data_7CAL
# 
_entry.id   7CAL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.334 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   7CAL         
WWPDB D_1300017239 
EMDB  EMD-30334    
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        
'Cryo-EM Structure of the Hyperpolarization-Activated Inwardly Rectifying Potassium Channel KAT1 from Arabidopsis' 
_pdbx_database_related.db_id          EMD-30334 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        7CAL 
_pdbx_database_status.recvd_initial_deposition_date   2020-06-09 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Li, S.Y.'    1  ? 
'Yang, F.'    2  ? 
'Sun, D.M.'   3  ? 
'Zhang, Y.'   4  ? 
'Zhang, M.G.' 5  ? 
'Zhou, P.'    6  ? 
'Liu, S.L.'   7  ? 
'Zhang, Y.N.' 8  ? 
'Zhang, L.H.' 9  ? 
'Tian, C.L.'  10 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   CN 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Cell Res.' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1001-0602 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            30 
_citation.language                  ? 
_citation.page_first                1049 
_citation.page_last                 1052 
_citation.title                     
'Cryo-EM structure of the hyperpolarization-activated inwardly rectifying potassium channel KAT1 from Arabidopsis.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41422-020-00407-3 
_citation.pdbx_database_id_PubMed   32901112 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Li, S.'    1  ? 
primary 'Yang, F.'  2  ? 
primary 'Sun, D.'   3  ? 
primary 'Zhang, Y.' 4  ? 
primary 'Zhang, M.' 5  ? 
primary 'Liu, S.'   6  ? 
primary 'Zhou, P.'  7  ? 
primary 'Shi, C.'   8  ? 
primary 'Zhang, L.' 9  ? 
primary 'Tian, C.'  10 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     7CAL 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.00 
_cell.length_a_esd                 ? 
_cell.length_b                     1.00 
_cell.length_b_esd                 ? 
_cell.length_c                     1.00 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        ? 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         7CAL 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Potassium channel KAT1'                    78361.445 4 ? ? ? ? 
2 non-polymer syn 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOETHANOLAMINE 748.065   4 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSISWTRNFFERFCVEEYNIDTIKQSSFLSADLLPSLGARINQSTKLRKHIISPFNPRYRAWEMWLVLLVIYSAWICPFQ
FAFITYKKDAIFIIDNIVNGFFAIDIILTFFVAYLDSHSYLLVDSPKKIAIRYLSTWFAFDVCSTAPFQPLSLLFNYNGS
ELGFRILSMLRLWRLRRVSSLFARLEKDIRFNYFWIRCTKLISVTLFAIHCAGCFNYLIADRYPNPRKTWIGAVYPNFKE
ASLWNRYVTALYWSITTLTTTGYGDFHAENPREMLFDIFFMMFNLGLTAYLIGNMTNLVVHWTSRTRTFRDSVRAASEFA
SRNQLPHDIQDQMLSHICLKFKTEGLKQQETLNNLPKAIRSSIANYLFFPIVHNIYLFQGVSRNFLFQLVSDIDAEYFPP
KEDIILQNEAPTDLYILVSGAVDFTVYVDGHDQFQGKAVIGETFGEVGVLYYRPQPFTVRTTELSQILRISRTSLMSAMH
AHADDGRVIMNNLFMKLRGQQSIAIDDSNTSGHENRDFKSMGWEEWRDSRKDGYGLDVTNPTSDTALMDAIHKEDTEMVK
KILKEQKIERAKVERSSSETAGRSYANDSSKKDPYCSSSNQIIKPCKREEKRVTIHMMSESKNGKLILLPSSIEELLRLA
SEKFGGCNFTKITNADNAEIDDLDVIWDGDHLYFSSN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSISWTRNFFERFCVEEYNIDTIKQSSFLSADLLPSLGARINQSTKLRKHIISPFNPRYRAWEMWLVLLVIYSAWICPFQ
FAFITYKKDAIFIIDNIVNGFFAIDIILTFFVAYLDSHSYLLVDSPKKIAIRYLSTWFAFDVCSTAPFQPLSLLFNYNGS
ELGFRILSMLRLWRLRRVSSLFARLEKDIRFNYFWIRCTKLISVTLFAIHCAGCFNYLIADRYPNPRKTWIGAVYPNFKE
ASLWNRYVTALYWSITTLTTTGYGDFHAENPREMLFDIFFMMFNLGLTAYLIGNMTNLVVHWTSRTRTFRDSVRAASEFA
SRNQLPHDIQDQMLSHICLKFKTEGLKQQETLNNLPKAIRSSIANYLFFPIVHNIYLFQGVSRNFLFQLVSDIDAEYFPP
KEDIILQNEAPTDLYILVSGAVDFTVYVDGHDQFQGKAVIGETFGEVGVLYYRPQPFTVRTTELSQILRISRTSLMSAMH
AHADDGRVIMNNLFMKLRGQQSIAIDDSNTSGHENRDFKSMGWEEWRDSRKDGYGLDVTNPTSDTALMDAIHKEDTEMVK
KILKEQKIERAKVERSSSETAGRSYANDSSKKDPYCSSSNQIIKPCKREEKRVTIHMMSESKNGKLILLPSSIEELLRLA
SEKFGGCNFTKITNADNAEIDDLDVIWDGDHLYFSSN
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   ILE n 
1 4   SER n 
1 5   TRP n 
1 6   THR n 
1 7   ARG n 
1 8   ASN n 
1 9   PHE n 
1 10  PHE n 
1 11  GLU n 
1 12  ARG n 
1 13  PHE n 
1 14  CYS n 
1 15  VAL n 
1 16  GLU n 
1 17  GLU n 
1 18  TYR n 
1 19  ASN n 
1 20  ILE n 
1 21  ASP n 
1 22  THR n 
1 23  ILE n 
1 24  LYS n 
1 25  GLN n 
1 26  SER n 
1 27  SER n 
1 28  PHE n 
1 29  LEU n 
1 30  SER n 
1 31  ALA n 
1 32  ASP n 
1 33  LEU n 
1 34  LEU n 
1 35  PRO n 
1 36  SER n 
1 37  LEU n 
1 38  GLY n 
1 39  ALA n 
1 40  ARG n 
1 41  ILE n 
1 42  ASN n 
1 43  GLN n 
1 44  SER n 
1 45  THR n 
1 46  LYS n 
1 47  LEU n 
1 48  ARG n 
1 49  LYS n 
1 50  HIS n 
1 51  ILE n 
1 52  ILE n 
1 53  SER n 
1 54  PRO n 
1 55  PHE n 
1 56  ASN n 
1 57  PRO n 
1 58  ARG n 
1 59  TYR n 
1 60  ARG n 
1 61  ALA n 
1 62  TRP n 
1 63  GLU n 
1 64  MET n 
1 65  TRP n 
1 66  LEU n 
1 67  VAL n 
1 68  LEU n 
1 69  LEU n 
1 70  VAL n 
1 71  ILE n 
1 72  TYR n 
1 73  SER n 
1 74  ALA n 
1 75  TRP n 
1 76  ILE n 
1 77  CYS n 
1 78  PRO n 
1 79  PHE n 
1 80  GLN n 
1 81  PHE n 
1 82  ALA n 
1 83  PHE n 
1 84  ILE n 
1 85  THR n 
1 86  TYR n 
1 87  LYS n 
1 88  LYS n 
1 89  ASP n 
1 90  ALA n 
1 91  ILE n 
1 92  PHE n 
1 93  ILE n 
1 94  ILE n 
1 95  ASP n 
1 96  ASN n 
1 97  ILE n 
1 98  VAL n 
1 99  ASN n 
1 100 GLY n 
1 101 PHE n 
1 102 PHE n 
1 103 ALA n 
1 104 ILE n 
1 105 ASP n 
1 106 ILE n 
1 107 ILE n 
1 108 LEU n 
1 109 THR n 
1 110 PHE n 
1 111 PHE n 
1 112 VAL n 
1 113 ALA n 
1 114 TYR n 
1 115 LEU n 
1 116 ASP n 
1 117 SER n 
1 118 HIS n 
1 119 SER n 
1 120 TYR n 
1 121 LEU n 
1 122 LEU n 
1 123 VAL n 
1 124 ASP n 
1 125 SER n 
1 126 PRO n 
1 127 LYS n 
1 128 LYS n 
1 129 ILE n 
1 130 ALA n 
1 131 ILE n 
1 132 ARG n 
1 133 TYR n 
1 134 LEU n 
1 135 SER n 
1 136 THR n 
1 137 TRP n 
1 138 PHE n 
1 139 ALA n 
1 140 PHE n 
1 141 ASP n 
1 142 VAL n 
1 143 CYS n 
1 144 SER n 
1 145 THR n 
1 146 ALA n 
1 147 PRO n 
1 148 PHE n 
1 149 GLN n 
1 150 PRO n 
1 151 LEU n 
1 152 SER n 
1 153 LEU n 
1 154 LEU n 
1 155 PHE n 
1 156 ASN n 
1 157 TYR n 
1 158 ASN n 
1 159 GLY n 
1 160 SER n 
1 161 GLU n 
1 162 LEU n 
1 163 GLY n 
1 164 PHE n 
1 165 ARG n 
1 166 ILE n 
1 167 LEU n 
1 168 SER n 
1 169 MET n 
1 170 LEU n 
1 171 ARG n 
1 172 LEU n 
1 173 TRP n 
1 174 ARG n 
1 175 LEU n 
1 176 ARG n 
1 177 ARG n 
1 178 VAL n 
1 179 SER n 
1 180 SER n 
1 181 LEU n 
1 182 PHE n 
1 183 ALA n 
1 184 ARG n 
1 185 LEU n 
1 186 GLU n 
1 187 LYS n 
1 188 ASP n 
1 189 ILE n 
1 190 ARG n 
1 191 PHE n 
1 192 ASN n 
1 193 TYR n 
1 194 PHE n 
1 195 TRP n 
1 196 ILE n 
1 197 ARG n 
1 198 CYS n 
1 199 THR n 
1 200 LYS n 
1 201 LEU n 
1 202 ILE n 
1 203 SER n 
1 204 VAL n 
1 205 THR n 
1 206 LEU n 
1 207 PHE n 
1 208 ALA n 
1 209 ILE n 
1 210 HIS n 
1 211 CYS n 
1 212 ALA n 
1 213 GLY n 
1 214 CYS n 
1 215 PHE n 
1 216 ASN n 
1 217 TYR n 
1 218 LEU n 
1 219 ILE n 
1 220 ALA n 
1 221 ASP n 
1 222 ARG n 
1 223 TYR n 
1 224 PRO n 
1 225 ASN n 
1 226 PRO n 
1 227 ARG n 
1 228 LYS n 
1 229 THR n 
1 230 TRP n 
1 231 ILE n 
1 232 GLY n 
1 233 ALA n 
1 234 VAL n 
1 235 TYR n 
1 236 PRO n 
1 237 ASN n 
1 238 PHE n 
1 239 LYS n 
1 240 GLU n 
1 241 ALA n 
1 242 SER n 
1 243 LEU n 
1 244 TRP n 
1 245 ASN n 
1 246 ARG n 
1 247 TYR n 
1 248 VAL n 
1 249 THR n 
1 250 ALA n 
1 251 LEU n 
1 252 TYR n 
1 253 TRP n 
1 254 SER n 
1 255 ILE n 
1 256 THR n 
1 257 THR n 
1 258 LEU n 
1 259 THR n 
1 260 THR n 
1 261 THR n 
1 262 GLY n 
1 263 TYR n 
1 264 GLY n 
1 265 ASP n 
1 266 PHE n 
1 267 HIS n 
1 268 ALA n 
1 269 GLU n 
1 270 ASN n 
1 271 PRO n 
1 272 ARG n 
1 273 GLU n 
1 274 MET n 
1 275 LEU n 
1 276 PHE n 
1 277 ASP n 
1 278 ILE n 
1 279 PHE n 
1 280 PHE n 
1 281 MET n 
1 282 MET n 
1 283 PHE n 
1 284 ASN n 
1 285 LEU n 
1 286 GLY n 
1 287 LEU n 
1 288 THR n 
1 289 ALA n 
1 290 TYR n 
1 291 LEU n 
1 292 ILE n 
1 293 GLY n 
1 294 ASN n 
1 295 MET n 
1 296 THR n 
1 297 ASN n 
1 298 LEU n 
1 299 VAL n 
1 300 VAL n 
1 301 HIS n 
1 302 TRP n 
1 303 THR n 
1 304 SER n 
1 305 ARG n 
1 306 THR n 
1 307 ARG n 
1 308 THR n 
1 309 PHE n 
1 310 ARG n 
1 311 ASP n 
1 312 SER n 
1 313 VAL n 
1 314 ARG n 
1 315 ALA n 
1 316 ALA n 
1 317 SER n 
1 318 GLU n 
1 319 PHE n 
1 320 ALA n 
1 321 SER n 
1 322 ARG n 
1 323 ASN n 
1 324 GLN n 
1 325 LEU n 
1 326 PRO n 
1 327 HIS n 
1 328 ASP n 
1 329 ILE n 
1 330 GLN n 
1 331 ASP n 
1 332 GLN n 
1 333 MET n 
1 334 LEU n 
1 335 SER n 
1 336 HIS n 
1 337 ILE n 
1 338 CYS n 
1 339 LEU n 
1 340 LYS n 
1 341 PHE n 
1 342 LYS n 
1 343 THR n 
1 344 GLU n 
1 345 GLY n 
1 346 LEU n 
1 347 LYS n 
1 348 GLN n 
1 349 GLN n 
1 350 GLU n 
1 351 THR n 
1 352 LEU n 
1 353 ASN n 
1 354 ASN n 
1 355 LEU n 
1 356 PRO n 
1 357 LYS n 
1 358 ALA n 
1 359 ILE n 
1 360 ARG n 
1 361 SER n 
1 362 SER n 
1 363 ILE n 
1 364 ALA n 
1 365 ASN n 
1 366 TYR n 
1 367 LEU n 
1 368 PHE n 
1 369 PHE n 
1 370 PRO n 
1 371 ILE n 
1 372 VAL n 
1 373 HIS n 
1 374 ASN n 
1 375 ILE n 
1 376 TYR n 
1 377 LEU n 
1 378 PHE n 
1 379 GLN n 
1 380 GLY n 
1 381 VAL n 
1 382 SER n 
1 383 ARG n 
1 384 ASN n 
1 385 PHE n 
1 386 LEU n 
1 387 PHE n 
1 388 GLN n 
1 389 LEU n 
1 390 VAL n 
1 391 SER n 
1 392 ASP n 
1 393 ILE n 
1 394 ASP n 
1 395 ALA n 
1 396 GLU n 
1 397 TYR n 
1 398 PHE n 
1 399 PRO n 
1 400 PRO n 
1 401 LYS n 
1 402 GLU n 
1 403 ASP n 
1 404 ILE n 
1 405 ILE n 
1 406 LEU n 
1 407 GLN n 
1 408 ASN n 
1 409 GLU n 
1 410 ALA n 
1 411 PRO n 
1 412 THR n 
1 413 ASP n 
1 414 LEU n 
1 415 TYR n 
1 416 ILE n 
1 417 LEU n 
1 418 VAL n 
1 419 SER n 
1 420 GLY n 
1 421 ALA n 
1 422 VAL n 
1 423 ASP n 
1 424 PHE n 
1 425 THR n 
1 426 VAL n 
1 427 TYR n 
1 428 VAL n 
1 429 ASP n 
1 430 GLY n 
1 431 HIS n 
1 432 ASP n 
1 433 GLN n 
1 434 PHE n 
1 435 GLN n 
1 436 GLY n 
1 437 LYS n 
1 438 ALA n 
1 439 VAL n 
1 440 ILE n 
1 441 GLY n 
1 442 GLU n 
1 443 THR n 
1 444 PHE n 
1 445 GLY n 
1 446 GLU n 
1 447 VAL n 
1 448 GLY n 
1 449 VAL n 
1 450 LEU n 
1 451 TYR n 
1 452 TYR n 
1 453 ARG n 
1 454 PRO n 
1 455 GLN n 
1 456 PRO n 
1 457 PHE n 
1 458 THR n 
1 459 VAL n 
1 460 ARG n 
1 461 THR n 
1 462 THR n 
1 463 GLU n 
1 464 LEU n 
1 465 SER n 
1 466 GLN n 
1 467 ILE n 
1 468 LEU n 
1 469 ARG n 
1 470 ILE n 
1 471 SER n 
1 472 ARG n 
1 473 THR n 
1 474 SER n 
1 475 LEU n 
1 476 MET n 
1 477 SER n 
1 478 ALA n 
1 479 MET n 
1 480 HIS n 
1 481 ALA n 
1 482 HIS n 
1 483 ALA n 
1 484 ASP n 
1 485 ASP n 
1 486 GLY n 
1 487 ARG n 
1 488 VAL n 
1 489 ILE n 
1 490 MET n 
1 491 ASN n 
1 492 ASN n 
1 493 LEU n 
1 494 PHE n 
1 495 MET n 
1 496 LYS n 
1 497 LEU n 
1 498 ARG n 
1 499 GLY n 
1 500 GLN n 
1 501 GLN n 
1 502 SER n 
1 503 ILE n 
1 504 ALA n 
1 505 ILE n 
1 506 ASP n 
1 507 ASP n 
1 508 SER n 
1 509 ASN n 
1 510 THR n 
1 511 SER n 
1 512 GLY n 
1 513 HIS n 
1 514 GLU n 
1 515 ASN n 
1 516 ARG n 
1 517 ASP n 
1 518 PHE n 
1 519 LYS n 
1 520 SER n 
1 521 MET n 
1 522 GLY n 
1 523 TRP n 
1 524 GLU n 
1 525 GLU n 
1 526 TRP n 
1 527 ARG n 
1 528 ASP n 
1 529 SER n 
1 530 ARG n 
1 531 LYS n 
1 532 ASP n 
1 533 GLY n 
1 534 TYR n 
1 535 GLY n 
1 536 LEU n 
1 537 ASP n 
1 538 VAL n 
1 539 THR n 
1 540 ASN n 
1 541 PRO n 
1 542 THR n 
1 543 SER n 
1 544 ASP n 
1 545 THR n 
1 546 ALA n 
1 547 LEU n 
1 548 MET n 
1 549 ASP n 
1 550 ALA n 
1 551 ILE n 
1 552 HIS n 
1 553 LYS n 
1 554 GLU n 
1 555 ASP n 
1 556 THR n 
1 557 GLU n 
1 558 MET n 
1 559 VAL n 
1 560 LYS n 
1 561 LYS n 
1 562 ILE n 
1 563 LEU n 
1 564 LYS n 
1 565 GLU n 
1 566 GLN n 
1 567 LYS n 
1 568 ILE n 
1 569 GLU n 
1 570 ARG n 
1 571 ALA n 
1 572 LYS n 
1 573 VAL n 
1 574 GLU n 
1 575 ARG n 
1 576 SER n 
1 577 SER n 
1 578 SER n 
1 579 GLU n 
1 580 THR n 
1 581 ALA n 
1 582 GLY n 
1 583 ARG n 
1 584 SER n 
1 585 TYR n 
1 586 ALA n 
1 587 ASN n 
1 588 ASP n 
1 589 SER n 
1 590 SER n 
1 591 LYS n 
1 592 LYS n 
1 593 ASP n 
1 594 PRO n 
1 595 TYR n 
1 596 CYS n 
1 597 SER n 
1 598 SER n 
1 599 SER n 
1 600 ASN n 
1 601 GLN n 
1 602 ILE n 
1 603 ILE n 
1 604 LYS n 
1 605 PRO n 
1 606 CYS n 
1 607 LYS n 
1 608 ARG n 
1 609 GLU n 
1 610 GLU n 
1 611 LYS n 
1 612 ARG n 
1 613 VAL n 
1 614 THR n 
1 615 ILE n 
1 616 HIS n 
1 617 MET n 
1 618 MET n 
1 619 SER n 
1 620 GLU n 
1 621 SER n 
1 622 LYS n 
1 623 ASN n 
1 624 GLY n 
1 625 LYS n 
1 626 LEU n 
1 627 ILE n 
1 628 LEU n 
1 629 LEU n 
1 630 PRO n 
1 631 SER n 
1 632 SER n 
1 633 ILE n 
1 634 GLU n 
1 635 GLU n 
1 636 LEU n 
1 637 LEU n 
1 638 ARG n 
1 639 LEU n 
1 640 ALA n 
1 641 SER n 
1 642 GLU n 
1 643 LYS n 
1 644 PHE n 
1 645 GLY n 
1 646 GLY n 
1 647 CYS n 
1 648 ASN n 
1 649 PHE n 
1 650 THR n 
1 651 LYS n 
1 652 ILE n 
1 653 THR n 
1 654 ASN n 
1 655 ALA n 
1 656 ASP n 
1 657 ASN n 
1 658 ALA n 
1 659 GLU n 
1 660 ILE n 
1 661 ASP n 
1 662 ASP n 
1 663 LEU n 
1 664 ASP n 
1 665 VAL n 
1 666 ILE n 
1 667 TRP n 
1 668 ASP n 
1 669 GLY n 
1 670 ASP n 
1 671 HIS n 
1 672 LEU n 
1 673 TYR n 
1 674 PHE n 
1 675 SER n 
1 676 SER n 
1 677 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   677 
_entity_src_gen.gene_src_common_name               'Mouse-ear cress' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'KAT1, At5g46240, MPL12.2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Arabidopsis thaliana' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     3702 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    KAT1_ARATH 
_struct_ref.pdbx_db_accession          Q39128 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSISWTRNFFERFCVEEYNIDTIKQSSFLSADLLPSLGARINQSTKLRKHIISPFNPRYRAWEMWLVLLVIYSAWICPFQ
FAFITYKKDAIFIIDNIVNGFFAIDIILTFFVAYLDSHSYLLVDSPKKIAIRYLSTWFAFDVCSTAPFQPLSLLFNYNGS
ELGFRILSMLRLWRLRRVSSLFARLEKDIRFNYFWIRCTKLISVTLFAIHCAGCFNYLIADRYPNPRKTWIGAVYPNFKE
ASLWNRYVTALYWSITTLTTTGYGDFHAENPREMLFDIFFMMFNLGLTAYLIGNMTNLVVHWTSRTRTFRDSVRAASEFA
SRNQLPHDIQDQMLSHICLKFKTEGLKQQETLNNLPKAIRSSIANYLFFPIVHNIYLFQGVSRNFLFQLVSDIDAEYFPP
KEDIILQNEAPTDLYILVSGAVDFTVYVDGHDQFQGKAVIGETFGEVGVLYYRPQPFTVRTTELSQILRISRTSLMSAMH
AHADDGRVIMNNLFMKLRGQQSIAIDDSNTSGHENRDFKSMGWEEWRDSRKDGYGLDVTNPTSDTALMDAIHKEDTEMVK
KILKEQKIERAKVERSSSETAGRSYANDSSKKDPYCSSSNQIIKPCKREEKRVTIHMMSESKNGKLILLPSSIEELLRLA
SEKFGGCNFTKITNADNAEIDDLDVIWDGDHLYFSSN
;
_struct_ref.pdbx_align_begin           1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 7CAL A 1 ? 677 ? Q39128 1 ? 677 ? 1 677 
2 1 7CAL B 1 ? 677 ? Q39128 1 ? 677 ? 1 677 
3 1 7CAL C 1 ? 677 ? Q39128 1 ? 677 ? 1 677 
4 1 7CAL D 1 ? 677 ? Q39128 1 ? 677 ? 1 677 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
3PE non-polymer         . 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOETHANOLAMINE 3-SN-PHOSPHATIDYLETHANOLAMINE 'C41 H82 N O8 P' 748.065 
ALA 'L-peptide linking' y ALANINE                                     ?                             'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                    ?                             'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                  ?                             'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                             ?                             'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                    ?                             'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                   ?                             'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                             ?                             'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                     ?                             'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                   ?                             'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                  ?                             'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                     ?                             'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                      ?                             'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                  ?                             'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                               ?                             'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                     ?                             'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                      ?                             'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                   ?                             'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                  ?                             'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                    ?                             'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                      ?                             'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   7CAL 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 7CAL 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            . 
_refine.ls_d_res_low                             ? 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       'CDL v1.2' 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON MICROSCOPY' ? 0.0071 ? 14480 ? f_bond_d           ? ? 
'ELECTRON MICROSCOPY' ? 1.0017 ? 19724 ? f_angle_d          ? ? 
'ELECTRON MICROSCOPY' ? 0.0604 ? 2224  ? f_chiral_restr     ? ? 
'ELECTRON MICROSCOPY' ? 0.0071 ? 2452  ? f_plane_restr      ? ? 
'ELECTRON MICROSCOPY' ? 7.0304 ? 8344  ? f_dihedral_angle_d ? ? 
# 
_struct.entry_id                     7CAL 
_struct.title                        
'Cryo-EM Structure of the Hyperpolarization-Activated Inwardly Rectifying Potassium Channel KAT1 from Arabidopsis' 
_struct.pdbx_descriptor              'Potassium channel KAT1' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        7CAL 
_struct_keywords.text            'Hyperpolarization-Activated Inwardly Rectifying Potassium Channel, MEMBRANE PROTEIN' 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ALA A 61  ? TYR A 72  ? ALA A 61  TYR A 72  1 ? 12 
HELX_P HELX_P2  AA2 TRP A 75  ? PHE A 83  ? TRP A 75  PHE A 83  1 ? 9  
HELX_P HELX_P3  AA3 ILE A 93  ? THR A 109 ? ILE A 93  THR A 109 1 ? 17 
HELX_P HELX_P4  AA4 SER A 125 ? TRP A 137 ? SER A 125 TRP A 137 1 ? 13 
HELX_P HELX_P5  AA5 PRO A 150 ? LEU A 154 ? PRO A 150 LEU A 154 5 ? 5  
HELX_P HELX_P6  AA6 GLU A 161 ? ILE A 166 ? GLU A 161 ILE A 166 1 ? 6  
HELX_P HELX_P7  AA7 LEU A 167 ? ARG A 174 ? LEU A 167 ARG A 174 5 ? 8  
HELX_P HELX_P8  AA8 LEU A 175 ? GLU A 186 ? LEU A 175 GLU A 186 1 ? 12 
HELX_P HELX_P9  AA9 TYR A 193 ? CYS A 214 ? TYR A 193 CYS A 214 1 ? 22 
HELX_P HELX_P10 AB1 TYR A 217 ? ARG A 222 ? TYR A 217 ARG A 222 1 ? 6  
HELX_P HELX_P11 AB2 TYR A 247 ? THR A 259 ? TYR A 247 THR A 259 1 ? 13 
HELX_P HELX_P12 AB3 ASN A 270 ? MET A 282 ? ASN A 270 MET A 282 1 ? 13 
HELX_P HELX_P13 AB4 MET A 282 ? THR A 303 ? MET A 282 THR A 303 1 ? 22 
HELX_P HELX_P14 AB5 SER A 304 ? ASN A 323 ? SER A 304 ASN A 323 1 ? 20 
HELX_P HELX_P15 AB6 PRO A 326 ? GLU A 344 ? PRO A 326 GLU A 344 1 ? 19 
HELX_P HELX_P16 AB7 ILE A 359 ? LEU A 367 ? ILE A 359 LEU A 367 1 ? 9  
HELX_P HELX_P17 AB8 PHE A 368 ? HIS A 373 ? PHE A 368 HIS A 373 1 ? 6  
HELX_P HELX_P18 AB9 ILE A 375 ? GLN A 379 ? ILE A 375 GLN A 379 5 ? 5  
HELX_P HELX_P19 AC1 HIS A 482 ? ASN A 491 ? HIS A 482 ASN A 491 1 ? 10 
HELX_P HELX_P20 AC2 ALA B 61  ? TYR B 72  ? ALA B 61  TYR B 72  1 ? 12 
HELX_P HELX_P21 AC3 TRP B 75  ? PHE B 83  ? TRP B 75  PHE B 83  1 ? 9  
HELX_P HELX_P22 AC4 ILE B 93  ? THR B 109 ? ILE B 93  THR B 109 1 ? 17 
HELX_P HELX_P23 AC5 SER B 125 ? TRP B 137 ? SER B 125 TRP B 137 1 ? 13 
HELX_P HELX_P24 AC6 PRO B 150 ? LEU B 154 ? PRO B 150 LEU B 154 5 ? 5  
HELX_P HELX_P25 AC7 GLU B 161 ? ILE B 166 ? GLU B 161 ILE B 166 1 ? 6  
HELX_P HELX_P26 AC8 LEU B 167 ? ARG B 174 ? LEU B 167 ARG B 174 5 ? 8  
HELX_P HELX_P27 AC9 LEU B 175 ? GLU B 186 ? LEU B 175 GLU B 186 1 ? 12 
HELX_P HELX_P28 AD1 TYR B 193 ? CYS B 214 ? TYR B 193 CYS B 214 1 ? 22 
HELX_P HELX_P29 AD2 TYR B 217 ? ARG B 222 ? TYR B 217 ARG B 222 1 ? 6  
HELX_P HELX_P30 AD3 TYR B 247 ? THR B 259 ? TYR B 247 THR B 259 1 ? 13 
HELX_P HELX_P31 AD4 ASN B 270 ? MET B 282 ? ASN B 270 MET B 282 1 ? 13 
HELX_P HELX_P32 AD5 MET B 282 ? THR B 303 ? MET B 282 THR B 303 1 ? 22 
HELX_P HELX_P33 AD6 SER B 304 ? ASN B 323 ? SER B 304 ASN B 323 1 ? 20 
HELX_P HELX_P34 AD7 PRO B 326 ? GLU B 344 ? PRO B 326 GLU B 344 1 ? 19 
HELX_P HELX_P35 AD8 ILE B 359 ? LEU B 367 ? ILE B 359 LEU B 367 1 ? 9  
HELX_P HELX_P36 AD9 PHE B 368 ? HIS B 373 ? PHE B 368 HIS B 373 1 ? 6  
HELX_P HELX_P37 AE1 ILE B 375 ? GLN B 379 ? ILE B 375 GLN B 379 5 ? 5  
HELX_P HELX_P38 AE2 HIS B 482 ? ASN B 491 ? HIS B 482 ASN B 491 1 ? 10 
HELX_P HELX_P39 AE3 ALA C 61  ? TYR C 72  ? ALA C 61  TYR C 72  1 ? 12 
HELX_P HELX_P40 AE4 TRP C 75  ? PHE C 83  ? TRP C 75  PHE C 83  1 ? 9  
HELX_P HELX_P41 AE5 ILE C 93  ? THR C 109 ? ILE C 93  THR C 109 1 ? 17 
HELX_P HELX_P42 AE6 SER C 125 ? TRP C 137 ? SER C 125 TRP C 137 1 ? 13 
HELX_P HELX_P43 AE7 PRO C 150 ? LEU C 154 ? PRO C 150 LEU C 154 5 ? 5  
HELX_P HELX_P44 AE8 GLU C 161 ? ILE C 166 ? GLU C 161 ILE C 166 1 ? 6  
HELX_P HELX_P45 AE9 LEU C 167 ? ARG C 174 ? LEU C 167 ARG C 174 5 ? 8  
HELX_P HELX_P46 AF1 LEU C 175 ? GLU C 186 ? LEU C 175 GLU C 186 1 ? 12 
HELX_P HELX_P47 AF2 TYR C 193 ? CYS C 214 ? TYR C 193 CYS C 214 1 ? 22 
HELX_P HELX_P48 AF3 TYR C 217 ? ARG C 222 ? TYR C 217 ARG C 222 1 ? 6  
HELX_P HELX_P49 AF4 TYR C 247 ? THR C 259 ? TYR C 247 THR C 259 1 ? 13 
HELX_P HELX_P50 AF5 ASN C 270 ? MET C 282 ? ASN C 270 MET C 282 1 ? 13 
HELX_P HELX_P51 AF6 MET C 282 ? THR C 303 ? MET C 282 THR C 303 1 ? 22 
HELX_P HELX_P52 AF7 SER C 304 ? ASN C 323 ? SER C 304 ASN C 323 1 ? 20 
HELX_P HELX_P53 AF8 PRO C 326 ? GLU C 344 ? PRO C 326 GLU C 344 1 ? 19 
HELX_P HELX_P54 AF9 ILE C 359 ? LEU C 367 ? ILE C 359 LEU C 367 1 ? 9  
HELX_P HELX_P55 AG1 PHE C 368 ? HIS C 373 ? PHE C 368 HIS C 373 1 ? 6  
HELX_P HELX_P56 AG2 ILE C 375 ? GLN C 379 ? ILE C 375 GLN C 379 5 ? 5  
HELX_P HELX_P57 AG3 HIS C 482 ? ASN C 491 ? HIS C 482 ASN C 491 1 ? 10 
HELX_P HELX_P58 AG4 ALA D 61  ? TYR D 72  ? ALA D 61  TYR D 72  1 ? 12 
HELX_P HELX_P59 AG5 TRP D 75  ? PHE D 83  ? TRP D 75  PHE D 83  1 ? 9  
HELX_P HELX_P60 AG6 ILE D 93  ? THR D 109 ? ILE D 93  THR D 109 1 ? 17 
HELX_P HELX_P61 AG7 SER D 125 ? TRP D 137 ? SER D 125 TRP D 137 1 ? 13 
HELX_P HELX_P62 AG8 PRO D 150 ? LEU D 154 ? PRO D 150 LEU D 154 5 ? 5  
HELX_P HELX_P63 AG9 GLU D 161 ? ILE D 166 ? GLU D 161 ILE D 166 1 ? 6  
HELX_P HELX_P64 AH1 LEU D 167 ? ARG D 174 ? LEU D 167 ARG D 174 5 ? 8  
HELX_P HELX_P65 AH2 LEU D 175 ? GLU D 186 ? LEU D 175 GLU D 186 1 ? 12 
HELX_P HELX_P66 AH3 TYR D 193 ? CYS D 214 ? TYR D 193 CYS D 214 1 ? 22 
HELX_P HELX_P67 AH4 TYR D 217 ? ARG D 222 ? TYR D 217 ARG D 222 1 ? 6  
HELX_P HELX_P68 AH5 TYR D 247 ? THR D 259 ? TYR D 247 THR D 259 1 ? 13 
HELX_P HELX_P69 AH6 ASN D 270 ? MET D 282 ? ASN D 270 MET D 282 1 ? 13 
HELX_P HELX_P70 AH7 MET D 282 ? THR D 303 ? MET D 282 THR D 303 1 ? 22 
HELX_P HELX_P71 AH8 SER D 304 ? ASN D 323 ? SER D 304 ASN D 323 1 ? 20 
HELX_P HELX_P72 AH9 PRO D 326 ? GLU D 344 ? PRO D 326 GLU D 344 1 ? 19 
HELX_P HELX_P73 AI1 ILE D 359 ? LEU D 367 ? ILE D 359 LEU D 367 1 ? 9  
HELX_P HELX_P74 AI2 PHE D 368 ? HIS D 373 ? PHE D 368 HIS D 373 1 ? 6  
HELX_P HELX_P75 AI3 ILE D 375 ? GLN D 379 ? ILE D 375 GLN D 379 5 ? 5  
HELX_P HELX_P76 AI4 HIS D 482 ? ASN D 491 ? HIS D 482 ASN D 491 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale none ? A LYS 200 NZ ? ? ? 1_555 E 3PE . O12 ? ? A LYS 200 A 3PE 701 1_555 ? ? ? ? ? ? ? 1.297 ? ? 
covale2 covale none ? B LYS 200 NZ ? ? ? 1_555 F 3PE . O12 ? ? B LYS 200 B 3PE 701 1_555 ? ? ? ? ? ? ? 1.298 ? ? 
covale3 covale none ? C LYS 200 NZ ? ? ? 1_555 G 3PE . O12 ? ? C LYS 200 C 3PE 701 1_555 ? ? ? ? ? ? ? 1.297 ? ? 
covale4 covale none ? D LYS 200 NZ ? ? ? 1_555 H 3PE . O12 ? ? D LYS 200 D 3PE 701 1_555 ? ? ? ? ? ? ? 1.297 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASN 56 A . ? ASN 56 A PRO 57 A ? PRO 57 A 1 -8.05 
2 ASN 56 B . ? ASN 56 B PRO 57 B ? PRO 57 B 1 -8.10 
3 ASN 56 C . ? ASN 56 C PRO 57 C ? PRO 57 C 1 -8.08 
4 ASN 56 D . ? ASN 56 D PRO 57 D ? PRO 57 D 1 -8.00 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 3 ? 
AA3 ? 3 ? 
AA4 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ASP A 432 ? PHE A 434 ? ASP A 432 PHE A 434 
AA1 2 VAL A 422 ? PHE A 424 ? VAL A 422 PHE A 424 
AA1 3 PHE A 457 ? THR A 458 ? PHE A 457 THR A 458 
AA2 1 ASP B 432 ? PHE B 434 ? ASP B 432 PHE B 434 
AA2 2 VAL B 422 ? PHE B 424 ? VAL B 422 PHE B 424 
AA2 3 PHE B 457 ? THR B 458 ? PHE B 457 THR B 458 
AA3 1 ASP C 432 ? PHE C 434 ? ASP C 432 PHE C 434 
AA3 2 VAL C 422 ? PHE C 424 ? VAL C 422 PHE C 424 
AA3 3 PHE C 457 ? THR C 458 ? PHE C 457 THR C 458 
AA4 1 ASP D 432 ? PHE D 434 ? ASP D 432 PHE D 434 
AA4 2 VAL D 422 ? PHE D 424 ? VAL D 422 PHE D 424 
AA4 3 PHE D 457 ? THR D 458 ? PHE D 457 THR D 458 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O ASP A 432 ? O ASP A 432 N PHE A 424 ? N PHE A 424 
AA1 2 3 N ASP A 423 ? N ASP A 423 O PHE A 457 ? O PHE A 457 
AA2 1 2 O ASP B 432 ? O ASP B 432 N PHE B 424 ? N PHE B 424 
AA2 2 3 N ASP B 423 ? N ASP B 423 O PHE B 457 ? O PHE B 457 
AA3 1 2 O ASP C 432 ? O ASP C 432 N PHE C 424 ? N PHE C 424 
AA3 2 3 N ASP C 423 ? N ASP C 423 O PHE C 457 ? O PHE C 457 
AA4 1 2 O ASP D 432 ? O ASP D 432 N PHE D 424 ? N PHE D 424 
AA4 2 3 N ASP D 423 ? N ASP D 423 O PHE D 457 ? O PHE D 457 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A 3PE 701 ? 12 'binding site for residue 3PE A 701'                  
AC2 Software B 3PE 701 ? 16 'binding site for Di-peptide 3PE B 701 and LYS B 200' 
AC3 Software C 3PE 701 ? 13 'binding site for Di-peptide 3PE C 701 and LYS C 200' 
AC4 Software D 3PE 701 ? 16 'binding site for Di-peptide 3PE D 701 and LYS D 200' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 TRP A 75  ? TRP A 75  . ? 1_555 ? 
