 28.89  ? 1047 TYR A O   1 
ATOM   7813  C CB  . TYR A  1 1078 ? 227.061 221.677 167.732 1.00 28.89  ? 1047 TYR A CB  1 
ATOM   7814  C CG  . TYR A  1 1078 ? 226.425 222.975 167.306 1.00 28.89  ? 1047 TYR A CG  1 
ATOM   7815  C CD1 . TYR A  1 1078 ? 227.139 223.918 166.590 1.00 28.89  ? 1047 TYR A CD1 1 
ATOM   7816  C CD2 . TYR A  1 1078 ? 225.100 223.242 167.596 1.00 28.89  ? 1047 TYR A CD2 1 
ATOM   7817  C CE1 . TYR A  1 1078 ? 226.557 225.098 166.196 1.00 28.89  ? 1047 TYR A CE1 1 
ATOM   7818  C CE2 . TYR A  1 1078 ? 224.510 224.414 167.206 1.00 28.89  ? 1047 TYR A CE2 1 
ATOM   7819  C CZ  . TYR A  1 1078 ? 225.240 225.341 166.506 1.00 28.89  ? 1047 TYR A CZ  1 
ATOM   7820  O OH  . TYR A  1 1078 ? 224.649 226.520 166.116 1.00 28.89  ? 1047 TYR A OH  1 
ATOM   7821  N N   . HIS A  1 1079 ? 227.131 219.337 170.330 1.00 22.82  ? 1048 HIS A N   1 
ATOM   7822  C CA  . HIS A  1 1079 ? 227.752 218.161 170.920 1.00 22.82  ? 1048 HIS A CA  1 
ATOM   7823  C C   . HIS A  1 1079 ? 228.139 217.164 169.838 1.00 22.82  ? 1048 HIS A C   1 
ATOM   7824  O O   . HIS A  1 1079 ? 227.336 216.840 168.961 1.00 22.82  ? 1048 HIS A O   1 
ATOM   7825  C CB  . HIS A  1 1079 ? 226.796 217.526 171.930 1.00 22.82  ? 1048 HIS A CB  1 
ATOM   7826  C CG  . HIS A  1 1079 ? 227.255 216.209 172.477 1.00 22.82  ? 1048 HIS A CG  1 
ATOM   7827  N ND1 . HIS A  1 1079 ? 226.597 215.027 172.224 1.00 22.82  ? 1048 HIS A ND1 1 
ATOM   7828  C CD2 . HIS A  1 1079 ? 228.292 215.893 173.286 1.00 22.82  ? 1048 HIS A CD2 1 
ATOM   7829  C CE1 . HIS A  1 1079 ? 227.217 214.039 172.839 1.00 22.82  ? 1048 HIS A CE1 1 
ATOM   7830  N NE2 . HIS A  1 1079 ? 228.244 214.540 173.496 1.00 22.82  ? 1048 HIS A NE2 1 
ATOM   7831  N N   . LEU A  1 1080 ? 229.378 216.681 169.896 1.00 22.84  ? 1049 LEU A N   1 
ATOM   7832  C CA  . LEU A  1 1080 ? 229.858 215.646 168.994 1.00 22.84  ? 1049 LEU A CA  1 
ATOM   7833  C C   . LEU A  1 1080 ? 229.966 214.299 169.696 1.00 22.84  ? 1049 LEU A C   1 
ATOM   7834  O O   . LEU A  1 1080 ? 229.327 213.336 169.270 1.00 22.84  ? 1049 LEU A O   1 
ATOM   7835  C CB  . LEU A  1 1080 ? 231.212 216.042 168.391 1.00 22.84  ? 1049 LEU A CB  1 
ATOM   7836  C CG  . LEU A  1 1080 ? 231.255 217.078 167.267 1.00 22.84  ? 1049 LEU A CG  1 
ATOM   7837  C CD1 . LEU A  1 1080 ? 232.681 217.402 166.936 1.00 22.84  ? 1049 LEU A CD1 1 
ATOM   7838  C CD2 . LEU A  1 1080 ? 230.548 216.581 166.036 1.00 22.84  ? 1049 LEU A CD2 1 
ATOM   7839  N N   . MET A  1 1081 ? 230.735 214.207 170.780 1.00 25.77  ? 1050 MET A N   1 
ATOM   7840  C CA  . MET A  1 1081 ? 230.832 212.935 171.497 1.00 25.77  ? 1050 MET A CA  1 
ATOM   7841  C C   . MET A  1 1081 ? 231.382 213.155 172.900 1.00 25.77  ? 1050 MET A C   1 
ATOM   7842  O O   . MET A  1 1081 ? 231.834 214.242 173.241 1.00 25.77  ? 1050 MET A O   1 
ATOM   7843  C CB  . MET A  1 1081 ? 231.680 211.923 170.729 1.00 25.77  ? 1050 MET A CB  1 
ATOM   7844  C CG  . MET A  1 1081 ? 233.128 212.294 170.576 1.00 25.77  ? 1050 MET A CG  1 
ATOM   7845  S SD  . MET A  1 1081 ? 233.756 211.686 169.016 1.00 25.77  ? 1050 MET A SD  1 
ATOM   7846  C CE  . MET A  1 1081 ? 233.371 209.952 169.201 1.00 25.77  ? 1050 MET A CE  1 
ATOM   7847  N N   . SER A  1 1082 ? 231.280 212.121 173.736 1.00 22.63  ? 1051 SER A N   1 
ATOM   7848  C CA  . SER A  1 1082 ? 231.769 212.193 175.108 1.00 22.63  ? 1051 SER A CA  1 
ATOM   7849  C C   . SER A  1 1082 ? 232.513 210.920 175.486 1.00 22.63  ? 1051 SER A C   1 
ATOM   7850  O O   . SER A  1 1082 ? 232.230 209.841 174.966 1.00 22.63  ? 1051 SER A O   1 
ATOM   7851  C CB  . SER A  1 1082 ? 230.631 212.424 176.102 1.00 22.63  ? 1051 SER A CB  1 
ATOM   7852  O OG  . SER A  1 1082 ? 229.845 213.528 175.712 1.00 22.63  ? 1051 SER A OG  1 
ATOM   7853  N N   . PHE A  1 1083 ? 233.477 211.069 176.399 1.00 24.34  ? 1052 PHE A N   1 
ATOM   7854  C CA  . PHE A  1 1083 ? 234.279 209.967 176.928 1.00 24.34  ? 1052 PHE A CA  1 
ATOM   7855  C C   . PHE A  1 1083 ? 234.239 209.976 178.453 1.00 24.34  ? 1052 PHE A C   1 
ATOM   7856  O O   . PHE A  1 1083 ? 234.502 211.018 179.065 1.00 24.34  ? 1052 PHE A O   1 
ATOM   7857  C CB  . PHE A  1 1083 ? 235.733 210.068 176.448 1.00 24.34  ? 1052 PHE A CB  1 
ATOM   7858  C CG  . PHE A  1 1083 ? 235.880 210.152 174.958 1.00 24.34  ? 1052 PHE A CG  1 
ATOM   7859  C CD1 . PHE A  1 1083 ? 235.657 209.047 174.161 1.00 24.34  ? 1052 PHE A CD1 1 
ATOM   7860  C CD2 . PHE A  1 1083 ? 236.247 211.337 174.355 1.00 24.34  ? 1052 PHE A CD2 1 
ATOM   7861  C CE1 . PHE A  1 1083 ? 235.788 209.127 172.797 1.00 24.34  ? 1052 PHE A CE1 1 
ATOM   7862  C CE2 . PHE A  1 1083 ? 236.380 211.417 172.991 1.00 24.34  ? 1052 PHE A CE2 1 
ATOM   7863  C CZ  . PHE A  1 1083 ? 236.150 210.311 172.214 1.00 24.34  ? 1052 PHE A CZ  1 
ATOM   7864  N N   . PRO A  1 1084 ? 233.917 208.859 179.107 1.00 26.93  ? 1053 PRO A N   1 
ATOM   7865  C CA  . PRO A  1 1084 ? 233.945 208.818 180.573 1.00 26.93  ? 1053 PRO A CA  1 
ATOM   7866  C C   . PRO A  1 1084 ? 235.288 208.400 181.156 1.00 26.93  ? 1053 PRO A C   1 
ATOM   7867  O O   . PRO A  1 1084 ? 236.018 207.586 180.593 1.00 26.93  ? 1053 PRO A O   1 
ATOM   7868  C CB  . PRO A  1 1084 ? 232.881 207.762 180.894 1.00 26.93  ? 1053 PRO A CB  1 
ATOM   7869  C CG  . PRO A  1 1084 ? 232.968 206.832 179.766 1.00 26.93  ? 1053 PRO A CG  1 
ATOM   7870  C CD  . PRO A  1 1084 ? 233.337 207.627 178.547 1.00 26.93  ? 1053 PRO A CD  1 
ATOM   7871  N N   . GLN A  1 1085 ? 235.604 208.971 182.321 1.00 31.01  ? 1054 GLN A N   1 
ATOM   7872  C CA  . GLN A  1 1085 ? 236.750 208.572 183.125 1.00 31.01  ? 1054 GLN A CA  1 
ATOM   7873  C C   . GLN A  1 1085 ? 236.328 208.440 184.582 1.00 31.01  ? 1054 GLN A C   1 
ATOM   7874  O O   . GLN A  1 1085 ? 235.537 209.242 185.076 1.00 31.01  ? 1054 GLN A O   1 
ATOM   7875  C CB  . GLN A  1 1085 ? 237.883 209.590 183.021 1.00 31.01  ? 1054 GLN A CB  1 
ATOM   7876  C CG  . GLN A  1 1085 ? 238.374 209.873 181.618 1.00 31.01  ? 1054 GLN A CG  1 
ATOM   7877  C CD  . GLN A  1 1085 ? 239.322 208.819 181.103 1.00 31.01  ? 1054 GLN A CD  1 
ATOM   7878  O OE1 . GLN A  1 1085 ? 238.937 207.680 180.858 1.00 31.01  ? 1054 GLN A OE1 1 
ATOM   7879  N NE2 . GLN A  1 1085 ? 240.577 209.189 180.950 1.00 31.01  ? 1054 GLN A NE2 1 
ATOM   7880  N N   . SER A  1 1086 ? 236.843 207.429 185.271 1.00 33.87  ? 1055 SER A N   1 
ATOM   7881  C CA  . SER A  1 1086 ? 236.494 207.227 186.672 1.00 33.87  ? 1055 SER A CA  1 
ATOM   7882  C C   . SER A  1 1086 ? 237.366 208.087 187.579 1.00 33.87  ? 1055 SER A C   1 
ATOM   7883  O O   . SER A  1 1086 ? 238.559 208.264 187.324 1.00 33.87  ? 1055 SER A O   1 
ATOM   7884  C CB  . SER A  1 1086 ? 236.634 205.756 187.045 1.00 33.87  ? 1055 SER A CB  1 
ATOM   7885  O OG  . SER A  1 1086 ? 237.948 205.303 186.806 1.00 33.87  ? 1055 SER A OG  1 
ATOM   7886  N N   . ALA A  1 1087 ? 236.777 208.616 188.643 1.00 34.87  ? 1056 ALA A N   1 
ATOM   7887  C CA  . ALA A  1 1087 ? 237.475 209.413 189.638 1.00 34.87  ? 1056 ALA A CA  1 
ATOM   7888  C C   . ALA A  1 1087 ? 237.076 208.898 191.010 1.00 34.87  ? 1056 ALA A C   1 
ATOM   7889  O O   . ALA A  1 1087 ? 236.019 208.276 191.157 1.00 34.87  ? 1056 ALA A O   1 
ATOM   7890  C CB  . ALA A  1 1087 ? 237.136 210.904 189.506 1.00 34.87  ? 1056 ALA A CB  1 
ATOM   7891  N N   . PRO A  1 1088 ? 237.893 209.133 192.039 1.00 37.83  ? 1057 PRO A N   1 
ATOM   7892  C CA  . PRO A  1 1088 ? 237.524 208.654 193.377 1.00 37.83  ? 1057 PRO A CA  1 
ATOM   7893  C C   . PRO A  1 1088 ? 236.214 209.247 193.865 1.00 37.83  ? 1057 PRO A C   1 
ATOM   7894  O O   . PRO A  1 1088 ? 236.110 210.458 194.073 1.00 37.83  ? 1057 PRO A O   1 
ATOM   7895  C CB  . PRO A  1 1088 ? 238.709 209.093 194.245 1.00 37.83  ? 1057 PRO A CB  1 
ATOM   7896  C CG  . PRO A  1 1088 ? 239.376 210.166 193.476 1.00 37.83  ? 1057 PRO A CG  1 
ATOM   7897  C CD  . PRO A  1 1088 ? 239.192 209.824 192.044 1.00 37.83  ? 1057 PRO A CD  1 
ATOM   7898  N N   . HIS A  1 1089 ? 235.212 208.379 194.034 1.00 33.13  ? 1058 HIS A N   1 
ATOM   7899  C CA  . HIS A  1 1089 ? 233.847 208.718 194.434 1.00 33.13  ? 1058 HIS A CA  1 
ATOM   7900  C C   . HIS A  1 1089 ? 233.058 209.435 193.344 1.00 33.13  ? 1058 HIS A C   1 
ATOM   7901  O O   . HIS A  1 1089 ? 232.057 210.087 193.646 1.00 33.13  ? 1058 HIS A O   1 
ATOM   7902  C CB  . HIS A  1 1089 ? 233.806 209.565 195.712 1.00 33.13  ? 1058 HIS A CB  1 
ATOM   7903  C CG  . HIS A  1 1089 ? 233.927 208.777 196.977 1.00 33.13  ? 1058 HIS A CG  1 
ATOM   7904  N ND1 . HIS A  1 1089 ? 234.420 209.317 198.144 1.00 33.13  ? 1058 HIS A ND1 1 
ATOM   7905  C CD2 . HIS A  1 1089 ? 233.615 207.491 197.261 1.00 33.13  ? 1058 HIS A CD2 1 
ATOM   7906  C CE1 . HIS A  1 1089 ? 234.404 208.400 199.092 1.00 33.13  ? 1058 HIS A CE1 1 
ATOM   7907  N NE2 . HIS A  1 1089 ? 233.923 207.282 198.581 1.00 33.13  ? 1058 HIS A NE2 1 
ATOM   7908  N N   . GLY A  1 1090 ? 233.461 209.340 192.083 1.00 29.12  ? 1059 GLY A N   1 
ATOM   7909  C CA  . GLY A  1 1090 ? 232.771 210.121 191.078 1.00 29.12  ? 1059 GLY A CA  1 
ATOM   7910  C C   . GLY A  1 1090 ? 233.189 209.778 189.667 1.00 29.12  ? 1059 GLY A C   1 
ATOM   7911  O O   . GLY A  1 1090 ? 233.924 208.819 189.422 1.00 29.12  ? 1059 GLY A O   1 
ATOM   7912  N N   . VAL A  1 1091 ? 232.748 210.628 188.740 1.00 24.91  ? 1060 VAL A N   1 
ATOM   7913  C CA  . VAL A  1 1091 ? 232.988 210.437 187.314 1.00 24.91  ? 1060 VAL A CA  1 
ATOM   7914  C C   . VAL A  1 1091 ? 233.347 211.775 186.682 1.00 24.91  ? 1060 VAL A C   1 
ATOM   7915  O O   . VAL A  1 1091 ? 232.907 212.837 187.129 1.00 24.91  ? 1060 VAL A O   1 
ATOM   7916  C CB  . VAL A  1 1091 ? 231.775 209.779 186.608 1.00 24.91  ? 1060 VAL A CB  1 
ATOM   7917  C CG1 . VAL A  1 1091 ? 230.595 210.709 186.564 1.00 24.91  ? 1060 VAL A CG1 1 
ATOM   7918  C CG2 . VAL A  1 1091 ? 232.148 209.290 185.219 1.00 24.91  ? 1060 VAL A CG2 1 
ATOM   7919  N N   . VAL A  1 1092 ? 234.186 211.717 185.651 1.00 24.91  ? 1061 VAL A N   1 
ATOM   7920  C CA  . VAL A  1 1092 ? 234.543 212.863 184.824 1.00 24.91  ? 1061 VAL A CA  1 
ATOM   7921  C C   . VAL A  1 1092 ? 234.123 212.570 183.390 1.00 24.91  ? 1061 VAL A C   1 
ATOM   7922  O O   . VAL A  1 1092 ? 234.314 211.456 182.897 1.00 24.91  ? 1061 VAL A O   1 
ATOM   7923  C CB  . VAL A  1 1092 ? 236.053 213.154 184.904 1.00 24.91  ? 1061 VAL A CB  1 
ATOM   7924  C CG1 . VAL A  1 1092 ? 236.422 214.330 184.036 1.00 24.91  ? 1061 VAL A CG1 1 
ATOM   7925  C CG2 . VAL A  1 1092 ? 236.463 213.401 186.333 1.00 24.91  ? 1061 VAL A CG2 1 
ATOM   7926  N N   . PHE A  1 1093 ? 233.486 213.541 182.752 1.00 21.52  ? 1062 PHE A N   1 
ATOM   7927  C CA  . PHE A  1 1093 ? 233.073 213.443 181.360 1.00 21.52  ? 1062 PHE A CA  1 
ATOM   7928  C C   . PHE A  1 1093 ? 233.930 214.381 180.524 1.00 21.52  ? 1062 PHE A C   1 
ATOM   7929  O O   . PHE A  1 1093 ? 234.129 215.537 180.904 1.00 21.52  ? 1062 PHE A O   1 
ATOM   7930  C CB  . PHE A  1 1093 ? 231.595 213.793 181.214 1.00 21.52  ? 1062 PHE A CB  1 
ATOM   7931  C CG  . PHE A  1 1093 ? 230.678 212.727 181.719 1.00 21.52  ? 1062 PHE A CG  1 
ATOM   7932  C CD1 . PHE A  1 1093 ? 229.997 212.896 182.908 1.00 21.52  ? 1062 PHE A CD1 1 
ATOM   7933  C CD2 . PHE A  1 1093 ? 230.519 211.545 181.028 1.00 21.52  ? 1062 PHE A CD2 1 
ATOM   7934  C CE1 . PHE A  1 1093 ? 229.164 211.917 183.381 1.00 21.52  ? 1062 PHE A CE1 1 
ATOM   7935  C CE2 . PHE A  1 1093 ? 229.688 210.567 181.503 1.00 21.52  ? 1062 PHE A CE2 1 
ATOM   7936  C CZ  . PHE A  1 1093 ? 229.012 210.754 182.680 1.00 21.52  ? 1062 PHE A CZ  1 
ATOM   7937  N N   . LEU A  1 1094 ? 234.453 213.879 179.406 1.00 23.12  ? 1063 LEU A N   1 
ATOM   7938  C CA  . LEU A  1 1094 ? 235.153 214.681 178.407 1.00 23.12  ? 1063 LEU A CA  1 
ATOM   7939  C C   . LEU A  1 1094 ? 234.216 214.896 177.223 1.00 23.12  ? 1063 LEU A C   1 
ATOM   7940  O O   . LEU A  1 1094 ? 233.954 213.960 176.465 1.00 23.12  ? 1063 LEU A O   1 
ATOM   7941  C CB  . LEU A  1 1094 ? 236.434 213.983 177.957 1.00 23.12  ? 1063 LEU A CB  1 
ATOM   7942  C CG  . LEU A  1 1094 ? 237.522 213.626 178.970 1.00 23.12  ? 1063 LEU A CG  1 
ATOM   7943  C CD1 . LEU A  1 1094 ? 238.683 212.972 178.267 1.00 23.12  ? 1063 LEU A CD1 1 
ATOM   7944  C CD2 . LEU A  1 1094 ? 237.999 214.827 179.726 1.00 23.12  ? 1063 LEU A CD2 1 
ATOM   7945  N N   . HIS A  1 1095 ? 233.690 216.112 177.087 1.00 23.90  ? 1064 HIS A N   1 
ATOM   7946  C CA  . HIS A  1 1095 ? 232.759 216.478 176.024 1.00 23.90  ? 1064 HIS A CA  1 
ATOM   7947  C C   . HIS A  1 1095 ? 233.497 217.141 174.866 1.00 23.90  ? 1064 HIS A C   1 
ATOM   7948  O O   . HIS A  1 1095 ? 234.118 218.192 175.049 1.00 23.90  ? 1064 HIS A O   1 
ATOM   7949  C CB  . HIS A  1 1095 ? 231.674 217.412 176.553 1.00 23.90  ? 1064 HIS A CB  1 
ATOM   7950  C CG  . HIS A  1 1095 ? 230.845 216.830 177.659 1.00 23.90  ? 1064 HIS A CG  1 
ATOM   7951  N ND1 . HIS A  1 1095 ? 230.817 217.365 178.928 1.00 23.90  ? 1064 HIS A ND1 1 
ATOM   7952  C CD2 . HIS A  1 1095 ? 230.007 215.769 177.680 1.00 23.90  ? 1064 HIS A CD2 1 
ATOM   7953  C CE1 . HIS A  1 1095 ? 229.995 216.659 179.682 1.00 23.90  ? 1064 HIS A CE1 1 
ATOM   7954  N NE2 . HIS A  1 1095 ? 229.496 215.681 178.951 1.00 23.90  ? 1064 HIS A NE2 1 
ATOM   7955  N N   . VAL A  1 1096 ? 233.438 216.523 173.686 1.00 24.20  ? 1065 VAL A N   1 
ATOM   7956  C CA  . VAL A  1 1096 ? 233.930 217.093 172.436 1.00 24.20  ? 1065 VAL A CA  1 
ATOM   7957  C C   . VAL A  1 1096 ? 232.766 217.744 171.705 1.00 24.20  ? 1065 VAL A C   1 
ATOM   7958  O O   . VAL A  1 1096 ? 231.792 217.058 171.354 1.00 24.20  ? 1065 VAL A O   1 
ATOM   7959  C CB  . VAL A  1 1096 ? 234.578 216.021 171.548 1.00 24.20  ? 1065 VAL A CB  1 
ATOM   7960  C CG1 . VAL A  1 1096 ? 235.387 216.667 170.449 1.00 24.20  ? 1065 VAL A CG1 1 
ATOM   7961  C CG2 . VAL A  1 1096 ? 235.432 215.094 172.374 1.00 24.20  ? 1065 VAL A CG2 1 
ATOM   7962  N N   . THR A  1 1097 ? 232.880 219.061 171.473 1.00 27.23  ? 1066 THR A N   1 
ATOM   7963  C CA  . THR A  1 1097 ? 231.868 219.867 170.804 1.00 27.23  ? 1066 THR A CA  1 
ATOM   7964  C C   . THR A  1 1097 ? 232.474 220.698 169.673 1.00 27.23  ? 1066 THR A C   1 
ATOM   7965  O O   . THR A  1 1097 ? 233.690 220.907 169.592 1.00 27.23  ? 1066 THR A O   1 
ATOM   7966  C CB  . THR A  1 1097 ? 231.151 220.797 171.794 1.00 27.23  ? 1066 THR A CB  1 
ATOM   7967  O OG1 . THR A  1 1097 ? 232.097 221.691 172.385 1.00 27.23  ? 1066 THR A OG1 1 
ATOM   7968  C CG2 . THR A  1 1097 ? 230.470 220.004 172.890 1.00 27.23  ? 1066 THR A CG2 1 
ATOM   7969  N N   . TYR A  1 1098 ? 231.580 221.190 168.815 1.00 28.08  ? 1067 TYR A N   1 
ATOM   7970  C CA  . TYR A  1 1098 ? 231.877 221.983 167.623 1.00 28.08  ? 1067 TYR A CA  1 
ATOM   7971  C C   . TYR A  1 1098 ? 231.512 223.448 167.833 1.00 28.08  ? 1067 TYR A C   1 
ATOM   7972  O O   . TYR A  1 1098 ? 230.399 223.747 168.271 1.00 28.08  ? 1067 TYR A O   1 
ATOM   7973  C CB  . TYR A  1 1098 ? 231.093 221.405 166.439 1.00 28.08  ? 1067 TYR A CB  1 
ATOM   7974  C CG  . TYR A  1 1098 ? 231.189 222.133 165.116 1.00 28.08  ? 1067 TYR A CG  1 
ATOM   7975  C CD1 . TYR A  1 1098 ? 230.470 223.293 164.885 1.00 28.08  ? 1067 TYR A CD1 1 
ATOM   7976  C CD2 . TYR A  1 1098 ? 231.949 221.627 164.079 1.00 28.08  ? 1067 TYR A CD2 1 
ATOM   7977  C CE1 . TYR A  1 1098 ? 230.539 223.946 163.683 1.00 28.08  ? 1067 TYR A CE1 1 
ATOM   7978  C CE2 . TYR A  1 1098 ? 232.020 222.277 162.871 1.00 28.08  ? 1067 TYR A CE2 1 
ATOM   7979  C CZ  . TYR A  1 1098 ? 231.313 223.436 162.682 1.00 28.08  ? 1067 TYR A CZ  1 
ATOM   7980  O OH  . TYR A  1 1098 ? 231.376 224.093 161.480 1.00 28.08  ? 1067 TYR A OH  1 
ATOM   7981  N N   . VAL A  1 1099 ? 232.438 224.364 167.531 1.00 30.60  ? 1068 VAL A N   1 
ATOM   7982  C CA  . VAL A  1 1099 ? 232.242 225.787 167.768 1.00 30.60  ? 1068 VAL A CA  1 
ATOM   7983  C C   . VAL A  1 1099 ? 232.477 226.562 166.473 1.00 30.60  ? 1068 VAL A C   1 
ATOM   7984  O O   . VAL A  1 1099 ? 233.541 226.440 165.870 1.00 30.60  ? 1068 VAL A O   1 
ATOM   7985  C CB  . VAL A  1 1099 ? 233.159 226.321 168.882 1.00 30.60  ? 1068 VAL A CB  1 
ATOM   7986  C CG1 . VAL A  1 1099 ? 232.858 227.773 169.161 1.00 30.60  ? 1068 VAL A CG1 1 
ATOM   7987  C CG2 . VAL A  1 1099 ? 232.992 225.503 170.144 1.00 30.60  ? 1068 VAL A CG2 1 
ATOM   7988  N N   . PRO A  1 1100 ? 231.526 227.368 166.000 1.00 32.87  ? 1069 PRO A N   1 
ATOM   7989  C CA  . PRO A  1 1100 ? 231.764 228.187 164.796 1.00 32.87  ? 1069 PRO A CA  1 
ATOM   7990  C C   . PRO A  1 1100 ? 232.739 229.333 165.053 1.00 32.87  ? 1069 PRO A C   1 
ATOM   7991  O O   . PRO A  1 1100 ? 232.609 230.060 166.038 1.00 32.87  ? 1069 PRO A O   1 
ATOM   7992  C CB  . PRO A  1 1100 ? 230.365 228.700 164.440 1.00 32.87  ? 1069 PRO A CB  1 
ATOM   7993  C CG  . PRO A  1 1100 ? 229.438 227.758 165.126 1.00 32.87  ? 1069 PRO A CG  1 
ATOM   7994  C CD  . PRO A  1 1100 ? 230.112 227.398 166.396 1.00 32.87  ? 1069 PRO A CD  1 
ATOM   7995  N N   . ALA A  1 1101 ? 233.712 229.506 164.149 1.00 39.40  ? 1070 ALA A N   1 
ATOM   7996  C CA  . ALA A  1 1101 ? 234.890 230.325 164.440 1.00 39.40  ? 1070 ALA A CA  1 
ATOM   7997  C C   . ALA A  1 1101 ? 234.890 231.716 163.807 1.00 39.40  ? 1070 ALA A C   1 
ATOM   7998  O O   . ALA A  1 1101 ? 234.918 232.713 164.532 1.00 39.40  ? 1070 ALA A O   1 
ATOM   7999  C CB  . ALA A  1 1101 ? 236.154 229.578 164.008 1.00 39.40  ? 1070 ALA A CB  1 
ATOM   8000  N N   . GLN A  1 1102 ? 234.886 231.820 162.478 1.00 46.37  ? 1071 GLN A N   1 
ATOM   8001  C CA  . GLN A  1 1102 ? 235.130 233.103 161.818 1.00 46.37  ? 1071 GLN A CA  1 
ATOM   8002  C C   . GLN A  1 1102 ? 233.953 233.495 160.938 1.00 46.37  ? 1071 GLN A C   1 
ATOM   8003  O O   . GLN A  1 1102 ? 233.657 232.814 159.953 1.00 46.37  ? 1071 GLN A O   1 
ATOM   8004  C CB  . GLN A  1 1102 ? 236.413 233.059 160.989 1.00 46.37  ? 1071 GLN A CB  1 
ATOM   8005  C CG  . GLN A  1 1102 ? 237.679 233.047 161.818 1.00 46.37  ? 1071 GLN A CG  1 
ATOM   8006  C CD  . GLN A  1 1102 ? 238.862 232.472 161.077 1.00 46.37  ? 1071 GLN A CD  1 
ATOM   8007  O OE1 . GLN A  1 1102 ? 238.964 232.596 159.860 1.00 46.37  ? 1071 GLN A OE1 1 
ATOM   8008  N NE2 . GLN A  1 1102 ? 239.769 231.843 161.809 1.00 46.37  ? 1071 GLN A NE2 1 
ATOM   8009  N N   . GLU A  1 1103 ? 233.318 234.614 161.272 1.00 49.53  ? 1072 GLU A N   1 
ATOM   8010  C CA  . GLU A  1 1103 ? 232.052 235.038 160.689 1.00 49.53  ? 1072 GLU A CA  1 
ATOM   8011  C C   . GLU A  1 1103 ? 232.268 236.125 159.647 1.00 49.53  ? 1072 GLU A C   1 
ATOM   8012  O O   . GLU A  1 1103 ? 233.164 236.959 159.784 1.00 49.53  ? 1072 GLU A O   1 
ATOM   8013  C CB  . GLU A  1 1103 ? 231.122 235.540 161.788 1.00 49.53  ? 1072 GLU A CB  1 
ATOM   8014  C CG  . GLU A  1 1103 ? 231.764 236.618 162.624 1.00 49.53  ? 1072 GLU A CG  1 
ATOM   8015  C CD  . GLU A  1 1103 ? 230.859 237.155 163.709 1.00 49.53  ? 1072 GLU A CD  1 
ATOM   8016  O OE1 . GLU A  1 1103 ? 229.627 237.059 163.563 1.00 49.53  ? 1072 GLU A OE1 1 
ATOM   8017  O OE2 . GLU A  1 1103 ? 231.385 237.655 164.726 1.00 49.53  ? 1072 GLU A OE2 1 
ATOM   8018  N N   . LYS A  1 1104 ? 231.455 236.102 158.592 1.00 47.29  ? 1073 LYS A N   1 
ATOM   8019  C CA  . LYS A  1 1104 ? 231.446 237.160 157.591 1.00 47.29  ? 1073 LYS A CA  1 
ATOM   8020  C C   . LYS A  1 1104 ? 230.027 237.662 157.351 1.00 47.29  ? 1073 LYS A C   1 
ATOM   8021  O O   . LYS A  1 1104 ? 229.054 236.921 157.515 1.00 47.29  ? 1073 LYS A O   1 
ATOM   8022  C CB  . LYS A  1 1104 ? 232.076 236.705 156.271 1.00 47.29  ? 1073 LYS A CB  1 
ATOM   8023  C CG  . LYS A  1 1104 ? 232.797 237.843 155.563 1.00 47.29  ? 1073 LYS A CG  1 
ATOM   8024  C CD  . LYS A  1 1104 ? 233.649 237.385 154.397 1.00 47.29  ? 1073 LYS A CD  1 
ATOM   8025  C CE  . LYS A  1 1104 ? 232.813 237.019 153.197 1.00 47.29  ? 1073 LYS A CE  1 
ATOM   8026  N NZ  . LYS A  1 1104 ? 233.669 236.656 152.035 1.00 47.29  ? 1073 LYS A NZ  1 
ATOM   8027  N N   . ASN A  1 1105 ? 229.927 238.942 156.980 1.00 49.85  ? 1074 ASN A N   1 
ATOM   8028  C CA  . ASN A  1 1105 ? 228.659 239.629 156.754 1.00 49.85  ? 1074 ASN A CA  1 
ATOM   8029  C C   . ASN A  1 1105 ? 228.193 239.487 155.309 1.00 49.85  ? 1074 ASN A C   1 
ATOM   8030  O O   . ASN A  1 1105 ? 228.983 239.634 154.374 1.00 49.85  ? 1074 ASN A O   1 
ATOM   8031  C CB  . ASN A  1 1105 ? 228.796 241.121 157.046 1.00 49.85  ? 1074 ASN A CB  1 
ATOM   8032  C CG  . ASN A  1 1105 ? 228.621 241.464 158.495 1.00 49.85  ? 1074 ASN A CG  1 
ATOM   8033  O OD1 . ASN A  1 1105 ? 227.925 240.782 159.241 1.00 49.85  ? 1074 ASN A OD1 1 
ATOM   8034  N ND2 . ASN A  1 1105 ? 229.256 242.551 158.901 1.00 49.85  ? 1074 ASN A ND2 1 
ATOM   8035  N N   . PHE A  1 1106 ? 226.900 239.215 155.133 1.00 43.00  ? 1075 PHE A N   1 
ATOM   8036  C CA  . PHE A  1 1106 ? 226.280 239.105 153.820 1.00 43.00  ? 1075 PHE A CA  1 
ATOM   8037  C C   . PHE A  1 1106 ? 224.915 239.775 153.854 1.00 43.00  ? 1075 PHE A C   1 
ATOM   8038  O O   . PHE A  1 1106 ? 224.284 239.863 154.906 1.00 43.00  ? 1075 PHE A O   1 
ATOM   8039  C CB  . PHE A  1 1106 ? 226.138 237.650 153.371 1.00 43.00  ? 1075 PHE A CB  1 
ATOM   8040  C CG  . PHE A  1 1106 ? 227.419 236.880 153.391 1.00 43.00  ? 1075 PHE A CG  1 
ATOM   8041  C CD1 . PHE A  1 1106 ? 228.264 236.893 152.303 1.00 43.00  ? 1075 PHE A CD1 1 
ATOM   8042  C CD2 . PHE A  1 1106 ? 227.764 236.121 154.488 1.00 43.00  ? 1075 PHE A CD2 1 
ATOM   8043  C CE1 . PHE A  1 1106 ? 229.437 236.179 152.321 1.00 43.00  ? 1075 PHE A CE1 1 
ATOM   8044  C CE2 . PHE A  1 1106 ? 228.937 235.406 154.509 1.00 43.00  ? 1075 PHE A CE2 1 
ATOM   8045  C CZ  . PHE A  1 1106 ? 229.772 235.435 153.427 1.00 43.00  ? 1075 PHE A CZ  1 
ATOM   8046  N N   . THR A  1 1107 ? 224.466 240.261 152.700 1.00 43.29  ? 1076 THR A N   1 
ATOM   8047  C CA  . THR A  1 1107 ? 223.067 240.638 152.532 1.00 43.29  ? 1076 THR A CA  1 
ATOM   8048  C C   . THR A  1 1107 ? 222.238 239.419 152.155 1.00 43.29  ? 1076 THR A C   1 
ATOM   8049  O O   . THR A  1 1107 ? 222.707 238.531 151.445 1.00 43.29  ? 1076 THR A O   1 
ATOM   8050  C CB  . THR A  1 1107 ? 222.917 241.729 151.477 1.00 43.29  ? 1076 THR A CB  1 
ATOM   8051  O OG1 . THR A  1 1107 ? 223.514 241.296 150.254 1.00 43.29  ? 1076 THR A OG1 1 
ATOM   8052  C CG2 . THR A  1 1107 ? 223.601 242.994 151.937 1.00 43.29  ? 1076 THR A CG2 1 
ATOM   8053  N N   . THR A  1 1108 ? 221.005 239.365 152.647 1.00 41.21  ? 1077 THR A N   1 
ATOM   8054  C CA  . THR A  1 1108 ? 220.175 238.184 152.480 1.00 41.21  ? 1077 THR A CA  1 
ATOM   8055  C C   . THR A  1 1108 ? 218.789 238.573 151.983 1.00 41.21  ? 1077 THR A C   1 
ATOM   8056  O O   . THR A  1 1108 ? 218.422 239.750 151.949 1.00 41.21  ? 1077 THR A O   1 
ATOM   8057  C CB  . THR A  1 1108 ? 220.058 237.412 153.798 1.00 41.21  ? 1077 THR A CB  1 
ATOM   8058  O OG1 . THR A  1 1108 ? 219.367 236.182 153.573 1.00 41.21  ? 1077 THR A OG1 1 
ATOM   8059  C CG2 . THR A  1 1108 ? 219.280 238.223 154.796 1.00 41.21  ? 1077 THR A CG2 1 
ATOM   8060  N N   . ALA A  1 1109 ? 218.015 237.559 151.597 1.00 40.58  ? 1078 ALA A N   1 
ATOM   8061  C CA  . ALA A  1 1109 ? 216.664 237.742 151.091 1.00 40.58  ? 1078 ALA A CA  1 
ATOM   8062  C C   . ALA A  1 1109 ? 215.852 236.493 151.388 1.00 40.58  ? 1078 ALA A C   1 
ATOM   8063  O O   . ALA A  1 1109 ? 216.407 235.390 151.413 1.00 40.58  ? 1078 ALA A O   1 
ATOM   8064  C CB  . ALA A  1 1109 ? 216.662 238.023 149.584 1.00 40.58  ? 1078 ALA A CB  1 
ATOM   8065  N N   . PRO A  1 1110 ? 214.546 236.632 151.637 1.00 40.44  ? 1079 PRO A N   1 
ATOM   8066  C CA  . PRO A  1 1110 ? 213.721 235.437 151.883 1.00 40.44  ? 1079 PRO A CA  1 
ATOM   8067  C C   . PRO A  1 1110 ? 213.477 234.579 150.653 1.00 40.44  ? 1079 PRO A C   1 
ATOM   8068  O O   . PRO A  1 1110 ? 213.450 233.350 150.771 1.00 40.44  ? 1079 PRO A O   1 
ATOM   8069  C CB  . PRO A  1 1110 ? 212.413 236.025 152.429 1.00 40.44  ? 1079 PRO A CB  1 
ATOM   8070  C CG  . PRO A  1 1110 ? 212.723 237.419 152.798 1.00 40.44  ? 1079 PRO A CG  1 
ATOM   8071  C CD  . PRO A  1 1110 ? 213.803 237.871 151.893 1.00 40.44  ? 1079 PRO A CD  1 
ATOM   8072  N N   . ALA A  1 1111 ? 213.267 235.182 149.483 1.00 43.94  ? 1080 ALA A N   1 
ATOM   8073  C CA  . ALA A  1 1111 ? 212.880 234.444 148.287 1.00 43.94  ? 1080 ALA A CA  1 
ATOM   8074  C C   . ALA A  1 1111 ? 213.476 235.116 147.058 1.00 43.94  ? 1080 ALA A C   1 
ATOM   8075  O O   . ALA A  1 1111 ? 214.045 236.204 147.136 1.00 43.94  ? 1080 ALA A O   1 
ATOM   8076  C CB  . ALA A  1 1111 ? 211.361 234.340 148.165 1.00 43.94  ? 1080 ALA A CB  1 
ATOM   8077  N N   . ILE A  1 1112 ? 213.352 234.440 145.916 1.00 47.70  ? 1081 ILE A N   1 
ATOM   8078  C CA  . ILE A  1 1112 ? 213.796 234.942 144.619 1.00 47.70  ? 1081 ILE A CA  1 
ATOM   8079  C C   . ILE A  1 1112 ? 212.606 234.930 143.669 1.00 47.70  ? 1081 ILE A C   1 
ATOM   8080  O O   . ILE A  1 1112 ? 211.895 233.926 143.578 1.00 47.70  ? 1081 ILE A O   1 
ATOM   8081  C CB  . ILE A  1 1112 ? 214.949 234.098 144.046 1.00 47.70  ? 1081 ILE A CB  1 
ATOM   8082  C CG1 . ILE A  1 1112 ? 216.116 234.033 145.024 1.00 47.70  ? 1081 ILE A CG1 1 
ATOM   8083  C CG2 . ILE A  1 1112 ? 215.424 234.667 142.732 1.00 47.70  ? 1081 ILE A CG2 1 
ATOM   8084  C CD1 . ILE A  1 1112 ? 216.892 235.300 145.118 1.00 47.70  ? 1081 ILE A CD1 1 
ATOM   8085  N N   . CYS A  1 1113 ? 212.406 236.031 142.948 1.00 57.14  ? 1082 CYS A N   1 
ATOM   8086  C CA  . CYS A  1 1113 ? 211.336 236.155 141.961 1.00 57.14  ? 1082 CYS A CA  1 
ATOM   8087  C C   . CYS A  1 1113 ? 211.919 236.029 140.558 1.00 57.14  ? 1082 CYS A C   1 
ATOM   8088  O O   . CYS A  1 1113 ? 212.667 236.903 140.112 1.00 57.14  ? 1082 CYS A O   1 
ATOM   8089  C CB  . CYS A  1 1113 ? 210.606 237.484 142.127 1.00 57.14  ? 1082 CYS A CB  1 
ATOM   8090  S SG  . CYS A  1 1113 ? 209.130 237.694 141.099 1.00 57.14  ? 1082 CYS A SG  1 
ATOM   8091  N N   . HIS A  1 1114 ? 211.582 234.942 139.862 1.00 63.01  ? 1083 HIS A N   1 
ATOM   8092  C CA  . HIS A  1 1114 ? 212.160 234.657 138.552 1.00 63.01  ? 1083 HIS A CA  1 
ATOM   8093  C C   . HIS A  1 1114 ? 211.221 235.031 137.408 1.00 63.01  ? 1083 HIS A C   1 
ATOM   8094  O O   . HIS A  1 1114 ? 211.560 235.881 136.579 1.00 63.01  ? 1083 HIS A O   1 
ATOM   8095  C CB  . HIS A  1 1114 ? 212.541 233.178 138.453 1.00 63.01  ? 1083 HIS A CB  1 
ATOM   8096  C CG  . HIS A  1 1114 ? 213.181 232.811 137.153 1.00 63.01  ? 1083 HIS A CG  1 
ATOM   8097  N ND1 . HIS A  1 1114 ? 213.031 231.572 136.572 1.00 63.01  ? 1083 HIS A ND1 1 
ATOM   8098  C CD2 . HIS A  1 1114 ? 213.984 233.520 136.325 1.00 63.01  ? 1083 HIS A CD2 1 
ATOM   8099  C CE1 . HIS A  1 1114 ? 213.707 231.536 135.438 1.00 63.01  ? 1083 HIS A CE1 1 
ATOM   8100  N NE2 . HIS A  1 1114 ? 214.296 232.704 135.266 1.00 63.01  ? 1083 HIS A NE2 1 
ATOM   8101  N N   . ASP A  1 1115 ? 210.045 234.413 137.344 1.00 67.42  ? 1084 ASP A N   1 
ATOM   8102  C CA  . ASP A  1 1115 ? 209.084 234.622 136.260 1.00 67.42  ? 1084 ASP A CA  1 
ATOM   8103  C C   . ASP A  1 1115 ? 207.682 234.805 136.813 1.00 67.42  ? 1084 ASP A C   1 
ATOM   8104  O O   . ASP A  1 1115 ? 206.719 234.183 136.364 1.00 67.42  ? 1084 ASP A O   1 
ATOM   8105  C CB  . ASP A  1 1115 ? 209.091 233.477 135.256 1.00 67.42  ? 1084 ASP A CB  1 
ATOM   8106  C CG  . ASP A  1 1115 ? 210.311 233.484 134.380 1.00 67.42  ? 1084 ASP A CG  1 
ATOM   8107  O OD1 . ASP A  1 1115 ? 210.843 234.583 134.127 1.00 67.42  ? 1084 ASP A OD1 1 
ATOM   8108  O OD2 . ASP A  1 1115 ? 210.728 232.399 133.927 1.00 67.42  ? 1084 ASP A OD2 1 
ATOM   8109  N N   . GLY A  1 1116 ? 207.551 235.659 137.819 1.00 65.15  ? 1085 GLY A N   1 
ATOM   8110  C CA  . GLY A  1 1116 ? 206.312 235.695 138.561 1.00 65.15  ? 1085 GLY A CA  1 
ATOM   8111  C C   . GLY A  1 1116 ? 206.129 234.527 139.492 1.00 65.15  ? 1085 GLY A C   1 
ATOM   8112  O O   . GLY A  1 1116 ? 205.015 234.289 139.960 1.00 65.15  ? 1085 GLY A O   1 
ATOM   8113  N N   . LYS A  1 1117 ? 207.196 233.784 139.767 1.00 60.05  ? 1086 LYS A N   1 
ATOM   8114  C CA  . LYS A  1 1117 ? 207.185 232.699 140.732 1.00 60.05  ? 1086 LYS A CA  1 
ATOM   8115  C C   . LYS A  1 1117 ? 208.135 233.030 141.872 1.00 60.05  ? 1086 LYS A C   1 
ATOM   8116  O O   . LYS A  1 1117 ? 209.107 233.766 141.695 1.00 60.05  ? 1086 LYS A O   1 
ATOM   8117  C CB  . LYS A  1 1117 ? 207.583 231.379 140.073 1.00 60.05  ? 1086 LYS A CB  1 
ATOM   8118  C CG  . LYS A  1 1117 ? 206.647 230.958 138.961 1.00 60.05  ? 1086 LYS A CG  1 
ATOM   8119  C CD  . LYS A  1 1117 ? 207.065 229.645 138.334 1.00 60.05  ? 1086 LYS A CD  1 
ATOM   8120  C CE  . LYS A  1 1117 ? 208.231 229.849 137.393 1.00 60.05  ? 1086 LYS A CE  1 
ATOM   8121  N NZ  . LYS A  1 1117 ? 208.832 228.559 136.970 1.00 60.05  ? 1086 LYS A NZ  1 
ATOM   8122  N N   . ALA A  1 1118 ? 207.841 232.488 143.047 1.00 51.93  ? 1087 ALA A N   1 
ATOM   8123  C CA  . ALA A  1 1118 ? 208.656 232.667 144.240 1.00 51.93  ? 1087 ALA A CA  1 
ATOM   8124  C C   . ALA A  1 1118 ? 209.405 231.379 144.540 1.00 51.93  ? 1087 ALA A C   1 
ATOM   8125  O O   . ALA A  1 1118 ? 208.791 230.316 144.649 1.00 51.93  ? 1087 ALA A O   1 
ATOM   8126  C CB  . ALA A  1 1118 ? 207.796 233.074 145.435 1.00 51.93  ? 1087 ALA A CB  1 
ATOM   8127  N N   . HIS A  1 1119 ? 210.723 231.473 144.651 1.00 46.61  ? 1088 HIS A N   1 
ATOM   8128  C CA  . HIS A  1 1119 ? 211.596 230.335 144.900 1.00 46.61  ? 1088 HIS A CA  1 
ATOM   8129  C C   . HIS A  1 1119 ? 212.133 230.434 146.319 1.00 46.61  ? 1088 HIS A C   1 
ATOM   8130  O O   . HIS A  1 1119 ? 212.583 231.502 146.736 1.00 46.61  ? 1088 HIS A O   1 
ATOM   8131  C CB  . HIS A  1 1119 ? 212.757 230.304 143.907 1.00 46.61  ? 1088 HIS A CB  1 
ATOM   8132  C CG  . HIS A  1 1119 ? 212.342 230.086 142.486 1.00 46.61  ? 1088 HIS A CG  1 
ATOM   8133  N ND1 . HIS A  1 1119 ? 212.464 228.869 141.853 1.00 46.61  ? 1088 HIS A ND1 1 
ATOM   8134  C CD2 . HIS A  1 1119 ? 211.810 230.931 141.573 1.00 46.61  ? 1088 HIS A CD2 1 
ATOM   8135  C CE1 . HIS A  1 1119 ? 212.030 228.976 140.610 1.00 46.61  ? 1088 HIS A CE1 1 
ATOM   8136  N NE2 . HIS A  1 1119 ? 211.620 230.215 140.418 1.00 46.61  ? 1088 HIS A NE2 1 
ATOM   8137  N N   . PHE A  1 1120 ? 212.082 229.330 147.061 1.00 43.07  ? 1089 PHE A N   1 
ATOM   8138  C CA  . PHE A  1 1120 ? 212.582 229.292 148.425 1.00 43.07  ? 1089 PHE A CA  1 
ATOM   8139  C C   . PHE A  1 1120 ? 213.664 228.230 148.547 1.00 43.07  ? 1089 PHE A C   1 
ATOM   8140  O O   . PHE A  1 1120 ? 213.632 227.231 147.825 1.00 43.07  ? 1089 PHE A O   1 
ATOM   8141  C CB  . PHE A  1 1120 ? 211.479 228.975 149.443 1.00 43.07  ? 1089 PHE A CB  1 
ATOM   8142  C CG  . PHE A  1 1120 ? 210.297 229.887 149.373 1.00 43.07  ? 1089 PHE A CG  1 
ATOM   8143  C CD1 . PHE A  1 1120 ? 209.286 229.666 148.463 1.00 43.07  ? 1089 PHE A CD1 1 
ATOM   8144  C CD2 . PHE A  1 1120 ? 210.202 230.973 150.218 1.00 43.07  ? 1089 PHE A CD2 1 
ATOM   8145  C CE1 . PHE A  1 1120 ? 208.205 230.507 148.402 1.00 43.07  ? 1089 PHE A CE1 1 
ATOM   8146  C CE2 . PHE A  1 1120 ? 209.128 231.812 150.159 1.00 43.07  ? 1089 PHE A CE2 1 
ATOM   8147  C CZ  . PHE A  1 1120 ? 208.127 231.584 149.249 1.00 43.07  ? 1089 PHE A CZ  1 
ATOM   8148  N N   . PRO A  1 1121 ? 214.642 228.421 149.433 1.00 44.35  ? 1090 PRO A N   1 
ATOM   8149  C CA  . PRO A  1 1121 ? 215.680 227.400 149.606 1.00 44.35  ? 1090 PRO A CA  1 
ATOM   8150  C C   . PRO A  1 1121 ? 215.104 226.122 150.190 1.00 44.35  ? 1090 PRO A C   1 
ATOM   8151  O O   . PRO A  1 1121 ? 214.234 226.157 151.062 1.00 44.35  ? 1090 PRO A O   1 
ATOM   8152  C CB  . PRO A  1 1121 ? 216.672 228.054 150.576 1.00 44.35  ? 1090 PRO A CB  1 
ATOM   8153  C CG  . PRO A  1 1121 ? 216.299 229.474 150.640 1.00 44.35  ? 1090 PRO A CG  1 
ATOM   8154  C CD  . PRO A  1 1121 ? 214.856 229.573 150.319 1.00 44.35  ? 1090 PRO A CD  1 
ATOM   8155  N N   . ARG A  1 1122 ? 215.605 224.984 149.710 1.00 51.27  ? 1091 ARG A N   1 
ATOM   8156  C CA  . ARG A  1 1122 ? 215.198 223.708 150.288 1.00 51.27  ? 1091 ARG A CA  1 
ATOM   8157  C C   . ARG A  1 1122 ? 215.747 223.539 151.696 1.00 51.27  ? 1091 ARG A C   1 
ATOM   8158  O O   . ARG A  1 1122 ? 214.995 223.279 152.642 1.00 51.27  ? 1091 ARG A O   1 
ATOM   8159  C CB  . ARG A  1 1122 ? 215.654 222.543 149.413 1.00 51.27  ? 1091 ARG A CB  1 
ATOM   8160  C CG  . ARG A  1 1122 ? 214.880 222.323 148.141 1.00 51.27  ? 1091 ARG A CG  1 
ATOM   8161  C CD  . ARG A  1 1122 ? 215.224 220.953 147.603 1.00 51.27  ? 1091 ARG A CD  1 
ATOM   8162  N NE  . ARG A  1 1122 ? 215.122 220.865 146.154 1.00 51.27  ? 1091 ARG A NE  1 
ATOM   8163  C CZ  . ARG A  1 1122 ? 214.024 220.494 145.508 1.00 51.27  ? 1091 ARG A CZ  1 
ATOM   8164  N NH1 . ARG A  1 1122 ? 212.931 220.181 146.187 1.00 51.27  ? 1091 ARG A NH1 1 
ATOM   8165  N NH2 . ARG A  1 1122 ? 214.019 220.439 144.185 1.00 51.27  ? 1091 ARG A NH2 1 
ATOM   8166  N N   . GLU A  1 1123 ? 217.064 223.668 151.854 1.00 53.97  ? 1092 GLU A N   1 
ATOM   8167  C CA  . GLU A  1 1123 ? 217.680 223.502 153.162 1.00 53.97  ? 1092 GLU A CA  1 
ATOM   8168  C C   . GLU A  1 1123 ? 218.823 224.483 153.414 1.00 53.97  ? 1092 GLU A C   1 
ATOM   8169  O O   . GLU A  1 1123 ? 219.726 224.194 154.206 1.00 53.97  ? 1092 GLU A O   1 
ATOM   8170  C CB  . GLU A  1 1123 ? 218.142 222.055 153.318 1.00 53.97  ? 1092 GLU A CB  1 
ATOM   8171  C CG  . GLU A  1 1123 ? 219.144 221.625 152.271 1.00 53.97  ? 1092 GLU A CG  1 
ATOM   8172  C CD  . GLU A  1 1123 ? 219.488 220.155 152.367 1.00 53.97  ? 1092 GLU A CD  1 
ATOM   8173  O OE1 . GLU A  1 1123 ? 219.193 219.537 153.413 1.00 53.97  ? 1092 GLU A OE1 1 
ATOM   8174  O OE2 . GLU A  1 1123 ? 220.039 219.612 151.388 1.00 53.97  ? 1092 GLU A OE2 1 
ATOM   8175  N N   . GLY A  1 1124 ? 218.807 225.644 152.767 1.00 44.10  ? 1093 GLY A N   1 
ATOM   8176  C CA  . GLY A  1 1124 ? 219.883 226.602 152.932 1.00 44.10  ? 1093 GLY A CA  1 
ATOM   8177  C C   . GLY A  1 1124 ? 219.396 228.022 153.133 1.00 44.10  ? 1093 GLY A C   1 
ATOM   8178  O O   . GLY A  1 1124 ? 218.253 228.237 153.542 1.00 44.10  ? 1093 GLY A O   1 
ATOM   8179  N N   . VAL A  1 1125 ? 220.257 229.001 152.861 1.00 40.22  ? 1094 VAL A N   1 
ATOM   8180  C CA  . VAL A  1 1125 ? 219.911 230.412 152.960 1.00 40.22  ? 1094 VAL A CA  1 
ATOM   8181  C C   . VAL A  1 1125 ? 220.481 231.149 151.750 1.00 40.22  ? 1094 VAL A C   1 
ATOM   8182  O O   . VAL A  1 1125 ? 221.538 230.791 151.226 1.00 40.22  ? 1094 VAL A O   1 
ATOM   8183  C CB  . VAL A  1 1125 ? 220.409 231.000 154.301 1.00 40.22  ? 1094 VAL A CB  1 
ATOM   8184  C CG1 . VAL A  1 1125 ? 221.909 230.917 154.402 1.00 40.22  ? 1094 VAL A CG1 1 
ATOM   8185  C CG2 . VAL A  1 1125 ? 219.940 232.417 154.480 1.00 40.22  ? 1094 VAL A CG2 1 
ATOM   8186  N N   . PHE A  1 1126 ? 219.754 232.166 151.286 1.00 40.27  ? 1095 PHE A N   1 
ATOM   8187  C CA  . PHE A  1 1126 ? 220.173 232.998 150.161 1.00 40.27  ? 1095 PHE A CA  1 
ATOM   8188  C C   . PHE A  1 1126 ? 221.052 234.150 150.637 1.00 40.27  ? 1095 PHE A C   1 
ATOM   8189  O O   . PHE A  1 1126 ? 220.659 234.899 151.534 1.00 40.27  ? 1095 PHE A O   1 
ATOM   8190  C CB  . PHE A  1 1126 ? 218.960 233.584 149.437 1.00 40.27  ? 1095 PHE A CB  1 
ATOM   8191  C CG  . PHE A  1 1126 ? 218.200 232.602 148.597 1.00 40.27  ? 1095 PHE A CG  1 
ATOM   8192  C CD1 . PHE A  1 1126 ? 216.821 232.649 148.552 1.00 40.27  ? 1095 PHE A CD1 1 
ATOM   8193  C CD2 . PHE A  1 1126 ? 218.848 231.650 147.842 1.00 40.27  ? 1095 PHE A CD2 1 
ATOM   8194  C CE1 . PHE A  1 1126 ? 216.110 231.764 147.781 1.00 40.27  ? 1095 PHE A CE1 1 
ATOM   8195  C CE2 . PHE A  1 1126 ? 218.131 230.757 147.076 1.00 40.27  ? 1095 PHE A CE2 1 
ATOM   8196  C CZ  . PHE A  1 1126 ? 216.764 230.819 147.044 1.00 40.27  ? 1095 PHE A CZ  1 
ATOM   8197  N N   . VAL A  1 1127 ? 222.241 234.297 150.044 1.00 43.62  ? 1096 VAL A N   1 
ATOM   8198  C CA  . VAL A  1 1127 ? 223.160 235.366 150.424 1.00 43.62  ? 1096 VAL A CA  1 
ATOM   8199  C C   . VAL A  1 1127 ? 223.699 236.055 149.175 1.00 43.62  ? 1096 VAL A C   1 
ATOM   8200  O O   . VAL A  1 1127 ? 223.611 235.538 148.062 1.00 43.62  ? 1096 VAL A O   1 
ATOM   8201  C CB  . VAL A  1 1127 ? 224.333 234.867 151.293 1.00 43.62  ? 1096 VAL A CB  1 
ATOM   8202  C CG1 . VAL A  1 1127 ? 223.829 234.251 152.577 1.00 43.62  ? 1096 VAL A CG1 1 
ATOM   8203  C CG2 . VAL A  1 1127 ? 225.177 233.877 150.522 1.00 43.62  ? 1096 VAL A CG2 1 
ATOM   8204  N N   . SER A  1 1128 ? 224.234 237.259 149.372 1.00 50.46  ? 1097 SER A N   1 
ATOM   8205  C CA  . SER A  1 1128 ? 224.838 238.042 148.302 1.00 50.46  ? 1097 SER A CA  1 
ATOM   8206  C C   . SER A  1 1128 ? 226.181 238.601 148.737 1.00 50.46  ? 1097 SER A C   1 
ATOM   8207  O O   . SER A  1 1128 ? 226.303 239.150 149.834 1.00 50.46  ? 1097 SER A O   1 
ATOM   8208  C CB  . SER A  1 1128 ? 223.941 239.200 147.888 1.00 50.46  ? 1097 SER A CB  1 
ATOM   8209  O OG  . SER A  1 1128 ? 224.434 239.827 146.723 1.00 50.46  ? 1097 SER A OG  1 
ATOM   8210  N N   . ASN A  1 1129 ? 227.183 238.488 147.868 1.00 62.92  ? 1098 ASN A N   1 
ATOM   8211  C CA  . ASN A  1 1129 ? 228.483 239.091 148.139 1.00 62.92  ? 1098 ASN A CA  1 
ATOM   8212  C C   . ASN A  1 1129 ? 228.540 240.563 147.744 1.00 62.92  ? 1098 ASN A C   1 
ATOM   8213  O O   . ASN A  1 1129 ? 229.616 241.164 147.798 1.00 62.92  ? 1098 ASN A O   1 
ATOM   8214  C CB  . ASN A  1 1129 ? 229.613 238.302 147.470 1.00 62.92  ? 1098 ASN A CB  1 
ATOM   8215  C CG  . ASN A  1 1129 ? 229.675 238.486 145.974 1.00 62.92  ? 1098 ASN A CG  1 
ATOM   8216  O OD1 . ASN A  1 1129 ? 228.771 239.030 145.347 1.00 62.92  ? 1098 ASN A OD1 1 
ATOM   8217  N ND2 . ASN A  1 1129 ? 230.777 238.031 145.393 1.00 62.92  ? 1098 ASN A ND2 1 
ATOM   8218  N N   . GLY A  1 1130 ? 227.416 241.138 147.330 1.00 64.73  ? 1099 GLY A N   1 
ATOM   8219  C CA  . GLY A  1 1130 ? 227.347 242.494 146.824 1.00 64.73  ? 1099 GLY A CA  1 
ATOM   8220  C C   . GLY A  1 1130 ? 226.809 242.556 145.410 1.00 64.73  ? 1099 GLY A C   1 
ATOM   8221  O O   . GLY A  1 1130 ? 225.909 243.348 145.123 1.00 64.73  ? 1099 GLY A O   1 
ATOM   8222  N N   . THR A  1 1131 ? 227.350 241.735 144.514 1.00 66.28  ? 1100 THR A N   1 
ATOM   8223  C CA  . THR A  1 1131 ? 226.928 241.746 143.121 1.00 66.28  ? 1100 THR A CA  1 
ATOM   8224  C C   . THR A  1 1131 ? 226.187 240.490 142.694 1.00 66.28  ? 1100 THR A C   1 
ATOM   8225  O O   . THR A  1 1131 ? 225.346 240.563 141.797 1.00 66.28  ? 1100 THR A O   1 
ATOM   8226  C CB  . THR A  1 1131 ? 228.135 241.942 142.196 1.00 66.28  ? 1100 THR A CB  1 
ATOM   8227  O OG1 . THR A  1 1131 ? 229.044 240.846 142.351 1.00 66.28  ? 1100 THR A OG1 1 
ATOM   8228  C CG2 . THR A  1 1131 ? 228.853 243.236 142.531 1.00 66.28  ? 1100 THR A CG2 1 
ATOM   8229  N N   . HIS A  1 1132 ? 226.473 239.345 143.313 1.00 61.70  ? 1101 HIS A N   1 
ATOM   8230  C CA  . HIS A  1 1132 ? 225.942 238.063 142.881 1.00 61.70  ? 1101 HIS A CA  1 
ATOM   8231  C C   . HIS A  1 1132 ? 225.214 237.378 144.030 1.00 61.70  ? 1101 HIS A C   1 
ATOM   8232  O O   . HIS A  1 1132 ? 225.446 237.675 145.202 1.00 61.70  ? 1101 HIS A O   1 
ATOM   8233  C CB  . HIS A  1 1132 ? 227.064 237.158 142.368 1.00 61.70  ? 1101 HIS A CB  1 
ATOM   8234  C CG  . HIS A  1 1132 ? 227.437 237.407 140.941 1.00 61.70  ? 1101 HIS A CG  1 
ATOM   8235  N ND1 . HIS A  1 1132 ? 228.188 238.493 140.548 1.00 61.70  ? 1101 HIS A ND1 1 
ATOM   8236  C CD2 . HIS A  1 1132 ? 227.169 236.707 139.814 1.00 61.70  ? 1101 HIS A CD2 1 
ATOM   8237  C CE1 . HIS A  1 1132 ? 228.364 238.454 139.240 1.00 61.70  ? 1101 HIS A CE1 1 
ATOM   8238  N NE2 . HIS A  1 1132 ? 227.755 237.381 138.770 1.00 61.70  ? 1101 HIS A NE2 1 
ATOM   8239  N N   . TRP A  1 1133 ? 224.317 236.461 143.675 1.00 47.92  ? 1102 TRP A N   1 
ATOM   8240  C CA  . TRP A  1 1133 ? 223.431 235.791 144.619 1.00 47.92  ? 1102 TRP A CA  1 
ATOM   8241  C C   . TRP A  1 1133 ? 223.722 234.297 144.626 1.00 47.92  ? 1102 TRP A C   1 
ATOM   8242  O O   . TRP A  1 1133 ? 223.768 233.670 143.565 1.00 47.92  ? 1102 TRP A O   1 
ATOM   8243  C CB  . TRP A  1 1133 ? 221.965 236.054 144.283 1.00 47.92  ? 1102 TRP A CB  1 
ATOM   8244  C CG  . TRP A  1 1133 ? 221.501 237.379 144.774 1.00 47.92  ? 1102 TRP A CG  1 
ATOM   8245  C CD1 . TRP A  1 1133 ? 221.461 238.541 144.073 1.00 47.92  ? 1102 TRP A CD1 1 
ATOM   8246  C CD2 . TRP A  1 1133 ? 221.011 237.682 146.081 1.00 47.92  ? 1102 TRP A CD2 1 
ATOM   8247  N NE1 . TRP A  1 1133 ? 220.981 239.554 144.861 1.00 47.92  ? 1102 TRP A NE1 1 
ATOM   8248  C CE2 . TRP A  1 1133 ? 220.700 239.050 146.102 1.00 47.92  ? 1102 TRP A CE2 1 
ATOM   8249  C CE3 . TRP A  1 1133 ? 220.815 236.932 147.240 1.00 47.92  ? 1102 TRP A CE3 1 
ATOM   8250  C CZ2 . TRP A  1 1133 ? 220.196 239.678 147.232 1.00 47.92  ? 1102 TRP A CZ2 1 
ATOM   8251  C CZ3 . TRP A  1 1133 ? 220.316 237.556 148.352 1.00 47.92  ? 1102 TRP A CZ3 1 
ATOM   8252  C CH2 . TRP A  1 1133 ? 220.011 238.912 148.343 1.00 47.92  ? 1102 TRP A CH2 1 
ATOM   8253  N N   . PHE A  1 1134 ? 223.908 233.731 145.817 1.00 45.23  ? 1103 PHE A N   1 
ATOM   8254  C CA  . PHE A  1 1134 ? 224.173 232.311 145.984 1.00 45.23  ? 1103 PHE A CA  1 
ATOM   8255  C C   . PHE A  1 1134 ? 223.258 231.748 147.062 1.00 45.23  ? 1103 PHE A C   1 
ATOM   8256  O O   . PHE A  1 1134 ? 222.587 232.486 147.785 1.00 45.23  ? 1103 PHE A O   1 
ATOM   8257  C CB  . PHE A  1 1134 ? 225.629 232.043 146.385 1.00 45.23  ? 1103 PHE A CB  1 
ATOM   8258  C CG  . PHE A  1 1134 ? 226.639 232.705 145.507 1.00 45.23  ? 1103 PHE A CG  1 
ATOM   8259  C CD1 . PHE A  1 1134 ? 226.884 232.235 144.235 1.00 45.23  ? 1103 PHE A CD1 1 
ATOM   8260  C CD2 . PHE A  1 1134 ? 227.384 233.766 145.977 1.00 45.23  ? 1103 PHE A CD2 1 
ATOM   8261  C CE1 . PHE A  1 1134 ? 227.822 232.837 143.436 1.00 45.23  ? 1103 PHE A CE1 1 
ATOM   8262  C CE2 . PHE A  1 1134 ? 228.327 234.367 145.183 1.00 45.23  ? 1103 PHE A CE2 1 
ATOM   8263  C CZ  . PHE A  1 1134 ? 228.545 233.902 143.912 1.00 45.23  ? 1103 PHE A CZ  1 
ATOM   8264  N N   . VAL A  1 1135 ? 223.248 230.422 147.172 1.00 41.02  ? 1104 VAL A N   1 
ATOM   8265  C CA  . VAL A  1 1135 ? 222.598 229.715 148.269 1.00 41.02  ? 1104 VAL A CA  1 
ATOM   8266  C C   . VAL A  1 1135 ? 223.653 228.903 149.007 1.00 41.02  ? 1104 VAL A C   1 
ATOM   8267  O O   . VAL A  1 1135 ? 224.540 228.313 148.385 1.00 41.02  ? 1104 VAL A O   1 
ATOM   8268  C CB  . VAL A  1 1135 ? 221.444 228.818 147.768 1.00 41.02  ? 1104 VAL A CB  1 
ATOM   8269  C CG1 . VAL A  1 1135 ? 221.958 227.744 146.857 1.00 41.02  ? 1104 VAL A CG1 1 
ATOM   8270  C CG2 . VAL A  1 1135 ? 220.693 228.211 148.926 1.00 41.02  ? 1104 VAL A CG2 1 
ATOM   8271  N N   . THR A  1 1136 ? 223.581 228.904 150.337 1.00 40.02  ? 1105 THR A N   1 
ATOM   8272  C CA  . THR A  1 1136 ? 224.563 228.207 151.156 1.00 40.02  ? 1105 THR A CA  1 
ATOM   8273  C C   . THR A  1 1136 ? 223.854 227.434 152.258 1.00 40.02  ? 1105 THR A C   1 
ATOM   8274  O O   . THR A  1 1136 ? 222.625 227.417 152.343 1.00 40.02  ? 1105 THR A O   1 
ATOM   8275  C CB  . THR A  1 1136 ? 225.595 229.176 151.744 1.00 40.02  ? 1105 THR A CB  1 
ATOM   8276  O OG1 . THR A  1 1136 ? 226.581 228.434 152.464 1.00 40.02  ? 1105 THR A OG1 1 
ATOM   8277  C CG2 . THR A  1 1136 ? 224.947 230.148 152.688 1.00 40.02  ? 1105 THR A CG2 1 
ATOM   8278  N N   . GLN A  1 1137 ? 224.645 226.797 153.116 1.00 37.39  ? 1106 GLN A N   1 
ATOM   8279  C CA  . GLN A  1 1137 ? 224.150 226.110 154.299 1.00 37.39  ? 1106 GLN A CA  1 
ATOM   8280  C C   . GLN A  1 1137 ? 224.365 227.005 155.511 1.00 37.39  ? 1106 GLN A C   1 
ATOM   8281  O O   . GLN A  1 1137 ? 225.262 227.848 155.524 1.00 37.39  ? 1106 GLN A O   1 
ATOM   8282  C CB  . GLN A  1 1137 ? 224.853 224.770 154.503 1.00 37.39  ? 1106 GLN A CB  1 
ATOM   8283  C CG  . GLN A  1 1137 ? 226.356 224.846 154.416 1.00 37.39  ? 1106 GLN A CG  1 
ATOM   8284  C CD  . GLN A  1 1137 ? 227.028 223.515 154.640 1.00 37.39  ? 1106 GLN A CD  1 
ATOM   8285  O OE1 . GLN A  1 1137 ? 227.237 223.105 155.773 1.00 37.39  ? 1106 GLN A OE1 1 
ATOM   8286  N NE2 . GLN A  1 1137 ? 227.396 222.847 153.564 1.00 37.39  ? 1106 GLN A NE2 1 
ATOM   8287  N N   . ARG A  1 1138 ? 223.537 226.816 156.538 1.00 40.12  ? 1107 ARG A N   1 
ATOM   8288  C CA  . ARG A  1 1138 ? 223.441 227.833 157.581 1.00 40.12  ? 1107 ARG A CA  1 
ATOM   8289  C C   . ARG A  1 1138 ? 224.700 227.922 158.439 1.00 40.12  ? 1107 ARG A C   1 
ATOM   8290  O O   . ARG A  1 1138 ? 225.107 229.023 158.820 1.00 40.12  ? 1107 ARG A O   1 
ATOM   8291  C CB  . ARG A  1 1138 ? 222.221 227.566 158.465 1.00 40.12  ? 1107 ARG A CB  1 
ATOM   8292  C CG  . ARG A  1 1138 ? 220.885 227.957 157.842 1.00 40.12  ? 1107 ARG A CG  1 
ATOM   8293  C CD  . ARG A  1 1138 ? 220.247 226.837 157.044 1.00 40.12  ? 1107 ARG A CD  1 
ATOM   8294  N NE  . ARG A  1 1138 ? 219.442 225.968 157.897 1.00 40.12  ? 1107 ARG A NE  1 
ATOM   8295  C CZ  . ARG A  1 1138 ? 218.112 225.987 157.956 1.00 40.12  ? 1107 ARG A CZ  1 
ATOM   8296  N NH1 . ARG A  1 1138 ? 217.416 226.803 157.179 1.00 40.12  ? 1107 ARG A NH1 1 
ATOM   8297  N NH2 . ARG A  1 1138 ? 217.473 225.165 158.774 1.00 40.12  ? 1107 ARG A NH2 1 
ATOM   8298  N N   . ASN A  1 1139 ? 225.334 226.796 158.755 1.00 38.87  ? 1108 ASN A N   1 
ATOM   8299  C CA  . ASN A  1 1139 ? 226.421 226.777 159.730 1.00 38.87  ? 1108 ASN A CA  1 
ATOM   8300  C C   . ASN A  1 1139 ? 227.820 226.787 159.128 1.00 38.87  ? 1108 ASN A C   1 
ATOM   8301  O O   . ASN A  1 1139 ? 228.793 226.822 159.882 1.00 38.87  ? 1108 ASN A O   1 
ATOM   8302  C CB  . ASN A  1 1139 ? 226.292 225.557 160.642 1.00 38.87  ? 1108 ASN A CB  1 
ATOM   8303  C CG  . ASN A  1 1139 ? 224.989 225.525 161.387 1.00 38.87  ? 1108 ASN A CG  1 
ATOM   8304  O OD1 . ASN A  1 1139 ? 224.080 224.776 161.040 1.00 38.87  ? 1108 ASN A OD1 1 
ATOM   8305  N ND2 . ASN A  1 1139 ? 224.887 226.341 162.422 1.00 38.87  ? 1108 ASN A ND2 1 
ATOM   8306  N N   . PHE A  1 1140 ? 227.955 226.752 157.808 1.00 36.26  ? 1109 PHE A N   1 
ATOM   8307  C CA  . PHE A  1 1140 ? 229.262 226.822 157.172 1.00 36.26  ? 1109 PHE A CA  1 
ATOM   8308  C C   . PHE A  1 1140 ? 229.084 227.487 155.817 1.00 36.26  ? 1109 PHE A C   1 
ATOM   8309  O O   . PHE A  1 1140 ? 228.058 227.309 155.163 1.00 36.26  ? 1109 PHE A O   1 
ATOM   8310  C CB  . PHE A  1 1140 ? 229.862 225.415 157.043 1.00 36.26  ? 1109 PHE A CB  1 
ATOM   8311  C CG  . PHE A  1 1140 ? 231.321 225.389 156.702 1.00 36.26  ? 1109 PHE A CG  1 
ATOM   8312  C CD1 . PHE A  1 1140 ? 232.270 225.617 157.673 1.00 36.26  ? 1109 PHE A CD1 1 
ATOM   8313  C CD2 . PHE A  1 1140 ? 231.745 225.099 155.422 1.00 36.26  ? 1109 PHE A CD2 1 
ATOM   8314  C CE1 . PHE A  1 1140 ? 233.608 225.579 157.370 1.00 36.26  ? 1109 PHE A CE1 1 
ATOM   8315  C CE2 . PHE A  1 1140 ? 233.085 225.063 155.115 1.00 36.26  ? 1109 PHE A CE2 1 
ATOM   8316  C CZ  . PHE A  1 1140 ? 234.015 225.301 156.091 1.00 36.26  ? 1109 PHE A CZ  1 
ATOM   8317  N N   . TYR A  1 1141 ? 230.076 228.263 155.396 1.00 40.45  ? 1110 TYR A N   1 
ATOM   8318  C CA  . TYR A  1 1141 ? 229.949 229.056 154.178 1.00 40.45  ? 1110 TYR A CA  1 
ATOM   8319  C C   . TYR A  1 1141 ? 230.473 228.262 152.989 1.00 40.45  ? 1110 TYR A C   1 
ATOM   8320  O O   . TYR A  1 1141 ? 231.670 227.977 152.899 1.00 40.45  ? 1110 TYR A O   1 
ATOM   8321  C CB  . TYR A  1 1141 ? 230.685 230.384 154.320 1.00 40.45  ? 1110 TYR A CB  1 
ATOM   8322  C CG  . TYR A  1 1141 ? 230.559 231.270 153.108 1.00 40.45  ? 1110 TYR A CG  1 
ATOM   8323  C CD1 . TYR A  1 1141 ? 231.676 231.657 152.389 1.00 40.45  ? 1110 TYR A CD1 1 
ATOM   8324  C CD2 . TYR A  1 1141 ? 229.321 231.682 152.659 1.00 40.45  ? 1110 TYR A CD2 1 
ATOM   8325  C CE1 . TYR A  1 1141 ? 231.562 232.452 151.275 1.00 40.45  ? 1110 TYR A CE1 1 
ATOM   8326  C CE2 . TYR A  1 1141 ? 229.198 232.473 151.544 1.00 40.45  ? 1110 TYR A CE2 1 
ATOM   8327  C CZ  . TYR A  1 1141 ? 230.318 232.854 150.855 1.00 40.45  ? 1110 TYR A CZ  1 
ATOM   8328  O OH  . TYR A  1 1141 ? 230.188 233.647 149.742 1.00 40.45  ? 1110 TYR A OH  1 
ATOM   8329  N N   . GLU A  1 1142 ? 229.566 227.895 152.084 1.00 46.34  ? 1111 GLU A N   1 
ATOM   8330  C CA  . GLU A  1 1142 ? 229.907 227.098 150.904 1.00 46.34  ? 1111 GLU A CA  1 
ATOM   8331  C C   . GLU A  1 1142 ? 228.988 227.502 149.758 1.00 46.34  ? 1111 GLU A C   1 
ATOM   8332  O O   . GLU A  1 1142 ? 227.978 226.847 149.484 1.00 46.34  ? 1111 GLU A O   1 
ATOM   8333  C CB  . GLU A  1 1142 ? 229.796 225.605 151.211 1.00 46.34  ? 1111 GLU A CB  1 
ATOM   8334  C CG  . GLU A  1 1142 ? 230.137 224.689 150.062 1.00 46.34  ? 1111 GLU A CG  1 
ATOM   8335  C CD  . GLU A  1 1142 ? 229.933 223.235 150.411 1.00 46.34  ? 1111 GLU A CD  1 
ATOM   8336  O OE1 . GLU A  1 1142 ? 230.866 222.631 150.974 1.00 46.34  ? 1111 GLU A OE1 1 
ATOM   8337  O OE2 . GLU A  1 1142 ? 228.845 222.696 150.122 1.00 46.34  ? 1111 GLU A OE2 1 
ATOM   8338  N N   . PRO A  1 1143 ? 229.301 228.603 149.076 1.00 46.04  ? 1112 PRO A N   1 
ATOM   8339  C CA  . PRO A  1 1143 ? 228.364 229.173 148.098 1.00 46.04  ? 1112 PRO A CA  1 
ATOM   8340  C C   . PRO A  1 1143 ? 228.162 228.311 146.860 1.00 46.04  ? 1112 PRO A C   1 
ATOM   8341  O O   . PRO A  1 1143 ? 229.073 227.625 146.394 1.00 46.04  ? 1112 PRO A O   1 
ATOM   8342  C CB  . PRO A  1 1143 ? 229.019 230.507 147.729 1.00 46.04  ? 1112 PRO A CB  1 
ATOM   8343  C CG  . PRO A  1 1143 ? 230.455 230.291 147.980 1.00 46.04  ? 1112 PRO A CG  1 
ATOM   8344  C CD  . PRO A  1 1143 ? 230.545 229.381 149.162 1.00 46.04  ? 1112 PRO A CD  1 
ATOM   8345  N N   . GLN A  1 1144 ? 226.943 228.366 146.320 1.00 47.62  ? 1113 GLN A N   1 
ATOM   8346  C CA  . GLN A  1 1144 ? 226.557 227.579 145.155 1.00 47.62  ? 1113 GLN A CA  1 
ATOM   8347  C C   . GLN A  1 1144 ? 225.572 228.370 144.305 1.00 47.62  ? 1113 GLN A C   1 
ATOM   8348  O O   . GLN A  1 1144 ? 224.904 229.285 144.787 1.00 47.62  ? 1113 GLN A O   1 
ATOM   8349  C CB  . GLN A  1 1144 ? 225.948 226.235 145.559 1.00 47.62  ? 1113 GLN A CB  1 
ATOM   8350  C CG  . GLN A  1 1144 ? 226.950 225.281 146.152 1.00 47.62  ? 1113 GLN A CG  1 
ATOM   8351  C CD  . GLN A  1 1144 ? 226.325 223.989 146.587 1.00 47.62  ? 1113 GLN A CD  1 
ATOM   8352  O OE1 . GLN A  1 1144 ? 225.104 223.847 146.591 1.00 47.62  ? 1113 GLN A OE1 1 
ATOM   8353  N NE2 . GLN A  1 1144 ? 227.159 223.023 146.944 1.00 47.62  ? 1113 GLN A NE2 1 
ATOM   8354  N N   . ILE A  1 1145 ? 225.488 228.007 143.029 1.00 50.73  ? 1114 ILE A N   1 
ATOM   8355  C CA  . ILE A  1 1145 ? 224.597 228.680 142.089 1.00 50.73  ? 1114 ILE A CA  1 
ATOM   8356  C C   . ILE A  1 1145 ? 223.165 228.205 142.303 1.00 50.73  ? 1114 ILE A C   1 
ATOM   8357  O O   . ILE A  1 1145 ? 222.911 227.007 142.464 1.00 50.73  ? 1114 ILE A O   1 
ATOM   8358  C CB  . ILE A  1 1145 ? 225.066 228.439 140.642 1.00 50.73  ? 1114 ILE A CB  1 
ATOM   8359  C CG1 . ILE A  1 1145 ? 226.425 229.097 140.413 1.00 50.73  ? 1114 ILE A CG1 1 
ATOM   8360  C CG2 . ILE A  1 1145 ? 224.070 228.993 139.652 1.00 50.73  ? 1114 ILE A CG2 1 
ATOM   8361  C CD1 . ILE A  1 1145 ? 227.195 228.520 139.256 1.00 50.73  ? 1114 ILE A CD1 1 
ATOM   8362  N N   . ILE A  1 1146 ? 222.223 229.146 142.296 1.00 52.28  ? 1115 ILE A N   1 
ATOM   8363  C CA  . ILE A  1 1146 ? 220.808 228.848 142.510 1.00 52.28  ? 1115 ILE A CA  1 
ATOM   8364  C C   . ILE A  1 1146 ? 220.241 228.178 141.263 1.00 52.28  ? 1115 ILE A C   1 
ATOM   8365  O O   . ILE A  1 1146 ? 220.166 228.794 140.198 1.00 52.28  ? 1115 ILE A O   1 
ATOM   8366  C CB  . ILE A  1 1146 ? 220.012 230.107 142.862 1.00 52.28  ? 1115 ILE A CB  1 
ATOM   8367  C CG1 . ILE A  1 1146 ? 220.587 230.792 144.093 1.00 52.28  ? 1115 ILE A CG1 1 
ATOM   8368  C CG2 . ILE A  1 1146 ? 218.571 229.764 143.108 1.00 52.28  ? 1115 ILE A CG2 1 
ATOM   8369  C CD1 . ILE A  1 1146 ? 219.971 232.136 144.357 1.00 52.28  ? 1115 ILE A CD1 1 
ATOM   8370  N N   . THR A  1 1147 ? 219.829 226.921 141.396 1.00 57.17  ? 1116 THR A N   1 
ATOM   8371  C CA  . THR A  1 1147 ? 219.221 226.148 140.324 1.00 57.17  ? 1116 THR A CA  1 
ATOM   8372  C C   . THR A  1 1147 ? 217.851 225.658 140.773 1.00 57.17  ? 1116 THR A C   1 
ATOM   8373  O O   . THR A  1 1147 ? 217.447 225.843 141.922 1.00 57.17  ? 1116 THR A O   1 
ATOM   8374  C CB  . THR A  1 1147 ? 220.093 224.955 139.915 1.00 57.17  ? 1116 THR A CB  1 
ATOM   8375  O OG1 . THR A  1 1147 ? 220.059 223.959 140.941 1.00 57.17  ? 1116 THR A OG1 1 
ATOM   8376  C CG2 . THR A  1 1147 ? 221.522 225.387 139.692 1.00 57.17  ? 1116 THR A CG2 1 
ATOM   8377  N N   . THR A  1 1148 ? 217.126 225.030 139.847 1.00 59.90  ? 1117 THR A N   1 
ATOM   8378  C CA  . THR A  1 1148 ? 215.808 224.497 140.172 1.00 59.90  ? 1117 THR A CA  1 
ATOM   8379  C C   . THR A  1 1148 ? 215.895 223.217 140.993 1.00 59.90  ? 1117 THR A C   1 
ATOM   8380  O O   . THR A  1 1148 ? 214.973 222.917 141.755 1.00 59.90  ? 1117 THR A O   1 
ATOM   8381  C CB  . THR A  1 1148 ? 215.000 224.239 138.900 1.00 59.90  ? 1117 THR A CB  1 
ATOM   8382  O OG1 . THR A  1 1148 ? 215.767 223.440 137.994 1.00 59.90  ? 1117 THR A OG1 1 
ATOM   8383  C CG2 . THR A  1 1148 ? 214.626 225.544 138.228 1.00 59.90  ? 1117 THR A CG2 1 
ATOM   8384  N N   . ASP A  1 1149 ? 216.971 222.447 140.840 1.00 59.11  ? 1118 ASP A N   1 
ATOM   8385  C CA  . ASP A  1 1149 ? 217.243 221.301 141.700 1.00 59.11  ? 1118 ASP A CA  1 
ATOM   8386  C C   . ASP A  1 1149 ? 217.757 221.707 143.074 1.00 59.11  ? 1118 ASP A C   1 
ATOM   8387  O O   . ASP A  1 1149 ? 218.233 220.855 143.829 1.00 59.11  ? 1118 ASP A O   1 
ATOM   8388  C CB  . ASP A  1 1149 ? 218.260 220.378 141.029 1.00 59.11  ? 1118 ASP A CB  1 
ATOM   8389  C CG  . ASP A  1 1149 ? 217.744 219.783 139.735 1.00 59.11  ? 1118 ASP A CG  1 
ATOM   8390  O OD1 . ASP A  1 1149 ? 216.723 220.281 139.215 1.00 59.11  ? 1118 ASP A OD1 1 
ATOM   8391  O OD2 . ASP A  1 1149 ? 218.360 218.818 139.237 1.00 59.11  ? 1118 ASP A OD2 1 
ATOM   8392  N N   . ASN A  1 1150 ? 217.667 222.990 143.399 1.00 51.49  ? 1119 ASN A N   1 
ATOM   8393  C CA  . ASN A  1 1150 ? 218.272 223.572 144.585 1.00 51.49  ? 1119 ASN A CA  1 