2  AC1 12 LEU A 175 ? LEU A 175 . ? 1_555 ? 
3  AC1 12 ARG A 197 ? ARG A 197 . ? 1_555 ? 
4  AC1 12 LYS A 200 ? LYS A 200 . ? 1_555 ? 
5  AC1 12 SER A 203 ? SER A 203 . ? 1_555 ? 
6  AC1 12 VAL A 204 ? VAL A 204 . ? 1_555 ? 
7  AC1 12 LEU A 206 ? LEU A 206 . ? 1_555 ? 
8  AC1 12 MET A 282 ? MET A 282 . ? 1_555 ? 
9  AC1 12 PHE A 283 ? PHE A 283 . ? 1_555 ? 
10 AC1 12 GLY A 286 ? GLY A 286 . ? 1_555 ? 
11 AC1 12 TYR A 290 ? TYR A 290 . ? 1_555 ? 
12 AC1 12 LEU B 206 ? LEU B 206 . ? 1_555 ? 
13 AC2 16 TRP B 75  ? TRP B 75  . ? 1_555 ? 
14 AC2 16 SER B 179 ? SER B 179 . ? 1_555 ? 
15 AC2 16 ILE B 196 ? ILE B 196 . ? 1_555 ? 
16 AC2 16 ARG B 197 ? ARG B 197 . ? 1_555 ? 
17 AC2 16 CYS B 198 ? CYS B 198 . ? 1_555 ? 
18 AC2 16 THR B 199 ? THR B 199 . ? 1_555 ? 
19 AC2 16 LEU B 201 ? LEU B 201 . ? 1_555 ? 
20 AC2 16 ILE B 202 ? ILE B 202 . ? 1_555 ? 
21 AC2 16 SER B 203 ? SER B 203 . ? 1_555 ? 
22 AC2 16 VAL B 204 ? VAL B 204 . ? 1_555 ? 
23 AC2 16 LEU B 206 ? LEU B 206 . ? 1_555 ? 
24 AC2 16 MET B 282 ? MET B 282 . ? 1_555 ? 
25 AC2 16 PHE B 283 ? PHE B 283 . ? 1_555 ? 
26 AC2 16 GLY B 286 ? GLY B 286 . ? 1_555 ? 
27 AC2 16 TYR B 290 ? TYR B 290 . ? 1_555 ? 
28 AC2 16 LEU C 206 ? LEU C 206 . ? 1_555 ? 
29 AC3 13 TRP C 75  ? TRP C 75  . ? 1_555 ? 
30 AC3 13 ILE C 196 ? ILE C 196 . ? 1_555 ? 
31 AC3 13 ARG C 197 ? ARG C 197 . ? 1_555 ? 
32 AC3 13 CYS C 198 ? CYS C 198 . ? 1_555 ? 
33 AC3 13 THR C 199 ? THR C 199 . ? 1_555 ? 
34 AC3 13 LEU C 201 ? LEU C 201 . ? 1_555 ? 
35 AC3 13 ILE C 202 ? ILE C 202 . ? 1_555 ? 
36 AC3 13 SER C 203 ? SER C 203 . ? 1_555 ? 
37 AC3 13 VAL C 204 ? VAL C 204 . ? 1_555 ? 
38 AC3 13 LEU C 206 ? LEU C 206 . ? 1_555 ? 
39 AC3 13 PHE C 283 ? PHE C 283 . ? 1_555 ? 
40 AC3 13 GLY C 286 ? GLY C 286 . ? 1_555 ? 
41 AC3 13 TYR C 290 ? TYR C 290 . ? 1_555 ? 
42 AC4 16 TRP D 75  ? TRP D 75  . ? 1_555 ? 
43 AC4 16 SER D 179 ? SER D 179 . ? 1_555 ? 
44 AC4 16 ILE D 196 ? ILE D 196 . ? 1_555 ? 
45 AC4 16 ARG D 197 ? ARG D 197 . ? 1_555 ? 
46 AC4 16 CYS D 198 ? CYS D 198 . ? 1_555 ? 
47 AC4 16 THR D 199 ? THR D 199 . ? 1_555 ? 
48 AC4 16 LEU D 201 ? LEU D 201 . ? 1_555 ? 
49 AC4 16 ILE D 202 ? ILE D 202 . ? 1_555 ? 
50 AC4 16 SER D 203 ? SER D 203 . ? 1_555 ? 
51 AC4 16 VAL D 204 ? VAL D 204 . ? 1_555 ? 
52 AC4 16 LEU D 206 ? LEU D 206 . ? 1_555 ? 
53 AC4 16 PHE D 279 ? PHE D 279 . ? 1_555 ? 
54 AC4 16 MET D 282 ? MET D 282 . ? 1_555 ? 
55 AC4 16 PHE D 283 ? PHE D 283 . ? 1_555 ? 
56 AC4 16 GLY D 286 ? GLY D 286 . ? 1_555 ? 
57 AC4 16 TYR D 290 ? TYR D 290 . ? 1_555 ? 
# 
_atom_sites.entry_id                    7CAL 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . LYS A 1 49  ? 164.24800 142.84400 129.29000 1.000 74.25902  ? 49  LYS A N   1 
ATOM   2     C CA  . LYS A 1 49  ? 165.53800 143.00100 128.63100 1.000 74.25902  ? 49  LYS A CA  1 
ATOM   3     C C   . LYS A 1 49  ? 165.47400 144.04700 127.51800 1.000 74.25902  ? 49  LYS A C   1 
ATOM   4     O O   . LYS A 1 49  ? 164.95100 145.14200 127.71300 1.000 74.25902  ? 49  LYS A O   1 
ATOM   5     C CB  . LYS A 1 49  ? 166.01300 141.66200 128.06400 1.000 74.25902  ? 49  LYS A CB  1 
ATOM   6     C CG  . LYS A 1 49  ? 166.32500 140.60700 129.10400 1.000 74.25902  ? 49  LYS A CG  1 
ATOM   7     C CD  . LYS A 1 49  ? 167.13000 139.47500 128.48500 1.000 74.25902  ? 49  LYS A CD  1 
ATOM   8     C CE  . LYS A 1 49  ? 167.52600 138.43300 129.51900 1.000 74.25902  ? 49  LYS A CE  1 
ATOM   9     N NZ  . LYS A 1 49  ? 166.35500 137.65700 130.01000 1.000 74.25902  ? 49  LYS A NZ  1 
ATOM   10    N N   . HIS A 1 50  ? 166.02000 143.70000 126.35500 1.000 76.36446  ? 50  HIS A N   1 
ATOM   11    C CA  . HIS A 1 50  ? 165.95800 144.52000 125.15000 1.000 76.36446  ? 50  HIS A CA  1 
ATOM   12    C C   . HIS A 1 50  ? 164.94700 143.95200 124.15700 1.000 76.36446  ? 50  HIS A C   1 
ATOM   13    O O   . HIS A 1 50  ? 165.13100 144.02500 122.94100 1.000 76.36446  ? 50  HIS A O   1 
ATOM   14    C CB  . HIS A 1 50  ? 167.33500 144.62800 124.50400 1.000 76.36446  ? 50  HIS A CB  1 
ATOM   15    C CG  . HIS A 1 50  ? 167.97000 143.30300 124.22200 1.000 76.36446  ? 50  HIS A CG  1 
ATOM   16    N ND1 . HIS A 1 50  ? 168.68900 142.60500 125.16800 1.000 76.36446  ? 50  HIS A ND1 1 
ATOM   17    C CD2 . HIS A 1 50  ? 167.98700 142.54300 123.10100 1.000 76.36446  ? 50  HIS A CD2 1 
ATOM   18    C CE1 . HIS A 1 50  ? 169.12600 141.47500 124.64100 1.000 76.36446  ? 50  HIS A CE1 1 
ATOM   19    N NE2 . HIS A 1 50  ? 168.71400 141.41300 123.38800 1.000 76.36446  ? 50  HIS A NE2 1 
ATOM   20    N N   . ILE A 1 51  ? 163.86300 143.38400 124.68000 1.000 68.36516  ? 51  ILE A N   1 
ATOM   21    C CA  . ILE A 1 51  ? 162.87900 142.64100 123.90600 1.000 68.36516  ? 51  ILE A CA  1 
ATOM   22    C C   . ILE A 1 51  ? 161.56400 143.40500 123.92100 1.000 68.36516  ? 51  ILE A C   1 
ATOM   23    O O   . ILE A 1 51  ? 161.13800 143.91900 124.96000 1.000 68.36516  ? 51  ILE A O   1 
ATOM   24    C CB  . ILE A 1 51  ? 162.71300 141.22200 124.49400 1.000 68.36516  ? 51  ILE A CB  1 
ATOM   25    C CG1 . ILE A 1 51  ? 164.06500 140.51800 124.58800 1.000 68.36516  ? 51  ILE A CG1 1 
ATOM   26    C CG2 . ILE A 1 51  ? 161.76900 140.38800 123.67700 1.000 68.36516  ? 51  ILE A CG2 1 
ATOM   27    C CD1 . ILE A 1 51  ? 164.76900 140.37200 123.27100 1.000 68.36516  ? 51  ILE A CD1 1 
ATOM   28    N N   . ILE A 1 52  ? 160.91600 143.48800 122.76000 1.000 64.40801  ? 52  ILE A N   1 
ATOM   29    C CA  . ILE A 1 52  ? 159.61400 144.13400 122.63500 1.000 64.40801  ? 52  ILE A CA  1 
ATOM   30    C C   . ILE A 1 52  ? 158.52400 143.10600 122.91100 1.000 64.40801  ? 52  ILE A C   1 
ATOM   31    O O   . ILE A 1 52  ? 158.54800 141.99500 122.36900 1.000 64.40801  ? 52  ILE A O   1 
ATOM   32    C CB  . ILE A 1 52  ? 159.44300 144.79800 121.25300 1.000 64.40801  ? 52  ILE A CB  1 
ATOM   33    C CG1 . ILE A 1 52  ? 157.99900 145.26000 121.01400 1.000 64.40801  ? 52  ILE A CG1 1 
ATOM   34    C CG2 . ILE A 1 52  ? 159.94500 143.91400 120.12600 1.000 64.40801  ? 52  ILE A CG2 1 
ATOM   35    C CD1 . ILE A 1 52  ? 157.52800 146.37100 121.93700 1.000 64.40801  ? 52  ILE A CD1 1 
ATOM   36    N N   . SER A 1 53  ? 157.59000 143.46600 123.78500 1.000 61.49353  ? 53  SER A N   1 
ATOM   37    C CA  . SER A 1 53  ? 156.43100 142.65500 124.11200 1.000 61.49353  ? 53  SER A CA  1 
ATOM   38    C C   . SER A 1 53  ? 155.43900 142.69100 122.95600 1.000 61.49353  ? 53  SER A C   1 
ATOM   39    O O   . SER A 1 53  ? 155.32800 143.71000 122.27200 1.000 61.49353  ? 53  SER A O   1 
ATOM   40    C CB  . SER A 1 53  ? 155.75900 143.18000 125.37300 1.000 61.49353  ? 53  SER A CB  1 
ATOM   41    O OG  . SER A 1 53  ? 154.77000 144.13900 125.05000 1.000 61.49353  ? 53  SER A OG  1 
ATOM   42    N N   . PRO A 1 54  ? 154.67900 141.61500 122.72800 1.000 58.09400  ? 54  PRO A N   1 
ATOM   43    C CA  . PRO A 1 54  ? 153.74700 141.60700 121.59400 1.000 58.09400  ? 54  PRO A CA  1 
ATOM   44    C C   . PRO A 1 54  ? 152.48100 142.41700 121.81400 1.000 58.09400  ? 54  PRO A C   1 
ATOM   45    O O   . PRO A 1 54  ? 151.38100 141.89800 121.62200 1.000 58.09400  ? 54  PRO A O   1 
ATOM   46    C CB  . PRO A 1 54  ? 153.41800 140.12100 121.43100 1.000 58.09400  ? 54  PRO A CB  1 
ATOM   47    C CG  . PRO A 1 54  ? 153.58300 139.56900 122.77200 1.000 58.09400  ? 54  PRO A CG  1 
ATOM   48    C CD  . PRO A 1 54  ? 154.74800 140.29300 123.36900 1.000 58.09400  ? 54  PRO A CD  1 
ATOM   49    N N   . PHE A 1 55  ? 152.61200 143.68200 122.20100 1.000 60.24343  ? 55  PHE A N   1 
ATOM   50    C CA  . PHE A 1 55  ? 151.48300 144.58200 122.33100 1.000 60.24343  ? 55  PHE A CA  1 
ATOM   51    C C   . PHE A 1 55  ? 151.88300 145.95200 121.79600 1.000 60.24343  ? 55  PHE A C   1 
ATOM   52    O O   . PHE A 1 55  ? 153.03200 146.17800 121.40500 1.000 60.24343  ? 55  PHE A O   1 
ATOM   53    C CB  . PHE A 1 55  ? 150.99700 144.66600 123.78400 1.000 60.24343  ? 55  PHE A CB  1 
ATOM   54    C CG  . PHE A 1 55  ? 150.54400 143.34400 124.34900 1.000 60.24343  ? 55  PHE A CG  1 
ATOM   55    C CD1 . PHE A 1 55  ? 149.35500 142.76700 123.93300 1.000 60.24343  ? 55  PHE A CD1 1 
ATOM   56    C CD2 . PHE A 1 55  ? 151.31000 142.67700 125.29100 1.000 60.24343  ? 55  PHE A CD2 1 
ATOM   57    C CE1 . PHE A 1 55  ? 148.94100 141.54900 124.44600 1.000 60.24343  ? 55  PHE A CE1 1 
ATOM   58    C CE2 . PHE A 1 55  ? 150.89800 141.46000 125.80700 1.000 60.24343  ? 55  PHE A CE2 1 
ATOM   59    C CZ  . PHE A 1 55  ? 149.71400 140.89700 125.38300 1.000 60.24343  ? 55  PHE A CZ  1 
ATOM   60    N N   . ASN A 1 56  ? 150.90600 146.86600 121.80300 1.000 64.07332  ? 56  ASN A N   1 
ATOM   61    C CA  . ASN A 1 56  ? 150.84000 148.17500 121.15200 1.000 64.07332  ? 56  ASN A CA  1 
ATOM   62    C C   . ASN A 1 56  ? 152.06700 149.04200 121.43300 1.000 64.07332  ? 56  ASN A C   1 
ATOM   63    O O   . ASN A 1 56  ? 152.73900 148.84100 122.45100 1.000 64.07332  ? 56  ASN A O   1 
ATOM   64    C CB  . ASN A 1 56  ? 149.56900 148.88600 121.63500 1.000 64.07332  ? 56  ASN A CB  1 
ATOM   65    C CG  . ASN A 1 56  ? 148.76700 149.50500 120.50400 1.000 64.07332  ? 56  ASN A CG  1 
ATOM   66    O OD1 . ASN A 1 56  ? 148.87800 149.09900 119.34900 1.000 64.07332  ? 56  ASN A OD1 1 
ATOM   67    N ND2 . ASN A 1 56  ? 147.95700 150.50000 120.83500 1.000 64.07332  ? 56  ASN A ND2 1 
ATOM   68    N N   . PRO A 1 57  ? 152.40300 150.01700 120.57000 1.000 66.08342  ? 57  PRO A N   1 
ATOM   69    C CA  . PRO A 1 57  ? 151.88600 150.36500 119.23900 1.000 66.08342  ? 57  PRO A CA  1 
ATOM   70    C C   . PRO A 1 57  ? 152.75900 149.95600 118.05900 1.000 66.08342  ? 57  PRO A C   1 
ATOM   71    O O   . PRO A 1 57  ? 152.25900 149.84900 116.94500 1.000 66.08342  ? 57  PRO A O   1 
ATOM   72    C CB  . PRO A 1 57  ? 151.77600 151.88600 119.31200 1.000 66.08342  ? 57  PRO A CB  1 
ATOM   73    C CG  . PRO A 1 57  ? 152.90100 152.28900 120.21100 1.000 66.08342  ? 57  PRO A CG  1 
ATOM   74    C CD  . PRO A 1 57  ? 153.13400 151.14700 121.17600 1.000 66.08342  ? 57  PRO A CD  1 
ATOM   75    N N   . ARG A 1 58  ? 154.04200 149.72300 118.30200 1.000 63.11738  ? 58  ARG A N   1 
ATOM   76    C CA  . ARG A 1 58  ? 154.99400 149.43900 117.24200 1.000 63.11738  ? 58  ARG A CA  1 
ATOM   77    C C   . ARG A 1 58  ? 155.00200 147.97800 116.82400 1.000 63.11738  ? 58  ARG A C   1 
ATOM   78    O O   . ARG A 1 58  ? 155.84900 147.59100 116.01400 1.000 63.11738  ? 58  ARG A O   1 
ATOM   79    C CB  . ARG A 1 58  ? 156.39700 149.86100 117.68000 1.000 63.11738  ? 58  ARG A CB  1 
ATOM   80    N N   . TYR A 1 59  ? 154.11300 147.16300 117.35700 1.000 58.74066  ? 59  TYR A N   1 
ATOM   81    C CA  . TYR A 1 59  ? 154.04500 145.77100 116.94200 1.000 58.74066  ? 59  TYR A CA  1 
ATOM   82    C C   . TYR A 1 59  ? 152.64300 145.32800 116.57200 1.000 58.74066  ? 59  TYR A C   1 
ATOM   83    O O   . TYR A 1 59  ? 152.49100 144.48000 115.69600 1.000 58.74066  ? 59  TYR A O   1 
ATOM   84    C CB  . TYR A 1 59  ? 154.58700 144.85600 118.02600 1.000 58.74066  ? 59  TYR A CB  1 
ATOM   85    C CG  . TYR A 1 59  ? 154.86400 143.47400 117.51700 1.000 58.74066  ? 59  TYR A CG  1 
ATOM   86    C CD1 . TYR A 1 59  ? 155.98600 143.21800 116.75400 1.000 58.74066  ? 59  TYR A CD1 1 
ATOM   87    C CD2 . TYR A 1 59  ? 153.99700 142.42800 117.78300 1.000 58.74066  ? 59  TYR A CD2 1 
ATOM   88    C CE1 . TYR A 1 59  ? 156.24600 141.95700 116.27600 1.000 58.74066  ? 59  TYR A CE1 1 
ATOM   89    C CE2 . TYR A 1 59  ? 154.24700 141.16200 117.30800 1.000 58.74066  ? 59  TYR A CE2 1 
ATOM   90    C CZ  . TYR A 1 59  ? 155.37300 140.93300 116.55600 1.000 58.74066  ? 59  TYR A CZ  1 
ATOM   91    O OH  . TYR A 1 59  ? 155.63300 139.67200 116.07800 1.000 58.74066  ? 59  TYR A OH  1 
ATOM   92    N N   . ARG A 1 60  ? 151.61800 145.86100 117.21800 1.000 59.94313  ? 60  ARG A N   1 
ATOM   93    C CA  . ARG A 1 60  ? 150.26000 145.50700 116.83900 1.000 59.94313  ? 60  ARG A CA  1 
ATOM   94    C C   . ARG A 1 60  ? 149.73400 146.35100 115.69000 1.000 59.94313  ? 60  ARG A C   1 
ATOM   95    O O   . ARG A 1 60  ? 148.59200 146.15500 115.26600 1.000 59.94313  ? 60  ARG A O   1 
ATOM   96    C CB  . ARG A 1 60  ? 149.32600 145.61500 118.04200 1.000 59.94313  ? 60  ARG A CB  1 
ATOM   97    C CG  . ARG A 1 60  ? 149.03600 144.28000 118.68700 1.000 59.94313  ? 60  ARG A CG  1 
ATOM   98    C CD  . ARG A 1 60  ? 148.01400 144.41000 119.79200 1.000 59.94313  ? 60  ARG A CD  1 
ATOM   99    N NE  . ARG A 1 60  ? 146.91300 145.29000 119.42000 1.000 59.94313  ? 60  ARG A NE  1 
ATOM   100   C CZ  . ARG A 1 60  ? 146.49500 146.31000 120.16100 1.000 59.94313  ? 60  ARG A CZ  1 
ATOM   101   N NH1 . ARG A 1 60  ? 147.09000 146.57600 121.31500 1.000 59.94313  ? 60  ARG A NH1 1 
ATOM   102   N NH2 . ARG A 1 60  ? 145.48200 147.06200 119.75100 1.000 59.94313  ? 60  ARG A NH2 1 
ATOM   103   N N   . ALA A 1 61  ? 150.53400 147.28600 115.18800 1.000 60.99840  ? 61  ALA A N   1 
ATOM   104   C CA  . ALA A 1 61  ? 150.27400 147.96300 113.92700 1.000 60.99840  ? 61  ALA A CA  1 
ATOM   105   C C   . ALA A 1 61  ? 151.17400 147.46900 112.81100 1.000 60.99840  ? 61  ALA A C   1 
ATOM   106   O O   . ALA A 1 61  ? 150.82500 147.59400 111.63800 1.000 60.99840  ? 61  ALA A O   1 
ATOM   107   C CB  . ALA A 1 61  ? 150.44400 149.47500 114.08700 1.000 60.99840  ? 61  ALA A CB  1 
ATOM   108   N N   . TRP A 1 62  ? 152.33300 146.91400 113.15700 1.000 56.58217  ? 62  TRP A N   1 
ATOM   109   C CA  . TRP A 1 62  ? 153.15300 146.23000 112.16800 1.000 56.58217  ? 62  TRP A CA  1 
ATOM   110   C C   . TRP A 1 62  ? 152.54000 144.89300 111.78800 1.000 56.58217  ? 62  TRP A C   1 
ATOM   111   O O   . TRP A 1 62  ? 152.61700 144.47600 110.63000 1.000 56.58217  ? 62  TRP A O   1 
ATOM   112   C CB  . TRP A 1 62  ? 154.56300 146.05200 112.71700 1.000 56.58217  ? 62  TRP A CB  1 
ATOM   113   C CG  . TRP A 1 62  ? 155.36100 144.94900 112.12100 1.000 56.58217  ? 62  TRP A CG  1 
ATOM   114   C CD1 . TRP A 1 62  ? 155.52500 143.69800 112.62400 1.000 56.58217  ? 62  TRP A CD1 1 
ATOM   115   C CD2 . TRP A 1 62  ? 156.15000 145.00900 110.93300 1.000 56.58217  ? 62  TRP A CD2 1 
ATOM   116   N NE1 . TRP A 1 62  ? 156.34900 142.96600 111.81600 1.000 56.58217  ? 62  TRP A NE1 1 
ATOM   117   C CE2 . TRP A 1 62  ? 156.75000 143.75100 110.76900 1.000 56.58217  ? 62  TRP A CE2 1 
ATOM   118   C CE3 . TRP A 1 62  ? 156.40000 146.00400 109.98600 1.000 56.58217  ? 62  TRP A CE3 1 
ATOM   119   C CZ2 . TRP A 1 62  ? 157.58400 143.45700 109.69800 1.000 56.58217  ? 62  TRP A CZ2 1 
ATOM   120   C CZ3 . TRP A 1 62  ? 157.22600 145.71100 108.92400 1.000 56.58217  ? 62  TRP A CZ3 1 
ATOM   121   C CH2 . TRP A 1 62  ? 157.81000 144.44900 108.78700 1.000 56.58217  ? 62  TRP A CH2 1 
ATOM   122   N N   . GLU A 1 63  ? 151.92100 144.20600 112.75000 1.000 58.56608  ? 63  GLU A N   1 
ATOM   123   C CA  . GLU A 1 63  ? 151.27100 142.93800 112.44700 1.000 58.56608  ? 63  GLU A CA  1 
ATOM   124   C C   . GLU A 1 63  ? 149.99700 143.13100 111.64500 1.000 58.56608  ? 63  GLU A C   1 
ATOM   125   O O   . GLU A 1 63  ? 149.59100 142.22900 110.90800 1.000 58.56608  ? 63  GLU A O   1 
ATOM   126   C CB  . GLU A 1 63  ? 150.94000 142.18300 113.72600 1.000 58.56608  ? 63  GLU A CB  1 
ATOM   127   C CG  . GLU A 1 63  ? 151.89500 141.07300 114.06100 1.000 58.56608  ? 63  GLU A CG  1 
ATOM   128   C CD  . GLU A 1 63  ? 151.45200 140.31100 115.28900 1.000 58.56608  ? 63  GLU A CD  1 
ATOM   129   O OE1 . GLU A 1 63  ? 151.16800 140.95600 116.31800 1.000 58.56608  ? 63  GLU A OE1 1 
ATOM   130   O OE2 . GLU A 1 63  ? 151.37500 139.06700 115.22100 1.000 58.56608  ? 63  GLU A OE2 1 
ATOM   131   N N   . MET A 1 64  ? 149.33800 144.27500 111.79500 1.000 58.50805  ? 64  MET A N   1 
ATOM   132   C CA  . MET A 1 64  ? 148.16400 144.55800 110.98700 1.000 58.50805  ? 64  MET A CA  1 
ATOM   133   C C   . MET A 1 64  ? 148.53300 144.95400 109.57000 1.000 58.50805  ? 64  MET A C   1 
ATOM   134   O O   . MET A 1 64  ? 147.68200 144.90300 108.68000 1.000 58.50805  ? 64  MET A O   1 
ATOM   135   C CB  . MET A 1 64  ? 147.33100 145.66200 111.63700 1.000 58.50805  ? 64  MET A CB  1 
ATOM   136   C CG  . MET A 1 64  ? 145.85300 145.62100 111.28800 1.000 58.50805  ? 64  MET A CG  1 
ATOM   137   S SD  . MET A 1 64  ? 145.09000 144.03300 111.65700 1.000 58.50805  ? 64  MET A SD  1 
ATOM   138   C CE  . MET A 1 64  ? 145.12600 144.04000 113.44400 1.000 58.50805  ? 64  MET A CE  1 
ATOM   139   N N   . TRP A 1 65  ? 149.78400 145.33900 109.33900 1.000 55.48874  ? 65  TRP A N   1 
ATOM   140   C CA  . TRP A 1 65  ? 150.20500 145.65500 107.98400 1.000 55.48874  ? 65  TRP A CA  1 
ATOM   141   C C   . TRP A 1 65  ? 150.63100 144.40700 107.22700 1.000 55.48874  ? 65  TRP A C   1 
ATOM   142   O O   . TRP A 1 65  ? 150.46200 144.33600 106.00800 1.000 55.48874  ? 65  TRP A O   1 
ATOM   143   C CB  . TRP A 1 65  ? 151.33800 146.67300 108.00300 1.000 55.48874  ? 65  TRP A CB  1 
ATOM   144   C CG  . TRP A 1 65  ? 151.53400 147.26700 106.67900 1.000 55.48874  ? 65  TRP A CG  1 
ATOM   145   C CD1 . TRP A 1 65  ? 150.64200 148.02500 105.98600 1.000 55.48874  ? 65  TRP A CD1 1 
ATOM   146   C CD2 . TRP A 1 65  ? 152.67800 147.12900 105.84600 1.000 55.48874  ? 65  TRP A CD2 1 
ATOM   147   N NE1 . TRP A 1 65  ? 151.16600 148.38400 104.77300 1.000 55.48874  ? 65  TRP A NE1 1 
ATOM   148   C CE2 . TRP A 1 65  ? 152.41800 147.84300 104.66200 1.000 55.48874  ? 65  TRP A CE2 1 
ATOM   149   C CE3 . TRP A 1 65  ? 153.90200 146.47600 105.98600 1.000 55.48874  ? 65  TRP A CE3 1 
ATOM   150   C CZ2 . TRP A 1 65  ? 153.33400 147.92500 103.63000 1.000 55.48874  ? 65  TRP A CZ2 1 
ATOM   151   C CZ3 . TRP A 1 65  ? 154.81000 146.55900 104.95900 1.000 55.48874  ? 65  TRP A CZ3 1 
ATOM   152   C CH2 . TRP A 1 65  ? 154.52200 147.27800 103.79600 1.000 55.48874  ? 65  TRP A CH2 1 
ATOM   153   N N   . LEU A 1 66  ? 151.17100 143.40700 107.92800 1.000 49.81499  ? 66  LEU A N   1 
ATOM   154   C CA  . LEU A 1 66  ? 151.53700 142.16700 107.25500 1.000 49.81499  ? 66  LEU A CA  1 
ATOM   155   C C   . LEU A 1 66  ? 150.31800 141.34300 106.87900 1.000 49.81499  ? 66  LEU A C   1 
ATOM   156   O O   . LEU A 1 66  ? 150.42100 140.43900 106.04900 1.000 49.81499  ? 66  LEU A O   1 
ATOM   157   C CB  . LEU A 1 66  ? 152.46700 141.33200 108.12400 1.000 49.81499  ? 66  LEU A CB  1 
ATOM   158   C CG  . LEU A 1 66  ? 153.92500 141.75600 108.19700 1.000 49.81499  ? 66  LEU A CG  1 
ATOM   159   C CD1 . LEU A 1 66  ? 154.70400 140.69000 108.91400 1.000 49.81499  ? 66  LEU A CD1 1 
ATOM   160   C CD2 . LEU A 1 66  ? 154.48300 141.97800 106.82100 1.000 49.81499  ? 66  LEU A CD2 1 
ATOM   161   N N   . VAL A 1 67  ? 149.16600 141.61800 107.48600 1.000 48.34030  ? 67  VAL A N   1 
ATOM   162   C CA  . VAL A 1 67  ? 147.93800 140.95100 107.07400 1.000 48.34030  ? 67  VAL A CA  1 
ATOM   163   C C   . VAL A 1 67  ? 147.50000 141.45500 105.70600 1.000 48.34030  ? 67  VAL A C   1 
ATOM   164   O O   . VAL A 1 67  ? 147.03800 140.67900 104.86300 1.000 48.34030  ? 67  VAL A O   1 
ATOM   165   C CB  . VAL A 1 67  ? 146.85900 141.14400 108.15400 1.000 48.34030  ? 67  VAL A CB  1 
ATOM   166   C CG1 . VAL A 1 67  ? 145.49000 140.73700 107.67000 1.000 48.34030  ? 67  VAL A CG1 1 
ATOM   167   C CG2 . VAL A 1 67  ? 147.22500 140.33000 109.36100 1.000 48.34030  ? 67  VAL A CG2 1 
ATOM   168   N N   . LEU A 1 68  ? 147.70700 142.74400 105.43300 1.000 47.93841  ? 68  LEU A N   1 
ATOM   169   C CA  . LEU A 1 68  ? 147.37600 143.27500 104.11500 1.000 47.93841  ? 68  LEU A CA  1 
ATOM   170   C C   . LEU A 1 68  ? 148.36500 142.81900 103.05200 1.000 47.93841  ? 68  LEU A C   1 
ATOM   171   O O   . LEU A 1 68  ? 148.07300 142.91800 101.85900 1.000 47.93841  ? 68  LEU A O   1 
ATOM   172   C CB  . LEU A 1 68  ? 147.31900 144.79700 104.15800 1.000 47.93841  ? 68  LEU A CB  1 
ATOM   173   C CG  . LEU A 1 68  ? 146.15900 145.38300 104.95600 1.000 47.93841  ? 68  LEU A CG  1 
ATOM   174   C CD1 . LEU A 1 68  ? 146.13000 146.89000 104.82500 1.000 47.93841  ? 68  LEU A CD1 1 
ATOM   175   C CD2 . LEU A 1 68  ? 144.84800 144.78300 104.50100 1.000 47.93841  ? 68  LEU A CD2 1 
ATOM   176   N N   . LEU A 1 69  ? 149.53400 142.32900 103.45100 1.000 48.15928  ? 69  LEU A N   1 
ATOM   177   C CA  . LEU A 1 69  ? 150.44400 141.73500 102.48700 1.000 48.15928  ? 69  LEU A CA  1 
ATOM   178   C C   . LEU A 1 69  ? 150.27300 140.23100 102.38700 1.000 48.15928  ? 69  LEU A C   1 
ATOM   179   O O   . LEU A 1 69  ? 151.05300 139.58000 101.69000 1.000 48.15928  ? 69  LEU A O   1 
ATOM   180   C CB  . LEU A 1 69  ? 151.89000 142.06000 102.84500 1.000 48.15928  ? 69  LEU A CB  1 
ATOM   181   C CG  . LEU A 1 69  ? 152.27400 143.53400 102.88800 1.000 48.15928  ? 69  LEU A CG  1 
ATOM   182   C CD1 . LEU A 1 69  ? 153.77400 143.65500 102.93200 1.000 48.15928  ? 69  LEU A CD1 1 
ATOM   183   C CD2 . LEU A 1 69  ? 151.71500 144.29000 101.70300 1.000 48.15928  ? 69  LEU A CD2 1 
ATOM   184   N N   . VAL A 1 70  ? 149.29700 139.66400 103.09100 1.000 46.68719  ? 70  VAL A N   1 
ATOM   185   C CA  . VAL A 1 70  ? 148.93800 138.26700 102.88600 1.000 46.68719  ? 70  VAL A CA  1 
ATOM   186   C C   . VAL A 1 70  ? 147.68200 138.17600 102.03400 1.000 46.68719  ? 70  VAL A C   1 
ATOM   187   O O   . VAL A 1 70  ? 147.56900 137.30700 101.16400 1.000 46.68719  ? 70  VAL A O   1 
ATOM   188   C CB  . VAL A 1 70  ? 148.78200 137.56100 104.24500 1.000 46.68719  ? 70  VAL A CB  1 
ATOM   189   C CG1 . VAL A 1 70  ? 148.15600 136.21200 104.10100 1.000 46.68719  ? 70  VAL A CG1 1 
ATOM   190   C CG2 . VAL A 1 70  ? 150.12100 137.39000 104.88500 1.000 46.68719  ? 70  VAL A CG2 1 
ATOM   191   N N   . ILE A 1 71  ? 146.74700 139.10500 102.23800 1.000 45.40176  ? 71  ILE A N   1 
ATOM   192   C CA  . ILE A 1 71  ? 145.54800 139.18500 101.41000 1.000 45.40176  ? 71  ILE A CA  1 
ATOM   193   C C   . ILE A 1 71  ? 145.91500 139.51300 99.96800  1.000 45.40176  ? 71  ILE A C   1 
ATOM   194   O O   . ILE A 1 71  ? 145.32900 138.97100 99.02400  1.000 45.40176  ? 71  ILE A O   1 
ATOM   195   C CB  . ILE A 1 71  ? 144.57800 140.21600 102.01300 1.000 45.40176  ? 71  ILE A CB  1 
ATOM   196   C CG1 . ILE A 1 71  ? 144.14200 139.75100 103.39700 1.000 45.40176  ? 71  ILE A CG1 1 
ATOM   197   C CG2 . ILE A 1 71  ? 143.36200 140.42400 101.13800 1.000 45.40176  ? 71  ILE A CG2 1 
ATOM   198   C CD1 . ILE A 1 71  ? 143.29000 140.74500 104.12200 1.000 45.40176  ? 71  ILE A CD1 1 
ATOM   199   N N   . TYR A 1 72  ? 146.92500 140.36200 99.77500  1.000 48.20815  ? 72  TYR A N   1 
ATOM   200   C CA  . TYR A 1 72  ? 147.43800 140.60000 98.43100  1.000 48.20815  ? 72  TYR A CA  1 
ATOM   201   C C   . TYR A 1 72  ? 148.18800 139.38600 97.90300  1.000 48.20815  ? 72  TYR A C   1 
ATOM   202   O O   . TYR A 1 72  ? 147.98200 138.97400 96.75900  1.000 48.20815  ? 72  TYR A O   1 
ATOM   203   C CB  . TYR A 1 72  ? 148.34600 141.82700 98.42600  1.000 48.20815  ? 72  TYR A CB  1 
ATOM   204   C CG  . TYR A 1 72  ? 149.15500 141.99500 97.16200  1.000 48.20815  ? 72  TYR A CG  1 
ATOM   205   C CD1 . TYR A 1 72  ? 150.50400 141.66300 97.12400  1.000 48.20815  ? 72  TYR A CD1 1 
ATOM   206   C CD2 . TYR A 1 72  ? 148.57200 142.50200 96.01200  1.000 48.20815  ? 72  TYR A CD2 1 
ATOM   207   C CE1 . TYR A 1 72  ? 151.23800 141.81200 95.97400  1.000 48.20815  ? 72  TYR A CE1 1 
ATOM   208   C CE2 . TYR A 1 72  ? 149.30300 142.66100 94.85600  1.000 48.20815  ? 72  TYR A CE2 1 
ATOM   209   C CZ  . TYR A 1 72  ? 150.63300 142.31500 94.84700  1.000 48.20815  ? 72  TYR A CZ  1 
ATOM   210   O OH  . TYR A 1 72  ? 151.36700 142.46800 93.69900  1.000 48.20815  ? 72  TYR A OH  1 
ATOM   211   N N   . SER A 1 73  ? 149.05100 138.78700 98.72300  1.000 47.18006  ? 73  SER A N   1 
ATOM   212   C CA  . SER A 1 73  ? 149.92400 137.73300 98.22100  1.000 47.18006  ? 73  SER A CA  1 
ATOM   213   C C   . SER A 1 73  ? 149.23100 136.38100 98.17000  1.000 47.18006  ? 73  SER A C   1 
ATOM   214   O O   . SER A 1 73  ? 149.87400 135.37500 97.85900  1.000 47.18006  ? 73  SER A O   1 
ATOM   215   C CB  . SER A 1 73  ? 151.18100 137.63200 99.07400  1.000 47.18006  ? 73  SER A CB  1 
ATOM   216   O OG  . SER A 1 73  ? 151.77500 136.35800 98.92900  1.000 47.18006  ? 73  SER A OG  1 
ATOM   217   N N   . ALA A 1 74  ? 147.94800 136.32100 98.50400  1.000 46.28342  ? 74  ALA A N   1 
ATOM   218   C CA  . ALA A 1 74  ? 147.13100 135.14600 98.24600  1.000 46.28342  ? 74  ALA A CA  1 
ATOM   219   C C   . ALA A 1 74  ? 146.09300 135.40200 97.17100  1.000 46.28342  ? 74  ALA A C   1 
ATOM   220   O O   . ALA A 1 74  ? 145.27500 134.52500 96.89500  1.000 46.28342  ? 74  ALA A O   1 
ATOM   221   C CB  . ALA A 1 74  ? 146.44300 134.67400 99.52600  1.000 46.28342  ? 74  ALA A CB  1 
ATOM   222   N N   . TRP A 1 75  ? 146.09900 136.58700 96.57400  1.000 44.70652  ? 75  TRP A N   1 
ATOM   223   C CA  . TRP A 1 75  ? 145.28100 136.89100 95.41300  1.000 44.70652  ? 75  TRP A CA  1 
ATOM   224   C C   . TRP A 1 75  ? 146.05300 136.76500 94.11400  1.000 44.70652  ? 75  TRP A C   1 
ATOM   225   O O   . TRP A 1 75  ? 145.53200 136.21300 93.14800  1.000 44.70652  ? 75  TRP A O   1 
ATOM   226   C CB  . TRP A 1 75  ? 144.70900 138.30300 95.52000  1.000 44.70652  ? 75  TRP A CB  1 
ATOM   227   C CG  . TRP A 1 75  ? 143.55500 138.55400 94.62000  1.000 44.70652  ? 75  TRP A CG  1 
ATOM   228   C CD1 . TRP A 1 75  ? 142.24100 138.41700 94.93000  1.000 44.70652  ? 75  TRP A CD1 1 
ATOM   229   C CD2 . TRP A 1 75  ? 143.60300 138.99600 93.25900  1.000 44.70652  ? 75  TRP A CD2 1 
ATOM   230   N NE1 . TRP A 1 75  ? 141.46100 138.74000 93.84800  1.000 44.70652  ? 75  TRP A NE1 1 
ATOM   231   C CE2 . TRP A 1 75  ? 142.27600 139.10100 92.80900  1.000 44.70652  ? 75  TRP A CE2 1 
ATOM   232   C CE3 . TRP A 1 75  ? 144.63800 139.31900 92.38000  1.000 44.70652  ? 75  TRP A CE3 1 
ATOM   233   C CZ2 . TRP A 1 75  ? 141.95800 139.51000 91.52100  1.000 44.70652  ? 75  TRP A CZ2 1 
ATOM   234   C CZ3 . TRP A 1 75  ? 144.32100 139.71900 91.10400  1.000 44.70652  ? 75  TRP A CZ3 1 
ATOM   235   C CH2 . TRP A 1 75  ? 142.99300 139.81200 90.68500  1.000 44.70652  ? 75  TRP A CH2 1 
ATOM   236   N N   . ILE A 1 76  ? 147.28700 137.26000 94.06600  1.000 48.89531  ? 76  ILE A N   1 
ATOM   237   C CA  . ILE A 1 76  ? 148.09600 137.19400 92.85700  1.000 48.89531  ? 76  ILE A CA  1 
ATOM   238   C C   . ILE A 1 76  ? 148.92600 135.92400 92.84900  1.000 48.89531  ? 76  ILE A C   1 
ATOM   239   O O   . ILE A 1 76  ? 149.70500 135.69300 91.92300  1.000 48.89531  ? 76  ILE A O   1 
ATOM   240   C CB  . ILE A 1 76  ? 149.01700 138.41300 92.72200  1.000 48.89531  ? 76  ILE A CB  1 
ATOM   241   C CG1 . ILE A 1 76  ? 150.04800 138.39300 93.84100  1.000 48.89531  ? 76  ILE A CG1 1 
ATOM   242   C CG2 . ILE A 1 76  ? 148.22000 139.68900 92.74300  1.000 48.89531  ? 76  ILE A CG2 1 
ATOM   243   C CD1 . ILE A 1 76  ? 151.33000 139.08900 93.49700  1.000 48.89531  ? 76  ILE A CD1 1 
ATOM   244   N N   . CYS A 1 77  ? 148.79800 135.11100 93.87700  1.000 53.28307  ? 77  CYS A N   1 
ATOM   245   C CA  . CYS A 1 77  ? 149.56600 133.87400 93.88400  1.000 53.28307  ? 77  CYS A CA  1 
ATOM   246   C C   . CYS A 1 77  ? 148.98100 132.79500 92.96900  1.000 53.28307  ? 77  CYS A C   1 
ATOM   247   O O   . CYS A 1 77  ? 149.76700 132.05300 92.37100  1.000 53.28307  ? 77  CYS A O   1 
ATOM   248   C CB  . CYS A 1 77  ? 149.73500 133.33900 95.30400  1.000 53.28307  ? 77  CYS A CB  1 
ATOM   249   S SG  . CYS A 1 77  ? 151.13600 132.23200 95.47400  1.000 53.28307  ? 77  CYS A SG  1 
ATOM   250   N N   . PRO A 1 78  ? 147.63300 132.62100 92.82800  1.000 48.03295  ? 78  PRO A N   1 
ATOM   251   C CA  . PRO A 1 78  ? 147.16400 131.78700 91.71600  1.000 48.03295  ? 78  PRO A CA  1 
ATOM   252   C C   . PRO A 1 78  ? 146.75200 132.58100 90.48700  1.000 48.03295  ? 78  PRO A C   1 
ATOM   253   O O   . PRO A 1 78  ? 146.43200 131.99100 89.45400  1.000 48.03295  ? 78  PRO A O   1 
ATOM   254   C CB  . PRO A 1 78  ? 145.97500 131.04800 92.32600  1.000 48.03295  ? 78  PRO A CB  1 
ATOM   255   C CG  . PRO A 1 78  ? 145.40000 132.02600 93.21300  1.000 48.03295  ? 78  PRO A CG  1 
ATOM   256   C CD  . PRO A 1 78  ? 146.53900 132.78900 93.80900  1.000 48.03295  ? 78  PRO A CD  1 
ATOM   257   N N   . PHE A 1 79  ? 146.75000 133.91000 90.57300  1.000 46.76591  ? 79  PHE A N   1 
ATOM   258   C CA  . PHE A 1 79  ? 146.33500 134.71100 89.42800  1.000 46.76591  ? 79  PHE A CA  1 
ATOM   259   C C   . PHE A 1 79  ? 147.45700 134.86500 88.41800  1.000 46.76591  ? 79  PHE A C   1 
ATOM   260   O O   . PHE A 1 79  ? 147.22400 134.75800 87.21300  1.000 46.76591  ? 79  PHE A O   1 
ATOM   261   C CB  . PHE A 1 79  ? 145.85700 136.08100 89.88300  1.000 46.76591  ? 79  PHE A CB  1 
ATOM   262   C CG  . PHE A 1 79  ? 145.42100 136.97400 88.76700  1.000 46.76591  ? 79  PHE A CG  1 
ATOM   263   C CD1 . PHE A 1 79  ? 144.21200 136.76900 88.13700  1.000 46.76591  ? 79  PHE A CD1 1 
ATOM   264   C CD2 . PHE A 1 79  ? 146.21200 138.03300 88.36100  1.000 46.76591  ? 79  PHE A CD2 1 
ATOM   265   C CE1 . PHE A 1 79  ? 143.80100 137.59500 87.11700  1.000 46.76591  ? 79  PHE A CE1 1 
ATOM   266   C CE2 . PHE A 1 79  ? 145.80800 138.86300 87.34000  1.000 46.76591  ? 79  PHE A CE2 1 
ATOM   267   C CZ  . PHE A 1 79  ? 144.60100 138.64400 86.71900  1.000 46.76591  ? 79  PHE A CZ  1 
ATOM   268   N N   . GLN A 1 80  ? 148.67400 135.13300 88.87800  1.000 53.95858  ? 80  GLN A N   1 
ATOM   269   C CA  . GLN A 1 80  ? 149.81200 135.14500 87.97300  1.000 53.95858  ? 80  GLN A CA  1 
ATOM   270   C C   . GLN A 1 80  ? 150.29100 133.74300 87.63700  1.000 53.95858  ? 80  GLN A C   1 
ATOM   271   O O   . GLN A 1 80  ? 151.10600 133.58100 86.72500  1.000 53.95858  ? 80  GLN A O   1 
ATOM   272   C CB  . GLN A 1 80  ? 150.95500 135.96400 88.57100  1.000 53.95858  ? 80  GLN A CB  1 
ATOM   273   C CG  . GLN A 1 80  ? 151.87300 135.19300 89.49400  1.000 53.95858  ? 80  GLN A CG  1 
ATOM   274   C CD  . GLN A 1 80  ? 152.86200 136.09400 90.19300  1.000 53.95858  ? 80  GLN A CD  1 
ATOM   275   O OE1 . GLN A 1 80  ? 152.97500 137.27400 89.86800  1.000 53.95858  ? 80  GLN A OE1 1 
ATOM   276   N NE2 . GLN A 1 80  ? 153.58400 135.54500 91.16100  1.000 53.95858  ? 80  GLN A NE2 1 
ATOM   277   N N   . PHE A 1 81  ? 149.79800 132.73600 88.34800  1.000 53.14336  ? 81  PHE A N   1 
ATOM   278   C CA  . PHE A 1 81  ? 150.08800 131.35200 88.01600  1.000 53.14336  ? 81  PHE A CA  1 
ATOM   279   C C   . PHE A 1 81  ? 149.38500 130.91900 86.73700  1.000 53.14336  ? 81  PHE A C   1 
ATOM   280   O O   . PHE A 1 81  ? 149.87200 130.02200 86.04400  1.000 53.14336  ? 81  PHE A O   1 
ATOM   281   C CB  . PHE A 1 81  ? 149.67300 130.47900 89.19600  1.000 53.14336  ? 81  PHE A CB  1 
ATOM   282   C CG  . PHE A 1 81  ? 149.87200 129.01400 88.99200  1.000 53.14336  ? 81  PHE A CG  1 
ATOM   283   C CD1 . PHE A 1 81  ? 151.13200 128.45700 89.04500  1.000 53.14336  ? 81  PHE A CD1 1 
ATOM   284   C CD2 . PHE A 1 81  ? 148.78600 128.18500 88.80200  1.000 53.14336  ? 81  PHE A CD2 1 
ATOM   285   C CE1 . PHE A 1 81  ? 151.30400 127.10000 88.88200  1.000 53.14336  ? 81  PHE A CE1 1 
ATOM   286   C CE2 . PHE A 1 81  ? 148.95700 126.83200 88.63900  1.000 53.14336  ? 81  PHE A CE2 1 
ATOM   287   C CZ  . PHE A 1 81  ? 150.21800 126.29000 88.67600  1.000 53.14336  ? 81  PHE A CZ  1 
ATOM   288   N N   . ALA A 1 82  ? 148.25500 131.54000 86.40200  1.000 49.38145  ? 82  ALA A N   1 
ATOM   289   C CA  . ALA A 1 82  ? 147.46800 131.12900 85.24700  1.000 49.38145  ? 82  ALA A CA  1 
ATOM   290   C C   . ALA A 1 82  ? 147.35800 132.20900 84.18100  1.000 49.38145  ? 82  ALA A C   1 
ATOM   291   O O   . ALA A 1 82  ? 147.73900 131.97100 83.03300  1.000 49.38145  ? 82  ALA A O   1 
ATOM   292   C CB  . ALA A 1 82  ? 146.07400 130.70000 85.70700  1.000 49.38145  ? 82  ALA A CB  1 
ATOM   293   N N   . PHE A 1 83  ? 146.84900 133.39000 84.51700  1.000 46.50803  ? 83  PHE A N   1 
ATOM   294   C CA  . PHE A 1 83  ? 146.49800 134.36100 83.48700  1.000 46.50803  ? 83  PHE A CA  1 
ATOM   295   C C   . PHE A 1 83  ? 147.71200 135.14900 83.01700  1.000 46.50803  ? 83  PHE A C   1 
ATOM   296   O O   . PHE A 1 83  ? 148.06800 135.11300 81.83600  1.000 46.50803  ? 83  PHE A O   1 
ATOM   297   C CB  . PHE A 1 83  ? 145.41200 135.29900 84.00600  1.000 46.50803  ? 83  PHE A CB  1 
ATOM   298   C CG  . PHE A 1 83  ? 144.12200 134.61000 84.27700  1.000 46.50803  ? 83  PHE A CG  1 
ATOM   299   C CD1 . PHE A 1 83  ? 143.82900 134.13100 85.53600  1.000 46.50803  ? 83  PHE A CD1 1 
ATOM   300   C CD2 . PHE A 1 83  ? 143.21200 134.41500 83.26300  1.000 46.50803  ? 83  PHE A CD2 1 
ATOM   301   C CE1 . PHE A 1 83  ? 142.64500 133.48300 85.77900  1.000 46.50803  ? 83  PHE A CE1 1 
ATOM   302   C CE2 . PHE A 1 83  ? 142.03100 133.76200 83.50000  1.000 46.50803  ? 83  PHE A CE2 1 
ATOM   303   C CZ  . PHE A 1 83  ? 141.74500 133.30000 84.76100  1.000 46.50803  ? 83  PHE A CZ  1 
ATOM   304   N N   . ILE A 1 84  ? 148.36200 135.86600 83.92600  1.000 57.58541  ? 84  ILE A N   1 
ATOM   305   C CA  . ILE A 1 84  ? 149.54600 136.65800 83.56900  1.000 57.58541  ? 84  ILE A CA  1 
ATOM   306   C C   . ILE A 1 84  ? 150.72900 135.70600 83.68900  1.000 57.58541  ? 84  ILE A C   1 
ATOM   307   O O   . ILE A 1 84  ? 151.44900 135.66100 84.68700  1.000 57.58541  ? 84  ILE A O   1 
ATOM   308   C CB  . ILE A 1 84  ? 149.69400 137.90400 84.44400  1.000 57.58541  ? 84  ILE A CB  1 
ATOM   309   N N   . THR A 1 85  ? 150.94400 134.93500 82.63000  1.000 67.93347  ? 85  THR A N   1 
ATOM   310   C CA  . THR A 1 85  ? 152.01500 133.95100 82.59900  1.000 67.93347  ? 85  THR A CA  1 
ATOM   311   C C   . THR A 1 85  ? 153.32600 134.52000 82.07700  1.000 67.93347  ? 85  THR A C   1 
ATOM   312   O O   . THR A 1 85  ? 154.28900 133.76500 81.90600  1.000 67.93347  ? 85  THR A O   1 
ATOM   313   C CB  . THR A 1 85  ? 151.60300 132.74700 81.74700  1.000 67.93347  ? 85  THR A CB  1 
ATOM   314   N N   . TYR A 1 86  ? 153.38900 135.82300 81.80700  1.000 74.96217  ? 86  TYR A N   1 
ATOM   315   C CA  . TYR A 1 86  ? 154.65200 136.42200 81.39600  1.000 74.96217  ? 86  TYR A CA  1 
ATOM   316   C C   . TYR A 1 86  ? 155.51700 136.75500 82.60600  1.000 74.96217  ? 86  TYR A C   1 
ATOM   317   O O   . TYR A 1 86  ? 156.57900 136.15200 82.80300  1.000 74.96217  ? 86  TYR A O   1 
ATOM   318   C CB  . TYR A 1 86  ? 154.38500 137.67300 80.55600  1.000 74.96217  ? 86  TYR A CB  1 
ATOM   319   N N   . LYS A 1 87  ? 155.04000 137.68900 83.44000  1.000 78.57969  ? 87  LYS A N   1 
ATOM   320   C CA  . LYS A 1 87  ? 155.70900 138.17000 84.65800  1.000 78.57969  ? 87  LYS A CA  1 
ATOM   321   C C   . LYS A 1 87  ? 157.13900 138.63500 84.38500  1.000 78.57969  ? 87  LYS A C   1 
ATOM   322   O O   . LYS A 1 87  ? 158.07800 138.28800 85.10400  1.000 78.57969  ? 87  LYS A O   1 
ATOM   323   C CB  . LYS A 1 87  ? 155.67900 137.10800 85.76000  1.000 78.57969  ? 87  LYS A CB  1 
ATOM   324   N N   . LYS A 1 88  ? 157.30800 139.39400 83.30100  1.000 77.25421  ? 88  LYS A N   1 
ATOM   325   C CA  . LYS A 1 88  ? 158.63500 139.84600 82.90300  1.000 77.25421  ? 88  LYS A CA  1 
ATOM   326   C C   . LYS A 1 88  ? 159.26000 140.82800 83.88900  1.000 77.25421  ? 88  LYS A C   1 
ATOM   327   O O   . LYS A 1 88  ? 160.19000 140.46400 84.61200  1.000 77.25421  ? 88  LYS A O   1 
ATOM   328   C CB  . LYS A 1 88  ? 158.57100 140.48400 81.51400  1.000 77.25421  ? 88  LYS A CB  1 
ATOM   329   N N   . ASP A 1 89  ? 158.74700 142.06300 83.94100  1.000 75.57424  ? 89  ASP A N   1 
ATOM   330   C CA  . ASP A 1 89  ? 159.28000 143.05500 84.87000  1.000 75.57424  ? 89  ASP A CA  1 
ATOM   331   C C   . ASP A 1 89  ? 158.25900 144.03600 85.43500  1.000 75.57424  ? 89  ASP A C   1 
ATOM   332   O O   . ASP A 1 89  ? 158.66900 144.95000 86.15500  1.000 75.57424  ? 89  ASP A O   1 
ATOM   333   C CB  . ASP A 1 89  ? 160.42600 143.83700 84.20500  1.000 75.57424  ? 89  ASP A CB  1 
ATOM   334   C CG  . ASP A 1 89  ? 161.79700 143.45100 84.74900  1.000 75.57424  ? 89  ASP A CG  1 
ATOM   335   O OD1 . ASP A 1 89  ? 161.88400 142.51300 85.56300  1.000 75.57424  ? 89  ASP A OD1 1 
ATOM   336   O OD2 . ASP A 1 89  ? 162.79500 144.10000 84.36800  1.000 75.57424  ? 89  ASP A OD2 1 
ATOM   337   N N   . ALA A 1 90  ? 156.96400 143.90700 85.14700  1.000 70.34513  ? 90  ALA A N   1 
ATOM   338   C CA  . ALA A 1 90  ? 156.02200 144.95400 85.54400  1.000 70.34513  ? 90  ALA A CA  1 
ATOM   339   C C   . ALA A 1 90  ? 155.57600 144.79500 86.99500  1.000 70.34513  ? 90  ALA A C   1 
ATOM   340   O O   . ALA A 1 90  ? 155.75000 145.70200 87.81500  1.000 70.34513  ? 90  ALA A O   1 
ATOM   341   C CB  . ALA A 1 90  ? 154.81400 144.95300 84.60500  1.000 70.34513  ? 90  ALA A CB  1 
ATOM   342   N N   . ILE A 1 91  ? 154.98500 143.64200 87.32200  1.000 69.81423  ? 91  ILE A N   1 
ATOM   343   C CA  . ILE A 1 91  ? 154.58600 143.32200 88.69200  1.000 69.81423  ? 91  ILE A CA  1 
ATOM   344   C C   . ILE A 1 91  ? 155.74500 142.76800 89.50500  1.000 69.81423  ? 91  ILE A C   1 
ATOM   345   O O   . ILE A 1 91  ? 155.58700 142.49900 90.70200  1.000 69.81423  ? 91  ILE A O   1 
ATOM   346   C CB  . ILE A 1 91  ? 153.39300 142.34600 88.62500  1.000 69.81423  ? 91  ILE A CB  1 
ATOM   347   C CG1 . ILE A 1 91  ? 152.44300 142.55000 89.80400  1.000 69.81423  ? 91  ILE A CG1 1 
ATOM   348   C CG2 . ILE A 1 91  ? 153.85700 140.89300 88.48900  1.000 69.81423  ? 91  ILE A CG2 1 
ATOM   349   C CD1 . ILE A 1 91  ? 151.66700 143.83700 89.72800  1.000 69.81423  ? 91  ILE A CD1 1 
ATOM   350   N N   . PHE A 1 92  ? 156.92000 142.64900 88.88300  1.000 70.97432  ? 92  PHE A N   1 
ATOM   351   C CA  . PHE A 1 92  ? 158.06600 141.96000 89.46300  1.000 70.97432  ? 92  PHE A CA  1 
ATOM   352   C C   . PHE A 1 92  ? 158.62100 142.67800 90.68400  1.000 70.97432  ? 92  PHE A C   1 
ATOM   353   O O   . PHE A 1 92  ? 159.19700 142.03700 91.56900  1.000 70.97432  ? 92  PHE A O   1 
ATOM   354   C CB  . PHE A 1 92  ? 159.13300 141.82900 88.38300  1.000 70.97432  ? 92  PHE A CB  1 
ATOM   355   C CG  . PHE A 1 92  ? 160.34000 141.05300 88.78900  1.000 70.97432  ? 92  PHE A CG  1 
ATOM   356   C CD1 . PHE A 1 92  ? 160.32000 139.67200 88.78000  1.000 70.97432  ? 92  PHE A CD1 1 
ATOM   357   C CD2 . PHE A 1 92  ? 161.51400 141.70700 89.12700  1.000 70.97432  ? 92  PHE A CD2 1 
ATOM   358   C CE1 . PHE A 1 92  ? 161.44000 138.95800 89.12900  1.000 70.97432  ? 92  PHE A CE1 1 
ATOM   359   C CE2 . PHE A 1 92  ? 162.63700 140.99800 89.48200  1.000 70.97432  ? 92  PHE A CE2 1 
ATOM   360   C CZ  . PHE A 1 92  ? 162.60100 139.62200 89.48200  1.000 70.97432  ? 92  PHE A CZ  1 
ATOM   361   N N   . ILE A 1 93  ? 158.45900 143.99800 90.76000  1.000 68.44352  ? 93  ILE A N   1 
ATOM   362   C CA  . ILE A 1 93  ? 159.02600 144.73100 91.88600  1.000 68.44352  ? 93  ILE A CA  1 
ATOM   363   C C   . ILE A 1 93  ? 158.10500 144.67000 93.09900  1.000 68.44352  ? 93  ILE A C   1 
ATOM   364   O O   . ILE A 1 93  ? 158.57200 144.71800 94.24100  1.000 68.44352  ? 93  ILE A O   1 
ATOM   365   C CB  . ILE A 1 93  ? 159.35700 146.18000 91.47700  1.000 68.44352  ? 93  ILE A CB  1 
ATOM   366   C CG1 . ILE A 1 93  ? 158.09900 146.94600 91.05600  1.000 68.44352  ? 93  ILE A CG1 1 
ATOM   367   C CG2 . ILE A 1 93  ? 160.38800 146.18800 90.36100  1.000 68.44352  ? 93  ILE A CG2 1 
ATOM   368   C CD1 . ILE A 1 93  ? 158.36400 148.35600 90.57700  1.000 68.44352  ? 93  ILE A CD1 1 
ATOM   369   N N   . ILE A 1 94  ? 156.79200 144.54000 92.88600  1.000 63.63283  ? 94  ILE A N   1 
ATOM   370   C CA  . ILE A 1 94  ? 155.87300 144.47200 94.01700  1.000 63.63283  ? 94  ILE A CA  1 
ATOM   371   C C   . ILE A 1 94  ? 155.95700 143.10800 94.68200  1.000 63.63283  ? 94  ILE A C   1 
ATOM   372   O O   . ILE A 1 94  ? 155.89900 142.99700 95.90900  1.000 63.63283  ? 94  ILE A O   1 
ATOM   373   C CB  . ILE A 1 94  ? 154.44100 144.80900 93.56900  1.000 63.63283  ? 94  ILE A CB  1 
ATOM   374   C CG1 . ILE A 1 94  ? 154.42400 146.15200 92.84200  1.000 63.63283  ? 94  ILE A CG1 1 
ATOM   375   C CG2 . ILE A 1 94  ? 153.50800 144.87000 94.76100  1.000 63.63283  ? 94  ILE A CG2 1 
ATOM   376   C CD1 . ILE A 1 94  ? 153.04000 146.64000 92.47200  1.000 63.63283  ? 94  ILE A CD1 1 
ATOM   377   N N   . ASP A 1 95  ? 156.15700 142.05600 93.89700  1.000 63.80791  ? 95  ASP A N   1 
ATOM   378   C CA  . ASP A 1 95  ? 156.31500 140.73100 94.48000  1.000 63.80791  ? 95  ASP A CA  1 
ATOM   379   C C   . ASP A 1 95  ? 157.69600 140.50000 95.07700  1.000 63.80791  ? 95  ASP A C   1 
ATOM   380   O O   . ASP A 1 95  ? 157.94000 139.41000 95.60200  1.000 63.80791  ? 95  ASP A O   1 
ATOM   381   C CB  . ASP A 1 95  ? 156.02000 139.66000 93.43100  1.000 63.80791  ? 95  ASP A CB  1 
ATOM   382   N N   . ASN A 1 96  ? 158.60000 141.47300 95.00400  1.000 65.46941  ? 96  ASN A N   1 
ATOM   383   C CA  . ASN A 1 96  ? 159.89200 141.40800 95.67700  1.000 65.46941  ? 96  ASN A CA  1 
ATOM   384   C C   . ASN A 1 96  ? 160.02400 142.41600 96.80500  1.000 65.46941  ? 96  ASN A C   1 
ATOM   385   O O   . ASN A 1 96  ? 160.81200 142.20200 97.72500  1.000 65.46941  ? 96  ASN A O   1 
ATOM   386   C CB  . ASN A 1 96  ? 161.02300 141.62500 94.67300  1.000 65.46941  ? 96  ASN A CB  1 
ATOM   387   C CG  . ASN A 1 96  ? 161.46000 140.34200 94.01700  1.000 65.46941  ? 96  ASN A CG  1 
ATOM   388   O OD1 . ASN A 1 96  ? 161.53400 139.29900 94.66200  1.000 65.46941  ? 96  ASN A OD1 1 
ATOM   389   N ND2 . ASN A 1 96  ? 161.74900 140.40700 92.72700  1.000 65.46941  ? 96  ASN A ND2 1 
ATOM   390   N N   . ILE A 1 97  ? 159.27800 143.52000 96.74200  1.000 62.04224  ? 97  ILE A N   1 
ATOM   391   C CA  . ILE A 1 97  ? 159.14000 144.39900 97.90000  1.000 62.04224  ? 97  ILE A CA  1 
ATOM   392   C C   . ILE A 1 97  ? 158.37000 143.68000 99.00000  1.000 62.04224  ? 97  ILE A C   1 
ATOM   393   O O   . ILE A 1 97  ? 158.76000 143.69800 100.17400 1.000 62.04224  ? 97  ILE A O   1 
ATOM   394   C CB  . ILE A 1 97  ? 158.45600 145.71500 97.48500  1.000 62.04224  ? 97  ILE A CB  1 
ATOM   395   C CG1 . ILE A 1 97  ? 159.46400 146.64800 96.82000  1.000 62.04224  ? 97  ILE A CG1 1 
ATOM   396   C CG2 . ILE A 1 97  ? 157.79500 146.41100 98.66200  1.000 62.04224  ? 97  ILE A CG2 1 
ATOM   397   C CD1 . ILE A 1 97  ? 158.84300 147.90500 96.27000  1.000 62.04224  ? 97  ILE A CD1 1 
ATOM   398   N N   . VAL A 1 98  ? 157.27800 143.01000 98.61900  1.000 60.17322  ? 98  VAL A N   1 
ATOM   399   C CA  . VAL A 1 98  ? 156.46900 142.24000 99.56200  1.000 60.17322  ? 98  VAL A CA  1 
ATOM   400   C C   . VAL A 1 98  ? 157.27100 141.07200 100.12200 1.000 60.17322  ? 98  VAL A C   1 
ATOM   401   O O   . VAL A 1 98  ? 157.26100 140.81200 101.32900 1.000 60.17322  ? 98  VAL A O   1 
ATOM   402   C CB  . VAL A 1 98  ? 155.17000 141.77400 98.87700  1.000 60.17322  ? 98  VAL A CB  1 
ATOM   403   C CG1 . VAL A 1 98  ? 154.59600 140.53100 99.52200  1.000 60.17322  ? 98  VAL A CG1 1 
ATOM   404   C CG2 . VAL A 1 98  ? 154.15200 142.89300 98.89000  1.000 60.17322  ? 98  VAL A CG2 1 
ATOM   405   N N   . ASN A 1 99  ? 158.04100 140.40100 99.26700  1.000 62.69489  ? 99  ASN A N   1 
ATOM   406   C CA  . ASN A 1 99  ? 158.87200 139.29500 99.72400  1.000 62.69489  ? 99  ASN A CA  1 
ATOM   407   C C   . ASN A 1 99  ? 160.05900 139.75400 100.55800 1.000 62.69489  ? 99  ASN A C   1 
ATOM   408   O O   . ASN A 1 99  ? 160.72900 138.91600 101.16800 1.000 62.69489  ? 99  ASN A O   1 
ATOM   409   C CB  . ASN A 1 99  ? 159.36700 138.48400 98.53200  1.000 62.69489  ? 99  ASN A CB  1 
ATOM   410   C CG  . ASN A 1 99  ? 159.61500 137.03900 98.87800  1.000 62.69489  ? 99  ASN A CG  1 
ATOM   411   O OD1 . ASN A 1 99  ? 159.36700 136.61100 100.00000 1.000 62.69489  ? 99  ASN A OD1 1 
ATOM   412   N ND2 . ASN A 1 99  ? 160.10200 136.27400 97.91300  1.000 62.69489  ? 99  ASN A ND2 1 
ATOM   413   N N   . GLY A 1 100 ? 160.34300 141.05300 100.59200 1.000 60.27755  ? 100 GLY A N   1 
ATOM   414   C CA  . GLY A 1 100 ? 161.36400 141.58700 101.46800 1.000 60.27755  ? 100 GLY A CA  1 
ATOM   415   C C   . GLY A 1 100 ? 160.80800 141.94200 102.83000 1.000 60.27755  ? 100 GLY A C   1 
ATOM   416   O O   . GLY A 1 100 ? 161.51700 141.87100 103.83600 1.000 60.27755  ? 100 GLY A O   1 
ATOM   417   N N   . PHE A 1 101 ? 159.52600 142.31300 102.87500 1.000 58.27131  ? 101 PHE A N   1 
ATOM   418   C CA  . PHE A 1 101 ? 158.88900 142.62900 104.14800 1.000 58.27131  ? 101 PHE A CA  1 
ATOM   419   C C   . PHE A 1 101 ? 158.57400 141.37600 104.94900 1.000 58.27131  ? 101 PHE A C   1 
ATOM   420   O O   . PHE A 1 101 ? 158.25200 141.47000 106.13600 1.000 58.27131  ? 101 PHE A O   1 
ATOM   421   C CB  . PHE A 1 101 ? 157.61900 143.43700 103.91400 1.000 58.27131  ? 101 PHE A CB  1 
ATOM   422   C CG  . PHE A 1 101 ? 157.87700 144.87800 103.65400 1.000 58.27131  ? 101 PHE A CG  1 
ATOM   423   C CD1 . PHE A 1 101 ? 158.70700 145.59900 104.48700 1.000 58.27131  ? 101 PHE A CD1 1 
ATOM   424   C CD2 . PHE A 1 101 ? 157.31800 145.51000 102.56200 1.000 58.27131  ? 101 PHE A CD2 1 
ATOM   425   C CE1 . PHE A 1 101 ? 158.96000 146.93500 104.24700 1.000 58.27131  ? 101 PHE A CE1 1 
ATOM   426   C CE2 . PHE A 1 101 ? 157.57400 146.84200 102.31100 1.000 58.27131  ? 101 PHE A CE2 1 
ATOM   427   C CZ  . PHE A 1 101 ? 158.38900 147.55600 103.15800 1.000 58.27131  ? 101 PHE A CZ  1 
ATOM   428   N N   . PHE A 1 102 ? 158.63700 140.20800 104.32400 1.000 56.86567  ? 102 PHE A N   1 
ATOM   429   C CA  . PHE A 1 102 ? 158.49600 138.95500 105.04100 1.000 56.86567  ? 102 PHE A CA  1 
ATOM   430   C C   . PHE A 1 102 ? 159.83500 138.34700 105.41300 1.000 56.86567  ? 102 PHE A C   1 
ATOM   431   O O   . PHE A 1 102 ? 159.86300 137.33600 106.11600 1.000 56.86567  ? 102 PHE A O   1 
ATOM   432   C CB  . PHE A 1 102 ? 157.69000 137.95600 104.21400 1.000 56.86567  ? 102 PHE A CB  1 
ATOM   433   C CG  . PHE A 1 102 ? 156.21400 138.17600 104.28100 1.000 56.86567  ? 102 PHE A CG  1 
ATOM   434   C CD1 . PHE A 1 102 ? 155.62600 139.21400 103.58700 1.000 56.86567  ? 102 PHE A CD1 1 
ATOM   435   C CD2 . PHE A 1 102 ? 155.41600 137.34900 105.04200 1.000 56.86567  ? 102 PHE A CD2 1 
ATOM   436   C CE1 . PHE A 1 102 ? 154.27500 139.42500 103.64600 1.000 56.86567  ? 102 PHE A CE1 1 
ATOM   437   C CE2 . PHE A 1 102 ? 154.05900 137.55600 105.10500 1.000 56.86567  ? 102 PHE A CE2 1 
ATOM   438   C CZ  . PHE A 1 102 ? 153.49200 138.59600 104.40400 1.000 56.86567  ? 102 PHE A CZ  1 
ATOM   439   N N   . ALA A 1 103 ? 160.93700 138.92800 104.94900 1.000 59.35623  ? 103 ALA A N   1 
ATOM   440   C CA  . ALA A 1 103 ? 162.25800 138.52900 105.41000 1.000 59.35623  ? 103 ALA A CA  1 
ATOM   441   C C   . ALA A 1 103 ? 162.69800 139.31900 106.62900 1.000 59.35623  ? 103 ALA A C   1 
ATOM   442   O O   . ALA A 1 103 ? 163.52100 138.83200 107.41100 1.000 59.35623  ? 103 ALA A O   1 
ATOM   443   C CB  . ALA A 1 103 ? 163.28500 138.70200 104.29000 1.000 59.35623  ? 103 ALA A CB  1 
ATOM   444   N N   . ILE A 1 104 ? 162.17800 140.53700 106.78600 1.000 59.39406  ? 104 ILE A N   1 
ATOM   445   C CA  . ILE A 1 104 ? 162.39000 141.30500 108.00800 1.000 59.39406  ? 104 ILE A CA  1 
ATOM   446   C C   . ILE A 1 104 ? 161.72000 140.61600 109.18800 1.000 59.39406  ? 104 ILE A C   1 
ATOM   447   O O   . ILE A 1 104 ? 162.29600 140.51400 110.27800 1.000 59.39406  ? 104 ILE A O   1 
ATOM   448   C CB  . ILE A 1 104 ? 161.87400 142.74400 107.81300 1.000 59.39406  ? 104 ILE A CB  1 
ATOM   449   C CG1 . ILE A 1 104 ? 162.75100 143.48500 106.80900 1.000 59.39406  ? 104 ILE A CG1 1 
ATOM   450   C CG2 . ILE A 1 104 ? 161.79800 143.50400 109.11800 1.000 59.39406  ? 104 ILE A CG2 1 
ATOM   451   C CD1 . ILE A 1 104 ? 162.20000 144.81800 106.40200 1.000 59.39406  ? 104 ILE A CD1 1 
ATOM   452   N N   . ASP A 1 105 ? 160.51700 140.08200 108.97300 1.000 60.71883  ? 105 ASP A N   1 
ATOM   453   C CA  . ASP A 1 105 ? 159.74300 139.54000 110.08300 1.000 60.71883  ? 105 ASP A CA  1 
ATOM   454   C C   . ASP A 1 105 ? 160.23400 138.16200 110.50500 1.000 60.71883  ? 105 ASP A C   1 
ATOM   455   O O   . ASP A 1 105 ? 159.81900 137.64600 111.54400 1.000 60.71883  ? 105 ASP A O   1 
ATOM   456   C CB  . ASP A 1 105 ? 158.26600 139.49100 109.71700 1.000 60.71883  ? 105 ASP A CB  1 
ATOM   457   C CG  . ASP A 1 105 ? 157.37200 139.54300 110.93200 1.000 60.71883  ? 105 ASP A CG  1 
ATOM   458   O OD1 . ASP A 1 105 ? 156.99000 138.47000 111.43700 1.000 60.71883  ? 105 ASP A OD1 1 
ATOM   459   O OD2 . ASP A 1 105 ? 157.05100 140.65900 111.38600 1.000 60.71883  ? 105 ASP A OD2 1 
ATOM   460   N N   . ILE A 1 106 ? 161.10000 137.53200 109.71300 1.000 60.91698  ? 106 ILE A N   1 
ATOM   461   C CA  . ILE A 1 106 ? 161.78300 136.34300 110.21400 1.000 60.91698  ? 106 ILE A CA  1 
ATOM   462   C C   . ILE A 1 106 ? 162.82700 136.75400 111.24300 1.000 60.91698  ? 106 ILE A C   1 
ATOM   463   O O   . ILE A 1 106 ? 163.02600 136.08200 112.26200 1.000 60.91698  ? 106 ILE A O   1 
ATOM   464   C CB  . ILE A 1 106 ? 162.40100 135.54800 109.04900 1.000 60.91698  ? 106 ILE A CB  1 
ATOM   465   C CG1 . ILE A 1 106 ? 161.30700 135.11800 108.07400 1.000 60.91698  ? 106 ILE A CG1 1 
ATOM   466   C CG2 . ILE A 1 106 ? 163.14300 134.32300 109.56300 1.000 60.91698  ? 106 ILE A CG2 1 
ATOM   467   C CD1 . ILE A 1 106 ? 161.75600 134.12300 107.02000 1.000 60.91698  ? 106 ILE A CD1 1 
ATOM   468   N N   . ILE A 1 107 ? 163.48000 137.89100 111.00800 1.000 60.94191  ? 107 ILE A N   1 
ATOM   469   C CA  . ILE A 1 107 ? 164.45600 138.41600 111.95700 1.000 60.94191  ? 107 ILE A CA  1 
ATOM   470   C C   . ILE A 1 107 ? 163.75300 138.94300 113.20500 1.000 60.94191  ? 107 ILE A C   1 
ATOM   471   O O   . ILE A 1 107 ? 164.17800 138.67200 114.33500 1.000 60.94191  ? 107 ILE A O   1 
ATOM   472   C CB  . ILE A 1 107 ? 165.31300 139.50100 111.27500 1.000 60.94191  ? 107 ILE A CB  1 
ATOM   473   C CG1 . ILE A 1 107 ? 166.34900 138.86200 110.34900 1.000 60.94191  ? 107 ILE A CG1 1 
ATOM   474   C CG2 . ILE A 1 107 ? 165.99300 140.41400 112.28600 1.000 60.94191  ? 107 ILE A CG2 1 
ATOM   475   C CD1 . ILE A 1 107 ? 167.37000 138.01300 111.06700 1.000 60.94191  ? 107 ILE A CD1 1 
ATOM   476   N N   . LEU A 1 108 ? 162.63600 139.65400 113.01300 1.000 59.82614  ? 108 LEU A N   1 
ATOM   477   C CA  . LEU A 1 108 ? 162.00400 140.40400 114.09600 1.000 59.82614  ? 108 LEU A CA  1 
ATOM   478   C C   . LEU A 1 108 ? 161.38700 139.48900 115.14800 1.000 59.82614  ? 108 LEU A C   1 
ATOM   479   O O   . LEU A 1 108 ? 161.38800 139.81700 116.33800 1.000 59.82614  ? 108 LEU A O   1 
ATOM   480   C CB  . LEU A 1 108 ? 160.94800 141.34500 113.51800 1.000 59.82614  ? 108 LEU A CB  1 
ATOM   481   C CG  . LEU A 1 108 ? 160.13800 142.20600 114.48200 1.000 59.82614  ? 108 LEU A CG  1 
ATOM   482   C CD1 . LEU A 1 108 ? 161.06500 143.02800 115.33600 1.000 59.82614  ? 108 LEU A CD1 1 
ATOM   483   C CD2 . LEU A 1 108 ? 159.19200 143.10300 113.73200 1.000 59.82614  ? 108 LEU A CD2 1 
ATOM   484   N N   . THR A 1 109 ? 160.89300 138.31700 114.74500 1.000 60.88170  ? 109 THR A N   1 
ATOM   485   C CA  . THR A 1 109 ? 160.27600 137.42600 115.72300 1.000 60.88170  ? 109 THR A CA  1 
ATOM   486   C C   . THR A 1 109 ? 161.27700 136.52400 116.42500 1.000 60.88170  ? 109 THR A C   1 
ATOM   487   O O   . THR A 1 109 ? 160.89400 135.45100 116.89900 1.000 60.88170  ? 109 THR A O   1 
ATOM   488   C CB  . THR A 1 109 ? 159.19400 136.57000 115.08400 1.000 60.88170  ? 109 THR A CB  1 
ATOM   489   O OG1 . THR A 1 109 ? 159.79500 135.60900 114.21200 1.000 60.88170  ? 109 THR A OG1 1 
ATOM   490   C CG2 . THR A 1 109 ? 158.20400 137.43200 114.34200 1.000 60.88170  ? 109 THR A CG2 1 
ATOM   491   N N   . PHE A 1 110 ? 162.54300 136.91100 116.47900 1.000 60.75061  ? 110 PHE A N   1 
ATOM   492   C CA  . PHE A 1 110 ? 163.44600 136.40300 117.49600 1.000 60.75061  ? 110 PHE A CA  1 
ATOM   493   C C   . PHE A 1 110 ? 163.53400 137.34100 118.69000 1.000 60.75061  ? 110 PHE A C   1 
ATOM   494   O O   . PHE A 1 110 ? 164.40400 137.16500 119.54600 1.000 60.75061  ? 110 PHE A O   1 
ATOM   495   C CB  . PHE A 1 110 ? 164.83300 136.16600 116.89900 1.000 60.75061  ? 110 PHE A CB  1 
ATOM   496   C CG  . PHE A 1 110 ? 164.96200 134.86100 116.17500 1.000 60.75061  ? 110 PHE A CG  1 
ATOM   497   C CD1 . PHE A 1 110 ? 165.15500 133.68400 116.87400 1.000 60.75061  ? 110 PHE A CD1 1 
ATOM   498   C CD2 . PHE A 1 110 ? 164.89200 134.80900 114.79600 1.000 60.75061  ? 110 PHE A CD2 1 
ATOM   499   C CE1 . PHE A 1 110 ? 165.27400 132.47800 116.21100 1.000 60.75061  ? 110 PHE A CE1 1 
ATOM   500   C CE2 . PHE A 1 110 ? 165.01000 133.60300 114.12800 1.000 60.75061  ? 110 PHE A CE2 1 
ATOM   501   C CZ  . PHE A 1 110 ? 165.20100 132.44000 114.83800 1.000 60.75061  ? 110 PHE A CZ  1 
ATOM   502   N N   . PHE A 1 111 ? 162.65500 138.33700 118.75500 1.000 62.05147  ? 111 PHE A N   1 
ATOM   503   C CA  . PHE A 1 111 ? 162.67100 139.35100 119.79900 1.000 62.05147  ? 111 PHE A CA  1 
ATOM   504   C C   . PHE A 1 111 ? 161.25100 139.65900 120.26700 1.000 62.05147  ? 111 PHE A C   1 
ATOM   505   O O   . PHE A 1 111 ? 160.87400 140.81600 120.44300 1.000 62.05147  ? 111 PHE A O   1 
ATOM   506   C CB  . PHE A 1 111 ? 163.35000 140.62900 119.30800 1.000 62.05147  ? 111 PHE A CB  1 
ATOM   507   C CG  . PHE A 1 111 ? 164.76600 140.43600 118.84600 1.000 62.05147  ? 111 PHE A CG  1 
ATOM   508   C CD1 . PHE A 1 111 ? 165.05000 140.24200 117.50600 1.000 62.05147  ? 111 PHE A CD1 1 
ATOM   509   C CD2 . PHE A 1 111 ? 165.81300 140.46800 119.74700 1.000 62.05147  ? 111 PHE A CD2 1 
ATOM   510   C CE1 . PHE A 1 111 ? 166.35000 140.06800 117.07600 1.000 62.05147  ? 111 PHE A CE1 1 
ATOM   511   C CE2 . PHE A 1 111 ? 167.11700 140.29700 119.32200 1.000 62.05147  ? 111 PHE A CE2 1 
ATOM   512   C CZ  . PHE A 1 111 ? 167.38300 140.09600 117.98500 1.000 62.05147  ? 111 PHE A CZ  1 
ATOM   513   N N   . VAL A 1 112 ? 160.43100 138.62800 120.47400 1.000 61.90993  ? 112 VAL A N   1 
ATOM   514   C CA  . VAL A 1 112 ? 159.06700 138.80900 120.96200 1.000 61.90993  ? 112 VAL A CA  1 
ATOM   515   C C   . VAL A 1 112 ? 158.80900 137.85800 122.12300 1.000 61.90993  ? 112 VAL A C   1 
ATOM   516   O O   . VAL A 1 112 ? 159.36400 136.75800 122.18100 1.000 61.90993  ? 112 VAL A O   1 
ATOM   517   C CB  . VAL A 1 112 ? 158.02500 138.60500 119.84700 1.000 61.90993  ? 112 VAL A CB  1 
ATOM   518   C CG1 . VAL A 1 112 ? 157.98600 139.81500 118.93400 1.000 61.90993  ? 112 VAL A CG1 1 
ATOM   519   C CG2 . VAL A 1 112 ? 158.35100 137.35400 119.06000 1.000 61.90993  ? 112 VAL A CG2 1 
ATOM   520   N N   . ALA A 1 113 ? 157.92100 138.27200 123.03200 1.000 60.75691  ? 113 ALA A N   1 
ATOM   521   C CA  . ALA A 1 113 ? 157.91400 137.71500 124.38300 1.000 60.75691  ? 113 ALA A CA  1 
ATOM   522   C C   . ALA A 1 113 ? 157.01200 136.49200 124.53200 1.000 60.75691  ? 113 ALA A C   1 
ATOM   523   O O   . ALA A 1 113 ? 157.20500 135.69400 125.45200 1.000 60.75691  ? 113 ALA A O   1 
ATOM   524   C CB  . ALA A 1 113 ? 157.50500 138.79600 125.37500 1.000 60.75691  ? 113 ALA A CB  1 
ATOM   525   N N   . TYR A 1 114 ? 155.97100 136.39200 123.72100 1.000 60.00687  ? 114 TYR A N   1 
ATOM   526   C CA  . TYR A 1 114 ? 155.15700 135.21700 123.38800 1.000 60.00687  ? 114 TYR A CA  1 
ATOM   527   C C   . TYR A 1 114 ? 154.19100 134.67400 124.45100 1.000 60.00687  ? 114 TYR A C   1 
ATOM   528   O O   . TYR A 1 114 ? 153.38300 133.82300 124.06400 1.000 60.00687  ? 114 TYR A O   1 
ATOM   529   C CB  . TYR A 1 114 ? 156.01300 134.04400 122.85200 1.000 60.00687  ? 114 TYR A CB  1 
ATOM   530   C CG  . TYR A 1 114 ? 156.74500 133.09100 123.80300 1.000 60.00687  ? 114 TYR A CG  1 
ATOM   531   C CD1 . TYR A 1 114 ? 156.08700 132.04300 124.44700 1.000 60.00687  ? 114 TYR A CD1 1 
ATOM   532   C CD2 . TYR A 1 114 ? 158.12000 133.16000 123.94300 1.000 60.00687  ? 114 TYR A CD2 1 
ATOM   533   C CE1 . TYR A 1 114 ? 156.75700 131.17400 125.26900 1.000 60.00687  ? 114 TYR A CE1 1 
ATOM   534   C CE2 . TYR A 1 114 ? 158.79900 132.28900 124.76400 1.000 60.00687  ? 114 TYR A CE2 1 
ATOM   535   C CZ  . TYR A 1 114 ? 158.11200 131.29600 125.42000 1.000 60.00687  ? 114 TYR A CZ  1 
ATOM   536   O OH  . TYR A 1 114 ? 158.78200 130.41900 126.23700 1.000 60.00687  ? 114 TYR A OH  1 
ATOM   537   N N   . LEU A 1 115 ? 154.21400 135.11900 125.71600 1.000 56.38259  ? 115 LEU A N   1 
ATOM   538   C CA  . LEU A 1 115 ? 153.14900 134.86800 126.70800 1.000 56.38259  ? 115 LEU A CA  1 
ATOM   539   C C   . LEU A 1 115 ? 152.92000 133.36900 126.95300 1.000 56.38259  ? 115 LEU A C   1 
ATOM   540   O O   . LEU A 1 115 ? 152.03000 132.75200 126.36900 1.000 56.38259  ? 115 LEU A O   1 
ATOM   541   C CB  . LEU A 1 115 ? 151.84500 135.57800 126.31300 1.000 56.38259  ? 115 LEU A CB  1 
ATOM   542   C CG  . LEU A 1 115 ? 150.76800 135.79900 127.38700 1.000 56.38259  ? 115 LEU A CG  1 
ATOM   543   C CD1 . LEU A 1 115 ? 150.07800 137.10900 127.10800 1.000 56.38259  ? 115 LEU A CD1 1 
ATOM   544   C CD2 . LEU A 1 115 ? 149.71600 134.71200 127.46500 1.000 56.38259  ? 115 LEU A CD2 1 
ATOM   545   N N   . ASP A 1 116 ? 153.82800 132.79000 127.74800 1.000 55.54843  ? 116 ASP A N   1 
ATOM   546   C CA  . ASP A 1 116 ? 153.89900 131.37400 128.12500 1.000 55.54843  ? 116 ASP A CA  1 
ATOM   547   C C   . ASP A 1 116 ? 152.55200 130.74200 128.46700 1.000 55.54843  ? 116 ASP A C   1 
ATOM   548   O O   . ASP A 1 116 ? 151.67300 131.39500 129.03200 1.000 55.54843  ? 116 ASP A O   1 
ATOM   549   C CB  . ASP A 1 116 ? 154.85700 131.23500 129.31600 1.000 55.54843  ? 116 ASP A CB  1 
ATOM   550   C CG  . ASP A 1 116 ? 155.26300 129.78700 129.61700 1.000 55.54843  ? 116 ASP A CG  1 
ATOM   551   O OD1 . ASP A 1 116 ? 154.41500 128.91700 129.91400 1.000 55.54843  ? 116 ASP A OD1 1 
ATOM   552   O OD2 . ASP A 1 116 ? 156.47800 129.51600 129.55400 1.000 55.54843  ? 116 ASP A OD2 1 
ATOM   553   N N   . SER A 1 117 ? 152.39200 129.46400 128.12800 1.000 54.21775  ? 117 SER A N   1 
ATOM   554   C CA  . SER A 1 117 ? 151.09800 128.79500 128.18600 1.000 54.21775  ? 117 SER A CA  1 
ATOM   555   C C   . SER A 1 117 ? 150.75000 128.24600 129.56000 1.000 54.21775  ? 117 SER A C   1 
ATOM   556   O O   . SER A 1 117 ? 149.57500 128.26400 129.93900 1.000 54.21775  ? 117 SER A O   1 
ATOM   557   C CB  . SER A 1 117 ? 151.06000 127.65000 127.17400 1.000 54.21775  ? 117 SER A CB  1 
ATOM   558   O OG  . SER A 1 117 ? 152.08200 126.71300 127.45200 1.000 54.21775  ? 117 SER A OG  1 
ATOM   559   N N   . HIS A 1 118 ? 151.72400 127.73400 130.30400 1.000 52.94889  ? 118 HIS A N   1 
ATOM   560   C CA  . HIS A 1 118 ? 151.45500 127.17100 131.61900 1.000 52.94889  ? 118 HIS A CA  1 
ATOM   561   C C   . HIS A 1 118 ? 151.61300 128.18000 132.74500 1.000 52.94889  ? 118 HIS A C   1 
ATOM   562   O O   . HIS A 1 118 ? 151.20800 127.89300 133.87400 1.000 52.94889  ? 118 HIS A O   1 
ATOM   563   C CB  . HIS A 1 118 ? 152.37500 125.97600 131.88400 1.000 52.94889  ? 118 HIS A CB  1 
ATOM   564   C CG  . HIS A 1 118 ? 151.94300 124.71900 131.19800 1.000 52.94889  ? 118 HIS A CG  1 
ATOM   565   N ND1 . HIS A 1 118 ? 152.62800 123.53100 131.32100 1.000 52.94889  ? 118 HIS A ND1 1 
ATOM   566   C CD2 . HIS A 1 118 ? 150.89500 124.46600 130.38000 1.000 52.94889  ? 118 HIS A CD2 1 
ATOM   567   C CE1 . HIS A 1 118 ? 152.02200 122.59900 130.60900 1.000 52.94889  ? 118 HIS A CE1 1 
ATOM   568   N NE2 . HIS A 1 118 ? 150.96800 123.14000 130.02700 1.000 52.94889  ? 118 HIS A NE2 1 
ATOM   569   N N   . SER A 1 119 ? 152.18900 129.34800 132.47000 1.000 49.78396  ? 119 SER A N   1 
ATOM   570   C CA  . SER A 1 119 ? 152.37900 130.36800 133.48500 1.000 49.78396  ? 119 SER A CA  1 
ATOM   571   C C   . SER A 1 119 ? 151.54800 131.61700 133.26400 1.000 49.78396  ? 119 SER A C   1 
ATOM   572   O O   . SER A 1 119 ? 151.40500 132.40400 134.20200 1.000 49.78396  ? 119 SER A O   1 
ATOM   573   C CB  . SER A 1 119 ? 153.85400 130.77600 133.56100 1.000 49.78396  ? 119 SER A CB  1 
ATOM   574   O OG  . SER A 1 119 ? 154.03000 131.83700 134.47900 1.000 49.78396  ? 119 SER A OG  1 
ATOM   575   N N   . TYR A 1 120 ? 151.01900 131.81300 132.05100 1.000 45.42185  ? 120 TYR A N   1 
ATOM   576   C CA  . TYR A 1 120 ? 150.20500 132.96800 131.65400 1.000 45.42185  ? 120 TYR A CA  1 
ATOM   577   C C   . TYR A 1 120 ? 150.93600 134.29000 131.86000 1.000 45.42185  ? 120 TYR A C   1 
ATOM   578   O O   . TYR A 1 120 ? 150.31800 135.31900 132.13100 1.000 45.42185  ? 120 TYR A O   1 
ATOM   579   C CB  . TYR A 1 120 ? 148.85100 132.97000 132.36700 1.000 45.42185  ? 120 TYR A CB  1 
ATOM   580   C CG  . TYR A 1 120 ? 148.20600 131.60900 132.37500 1.000 45.42185  ? 120 TYR A CG  1 
ATOM   581   C CD1 . TYR A 1 120 ? 147.60100 131.10300 131.23800 1.000 45.42185  ? 120 TYR A CD1 1 
ATOM   582   C CD2 . TYR A 1 120 ? 148.21800 130.82200 133.51300 1.000 45.42185  ? 120 TYR A CD2 1 
ATOM   583   C CE1 . TYR A 1 120 ? 147.02000 129.85400 131.24000 1.000 45.42185  ? 120 TYR A CE1 1 
ATOM   584   C CE2 . TYR A 1 120 ? 147.64200 129.57500 133.52300 1.000 45.42185  ? 120 TYR A CE2 1 
ATOM   585   C CZ  . TYR A 1 120 ? 147.04500 129.09800 132.38800 1.000 45.42185  ? 120 TYR A CZ  1 
ATOM   586   O OH  . TYR A 1 120 ? 146.47200 127.85200 132.40300 1.000 45.42185  ? 120 TYR A OH  1 
ATOM   587   N N   . LEU A 1 121 ? 152.25600 134.26900 131.71500 1.000 51.57151  ? 121 LEU A N   1 
ATOM   588   C CA  . LEU A 1 121 ? 153.08800 135.45100 131.84400 1.000 51.57151  ? 121 LEU A CA  1 
ATOM   589   C C   . LEU A 1 121 ? 154.06700 135.49900 130.68300 1.000 51.57151  ? 121 LEU A C   1 
ATOM   590   O O   . LEU A 1 121 ? 154.37400 134.47600 130.06700 1.000 51.57151  ? 121 LEU A O   1 
ATOM   591   C CB  . LEU A 1 121 ? 153.85300 135.45500 133.16800 1.000 51.57151  ? 121 LEU A CB  1 
ATOM   592   C CG  . LEU A 1 121 ? 153.06400 135.86000 134.41100 1.000 51.57151  ? 121 LEU A CG  1 
ATOM   593   C CD1 . LEU A 1 121 ? 153.81100 135.45500 135.65800 1.000 51.57151  ? 121 LEU A CD1 1 
ATOM   594   C CD2 . LEU A 1 121 ? 152.80400 137.35200 134.41300 1.000 51.57151  ? 121 LEU A CD2 1 
ATOM   595   N N   . LEU A 1 122 ? 154.55800 136.69800 130.39600 1.000 56.51074  ? 122 LEU A N   1 
ATOM   596   C CA  . LEU A 1 122 ? 155.45600 136.89700 129.26700 1.000 56.51074  ? 122 LEU A CA  1 
ATOM   597   C C   . LEU A 1 122 ? 156.84600 136.36400 129.58300 1.000 56.51074  ? 122 LEU A C   1 
ATOM   598   O O   . LEU A 1 122 ? 157.34300 136.50600 130.70100 1.000 56.51074  ? 122 LEU A O   1 
ATOM   599   C CB  . LEU A 1 122 ? 155.53300 138.38000 128.91500 1.000 56.51074  ? 122 LEU A CB  1 
ATOM   600   C CG  . LEU A 1 122 ? 154.54700 138.96400 127.90300 1.000 56.51074  ? 122 LEU A CG  1 
ATOM   601   C CD1 . LEU A 1 122 ? 153.12400 138.96100 128.40100 1.000 56.51074  ? 122 LEU A CD1 1 
ATOM   602   C CD2 . LEU A 1 122 ? 154.95400 140.37500 127.61200 1.000 56.51074  ? 122 LEU A CD2 1 
ATOM   603   N N   . VAL A 1 123 ? 157.47400 135.74700 128.59000 1.000 61.41165  ? 123 VAL A N   1 
ATOM   604   C CA  . VAL A 1 123 ? 158.81700 135.19800 128.72100 1.000 61.41165  ? 123 VAL A CA  1 
ATOM   605   C C   . VAL A 1 123 ? 159.77500 136.17200 128.05400 1.000 61.41165  ? 123 VAL A C   1 
ATOM   606   O O   . VAL A 1 123 ? 159.69800 136.40200 126.84300 1.000 61.41165  ? 123 VAL A O   1 
ATOM   607   C CB  . VAL A 1 123 ? 158.92900 133.80100 128.09800 1.000 61.41165  ? 123 VAL A CB  1 
ATOM   608   C CG1 . VAL A 1 123 ? 160.37700 133.38800 127.97500 1.000 61.41165  ? 123 VAL A CG1 1 
ATOM   609   C CG2 . VAL A 1 123 ? 158.18500 132.79800 128.92900 1.000 61.41165  ? 123 VAL A CG2 1 
ATOM   610   N N   . ASP A 1 124 ? 160.67300 136.75900 128.83700 1.000 69.63495  ? 124 ASP A N   1 
ATOM   611   C CA  . ASP A 1 124 ? 161.72200 137.62500 128.31000 1.000 69.63495  ? 124 ASP A CA  1 
ATOM   612   C C   . ASP A 1 124 ? 163.04500 136.89800 128.50500 1.000 69.63495  ? 124 ASP A C   1 
ATOM   613   O O   . ASP A 1 124 ? 163.77100 137.12200 129.47400 1.000 69.63495  ? 124 ASP A O   1 
ATOM   614   C CB  . ASP A 1 124 ? 161.71700 138.97500 128.99700 1.000 69.63495  ? 124 ASP A CB  1 
ATOM   615   C CG  . ASP A 1 124 ? 160.47900 139.77500 128.68800 1.000 69.63495  ? 124 ASP A CG  1 
ATOM   616   O OD1 . ASP A 1 124 ? 159.71900 139.35700 127.79500 1.000 69.63495  ? 124 ASP A OD1 1 
ATOM   617   O OD2 . ASP A 1 124 ? 160.26400 140.82200 129.33300 1.000 69.63495  ? 124 ASP A OD2 1 
ATOM   618   N N   . SER A 1 125 ? 163.35700 136.02100 127.56900 1.000 69.49374  ? 125 SER A N   1 
ATOM   619   C CA  . SER A 1 125 ? 164.60300 135.26000 127.59900 1.000 69.49374  ? 125 SER A CA  1 
ATOM   620   C C   . SER A 1 125 ? 164.91900 134.88800 126.16500 1.000 69.49374  ? 125 SER A C   1 
ATOM   621   O O   . SER A 1 125 ? 164.22100 134.05900 125.56200 1.000 69.49374  ? 125 SER A O   1 
ATOM   622   C CB  . SER A 1 125 ? 164.49900 134.01800 128.47700 1.000 69.49374  ? 125 SER A CB  1 
ATOM   623   O OG  . SER A 1 125 ? 164.01200 132.92400 127.72900 1.000 69.49374  ? 125 SER A OG  1 
ATOM   624   N N   . PRO A 1 126 ? 165.98300 135.45700 125.58600 1.000 69.34798  ? 126 PRO A N   1 
ATOM   625   C CA  . PRO A 1 126 ? 166.21200 135.31600 124.14100 1.000 69.34798  ? 126 PRO A CA  1 
ATOM   626   C C   . PRO A 1 126 ? 166.65200 133.92900 123.69900 1.000 69.34798  ? 126 PRO A C   1 
ATOM   627   O O   . PRO A 1 126 ? 166.74800 133.67000 122.49800 1.000 69.34798  ? 126 PRO A O   1 
ATOM   628   C CB  . PRO A 1 126 ? 167.30200 136.35500 123.86700 1.000 69.34798  ? 126 PRO A CB  1 
ATOM   629   C CG  . PRO A 1 126 ? 168.03200 136.46100 125.14900 1.000 69.34798  ? 126 PRO A CG  1 
ATOM   630   C CD  . PRO A 1 126 ? 167.00400 136.30200 126.22400 1.000 69.34798  ? 126 PRO A CD  1 
ATOM   631   N N   . LYS A 1 127 ? 166.91600 133.03000 124.64200 1.000 70.04525  ? 127 LYS A N   1 
ATOM   632   C CA  . LYS A 1 127 ? 167.17300 131.64800 124.26700 1.000 70.04525  ? 127 LYS A CA  1 
ATOM   633   C C   . LYS A 1 127 ? 165.89000 130.84400 124.12000 1.000 70.04525  ? 127 LYS A C   1 
ATOM   634   O O   . LYS A 1 127 ? 165.71800 130.14700 123.11700 1.000 70.04525  ? 127 LYS A O   1 
ATOM   635   C CB  . LYS A 1 127 ? 168.09500 130.97600 125.28500 1.000 70.04525  ? 127 LYS A CB  1 
ATOM   636   C CG  . LYS A 1 127 ? 168.64900 129.63200 124.82300 1.000 70.04525  ? 127 LYS A CG  1 
ATOM   637   C CD  . LYS A 1 127 ? 169.34300 129.71100 123.46000 1.000 70.04525  ? 127 LYS A CD  1 
ATOM   638   C CE  . LYS A 1 127 ? 170.60300 130.57700 123.48600 1.000 70.04525  ? 127 LYS A CE  1 
ATOM   639   N NZ  . LYS A 1 127 ? 171.35800 130.51200 122.20300 1.000 70.04525  ? 127 LYS A NZ  1 
ATOM   640   N N   . LYS A 1 128 ? 164.97200 130.93900 125.08700 1.000 68.80409  ? 128 LYS A N   1 
ATOM   641   C CA  . LYS A 1 128 ? 163.72600 130.18300 124.99300 1.000 68.80409  ? 128 LYS A CA  1 
ATOM   642   C C   . LYS A 1 128 ? 162.78200 130.78100 123.95800 1.000 68.80409  ? 128 LYS A C   1 
ATOM   643   O O   . LYS A 1 128 ? 161.88900 130.08700 123.45900 1.000 68.80409  ? 128 LYS A O   1 
ATOM   644   C CB  . LYS A 1 128 ? 163.03900 130.11200 126.35500 1.000 68.80409  ? 128 LYS A CB  1 
ATOM   645   C CG  . LYS A 1 128 ? 163.51500 128.96900 127.22700 1.000 68.80409  ? 128 LYS A CG  1 
ATOM   646   C CD  . LYS A 1 128 ? 163.56500 129.37900 128.68800 1.000 68.80409  ? 128 LYS A CD  1 
ATOM   647   C CE  . LYS A 1 128 ? 162.18700 129.75200 129.20100 1.000 68.80409  ? 128 LYS A CE  1 
ATOM   648   N NZ  . LYS A 1 128 ? 161.41300 128.54900 129.60900 1.000 68.80409  ? 128 LYS A NZ  1 
ATOM   649   N N   . ILE A 1 129 ? 162.95100 132.06800 123.64700 1.000 65.61660  ? 129 ILE A N   1 
ATOM   650   C CA  . ILE A 1 129 ? 162.29100 132.65800 122.48400 1.000 65.61660  ? 129 ILE A CA  1 
ATOM   651   C C   . ILE A 1 129 ? 162.76800 131.96400 121.21500 1.000 65.61660  ? 129 ILE A C   1 
ATOM   652   O O   . ILE A 1 129 ? 161.97300 131.61000 120.33600 1.000 65.61660  ? 129 ILE A O   1 
ATOM   653   C CB  . ILE A 1 129 ? 162.56200 134.17300 122.43500 1.000 65.61660  ? 129 ILE A CB  1 
ATOM   654   C CG1 . ILE A 1 129 ? 161.75700 134.90000 123.50200 1.000 65.61660  ? 129 ILE A CG1 1 
ATOM   655   C CG2 . ILE A 1 129 ? 162.23200 134.75800 121.08400 1.000 65.61660  ? 129 ILE A CG2 1 
ATOM   656   C CD1 . ILE A 1 129 ? 162.21600 136.31100 123.72300 1.000 65.61660  ? 129 ILE A CD1 1 
ATOM   657   N N   . ALA A 1 130 ? 164.07500 131.70800 121.13700 1.000 66.65569  ? 130 ALA A N   1 
ATOM   658   C CA  . ALA A 1 130 ? 164.68100 131.21000 119.90900 1.000 66.65569  ? 130 ALA A CA  1 
ATOM   659   C C   . ALA A 1 130 ? 164.33700 129.74800 119.66100 1.000 66.65569  ? 130 ALA A C   1 
ATOM   660   O O   . ALA A 1 130 ? 164.06100 129.36000 118.52300 1.000 66.65569  ? 130 ALA A O   1 
ATOM   661   C CB  . ALA A 1 130 ? 166.19300 131.40400 119.96100 1.000 66.65569  ? 130 ALA A CB  1 
ATOM   662   N N   . ILE A 1 131 ? 164.34800 128.92000 120.70800 1.000 66.09212  ? 131 ILE A N   1 
ATOM   663   C CA  . ILE A 1 131 ? 164.06700 127.49600 120.52100 1.000 66.09212  ? 131 ILE A CA  1 
ATOM   664   C C   . ILE A 1 131 ? 162.59300 127.28400 120.19500 1.000 66.09212  ? 131 ILE A C   1 
ATOM   665   O O   . ILE A 1 131 ? 162.22700 126.34300 119.47900 1.000 66.09212  ? 131 ILE A O   1 
ATOM   666   C CB  . ILE A 1 131 ? 164.50600 126.69500 121.76300 1.000 66.09212  ? 131 ILE A CB  1 
ATOM   667   C CG1 . ILE A 1 131 ? 165.94700 127.02800 122.13200 1.000 66.09212  ? 131 ILE A CG1 1 
ATOM   668   C CG2 . ILE A 1 131 ? 164.41500 125.19500 121.53200 1.000 66.09212  ? 131 ILE A CG2 1 
ATOM   669   C CD1 . ILE A 1 131 ? 166.22500 126.93800 123.61400 1.000 66.09212  ? 131 ILE A CD1 1 
ATOM   670   N N   . ARG A 1 132 ? 161.72900 128.18000 120.67400 1.000 64.20916  ? 132 ARG A N   1 
ATOM   671   C CA  . ARG A 1 132 ? 160.31000 128.07400 120.35500 1.000 64.20916  ? 132 ARG A CA  1 
ATOM   672   C C   . ARG A 1 132 ? 160.04500 128.42500 118.89800 1.000 64.20916  ? 132 ARG A C   1 
ATOM   673   O O   . ARG A 1 132 ? 159.29800 127.72600 118.20800 1.000 64.20916  ? 132 ARG A O   1 
ATOM   674   C CB  . ARG A 1 132 ? 159.49000 128.97200 121.27300 1.000 64.20916  ? 132 ARG A CB  1 
ATOM   675   C CG  . ARG A 1 132 ? 158.00700 128.90400 120.99900 1.000 64.20916  ? 132 ARG A CG  1 
ATOM   676   C CD  . ARG A 1 132 ? 157.23900 129.72900 121.98500 1.000 64.20916  ? 132 ARG A CD  1 
ATOM   677   N NE  . ARG A 1 132 ? 155.80900 129.73400 121.70600 1.000 64.20916  ? 132 ARG A NE  1 
ATOM   678   C CZ  . ARG A 1 132 ? 155.19500 130.65400 120.97100 1.000 64.20916  ? 132 ARG A CZ  1 
ATOM   679   N NH1 . ARG A 1 132 ? 155.88500 131.64600 120.43000 1.000 64.20916  ? 132 ARG A NH1 1 
ATOM   680   N NH2 . ARG A 1 132 ? 153.88900 130.57900 120.77400 1.000 64.20916  ? 132 ARG A NH2 1 
ATOM   681   N N   . TYR A 1 133 ? 160.65700 129.50300 118.40600 1.000 64.16043  ? 133 TYR A N   1 
ATOM   682   C CA  . TYR A 1 133 ? 160.40100 129.92100 117.03300 1.000 64.16043  ? 133 TYR A CA  1 
ATOM   683   C C   . TYR A 1 133 ? 161.06900 128.98400 116.03700 1.000 64.16043  ? 133 TYR A C   1 
ATOM   684   O O   . TYR A 1 133 ? 160.57000 128.78500 114.92500 1.000 64.16043  ? 133 TYR A O   1 
ATOM   685   C CB  . TYR A 1 133 ? 160.87200 131.35400 116.81600 1.000 64.16043  ? 133 TYR A CB  1 
ATOM   686   C CG  . TYR A 1 133 ? 160.53800 131.85700 115.44200 1.000 64.16043  ? 133 TYR A CG  1 
ATOM   687   C CD1 . TYR A 1 133 ? 159.24500 131.76800 114.95500 1.000 64.16043  ? 133 TYR A CD1 1 
ATOM   688   C CD2 . TYR A 1 133 ? 161.50800 132.40000 114.62500 1.000 64.16043  ? 133 TYR A CD2 1 
ATOM   689   C CE1 . TYR A 1 133 ? 158.92600 132.21800 113.69800 1.000 64.16043  ? 133 TYR A CE1 1 
ATOM   690   C CE2 . TYR A 1 133 ? 161.20000 132.85000 113.36200 1.000 64.16043  ? 133 TYR A CE2 1 
ATOM   691   C CZ  . TYR A 1 133 ? 159.90700 132.75400 112.90600 1.000 64.16043  ? 133 TYR A CZ  1 
ATOM   692   O OH  . TYR A 1 133 ? 159.58900 133.20300 111.65000 1.000 64.16043  ? 133 TYR A OH  1 
ATOM   693   N N   . LEU A 1 134 ? 162.19200 128.38200 116.42400 1.000 64.03837  ? 134 LEU A N   1 
ATOM   694   C CA  . LEU A 1 134 ? 162.88100 127.46700 115.52500 1.000 64.03837  ? 134 LEU A CA  1 
ATOM   695   C C   . LEU A 1 134 ? 162.22100 126.09700 115.46700 1.000 64.03837  ? 134 LEU A C   1 
ATOM   696   O O   . LEU A 1 134 ? 162.54500 125.30700 114.57700 1.000 64.03837  ? 134 LEU A O   1 
ATOM   697   C CB  . LEU A 1 134 ? 164.34500 127.33100 115.93900 1.000 64.03837  ? 134 LEU A CB  1 
ATOM   698   C CG  . LEU A 1 134 ? 165.24300 128.50800 115.55000 1.000 64.03837  ? 134 LEU A CG  1 
ATOM   699   C CD1 . LEU A 1 134 ? 166.50800 128.53100 116.38100 1.000 64.03837  ? 134 LEU A CD1 1 
ATOM   700   C CD2 . LEU A 1 134 ? 165.59600 128.42500 114.09500 1.000 64.03837  ? 134 LEU A CD2 1 
ATOM   701   N N   . SER A 1 135 ? 161.30400 125.79700 116.38400 1.000 64.65817  ? 135 SER A N   1 
ATOM   702   C CA  . SER A 1 135 ? 160.65100 124.49600 116.40100 1.000 64.65817  ? 135 SER A CA  1 
ATOM   703   C C   . SER A 1 135 ? 159.23700 124.51700 115.84000 1.000 64.65817  ? 135 SER A C   1 
ATOM   704   O O   . SER A 1 135 ? 158.71800 123.45700 115.47400 1.000 64.65817  ? 135 SER A O   1 
ATOM   705   C CB  . SER A 1 135 ? 160.60800 123.94300 117.82700 1.000 64.65817  ? 135 SER A CB  1 
ATOM   706   O OG  . SER A 1 135 ? 161.91100 123.76400 118.34400 1.000 64.65817  ? 135 SER A OG  1 
ATOM   707   N N   . THR A 1 136 ? 158.58900 125.68000 115.78300 1.000 65.19313  ? 136 THR A N   1 
ATOM   708   C CA  . THR A 1 136 ? 157.22400 125.76400 115.27800 1.000 65.19313  ? 136 THR A CA  1 
ATOM   709   C C   . THR A 1 136 ? 157.14500 126.31500 113.85700 1.000 65.19313  ? 136 THR A C   1 
ATOM   710   O O   . THR A 1 136 ? 156.64000 125.63900 112.95900 1.000 65.19313  ? 136 THR A O   1 
ATOM   711   C CB  . THR A 1 136 ? 156.36100 126.60800 116.22800 1.000 65.19313  ? 136 THR A CB  1 
ATOM   712   O OG1 . THR A 1 136 ? 156.73700 127.98500 116.13200 1.000 65.19313  ? 136 THR A OG1 1 
ATOM   713   C CG2 . THR A 1 136 ? 156.50000 126.12800 117.65900 1.000 65.19313  ? 136 THR A CG2 1 
ATOM   714   N N   . TRP A 1 137 ? 157.63900 127.52800 113.62900 1.000 65.19707  ? 137 TRP A N   1 
ATOM   715   C CA  . TRP A 1 137 ? 157.38500 128.22000 112.36900 1.000 65.19707  ? 137 TRP A CA  1 
ATOM   716   C C   . TRP A 1 137 ? 158.65800 128.83800 111.80900 1.000 65.19707  ? 137 TRP A C   1 
ATOM   717   O O   . TRP A 1 137 ? 158.68100 130.00200 111.41100 1.000 65.19707  ? 137 TRP A O   1 
ATOM   718   C CB  . TRP A 1 137 ? 156.32400 129.30600 112.53100 1.000 65.19707  ? 137 TRP A CB  1 
ATOM   719   C CG  . TRP A 1 137 ? 155.01600 128.85100 113.08400 1.000 65.19707  ? 137 TRP A CG  1 
ATOM   720   C CD1 . TRP A 1 137 ? 154.48400 129.18500 114.29100 1.000 65.19707  ? 137 TRP A CD1 1 
ATOM   721   C CD2 . TRP A 1 137 ? 154.06000 128.00100 112.44500 1.000 65.19707  ? 137 TRP A CD2 1 
ATOM   722   N NE1 . TRP A 1 137 ? 153.26100 128.58700 114.45000 1.000 65.19707  ? 137 TRP A NE1 1 
ATOM   723   C CE2 . TRP A 1 137 ? 152.97700 127.85500 113.32800 1.000 65.19707  ? 137 TRP A CE2 1 
ATOM   724   C CE3 . TRP A 1 137 ? 154.01600 127.34500 111.21500 1.000 65.19707  ? 137 TRP A CE3 1 
ATOM   725   C CZ2 . TRP A 1 137 ? 151.86600 127.08100 113.02200 1.000 65.19707  ? 137 TRP A CZ2 1 
ATOM   726   C CZ3 . TRP A 1 137 ? 152.91100 126.57800 110.91300 1.000 65.19707  ? 137 TRP A CZ3 1 
ATOM   727   C CH2 . TRP A 1 137 ? 151.85300 126.45200 111.81100 1.000 65.19707  ? 137 TRP A CH2 1 
ATOM   728   N N   . PHE A 1 138 ? 159.74200 128.07100 111.76000 1.000 67.13994  ? 138 PHE A N   1 
ATOM   729   C CA  . PHE A 1 138 ? 160.93600 128.51900 111.05600 1.000 67.13994  ? 138 PHE A CA  1 
ATOM   730   C C   . PHE A 1 138 ? 161.17300 127.71600 109.78700 1.000 67.13994  ? 138 PHE A C   1 
ATOM   731   O O   . PHE A 1 138 ? 161.40600 128.29500 108.72500 1.000 67.13994  ? 138 PHE A O   1 
ATOM   732   C CB  . PHE A 1 138 ? 162.17400 128.45400 111.94600 1.000 67.13994  ? 138 PHE A CB  1 
ATOM   733   C CG  . PHE A 1 138 ? 163.35100 129.17700 111.37200 1.000 67.13994  ? 138 PHE A CG  1 
ATOM   734   C CD1 . PHE A 1 138 ? 163.43300 130.55500 111.45400 1.000 67.13994  ? 138 PHE A CD1 1 
ATOM   735   C CD2 . PHE A 1 138 ? 164.36300 128.48600 110.72800 1.000 67.13994  ? 138 PHE A CD2 1 
ATOM   736   C CE1 . PHE A 1 138 ? 164.50900 131.22800 110.92500 1.000 67.13994  ? 138 PHE A CE1 1 
ATOM   737   C CE2 . PHE A 1 138 ? 165.44100 129.15500 110.19600 1.000 67.13994  ? 138 PHE A CE2 1 
ATOM   738   C CZ  . PHE A 1 138 ? 165.51300 130.52800 110.29400 1.000 67.13994  ? 138 PHE A CZ  1 
ATOM   739   N N   . ALA A 1 139 ? 161.10300 126.38700 109.86700 1.000 71.87293  ? 139 ALA A N   1 
ATOM   740   C CA  . ALA A 1 139 ? 161.22900 125.55300 108.67900 1.000 71.87293  ? 139 ALA A CA  1 
ATOM   741   C C   . ALA A 1 139 ? 160.01900 125.65500 107.76800 1.000 71.87293  ? 139 ALA A C   1 
ATOM   742   O O   . ALA A 1 139 ? 160.07400 125.17600 106.63100 1.000 71.87293  ? 139 ALA A O   1 
ATOM   743   C CB  . ALA A 1 139 ? 161.44800 124.09500 109.08100 1.000 71.87293  ? 139 ALA A CB  1 
ATOM   744   N N   . PHE A 1 140 ? 158.93400 126.25400 108.24500 1.000 70.50838  ? 140 PHE A N   1 
ATOM   745   C CA  . PHE A 1 140 ? 157.73400 126.53300 107.47800 1.000 70.50838  ? 140 PHE A CA  1 
ATOM   746   C C   . PHE A 1 140 ? 157.73400 127.93500 106.89100 1.000 70.50838  ? 140 PHE A C   1 
ATOM   747   O O   . PHE A 1 140 ? 157.24500 128.13900 105.78000 1.000 70.50838  ? 140 PHE A O   1 
ATOM   748   C CB  . PHE A 1 140 ? 156.51900 126.33800 108.39000 1.000 70.50838  ? 140 PHE A CB  1 
ATOM   749   C CG  . PHE A 1 140 ? 155.20600 126.40700 107.68900 1.000 70.50838  ? 140 PHE A CG  1 
ATOM   750   C CD1 . PHE A 1 140 ? 154.46900 127.57800 107.69100 1.000 70.50838  ? 140 PHE A CD1 1 
ATOM   751   C CD2 . PHE A 1 140 ? 154.68900 125.29300 107.06000 1.000 70.50838  ? 140 PHE A CD2 1 
ATOM   752   C CE1 . PHE A 1 140 ? 153.25600 127.64200 107.06000 1.000 70.50838  ? 140 PHE A CE1 1 
ATOM   753   C CE2 . PHE A 1 140 ? 153.47000 125.35200 106.42500 1.000 70.50838  ? 140 PHE A CE2 1 
ATOM   754   C CZ  . PHE A 1 140 ? 152.75300 126.53200 106.42600 1.000 70.50838  ? 140 PHE A CZ  1 
ATOM   755   N N   . ASP A 1 141 ? 158.28300 128.91200 107.61000 1.000 70.37897  ? 141 ASP A N   1 
ATOM   756   C CA  . ASP A 1 141 ? 158.19600 130.30300 107.19100 1.000 70.37897  ? 141 ASP A CA  1 
ATOM   757   C C   . ASP A 1 141 ? 159.43700 130.80000 106.46500 1.000 70.37897  ? 141 ASP A C   1 
ATOM   758   O O   . ASP A 1 141 ? 159.45100 131.95700 106.03700 1.000 70.37897  ? 141 ASP A O   1 