ATOM   8394  C C   . ASN A  1 1150 ? 217.292 224.383 145.414 1.00 51.49  ? 1119 ASN A C   1 
ATOM   8395  O O   . ASN A  1 1150 ? 217.582 224.661 146.583 1.00 51.49  ? 1119 ASN A O   1 
ATOM   8396  C CB  . ASN A  1 1150 ? 219.446 224.469 144.171 1.00 51.49  ? 1119 ASN A CB  1 
ATOM   8397  C CG  . ASN A  1 1150 ? 220.528 224.527 145.201 1.00 51.49  ? 1119 ASN A CG  1 
ATOM   8398  O OD1 . ASN A  1 1150 ? 220.466 223.855 146.224 1.00 51.49  ? 1119 ASN A OD1 1 
ATOM   8399  N ND2 . ASN A  1 1150 ? 221.559 225.302 144.917 1.00 51.49  ? 1119 ASN A ND2 1 
ATOM   8400  N N   . THR A  1 1151 ? 216.157 224.780 144.842 1.00 48.97  ? 1120 THR A N   1 
ATOM   8401  C CA  . THR A  1 1151 ? 215.100 225.559 145.467 1.00 48.97  ? 1120 THR A CA  1 
ATOM   8402  C C   . THR A  1 1151 ? 213.771 224.846 145.245 1.00 48.97  ? 1120 THR A C   1 
ATOM   8403  O O   . THR A  1 1151 ? 213.719 223.754 144.677 1.00 48.97  ? 1120 THR A O   1 
ATOM   8404  C CB  . THR A  1 1151 ? 215.052 226.974 144.878 1.00 48.97  ? 1120 THR A CB  1 
ATOM   8405  O OG1 . THR A  1 1151 ? 214.744 226.896 143.484 1.00 48.97  ? 1120 THR A OG1 1 
ATOM   8406  C CG2 . THR A  1 1151 ? 216.382 227.659 145.027 1.00 48.97  ? 1120 THR A CG2 1 
ATOM   8407  N N   . PHE A  1 1152 ? 212.684 225.463 145.702 1.00 43.62  ? 1121 PHE A N   1 
ATOM   8408  C CA  . PHE A  1 1152 ? 211.352 224.983 145.356 1.00 43.62  ? 1121 PHE A CA  1 
ATOM   8409  C C   . PHE A  1 1152 ? 210.404 226.165 145.223 1.00 43.62  ? 1121 PHE A C   1 
ATOM   8410  O O   . PHE A  1 1152 ? 210.566 227.183 145.893 1.00 43.62  ? 1121 PHE A O   1 
ATOM   8411  C CB  . PHE A  1 1152 ? 210.830 223.954 146.370 1.00 43.62  ? 1121 PHE A CB  1 
ATOM   8412  C CG  . PHE A  1 1152 ? 210.509 224.515 147.728 1.00 43.62  ? 1121 PHE A CG  1 
ATOM   8413  C CD1 . PHE A  1 1152 ? 211.445 224.481 148.738 1.00 43.62  ? 1121 PHE A CD1 1 
ATOM   8414  C CD2 . PHE A  1 1152 ? 209.254 225.015 148.011 1.00 43.62  ? 1121 PHE A CD2 1 
ATOM   8415  C CE1 . PHE A  1 1152 ? 211.152 224.974 149.982 1.00 43.62  ? 1121 PHE A CE1 1 
ATOM   8416  C CE2 . PHE A  1 1152 ? 208.959 225.501 149.258 1.00 43.62  ? 1121 PHE A CE2 1 
ATOM   8417  C CZ  . PHE A  1 1152 ? 209.909 225.479 150.243 1.00 43.62  ? 1121 PHE A CZ  1 
ATOM   8418  N N   . VAL A  1 1153 ? 209.407 226.015 144.353 1.00 47.26  ? 1122 VAL A N   1 
ATOM   8419  C CA  . VAL A  1 1153 ? 208.500 227.097 143.977 1.00 47.26  ? 1122 VAL A CA  1 
ATOM   8420  C C   . VAL A  1 1153 ? 207.237 227.036 144.815 1.00 47.26  ? 1122 VAL A C   1 
ATOM   8421  O O   . VAL A  1 1153 ? 206.764 225.953 145.179 1.00 47.26  ? 1122 VAL A O   1 
ATOM   8422  C CB  . VAL A  1 1153 ? 208.143 227.037 142.481 1.00 47.26  ? 1122 VAL A CB  1 
ATOM   8423  C CG1 . VAL A  1 1153 ? 209.318 227.432 141.648 1.00 47.26  ? 1122 VAL A CG1 1 
ATOM   8424  C CG2 . VAL A  1 1153 ? 207.703 225.642 142.111 1.00 47.26  ? 1122 VAL A CG2 1 
ATOM   8425  N N   . SER A  1 1154 ? 206.694 228.208 145.133 1.00 51.88  ? 1123 SER A N   1 
ATOM   8426  C CA  . SER A  1 1154 ? 205.406 228.293 145.813 1.00 51.88  ? 1123 SER A CA  1 
ATOM   8427  C C   . SER A  1 1154 ? 204.819 229.670 145.545 1.00 51.88  ? 1123 SER A C   1 
ATOM   8428  O O   . SER A  1 1154 ? 205.334 230.666 146.056 1.00 51.88  ? 1123 SER A O   1 
ATOM   8429  C CB  . SER A  1 1154 ? 205.564 228.050 147.304 1.00 51.88  ? 1123 SER A CB  1 
ATOM   8430  O OG  . SER A  1 1154 ? 204.363 228.357 147.985 1.00 51.88  ? 1123 SER A OG  1 
ATOM   8431  N N   . GLY A  1 1155 ? 203.751 229.724 144.760 1.00 56.85  ? 1124 GLY A N   1 
ATOM   8432  C CA  . GLY A  1 1155 ? 203.043 230.971 144.571 1.00 56.85  ? 1124 GLY A CA  1 
ATOM   8433  C C   . GLY A  1 1155 ? 203.759 231.962 143.666 1.00 56.85  ? 1124 GLY A C   1 
ATOM   8434  O O   . GLY A  1 1155 ? 204.737 231.657 142.987 1.00 56.85  ? 1124 GLY A O   1 
ATOM   8435  N N   . ASN A  1 1156 ? 203.234 233.184 143.680 1.00 65.12  ? 1125 ASN A N   1 
ATOM   8436  C CA  . ASN A  1 1156 ? 203.754 234.314 142.930 1.00 65.12  ? 1125 ASN A CA  1 
ATOM   8437  C C   . ASN A  1 1156 ? 204.539 235.244 143.858 1.00 65.12  ? 1125 ASN A C   1 
ATOM   8438  O O   . ASN A  1 1156 ? 204.801 234.922 145.020 1.00 65.12  ? 1125 ASN A O   1 
ATOM   8439  C CB  . ASN A  1 1156 ? 202.607 235.025 142.213 1.00 65.12  ? 1125 ASN A CB  1 
ATOM   8440  C CG  . ASN A  1 1156 ? 201.545 235.523 143.165 1.00 65.12  ? 1125 ASN A CG  1 
ATOM   8441  O OD1 . ASN A  1 1156 ? 201.674 236.592 143.753 1.00 65.12  ? 1125 ASN A OD1 1 
ATOM   8442  N ND2 . ASN A  1 1156 ? 200.482 234.746 143.321 1.00 65.12  ? 1125 ASN A ND2 1 
ATOM   8443  N N   . CYS A  1 1157 ? 204.915 236.418 143.351 1.00 66.76  ? 1126 CYS A N   1 
ATOM   8444  C CA  . CYS A  1 1157 ? 205.803 237.326 144.068 1.00 66.76  ? 1126 CYS A CA  1 
ATOM   8445  C C   . CYS A  1 1157 ? 205.076 238.484 144.742 1.00 66.76  ? 1126 CYS A C   1 
ATOM   8446  O O   . CYS A  1 1157 ? 205.726 239.454 145.143 1.00 66.76  ? 1126 CYS A O   1 
ATOM   8447  C CB  . CYS A  1 1157 ? 206.870 237.883 143.122 1.00 66.76  ? 1126 CYS A CB  1 
ATOM   8448  S SG  . CYS A  1 1157 ? 207.671 236.661 142.063 1.00 66.76  ? 1126 CYS A SG  1 
ATOM   8449  N N   . ASP A  1 1158 ? 203.754 238.412 144.882 1.00 71.21  ? 1127 ASP A N   1 
ATOM   8450  C CA  . ASP A  1 1158 ? 202.988 239.537 145.403 1.00 71.21  ? 1127 ASP A CA  1 
ATOM   8451  C C   . ASP A  1 1158 ? 202.801 239.496 146.913 1.00 71.21  ? 1127 ASP A C   1 
ATOM   8452  O O   . ASP A  1 1158 ? 202.288 240.467 147.478 1.00 71.21  ? 1127 ASP A O   1 
ATOM   8453  C CB  . ASP A  1 1158 ? 201.610 239.606 144.738 1.00 71.21  ? 1127 ASP A CB  1 
ATOM   8454  C CG  . ASP A  1 1158 ? 201.695 239.774 143.238 1.00 71.21  ? 1127 ASP A CG  1 
ATOM   8455  O OD1 . ASP A  1 1158 ? 202.733 240.271 142.753 1.00 71.21  ? 1127 ASP A OD1 1 
ATOM   8456  O OD2 . ASP A  1 1158 ? 200.722 239.414 142.544 1.00 71.21  ? 1127 ASP A OD2 1 
ATOM   8457  N N   . VAL A  1 1159 ? 203.189 238.412 147.582 1.00 62.62  ? 1128 VAL A N   1 
ATOM   8458  C CA  . VAL A  1 1159 ? 202.877 238.246 148.990 1.00 62.62  ? 1128 VAL A CA  1 
ATOM   8459  C C   . VAL A  1 1159 ? 204.117 238.284 149.879 1.00 62.62  ? 1128 VAL A C   1 
ATOM   8460  O O   . VAL A  1 1159 ? 204.034 238.778 151.009 1.00 62.62  ? 1128 VAL A O   1 
ATOM   8461  C CB  . VAL A  1 1159 ? 202.067 236.952 149.224 1.00 62.62  ? 1128 VAL A CB  1 
ATOM   8462  C CG1 . VAL A  1 1159 ? 202.893 235.720 148.909 1.00 62.62  ? 1128 VAL A CG1 1 
ATOM   8463  C CG2 . VAL A  1 1159 ? 201.540 236.901 150.641 1.00 62.62  ? 1128 VAL A CG2 1 
ATOM   8464  N N   . VAL A  1 1160 ? 205.262 237.783 149.415 1.00 55.73  ? 1129 VAL A N   1 
ATOM   8465  C CA  . VAL A  1 1160 ? 206.444 237.721 150.265 1.00 55.73  ? 1129 VAL A CA  1 
ATOM   8466  C C   . VAL A  1 1160 ? 207.012 239.125 150.424 1.00 55.73  ? 1129 VAL A C   1 
ATOM   8467  O O   . VAL A  1 1160 ? 207.119 239.881 149.451 1.00 55.73  ? 1129 VAL A O   1 
ATOM   8468  C CB  . VAL A  1 1160 ? 207.474 236.742 149.686 1.00 55.73  ? 1129 VAL A CB  1 
ATOM   8469  C CG1 . VAL A  1 1160 ? 208.699 236.666 150.573 1.00 55.73  ? 1129 VAL A CG1 1 
ATOM   8470  C CG2 . VAL A  1 1160 ? 206.855 235.371 149.539 1.00 55.73  ? 1129 VAL A CG2 1 
ATOM   8471  N N   . ILE A  1 1161 ? 207.359 239.487 151.660 1.00 54.88  ? 1130 ILE A N   1 
ATOM   8472  C CA  . ILE A  1 1161 ? 207.602 240.888 151.995 1.00 54.88  ? 1130 ILE A CA  1 
ATOM   8473  C C   . ILE A  1 1161 ? 208.865 241.409 151.314 1.00 54.88  ? 1130 ILE A C   1 
ATOM   8474  O O   . ILE A  1 1161 ? 208.855 242.477 150.693 1.00 54.88  ? 1130 ILE A O   1 
ATOM   8475  C CB  . ILE A  1 1161 ? 207.668 241.069 153.519 1.00 54.88  ? 1130 ILE A CB  1 
ATOM   8476  C CG1 . ILE A  1 1161 ? 206.277 240.919 154.132 1.00 54.88  ? 1130 ILE A CG1 1 
ATOM   8477  C CG2 . ILE A  1 1161 ? 208.214 242.436 153.861 1.00 54.88  ? 1130 ILE A CG2 1 
ATOM   8478  C CD1 . ILE A  1 1161 ? 205.298 241.969 153.694 1.00 54.88  ? 1130 ILE A CD1 1 
ATOM   8479  N N   . GLY A  1 1162 ? 209.967 240.671 151.416 1.00 51.65  ? 1131 GLY A N   1 
ATOM   8480  C CA  . GLY A  1 1162 ? 211.251 241.165 150.948 1.00 51.65  ? 1131 GLY A CA  1 
ATOM   8481  C C   . GLY A  1 1162 ? 211.877 240.432 149.779 1.00 51.65  ? 1131 GLY A C   1 
ATOM   8482  O O   . GLY A  1 1162 ? 213.099 240.280 149.726 1.00 51.65  ? 1131 GLY A O   1 
ATOM   8483  N N   . ILE A  1 1163 ? 211.054 239.980 148.833 1.00 50.96  ? 1132 ILE A N   1 
ATOM   8484  C CA  . ILE A  1 1163 ? 211.540 239.203 147.700 1.00 50.96  ? 1132 ILE A CA  1 
ATOM   8485  C C   . ILE A  1 1163 ? 212.421 240.062 146.795 1.00 50.96  ? 1132 ILE A C   1 
ATOM   8486  O O   . ILE A  1 1163 ? 212.262 241.286 146.711 1.00 50.96  ? 1132 ILE A O   1 
ATOM   8487  C CB  . ILE A  1 1163 ? 210.327 238.634 146.942 1.00 50.96  ? 1132 ILE A CB  1 
ATOM   8488  C CG1 . ILE A  1 1163 ? 210.737 237.541 145.964 1.00 50.96  ? 1132 ILE A CG1 1 
ATOM   8489  C CG2 . ILE A  1 1163 ? 209.578 239.738 146.238 1.00 50.96  ? 1132 ILE A CG2 1 
ATOM   8490  C CD1 . ILE A  1 1163 ? 209.590 236.679 145.532 1.00 50.96  ? 1132 ILE A CD1 1 
ATOM   8491  N N   . VAL A  1 1164 ? 213.385 239.419 146.125 1.00 51.93  ? 1133 VAL A N   1 
ATOM   8492  C CA  . VAL A  1 1164 ? 214.325 240.096 145.239 1.00 51.93  ? 1133 VAL A CA  1 
ATOM   8493  C C   . VAL A  1 1164 ? 214.327 239.407 143.880 1.00 51.93  ? 1133 VAL A C   1 
ATOM   8494  O O   . VAL A  1 1164 ? 213.881 238.269 143.732 1.00 51.93  ? 1133 VAL A O   1 
ATOM   8495  C CB  . VAL A  1 1164 ? 215.756 240.151 145.811 1.00 51.93  ? 1133 VAL A CB  1 
ATOM   8496  C CG1 . VAL A  1 1164 ? 215.743 240.722 147.210 1.00 51.93  ? 1133 VAL A CG1 1 
ATOM   8497  C CG2 . VAL A  1 1164 ? 216.383 238.789 145.799 1.00 51.93  ? 1133 VAL A CG2 1 
ATOM   8498  N N   . ASN A  1 1165 ? 214.843 240.120 142.880 1.00 62.17  ? 1134 ASN A N   1 
ATOM   8499  C CA  . ASN A  1 1165 ? 214.878 239.648 141.500 1.00 62.17  ? 1134 ASN A CA  1 
ATOM   8500  C C   . ASN A  1 1165 ? 216.230 239.033 141.171 1.00 62.17  ? 1134 ASN A C   1 
ATOM   8501  O O   . ASN A  1 1165 ? 217.270 239.672 141.352 1.00 62.17  ? 1134 ASN A O   1 
ATOM   8502  C CB  . ASN A  1 1165 ? 214.599 240.788 140.521 1.00 62.17  ? 1134 ASN A CB  1 
ATOM   8503  C CG  . ASN A  1 1165 ? 213.172 241.262 140.564 1.00 62.17  ? 1134 ASN A CG  1 
ATOM   8504  O OD1 . ASN A  1 1165 ? 212.384 240.830 141.399 1.00 62.17  ? 1134 ASN A OD1 1 
ATOM   8505  N ND2 . ASN A  1 1165 ? 212.831 242.165 139.658 1.00 62.17  ? 1134 ASN A ND2 1 
ATOM   8506  N N   . ASN A  1 1166 ? 216.206 237.803 140.671 1.00 58.02  ? 1135 ASN A N   1 
ATOM   8507  C CA  . ASN A  1 1166 ? 217.410 237.108 140.240 1.00 58.02  ? 1135 ASN A CA  1 
ATOM   8508  C C   . ASN A  1 1166 ? 216.982 235.968 139.327 1.00 58.02  ? 1135 ASN A C   1 
ATOM   8509  O O   . ASN A  1 1166 ? 215.798 235.644 139.226 1.00 58.02  ? 1135 ASN A O   1 
ATOM   8510  C CB  . ASN A  1 1166 ? 218.220 236.602 141.438 1.00 58.02  ? 1135 ASN A CB  1 
ATOM   8511  C CG  . ASN A  1 1166 ? 219.639 236.228 141.072 1.00 58.02  ? 1135 ASN A CG  1 
ATOM   8512  O OD1 . ASN A  1 1166 ? 220.032 235.071 141.177 1.00 58.02  ? 1135 ASN A OD1 1 
ATOM   8513  N ND2 . ASN A  1 1166 ? 220.421 237.211 140.655 1.00 58.02  ? 1135 ASN A ND2 1 
ATOM   8514  N N   . THR A  1 1167 ? 217.955 235.389 138.634 1.00 61.35  ? 1136 THR A N   1 
ATOM   8515  C CA  . THR A  1 1167 ? 217.727 234.292 137.705 1.00 61.35  ? 1136 THR A CA  1 
ATOM   8516  C C   . THR A  1 1167 ? 218.002 232.943 138.364 1.00 61.35  ? 1136 THR A C   1 
ATOM   8517  O O   . THR A  1 1167 ? 218.868 232.822 139.232 1.00 61.35  ? 1136 THR A O   1 
ATOM   8518  C CB  . THR A  1 1167 ? 218.600 234.452 136.459 1.00 61.35  ? 1136 THR A CB  1 
ATOM   8519  O OG1 . THR A  1 1167 ? 218.354 233.371 135.554 1.00 61.35  ? 1136 THR A OG1 1 
ATOM   8520  C CG2 . THR A  1 1167 ? 220.066 234.470 136.830 1.00 61.35  ? 1136 THR A CG2 1 
ATOM   8521  N N   . VAL A  1 1168 ? 217.242 231.929 137.952 1.00 64.10  ? 1137 VAL A N   1 
ATOM   8522  C CA  . VAL A  1 1168 ? 217.410 230.554 138.419 1.00 64.10  ? 1137 VAL A CA  1 
ATOM   8523  C C   . VAL A  1 1168 ? 217.902 229.723 137.237 1.00 64.10  ? 1137 VAL A C   1 
ATOM   8524  O O   . VAL A  1 1168 ? 217.239 229.664 136.196 1.00 64.10  ? 1137 VAL A O   1 
ATOM   8525  C CB  . VAL A  1 1168 ? 216.107 229.995 139.006 1.00 64.10  ? 1137 VAL A CB  1 
ATOM   8526  C CG1 . VAL A  1 1168 ? 216.326 228.613 139.562 1.00 64.10  ? 1137 VAL A CG1 1 
ATOM   8527  C CG2 . VAL A  1 1168 ? 215.603 230.911 140.098 1.00 64.10  ? 1137 VAL A CG2 1 
ATOM   8528  N N   . TYR A  1 1169 ? 219.066 229.087 137.407 1.00 74.93  ? 1138 TYR A N   1 
ATOM   8529  C CA  . TYR A  1 1169 ? 219.744 228.388 136.313 1.00 74.93  ? 1138 TYR A CA  1 
ATOM   8530  C C   . TYR A  1 1169 ? 218.833 227.399 135.580 1.00 74.93  ? 1138 TYR A C   1 
ATOM   8531  O O   . TYR A  1 1169 ? 218.697 227.468 134.354 1.00 74.93  ? 1138 TYR A O   1 
ATOM   8532  C CB  . TYR A  1 1169 ? 220.993 227.686 136.859 1.00 74.93  ? 1138 TYR A CB  1 
ATOM   8533  C CG  . TYR A  1 1169 ? 221.795 226.850 135.871 1.00 74.93  ? 1138 TYR A CG  1 
ATOM   8534  C CD1 . TYR A  1 1169 ? 221.638 226.994 134.497 1.00 74.93  ? 1138 TYR A CD1 1 
ATOM   8535  C CD2 . TYR A  1 1169 ? 222.703 225.909 136.324 1.00 74.93  ? 1138 TYR A CD2 1 
ATOM   8536  C CE1 . TYR A  1 1169 ? 222.358 226.231 133.612 1.00 74.93  ? 1138 TYR A CE1 1 
ATOM   8537  C CE2 . TYR A  1 1169 ? 223.432 225.140 135.444 1.00 74.93  ? 1138 TYR A CE2 1 
ATOM   8538  C CZ  . TYR A  1 1169 ? 223.255 225.305 134.088 1.00 74.93  ? 1138 TYR A CZ  1 
ATOM   8539  O OH  . TYR A  1 1169 ? 223.979 224.541 133.202 1.00 74.93  ? 1138 TYR A OH  1 
ATOM   8540  N N   . ASP A  1 1170 ? 218.196 226.473 136.312 1.00 78.76  ? 1139 ASP A N   1 
ATOM   8541  C CA  . ASP A  1 1170 ? 217.443 225.366 135.708 1.00 78.76  ? 1139 ASP A CA  1 
ATOM   8542  C C   . ASP A  1 1170 ? 218.367 224.494 134.858 1.00 78.76  ? 1139 ASP A C   1 
ATOM   8543  O O   . ASP A  1 1170 ? 218.392 224.625 133.628 1.00 78.76  ? 1139 ASP A O   1 
ATOM   8544  C CB  . ASP A  1 1170 ? 216.263 225.880 134.874 1.00 78.76  ? 1139 ASP A CB  1 
ATOM   8545  C CG  . ASP A  1 1170 ? 215.546 224.772 134.118 1.00 78.76  ? 1139 ASP A CG  1 
ATOM   8546  O OD1 . ASP A  1 1170 ? 215.684 223.591 134.496 1.00 78.76  ? 1139 ASP A OD1 1 
ATOM   8547  O OD2 . ASP A  1 1170 ? 214.841 225.086 133.137 1.00 78.76  ? 1139 ASP A OD2 1 
ATOM   8548  N N   . PRO A  1 1171 ? 219.152 223.597 135.479 1.00 83.12  ? 1140 PRO A N   1 
ATOM   8549  C CA  . PRO A  1 1171 ? 220.224 222.865 134.791 1.00 83.12  ? 1140 PRO A CA  1 
ATOM   8550  C C   . PRO A  1 1171 ? 219.760 221.685 133.939 1.00 83.12  ? 1140 PRO A C   1 
ATOM   8551  O O   . PRO A  1 1171 ? 220.219 220.555 134.108 1.00 83.12  ? 1140 PRO A O   1 
ATOM   8552  C CB  . PRO A  1 1171 ? 221.095 222.379 135.953 1.00 83.12  ? 1140 PRO A CB  1 
ATOM   8553  C CG  . PRO A  1 1171 ? 220.120 222.162 137.050 1.00 83.12  ? 1140 PRO A CG  1 
ATOM   8554  C CD  . PRO A  1 1171 ? 219.063 223.225 136.900 1.00 83.12  ? 1140 PRO A CD  1 
ATOM   8555  N N   . LEU A  1 1172 ? 218.842 221.945 133.014 1.00 98.73  ? 1141 LEU A N   1 
ATOM   8556  C CA  . LEU A  1 1172 ? 218.438 220.909 132.072 1.00 98.73  ? 1141 LEU A CA  1 
ATOM   8557  C C   . LEU A  1 1172 ? 218.452 221.446 130.650 1.00 98.73  ? 1141 LEU A C   1 
ATOM   8558  O O   . LEU A  1 1172 ? 218.687 220.699 129.696 1.00 98.73  ? 1141 LEU A O   1 
ATOM   8559  C CB  . LEU A  1 1172 ? 217.045 220.378 132.418 1.00 98.73  ? 1141 LEU A CB  1 
ATOM   8560  C CG  . LEU A  1 1172 ? 216.496 219.279 131.509 1.00 98.73  ? 1141 LEU A CG  1 
ATOM   8561  C CD1 . LEU A  1 1172 ? 217.399 218.061 131.552 1.00 98.73  ? 1141 LEU A CD1 1 
ATOM   8562  C CD2 . LEU A  1 1172 ? 215.070 218.913 131.887 1.00 98.73  ? 1141 LEU A CD2 1 
ATOM   8563  N N   . GLN A  1 1173 ? 218.194 222.744 130.510 1.00 105.22 ? 1142 GLN A N   1 
ATOM   8564  C CA  . GLN A  1 1173 ? 218.103 223.355 129.186 1.00 105.22 ? 1142 GLN A CA  1 
ATOM   8565  C C   . GLN A  1 1173 ? 219.360 223.166 128.343 1.00 105.22 ? 1142 GLN A C   1 
ATOM   8566  O O   . GLN A  1 1173 ? 219.227 222.830 127.153 1.00 105.22 ? 1142 GLN A O   1 
ATOM   8567  C CB  . GLN A  1 1173 ? 217.743 224.836 129.334 1.00 105.22 ? 1142 GLN A CB  1 
ATOM   8568  C CG  . GLN A  1 1173 ? 217.448 225.520 128.020 1.00 105.22 ? 1142 GLN A CG  1 
ATOM   8569  C CD  . GLN A  1 1173 ? 216.249 224.914 127.323 1.00 105.22 ? 1142 GLN A CD  1 
ATOM   8570  O OE1 . GLN A  1 1173 ? 216.390 224.187 126.341 1.00 105.22 ? 1142 GLN A OE1 1 
ATOM   8571  N NE2 . GLN A  1 1173 ? 215.058 225.207 127.832 1.00 105.22 ? 1142 GLN A NE2 1 
ATOM   8572  N N   . PRO A  1 1174 ? 220.582 223.377 128.854 1.00 104.97 ? 1143 PRO A N   1 
ATOM   8573  C CA  . PRO A  1 1174 ? 221.762 223.102 128.014 1.00 104.97 ? 1143 PRO A CA  1 
ATOM   8574  C C   . PRO A  1 1174 ? 221.843 221.667 127.523 1.00 104.97 ? 1143 PRO A C   1 
ATOM   8575  O O   . PRO A  1 1174 ? 222.243 221.434 126.376 1.00 104.97 ? 1143 PRO A O   1 
ATOM   8576  C CB  . PRO A  1 1174 ? 222.935 223.448 128.941 1.00 104.97 ? 1143 PRO A CB  1 
ATOM   8577  C CG  . PRO A  1 1174 ? 222.377 224.407 129.911 1.00 104.97 ? 1143 PRO A CG  1 
ATOM   8578  C CD  . PRO A  1 1174 ? 220.970 223.966 130.147 1.00 104.97 ? 1143 PRO A CD  1 
ATOM   8579  N N   . GLU A  1 1175 ? 221.470 220.694 128.356 1.00 108.84 ? 1144 GLU A N   1 
ATOM   8580  C CA  . GLU A  1 1175 ? 221.594 219.298 127.950 1.00 108.84 ? 1144 GLU A CA  1 
ATOM   8581  C C   . GLU A  1 1175 ? 220.564 218.949 126.885 1.00 108.84 ? 1144 GLU A C   1 
ATOM   8582  O O   . GLU A  1 1175 ? 220.860 218.193 125.953 1.00 108.84 ? 1144 GLU A O   1 
ATOM   8583  C CB  . GLU A  1 1175 ? 221.458 218.384 129.165 1.00 108.84 ? 1144 GLU A CB  1 
ATOM   8584  C CG  . GLU A  1 1175 ? 222.562 218.574 130.193 1.00 108.84 ? 1144 GLU A CG  1 
ATOM   8585  C CD  . GLU A  1 1175 ? 222.366 217.719 131.429 1.00 108.84 ? 1144 GLU A CD  1 
ATOM   8586  O OE1 . GLU A  1 1175 ? 221.283 217.112 131.569 1.00 108.84 ? 1144 GLU A OE1 1 
ATOM   8587  O OE2 . GLU A  1 1175 ? 223.294 217.657 132.263 1.00 108.84 ? 1144 GLU A OE2 1 
ATOM   8588  N N   . LEU A  1 1176 ? 219.347 219.482 127.010 1.00 108.94 ? 1145 LEU A N   1 
ATOM   8589  C CA  . LEU A  1 1176 ? 218.315 219.236 126.012 1.00 108.94 ? 1145 LEU A CA  1 
ATOM   8590  C C   . LEU A  1 1176 ? 218.672 219.836 124.660 1.00 108.94 ? 1145 LEU A C   1 
ATOM   8591  O O   . LEU A  1 1176 ? 218.124 219.405 123.640 1.00 108.94 ? 1145 LEU A O   1 
ATOM   8592  C CB  . LEU A  1 1176 ? 216.977 219.806 126.484 1.00 108.94 ? 1145 LEU A CB  1 
ATOM   8593  C CG  . LEU A  1 1176 ? 216.276 219.082 127.633 1.00 108.94 ? 1145 LEU A CG  1 
ATOM   8594  C CD1 . LEU A  1 1176 ? 215.023 219.831 128.055 1.00 108.94 ? 1145 LEU A CD1 1 
ATOM   8595  C CD2 . LEU A  1 1176 ? 215.936 217.667 127.221 1.00 108.94 ? 1145 LEU A CD2 1 
ATOM   8596  N N   . ASP A  1 1177 ? 219.571 220.815 124.631 1.00 109.14 ? 1146 ASP A N   1 
ATOM   8597  C CA  . ASP A  1 1177 ? 219.976 221.459 123.389 1.00 109.14 ? 1146 ASP A CA  1 
ATOM   8598  C C   . ASP A  1 1177 ? 221.241 220.826 122.824 1.00 109.14 ? 1146 ASP A C   1 
ATOM   8599  O O   . ASP A  1 1177 ? 222.262 221.496 122.665 1.00 109.14 ? 1146 ASP A O   1 
ATOM   8600  C CB  . ASP A  1 1177 ? 220.194 222.956 123.611 1.00 109.14 ? 1146 ASP A CB  1 
ATOM   8601  C CG  . ASP A  1 1177 ? 218.944 223.660 124.096 1.00 109.14 ? 1146 ASP A CG  1 
ATOM   8602  O OD1 . ASP A  1 1177 ? 217.836 223.129 123.872 1.00 109.14 ? 1146 ASP A OD1 1 
ATOM   8603  O OD2 . ASP A  1 1177 ? 219.069 224.744 124.703 1.00 109.14 ? 1146 ASP A OD2 1 
ATOM   8604  N N   . GLN B  1 45   ? 163.443 237.963 265.427 1.00 91.51  ? 14   GLN B N   1 
ATOM   8605  C CA  . GLN B  1 45   ? 162.361 236.995 265.296 1.00 91.51  ? 14   GLN B CA  1 
ATOM   8606  C C   . GLN B  1 45   ? 162.142 236.632 263.836 1.00 91.51  ? 14   GLN B C   1 
ATOM   8607  O O   . GLN B  1 45   ? 162.398 237.441 262.951 1.00 91.51  ? 14   GLN B O   1 
ATOM   8608  C CB  . GLN B  1 45   ? 161.071 237.547 265.902 1.00 91.51  ? 14   GLN B CB  1 
ATOM   8609  C CG  . GLN B  1 45   ? 161.126 237.725 267.409 1.00 91.51  ? 14   GLN B CG  1 
ATOM   8610  C CD  . GLN B  1 45   ? 159.860 238.341 267.967 1.00 91.51  ? 14   GLN B CD  1 
ATOM   8611  O OE1 . GLN B  1 45   ? 159.136 239.045 267.262 1.00 91.51  ? 14   GLN B OE1 1 
ATOM   8612  N NE2 . GLN B  1 45   ? 159.583 238.079 269.239 1.00 91.51  ? 14   GLN B NE2 1 
ATOM   8613  N N   . CYS B  1 46   ? 161.677 235.412 263.584 1.00 91.07  ? 15   CYS B N   1 
ATOM   8614  C CA  . CYS B  1 46   ? 161.500 234.907 262.232 1.00 91.07  ? 15   CYS B CA  1 
ATOM   8615  C C   . CYS B  1 46   ? 160.015 234.746 261.935 1.00 91.07  ? 15   CYS B C   1 
ATOM   8616  O O   . CYS B  1 46   ? 159.254 234.270 262.784 1.00 91.07  ? 15   CYS B O   1 
ATOM   8617  C CB  . CYS B  1 46   ? 162.202 233.559 262.053 1.00 91.07  ? 15   CYS B CB  1 
ATOM   8618  S SG  . CYS B  1 46   ? 163.962 233.492 262.503 1.00 91.07  ? 15   CYS B SG  1 
ATOM   8619  N N   . VAL B  1 47   ? 159.602 235.153 260.735 1.00 86.46  ? 16   VAL B N   1 
ATOM   8620  C CA  . VAL B  1 47   ? 158.209 235.076 260.308 1.00 86.46  ? 16   VAL B CA  1 
ATOM   8621  C C   . VAL B  1 47   ? 158.142 234.334 258.979 1.00 86.46  ? 16   VAL B C   1 
ATOM   8622  O O   . VAL B  1 47   ? 158.928 234.613 258.067 1.00 86.46  ? 16   VAL B O   1 
ATOM   8623  C CB  . VAL B  1 47   ? 157.561 236.469 260.198 1.00 86.46  ? 16   VAL B CB  1 
ATOM   8624  C CG1 . VAL B  1 47   ? 157.464 237.106 261.561 1.00 86.46  ? 16   VAL B CG1 1 
ATOM   8625  C CG2 . VAL B  1 47   ? 158.365 237.357 259.295 1.00 86.46  ? 16   VAL B CG2 1 
ATOM   8626  N N   . ASN B  1 48   ? 157.238 233.362 258.881 1.00 90.54  ? 17   ASN B N   1 
ATOM   8627  C CA  . ASN B  1 48   ? 157.048 232.607 257.646 1.00 90.54  ? 17   ASN B CA  1 
ATOM   8628  C C   . ASN B  1 48   ? 156.051 233.335 256.751 1.00 90.54  ? 17   ASN B C   1 
ATOM   8629  O O   . ASN B  1 48   ? 154.870 233.449 257.093 1.00 90.54  ? 17   ASN B O   1 
ATOM   8630  C CB  . ASN B  1 48   ? 156.572 231.186 257.938 1.00 90.54  ? 17   ASN B CB  1 
ATOM   8631  C CG  . ASN B  1 48   ? 157.661 230.301 258.506 1.00 90.54  ? 17   ASN B CG  1 
ATOM   8632  O OD1 . ASN B  1 48   ? 158.846 230.541 258.285 1.00 90.54  ? 17   ASN B OD1 1 
ATOM   8633  N ND2 . ASN B  1 48   ? 157.264 229.259 259.228 1.00 90.54  ? 17   ASN B ND2 1 
ATOM   8634  N N   . LEU B  1 49   ? 156.528 233.840 255.617 1.00 85.51  ? 18   LEU B N   1 
ATOM   8635  C CA  . LEU B  1 49   ? 155.674 234.569 254.686 1.00 85.51  ? 18   LEU B CA  1 
ATOM   8636  C C   . LEU B  1 49   ? 154.648 233.635 254.052 1.00 85.51  ? 18   LEU B C   1 
ATOM   8637  O O   . LEU B  1 49   ? 154.987 232.533 253.611 1.00 85.51  ? 18   LEU B O   1 
ATOM   8638  C CB  . LEU B  1 49   ? 156.515 235.241 253.605 1.00 85.51  ? 18   LEU B CB  1 
ATOM   8639  C CG  . LEU B  1 49   ? 157.440 236.355 254.087 1.00 85.51  ? 18   LEU B CG  1 
ATOM   8640  C CD1 . LEU B  1 49   ? 158.225 236.919 252.921 1.00 85.51  ? 18   LEU B CD1 1 
ATOM   8641  C CD2 . LEU B  1 49   ? 156.648 237.446 254.780 1.00 85.51  ? 18   LEU B CD2 1 
ATOM   8642  N N   . THR B  1 50   ? 153.393 234.071 254.009 1.00 90.86  ? 19   THR B N   1 
ATOM   8643  C CA  . THR B  1 50   ? 152.321 233.343 253.348 1.00 90.86  ? 19   THR B CA  1 
ATOM   8644  C C   . THR B  1 50   ? 151.832 234.121 252.123 1.00 90.86  ? 19   THR B C   1 
ATOM   8645  O O   . THR B  1 50   ? 152.385 235.163 251.761 1.00 90.86  ? 19   THR B O   1 
ATOM   8646  C CB  . THR B  1 50   ? 151.181 233.077 254.333 1.00 90.86  ? 19   THR B CB  1 
ATOM   8647  O OG1 . THR B  1 50   ? 150.723 234.319 254.879 1.00 90.86  ? 19   THR B OG1 1 
ATOM   8648  C CG2 . THR B  1 50   ? 151.654 232.174 255.458 1.00 90.86  ? 19   THR B CG2 1 
ATOM   8649  N N   . THR B  1 51   ? 150.773 233.604 251.489 1.00 91.44  ? 20   THR B N   1 
ATOM   8650  C CA  . THR B  1 51   ? 150.132 234.245 250.334 1.00 91.44  ? 20   THR B CA  1 
ATOM   8651  C C   . THR B  1 51   ? 151.112 234.461 249.181 1.00 91.44  ? 20   THR B C   1 
ATOM   8652  O O   . THR B  1 51   ? 151.278 235.574 248.678 1.00 91.44  ? 20   THR B O   1 
ATOM   8653  C CB  . THR B  1 51   ? 149.465 235.565 250.730 1.00 91.44  ? 20   THR B CB  1 
ATOM   8654  O OG1 . THR B  1 51   ? 150.461 236.507 251.141 1.00 91.44  ? 20   THR B OG1 1 
ATOM   8655  C CG2 . THR B  1 51   ? 148.487 235.342 251.869 1.00 91.44  ? 20   THR B CG2 1 
ATOM   8656  N N   . ARG B  1 52   ? 151.761 233.381 248.753 1.00 84.17  ? 21   ARG B N   1 
ATOM   8657  C CA  . ARG B  1 52   ? 152.714 233.429 247.650 1.00 84.17  ? 21   ARG B CA  1 
ATOM   8658  C C   . ARG B  1 52   ? 152.413 232.288 246.687 1.00 84.17  ? 21   ARG B C   1 
ATOM   8659  O O   . ARG B  1 52   ? 152.540 231.114 247.050 1.00 84.17  ? 21   ARG B O   1 
ATOM   8660  C CB  . ARG B  1 52   ? 154.148 233.360 248.184 1.00 84.17  ? 21   ARG B CB  1 
ATOM   8661  C CG  . ARG B  1 52   ? 155.230 233.239 247.134 1.00 84.17  ? 21   ARG B CG  1 
ATOM   8662  C CD  . ARG B  1 52   ? 156.603 233.446 247.754 1.00 84.17  ? 21   ARG B CD  1 
ATOM   8663  N NE  . ARG B  1 52   ? 156.758 232.713 249.005 1.00 84.17  ? 21   ARG B NE  1 
ATOM   8664  C CZ  . ARG B  1 52   ? 157.761 232.897 249.855 1.00 84.17  ? 21   ARG B CZ  1 
ATOM   8665  N NH1 . ARG B  1 52   ? 158.697 233.793 249.593 1.00 84.17  ? 21   ARG B NH1 1 
ATOM   8666  N NH2 . ARG B  1 52   ? 157.826 232.190 250.972 1.00 84.17  ? 21   ARG B NH2 1 
ATOM   8667  N N   . THR B  1 53   ? 152.019 232.641 245.463 1.00 86.96  ? 22   THR B N   1 
ATOM   8668  C CA  . THR B  1 53   ? 151.633 231.659 244.454 1.00 86.96  ? 22   THR B CA  1 
ATOM   8669  C C   . THR B  1 53   ? 152.827 230.870 243.937 1.00 86.96  ? 22   THR B C   1 
ATOM   8670  O O   . THR B  1 53   ? 153.891 231.428 243.655 1.00 86.96  ? 22   THR B O   1 
ATOM   8671  C CB  . THR B  1 53   ? 150.939 232.351 243.282 1.00 86.96  ? 22   THR B CB  1 
ATOM   8672  O OG1 . THR B  1 53   ? 150.030 233.340 243.778 1.00 86.96  ? 22   THR B OG1 1 
ATOM   8673  C CG2 . THR B  1 53   ? 150.175 231.342 242.449 1.00 86.96  ? 22   THR B CG2 1 
ATOM   8674  N N   . GLN B  1 54   ? 152.640 229.558 243.809 1.00 90.34  ? 23   GLN B N   1 
ATOM   8675  C CA  . GLN B  1 54   ? 153.684 228.657 243.337 1.00 90.34  ? 23   GLN B CA  1 
ATOM   8676  C C   . GLN B  1 54   ? 153.562 228.445 241.830 1.00 90.34  ? 23   GLN B C   1 
ATOM   8677  O O   . GLN B  1 54   ? 152.473 228.167 241.317 1.00 90.34  ? 23   GLN B O   1 
ATOM   8678  C CB  . GLN B  1 54   ? 153.617 227.326 244.091 1.00 90.34  ? 23   GLN B CB  1 
ATOM   8679  C CG  . GLN B  1 54   ? 152.263 226.635 244.060 1.00 90.34  ? 23   GLN B CG  1 
ATOM   8680  C CD  . GLN B  1 54   ? 152.132 225.651 242.920 1.00 90.34  ? 23   GLN B CD  1 
ATOM   8681  O OE1 . GLN B  1 54   ? 153.124 225.098 242.447 1.00 90.34  ? 23   GLN B OE1 1 
ATOM   8682  N NE2 . GLN B  1 54   ? 150.903 225.425 242.472 1.00 90.34  ? 23   GLN B NE2 1 
ATOM   8683  N N   . LEU B  1 55   ? 154.681 228.601 241.128 1.00 87.30  ? 24   LEU B N   1 