ATOM   759   C CB  . ASP A 1 141 ? 157.92900 131.20400 108.39900 1.000 70.37897  ? 141 ASP A CB  1 
ATOM   760   N N   . VAL A 1 142 ? 160.47500 129.97900 106.32000 1.000 71.70636  ? 142 VAL A N   1 
ATOM   761   C CA  . VAL A 1 142 ? 161.63100 130.38400 105.52900 1.000 71.70636  ? 142 VAL A CA  1 
ATOM   762   C C   . VAL A 1 142 ? 161.49500 129.73000 104.16000 1.000 71.70636  ? 142 VAL A C   1 
ATOM   763   O O   . VAL A 1 142 ? 162.16700 130.11800 103.20000 1.000 71.70636  ? 142 VAL A O   1 
ATOM   764   C CB  . VAL A 1 142 ? 162.96100 130.01800 106.21800 1.000 71.70636  ? 142 VAL A CB  1 
ATOM   765   C CG1 . VAL A 1 142 ? 163.30200 128.55100 106.02600 1.000 71.70636  ? 142 VAL A CG1 1 
ATOM   766   C CG2 . VAL A 1 142 ? 164.08900 130.91900 105.73800 1.000 71.70636  ? 142 VAL A CG2 1 
ATOM   767   N N   . CYS A 1 143 ? 160.60000 128.74600 104.05700 1.000 73.05752  ? 143 CYS A N   1 
ATOM   768   C CA  . CYS A 1 143 ? 160.28000 128.15500 102.76600 1.000 73.05752  ? 143 CYS A CA  1 
ATOM   769   C C   . CYS A 1 143 ? 159.26300 128.97700 101.98800 1.000 73.05752  ? 143 CYS A C   1 
ATOM   770   O O   . CYS A 1 143 ? 158.95300 128.63000 100.84500 1.000 73.05752  ? 143 CYS A O   1 
ATOM   771   C CB  . CYS A 1 143 ? 159.76000 126.73400 102.95600 1.000 73.05752  ? 143 CYS A CB  1 
ATOM   772   S SG  . CYS A 1 143 ? 161.03200 125.55200 103.43800 1.000 73.05752  ? 143 CYS A SG  1 
ATOM   773   N N   . SER A 1 144 ? 158.73400 130.04300 102.58400 1.000 69.69662  ? 144 SER A N   1 
ATOM   774   C CA  . SER A 1 144 ? 157.81900 130.96100 101.92500 1.000 69.69662  ? 144 SER A CA  1 
ATOM   775   C C   . SER A 1 144 ? 158.44700 132.32500 101.69600 1.000 69.69662  ? 144 SER A C   1 
ATOM   776   O O   . SER A 1 144 ? 157.74300 133.27200 101.33500 1.000 69.69662  ? 144 SER A O   1 
ATOM   777   C CB  . SER A 1 144 ? 156.54500 131.11000 102.75200 1.000 69.69662  ? 144 SER A CB  1 
ATOM   778   O OG  . SER A 1 144 ? 156.09300 129.84700 103.19500 1.000 69.69662  ? 144 SER A OG  1 
ATOM   779   N N   . THR A 1 145 ? 159.74800 132.45000 101.90600 1.000 71.66769  ? 145 THR A N   1 
ATOM   780   C CA  . THR A 1 145 ? 160.43100 133.72900 101.83000 1.000 71.66769  ? 145 THR A CA  1 
ATOM   781   C C   . THR A 1 145 ? 161.53900 133.75400 100.78900 1.000 71.66769  ? 145 THR A C   1 
ATOM   782   O O   . THR A 1 145 ? 161.67500 134.75600 100.08000 1.000 71.66769  ? 145 THR A O   1 
ATOM   783   C CB  . THR A 1 145 ? 160.99800 134.08700 103.21500 1.000 71.66769  ? 145 THR A CB  1 
ATOM   784   O OG1 . THR A 1 145 ? 159.92000 134.14000 104.15600 1.000 71.66769  ? 145 THR A OG1 1 
ATOM   785   C CG2 . THR A 1 145 ? 161.69100 135.44000 103.21700 1.000 71.66769  ? 145 THR A CG2 1 
ATOM   786   N N   . ALA A 1 146 ? 162.29400 132.66900 100.64700 1.000 78.98938  ? 146 ALA A N   1 
ATOM   787   C CA  . ALA A 1 146 ? 163.37500 132.58800 99.67300  1.000 78.98938  ? 146 ALA A CA  1 
ATOM   788   C C   . ALA A 1 146 ? 162.81700 132.62000 98.25600  1.000 78.98938  ? 146 ALA A C   1 
ATOM   789   O O   . ALA A 1 146 ? 161.95000 131.79900 97.92300  1.000 78.98938  ? 146 ALA A O   1 
ATOM   790   C CB  . ALA A 1 146 ? 164.18900 131.31700 99.88800  1.000 78.98938  ? 146 ALA A CB  1 
ATOM   791   N N   . PRO A 1 147 ? 163.25900 133.54800 97.40700  1.000 83.82055  ? 147 PRO A N   1 
ATOM   792   C CA  . PRO A 1 147 ? 162.65800 133.67500 96.07400  1.000 83.82055  ? 147 PRO A CA  1 
ATOM   793   C C   . PRO A 1 147 ? 163.15300 132.58100 95.14200  1.000 83.82055  ? 147 PRO A C   1 
ATOM   794   O O   . PRO A 1 147 ? 164.35700 132.36500 94.99500  1.000 83.82055  ? 147 PRO A O   1 
ATOM   795   C CB  . PRO A 1 147 ? 163.11200 135.06300 95.60500  1.000 83.82055  ? 147 PRO A CB  1 
ATOM   796   C CG  . PRO A 1 147 ? 163.73400 135.71700 96.80700  1.000 83.82055  ? 147 PRO A CG  1 
ATOM   797   C CD  . PRO A 1 147 ? 164.23600 134.61300 97.66600  1.000 83.82055  ? 147 PRO A CD  1 
ATOM   798   N N   . PHE A 1 148 ? 162.20700 131.88200 94.52300  1.000 87.15700  ? 148 PHE A N   1 
ATOM   799   C CA  . PHE A 1 148 ? 162.49900 130.87500 93.51500  1.000 87.15700  ? 148 PHE A CA  1 
ATOM   800   C C   . PHE A 1 148 ? 162.28800 131.40400 92.10800  1.000 87.15700  ? 148 PHE A C   1 
ATOM   801   O O   . PHE A 1 148 ? 163.13600 131.21000 91.23800  1.000 87.15700  ? 148 PHE A O   1 
ATOM   802   C CB  . PHE A 1 148 ? 161.62900 129.63200 93.73900  1.000 87.15700  ? 148 PHE A CB  1 
ATOM   803   C CG  . PHE A 1 148 ? 162.05100 128.80300 94.91300  1.000 87.15700  ? 148 PHE A CG  1 
ATOM   804   C CD1 . PHE A 1 148 ? 161.61800 129.11700 96.19000  1.000 87.15700  ? 148 PHE A CD1 1 
ATOM   805   C CD2 . PHE A 1 148 ? 162.88200 127.71100 94.74100  1.000 87.15700  ? 148 PHE A CD2 1 
ATOM   806   C CE1 . PHE A 1 148 ? 162.00500 128.35800 97.27700  1.000 87.15700  ? 148 PHE A CE1 1 
ATOM   807   C CE2 . PHE A 1 148 ? 163.27400 126.94600 95.82400  1.000 87.15700  ? 148 PHE A CE2 1 
ATOM   808   C CZ  . PHE A 1 148 ? 162.83400 127.27100 97.09400  1.000 87.15700  ? 148 PHE A CZ  1 
ATOM   809   N N   . GLN A 1 149 ? 161.16300 132.07800 91.86000  1.000 89.96387  ? 149 GLN A N   1 
ATOM   810   C CA  . GLN A 1 149 ? 160.95000 132.66800 90.53800  1.000 89.96387  ? 149 GLN A CA  1 
ATOM   811   C C   . GLN A 1 149 ? 161.80700 133.91300 90.29800  1.000 89.96387  ? 149 GLN A C   1 
ATOM   812   O O   . GLN A 1 149 ? 162.43500 134.00100 89.23000  1.000 89.96387  ? 149 GLN A O   1 
ATOM   813   C CB  . GLN A 1 149 ? 159.45400 132.91500 90.30600  1.000 89.96387  ? 149 GLN A CB  1 
ATOM   814   N N   . PRO A 1 150 ? 161.88000 134.93100 91.22700  1.000 89.25404  ? 150 PRO A N   1 
ATOM   815   C CA  . PRO A 1 150 ? 162.77400 136.06400 90.94000  1.000 89.25404  ? 150 PRO A CA  1 
ATOM   816   C C   . PRO A 1 150 ? 164.25500 135.73400 90.99800  1.000 89.25404  ? 150 PRO A C   1 
ATOM   817   O O   . PRO A 1 150 ? 164.99800 136.04300 90.06300  1.000 89.25404  ? 150 PRO A O   1 
ATOM   818   C CB  . PRO A 1 150 ? 162.40800 137.08300 92.02700  1.000 89.25404  ? 150 PRO A CB  1 
ATOM   819   C CG  . PRO A 1 150 ? 161.05700 136.72300 92.43500  1.000 89.25404  ? 150 PRO A CG  1 
ATOM   820   C CD  . PRO A 1 150 ? 161.09300 135.24000 92.43900  1.000 89.25404  ? 150 PRO A CD  1 
ATOM   821   N N   . LEU A 1 151 ? 164.69500 135.11000 92.09100  1.000 95.16218  ? 151 LEU A N   1 
ATOM   822   C CA  . LEU A 1 151 ? 166.12800 135.01000 92.34700  1.000 95.16218  ? 151 LEU A CA  1 
ATOM   823   C C   . LEU A 1 151 ? 166.78000 133.93500 91.49200  1.000 95.16218  ? 151 LEU A C   1 
ATOM   824   O O   . LEU A 1 151 ? 167.90300 134.12000 91.01100  1.000 95.16218  ? 151 LEU A O   1 
ATOM   825   C CB  . LEU A 1 151 ? 166.38400 134.74100 93.82900  1.000 95.16218  ? 151 LEU A CB  1 
ATOM   826   N N   . SER A 1 152 ? 166.10000 132.80900 91.28300  1.000 97.89258  ? 152 SER A N   1 
ATOM   827   C CA  . SER A 1 152 ? 166.69600 131.76800 90.45600  1.000 97.89258  ? 152 SER A CA  1 
ATOM   828   C C   . SER A 1 152 ? 166.35300 131.91900 88.98200  1.000 97.89258  ? 152 SER A C   1 
ATOM   829   O O   . SER A 1 152 ? 166.40700 130.93000 88.24500  1.000 97.89258  ? 152 SER A O   1 
ATOM   830   C CB  . SER A 1 152 ? 166.28000 130.38400 90.95000  1.000 97.89258  ? 152 SER A CB  1 
ATOM   831   O OG  . SER A 1 152 ? 166.62600 129.39100 90.00500  1.000 97.89258  ? 152 SER A OG  1 
ATOM   832   N N   . LEU A 1 153 ? 165.98500 133.12400 88.54500  1.000 100.34454 ? 153 LEU A N   1 
ATOM   833   C CA  . LEU A 1 153 ? 165.93400 133.45900 87.13000  1.000 100.34454 ? 153 LEU A CA  1 
ATOM   834   C C   . LEU A 1 153 ? 167.31800 133.49000 86.50100  1.000 100.34454 ? 153 LEU A C   1 
ATOM   835   O O   . LEU A 1 153 ? 167.44400 133.26000 85.29400  1.000 100.34454 ? 153 LEU A O   1 
ATOM   836   C CB  . LEU A 1 153 ? 165.24100 134.81600 86.96800  1.000 100.34454 ? 153 LEU A CB  1 
ATOM   837   C CG  . LEU A 1 153 ? 165.05300 135.48100 85.60600  1.000 100.34454 ? 153 LEU A CG  1 
ATOM   838   C CD1 . LEU A 1 153 ? 164.37500 134.53200 84.64300  1.000 100.34454 ? 153 LEU A CD1 1 
ATOM   839   C CD2 . LEU A 1 153 ? 164.24900 136.76500 85.75300  1.000 100.34454 ? 153 LEU A CD2 1 
ATOM   840   N N   . LEU A 1 154 ? 168.35700 133.72900 87.29700  1.000 104.38801 ? 154 LEU A N   1 
ATOM   841   C CA  . LEU A 1 154 ? 169.69800 133.98600 86.79800  1.000 104.38801 ? 154 LEU A CA  1 
ATOM   842   C C   . LEU A 1 154 ? 170.49300 132.72800 86.47800  1.000 104.38801 ? 154 LEU A C   1 
ATOM   843   O O   . LEU A 1 154 ? 171.59600 132.84500 85.93500  1.000 104.38801 ? 154 LEU A O   1 
ATOM   844   C CB  . LEU A 1 154 ? 170.47600 134.82600 87.81700  1.000 104.38801 ? 154 LEU A CB  1 
ATOM   845   C CG  . LEU A 1 154 ? 169.86400 136.18800 88.14300  1.000 104.38801 ? 154 LEU A CG  1 
ATOM   846   C CD1 . LEU A 1 154 ? 170.66700 136.89800 89.21400  1.000 104.38801 ? 154 LEU A CD1 1 
ATOM   847   C CD2 . LEU A 1 154 ? 169.77100 137.03900 86.89100  1.000 104.38801 ? 154 LEU A CD2 1 
ATOM   848   N N   . PHE A 1 155 ? 169.98800 131.53500 86.79100  1.000 109.59553 ? 155 PHE A N   1 
ATOM   849   C CA  . PHE A 1 155 ? 170.79000 130.34100 86.52700  1.000 109.59553 ? 155 PHE A CA  1 
ATOM   850   C C   . PHE A 1 155 ? 170.72000 129.93200 85.05900  1.000 109.59553 ? 155 PHE A C   1 
ATOM   851   O O   . PHE A 1 155 ? 171.70900 130.03200 84.32600  1.000 109.59553 ? 155 PHE A O   1 
ATOM   852   C CB  . PHE A 1 155 ? 170.33200 129.18400 87.42200  1.000 109.59553 ? 155 PHE A CB  1 
ATOM   853   C CG  . PHE A 1 155 ? 170.91900 129.20600 88.80400  1.000 109.59553 ? 155 PHE A CG  1 
ATOM   854   C CD1 . PHE A 1 155 ? 171.87300 130.14700 89.15900  1.000 109.59553 ? 155 PHE A CD1 1 
ATOM   855   C CD2 . PHE A 1 155 ? 170.53400 128.26000 89.74000  1.000 109.59553 ? 155 PHE A CD2 1 
ATOM   856   C CE1 . PHE A 1 155 ? 172.41500 130.15700 90.43000  1.000 109.59553 ? 155 PHE A CE1 1 
ATOM   857   C CE2 . PHE A 1 155 ? 171.07300 128.26100 91.01000  1.000 109.59553 ? 155 PHE A CE2 1 
ATOM   858   C CZ  . PHE A 1 155 ? 172.01600 129.21100 91.35600  1.000 109.59553 ? 155 PHE A CZ  1 
ATOM   859   N N   . ASN A 1 156 ? 169.55500 129.47000 84.61200  1.000 111.73067 ? 156 ASN A N   1 
ATOM   860   C CA  . ASN A 1 156 ? 169.38300 129.09500 83.21200  1.000 111.73067 ? 156 ASN A CA  1 
ATOM   861   C C   . ASN A 1 156 ? 168.04000 129.47800 82.61100  1.000 111.73067 ? 156 ASN A C   1 
ATOM   862   O O   . ASN A 1 156 ? 167.95200 129.59000 81.38300  1.000 111.73067 ? 156 ASN A O   1 
ATOM   863   C CB  . ASN A 1 156 ? 169.58500 127.58600 83.03600  1.000 111.73067 ? 156 ASN A CB  1 
ATOM   864   C CG  . ASN A 1 156 ? 170.21100 127.23500 81.70400  1.000 111.73067 ? 156 ASN A CG  1 
ATOM   865   O OD1 . ASN A 1 156 ? 170.63100 128.11500 80.95400  1.000 111.73067 ? 156 ASN A OD1 1 
ATOM   866   N ND2 . ASN A 1 156 ? 170.27300 125.94500 81.39900  1.000 111.73067 ? 156 ASN A ND2 1 
ATOM   867   N N   . TYR A 1 157 ? 167.00000 129.68900 83.40700  1.000 108.56379 ? 157 TYR A N   1 
ATOM   868   C CA  . TYR A 1 157 ? 165.62700 129.61200 82.93700  1.000 108.56379 ? 157 TYR A CA  1 
ATOM   869   C C   . TYR A 1 157 ? 165.07300 130.99000 82.59500  1.000 108.56379 ? 157 TYR A C   1 
ATOM   870   O O   . TYR A 1 157 ? 165.70100 132.02300 82.83000  1.000 108.56379 ? 157 TYR A O   1 
ATOM   871   C CB  . TYR A 1 157 ? 164.75000 128.92700 83.98900  1.000 108.56379 ? 157 TYR A CB  1 
ATOM   872   C CG  . TYR A 1 157 ? 165.33600 127.63800 84.52300  1.000 108.56379 ? 157 TYR A CG  1 
ATOM   873   C CD1 . TYR A 1 157 ? 166.07100 127.61900 85.70500  1.000 108.56379 ? 157 TYR A CD1 1 
ATOM   874   C CD2 . TYR A 1 157 ? 165.15300 126.43900 83.84600  1.000 108.56379 ? 157 TYR A CD2 1 
ATOM   875   C CE1 . TYR A 1 157 ? 166.60900 126.44500 86.19500  1.000 108.56379 ? 157 TYR A CE1 1 
ATOM   876   C CE2 . TYR A 1 157 ? 165.68500 125.25800 84.33100  1.000 108.56379 ? 157 TYR A CE2 1 
ATOM   877   C CZ  . TYR A 1 157 ? 166.41100 125.26800 85.50500  1.000 108.56379 ? 157 TYR A CZ  1 
ATOM   878   O OH  . TYR A 1 157 ? 166.94100 124.09800 85.99000  1.000 108.56379 ? 157 TYR A OH  1 
ATOM   879   N N   . ASN A 1 158 ? 163.86700 130.98400 82.02700  1.000 104.74901 ? 158 ASN A N   1 
ATOM   880   C CA  . ASN A 1 158 ? 163.19600 132.19300 81.57200  1.000 104.74901 ? 158 ASN A CA  1 
ATOM   881   C C   . ASN A 1 158 ? 162.07400 132.62700 82.50600  1.000 104.74901 ? 158 ASN A C   1 
ATOM   882   O O   . ASN A 1 158 ? 161.19800 133.39600 82.09800  1.000 104.74901 ? 158 ASN A O   1 
ATOM   883   C CB  . ASN A 1 158 ? 162.65100 131.99200 80.15700  1.000 104.74901 ? 158 ASN A CB  1 
ATOM   884   N N   . GLY A 1 159 ? 162.08200 132.14900 83.74800  1.000 102.05906 ? 159 GLY A N   1 
ATOM   885   C CA  . GLY A 1 159 ? 161.08400 132.56100 84.71400  1.000 102.05906 ? 159 GLY A CA  1 
ATOM   886   C C   . GLY A 1 159 ? 159.74700 131.87400 84.58800  1.000 102.05906 ? 159 GLY A C   1 
ATOM   887   O O   . GLY A 1 159 ? 158.76000 132.36200 85.14600  1.000 102.05906 ? 159 GLY A O   1 
ATOM   888   N N   . SER A 1 160 ? 159.68100 130.75200 83.87400  1.000 94.82266  ? 160 SER A N   1 
ATOM   889   C CA  . SER A 1 160 ? 158.43000 130.02200 83.71600  1.000 94.82266  ? 160 SER A CA  1 
ATOM   890   C C   . SER A 1 160 ? 158.73900 128.57200 83.38800  1.000 94.82266  ? 160 SER A C   1 
ATOM   891   O O   . SER A 1 160 ? 159.50800 128.29400 82.46200  1.000 94.82266  ? 160 SER A O   1 
ATOM   892   C CB  . SER A 1 160 ? 157.55800 130.63300 82.61500  1.000 94.82266  ? 160 SER A CB  1 
ATOM   893   O OG  . SER A 1 160 ? 156.61400 129.68900 82.14100  1.000 94.82266  ? 160 SER A OG  1 
ATOM   894   N N   . GLU A 1 161 ? 158.13400 127.66400 84.14600  1.000 85.74168  ? 161 GLU A N   1 
ATOM   895   C CA  . GLU A 1 161 ? 158.15300 126.22500 83.92900  1.000 85.74168  ? 161 GLU A CA  1 
ATOM   896   C C   . GLU A 1 161 ? 157.05400 125.64900 84.80600  1.000 85.74168  ? 161 GLU A C   1 
ATOM   897   O O   . GLU A 1 161 ? 156.52600 126.33800 85.68100  1.000 85.74168  ? 161 GLU A O   1 
ATOM   898   C CB  . GLU A 1 161 ? 159.50500 125.59200 84.27100  1.000 85.74168  ? 161 GLU A CB  1 
ATOM   899   N N   . LEU A 1 162 ? 156.70500 124.38600 84.55800  1.000 84.63775  ? 162 LEU A N   1 
ATOM   900   C CA  . LEU A 1 162 ? 155.65600 123.75600 85.35400  1.000 84.63775  ? 162 LEU A CA  1 
ATOM   901   C C   . LEU A 1 162 ? 156.13900 123.47400 86.77000  1.000 84.63775  ? 162 LEU A C   1 
ATOM   902   O O   . LEU A 1 162 ? 155.55300 123.95100 87.74500  1.000 84.63775  ? 162 LEU A O   1 
ATOM   903   C CB  . LEU A 1 162 ? 155.16800 122.46900 84.69300  1.000 84.63775  ? 162 LEU A CB  1 
ATOM   904   C CG  . LEU A 1 162 ? 154.06200 121.82200 85.52500  1.000 84.63775  ? 162 LEU A CG  1 
ATOM   905   C CD1 . LEU A 1 162 ? 152.76900 122.61600 85.40500  1.000 84.63775  ? 162 LEU A CD1 1 
ATOM   906   C CD2 . LEU A 1 162 ? 153.85200 120.36900 85.13800  1.000 84.63775  ? 162 LEU A CD2 1 
ATOM   907   N N   . GLY A 1 163 ? 157.23500 122.73100 86.90200  1.000 84.99063  ? 163 GLY A N   1 
ATOM   908   C CA  . GLY A 1 163 ? 157.75100 122.38600 88.21300  1.000 84.99063  ? 163 GLY A CA  1 
ATOM   909   C C   . GLY A 1 163 ? 158.66500 123.43300 88.82100  1.000 84.99063  ? 163 GLY A C   1 
ATOM   910   O O   . GLY A 1 163 ? 159.50800 123.11300 89.66400  1.000 84.99063  ? 163 GLY A O   1 
ATOM   911   N N   . PHE A 1 164 ? 158.50600 124.68800 88.40500  1.000 82.72787  ? 164 PHE A N   1 
ATOM   912   C CA  . PHE A 1 164 ? 159.33400 125.77500 88.90400  1.000 82.72787  ? 164 PHE A CA  1 
ATOM   913   C C   . PHE A 1 164 ? 158.46800 126.92600 89.38800  1.000 82.72787  ? 164 PHE A C   1 
ATOM   914   O O   . PHE A 1 164 ? 158.88100 127.69100 90.26300  1.000 82.72787  ? 164 PHE A O   1 
ATOM   915   C CB  . PHE A 1 164 ? 160.29500 126.25100 87.81800  1.000 82.72787  ? 164 PHE A CB  1 
ATOM   916   C CG  . PHE A 1 164 ? 161.50800 126.94800 88.34600  1.000 82.72787  ? 164 PHE A CG  1 
ATOM   917   C CD1 . PHE A 1 164 ? 161.53800 128.32600 88.45100  1.000 82.72787  ? 164 PHE A CD1 1 
ATOM   918   C CD2 . PHE A 1 164 ? 162.62200 126.22200 88.73400  1.000 82.72787  ? 164 PHE A CD2 1 
ATOM   919   C CE1 . PHE A 1 164 ? 162.65700 128.96800 88.93100  1.000 82.72787  ? 164 PHE A CE1 1 
ATOM   920   C CE2 . PHE A 1 164 ? 163.74100 126.85800 89.21800  1.000 82.72787  ? 164 PHE A CE2 1 
ATOM   921   C CZ  . PHE A 1 164 ? 163.75800 128.23100 89.31600  1.000 82.72787  ? 164 PHE A CZ  1 
ATOM   922   N N   . ARG A 1 165 ? 157.27800 127.07400 88.81200  1.000 71.88120  ? 165 ARG A N   1 
ATOM   923   C CA  . ARG A 1 165 ? 156.33800 128.06900 89.30700  1.000 71.88120  ? 165 ARG A CA  1 
ATOM   924   C C   . ARG A 1 165 ? 155.30300 127.46200 90.24600  1.000 71.88120  ? 165 ARG A C   1 
ATOM   925   O O   . ARG A 1 165 ? 154.57500 128.20200 90.91400  1.000 71.88120  ? 165 ARG A O   1 
ATOM   926   C CB  . ARG A 1 165 ? 155.65700 128.78800 88.13800  1.000 71.88120  ? 165 ARG A CB  1 
ATOM   927   C CG  . ARG A 1 165 ? 154.45300 128.07300 87.56800  1.000 71.88120  ? 165 ARG A CG  1 
ATOM   928   C CD  . ARG A 1 165 ? 154.09600 128.56400 86.17000  1.000 71.88120  ? 165 ARG A CD  1 
ATOM   929   N NE  . ARG A 1 165 ? 154.06800 130.01800 86.07800  1.000 71.88120  ? 165 ARG A NE  1 
ATOM   930   C CZ  . ARG A 1 165 ? 153.43500 130.69000 85.12300  1.000 71.88120  ? 165 ARG A CZ  1 
ATOM   931   N NH1 . ARG A 1 165 ? 152.77200 130.03700 84.18200  1.000 71.88120  ? 165 ARG A NH1 1 
ATOM   932   N NH2 . ARG A 1 165 ? 153.46000 132.01400 85.11100  1.000 71.88120  ? 165 ARG A NH2 1 
ATOM   933   N N   . ILE A 1 166 ? 155.22800 126.13000 90.31500  1.000 72.15461  ? 166 ILE A N   1 
ATOM   934   C CA  . ILE A 1 166 ? 154.52800 125.46800 91.41000  1.000 72.15461  ? 166 ILE A CA  1 
ATOM   935   C C   . ILE A 1 166 ? 155.26200 125.68500 92.72900  1.000 72.15461  ? 166 ILE A C   1 
ATOM   936   O O   . ILE A 1 166 ? 154.62600 125.80700 93.78000  1.000 72.15461  ? 166 ILE A O   1 
ATOM   937   C CB  . ILE A 1 166 ? 154.32000 123.97200 91.06000  1.000 72.15461  ? 166 ILE A CB  1 
ATOM   938   C CG1 . ILE A 1 166 ? 153.21300 123.82900 90.01900  1.000 72.15461  ? 166 ILE A CG1 1 
ATOM   939   C CG2 . ILE A 1 166 ? 153.99200 123.10500 92.26200  1.000 72.15461  ? 166 ILE A CG2 1 
ATOM   940   C CD1 . ILE A 1 166 ? 153.05500 122.42500 89.49300  1.000 72.15461  ? 166 ILE A CD1 1 
ATOM   941   N N   . LEU A 1 167 ? 156.58900 125.82900 92.69400  1.000 73.06383  ? 167 LEU A N   1 
ATOM   942   C CA  . LEU A 1 167 ? 157.32900 126.19200 93.90100  1.000 73.06383  ? 167 LEU A CA  1 
ATOM   943   C C   . LEU A 1 167 ? 157.03300 127.61500 94.36400  1.000 73.06383  ? 167 LEU A C   1 
ATOM   944   O O   . LEU A 1 167 ? 157.34300 127.95700 95.50800  1.000 73.06383  ? 167 LEU A O   1 
ATOM   945   C CB  . LEU A 1 167 ? 158.83400 126.02400 93.68200  1.000 73.06383  ? 167 LEU A CB  1 
ATOM   946   C CG  . LEU A 1 167 ? 159.49000 124.67800 94.02200  1.000 73.06383  ? 167 LEU A CG  1 
ATOM   947   C CD1 . LEU A 1 167 ? 159.37300 124.38900 95.51000  1.000 73.06383  ? 167 LEU A CD1 1 
ATOM   948   C CD2 . LEU A 1 167 ? 158.94300 123.51300 93.20500  1.000 73.06383  ? 167 LEU A CD2 1 
ATOM   949   N N   . SER A 1 168 ? 156.44000 128.44900 93.51100  1.000 67.76805  ? 168 SER A N   1 
ATOM   950   C CA  . SER A 1 168 ? 155.94300 129.74400 93.94900  1.000 67.76805  ? 168 SER A CA  1 
ATOM   951   C C   . SER A 1 168 ? 154.55100 129.67300 94.55900  1.000 67.76805  ? 168 SER A C   1 
ATOM   952   O O   . SER A 1 168 ? 153.99700 130.72400 94.88900  1.000 67.76805  ? 168 SER A O   1 
ATOM   953   C CB  . SER A 1 168 ? 155.93400 130.72800 92.78500  1.000 67.76805  ? 168 SER A CB  1 
ATOM   954   O OG  . SER A 1 168 ? 155.16000 131.86800 93.10600  1.000 67.76805  ? 168 SER A OG  1 
ATOM   955   N N   . MET A 1 169 ? 153.96400 128.48300 94.70000  1.000 64.51027  ? 169 MET A N   1 
ATOM   956   C CA  . MET A 1 169 ? 152.73100 128.33600 95.46200  1.000 64.51027  ? 169 MET A CA  1 
ATOM   957   C C   . MET A 1 169 ? 152.97800 128.24000 96.95500  1.000 64.51027  ? 169 MET A C   1 
ATOM   958   O O   . MET A 1 169 ? 152.01600 128.18100 97.72400  1.000 64.51027  ? 169 MET A O   1 
ATOM   959   C CB  . MET A 1 169 ? 151.95300 127.10100 95.01600  1.000 64.51027  ? 169 MET A CB  1 
ATOM   960   C CG  . MET A 1 169 ? 151.10600 127.32000 93.80500  1.000 64.51027  ? 169 MET A CG  1 
ATOM   961   S SD  . MET A 1 169 ? 150.07900 128.76600 94.03500  1.000 64.51027  ? 169 MET A SD  1 
ATOM   962   C CE  . MET A 1 169 ? 149.21400 128.75400 92.48300  1.000 64.51027  ? 169 MET A CE  1 
ATOM   963   N N   . LEU A 1 170 ? 154.23900 128.22100 97.38400  1.000 64.22283  ? 170 LEU A N   1 
ATOM   964   C CA  . LEU A 1 170 ? 154.55200 128.27100 98.80300  1.000 64.22283  ? 170 LEU A CA  1 
ATOM   965   C C   . LEU A 1 170 ? 154.35600 129.65700 99.39100  1.000 64.22283  ? 170 LEU A C   1 
ATOM   966   O O   . LEU A 1 170 ? 154.45400 129.81000 100.60800 1.000 64.22283  ? 170 LEU A O   1 
ATOM   967   C CB  . LEU A 1 170 ? 155.98300 127.80200 99.04000  1.000 64.22283  ? 170 LEU A CB  1 
ATOM   968   C CG  . LEU A 1 170 ? 156.32300 126.45300 98.41400  1.000 64.22283  ? 170 LEU A CG  1 
ATOM   969   C CD1 . LEU A 1 170 ? 157.78600 126.13200 98.62900  1.000 64.22283  ? 170 LEU A CD1 1 
ATOM   970   C CD2 . LEU A 1 170 ? 155.44500 125.36600 98.98900  1.000 64.22283  ? 170 LEU A CD2 1 
ATOM   971   N N   . ARG A 1 171 ? 154.06700 130.66300 98.56700  1.000 60.44326  ? 171 ARG A N   1 
ATOM   972   C CA  . ARG A 1 171 ? 153.59500 131.94700 99.05800  1.000 60.44326  ? 171 ARG A CA  1 
ATOM   973   C C   . ARG A 1 171 ? 152.13100 131.91600 99.47600  1.000 60.44326  ? 171 ARG A C   1 
ATOM   974   O O   . ARG A 1 171 ? 151.59700 132.95600 99.86500  1.000 60.44326  ? 171 ARG A O   1 
ATOM   975   C CB  . ARG A 1 171 ? 153.81600 133.02000 97.99600  1.000 60.44326  ? 171 ARG A CB  1 
ATOM   976   C CG  . ARG A 1 171 ? 155.27600 133.35700 97.78200  1.000 60.44326  ? 171 ARG A CG  1 
ATOM   977   C CD  . ARG A 1 171 ? 155.52600 133.93300 96.40300  1.000 60.44326  ? 171 ARG A CD  1 
ATOM   978   N NE  . ARG A 1 171 ? 154.82100 135.19100 96.18800  1.000 60.44326  ? 171 ARG A NE  1 
ATOM   979   C CZ  . ARG A 1 171 ? 153.96200 135.40500 95.19800  1.000 60.44326  ? 171 ARG A CZ  1 
ATOM   980   N NH1 . ARG A 1 171 ? 153.70000 134.44300 94.32700  1.000 60.44326  ? 171 ARG A NH1 1 
ATOM   981   N NH2 . ARG A 1 171 ? 153.36800 136.58100 95.07700  1.000 60.44326  ? 171 ARG A NH2 1 
ATOM   982   N N   . LEU A 1 172 ? 151.46300 130.76900 99.37500  1.000 57.20108  ? 172 LEU A N   1 
ATOM   983   C CA  . LEU A 1 172 ? 150.19100 130.54300 100.03900 1.000 57.20108  ? 172 LEU A CA  1 
ATOM   984   C C   . LEU A 1 172 ? 150.36700 130.00500 101.44600 1.000 57.20108  ? 172 LEU A C   1 
ATOM   985   O O   . LEU A 1 172 ? 149.38500 129.91800 102.18500 1.000 57.20108  ? 172 LEU A O   1 
ATOM   986   C CB  . LEU A 1 172 ? 149.32900 129.56300 99.24100  1.000 57.20108  ? 172 LEU A CB  1 
ATOM   987   C CG  . LEU A 1 172 ? 148.59200 130.07800 98.00700  1.000 57.20108  ? 172 LEU A CG  1 
ATOM   988   C CD1 . LEU A 1 172 ? 147.60700 129.03600 97.53600  1.000 57.20108  ? 172 LEU A CD1 1 
ATOM   989   C CD2 . LEU A 1 172 ? 147.88500 131.38000 98.29400  1.000 57.20108  ? 172 LEU A CD2 1 
ATOM   990   N N   . TRP A 1 173 ? 151.58600 129.63700 101.83100 1.000 60.95749  ? 173 TRP A N   1 
ATOM   991   C CA  . TRP A 1 173 ? 151.83500 129.16100 103.18200 1.000 60.95749  ? 173 TRP A CA  1 
ATOM   992   C C   . TRP A 1 173 ? 151.93400 130.28500 104.19500 1.000 60.95749  ? 173 TRP A C   1 
ATOM   993   O O   . TRP A 1 173 ? 151.97000 130.01100 105.39500 1.000 60.95749  ? 173 TRP A O   1 
ATOM   994   C CB  . TRP A 1 173 ? 153.11400 128.33300 103.23200 1.000 60.95749  ? 173 TRP A CB  1 
ATOM   995   C CG  . TRP A 1 173 ? 152.88600 126.89700 102.99000 1.000 60.95749  ? 173 TRP A CG  1 
ATOM   996   C CD1 . TRP A 1 173 ? 151.69800 126.29400 102.73000 1.000 60.95749  ? 173 TRP A CD1 1 
ATOM   997   C CD2 . TRP A 1 173 ? 153.87300 125.86700 102.98100 1.000 60.95749  ? 173 TRP A CD2 1 
ATOM   998   N NE1 . TRP A 1 173 ? 151.88100 124.94600 102.55900 1.000 60.95749  ? 173 TRP A NE1 1 
ATOM   999   C CE2 . TRP A 1 173 ? 153.21100 124.65900 102.70900 1.000 60.95749  ? 173 TRP A CE2 1 
ATOM   1000  C CE3 . TRP A 1 173 ? 155.25500 125.85000 103.17700 1.000 60.95749  ? 173 TRP A CE3 1 
ATOM   1001  C CZ2 . TRP A 1 173 ? 153.88100 123.44500 102.62900 1.000 60.95749  ? 173 TRP A CZ2 1 
ATOM   1002  C CZ3 . TRP A 1 173 ? 155.91900 124.64500 103.09800 1.000 60.95749  ? 173 TRP A CZ3 1 
ATOM   1003  C CH2 . TRP A 1 173 ? 155.23200 123.45900 102.82500 1.000 60.95749  ? 173 TRP A CH2 1 
ATOM   1004  N N   . ARG A 1 174 ? 151.97500 131.53800 103.75700 1.000 56.57617  ? 174 ARG A N   1 
ATOM   1005  C CA  . ARG A 1 174 ? 151.93100 132.65900 104.67700 1.000 56.57617  ? 174 ARG A CA  1 
ATOM   1006  C C   . ARG A 1 174 ? 150.50900 133.06700 105.01800 1.000 56.57617  ? 174 ARG A C   1 
ATOM   1007  O O   . ARG A 1 174 ? 150.30000 134.15000 105.56700 1.000 56.57617  ? 174 ARG A O   1 
ATOM   1008  C CB  . ARG A 1 174 ? 152.70300 133.84500 104.10400 1.000 56.57617  ? 174 ARG A CB  1 
ATOM   1009  C CG  . ARG A 1 174 ? 152.16900 134.35300 102.80000 1.000 56.57617  ? 174 ARG A CG  1 
ATOM   1010  C CD  . ARG A 1 174 ? 153.01300 135.49200 102.27000 1.000 56.57617  ? 174 ARG A CD  1 
ATOM   1011  N NE  . ARG A 1 174 ? 154.38600 135.09000 101.99200 1.000 56.57617  ? 174 ARG A NE  1 
ATOM   1012  C CZ  . ARG A 1 174 ? 155.17200 135.70300 101.11400 1.000 56.57617  ? 174 ARG A CZ  1 
ATOM   1013  N NH1 . ARG A 1 174 ? 154.71300 136.73900 100.42900 1.000 56.57617  ? 174 ARG A NH1 1 
ATOM   1014  N NH2 . ARG A 1 174 ? 156.41200 135.28100 100.91800 1.000 56.57617  ? 174 ARG A NH2 1 
ATOM   1015  N N   . LEU A 1 175 ? 149.52900 132.21800 104.71300 1.000 49.92898  ? 175 LEU A N   1 
ATOM   1016  C CA  . LEU A 1 175 ? 148.14300 132.44900 105.08600 1.000 49.92898  ? 175 LEU A CA  1 
ATOM   1017  C C   . LEU A 1 175 ? 147.87600 132.18100 106.55500 1.000 49.92898  ? 175 LEU A C   1 
ATOM   1018  O O   . LEU A 1 175 ? 146.77500 132.47400 107.02600 1.000 49.92898  ? 175 LEU A O   1 
ATOM   1019  C CB  . LEU A 1 175 ? 147.21900 131.57100 104.24800 1.000 49.92898  ? 175 LEU A CB  1 
ATOM   1020  C CG  . LEU A 1 175 ? 146.75400 132.10400 102.90000 1.000 49.92898  ? 175 LEU A CG  1 
ATOM   1021  C CD1 . LEU A 1 175 ? 145.89900 131.06400 102.22800 1.000 49.92898  ? 175 LEU A CD1 1 
ATOM   1022  C CD2 . LEU A 1 175 ? 145.98200 133.37900 103.07300 1.000 49.92898  ? 175 LEU A CD2 1 
ATOM   1023  N N   . ARG A 1 176 ? 148.84400 131.63200 107.28900 1.000 50.84916  ? 176 ARG A N   1 
ATOM   1024  C CA  . ARG A 1 176 ? 148.62900 131.34800 108.69900 1.000 50.84916  ? 176 ARG A CA  1 
ATOM   1025  C C   . ARG A 1 176 ? 148.60100 132.61100 109.54500 1.000 50.84916  ? 176 ARG A C   1 
ATOM   1026  O O   . ARG A 1 176 ? 148.13500 132.56200 110.68400 1.000 50.84916  ? 176 ARG A O   1 
ATOM   1027  C CB  . ARG A 1 176 ? 149.69400 130.36700 109.19600 1.000 50.84916  ? 176 ARG A CB  1 
ATOM   1028  C CG  . ARG A 1 176 ? 151.13700 130.81800 109.05700 1.000 50.84916  ? 176 ARG A CG  1 
ATOM   1029  C CD  . ARG A 1 176 ? 151.68900 131.37200 110.35500 1.000 50.84916  ? 176 ARG A CD  1 
ATOM   1030  N NE  . ARG A 1 176 ? 153.10900 131.68500 110.26300 1.000 50.84916  ? 176 ARG A NE  1 
ATOM   1031  C CZ  . ARG A 1 176 ? 153.79400 132.29800 111.21900 1.000 50.84916  ? 176 ARG A CZ  1 
ATOM   1032  N NH1 . ARG A 1 176 ? 153.19000 132.66100 112.34000 1.000 50.84916  ? 176 ARG A NH1 1 
ATOM   1033  N NH2 . ARG A 1 176 ? 155.08200 132.54900 111.05300 1.000 50.84916  ? 176 ARG A NH2 1 
ATOM   1034  N N   . ARG A 1 177 ? 149.09200 133.73500 109.02600 1.000 47.59863  ? 177 ARG A N   1 
ATOM   1035  C CA  . ARG A 1 177 ? 148.95900 134.99400 109.74300 1.000 47.59863  ? 177 ARG A CA  1 
ATOM   1036  C C   . ARG A 1 177 ? 147.53300 135.51100 109.72500 1.000 47.59863  ? 177 ARG A C   1 
ATOM   1037  O O   . ARG A 1 177 ? 147.15500 136.27800 110.61200 1.000 47.59863  ? 177 ARG A O   1 
ATOM   1038  C CB  . ARG A 1 177 ? 149.88800 136.04000 109.14400 1.000 47.59863  ? 177 ARG A CB  1 
ATOM   1039  C CG  . ARG A 1 177 ? 151.26300 135.51200 108.88100 1.000 47.59863  ? 177 ARG A CG  1 
ATOM   1040  C CD  . ARG A 1 177 ? 152.20800 136.60900 108.48000 1.000 47.59863  ? 177 ARG A CD  1 
ATOM   1041  N NE  . ARG A 1 177 ? 153.58500 136.14500 108.55900 1.000 47.59863  ? 177 ARG A NE  1 
ATOM   1042  C CZ  . ARG A 1 177 ? 154.33000 136.23100 109.65400 1.000 47.59863  ? 177 ARG A CZ  1 
ATOM   1043  N NH1 . ARG A 1 177 ? 153.82700 136.77400 110.75300 1.000 47.59863  ? 177 ARG A NH1 1 
ATOM   1044  N NH2 . ARG A 1 177 ? 155.57500 135.77800 109.64900 1.000 47.59863  ? 177 ARG A NH2 1 
ATOM   1045  N N   . VAL A 1 178 ? 146.74600 135.12200 108.72900 1.000 40.99679  ? 178 VAL A N   1 
ATOM   1046  C CA  . VAL A 1 178 ? 145.34000 135.49300 108.67500 1.000 40.99679  ? 178 VAL A CA  1 
ATOM   1047  C C   . VAL A 1 178 ? 144.49100 134.50600 109.45800 1.000 40.99679  ? 178 VAL A C   1 
ATOM   1048  O O   . VAL A 1 178 ? 143.56400 134.90100 110.16800 1.000 40.99679  ? 178 VAL A O   1 
ATOM   1049  C CB  . VAL A 1 178 ? 144.90200 135.60300 107.20100 1.000 40.99679  ? 178 VAL A CB  1 
ATOM   1050  C CG1 . VAL A 1 178 ? 143.39900 135.60800 107.05100 1.000 40.99679  ? 178 VAL A CG1 1 
ATOM   1051  C CG2 . VAL A 1 178 ? 145.46200 136.86100 106.60900 1.000 40.99679  ? 178 VAL A CG2 1 
ATOM   1052  N N   . SER A 1 179 ? 144.83400 133.22100 109.39700 1.000 39.53912  ? 179 SER A N   1 
ATOM   1053  C CA  . SER A 1 179 ? 144.05500 132.21800 110.10900 1.000 39.53912  ? 179 SER A CA  1 
ATOM   1054  C C   . SER A 1 179 ? 144.26300 132.29500 111.61300 1.000 39.53912  ? 179 SER A C   1 
ATOM   1055  O O   . SER A 1 179 ? 143.35600 131.95300 112.37700 1.000 39.53912  ? 179 SER A O   1 
ATOM   1056  C CB  . SER A 1 179 ? 144.40600 130.82700 109.60700 1.000 39.53912  ? 179 SER A CB  1 
ATOM   1057  O OG  . SER A 1 179 ? 143.97400 129.85300 110.53200 1.000 39.53912  ? 179 SER A OG  1 
ATOM   1058  N N   . SER A 1 180 ? 145.43500 132.73700 112.06000 1.000 38.67195  ? 180 SER A N   1 
ATOM   1059  C CA  . SER A 1 180 ? 145.67700 132.94600 113.48000 1.000 38.67195  ? 180 SER A CA  1 
ATOM   1060  C C   . SER A 1 180 ? 145.29600 134.34200 113.93900 1.000 38.67195  ? 180 SER A C   1 
ATOM   1061  O O   . SER A 1 180 ? 145.57400 134.69700 115.08500 1.000 38.67195  ? 180 SER A O   1 
ATOM   1062  C CB  . SER A 1 180 ? 147.14100 132.69400 113.82500 1.000 38.67195  ? 180 SER A CB  1 
ATOM   1063  O OG  . SER A 1 180 ? 147.95400 133.71900 113.29300 1.000 38.67195  ? 180 SER A OG  1 
ATOM   1064  N N   . LEU A 1 181 ? 144.69800 135.14800 113.06900 1.000 36.50602  ? 181 LEU A N   1 
ATOM   1065  C CA  . LEU A 1 181 ? 144.08400 136.39700 113.48800 1.000 36.50602  ? 181 LEU A CA  1 
ATOM   1066  C C   . LEU A 1 181 ? 142.58900 136.23100 113.69600 1.000 36.50602  ? 181 LEU A C   1 
ATOM   1067  O O   . LEU A 1 181 ? 142.00200 136.91700 114.53300 1.000 36.50602  ? 181 LEU A O   1 
ATOM   1068  C CB  . LEU A 1 181 ? 144.37500 137.49900 112.46600 1.000 36.50602  ? 181 LEU A CB  1 
ATOM   1069  C CG  . LEU A 1 181 ? 143.90500 138.92900 112.72600 1.000 36.50602  ? 181 LEU A CG  1 
ATOM   1070  C CD1 . LEU A 1 181 ? 144.96400 139.88400 112.28100 1.000 36.50602  ? 181 LEU A CD1 1 
ATOM   1071  C CD2 . LEU A 1 181 ? 142.64900 139.22100 111.93600 1.000 36.50602  ? 181 LEU A CD2 1 
ATOM   1072  N N   . PHE A 1 182 ? 141.95800 135.32200 112.95600 1.000 35.03656  ? 182 PHE A N   1 
ATOM   1073  C CA  . PHE A 1 182 ? 140.55300 135.03100 113.20500 1.000 35.03656  ? 182 PHE A CA  1 
ATOM   1074  C C   . PHE A 1 182 ? 140.37900 134.25500 114.49900 1.000 35.03656  ? 182 PHE A C   1 
ATOM   1075  O O   . PHE A 1 182 ? 139.32600 134.32900 115.13800 1.000 35.03656  ? 182 PHE A O   1 
ATOM   1076  C CB  . PHE A 1 182 ? 139.96300 134.25400 112.03600 1.000 35.03656  ? 182 PHE A CB  1 
ATOM   1077  C CG  . PHE A 1 182 ? 139.60600 135.10700 110.86900 1.000 35.03656  ? 182 PHE A CG  1 
ATOM   1078  C CD1 . PHE A 1 182 ? 138.73700 136.16600 111.01600 1.000 35.03656  ? 182 PHE A CD1 1 
ATOM   1079  C CD2 . PHE A 1 182 ? 140.13600 134.84600 109.62400 1.000 35.03656  ? 182 PHE A CD2 1 
ATOM   1080  C CE1 . PHE A 1 182 ? 138.40700 136.95000 109.94400 1.000 35.03656  ? 182 PHE A CE1 1 
ATOM   1081  C CE2 . PHE A 1 182 ? 139.80900 135.62500 108.55000 1.000 35.03656  ? 182 PHE A CE2 1 
ATOM   1082  C CZ  . PHE A 1 182 ? 138.94400 136.67900 108.71000 1.000 35.03656  ? 182 PHE A CZ  1 
ATOM   1083  N N   . ALA A 1 183 ? 141.39700 133.49300 114.89800 1.000 34.95559  ? 183 ALA A N   1 
ATOM   1084  C CA  . ALA A 1 183 ? 141.33400 132.79600 116.17500 1.000 34.95559  ? 183 ALA A CA  1 
ATOM   1085  C C   . ALA A 1 183 ? 141.55300 133.74900 117.33400 1.000 34.95559  ? 183 ALA A C   1 
ATOM   1086  O O   . ALA A 1 183 ? 141.06200 133.50400 118.43900 1.000 34.95559  ? 183 ALA A O   1 
ATOM   1087  C CB  . ALA A 1 183 ? 142.36600 131.67400 116.22000 1.000 34.95559  ? 183 ALA A CB  1 
ATOM   1088  N N   . ARG A 1 184 ? 142.28900 134.83100 117.11000 1.000 35.87932  ? 184 ARG A N   1 
ATOM   1089  C CA  . ARG A 1 184 ? 142.53800 135.78800 118.17800 1.000 35.87932  ? 184 ARG A CA  1 
ATOM   1090  C C   . ARG A 1 184 ? 141.36900 136.74600 118.35000 1.000 35.87932  ? 184 ARG A C   1 
ATOM   1091  O O   . ARG A 1 184 ? 141.00600 137.08700 119.47900 1.000 35.87932  ? 184 ARG A O   1 
ATOM   1092  C CB  . ARG A 1 184 ? 143.82700 136.54900 117.89300 1.000 35.87932  ? 184 ARG A CB  1 
ATOM   1093  C CG  . ARG A 1 184 ? 144.12300 137.67200 118.85200 1.000 35.87932  ? 184 ARG A CG  1 
ATOM   1094  C CD  . ARG A 1 184 ? 145.12600 138.62300 118.25700 1.000 35.87932  ? 184 ARG A CD  1 
ATOM   1095  N NE  . ARG A 1 184 ? 146.35000 137.92800 117.88900 1.000 35.87932  ? 184 ARG A NE  1 
ATOM   1096  C CZ  . ARG A 1 184 ? 147.23500 138.39600 117.02200 1.000 35.87932  ? 184 ARG A CZ  1 
ATOM   1097  N NH1 . ARG A 1 184 ? 147.02700 139.56200 116.43000 1.000 35.87932  ? 184 ARG A NH1 1 
ATOM   1098  N NH2 . ARG A 1 184 ? 148.32400 137.69700 116.74500 1.000 35.87932  ? 184 ARG A NH2 1 
ATOM   1099  N N   . LEU A 1 185 ? 140.74800 137.17000 117.25000 1.000 33.48416  ? 185 LEU A N   1 
ATOM   1100  C CA  . LEU A 1 185 ? 139.64600 138.12000 117.33700 1.000 33.48416  ? 185 LEU A CA  1 
ATOM   1101  C C   . LEU A 1 185 ? 138.35900 137.49100 117.84500 1.000 33.48416  ? 185 LEU A C   1 
ATOM   1102  O O   . LEU A 1 185 ? 137.43500 138.22200 118.20500 1.000 33.48416  ? 185 LEU A O   1 
ATOM   1103  C CB  . LEU A 1 185 ? 139.38200 138.75700 115.97800 1.000 33.48416  ? 185 LEU A CB  1 
ATOM   1104  C CG  . LEU A 1 185 ? 140.42100 139.69500 115.38200 1.000 33.48416  ? 185 LEU A CG  1 
ATOM   1105  C CD1 . LEU A 1 185 ? 139.78200 140.50900 114.29100 1.000 33.48416  ? 185 LEU A CD1 1 
ATOM   1106  C CD2 . LEU A 1 185 ? 141.01100 140.59400 116.43500 1.000 33.48416  ? 185 LEU A CD2 1 
ATOM   1107  N N   . GLU A 1 186 ? 138.26500 136.16200 117.86700 1.000 33.97617  ? 186 GLU A N   1 
ATOM   1108  C CA  . GLU A 1 186 ? 137.05100 135.52500 118.36300 1.000 33.97617  ? 186 GLU A CA  1 
ATOM   1109  C C   . GLU A 1 186 ? 136.96700 135.58400 119.87700 1.000 33.97617  ? 186 GLU A C   1 
ATOM   1110  O O   . GLU A 1 186 ? 135.86600 135.61700 120.43300 1.000 33.97617  ? 186 GLU A O   1 
ATOM   1111  C CB  . GLU A 1 186 ? 136.98900 134.07700 117.90200 1.000 33.97617  ? 186 GLU A CB  1 
ATOM   1112  C CG  . GLU A 1 186 ? 136.33300 133.88200 116.56800 1.000 33.97617  ? 186 GLU A CG  1 
ATOM   1113  C CD  . GLU A 1 186 ? 136.53800 132.48400 116.04400 1.000 33.97617  ? 186 GLU A CD  1 
ATOM   1114  O OE1 . GLU A 1 186 ? 136.62400 131.55100 116.86900 1.000 33.97617  ? 186 GLU A OE1 1 
ATOM   1115  O OE2 . GLU A 1 186 ? 136.62800 132.31800 114.81100 1.000 33.97617  ? 186 GLU A OE2 1 
ATOM   1116  N N   . LYS A 1 187 ? 138.10600 135.59500 120.55500 1.000 33.95752  ? 187 LYS A N   1 
ATOM   1117  C CA  . LYS A 1 187 ? 138.15600 135.67100 122.00400 1.000 33.95752  ? 187 LYS A CA  1 
ATOM   1118  C C   . LYS A 1 187 ? 138.37700 137.08600 122.51200 1.000 33.95752  ? 187 LYS A C   1 
ATOM   1119  O O   . LYS A 1 187 ? 138.41300 137.29400 123.72500 1.000 33.95752  ? 187 LYS A O   1 
ATOM   1120  C CB  . LYS A 1 187 ? 139.25300 134.75000 122.52700 1.000 33.95752  ? 187 LYS A CB  1 
ATOM   1121  C CG  . LYS A 1 187 ? 139.25500 133.40300 121.84700 1.000 33.95752  ? 187 LYS A CG  1 
ATOM   1122  C CD  . LYS A 1 187 ? 140.29900 132.49300 122.43800 1.000 33.95752  ? 187 LYS A CD  1 
ATOM   1123  C CE  . LYS A 1 187 ? 141.69100 132.97800 122.11100 1.000 33.95752  ? 187 LYS A CE  1 
ATOM   1124  N NZ  . LYS A 1 187 ? 142.10000 132.54600 120.75500 1.000 33.95752  ? 187 LYS A NZ  1 
ATOM   1125  N N   . ASP A 1 188 ? 138.52500 138.05900 121.62000 1.000 36.68284  ? 188 ASP A N   1 
ATOM   1126  C CA  . ASP A 1 188 ? 138.61800 139.45700 122.01400 1.000 36.68284  ? 188 ASP A CA  1 
ATOM   1127  C C   . ASP A 1 188 ? 137.21500 139.98500 122.26700 1.000 36.68284  ? 188 ASP A C   1 
ATOM   1128  O O   . ASP A 1 188 ? 136.37900 139.98700 121.36000 1.000 36.68284  ? 188 ASP A O   1 
ATOM   1129  C CB  . ASP A 1 188 ? 139.30900 140.26300 120.92000 1.000 36.68284  ? 188 ASP A CB  1 
ATOM   1130  C CG  . ASP A 1 188 ? 140.04400 141.46800 121.45600 1.000 36.68284  ? 188 ASP A CG  1 
ATOM   1131  O OD1 . ASP A 1 188 ? 139.65700 141.98000 122.52400 1.000 36.68284  ? 188 ASP A OD1 1 
ATOM   1132  O OD2 . ASP A 1 188 ? 141.01100 141.91100 120.80400 1.000 36.68284  ? 188 ASP A OD2 1 
ATOM   1133  N N   . ILE A 1 189 ? 136.95200 140.44200 123.49200 1.000 35.58502  ? 189 ILE A N   1 
ATOM   1134  C CA  . ILE A 1 189 ? 135.58600 140.78000 123.87300 1.000 35.58502  ? 189 ILE A CA  1 
ATOM   1135  C C   . ILE A 1 189 ? 135.12900 142.11400 123.31000 1.000 35.58502  ? 189 ILE A C   1 
ATOM   1136  O O   . ILE A 1 189 ? 133.93700 142.42700 123.38000 1.000 35.58502  ? 189 ILE A O   1 
ATOM   1137  C CB  . ILE A 1 189 ? 135.44100 140.78500 125.40100 1.000 35.58502  ? 189 ILE A CB  1 
ATOM   1138  C CG1 . ILE A 1 189 ? 136.49300 141.70100 126.01800 1.000 35.58502  ? 189 ILE A CG1 1 
ATOM   1139  C CG2 . ILE A 1 189 ? 135.57000 139.38500 125.93100 1.000 35.58502  ? 189 ILE A CG2 1 
ATOM   1140  C CD1 . ILE A 1 189 ? 136.44300 141.77300 127.51400 1.000 35.58502  ? 189 ILE A CD1 1 
ATOM   1141  N N   . ARG A 1 190 ? 136.02900 142.91800 122.75900 1.000 39.22139  ? 190 ARG A N   1 
ATOM   1142  C CA  . ARG A 1 190 ? 135.62200 144.17300 122.14700 1.000 39.22139  ? 190 ARG A CA  1 
ATOM   1143  C C   . ARG A 1 190 ? 135.31000 144.02900 120.66700 1.000 39.22139  ? 190 ARG A C   1 
ATOM   1144  O O   . ARG A 1 190 ? 135.03100 145.03300 120.00900 1.000 39.22139  ? 190 ARG A O   1 
ATOM   1145  C CB  . ARG A 1 190 ? 136.69700 145.24000 122.35400 1.000 39.22139  ? 190 ARG A CB  1 
ATOM   1146  C CG  . ARG A 1 190 ? 138.06800 144.83000 121.90000 1.000 39.22139  ? 190 ARG A CG  1 
ATOM   1147  C CD  . ARG A 1 190 ? 139.09600 145.86100 122.29400 1.000 39.22139  ? 190 ARG A CD  1 
ATOM   1148  N NE  . ARG A 1 190 ? 140.14400 145.98600 121.28900 1.000 39.22139  ? 190 ARG A NE  1 
ATOM   1149  C CZ  . ARG A 1 190 ? 141.23800 145.23500 121.25500 1.000 39.22139  ? 190 ARG A CZ  1 
ATOM   1150  N NH1 . ARG A 1 190 ? 141.43200 144.30100 122.17400 1.000 39.22139  ? 190 ARG A NH1 1 
ATOM   1151  N NH2 . ARG A 1 190 ? 142.14300 145.42100 120.30400 1.000 39.22139  ? 190 ARG A NH2 1 
ATOM   1152  N N   . PHE A 1 191 ? 135.34900 142.81400 120.13400 1.000 36.38704  ? 191 PHE A N   1 
ATOM   1153  C CA  . PHE A 1 191 ? 134.91600 142.52100 118.77900 1.000 36.38704  ? 191 PHE A CA  1 
ATOM   1154  C C   . PHE A 1 191 ? 133.70500 141.60200 118.82000 1.000 36.38704  ? 191 PHE A C   1 
ATOM   1155  O O   . PHE A 1 191 ? 133.55300 140.79500 119.73900 1.000 36.38704  ? 191 PHE A O   1 
ATOM   1156  C CB  . PHE A 1 191 ? 136.03300 141.86300 117.97000 1.000 36.38704  ? 191 PHE A CB  1 
ATOM   1157  C CG  . PHE A 1 191 ? 137.15700 142.78700 117.63200 1.000 36.38704  ? 191 PHE A CG  1 
ATOM   1158  C CD1 . PHE A 1 191 ? 136.99100 143.77600 116.68200 1.000 36.38704  ? 191 PHE A CD1 1 
ATOM   1159  C CD2 . PHE A 1 191 ? 138.38000 142.66600 118.26000 1.000 36.38704  ? 191 PHE A CD2 1 
ATOM   1160  C CE1 . PHE A 1 191 ? 138.02300 144.63000 116.36900 1.000 36.38704  ? 191 PHE A CE1 1 
ATOM   1161  C CE2 . PHE A 1 191 ? 139.41600 143.51600 117.95000 1.000 36.38704  ? 191 PHE A CE2 1 
ATOM   1162  C CZ  . PHE A 1 191 ? 139.23700 144.49800 117.00300 1.000 36.38704  ? 191 PHE A CZ  1 
ATOM   1163  N N   . ASN A 1 192 ? 132.84300 141.72800 117.81900 1.000 33.69667  ? 192 ASN A N   1 
ATOM   1164  C CA  . ASN A 1 192 ? 131.65100 140.90100 117.76600 1.000 33.69667  ? 192 ASN A CA  1 
ATOM   1165  C C   . ASN A 1 192 ? 132.00900 139.47000 117.39000 1.000 33.69667  ? 192 ASN A C   1 
ATOM   1166  O O   . ASN A 1 192 ? 133.10300 139.18000 116.91100 1.000 33.69667  ? 192 ASN A O   1 
ATOM   1167  C CB  . ASN A 1 192 ? 130.64700 141.46500 116.76900 1.000 33.69667  ? 192 ASN A CB  1 
ATOM   1168  C CG  . ASN A 1 192 ? 129.22400 141.17400 117.16000 1.000 33.69667  ? 192 ASN A CG  1 
ATOM   1169  O OD1 . ASN A 1 192 ? 128.96400 140.29600 117.97400 1.000 33.69667  ? 192 ASN A OD1 1 
ATOM   1170  N ND2 . ASN A 1 192 ? 128.29100 141.91000 116.58700 1.000 33.69667  ? 192 ASN A ND2 1 
ATOM   1171  N N   . TYR A 1 193 ? 131.07300 138.56400 117.63200 1.000 31.43541  ? 193 TYR A N   1 
ATOM   1172  C CA  . TYR A 1 193 ? 131.24300 137.15800 117.30300 1.000 31.43541  ? 193 TYR A CA  1 
ATOM   1173  C C   . TYR A 1 193 ? 130.40700 136.72400 116.11600 1.000 31.43541  ? 193 TYR A C   1 
ATOM   1174  O O   . TYR A 1 193 ? 130.79000 135.80200 115.40500 1.000 31.43541  ? 193 TYR A O   1 
ATOM   1175  C CB  . TYR A 1 193 ? 130.89200 136.28900 118.50800 1.000 31.43541  ? 193 TYR A CB  1 
ATOM   1176  C CG  . TYR A 1 193 ? 131.24100 134.83700 118.34400 1.000 31.43541  ? 193 TYR A CG  1 
ATOM   1177  C CD1 . TYR A 1 193 ? 132.55600 134.43400 118.24200 1.000 31.43541  ? 193 TYR A CD1 1 
ATOM   1178  C CD2 . TYR A 1 193 ? 130.25500 133.86900 118.30200 1.000 31.43541  ? 193 TYR A CD2 1 
ATOM   1179  C CE1 . TYR A 1 193 ? 132.88100 133.11200 118.09800 1.000 31.43541  ? 193 TYR A CE1 1 
ATOM   1180  C CE2 . TYR A 1 193 ? 130.57100 132.54500 118.15600 1.000 31.43541  ? 193 TYR A CE2 1 
ATOM   1181  C CZ  . TYR A 1 193 ? 131.88600 132.17300 118.05500 1.000 31.43541  ? 193 TYR A CZ  1 
ATOM   1182  O OH  . TYR A 1 193 ? 132.22100 130.85100 117.90900 1.000 31.43541  ? 193 TYR A OH  1 
ATOM   1183  N N   . PHE A 1 194 ? 129.26700 137.36300 115.88000 1.000 35.77125  ? 194 PHE A N   1 
ATOM   1184  C CA  . PHE A 1 194 ? 128.49700 137.04100 114.69200 1.000 35.77125  ? 194 PHE A CA  1 
ATOM   1185  C C   . PHE A 1 194 ? 129.06900 137.67200 113.44000 1.000 35.77125  ? 194 PHE A C   1 
ATOM   1186  O O   . PHE A 1 194 ? 128.74800 137.21400 112.34600 1.000 35.77125  ? 194 PHE A O   1 
ATOM   1187  C CB  . PHE A 1 194 ? 127.04900 137.48500 114.84900 1.000 35.77125  ? 194 PHE A CB  1 
ATOM   1188  C CG  . PHE A 1 194 ? 126.38400 136.93900 116.06300 1.000 35.77125  ? 194 PHE A CG  1 
ATOM   1189  C CD1 . PHE A 1 194 ? 125.92600 135.64000 116.08300 1.000 35.77125  ? 194 PHE A CD1 1 
ATOM   1190  C CD2 . PHE A 1 194 ? 126.20900 137.72700 117.18600 1.000 35.77125  ? 194 PHE A CD2 1 
ATOM   1191  C CE1 . PHE A 1 194 ? 125.30600 135.13400 117.20100 1.000 35.77125  ? 194 PHE A CE1 1 
ATOM   1192  C CE2 . PHE A 1 194 ? 125.59300 137.22300 118.30900 1.000 35.77125  ? 194 PHE A CE2 1 
ATOM   1193  C CZ  . PHE A 1 194 ? 125.14300 135.92600 118.31500 1.000 35.77125  ? 194 PHE A CZ  1 
ATOM   1194  N N   . TRP A 1 195 ? 129.88300 138.71400 113.55800 1.000 36.31700  ? 195 TRP A N   1 
ATOM   1195  C CA  . TRP A 1 195 ? 130.46400 139.34100 112.38500 1.000 36.31700  ? 195 TRP A CA  1 
ATOM   1196  C C   . TRP A 1 195 ? 131.95900 139.11700 112.28000 1.000 36.31700  ? 195 TRP A C   1 
ATOM   1197  O O   . TRP A 1 195 ? 132.61600 139.79000 111.48600 1.000 36.31700  ? 195 TRP A O   1 
ATOM   1198  C CB  . TRP A 1 195 ? 130.13900 140.83400 112.36700 1.000 36.31700  ? 195 TRP A CB  1 
ATOM   1199  C CG  . TRP A 1 195 ? 128.65800 141.06900 112.38700 1.000 36.31700  ? 195 TRP A CG  1 
ATOM   1200  C CD1 . TRP A 1 195 ? 127.93600 141.62500 113.39500 1.000 36.31700  ? 195 TRP A CD1 1 
ATOM   1201  C CD2 . TRP A 1 195 ? 127.71100 140.71900 111.36300 1.000 36.31700  ? 195 TRP A CD2 1 
ATOM   1202  N NE1 . TRP A 1 195 ? 126.60500 141.65600 113.06600 1.000 36.31700  ? 195 TRP A NE1 1 
ATOM   1203  C CE2 . TRP A 1 195 ? 126.44100 141.10500 111.82300 1.000 36.31700  ? 195 TRP A CE2 1 
ATOM   1204  C CE3 . TRP A 1 195 ? 127.81600 140.12600 110.09900 1.000 36.31700  ? 195 TRP A CE3 1 
ATOM   1205  C CZ2 . TRP A 1 195 ? 125.29000 140.91500 111.07000 1.000 36.31700  ? 195 TRP A CZ2 1 
ATOM   1206  C CZ3 . TRP A 1 195 ? 126.67400 139.93800 109.35900 1.000 36.31700  ? 195 TRP A CZ3 1 
ATOM   1207  C CH2 . TRP A 1 195 ? 125.42800 140.33200 109.84400 1.000 36.31700  ? 195 TRP A CH2 1 
ATOM   1208  N N   . ILE A 1 196 ? 132.50400 138.20500 113.07300 1.000 32.35610  ? 196 ILE A N   1 
ATOM   1209  C CA  . ILE A 1 196 ? 133.81600 137.62700 112.82400 1.000 32.35610  ? 196 ILE A CA  1 
ATOM   1210  C C   . ILE A 1 196 ? 133.68300 136.21900 112.26600 1.000 32.35610  ? 196 ILE A C   1 
ATOM   1211  O O   . ILE A 1 196 ? 134.41000 135.83300 111.35000 1.000 32.35610  ? 196 ILE A O   1 
ATOM   1212  C CB  . ILE A 1 196 ? 134.65200 137.66600 114.12100 1.000 32.35610  ? 196 ILE A CB  1 
ATOM   1213  C CG1 . ILE A 1 196 ? 135.14200 139.08500 114.38600 1.000 32.35610  ? 196 ILE A CG1 1 
ATOM   1214  C CG2 . ILE A 1 196 ? 135.83300 136.73100 114.07600 1.000 32.35610  ? 196 ILE A CG2 1 
ATOM   1215  C CD1 . ILE A 1 196 ? 136.04900 139.62100 113.32000 1.000 32.35610  ? 196 ILE A CD1 1 
ATOM   1216  N N   . ARG A 1 197 ? 132.70700 135.46100 112.76600 1.000 31.73840  ? 197 ARG A N   1 
ATOM   1217  C CA  . ARG A 1 197 ? 132.45800 134.12100 112.25800 1.000 31.73840  ? 197 ARG A CA  1 
ATOM   1218  C C   . ARG A 1 197 ? 131.90600 134.11700 110.84200 1.000 31.73840  ? 197 ARG A C   1 
ATOM   1219  O O   . ARG A 1 197 ? 132.14000 133.15100 110.11800 1.000 31.73840  ? 197 ARG A O   1 
ATOM   1220  C CB  . ARG A 1 197 ? 131.49300 133.37400 113.16900 1.000 31.73840  ? 197 ARG A CB  1 
ATOM   1221  C CG  . ARG A 1 197 ? 132.10700 132.89800 114.45500 1.000 31.73840  ? 197 ARG A CG  1 
ATOM   1222  C CD  . ARG A 1 197 ? 133.35300 132.09000 114.21100 1.000 31.73840  ? 197 ARG A CD  1 
ATOM   1223  N NE  . ARG A 1 197 ? 133.08500 130.84800 113.50400 1.000 31.73840  ? 197 ARG A NE  1 
ATOM   1224  C CZ  . ARG A 1 197 ? 134.01300 129.94000 113.24200 1.000 31.73840  ? 197 ARG A CZ  1 
ATOM   1225  N NH1 . ARG A 1 197 ? 135.25900 130.14000 113.63400 1.000 31.73840  ? 197 ARG A NH1 1 
ATOM   1226  N NH2 . ARG A 1 197 ? 133.70200 128.83400 112.59300 1.000 31.73840  ? 197 ARG A NH2 1 
ATOM   1227  N N   . CYS A 1 198 ? 131.18400 135.15700 110.42500 1.000 33.59020  ? 198 CYS A N   1 
ATOM   1228  C CA  . CYS A 1 198 ? 130.75500 135.23000 109.03300 1.000 33.59020  ? 198 CYS A CA  1 
ATOM   1229  C C   . CYS A 1 198 ? 131.82600 135.79600 108.11300 1.000 33.59020  ? 198 CYS A C   1 
ATOM   1230  O O   . CYS A 1 198 ? 131.85600 135.45200 106.93000 1.000 33.59020  ? 198 CYS A O   1 
ATOM   1231  C CB  . CYS A 1 198 ? 129.47400 136.05000 108.89900 1.000 33.59020  ? 198 CYS A CB  1 
ATOM   1232  S SG  . CYS A 1 198 ? 128.08800 135.40500 109.83300 1.000 33.59020  ? 198 CYS A SG  1 
ATOM   1233  N N   . THR A 1 199 ? 132.70500 136.65900 108.61800 1.000 32.38755  ? 199 THR A N   1 
ATOM   1234  C CA  . THR A 1 199 ? 133.86100 137.09000 107.84200 1.000 32.38755  ? 199 THR A CA  1 
ATOM   1235  C C   . THR A 1 199 ? 134.83700 135.94900 107.58900 1.000 32.38755  ? 199 THR A C   1 
ATOM   1236  O O   . THR A 1 199 ? 135.46200 135.90600 106.52600 1.000 32.38755  ? 199 THR A O   1 
ATOM   1237  C CB  . THR A 1 199 ? 134.55300 138.24700 108.56500 1.000 32.38755  ? 199 THR A CB  1 
ATOM   1238  O OG1 . THR A 1 199 ? 133.57800 139.23900 108.89400 1.000 32.38755  ? 199 THR A OG1 1 
ATOM   1239  C CG2 . THR A 1 199 ? 135.60600 138.89500 107.70000 1.000 32.38755  ? 199 THR A CG2 1 
ATOM   1240  N N   . LYS A 1 200 ? 134.94700 135.00100 108.51400 1.000 32.24256  ? 200 LYS A N   1 
ATOM   1241  C CA  . LYS A 1 200 ? 135.73200 133.80200 108.26400 1.000 32.24256  ? 200 LYS A CA  1 
ATOM   1242  C C   . LYS A 1 200 ? 135.02700 132.87300 107.28800 1.000 32.24256  ? 200 LYS A C   1 
ATOM   1243  O O   . LYS A 1 200 ? 135.68100 132.13200 106.55400 1.000 32.24256  ? 200 LYS A O   1 
ATOM   1244  C CB  . LYS A 1 200 ? 136.00300 133.08200 109.58000 1.000 32.24256  ? 200 LYS A CB  1 
ATOM   1245  C CG  . LYS A 1 200 ? 137.06200 132.00900 109.53100 1.000 32.24256  ? 200 LYS A CG  1 
ATOM   1246  C CD  . LYS A 1 200 ? 137.29100 131.46200 110.91700 1.000 32.24256  ? 200 LYS A CD  1 
ATOM   1247  C CE  . LYS A 1 200 ? 138.23300 130.29100 110.90100 1.000 32.24256  ? 200 LYS A CE  1 
ATOM   1248  N NZ  . LYS A 1 200 ? 138.07300 129.45200 112.11900 1.000 32.24256  ? 200 LYS A NZ  1 
ATOM   1249  N N   . LEU A 1 201 ? 133.69600 132.89100 107.26400 1.000 30.32457  ? 201 LEU A N   1 
ATOM   1250  C CA  . LEU A 1 201 ? 132.97400 132.02500 106.34200 1.000 30.32457  ? 201 LEU A CA  1 
ATOM   1251  C C   . LEU A 1 201 ? 132.92200 132.61300 104.94500 1.000 30.32457  ? 201 LEU A C   1 
ATOM   1252  O O   . LEU A 1 201 ? 132.72500 131.87800 103.97800 1.000 30.32457  ? 201 LEU A O   1 
ATOM   1253  C CB  . LEU A 1 201 ? 131.55500 131.77000 106.84000 1.000 30.32457  ? 201 LEU A CB  1 
ATOM   1254  C CG  . LEU A 1 201 ? 131.33700 130.80600 108.00200 1.000 30.32457  ? 201 LEU A CG  1 
ATOM   1255  C CD1 . LEU A 1 201 ? 129.85700 130.54300 108.16500 1.000 30.32457  ? 201 LEU A CD1 1 
ATOM   1256  C CD2 . LEU A 1 201 ? 132.10600 129.52200 107.80700 1.000 30.32457  ? 201 LEU A CD2 1 
ATOM   1257  N N   . ILE A 1 202 ? 133.06500 133.92700 104.81900 1.000 29.45419  ? 202 ILE A N   1 
ATOM   1258  C CA  . ILE A 1 202 ? 133.05500 134.54500 103.50000 1.000 29.45419  ? 202 ILE A CA  1 
ATOM   1259  C C   . ILE A 1 202 ? 134.43300 134.45200 102.86100 1.000 29.45419  ? 202 ILE A C   1 
ATOM   1260  O O   . ILE A 1 202 ? 134.55800 134.13900 101.67300 1.000 29.45419  ? 202 ILE A O   1 
ATOM   1261  C CB  . ILE A 1 202 ? 132.55200 135.99600 103.61300 1.000 29.45419  ? 202 ILE A CB  1 
ATOM   1262  C CG1 . ILE A 1 202 ? 131.03700 136.01400 103.76100 1.000 29.45419  ? 202 ILE A CG1 1 
ATOM   1263  C CG2 . ILE A 1 202 ? 132.93200 136.82300 102.41200 1.000 29.45419  ? 202 ILE A CG2 1 
ATOM   1264  C CD1 . ILE A 1 202 ? 130.47800 137.37200 104.04600 1.000 29.45419  ? 202 ILE A CD1 1 
ATOM   1265  N N   . SER A 1 203 ? 135.48700 134.65100 103.65100 1.000 31.28331  ? 203 SER A N   1 
ATOM   1266  C CA  . SER A 1 203 ? 136.83900 134.68000 103.10700 1.000 31.28331  ? 203 SER A CA  1 
ATOM   1267  C C   . SER A 1 203 ? 137.30700 133.29900 102.67400 1.000 31.28331  ? 203 SER A C   1 
ATOM   1268  O O   . SER A 1 203 ? 138.21600 133.17700 101.85000 1.000 31.28331  ? 203 SER A O   1 
ATOM   1269  C CB  . SER A 1 203 ? 137.79400 135.25700 104.14300 1.000 31.28331  ? 203 SER A CB  1 
ATOM   1270  O OG  . SER A 1 203 ? 137.43500 136.58300 104.46700 1.000 31.28331  ? 203 SER A OG  1 
ATOM   1271  N N   . VAL A 1 204 ? 136.70300 132.24500 103.21500 1.000 29.90730  ? 204 VAL A N   1 
ATOM   1272  C CA  . VAL A 1 204 ? 137.06900 130.89200 102.81000 1.000 29.90730  ? 204 VAL A CA  1 
ATOM   1273  C C   . VAL A 1 204 ? 136.47500 130.57300 101.44300 1.000 29.90730  ? 204 VAL A C   1 
ATOM   1274  O O   . VAL A 1 204 ? 137.14100 129.99500 100.57700 1.000 29.90730  ? 204 VAL A O   1 
ATOM   1275  C CB  . VAL A 1 204 ? 136.63300 129.88400 103.88900 1.000 29.90730  ? 204 VAL A CB  1 
ATOM   1276  C CG1 . VAL A 1 204 ? 136.57400 128.47400 103.35200 1.000 29.90730  ? 204 VAL A CG1 1 
ATOM   1277  C CG2 . VAL A 1 204 ? 137.59000 129.93300 105.04100 1.000 29.90730  ? 204 VAL A CG2 1 
ATOM   1278  N N   . THR A 1 205 ? 135.23100 130.99100 101.20500 1.000 29.10128  ? 205 THR A N   1 
ATOM   1279  C CA  . THR A 1 205 ? 134.59000 130.68000 99.93300  1.000 29.10128  ? 205 THR A CA  1 
ATOM   1280  C C   . THR A 1 205 ? 135.06700 131.60600 98.82300  1.000 29.10128  ? 205 THR A C   1 
ATOM   1281  O O   . THR A 1 205 ? 135.12200 131.20400 97.65800  1.000 29.10128  ? 205 THR A O   1 
ATOM   1282  C CB  . THR A 1 205 ? 133.07900 130.75500 100.06700 1.000 29.10128  ? 205 THR A CB  1 
ATOM   1283  O OG1 . THR A 1 205 ? 132.68200 132.12300 100.16800 1.000 29.10128  ? 205 THR A OG1 1 
ATOM   1284  C CG2 . THR A 1 205 ? 132.64300 130.02100 101.29000 1.000 29.10128  ? 205 THR A CG2 1 
ATOM   1285  N N   . LEU A 1 206 ? 135.40400 132.85500 99.15700  1.000 30.46789  ? 206 LEU A N   1 
ATOM   1286  C CA  . LEU A 1 206 ? 135.98600 133.75600 98.16500  1.000 30.46789  ? 206 LEU A CA  1 
ATOM   1287  C C   . LEU A 1 206 ? 137.35500 133.27500 97.72100  1.000 30.46789  ? 206 LEU A C   1 
ATOM   1288  O O   . LEU A 1 206 ? 137.77800 133.53300 96.59300  1.000 30.46789  ? 206 LEU A O   1 
ATOM   1289  C CB  . LEU A 1 206 ? 136.10500 135.16700 98.72500  1.000 30.46789  ? 206 LEU A CB  1 
ATOM   1290  C CG  . LEU A 1 206 ? 134.87800 136.03900 98.93500  1.000 30.46789  ? 206 LEU A CG  1 
ATOM   1291  C CD1 . LEU A 1 206 ? 135.34800 137.35300 99.50900  1.000 30.46789  ? 206 LEU A CD1 1 
ATOM   1292  C CD2 . LEU A 1 206 ? 134.13400 136.25400 97.64700  1.000 30.46789  ? 206 LEU A CD2 1 
ATOM   1293  N N   . PHE A 1 207 ? 138.07100 132.58500 98.59800  1.000 32.07114  ? 207 PHE A N   1 
ATOM   1294  C CA  . PHE A 1 207 ? 139.33800 132.00900 98.18700  1.000 32.07114  ? 207 PHE A CA  1 
ATOM   1295  C C   . PHE A 1 207 ? 139.13100 130.69900 97.44600  1.000 32.07114  ? 207 PHE A C   1 
ATOM   1296  O O   . PHE A 1 207 ? 139.96300 130.31200 96.62800  1.000 32.07114  ? 207 PHE A O   1 
ATOM   1297  C CB  . PHE A 1 207 ? 140.23800 131.79900 99.39400  1.000 32.07114  ? 207 PHE A CB  1 
ATOM   1298  C CG  . PHE A 1 207 ? 141.63500 131.43600 99.03500  1.000 32.07114  ? 207 PHE A CG  1 
ATOM   1299  C CD1 . PHE A 1 207 ? 142.39100 132.27600 98.24700  1.000 32.07114  ? 207 PHE A CD1 1 
ATOM   1300  C CD2 . PHE A 1 207 ? 142.18800 130.25100 99.47000  1.000 32.07114  ? 207 PHE A CD2 1 
ATOM   1301  C CE1 . PHE A 1 207 ? 143.67000 131.94500 97.90800  1.000 32.07114  ? 207 PHE A CE1 1 
ATOM   1302  C CE2 . PHE A 1 207 ? 143.47300 129.91700 99.13200  1.000 32.07114  ? 207 PHE A CE2 1 
ATOM   1303  C CZ  . PHE A 1 207 ? 144.21300 130.76600 98.35100  1.000 32.07114  ? 207 PHE A CZ  1 
ATOM   1304  N N   . ALA A 1 208 ? 138.03200 129.99700 97.71200  1.000 30.72110  ? 208 ALA A N   1 
ATOM   1305  C CA  . ALA A 1 208 ? 137.79200 128.73400 97.02300  1.000 30.72110  ? 208 ALA A CA  1 
ATOM   1306  C C   . ALA A 1 208 ? 137.26500 128.97200 95.61600  1.000 30.72110  ? 208 ALA A C   1 
ATOM   1307  O O   . ALA A 1 208 ? 137.46400 128.15000 94.72000  1.000 30.72110  ? 208 ALA A O   1 
ATOM   1308  C CB  . ALA A 1 208 ? 136.82100 127.87400 97.82500  1.000 30.72110  ? 208 ALA A CB  1 
ATOM   1309  N N   . ILE A 1 209 ? 136.57000 130.08700 95.41100  1.000 30.62811  ? 209 ILE A N   1 
ATOM   1310  C CA  . ILE A 1 209 ? 136.12300 130.46400 94.07400  1.000 30.62811  ? 209 ILE A CA  1 
ATOM   1311  C C   . ILE A 1 209 ? 137.30900 130.92200 93.23800  1.000 30.62811  ? 209 ILE A C   1 
ATOM   1312  O O   . ILE A 1 209 ? 137.46200 130.53700 92.07400  1.000 30.62811  ? 209 ILE A O   1 
ATOM   1313  C CB  . ILE A 1 209 ? 135.04400 131.55500 94.17200  1.000 30.62811  ? 209 ILE A CB  1 
ATOM   1314  C CG1 . ILE A 1 209 ? 133.73300 130.96100 94.66000  1.000 30.62811  ? 209 ILE A CG1 1 
ATOM   1315  C CG2 . ILE A 1 209 ? 134.83500 132.26100 92.86200  1.000 30.62811  ? 209 ILE A CG2 1 
ATOM   1316  C CD1 . ILE A 1 209 ? 132.88100 131.95900 95.35400  1.000 30.62811  ? 209 ILE A CD1 1 
ATOM   1317  N N   . HIS A 1 210 ? 138.18200 131.72800 93.83800  1.000 34.54526  ? 210 HIS A N   1 
ATOM   1318  C CA  . HIS A 1 210 ? 139.31700 132.28900 93.11800  1.000 34.54526  ? 210 HIS A CA  1 
ATOM   1319  C C   . HIS A 1 210 ? 140.35000 131.22200 92.78700  1.000 34.54526  ? 210 HIS A C   1 
ATOM   1320  O O   . HIS A 1 210 ? 140.79900 131.11400 91.64400  1.000 34.54526  ? 210 HIS A O   1 
ATOM   1321  C CB  . HIS A 1 210 ? 139.93800 133.40400 93.95300  1.000 34.54526  ? 210 HIS A CB  1 
ATOM   1322  C CG  . HIS A 1 210 ? 141.07200 134.10700 93.28500  1.000 34.54526  ? 210 HIS A CG  1 
ATOM   1323  N ND1 . HIS A 1 210 ? 140.90400 135.26800 92.56400  1.000 34.54526  ? 210 HIS A ND1 1 
ATOM   1324  C CD2 . HIS A 1 210 ? 142.39400 133.82800 93.24700  1.000 34.54526  ? 210 HIS A CD2 1 
ATOM   1325  C CE1 . HIS A 1 210 ? 142.07300 135.66600 92.10000  1.000 34.54526  ? 210 HIS A CE1 1 
ATOM   1326  N NE2 . HIS A 1 210 ? 142.99300 134.80900 92.49800  1.000 34.54526  ? 210 HIS A NE2 1 
ATOM   1327  N N   . CYS A 1 211 ? 140.72500 130.40700 93.77000  1.000 36.42721  ? 211 CYS A N   1 
ATOM   1328  C CA  . CYS A 1 211 ? 141.79600 129.44100 93.56600  1.000 36.42721  ? 211 CYS A CA  1 
ATOM   1329  C C   . CYS A 1 211 ? 141.35200 128.24600 92.73400  1.000 36.42721  ? 211 CYS A C   1 
ATOM   1330  O O   . CYS A 1 211 ? 142.20000 127.47100 92.29200  1.000 36.42721  ? 211 CYS A O   1 
ATOM   1331  C CB  . CYS A 1 211 ? 142.34200 128.98900 94.92300  1.000 36.42721  ? 211 CYS A CB  1 
ATOM   1332  S SG  . CYS A 1 211 ? 143.83400 127.98700 94.94000  1.000 36.42721  ? 211 CYS A SG  1 
ATOM   1333  N N   . ALA A 1 212 ? 140.06000 128.08400 92.47700  1.000 32.91692  ? 212 ALA A N   1 
ATOM   1334  C CA  . ALA A 1 212 ? 139.60000 127.03700 91.58500  1.000 32.91692  ? 212 ALA A CA  1 
ATOM   1335  C C   . ALA A 1 212 ? 139.04200 127.56300 90.27600  1.000 32.91692  ? 212 ALA A C   1 
ATOM   1336  O O   . ALA A 1 212 ? 138.68800 126.76200 89.41000  1.000 32.91692  ? 212 ALA A O   1 
ATOM   1337  C CB  . ALA A 1 212 ? 138.54100 126.17600 92.26900  1.000 32.91692  ? 212 ALA A CB  1 
ATOM   1338  N N   . GLY A 1 213 ? 138.92900 128.87500 90.12100  1.000 35.93401  ? 213 GLY A N   1 
ATOM   1339  C CA  . GLY A 1 213 ? 138.70000 129.47000 88.82400  1.000 35.93401  ? 213 GLY A CA  1 
ATOM   1340  C C   . GLY A 1 213 ? 139.95900 129.80600 88.08900  1.000 35.93401  ? 213 GLY A C   1 
ATOM   1341  O O   . GLY A 1 213 ? 139.92400 130.08000 86.89200  1.000 35.93401  ? 213 GLY A O   1 
ATOM   1342  N N   . CYS A 1 214 ? 141.08500 129.79800 88.79200  1.000 39.38781  ? 214 CYS A N   1 
ATOM   1343  C CA  . CYS A 1 214 ? 142.38700 129.95800 88.17500  1.000 39.38781  ? 214 CYS A CA  1 
ATOM   1344  C C   . CYS A 1 214 ? 143.10400 128.63600 87.97700  1.000 39.38781  ? 214 CYS A C   1 
ATOM   1345  O O   . CYS A 1 214 ? 144.06900 128.58300 87.21500  1.000 39.38781  ? 214 CYS A O   1 
ATOM   1346  C CB  . CYS A 1 214 ? 143.26100 130.88500 89.02000  1.000 39.38781  ? 214 CYS A CB  1 
ATOM   1347  S SG  . CYS A 1 214 ? 142.56700 132.52900 89.25600  1.000 39.38781  ? 214 CYS A SG  1 
ATOM   1348  N N   . PHE A 1 215 ? 142.66700 127.57500 88.64100  1.000 39.79132  ? 215 PHE A N   1 
ATOM   1349  C CA  . PHE A 1 215 ? 143.24100 126.26100 88.40300  1.000 39.79132  ? 215 PHE A CA  1 
ATOM   1350  C C   . PHE A 1 215 ? 142.49500 125.49600 87.32700  1.000 39.79132  ? 215 PHE A C   1 
ATOM   1351  O O   . PHE A 1 215 ? 142.95300 124.42600 86.92500  1.000 39.79132  ? 215 PHE A O   1 
ATOM   1352  C CB  . PHE A 1 215 ? 143.25300 125.42000 89.68200  1.000 39.79132  ? 215 PHE A CB  1 
ATOM   1353  C CG  . PHE A 1 215 ? 144.30800 125.81900 90.68100  1.000 39.79132  ? 215 PHE A CG  1 
ATOM   1354  C CD1 . PHE A 1 215 ? 145.20500 126.84400 90.41900  1.000 39.79132  ? 215 PHE A CD1 1 
ATOM   1355  C CD2 . PHE A 1 215 ? 144.39500 125.15800 91.89400  1.000 39.79132  ? 215 PHE A CD2 1 
ATOM   1356  C CE1 . PHE A 1 215 ? 146.15500 127.20400 91.34600  1.000 39.79132  ? 215 PHE A CE1 1 
ATOM   1357  C CE2 . PHE A 1 215 ? 145.34900 125.51500 92.82300  1.000 39.79132  ? 215 PHE A CE2 1 
ATOM   1358  C CZ  . PHE A 1 215 ? 146.23000 126.53900 92.54700  1.000 39.79132  ? 215 PHE A CZ  1 
ATOM   1359  N N   . ASN A 1 216 ? 141.35400 126.00400 86.87400  1.000 39.96060  ? 216 ASN A N   1 
ATOM   1360  C CA  . ASN A 1 216 ? 140.62000 125.42700 85.76000  1.000 39.96060  ? 216 ASN A CA  1 
ATOM   1361  C C   . ASN A 1 216 ? 140.77200 126.24300 84.49400  1.000 39.96060  ? 216 ASN A C   1 
ATOM   1362  O O   . ASN A 1 216 ? 140.23000 125.86500 83.45500  1.000 39.96060  ? 216 ASN A O   1 
ATOM   1363  C CB  . ASN A 1 216 ? 139.14400 125.29000 86.10700  1.000 39.96060  ? 216 ASN A CB  1 
ATOM   1364  C CG  . ASN A 1 216 ? 138.47700 124.17400 85.34700  1.000 39.96060  ? 216 ASN A CG  1 
ATOM   1365  O OD1 . ASN A 1 216 ? 138.99000 123.06400 85.27800  1.000 39.96060  ? 216 ASN A OD1 1 
ATOM   1366  N ND2 . ASN A 1 216 ? 137.33300 124.46800 84.75300  1.000 39.96060  ? 216 ASN A ND2 1 
ATOM   1367  N N   . TYR A 1 217 ? 141.47600 127.36400 84.55900  1.000 43.39270  ? 217 TYR A N   1 
ATOM   1368  C CA  . TYR A 1 217 ? 141.93300 128.03400 83.35600  1.000 43.39270  ? 217 TYR A CA  1 
ATOM   1369  C C   . TYR A 1 217 ? 143.28000 127.51800 82.89700  1.000 43.39270  ? 217 TYR A C   1 
ATOM   1370  O O   . TYR A 1 217 ? 143.57700 127.57900 81.70500  1.000 43.39270  ? 217 TYR A O   1 
ATOM   1371  C CB  . TYR A 1 217 ? 142.02300 129.54000 83.58500  1.000 43.39270  ? 217 TYR A CB  1 
ATOM   1372  C CG  . TYR A 1 217 ? 142.18600 130.34400 82.32700  1.000 43.39270  ? 217 TYR A CG  1 
ATOM   1373  C CD1 . TYR A 1 217 ? 141.09300 130.65600 81.53800  1.000 43.39270  ? 217 TYR A CD1 1 
ATOM   1374  C CD2 . TYR A 1 217 ? 143.43200 130.80000 81.93100  1.000 43.39270  ? 217 TYR A CD2 1 
ATOM   1375  C CE1 . TYR A 1 217 ? 141.23700 131.39900 80.38900  1.000 43.39270  ? 217 TYR A CE1 1 
ATOM   1376  C CE2 . TYR A 1 217 ? 143.58700 131.54100 80.78400  1.000 43.39270  ? 217 TYR A CE2 1 
ATOM   1377  C CZ  . TYR A 1 217 ? 142.48800 131.83800 80.01800  1.000 43.39270  ? 217 TYR A CZ  1 
ATOM   1378  O OH  . TYR A 1 217 ? 142.64600 132.58100 78.87400  1.000 43.39270  ? 217 TYR A OH  1 
ATOM   1379  N N   . LEU A 1 218 ? 144.09300 127.00400 83.81700  1.000 44.40839  ? 218 LEU A N   1 
ATOM   1380  C CA  . LEU A 1 218 ? 145.36500 126.40900 83.43900  1.000 44.40839  ? 218 LEU A CA  1 
ATOM   1381  C C   . LEU A 1 218 ? 145.17000 125.08600 82.71300  1.000 44.40839  ? 218 LEU A C   1 
ATOM   1382  O O   . LEU A 1 218 ? 146.00000 124.71200 81.88100  1.000 44.40839  ? 218 LEU A O   1 
ATOM   1383  C CB  . LEU A 1 218 ? 146.22700 126.20500 84.67700  1.000 44.40839  ? 218 LEU A CB  1 
ATOM   1384  C CG  . LEU A 1 218 ? 147.70900 126.01200 84.40300  1.000 44.40839  ? 218 LEU A CG  1 
ATOM   1385  C CD1 . LEU A 1 218 ? 148.38000 127.35800 84.25200  1.000 44.40839  ? 218 LEU A CD1 1 
ATOM   1386  C CD2 . LEU A 1 218 ? 148.35200 125.18700 85.49300  1.000 44.40839  ? 218 LEU A CD2 1 
ATOM   1387  N N   . ILE A 1 219 ? 144.09500 124.36000 83.01900  1.000 43.09673  ? 219 ILE A N   1 
ATOM   1388  C CA  . ILE A 1 219 ? 143.81500 123.12300 82.30000  1.000 43.09673  ? 219 ILE A CA  1 
ATOM   1389  C C   . ILE A 1 219 ? 143.36200 123.42600 80.87900  1.000 43.09673  ? 219 ILE A C   1 
ATOM   1390  O O   . ILE A 1 219 ? 143.65900 122.66800 79.95000  1.000 43.09673  ? 219 ILE A O   1 
ATOM   1391  C CB  . ILE A 1 219 ? 142.77100 122.28700 83.06300  1.000 43.09673  ? 219 ILE A CB  1 
ATOM   1392  C CG1 . ILE A 1 219 ? 143.13900 122.18500 84.53700  1.000 43.09673  ? 219 ILE A CG1 1 
ATOM   1393  C CG2 . ILE A 1 219 ? 142.67000 120.89500 82.48800  1.000 43.09673  ? 219 ILE A CG2 1 
ATOM   1394  C CD1 . ILE A 1 219 ? 144.39900 121.41300 84.80100  1.000 43.09673  ? 219 ILE A CD1 1 
ATOM   1395  N N   . ALA A 1 220 ? 142.66300 124.53800 80.67600  1.000 45.59016  ? 220 ALA A N   1 
ATOM   1396  C CA  . ALA A 1 220 ? 142.21300 124.91100 79.34300  1.000 45.59016  ? 220 ALA A CA  1 
ATOM   1397  C C   . ALA A 1 220 ? 143.29500 125.61300 78.53900  1.000 45.59016  ? 220 ALA A C   1 
ATOM   1398  O O   . ALA A 1 220 ? 143.40300 125.39700 77.33000  1.000 45.59016  ? 220 ALA A O   1 
ATOM   1399  C CB  . ALA A 1 220 ? 140.97900 125.80700 79.43300  1.000 45.59016  ? 220 ALA A CB  1 
ATOM   1400  N N   . ASP A 1 221 ? 144.10200 126.45400 79.18400  1.000 50.08875  ? 221 ASP A N   1 
ATOM   1401  C CA  . ASP A 1 221 ? 145.12100 127.20300 78.46100  1.000 50.08875  ? 221 ASP A CA  1 
ATOM   1402  C C   . ASP A 1 221 ? 146.31300 126.34500 78.07300  1.000 50.08875  ? 221 ASP A C   1 
ATOM   1403  O O   . ASP A 1 221 ? 147.01800 126.68500 77.12000  1.000 50.08875  ? 221 ASP A O   1 
ATOM   1404  C CB  . ASP A 1 221 ? 145.60500 128.38300 79.29900  1.000 50.08875  ? 221 ASP A CB  1 
ATOM   1405  C CG  . ASP A 1 221 ? 145.94900 129.58100 78.46300  1.000 50.08875  ? 221 ASP A CG  1 
ATOM   1406  O OD1 . ASP A 1 221 ? 146.00900 129.43700 77.22800  1.000 50.08875  ? 221 ASP A OD1 1 
ATOM   1407  O OD2 . ASP A 1 221 ? 146.16400 130.66700 79.03700  1.000 50.08875  ? 221 ASP A OD2 1 
ATOM   1408  N N   . ARG A 1 222 ? 146.55700 125.25100 78.78200  1.000 50.79569  ? 222 ARG A N   1 
ATOM   1409  C CA  . ARG A 1 222 ? 147.71200 124.39800 78.53900  1.000 50.79569  ? 222 ARG A CA  1 
ATOM   1410  C C   . ARG A 1 222 ? 147.29400 123.04200 77.99000  1.000 50.79569  ? 222 ARG A C   1 
ATOM   1411  O O   . ARG A 1 222 ? 147.82400 122.00500 78.38500  1.000 50.79569  ? 222 ARG A O   1 
ATOM   1412  C CB  . ARG A 1 222 ? 148.53400 124.22300 79.81000  1.000 50.79569  ? 222 ARG A CB  1 
ATOM   1413  C CG  . ARG A 1 222 ? 149.23300 125.48300 80.27200  1.000 50.79569  ? 222 ARG A CG  1 
ATOM   1414  C CD  . ARG A 1 222 ? 150.29400 125.17200 81.30800  1.000 50.79569  ? 222 ARG A CD  1 
ATOM   1415  N NE  . ARG A 1 222 ? 151.50600 124.62000 80.71000  1.000 50.79569  ? 222 ARG A NE  1 
ATOM   1416  C CZ  . ARG A 1 222 ? 151.84200 123.33500 80.74400  1.000 50.79569  ? 222 ARG A CZ  1 
ATOM   1417  N NH1 . ARG A 1 222 ? 151.05600 122.45400 81.34800  1.000 50.79569  ? 222 ARG A NH1 1 
ATOM   1418  N NH2 . ARG A 1 222 ? 152.96700 122.92900 80.17200  1.000 50.79569  ? 222 ARG A NH2 1 
ATOM   1419  N N   . TYR A 1 223 ? 146.32600 123.03500 77.08100  1.000 53.65893  ? 223 TYR A N   1 
ATOM   1420  C CA  . TYR A 1 223 ? 145.87400 121.79900 76.47200  1.000 53.65893  ? 223 TYR A CA  1 
ATOM   1421  C C   . TYR A 1 223 ? 146.42300 121.72500 75.05800  1.000 53.65893  ? 223 TYR A C   1 
ATOM   1422  O O   . TYR A 1 223 ? 146.16400 122.64100 74.26200  1.000 53.65893  ? 223 TYR A O   1 
ATOM   1423  C CB  . TYR A 1 223 ? 144.35300 121.72800 76.46900  1.000 53.65893  ? 223 TYR A CB  1 
ATOM   1424  C CG  . TYR A 1 223 ? 143.80600 120.35700 76.17800  1.000 53.65893  ? 223 TYR A CG  1 
ATOM   1425  C CD1 . TYR A 1 223 ? 144.22300 119.26100 76.91100  1.000 53.65893  ? 223 TYR A CD1 1 
ATOM   1426  C CD2 . TYR A 1 223 ? 142.84200 120.16400 75.20500  1.000 53.65893  ? 223 TYR A CD2 1 
ATOM   1427  C CE1 . TYR A 1 223 ? 143.73000 118.00300 76.65600  1.000 53.65893  ? 223 TYR A CE1 1 
ATOM   1428  C CE2 . TYR A 1 223 ? 142.33200 118.90900 74.95200  1.000 53.65893  ? 223 TYR A CE2 1 
ATOM   1429  C CZ  . TYR A 1 223 ? 142.78400 117.83400 75.67800  1.000 53.65893  ? 223 TYR A CZ  1 
ATOM   1430  O OH  . TYR A 1 223 ? 142.28900 116.57900 75.43200  1.000 53.65893  ? 223 TYR A OH  1 
ATOM   1431  N N   . PRO A 1 224 ? 147.19100 120.68300 74.70900  1.000 59.05274  ? 224 PRO A N   1 
ATOM   1432  C CA  . PRO A 1 224 ? 147.90300 120.69600 73.41800  1.000 59.05274  ? 224 PRO A CA  1 
ATOM   1433  C C   . PRO A 1 224 ? 146.99100 120.51800 72.22400  1.000 59.05274  ? 224 PRO A C   1 
ATOM   1434  O O   . PRO A 1 224 ? 147.32500 120.95400 71.11700  1.000 59.05274  ? 224 PRO A O   1 
ATOM   1435  C CB  . PRO A 1 224 ? 148.88100 119.52300 73.55800  1.000 59.05274  ? 224 PRO A CB  1 
ATOM   1436  C CG  . PRO A 1 224 ? 148.19000 118.58900 74.49400  1.000 59.05274  ? 224 PRO A CG  1 
ATOM   1437  C CD  . PRO A 1 224 ? 147.49000 119.46900 75.48700  1.000 59.05274  ? 224 PRO A CD  1 
ATOM   1438  N N   . ASN A 1 225 ? 145.84500 119.89500 72.42400  1.000 59.75992  ? 225 ASN A N   1 
ATOM   1439  C CA  . ASN A 1 225 ? 144.84500 119.72900 71.38400  1.000 59.75992  ? 225 ASN A CA  1 
ATOM   1440  C C   . ASN A 1 225 ? 144.13500 121.06600 71.17400  1.000 59.75992  ? 225 ASN A C   1 
ATOM   1441  O O   . ASN A 1 225 ? 144.31900 121.98800 71.98000  1.000 59.75992  ? 225 ASN A O   1 
ATOM   1442  C CB  . ASN A 1 225 ? 143.88200 118.60600 71.78700  1.000 59.75992  ? 225 ASN A CB  1 
ATOM   1443  N N   . PRO A 1 226 ? 143.31200 121.23300 70.11600  1.000 61.01816  ? 226 PRO A N   1 
ATOM   1444  C CA  . PRO A 1 226 ? 142.57700 122.49800 69.96400  1.000 61.01816  ? 226 PRO A CA  1 
ATOM   1445  C C   . PRO A 1 226 ? 141.46900 122.69700 70.98400  1.000 61.01816  ? 226 PRO A C   1 
ATOM   1446  O O   . PRO A 1 226 ? 141.36900 121.96700 71.97400  1.000 61.01816  ? 226 PRO A O   1 
ATOM   1447  C CB  . PRO A 1 226 ? 142.00200 122.40100 68.54300  1.000 61.01816  ? 226 PRO A CB  1 
ATOM   1448  C CG  . PRO A 1 226 ? 142.04800 120.95500 68.21000  1.000 61.01816  ? 226 PRO A CG  1 
ATOM   1449  C CD  . PRO A 1 226 ? 143.30100 120.48300 68.84600  1.000 61.01816  ? 226 PRO A CD  1 
ATOM   1450  N N   . ARG A 1 227 ? 140.62800 123.70300 70.75100  1.000 57.81745  ? 227 ARG A N   1 
ATOM   1451  C CA  . ARG A 1 227 ? 139.61700 124.10700 71.71700  1.000 57.81745  ? 227 ARG A CA  1 
ATOM   1452  C C   . ARG A 1 227 ? 138.50900 123.06900 71.85200  1.000 57.81745  ? 227 ARG A C   1 
ATOM   1453  O O   . ARG A 1 227 ? 137.39200 123.25800 71.36200  1.000 57.81745  ? 227 ARG A O   1 
ATOM   1454  C CB  . ARG A 1 227 ? 139.02300 125.45500 71.31700  1.000 57.81745  ? 227 ARG A CB  1 
ATOM   1455  N N   . LYS A 1 228 ? 138.84000 121.96100 72.50800  1.000 51.34491  ? 228 LYS A N   1 
ATOM   1456  C CA  . LYS A 1 228 ? 137.89500 120.97500 73.01000  1.000 51.34491  ? 228 LYS A CA  1 
ATOM   1457  C C   . LYS A 1 228 ? 137.95700 120.95900 74.53000  1.000 51.34491  ? 228 LYS A C   1 
ATOM   1458  O O   . LYS A 1 228 ? 138.03000 119.90700 75.16000  1.000 51.34491  ? 228 LYS A O   1 
ATOM   1459  C CB  . LYS A 1 228 ? 138.18400 119.58900 72.44200  1.000 51.34491  ? 228 LYS A CB  1 
ATOM   1460  N N   . THR A 1 229 ? 137.99100 122.14500 75.11700  1.000 47.61406  ? 229 THR A N   1 
ATOM   1461  C CA  . THR A 1 229 ? 138.01700 122.36100 76.55100  1.000 47.61406  ? 229 THR A CA  1 
ATOM   1462  C C   . THR A 1 229 ? 136.66700 122.91200 77.00000  1.000 47.61406  ? 229 THR A C   1 
ATOM   1463  O O   . THR A 1 229 ? 135.72100 123.00300 76.21800  1.000 47.61406  ? 229 THR A O   1 
ATOM   1464  C CB  . THR A 1 229 ? 139.15600 123.30400 76.92000  1.000 47.61406  ? 229 THR A CB  1 
ATOM   1465  O OG1 . THR A 1 229 ? 138.96800 124.55200 76.25000  1.000 47.61406  ? 229 THR A OG1 1 
ATOM   1466  C CG2 . THR A 1 229 ? 140.47100 122.72100 76.48000  1.000 47.61406  ? 229 THR A CG2 1 
ATOM   1467  N N   . TRP A 1 230 ? 136.58300 123.28300 78.27800  1.000 41.66470  ? 230 TRP A N   1 
ATOM   1468  C CA  . TRP A 1 230 ? 135.31100 123.73700 78.82800  1.000 41.66470  ? 230 TRP A CA  1 
ATOM   1469  C C   . TRP A 1 230 ? 134.92600 125.11000 78.29500  1.000 41.66470  ? 230 TRP A C   1 
ATOM   1470  O O   . TRP A 1 230 ? 133.74000 125.39300 78.10300  1.000 41.66470  ? 230 TRP A O   1 
ATOM   1471  C CB  . TRP A 1 230 ? 135.36900 123.75200 80.35600  1.000 41.66470  ? 230 TRP A CB  1 
ATOM   1472  C CG  . TRP A 1 230 ? 136.37300 124.68800 80.93600  1.000 41.66470  ? 230 TRP A CG  1 
ATOM   1473  C CD1 . TRP A 1 230 ? 137.68200 124.43000 81.18100  1.000 41.66470  ? 230 TRP A CD1 1 
ATOM   1474  C CD2 . TRP A 1 230 ? 136.14400 126.03100 81.36100  1.000 41.66470  ? 230 TRP A CD2 1 
ATOM   1475  N NE1 . TRP A 1 230 ? 138.28900 125.52900 81.72400  1.000 41.66470  ? 230 TRP A NE1 1 
ATOM   1476  C CE2 . TRP A 1 230 ? 137.36200 126.52800 81.84300  1.000 41.66470  ? 230 TRP A CE2 1 
ATOM   1477  C CE3 . TRP A 1 230 ? 135.02800 126.86400 81.37300  1.000 41.66470  ? 230 TRP A CE3 1 
ATOM   1478  C CZ2 . TRP A 1 230 ? 137.49400 127.81600 82.33300  1.000 41.66470  ? 230 TRP A CZ2 1 
ATOM   1479  C CZ3 . TRP A 1 230 ? 135.16200 128.14100 81.85400  1.000 41.66470  ? 230 TRP A CZ3 1 
ATOM   1480  C CH2 . TRP A 1 230 ? 136.38300 128.60500 82.33000  1.000 41.66470  ? 230 TRP A CH2 1 
ATOM   1481  N N   . ILE A 1 231 ? 135.90900 125.96700 78.03400  1.000 46.07882  ? 231 ILE A N   1 
ATOM   1482  C CA  . ILE A 1 231 ? 135.64400 127.32800 77.58600  1.000 46.07882  ? 231 ILE A CA  1 
ATOM   1483  C C   . ILE A 1 231 ? 135.75700 127.35800 76.06900  1.000 46.07882  ? 231 ILE A C   1 
ATOM   1484  O O   . ILE A 1 231 ? 135.09300 128.15500 75.39700  1.000 46.07882  ? 231 ILE A O   1 
ATOM   1485  C CB  . ILE A 1 231 ? 136.59500 128.32500 78.28200  1.000 46.07882  ? 231 ILE A CB  1 
ATOM   1486  C CG1 . ILE A 1 231 ? 136.33000 129.76900 77.85900  1.000 46.07882  ? 231 ILE A CG1 1 
ATOM   1487  C CG2 . ILE A 1 231 ? 138.04200 127.94800 78.07400  1.000 46.07882  ? 231 ILE A CG2 1 
ATOM   1488  C CD1 . ILE A 1 231 ? 137.14400 130.77800 78.62100  1.000 46.07882  ? 231 ILE A CD1 1 
ATOM   1489  N N   . GLY A 1 232 ? 136.54800 126.44300 75.50900  1.000 49.58339  ? 232 GLY A N   1 
ATOM   1490  C CA  . GLY A 1 232 ? 136.73900 126.41200 74.07300  1.000 49.58339  ? 232 GLY A CA  1 
ATOM   1491  C C   . GLY A 1 232 ? 135.54800 125.89500 73.30000  1.000 49.58339  ? 232 GLY A C   1 
ATOM   1492  O O   . GLY A 1 232 ? 135.44900 126.14800 72.09700  1.000 49.58339  ? 232 GLY A O   1 
ATOM   1493  N N   . ALA A 1 233 ? 134.64200 125.18200 73.95700  1.000 51.89742  ? 233 ALA A N   1 
ATOM   1494  C CA  . ALA A 1 233 ? 133.47800 124.64000 73.27700  1.000 51.89742  ? 233 ALA A CA  1 
ATOM   1495  C C   . ALA A 1 233 ? 132.41200 125.68600 72.99500  1.000 51.89742  ? 233 ALA A C   1 
ATOM   1496  O O   . ALA A 1 233 ? 131.51000 125.42300 72.19600  1.000 51.89742  ? 233 ALA A O   1 
ATOM   1497  C CB  . ALA A 1 233 ? 132.87500 123.50400 74.10000  1.000 51.89742  ? 233 ALA A CB  1 
ATOM   1498  N N   . VAL A 1 234 ? 132.48300 126.85500 73.62600  1.000 52.51381  ? 234 VAL A N   1 
ATOM   1499  C CA  . VAL A 1 234 ? 131.50200 127.90900 73.39800  1.000 52.51381  ? 234 VAL A CA  1 
ATOM   1500  C C   . VAL A 1 234 ? 132.18800 129.16800 72.87000  1.000 52.51381  ? 234 VAL A C   1 
ATOM   1501  O O   . VAL A 1 234 ? 131.69400 129.80500 71.93400  1.000 52.51381  ? 234 VAL A O   1 
ATOM   1502  C CB  . VAL A 1 234 ? 130.66500 128.15300 74.67500  1.000 52.51381  ? 234 VAL A CB  1 
ATOM   1503  C CG1 . VAL A 1 234 ? 131.53500 128.33100 75.88800  1.000 52.51381  ? 234 VAL A CG1 1 
ATOM   1504  C CG2 . VAL A 1 234 ? 129.74900 129.35200 74.51200  1.000 52.51381  ? 234 VAL A CG2 1 
ATOM   1505  N N   . TYR A 1 235 ? 133.35100 129.51400 73.42200  1.000 54.27063  ? 235 TYR A N   1 
ATOM   1506  C CA  . TYR A 1 235 ? 134.18900 130.59400 72.90500  1.000 54.27063  ? 235 TYR A CA  1 
ATOM   1507  C C   . TYR A 1 235 ? 135.40800 129.92700 72.28800  1.000 54.27063  ? 235 TYR A C   1 
ATOM   1508  O O   . TYR A 1 235 ? 136.33500 129.53500 73.01000  1.000 54.27063  ? 235 TYR A O   1 
ATOM   1509  C CB  . TYR A 1 235 ? 134.58600 131.57400 74.00400  1.000 54.27063  ? 235 TYR A CB  1 
ATOM   1510  C CG  . TYR A 1 235 ? 133.41600 132.25800 74.66000  1.000 54.27063  ? 235 TYR A CG  1 
ATOM   1511  C CD1 . TYR A 1 235 ? 132.32900 132.68900 73.91300  1.000 54.27063  ? 235 TYR A CD1 1 
ATOM   1512  C CD2 . TYR A 1 235 ? 133.39400 132.46500 76.03000  1.000 54.27063  ? 235 TYR A CD2 1 
ATOM   1513  C CE1 . TYR A 1 235 ? 131.25400 133.31400 74.51400  1.000 54.27063  ? 235 TYR A CE1 1 
ATOM   1514  C CE2 . TYR A 1 235 ? 132.32600 133.08600 76.63900  1.000 54.27063  ? 235 TYR A CE2 1 
ATOM   1515  C CZ  . TYR A 1 235 ? 131.26000 133.50800 75.88000  1.000 54.27063  ? 235 TYR A CZ  1 
ATOM   1516  O OH  . TYR A 1 235 ? 130.19700 134.12700 76.49400  1.000 54.27063  ? 235 TYR A OH  1 
ATOM   1517  N N   . PRO A 1 236 ? 135.44600 129.76700 70.96300  1.000 54.23136  ? 236 PRO A N   1 
ATOM   1518  C CA  . PRO A 1 236 ? 136.44900 128.87700 70.36100  1.000 54.23136  ? 236 PRO A CA  1 
ATOM   1519  C C   . PRO A 1 236 ? 137.86600 129.41100 70.39000  1.000 54.23136  ? 236 PRO A C   1 
ATOM   1520  O O   . PRO A 1 236 ? 138.81200 128.61600 70.35600  1.000 54.23136  ? 236 PRO A O   1 
ATOM   1521  C CB  . PRO A 1 236 ? 135.94600 128.71500 68.92100  1.000 54.23136  ? 236 PRO A CB  1 
ATOM   1522  C CG  . PRO A 1 236 ? 134.52200 129.14300 68.95400  1.000 54.23136  ? 236 PRO A CG  1 
ATOM   1523  C CD  . PRO A 1 236 ? 134.46100 130.22000 69.97400  1.000 54.23136  ? 236 PRO A CD  1 
ATOM   1524  N N   . ASN A 1 237 ? 138.05700 130.72600 70.44600  1.000 57.91599  ? 237 ASN A N   1 
ATOM   1525  C CA  . ASN A 1 237 ? 139.40500 131.28200 70.45200  1.000 57.91599  ? 237 ASN A CA  1 
ATOM   1526  C C   . ASN A 1 237 ? 139.91100 131.58200 71.86100  1.000 57.91599  ? 237 ASN A C   1 
ATOM   1527  O O   . ASN A 1 237 ? 140.92000 131.01100 72.28600  1.000 57.91599  ? 237 ASN A O   1 
ATOM   1528  C CB  . ASN A 1 237 ? 139.44300 132.53500 69.56700  1.000 57.91599  ? 237 ASN A CB  1 
ATOM   1529  C CG  . ASN A 1 237 ? 138.20800 133.39100 69.71800  1.000 57.91599  ? 237 ASN A CG  1 
ATOM   1530  O OD1 . ASN A 1 237 ? 137.35600 133.12400 70.56300  1.000 57.91599  ? 237 ASN A OD1 1 
ATOM   1531  N ND2 . ASN A 1 237 ? 138.09800 134.42300 68.89200  1.000 57.91599  ? 237 ASN A ND2 1 
ATOM   1532  N N   . PHE A 1 238 ? 139.26100 132.51700 72.56600  1.000 55.73591  ? 238 PHE A N   1 
ATOM   1533  C CA  . PHE A 1 238 ? 139.44800 132.91900 73.96800  1.000 55.73591  ? 238 PHE A CA  1 
ATOM   1534  C C   . PHE A 1 238 ? 140.88800 133.22600 74.39100  1.000 55.73591  ? 238 PHE A C   1 
ATOM   1535  O O   . PHE A 1 238 ? 141.14800 133.41900 75.58100  1.000 55.73591  ? 238 PHE A O   1 
ATOM   1536  C CB  . PHE A 1 238 ? 138.79200 131.89400 74.93300  1.000 55.73591  ? 238 PHE A CB  1 
ATOM   1537  C CG  . PHE A 1 238 ? 139.53900 130.57700 75.13100  1.000 55.73591  ? 238 PHE A CG  1 
ATOM   1538  C CD1 . PHE A 1 238 ? 140.49300 130.42700 76.13100  1.000 55.73591  ? 238 PHE A CD1 1 
ATOM   1539  C CD2 . PHE A 1 238 ? 139.18600 129.45600 74.40600  1.000 55.73591  ? 238 PHE A CD2 1 
ATOM   1540  C CE1 . PHE A 1 238 ? 141.14200 129.23100 76.32400  1.000 55.73591  ? 238 PHE A CE1 1 
ATOM   1541  C CE2 . PHE A 1 238 ? 139.83000 128.25300 74.60200  1.000 55.73591  ? 238 PHE A CE2 1 
ATOM   1542  C CZ  . PHE A 1 238 ? 140.80500 128.14300 75.56300  1.000 55.73591  ? 238 PHE A CZ  1 