ATOM   8684  C CA  . LEU B  1 55   ? 154.779 228.507 239.681 1.00 87.30  ? 24   LEU B CA  1 
ATOM   8685  C C   . LEU B  1 55   ? 155.935 227.599 239.291 1.00 87.30  ? 24   LEU B C   1 
ATOM   8686  O O   . LEU B  1 55   ? 156.894 227.443 240.053 1.00 87.30  ? 24   LEU B O   1 
ATOM   8687  C CB  . LEU B  1 55   ? 154.984 229.890 239.047 1.00 87.30  ? 24   LEU B CB  1 
ATOM   8688  C CG  . LEU B  1 55   ? 153.844 230.897 239.186 1.00 87.30  ? 24   LEU B CG  1 
ATOM   8689  C CD1 . LEU B  1 55   ? 154.266 232.248 238.635 1.00 87.30  ? 24   LEU B CD1 1 
ATOM   8690  C CD2 . LEU B  1 55   ? 152.604 230.392 238.473 1.00 87.30  ? 24   LEU B CD2 1 
ATOM   8691  N N   . PRO B  1 56   ? 155.861 226.969 238.116 1.00 85.06  ? 25   PRO B N   1 
ATOM   8692  C CA  . PRO B  1 56   ? 156.971 226.131 237.669 1.00 85.06  ? 25   PRO B CA  1 
ATOM   8693  C C   . PRO B  1 56   ? 158.210 226.964 237.400 1.00 85.06  ? 25   PRO B C   1 
ATOM   8694  O O   . PRO B  1 56   ? 158.115 228.158 237.070 1.00 85.06  ? 25   PRO B O   1 
ATOM   8695  C CB  . PRO B  1 56   ? 156.435 225.492 236.374 1.00 85.06  ? 25   PRO B CB  1 
ATOM   8696  C CG  . PRO B  1 56   ? 155.270 226.345 235.974 1.00 85.06  ? 25   PRO B CG  1 
ATOM   8697  C CD  . PRO B  1 56   ? 154.679 226.823 237.254 1.00 85.06  ? 25   PRO B CD  1 
ATOM   8698  N N   . PRO B  1 57   ? 159.400 226.380 237.535 1.00 79.92  ? 26   PRO B N   1 
ATOM   8699  C CA  . PRO B  1 57   ? 160.632 227.148 237.329 1.00 79.92  ? 26   PRO B CA  1 
ATOM   8700  C C   . PRO B  1 57   ? 160.841 227.501 235.868 1.00 79.92  ? 26   PRO B C   1 
ATOM   8701  O O   . PRO B  1 57   ? 160.363 226.813 234.963 1.00 79.92  ? 26   PRO B O   1 
ATOM   8702  C CB  . PRO B  1 57   ? 161.725 226.199 237.824 1.00 79.92  ? 26   PRO B CB  1 
ATOM   8703  C CG  . PRO B  1 57   ? 161.150 224.842 237.594 1.00 79.92  ? 26   PRO B CG  1 
ATOM   8704  C CD  . PRO B  1 57   ? 159.677 224.971 237.865 1.00 79.92  ? 26   PRO B CD  1 
ATOM   8705  N N   . ALA B  1 58   ? 161.566 228.593 235.643 1.00 67.20  ? 27   ALA B N   1 
ATOM   8706  C CA  . ALA B  1 58   ? 161.815 229.098 234.304 1.00 67.20  ? 27   ALA B CA  1 
ATOM   8707  C C   . ALA B  1 58   ? 163.305 229.038 233.997 1.00 67.20  ? 27   ALA B C   1 
ATOM   8708  O O   . ALA B  1 58   ? 164.152 229.214 234.880 1.00 67.20  ? 27   ALA B O   1 
ATOM   8709  C CB  . ALA B  1 58   ? 161.306 230.532 234.152 1.00 67.20  ? 27   ALA B CB  1 
ATOM   8710  N N   . TYR B  1 59   ? 163.614 228.832 232.725 1.00 65.43  ? 28   TYR B N   1 
ATOM   8711  C CA  . TYR B  1 59   ? 164.983 228.705 232.260 1.00 65.43  ? 28   TYR B CA  1 
ATOM   8712  C C   . TYR B  1 59   ? 165.218 229.651 231.096 1.00 65.43  ? 28   TYR B C   1 
ATOM   8713  O O   . TYR B  1 59   ? 164.287 230.045 230.392 1.00 65.43  ? 28   TYR B O   1 
ATOM   8714  C CB  . TYR B  1 59   ? 165.284 227.265 231.854 1.00 65.43  ? 28   TYR B CB  1 
ATOM   8715  C CG  . TYR B  1 59   ? 164.978 226.290 232.959 1.00 65.43  ? 28   TYR B CG  1 
ATOM   8716  C CD1 . TYR B  1 59   ? 163.839 225.507 232.925 1.00 65.43  ? 28   TYR B CD1 1 
ATOM   8717  C CD2 . TYR B  1 59   ? 165.837 226.146 234.032 1.00 65.43  ? 28   TYR B CD2 1 
ATOM   8718  C CE1 . TYR B  1 59   ? 163.559 224.619 233.936 1.00 65.43  ? 28   TYR B CE1 1 
ATOM   8719  C CE2 . TYR B  1 59   ? 165.566 225.263 235.042 1.00 65.43  ? 28   TYR B CE2 1 
ATOM   8720  C CZ  . TYR B  1 59   ? 164.429 224.501 234.991 1.00 65.43  ? 28   TYR B CZ  1 
ATOM   8721  O OH  . TYR B  1 59   ? 164.158 223.614 236.005 1.00 65.43  ? 28   TYR B OH  1 
ATOM   8722  N N   . THR B  1 60   ? 166.480 230.015 230.904 1.00 55.46  ? 29   THR B N   1 
ATOM   8723  C CA  . THR B  1 60   ? 166.858 230.863 229.782 1.00 55.46  ? 29   THR B CA  1 
ATOM   8724  C C   . THR B  1 60   ? 168.272 230.492 229.361 1.00 55.46  ? 29   THR B C   1 
ATOM   8725  O O   . THR B  1 60   ? 168.869 229.551 229.890 1.00 55.46  ? 29   THR B O   1 
ATOM   8726  C CB  . THR B  1 60   ? 166.702 232.350 230.131 1.00 55.46  ? 29   THR B CB  1 
ATOM   8727  O OG1 . THR B  1 60   ? 167.331 233.151 229.125 1.00 55.46  ? 29   THR B OG1 1 
ATOM   8728  C CG2 . THR B  1 60   ? 167.291 232.668 231.482 1.00 55.46  ? 29   THR B CG2 1 
ATOM   8729  N N   . ASN B  1 61   ? 168.824 231.252 228.426 1.00 54.29  ? 30   ASN B N   1 
ATOM   8730  C CA  . ASN B  1 61   ? 170.088 230.918 227.792 1.00 54.29  ? 30   ASN B CA  1 
ATOM   8731  C C   . ASN B  1 61   ? 171.095 232.021 228.068 1.00 54.29  ? 30   ASN B C   1 
ATOM   8732  O O   . ASN B  1 61   ? 170.755 233.206 228.032 1.00 54.29  ? 30   ASN B O   1 
ATOM   8733  C CB  . ASN B  1 61   ? 169.868 230.747 226.284 1.00 54.29  ? 30   ASN B CB  1 
ATOM   8734  C CG  . ASN B  1 61   ? 171.091 230.259 225.559 1.00 54.29  ? 30   ASN B CG  1 
ATOM   8735  O OD1 . ASN B  1 61   ? 171.373 229.066 225.532 1.00 54.29  ? 30   ASN B OD1 1 
ATOM   8736  N ND2 . ASN B  1 61   ? 171.814 231.179 224.944 1.00 54.29  ? 30   ASN B ND2 1 
ATOM   8737  N N   . SER B  1 62   ? 172.334 231.629 228.364 1.00 52.66  ? 31   SER B N   1 
ATOM   8738  C CA  . SER B  1 62   ? 173.409 232.601 228.563 1.00 52.66  ? 31   SER B CA  1 
ATOM   8739  C C   . SER B  1 62   ? 174.177 232.829 227.265 1.00 52.66  ? 31   SER B C   1 
ATOM   8740  O O   . SER B  1 62   ? 174.791 231.900 226.735 1.00 52.66  ? 31   SER B O   1 
ATOM   8741  C CB  . SER B  1 62   ? 174.354 232.141 229.668 1.00 52.66  ? 31   SER B CB  1 
ATOM   8742  O OG  . SER B  1 62   ? 174.912 230.880 229.365 1.00 52.66  ? 31   SER B OG  1 
ATOM   8743  N N   . PHE B  1 63   ? 174.176 234.066 226.770 1.00 54.30  ? 32   PHE B N   1 
ATOM   8744  C CA  . PHE B  1 63   ? 174.797 234.381 225.484 1.00 54.30  ? 32   PHE B CA  1 
ATOM   8745  C C   . PHE B  1 63   ? 176.206 234.920 225.715 1.00 54.30  ? 32   PHE B C   1 
ATOM   8746  O O   . PHE B  1 63   ? 176.415 236.132 225.787 1.00 54.30  ? 32   PHE B O   1 
ATOM   8747  C CB  . PHE B  1 63   ? 173.971 235.398 224.708 1.00 54.30  ? 32   PHE B CB  1 
ATOM   8748  C CG  . PHE B  1 63   ? 172.563 234.977 224.450 1.00 54.30  ? 32   PHE B CG  1 
ATOM   8749  C CD1 . PHE B  1 63   ? 172.239 234.245 223.323 1.00 54.30  ? 32   PHE B CD1 1 
ATOM   8750  C CD2 . PHE B  1 63   ? 171.550 235.368 225.305 1.00 54.30  ? 32   PHE B CD2 1 
ATOM   8751  C CE1 . PHE B  1 63   ? 170.936 233.868 223.078 1.00 54.30  ? 32   PHE B CE1 1 
ATOM   8752  C CE2 . PHE B  1 63   ? 170.245 235.003 225.063 1.00 54.30  ? 32   PHE B CE2 1 
ATOM   8753  C CZ  . PHE B  1 63   ? 169.936 234.248 223.947 1.00 54.30  ? 32   PHE B CZ  1 
ATOM   8754  N N   . THR B  1 64   ? 177.182 234.020 225.813 1.00 49.75  ? 33   THR B N   1 
ATOM   8755  C CA  . THR B  1 64   ? 178.584 234.387 226.049 1.00 49.75  ? 33   THR B CA  1 
ATOM   8756  C C   . THR B  1 64   ? 178.762 235.307 227.260 1.00 49.75  ? 33   THR B C   1 
ATOM   8757  O O   . THR B  1 64   ? 179.443 236.331 227.195 1.00 49.75  ? 33   THR B O   1 
ATOM   8758  C CB  . THR B  1 64   ? 179.193 235.028 224.802 1.00 49.75  ? 33   THR B CB  1 
ATOM   8759  O OG1 . THR B  1 64   ? 178.564 236.289 224.551 1.00 49.75  ? 33   THR B OG1 1 
ATOM   8760  C CG2 . THR B  1 64   ? 178.980 234.137 223.600 1.00 49.75  ? 33   THR B CG2 1 
ATOM   8761  N N   . ARG B  1 65   ? 178.152 234.936 228.377 1.00 47.85  ? 34   ARG B N   1 
ATOM   8762  C CA  . ARG B  1 65   ? 178.265 235.686 229.619 1.00 47.85  ? 34   ARG B CA  1 
ATOM   8763  C C   . ARG B  1 65   ? 179.238 235.013 230.587 1.00 47.85  ? 34   ARG B C   1 
ATOM   8764  O O   . ARG B  1 65   ? 179.639 233.861 230.409 1.00 47.85  ? 34   ARG B O   1 
ATOM   8765  C CB  . ARG B  1 65   ? 176.890 235.826 230.273 1.00 47.85  ? 34   ARG B CB  1 
ATOM   8766  C CG  . ARG B  1 65   ? 175.943 236.802 229.612 1.00 47.85  ? 34   ARG B CG  1 
ATOM   8767  C CD  . ARG B  1 65   ? 176.225 238.200 230.101 1.00 47.85  ? 34   ARG B CD  1 
ATOM   8768  N NE  . ARG B  1 65   ? 175.482 239.212 229.366 1.00 47.85  ? 34   ARG B NE  1 
ATOM   8769  C CZ  . ARG B  1 65   ? 175.696 240.518 229.477 1.00 47.85  ? 34   ARG B CZ  1 
ATOM   8770  N NH1 . ARG B  1 65   ? 176.635 240.974 230.291 1.00 47.85  ? 34   ARG B NH1 1 
ATOM   8771  N NH2 . ARG B  1 65   ? 174.972 241.370 228.772 1.00 47.85  ? 34   ARG B NH2 1 
ATOM   8772  N N   . GLY B  1 66   ? 179.610 235.754 231.632 1.00 42.11  ? 35   GLY B N   1 
ATOM   8773  C CA  . GLY B  1 66   ? 180.368 235.187 232.734 1.00 42.11  ? 35   GLY B CA  1 
ATOM   8774  C C   . GLY B  1 66   ? 181.863 235.033 232.549 1.00 42.11  ? 35   GLY B C   1 
ATOM   8775  O O   . GLY B  1 66   ? 182.448 234.095 233.097 1.00 42.11  ? 35   GLY B O   1 
ATOM   8776  N N   . VAL B  1 67   ? 182.501 235.909 231.785 1.00 40.20  ? 36   VAL B N   1 
ATOM   8777  C CA  . VAL B  1 67   ? 183.949 235.880 231.588 1.00 40.20  ? 36   VAL B CA  1 
ATOM   8778  C C   . VAL B  1 67   ? 184.601 236.852 232.560 1.00 40.20  ? 36   VAL B C   1 
ATOM   8779  O O   . VAL B  1 67   ? 184.096 237.957 232.777 1.00 40.20  ? 36   VAL B O   1 
ATOM   8780  C CB  . VAL B  1 67   ? 184.320 236.210 230.129 1.00 40.20  ? 36   VAL B CB  1 
ATOM   8781  C CG1 . VAL B  1 67   ? 185.798 236.503 230.000 1.00 40.20  ? 36   VAL B CG1 1 
ATOM   8782  C CG2 . VAL B  1 67   ? 183.934 235.074 229.218 1.00 40.20  ? 36   VAL B CG2 1 
ATOM   8783  N N   . TYR B  1 68   ? 185.700 236.429 233.188 1.00 35.66  ? 37   TYR B N   1 
ATOM   8784  C CA  . TYR B  1 68   ? 186.431 237.269 234.125 1.00 35.66  ? 37   TYR B CA  1 
ATOM   8785  C C   . TYR B  1 68   ? 187.922 237.216 233.816 1.00 35.66  ? 37   TYR B C   1 
ATOM   8786  O O   . TYR B  1 68   ? 188.390 236.359 233.066 1.00 35.66  ? 37   TYR B O   1 
ATOM   8787  C CB  . TYR B  1 68   ? 186.176 236.866 235.587 1.00 35.66  ? 37   TYR B CB  1 
ATOM   8788  C CG  . TYR B  1 68   ? 186.512 235.436 235.940 1.00 35.66  ? 37   TYR B CG  1 
ATOM   8789  C CD1 . TYR B  1 68   ? 185.619 234.414 235.691 1.00 35.66  ? 37   TYR B CD1 1 
ATOM   8790  C CD2 . TYR B  1 68   ? 187.736 235.108 236.497 1.00 35.66  ? 37   TYR B CD2 1 
ATOM   8791  C CE1 . TYR B  1 68   ? 185.922 233.116 236.009 1.00 35.66  ? 37   TYR B CE1 1 
ATOM   8792  C CE2 . TYR B  1 68   ? 188.048 233.815 236.813 1.00 35.66  ? 37   TYR B CE2 1 
ATOM   8793  C CZ  . TYR B  1 68   ? 187.140 232.823 236.564 1.00 35.66  ? 37   TYR B CZ  1 
ATOM   8794  O OH  . TYR B  1 68   ? 187.453 231.527 236.881 1.00 35.66  ? 37   TYR B OH  1 
ATOM   8795  N N   . TYR B  1 69   ? 188.658 238.169 234.374 1.00 38.37  ? 38   TYR B N   1 
ATOM   8796  C CA  . TYR B  1 69   ? 190.110 238.206 234.206 1.00 38.37  ? 38   TYR B CA  1 
ATOM   8797  C C   . TYR B  1 69   ? 190.750 237.082 235.007 1.00 38.37  ? 38   TYR B C   1 
ATOM   8798  O O   . TYR B  1 69   ? 190.600 237.051 236.234 1.00 38.37  ? 38   TYR B O   1 
ATOM   8799  C CB  . TYR B  1 69   ? 190.660 239.548 234.669 1.00 38.37  ? 38   TYR B CB  1 
ATOM   8800  C CG  . TYR B  1 69   ? 190.400 240.683 233.715 1.00 38.37  ? 38   TYR B CG  1 
ATOM   8801  C CD1 . TYR B  1 69   ? 191.375 241.117 232.833 1.00 38.37  ? 38   TYR B CD1 1 
ATOM   8802  C CD2 . TYR B  1 69   ? 189.181 241.332 233.704 1.00 38.37  ? 38   TYR B CD2 1 
ATOM   8803  C CE1 . TYR B  1 69   ? 191.134 242.158 231.965 1.00 38.37  ? 38   TYR B CE1 1 
ATOM   8804  C CE2 . TYR B  1 69   ? 188.935 242.366 232.844 1.00 38.37  ? 38   TYR B CE2 1 
ATOM   8805  C CZ  . TYR B  1 69   ? 189.910 242.775 231.977 1.00 38.37  ? 38   TYR B CZ  1 
ATOM   8806  O OH  . TYR B  1 69   ? 189.648 243.811 231.119 1.00 38.37  ? 38   TYR B OH  1 
ATOM   8807  N N   . PRO B  1 70   ? 191.494 236.169 234.380 1.00 41.03  ? 39   PRO B N   1 
ATOM   8808  C CA  . PRO B  1 70   ? 192.058 235.053 235.156 1.00 41.03  ? 39   PRO B CA  1 
ATOM   8809  C C   . PRO B  1 70   ? 193.178 235.452 236.101 1.00 41.03  ? 39   PRO B C   1 
ATOM   8810  O O   . PRO B  1 70   ? 193.212 234.962 237.235 1.00 41.03  ? 39   PRO B O   1 
ATOM   8811  C CB  . PRO B  1 70   ? 192.549 234.092 234.067 1.00 41.03  ? 39   PRO B CB  1 
ATOM   8812  C CG  . PRO B  1 70   ? 192.752 234.935 232.879 1.00 41.03  ? 39   PRO B CG  1 
ATOM   8813  C CD  . PRO B  1 70   ? 191.725 236.009 232.937 1.00 41.03  ? 39   PRO B CD  1 
ATOM   8814  N N   . ASP B  1 71   ? 194.095 236.325 235.683 1.00 43.84  ? 40   ASP B N   1 
ATOM   8815  C CA  . ASP B  1 71   ? 195.179 236.749 236.564 1.00 43.84  ? 40   ASP B CA  1 
ATOM   8816  C C   . ASP B  1 71   ? 195.378 238.260 236.565 1.00 43.84  ? 40   ASP B C   1 
ATOM   8817  O O   . ASP B  1 71   ? 194.561 238.998 236.010 1.00 43.84  ? 40   ASP B O   1 
ATOM   8818  C CB  . ASP B  1 71   ? 196.469 236.008 236.204 1.00 43.84  ? 40   ASP B CB  1 
ATOM   8819  C CG  . ASP B  1 71   ? 196.936 236.285 234.800 1.00 43.84  ? 40   ASP B CG  1 
ATOM   8820  O OD1 . ASP B  1 71   ? 197.289 237.437 234.494 1.00 43.84  ? 40   ASP B OD1 1 
ATOM   8821  O OD2 . ASP B  1 71   ? 196.968 235.334 233.996 1.00 43.84  ? 40   ASP B OD2 1 
ATOM   8822  N N   . LYS B  1 72   ? 196.468 238.733 237.169 1.00 42.59  ? 41   LYS B N   1 
ATOM   8823  C CA  . LYS B  1 72   ? 196.692 240.159 237.380 1.00 42.59  ? 41   LYS B CA  1 
ATOM   8824  C C   . LYS B  1 72   ? 197.884 240.710 236.599 1.00 42.59  ? 41   LYS B C   1 
ATOM   8825  O O   . LYS B  1 72   ? 198.540 241.651 237.046 1.00 42.59  ? 41   LYS B O   1 
ATOM   8826  C CB  . LYS B  1 72   ? 196.865 240.431 238.870 1.00 42.59  ? 41   LYS B CB  1 
ATOM   8827  C CG  . LYS B  1 72   ? 195.606 240.173 239.661 1.00 42.59  ? 41   LYS B CG  1 
ATOM   8828  C CD  . LYS B  1 72   ? 195.765 240.551 241.107 1.00 42.59  ? 41   LYS B CD  1 
ATOM   8829  C CE  . LYS B  1 72   ? 194.470 240.347 241.853 1.00 42.59  ? 41   LYS B CE  1 
ATOM   8830  N NZ  . LYS B  1 72   ? 194.537 240.946 243.205 1.00 42.59  ? 41   LYS B NZ  1 
ATOM   8831  N N   . VAL B  1 73   ? 198.172 240.135 235.439 1.00 42.10  ? 42   VAL B N   1 
ATOM   8832  C CA  . VAL B  1 73   ? 199.247 240.586 234.565 1.00 42.10  ? 42   VAL B CA  1 
ATOM   8833  C C   . VAL B  1 73   ? 198.633 241.376 233.416 1.00 42.10  ? 42   VAL B C   1 
ATOM   8834  O O   . VAL B  1 73   ? 197.632 240.949 232.829 1.00 42.10  ? 42   VAL B O   1 
ATOM   8835  C CB  . VAL B  1 73   ? 200.074 239.394 234.051 1.00 42.10  ? 42   VAL B CB  1 
ATOM   8836  C CG1 . VAL B  1 73   ? 200.728 239.717 232.732 1.00 42.10  ? 42   VAL B CG1 1 
ATOM   8837  C CG2 . VAL B  1 73   ? 201.113 239.002 235.072 1.00 42.10  ? 42   VAL B CG2 1 
ATOM   8838  N N   . PHE B  1 74   ? 199.194 242.549 233.126 1.00 41.52  ? 43   PHE B N   1 
ATOM   8839  C CA  . PHE B  1 74   ? 198.733 243.341 231.991 1.00 41.52  ? 43   PHE B CA  1 
ATOM   8840  C C   . PHE B  1 74   ? 199.197 242.724 230.675 1.00 41.52  ? 43   PHE B C   1 
ATOM   8841  O O   . PHE B  1 74   ? 200.375 242.401 230.510 1.00 41.52  ? 43   PHE B O   1 
ATOM   8842  C CB  . PHE B  1 74   ? 199.251 244.771 232.111 1.00 41.52  ? 43   PHE B CB  1 
ATOM   8843  C CG  . PHE B  1 74   ? 198.866 245.667 230.965 1.00 41.52  ? 43   PHE B CG  1 
ATOM   8844  C CD1 . PHE B  1 74   ? 199.690 245.813 229.868 1.00 41.52  ? 43   PHE B CD1 1 
ATOM   8845  C CD2 . PHE B  1 74   ? 197.695 246.396 231.007 1.00 41.52  ? 43   PHE B CD2 1 
ATOM   8846  C CE1 . PHE B  1 74   ? 199.337 246.639 228.828 1.00 41.52  ? 43   PHE B CE1 1 
ATOM   8847  C CE2 . PHE B  1 74   ? 197.344 247.222 229.970 1.00 41.52  ? 43   PHE B CE2 1 
ATOM   8848  C CZ  . PHE B  1 74   ? 198.169 247.344 228.884 1.00 41.52  ? 43   PHE B CZ  1 
ATOM   8849  N N   . ARG B  1 75   ? 198.265 242.555 229.740 1.00 43.67  ? 44   ARG B N   1 
ATOM   8850  C CA  . ARG B  1 75   ? 198.554 242.086 228.392 1.00 43.67  ? 44   ARG B CA  1 
ATOM   8851  C C   . ARG B  1 75   ? 197.804 242.962 227.402 1.00 43.67  ? 44   ARG B C   1 
ATOM   8852  O O   . ARG B  1 75   ? 196.721 243.463 227.701 1.00 43.67  ? 44   ARG B O   1 
ATOM   8853  C CB  . ARG B  1 75   ? 198.158 240.630 228.191 1.00 43.67  ? 44   ARG B CB  1 
ATOM   8854  C CG  . ARG B  1 75   ? 198.761 239.686 229.189 1.00 43.67  ? 44   ARG B CG  1 
ATOM   8855  C CD  . ARG B  1 75   ? 198.233 238.290 228.999 1.00 43.67  ? 44   ARG B CD  1 
ATOM   8856  N NE  . ARG B  1 75   ? 198.462 237.475 230.184 1.00 43.67  ? 44   ARG B NE  1 
ATOM   8857  C CZ  . ARG B  1 75   ? 199.572 236.783 230.407 1.00 43.67  ? 44   ARG B CZ  1 
ATOM   8858  N NH1 . ARG B  1 75   ? 200.553 236.794 229.515 1.00 43.67  ? 44   ARG B NH1 1 
ATOM   8859  N NH2 . ARG B  1 75   ? 199.696 236.067 231.514 1.00 43.67  ? 44   ARG B NH2 1 
ATOM   8860  N N   . SER B  1 76   ? 198.376 243.146 226.217 1.00 44.16  ? 45   SER B N   1 
ATOM   8861  C CA  . SER B  1 76   ? 197.718 243.952 225.201 1.00 44.16  ? 45   SER B CA  1 
ATOM   8862  C C   . SER B  1 76   ? 197.959 243.381 223.813 1.00 44.16  ? 45   SER B C   1 
ATOM   8863  O O   . SER B  1 76   ? 199.056 242.907 223.510 1.00 44.16  ? 45   SER B O   1 
ATOM   8864  C CB  . SER B  1 76   ? 198.195 245.404 225.253 1.00 44.16  ? 45   SER B CB  1 
ATOM   8865  O OG  . SER B  1 76   ? 199.458 245.547 224.636 1.00 44.16  ? 45   SER B OG  1 
ATOM   8866  N N   . SER B  1 77   ? 196.923 243.446 222.974 1.00 46.40  ? 46   SER B N   1 
ATOM   8867  C CA  . SER B  1 77   ? 196.987 243.054 221.565 1.00 46.40  ? 46   SER B CA  1 
ATOM   8868  C C   . SER B  1 77   ? 197.457 241.609 221.392 1.00 46.40  ? 46   SER B C   1 
ATOM   8869  O O   . SER B  1 77   ? 198.451 241.335 220.720 1.00 46.40  ? 46   SER B O   1 
ATOM   8870  C CB  . SER B  1 77   ? 197.891 244.008 220.779 1.00 46.40  ? 46   SER B CB  1 
ATOM   8871  O OG  . SER B  1 77   ? 197.371 245.322 220.769 1.00 46.40  ? 46   SER B OG  1 
ATOM   8872  N N   . VAL B  1 78   ? 196.723 240.676 221.998 1.00 46.14  ? 47   VAL B N   1 
ATOM   8873  C CA  . VAL B  1 78   ? 197.182 239.291 222.020 1.00 46.14  ? 47   VAL B CA  1 
ATOM   8874  C C   . VAL B  1 78   ? 195.994 238.349 222.171 1.00 46.14  ? 47   VAL B C   1 
ATOM   8875  O O   . VAL B  1 78   ? 194.983 238.688 222.787 1.00 46.14  ? 47   VAL B O   1 
ATOM   8876  C CB  . VAL B  1 78   ? 198.224 239.080 223.145 1.00 46.14  ? 47   VAL B CB  1 
ATOM   8877  C CG1 . VAL B  1 78   ? 197.567 239.130 224.503 1.00 46.14  ? 47   VAL B CG1 1 
ATOM   8878  C CG2 . VAL B  1 78   ? 198.983 237.784 222.951 1.00 46.14  ? 47   VAL B CG2 1 
ATOM   8879  N N   . LEU B  1 79   ? 196.110 237.162 221.579 1.00 44.77  ? 48   LEU B N   1 
ATOM   8880  C CA  . LEU B  1 79   ? 195.205 236.051 221.847 1.00 44.77  ? 48   LEU B CA  1 
ATOM   8881  C C   . LEU B  1 79   ? 195.867 235.113 222.848 1.00 44.77  ? 48   LEU B C   1 
ATOM   8882  O O   . LEU B  1 79   ? 196.980 234.637 222.608 1.00 44.77  ? 48   LEU B O   1 
ATOM   8883  C CB  . LEU B  1 79   ? 194.867 235.305 220.558 1.00 44.77  ? 48   LEU B CB  1 
ATOM   8884  C CG  . LEU B  1 79   ? 194.192 236.104 219.445 1.00 44.77  ? 48   LEU B CG  1 
ATOM   8885  C CD1 . LEU B  1 79   ? 193.739 235.181 218.345 1.00 44.77  ? 48   LEU B CD1 1 
ATOM   8886  C CD2 . LEU B  1 79   ? 193.026 236.886 219.982 1.00 44.77  ? 48   LEU B CD2 1 
ATOM   8887  N N   . HIS B  1 80   ? 195.185 234.846 223.961 1.00 43.15  ? 49   HIS B N   1 
ATOM   8888  C CA  . HIS B  1 80   ? 195.757 234.088 225.066 1.00 43.15  ? 49   HIS B CA  1 
ATOM   8889  C C   . HIS B  1 80   ? 194.827 232.947 225.464 1.00 43.15  ? 49   HIS B C   1 
ATOM   8890  O O   . HIS B  1 80   ? 193.644 233.175 225.711 1.00 43.15  ? 49   HIS B O   1 
ATOM   8891  C CB  . HIS B  1 80   ? 196.006 235.027 226.251 1.00 43.15  ? 49   HIS B CB  1 
ATOM   8892  C CG  . HIS B  1 80   ? 196.795 234.416 227.364 1.00 43.15  ? 49   HIS B CG  1 
ATOM   8893  N ND1 . HIS B  1 80   ? 196.273 234.222 228.624 1.00 43.15  ? 49   HIS B ND1 1 
ATOM   8894  C CD2 . HIS B  1 80   ? 198.071 233.970 227.412 1.00 43.15  ? 49   HIS B CD2 1 
ATOM   8895  C CE1 . HIS B  1 80   ? 197.192 233.674 229.397 1.00 43.15  ? 49   HIS B CE1 1 
ATOM   8896  N NE2 . HIS B  1 80   ? 198.291 233.510 228.685 1.00 43.15  ? 49   HIS B NE2 1 
ATOM   8897  N N   . SER B  1 81   ? 195.356 231.728 225.539 1.00 45.03  ? 50   SER B N   1 
ATOM   8898  C CA  . SER B  1 81   ? 194.580 230.574 225.979 1.00 45.03  ? 50   SER B CA  1 
ATOM   8899  C C   . SER B  1 81   ? 194.767 230.333 227.470 1.00 45.03  ? 50   SER B C   1 
ATOM   8900  O O   . SER B  1 81   ? 195.883 230.423 227.986 1.00 45.03  ? 50   SER B O   1 
ATOM   8901  C CB  . SER B  1 81   ? 194.984 229.315 225.214 1.00 45.03  ? 50   SER B CB  1 
ATOM   8902  O OG  . SER B  1 81   ? 194.558 229.366 223.868 1.00 45.03  ? 50   SER B OG  1 
ATOM   8903  N N   . THR B  1 82   ? 193.675 229.993 228.156 1.00 46.56  ? 51   THR B N   1 
ATOM   8904  C CA  . THR B  1 82   ? 193.744 229.725 229.587 1.00 46.56  ? 51   THR B CA  1 
ATOM   8905  C C   . THR B  1 82   ? 192.701 228.689 229.978 1.00 46.56  ? 51   THR B C   1 
ATOM   8906  O O   . THR B  1 82   ? 191.585 228.688 229.457 1.00 46.56  ? 51   THR B O   1 
ATOM   8907  C CB  . THR B  1 82   ? 193.555 231.001 230.414 1.00 46.56  ? 51   THR B CB  1 
ATOM   8908  O OG1 . THR B  1 82   ? 193.546 230.673 231.807 1.00 46.56  ? 51   THR B OG1 1 
ATOM   8909  C CG2 . THR B  1 82   ? 192.256 231.665 230.074 1.00 46.56  ? 51   THR B CG2 1 
ATOM   8910  N N   . GLN B  1 83   ? 193.077 227.813 230.905 1.00 45.13  ? 52   GLN B N   1 
ATOM   8911  C CA  . GLN B  1 83   ? 192.223 226.748 231.414 1.00 45.13  ? 52   GLN B CA  1 
ATOM   8912  C C   . GLN B  1 83   ? 191.849 227.085 232.850 1.00 45.13  ? 52   GLN B C   1 
ATOM   8913  O O   . GLN B  1 83   ? 192.734 227.254 233.694 1.00 45.13  ? 52   GLN B O   1 
ATOM   8914  C CB  . GLN B  1 83   ? 192.958 225.409 231.327 1.00 45.13  ? 52   GLN B CB  1 
ATOM   8915  C CG  . GLN B  1 83   ? 192.097 224.159 231.319 1.00 45.13  ? 52   GLN B CG  1 
ATOM   8916  C CD  . GLN B  1 83   ? 191.949 223.539 232.687 1.00 45.13  ? 52   GLN B CD  1 
ATOM   8917  O OE1 . GLN B  1 83   ? 192.865 223.588 233.502 1.00 45.13  ? 52   GLN B OE1 1 
ATOM   8918  N NE2 . GLN B  1 83   ? 190.802 222.927 232.937 1.00 45.13  ? 52   GLN B NE2 1 
ATOM   8919  N N   . ASP B  1 84   ? 190.552 227.191 233.127 1.00 43.30  ? 53   ASP B N   1 
ATOM   8920  C CA  . ASP B  1 84   ? 190.090 227.608 234.449 1.00 43.30  ? 53   ASP B CA  1 
ATOM   8921  C C   . ASP B  1 84   ? 188.600 227.308 234.552 1.00 43.30  ? 53   ASP B C   1 
ATOM   8922  O O   . ASP B  1 84   ? 187.998 226.759 233.628 1.00 43.30  ? 53   ASP B O   1 
ATOM   8923  C CB  . ASP B  1 84   ? 190.380 229.091 234.682 1.00 43.30  ? 53   ASP B CB  1 
ATOM   8924  C CG  . ASP B  1 84   ? 190.632 229.417 236.138 1.00 43.30  ? 53   ASP B CG  1 
ATOM   8925  O OD1 . ASP B  1 84   ? 189.974 228.817 237.010 1.00 43.30  ? 53   ASP B OD1 1 
ATOM   8926  O OD2 . ASP B  1 84   ? 191.492 230.280 236.412 1.00 43.30  ? 53   ASP B OD2 1 
ATOM   8927  N N   . LEU B  1 85   ? 188.000 227.679 235.682 1.00 38.88  ? 54   LEU B N   1 
ATOM   8928  C CA  . LEU B  1 85   ? 186.578 227.440 235.916 1.00 38.88  ? 54   LEU B CA  1 
ATOM   8929  C C   . LEU B  1 85   ? 185.762 228.569 235.300 1.00 38.88  ? 54   LEU B C   1 
ATOM   8930  O O   . LEU B  1 85   ? 185.729 229.678 235.838 1.00 38.88  ? 54   LEU B O   1 
ATOM   8931  C CB  . LEU B  1 85   ? 186.290 227.335 237.410 1.00 38.88  ? 54   LEU B CB  1 
ATOM   8932  C CG  . LEU B  1 85   ? 186.283 225.968 238.095 1.00 38.88  ? 54   LEU B CG  1 
ATOM   8933  C CD1 . LEU B  1 85   ? 187.538 225.192 237.785 1.00 38.88  ? 54   LEU B CD1 1 
ATOM   8934  C CD2 . LEU B  1 85   ? 186.110 226.123 239.587 1.00 38.88  ? 54   LEU B CD2 1 
ATOM   8935  N N   . PHE B  1 86   ? 185.068 228.282 234.199 1.00 37.38  ? 55   PHE B N   1 
ATOM   8936  C CA  . PHE B  1 86   ? 184.263 229.276 233.510 1.00 37.38  ? 55   PHE B CA  1 
ATOM   8937  C C   . PHE B  1 86   ? 182.829 228.783 233.370 1.00 37.38  ? 55   PHE B C   1 
ATOM   8938  O O   . PHE B  1 86   ? 182.547 227.590 233.487 1.00 37.38  ? 55   PHE B O   1 
ATOM   8939  C CB  . PHE B  1 86   ? 184.805 229.584 232.108 1.00 37.38  ? 55   PHE B CB  1 
ATOM   8940  C CG  . PHE B  1 86   ? 186.166 230.210 232.092 1.00 37.38  ? 55   PHE B CG  1 
ATOM   8941  C CD1 . PHE B  1 86   ? 186.317 231.574 232.214 1.00 37.38  ? 55   PHE B CD1 1 
ATOM   8942  C CD2 . PHE B  1 86   ? 187.284 229.443 231.847 1.00 37.38  ? 55   PHE B CD2 1 
ATOM   8943  C CE1 . PHE B  1 86   ? 187.561 232.146 232.177 1.00 37.38  ? 55   PHE B CE1 1 
ATOM   8944  C CE2 . PHE B  1 86   ? 188.526 230.013 231.798 1.00 37.38  ? 55   PHE B CE2 1 
ATOM   8945  C CZ  . PHE B  1 86   ? 188.665 231.367 231.963 1.00 37.38  ? 55   PHE B CZ  1 
ATOM   8946  N N   . LEU B  1 87   ? 181.923 229.722 233.124 1.00 38.95  ? 56   LEU B N   1 
ATOM   8947  C CA  . LEU B  1 87   ? 180.553 229.393 232.739 1.00 38.95  ? 56   LEU B CA  1 
ATOM   8948  C C   . LEU B  1 87   ? 180.503 229.094 231.245 1.00 38.95  ? 56   LEU B C   1 
ATOM   8949  O O   . LEU B  1 87   ? 180.836 229.971 230.440 1.00 38.95  ? 56   LEU B O   1 
ATOM   8950  C CB  . LEU B  1 87   ? 179.607 230.531 233.090 1.00 38.95  ? 56   LEU B CB  1 
ATOM   8951  C CG  . LEU B  1 87   ? 178.153 230.367 232.659 1.00 38.95  ? 56   LEU B CG  1 
ATOM   8952  C CD1 . LEU B  1 87   ? 177.449 229.405 233.574 1.00 38.95  ? 56   LEU B CD1 1 
ATOM   8953  C CD2 . LEU B  1 87   ? 177.445 231.694 232.671 1.00 38.95  ? 56   LEU B CD2 1 
ATOM   8954  N N   . PRO B  1 88   ? 180.105 227.889 230.832 1.00 40.61  ? 57   PRO B N   1 
ATOM   8955  C CA  . PRO B  1 88   ? 180.138 227.540 229.406 1.00 40.61  ? 57   PRO B CA  1 
ATOM   8956  C C   . PRO B  1 88   ? 179.212 228.403 228.563 1.00 40.61  ? 57   PRO B C   1 
ATOM   8957  O O   . PRO B  1 88   ? 178.166 228.864 229.022 1.00 40.61  ? 57   PRO B O   1 
ATOM   8958  C CB  . PRO B  1 88   ? 179.684 226.078 229.396 1.00 40.61  ? 57   PRO B CB  1 
ATOM   8959  C CG  . PRO B  1 88   ? 179.945 225.591 230.758 1.00 40.61  ? 57   PRO B CG  1 
ATOM   8960  C CD  . PRO B  1 88   ? 179.712 226.744 231.664 1.00 40.61  ? 57   PRO B CD  1 
ATOM   8961  N N   . PHE B  1 89   ? 179.610 228.617 227.308 1.00 44.79  ? 58   PHE B N   1 
ATOM   8962  C CA  . PHE B  1 89   ? 178.829 229.453 226.405 1.00 44.79  ? 58   PHE B CA  1 
ATOM   8963  C C   . PHE B  1 89   ? 177.528 228.779 226.008 1.00 44.79  ? 58   PHE B C   1 
ATOM   8964  O O   . PHE B  1 89   ? 177.463 227.560 225.837 1.00 44.79  ? 58   PHE B O   1 
ATOM   8965  C CB  . PHE B  1 89   ? 179.604 229.798 225.132 1.00 44.79  ? 58   PHE B CB  1 
ATOM   8966  C CG  . PHE B  1 89   ? 180.670 230.837 225.313 1.00 44.79  ? 58   PHE B CG  1 
ATOM   8967  C CD1 . PHE B  1 89   ? 181.564 231.101 224.295 1.00 44.79  ? 58   PHE B CD1 1 
ATOM   8968  C CD2 . PHE B  1 89   ? 180.767 231.564 226.479 1.00 44.79  ? 58   PHE B CD2 1 
ATOM   8969  C CE1 . PHE B  1 89   ? 182.529 232.056 224.443 1.00 44.79  ? 58   PHE B CE1 1 
ATOM   8970  C CE2 . PHE B  1 89   ? 181.742 232.518 226.628 1.00 44.79  ? 58   PHE B CE2 1 
ATOM   8971  C CZ  . PHE B  1 89   ? 182.621 232.764 225.609 1.00 44.79  ? 58   PHE B CZ  1 
ATOM   8972  N N   . PHE B  1 90   ? 176.494 229.597 225.848 1.00 48.59  ? 59   PHE B N   1 
ATOM   8973  C CA  . PHE B  1 90   ? 175.150 229.154 225.499 1.00 48.59  ? 59   PHE B CA  1 
ATOM   8974  C C   . PHE B  1 90   ? 174.645 228.093 226.465 1.00 48.59  ? 59   PHE B C   1 