ATOM   1543  N N   . LYS A 1 239 ? 141.81000 133.35400 73.44400  1.000 61.73368  ? 239 LYS A N   1 
ATOM   1544  C CA  . LYS A 1 239 ? 143.22700 133.52300 73.72400  1.000 61.73368  ? 239 LYS A CA  1 
ATOM   1545  C C   . LYS A 1 239 ? 143.76300 134.64400 72.85300  1.000 61.73368  ? 239 LYS A C   1 
ATOM   1546  O O   . LYS A 1 239 ? 143.42500 134.72900 71.66700  1.000 61.73368  ? 239 LYS A O   1 
ATOM   1547  C CB  . LYS A 1 239 ? 144.01700 132.24100 73.45900  1.000 61.73368  ? 239 LYS A CB  1 
ATOM   1548  C CG  . LYS A 1 239 ? 143.64100 131.08000 74.34100  1.000 61.73368  ? 239 LYS A CG  1 
ATOM   1549  C CD  . LYS A 1 239 ? 144.06300 129.76500 73.72600  1.000 61.73368  ? 239 LYS A CD  1 
ATOM   1550  C CE  . LYS A 1 239 ? 145.53400 129.50500 73.94200  1.000 61.73368  ? 239 LYS A CE  1 
ATOM   1551  N NZ  . LYS A 1 239 ? 145.80900 128.04900 74.03200  1.000 61.73368  ? 239 LYS A NZ  1 
ATOM   1552  N N   . GLU A 1 240 ? 144.57400 135.51400 73.46900  1.000 68.29781  ? 240 GLU A N   1 
ATOM   1553  C CA  . GLU A 1 240 ? 145.05600 136.77500 72.88200  1.000 68.29781  ? 240 GLU A CA  1 
ATOM   1554  C C   . GLU A 1 240 ? 143.89600 137.65700 72.42200  1.000 68.29781  ? 240 GLU A C   1 
ATOM   1555  O O   . GLU A 1 240 ? 144.02800 138.44900 71.48500  1.000 68.29781  ? 240 GLU A O   1 
ATOM   1556  C CB  . GLU A 1 240 ? 146.04900 136.53200 71.73600  1.000 68.29781  ? 240 GLU A CB  1 
ATOM   1557  N N   . ALA A 1 241 ? 142.76400 137.53300 73.10900  1.000 66.25082  ? 241 ALA A N   1 
ATOM   1558  C CA  . ALA A 1 241 ? 141.53200 138.21400 72.76700  1.000 66.25082  ? 241 ALA A CA  1 
ATOM   1559  C C   . ALA A 1 241 ? 140.62100 138.15500 73.98400  1.000 66.25082  ? 241 ALA A C   1 
ATOM   1560  O O   . ALA A 1 241 ? 141.00900 137.65500 75.04400  1.000 66.25082  ? 241 ALA A O   1 
ATOM   1561  C CB  . ALA A 1 241 ? 140.87500 137.57900 71.53500  1.000 66.25082  ? 241 ALA A CB  1 
ATOM   1562  N N   . SER A 1 242 ? 139.39400 138.64900 73.80700  1.000 66.36498  ? 242 SER A N   1 
ATOM   1563  C CA  . SER A 1 242 ? 138.29400 138.58400 74.78100  1.000 66.36498  ? 242 SER A CA  1 
ATOM   1564  C C   . SER A 1 242 ? 138.65100 139.19400 76.13700  1.000 66.36498  ? 242 SER A C   1 
ATOM   1565  O O   . SER A 1 242 ? 138.11500 138.76900 77.16300  1.000 66.36498  ? 242 SER A O   1 
ATOM   1566  C CB  . SER A 1 242 ? 137.76300 137.15400 74.96200  1.000 66.36498  ? 242 SER A CB  1 
ATOM   1567  O OG  . SER A 1 242 ? 138.75900 136.20200 75.29000  1.000 66.36498  ? 242 SER A OG  1 
ATOM   1568  N N   . LEU A 1 243 ? 139.54100 140.19600 76.13200  1.000 61.95192  ? 243 LEU A N   1 
ATOM   1569  C CA  . LEU A 1 243 ? 139.77500 141.11300 77.25500  1.000 61.95192  ? 243 LEU A CA  1 
ATOM   1570  C C   . LEU A 1 243 ? 140.25000 140.36900 78.50900  1.000 61.95192  ? 243 LEU A C   1 
ATOM   1571  O O   . LEU A 1 243 ? 139.49700 140.14600 79.45700  1.000 61.95192  ? 243 LEU A O   1 
ATOM   1572  C CB  . LEU A 1 243 ? 138.52500 141.96500 77.52500  1.000 61.95192  ? 243 LEU A CB  1 
ATOM   1573  C CG  . LEU A 1 243 ? 138.55400 143.09800 78.56000  1.000 61.95192  ? 243 LEU A CG  1 
ATOM   1574  C CD1 . LEU A 1 243 ? 139.82700 143.91700 78.41000  1.000 61.95192  ? 243 LEU A CD1 1 
ATOM   1575  C CD2 . LEU A 1 243 ? 137.31900 143.98400 78.44300  1.000 61.95192  ? 243 LEU A CD2 1 
ATOM   1576  N N   . TRP A 1 244 ? 141.50200 139.90700 78.45000  1.000 63.28198  ? 244 TRP A N   1 
ATOM   1577  C CA  . TRP A 1 244 ? 142.18500 139.13900 79.49700  1.000 63.28198  ? 244 TRP A CA  1 
ATOM   1578  C C   . TRP A 1 244 ? 142.07200 139.65900 80.93000  1.000 63.28198  ? 244 TRP A C   1 
ATOM   1579  O O   . TRP A 1 244 ? 142.21700 138.88500 81.87800  1.000 63.28198  ? 244 TRP A O   1 
ATOM   1580  C CB  . TRP A 1 244 ? 143.66800 139.02900 79.15100  1.000 63.28198  ? 244 TRP A CB  1 
ATOM   1581  C CG  . TRP A 1 244 ? 144.05300 137.75100 78.49100  1.000 63.28198  ? 244 TRP A CG  1 
ATOM   1582  C CD1 . TRP A 1 244 ? 143.37900 136.56600 78.53200  1.000 63.28198  ? 244 TRP A CD1 1 
ATOM   1583  C CD2 . TRP A 1 244 ? 145.20800 137.53100 77.68000  1.000 63.28198  ? 244 TRP A CD2 1 
ATOM   1584  N NE1 . TRP A 1 244 ? 144.05200 135.61800 77.80500  1.000 63.28198  ? 244 TRP A NE1 1 
ATOM   1585  C CE2 . TRP A 1 244 ? 145.17800 136.18700 77.26700  1.000 63.28198  ? 244 TRP A CE2 1 
ATOM   1586  C CE3 . TRP A 1 244 ? 146.26900 138.34300 77.26300  1.000 63.28198  ? 244 TRP A CE3 1 
ATOM   1587  C CZ2 . TRP A 1 244 ? 146.16800 135.63400 76.45500  1.000 63.28198  ? 244 TRP A CZ2 1 
ATOM   1588  C CZ3 . TRP A 1 244 ? 147.24900 137.79400 76.46000  1.000 63.28198  ? 244 TRP A CZ3 1 
ATOM   1589  C CH2 . TRP A 1 244 ? 147.19200 136.45300 76.06300  1.000 63.28198  ? 244 TRP A CH2 1 
ATOM   1590  N N   . ASN A 1 245 ? 141.82100 140.95400 81.11200  1.000 60.83082  ? 245 ASN A N   1 
ATOM   1591  C CA  . ASN A 1 245 ? 141.62800 141.49000 82.45400  1.000 60.83082  ? 245 ASN A CA  1 
ATOM   1592  C C   . ASN A 1 245 ? 140.19900 141.21500 82.91500  1.000 60.83082  ? 245 ASN A C   1 
ATOM   1593  O O   . ASN A 1 245 ? 139.85900 141.45300 84.07700  1.000 60.83082  ? 245 ASN A O   1 
ATOM   1594  C CB  . ASN A 1 245 ? 141.93900 142.99400 82.48600  1.000 60.83082  ? 245 ASN A CB  1 
ATOM   1595  C CG  . ASN A 1 245 ? 142.22900 143.51600 83.89500  1.000 60.83082  ? 245 ASN A CG  1 
ATOM   1596  O OD1 . ASN A 1 245 ? 142.25600 142.75800 84.86600  1.000 60.83082  ? 245 ASN A OD1 1 
ATOM   1597  N ND2 . ASN A 1 245 ? 142.44900 144.82100 84.00300  1.000 60.83082  ? 245 ASN A ND2 1 
ATOM   1598  N N   . ARG A 1 246 ? 139.35400 140.70400 82.02500  1.000 51.13969  ? 246 ARG A N   1 
ATOM   1599  C CA  . ARG A 1 246 ? 138.02000 140.25300 82.40200  1.000 51.13969  ? 246 ARG A CA  1 
ATOM   1600  C C   . ARG A 1 246 ? 138.00100 138.73600 82.27400  1.000 51.13969  ? 246 ARG A C   1 
ATOM   1601  O O   . ARG A 1 246 ? 137.65000 138.17600 81.23300  1.000 51.13969  ? 246 ARG A O   1 
ATOM   1602  C CB  . ARG A 1 246 ? 136.95500 140.91200 81.57400  1.000 51.13969  ? 246 ARG A CB  1 
ATOM   1603  C CG  . ARG A 1 246 ? 136.82000 142.40700 81.83700  1.000 51.13969  ? 246 ARG A CG  1 
ATOM   1604  C CD  . ARG A 1 246 ? 136.88500 142.74300 83.31900  1.000 51.13969  ? 246 ARG A CD  1 
ATOM   1605  N NE  . ARG A 1 246 ? 135.59000 142.64300 83.97600  1.000 51.13969  ? 246 ARG A NE  1 
ATOM   1606  C CZ  . ARG A 1 246 ? 135.43200 142.55600 85.29100  1.000 51.13969  ? 246 ARG A CZ  1 
ATOM   1607  N NH1 . ARG A 1 246 ? 136.48500 142.54900 86.09300  1.000 51.13969  ? 246 ARG A NH1 1 
ATOM   1608  N NH2 . ARG A 1 246 ? 134.21700 142.46900 85.80500  1.000 51.13969  ? 246 ARG A NH2 1 
ATOM   1609  N N   . TYR A 1 247 ? 138.39000 138.08000 83.36900  1.000 42.94903  ? 247 TYR A N   1 
ATOM   1610  C CA  . TYR A 1 247 ? 138.36600 136.63500 83.55200  1.000 42.94903  ? 247 TYR A CA  1 
ATOM   1611  C C   . TYR A 1 247 ? 137.09300 136.17000 84.24100  1.000 42.94903  ? 247 TYR A C   1 
ATOM   1612  O O   . TYR A 1 247 ? 137.09500 135.12400 84.89600  1.000 42.94903  ? 247 TYR A O   1 
ATOM   1613  C CB  . TYR A 1 247 ? 139.60200 136.19400 84.34100  1.000 42.94903  ? 247 TYR A CB  1 
ATOM   1614  C CG  . TYR A 1 247 ? 139.61300 136.50900 85.82500  1.000 42.94903  ? 247 TYR A CG  1 
ATOM   1615  C CD1 . TYR A 1 247 ? 139.64400 137.81500 86.28900  1.000 42.94903  ? 247 TYR A CD1 1 
ATOM   1616  C CD2 . TYR A 1 247 ? 139.67100 135.49100 86.75700  1.000 42.94903  ? 247 TYR A CD2 1 
ATOM   1617  C CE1 . TYR A 1 247 ? 139.66600 138.08900 87.63400  1.000 42.94903  ? 247 TYR A CE1 1 
ATOM   1618  C CE2 . TYR A 1 247 ? 139.71500 135.76200 88.10000  1.000 42.94903  ? 247 TYR A CE2 1 
ATOM   1619  C CZ  . TYR A 1 247 ? 139.70200 137.05600 88.53100  1.000 42.94903  ? 247 TYR A CZ  1 
ATOM   1620  O OH  . TYR A 1 247 ? 139.73600 137.31400 89.87200  1.000 42.94903  ? 247 TYR A OH  1 
ATOM   1621  N N   . VAL A 1 248 ? 136.00000 136.91600 84.06500  1.000 37.95344  ? 248 VAL A N   1 
ATOM   1622  C CA  . VAL A 1 248 ? 134.71800 136.64800 84.70600  1.000 37.95344  ? 248 VAL A CA  1 
ATOM   1623  C C   . VAL A 1 248 ? 134.14600 135.30800 84.27600  1.000 37.95344  ? 248 VAL A C   1 
ATOM   1624  O O   . VAL A 1 248 ? 133.37300 134.69000 85.01300  1.000 37.95344  ? 248 VAL A O   1 
ATOM   1625  C CB  . VAL A 1 248 ? 133.75200 137.80300 84.38500  1.000 37.95344  ? 248 VAL A CB  1 
ATOM   1626  C CG1 . VAL A 1 248 ? 132.58700 137.81400 85.32500  1.000 37.95344  ? 248 VAL A CG1 1 
ATOM   1627  C CG2 . VAL A 1 248 ? 134.48100 139.10800 84.46400  1.000 37.95344  ? 248 VAL A CG2 1 
ATOM   1628  N N   . THR A 1 249 ? 134.52000 134.83400 83.08700  1.000 37.08307  ? 249 THR A N   1 
ATOM   1629  C CA  . THR A 1 249 ? 134.06900 133.53300 82.60800  1.000 37.08307  ? 249 THR A CA  1 
ATOM   1630  C C   . THR A 1 249 ? 134.61700 132.40500 83.47300  1.000 37.08307  ? 249 THR A C   1 
ATOM   1631  O O   . THR A 1 249 ? 133.92400 131.41400 83.72300  1.000 37.08307  ? 249 THR A O   1 
ATOM   1632  C CB  . THR A 1 249 ? 134.49400 133.35400 81.15300  1.000 37.08307  ? 249 THR A CB  1 
ATOM   1633  O OG1 . THR A 1 249 ? 134.05400 134.48100 80.39100  1.000 37.08307  ? 249 THR A OG1 1 
ATOM   1634  C CG2 . THR A 1 249 ? 133.87400 132.11900 80.55900  1.000 37.08307  ? 249 THR A CG2 1 
ATOM   1635  N N   . ALA A 1 250 ? 135.84500 132.55300 83.97000  1.000 34.62828  ? 250 ALA A N   1 
ATOM   1636  C CA  . ALA A 1 250 ? 136.43800 131.50200 84.78700  1.000 34.62828  ? 250 ALA A CA  1 
ATOM   1637  C C   . ALA A 1 250 ? 135.87300 131.49800 86.19800  1.000 34.62828  ? 250 ALA A C   1 
ATOM   1638  O O   . ALA A 1 250 ? 135.83500 130.44700 86.84000  1.000 34.62828  ? 250 ALA A O   1 
ATOM   1639  C CB  . ALA A 1 250 ? 137.95100 131.65800 84.82400  1.000 34.62828  ? 250 ALA A CB  1 
ATOM   1640  N N   . LEU A 1 251 ? 135.44300 132.65300 86.70100  1.000 32.28623  ? 251 LEU A N   1 
ATOM   1641  C CA  . LEU A 1 251 ? 134.73800 132.69500 87.97600  1.000 32.28623  ? 251 LEU A CA  1 
ATOM   1642  C C   . LEU A 1 251 ? 133.27600 132.30900 87.84100  1.000 32.28623  ? 251 LEU A C   1 
ATOM   1643  O O   . LEU A 1 251 ? 132.69200 131.78900 88.79300  1.000 32.28623  ? 251 LEU A O   1 
ATOM   1644  C CB  . LEU A 1 251 ? 134.85700 134.07700 88.61000  1.000 32.28623  ? 251 LEU A CB  1 
ATOM   1645  C CG  . LEU A 1 251 ? 135.81500 134.20100 89.78400  1.000 32.28623  ? 251 LEU A CG  1 
ATOM   1646  C CD1 . LEU A 1 251 ? 137.17800 133.72300 89.43300  1.000 32.28623  ? 251 LEU A CD1 1 
ATOM   1647  C CD2 . LEU A 1 251 ? 135.87700 135.64300 90.19300  1.000 32.28623  ? 251 LEU A CD2 1 
ATOM   1648  N N   . TYR A 1 252 ? 132.66600 132.55900 86.68300  1.000 32.94042  ? 252 TYR A N   1 
ATOM   1649  C CA  . TYR A 1 252 ? 131.28300 132.14700 86.47800  1.000 32.94042  ? 252 TYR A CA  1 
ATOM   1650  C C   . TYR A 1 252 ? 131.16900 130.63400 86.42800  1.000 32.94042  ? 252 TYR A C   1 
ATOM   1651  O O   . TYR A 1 252 ? 130.15000 130.07000 86.83400  1.000 32.94042  ? 252 TYR A O   1 
ATOM   1652  C CB  . TYR A 1 252 ? 130.73900 132.77200 85.20100  1.000 32.94042  ? 252 TYR A CB  1 
ATOM   1653  C CG  . TYR A 1 252 ? 129.36500 132.31500 84.79400  1.000 32.94042  ? 252 TYR A CG  1 
ATOM   1654  C CD1 . TYR A 1 252 ? 128.24100 132.79300 85.43700  1.000 32.94042  ? 252 TYR A CD1 1 
ATOM   1655  C CD2 . TYR A 1 252 ? 129.19100 131.42300 83.74300  1.000 32.94042  ? 252 TYR A CD2 1 
ATOM   1656  C CE1 . TYR A 1 252 ? 126.99000 132.38800 85.06000  1.000 32.94042  ? 252 TYR A CE1 1 
ATOM   1657  C CE2 . TYR A 1 252 ? 127.94200 131.01200 83.36400  1.000 32.94042  ? 252 TYR A CE2 1 
ATOM   1658  C CZ  . TYR A 1 252 ? 126.84900 131.50000 84.02500  1.000 32.94042  ? 252 TYR A CZ  1 
ATOM   1659  O OH  . TYR A 1 252 ? 125.59800 131.09800 83.64800  1.000 32.94042  ? 252 TYR A OH  1 
ATOM   1660  N N   . TRP A 1 253 ? 132.20600 129.95600 85.94000  1.000 32.32512  ? 253 TRP A N   1 
ATOM   1661  C CA  . TRP A 1 253 ? 132.20700 128.50200 85.99800  1.000 32.32512  ? 253 TRP A CA  1 
ATOM   1662  C C   . TRP A 1 253 ? 132.35800 128.00900 87.42900  1.000 32.32512  ? 253 TRP A C   1 
ATOM   1663  O O   . TRP A 1 253 ? 131.71200 127.03500 87.81700  1.000 32.32512  ? 253 TRP A O   1 
ATOM   1664  C CB  . TRP A 1 253 ? 133.31700 127.92900 85.12500  1.000 32.32512  ? 253 TRP A CB  1 
ATOM   1665  C CG  . TRP A 1 253 ? 133.41900 126.44700 85.24600  1.000 32.32512  ? 253 TRP A CG  1 
ATOM   1666  C CD1 . TRP A 1 253 ? 132.68800 125.52200 84.57200  1.000 32.32512  ? 253 TRP A CD1 1 
ATOM   1667  C CD2 . TRP A 1 253 ? 134.29000 125.71500 86.11200  1.000 32.32512  ? 253 TRP A CD2 1 
ATOM   1668  N NE1 . TRP A 1 253 ? 133.05100 124.25900 84.95600  1.000 32.32512  ? 253 TRP A NE1 1 
ATOM   1669  C CE2 . TRP A 1 253 ? 134.03000 124.35100 85.90700  1.000 32.32512  ? 253 TRP A CE2 1 
ATOM   1670  C CE3 . TRP A 1 253 ? 135.25600 126.08200 87.05100  1.000 32.32512  ? 253 TRP A CE3 1 
ATOM   1671  C CZ2 . TRP A 1 253 ? 134.70600 123.35400 86.60000  1.000 32.32512  ? 253 TRP A CZ2 1 
ATOM   1672  C CZ3 . TRP A 1 253 ? 135.92300 125.09200 87.73600  1.000 32.32512  ? 253 TRP A CZ3 1 
ATOM   1673  C CH2 . TRP A 1 253 ? 135.64600 123.74600 87.51100  1.000 32.32512  ? 253 TRP A CH2 1 
ATOM   1674  N N   . SER A 1 254 ? 133.20200 128.66000 88.23000  1.000 29.17085  ? 254 SER A N   1 
ATOM   1675  C CA  . SER A 1 254 ? 133.49700 128.14400 89.56300  1.000 29.17085  ? 254 SER A CA  1 
ATOM   1676  C C   . SER A 1 254 ? 132.34600 128.37400 90.52600  1.000 29.17085  ? 254 SER A C   1 
ATOM   1677  O O   . SER A 1 254 ? 132.07400 127.53400 91.38400  1.000 29.17085  ? 254 SER A O   1 
ATOM   1678  C CB  . SER A 1 254 ? 134.76800 128.77300 90.10600  1.000 29.17085  ? 254 SER A CB  1 
ATOM   1679  O OG  . SER A 1 254 ? 135.89000 128.05400 89.65300  1.000 29.17085  ? 254 SER A OG  1 
ATOM   1680  N N   . ILE A 1 255 ? 131.65700 129.50900 90.40800  1.000 28.40537  ? 255 ILE A N   1 
ATOM   1681  C CA  . ILE A 1 255 ? 130.50500 129.75400 91.26300  1.000 28.40537  ? 255 ILE A CA  1 
ATOM   1682  C C   . ILE A 1 255 ? 129.32600 128.86600 90.87000  1.000 28.40537  ? 255 ILE A C   1 
ATOM   1683  O O   . ILE A 1 255 ? 128.46700 128.57900 91.70400  1.000 28.40537  ? 255 ILE A O   1 
ATOM   1684  C CB  . ILE A 1 255 ? 130.16800 131.26100 91.23800  1.000 28.40537  ? 255 ILE A CB  1 
ATOM   1685  C CG1 . ILE A 1 255 ? 129.16100 131.64800 92.31300  1.000 28.40537  ? 255 ILE A CG1 1 
ATOM   1686  C CG2 . ILE A 1 255 ? 129.59500 131.67200 89.91900  1.000 28.40537  ? 255 ILE A CG2 1 
ATOM   1687  C CD1 . ILE A 1 255 ? 129.64200 131.48700 93.69500  1.000 28.40537  ? 255 ILE A CD1 1 
ATOM   1688  N N   . THR A 1 256 ? 129.29000 128.36200 89.63800  1.000 29.87905  ? 256 THR A N   1 
ATOM   1689  C CA  . THR A 1 256 ? 128.17200 127.53300 89.20500  1.000 29.87905  ? 256 THR A CA  1 
ATOM   1690  C C   . THR A 1 256 ? 128.26300 126.11400 89.74600  1.000 29.87905  ? 256 THR A C   1 
ATOM   1691  O O   . THR A 1 256 ? 127.23200 125.47800 89.98200  1.000 29.87905  ? 256 THR A O   1 
ATOM   1692  C CB  . THR A 1 256 ? 128.10800 127.52200 87.68100  1.000 29.87905  ? 256 THR A CB  1 
ATOM   1693  O OG1 . THR A 1 256 ? 128.27400 128.85600 87.20300  1.000 29.87905  ? 256 THR A OG1 1 
ATOM   1694  C CG2 . THR A 1 256 ? 126.77800 127.03100 87.20000  1.000 29.87905  ? 256 THR A CG2 1 
ATOM   1695  N N   . THR A 1 257 ? 129.46700 125.60200 89.97500  1.000 28.93191  ? 257 THR A N   1 
ATOM   1696  C CA  . THR A 1 257 ? 129.61200 124.26600 90.52900  1.000 28.93191  ? 257 THR A CA  1 
ATOM   1697  C C   . THR A 1 257 ? 129.80300 124.25600 92.03600  1.000 28.93191  ? 257 THR A C   1 
ATOM   1698  O O   . THR A 1 257 ? 129.46500 123.25700 92.67500  1.000 28.93191  ? 257 THR A O   1 
ATOM   1699  C CB  . THR A 1 257 ? 130.79300 123.54300 89.88900  1.000 28.93191  ? 257 THR A CB  1 
ATOM   1700  O OG1 . THR A 1 257 ? 131.98700 123.90500 90.57800  1.000 28.93191  ? 257 THR A OG1 1 
ATOM   1701  C CG2 . THR A 1 257 ? 130.93400 123.95400 88.46400  1.000 28.93191  ? 257 THR A CG2 1 
ATOM   1702  N N   . LEU A 1 258 ? 130.34200 125.32900 92.61400  1.000 28.50932  ? 258 LEU A N   1 
ATOM   1703  C CA  . LEU A 1 258 ? 130.52100 125.38800 94.05900  1.000 28.50932  ? 258 LEU A CA  1 
ATOM   1704  C C   . LEU A 1 258 ? 129.19100 125.55800 94.77300  1.000 28.50932  ? 258 LEU A C   1 
ATOM   1705  O O   . LEU A 1 258 ? 128.99000 124.99800 95.85400  1.000 28.50932  ? 258 LEU A O   1 
ATOM   1706  C CB  . LEU A 1 258 ? 131.48100 126.52100 94.41800  1.000 28.50932  ? 258 LEU A CB  1 
ATOM   1707  C CG  . LEU A 1 258 ? 131.99500 126.72900 95.83700  1.000 28.50932  ? 258 LEU A CG  1 
ATOM   1708  C CD1 . LEU A 1 258 ? 133.42600 127.17900 95.74300  1.000 28.50932  ? 258 LEU A CD1 1 
ATOM   1709  C CD2 . LEU A 1 258 ? 131.19800 127.78800 96.55800  1.000 28.50932  ? 258 LEU A CD2 1 
ATOM   1710  N N   . THR A 1 259 ? 128.27500 126.32200 94.18800  1.000 27.07613  ? 259 THR A N   1 
ATOM   1711  C CA  . THR A 1 259 ? 126.92200 126.40100 94.71100  1.000 27.07613  ? 259 THR A CA  1 
ATOM   1712  C C   . THR A 1 259 ? 126.04700 125.27100 94.22700  1.000 27.07613  ? 259 THR A C   1 
ATOM   1713  O O   . THR A 1 259 ? 124.87800 125.22800 94.61500  1.000 27.07613  ? 259 THR A O   1 
ATOM   1714  C CB  . THR A 1 259 ? 126.28200 127.72200 94.32300  1.000 27.07613  ? 259 THR A CB  1 
ATOM   1715  O OG1 . THR A 1 259 ? 126.07300 127.74400 92.91200  1.000 27.07613  ? 259 THR A OG1 1 
ATOM   1716  C CG2 . THR A 1 259 ? 127.18000 128.85500 94.69900  1.000 27.07613  ? 259 THR A CG2 1 
ATOM   1717  N N   . THR A 1 260 ? 126.59900 124.37200 93.40700  1.000 27.28607  ? 260 THR A N   1 
ATOM   1718  C CA  . THR A 1 260 ? 125.91300 123.22300 92.80700  1.000 27.28607  ? 260 THR A CA  1 
ATOM   1719  C C   . THR A 1 260 ? 124.66400 123.63600 92.04400  1.000 27.28607  ? 260 THR A C   1 
ATOM   1720  O O   . THR A 1 260 ? 123.64300 122.94900 92.09100  1.000 27.28607  ? 260 THR A O   1 
ATOM   1721  C CB  . THR A 1 260 ? 125.56600 122.14400 93.83700  1.000 27.28607  ? 260 THR A CB  1 
ATOM   1722  O OG1 . THR A 1 260 ? 124.56900 122.63000 94.74000  1.000 27.28607  ? 260 THR A OG1 1 
ATOM   1723  C CG2 . THR A 1 260 ? 126.79500 121.74300 94.62200  1.000 27.28607  ? 260 THR A CG2 1 
ATOM   1724  N N   . THR A 1 261 ? 124.72100 124.76300 91.33700  1.000 27.18240  ? 261 THR A N   1 
ATOM   1725  C CA  . THR A 1 261 ? 123.60400 125.09300 90.46000  1.000 27.18240  ? 261 THR A CA  1 
ATOM   1726  C C   . THR A 1 261 ? 123.68800 124.24400 89.20200  1.000 27.18240  ? 261 THR A C   1 
ATOM   1727  O O   . THR A 1 261 ? 122.87200 123.34400 88.98800  1.000 27.18240  ? 261 THR A O   1 
ATOM   1728  C CB  . THR A 1 261 ? 123.61900 126.57900 90.10400  1.000 27.18240  ? 261 THR A CB  1 
ATOM   1729  O OG1 . THR A 1 261 ? 123.82500 127.35200 91.28600  1.000 27.18240  ? 261 THR A OG1 1 
ATOM   1730  C CG2 . THR A 1 261 ? 122.31400 126.97400 89.48700  1.000 27.18240  ? 261 THR A CG2 1 
ATOM   1731  N N   . GLY A 1 262 ? 124.68400 124.50800 88.36800  1.000 30.71371  ? 262 GLY A N   1 
ATOM   1732  C CA  . GLY A 1 262 ? 125.01100 123.61500 87.28400  1.000 30.71371  ? 262 GLY A CA  1 
ATOM   1733  C C   . GLY A 1 262 ? 124.14600 123.95300 86.09700  1.000 30.71371  ? 262 GLY A C   1 
ATOM   1734  O O   . GLY A 1 262 ? 122.98900 123.53100 86.05300  1.000 30.71371  ? 262 GLY A O   1 
ATOM   1735  N N   . TYR A 1 263 ? 124.67200 124.67200 85.11700  1.000 34.66415  ? 263 TYR A N   1 
ATOM   1736  C CA  . TYR A 1 263 ? 123.85100 124.94400 83.94800  1.000 34.66415  ? 263 TYR A CA  1 
ATOM   1737  C C   . TYR A 1 263 ? 124.15400 123.98300 82.81600  1.000 34.66415  ? 263 TYR A C   1 
ATOM   1738  O O   . TYR A 1 263 ? 123.25500 123.61900 82.05500  1.000 34.66415  ? 263 TYR A O   1 
ATOM   1739  C CB  . TYR A 1 263 ? 124.04900 126.37500 83.46600  1.000 34.66415  ? 263 TYR A CB  1 
ATOM   1740  C CG  . TYR A 1 263 ? 123.51900 127.42800 84.39500  1.000 34.66415  ? 263 TYR A CG  1 
ATOM   1741  C CD1 . TYR A 1 263 ? 122.17300 127.50200 84.70600  1.000 34.66415  ? 263 TYR A CD1 1 
ATOM   1742  C CD2 . TYR A 1 263 ? 124.36500 128.37200 84.92800  1.000 34.66415  ? 263 TYR A CD2 1 
ATOM   1743  C CE1 . TYR A 1 263 ? 121.69900 128.48100 85.54800  1.000 34.66415  ? 263 TYR A CE1 1 
ATOM   1744  C CE2 . TYR A 1 263 ? 123.90500 129.34200 85.76200  1.000 34.66415  ? 263 TYR A CE2 1 
ATOM   1745  C CZ  . TYR A 1 263 ? 122.57900 129.39700 86.06600  1.000 34.66415  ? 263 TYR A CZ  1 
ATOM   1746  O OH  . TYR A 1 263 ? 122.16000 130.38800 86.90300  1.000 34.66415  ? 263 TYR A OH  1 
ATOM   1747  N N   . GLY A 1 264 ? 125.40300 123.56300 82.69300  1.000 38.08091  ? 264 GLY A N   1 
ATOM   1748  C CA  . GLY A 1 264 ? 125.79500 122.65400 81.64600  1.000 38.08091  ? 264 GLY A CA  1 
ATOM   1749  C C   . GLY A 1 264 ? 126.28200 123.32500 80.39000  1.000 38.08091  ? 264 GLY A C   1 
ATOM   1750  O O   . GLY A 1 264 ? 126.60600 122.62600 79.42500  1.000 38.08091  ? 264 GLY A O   1 
ATOM   1751  N N   . ASP A 1 265 ? 126.32500 124.65600 80.36300  1.000 39.41884  ? 265 ASP A N   1 
ATOM   1752  C CA  . ASP A 1 265 ? 126.91300 125.35100 79.22700  1.000 39.41884  ? 265 ASP A CA  1 
ATOM   1753  C C   . ASP A 1 265 ? 128.43500 125.29800 79.28000  1.000 39.41884  ? 265 ASP A C   1 
ATOM   1754  O O   . ASP A 1 265 ? 129.09900 125.19700 78.24300  1.000 39.41884  ? 265 ASP A O   1 
ATOM   1755  C CB  . ASP A 1 265 ? 126.38900 126.78400 79.17300  1.000 39.41884  ? 265 ASP A CB  1 
ATOM   1756  C CG  . ASP A 1 265 ? 126.47300 127.48800 80.50300  1.000 39.41884  ? 265 ASP A CG  1 
ATOM   1757  O OD1 . ASP A 1 265 ? 126.88600 126.85100 81.48900  1.000 39.41884  ? 265 ASP A OD1 1 
ATOM   1758  O OD2 . ASP A 1 265 ? 126.10100 128.67500 80.57300  1.000 39.41884  ? 265 ASP A OD2 1 
ATOM   1759  N N   . PHE A 1 266 ? 129.00500 125.34800 80.48100  1.000 38.84172  ? 266 PHE A N   1 
ATOM   1760  C CA  . PHE A 1 266 ? 130.41600 125.05200 80.70100  1.000 38.84172  ? 266 PHE A CA  1 
ATOM   1761  C C   . PHE A 1 266 ? 130.50500 123.73700 81.46500  1.000 38.84172  ? 266 PHE A C   1 
ATOM   1762  O O   . PHE A 1 266 ? 130.12500 123.67200 82.63600  1.000 38.84172  ? 266 PHE A O   1 
ATOM   1763  C CB  . PHE A 1 266 ? 131.10800 126.15900 81.49000  1.000 38.84172  ? 266 PHE A CB  1 
ATOM   1764  C CG  . PHE A 1 266 ? 131.07500 127.50200 80.83500  1.000 38.84172  ? 266 PHE A CG  1 
ATOM   1765  C CD1 . PHE A 1 266 ? 132.03000 127.86100 79.91000  1.000 38.84172  ? 266 PHE A CD1 1 
ATOM   1766  C CD2 . PHE A 1 266 ? 130.11100 128.42300 81.17900  1.000 38.84172  ? 266 PHE A CD2 1 
ATOM   1767  C CE1 . PHE A 1 266 ? 132.01200 129.10500 79.33100  1.000 38.84172  ? 266 PHE A CE1 1 
ATOM   1768  C CE2 . PHE A 1 266 ? 130.08700 129.66800 80.59300  1.000 38.84172  ? 266 PHE A CE2 1 
ATOM   1769  C CZ  . PHE A 1 266 ? 131.03700 130.00300 79.66600  1.000 38.84172  ? 266 PHE A CZ  1 
ATOM   1770  N N   . HIS A 1 267 ? 131.00700 122.69300 80.81400  1.000 40.00564  ? 267 HIS A N   1 
ATOM   1771  C CA  . HIS A 1 267 ? 131.23600 121.42300 81.48400  1.000 40.00564  ? 267 HIS A CA  1 
ATOM   1772  C C   . HIS A 1 267 ? 132.53100 120.82000 80.96300  1.000 40.00564  ? 267 HIS A C   1 
ATOM   1773  O O   . HIS A 1 267 ? 133.15100 121.34000 80.03500  1.000 40.00564  ? 267 HIS A O   1 
ATOM   1774  C CB  . HIS A 1 267 ? 130.05500 120.46700 81.29400  1.000 40.00564  ? 267 HIS A CB  1 
ATOM   1775  C CG  . HIS A 1 267 ? 129.66300 120.25900 79.86700  1.000 40.00564  ? 267 HIS A CG  1 
ATOM   1776  N ND1 . HIS A 1 267 ? 128.54300 120.83600 79.31300  1.000 40.00564  ? 267 HIS A ND1 1 
ATOM   1777  C CD2 . HIS A 1 267 ? 130.23100 119.52300 78.88600  1.000 40.00564  ? 267 HIS A CD2 1 
ATOM   1778  C CE1 . HIS A 1 267 ? 128.44400 120.47400 78.04700  1.000 40.00564  ? 267 HIS A CE1 1 
ATOM   1779  N NE2 . HIS A 1 267 ? 129.45700 119.67700 77.76300  1.000 40.00564  ? 267 HIS A NE2 1 
ATOM   1780  N N   . ALA A 1 268 ? 132.94000 119.70900 81.56600  1.000 40.50238  ? 268 ALA A N   1 
ATOM   1781  C CA  . ALA A 1 268 ? 134.19200 119.06600 81.20300  1.000 40.50238  ? 268 ALA A CA  1 
ATOM   1782  C C   . ALA A 1 268 ? 134.06300 118.32300 79.88100  1.000 40.50238  ? 268 ALA A C   1 
ATOM   1783  O O   . ALA A 1 268 ? 133.07000 117.63600 79.63100  1.000 40.50238  ? 268 ALA A O   1 
ATOM   1784  C CB  . ALA A 1 268 ? 134.62500 118.09900 82.29900  1.000 40.50238  ? 268 ALA A CB  1 
ATOM   1785  N N   . GLU A 1 269 ? 135.08100 118.45700 79.03900  1.000 44.29702  ? 269 GLU A N   1 
ATOM   1786  C CA  . GLU A 1 269 ? 135.09500 117.83800 77.72100  1.000 44.29702  ? 269 GLU A CA  1 
ATOM   1787  C C   . GLU A 1 269 ? 136.18400 116.78900 77.57700  1.000 44.29702  ? 269 GLU A C   1 
ATOM   1788  O O   . GLU A 1 269 ? 135.90600 115.66900 77.14100  1.000 44.29702  ? 269 GLU A O   1 
ATOM   1789  C CB  . GLU A 1 269 ? 135.27900 118.91400 76.64700  1.000 44.29702  ? 269 GLU A CB  1 
ATOM   1790  C CG  . GLU A 1 269 ? 134.30300 120.07000 76.73300  1.000 44.29702  ? 269 GLU A CG  1 
ATOM   1791  C CD  . GLU A 1 269 ? 133.13400 119.93500 75.78600  1.000 44.29702  ? 269 GLU A CD  1 
ATOM   1792  O OE1 . GLU A 1 269 ? 133.26800 119.22900 74.76700  1.000 44.29702  ? 269 GLU A OE1 1 
ATOM   1793  O OE2 . GLU A 1 269 ? 132.08500 120.55200 76.04600  1.000 44.29702  ? 269 GLU A OE2 1 
ATOM   1794  N N   . ASN A 1 270 ? 137.40000 117.11900 77.92500  1.000 44.93679  ? 270 ASN A N   1 
ATOM   1795  C CA  . ASN A 1 270 ? 138.55600 116.24200 77.88900  1.000 44.93679  ? 270 ASN A CA  1 
ATOM   1796  C C   . ASN A 1 270 ? 138.72600 115.52300 79.22300  1.000 44.93679  ? 270 ASN A C   1 
ATOM   1797  O O   . ASN A 1 270 ? 138.21400 115.97700 80.24600  1.000 44.93679  ? 270 ASN A O   1 
ATOM   1798  C CB  . ASN A 1 270 ? 139.79700 117.06000 77.53600  1.000 44.93679  ? 270 ASN A CB  1 
ATOM   1799  C CG  . ASN A 1 270 ? 139.92000 118.31400 78.36300  1.000 44.93679  ? 270 ASN A CG  1 
ATOM   1800  O OD1 . ASN A 1 270 ? 139.10600 118.56800 79.23900  1.000 44.93679  ? 270 ASN A OD1 1 
ATOM   1801  N ND2 . ASN A 1 270 ? 140.93600 119.11400 78.08100  1.000 44.93679  ? 270 ASN A ND2 1 
ATOM   1802  N N   . PRO A 1 271 ? 139.42600 114.38300 79.25700  1.000 42.79326  ? 271 PRO A N   1 
ATOM   1803  C CA  . PRO A 1 271 ? 139.60400 113.66900 80.53200  1.000 42.79326  ? 271 PRO A CA  1 
ATOM   1804  C C   . PRO A 1 271 ? 140.57700 114.31600 81.50800  1.000 42.79326  ? 271 PRO A C   1 
ATOM   1805  O O   . PRO A 1 271 ? 140.80900 113.74400 82.57700  1.000 42.79326  ? 271 PRO A O   1 
ATOM   1806  C CB  . PRO A 1 271 ? 140.11900 112.29500 80.09100  1.000 42.79326  ? 271 PRO A CB  1 
ATOM   1807  C CG  . PRO A 1 271 ? 139.64000 112.14800 78.70600  1.000 42.79326  ? 271 PRO A CG  1 
ATOM   1808  C CD  . PRO A 1 271 ? 139.74700 113.51000 78.11700  1.000 42.79326  ? 271 PRO A CD  1 
ATOM   1809  N N   . ARG A 1 272 ? 141.17500 115.46100 81.18800  1.000 45.56946  ? 272 ARG A N   1 
ATOM   1810  C CA  . ARG A 1 272 ? 141.89700 116.23100 82.19100  1.000 45.56946  ? 272 ARG A CA  1 
ATOM   1811  C C   . ARG A 1 272 ? 140.95000 117.04300 83.05800  1.000 45.56946  ? 272 ARG A C   1 
ATOM   1812  O O   . ARG A 1 272 ? 141.19000 117.20300 84.25600  1.000 45.56946  ? 272 ARG A O   1 
ATOM   1813  C CB  . ARG A 1 272 ? 142.89900 117.17400 81.53100  1.000 45.56946  ? 272 ARG A CB  1 
ATOM   1814  C CG  . ARG A 1 272 ? 144.05300 116.49400 80.83800  1.000 45.56946  ? 272 ARG A CG  1 
ATOM   1815  C CD  . ARG A 1 272 ? 145.06600 117.52500 80.39500  1.000 45.56946  ? 272 ARG A CD  1 
ATOM   1816  N NE  . ARG A 1 272 ? 146.02700 116.98800 79.44100  1.000 45.56946  ? 272 ARG A NE  1 
ATOM   1817  C CZ  . ARG A 1 272 ? 147.05800 117.67500 78.96700  1.000 45.56946  ? 272 ARG A CZ  1 
ATOM   1818  N NH1 . ARG A 1 272 ? 147.25600 118.92300 79.36400  1.000 45.56946  ? 272 ARG A NH1 1 
ATOM   1819  N NH2 . ARG A 1 272 ? 147.89000 117.11900 78.10000  1.000 45.56946  ? 272 ARG A NH2 1 
ATOM   1820  N N   . GLU A 1 273 ? 139.87600 117.56700 82.47100  1.000 41.17479  ? 273 GLU A N   1 
ATOM   1821  C CA  . GLU A 1 273 ? 138.91700 118.33400 83.24900  1.000 41.17479  ? 273 GLU A CA  1 
ATOM   1822  C C   . GLU A 1 273 ? 137.92200 117.43400 83.95900  1.000 41.17479  ? 273 GLU A C   1 
ATOM   1823  O O   . GLU A 1 273 ? 137.24700 117.87700 84.89000  1.000 41.17479  ? 273 GLU A O   1 
ATOM   1824  C CB  . GLU A 1 273 ? 138.18200 119.32100 82.35500  1.000 41.17479  ? 273 GLU A CB  1 
ATOM   1825  C CG  . GLU A 1 273 ? 139.00900 120.51000 81.96900  1.000 41.17479  ? 273 GLU A CG  1 
ATOM   1826  C CD  . GLU A 1 273 ? 138.48200 121.20000 80.74200  1.000 41.17479  ? 273 GLU A CD  1 
ATOM   1827  O OE1 . GLU A 1 273 ? 137.29500 121.00700 80.41800  1.000 41.17479  ? 273 GLU A OE1 1 
ATOM   1828  O OE2 . GLU A 1 273 ? 139.25500 121.92600 80.09000  1.000 41.17479  ? 273 GLU A OE2 1 
ATOM   1829  N N   . MET A 1 274 ? 137.79800 116.18200 83.53100  1.000 37.85973  ? 274 MET A N   1 
ATOM   1830  C CA  . MET A 1 274 ? 136.96000 115.25500 84.27500  1.000 37.85973  ? 274 MET A CA  1 
ATOM   1831  C C   . MET A 1 274 ? 137.63400 114.83600 85.57200  1.000 37.85973  ? 274 MET A C   1 
ATOM   1832  O O   . MET A 1 274 ? 136.95700 114.53400 86.55600  1.000 37.85973  ? 274 MET A O   1 
ATOM   1833  C CB  . MET A 1 274 ? 136.62800 114.04000 83.41900  1.000 37.85973  ? 274 MET A CB  1 
ATOM   1834  C CG  . MET A 1 274 ? 135.50200 114.27800 82.45300  1.000 37.85973  ? 274 MET A CG  1 
ATOM   1835  S SD  . MET A 1 274 ? 135.08200 112.80700 81.52700  1.000 37.85973  ? 274 MET A SD  1 
ATOM   1836  C CE  . MET A 1 274 ? 133.82000 113.46600 80.45600  1.000 37.85973  ? 274 MET A CE  1 
ATOM   1837  N N   . LEU A 1 275 ? 138.96600 114.80200 85.59500  1.000 39.20174  ? 275 LEU A N   1 
ATOM   1838  C CA  . LEU A 1 275 ? 139.66500 114.54600 86.84900  1.000 39.20174  ? 275 LEU A CA  1 
ATOM   1839  C C   . LEU A 1 275 ? 139.59000 115.74500 87.77600  1.000 39.20174  ? 275 LEU A C   1 
ATOM   1840  O O   . LEU A 1 275 ? 139.46200 115.58900 88.99400  1.000 39.20174  ? 275 LEU A O   1 
ATOM   1841  C CB  . LEU A 1 275 ? 141.12200 114.18000 86.59900  1.000 39.20174  ? 275 LEU A CB  1 
ATOM   1842  C CG  . LEU A 1 275 ? 141.40600 112.74900 86.19700  1.000 39.20174  ? 275 LEU A CG  1 
ATOM   1843  C CD1 . LEU A 1 275 ? 142.86000 112.60700 85.82800  1.000 39.20174  ? 275 LEU A CD1 1 
ATOM   1844  C CD2 . LEU A 1 275 ? 141.08700 111.88100 87.38200  1.000 39.20174  ? 275 LEU A CD2 1 
ATOM   1845  N N   . PHE A 1 276 ? 139.69600 116.95200 87.22500  1.000 38.29507  ? 276 PHE A N   1 
ATOM   1846  C CA  . PHE A 1 276 ? 139.68600 118.12600 88.08500  1.000 38.29507  ? 276 PHE A CA  1 
ATOM   1847  C C   . PHE A 1 276 ? 138.29400 118.39000 88.63200  1.000 38.29507  ? 276 PHE A C   1 
ATOM   1848  O O   . PHE A 1 276 ? 138.14900 118.87100 89.75800  1.000 38.29507  ? 276 PHE A O   1 
ATOM   1849  C CB  . PHE A 1 276 ? 140.20300 119.35200 87.34300  1.000 38.29507  ? 276 PHE A CB  1 
ATOM   1850  C CG  . PHE A 1 276 ? 140.27800 120.57800 88.20500  1.000 38.29507  ? 276 PHE A CG  1 
ATOM   1851  C CD1 . PHE A 1 276 ? 141.28900 120.71900 89.13500  1.000 38.29507  ? 276 PHE A CD1 1 
ATOM   1852  C CD2 . PHE A 1 276 ? 139.32400 121.57400 88.10400  1.000 38.29507  ? 276 PHE A CD2 1 
ATOM   1853  C CE1 . PHE A 1 276 ? 141.35400 121.83500 89.93800  1.000 38.29507  ? 276 PHE A CE1 1 
ATOM   1854  C CE2 . PHE A 1 276 ? 139.38600 122.69000 88.90600  1.000 38.29507  ? 276 PHE A CE2 1 
ATOM   1855  C CZ  . PHE A 1 276 ? 140.40200 122.81900 89.82300  1.000 38.29507  ? 276 PHE A CZ  1 
ATOM   1856  N N   . ASP A 1 277 ? 137.25700 118.07400 87.85800  1.000 37.71802  ? 277 ASP A N   1 
ATOM   1857  C CA  . ASP A 1 277 ? 135.90400 118.27800 88.35300  1.000 37.71802  ? 277 ASP A CA  1 
ATOM   1858  C C   . ASP A 1 277 ? 135.52600 117.24700 89.39900  1.000 37.71802  ? 277 ASP A C   1 
ATOM   1859  O O   . ASP A 1 277 ? 134.65600 117.51100 90.22600  1.000 37.71802  ? 277 ASP A O   1 
ATOM   1860  C CB  . ASP A 1 277 ? 134.90100 118.24700 87.20900  1.000 37.71802  ? 277 ASP A CB  1 
ATOM   1861  C CG  . ASP A 1 277 ? 134.81900 119.56400 86.48500  1.000 37.71802  ? 277 ASP A CG  1 
ATOM   1862  O OD1 . ASP A 1 277 ? 135.85000 120.25900 86.41500  1.000 37.71802  ? 277 ASP A OD1 1 
ATOM   1863  O OD2 . ASP A 1 277 ? 133.72600 119.91300 85.99600  1.000 37.71802  ? 277 ASP A OD2 1 
ATOM   1864  N N   . ILE A 1 278 ? 136.15500 116.07500 89.38800  1.000 35.66949  ? 278 ILE A N   1 
ATOM   1865  C CA  . ILE A 1 278 ? 135.89000 115.09900 90.43700  1.000 35.66949  ? 278 ILE A CA  1 
ATOM   1866  C C   . ILE A 1 278 ? 136.53500 115.54800 91.74100  1.000 35.66949  ? 278 ILE A C   1 
ATOM   1867  O O   . ILE A 1 278 ? 135.90900 115.52100 92.80500  1.000 35.66949  ? 278 ILE A O   1 
ATOM   1868  C CB  . ILE A 1 278 ? 136.36600 113.70300 90.00300  1.000 35.66949  ? 278 ILE A CB  1 
ATOM   1869  C CG1 . ILE A 1 278 ? 135.38300 113.11100 89.00800  1.000 35.66949  ? 278 ILE A CG1 1 
ATOM   1870  C CG2 . ILE A 1 278 ? 136.46000 112.76300 91.17500  1.000 35.66949  ? 278 ILE A CG2 1 
ATOM   1871  C CD1 . ILE A 1 278 ? 135.88800 111.87600 88.35400  1.000 35.66949  ? 278 ILE A CD1 1 
ATOM   1872  N N   . PHE A 1 279 ? 137.77800 116.01800 91.67200  1.000 37.40777  ? 279 PHE A N   1 
ATOM   1873  C CA  . PHE A 1 279 ? 138.45100 116.49100 92.87400  1.000 37.40777  ? 279 PHE A CA  1 
ATOM   1874  C C   . PHE A 1 279 ? 137.91500 117.82800 93.35800  1.000 37.40777  ? 279 PHE A C   1 
ATOM   1875  O O   . PHE A 1 279 ? 138.14400 118.18400 94.51400  1.000 37.40777  ? 279 PHE A O   1 
ATOM   1876  C CB  . PHE A 1 279 ? 139.95200 116.59600 92.63000  1.000 37.40777  ? 279 PHE A CB  1 
ATOM   1877  C CG  . PHE A 1 279 ? 140.61500 115.27600 92.40200  1.000 37.40777  ? 279 PHE A CG  1 
ATOM   1878  C CD1 . PHE A 1 279 ? 140.26900 114.17600 93.16500  1.000 37.40777  ? 279 PHE A CD1 1 
ATOM   1879  C CD2 . PHE A 1 279 ? 141.57800 115.12900 91.42000  1.000 37.40777  ? 279 PHE A CD2 1 
ATOM   1880  C CE1 . PHE A 1 279 ? 140.86900 112.95500 92.95400  1.000 37.40777  ? 279 PHE A CE1 1 
ATOM   1881  C CE2 . PHE A 1 279 ? 142.18200 113.91100 91.20600  1.000 37.40777  ? 279 PHE A CE2 1 
ATOM   1882  C CZ  . PHE A 1 279 ? 141.82600 112.82200 91.97500  1.000 37.40777  ? 279 PHE A CZ  1 
ATOM   1883  N N   . PHE A 1 280 ? 137.21600 118.57800 92.51000  1.000 33.03961  ? 280 PHE A N   1 
ATOM   1884  C CA  . PHE A 1 280 ? 136.59900 119.82100 92.94700  1.000 33.03961  ? 280 PHE A CA  1 
ATOM   1885  C C   . PHE A 1 280 ? 135.19200 119.60200 93.48100  1.000 33.03961  ? 280 PHE A C   1 
ATOM   1886  O O   . PHE A 1 280 ? 134.80400 120.23500 94.46500  1.000 33.03961  ? 280 PHE A O   1 
ATOM   1887  C CB  . PHE A 1 280 ? 136.57200 120.83300 91.80400  1.000 33.03961  ? 280 PHE A CB  1 
ATOM   1888  C CG  . PHE A 1 280 ? 136.13300 122.20000 92.21700  1.000 33.03961  ? 280 PHE A CG  1 
ATOM   1889  C CD1 . PHE A 1 280 ? 136.55000 122.74300 93.41500  1.000 33.03961  ? 280 PHE A CD1 1 
ATOM   1890  C CD2 . PHE A 1 280 ? 135.30700 122.94900 91.40200  1.000 33.03961  ? 280 PHE A CD2 1 
ATOM   1891  C CE1 . PHE A 1 280 ? 136.14000 124.00100 93.79600  1.000 33.03961  ? 280 PHE A CE1 1 
ATOM   1892  C CE2 . PHE A 1 280 ? 134.90500 124.20700 91.77700  1.000 33.03961  ? 280 PHE A CE2 1 
ATOM   1893  C CZ  . PHE A 1 280 ? 135.31700 124.73200 92.97300  1.000 33.03961  ? 280 PHE A CZ  1 
ATOM   1894  N N   . MET A 1 281 ? 134.41500 118.71300 92.86800  1.000 32.82751  ? 281 MET A N   1 
ATOM   1895  C CA  . MET A 1 281 ? 133.07000 118.46800 93.36500  1.000 32.82751  ? 281 MET A CA  1 
ATOM   1896  C C   . MET A 1 281 ? 133.04500 117.57400 94.59400  1.000 32.82751  ? 281 MET A C   1 
ATOM   1897  O O   . MET A 1 281 ? 131.98300 117.42400 95.20000  1.000 32.82751  ? 281 MET A O   1 
ATOM   1898  C CB  . MET A 1 281 ? 132.19200 117.86600 92.27100  1.000 32.82751  ? 281 MET A CB  1 
ATOM   1899  C CG  . MET A 1 281 ? 131.79700 118.85900 91.20600  1.000 32.82751  ? 281 MET A CG  1 
ATOM   1900  S SD  . MET A 1 281 ? 130.53700 118.25100 90.08600  1.000 32.82751  ? 281 MET A SD  1 
ATOM   1901  C CE  . MET A 1 281 ? 131.54200 117.35200 88.92500  1.000 32.82751  ? 281 MET A CE  1 
ATOM   1902  N N   . MET A 1 282 ? 134.16900 116.97200 94.97400  1.000 36.42966  ? 282 MET A N   1 
ATOM   1903  C CA  . MET A 1 282 ? 134.26000 116.37300 96.29700  1.000 36.42966  ? 282 MET A CA  1 
ATOM   1904  C C   . MET A 1 282 ? 134.65900 117.39300 97.34500  1.000 36.42966  ? 282 MET A C   1 
ATOM   1905  O O   . MET A 1 282 ? 134.34200 117.21900 98.52300  1.000 36.42966  ? 282 MET A O   1 
ATOM   1906  C CB  . MET A 1 282 ? 135.25700 115.22200 96.29900  1.000 36.42966  ? 282 MET A CB  1 
ATOM   1907  C CG  . MET A 1 282 ? 134.80000 114.02200 95.51600  1.000 36.42966  ? 282 MET A CG  1 
ATOM   1908  S SD  . MET A 1 282 ? 135.94400 112.63800 95.62500  1.000 36.42966  ? 282 MET A SD  1 
ATOM   1909  C CE  . MET A 1 282 ? 137.52900 113.47200 95.63100  1.000 36.42966  ? 282 MET A CE  1 
ATOM   1910  N N   . PHE A 1 283 ? 135.35200 118.45300 96.94000  1.000 32.56509  ? 283 PHE A N   1 
ATOM   1911  C CA  . PHE A 1 283 ? 135.64000 119.54600 97.85500  1.000 32.56509  ? 283 PHE A CA  1 
ATOM   1912  C C   . PHE A 1 283 ? 134.38700 120.35200 98.16000  1.000 32.56509  ? 283 PHE A C   1 
ATOM   1913  O O   . PHE A 1 283 ? 134.22800 120.85300 99.27500  1.000 32.56509  ? 283 PHE A O   1 
ATOM   1914  C CB  . PHE A 1 283 ? 136.72300 120.44100 97.26100  1.000 32.56509  ? 283 PHE A CB  1 
ATOM   1915  C CG  . PHE A 1 283 ? 137.06100 121.63000 98.10200  1.000 32.56509  ? 283 PHE A CG  1 
ATOM   1916  C CD1 . PHE A 1 283 ? 137.84700 121.49300 99.22800  1.000 32.56509  ? 283 PHE A CD1 1 
ATOM   1917  C CD2 . PHE A 1 283 ? 136.60700 122.89000 97.75800  1.000 32.56509  ? 283 PHE A CD2 1 
ATOM   1918  C CE1 . PHE A 1 283 ? 138.16200 122.58400 100.00200 1.000 32.56509  ? 283 PHE A CE1 1 
ATOM   1919  C CE2 . PHE A 1 283 ? 136.91900 123.98300 98.53200  1.000 32.56509  ? 283 PHE A CE2 1 
ATOM   1920  C CZ  . PHE A 1 283 ? 137.69600 123.82800 99.65300  1.000 32.56509  ? 283 PHE A CZ  1 
ATOM   1921  N N   . ASN A 1 284 ? 133.48000 120.47900 97.19200  1.000 31.89865  ? 284 ASN A N   1 
ATOM   1922  C CA  . ASN A 1 284 ? 132.28700 121.28800 97.40800  1.000 31.89865  ? 284 ASN A CA  1 
ATOM   1923  C C   . ASN A 1 284 ? 131.24300 120.55900 98.23400  1.000 31.89865  ? 284 ASN A C   1 
ATOM   1924  O O   . ASN A 1 284 ? 130.32500 121.19500 98.75600  1.000 31.89865  ? 284 ASN A O   1 
ATOM   1925  C CB  . ASN A 1 284 ? 131.68700 121.71100 96.07800  1.000 31.89865  ? 284 ASN A CB  1 
ATOM   1926  C CG  . ASN A 1 284 ? 132.66400 122.45300 95.22700  1.000 31.89865  ? 284 ASN A CG  1 
ATOM   1927  O OD1 . ASN A 1 284 ? 132.72100 122.25500 94.02100  1.000 31.89865  ? 284 ASN A OD1 1 
ATOM   1928  N ND2 . ASN A 1 284 ? 133.45300 123.31200 95.84800  1.000 31.89865  ? 284 ASN A ND2 1 
ATOM   1929  N N   . LEU A 1 285 ? 131.33600 119.23600 98.34100  1.000 30.19382  ? 285 LEU A N   1 
ATOM   1930  C CA  . LEU A 1 285 ? 130.53300 118.53300 99.33300  1.000 30.19382  ? 285 LEU A CA  1 
ATOM   1931  C C   . LEU A 1 285 ? 130.99500 118.88300 100.73700 1.000 30.19382  ? 285 LEU A C   1 
ATOM   1932  O O   . LEU A 1 285 ? 130.18000 119.11600 101.63300 1.000 30.19382  ? 285 LEU A O   1 
ATOM   1933  C CB  . LEU A 1 285 ? 130.61100 117.02700 99.11500  1.000 30.19382  ? 285 LEU A CB  1 
ATOM   1934  C CG  . LEU A 1 285 ? 129.45800 116.33900 98.40900  1.000 30.19382  ? 285 LEU A CG  1 
ATOM   1935  C CD1 . LEU A 1 285 ? 129.85500 114.92000 98.11600  1.000 30.19382  ? 285 LEU A CD1 1 
ATOM   1936  C CD2 . LEU A 1 285 ? 128.23000 116.37100 99.27500  1.000 30.19382  ? 285 LEU A CD2 1 
ATOM   1937  N N   . GLY A 1 286 ? 132.30900 118.92200 100.94800 1.000 30.63326  ? 286 GLY A N   1 
ATOM   1938  C CA  . GLY A 1 286 ? 132.82500 119.25200 102.26000 1.000 30.63326  ? 286 GLY A CA  1 
ATOM   1939  C C   . GLY A 1 286 ? 132.74600 120.72700 102.57800 1.000 30.63326  ? 286 GLY A C   1 
ATOM   1940  O O   . GLY A 1 286 ? 132.78400 121.11100 103.74700 1.000 30.63326  ? 286 GLY A O   1 
ATOM   1941  N N   . LEU A 1 287 ? 132.63800 121.57200 101.55600 1.000 30.44230  ? 287 LEU A N   1 
ATOM   1942  C CA  . LEU A 1 287 ? 132.56900 123.00600 101.79900 1.000 30.44230  ? 287 LEU A CA  1 
ATOM   1943  C C   . LEU A 1 287 ? 131.16200 123.43200 102.18700 1.000 30.44230  ? 287 LEU A C   1 
ATOM   1944  O O   . LEU A 1 287 ? 130.97500 124.14400 103.17700 1.000 30.44230  ? 287 LEU A O   1 
ATOM   1945  C CB  . LEU A 1 287 ? 133.03900 123.77600 100.57000 1.000 30.44230  ? 287 LEU A CB  1 
ATOM   1946  C CG  . LEU A 1 287 ? 133.28500 125.26300 100.80700 1.000 30.44230  ? 287 LEU A CG  1 
ATOM   1947  C CD1 . LEU A 1 287 ? 134.57400 125.46200 101.56100 1.000 30.44230  ? 287 LEU A CD1 1 
ATOM   1948  C CD2 . LEU A 1 287 ? 133.31300 126.02000 99.50000  1.000 30.44230  ? 287 LEU A CD2 1 
ATOM   1949  N N   . THR A 1 288 ? 130.15400 123.00800 101.42300 1.000 29.36460  ? 288 THR A N   1 
ATOM   1950  C CA  . THR A 1 288 ? 128.79800 123.45900 101.71300 1.000 29.36460  ? 288 THR A CA  1 
ATOM   1951  C C   . THR A 1 288 ? 128.18800 122.71700 102.88900 1.000 29.36460  ? 288 THR A C   1 
ATOM   1952  O O   . THR A 1 288 ? 127.16700 123.15400 103.42100 1.000 29.36460  ? 288 THR A O   1 
ATOM   1953  C CB  . THR A 1 288 ? 127.90000 123.31100 100.49200 1.000 29.36460  ? 288 THR A CB  1 
ATOM   1954  O OG1 . THR A 1 288 ? 127.64600 121.92400 100.25600 1.000 29.36460  ? 288 THR A OG1 1 
ATOM   1955  C CG2 . THR A 1 288 ? 128.54300 123.94000 99.27100  1.000 29.36460  ? 288 THR A CG2 1 
ATOM   1956  N N   . ALA A 1 289 ? 128.77600 121.60000 103.30700 1.000 28.44695  ? 289 ALA A N   1 
ATOM   1957  C CA  . ALA A 1 289 ? 128.36800 121.00100 104.56900 1.000 28.44695  ? 289 ALA A CA  1 
ATOM   1958  C C   . ALA A 1 289 ? 129.06200 121.64500 105.75300 1.000 28.44695  ? 289 ALA A C   1 
ATOM   1959  O O   . ALA A 1 289 ? 128.69700 121.36100 106.89500 1.000 28.44695  ? 289 ALA A O   1 
ATOM   1960  C CB  . ALA A 1 289 ? 128.64700 119.50300 104.57100 1.000 28.44695  ? 289 ALA A CB  1 
ATOM   1961  N N   . TYR A 1 290 ? 130.05000 122.49500 105.50300 1.000 28.67599  ? 290 TYR A N   1 
ATOM   1962  C CA  . TYR A 1 290 ? 130.74100 123.25600 106.52900 1.000 28.67599  ? 290 TYR A CA  1 
ATOM   1963  C C   . TYR A 1 290 ? 130.14000 124.64400 106.68700 1.000 28.67599  ? 290 TYR A C   1 
ATOM   1964  O O   . TYR A 1 290 ? 130.15100 125.19600 107.78600 1.000 28.67599  ? 290 TYR A O   1 
ATOM   1965  C CB  . TYR A 1 290 ? 132.23100 123.33000 106.18300 1.000 28.67599  ? 290 TYR A CB  1 
ATOM   1966  C CG  . TYR A 1 290 ? 133.03400 124.41100 106.86400 1.000 28.67599  ? 290 TYR A CG  1 
ATOM   1967  C CD1 . TYR A 1 290 ? 133.53600 124.22700 108.14200 1.000 28.67599  ? 290 TYR A CD1 1 
ATOM   1968  C CD2 . TYR A 1 290 ? 133.33200 125.59800 106.20900 1.000 28.67599  ? 290 TYR A CD2 1 
ATOM   1969  C CE1 . TYR A 1 290 ? 134.28600 125.20500 108.75700 1.000 28.67599  ? 290 TYR A CE1 1 
ATOM   1970  C CE2 . TYR A 1 290 ? 134.07200 126.57900 106.81800 1.000 28.67599  ? 290 TYR A CE2 1 
ATOM   1971  C CZ  . TYR A 1 290 ? 134.54600 126.37900 108.08900 1.000 28.67599  ? 290 TYR A CZ  1 
ATOM   1972  O OH  . TYR A 1 290 ? 135.28900 127.36200 108.69200 1.000 28.67599  ? 290 TYR A OH  1 
ATOM   1973  N N   . LEU A 1 291 ? 129.60700 125.22300 105.61200 1.000 27.67103  ? 291 LEU A N   1 
ATOM   1974  C CA  . LEU A 1 291 ? 128.94400 126.51600 105.73300 1.000 27.67103  ? 291 LEU A CA  1 
ATOM   1975  C C   . LEU A 1 291 ? 127.55700 126.36700 106.33200 1.000 27.67103  ? 291 LEU A C   1 
ATOM   1976  O O   . LEU A 1 291 ? 127.11700 127.21800 107.11100 1.000 27.67103  ? 291 LEU A O   1 
ATOM   1977  C CB  . LEU A 1 291 ? 128.84300 127.19700 104.37400 1.000 27.67103  ? 291 LEU A CB  1 
ATOM   1978  C CG  . LEU A 1 291 ? 130.09200 127.31700 103.51800 1.000 27.67103  ? 291 LEU A CG  1 
ATOM   1979  C CD1 . LEU A 1 291 ? 129.70100 127.89000 102.18800 1.000 27.67103  ? 291 LEU A CD1 1 
ATOM   1980  C CD2 . LEU A 1 291 ? 131.11100 128.18700 104.19300 1.000 27.67103  ? 291 LEU A CD2 1 
ATOM   1981  N N   . ILE A 1 292 ? 126.84500 125.30400 105.96300 1.000 26.91601  ? 292 ILE A N   1 
ATOM   1982  C CA  . ILE A 1 292 ? 125.51100 125.07500 106.50300 1.000 26.91601  ? 292 ILE A CA  1 
ATOM   1983  C C   . ILE A 1 292 ? 125.59600 124.67500 107.96900 1.000 26.91601  ? 292 ILE A C   1 
ATOM   1984  O O   . ILE A 1 292 ? 124.80600 125.13800 108.79700 1.000 26.91601  ? 292 ILE A O   1 
ATOM   1985  C CB  . ILE A 1 292 ? 124.77900 124.02300 105.65200 1.000 26.91601  ? 292 ILE A CB  1 
ATOM   1986  C CG1 . ILE A 1 292 ? 124.38100 124.61600 104.30600 1.000 26.91601  ? 292 ILE A CG1 1 
ATOM   1987  C CG2 . ILE A 1 292 ? 123.53900 123.53100 106.33000 1.000 26.91601  ? 292 ILE A CG2 1 
ATOM   1988  C CD1 . ILE A 1 292 ? 123.76400 123.61600 103.37300 1.000 26.91601  ? 292 ILE A CD1 1 
ATOM   1989  N N   . GLY A 1 293 ? 126.59100 123.86100 108.32200 1.000 26.44943  ? 293 GLY A N   1 
ATOM   1990  C CA  . GLY A 1 293 ? 126.76600 123.47400 109.71200 1.000 26.44943  ? 293 GLY A CA  1 
ATOM   1991  C C   . GLY A 1 293 ? 127.24000 124.61300 110.59200 1.000 26.44943  ? 293 GLY A C   1 
ATOM   1992  O O   . GLY A 1 293 ? 127.00800 124.61000 111.80000 1.000 26.44943  ? 293 GLY A O   1 
ATOM   1993  N N   . ASN A 1 294 ? 127.90900 125.60300 110.00200 1.000 27.85369  ? 294 ASN A N   1 
ATOM   1994  C CA  . ASN A 1 294 ? 128.35400 126.75500 110.77800 1.000 27.85369  ? 294 ASN A CA  1 
ATOM   1995  C C   . ASN A 1 294 ? 127.25800 127.79900 110.90900 1.000 27.85369  ? 294 ASN A C   1 
ATOM   1996  O O   . ASN A 1 294 ? 127.13800 128.45000 111.95000 1.000 27.85369  ? 294 ASN A O   1 
ATOM   1997  C CB  . ASN A 1 294 ? 129.59900 127.36900 110.15400 1.000 27.85369  ? 294 ASN A CB  1 
ATOM   1998  C CG  . ASN A 1 294 ? 130.85900 126.84400 110.76800 1.000 27.85369  ? 294 ASN A CG  1 
ATOM   1999  O OD1 . ASN A 1 294 ? 131.57000 126.05200 110.17200 1.000 27.85369  ? 294 ASN A OD1 1 
ATOM   2000  N ND2 . ASN A 1 294 ? 131.15300 127.29600 111.97000 1.000 27.85369  ? 294 ASN A ND2 1 
ATOM   2001  N N   . MET A 1 295 ? 126.45500 127.99000 109.86400 1.000 27.58493  ? 295 MET A N   1 
ATOM   2002  C CA  . MET A 1 295 ? 125.34700 128.92800 109.98100 1.000 27.58493  ? 295 MET A CA  1 
ATOM   2003  C C   . MET A 1 295 ? 124.22600 128.36600 110.84300 1.000 27.58493  ? 295 MET A C   1 
ATOM   2004  O O   . MET A 1 295 ? 123.46300 129.13200 111.43600 1.000 27.58493  ? 295 MET A O   1 
ATOM   2005  C CB  . MET A 1 295 ? 124.82400 129.30800 108.60200 1.000 27.58493  ? 295 MET A CB  1 
ATOM   2006  C CG  . MET A 1 295 ? 124.06400 130.62400 108.57600 1.000 27.58493  ? 295 MET A CG  1 
ATOM   2007  S SD  . MET A 1 295 ? 125.10800 132.07300 108.76900 1.000 27.58493  ? 295 MET A SD  1 
ATOM   2008  C CE  . MET A 1 295 ? 125.62100 132.35000 107.07600 1.000 27.58493  ? 295 MET A CE  1 
ATOM   2009  N N   . THR A 1 296 ? 124.11200 127.04200 110.93200 1.000 26.94241  ? 296 THR A N   1 
ATOM   2010  C CA  . THR A 1 296 ? 123.18700 126.43800 111.88400 1.000 26.94241  ? 296 THR A CA  1 
ATOM   2011  C C   . THR A 1 296 ? 123.65100 126.68300 113.31100 1.000 26.94241  ? 296 THR A C   1 
ATOM   2012  O O   . THR A 1 296 ? 122.83800 126.87800 114.21800 1.000 26.94241  ? 296 THR A O   1 
ATOM   2013  C CB  . THR A 1 296 ? 123.06400 124.94500 111.60900 1.000 26.94241  ? 296 THR A CB  1 
ATOM   2014  O OG1 . THR A 1 296 ? 122.81400 124.74100 110.21800 1.000 26.94241  ? 296 THR A OG1 1 
ATOM   2015  C CG2 . THR A 1 296 ? 121.93400 124.34500 112.38900 1.000 26.94241  ? 296 THR A CG2 1 
ATOM   2016  N N   . ASN A 1 297 ? 124.96500 126.69000 113.52300 1.000 28.85554  ? 297 ASN A N   1 
ATOM   2017  C CA  . ASN A 1 297 ? 125.51700 127.00900 114.83300 1.000 28.85554  ? 297 ASN A CA  1 
ATOM   2018  C C   . ASN A 1 297 ? 125.33000 128.48300 115.16400 1.000 28.85554  ? 297 ASN A C   1 
ATOM   2019  O O   . ASN A 1 297 ? 125.22200 128.85500 116.33500 1.000 28.85554  ? 297 ASN A O   1 
ATOM   2020  C CB  . ASN A 1 297 ? 126.99700 126.62800 114.85900 1.000 28.85554  ? 297 ASN A CB  1 
ATOM   2021  C CG  . ASN A 1 297 ? 127.64800 126.88700 116.19200 1.000 28.85554  ? 297 ASN A CG  1 
ATOM   2022  O OD1 . ASN A 1 297 ? 127.08700 126.57500 117.23800 1.000 28.85554  ? 297 ASN A OD1 1 
ATOM   2023  N ND2 . ASN A 1 297 ? 128.84600 127.45700 116.16300 1.000 28.85554  ? 297 ASN A ND2 1 
ATOM   2024  N N   . LEU A 1 298 ? 125.27500 129.33800 114.14400 1.000 28.54032  ? 298 LEU A N   1 
ATOM   2025  C CA  . LEU A 1 298 ? 125.14000 130.76900 114.38900 1.000 28.54032  ? 298 LEU A CA  1 
ATOM   2026  C C   . LEU A 1 298 ? 123.69000 131.16500 114.61500 1.000 28.54032  ? 298 LEU A C   1 
ATOM   2027  O O   . LEU A 1 298 ? 123.41200 132.07600 115.39800 1.000 28.54032  ? 298 LEU A O   1 
ATOM   2028  C CB  . LEU A 1 298 ? 125.72900 131.55900 113.22700 1.000 28.54032  ? 298 LEU A CB  1 
ATOM   2029  C CG  . LEU A 1 298 ? 127.24600 131.68600 113.23000 1.000 28.54032  ? 298 LEU A CG  1 
ATOM   2030  C CD1 . LEU A 1 298 ? 127.69200 132.46100 112.02500 1.000 28.54032  ? 298 LEU A CD1 1 
ATOM   2031  C CD2 . LEU A 1 298 ? 127.70800 132.36000 114.49700 1.000 28.54032  ? 298 LEU A CD2 1 
ATOM   2032  N N   . VAL A 1 299 ? 122.75500 130.50700 113.92800 1.000 27.97645  ? 299 VAL A N   1 
ATOM   2033  C CA  . VAL A 1 299 ? 121.33700 130.79200 114.12300 1.000 27.97645  ? 299 VAL A CA  1 
ATOM   2034  C C   . VAL A 1 299 ? 120.88700 130.34100 115.50500 1.000 27.97645  ? 299 VAL A C   1 
ATOM   2035  O O   . VAL A 1 299 ? 120.08600 131.01500 116.16500 1.000 27.97645  ? 299 VAL A O   1 
ATOM   2036  C CB  . VAL A 1 299 ? 120.52100 130.14600 112.99100 1.000 27.97645  ? 299 VAL A CB  1 
ATOM   2037  C CG1 . VAL A 1 299 ? 119.05300 130.13600 113.29400 1.000 27.97645  ? 299 VAL A CG1 1 
ATOM   2038  C CG2 . VAL A 1 299 ? 120.74000 130.92000 111.72300 1.000 27.97645  ? 299 VAL A CG2 1 
ATOM   2039  N N   . VAL A 1 300 ? 121.43800 129.23200 115.99200 1.000 29.57909  ? 300 VAL A N   1 
ATOM   2040  C CA  . VAL A 1 300 ? 121.17000 128.80200 117.36000 1.000 29.57909  ? 300 VAL A CA  1 
ATOM   2041  C C   . VAL A 1 300 ? 121.76700 129.79100 118.36000 1.000 29.57909  ? 300 VAL A C   1 
ATOM   2042  O O   . VAL A 1 300 ? 121.14300 130.11800 119.37400 1.000 29.57909  ? 300 VAL A O   1 
ATOM   2043  C CB  . VAL A 1 300 ? 121.68700 127.36600 117.55700 1.000 29.57909  ? 300 VAL A CB  1 
ATOM   2044  C CG1 . VAL A 1 300 ? 121.75600 126.98000 119.02000 1.000 29.57909  ? 300 VAL A CG1 1 
ATOM   2045  C CG2 . VAL A 1 300 ? 120.79700 126.39600 116.80200 1.000 29.57909  ? 300 VAL A CG2 1 
ATOM   2046  N N   . HIS A 1 301 ? 122.94300 130.34200 118.05900 1.000 32.71007  ? 301 HIS A N   1 
ATOM   2047  C CA  . HIS A 1 301 ? 123.49000 131.40400 118.90100 1.000 32.71007  ? 301 HIS A CA  1 
ATOM   2048  C C   . HIS A 1 301 ? 122.74900 132.72400 118.70400 1.000 32.71007  ? 301 HIS A C   1 
ATOM   2049  O O   . HIS A 1 301 ? 122.74900 133.56800 119.60300 1.000 32.71007  ? 301 HIS A O   1 
ATOM   2050  C CB  . HIS A 1 301 ? 124.98000 131.58700 118.61400 1.000 32.71007  ? 301 HIS A CB  1 
ATOM   2051  C CG  . HIS A 1 301 ? 125.73400 132.28200 119.70600 1.000 32.71007  ? 301 HIS A CG  1 
ATOM   2052  N ND1 . HIS A 1 301 ? 126.65300 133.27800 119.46000 1.000 32.71007  ? 301 HIS A ND1 1 
ATOM   2053  C CD2 . HIS A 1 301 ? 125.72600 132.10700 121.04800 1.000 32.71007  ? 301 HIS A CD2 1 
ATOM   2054  C CE1 . HIS A 1 301 ? 127.16300 133.70200 120.60100 1.000 32.71007  ? 301 HIS A CE1 1 
ATOM   2055  N NE2 . HIS A 1 301 ? 126.62000 133.00500 121.58100 1.000 32.71007  ? 301 HIS A NE2 1 
ATOM   2056  N N   . TRP A 1 302 ? 122.13300 132.92700 117.53500 1.000 34.98543  ? 302 TRP A N   1 
ATOM   2057  C CA  . TRP A 1 302 ? 121.31800 134.11700 117.29700 1.000 34.98543  ? 302 TRP A CA  1 
ATOM   2058  C C   . TRP A 1 302 ? 120.07000 134.09900 118.16600 1.000 34.98543  ? 302 TRP A C   1 
ATOM   2059  O O   . TRP A 1 302 ? 119.84800 134.99700 118.98300 1.000 34.98543  ? 302 TRP A O   1 
ATOM   2060  C CB  . TRP A 1 302 ? 120.89300 134.19400 115.82700 1.000 34.98543  ? 302 TRP A CB  1 
ATOM   2061  C CG  . TRP A 1 302 ? 121.71900 135.02600 114.89100 1.000 34.98543  ? 302 TRP A CG  1 
ATOM   2062  C CD1 . TRP A 1 302 ? 122.41000 134.58000 113.80100 1.000 34.98543  ? 302 TRP A CD1 1 
ATOM   2063  C CD2 . TRP A 1 302 ? 121.89300 136.44700 114.91700 1.000 34.98543  ? 302 TRP A CD2 1 
ATOM   2064  N NE1 . TRP A 1 302 ? 123.02600 135.62800 113.16500 1.000 34.98543  ? 302 TRP A NE1 1 
ATOM   2065  C CE2 . TRP A 1 302 ? 122.72100 136.78700 113.82900 1.000 34.98543  ? 302 TRP A CE2 1 
ATOM   2066  C CE3 . TRP A 1 302 ? 121.44200 137.46300 115.76000 1.000 34.98543  ? 302 TRP A CE3 1 
ATOM   2067  C CZ2 . TRP A 1 302 ? 123.10400 138.10000 113.56500 1.000 34.98543  ? 302 TRP A CZ2 1 
ATOM   2068  C CZ3 . TRP A 1 302 ? 121.82800 138.76400 115.49500 1.000 34.98543  ? 302 TRP A CZ3 1 
ATOM   2069  C CH2 . TRP A 1 302 ? 122.64800 139.07000 114.40900 1.000 34.98543  ? 302 TRP A CH2 1 
ATOM   2070  N N   . THR A 1 303 ? 119.24700 133.06900 118.00100 1.000 32.19011  ? 303 THR A N   1 
ATOM   2071  C CA  . THR A 1 303 ? 117.87600 133.04500 118.49200 1.000 32.19011  ? 303 THR A CA  1 
ATOM   2072  C C   . THR A 1 303 ? 117.69200 132.07600 119.65200 1.000 32.19011  ? 303 THR A C   1 
ATOM   2073  O O   . THR A 1 303 ? 116.70400 131.35200 119.70900 1.000 32.19011  ? 303 THR A O   1 
ATOM   2074  C CB  . THR A 1 303 ? 116.91000 132.66900 117.37600 1.000 32.19011  ? 303 THR A CB  1 
ATOM   2075  O OG1 . THR A 1 303 ? 117.12700 131.30500 117.00900 1.000 32.19011  ? 303 THR A OG1 1 
ATOM   2076  C CG2 . THR A 1 303 ? 117.14800 133.53100 116.16300 1.000 32.19011  ? 303 THR A CG2 1 
ATOM   2077  N N   . SER A 1 304 ? 118.64200 132.02200 120.57700 1.000 33.95713  ? 304 SER A N   1 
ATOM   2078  C CA  . SER A 1 304 ? 118.44500 131.19200 121.75400 1.000 33.95713  ? 304 SER A CA  1 
ATOM   2079  C C   . SER A 1 304 ? 117.76500 131.93900 122.88600 1.000 33.95713  ? 304 SER A C   1 
ATOM   2080  O O   . SER A 1 304 ? 117.20000 131.30200 123.77600 1.000 33.95713  ? 304 SER A O   1 
ATOM   2081  C CB  . SER A 1 304 ? 119.77300 130.62800 122.25800 1.000 33.95713  ? 304 SER A CB  1 
ATOM   2082  O OG  . SER A 1 304 ? 120.61800 131.65700 122.72700 1.000 33.95713  ? 304 SER A OG  1 
ATOM   2083  N N   . ARG A 1 305 ? 117.80200 133.26600 122.88500 1.000 37.60008  ? 305 ARG A N   1 
ATOM   2084  C CA  . ARG A 1 305 ? 117.16500 134.00600 123.96600 1.000 37.60008  ? 305 ARG A CA  1 
ATOM   2085  C C   . ARG A 1 305 ? 115.65100 134.02400 123.79800 1.000 37.60008  ? 305 ARG A C   1 
ATOM   2086  O O   . ARG A 1 305 ? 114.90800 133.83500 124.76400 1.000 37.60008  ? 305 ARG A O   1 
ATOM   2087  C CB  . ARG A 1 305 ? 117.72300 135.42500 124.03000 1.000 37.60008  ? 305 ARG A CB  1 
ATOM   2088  C CG  . ARG A 1 305 ? 119.16800 135.50200 124.48300 1.000 37.60008  ? 305 ARG A CG  1 
ATOM   2089  C CD  . ARG A 1 305 ? 119.60100 136.94000 124.70800 1.000 37.60008  ? 305 ARG A CD  1 
ATOM   2090  N NE  . ARG A 1 305 ? 119.03600 137.51300 125.92900 1.000 37.60008  ? 305 ARG A NE  1 
ATOM   2091  C CZ  . ARG A 1 305 ? 118.02000 138.37300 125.96100 1.000 37.60008  ? 305 ARG A CZ  1 
ATOM   2092  N NH1 . ARG A 1 305 ? 117.43800 138.76400 124.83600 1.000 37.60008  ? 305 ARG A NH1 1 
ATOM   2093  N NH2 . ARG A 1 305 ? 117.58200 138.83900 127.12100 1.000 37.60008  ? 305 ARG A NH2 1 
ATOM   2094  N N   . THR A 1 306 ? 115.17500 134.23700 122.57600 1.000 32.03830  ? 306 THR A N   1 
ATOM   2095  C CA  . THR A 1 306 ? 113.74100 134.29800 122.33300 1.000 32.03830  ? 306 THR A CA  1 
ATOM   2096  C C   . THR A 1 306 ? 113.11100 132.92000 122.22600 1.000 32.03830  ? 306 THR A C   1 
ATOM   2097  O O   . THR A 1 306 ? 111.89100 132.79900 122.31800 1.000 32.03830  ? 306 THR A O   1 
ATOM   2098  C CB  . THR A 1 306 ? 113.47400 135.09800 121.06300 1.000 32.03830  ? 306 THR A CB  1 
ATOM   2099  O OG1 . THR A 1 306 ? 114.44700 136.13900 120.96400 1.000 32.03830  ? 306 THR A OG1 1 
ATOM   2100  C CG2 . THR A 1 306 ? 112.10600 135.75400 121.11000 1.000 32.03830  ? 306 THR A CG2 1 
ATOM   2101  N N   . ARG A 1 307 ? 113.89900 131.87000 122.05300 1.000 32.99193  ? 307 ARG A N   1 
ATOM   2102  C CA  . ARG A 1 307 ? 113.34400 130.53300 121.93000 1.000 32.99193  ? 307 ARG A CA  1 
ATOM   2103  C C   . ARG A 1 307 ? 113.15300 129.84900 123.27000 1.000 32.99193  ? 307 ARG A C   1 
ATOM   2104  O O   . ARG A 1 307 ? 112.15300 129.15800 123.46400 1.000 32.99193  ? 307 ARG A O   1 
ATOM   2105  C CB  . ARG A 1 307 ? 114.24400 129.67700 121.04800 1.000 32.99193  ? 307 ARG A CB  1 
ATOM   2106  C CG  . ARG A 1 307 ? 113.65000 128.36800 120.62300 1.000 32.99193  ? 307 ARG A CG  1 
ATOM   2107  C CD  . ARG A 1 307 ? 114.54300 127.70000 119.60800 1.000 32.99193  ? 307 ARG A CD  1 
ATOM   2108  N NE  . ARG A 1 307 ? 115.95800 127.91700 119.89400 1.000 32.99193  ? 307 ARG A NE  1 
ATOM   2109  C CZ  . ARG A 1 307 ? 116.68100 127.16500 120.71600 1.000 32.99193  ? 307 ARG A CZ  1 
ATOM   2110  N NH1 . ARG A 1 307 ? 117.95900 127.43900 120.91400 1.000 32.99193  ? 307 ARG A NH1 1 
ATOM   2111  N NH2 . ARG A 1 307 ? 116.12300 126.14400 121.34400 1.000 32.99193  ? 307 ARG A NH2 1 
ATOM   2112  N N   . THR A 1 308 ? 114.08200 130.02400 124.20800 1.000 32.34271  ? 308 THR A N   1 
ATOM   2113  C CA  . THR A 1 308 ? 113.88200 129.45400 125.53300 1.000 32.34271  ? 308 THR A CA  1 
ATOM   2114  C C   . THR A 1 308 ? 112.94500 130.31000 126.36900 1.000 32.34271  ? 308 THR A C   1 
ATOM   2115  O O   . THR A 1 308 ? 112.45800 129.86200 127.40900 1.000 32.34271  ? 308 THR A O   1 
ATOM   2116  C CB  . THR A 1 308 ? 115.21200 129.27500 126.25000 1.000 32.34271  ? 308 THR A CB  1 
ATOM   2117  O OG1 . THR A 1 308 ? 115.68600 130.54900 126.68700 1.000 32.34271  ? 308 THR A OG1 1 
ATOM   2118  C CG2 . THR A 1 308 ? 116.22900 128.62100 125.34000 1.000 32.34271  ? 308 THR A CG2 1 
ATOM   2119  N N   . PHE A 1 309 ? 112.69700 131.55000 125.95000 1.000 30.22091  ? 309 PHE A N   1 
ATOM   2120  C CA  . PHE A 1 309 ? 111.61500 132.31300 126.55600 1.000 30.22091  ? 309 PHE A CA  1 
ATOM   2121  C C   . PHE A 1 309 ? 110.26600 131.78000 126.10800 1.000 30.22091  ? 309 PHE A C   1 
ATOM   2122  O O   . PHE A 1 309 ? 109.32900 131.70000 126.90300 1.000 30.22091  ? 309 PHE A O   1 
ATOM   2123  C CB  . PHE A 1 309 ? 111.74800 133.79100 126.20900 1.000 30.22091  ? 309 PHE A CB  1 
ATOM   2124  C CG  . PHE A 1 309 ? 110.47100 134.57000 126.35100 1.000 30.22091  ? 309 PHE A CG  1 
ATOM   2125  C CD1 . PHE A 1 309 ? 109.89900 134.78100 127.59100 1.000 30.22091  ? 309 PHE A CD1 1 
ATOM   2126  C CD2 . PHE A 1 309 ? 109.85400 135.11100 125.24400 1.000 30.22091  ? 309 PHE A CD2 1 
ATOM   2127  C CE1 . PHE A 1 309 ? 108.73500 135.49700 127.71100 1.000 30.22091  ? 309 PHE A CE1 1 
ATOM   2128  C CE2 . PHE A 1 309 ? 108.69000 135.82900 125.36900 1.000 30.22091  ? 309 PHE A CE2 1 
ATOM   2129  C CZ  . PHE A 1 309 ? 108.13300 136.02000 126.59900 1.000 30.22091  ? 309 PHE A CZ  1 
ATOM   2130  N N   . ARG A 1 310 ? 110.15100 131.39100 124.84100 1.000 30.91554  ? 310 ARG A N   1 
ATOM   2131  C CA  . ARG A 1 310 ? 108.88200 130.87100 124.35500 1.000 30.91554  ? 310 ARG A CA  1 
ATOM   2132  C C   . ARG A 1 310 ? 108.69200 129.41600 124.74700 1.000 30.91554  ? 310 ARG A C   1 
ATOM   2133  O O   . ARG A 1 310 ? 107.61100 128.86100 124.54200 1.000 30.91554  ? 310 ARG A O   1 
ATOM   2134  C CB  . ARG A 1 310 ? 108.78800 131.02300 122.84200 1.000 30.91554  ? 310 ARG A CB  1 
ATOM   2135  C CG  . ARG A 1 310 ? 108.64800 132.44200 122.34900 1.000 30.91554  ? 310 ARG A CG  1 
ATOM   2136  C CD  . ARG A 1 310 ? 107.52400 133.17000 123.01900 1.000 30.91554  ? 310 ARG A CD  1 
ATOM   2137  N NE  . ARG A 1 310 ? 106.22700 132.70600 122.55900 1.000 30.91554  ? 310 ARG A NE  1 
ATOM   2138  C CZ  . ARG A 1 310 ? 105.46700 133.36900 121.70300 1.000 30.91554  ? 310 ARG A CZ  1 
ATOM   2139  N NH1 . ARG A 1 310 ? 105.88400 134.51800 121.20600 1.000 30.91554  ? 310 ARG A NH1 1 
ATOM   2140  N NH2 . ARG A 1 310 ? 104.29600 132.88000 121.33900 1.000 30.91554  ? 310 ARG A NH2 1 
ATOM   2141  N N   . ASP A 1 311 ? 109.73000 128.77800 125.28400 1.000 32.41744  ? 311 ASP A N   1 
ATOM   2142  C CA  . ASP A 1 311 ? 109.57100 127.44700 125.85400 1.000 32.41744  ? 311 ASP A CA  1 
ATOM   2143  C C   . ASP A 1 311 ? 108.96400 127.51700 127.24600 1.000 32.41744  ? 311 ASP A C   1 
ATOM   2144  O O   . ASP A 1 311 ? 108.13900 126.67600 127.61300 1.000 32.41744  ? 311 ASP A O   1 
ATOM   2145  C CB  . ASP A 1 311 ? 110.91900 126.73600 125.90700 1.000 32.41744  ? 311 ASP A CB  1 
ATOM   2146  C CG  . ASP A 1 311 ? 111.10600 125.76200 124.77300 1.000 32.41744  ? 311 ASP A CG  1 
ATOM   2147  O OD1 . ASP A 1 311 ? 110.16200 125.59300 123.97900 1.000 32.41744  ? 311 ASP A OD1 1 
ATOM   2148  O OD2 . ASP A 1 311 ? 112.19600 125.16100 124.67400 1.000 32.41744  ? 311 ASP A OD2 1 
ATOM   2149  N N   . SER A 1 312 ? 109.37100 128.50900 128.03800 1.000 30.38419  ? 312 SER A N   1 
ATOM   2150  C CA  . SER A 1 312 ? 108.90800 128.60500 129.41500 1.000 30.38419  ? 312 SER A CA  1 
ATOM   2151  C C   . SER A 1 312 ? 107.51700 129.21100 129.49600 1.000 30.38419  ? 312 SER A C   1 
ATOM   2152  O O   . SER A 1 312 ? 106.78400 128.95900 130.45500 1.000 30.38419  ? 312 SER A O   1 
ATOM   2153  C CB  . SER A 1 312 ? 109.89200 129.42500 130.23800 1.000 30.38419  ? 312 SER A CB  1 
ATOM   2154  O OG  . SER A 1 312 ? 109.76900 130.79500 129.92900 1.000 30.38419  ? 312 SER A OG  1 
ATOM   2155  N N   . VAL A 1 313 ? 107.14500 130.03200 128.51700 1.000 29.67646  ? 313 VAL A N   1 
ATOM   2156  C CA  . VAL A 1 313 ? 105.76900 130.50800 128.43100 1.000 29.67646  ? 313 VAL A CA  1 
ATOM   2157  C C   . VAL A 1 313 ? 104.84700 129.37000 128.02400 1.000 29.67646  ? 313 VAL A C   1 
ATOM   2158  O O   . VAL A 1 313 ? 103.74000 129.22500 128.55300 1.000 29.67646  ? 313 VAL A O   1 
ATOM   2159  C CB  . VAL A 1 313 ? 105.68800 131.69800 127.45900 1.000 29.67646  ? 313 VAL A CB  1 
ATOM   2160  C CG1 . VAL A 1 313 ? 104.27200 131.98500 127.04700 1.000 29.67646  ? 313 VAL A CG1 1 
ATOM   2161  C CG2 . VAL A 1 313 ? 106.26200 132.91000 128.11100 1.000 29.67646  ? 313 VAL A CG2 1 
ATOM   2162  N N   . ARG A 1 314 ? 105.31000 128.52200 127.10700 1.000 31.97029  ? 314 ARG A N   1 
ATOM   2163  C CA  . ARG A 1 314 ? 104.52700 127.37100 126.67700 1.000 31.97029  ? 314 ARG A CA  1 
ATOM   2164  C C   . ARG A 1 314 ? 104.36600 126.36200 127.80200 1.000 31.97029  ? 314 ARG A C   1 
ATOM   2165  O O   . ARG A 1 314 ? 103.29100 125.77800 127.97100 1.000 31.97029  ? 314 ARG A O   1 
ATOM   2166  C CB  . ARG A 1 314 ? 105.19500 126.72600 125.46900 1.000 31.97029  ? 314 ARG A CB  1 
ATOM   2167  C CG  . ARG A 1 314 ? 104.55000 125.46100 124.97300 1.000 31.97029  ? 314 ARG A CG  1 
ATOM   2168  C CD  . ARG A 1 314 ? 105.21700 124.98000 123.70200 1.000 31.97029  ? 314 ARG A CD  1 
ATOM   2169  N NE  . ARG A 1 314 ? 106.62300 124.65400 123.91000 1.000 31.97029  ? 314 ARG A NE  1 
ATOM   2170  C CZ  . ARG A 1 314 ? 107.36900 123.98700 123.03600 1.000 31.97029  ? 314 ARG A CZ  1 
ATOM   2171  N NH1 . ARG A 1 314 ? 106.84100 123.57100 121.89800 1.000 31.97029  ? 314 ARG A NH1 1 
ATOM   2172  N NH2 . ARG A 1 314 ? 108.64000 123.72900 123.30100 1.000 31.97029  ? 314 ARG A NH2 1 
ATOM   2173  N N   . ALA A 1 315 ? 105.41200 126.16700 128.60200 1.000 33.52887  ? 315 ALA A N   1 
ATOM   2174  C CA  . ALA A 1 315 ? 105.34700 125.18600 129.67800 1.000 33.52887  ? 315 ALA A CA  1 
ATOM   2175  C C   . ALA A 1 315 ? 104.47900 125.66200 130.83000 1.000 33.52887  ? 315 ALA A C   1 
ATOM   2176  O O   . ALA A 1 315 ? 103.98100 124.84000 131.60200 1.000 33.52887  ? 315 ALA A O   1 
ATOM   2177  C CB  . ALA A 1 315 ? 106.75000 124.86200 130.17700 1.000 33.52887  ? 315 ALA A CB  1 
ATOM   2178  N N   . ALA A 1 316 ? 104.29000 126.96900 130.97000 1.000 33.89950  ? 316 ALA A N   1 
ATOM   2179  C CA  . ALA A 1 316 ? 103.41300 127.51700 131.99300 1.000 33.89950  ? 316 ALA A CA  1 
ATOM   2180  C C   . ALA A 1 316 ? 102.00000 127.75600 131.49400 1.000 33.89950  ? 316 ALA A C   1 
ATOM   2181  O O   . ALA A 1 316 ? 101.13800 128.12800 132.29000 1.000 33.89950  ? 316 ALA A O   1 
ATOM   2182  C CB  . ALA A 1 316 ? 103.97800 128.82600 132.53600 1.000 33.89950  ? 316 ALA A CB  1 
ATOM   2183  N N   . SER A 1 317 ? 101.74900 127.58300 130.20200 1.000 36.29619  ? 317 SER A N   1 
ATOM   2184  C CA  . SER A 1 317 ? 100.39000 127.54500 129.69000 1.000 36.29619  ? 317 SER A CA  1 
ATOM   2185  C C   . SER A 1 317 ? 99.87600  126.12500 129.55100 1.000 36.29619  ? 317 SER A C   1 
ATOM   2186  O O   . SER A 1 317 ? 98.66100  125.91300 129.52200 1.000 36.29619  ? 317 SER A O   1 
ATOM   2187  C CB  . SER A 1 317 ? 100.30900 128.25300 128.34200 1.000 36.29619  ? 317 SER A CB  1 
ATOM   2188  O OG  . SER A 1 317 ? 100.31500 129.65200 128.51600 1.000 36.29619  ? 317 SER A OG  1 
ATOM   2189  N N   . GLU A 1 318 ? 100.77700 125.14900 129.44700 1.000 40.02165  ? 318 GLU A N   1 
ATOM   2190  C CA  . GLU A 1 318 ? 100.36700 123.75700 129.56600 1.000 40.02165  ? 318 GLU A CA  1 
ATOM   2191  C C   . GLU A 1 318 ? 100.00200 123.42000 131.00100 1.000 40.02165  ? 318 GLU A C   1 
ATOM   2192  O O   . GLU A 1 318 ? 99.13700  122.57500 131.24500 1.000 40.02165  ? 318 GLU A O   1 
ATOM   2193  C CB  . GLU A 1 318 ? 101.47900 122.83200 129.08500 1.000 40.02165  ? 318 GLU A CB  1 
ATOM   2194  C CG  . GLU A 1 318 ? 101.57400 122.68600 127.58900 1.000 40.02165  ? 318 GLU A CG  1 
ATOM   2195  C CD  . GLU A 1 318 ? 102.93900 122.21100 127.14600 1.000 40.02165  ? 318 GLU A CD  1 
ATOM   2196  O OE1 . GLU A 1 318 ? 103.34300 122.52600 126.00900 1.000 40.02165  ? 318 GLU A OE1 1 
ATOM   2197  O OE2 . GLU A 1 318 ? 103.61000 121.52100 127.94100 1.000 40.02165  ? 318 GLU A OE2 1 
ATOM   2198  N N   . PHE A 1 319 ? 100.66100 124.06100 131.96400 1.000 41.06456  ? 319 PHE A N   1 
ATOM   2199  C CA  . PHE A 1 319 ? 100.39200 123.75800 133.36300 1.000 41.06456  ? 319 PHE A CA  1 
ATOM   2200  C C   . PHE A 1 319 ? 99.07300  124.36400 133.81300 1.000 41.06456  ? 319 PHE A C   1 
ATOM   2201  O O   . PHE A 1 319 ? 98.33400  123.75300 134.58900 1.000 41.06456  ? 319 PHE A O   1 
ATOM   2202  C CB  . PHE A 1 319 ? 101.53400 124.26300 134.23800 1.000 41.06456  ? 319 PHE A CB  1 
ATOM   2203  C CG  . PHE A 1 319 ? 101.27700 124.11600 135.70100 1.000 41.06456  ? 319 PHE A CG  1 
ATOM   2204  C CD1 . PHE A 1 319 ? 101.34900 122.87600 136.30000 1.000 41.06456  ? 319 PHE A CD1 1 
ATOM   2205  C CD2 . PHE A 1 319 ? 100.95900 125.21300 136.47900 1.000 41.06456  ? 319 PHE A CD2 1 
ATOM   2206  C CE1 . PHE A 1 319 ? 101.11100 122.73200 137.64300 1.000 41.06456  ? 319 PHE A CE1 1 
ATOM   2207  C CE2 . PHE A 1 319 ? 100.71400 125.07200 137.82200 1.000 41.06456  ? 319 PHE A CE2 1 
ATOM   2208  C CZ  . PHE A 1 319 ? 100.79000 123.83100 138.40300 1.000 41.06456  ? 319 PHE A CZ  1 
ATOM   2209  N N   . ALA A 1 320 ? 98.76400  125.56400 133.35300 1.000 43.77400  ? 320 ALA A N   1 
ATOM   2210  C CA  . ALA A 1 320 ? 97.54200  126.22700 133.77300 1.000 43.77400  ? 320 ALA A CA  1 
ATOM   2211  C C   . ALA A 1 320 ? 96.33000  125.79300 132.97100 1.000 43.77400  ? 320 ALA A C   1 
ATOM   2212  O O   . ALA A 1 320 ? 95.23700  126.31200 133.20300 1.000 43.77400  ? 320 ALA A O   1 
ATOM   2213  C CB  . ALA A 1 320 ? 97.70800  127.73900 133.67200 1.000 43.77400  ? 320 ALA A CB  1 
ATOM   2214  N N   . SER A 1 321 ? 96.49500  124.87700 132.02700 1.000 45.09613  ? 321 SER A N   1 
ATOM   2215  C CA  . SER A 1 321 ? 95.38500  124.34300 131.25800 1.000 45.09613  ? 321 SER A CA  1 
ATOM   2216  C C   . SER A 1 321 ? 95.04200  122.91600 131.62300 1.000 45.09613  ? 321 SER A C   1 
ATOM   2217  O O   . SER A 1 321 ? 93.88600  122.51900 131.48300 1.000 45.09613  ? 321 SER A O   1 
ATOM   2218  C CB  . SER A 1 321 ? 95.69300  124.40700 129.76100 1.000 45.09613  ? 321 SER A CB  1 
ATOM   2219  O OG  . SER A 1 321 ? 94.64800  123.82400 129.00900 1.000 45.09613  ? 321 SER A OG  1 
ATOM   2220  N N   . ARG A 1 322 ? 96.02000  122.13600 132.08100 1.000 44.44832  ? 322 ARG A N   1 
ATOM   2221  C CA  . ARG A 1 322 ? 95.73200  120.79400 132.56200 1.000 44.44832  ? 322 ARG A CA  1 
ATOM   2222  C C   . ARG A 1 322 ? 94.98300  120.82900 133.88100 1.000 44.44832  ? 322 ARG A C   1 
ATOM   2223  O O   . ARG A 1 322 ? 94.13600  119.96700 134.13700 1.000 44.44832  ? 322 ARG A O   1 
ATOM   2224  C CB  . ARG A 1 322 ? 97.02500  120.01100 132.73000 1.000 44.44832  ? 322 ARG A CB  1 
ATOM   2225  C CG  . ARG A 1 322 ? 97.60600  119.49600 131.44800 1.000 44.44832  ? 322 ARG A CG  1 
ATOM   2226  C CD  . ARG A 1 322 ? 98.69900  118.51300 131.74800 1.000 44.44832  ? 322 ARG A CD  1 
ATOM   2227  N NE  . ARG A 1 322 ? 99.74600  119.12900 132.54900 1.000 44.44832  ? 322 ARG A NE  1 
ATOM   2228  C CZ  . ARG A 1 322 ? 100.99500 119.28900 132.13300 1.000 44.44832  ? 322 ARG A CZ  1 
ATOM   2229  N NH1 . ARG A 1 322 ? 101.34800 118.86800 130.92800 1.000 44.44832  ? 322 ARG A NH1 1 
ATOM   2230  N NH2 . ARG A 1 322 ? 101.89100 119.86200 132.92100 1.000 44.44832  ? 322 ARG A NH2 1 
ATOM   2231  N N   . ASN A 1 323 ? 95.27800  121.80900 134.72700 1.000 46.43409  ? 323 ASN A N   1 
ATOM   2232  C CA  . ASN A 1 323 ? 94.70900  121.89400 136.06100 1.000 46.43409  ? 323 ASN A CA  1 
ATOM   2233  C C   . ASN A 1 323 ? 93.47500  122.77500 136.12200 1.000 46.43409  ? 323 ASN A C   1 
ATOM   2234  O O   . ASN A 1 323 ? 92.90900  122.93800 137.20600 1.000 46.43409  ? 323 ASN A O   1 
ATOM   2235  C CB  . ASN A 1 323 ? 95.76400  122.39300 137.03800 1.000 46.43409  ? 323 ASN A CB  1 
ATOM   2236  C CG  . ASN A 1 323 ? 97.00200  121.54600 137.00900 1.000 46.43409  ? 323 ASN A CG  1 
ATOM   2237  O OD1 . ASN A 1 323 ? 97.08500  120.58800 136.25300 1.000 46.43409  ? 323 ASN A OD1 1 
ATOM   2238  N ND2 . ASN A 1 323 ? 97.97200  121.88700 137.83200 1.000 46.43409  ? 323 ASN A ND2 1 
ATOM   2239  N N   . GLN A 1 324 ? 93.05400  123.33000 134.97800 1.000 51.25540  ? 324 GLN A N   1 
ATOM   2240  C CA  . GLN A 1 324 ? 91.84200  124.14300 134.83200 1.000 51.25540  ? 324 GLN A CA  1 
ATOM   2241  C C   . GLN A 1 324 ? 91.84500  125.33700 135.77900 1.000 51.25540  ? 324 GLN A C   1 
ATOM   2242  O O   . GLN A 1 324 ? 90.88200  125.58200 136.50600 1.000 51.25540  ? 324 GLN A O   1 
ATOM   2243  C CB  . GLN A 1 324 ? 90.58100  123.29800 135.01600 1.000 51.25540  ? 324 GLN A CB  1 
ATOM   2244  C CG  . GLN A 1 324 ? 90.57400  122.02000 134.20000 1.000 51.25540  ? 324 GLN A CG  1 
ATOM   2245  C CD  . GLN A 1 324 ? 89.48100  121.06700 134.62600 1.000 51.25540  ? 324 GLN A CD  1 
ATOM   2246  O OE1 . GLN A 1 324 ? 88.57900  121.43500 135.37700 1.000 51.25540  ? 324 GLN A OE1 1 
ATOM   2247  N NE2 . GLN A 1 324 ? 89.55800  119.83200 134.15600 1.000 51.25540  ? 324 GLN A NE2 1 
ATOM   2248  N N   . LEU A 1 325 ? 92.95600  126.06800 135.78200 1.000 51.01583  ? 325 LEU A N   1 
ATOM   2249  C CA  . LEU A 1 325 ? 93.11500  127.20900 136.66500 1.000 51.01583  ? 325 LEU A CA  1 
ATOM   2250  C C   . LEU A 1 325 ? 92.18000  128.33900 136.23700 1.000 51.01583  ? 325 LEU A C   1 
ATOM   2251  O O   . LEU A 1 325 ? 91.82600  128.44500 135.06000 1.000 51.01583  ? 325 LEU A O   1 
ATOM   2252  C CB  . LEU A 1 325 ? 94.56200  127.69200 136.64200 1.000 51.01583  ? 325 LEU A CB  1 
ATOM   2253  C CG  . LEU A 1 325 ? 95.53000  126.93600 137.54100 1.000 51.01583  ? 325 LEU A CG  1 
ATOM   2254  C CD1 . LEU A 1 325 ? 96.92100  127.49300 137.39800 1.000 51.01583  ? 325 LEU A CD1 1 
ATOM   2255  C CD2 . LEU A 1 325 ? 95.07300  127.04100 138.96100 1.000 51.01583  ? 325 LEU A CD2 1 
ATOM   2256  N N   . PRO A 1 326 ? 91.73900  129.17800 137.17200 1.000 55.25766  ? 326 PRO A N   1 
ATOM   2257  C CA  . PRO A 1 326 ? 90.94100  130.34100 136.78200 1.000 55.25766  ? 326 PRO A CA  1 
ATOM   2258  C C   . PRO A 1 326 ? 91.79500  131.36900 136.06500 1.000 55.25766  ? 326 PRO A C   1 
ATOM   2259  O O   . PRO A 1 326 ? 93.02300  131.36600 136.15800 1.000 55.25766  ? 326 PRO A O   1 
ATOM   2260  C CB  . PRO A 1 326 ? 90.42300  130.88400 138.11600 1.000 55.25766  ? 326 PRO A CB  1 
ATOM   2261  C CG  . PRO A 1 326 ? 91.37800  130.39100 139.11600 1.000 55.25766  ? 326 PRO A CG  1 
ATOM   2262  C CD  . PRO A 1 326 ? 91.83400  129.05600 138.63500 1.000 55.25766  ? 326 PRO A CD  1 
ATOM   2263  N N   . HIS A 1 327 ? 91.12000  132.26600 135.34600 1.000 56.47197  ? 327 HIS A N   1 
ATOM   2264  C CA  . HIS A 1 327 ? 91.82900  133.25400 134.54500 1.000 56.47197  ? 327 HIS A CA  1 
ATOM   2265  C C   . HIS A 1 327 ? 92.49800  134.31700 135.40500 1.000 56.47197  ? 327 HIS A C   1 
ATOM   2266  O O   . HIS A 1 327 ? 93.38200  135.03100 134.92800 1.000 56.47197  ? 327 HIS A O   1 
ATOM   2267  C CB  . HIS A 1 327 ? 90.86800  133.90900 133.55700 1.000 56.47197  ? 327 HIS A CB  1 
ATOM   2268  C CG  . HIS A 1 327 ? 91.54700  134.49300 132.36000 1.000 56.47197  ? 327 HIS A CG  1 
ATOM   2269  N ND1 . HIS A 1 327 ? 91.97600  133.72600 131.29900 1.000 56.47197  ? 327 HIS A ND1 1 
ATOM   2270  C CD2 . HIS A 1 327 ? 91.88400  135.76900 132.06100 1.000 56.47197  ? 327 HIS A CD2 1 
ATOM   2271  C CE1 . HIS A 1 327 ? 92.54300  134.50400 130.39600 1.000 56.47197  ? 327 HIS A CE1 1 
ATOM   2272  N NE2 . HIS A 1 327 ? 92.50100  135.74900 130.83400 1.000 56.47197  ? 327 HIS A NE2 1 
ATOM   2273  N N   . ASP A 1 328 ? 92.09800  134.43900 136.66600 1.000 56.78457  ? 328 ASP A N   1 
ATOM   2274  C CA  . ASP A 1 328 ? 92.63400  135.48000 137.52900 1.000 56.78457  ? 328 ASP A CA  1 
ATOM   2275  C C   . ASP A 1 328 ? 93.97300  135.11600 138.15200 1.000 56.78457  ? 328 ASP A C   1 
ATOM   2276  O O   . ASP A 1 328 ? 94.63400  136.00000 138.70400 1.000 56.78457  ? 328 ASP A O   1 
ATOM   2277  C CB  . ASP A 1 328 ? 91.62200  135.80900 138.62600 1.000 56.78457  ? 328 ASP A CB  1 
ATOM   2278  C CG  . ASP A 1 328 ? 90.26300  136.18600 138.06500 1.000 56.78457  ? 328 ASP A CG  1 
ATOM   2279  O OD1 . ASP A 1 328 ? 89.85100  137.35300 138.23200 1.000 56.78457  ? 328 ASP A OD1 1 
ATOM   2280  O OD2 . ASP A 1 328 ? 89.60900  135.31800 137.44900 1.000 56.78457  ? 328 ASP A OD2 1 
ATOM   2281  N N   . ILE A 1 329 ? 94.38700  133.85400 138.08800 1.000 51.36409  ? 329 ILE A N   1 
ATOM   2282  C CA  . ILE A 1 329 ? 95.69600  133.43400 138.56100 1.000 51.36409  ? 329 ILE A CA  1 
ATOM   2283  C C   . ILE A 1 329 ? 96.59600  133.01900 137.40200 1.000 51.36409  ? 329 ILE A C   1 
ATOM   2284  O O   . ILE A 1 329 ? 97.82300  133.04500 137.51700 1.000 51.36409  ? 329 ILE A O   1 
ATOM   2285  C CB  . ILE A 1 329 ? 95.55600  132.30500 139.61300 1.000 51.36409  ? 329 ILE A CB  1 
ATOM   2286  C CG1 . ILE A 1 329 ? 96.87300  132.00600 140.33300 1.000 51.36409  ? 329 ILE A CG1 1 
ATOM   2287  C CG2 . ILE A 1 329 ? 95.02200  131.04400 138.99300 1.000 51.36409  ? 329 ILE A CG2 1 
ATOM   2288  C CD1 . ILE A 1 329 ? 97.49600  133.21300 140.98300 1.000 51.36409  ? 329 ILE A CD1 1 
ATOM   2289  N N   . GLN A 1 330 ? 96.00400  132.70200 136.25100 1.000 50.42126  ? 330 GLN A N   1 
ATOM   2290  C CA  . GLN A 1 330 ? 96.80100  132.43500 135.06200 1.000 50.42126  ? 330 GLN A CA  1 
ATOM   2291  C C   . GLN A 1 330 ? 97.44100  133.70900 134.53100 1.000 50.42126  ? 330 GLN A C   1 
ATOM   2292  O O   . GLN A 1 330 ? 98.54300  133.67300 133.97700 1.000 50.42126  ? 330 GLN A O   1 
ATOM   2293  C CB  . GLN A 1 330 ? 95.93000  131.78600 133.99500 1.000 50.42126  ? 330 GLN A CB  1 
ATOM   2294  C CG  . GLN A 1 330 ? 96.69700  131.21700 132.83900 1.000 50.42126  ? 330 GLN A CG  1 
ATOM   2295  C CD  . GLN A 1 330 ? 95.83000  130.37100 131.94900 1.000 50.42126  ? 330 GLN A CD  1 
ATOM   2296  O OE1 . GLN A 1 330 ? 94.60400  130.41600 132.03500 1.000 50.42126  ? 330 GLN A OE1 1 
ATOM   2297  N NE2 . GLN A 1 330 ? 96.45900  129.59100 131.07900 1.000 50.42126  ? 330 GLN A NE2 1 
ATOM   2298  N N   . ASP A 1 331 ? 96.77600  134.85200 134.70600 1.000 50.43888  ? 331 ASP A N   1 
ATOM   2299  C CA  . ASP A 1 331 ? 97.35900  136.11200 134.25900 1.000 50.43888  ? 331 ASP A CA  1 
ATOM   2300  C C   . ASP A 1 331 ? 98.48400  136.56400 135.17600 1.000 50.43888  ? 331 ASP A C   1 
ATOM   2301  O O   . ASP A 1 331 ? 99.34500  137.34800 134.76800 1.000 50.43888  ? 331 ASP A O   1 
ATOM   2302  C CB  . ASP A 1 331 ? 96.29400  137.19700 134.17500 1.000 50.43888  ? 331 ASP A CB  1 
ATOM   2303  C CG  . ASP A 1 331 ? 95.20700  136.86300 133.19400 1.000 50.43888  ? 331 ASP A CG  1 
ATOM   2304  O OD1 . ASP A 1 331 ? 94.18400  137.57900 133.17800 1.000 50.43888  ? 331 ASP A OD1 1 
ATOM   2305  O OD2 . ASP A 1 331 ? 95.37100  135.88200 132.44200 1.000 50.43888  ? 331 ASP A OD2 1 
ATOM   2306  N N   . GLN A 1 332 ? 98.48700  136.10400 136.42300 1.000 45.49410  ? 332 GLN A N   1 
ATOM   2307  C CA  . GLN A 1 332 ? 99.55100  136.50500 137.33200 1.000 45.49410  ? 332 GLN A CA  1 
ATOM   2308  C C   . GLN A 1 332 ? 100.83000 135.73600 137.05200 1.000 45.49410  ? 332 GLN A C   1 
ATOM   2309  O O   . GLN A 1 332 ? 101.93000 136.25400 137.26300 1.000 45.49410  ? 332 GLN A O   1 
ATOM   2310  C CB  . GLN A 1 332 ? 99.11400  136.30200 138.77700 1.000 45.49410  ? 332 GLN A CB  1 
ATOM   2311  C CG  . GLN A 1 332 ? 98.21000  137.38400 139.30000 1.000 45.49410  ? 332 GLN A CG  1 
ATOM   2312  C CD  . GLN A 1 332 ? 97.98600  137.25600 140.78000 1.000 45.49410  ? 332 GLN A CD  1 
ATOM   2313  O OE1 . GLN A 1 332 ? 98.72200  136.55300 141.46800 1.000 45.49410  ? 332 GLN A OE1 1 
ATOM   2314  N NE2 . GLN A 1 332 ? 96.96400  137.93000 141.28300 1.000 45.49410  ? 332 GLN A NE2 1 
ATOM   2315  N N   . MET A 1 333 ? 100.71100 134.49800 136.58000 1.000 40.34192  ? 333 MET A N   1 
ATOM   2316  C CA  . MET A 1 333 ? 101.90200 133.71300 136.30100 1.000 40.34192  ? 333 MET A CA  1 
ATOM   2317  C C   . MET A 1 333 ? 102.43400 133.94200 134.90100 1.000 40.34192  ? 333 MET A C   1 
ATOM   2318  O O   . MET A 1 333 ? 103.58500 133.59900 134.63400 1.000 40.34192  ? 333 MET A O   1 
ATOM   2319  C CB  . MET A 1 333 ? 101.62600 132.22400 136.51700 1.000 40.34192  ? 333 MET A CB  1 
ATOM   2320  C CG  . MET A 1 333 ? 100.84000 131.56000 135.42200 1.000 40.34192  ? 333 MET A CG  1 
ATOM   2321  S SD  . MET A 1 333 ? 100.42000 129.85900 135.81200 1.000 40.34192  ? 333 MET A SD  1 
ATOM   2322  C CE  . MET A 1 333 ? 102.00100 129.25400 136.36800 1.000 40.34192  ? 333 MET A CE  1 
ATOM   2323  N N   . LEU A 1 334 ? 101.63800 134.51800 134.00600 1.000 37.60162  ? 334 LEU A N   1 
ATOM   2324  C CA  . LEU A 1 334 ? 102.09500 134.77500 132.64900 1.000 37.60162  ? 334 LEU A CA  1 
ATOM   2325  C C   . LEU A 1 334 ? 102.62500 136.18700 132.48200 1.000 37.60162  ? 334 LEU A C   1 
ATOM   2326  O O   . LEU A 1 334 ? 103.51300 136.41800 131.66100 1.000 37.60162  ? 334 LEU A O   1 