ATOM   8975  O O   . PHE B  1 90   ? 174.172 227.027 226.067 1.00 48.59  ? 59   PHE B O   1 
ATOM   8976  C CB  . PHE B  1 90   ? 175.089 228.661 224.053 1.00 48.59  ? 59   PHE B CB  1 
ATOM   8977  C CG  . PHE B  1 90   ? 175.647 229.639 223.065 1.00 48.59  ? 59   PHE B CG  1 
ATOM   8978  C CD1 . PHE B  1 90   ? 176.896 229.449 222.508 1.00 48.59  ? 59   PHE B CD1 1 
ATOM   8979  C CD2 . PHE B  1 90   ? 174.926 230.761 222.712 1.00 48.59  ? 59   PHE B CD2 1 
ATOM   8980  C CE1 . PHE B  1 90   ? 177.406 230.353 221.614 1.00 48.59  ? 59   PHE B CE1 1 
ATOM   8981  C CE2 . PHE B  1 90   ? 175.433 231.664 221.821 1.00 48.59  ? 59   PHE B CE2 1 
ATOM   8982  C CZ  . PHE B  1 90   ? 176.672 231.462 221.270 1.00 48.59  ? 59   PHE B CZ  1 
ATOM   8983  N N   . SER B  1 91   ? 174.743 228.388 227.757 1.00 50.13  ? 60   SER B N   1 
ATOM   8984  C CA  . SER B  1 91   ? 174.309 227.398 228.720 1.00 50.13  ? 60   SER B CA  1 
ATOM   8985  C C   . SER B  1 91   ? 172.840 227.650 229.025 1.00 50.13  ? 60   SER B C   1 
ATOM   8986  O O   . SER B  1 91   ? 172.229 228.592 228.507 1.00 50.13  ? 60   SER B O   1 
ATOM   8987  C CB  . SER B  1 91   ? 175.163 227.448 229.986 1.00 50.13  ? 60   SER B CB  1 
ATOM   8988  O OG  . SER B  1 91   ? 176.501 227.080 229.725 1.00 50.13  ? 60   SER B OG  1 
ATOM   8989  N N   . ASN B  1 92   ? 172.337 226.941 230.022 1.00 60.60  ? 61   ASN B N   1 
ATOM   8990  C CA  . ASN B  1 92   ? 170.936 226.965 230.411 1.00 60.60  ? 61   ASN B CA  1 
ATOM   8991  C C   . ASN B  1 92   ? 170.874 227.394 231.871 1.00 60.60  ? 61   ASN B C   1 
ATOM   8992  O O   . ASN B  1 92   ? 171.141 226.592 232.769 1.00 60.60  ? 61   ASN B O   1 
ATOM   8993  C CB  . ASN B  1 92   ? 170.361 225.577 230.158 1.00 60.60  ? 61   ASN B CB  1 
ATOM   8994  C CG  . ASN B  1 92   ? 168.901 225.447 230.493 1.00 60.60  ? 61   ASN B CG  1 
ATOM   8995  O OD1 . ASN B  1 92   ? 168.227 226.405 230.856 1.00 60.60  ? 61   ASN B OD1 1 
ATOM   8996  N ND2 . ASN B  1 92   ? 168.399 224.224 230.341 1.00 60.60  ? 61   ASN B ND2 1 
ATOM   8997  N N   . VAL B  1 93   ? 170.520 228.652 232.104 1.00 51.22  ? 62   VAL B N   1 
ATOM   8998  C CA  . VAL B  1 93   ? 170.546 229.230 233.441 1.00 51.22  ? 62   VAL B CA  1 
ATOM   8999  C C   . VAL B  1 93   ? 169.133 229.224 233.993 1.00 51.22  ? 62   VAL B C   1 
ATOM   9000  O O   . VAL B  1 93   ? 168.149 229.255 233.244 1.00 51.22  ? 62   VAL B O   1 
ATOM   9001  C CB  . VAL B  1 93   ? 171.155 230.645 233.443 1.00 51.22  ? 62   VAL B CB  1 
ATOM   9002  C CG1 . VAL B  1 93   ? 172.607 230.579 233.042 1.00 51.22  ? 62   VAL B CG1 1 
ATOM   9003  C CG2 . VAL B  1 93   ? 170.401 231.547 232.528 1.00 51.22  ? 62   VAL B CG2 1 
ATOM   9004  N N   . THR B  1 94   ? 169.027 229.215 235.319 1.00 50.14  ? 63   THR B N   1 
ATOM   9005  C CA  . THR B  1 94   ? 167.725 229.302 235.962 1.00 50.14  ? 63   THR B CA  1 
ATOM   9006  C C   . THR B  1 94   ? 167.358 230.745 236.267 1.00 50.14  ? 63   THR B C   1 
ATOM   9007  O O   . THR B  1 94   ? 168.222 231.576 236.564 1.00 50.14  ? 63   THR B O   1 
ATOM   9008  C CB  . THR B  1 94   ? 167.711 228.475 237.244 1.00 50.14  ? 63   THR B CB  1 
ATOM   9009  O OG1 . THR B  1 94   ? 168.311 227.202 236.986 1.00 50.14  ? 63   THR B OG1 1 
ATOM   9010  C CG2 . THR B  1 94   ? 166.292 228.230 237.706 1.00 50.14  ? 63   THR B CG2 1 
ATOM   9011  N N   . TRP B  1 95   ? 166.055 231.024 236.227 1.00 51.88  ? 64   TRP B N   1 
ATOM   9012  C CA  . TRP B  1 95   ? 165.514 232.374 236.250 1.00 51.88  ? 64   TRP B CA  1 
ATOM   9013  C C   . TRP B  1 95   ? 164.547 232.502 237.418 1.00 51.88  ? 64   TRP B C   1 
ATOM   9014  O O   . TRP B  1 95   ? 163.695 231.631 237.612 1.00 51.88  ? 64   TRP B O   1 
ATOM   9015  C CB  . TRP B  1 95   ? 164.791 232.628 234.923 1.00 51.88  ? 64   TRP B CB  1 
ATOM   9016  C CG  . TRP B  1 95   ? 164.149 233.959 234.712 1.00 51.88  ? 64   TRP B CG  1 
ATOM   9017  C CD1 . TRP B  1 95   ? 164.089 235.000 235.583 1.00 51.88  ? 64   TRP B CD1 1 
ATOM   9018  C CD2 . TRP B  1 95   ? 163.426 234.370 233.548 1.00 51.88  ? 64   TRP B CD2 1 
ATOM   9019  N NE1 . TRP B  1 95   ? 163.401 236.048 235.023 1.00 51.88  ? 64   TRP B NE1 1 
ATOM   9020  C CE2 . TRP B  1 95   ? 162.976 235.680 233.775 1.00 51.88  ? 64   TRP B CE2 1 
ATOM   9021  C CE3 . TRP B  1 95   ? 163.122 233.755 232.331 1.00 51.88  ? 64   TRP B CE3 1 
ATOM   9022  C CZ2 . TRP B  1 95   ? 162.244 236.390 232.832 1.00 51.88  ? 64   TRP B CZ2 1 
ATOM   9023  C CZ3 . TRP B  1 95   ? 162.395 234.459 231.398 1.00 51.88  ? 64   TRP B CZ3 1 
ATOM   9024  C CH2 . TRP B  1 95   ? 161.962 235.764 231.653 1.00 51.88  ? 64   TRP B CH2 1 
ATOM   9025  N N   . PHE B  1 96   ? 164.662 233.590 238.186 1.00 47.40  ? 65   PHE B N   1 
ATOM   9026  C CA  . PHE B  1 96   ? 163.823 233.794 239.359 1.00 47.40  ? 65   PHE B CA  1 
ATOM   9027  C C   . PHE B  1 96   ? 163.312 235.224 239.362 1.00 47.40  ? 65   PHE B C   1 
ATOM   9028  O O   . PHE B  1 96   ? 164.033 236.158 238.994 1.00 47.40  ? 65   PHE B O   1 
ATOM   9029  C CB  . PHE B  1 96   ? 164.552 233.521 240.682 1.00 47.40  ? 65   PHE B CB  1 
ATOM   9030  C CG  . PHE B  1 96   ? 165.170 232.159 240.780 1.00 47.40  ? 65   PHE B CG  1 
ATOM   9031  C CD1 . PHE B  1 96   ? 164.481 231.120 241.370 1.00 47.40  ? 65   PHE B CD1 1 
ATOM   9032  C CD2 . PHE B  1 96   ? 166.440 231.921 240.302 1.00 47.40  ? 65   PHE B CD2 1 
ATOM   9033  C CE1 . PHE B  1 96   ? 165.043 229.873 241.468 1.00 47.40  ? 65   PHE B CE1 1 
ATOM   9034  C CE2 . PHE B  1 96   ? 167.005 230.678 240.401 1.00 47.40  ? 65   PHE B CE2 1 
ATOM   9035  C CZ  . PHE B  1 96   ? 166.306 229.653 240.983 1.00 47.40  ? 65   PHE B CZ  1 
ATOM   9036  N N   . HIS B  1 97   ? 162.080 235.382 239.848 1.00 60.48  ? 66   HIS B N   1 
ATOM   9037  C CA  . HIS B  1 97   ? 161.338 236.632 239.801 1.00 60.48  ? 66   HIS B CA  1 
ATOM   9038  C C   . HIS B  1 97   ? 161.035 237.154 241.198 1.00 60.48  ? 66   HIS B C   1 
ATOM   9039  O O   . HIS B  1 97   ? 161.007 236.403 242.175 1.00 60.48  ? 66   HIS B O   1 
ATOM   9040  C CB  . HIS B  1 97   ? 159.990 236.453 239.091 1.00 60.48  ? 66   HIS B CB  1 
ATOM   9041  C CG  . HIS B  1 97   ? 160.097 236.052 237.656 1.00 60.48  ? 66   HIS B CG  1 
ATOM   9042  N ND1 . HIS B  1 97   ? 160.202 236.967 236.632 1.00 60.48  ? 66   HIS B ND1 1 
ATOM   9043  C CD2 . HIS B  1 97   ? 160.071 234.831 237.071 1.00 60.48  ? 66   HIS B CD2 1 
ATOM   9044  C CE1 . HIS B  1 97   ? 160.262 236.326 235.479 1.00 60.48  ? 66   HIS B CE1 1 
ATOM   9045  N NE2 . HIS B  1 97   ? 160.185 235.029 235.718 1.00 60.48  ? 66   HIS B NE2 1 
ATOM   9046  N N   . ALA B  1 98   ? 160.819 238.468 241.280 1.00 67.25  ? 67   ALA B N   1 
ATOM   9047  C CA  . ALA B  1 98   ? 160.119 239.096 242.403 1.00 67.25  ? 67   ALA B CA  1 
ATOM   9048  C C   . ALA B  1 98   ? 159.159 240.103 241.773 1.00 67.25  ? 67   ALA B C   1 
ATOM   9049  O O   . ALA B  1 98   ? 159.540 241.253 241.519 1.00 67.25  ? 67   ALA B O   1 
ATOM   9050  C CB  . ALA B  1 98   ? 161.075 239.753 243.384 1.00 67.25  ? 67   ALA B CB  1 
ATOM   9051  N N   . ILE B  1 99   ? 157.952 239.636 241.449 1.00 78.78  ? 68   ILE B N   1 
ATOM   9052  C CA  . ILE B  1 99   ? 156.955 240.405 240.706 1.00 78.78  ? 68   ILE B CA  1 
ATOM   9053  C C   . ILE B  1 99   ? 155.616 240.314 241.432 1.00 78.78  ? 68   ILE B C   1 
ATOM   9054  O O   . ILE B  1 99   ? 155.060 239.219 241.569 1.00 78.78  ? 68   ILE B O   1 
ATOM   9055  C CB  . ILE B  1 99   ? 156.828 239.915 239.253 1.00 78.78  ? 68   ILE B CB  1 
ATOM   9056  C CG1 . ILE B  1 99   ? 155.590 240.506 238.585 1.00 78.78  ? 68   ILE B CG1 1 
ATOM   9057  C CG2 . ILE B  1 99   ? 156.801 238.394 239.186 1.00 78.78  ? 68   ILE B CG2 1 
ATOM   9058  C CD1 . ILE B  1 99   ? 155.446 240.094 237.138 1.00 78.78  ? 68   ILE B CD1 1 
ATOM   9059  N N   . HIS B  1 100  ? 155.096 241.451 241.897 1.00 83.39  ? 69   HIS B N   1 
ATOM   9060  C CA  . HIS B  1 100  ? 153.837 241.423 242.642 1.00 83.39  ? 69   HIS B CA  1 
ATOM   9061  C C   . HIS B  1 100  ? 152.649 241.139 241.729 1.00 83.39  ? 69   HIS B C   1 
ATOM   9062  O O   . HIS B  1 100  ? 151.966 240.120 241.876 1.00 83.39  ? 69   HIS B O   1 
ATOM   9063  C CB  . HIS B  1 100  ? 153.634 242.738 243.391 1.00 83.39  ? 69   HIS B CB  1 
ATOM   9064  C CG  . HIS B  1 100  ? 152.244 242.922 243.916 1.00 83.39  ? 69   HIS B CG  1 
ATOM   9065  N ND1 . HIS B  1 100  ? 151.731 242.158 244.941 1.00 83.39  ? 69   HIS B ND1 1 
ATOM   9066  C CD2 . HIS B  1 100  ? 151.268 243.795 243.573 1.00 83.39  ? 69   HIS B CD2 1 
ATOM   9067  C CE1 . HIS B  1 100  ? 150.494 242.542 245.199 1.00 83.39  ? 69   HIS B CE1 1 
ATOM   9068  N NE2 . HIS B  1 100  ? 150.190 243.535 244.384 1.00 83.39  ? 69   HIS B NE2 1 
ATOM   9069  N N   . VAL B  1 101  ? 152.394 242.033 240.774 1.00 85.44  ? 70   VAL B N   1 
ATOM   9070  C CA  . VAL B  1 101  ? 151.179 242.013 239.948 1.00 85.44  ? 70   VAL B CA  1 
ATOM   9071  C C   . VAL B  1 101  ? 149.920 241.817 240.788 1.00 85.44  ? 70   VAL B C   1 
ATOM   9072  O O   . VAL B  1 101  ? 148.914 242.502 240.590 1.00 85.44  ? 70   VAL B O   1 
ATOM   9073  C CB  . VAL B  1 101  ? 151.268 240.940 238.846 1.00 85.44  ? 70   VAL B CB  1 
ATOM   9074  C CG1 . VAL B  1 101  ? 149.890 240.630 238.293 1.00 85.44  ? 70   VAL B CG1 1 
ATOM   9075  C CG2 . VAL B  1 101  ? 152.170 241.418 237.731 1.00 85.44  ? 70   VAL B CG2 1 
ATOM   9076  N N   . THR B  1 107  ? 150.235 237.452 242.028 1.00 84.08  ? 76   THR B N   1 
ATOM   9077  C CA  . THR B  1 107  ? 150.965 236.194 242.105 1.00 84.08  ? 76   THR B CA  1 
ATOM   9078  C C   . THR B  1 107  ? 152.004 236.230 243.234 1.00 84.08  ? 76   THR B C   1 
ATOM   9079  O O   . THR B  1 107  ? 152.320 235.204 243.833 1.00 84.08  ? 76   THR B O   1 
ATOM   9080  C CB  . THR B  1 107  ? 151.647 235.883 240.764 1.00 84.08  ? 76   THR B CB  1 
ATOM   9081  O OG1 . THR B  1 107  ? 152.513 236.964 240.405 1.00 84.08  ? 76   THR B OG1 1 
ATOM   9082  C CG2 . THR B  1 107  ? 150.605 235.717 239.677 1.00 84.08  ? 76   THR B CG2 1 
ATOM   9083  N N   . LYS B  1 108  ? 152.544 237.425 243.474 1.00 83.28  ? 77   LYS B N   1 
ATOM   9084  C CA  . LYS B  1 108  ? 153.573 237.731 244.466 1.00 83.28  ? 77   LYS B CA  1 
ATOM   9085  C C   . LYS B  1 108  ? 154.928 237.155 244.060 1.00 83.28  ? 77   LYS B C   1 
ATOM   9086  O O   . LYS B  1 108  ? 155.881 237.905 243.827 1.00 83.28  ? 77   LYS B O   1 
ATOM   9087  C CB  . LYS B  1 108  ? 153.155 237.201 245.841 1.00 83.28  ? 77   LYS B CB  1 
ATOM   9088  C CG  . LYS B  1 108  ? 151.754 237.622 246.273 1.00 83.28  ? 77   LYS B CG  1 
ATOM   9089  C CD  . LYS B  1 108  ? 151.535 239.113 246.170 1.00 83.28  ? 77   LYS B CD  1 
ATOM   9090  C CE  . LYS B  1 108  ? 152.363 239.856 247.196 1.00 83.28  ? 77   LYS B CE  1 
ATOM   9091  N NZ  . LYS B  1 108  ? 152.019 239.398 248.570 1.00 83.28  ? 77   LYS B NZ  1 
ATOM   9092  N N   . ARG B  1 109  ? 155.020 235.827 243.976 1.00 78.70  ? 78   ARG B N   1 
ATOM   9093  C CA  . ARG B  1 109  ? 156.191 235.127 243.437 1.00 78.70  ? 78   ARG B CA  1 
ATOM   9094  C C   . ARG B  1 109  ? 157.512 235.607 244.053 1.00 78.70  ? 78   ARG B C   1 
ATOM   9095  O O   . ARG B  1 109  ? 158.510 235.793 243.357 1.00 78.70  ? 78   ARG B O   1 
ATOM   9096  C CB  . ARG B  1 109  ? 156.215 235.234 241.913 1.00 78.70  ? 78   ARG B CB  1 
ATOM   9097  C CG  . ARG B  1 109  ? 156.981 234.116 241.253 1.00 78.70  ? 78   ARG B CG  1 
ATOM   9098  C CD  . ARG B  1 109  ? 156.491 232.778 241.767 1.00 78.70  ? 78   ARG B CD  1 
ATOM   9099  N NE  . ARG B  1 109  ? 157.357 231.682 241.351 1.00 78.70  ? 78   ARG B NE  1 
ATOM   9100  C CZ  . ARG B  1 109  ? 157.464 230.532 242.005 1.00 78.70  ? 78   ARG B CZ  1 
ATOM   9101  N NH1 . ARG B  1 109  ? 156.762 230.332 243.114 1.00 78.70  ? 78   ARG B NH1 1 
ATOM   9102  N NH2 . ARG B  1 109  ? 158.278 229.585 241.559 1.00 78.70  ? 78   ARG B NH2 1 
ATOM   9103  N N   . PHE B  1 110  ? 157.525 235.816 245.368 1.00 70.46  ? 79   PHE B N   1 
ATOM   9104  C CA  . PHE B  1 110  ? 158.737 236.210 246.096 1.00 70.46  ? 79   PHE B CA  1 
ATOM   9105  C C   . PHE B  1 110  ? 159.728 235.050 246.228 1.00 70.46  ? 79   PHE B C   1 
ATOM   9106  O O   . PHE B  1 110  ? 159.865 234.428 247.282 1.00 70.46  ? 79   PHE B O   1 
ATOM   9107  C CB  . PHE B  1 110  ? 158.344 236.761 247.460 1.00 70.46  ? 79   PHE B CB  1 
ATOM   9108  C CG  . PHE B  1 110  ? 159.384 237.629 248.089 1.00 70.46  ? 79   PHE B CG  1 
ATOM   9109  C CD1 . PHE B  1 110  ? 159.564 238.931 247.663 1.00 70.46  ? 79   PHE B CD1 1 
ATOM   9110  C CD2 . PHE B  1 110  ? 160.163 237.154 249.126 1.00 70.46  ? 79   PHE B CD2 1 
ATOM   9111  C CE1 . PHE B  1 110  ? 160.517 239.734 248.243 1.00 70.46  ? 79   PHE B CE1 1 
ATOM   9112  C CE2 . PHE B  1 110  ? 161.115 237.953 249.710 1.00 70.46  ? 79   PHE B CE2 1 
ATOM   9113  C CZ  . PHE B  1 110  ? 161.294 239.243 249.266 1.00 70.46  ? 79   PHE B CZ  1 
ATOM   9114  N N   . ASP B  1 111  ? 160.435 234.754 245.136 1.00 65.43  ? 80   ASP B N   1 
ATOM   9115  C CA  . ASP B  1 111  ? 161.338 233.602 245.097 1.00 65.43  ? 80   ASP B CA  1 
ATOM   9116  C C   . ASP B  1 111  ? 162.596 233.814 245.939 1.00 65.43  ? 80   ASP B C   1 
ATOM   9117  O O   . ASP B  1 111  ? 163.300 234.813 245.777 1.00 65.43  ? 80   ASP B O   1 
ATOM   9118  C CB  . ASP B  1 111  ? 161.740 233.287 243.659 1.00 65.43  ? 80   ASP B CB  1 
ATOM   9119  C CG  . ASP B  1 111  ? 160.576 232.829 242.817 1.00 65.43  ? 80   ASP B CG  1 
ATOM   9120  O OD1 . ASP B  1 111  ? 159.488 232.608 243.381 1.00 65.43  ? 80   ASP B OD1 1 
ATOM   9121  O OD2 . ASP B  1 111  ? 160.748 232.682 241.592 1.00 65.43  ? 80   ASP B OD2 1 
ATOM   9122  N N   . ASN B  1 112  ? 162.892 232.854 246.830 1.00 56.63  ? 81   ASN B N   1 
ATOM   9123  C CA  . ASN B  1 112  ? 164.184 232.776 247.513 1.00 56.63  ? 81   ASN B CA  1 
ATOM   9124  C C   . ASN B  1 112  ? 164.519 231.337 247.906 1.00 56.63  ? 81   ASN B C   1 
ATOM   9125  O O   . ASN B  1 112  ? 164.675 231.044 249.097 1.00 56.63  ? 81   ASN B O   1 
ATOM   9126  C CB  . ASN B  1 112  ? 164.217 233.682 248.748 1.00 56.63  ? 81   ASN B CB  1 
ATOM   9127  C CG  . ASN B  1 112  ? 163.056 233.445 249.691 1.00 56.63  ? 81   ASN B CG  1 
ATOM   9128  O OD1 . ASN B  1 112  ? 162.318 232.474 249.561 1.00 56.63  ? 81   ASN B OD1 1 
ATOM   9129  N ND2 . ASN B  1 112  ? 162.903 234.329 250.665 1.00 56.63  ? 81   ASN B ND2 1 
ATOM   9130  N N   . PRO B  1 113  ? 164.657 230.420 246.951 1.00 47.63  ? 82   PRO B N   1 
ATOM   9131  C CA  . PRO B  1 113  ? 164.994 229.034 247.294 1.00 47.63  ? 82   PRO B CA  1 
ATOM   9132  C C   . PRO B  1 113  ? 166.426 228.889 247.787 1.00 47.63  ? 82   PRO B C   1 
ATOM   9133  O O   . PRO B  1 113  ? 167.290 229.729 247.539 1.00 47.63  ? 82   PRO B O   1 
ATOM   9134  C CB  . PRO B  1 113  ? 164.805 228.289 245.969 1.00 47.63  ? 82   PRO B CB  1 
ATOM   9135  C CG  . PRO B  1 113  ? 164.097 229.247 245.064 1.00 47.63  ? 82   PRO B CG  1 
ATOM   9136  C CD  . PRO B  1 113  ? 164.536 230.592 245.497 1.00 47.63  ? 82   PRO B CD  1 
ATOM   9137  N N   . VAL B  1 114  ? 166.665 227.794 248.505 1.00 39.97  ? 83   VAL B N   1 
ATOM   9138  C CA  . VAL B  1 114  ? 168.025 227.362 248.815 1.00 39.97  ? 83   VAL B CA  1 
ATOM   9139  C C   . VAL B  1 114  ? 168.572 226.592 247.620 1.00 39.97  ? 83   VAL B C   1 
ATOM   9140  O O   . VAL B  1 114  ? 167.974 225.605 247.183 1.00 39.97  ? 83   VAL B O   1 
ATOM   9141  C CB  . VAL B  1 114  ? 168.055 226.496 250.081 1.00 39.97  ? 83   VAL B CB  1 
ATOM   9142  C CG1 . VAL B  1 114  ? 169.436 225.919 250.289 1.00 39.97  ? 83   VAL B CG1 1 
ATOM   9143  C CG2 . VAL B  1 114  ? 167.629 227.294 251.280 1.00 39.97  ? 83   VAL B CG2 1 
ATOM   9144  N N   . LEU B  1 115  ? 169.714 227.026 247.100 1.00 38.50  ? 84   LEU B N   1 
ATOM   9145  C CA  . LEU B  1 115  ? 170.280 226.443 245.898 1.00 38.50  ? 84   LEU B CA  1 
ATOM   9146  C C   . LEU B  1 115  ? 171.603 225.745 246.180 1.00 38.50  ? 84   LEU B C   1 
ATOM   9147  O O   . LEU B  1 115  ? 172.291 226.063 247.156 1.00 38.50  ? 84   LEU B O   1 
ATOM   9148  C CB  . LEU B  1 115  ? 170.482 227.537 244.843 1.00 38.50  ? 84   LEU B CB  1 
ATOM   9149  C CG  . LEU B  1 115  ? 169.277 228.458 244.668 1.00 38.50  ? 84   LEU B CG  1 
ATOM   9150  C CD1 . LEU B  1 115  ? 169.586 229.605 243.741 1.00 38.50  ? 84   LEU B CD1 1 
ATOM   9151  C CD2 . LEU B  1 115  ? 168.127 227.649 244.119 1.00 38.50  ? 84   LEU B CD2 1 
ATOM   9152  N N   . PRO B  1 116  ? 171.986 224.781 245.345 1.00 37.18  ? 85   PRO B N   1 
ATOM   9153  C CA  . PRO B  1 116  ? 173.320 224.179 245.455 1.00 37.18  ? 85   PRO B CA  1 
ATOM   9154  C C   . PRO B  1 116  ? 174.428 225.156 245.089 1.00 37.18  ? 85   PRO B C   1 
ATOM   9155  O O   . PRO B  1 116  ? 174.221 226.151 244.397 1.00 37.18  ? 85   PRO B O   1 
ATOM   9156  C CB  . PRO B  1 116  ? 173.271 223.010 244.466 1.00 37.18  ? 85   PRO B CB  1 
ATOM   9157  C CG  . PRO B  1 116  ? 171.850 222.814 244.144 1.00 37.18  ? 85   PRO B CG  1 
ATOM   9158  C CD  . PRO B  1 116  ? 171.159 224.108 244.334 1.00 37.18  ? 85   PRO B CD  1 
ATOM   9159  N N   . PHE B  1 117  ? 175.627 224.858 245.587 1.00 36.52  ? 86   PHE B N   1 
ATOM   9160  C CA  . PHE B  1 117  ? 176.845 225.601 245.262 1.00 36.52  ? 86   PHE B CA  1 
ATOM   9161  C C   . PHE B  1 117  ? 177.866 224.561 244.815 1.00 36.52  ? 86   PHE B C   1 
ATOM   9162  O O   . PHE B  1 117  ? 178.657 224.079 245.627 1.00 36.52  ? 86   PHE B O   1 
ATOM   9163  C CB  . PHE B  1 117  ? 177.323 226.400 246.475 1.00 36.52  ? 86   PHE B CB  1 
ATOM   9164  C CG  . PHE B  1 117  ? 178.476 227.321 246.200 1.00 36.52  ? 86   PHE B CG  1 
ATOM   9165  C CD1 . PHE B  1 117  ? 178.263 228.676 246.051 1.00 36.52  ? 86   PHE B CD1 1 
ATOM   9166  C CD2 . PHE B  1 117  ? 179.772 226.847 246.128 1.00 36.52  ? 86   PHE B CD2 1 
ATOM   9167  C CE1 . PHE B  1 117  ? 179.308 229.524 245.811 1.00 36.52  ? 86   PHE B CE1 1 
ATOM   9168  C CE2 . PHE B  1 117  ? 180.821 227.702 245.886 1.00 36.52  ? 86   PHE B CE2 1 
ATOM   9169  C CZ  . PHE B  1 117  ? 180.587 229.035 245.735 1.00 36.52  ? 86   PHE B CZ  1 
ATOM   9170  N N   . ASN B  1 118  ? 177.858 224.198 243.534 1.00 41.15  ? 87   ASN B N   1 
ATOM   9171  C CA  . ASN B  1 118  ? 178.580 222.993 243.125 1.00 41.15  ? 87   ASN B CA  1 
ATOM   9172  C C   . ASN B  1 118  ? 180.088 223.227 243.060 1.00 41.15  ? 87   ASN B C   1 
ATOM   9173  O O   . ASN B  1 118  ? 180.846 222.668 243.857 1.00 41.15  ? 87   ASN B O   1 
ATOM   9174  C CB  . ASN B  1 118  ? 178.045 222.495 241.779 1.00 41.15  ? 87   ASN B CB  1 
ATOM   9175  C CG  . ASN B  1 118  ? 176.659 221.914 241.884 1.00 41.15  ? 87   ASN B CG  1 
ATOM   9176  O OD1 . ASN B  1 118  ? 175.728 222.376 241.234 1.00 41.15  ? 87   ASN B OD1 1 
ATOM   9177  N ND2 . ASN B  1 118  ? 176.516 220.882 242.695 1.00 41.15  ? 87   ASN B ND2 1 
ATOM   9178  N N   . ASP B  1 119  ? 180.542 224.063 242.119 1.00 43.12  ? 88   ASP B N   1 
ATOM   9179  C CA  . ASP B  1 119  ? 181.954 224.411 242.012 1.00 43.12  ? 88   ASP B CA  1 
ATOM   9180  C C   . ASP B  1 119  ? 182.169 225.911 241.883 1.00 43.12  ? 88   ASP B C   1 
ATOM   9181  O O   . ASP B  1 119  ? 183.248 226.341 241.474 1.00 43.12  ? 88   ASP B O   1 
ATOM   9182  C CB  . ASP B  1 119  ? 182.602 223.705 240.822 1.00 43.12  ? 88   ASP B CB  1 
ATOM   9183  C CG  . ASP B  1 119  ? 182.826 222.238 241.071 1.00 43.12  ? 88   ASP B CG  1 
ATOM   9184  O OD1 . ASP B  1 119  ? 182.992 221.860 242.247 1.00 43.12  ? 88   ASP B OD1 1 
ATOM   9185  O OD2 . ASP B  1 119  ? 182.842 221.464 240.090 1.00 43.12  ? 88   ASP B OD2 1 
ATOM   9186  N N   . GLY B  1 120  ? 181.180 226.714 242.233 1.00 35.40  ? 89   GLY B N   1 
ATOM   9187  C CA  . GLY B  1 120  ? 181.256 228.149 242.041 1.00 35.40  ? 89   GLY B CA  1 
ATOM   9188  C C   . GLY B  1 120  ? 180.044 228.563 241.242 1.00 35.40  ? 89   GLY B C   1 
ATOM   9189  O O   . GLY B  1 120  ? 179.480 227.781 240.475 1.00 35.40  ? 89   GLY B O   1 
ATOM   9190  N N   . VAL B  1 121  ? 179.625 229.807 241.434 1.00 32.38  ? 90   VAL B N   1 
ATOM   9191  C CA  . VAL B  1 121  ? 178.338 230.270 240.934 1.00 32.38  ? 90   VAL B CA  1 
ATOM   9192  C C   . VAL B  1 121  ? 178.523 231.537 240.114 1.00 32.38  ? 90   VAL B C   1 
ATOM   9193  O O   . VAL B  1 121  ? 179.286 232.428 240.500 1.00 32.38  ? 90   VAL B O   1 
ATOM   9194  C CB  . VAL B  1 121  ? 177.348 230.505 242.093 1.00 32.38  ? 90   VAL B CB  1 
ATOM   9195  C CG1 . VAL B  1 121  ? 176.131 231.256 241.623 1.00 32.38  ? 90   VAL B CG1 1 
ATOM   9196  C CG2 . VAL B  1 121  ? 176.932 229.184 242.685 1.00 32.38  ? 90   VAL B CG2 1 
ATOM   9197  N N   . TYR B  1 122  ? 177.853 231.601 238.966 1.00 35.68  ? 91   TYR B N   1 
ATOM   9198  C CA  . TYR B  1 122  ? 177.640 232.851 238.248 1.00 35.68  ? 91   TYR B CA  1 
ATOM   9199  C C   . TYR B  1 122  ? 176.263 233.375 238.622 1.00 35.68  ? 91   TYR B C   1 
ATOM   9200  O O   . TYR B  1 122  ? 175.258 232.685 238.410 1.00 35.68  ? 91   TYR B O   1 
ATOM   9201  C CB  . TYR B  1 122  ? 177.751 232.661 236.737 1.00 35.68  ? 91   TYR B CB  1 
ATOM   9202  C CG  . TYR B  1 122  ? 177.306 233.874 235.957 1.00 35.68  ? 91   TYR B CG  1 
ATOM   9203  C CD1 . TYR B  1 122  ? 178.170 234.925 235.703 1.00 35.68  ? 91   TYR B CD1 1 
ATOM   9204  C CD2 . TYR B  1 122  ? 176.013 233.963 235.466 1.00 35.68  ? 91   TYR B CD2 1 
ATOM   9205  C CE1 . TYR B  1 122  ? 177.754 236.030 235.002 1.00 35.68  ? 91   TYR B CE1 1 
ATOM   9206  C CE2 . TYR B  1 122  ? 175.593 235.062 234.761 1.00 35.68  ? 91   TYR B CE2 1 
ATOM   9207  C CZ  . TYR B  1 122  ? 176.466 236.090 234.532 1.00 35.68  ? 91   TYR B CZ  1 
ATOM   9208  O OH  . TYR B  1 122  ? 176.044 237.182 233.824 1.00 35.68  ? 91   TYR B OH  1 
ATOM   9209  N N   . PHE B  1 123  ? 176.215 234.585 239.170 1.00 35.47  ? 92   PHE B N   1 
ATOM   9210  C CA  . PHE B  1 123  ? 174.977 235.196 239.633 1.00 35.47  ? 92   PHE B CA  1 
ATOM   9211  C C   . PHE B  1 123  ? 174.773 236.517 238.910 1.00 35.47  ? 92   PHE B C   1 
ATOM   9212  O O   . PHE B  1 123  ? 175.610 237.413 239.016 1.00 35.47  ? 92   PHE B O   1 
ATOM   9213  C CB  . PHE B  1 123  ? 175.022 235.413 241.145 1.00 35.47  ? 92   PHE B CB  1 
ATOM   9214  C CG  . PHE B  1 123  ? 173.757 235.961 241.724 1.00 35.47  ? 92   PHE B CG  1 
ATOM   9215  C CD1 . PHE B  1 123  ? 173.528 237.318 241.773 1.00 35.47  ? 92   PHE B CD1 1 
ATOM   9216  C CD2 . PHE B  1 123  ? 172.803 235.112 242.241 1.00 35.47  ? 92   PHE B CD2 1 
ATOM   9217  C CE1 . PHE B  1 123  ? 172.368 237.813 242.315 1.00 35.47  ? 92   PHE B CE1 1 
ATOM   9218  C CE2 . PHE B  1 123  ? 171.646 235.602 242.775 1.00 35.47  ? 92   PHE B CE2 1 
ATOM   9219  C CZ  . PHE B  1 123  ? 171.427 236.956 242.812 1.00 35.47  ? 92   PHE B CZ  1 
ATOM   9220  N N   . ALA B  1 124  ? 173.667 236.646 238.188 1.00 39.72  ? 93   ALA B N   1 
ATOM   9221  C CA  . ALA B  1 124  ? 173.355 237.891 237.500 1.00 39.72  ? 93   ALA B CA  1 
ATOM   9222  C C   . ALA B  1 124  ? 172.074 238.470 238.075 1.00 39.72  ? 93   ALA B C   1 
ATOM   9223  O O   . ALA B  1 124  ? 171.167 237.731 238.456 1.00 39.72  ? 93   ALA B O   1 
ATOM   9224  C CB  . ALA B  1 124  ? 173.210 237.684 235.995 1.00 39.72  ? 93   ALA B CB  1 
ATOM   9225  N N   . SER B  1 125  ? 171.990 239.796 238.117 1.00 45.23  ? 94   SER B N   1 
ATOM   9226  C CA  . SER B  1 125  ? 170.849 240.463 238.734 1.00 45.23  ? 94   SER B CA  1 
ATOM   9227  C C   . SER B  1 125  ? 170.424 241.663 237.907 1.00 45.23  ? 94   SER B C   1 
ATOM   9228  O O   . SER B  1 125  ? 171.224 242.573 237.680 1.00 45.23  ? 94   SER B O   1 
ATOM   9229  C CB  . SER B  1 125  ? 171.187 240.910 240.156 1.00 45.23  ? 94   SER B CB  1 
ATOM   9230  O OG  . SER B  1 125  ? 170.102 241.606 240.733 1.00 45.23  ? 94   SER B OG  1 
ATOM   9231  N N   . THR B  1 126  ? 169.171 241.653 237.452 1.00 53.29  ? 95   THR B N   1 
ATOM   9232  C CA  . THR B  1 126  ? 168.564 242.787 236.765 1.00 53.29  ? 95   THR B CA  1 
ATOM   9233  C C   . THR B  1 126  ? 167.629 243.502 237.733 1.00 53.29  ? 95   THR B C   1 
ATOM   9234  O O   . THR B  1 126  ? 166.636 242.916 238.200 1.00 53.29  ? 95   THR B O   1 
ATOM   9235  C CB  . THR B  1 126  ? 167.808 242.355 235.510 1.00 53.29  ? 95   THR B CB  1 
ATOM   9236  O OG1 . THR B  1 126  ? 166.819 241.380 235.857 1.00 53.29  ? 95   THR B OG1 1 
ATOM   9237  C CG2 . THR B  1 126  ? 168.763 241.767 234.488 1.00 53.29  ? 95   THR B CG2 1 
ATOM   9238  N N   . GLU B  1 127  ? 167.960 244.756 238.044 1.00 61.42  ? 96   GLU B N   1 
ATOM   9239  C CA  . GLU B  1 127  ? 167.278 245.513 239.082 1.00 61.42  ? 96   GLU B CA  1 
ATOM   9240  C C   . GLU B  1 127  ? 167.055 246.953 238.655 1.00 61.42  ? 96   GLU B C   1 
ATOM   9241  O O   . GLU B  1 127  ? 167.717 247.478 237.757 1.00 61.42  ? 96   GLU B O   1 
ATOM   9242  C CB  . GLU B  1 127  ? 168.075 245.548 240.386 1.00 61.42  ? 96   GLU B CB  1 
ATOM   9243  C CG  . GLU B  1 127  ? 167.801 244.450 241.364 1.00 61.42  ? 96   GLU B CG  1 
ATOM   9244  C CD  . GLU B  1 127  ? 168.613 244.637 242.617 1.00 61.42  ? 96   GLU B CD  1 
ATOM   9245  O OE1 . GLU B  1 127  ? 169.564 245.442 242.585 1.00 61.42  ? 96   GLU B OE1 1 
ATOM   9246  O OE2 . GLU B  1 127  ? 168.285 244.018 243.645 1.00 61.42  ? 96   GLU B OE2 1 
ATOM   9247  N N   . LYS B  1 128  ? 166.105 247.585 239.343 1.00 70.02  ? 97   LYS B N   1 
ATOM   9248  C CA  . LYS B  1 128  ? 165.917 249.027 239.323 1.00 70.02  ? 97   LYS B CA  1 
ATOM   9249  C C   . LYS B  1 128  ? 165.661 249.623 240.700 1.00 70.02  ? 97   LYS B C   1 
ATOM   9250  O O   . LYS B  1 128  ? 165.611 250.850 240.808 1.00 70.02  ? 97   LYS B O   1 
ATOM   9251  C CB  . LYS B  1 128  ? 164.760 249.403 238.389 1.00 70.02  ? 97   LYS B CB  1 
ATOM   9252  C CG  . LYS B  1 128  ? 163.423 248.803 238.785 1.00 70.02  ? 97   LYS B CG  1 
ATOM   9253  C CD  . LYS B  1 128  ? 162.402 248.981 237.685 1.00 70.02  ? 97   LYS B CD  1 
ATOM   9254  C CE  . LYS B  1 128  ? 161.107 248.255 237.994 1.00 70.02  ? 97   LYS B CE  1 
ATOM   9255  N NZ  . LYS B  1 128  ? 160.340 248.906 239.080 1.00 70.02  ? 97   LYS B NZ  1 
ATOM   9256  N N   . SER B  1 129  ? 165.507 248.808 241.758 1.00 68.79  ? 98   SER B N   1 
ATOM   9257  C CA  . SER B  1 129  ? 165.112 249.320 243.066 1.00 68.79  ? 98   SER B CA  1 
ATOM   9258  C C   . SER B  1 129  ? 165.856 248.665 244.229 1.00 68.79  ? 98   SER B C   1 
ATOM   9259  O O   . SER B  1 129  ? 165.368 248.723 245.363 1.00 68.79  ? 98   SER B O   1 
ATOM   9260  C CB  . SER B  1 129  ? 163.612 249.129 243.291 1.00 68.79  ? 98   SER B CB  1 
ATOM   9261  O OG  . SER B  1 129  ? 162.855 249.858 242.350 1.00 68.79  ? 98   SER B OG  1 
ATOM   9262  N N   . ASN B  1 130  ? 167.019 248.054 243.987 1.00 62.31  ? 99   ASN B N   1 
ATOM   9263  C CA  . ASN B  1 130  ? 167.864 247.504 245.052 1.00 62.31  ? 99   ASN B CA  1 
ATOM   9264  C C   . ASN B  1 130  ? 167.123 246.456 245.884 1.00 62.31  ? 99   ASN B C   1 
ATOM   9265  O O   . ASN B  1 130  ? 167.119 246.501 247.114 1.00 62.31  ? 99   ASN B O   1 
ATOM   9266  C CB  . ASN B  1 130  ? 168.403 248.621 245.950 1.00 62.31  ? 99   ASN B CB  1 
ATOM   9267  C CG  . ASN B  1 130  ? 169.180 249.664 245.184 1.00 62.31  ? 99   ASN B CG  1 
ATOM   9268  O OD1 . ASN B  1 130  ? 169.733 249.387 244.124 1.00 62.31  ? 99   ASN B OD1 1 
ATOM   9269  N ND2 . ASN B  1 130  ? 169.221 250.875 245.717 1.00 62.31  ? 99   ASN B ND2 1 
ATOM   9270  N N   . ILE B  1 131  ? 166.477 245.511 245.205 1.00 58.52  ? 100  ILE B N   1 
ATOM   9271  C CA  . ILE B  1 131  ? 165.774 244.448 245.919 1.00 58.52  ? 100  ILE B CA  1 
ATOM   9272  C C   . ILE B  1 131  ? 166.736 243.370 246.410 1.00 58.52  ? 100  ILE B C   1 
ATOM   9273  O O   . ILE B  1 131  ? 166.692 242.974 247.579 1.00 58.52  ? 100  ILE B O   1 
ATOM   9274  C CB  . ILE B  1 131  ? 164.662 243.863 245.032 1.00 58.52  ? 100  ILE B CB  1 
ATOM   9275  C CG1 . ILE B  1 131  ? 163.695 244.969 244.636 1.00 58.52  ? 100  ILE B CG1 1 
ATOM   9276  C CG2 . ILE B  1 131  ? 163.920 242.768 245.760 1.00 58.52  ? 100  ILE B CG2 1 
ATOM   9277  C CD1 . ILE B  1 131  ? 163.011 245.605 245.805 1.00 58.52  ? 100  ILE B CD1 1 
ATOM   9278  N N   . ILE B  1 132  ? 167.603 242.863 245.535 1.00 52.11  ? 101  ILE B N   1 
ATOM   9279  C CA  . ILE B  1 132  ? 168.537 241.810 245.931 1.00 52.11  ? 101  ILE B CA  1 
ATOM   9280  C C   . ILE B  1 132  ? 169.600 242.410 246.841 1.00 52.11  ? 101  ILE B C   1 
ATOM   9281  O O   . ILE B  1 132  ? 170.336 243.318 246.439 1.00 52.11  ? 101  ILE B O   1 
ATOM   9282  C CB  . ILE B  1 132  ? 169.173 241.134 244.711 1.00 52.11  ? 101  ILE B CB  1 
ATOM   9283  C CG1 . ILE B  1 132  ? 168.140 240.324 243.925 1.00 52.11  ? 101  ILE B CG1 1 
ATOM   9284  C CG2 . ILE B  1 132  ? 170.292 240.223 245.157 1.00 52.11  ? 101  ILE B CG2 1 
ATOM   9285  C CD1 . ILE B  1 132  ? 167.450 241.075 242.829 1.00 52.11  ? 101  ILE B CD1 1 
ATOM   9286  N N   . ARG B  1 133  ? 169.685 241.907 248.077 1.00 50.45  ? 102  ARG B N   1 
ATOM   9287  C CA  . ARG B  1 133  ? 170.520 242.537 249.089 1.00 50.45  ? 102  ARG B CA  1 
ATOM   9288  C C   . ARG B  1 133  ? 171.737 241.737 249.518 1.00 50.45  ? 102  ARG B C   1 
ATOM   9289  O O   . ARG B  1 133  ? 172.690 242.337 250.016 1.00 50.45  ? 102  ARG B O   1 
ATOM   9290  C CB  . ARG B  1 133  ? 169.700 242.841 250.345 1.00 50.45  ? 102  ARG B CB  1 
ATOM   9291  C CG  . ARG B  1 133  ? 168.716 243.954 250.164 1.00 50.45  ? 102  ARG B CG  1 
ATOM   9292  C CD  . ARG B  1 133  ? 169.379 245.301 250.158 1.00 50.45  ? 102  ARG B CD  1 
ATOM   9293  N NE  . ARG B  1 133  ? 168.371 246.342 250.264 1.00 50.45  ? 102  ARG B NE  1 
ATOM   9294  C CZ  . ARG B  1 133  ? 167.940 246.836 251.416 1.00 50.45  ? 102  ARG B CZ  1 
ATOM   9295  N NH1 . ARG B  1 133  ? 168.441 246.391 252.554 1.00 50.45  ? 102  ARG B NH1 1 
ATOM   9296  N NH2 . ARG B  1 133  ? 167.012 247.775 251.434 1.00 50.45  ? 102  ARG B NH2 1 
ATOM   9297  N N   . GLY B  1 134  ? 171.753 240.420 249.354 1.00 40.57  ? 103  GLY B N   1 
ATOM   9298  C CA  . GLY B  1 134  ? 172.980 239.712 249.676 1.00 40.57  ? 103  GLY B CA  1 
ATOM   9299  C C   . GLY B  1 134  ? 172.804 238.211 249.609 1.00 40.57  ? 103  GLY B C   1 
ATOM   9300  O O   . GLY B  1 134  ? 171.899 237.712 248.946 1.00 40.57  ? 103  GLY B O   1 
ATOM   9301  N N   . TRP B  1 135  ? 173.677 237.500 250.321 1.00 36.76  ? 104  TRP B N   1 
ATOM   9302  C CA  . TRP B  1 135  ? 173.642 236.046 250.282 1.00 36.76  ? 104  TRP B CA  1 
ATOM   9303  C C   . TRP B  1 135  ? 174.089 235.473 251.616 1.00 36.76  ? 104  TRP B C   1 
ATOM   9304  O O   . TRP B  1 135  ? 174.762 236.136 252.415 1.00 36.76  ? 104  TRP B O   1 
ATOM   9305  C CB  . TRP B  1 135  ? 174.536 235.483 249.174 1.00 36.76  ? 104  TRP B CB  1 
ATOM   9306  C CG  . TRP B  1 135  ? 174.338 236.116 247.841 1.00 36.76  ? 104  TRP B CG  1 
ATOM   9307  C CD1 . TRP B  1 135  ? 173.485 235.720 246.863 1.00 36.76  ? 104  TRP B CD1 1 
ATOM   9308  C CD2 . TRP B  1 135  ? 175.012 237.275 247.341 1.00 36.76  ? 104  TRP B CD2 1 
ATOM   9309  N NE1 . TRP B  1 135  ? 173.583 236.558 245.785 1.00 36.76  ? 104  TRP B NE1 1 
ATOM   9310  C CE2 . TRP B  1 135  ? 174.517 237.523 246.055 1.00 36.76  ? 104  TRP B CE2 1 
ATOM   9311  C CE3 . TRP B  1 135  ? 175.988 238.128 247.861 1.00 36.76  ? 104  TRP B CE3 1 
ATOM   9312  C CZ2 . TRP B  1 135  ? 174.960 238.579 245.283 1.00 36.76  ? 104  TRP B CZ2 1 
ATOM   9313  C CZ3 . TRP B  1 135  ? 176.428 239.173 247.092 1.00 36.76  ? 104  TRP B CZ3 1 
ATOM   9314  C CH2 . TRP B  1 135  ? 175.915 239.393 245.819 1.00 36.76  ? 104  TRP B CH2 1 
ATOM   9315  N N   . ILE B  1 136  ? 173.703 234.218 251.840 1.00 36.38  ? 105  ILE B N   1 
ATOM   9316  C CA  . ILE B  1 136  ? 174.246 233.389 252.909 1.00 36.38  ? 105  ILE B CA  1 
ATOM   9317  C C   . ILE B  1 136  ? 174.761 232.088 252.306 1.00 36.38  ? 105  ILE B C   1 
ATOM   9318  O O   . ILE B  1 136  ? 174.077 231.463 251.490 1.00 36.38  ? 105  ILE B O   1 
ATOM   9319  C CB  . ILE B  1 136  ? 173.203 233.117 254.009 1.00 36.38  ? 105  ILE B CB  1 
ATOM   9320  C CG1 . ILE B  1 136  ? 171.941 232.499 253.426 1.00 36.38  ? 105  ILE B CG1 1 
ATOM   9321  C CG2 . ILE B  1 136  ? 172.840 234.398 254.715 1.00 36.38  ? 105  ILE B CG2 1 
ATOM   9322  C CD1 . ILE B  1 136  ? 170.918 232.148 254.454 1.00 36.38  ? 105  ILE B CD1 1 
ATOM   9323  N N   . PHE B  1 137  ? 175.973 231.696 252.690 1.00 34.21  ? 106  PHE B N   1 
ATOM   9324  C CA  . PHE B  1 137  ? 176.625 230.489 252.198 1.00 34.21  ? 106  PHE B CA  1 
ATOM   9325  C C   . PHE B  1 137  ? 176.943 229.556 253.358 1.00 34.21  ? 106  PHE B C   1 
ATOM   9326  O O   . PHE B  1 137  ? 177.342 230.010 254.432 1.00 34.21  ? 106  PHE B O   1 
ATOM   9327  C CB  . PHE B  1 137  ? 177.926 230.817 251.442 1.00 34.21  ? 106  PHE B CB  1 
ATOM   9328  C CG  . PHE B  1 137  ? 177.777 231.871 250.384 1.00 34.21  ? 106  PHE B CG  1 
ATOM   9329  C CD1 . PHE B  1 137  ? 177.851 233.210 250.704 1.00 34.21  ? 106  PHE B CD1 1 
ATOM   9330  C CD2 . PHE B  1 137  ? 177.588 231.521 249.065 1.00 34.21  ? 106  PHE B CD2 1 
ATOM   9331  C CE1 . PHE B  1 137  ? 177.716 234.170 249.737 1.00 34.21  ? 106  PHE B CE1 1 
ATOM   9332  C CE2 . PHE B  1 137  ? 177.450 232.481 248.097 1.00 34.21  ? 106  PHE B CE2 1 
ATOM   9333  C CZ  . PHE B  1 137  ? 177.521 233.807 248.435 1.00 34.21  ? 106  PHE B CZ  1 
ATOM   9334  N N   . GLY B  1 138  ? 176.771 228.256 253.160 1.00 38.31  ? 107  GLY B N   1 
ATOM   9335  C CA  . GLY B  1 138  ? 177.045 227.333 254.245 1.00 38.31  ? 107  GLY B CA  1 
ATOM   9336  C C   . GLY B  1 138  ? 176.858 225.891 253.842 1.00 38.31  ? 107  GLY B C   1 
ATOM   9337  O O   . GLY B  1 138  ? 176.823 225.568 252.657 1.00 38.31  ? 107  GLY B O   1 
ATOM   9338  N N   . THR B  1 139  ? 176.756 225.017 254.843 1.00 47.10  ? 108  THR B N   1 
ATOM   9339  C CA  . THR B  1 139  ? 176.414 223.615 254.631 1.00 47.10  ? 108  THR B CA  1 
ATOM   9340  C C   . THR B  1 139  ? 175.050 223.242 255.199 1.00 47.10  ? 108  THR B C   1 
ATOM   9341  O O   . THR B  1 139  ? 174.175 222.795 254.456 1.00 47.10  ? 108  THR B O   1 
ATOM   9342  C CB  . THR B  1 139  ? 177.505 222.723 255.233 1.00 47.10  ? 108  THR B CB  1 
ATOM   9343  O OG1 . THR B  1 139  ? 178.683 222.803 254.426 1.00 47.10  ? 108  THR B OG1 1 
ATOM   9344  C CG2 . THR B  1 139  ? 177.048 221.288 255.270 1.00 47.10  ? 108  THR B CG2 1 
ATOM   9345  N N   . THR B  1 140  ? 174.841 223.415 256.505 1.00 52.43  ? 109  THR B N   1 
ATOM   9346  C CA  . THR B  1 140  ? 173.575 223.061 257.133 1.00 52.43  ? 109  THR B CA  1 
ATOM   9347  C C   . THR B  1 140  ? 172.750 224.267 257.541 1.00 52.43  ? 109  THR B C   1 
ATOM   9348  O O   . THR B  1 140  ? 171.527 224.146 257.647 1.00 52.43  ? 109  THR B O   1 
ATOM   9349  C CB  . THR B  1 140  ? 173.807 222.195 258.380 1.00 52.43  ? 109  THR B CB  1 
ATOM   9350  O OG1 . THR B  1 140  ? 174.567 222.933 259.343 1.00 52.43  ? 109  THR B OG1 1 
ATOM   9351  C CG2 . THR B  1 140  ? 174.551 220.927 258.024 1.00 52.43  ? 109  THR B CG2 1 
ATOM   9352  N N   . LEU B  1 141  ? 173.388 225.415 257.762 1.00 52.17  ? 110  LEU B N   1 
ATOM   9353  C CA  . LEU B  1 141  ? 172.708 226.667 258.080 1.00 52.17  ? 110  LEU B CA  1 
ATOM   9354  C C   . LEU B  1 141  ? 171.869 226.560 259.353 1.00 52.17  ? 110  LEU B C   1 
ATOM   9355  O O   . LEU B  1 141  ? 170.781 227.130 259.439 1.00 52.17  ? 110  LEU B O   1 
ATOM   9356  C CB  . LEU B  1 141  ? 171.841 227.117 256.899 1.00 52.17  ? 110  LEU B CB  1 
ATOM   9357  C CG  . LEU B  1 141  ? 172.483 227.131 255.504 1.00 52.17  ? 110  LEU B CG  1 
ATOM   9358  C CD1 . LEU B  1 141  ? 171.423 227.173 254.425 1.00 52.17  ? 110  LEU B CD1 1 
ATOM   9359  C CD2 . LEU B  1 141  ? 173.426 228.300 255.331 1.00 52.17  ? 110  LEU B CD2 1 
ATOM   9360  N N   . ASP B  1 142  ? 172.367 225.822 260.357 1.00 57.03  ? 111  ASP B N   1 
ATOM   9361  C CA  . ASP B  1 142  ? 171.556 225.600 261.553 1.00 57.03  ? 111  ASP B CA  1 
ATOM   9362  C C   . ASP B  1 142  ? 172.370 225.625 262.846 1.00 57.03  ? 111  ASP B C   1 
ATOM   9363  O O   . ASP B  1 142  ? 172.035 224.911 263.797 1.00 57.03  ? 111  ASP B O   1 
ATOM   9364  C CB  . ASP B  1 142  ? 170.785 224.279 261.472 1.00 57.03  ? 111  ASP B CB  1 
ATOM   9365  C CG  . ASP B  1 142  ? 171.692 223.067 261.410 1.00 57.03  ? 111  ASP B CG  1 
ATOM   9366  O OD1 . ASP B  1 142  ? 172.928 223.229 261.365 1.00 57.03  ? 111  ASP B OD1 1 
ATOM   9367  O OD2 . ASP B  1 142  ? 171.160 221.940 261.423 1.00 57.03  ? 111  ASP B OD2 1 
ATOM   9368  N N   . SER B  1 143  ? 173.439 226.415 262.906 1.00 55.27  ? 112  SER B N   1 
ATOM   9369  C CA  . SER B  1 143  ? 174.245 226.657 264.107 1.00 55.27  ? 112  SER B CA  1 
ATOM   9370  C C   . SER B  1 143  ? 175.052 225.448 264.552 1.00 55.27  ? 112  SER B C   1 
ATOM   9371  O O   . SER B  1 143  ? 175.769 225.542 265.549 1.00 55.27  ? 112  SER B O   1 
ATOM   9372  C CB  . SER B  1 143  ? 173.410 227.128 265.304 1.00 55.27  ? 112  SER B CB  1 
ATOM   9373  O OG  . SER B  1 143  ? 172.646 226.065 265.835 1.00 55.27  ? 112  SER B OG  1 
ATOM   9374  N N   . LYS B  1 144  ? 174.953 224.312 263.863 1.00 57.65  ? 113  LYS B N   1 
ATOM   9375  C CA  . LYS B  1 144  ? 175.867 223.210 264.125 1.00 57.65  ? 113  LYS B CA  1 
ATOM   9376  C C   . LYS B  1 144  ? 177.166 223.372 263.356 1.00 57.65  ? 113  LYS B C   1 
ATOM   9377  O O   . LYS B  1 144  ? 178.198 222.838 263.770 1.00 57.65  ? 113  LYS B O   1 
ATOM   9378  C CB  . LYS B  1 144  ? 175.217 221.878 263.755 1.00 57.65  ? 113  LYS B CB  1 
ATOM   9379  C CG  . LYS B  1 144  ? 174.041 221.481 264.617 1.00 57.65  ? 113  LYS B CG  1 
ATOM   9380  C CD  . LYS B  1 144  ? 173.460 220.162 264.142 1.00 57.65  ? 113  LYS B CD  1 
ATOM   9381  C CE  . LYS B  1 144  ? 172.290 219.728 265.000 1.00 57.65  ? 113  LYS B CE  1 
ATOM   9382  N NZ  . LYS B  1 144  ? 171.707 218.447 264.517 1.00 57.65  ? 113  LYS B NZ  1 
ATOM   9383  N N   . THR B  1 145  ? 177.128 224.087 262.239 1.00 53.28  ? 114  THR B N   1 
ATOM   9384  C CA  . THR B  1 145  ? 178.291 224.381 261.421 1.00 53.28  ? 114  THR B CA  1 
ATOM   9385  C C   . THR B  1 145  ? 178.429 225.892 261.270 1.00 53.28  ? 114  THR B C   1 
ATOM   9386  O O   . THR B  1 145  ? 177.600 226.665 261.751 1.00 53.28  ? 114  THR B O   1 
ATOM   9387  C CB  . THR B  1 145  ? 178.182 223.704 260.055 1.00 53.28  ? 114  THR B CB  1 
ATOM   9388  O OG1 . THR B  1 145  ? 176.971 224.118 259.417 1.00 53.28  ? 114  THR B OG1 1 
ATOM   9389  C CG2 . THR B  1 145  ? 178.172 222.199 260.209 1.00 53.28  ? 114  THR B CG2 1 
ATOM   9390  N N   . GLN B  1 146  ? 179.495 226.307 260.595 1.00 48.57  ? 115  GLN B N   1 
ATOM   9391  C CA  . GLN B  1 146  ? 179.807 227.714 260.392 1.00 48.57  ? 115  GLN B CA  1 
ATOM   9392  C C   . GLN B  1 146  ? 179.300 228.187 259.035 1.00 48.57  ? 115  GLN B C   1 
ATOM   9393  O O   . GLN B  1 146  ? 179.340 227.441 258.054 1.00 48.57  ? 115  GLN B O   1 
ATOM   9394  C CB  . GLN B  1 146  ? 181.311 227.938 260.503 1.00 48.57  ? 115  GLN B CB  1 
ATOM   9395  C CG  . GLN B  1 146  ? 181.792 228.054 261.931 1.00 48.57  ? 115  GLN B CG  1 
ATOM   9396  C CD  . GLN B  1 146  ? 183.106 228.764 262.036 1.00 48.57  ? 115  GLN B CD  1 
ATOM   9397  O OE1 . GLN B  1 146  ? 184.115 228.304 261.507 1.00 48.57  ? 115  GLN B OE1 1 
ATOM   9398  N NE2 . GLN B  1 146  ? 183.114 229.890 262.734 1.00 48.57  ? 115  GLN B NE2 1 
ATOM   9399  N N   . SER B  1 147  ? 178.819 229.426 258.988 1.00 44.44  ? 116  SER B N   1 
ATOM   9400  C CA  . SER B  1 147  ? 178.242 230.006 257.786 1.00 44.44  ? 116  SER B CA  1 
ATOM   9401  C C   . SER B  1 147  ? 178.795 231.403 257.549 1.00 44.44  ? 116  SER B C   1 
ATOM   9402  O O   . SER B  1 147  ? 179.268 232.079 258.473 1.00 44.44  ? 116  SER B O   1 
ATOM   9403  C CB  . SER B  1 147  ? 176.717 230.061 257.871 1.00 44.44  ? 116  SER B CB  1 
ATOM   9404  O OG  . SER B  1 147  ? 176.170 228.757 257.864 1.00 44.44  ? 116  SER B OG  1 
ATOM   9405  N N   . LEU B  1 148  ? 178.697 231.828 256.289 1.00 35.12  ? 117  LEU B N   1 
ATOM   9406  C CA  . LEU B  1 148  ? 179.160 233.128 255.825 1.00 35.12  ? 117  LEU B CA  1 
ATOM   9407  C C   . LEU B  1 148  ? 177.966 233.979 255.417 1.00 35.12  ? 117  LEU B C   1 
ATOM   9408  O O   . LEU B  1 148  ? 177.128 233.541 254.625 1.00 35.12  ? 117  LEU B O   1 
ATOM   9409  C CB  . LEU B  1 148  ? 180.112 232.965 254.637 1.00 35.12  ? 117  LEU B CB  1 
ATOM   9410  C CG  . LEU B  1 148  ? 180.524 234.193 253.823 1.00 35.12  ? 117  LEU B CG  1 
ATOM   9411  C CD1 . LEU B  1 148  ? 181.345 235.168 254.635 1.00 35.12  ? 117  LEU B CD1 1 
ATOM   9412  C CD2 . LEU B  1 148  ? 181.278 233.782 252.585 1.00 35.12  ? 117  LEU B CD2 1 
ATOM   9413  N N   . LEU B  1 149  ? 177.901 235.189 255.957 1.00 36.22  ? 118  LEU B N   1 
ATOM   9414  C CA  . LEU B  1 149  ? 176.869 236.171 255.661 1.00 36.22  ? 118  LEU B CA  1 
ATOM   9415  C C   . LEU B  1 149  ? 177.497 237.351 254.937 1.00 36.22  ? 118  LEU B C   1 
ATOM   9416  O O   . LEU B  1 149  ? 178.454 237.944 255.448 1.00 36.22  ? 118  LEU B O   1 
ATOM   9417  C CB  . LEU B  1 149  ? 176.198 236.641 256.948 1.00 36.22  ? 118  LEU B CB  1 
ATOM   9418  C CG  . LEU B  1 149  ? 175.303 237.873 256.886 1.00 36.22  ? 118  LEU B CG  1 
ATOM   9419  C CD1 . LEU B  1 149  ? 174.011 237.568 256.170 1.00 36.22  ? 118  LEU B CD1 1 
ATOM   9420  C CD2 . LEU B  1 149  ? 175.041 238.394 258.274 1.00 36.22  ? 118  LEU B CD2 1 
ATOM   9421  N N   . ILE B  1 150  ? 176.974 237.686 253.755 1.00 37.81  ? 119  ILE B N   1 
ATOM   9422  C CA  . ILE B  1 150  ? 177.363 238.903 253.042 1.00 37.81  ? 119  ILE B CA  1 
ATOM   9423  C C   . ILE B  1 150  ? 176.094 239.702 252.807 1.00 37.81  ? 119  ILE B C   1 
ATOM   9424  O O   . ILE B  1 150  ? 175.266 239.325 251.969 1.00 37.81  ? 119  ILE B O   1 
ATOM   9425  C CB  . ILE B  1 150  ? 178.075 238.618 251.716 1.00 37.81  ? 119  ILE B CB  1 
ATOM   9426  C CG1 . ILE B  1 150  ? 179.311 237.755 251.932 1.00 37.81  ? 119  ILE B CG1 1 
ATOM   9427  C CG2 . ILE B  1 150  ? 178.451 239.910 251.041 1.00 37.81  ? 119  ILE B CG2 1 
ATOM   9428  C CD1 . ILE B  1 150  ? 179.975 237.348 250.661 1.00 37.81  ? 119  ILE B CD1 1 
ATOM   9429  N N   . VAL B  1 151  ? 175.922 240.794 253.548 1.00 44.16  ? 120  VAL B N   1 
ATOM   9430  C CA  . VAL B  1 151  ? 174.675 241.544 253.490 1.00 44.16  ? 120  VAL B CA  1 
ATOM   9431  C C   . VAL B  1 151  ? 174.965 243.020 253.269 1.00 44.16  ? 120  VAL B C   1 
ATOM   9432  O O   . VAL B  1 151  ? 176.012 243.542 253.668 1.00 44.16  ? 120  VAL B O   1 
ATOM   9433  C CB  . VAL B  1 151  ? 173.821 241.336 254.759 1.00 44.16  ? 120  VAL B CB  1 
ATOM   9434  C CG1 . VAL B  1 151  ? 174.432 242.041 255.949 1.00 44.16  ? 120  VAL B CG1 1 
ATOM   9435  C CG2 . VAL B  1 151  ? 172.392 241.788 254.526 1.00 44.16  ? 120  VAL B CG2 1 
ATOM   9436  N N   . ASN B  1 152  ? 174.042 243.687 252.585 1.00 52.56  ? 121  ASN B N   1 
ATOM   9437  C CA  . ASN B  1 152  ? 174.076 245.133 252.407 1.00 52.56  ? 121  ASN B CA  1 
ATOM   9438  C C   . ASN B  1 152  ? 172.848 245.730 253.080 1.00 52.56  ? 121  ASN B C   1 
ATOM   9439  O O   . ASN B  1 152  ? 171.768 245.775 252.489 1.00 52.56  ? 121  ASN B O   1 
ATOM   9440  C CB  . ASN B  1 152  ? 174.108 245.495 250.923 1.00 52.56  ? 121  ASN B CB  1 
ATOM   9441  C CG  . ASN B  1 152  ? 174.264 246.987 250.674 1.00 52.56  ? 121  ASN B CG  1 
ATOM   9442  O OD1 . ASN B  1 152  ? 173.844 247.815 251.473 1.00 52.56  ? 121  ASN B OD1 1 
ATOM   9443  N ND2 . ASN B  1 152  ? 174.869 247.332 249.550 1.00 52.56  ? 121  ASN B ND2 1 
ATOM   9444  N N   . ASN B  1 153  ? 173.012 246.193 254.311 1.00 60.89  ? 122  ASN B N   1 
ATOM   9445  C CA  . ASN B  1 153  ? 171.943 246.918 254.972 1.00 60.89  ? 122  ASN B CA  1 
ATOM   9446  C C   . ASN B  1 153  ? 172.017 248.382 254.542 1.00 60.89  ? 122  ASN B C   1 
ATOM   9447  O O   . ASN B  1 153  ? 173.007 248.823 253.956 1.00 60.89  ? 122  ASN B O   1 
ATOM   9448  C CB  . ASN B  1 153  ? 171.978 246.671 256.491 1.00 60.89  ? 122  ASN B CB  1 
ATOM   9449  C CG  . ASN B  1 153  ? 172.967 247.543 257.254 1.00 60.89  ? 122  ASN B CG  1 
ATOM   9450  O OD1 . ASN B  1 153  ? 173.554 248.486 256.736 1.00 60.89  ? 122  ASN B OD1 1 
ATOM   9451  N ND2 . ASN B  1 153  ? 173.149 247.208 258.527 1.00 60.89  ? 122  ASN B ND2 1 
ATOM   9452  N N   . ALA B  1 154  ? 170.948 249.127 254.801 1.00 65.10  ? 123  ALA B N   1 
ATOM   9453  C CA  . ALA B  1 154  ? 170.841 250.503 254.323 1.00 65.10  ? 123  ALA B CA  1 
ATOM   9454  C C   . ALA B  1 154  ? 172.091 251.362 254.509 1.00 65.10  ? 123  ALA B C   1 
ATOM   9455  O O   . ALA B  1 154  ? 172.300 252.307 253.743 1.00 65.10  ? 123  ALA B O   1 
ATOM   9456  C CB  . ALA B  1 154  ? 169.660 251.197 255.000 1.00 65.10  ? 123  ALA B CB  1 
ATOM   9457  N N   . THR B  1 155  ? 172.937 251.059 255.490 1.00 63.15  ? 124  THR B N   1 
ATOM   9458  C CA  . THR B  1 155  ? 174.073 251.926 255.788 1.00 63.15  ? 124  THR B CA  1 
ATOM   9459  C C   . THR B  1 155  ? 175.434 251.308 255.502 1.00 63.15  ? 124  THR B C   1 
ATOM   9460  O O   . THR B  1 155  ? 176.331 252.017 255.045 1.00 63.15  ? 124  THR B O   1 
ATOM   9461  C CB  . THR B  1 155  ? 174.032 252.369 257.254 1.00 63.15  ? 124  THR B CB  1 
ATOM   9462  O OG1 . THR B  1 155  ? 174.239 251.237 258.105 1.00 63.15  ? 124  THR B OG1 1 
ATOM   9463  C CG2 . THR B  1 155  ? 172.696 253.001 257.582 1.00 63.15  ? 124  THR B CG2 1 
ATOM   9464  N N   . ASN B  1 156  ? 175.632 250.015 255.758 1.00 58.64  ? 125  ASN B N   1 
ATOM   9465  C CA  . ASN B  1 156  ? 176.954 249.407 255.674 1.00 58.64  ? 125  ASN B CA  1 
ATOM   9466  C C   . ASN B  1 156  ? 176.901 248.129 254.850 1.00 58.64  ? 125  ASN B C   1 
ATOM   9467  O O   . ASN B  1 156  ? 175.832 247.599 254.548 1.00 58.64  ? 125  ASN B O   1 
ATOM   9468  C CB  . ASN B  1 156  ? 177.523 249.092 257.064 1.00 58.64  ? 125  ASN B CB  1 
ATOM   9469  C CG  . ASN B  1 156  ? 177.565 250.299 257.968 1.00 58.64  ? 125  ASN B CG  1 
ATOM   9470  O OD1 . ASN B  1 156  ? 176.539 250.743 258.477 1.00 58.64  ? 125  ASN B OD1 1 
ATOM   9471  N ND2 . ASN B  1 156  ? 178.760 250.826 258.192 1.00 58.64  ? 125  ASN B ND2 1 
ATOM   9472  N N   . VAL B  1 157  ? 178.083 247.639 254.486 1.00 51.12  ? 126  VAL B N   1 
ATOM   9473  C CA  . VAL B  1 157  ? 178.272 246.302 253.936 1.00 51.12  ? 126  VAL B CA  1 
ATOM   9474  C C   . VAL B  1 157  ? 178.914 245.445 255.016 1.00 51.12  ? 126  VAL B C   1 
ATOM   9475  O O   . VAL B  1 157  ? 179.966 245.806 255.551 1.00 51.12  ? 126  VAL B O   1 
ATOM   9476  C CB  . VAL B  1 157  ? 179.139 246.331 252.666 1.00 51.12  ? 126  VAL B CB  1 
ATOM   9477  C CG1 . VAL B  1 157  ? 179.335 244.931 252.131 1.00 51.12  ? 126  VAL B CG1 1 
ATOM   9478  C CG2 . VAL B  1 157  ? 178.492 247.199 251.617 1.00 51.12  ? 126  VAL B CG2 1 
ATOM   9479  N N   . VAL B  1 158  ? 178.290 244.315 255.343 1.00 45.58  ? 127  VAL B N   1 
ATOM   9480  C CA  . VAL B  1 158  ? 178.689 243.512 256.492 1.00 45.58  ? 127  VAL B CA  1 
ATOM   9481  C C   . VAL B  1 158  ? 179.020 242.105 256.021 1.00 45.58  ? 127  VAL B C   1 
ATOM   9482  O O   . VAL B  1 158  ? 178.190 241.449 255.376 1.00 45.58  ? 127  VAL B O   1 
ATOM   9483  C CB  . VAL B  1 158  ? 177.591 243.479 257.564 1.00 45.58  ? 127  VAL B CB  1 
ATOM   9484  C CG1 . VAL B  1 158  ? 177.933 242.469 258.632 1.00 45.58  ? 127  VAL B CG1 1 
ATOM   9485  C CG2 . VAL B  1 158  ? 177.400 244.853 258.160 1.00 45.58  ? 127  VAL B CG2 1 
ATOM   9486  N N   . ILE B  1 159  ? 180.230 241.646 256.333 1.00 42.74  ? 128  ILE B N   1 
ATOM   9487  C CA  . ILE B  1 159  ? 180.684 240.302 255.992 1.00 42.74  ? 128  ILE B CA  1 
ATOM   9488  C C   . ILE B  1 159  ? 181.082 239.608 257.286 1.00 42.74  ? 128  ILE B C   1 
ATOM   9489  O O   . ILE B  1 159  ? 182.036 240.027 257.946 1.00 42.74  ? 128  ILE B O   1 
ATOM   9490  C CB  . ILE B  1 159  ? 181.855 240.332 255.001 1.00 42.74  ? 128  ILE B CB  1 
ATOM   9491  C CG1 . ILE B  1 159  ? 181.476 241.150 253.771 1.00 42.74  ? 128  ILE B CG1 1 
ATOM   9492  C CG2 . ILE B  1 159  ? 182.249 238.935 254.605 1.00 42.74  ? 128  ILE B CG2 1 
ATOM   9493  C CD1 . ILE B  1 159  ? 182.527 241.184 252.712 1.00 42.74  ? 128  ILE B CD1 1 
ATOM   9494  N N   . LYS B  1 160  ? 180.371 238.545 257.642 1.00 42.13  ? 129  LYS B N   1 
ATOM   9495  C CA  . LYS B  1 160  ? 180.628 237.848 258.898 1.00 42.13  ? 129  LYS B CA  1 
ATOM   9496  C C   . LYS B  1 160  ? 180.685 236.341 258.703 1.00 42.13  ? 129  LYS B C   1 
ATOM   9497  O O   . LYS B  1 160  ? 179.953 235.785 257.884 1.00 42.13  ? 129  LYS B O   1 
ATOM   9498  C CB  . LYS B  1 160  ? 179.572 238.198 259.941 1.00 42.13  ? 129  LYS B CB  1 
ATOM   9499  C CG  . LYS B  1 160  ? 179.659 239.622 260.425 1.00 42.13  ? 129  LYS B CG  1 
ATOM   9500  C CD  . LYS B  1 160  ? 178.520 239.965 261.360 1.00 42.13  ? 129  LYS B CD  1 
ATOM   9501  C CE  . LYS B  1 160  ? 178.589 239.159 262.638 1.00 42.13  ? 129  LYS B CE  1 
ATOM   9502  N NZ  . LYS B  1 160  ? 177.538 239.586 263.596 1.00 42.13  ? 129  LYS B NZ  1 
ATOM   9503  N N   . VAL B  1 161  ? 181.550 235.675 259.464 1.00 45.11  ? 130  VAL B N   1 
ATOM   9504  C CA  . VAL B  1 161  ? 181.639 234.217 259.464 1.00 45.11  ? 130  VAL B CA  1 
ATOM   9505  C C   . VAL B  1 161  ? 181.404 233.745 260.889 1.00 45.11  ? 130  VAL B C   1 
ATOM   9506  O O   . VAL B  1 161  ? 182.278 233.900 261.749 1.00 45.11  ? 130  VAL B O   1 
ATOM   9507  C CB  . VAL B  1 161  ? 182.993 233.716 258.946 1.00 45.11  ? 130  VAL B CB  1 
ATOM   9508  C CG1 . VAL B  1 161  ? 182.998 232.212 258.853 1.00 45.11  ? 130  VAL B CG1 1 
ATOM   9509  C CG2 . VAL B  1 161  ? 183.302 234.317 257.603 1.00 45.11  ? 130  VAL B CG2 1 
ATOM   9510  N N   . CYS B  1 162  ? 180.222 233.188 261.153 1.00 52.85  ? 131  CYS B N   1 
ATOM   9511  C CA  . CYS B  1 162  ? 179.858 232.808 262.518 1.00 52.85  ? 131  CYS B CA  1 
ATOM   9512  C C   . CYS B  1 162  ? 179.039 231.528 262.480 1.00 52.85  ? 131  CYS B C   1 
ATOM   9513  O O   . CYS B  1 162  ? 178.865 230.916 261.428 1.00 52.85  ? 131  CYS B O   1 
ATOM   9514  C CB  . CYS B  1 162  ? 179.072 233.918 263.233 1.00 52.85  ? 131  CYS B CB  1 
ATOM   9515  S SG  . CYS B  1 162  ? 179.768 235.589 263.147 1.00 52.85  ? 131  CYS B SG  1 
ATOM   9516  N N   . GLU B  1 163  ? 178.544 231.103 263.641 1.00 55.86  ? 132  GLU B N   1 
ATOM   9517  C CA  . GLU B  1 163  ? 177.595 229.990 263.721 1.00 55.86  ? 132  GLU B CA  1 
ATOM   9518  C C   . GLU B  1 163  ? 176.190 230.564 263.869 1.00 55.86  ? 132  GLU B C   1 
ATOM   9519  O O   . GLU B  1 163  ? 175.715 230.813 264.975 1.00 55.86  ? 132  GLU B O   1 
ATOM   9520  C CB  . GLU B  1 163  ? 177.942 229.045 264.865 1.00 55.86  ? 132  GLU B CB  1 
ATOM   9521  C CG  . GLU B  1 163  ? 179.399 228.639 264.908 1.00 55.86  ? 132  GLU B CG  1 
ATOM   9522  C CD  . GLU B  1 163  ? 179.635 227.381 265.719 1.00 55.86  ? 132  GLU B CD  1 
ATOM   9523  O OE1 . GLU B  1 163  ? 179.804 227.485 266.949 1.00 55.86  ? 132  GLU B OE1 1 
ATOM   9524  O OE2 . GLU B  1 163  ? 179.655 226.285 265.127 1.00 55.86  ? 132  GLU B OE2 1 
ATOM   9525  N N   . PHE B  1 164  ? 175.512 230.748 262.738 1.00 52.17  ? 133  PHE B N   1 
ATOM   9526  C CA  . PHE B  1 164  ? 174.206 231.387 262.701 1.00 52.17  ? 133  PHE B CA  1 
ATOM   9527  C C   . PHE B  1 164  ? 173.098 230.348 262.779 1.00 52.17  ? 133  PHE B C   1 
ATOM   9528  O O   . PHE B  1 164  ? 173.195 229.276 262.179 1.00 52.17  ? 133  PHE B O   1 
ATOM   9529  C CB  . PHE B  1 164  ? 174.021 232.203 261.423 1.00 52.17  ? 133  PHE B CB  1 
ATOM   9530  C CG  . PHE B  1 164  ? 174.999 233.325 261.247 1.00 52.17  ? 133  PHE B CG  1 
ATOM   9531  C CD1 . PHE B  1 164  ? 176.091 233.186 260.416 1.00 52.17  ? 133  PHE B CD1 1 
ATOM   9532  C CD2 . PHE B  1 164  ? 174.792 234.539 261.866 1.00 52.17  ? 133  PHE B CD2 1 
ATOM   9533  C CE1 . PHE B  1 164  ? 176.974 234.225 260.237 1.00 52.17  ? 133  PHE B CE1 1 
ATOM   9534  C CE2 . PHE B  1 164  ? 175.673 235.580 261.686 1.00 52.17  ? 133  PHE B CE2 1 
ATOM   9535  C CZ  . PHE B  1 164  ? 176.764 235.422 260.874 1.00 52.17  ? 133  PHE B CZ  1 
ATOM   9536  N N   . GLN B  1 165  ? 172.040 230.674 263.517 1.00 57.94  ? 134  GLN B N   1 
ATOM   9537  C CA  . GLN B  1 165  ? 170.751 229.993 263.393 1.00 57.94  ? 134  GLN B CA  1 
ATOM   9538  C C   . GLN B  1 165  ? 169.892 230.845 262.467 1.00 57.94  ? 134  GLN B C   1 
ATOM   9539  O O   . GLN B  1 165  ? 169.124 231.696 262.912 1.00 57.94  ? 134  GLN B O   1 
ATOM   9540  C CB  . GLN B  1 165  ? 170.090 229.785 264.747 1.00 57.94  ? 134  GLN B CB  1 
ATOM   9541  C CG  . GLN B  1 165  ? 168.820 228.960 264.667 1.00 57.94  ? 134  GLN B CG  1 
ATOM   9542  C CD  . GLN B  1 165  ? 169.090 227.510 264.334 1.00 57.94  ? 134  GLN B CD  1 
ATOM   9543  O OE1 . GLN B  1 165  ? 170.105 226.951 264.735 1.00 57.94  ? 134  GLN B OE1 1 
ATOM   9544  N NE2 . GLN B  1 165  ? 168.180 226.895 263.596 1.00 57.94  ? 134  GLN B NE2 1 
ATOM   9545  N N   . PHE B  1 166  ? 170.031 230.616 261.165 1.00 54.32  ? 135  PHE B N   1 
ATOM   9546  C CA  . PHE B  1 166  ? 169.300 231.408 260.187 1.00 54.32  ? 135  PHE B CA  1 
ATOM   9547  C C   . PHE B  1 166  ? 167.807 231.103 260.237 1.00 54.32  ? 135  PHE B C   1 
ATOM   9548  O O   . PHE B  1 166  ? 167.385 229.995 260.572 1.00 54.32  ? 135  PHE B O   1 
ATOM   9549  C CB  . PHE B  1 166  ? 169.825 231.127 258.782 1.00 54.32  ? 135  PHE B CB  1 
ATOM   9550  C CG  . PHE B  1 166  ? 171.160 231.740 258.496 1.00 54.32  ? 135  PHE B CG  1 
ATOM   9551  C CD1 . PHE B  1 166  ? 172.240 230.940 258.181 1.00 54.32  ? 135  PHE B CD1 1 
ATOM   9552  C CD2 . PHE B  1 166  ? 171.350 233.101 258.578 1.00 54.32  ? 135  PHE B CD2 1 
ATOM   9553  C CE1 . PHE B  1 166  ? 173.471 231.488 257.916 1.00 54.32  ? 135  PHE B CE1 1 
ATOM   9554  C CE2 . PHE B  1 166  ? 172.583 233.655 258.321 1.00 54.32  ? 135  PHE B CE2 1 
ATOM   9555  C CZ  . PHE B  1 166  ? 173.644 232.847 257.989 1.00 54.32  ? 135  PHE B CZ  1 
ATOM   9556  N N   . CYS B  1 167  ? 167.004 232.106 259.890 1.00 70.24  ? 136  CYS B N   1 
ATOM   9557  C CA  . CYS B  1 167  ? 165.573 231.908 259.746 1.00 70.24  ? 136  CYS B CA  1 
ATOM   9558  C C   . CYS B  1 167  ? 165.274 231.036 258.533 1.00 70.24  ? 136  CYS B C   1 
ATOM   9559  O O   . CYS B  1 167  ? 166.064 230.939 257.591 1.00 70.24  ? 136  CYS B O   1 
ATOM   9560  C CB  . CYS B  1 167  ? 164.838 233.240 259.600 1.00 70.24  ? 136  CYS B CB  1 
ATOM   9561  S SG  . CYS B  1 167  ? 164.958 234.396 260.982 1.00 70.24  ? 136  CYS B SG  1 
ATOM   9562  N N   . ASN B  1 168  ? 164.114 230.378 258.576 1.00 75.53  ? 137  ASN B N   1 
ATOM   9563  C CA  . ASN B  1 168  ? 163.673 229.572 257.442 1.00 75.53  ? 137  ASN B CA  1 
ATOM   9564  C C   . ASN B  1 168  ? 163.392 230.433 256.217 1.00 75.53  ? 137  ASN B C   1 
ATOM   9565  O O   . ASN B  1 168  ? 163.570 229.973 255.084 1.00 75.53  ? 137  ASN B O   1 
ATOM   9566  C CB  . ASN B  1 168  ? 162.434 228.766 257.820 1.00 75.53  ? 137  ASN B CB  1 
ATOM   9567  C CG  . ASN B  1 168  ? 162.148 227.652 256.836 1.00 75.53  ? 137  ASN B CG  1 
ATOM   9568  O OD1 . ASN B  1 168  ? 162.965 227.349 255.970 1.00 75.53  ? 137  ASN B OD1 1 
ATOM   9569  N ND2 . ASN B  1 168  ? 160.979 227.040 256.962 1.00 75.53  ? 137  ASN B ND2 1 
ATOM   9570  N N   . ASP B  1 169  ? 162.962 231.679 256.422 1.00 73.83  ? 138  ASP B N   1 
ATOM   9571  C CA  . ASP B  1 169  ? 162.633 232.612 255.344 1.00 73.83  ? 138  ASP B CA  1 
ATOM   9572  C C   . ASP B  1 169  ? 163.266 233.959 255.660 1.00 73.83  ? 138  ASP B C   1 
ATOM   9573  O O   . ASP B  1 169  ? 162.594 234.871 256.161 1.00 73.83  ? 138  ASP B O   1 
ATOM   9574  C CB  . ASP B  1 169  ? 161.117 232.749 255.198 1.00 73.83  ? 138  ASP B CB  1 
ATOM   9575  C CG  . ASP B  1 169  ? 160.685 232.999 253.774 1.00 73.83  ? 138  ASP B CG  1 
ATOM   9576  O OD1 . ASP B  1 169  ? 161.356 233.785 253.075 1.00 73.83  ? 138  ASP B OD1 1 
ATOM   9577  O OD2 . ASP B  1 169  ? 159.668 232.409 253.352 1.00 73.83  ? 138  ASP B OD2 1 
ATOM   9578  N N   . PRO B  1 170  ? 164.556 234.125 255.378 1.00 66.11  ? 139  PRO B N   1 
ATOM   9579  C CA  . PRO B  1 170  ? 165.228 235.382 255.714 1.00 66.11  ? 139  PRO B CA  1 
ATOM   9580  C C   . PRO B  1 170  ? 164.854 236.495 254.753 1.00 66.11  ? 139  PRO B C   1 
ATOM   9581  O O   . PRO B  1 170  ? 164.663 236.277 253.555 1.00 66.11  ? 139  PRO B O   1 
ATOM   9582  C CB  . PRO B  1 170  ? 166.716 235.030 255.587 1.00 66.11  ? 139  PRO B CB  1 
ATOM   9583  C CG  . PRO B  1 170  ? 166.771 233.551 255.340 1.00 66.11  ? 139  PRO B CG  1 
ATOM   9584  C CD  . PRO B  1 170  ? 165.474 233.183 254.730 1.00 66.11  ? 139  PRO B CD  1 
ATOM   9585  N N   . PHE B  1 171  ? 164.787 237.710 255.287 1.00 66.32  ? 140  PHE B N   1 
ATOM   9586  C CA  . PHE B  1 171  ? 164.502 238.853 254.434 1.00 66.32  ? 140  PHE B CA  1 
ATOM   9587  C C   . PHE B  1 171  ? 164.824 240.146 255.168 1.00 66.32  ? 140  PHE B C   1 
ATOM   9588  O O   . PHE B  1 171  ? 165.183 240.159 256.351 1.00 66.32  ? 140  PHE B O   1 
ATOM   9589  C CB  . PHE B  1 171  ? 163.049 238.854 253.938 1.00 66.32  ? 140  PHE B CB  1 
ATOM   9590  C CG  . PHE B  1 171  ? 162.021 238.996 255.023 1.00 66.32  ? 140  PHE B CG  1 
ATOM   9591  C CD1 . PHE B  1 171  ? 161.354 237.891 255.503 1.00 66.32  ? 140  PHE B CD1 1 
ATOM   9592  C CD2 . PHE B  1 171  ? 161.698 240.237 255.537 1.00 66.32  ? 140  PHE B CD2 1 
ATOM   9593  C CE1 . PHE B  1 171  ? 160.408 238.018 256.485 1.00 66.32  ? 140  PHE B CE1 1 
ATOM   9594  C CE2 . PHE B  1 171  ? 160.756 240.365 256.524 1.00 66.32  ? 140  PHE B CE2 1 
ATOM   9595  C CZ  . PHE B  1 171  ? 160.107 239.257 256.993 1.00 66.32  ? 140  PHE B CZ  1 
ATOM   9596  N N   . LEU B  1 172  ? 164.713 241.235 254.416 1.00 65.83  ? 141  LEU B N   1 
ATOM   9597  C CA  . LEU B  1 172  ? 164.886 242.593 254.887 1.00 65.83  ? 141  LEU B CA  1 
ATOM   9598  C C   . LEU B  1 172  ? 163.581 243.324 254.621 1.00 65.83  ? 141  LEU B C   1 
ATOM   9599  O O   . LEU B  1 172  ? 162.804 242.938 253.746 1.00 65.83  ? 141  LEU B O   1 
ATOM   9600  C CB  . LEU B  1 172  ? 166.035 243.304 254.162 1.00 65.83  ? 141  LEU B CB  1 
ATOM   9601  C CG  . LEU B  1 172  ? 167.491 242.917 254.410 1.00 65.83  ? 141  LEU B CG  1 
ATOM   9602  C CD1 . LEU B  1 172  ? 167.757 242.883 255.875 1.00 65.83  ? 141  LEU B CD1 1 
ATOM   9603  C CD2 . LEU B  1 172  ? 167.842 241.586 253.771 1.00 65.83  ? 141  LEU B CD2 1 
ATOM   9604  N N   . GLY B  1 173  ? 163.331 244.375 255.391 1.00 74.94  ? 142  GLY B N   1 
ATOM   9605  C CA  . GLY B  1 173  ? 162.074 245.085 255.283 1.00 74.94  ? 142  GLY B CA  1 
ATOM   9606  C C   . GLY B  1 173  ? 162.228 246.576 255.107 1.00 74.94  ? 142  GLY B C   1 
ATOM   9607  O O   . GLY B  1 173  ? 162.828 247.237 255.962 1.00 74.94  ? 142  GLY B O   1 
ATOM   9608  N N   . VAL B  1 174  ? 161.601 247.110 254.061 1.00 81.63  ? 143  VAL B N   1 
ATOM   9609  C CA  . VAL B  1 174  ? 161.516 248.542 253.791 1.00 81.63  ? 143  VAL B CA  1 
ATOM   9610  C C   . VAL B  1 174  ? 160.073 248.976 254.001 1.00 81.63  ? 143  VAL B C   1 
ATOM   9611  O O   . VAL B  1 174  ? 159.147 248.342 253.484 1.00 81.63  ? 143  VAL B O   1 
ATOM   9612  C CB  . VAL B  1 174  ? 161.972 248.880 252.361 1.00 81.63  ? 143  VAL B CB  1 
ATOM   9613  C CG1 . VAL B  1 174  ? 161.768 250.349 252.080 1.00 81.63  ? 143  VAL B CG1 1 
ATOM   9614  C CG2 . VAL B  1 174  ? 163.418 248.503 252.158 1.00 81.63  ? 143  VAL B CG2 1 
ATOM   9615  N N   . TYR B  1 175  ? 159.883 250.043 254.768 1.00 93.05  ? 144  TYR B N   1 
ATOM   9616  C CA  . TYR B  1 175  ? 158.561 250.575 255.057 1.00 93.05  ? 144  TYR B CA  1 
ATOM   9617  C C   . TYR B  1 175  ? 158.405 251.941 254.406 1.00 93.05  ? 144  TYR B C   1 
ATOM   9618  O O   . TYR B  1 175  ? 159.352 252.732 254.368 1.00 93.05  ? 144  TYR B O   1 
ATOM   9619  C CB  . TYR B  1 175  ? 158.344 250.686 256.566 1.00 93.05  ? 144  TYR B CB  1 
ATOM   9620  C CG  . TYR B  1 175  ? 156.934 251.037 256.968 1.00 93.05  ? 144  TYR B CG  1 
ATOM   9621  C CD1 . TYR B  1 175  ? 155.938 250.074 256.996 1.00 93.05  ? 144  TYR B CD1 1 
ATOM   9622  C CD2 . TYR B  1 175  ? 156.600 252.333 257.330 1.00 93.05  ? 144  TYR B CD2 1 
ATOM   9623  C CE1 . TYR B  1 175  ? 154.650 250.392 257.367 1.00 93.05  ? 144  TYR B CE1 1 
ATOM   9624  C CE2 . TYR B  1 175  ? 155.315 252.659 257.703 1.00 93.05  ? 144  TYR B CE2 1 
ATOM   9625  C CZ  . TYR B  1 175  ? 154.345 251.687 257.720 1.00 93.05  ? 144  TYR B CZ  1 
ATOM   9626  O OH  . TYR B  1 175  ? 153.061 252.009 258.091 1.00 93.05  ? 144  TYR B OH  1 
ATOM   9627  N N   . TYR B  1 176  ? 157.205 252.212 253.898 1.00 98.71  ? 145  TYR B N   1 
ATOM   9628  C CA  . TYR B  1 176  ? 156.899 253.445 253.186 1.00 98.71  ? 145  TYR B CA  1 
ATOM   9629  C C   . TYR B  1 176  ? 155.843 254.233 253.946 1.00 98.71  ? 145  TYR B C   1 
ATOM   9630  O O   . TYR B  1 176  ? 154.775 253.699 254.261 1.00 98.71  ? 145  TYR B O   1 
ATOM   9631  C CB  . TYR B  1 176  ? 156.410 253.134 251.773 1.00 98.71  ? 145  TYR B CB  1 
ATOM   9632  C CG  . TYR B  1 176  ? 155.951 254.338 250.985 1.00 98.71  ? 145  TYR B CG  1 
ATOM   9633  C CD1 . TYR B  1 176  ? 154.735 254.330 250.318 1.00 98.71  ? 145  TYR B CD1 1 
ATOM   9634  C CD2 . TYR B  1 176  ? 156.732 255.480 250.906 1.00 98.71  ? 145  TYR B CD2 1 
ATOM   9635  C CE1 . TYR B  1 176  ? 154.311 255.422 249.595 1.00 98.71  ? 145  TYR B CE1 1 
ATOM   9636  C CE2 . TYR B  1 176  ? 156.315 256.579 250.184 1.00 98.71  ? 145  TYR B CE2 1 
ATOM   9637  C CZ  . TYR B  1 176  ? 155.104 256.545 249.532 1.00 98.71  ? 145  TYR B CZ  1 
ATOM   9638  O OH  . TYR B  1 176  ? 154.686 257.638 248.810 1.00 98.71  ? 145  TYR B OH  1 
ATOM   9639  N N   . HIS B  1 177  ? 156.135 255.501 254.223 1.00 104.90 ? 146  HIS B N   1 
ATOM   9640  C CA  . HIS B  1 177  ? 155.203 256.384 254.908 1.00 104.90 ? 146  HIS B CA  1 
ATOM   9641  C C   . HIS B  1 177  ? 154.483 257.264 253.897 1.00 104.90 ? 146  HIS B C   1 
ATOM   9642  O O   . HIS B  1 177  ? 155.120 257.876 253.034 1.00 104.90 ? 146  HIS B O   1 
ATOM   9643  C CB  . HIS B  1 177  ? 155.933 257.241 255.941 1.00 104.90 ? 146  HIS B CB  1 
ATOM   9644  C CG  . HIS B  1 177  ? 156.769 256.447 256.894 1.00 104.90 ? 146  HIS B CG  1 
ATOM   9645  N ND1 . HIS B  1 177  ? 158.119 256.245 256.711 1.00 104.90 ? 146  HIS B ND1 1 
ATOM   9646  C CD2 . HIS B  1 177  ? 156.442 255.794 258.034 1.00 104.90 ? 146  HIS B CD2 1 
ATOM   9647  C CE1 . HIS B  1 177  ? 158.589 255.507 257.701 1.00 104.90 ? 146  HIS B CE1 1 
ATOM   9648  N NE2 . HIS B  1 177  ? 157.592 255.220 258.517 1.00 104.90 ? 146  HIS B NE2 1 
ATOM   9649  N N   . LYS B  1 178  ? 153.156 257.322 254.008 1.00 108.85 ? 147  LYS B N   1 
ATOM   9650  C CA  . LYS B  1 178  ? 152.365 258.141 253.097 1.00 108.85 ? 147  LYS B CA  1 
ATOM   9651  C C   . LYS B  1 178  ? 152.411 259.623 253.459 1.00 108.85 ? 147  LYS B C   1 
ATOM   9652  O O   . LYS B  1 178  ? 152.518 260.476 252.572 1.00 108.85 ? 147  LYS B O   1 
ATOM   9653  C CB  . LYS B  1 178  ? 150.921 257.640 253.080 1.00 108.85 ? 147  LYS B CB  1 
ATOM   9654  C CG  . LYS B  1 178  ? 150.013 258.369 252.108 1.00 108.85 ? 147  LYS B CG  1 
ATOM   9655  C CD  . LYS B  1 178  ? 148.562 257.976 252.325 1.00 108.85 ? 147  LYS B CD  1 
ATOM   9656  C CE  . LYS B  1 178  ? 147.650 258.642 251.310 1.00 108.85 ? 147  LYS B CE  1 
ATOM   9657  N NZ  . LYS B  1 178  ? 147.866 258.104 249.939 1.00 108.85 ? 147  LYS B NZ  1 
ATOM   9658  N N   . ASN B  1 179  ? 152.321 259.945 254.754 1.00 111.98 ? 148  ASN B N   1 
ATOM   9659  C CA  . ASN B  1 179  ? 152.195 261.341 255.170 1.00 111.98 ? 148  ASN B CA  1 
ATOM   9660  C C   . ASN B  1 179  ? 153.403 262.179 254.764 1.00 111.98 ? 148  ASN B C   1 
ATOM   9661  O O   . ASN B  1 179  ? 153.243 263.307 254.282 1.00 111.98 ? 148  ASN B O   1 
ATOM   9662  C CB  . ASN B  1 179  ? 151.947 261.412 256.674 1.00 111.98 ? 148  ASN B CB  1 
ATOM   9663  C CG  . ASN B  1 179  ? 152.908 260.558 257.462 1.00 111.98 ? 148  ASN B CG  1 
ATOM   9664  O OD1 . ASN B  1 179  ? 153.996 260.225 256.995 1.00 111.98 ? 148  ASN B OD1 1 
ATOM   9665  N ND2 . ASN B  1 179  ? 152.487 260.154 258.653 1.00 111.98 ? 148  ASN B ND2 1 
ATOM   9666  N N   . ASN B  1 180  ? 154.616 261.662 254.948 1.00 112.49 ? 149  ASN B N   1 
ATOM   9667  C CA  . ASN B  1 180  ? 155.797 262.265 254.341 1.00 112.49 ? 149  ASN B CA  1 
ATOM   9668  C C   . ASN B  1 180  ? 156.466 261.220 253.459 1.00 112.49 ? 149  ASN B C   1 
ATOM   9669  O O   . ASN B  1 180  ? 156.833 260.143 253.935 1.00 112.49 ? 149  ASN B O   1 
ATOM   9670  C CB  . ASN B  1 180  ? 156.776 262.831 255.381 1.00 112.49 ? 149  ASN B CB  1 
ATOM   9671  C CG  . ASN B  1 180  ? 157.224 261.817 256.433 1.00 112.49 ? 149  ASN B CG  1 
ATOM   9672  O OD1 . ASN B  1 180  ? 156.802 260.664 256.452 1.00 112.49 ? 149  ASN B OD1 1 
ATOM   9673  N ND2 . ASN B  1 180  ? 158.116 262.277 257.315 1.00 112.49 ? 149  ASN B ND2 1 
ATOM   9674  N N   . LYS B  1 181  ? 156.606 261.531 252.175 1.00 109.57 ? 150  LYS B N   1 
ATOM   9675  C CA  . LYS B  1 181  ? 157.104 260.547 251.222 1.00 109.57 ? 150  LYS B CA  1 
ATOM   9676  C C   . LYS B  1 181  ? 158.557 260.223 251.542 1.00 109.57 ? 150  LYS B C   1 
ATOM   9677  O O   . LYS B  1 181  ? 159.446 261.057 251.351 1.00 109.57 ? 150  LYS B O   1 
ATOM   9678  C CB  . LYS B  1 181  ? 156.955 261.061 249.794 1.00 109.57 ? 150  LYS B CB  1 
ATOM   9679  C CG  . LYS B  1 181  ? 155.512 261.202 249.345 1.00 109.57 ? 150  LYS B CG  1 
ATOM   9680  C CD  . LYS B  1 181  ? 155.422 261.739 247.928 1.00 109.57 ? 150  LYS B CD  1 
ATOM   9681  C CE  . LYS B  1 181  ? 153.976 261.854 247.477 1.00 109.57 ? 150  LYS B CE  1 
ATOM   9682  N NZ  . LYS B  1 181  ? 153.864 262.400 246.097 1.00 109.57 ? 150  LYS B NZ  1 
ATOM   9683  N N   . SER B  1 182  ? 158.795 259.007 252.026 1.00 103.36 ? 151  SER B N   1 
ATOM   9684  C CA  . SER B  1 182  ? 160.120 258.582 252.444 1.00 103.36 ? 151  SER B CA  1 
ATOM   9685  C C   . SER B  1 182  ? 160.105 257.073 252.622 1.00 103.36 ? 151  SER B C   1 
ATOM   9686  O O   . SER B  1 182  ? 159.170 256.522 253.207 1.00 103.36 ? 151  SER B O   1 
ATOM   9687  C CB  . SER B  1 182  ? 160.535 259.266 253.749 1.00 103.36 ? 151  SER B CB  1 
ATOM   9688  O OG  . SER B  1 182  ? 161.809 258.817 254.169 1.00 103.36 ? 151  SER B OG  1 
ATOM   9689  N N   . TRP B  1 183  ? 161.158 256.423 252.140 1.00 94.21  ? 152  TRP B N   1 
ATOM   9690  C CA  . TRP B  1 183  ? 161.361 254.989 252.291 1.00 94.21  ? 152  TRP B CA  1 
ATOM   9691  C C   . TRP B  1 183  ? 162.527 254.759 253.240 1.00 94.21  ? 152  TRP B C   1 
ATOM   9692  O O   . TRP B  1 183  ? 163.626 255.269 253.009 1.00 94.21  ? 152  TRP B O   1 
ATOM   9693  C CB  . TRP B  1 183  ? 161.637 254.340 250.937 1.00 94.21  ? 152  TRP B CB  1 
ATOM   9694  C CG  . TRP B  1 183  ? 160.598 254.628 249.907 1.00 94.21  ? 152  TRP B CG  1 
ATOM   9695  C CD1 . TRP B  1 183  ? 160.388 255.809 249.263 1.00 94.21  ? 152  TRP B CD1 1 
ATOM   9696  C CD2 . TRP B  1 183  ? 159.653 253.702 249.364 1.00 94.21  ? 152  TRP B CD2 1 
ATOM   9697  N NE1 . TRP B  1 183  ? 159.352 255.685 248.372 1.00 94.21  ? 152  TRP B NE1 1 
ATOM   9698  C CE2 . TRP B  1 183  ? 158.887 254.398 248.412 1.00 94.21  ? 152  TRP B CE2 1 
ATOM   9699  C CE3 . TRP B  1 183  ? 159.374 252.353 249.596 1.00 94.21  ? 152  TRP B CE3 1 
ATOM   9700  C CZ2 . TRP B  1 183  ? 157.862 253.793 247.696 1.00 94.21  ? 152  TRP B CZ2 1 
ATOM   9701  C CZ3 . TRP B  1 183  ? 158.356 251.757 248.885 1.00 94.21  ? 152  TRP B CZ3 1 
ATOM   9702  C CH2 . TRP B  1 183  ? 157.614 252.474 247.946 1.00 94.21  ? 152  TRP B CH2 1 
ATOM   9703  N N   . MET B  1 184  ? 162.289 253.996 254.300 1.00 94.04  ? 153  MET B N   1 
ATOM   9704  C CA  . MET B  1 184  ? 163.328 253.713 255.274 1.00 94.04  ? 153  MET B CA  1 
ATOM   9705  C C   . MET B  1 184  ? 163.293 252.239 255.646 1.00 94.04  ? 153  MET B C   1 
ATOM   9706  O O   . MET B  1 184  ? 162.242 251.596 255.614 1.00 94.04  ? 153  MET B O   1 
ATOM   9707  C CB  . MET B  1 184  ? 163.169 254.585 256.515 1.00 94.04  ? 153  MET B CB  1 
ATOM   9708  C CG  . MET B  1 184  ? 161.877 254.358 257.253 1.00 94.04  ? 153  MET B CG  1 
ATOM   9709  S SD  . MET B  1 184  ? 161.807 255.411 258.699 1.00 94.04  ? 153  MET B SD  1 
ATOM   9710  C CE  . MET B  1 184  ? 161.859 256.994 257.876 1.00 94.04  ? 153  MET B CE  1 
ATOM   9711  N N   . GLU B  1 185  ? 164.458 251.716 256.011 1.00 80.86  ? 154  GLU B N   1 
ATOM   9712  C CA  . GLU B  1 185  ? 164.596 250.306 256.343 1.00 80.86  ? 154  GLU B CA  1 
ATOM   9713  C C   . GLU B  1 185  ? 164.142 250.053 257.772 1.00 80.86  ? 154  GLU B C   1 
ATOM   9714  O O   . GLU B  1 185  ? 164.634 250.687 258.711 1.00 80.86  ? 154  GLU B O   1 
ATOM   9715  C CB  . GLU B  1 185  ? 166.040 249.853 256.154 1.00 80.86  ? 154  GLU B CB  1 
ATOM   9716  C CG  . GLU B  1 185  ? 166.269 248.425 256.587 1.00 80.86  ? 154  GLU B CG  1 
ATOM   9717  C CD  . GLU B  1 185  ? 167.522 247.827 256.002 1.00 80.86  ? 154  GLU B CD  1 
ATOM   9718  O OE1 . GLU B  1 185  ? 168.106 248.443 255.090 1.00 80.86  ? 154  GLU B OE1 1 
ATOM   9719  O OE2 . GLU B  1 185  ? 167.926 246.740 256.462 1.00 80.86  ? 154  GLU B OE2 1 
ATOM   9720  N N   . SER B  1 186  ? 163.186 249.143 257.930 1.00 81.90  ? 155  SER B N   1 
ATOM   9721  C CA  . SER B  1 186  ? 162.613 248.806 259.226 1.00 81.90  ? 155  SER B CA  1 
ATOM   9722  C C   . SER B  1 186  ? 162.983 247.418 259.716 1.00 81.90  ? 155  SER B C   1 
ATOM   9723  O O   . SER B  1 186  ? 163.249 247.249 260.906 1.00 81.90  ? 155  SER B O   1 
ATOM   9724  C CB  . SER B  1 186  ? 161.087 248.921 259.184 1.00 81.90  ? 155  SER B CB  1 
ATOM   9725  O OG  . SER B  1 186  ? 160.684 250.264 258.993 1.00 81.90  ? 155  SER B OG  1 
ATOM   9726  N N   . GLU B  1 187  ? 163.011 246.411 258.846 1.00 77.60  ? 156  GLU B N   1 
ATOM   9727  C CA  . GLU B  1 187  ? 163.162 245.032 259.295 1.00 77.60  ? 156  GLU B CA  1 
ATOM   9728  C C   . GLU B  1 187  ? 164.486 244.417 258.857 1.00 77.60  ? 156  GLU B C   1 
ATOM   9729  O O   . GLU B  1 187  ? 164.950 244.648 257.739 1.00 77.60  ? 156  GLU B O   1 
ATOM   9730  C CB  . GLU B  1 187  ? 162.009 244.172 258.775 1.00 77.60  ? 156  GLU B CB  1 
ATOM   9731  C CG  . GLU B  1 187  ? 160.683 244.455 259.456 1.00 77.60  ? 156  GLU B CG  1 
ATOM   9732  C CD  . GLU B  1 187  ? 159.524 243.747 258.791 1.00 77.60  ? 156  GLU B CD  1 
ATOM   9733  O OE1 . GLU B  1 187  ? 159.415 243.822 257.550 1.00 77.60  ? 156  GLU B OE1 1 
ATOM   9734  O OE2 . GLU B  1 187  ? 158.718 243.122 259.508 1.00 77.60  ? 156  GLU B OE2 1 
ATOM   9735  N N   . PHE B  1 188  ? 165.059 243.597 259.741 1.00 66.26  ? 157  PHE B N   1 
ATOM   9736  C CA  . PHE B  1 188  ? 166.238 242.768 259.469 1.00 66.26  ? 157  PHE B CA  1 
ATOM   9737  C C   . PHE B  1 188  ? 165.969 241.400 260.090 1.00 66.26  ? 157  PHE B C   1 
ATOM   9738  O O   . PHE B  1 188  ? 166.284 241.177 261.262 1.00 66.26  ? 157  PHE B O   1 
ATOM   9739  C CB  . PHE B  1 188  ? 167.496 243.408 260.047 1.00 66.26  ? 157  PHE B CB  1 
ATOM   9740  C CG  . PHE B  1 188  ? 168.780 242.742 259.629 1.00 66.26  ? 157  PHE B CG  1 
ATOM   9741  C CD1 . PHE B  1 188  ? 169.562 243.280 258.630 1.00 66.26  ? 157  PHE B CD1 1 
ATOM   9742  C CD2 . PHE B  1 188  ? 169.223 241.600 260.265 1.00 66.26  ? 157  PHE B CD2 1 
ATOM   9743  C CE1 . PHE B  1 188  ? 170.739 242.673 258.251 1.00 66.26  ? 157  PHE B CE1 1 
ATOM   9744  C CE2 . PHE B  1 188  ? 170.398 240.994 259.891 1.00 66.26  ? 157  PHE B CE2 1 
ATOM   9745  C CZ  . PHE B  1 188  ? 171.156 241.530 258.886 1.00 66.26  ? 157  PHE B CZ  1 
ATOM   9746  N N   . ARG B  1 189  ? 165.390 240.480 259.318 1.00 68.49  ? 158  ARG B N   1 
ATOM   9747  C CA  . ARG B  1 189  ? 164.982 239.189 259.863 1.00 68.49  ? 158  ARG B CA  1 
ATOM   9748  C C   . ARG B  1 189  ? 165.754 238.098 259.129 1.00 68.49  ? 158  ARG B C   1 
ATOM   9749  O O   . ARG B  1 189  ? 165.261 237.507 258.169 1.00 68.49  ? 158  ARG B O   1 
ATOM   9750  C CB  . ARG B  1 189  ? 163.495 239.012 259.745 1.00 68.49  ? 158  ARG B CB  1 
ATOM   9751  C CG  . ARG B  1 189  ? 162.688 240.070 260.474 1.00 68.49  ? 158  ARG B CG  1 
ATOM   9752  C CD  . ARG B  1 189  ? 161.318 239.535 260.832 1.00 68.49  ? 158  ARG B CD  1 
ATOM   9753  N NE  . ARG B  1 189  ? 160.365 240.581 261.186 1.00 68.49  ? 158  ARG B NE  1 
ATOM   9754  C CZ  . ARG B  1 189  ? 160.402 241.285 262.311 1.00 68.49  ? 158  ARG B CZ  1 
ATOM   9755  N NH1 . ARG B  1 189  ? 161.353 241.064 263.206 1.00 68.49  ? 158  ARG B NH1 1 
ATOM   9756  N NH2 . ARG B  1 189  ? 159.487 242.214 262.542 1.00 68.49  ? 158  ARG B NH2 1 
ATOM   9757  N N   . VAL B  1 190  ? 166.980 237.834 259.587 1.00 61.43  ? 159  VAL B N   1 
ATOM   9758  C CA  . VAL B  1 190  ? 167.896 236.921 258.916 1.00 61.43  ? 159  VAL B CA  1 
ATOM   9759  C C   . VAL B  1 190  ? 168.296 235.763 259.823 1.00 61.43  ? 159  VAL B C   1 
ATOM   9760  O O   . VAL B  1 190  ? 168.247 234.600 259.417 1.00 61.43  ? 159  VAL B O   1 
ATOM   9761  C CB  . VAL B  1 190  ? 169.145 237.658 258.389 1.00 61.43  ? 159  VAL B CB  1 
ATOM   9762  C CG1 . VAL B  1 190  ? 170.093 236.673 257.735 1.00 61.43  ? 159  VAL B CG1 1 
ATOM   9763  C CG2 . VAL B  1 190  ? 168.743 238.732 257.410 1.00 61.43  ? 159  VAL B CG2 1 
ATOM   9764  N N   . TYR B  1 191  ? 168.711 236.060 261.053 1.00 58.87  ? 160  TYR B N   1 
ATOM   9765  C CA  . TYR B  1 191  ? 169.154 235.013 261.963 1.00 58.87  ? 160  TYR B CA  1 
ATOM   9766  C C   . TYR B  1 191  ? 168.637 235.291 263.366 1.00 58.87  ? 160  TYR B C   1 
ATOM   9767  O O   . TYR B  1 191  ? 168.306 236.424 263.721 1.00 58.87  ? 160  TYR B O   1 
ATOM   9768  C CB  . TYR B  1 191  ? 170.686 234.884 261.989 1.00 58.87  ? 160  TYR B CB  1 
ATOM   9769  C CG  . TYR B  1 191  ? 171.421 236.154 262.350 1.00 58.87  ? 160  TYR B CG  1 
ATOM   9770  C CD1 . TYR B  1 191  ? 172.016 236.934 261.375 1.00 58.87  ? 160  TYR B CD1 1 
ATOM   9771  C CD2 . TYR B  1 191  ? 171.524 236.571 263.664 1.00 58.87  ? 160  TYR B CD2 1 
ATOM   9772  C CE1 . TYR B  1 191  ? 172.685 238.090 261.698 1.00 58.87  ? 160  TYR B CE1 1 
ATOM   9773  C CE2 . TYR B  1 191  ? 172.187 237.729 263.993 1.00 58.87  ? 160  TYR B CE2 1 
ATOM   9774  C CZ  . TYR B  1 191  ? 172.767 238.482 263.008 1.00 58.87  ? 160  TYR B CZ  1 
ATOM   9775  O OH  . TYR B  1 191  ? 173.434 239.636 263.334 1.00 58.87  ? 160  TYR B OH  1 
ATOM   9776  N N   . SER B  1 192  ? 168.556 234.220 264.158 1.00 61.41  ? 161  SER B N   1 
ATOM   9777  C CA  . SER B  1 192  ? 168.194 234.326 265.567 1.00 61.41  ? 161  SER B CA  1 
ATOM   9778  C C   . SER B  1 192  ? 169.403 234.674 266.432 1.00 61.41  ? 161  SER B C   1 
ATOM   9779  O O   . SER B  1 192  ? 169.366 235.636 267.206 1.00 61.41  ? 161  SER B O   1 
ATOM   9780  C CB  . SER B  1 192  ? 167.554 233.023 266.040 1.00 61.41  ? 161  SER B CB  1 
ATOM   9781  O OG  . SER B  1 192  ? 166.487 232.648 265.189 1.00 61.41  ? 161  SER B OG  1 
ATOM   9782  N N   . SER B  1 193  ? 170.478 233.895 266.318 1.00 60.79  ? 162  SER B N   1 
ATOM   9783  C CA  . SER B  1 193  ? 171.667 234.057 267.143 1.00 60.79  ? 162  SER B CA  1 
ATOM   9784  C C   . SER B  1 193  ? 172.911 233.749 266.323 1.00 60.79  ? 162  SER B C   1 
ATOM   9785  O O   . SER B  1 193  ? 172.883 232.917 265.415 1.00 60.79  ? 162  SER B O   1 
ATOM   9786  C CB  . SER B  1 193  ? 171.620 233.143 268.367 1.00 60.79  ? 162  SER B CB  1 
ATOM   9787  O OG  . SER B  1 193  ? 171.393 231.801 267.979 1.00 60.79  ? 162  SER B OG  1 
ATOM   9788  N N   . ALA B  1 194  ? 174.001 234.443 266.645 1.00 59.75  ? 163  ALA B N   1 
ATOM   9789  C CA  . ALA B  1 194  ? 175.319 234.173 266.081 1.00 59.75  ? 163  ALA B CA  1 
ATOM   9790  C C   . ALA B  1 194  ? 176.323 234.080 267.218 1.00 59.75  ? 163  ALA B C   1 
ATOM   9791  O O   . ALA B  1 194  ? 176.515 235.056 267.950 1.00 59.75  ? 163  ALA B O   1 
ATOM   9792  C CB  . ALA B  1 194  ? 175.727 235.272 265.104 1.00 59.75  ? 163  ALA B CB  1 
ATOM   9793  N N   . ASN B  1 195  ? 176.964 232.920 267.371 1.00 65.94  ? 164  ASN B N   1 
ATOM   9794  C CA  . ASN B  1 195  ? 177.804 232.727 268.548 1.00 65.94  ? 164  ASN B CA  1 
ATOM   9795  C C   . ASN B  1 195  ? 179.301 232.902 268.298 1.00 65.94  ? 164  ASN B C   1 
ATOM   9796  O O   . ASN B  1 195  ? 179.870 233.926 268.688 1.00 65.94  ? 164  ASN B O   1 
ATOM   9797  C CB  . ASN B  1 195  ? 177.530 231.342 269.130 1.00 65.94  ? 164  ASN B CB  1 
ATOM   9798  C CG  . ASN B  1 195  ? 178.259 231.103 270.424 1.00 65.94  ? 164  ASN B CG  1 
ATOM   9799  O OD1 . ASN B  1 195  ? 178.598 229.971 270.754 1.00 65.94  ? 164  ASN B OD1 1 
ATOM   9800  N ND2 . ASN B  1 195  ? 178.497 232.170 271.177 1.00 65.94  ? 164  ASN B ND2 1 
ATOM   9801  N N   . ASN B  1 196  ? 179.958 231.934 267.658 1.00 62.08  ? 165  ASN B N   1 
ATOM   9802  C CA  . ASN B  1 196  ? 181.422 231.941 267.561 1.00 62.08  ? 165  ASN B CA  1 
ATOM   9803  C C   . ASN B  1 196  ? 181.843 232.590 266.252 1.00 62.08  ? 165  ASN B C   1 
ATOM   9804  O O   . ASN B  1 196  ? 181.827 231.950 265.201 1.00 62.08  ? 165  ASN B O   1 
ATOM   9805  C CB  . ASN B  1 196  ? 181.999 230.534 267.659 1.00 62.08  ? 165  ASN B CB  1 
ATOM   9806  C CG  . ASN B  1 196  ? 181.935 229.965 269.056 1.00 62.08  ? 165  ASN B CG  1 
ATOM   9807  O OD1 . ASN B  1 196  ? 181.986 230.694 270.043 1.00 62.08  ? 165  ASN B OD1 1 
ATOM   9808  N ND2 . ASN B  1 196  ? 181.850 228.647 269.143 1.00 62.08  ? 165  ASN B ND2 1 
ATOM   9809  N N   . CYS B  1 197  ? 182.262 233.847 266.307 1.00 59.58  ? 166  CYS B N   1 
ATOM   9810  C CA  . CYS B  1 197  ? 182.621 234.576 265.101 1.00 59.58  ? 166  CYS B CA  1 
ATOM   9811  C C   . CYS B  1 197  ? 184.132 234.596 264.945 1.00 59.58  ? 166  CYS B C   1 
ATOM   9812  O O   . CYS B  1 197  ? 184.850 235.012 265.859 1.00 59.58  ? 166  CYS B O   1 
ATOM   9813  C CB  . CYS B  1 197  ? 182.067 236.000 265.129 1.00 59.58  ? 166  CYS B CB  1 
ATOM   9814  S SG  . CYS B  1 197  ? 180.258 236.088 265.059 1.00 59.58  ? 166  CYS B SG  1 
ATOM   9815  N N   . THR B  1 198  ? 184.606 234.160 263.783 1.00 52.97  ? 167  THR B N   1 
ATOM   9816  C CA  . THR B  1 198  ? 186.028 234.102 263.478 1.00 52.97  ? 167  THR B CA  1 
ATOM   9817  C C   . THR B  1 198  ? 186.484 235.258 262.604 1.00 52.97  ? 167  THR B C   1 
ATOM   9818  O O   . THR B  1 198  ? 187.584 235.780 262.803 1.00 52.97  ? 167  THR B O   1 
ATOM   9819  C CB  . THR B  1 198  ? 186.379 232.777 262.798 1.00 52.97  ? 167  THR B CB  1 
ATOM   9820  O OG1 . THR B  1 198  ? 185.614 232.636 261.598 1.00 52.97  ? 167  THR B OG1 1 
ATOM   9821  C CG2 . THR B  1 198  ? 186.083 231.609 263.713 1.00 52.97  ? 167  THR B CG2 1 
ATOM   9822  N N   . PHE B  1 199  ? 185.678 235.663 261.628 1.00 49.39  ? 168  PHE B N   1 
ATOM   9823  C CA  . PHE B  1 199  ? 186.033 236.744 260.724 1.00 49.39  ? 168  PHE B CA  1 
ATOM   9824  C C   . PHE B  1 199  ? 184.874 237.728 260.651 1.00 49.39  ? 168  PHE B C   1 
ATOM   9825  O O   . PHE B  1 199  ? 183.710 237.321 260.611 1.00 49.39  ? 168  PHE B O   1 
ATOM   9826  C CB  . PHE B  1 199  ? 186.376 236.190 259.330 1.00 49.39  ? 168  PHE B CB  1 
ATOM   9827  C CG  . PHE B  1 199  ? 186.527 237.238 258.266 1.00 49.39  ? 168  PHE B CG  1 
ATOM   9828  C CD1 . PHE B  1 199  ? 187.764 237.789 258.000 1.00 49.39  ? 168  PHE B CD1 1 
ATOM   9829  C CD2 . PHE B  1 199  ? 185.443 237.655 257.517 1.00 49.39  ? 168  PHE B CD2 1 
ATOM   9830  C CE1 . PHE B  1 199  ? 187.914 238.742 257.024 1.00 49.39  ? 168  PHE B CE1 1 
ATOM   9831  C CE2 . PHE B  1 199  ? 185.590 238.612 256.543 1.00 49.39  ? 168  PHE B CE2 1 
ATOM   9832  C CZ  . PHE B  1 199  ? 186.827 239.154 256.297 1.00 49.39  ? 168  PHE B CZ  1 
ATOM   9833  N N   . GLU B  1 200  ? 185.197 239.019 260.645 1.00 51.22  ? 169  GLU B N   1 
ATOM   9834  C CA  . GLU B  1 200  ? 184.200 240.079 260.602 1.00 51.22  ? 169  GLU B CA  1 
ATOM   9835  C C   . GLU B  1 200  ? 184.748 241.265 259.826 1.00 51.22  ? 169  GLU B C   1 
ATOM   9836  O O   . GLU B  1 200  ? 185.941 241.565 259.910 1.00 51.22  ? 169  GLU B O   1 
ATOM   9837  C CB  . GLU B  1 200  ? 183.797 240.539 262.005 1.00 51.22  ? 169  GLU B CB  1 
ATOM   9838  C CG  . GLU B  1 200  ? 182.718 241.609 262.005 1.00 51.22  ? 169  GLU B CG  1 
ATOM   9839  C CD  . GLU B  1 200  ? 181.910 241.640 263.283 1.00 51.22  ? 169  GLU B CD  1 
ATOM   9840  O OE1 . GLU B  1 200  ? 181.928 240.640 264.031 1.00 51.22  ? 169  GLU B OE1 1 
ATOM   9841  O OE2 . GLU B  1 200  ? 181.254 242.670 263.539 1.00 51.22  ? 169  GLU B OE2 1 
ATOM   9842  N N   . TYR B  1 201  ? 183.878 241.933 259.074 1.00 50.71  ? 170  TYR B N   1 
ATOM   9843  C CA  . TYR B  1 201  ? 184.260 243.155 258.379 1.00 50.71  ? 170  TYR B CA  1 
ATOM   9844  C C   . TYR B  1 201  ? 183.016 244.015 258.229 1.00 50.71  ? 170  TYR B C   1 
ATOM   9845  O O   . TYR B  1 201  ? 181.959 243.510 257.836 1.00 50.71  ? 170  TYR B O   1 
ATOM   9846  C CB  . TYR B  1 201  ? 184.875 242.852 257.010 1.00 50.71  ? 170  TYR B CB  1 
ATOM   9847  C CG  . TYR B  1 201  ? 184.944 244.043 256.089 1.00 50.71  ? 170  TYR B CG  1 
ATOM   9848  C CD1 . TYR B  1 201  ? 185.960 244.975 256.218 1.00 50.71  ? 170  TYR B CD1 1 
ATOM   9849  C CD2 . TYR B  1 201  ? 184.003 244.241 255.094 1.00 50.71  ? 170  TYR B CD2 1 
ATOM   9850  C CE1 . TYR B  1 201  ? 186.039 246.065 255.386 1.00 50.71  ? 170  TYR B CE1 1 
ATOM   9851  C CE2 . TYR B  1 201  ? 184.072 245.336 254.256 1.00 50.71  ? 170  TYR B CE2 1 
ATOM   9852  C CZ  . TYR B  1 201  ? 185.096 246.243 254.408 1.00 50.71  ? 170  TYR B CZ  1 
ATOM   9853  O OH  . TYR B  1 201  ? 185.179 247.333 253.579 1.00 50.71  ? 170  TYR B OH  1 
ATOM   9854  N N   . VAL B  1 202  ? 183.149 245.307 258.534 1.00 51.49  ? 171  VAL B N   1 
ATOM   9855  C CA  . VAL B  1 202  ? 182.088 246.292 258.357 1.00 51.49  ? 171  VAL B CA  1 
ATOM   9856  C C   . VAL B  1 202  ? 182.654 247.479 257.587 1.00 51.49  ? 171  VAL B C   1 
ATOM   9857  O O   . VAL B  1 202  ? 183.709 248.011 257.948 1.00 51.49  ? 171  VAL B O   1 
ATOM   9858  C CB  . VAL B  1 202  ? 181.496 246.746 259.704 1.00 51.49  ? 171  VAL B CB  1 
ATOM   9859  C CG1 . VAL B  1 202  ? 180.464 247.824 259.489 1.00 51.49  ? 171  VAL B CG1 1 
ATOM   9860  C CG2 . VAL B  1 202  ? 180.880 245.573 260.429 1.00 51.49  ? 171  VAL B CG2 1 
ATOM   9861  N N   . SER B  1 203  ? 181.956 247.891 256.535 1.00 56.54  ? 172  SER B N   1 
ATOM   9862  C CA  . SER B  1 203  ? 182.393 248.972 255.668 1.00 56.54  ? 172  SER B CA  1 
ATOM   9863  C C   . SER B  1 203  ? 182.003 250.344 256.221 1.00 56.54  ? 172  SER B C   1 
ATOM   9864  O O   . SER B  1 203  ? 181.254 250.472 257.193 1.00 56.54  ? 172  SER B O   1 
ATOM   9865  C CB  . SER B  1 203  ? 181.810 248.798 254.272 1.00 56.54  ? 172  SER B CB  1 
ATOM   9866  O OG  . SER B  1 203  ? 182.219 249.854 253.426 1.00 56.54  ? 172  SER B OG  1 
ATOM   9867  N N   . GLN B  1 204  ? 182.546 251.381 255.584 1.00 65.24  ? 173  GLN B N   1 
ATOM   9868  C CA  . GLN B  1 204  ? 182.276 252.758 255.968 1.00 65.24  ? 173  GLN B CA  1 
ATOM   9869  C C   . GLN B  1 204  ? 180.824 253.128 255.660 1.00 65.24  ? 173  GLN B C   1 
ATOM   9870  O O   . GLN B  1 204  ? 180.238 252.624 254.699 1.00 65.24  ? 173  GLN B O   1 
ATOM   9871  C CB  . GLN B  1 204  ? 183.211 253.715 255.231 1.00 65.24  ? 173  GLN B CB  1 
ATOM   9872  C CG  . GLN B  1 204  ? 184.698 253.473 255.447 1.00 65.24  ? 173  GLN B CG  1 
ATOM   9873  C CD  . GLN B  1 204  ? 185.157 253.765 256.866 1.00 65.24  ? 173  GLN B CD  1 
ATOM   9874  O OE1 . GLN B  1 204  ? 184.396 254.269 257.692 1.00 65.24  ? 173  GLN B OE1 1 
ATOM   9875  N NE2 . GLN B  1 204  ? 186.415 253.455 257.151 1.00 65.24  ? 173  GLN B NE2 1 
ATOM   9876  N N   . PRO B  1 205  ? 180.223 254.006 256.463 1.00 65.61  ? 174  PRO B N   1 
ATOM   9877  C CA  . PRO B  1 205  ? 178.788 254.284 256.315 1.00 65.61  ? 174  PRO B CA  1 
ATOM   9878  C C   . PRO B  1 205  ? 178.465 255.027 255.026 1.00 65.61  ? 174  PRO B C   1 
ATOM   9879  O O   . PRO B  1 205  ? 179.198 255.918 254.594 1.00 65.61  ? 174  PRO B O   1 
ATOM   9880  C CB  . PRO B  1 205  ? 178.467 255.140 257.544 1.00 65.61  ? 174  PRO B CB  1 
ATOM   9881  C CG  . PRO B  1 205  ? 179.761 255.760 257.914 1.00 65.61  ? 174  PRO B CG  1 
ATOM   9882  C CD  . PRO B  1 205  ? 180.816 254.753 257.583 1.00 65.61  ? 174  PRO B CD  1 
ATOM   9883  N N   . PHE B  1 206  ? 177.354 254.628 254.406 1.00 66.22  ? 175  PHE B N   1 
ATOM   9884  C CA  . PHE B  1 206  ? 176.810 255.285 253.225 1.00 66.22  ? 175  PHE B CA  1 
ATOM   9885  C C   . PHE B  1 206  ? 175.301 255.402 253.385 1.00 66.22  ? 175  PHE B C   1 
ATOM   9886  O O   . PHE B  1 206  ? 174.696 254.763 254.248 1.00 66.22  ? 175  PHE B O   1 
ATOM   9887  C CB  . PHE B  1 206  ? 177.165 254.528 251.940 1.00 66.22  ? 175  PHE B CB  1 
ATOM   9888  C CG  . PHE B  1 206  ? 176.861 253.060 251.995 1.00 66.22  ? 175  PHE B CG  1 
ATOM   9889  C CD1 . PHE B  1 206  ? 175.567 252.598 251.859 1.00 66.22  ? 175  PHE B CD1 1 
ATOM   9890  C CD2 . PHE B  1 206  ? 177.874 252.143 252.184 1.00 66.22  ? 175  PHE B CD2 1 
ATOM   9891  C CE1 . PHE B  1 206  ? 175.291 251.256 251.913 1.00 66.22  ? 175  PHE B CE1 1 
ATOM   9892  C CE2 . PHE B  1 206  ? 177.603 250.803 252.237 1.00 66.22  ? 175  PHE B CE2 1 
ATOM   9893  C CZ  . PHE B  1 206  ? 176.309 250.358 252.101 1.00 66.22  ? 175  PHE B CZ  1 
ATOM   9894  N N   . LEU B  1 207  ? 174.693 256.234 252.549 1.00 74.60  ? 176  LEU B N   1 
ATOM   9895  C CA  . LEU B  1 207  ? 173.242 256.338 252.446 1.00 74.60  ? 176  LEU B CA  1 
ATOM   9896  C C   . LEU B  1 207  ? 172.785 255.799 251.096 1.00 74.60  ? 176  LEU B C   1 
ATOM   9897  O O   . LEU B  1 207  ? 173.245 256.270 250.051 1.00 74.60  ? 176  LEU B O   1 
ATOM   9898  C CB  . LEU B  1 207  ? 172.800 257.787 252.630 1.00 74.60  ? 176  LEU B CB  1 
ATOM   9899  C CG  . LEU B  1 207  ? 172.942 258.313 254.058 1.00 74.60  ? 176  LEU B CG  1 
ATOM   9900  C CD1 . LEU B  1 207  ? 172.582 259.786 254.138 1.00 74.60  ? 176  LEU B CD1 1 
ATOM   9901  C CD2 . LEU B  1 207  ? 172.070 257.501 254.997 1.00 74.60  ? 176  LEU B CD2 1 
ATOM   9902  N N   . MET B  1 208  ? 171.880 254.823 251.118 1.00 79.06  ? 177  MET B N   1 
ATOM   9903  C CA  . MET B  1 208  ? 171.337 254.245 249.899 1.00 79.06  ? 177  MET B CA  1 
ATOM   9904  C C   . MET B  1 208  ? 169.991 254.890 249.565 1.00 79.06  ? 177  MET B C   1 
ATOM   9905  O O   . MET B  1 208  ? 169.379 255.571 250.389 1.00 79.06  ? 177  MET B O   1 
ATOM   9906  C CB  . MET B  1 208  ? 171.199 252.725 250.062 1.00 79.06  ? 177  MET B CB  1 
ATOM   9907  C CG  . MET B  1 208  ? 170.878 251.955 248.789 1.00 79.06  ? 177  MET B CG  1 
ATOM   9908  S SD  . MET B  1 208  ? 170.960 250.170 248.989 1.00 79.06  ? 177  MET B SD  1 
ATOM   9909  C CE  . MET B  1 208  ? 172.726 249.933 248.930 1.00 79.06  ? 177  MET B CE  1 
ATOM   9910  N N   . ASP B  1 209  ? 169.534 254.667 248.330 1.00 87.36  ? 178  ASP B N   1 
ATOM   9911  C CA  . ASP B  1 209  ? 168.360 255.369 247.818 1.00 87.36  ? 178  ASP B CA  1 
ATOM   9912  C C   . ASP B  1 209  ? 167.057 254.818 248.391 1.00 87.36  ? 178  ASP B C   1 
ATOM   9913  O O   . ASP B  1 209  ? 166.293 255.547 249.032 1.00 87.36  ? 178  ASP B O   1 
ATOM   9914  C CB  . ASP B  1 209  ? 168.341 255.298 246.291 1.00 87.36  ? 178  ASP B CB  1 
ATOM   9915  C CG  . ASP B  1 209  ? 167.425 256.335 245.671 1.00 87.36  ? 178  ASP B CG  1 
ATOM   9916  O OD1 . ASP B  1 209  ? 166.807 257.113 246.427 1.00 87.36  ? 178  ASP B OD1 1 
ATOM   9917  O OD2 . ASP B  1 209  ? 167.317 256.369 244.426 1.00 87.36  ? 178  ASP B OD2 1 
ATOM   9918  N N   . LEU B  1 210  ? 166.781 253.535 248.147 1.00 86.14  ? 179  LEU B N   1 
ATOM   9919  C CA  . LEU B  1 210  ? 165.642 252.769 248.653 1.00 86.14  ? 179  LEU B CA  1 
ATOM   9920  C C   . LEU B  1 210  ? 164.311 253.155 248.012 1.00 86.14  ? 179  LEU B C   1 
ATOM   9921  O O   . LEU B  1 210  ? 163.297 252.510 248.299 1.00 86.14  ? 179  LEU B O   1 
ATOM   9922  C CB  . LEU B  1 210  ? 165.486 252.867 250.177 1.00 86.14  ? 179  LEU B CB  1 
ATOM   9923  C CG  . LEU B  1 210  ? 166.667 252.363 250.997 1.00 86.14  ? 179  LEU B CG  1 
ATOM   9924  C CD1 . LEU B  1 210  ? 166.389 252.518 252.478 1.00 86.14  ? 179  LEU B CD1 1 
ATOM   9925  C CD2 . LEU B  1 210  ? 166.971 250.927 250.645 1.00 86.14  ? 179  LEU B CD2 1 
ATOM   9926  N N   . GLU B  1 211  ? 164.273 254.175 247.159 1.00 88.94  ? 180  GLU B N   1 
ATOM   9927  C CA  . GLU B  1 211  ? 163.016 254.601 246.558 1.00 88.94  ? 180  GLU B CA  1 
ATOM   9928  C C   . GLU B  1 211  ? 162.540 253.615 245.497 1.00 88.94  ? 180  GLU B C   1 
ATOM   9929  O O   . GLU B  1 211  ? 163.325 253.128 244.680 1.00 88.94  ? 180  GLU B O   1 
ATOM   9930  C CB  . GLU B  1 211  ? 163.174 255.990 245.944 1.00 88.94  ? 180  GLU B CB  1 
ATOM   9931  C CG  . GLU B  1 211  ? 161.906 256.538 245.316 1.00 88.94  ? 180  GLU B CG  1 
ATOM   9932  C CD  . GLU B  1 211  ? 162.093 257.930 244.750 1.00 88.94  ? 180  GLU B CD  1 
ATOM   9933  O OE1 . GLU B  1 211  ? 163.223 258.457 244.832 1.00 88.94  ? 180  GLU B OE1 1 
ATOM   9934  O OE2 . GLU B  1 211  ? 161.112 258.500 244.226 1.00 88.94  ? 180  GLU B OE2 1 
ATOM   9935  N N   . GLY B  1 212  ? 161.246 253.309 245.527 1.00 86.69  ? 181  GLY B N   1 
ATOM   9936  C CA  . GLY B  1 212  ? 160.657 252.460 244.501 1.00 86.69  ? 181  GLY B CA  1 
ATOM   9937  C C   . GLY B  1 212  ? 160.579 253.184 243.166 1.00 86.69  ? 181  GLY B C   1 
ATOM   9938  O O   . GLY B  1 212  ? 160.117 254.328 243.091 1.00 86.69  ? 181  GLY B O   1 
ATOM   9939  N N   . LYS B  1 213  ? 161.027 252.520 242.105 1.00 83.86  ? 182  LYS B N   1 
ATOM   9940  C CA  . LYS B  1 213  ? 161.021 253.075 240.759 1.00 83.86  ? 182  LYS B CA  1 
ATOM   9941  C C   . LYS B  1 213  ? 159.939 252.423 239.907 1.00 83.86  ? 182  LYS B C   1 
ATOM   9942  O O   . LYS B  1 213  ? 159.403 251.364 240.243 1.00 83.86  ? 182  LYS B O   1 
ATOM   9943  C CB  . LYS B  1 213  ? 162.385 252.902 240.091 1.00 83.86  ? 182  LYS B CB  1 
ATOM   9944  C CG  . LYS B  1 213  ? 163.526 253.523 240.863 1.00 83.86  ? 182  LYS B CG  1 
ATOM   9945  C CD  . LYS B  1 213  ? 163.345 255.020 240.999 1.00 83.86  ? 182  LYS B CD  1 
ATOM   9946  C CE  . LYS B  1 213  ? 164.521 255.648 241.722 1.00 83.86  ? 182  LYS B CE  1 
ATOM   9947  N NZ  . LYS B  1 213  ? 164.354 257.118 241.878 1.00 83.86  ? 182  LYS B NZ  1 
ATOM   9948  N N   . GLN B  1 214  ? 159.619 253.080 238.787 1.00 84.41  ? 183  GLN B N   1 
ATOM   9949  C CA  . GLN B  1 214  ? 158.520 252.673 237.922 1.00 84.41  ? 183  GLN B CA  1 
ATOM   9950  C C   . GLN B  1 214  ? 158.925 252.260 236.514 1.00 84.41  ? 183  GLN B C   1 
ATOM   9951  O O   . GLN B  1 214  ? 158.165 251.527 235.871 1.00 84.41  ? 183  GLN B O   1 
ATOM   9952  C CB  . GLN B  1 214  ? 157.482 253.801 237.809 1.00 84.41  ? 183  GLN B CB  1 
ATOM   9953  C CG  . GLN B  1 214  ? 156.716 254.075 239.087 1.00 84.41  ? 183  GLN B CG  1 
ATOM   9954  C CD  . GLN B  1 214  ? 156.027 252.834 239.620 1.00 84.41  ? 183  GLN B CD  1 
ATOM   9955  O OE1 . GLN B  1 214  ? 155.332 252.134 238.885 1.00 84.41  ? 183  GLN B OE1 1 
ATOM   9956  N NE2 . GLN B  1 214  ? 156.215 252.556 240.904 1.00 84.41  ? 183  GLN B NE2 1 
ATOM   9957  N N   . GLY B  1 215  ? 160.080 252.691 236.019 1.00 80.00  ? 184  GLY B N   1 
ATOM   9958  C CA  . GLY B  1 215  ? 160.493 252.348 234.676 1.00 80.00  ? 184  GLY B CA  1 
ATOM   9959  C C   . GLY B  1 215  ? 160.841 250.875 234.529 1.00 80.00  ? 184  GLY B C   1 
ATOM   9960  O O   . GLY B  1 215  ? 160.534 250.032 235.371 1.00 80.00  ? 184  GLY B O   1 
ATOM   9961  N N   . ASN B  1 216  ? 161.478 250.565 233.403 1.00 74.01  ? 185  ASN B N   1 
ATOM   9962  C CA  . ASN B  1 216  ? 162.018 249.230 233.212 1.00 74.01  ? 185  ASN B CA  1 
ATOM   9963  C C   . ASN B  1 216  ? 163.375 249.094 233.901 1.00 74.01  ? 185  ASN B C   1 
ATOM   9964  O O   . ASN B  1 216  ? 163.947 250.061 234.409 1.00 74.01  ? 185  ASN B O   1 
ATOM   9965  C CB  . ASN B  1 216  ? 162.113 248.902 231.725 1.00 74.01  ? 185  ASN B CB  1 
ATOM   9966  C CG  . ASN B  1 216  ? 162.714 250.027 230.917 1.00 74.01  ? 185  ASN B CG  1 
ATOM   9967  O OD1 . ASN B  1 216  ? 163.158 251.034 231.466 1.00 74.01  ? 185  ASN B OD1 1 
ATOM   9968  N ND2 . ASN B  1 216  ? 162.721 249.868 229.599 1.00 74.01  ? 185  ASN B ND2 1 
ATOM   9969  N N   . PHE B  1 217  ? 163.889 247.865 233.904 1.00 66.79  ? 186  PHE B N   1 
ATOM   9970  C CA  . PHE B  1 217  ? 165.142 247.552 234.580 1.00 66.79  ? 186  PHE B CA  1 
ATOM   9971  C C   . PHE B  1 217  ? 166.299 248.389 234.050 1.00 66.79  ? 186  PHE B C   1 
ATOM   9972  O O   . PHE B  1 217  ? 166.472 248.533 232.838 1.00 66.79  ? 186  PHE B O   1 
ATOM   9973  C CB  . PHE B  1 217  ? 165.448 246.067 234.418 1.00 66.79  ? 186  PHE B CB  1 
ATOM   9974  C CG  . PHE B  1 217  ? 164.471 245.175 235.118 1.00 66.79  ? 186  PHE B CG  1 
ATOM   9975  C CD1 . PHE B  1 217  ? 163.948 245.530 236.347 1.00 66.79  ? 186  PHE B CD1 1 
ATOM   9976  C CD2 . PHE B  1 217  ? 164.063 243.988 234.543 1.00 66.79  ? 186  PHE B CD2 1 
ATOM   9977  C CE1 . PHE B  1 217  ? 163.047 244.715 236.989 1.00 66.79  ? 186  PHE B CE1 1 
ATOM   9978  C CE2 . PHE B  1 217  ? 163.161 243.172 235.182 1.00 66.79  ? 186  PHE B CE2 1 
ATOM   9979  C CZ  . PHE B  1 217  ? 162.653 243.536 236.405 1.00 66.79  ? 186  PHE B CZ  1 
ATOM   9980  N N   . LYS B  1 218  ? 167.091 248.946 234.968 1.00 63.04  ? 187  LYS B N   1 
ATOM   9981  C CA  . LYS B  1 218  ? 168.164 249.864 234.618 1.00 63.04  ? 187  LYS B CA  1 
ATOM   9982  C C   . LYS B  1 218  ? 169.565 249.416 235.022 1.00 63.04  ? 187  LYS B C   1 
ATOM   9983  O O   . LYS B  1 218  ? 170.530 250.083 234.634 1.00 63.04  ? 187  LYS B O   1 
ATOM   9984  C CB  . LYS B  1 218  ? 167.902 251.260 235.198 1.00 63.04  ? 187  LYS B CB  1 
ATOM   9985  C CG  . LYS B  1 218  ? 166.716 251.959 234.575 1.00 63.04  ? 187  LYS B CG  1 
ATOM   9986  C CD  . LYS B  1 218  ? 166.495 253.318 235.201 1.00 63.04  ? 187  LYS B CD  1 
ATOM   9987  C CE  . LYS B  1 218  ? 165.323 254.037 234.566 1.00 63.04  ? 187  LYS B CE  1 
ATOM   9988  N NZ  . LYS B  1 218  ? 165.091 255.367 235.197 1.00 63.04  ? 187  LYS B NZ  1 
ATOM   9989  N N   . ASN B  1 219  ? 169.723 248.335 235.785 1.00 57.26  ? 188  ASN B N   1 
ATOM   9990  C CA  . ASN B  1 219  ? 171.046 247.979 236.284 1.00 57.26  ? 188  ASN B CA  1 
ATOM   9991  C C   . ASN B  1 219  ? 171.241 246.474 236.229 1.00 57.26  ? 188  ASN B C   1 
ATOM   9992  O O   . ASN B  1 219  ? 170.419 245.719 236.755 1.00 57.26  ? 188  ASN B O   1 
ATOM   9993  C CB  . ASN B  1 219  ? 171.236 248.458 237.725 1.00 57.26  ? 188  ASN B CB  1 
ATOM   9994  C CG  . ASN B  1 219  ? 171.495 249.939 237.817 1.00 57.26  ? 188  ASN B CG  1 
ATOM   9995  O OD1 . ASN B  1 219  ? 170.701 250.685 238.386 1.00 57.26  ? 188  ASN B OD1 1 
ATOM   9996  N ND2 . ASN B  1 219  ? 172.609 250.379 237.252 1.00 57.26  ? 188  ASN B ND2 1 
ATOM   9997  N N   . LEU B  1 220  ? 172.336 246.044 235.605 1.00 49.06  ? 189  LEU B N   1 
ATOM   9998  C CA  . LEU B  1 220  ? 172.758 244.652 235.604 1.00 49.06  ? 189  LEU B CA  1 
ATOM   9999  C C   . LEU B  1 220  ? 173.996 244.513 236.476 1.00 49.06  ? 189  LEU B C   1 
ATOM   10000 O O   . LEU B  1 220  ? 174.975 245.238 236.287 1.00 49.06  ? 189  LEU B O   1 
ATOM   10001 C CB  . LEU B  1 220  ? 173.054 244.187 234.179 1.00 49.06  ? 189  LEU B CB  1 
ATOM   10002 C CG  . LEU B  1 220  ? 173.588 242.782 233.922 1.00 49.06  ? 189  LEU B CG  1 
ATOM   10003 C CD1 . LEU B  1 220  ? 172.565 241.734 234.303 1.00 49.06  ? 189  LEU B CD1 1 
ATOM   10004 C CD2 . LEU B  1 220  ? 173.984 242.637 232.471 1.00 49.06  ? 189  LEU B CD2 1 
ATOM   10005 N N   . ARG B  1 221  ? 173.957 243.590 237.430 1.00 46.61  ? 190  ARG B N   1 
ATOM   10006 C CA  . ARG B  1 221  ? 175.089 243.336 238.314 1.00 46.61  ? 190  ARG B CA  1 
ATOM   10007 C C   . ARG B  1 221  ? 175.469 241.868 238.241 1.00 46.61  ? 190  ARG B C   1 
ATOM   10008 O O   . ARG B  1 221  ? 174.638 240.998 238.522 1.00 46.61  ? 190  ARG B O   1 
ATOM   10009 C CB  . ARG B  1 221  ? 174.778 243.738 239.753 1.00 46.61  ? 190  ARG B CB  1 
ATOM   10010 C CG  . ARG B  1 221  ? 174.117 245.087 239.918 1.00 46.61  ? 190  ARG B CG  1 
ATOM   10011 C CD  . ARG B  1 221  ? 174.079 245.437 241.390 1.00 46.61  ? 190  ARG B CD  1 
ATOM   10012 N NE  . ARG B  1 221  ? 172.900 246.205 241.776 1.00 46.61  ? 190  ARG B NE  1 
ATOM   10013 C CZ  . ARG B  1 221  ? 172.814 247.525 241.697 1.00 46.61  ? 190  ARG B CZ  1 
ATOM   10014 N NH1 . ARG B  1 221  ? 173.838 248.227 241.237 1.00 46.61  ? 190  ARG B NH1 1 
ATOM   10015 N NH2 . ARG B  1 221  ? 171.709 248.147 242.078 1.00 46.61  ? 190  ARG B NH2 1 
ATOM   10016 N N   . GLU B  1 222  ? 176.699 241.594 237.815 1.00 40.29  ? 191  GLU B N   1 
ATOM   10017 C CA  . GLU B  1 222  ? 177.186 240.239 237.604 1.00 40.29  ? 191  GLU B CA  1 
ATOM   10018 C C   . GLU B  1 222  ? 178.266 239.907 238.621 1.00 40.29  ? 191  GLU B C   1 
ATOM   10019 O O   . GLU B  1 222  ? 179.174 240.711 238.843 1.00 40.29  ? 191  GLU B O   1 
ATOM   10020 C CB  . GLU B  1 222  ? 177.723 240.067 236.186 1.00 40.29  ? 191  GLU B CB  1 
ATOM   10021 C CG  . GLU B  1 222  ? 176.659 240.211 235.122 1.00 40.29  ? 191  GLU B CG  1 
ATOM   10022 C CD  . GLU B  1 222  ? 177.213 240.115 233.721 1.00 40.29  ? 191  GLU B CD  1 
ATOM   10023 O OE1 . GLU B  1 222  ? 178.444 240.213 233.551 1.00 40.29  ? 191  GLU B OE1 1 
ATOM   10024 O OE2 . GLU B  1 222  ? 176.416 239.928 232.782 1.00 40.29  ? 191  GLU B OE2 1 
ATOM   10025 N N   . PHE B  1 223  ? 178.161 238.729 239.240 1.00 32.95  ? 192  PHE B N   1 
ATOM   10026 C CA  . PHE B  1 223  ? 179.117 238.250 240.229 1.00 32.95  ? 192  PHE B CA  1 
ATOM   10027 C C   . PHE B  1 223  ? 179.542 236.830 239.892 1.00 32.95  ? 192  PHE B C   1 
ATOM   10028 O O   . PHE B  1 223  ? 178.761 236.046 239.351 1.00 32.95  ? 192  PHE B O   1 
ATOM   10029 C CB  . PHE B  1 223  ? 178.553 238.232 241.653 1.00 32.95  ? 192  PHE B CB  1 
ATOM   10030 C CG  . PHE B  1 223  ? 178.140 239.569 242.173 1.00 32.95  ? 192  PHE B CG  1 
ATOM   10031 C CD1 . PHE B  1 223  ? 176.868 240.052 241.949 1.00 32.95  ? 192  PHE B CD1 1 
ATOM   10032 C CD2 . PHE B  1 223  ? 179.028 240.345 242.886 1.00 32.95  ? 192  PHE B CD2 1 
ATOM   10033 C CE1 . PHE B  1 223  ? 176.489 241.277 242.434 1.00 32.95  ? 192  PHE B CE1 1 
ATOM   10034 C CE2 . PHE B  1 223  ? 178.656 241.575 243.362 1.00 32.95  ? 192  PHE B CE2 1 
ATOM   10035 C CZ  . PHE B  1 223  ? 177.385 242.041 243.136 1.00 32.95  ? 192  PHE B CZ  1 
ATOM   10036 N N   . VAL B  1 224  ? 180.785 236.501 240.231 1.00 31.12  ? 193  VAL B N   1 
ATOM   10037 C CA  . VAL B  1 224  ? 181.283 235.130 240.169 1.00 31.12  ? 193  VAL B CA  1 
ATOM   10038 C C   . VAL B  1 224  ? 181.880 234.779 241.523 1.00 31.12  ? 193  VAL B C   1 
ATOM   10039 O O   . VAL B  1 224  ? 182.717 235.526 242.049 1.00 31.12  ? 193  VAL B O   1 
ATOM   10040 C CB  . VAL B  1 224  ? 182.332 234.939 239.059 1.00 31.12  ? 193  VAL B CB  1 
ATOM   10041 C CG1 . VAL B  1 224  ? 183.029 233.609 239.224 1.00 31.12  ? 193  VAL B CG1 1 
ATOM   10042 C CG2 . VAL B  1 224  ? 181.689 235.025 237.700 1.00 31.12  ? 193  VAL B CG2 1 
ATOM   10043 N N   . PHE B  1 225  ? 181.444 233.647 242.082 1.00 32.06  ? 194  PHE B N   1 
ATOM   10044 C CA  . PHE B  1 225  ? 181.828 233.187 243.411 1.00 32.06  ? 194  PHE B CA  1 
ATOM   10045 C C   . PHE B  1 225  ? 182.581 231.867 243.314 1.00 32.06  ? 194  PHE B C   1 
ATOM   10046 O O   . PHE B  1 225  ? 182.082 230.916 242.697 1.00 32.06  ? 194  PHE B O   1 
ATOM   10047 C CB  . PHE B  1 225  ? 180.602 232.995 244.303 1.00 32.06  ? 194  PHE B CB  1 
ATOM   10048 C CG  . PHE B  1 225  ? 179.822 234.248 244.552 1.00 32.06  ? 194  PHE B CG  1 
ATOM   10049 C CD1 . PHE B  1 225  ? 178.510 234.348 244.137 1.00 32.06  ? 194  PHE B CD1 1 
ATOM   10050 C CD2 . PHE B  1 225  ? 180.397 235.329 245.180 1.00 32.06  ? 194  PHE B CD2 1 
ATOM   10051 C CE1 . PHE B  1 225  ? 177.790 235.487 244.360 1.00 32.06  ? 194  PHE B CE1 1 
ATOM   10052 C CE2 . PHE B  1 225  ? 179.674 236.471 245.402 1.00 32.06  ? 194  PHE B CE2 1 
ATOM   10053 C CZ  . PHE B  1 225  ? 178.372 236.549 244.988 1.00 32.06  ? 194  PHE B CZ  1 
ATOM   10054 N N   . LYS B  1 226  ? 183.762 231.802 243.935 1.00 33.75  ? 195  LYS B N   1 
ATOM   10055 C CA  . LYS B  1 226  ? 184.582 230.593 243.965 1.00 33.75  ? 195  LYS B CA  1 
ATOM   10056 C C   . LYS B  1 226  ? 185.054 230.327 245.390 1.00 33.75  ? 195  LYS B C   1 
ATOM   10057 O O   . LYS B  1 226  ? 185.159 231.243 246.203 1.00 33.75  ? 195  LYS B O   1 
ATOM   10058 C CB  . LYS B  1 226  ? 185.787 230.692 243.027 1.00 33.75  ? 195  LYS B CB  1 
ATOM   10059 C CG  . LYS B  1 226  ? 185.428 230.821 241.572 1.00 33.75  ? 195  LYS B CG  1 
ATOM   10060 C CD  . LYS B  1 226  ? 186.588 231.358 240.767 1.00 33.75  ? 195  LYS B CD  1 
ATOM   10061 C CE  . LYS B  1 226  ? 187.672 230.333 240.603 1.00 33.75  ? 195  LYS B CE  1 
ATOM   10062 N NZ  . LYS B  1 226  ? 188.741 230.840 239.718 1.00 33.75  ? 195  LYS B NZ  1 
ATOM   10063 N N   . ASN B  1 227  ? 185.359 229.061 245.685 1.00 36.29  ? 196  ASN B N   1 
ATOM   10064 C CA  . ASN B  1 227  ? 185.812 228.637 247.017 1.00 36.29  ? 196  ASN B CA  1 
ATOM   10065 C C   . ASN B  1 227  ? 186.983 227.668 246.861 1.00 36.29  ? 196  ASN B C   1 
ATOM   10066 O O   . ASN B  1 227  ? 186.770 226.479 246.616 1.00 36.29  ? 196  ASN B O   1 
ATOM   10067 C CB  . ASN B  1 227  ? 184.660 227.989 247.775 1.00 36.29  ? 196  ASN B CB  1 
ATOM   10068 C CG  . ASN B  1 227  ? 184.857 227.995 249.271 1.00 36.29  ? 196  ASN B CG  1 
ATOM   10069 O OD1 . ASN B  1 227  ? 185.603 228.802 249.809 1.00 36.29  ? 196  ASN B OD1 1 
ATOM   10070 N ND2 . ASN B  1 227  ? 184.171 227.094 249.954 1.00 36.29  ? 196  ASN B ND2 1 
ATOM   10071 N N   . ILE B  1 228  ? 188.213 228.163 247.013 1.00 40.98  ? 197  ILE B N   1 
ATOM   10072 C CA  . ILE B  1 228  ? 189.411 227.364 246.742 1.00 40.98  ? 197  ILE B CA  1 
ATOM   10073 C C   . ILE B  1 228  ? 190.435 227.552 247.860 1.00 40.98  ? 197  ILE B C   1 
ATOM   10074 O O   . ILE B  1 228  ? 190.852 228.681 248.137 1.00 40.98  ? 197  ILE B O   1 
ATOM   10075 C CB  . ILE B  1 228  ? 190.049 227.733 245.392 1.00 40.98  ? 197  ILE B CB  1 
ATOM   10076 C CG1 . ILE B  1 228  ? 189.083 227.456 244.244 1.00 40.98  ? 197  ILE B CG1 1 
ATOM   10077 C CG2 . ILE B  1 228  ? 191.330 226.954 245.190 1.00 40.98  ? 197  ILE B CG2 1 
ATOM   10078 C CD1 . ILE B  1 228  ? 189.583 227.937 242.913 1.00 40.98  ? 197  ILE B CD1 1 
ATOM   10079 N N   . ASP B  1 229  ? 190.853 226.445 248.479 1.00 42.54  ? 198  ASP B N   1 
ATOM   10080 C CA  . ASP B  1 229  ? 191.934 226.408 249.476 1.00 42.54  ? 198  ASP B CA  1 
ATOM   10081 C C   . ASP B  1 229  ? 191.720 227.408 250.606 1.00 42.54  ? 198  ASP B C   1 
ATOM   10082 O O   . ASP B  1 229  ? 192.637 228.119 251.019 1.00 42.54  ? 198  ASP B O   1 
ATOM   10083 C CB  . ASP B  1 229  ? 193.302 226.637 248.830 1.00 42.54  ? 198  ASP B CB  1 
ATOM   10084 C CG  . ASP B  1 229  ? 193.787 225.445 248.032 1.00 42.54  ? 198  ASP B CG  1 
ATOM   10085 O OD1 . ASP B  1 229  ? 193.259 224.330 248.223 1.00 42.54  ? 198  ASP B OD1 1 
ATOM   10086 O OD2 . ASP B  1 229  ? 194.720 225.622 247.224 1.00 42.54  ? 198  ASP B OD2 1 
ATOM   10087 N N   . GLY B  1 230  ? 190.500 227.462 251.119 1.00 40.01  ? 199  GLY B N   1 
ATOM   10088 C CA  . GLY B  1 230  ? 190.220 228.351 252.220 1.00 40.01  ? 199  GLY B CA  1 
ATOM   10089 C C   . GLY B  1 230  ? 189.973 229.785 251.831 1.00 40.01  ? 199  GLY B C   1 
ATOM   10090 O O   . GLY B  1 230  ? 189.769 230.619 252.718 1.00 40.01  ? 199  GLY B O   1 
ATOM   10091 N N   . TYR B  1 231  ? 190.011 230.109 250.543 1.00 38.28  ? 200  TYR B N   1 
ATOM   10092 C CA  . TYR B  1 231  ? 189.762 231.457 250.059 1.00 38.28  ? 200  TYR B CA  1 
ATOM   10093 C C   . TYR B  1 231  ? 188.432 231.498 249.327 1.00 38.28  ? 200  TYR B C   1 
ATOM   10094 O O   . TYR B  1 231  ? 188.191 230.687 248.432 1.00 38.28  ? 200  TYR B O   1 
ATOM   10095 C CB  . TYR B  1 231  ? 190.891 231.898 249.131 1.00 38.28  ? 200  TYR B CB  1 
ATOM   10096 C CG  . TYR B  1 231  ? 192.186 232.122 249.866 1.00 38.28  ? 200  TYR B CG  1 
ATOM   10097 C CD1 . TYR B  1 231  ? 193.188 231.165 249.829 1.00 38.28  ? 200  TYR B CD1 1 
ATOM   10098 C CD2 . TYR B  1 231  ? 192.410 233.278 250.592 1.00 38.28  ? 200  TYR B CD2 1 
ATOM   10099 C CE1 . TYR B  1 231  ? 194.370 231.346 250.499 1.00 38.28  ? 200  TYR B CE1 1 
ATOM   10100 C CE2 . TYR B  1 231  ? 193.593 233.471 251.268 1.00 38.28  ? 200  TYR B CE2 1 
ATOM   10101 C CZ  . TYR B  1 231  ? 194.571 232.499 251.216 1.00 38.28  ? 200  TYR B CZ  1 
ATOM   10102 O OH  . TYR B  1 231  ? 195.760 232.668 251.882 1.00 38.28  ? 200  TYR B OH  1 
ATOM   10103 N N   . PHE B  1 232  ? 187.582 232.443 249.703 1.00 33.32  ? 201  PHE B N   1 
ATOM   10104 C CA  . PHE B  1 232  ? 186.350 232.747 248.986 1.00 33.32  ? 201  PHE B CA  1 
ATOM   10105 C C   . PHE B  1 232  ? 186.622 233.927 248.060 1.00 33.32  ? 201  PHE B C   1 
ATOM   10106 O O   . PHE B  1 232  ? 186.880 235.040 248.525 1.00 33.32  ? 201  PHE B O   1 
ATOM   10107 C CB  . PHE B  1 232  ? 185.215 233.042 249.961 1.00 33.32  ? 201  PHE B CB  1 
ATOM   10108 C CG  . PHE B  1 232  ? 183.871 233.154 249.312 1.00 33.32  ? 201  PHE B CG  1 
ATOM   10109 C CD1 . PHE B  1 232  ? 183.131 232.025 249.027 1.00 33.32  ? 201  PHE B CD1 1 
ATOM   10110 C CD2 . PHE B  1 232  ? 183.333 234.390 249.018 1.00 33.32  ? 201  PHE B CD2 1 
ATOM   10111 C CE1 . PHE B  1 232  ? 181.899 232.127 248.435 1.00 33.32  ? 201  PHE B CE1 1 
ATOM   10112 C CE2 . PHE B  1 232  ? 182.099 234.495 248.426 1.00 33.32  ? 201  PHE B CE2 1 
ATOM   10113 C CZ  . PHE B  1 232  ? 181.382 233.363 248.135 1.00 33.32  ? 201  PHE B CZ  1 
ATOM   10114 N N   . LYS B  1 233  ? 186.585 233.681 246.757 1.00 34.39  ? 202  LYS B N   1 
ATOM   10115 C CA  . LYS B  1 233  ? 186.985 234.661 245.758 1.00 34.39  ? 202  LYS B CA  1 
ATOM   10116 C C   . LYS B  1 233  ? 185.747 235.232 245.088 1.00 34.39  ? 202  LYS B C   1 
ATOM   10117 O O   . LYS B  1 233  ? 184.862 234.476 244.668 1.00 34.39  ? 202  LYS B O   1 
ATOM   10118 C CB  . LYS B  1 233  ? 187.881 234.016 244.706 1.00 34.39  ? 202  LYS B CB  1 
ATOM   10119 C CG  . LYS B  1 233  ? 189.213 233.562 245.226 1.00 34.39  ? 202  LYS B CG  1 
ATOM   10120 C CD  . LYS B  1 233  ? 190.041 232.973 244.118 1.00 34.39  ? 202  LYS B CD  1 
ATOM   10121 C CE  . LYS B  1 233  ? 191.407 232.587 244.620 1.00 34.39  ? 202  LYS B CE  1 
ATOM   10122 N NZ  . LYS B  1 233  ? 192.226 231.998 243.531 1.00 34.39  ? 202  LYS B NZ  1 
ATOM   10123 N N   . ILE B  1 234  ? 185.707 236.556 244.956 1.00 31.72  ? 203  ILE B N   1 
ATOM   10124 C CA  . ILE B  1 234  ? 184.577 237.260 244.364 1.00 31.72  ? 203  ILE B CA  1 
ATOM   10125 C C   . ILE B  1 234  ? 185.087 238.143 243.235 1.00 31.72  ? 203  ILE B C   1 
ATOM   10126 O O   . ILE B  1 234  ? 185.967 238.988 243.460 1.00 31.72  ? 203  ILE B O   1 
ATOM   10127 C CB  . ILE B  1 234  ? 183.822 238.112 245.398 1.00 31.72  ? 203  ILE B CB  1 
ATOM   10128 C CG1 . ILE B  1 234  ? 183.441 237.275 246.613 1.00 31.72  ? 203  ILE B CG1 1 
ATOM   10129 C CG2 . ILE B  1 234  ? 182.576 238.701 244.785 1.00 31.72  ? 203  ILE B CG2 1 
ATOM   10130 C CD1 . ILE B  1 234  ? 182.816 238.070 247.727 1.00 31.72  ? 203  ILE B CD1 1 
ATOM   10131 N N   . TYR B  1 235  ? 184.511 237.961 242.040 1.00 32.09  ? 204  TYR B N   1 
ATOM   10132 C CA  . TYR B  1 235  ? 184.664 238.860 240.900 1.00 32.09  ? 204  TYR B CA  1 
ATOM   10133 C C   . TYR B  1 235  ? 183.321 239.521 240.617 1.00 32.09  ? 204  TYR B C   1 
ATOM   10134 O O   . TYR B  1 235  ? 182.271 238.924 240.856 1.00 32.09  ? 204  TYR B O   1 
ATOM   10135 C CB  . TYR B  1 235  ? 185.132 238.110 239.647 1.00 32.09  ? 204  TYR B CB  1 
ATOM   10136 C CG  . TYR B  1 235  ? 186.364 237.265 239.843 1.00 32.09  ? 204  TYR B CG