ATOM   2327  C CB  . LEU A 1 334 ? 100.96700 134.52600 131.65400 1.000 37.60162  ? 334 LEU A CB  1 
ATOM   2328  C CG  . LEU A 1 334 ? 100.83800 133.08100 131.19400 1.000 37.60162  ? 334 LEU A CG  1 
ATOM   2329  C CD1 . LEU A 1 334 ? 99.63800  132.93300 130.29800 1.000 37.60162  ? 334 LEU A CD1 1 
ATOM   2330  C CD2 . LEU A 1 334 ? 102.08900 132.66400 130.47300 1.000 37.60162  ? 334 LEU A CD2 1 
ATOM   2331  N N   . SER A 1 335 ? 102.09600 137.14300 133.24400 1.000 37.45920  ? 335 SER A N   1 
ATOM   2332  C CA  . SER A 1 335 ? 102.65500 138.48600 133.22200 1.000 37.45920  ? 335 SER A CA  1 
ATOM   2333  C C   . SER A 1 335 ? 103.97700 138.54900 133.96100 1.000 37.45920  ? 335 SER A C   1 
ATOM   2334  O O   . SER A 1 335 ? 104.75500 139.48300 133.75600 1.000 37.45920  ? 335 SER A O   1 
ATOM   2335  C CB  . SER A 1 335 ? 101.67600 139.48000 133.83200 1.000 37.45920  ? 335 SER A CB  1 
ATOM   2336  O OG  . SER A 1 335 ? 100.36900 139.26100 133.34400 1.000 37.45920  ? 335 SER A OG  1 
ATOM   2337  N N   . HIS A 1 336 ? 104.25000 137.57900 134.82900 1.000 36.73280  ? 336 HIS A N   1 
ATOM   2338  C CA  . HIS A 1 336 ? 105.51000 137.59700 135.55600 1.000 36.73280  ? 336 HIS A CA  1 
ATOM   2339  C C   . HIS A 1 336 ? 106.65200 137.06800 134.70200 1.000 36.73280  ? 336 HIS A C   1 
ATOM   2340  O O   . HIS A 1 336 ? 107.78000 137.55500 134.80900 1.000 36.73280  ? 336 HIS A O   1 
ATOM   2341  C CB  . HIS A 1 336 ? 105.39900 136.79200 136.84200 1.000 36.73280  ? 336 HIS A CB  1 
ATOM   2342  C CG  . HIS A 1 336 ? 106.67300 136.74600 137.61700 1.000 36.73280  ? 336 HIS A CG  1 
ATOM   2343  N ND1 . HIS A 1 336 ? 107.11000 137.80200 138.38600 1.000 36.73280  ? 336 HIS A ND1 1 
ATOM   2344  C CD2 . HIS A 1 336 ? 107.62500 135.79000 137.71300 1.000 36.73280  ? 336 HIS A CD2 1 
ATOM   2345  C CE1 . HIS A 1 336 ? 108.26900 137.49100 138.93700 1.000 36.73280  ? 336 HIS A CE1 1 
ATOM   2346  N NE2 . HIS A 1 336 ? 108.60300 136.27500 138.54500 1.000 36.73280  ? 336 HIS A NE2 1 
ATOM   2347  N N   . ILE A 1 337 ? 106.38500 136.06500 133.86300 1.000 33.34713  ? 337 ILE A N   1 
ATOM   2348  C CA  . ILE A 1 337 ? 107.42200 135.51500 132.99200 1.000 33.34713  ? 337 ILE A CA  1 
ATOM   2349  C C   . ILE A 1 337 ? 107.80600 136.52700 131.92300 1.000 33.34713  ? 337 ILE A C   1 
ATOM   2350  O O   . ILE A 1 337 ? 108.97900 136.65200 131.55600 1.000 33.34713  ? 337 ILE A O   1 
ATOM   2351  C CB  . ILE A 1 337 ? 106.94500 134.18900 132.37500 1.000 33.34713  ? 337 ILE A CB  1 
ATOM   2352  C CG1 . ILE A 1 337 ? 106.62000 133.19200 133.47000 1.000 33.34713  ? 337 ILE A CG1 1 
ATOM   2353  C CG2 . ILE A 1 337 ? 108.00300 133.57900 131.50000 1.000 33.34713  ? 337 ILE A CG2 1 
ATOM   2354  C CD1 . ILE A 1 337 ? 105.96900 131.95800 132.96400 1.000 33.34713  ? 337 ILE A CD1 1 
ATOM   2355  N N   . CYS A 1 338 ? 106.82900 137.29000 131.43500 1.000 34.14550  ? 338 CYS A N   1 
ATOM   2356  C CA  . CYS A 1 338 ? 107.09700 138.28700 130.40900 1.000 34.14550  ? 338 CYS A CA  1 
ATOM   2357  C C   . CYS A 1 338 ? 107.90200 139.45200 130.96500 1.000 34.14550  ? 338 CYS A C   1 
ATOM   2358  O O   . CYS A 1 338 ? 108.71900 140.04700 130.25700 1.000 34.14550  ? 338 CYS A O   1 
ATOM   2359  C CB  . CYS A 1 338 ? 105.78400 138.78400 129.81800 1.000 34.14550  ? 338 CYS A CB  1 
ATOM   2360  S SG  . CYS A 1 338 ? 104.89100 137.54400 128.89400 1.000 34.14550  ? 338 CYS A SG  1 
ATOM   2361  N N   . LEU A 1 339 ? 107.68200 139.80100 132.23200 1.000 32.80039  ? 339 LEU A N   1 
ATOM   2362  C CA  . LEU A 1 339 ? 108.41100 140.92000 132.81500 1.000 32.80039  ? 339 LEU A CA  1 
ATOM   2363  C C   . LEU A 1 339 ? 109.76700 140.48000 133.34500 1.000 32.80039  ? 339 LEU A C   1 
ATOM   2364  O O   . LEU A 1 339 ? 110.69800 141.28700 133.42800 1.000 32.80039  ? 339 LEU A O   1 
ATOM   2365  C CB  . LEU A 1 339 ? 107.58600 141.57100 133.91900 1.000 32.80039  ? 339 LEU A CB  1 
ATOM   2366  C CG  . LEU A 1 339 ? 108.05900 142.92900 134.43500 1.000 32.80039  ? 339 LEU A CG  1 
ATOM   2367  C CD1 . LEU A 1 339 ? 108.48300 143.82700 133.31300 1.000 32.80039  ? 339 LEU A CD1 1 
ATOM   2368  C CD2 . LEU A 1 339 ? 106.96500 143.58300 135.19000 1.000 32.80039  ? 339 LEU A CD2 1 
ATOM   2369  N N   . LYS A 1 340 ? 109.90200 139.20700 133.70800 1.000 34.43415  ? 340 LYS A N   1 
ATOM   2370  C CA  . LYS A 1 340 ? 111.21000 138.69500 134.09500 1.000 34.43415  ? 340 LYS A CA  1 
ATOM   2371  C C   . LYS A 1 340 ? 112.13600 138.61000 132.89300 1.000 34.43415  ? 340 LYS A C   1 
ATOM   2372  O O   . LYS A 1 340 ? 113.35500 138.73900 133.02900 1.000 34.43415  ? 340 LYS A O   1 
ATOM   2373  C CB  . LYS A 1 340 ? 111.06000 137.32900 134.75400 1.000 34.43415  ? 340 LYS A CB  1 
ATOM   2374  C CG  . LYS A 1 340 ? 112.27500 136.85900 135.50900 1.000 34.43415  ? 340 LYS A CG  1 
ATOM   2375  C CD  . LYS A 1 340 ? 112.02700 135.50500 136.13100 1.000 34.43415  ? 340 LYS A CD  1 
ATOM   2376  C CE  . LYS A 1 340 ? 113.29400 134.94000 136.73200 1.000 34.43415  ? 340 LYS A CE  1 
ATOM   2377  N NZ  . LYS A 1 340 ? 113.07600 133.59500 137.32100 1.000 34.43415  ? 340 LYS A NZ  1 
ATOM   2378  N N   . PHE A 1 341 ? 111.57500 138.40800 131.70400 1.000 33.05808  ? 341 PHE A N   1 
ATOM   2379  C CA  . PHE A 1 341 ? 112.39400 138.34900 130.50300 1.000 33.05808  ? 341 PHE A CA  1 
ATOM   2380  C C   . PHE A 1 341 ? 112.82200 139.73700 130.05600 1.000 33.05808  ? 341 PHE A C   1 
ATOM   2381  O O   . PHE A 1 341 ? 113.92900 139.91300 129.54000 1.000 33.05808  ? 341 PHE A O   1 
ATOM   2382  C CB  . PHE A 1 341 ? 111.62700 137.64100 129.39400 1.000 33.05808  ? 341 PHE A CB  1 
ATOM   2383  C CG  . PHE A 1 341 ? 112.37100 137.55700 128.10000 1.000 33.05808  ? 341 PHE A CG  1 
ATOM   2384  C CD1 . PHE A 1 341 ? 113.47300 136.73200 127.97300 1.000 33.05808  ? 341 PHE A CD1 1 
ATOM   2385  C CD2 . PHE A 1 341 ? 111.96100 138.29600 127.00500 1.000 33.05808  ? 341 PHE A CD2 1 
ATOM   2386  C CE1 . PHE A 1 341 ? 114.15500 136.65300 126.78500 1.000 33.05808  ? 341 PHE A CE1 1 
ATOM   2387  C CE2 . PHE A 1 341 ? 112.64100 138.21700 125.81200 1.000 33.05808  ? 341 PHE A CE2 1 
ATOM   2388  C CZ  . PHE A 1 341 ? 113.73900 137.39400 125.70500 1.000 33.05808  ? 341 PHE A CZ  1 
ATOM   2389  N N   . LYS A 1 342 ? 111.95800 140.73500 130.23800 1.000 33.37840  ? 342 LYS A N   1 
ATOM   2390  C CA  . LYS A 1 342 ? 112.27700 142.08300 129.78500 1.000 33.37840  ? 342 LYS A CA  1 
ATOM   2391  C C   . LYS A 1 342 ? 113.33800 142.72600 130.65800 1.000 33.37840  ? 342 LYS A C   1 
ATOM   2392  O O   . LYS A 1 342 ? 114.15100 143.51900 130.17500 1.000 33.37840  ? 342 LYS A O   1 
ATOM   2393  C CB  . LYS A 1 342 ? 111.02500 142.94800 129.78600 1.000 33.37840  ? 342 LYS A CB  1 
ATOM   2394  C CG  . LYS A 1 342 ? 110.26100 142.95200 128.49500 1.000 33.37840  ? 342 LYS A CG  1 
ATOM   2395  C CD  . LYS A 1 342 ? 108.86600 143.49800 128.70500 1.000 33.37840  ? 342 LYS A CD  1 
ATOM   2396  C CE  . LYS A 1 342 ? 108.89600 144.88800 129.31100 1.000 33.37840  ? 342 LYS A CE  1 
ATOM   2397  N NZ  . LYS A 1 342 ? 107.53000 145.34400 129.67700 1.000 33.37840  ? 342 LYS A NZ  1 
ATOM   2398  N N   . THR A 1 343 ? 113.34300 142.40500 131.94800 1.000 36.46708  ? 343 THR A N   1 
ATOM   2399  C CA  . THR A 1 343 ? 114.17900 143.10300 132.91200 1.000 36.46708  ? 343 THR A CA  1 
ATOM   2400  C C   . THR A 1 343 ? 115.34200 142.26100 133.41400 1.000 36.46708  ? 343 THR A C   1 
ATOM   2401  O O   . THR A 1 343 ? 116.47600 142.73400 133.43700 1.000 36.46708  ? 343 THR A O   1 
ATOM   2402  C CB  . THR A 1 343 ? 113.33300 143.56300 134.09700 1.000 36.46708  ? 343 THR A CB  1 
ATOM   2403  O OG1 . THR A 1 343 ? 112.88000 142.42200 134.82600 1.000 36.46708  ? 343 THR A OG1 1 
ATOM   2404  C CG2 . THR A 1 343 ? 112.14000 144.34000 133.61200 1.000 36.46708  ? 343 THR A CG2 1 
ATOM   2405  N N   . GLU A 1 344 ? 115.09100 141.02800 133.82700 1.000 39.25046  ? 344 GLU A N   1 
ATOM   2406  C CA  . GLU A 1 344 ? 116.14300 140.20200 134.40300 1.000 39.25046  ? 344 GLU A CA  1 
ATOM   2407  C C   . GLU A 1 344 ? 116.88700 139.38900 133.37300 1.000 39.25046  ? 344 GLU A C   1 
ATOM   2408  O O   . GLU A 1 344 ? 117.65100 138.50200 133.75700 1.000 39.25046  ? 344 GLU A O   1 
ATOM   2409  C CB  . GLU A 1 344 ? 115.56600 139.27100 135.47100 1.000 39.25046  ? 344 GLU A CB  1 
ATOM   2410  N N   . GLY A 1 345 ? 116.69300 139.66400 132.09000 1.000 40.84735  ? 345 GLY A N   1 
ATOM   2411  C CA  . GLY A 1 345 ? 117.37900 138.89900 131.06700 1.000 40.84735  ? 345 GLY A CA  1 
ATOM   2412  C C   . GLY A 1 345 ? 116.86000 137.48100 130.99200 1.000 40.84735  ? 345 GLY A C   1 
ATOM   2413  O O   . GLY A 1 345 ? 115.66700 137.21500 131.16100 1.000 40.84735  ? 345 GLY A O   1 
ATOM   2414  N N   . LEU A 1 346 ? 117.77200 136.54800 130.74600 1.000 45.35879  ? 346 LEU A N   1 
ATOM   2415  C CA  . LEU A 1 346 ? 117.43700 135.13500 130.66500 1.000 45.35879  ? 346 LEU A CA  1 
ATOM   2416  C C   . LEU A 1 346 ? 118.08500 134.33900 131.79000 1.000 45.35879  ? 346 LEU A C   1 
ATOM   2417  O O   . LEU A 1 346 ? 117.40000 133.61200 132.51300 1.000 45.35879  ? 346 LEU A O   1 
ATOM   2418  C CB  . LEU A 1 346 ? 117.85900 134.57600 129.30300 1.000 45.35879  ? 346 LEU A CB  1 
ATOM   2419  C CG  . LEU A 1 346 ? 117.28800 133.20800 128.95000 1.000 45.35879  ? 346 LEU A CG  1 
ATOM   2420  C CD1 . LEU A 1 346 ? 115.83200 133.34100 128.57200 1.000 45.35879  ? 346 LEU A CD1 1 
ATOM   2421  C CD2 . LEU A 1 346 ? 118.08700 132.58000 127.82700 1.000 45.35879  ? 346 LEU A CD2 1 
ATOM   2422  N N   . LYS A 1 347 ? 119.40000 134.46000 131.95700 1.000 49.83191  ? 347 LYS A N   1 
ATOM   2423  C CA  . LYS A 1 347 ? 120.12900 133.77000 133.02200 1.000 49.83191  ? 347 LYS A CA  1 
ATOM   2424  C C   . LYS A 1 347 ? 120.95800 134.82400 133.75000 1.000 49.83191  ? 347 LYS A C   1 
ATOM   2425  O O   . LYS A 1 347 ? 122.12500 135.05000 133.41900 1.000 49.83191  ? 347 LYS A O   1 
ATOM   2426  C CB  . LYS A 1 347 ? 120.99600 132.65000 132.46600 1.000 49.83191  ? 347 LYS A CB  1 
ATOM   2427  N N   . GLN A 1 348 ? 120.34200 135.47500 134.73400 1.000 47.97437  ? 348 GLN A N   1 
ATOM   2428  C CA  . GLN A 1 348 ? 121.03000 136.46400 135.55200 1.000 47.97437  ? 348 GLN A CA  1 
ATOM   2429  C C   . GLN A 1 348 ? 121.52400 135.85300 136.85700 1.000 47.97437  ? 348 GLN A C   1 
ATOM   2430  O O   . GLN A 1 348 ? 122.59800 136.20800 137.34900 1.000 47.97437  ? 348 GLN A O   1 
ATOM   2431  C CB  . GLN A 1 348 ? 120.10000 137.64700 135.82500 1.000 47.97437  ? 348 GLN A CB  1 
ATOM   2432  C CG  . GLN A 1 348 ? 120.67000 138.69700 136.73800 1.000 47.97437  ? 348 GLN A CG  1 
ATOM   2433  C CD  . GLN A 1 348 ? 119.66100 139.74400 137.11300 1.000 47.97437  ? 348 GLN A CD  1 
ATOM   2434  O OE1 . GLN A 1 348 ? 119.34200 140.62400 136.31800 1.000 47.97437  ? 348 GLN A OE1 1 
ATOM   2435  N NE2 . GLN A 1 348 ? 119.14300 139.65600 138.33000 1.000 47.97437  ? 348 GLN A NE2 1 
ATOM   2436  N N   . GLN A 1 349 ? 120.76000 134.91500 137.41800 1.000 49.13058  ? 349 GLN A N   1 
ATOM   2437  C CA  . GLN A 1 349 ? 121.20200 134.23700 138.62900 1.000 49.13058  ? 349 GLN A CA  1 
ATOM   2438  C C   . GLN A 1 349 ? 122.38700 133.32700 138.35400 1.000 49.13058  ? 349 GLN A C   1 
ATOM   2439  O O   . GLN A 1 349 ? 123.22300 133.11800 139.23600 1.000 49.13058  ? 349 GLN A O   1 
ATOM   2440  C CB  . GLN A 1 349 ? 120.05200 133.44000 139.24100 1.000 49.13058  ? 349 GLN A CB  1 
ATOM   2441  N N   . GLU A 1 350 ? 122.48300 132.78100 137.14200 1.000 47.88089  ? 350 GLU A N   1 
ATOM   2442  C CA  . GLU A 1 350 ? 123.65500 131.99600 136.78300 1.000 47.88089  ? 350 GLU A CA  1 
ATOM   2443  C C   . GLU A 1 350 ? 124.83400 132.87500 136.40200 1.000 47.88089  ? 350 GLU A C   1 
ATOM   2444  O O   . GLU A 1 350 ? 125.96800 132.39300 136.38600 1.000 47.88089  ? 350 GLU A O   1 
ATOM   2445  C CB  . GLU A 1 350 ? 123.32500 131.04400 135.63600 1.000 47.88089  ? 350 GLU A CB  1 
ATOM   2446  N N   . THR A 1 351 ? 124.59200 134.14600 136.08700 1.000 47.60614  ? 351 THR A N   1 
ATOM   2447  C CA  . THR A 1 351 ? 125.67800 135.06600 135.77300 1.000 47.60614  ? 351 THR A CA  1 
ATOM   2448  C C   . THR A 1 351 ? 126.47500 135.41500 137.01800 1.000 47.60614  ? 351 THR A C   1 
ATOM   2449  O O   . THR A 1 351 ? 127.69300 135.22500 137.05800 1.000 47.60614  ? 351 THR A O   1 
ATOM   2450  C CB  . THR A 1 351 ? 125.12000 136.33600 135.13200 1.000 47.60614  ? 351 THR A CB  1 
ATOM   2451  O OG1 . THR A 1 351 ? 124.61900 136.03200 133.82700 1.000 47.60614  ? 351 THR A OG1 1 
ATOM   2452  C CG2 . THR A 1 351 ? 126.19100 137.40500 135.02600 1.000 47.60614  ? 351 THR A CG2 1 
ATOM   2453  N N   . LEU A 1 352 ? 125.79700 135.91800 138.04700 1.000 48.14064  ? 352 LEU A N   1 
ATOM   2454  C CA  . LEU A 1 352 ? 126.43700 136.34400 139.28200 1.000 48.14064  ? 352 LEU A CA  1 
ATOM   2455  C C   . LEU A 1 352 ? 126.44200 135.25900 140.35000 1.000 48.14064  ? 352 LEU A C   1 
ATOM   2456  O O   . LEU A 1 352 ? 126.47700 135.56400 141.54400 1.000 48.14064  ? 352 LEU A O   1 
ATOM   2457  C CB  . LEU A 1 352 ? 125.78300 137.63100 139.78700 1.000 48.14064  ? 352 LEU A CB  1 
ATOM   2458  C CG  . LEU A 1 352 ? 124.26300 137.76700 139.87000 1.000 48.14064  ? 352 LEU A CG  1 
ATOM   2459  C CD1 . LEU A 1 352 ? 123.66600 137.24600 141.16400 1.000 48.14064  ? 352 LEU A CD1 1 
ATOM   2460  C CD2 . LEU A 1 352 ? 123.90500 139.22100 139.67400 1.000 48.14064  ? 352 LEU A CD2 1 
ATOM   2461  N N   . ASN A 1 353 ? 126.40500 133.99700 139.94700 1.000 49.71845  ? 353 ASN A N   1 
ATOM   2462  C CA  . ASN A 1 353 ? 126.79900 132.89600 140.80800 1.000 49.71845  ? 353 ASN A CA  1 
ATOM   2463  C C   . ASN A 1 353 ? 128.20200 132.41700 140.49400 1.000 49.71845  ? 353 ASN A C   1 
ATOM   2464  O O   . ASN A 1 353 ? 128.66700 131.45300 141.10400 1.000 49.71845  ? 353 ASN A O   1 
ATOM   2465  C CB  . ASN A 1 353 ? 125.82200 131.72800 140.67500 1.000 49.71845  ? 353 ASN A CB  1 
ATOM   2466  C CG  . ASN A 1 353 ? 124.69800 131.79100 141.68000 1.000 49.71845  ? 353 ASN A CG  1 
ATOM   2467  O OD1 . ASN A 1 353 ? 124.78200 132.50200 142.67800 1.000 49.71845  ? 353 ASN A OD1 1 
ATOM   2468  N ND2 . ASN A 1 353 ? 123.63500 131.04200 141.42500 1.000 49.71845  ? 353 ASN A ND2 1 
ATOM   2469  N N   . ASN A 1 354 ? 128.87300 133.05500 139.53700 1.000 49.11044  ? 354 ASN A N   1 
ATOM   2470  C CA  . ASN A 1 354 ? 130.24000 132.72100 139.17700 1.000 49.11044  ? 354 ASN A CA  1 
ATOM   2471  C C   . ASN A 1 354 ? 131.24700 133.78200 139.58300 1.000 49.11044  ? 354 ASN A C   1 
ATOM   2472  O O   . ASN A 1 354 ? 132.44400 133.48600 139.61400 1.000 49.11044  ? 354 ASN A O   1 
ATOM   2473  C CB  . ASN A 1 354 ? 130.35000 132.48700 137.66700 1.000 49.11044  ? 354 ASN A CB  1 
ATOM   2474  C CG  . ASN A 1 354 ? 129.64300 131.22900 137.22400 1.000 49.11044  ? 354 ASN A CG  1 
ATOM   2475  O OD1 . ASN A 1 354 ? 128.64400 131.28300 136.51300 1.000 49.11044  ? 354 ASN A OD1 1 
ATOM   2476  N ND2 . ASN A 1 354 ? 130.16200 130.08400 137.63900 1.000 49.11044  ? 354 ASN A ND2 1 
ATOM   2477  N N   . LEU A 1 355 ? 130.80100 134.99800 139.87100 1.000 48.82786  ? 355 LEU A N   1 
ATOM   2478  C CA  . LEU A 1 355 ? 131.69100 136.00100 140.42900 1.000 48.82786  ? 355 LEU A CA  1 
ATOM   2479  C C   . LEU A 1 355 ? 132.08800 135.59000 141.84300 1.000 48.82786  ? 355 LEU A C   1 
ATOM   2480  O O   . LEU A 1 355 ? 131.23400 135.12900 142.60900 1.000 48.82786  ? 355 LEU A O   1 
ATOM   2481  C CB  . LEU A 1 355 ? 131.00200 137.35900 140.43900 1.000 48.82786  ? 355 LEU A CB  1 
ATOM   2482  C CG  . LEU A 1 355 ? 130.44800 137.75400 139.08200 1.000 48.82786  ? 355 LEU A CG  1 
ATOM   2483  C CD1 . LEU A 1 355 ? 129.44700 138.87100 139.24800 1.000 48.82786  ? 355 LEU A CD1 1 
ATOM   2484  C CD2 . LEU A 1 355 ? 131.58600 138.17200 138.18200 1.000 48.82786  ? 355 LEU A CD2 1 
ATOM   2485  N N   . PRO A 1 356 ? 133.37600 135.71000 142.21000 1.000 48.60899  ? 356 PRO A N   1 
ATOM   2486  C CA  . PRO A 1 356 ? 133.89100 134.96000 143.36700 1.000 48.60899  ? 356 PRO A CA  1 
ATOM   2487  C C   . PRO A 1 356 ? 133.32900 135.29900 144.74600 1.000 48.60899  ? 356 PRO A C   1 
ATOM   2488  O O   . PRO A 1 356 ? 132.55700 134.50500 145.29100 1.000 48.60899  ? 356 PRO A O   1 
ATOM   2489  C CB  . PRO A 1 356 ? 135.39400 135.26400 143.31400 1.000 48.60899  ? 356 PRO A CB  1 
ATOM   2490  C CG  . PRO A 1 356 ? 135.50700 136.52500 142.53600 1.000 48.60899  ? 356 PRO A CG  1 
ATOM   2491  C CD  . PRO A 1 356 ? 134.42600 136.48500 141.53500 1.000 48.60899  ? 356 PRO A CD  1 
ATOM   2492  N N   . LYS A 1 357 ? 133.68400 136.44300 145.33100 1.000 50.51199  ? 357 LYS A N   1 
ATOM   2493  C CA  . LYS A 1 357 ? 133.03400 136.86600 146.56500 1.000 50.51199  ? 357 LYS A CA  1 
ATOM   2494  C C   . LYS A 1 357 ? 132.93500 138.37800 146.66300 1.000 50.51199  ? 357 LYS A C   1 
ATOM   2495  O O   . LYS A 1 357 ? 132.05200 138.90800 147.34100 1.000 50.51199  ? 357 LYS A O   1 
ATOM   2496  C CB  . LYS A 1 357 ? 133.77600 136.31300 147.78000 1.000 50.51199  ? 357 LYS A CB  1 
ATOM   2497  N N   . ALA A 1 358 ? 133.84800 139.07600 146.00100 1.000 50.34863  ? 358 ALA A N   1 
ATOM   2498  C CA  . ALA A 1 358 ? 134.01000 140.50800 146.18500 1.000 50.34863  ? 358 ALA A CA  1 
ATOM   2499  C C   . ALA A 1 358 ? 133.63800 141.31600 144.96200 1.000 50.34863  ? 358 ALA A C   1 
ATOM   2500  O O   . ALA A 1 358 ? 133.42500 142.52200 145.07800 1.000 50.34863  ? 358 ALA A O   1 
ATOM   2501  C CB  . ALA A 1 358 ? 135.45400 140.83500 146.57200 1.000 50.34863  ? 358 ALA A CB  1 
ATOM   2502  N N   . ILE A 1 359 ? 133.58100 140.68600 143.79000 1.000 49.36098  ? 359 ILE A N   1 
ATOM   2503  C CA  . ILE A 1 359 ? 132.94600 141.33000 142.64900 1.000 49.36098  ? 359 ILE A CA  1 
ATOM   2504  C C   . ILE A 1 359 ? 131.44600 141.38700 142.87200 1.000 49.36098  ? 359 ILE A C   1 
ATOM   2505  O O   . ILE A 1 359 ? 130.79000 142.37800 142.53900 1.000 49.36098  ? 359 ILE A O   1 
ATOM   2506  C CB  . ILE A 1 359 ? 133.29300 140.59100 141.34500 1.000 49.36098  ? 359 ILE A CB  1 
ATOM   2507  C CG1 . ILE A 1 359 ? 134.77100 140.20700 141.30700 1.000 49.36098  ? 359 ILE A CG1 1 
ATOM   2508  C CG2 . ILE A 1 359 ? 132.94200 141.44600 140.15800 1.000 49.36098  ? 359 ILE A CG2 1 
ATOM   2509  C CD1 . ILE A 1 359 ? 135.70700 141.37200 141.15900 1.000 49.36098  ? 359 ILE A CD1 1 
ATOM   2510  N N   . ARG A 1 360 ? 130.88800 140.33000 143.46100 1.000 51.76223  ? 360 ARG A N   1 
ATOM   2511  C CA  . ARG A 1 360 ? 129.45400 140.27500 143.71400 1.000 51.76223  ? 360 ARG A CA  1 
ATOM   2512  C C   . ARG A 1 360 ? 129.05100 141.22300 144.83300 1.000 51.76223  ? 360 ARG A C   1 
ATOM   2513  O O   . ARG A 1 360 ? 128.03000 141.91100 144.74100 1.000 51.76223  ? 360 ARG A O   1 
ATOM   2514  C CB  . ARG A 1 360 ? 129.05000 138.84800 144.05500 1.000 51.76223  ? 360 ARG A CB  1 
ATOM   2515  C CG  . ARG A 1 360 ? 127.62900 138.51300 143.71600 1.000 51.76223  ? 360 ARG A CG  1 
ATOM   2516  C CD  . ARG A 1 360 ? 127.27800 137.17200 144.29600 1.000 51.76223  ? 360 ARG A CD  1 
ATOM   2517  N NE  . ARG A 1 360 ? 128.37200 136.22700 144.11400 1.000 51.76223  ? 360 ARG A NE  1 
ATOM   2518  C CZ  . ARG A 1 360 ? 128.43500 135.04000 144.70400 1.000 51.76223  ? 360 ARG A CZ  1 
ATOM   2519  N NH1 . ARG A 1 360 ? 127.46400 134.65100 145.51700 1.000 51.76223  ? 360 ARG A NH1 1 
ATOM   2520  N NH2 . ARG A 1 360 ? 129.47000 134.24300 144.48200 1.000 51.76223  ? 360 ARG A NH2 1 
ATOM   2521  N N   . SER A 1 361 ? 129.84500 141.27700 145.90200 1.000 50.77300  ? 361 SER A N   1 
ATOM   2522  C CA  . SER A 1 361 ? 129.53200 142.14000 147.03200 1.000 50.77300  ? 361 SER A CA  1 
ATOM   2523  C C   . SER A 1 361 ? 129.85200 143.60100 146.77100 1.000 50.77300  ? 361 SER A C   1 
ATOM   2524  O O   . SER A 1 361 ? 129.48100 144.44700 147.58600 1.000 50.77300  ? 361 SER A O   1 
ATOM   2525  C CB  . SER A 1 361 ? 130.28300 141.67100 148.27100 1.000 50.77300  ? 361 SER A CB  1 
ATOM   2526  O OG  . SER A 1 361 ? 129.82900 140.39600 148.67900 1.000 50.77300  ? 361 SER A OG  1 
ATOM   2527  N N   . SER A 1 362 ? 130.54000 143.92000 145.68200 1.000 50.45771  ? 362 SER A N   1 
ATOM   2528  C CA  . SER A 1 362 ? 130.70500 145.30800 145.28600 1.000 50.45771  ? 362 SER A CA  1 
ATOM   2529  C C   . SER A 1 362 ? 129.65100 145.74600 144.28600 1.000 50.45771  ? 362 SER A C   1 
ATOM   2530  O O   . SER A 1 362 ? 129.42400 146.94900 144.12400 1.000 50.45771  ? 362 SER A O   1 
ATOM   2531  C CB  . SER A 1 362 ? 132.09300 145.53200 144.69300 1.000 50.45771  ? 362 SER A CB  1 
ATOM   2532  O OG  . SER A 1 362 ? 132.41200 146.90900 144.66300 1.000 50.45771  ? 362 SER A OG  1 
ATOM   2533  N N   . ILE A 1 363 ? 129.02200 144.79500 143.59400 1.000 50.06034  ? 363 ILE A N   1 
ATOM   2534  C CA  . ILE A 1 363 ? 127.85500 145.11200 142.77800 1.000 50.06034  ? 363 ILE A CA  1 
ATOM   2535  C C   . ILE A 1 363 ? 126.69900 145.52200 143.67600 1.000 50.06034  ? 363 ILE A C   1 
ATOM   2536  O O   . ILE A 1 363 ? 126.04100 146.54400 143.45100 1.000 50.06034  ? 363 ILE A O   1 
ATOM   2537  C CB  . ILE A 1 363 ? 127.48500 143.91200 141.88700 1.000 50.06034  ? 363 ILE A CB  1 
ATOM   2538  C CG1 . ILE A 1 363 ? 128.45600 143.79100 140.72000 1.000 50.06034  ? 363 ILE A CG1 1 
ATOM   2539  C CG2 . ILE A 1 363 ? 126.08400 144.03900 141.34800 1.000 50.06034  ? 363 ILE A CG2 1 
ATOM   2540  C CD1 . ILE A 1 363 ? 128.47300 142.42500 140.10800 1.000 50.06034  ? 363 ILE A CD1 1 
ATOM   2541  N N   . ALA A 1 364 ? 126.48600 144.76800 144.75600 1.000 52.18182  ? 364 ALA A N   1 
ATOM   2542  C CA  . ALA A 1 364 ? 125.37700 145.03300 145.66200 1.000 52.18182  ? 364 ALA A CA  1 
ATOM   2543  C C   . ALA A 1 364 ? 125.63700 146.20400 146.60300 1.000 52.18182  ? 364 ALA A C   1 
ATOM   2544  O O   . ALA A 1 364 ? 124.80400 146.47500 147.46800 1.000 52.18182  ? 364 ALA A O   1 
ATOM   2545  C CB  . ALA A 1 364 ? 125.06700 143.77900 146.47400 1.000 52.18182  ? 364 ALA A CB  1 
ATOM   2546  N N   . ASN A 1 365 ? 126.77000 146.89300 146.47500 1.000 54.67702  ? 365 ASN A N   1 
ATOM   2547  C CA  . ASN A 1 365 ? 127.03400 148.07000 147.29000 1.000 54.67702  ? 365 ASN A CA  1 
ATOM   2548  C C   . ASN A 1 365 ? 126.99500 149.34800 146.47100 1.000 54.67702  ? 365 ASN A C   1 
ATOM   2549  O O   . ASN A 1 365 ? 126.82500 150.43200 147.02900 1.000 54.67702  ? 365 ASN A O   1 
ATOM   2550  C CB  . ASN A 1 365 ? 128.38600 147.95100 147.99200 1.000 54.67702  ? 365 ASN A CB  1 
ATOM   2551  C CG  . ASN A 1 365 ? 128.34700 146.99800 149.15900 1.000 54.67702  ? 365 ASN A CG  1 
ATOM   2552  O OD1 . ASN A 1 365 ? 129.38000 146.63500 149.71600 1.000 54.67702  ? 365 ASN A OD1 1 
ATOM   2553  N ND2 . ASN A 1 365 ? 127.15200 146.57300 149.53000 1.000 54.67702  ? 365 ASN A ND2 1 
ATOM   2554  N N   . TYR A 1 366 ? 127.18700 149.26000 145.15800 1.000 54.30702  ? 366 TYR A N   1 
ATOM   2555  C CA  . TYR A 1 366 ? 126.79600 150.38100 144.31800 1.000 54.30702  ? 366 TYR A CA  1 
ATOM   2556  C C   . TYR A 1 366 ? 125.29000 150.39000 144.13600 1.000 54.30702  ? 366 TYR A C   1 
ATOM   2557  O O   . TYR A 1 366 ? 124.65500 151.44900 144.15400 1.000 54.30702  ? 366 TYR A O   1 
ATOM   2558  C CB  . TYR A 1 366 ? 127.50100 150.31300 142.96400 1.000 54.30702  ? 366 TYR A CB  1 
ATOM   2559  C CG  . TYR A 1 366 ? 127.16000 151.46600 142.05200 1.000 54.30702  ? 366 TYR A CG  1 
ATOM   2560  C CD1 . TYR A 1 366 ? 126.21300 151.32900 141.04700 1.000 54.30702  ? 366 TYR A CD1 1 
ATOM   2561  C CD2 . TYR A 1 366 ? 127.78300 152.69400 142.20000 1.000 54.30702  ? 366 TYR A CD2 1 
ATOM   2562  C CE1 . TYR A 1 366 ? 125.89100 152.38100 140.22200 1.000 54.30702  ? 366 TYR A CE1 1 
ATOM   2563  C CE2 . TYR A 1 366 ? 127.47300 153.75500 141.37300 1.000 54.30702  ? 366 TYR A CE2 1 
ATOM   2564  C CZ  . TYR A 1 366 ? 126.52700 153.59100 140.38700 1.000 54.30702  ? 366 TYR A CZ  1 
ATOM   2565  O OH  . TYR A 1 366 ? 126.21300 154.64400 139.56100 1.000 54.30702  ? 366 TYR A OH  1 
ATOM   2566  N N   . LEU A 1 367 ? 124.70900 149.21100 143.96400 1.000 53.44311  ? 367 LEU A N   1 
ATOM   2567  C CA  . LEU A 1 367 ? 123.28000 149.05100 143.76500 1.000 53.44311  ? 367 LEU A CA  1 
ATOM   2568  C C   . LEU A 1 367 ? 122.59300 148.96100 145.11700 1.000 53.44311  ? 367 LEU A C   1 
ATOM   2569  O O   . LEU A 1 367 ? 123.02600 148.19200 145.98100 1.000 53.44311  ? 367 LEU A O   1 
ATOM   2570  C CB  . LEU A 1 367 ? 122.99800 147.78900 142.95700 1.000 53.44311  ? 367 LEU A CB  1 
ATOM   2571  C CG  . LEU A 1 367 ? 122.69200 147.87100 141.47300 1.000 53.44311  ? 367 LEU A CG  1 
ATOM   2572  C CD1 . LEU A 1 367 ? 123.76000 148.64300 140.75300 1.000 53.44311  ? 367 LEU A CD1 1 
ATOM   2573  C CD2 . LEU A 1 367 ? 122.61400 146.46400 140.94800 1.000 53.44311  ? 367 LEU A CD2 1 
ATOM   2574  N N   . PHE A 1 368 ? 121.50900 149.72500 145.26900 1.000 57.09990  ? 368 PHE A N   1 
ATOM   2575  C CA  . PHE A 1 368 ? 120.56900 149.72600 146.40700 1.000 57.09990  ? 368 PHE A CA  1 
ATOM   2576  C C   . PHE A 1 368 ? 121.23900 149.72800 147.78700 1.000 57.09990  ? 368 PHE A C   1 
ATOM   2577  O O   . PHE A 1 368 ? 120.72900 149.15800 148.75000 1.000 57.09990  ? 368 PHE A O   1 
ATOM   2578  C CB  . PHE A 1 368 ? 119.53100 148.59000 146.29800 1.000 57.09990  ? 368 PHE A CB  1 
ATOM   2579  C CG  . PHE A 1 368 ? 120.09700 147.20500 146.07600 1.000 57.09990  ? 368 PHE A CG  1 
ATOM   2580  C CD1 . PHE A 1 368 ? 120.57400 146.44700 147.13300 1.000 57.09990  ? 368 PHE A CD1 1 
ATOM   2581  C CD2 . PHE A 1 368 ? 120.11400 146.65100 144.80600 1.000 57.09990  ? 368 PHE A CD2 1 
ATOM   2582  C CE1 . PHE A 1 368 ? 121.07600 145.18100 146.92300 1.000 57.09990  ? 368 PHE A CE1 1 
ATOM   2583  C CE2 . PHE A 1 368 ? 120.62500 145.38700 144.59200 1.000 57.09990  ? 368 PHE A CE2 1 
ATOM   2584  C CZ  . PHE A 1 368 ? 121.09700 144.64900 145.65200 1.000 57.09990  ? 368 PHE A CZ  1 
ATOM   2585  N N   . PHE A 1 369 ? 122.38500 150.39600 147.89200 1.000 59.12035  ? 369 PHE A N   1 
ATOM   2586  C CA  . PHE A 1 369 ? 122.94100 150.66000 149.21600 1.000 59.12035  ? 369 PHE A CA  1 
ATOM   2587  C C   . PHE A 1 369 ? 122.29800 151.86900 149.89300 1.000 59.12035  ? 369 PHE A C   1 
ATOM   2588  O O   . PHE A 1 369 ? 122.02400 151.78500 151.09400 1.000 59.12035  ? 369 PHE A O   1 
ATOM   2589  C CB  . PHE A 1 369 ? 124.45800 150.82100 149.17500 1.000 59.12035  ? 369 PHE A CB  1 
ATOM   2590  C CG  . PHE A 1 369 ? 125.05300 151.27900 150.47200 1.000 59.12035  ? 369 PHE A CG  1 
ATOM   2591  C CD1 . PHE A 1 369 ? 125.12300 150.41900 151.55200 1.000 59.12035  ? 369 PHE A CD1 1 
ATOM   2592  C CD2 . PHE A 1 369 ? 125.56000 152.56400 150.60700 1.000 59.12035  ? 369 PHE A CD2 1 
ATOM   2593  C CE1 . PHE A 1 369 ? 125.67600 150.83200 152.74400 1.000 59.12035  ? 369 PHE A CE1 1 
ATOM   2594  C CE2 . PHE A 1 369 ? 126.11400 152.98400 151.80000 1.000 59.12035  ? 369 PHE A CE2 1 
ATOM   2595  C CZ  . PHE A 1 369 ? 126.17300 152.11600 152.86900 1.000 59.12035  ? 369 PHE A CZ  1 
ATOM   2596  N N   . PRO A 1 370 ? 122.01200 153.02200 149.20400 1.000 58.69341  ? 370 PRO A N   1 
ATOM   2597  C CA  . PRO A 1 370 ? 121.20900 154.04900 149.88400 1.000 58.69341  ? 370 PRO A CA  1 
ATOM   2598  C C   . PRO A 1 370 ? 119.71300 153.78400 149.83700 1.000 58.69341  ? 370 PRO A C   1 
ATOM   2599  O O   . PRO A 1 370 ? 118.91500 154.70000 150.04300 1.000 58.69341  ? 370 PRO A O   1 
ATOM   2600  C CB  . PRO A 1 370 ? 121.56500 155.33700 149.13100 1.000 58.69341  ? 370 PRO A CB  1 
ATOM   2601  C CG  . PRO A 1 370 ? 122.80200 155.02200 148.38700 1.000 58.69341  ? 370 PRO A CG  1 
ATOM   2602  C CD  . PRO A 1 370 ? 122.61200 153.61100 147.99000 1.000 58.69341  ? 370 PRO A CD  1 
ATOM   2603  N N   . ILE A 1 371 ? 119.31900 152.55300 149.53200 1.000 56.70375  ? 371 ILE A N   1 
ATOM   2604  C CA  . ILE A 1 371 ? 117.93000 152.13200 149.61000 1.000 56.70375  ? 371 ILE A CA  1 
ATOM   2605  C C   . ILE A 1 371 ? 117.71000 151.46900 150.96100 1.000 56.70375  ? 371 ILE A C   1 
ATOM   2606  O O   . ILE A 1 371 ? 116.72400 151.74700 151.65100 1.000 56.70375  ? 371 ILE A O   1 
ATOM   2607  C CB  . ILE A 1 371 ? 117.57600 151.18900 148.44900 1.000 56.70375  ? 371 ILE A CB  1 
ATOM   2608  C CG1 . ILE A 1 371 ? 117.64700 151.94700 147.12900 1.000 56.70375  ? 371 ILE A CG1 1 
ATOM   2609  C CG2 . ILE A 1 371 ? 116.19600 150.59900 148.63100 1.000 56.70375  ? 371 ILE A CG2 1 
ATOM   2610  C CD1 . ILE A 1 371 ? 116.72600 153.13600 147.06900 1.000 56.70375  ? 371 ILE A CD1 1 
ATOM   2611  N N   . VAL A 1 372 ? 118.64400 150.61100 151.36200 1.000 55.43561  ? 372 VAL A N   1 
ATOM   2612  C CA  . VAL A 1 372 ? 118.54100 149.88900 152.62300 1.000 55.43561  ? 372 VAL A CA  1 
ATOM   2613  C C   . VAL A 1 372 ? 119.13700 150.75200 153.72800 1.000 55.43561  ? 372 VAL A C   1 
ATOM   2614  O O   . VAL A 1 372 ? 119.01400 150.43700 154.91600 1.000 55.43561  ? 372 VAL A O   1 
ATOM   2615  C CB  . VAL A 1 372 ? 119.24000 148.51900 152.52700 1.000 55.43561  ? 372 VAL A CB  1 
ATOM   2616  C CG1 . VAL A 1 372 ? 120.73200 148.66600 152.70000 1.000 55.43561  ? 372 VAL A CG1 1 
ATOM   2617  C CG2 . VAL A 1 372 ? 118.66500 147.52800 153.52200 1.000 55.43561  ? 372 VAL A CG2 1 
ATOM   2618  N N   . HIS A 1 373 ? 119.77400 151.85900 153.34700 1.000 60.63351  ? 373 HIS A N   1 
ATOM   2619  C CA  . HIS A 1 373 ? 120.38100 152.73500 154.34200 1.000 60.63351  ? 373 HIS A CA  1 
ATOM   2620  C C   . HIS A 1 373 ? 119.32900 153.53400 155.09500 1.000 60.63351  ? 373 HIS A C   1 
ATOM   2621  O O   . HIS A 1 373 ? 119.16900 153.38200 156.31000 1.000 60.63351  ? 373 HIS A O   1 
ATOM   2622  C CB  . HIS A 1 373 ? 121.37400 153.67900 153.67200 1.000 60.63351  ? 373 HIS A CB  1 
ATOM   2623  C CG  . HIS A 1 373 ? 122.10500 154.55900 154.63100 1.000 60.63351  ? 373 HIS A CG  1 
ATOM   2624  N ND1 . HIS A 1 373 ? 122.96100 154.06400 155.58900 1.000 60.63351  ? 373 HIS A ND1 1 
ATOM   2625  C CD2 . HIS A 1 373 ? 122.11000 155.90400 154.77900 1.000 60.63351  ? 373 HIS A CD2 1 
ATOM   2626  C CE1 . HIS A 1 373 ? 123.46200 155.06600 156.28800 1.000 60.63351  ? 373 HIS A CE1 1 
ATOM   2627  N NE2 . HIS A 1 373 ? 122.96200 156.19400 155.81600 1.000 60.63351  ? 373 HIS A NE2 1 
ATOM   2628  N N   . ASN A 1 374 ? 118.58900 154.38200 154.38900 1.000 59.36651  ? 374 ASN A N   1 
ATOM   2629  C CA  . ASN A 1 374 ? 117.71300 155.34800 155.04300 1.000 59.36651  ? 374 ASN A CA  1 
ATOM   2630  C C   . ASN A 1 374 ? 116.27500 154.83300 155.07900 1.000 59.36651  ? 374 ASN A C   1 
ATOM   2631  O O   . ASN A 1 374 ? 115.35700 155.39900 154.49200 1.000 59.36651  ? 374 ASN A O   1 
ATOM   2632  C CB  . ASN A 1 374 ? 117.82200 156.70600 154.35600 1.000 59.36651  ? 374 ASN A CB  1 
ATOM   2633  C CG  . ASN A 1 374 ? 117.76500 156.60900 152.85000 1.000 59.36651  ? 374 ASN A CG  1 
ATOM   2634  O OD1 . ASN A 1 374 ? 117.34900 155.59700 152.29600 1.000 59.36651  ? 374 ASN A OD1 1 
ATOM   2635  N ND2 . ASN A 1 374 ? 118.20400 157.66400 152.17600 1.000 59.36651  ? 374 ASN A ND2 1 
ATOM   2636  N N   . ILE A 1 375 ? 116.09700 153.72800 155.79500 1.000 58.57301  ? 375 ILE A N   1 
ATOM   2637  C CA  . ILE A 1 375 ? 114.77900 153.27900 156.21700 1.000 58.57301  ? 375 ILE A CA  1 
ATOM   2638  C C   . ILE A 1 375 ? 114.78000 153.23000 157.73700 1.000 58.57301  ? 375 ILE A C   1 
ATOM   2639  O O   . ILE A 1 375 ? 115.83700 153.26200 158.37300 1.000 58.57301  ? 375 ILE A O   1 
ATOM   2640  C CB  . ILE A 1 375 ? 114.38700 151.91300 155.61800 1.000 58.57301  ? 375 ILE A CB  1 
ATOM   2641  C CG1 . ILE A 1 375 ? 115.31800 150.81400 156.11200 1.000 58.57301  ? 375 ILE A CG1 1 
ATOM   2642  C CG2 . ILE A 1 375 ? 114.40000 151.97500 154.10800 1.000 58.57301  ? 375 ILE A CG2 1 
ATOM   2643  C CD1 . ILE A 1 375 ? 114.90000 149.45400 155.65700 1.000 58.57301  ? 375 ILE A CD1 1 
ATOM   2644  N N   . TYR A 1 376 ? 113.58400 153.15800 158.32200 1.000 61.99646  ? 376 TYR A N   1 
ATOM   2645  C CA  . TYR A 1 376 ? 113.46500 153.34000 159.76400 1.000 61.99646  ? 376 TYR A CA  1 
ATOM   2646  C C   . TYR A 1 376 ? 113.92700 152.11000 160.53400 1.000 61.99646  ? 376 TYR A C   1 
ATOM   2647  O O   . TYR A 1 376 ? 114.36400 152.22100 161.68400 1.000 61.99646  ? 376 TYR A O   1 
ATOM   2648  C CB  . TYR A 1 376 ? 112.02500 153.69600 160.13200 1.000 61.99646  ? 376 TYR A CB  1 
ATOM   2649  C CG  . TYR A 1 376 ? 111.08900 152.51700 160.18600 1.000 61.99646  ? 376 TYR A CG  1 
ATOM   2650  C CD1 . TYR A 1 376 ? 110.72300 151.95100 161.39900 1.000 61.99646  ? 376 TYR A CD1 1 
ATOM   2651  C CD2 . TYR A 1 376 ? 110.57100 151.97200 159.02600 1.000 61.99646  ? 376 TYR A CD2 1 
ATOM   2652  C CE1 . TYR A 1 376 ? 109.88100 150.87800 161.45100 1.000 61.99646  ? 376 TYR A CE1 1 
ATOM   2653  C CE2 . TYR A 1 376 ? 109.71900 150.89800 159.07200 1.000 61.99646  ? 376 TYR A CE2 1 
ATOM   2654  C CZ  . TYR A 1 376 ? 109.38300 150.35800 160.28800 1.000 61.99646  ? 376 TYR A CZ  1 
ATOM   2655  O OH  . TYR A 1 376 ? 108.53200 149.29200 160.35200 1.000 61.99646  ? 376 TYR A OH  1 
ATOM   2656  N N   . LEU A 1 377 ? 113.81600 150.92500 159.93200 1.000 59.41876  ? 377 LEU A N   1 
ATOM   2657  C CA  . LEU A 1 377 ? 114.16000 149.70300 160.64600 1.000 59.41876  ? 377 LEU A CA  1 
ATOM   2658  C C   . LEU A 1 377 ? 115.65900 149.57200 160.85700 1.000 59.41876  ? 377 LEU A C   1 
ATOM   2659  O O   . LEU A 1 377 ? 116.08800 148.87900 161.78400 1.000 59.41876  ? 377 LEU A O   1 
ATOM   2660  C CB  . LEU A 1 377 ? 113.62500 148.48900 159.89500 1.000 59.41876  ? 377 LEU A CB  1 
ATOM   2661  C CG  . LEU A 1 377 ? 113.38600 147.24600 160.74200 1.000 59.41876  ? 377 LEU A CG  1 
ATOM   2662  C CD1 . LEU A 1 377 ? 112.36100 147.53600 161.80500 1.000 59.41876  ? 377 LEU A CD1 1 
ATOM   2663  C CD2 . LEU A 1 377 ? 112.93900 146.09500 159.87300 1.000 59.41876  ? 377 LEU A CD2 1 
ATOM   2664  N N   . PHE A 1 378 ? 116.46200 150.22400 160.02100 1.000 60.31625  ? 378 PHE A N   1 
ATOM   2665  C CA  . PHE A 1 378 ? 117.89100 150.37100 160.25200 1.000 60.31625  ? 378 PHE A CA  1 
ATOM   2666  C C   . PHE A 1 378 ? 118.19600 151.86700 160.22000 1.000 60.31625  ? 378 PHE A C   1 
ATOM   2667  O O   . PHE A 1 378 ? 118.59600 152.42000 159.19600 1.000 60.31625  ? 378 PHE A O   1 
ATOM   2668  C CB  . PHE A 1 378 ? 118.71400 149.60600 159.21300 1.000 60.31625  ? 378 PHE A CB  1 
ATOM   2669  C CG  . PHE A 1 378 ? 118.12700 148.28300 158.82600 1.000 60.31625  ? 378 PHE A CG  1 
ATOM   2670  C CD1 . PHE A 1 378 ? 118.09700 147.23200 159.72000 1.000 60.31625  ? 378 PHE A CD1 1 
ATOM   2671  C CD2 . PHE A 1 378 ? 117.61800 148.08800 157.56100 1.000 60.31625  ? 378 PHE A CD2 1 
ATOM   2672  C CE1 . PHE A 1 378 ? 117.55800 146.01200 159.35800 1.000 60.31625  ? 378 PHE A CE1 1 
ATOM   2673  C CE2 . PHE A 1 378 ? 117.07600 146.87600 157.19600 1.000 60.31625  ? 378 PHE A CE2 1 
ATOM   2674  C CZ  . PHE A 1 378 ? 117.04800 145.83700 158.09500 1.000 60.31625  ? 378 PHE A CZ  1 
ATOM   2675  N N   . GLN A 1 379 ? 118.00000 152.52300 161.35700 1.000 67.73109  ? 379 GLN A N   1 
ATOM   2676  C CA  . GLN A 1 379 ? 118.31200 153.93400 161.52100 1.000 67.73109  ? 379 GLN A CA  1 
ATOM   2677  C C   . GLN A 1 379 ? 119.14900 154.08900 162.77700 1.000 67.73109  ? 379 GLN A C   1 
ATOM   2678  O O   . GLN A 1 379 ? 118.75500 153.62100 163.84900 1.000 67.73109  ? 379 GLN A O   1 
ATOM   2679  C CB  . GLN A 1 379 ? 117.04400 154.78300 161.61500 1.000 67.73109  ? 379 GLN A CB  1 
ATOM   2680  N N   . GLY A 1 380 ? 120.30700 154.72400 162.64000 1.000 72.13285  ? 380 GLY A N   1 
ATOM   2681  C CA  . GLY A 1 380 ? 121.22100 154.85000 163.75600 1.000 72.13285  ? 380 GLY A CA  1 
ATOM   2682  C C   . GLY A 1 380 ? 122.00600 153.58300 164.02400 1.000 72.13285  ? 380 GLY A C   1 
ATOM   2683  O O   . GLY A 1 380 ? 122.65300 153.45600 165.06800 1.000 72.13285  ? 380 GLY A O   1 
ATOM   2684  N N   . VAL A 1 381 ? 121.95800 152.63800 163.08900 1.000 73.35463  ? 381 VAL A N   1 
ATOM   2685  C CA  . VAL A 1 381 ? 122.74700 151.42100 163.20600 1.000 73.35463  ? 381 VAL A CA  1 
ATOM   2686  C C   . VAL A 1 381 ? 124.09100 151.63400 162.50900 1.000 73.35463  ? 381 VAL A C   1 
ATOM   2687  O O   . VAL A 1 381 ? 124.25400 152.53800 161.68300 1.000 73.35463  ? 381 VAL A O   1 
ATOM   2688  C CB  . VAL A 1 381 ? 121.96600 150.22200 162.62500 1.000 73.35463  ? 381 VAL A CB  1 
ATOM   2689  C CG1 . VAL A 1 381 ? 121.89400 150.29300 161.11400 1.000 73.35463  ? 381 VAL A CG1 1 
ATOM   2690  C CG2 . VAL A 1 381 ? 122.47100 148.86400 163.14000 1.000 73.35463  ? 381 VAL A CG2 1 
ATOM   2691  N N   . SER A 1 382 ? 125.07800 150.81700 162.87900 1.000 75.15586  ? 382 SER A N   1 
ATOM   2692  C CA  . SER A 1 382 ? 126.45000 150.98000 162.42500 1.000 75.15586  ? 382 SER A CA  1 
ATOM   2693  C C   . SER A 1 382 ? 126.58100 150.71200 160.92500 1.000 75.15586  ? 382 SER A C   1 
ATOM   2694  O O   . SER A 1 382 ? 125.69200 150.16000 160.27800 1.000 75.15586  ? 382 SER A O   1 
ATOM   2695  C CB  . SER A 1 382 ? 127.37400 150.04200 163.19600 1.000 75.15586  ? 382 SER A CB  1 
ATOM   2696  O OG  . SER A 1 382 ? 126.83400 148.73200 163.24400 1.000 75.15586  ? 382 SER A OG  1 
ATOM   2697  N N   . ARG A 1 383 ? 127.72700 151.12400 160.37800 1.000 73.53503  ? 383 ARG A N   1 
ATOM   2698  C CA  . ARG A 1 383 ? 128.01700 150.93300 158.96100 1.000 73.53503  ? 383 ARG A CA  1 
ATOM   2699  C C   . ARG A 1 383 ? 128.21400 149.46100 158.62200 1.000 73.53503  ? 383 ARG A C   1 
ATOM   2700  O O   . ARG A 1 383 ? 127.75400 148.99500 157.57500 1.000 73.53503  ? 383 ARG A O   1 
ATOM   2701  C CB  . ARG A 1 383 ? 129.25800 151.74000 158.57900 1.000 73.53503  ? 383 ARG A CB  1 
ATOM   2702  C CG  . ARG A 1 383 ? 129.72400 151.55700 157.15200 1.000 73.53503  ? 383 ARG A CG  1 
ATOM   2703  C CD  . ARG A 1 383 ? 128.81000 152.27500 156.18400 1.000 73.53503  ? 383 ARG A CD  1 
ATOM   2704  N NE  . ARG A 1 383 ? 128.94500 153.72400 156.27300 1.000 73.53503  ? 383 ARG A NE  1 
ATOM   2705  C CZ  . ARG A 1 383 ? 129.79400 154.43900 155.54300 1.000 73.53503  ? 383 ARG A CZ  1 
ATOM   2706  N NH1 . ARG A 1 383 ? 130.58700 153.83800 154.66900 1.000 73.53503  ? 383 ARG A NH1 1 
ATOM   2707  N NH2 . ARG A 1 383 ? 129.85000 155.75500 155.68600 1.000 73.53503  ? 383 ARG A NH2 1 
ATOM   2708  N N   . ASN A 1 384 ? 128.85900 148.71100 159.50800 1.000 70.66475  ? 384 ASN A N   1 
ATOM   2709  C CA  . ASN A 1 384 ? 129.20500 147.32900 159.21500 1.000 70.66475  ? 384 ASN A CA  1 
ATOM   2710  C C   . ASN A 1 384 ? 128.01800 146.38200 159.26900 1.000 70.66475  ? 384 ASN A C   1 
ATOM   2711  O O   . ASN A 1 384 ? 128.15800 145.24400 158.81200 1.000 70.66475  ? 384 ASN A O   1 
ATOM   2712  C CB  . ASN A 1 384 ? 130.28900 146.84900 160.17800 1.000 70.66475  ? 384 ASN A CB  1 
ATOM   2713  N N   . PHE A 1 385 ? 126.87100 146.78500 159.81700 1.000 70.86235  ? 385 PHE A N   1 
ATOM   2714  C CA  . PHE A 1 385 ? 125.71100 145.89900 159.76800 1.000 70.86235  ? 385 PHE A CA  1 
ATOM   2715  C C   . PHE A 1 385 ? 124.95000 146.04400 158.45900 1.000 70.86235  ? 385 PHE A C   1 
ATOM   2716  O O   . PHE A 1 385 ? 124.48700 145.05200 157.89000 1.000 70.86235  ? 385 PHE A O   1 
ATOM   2717  C CB  . PHE A 1 385 ? 124.76000 146.15600 160.93400 1.000 70.86235  ? 385 PHE A CB  1 
ATOM   2718  C CG  . PHE A 1 385 ? 123.54200 145.28000 160.90200 1.000 70.86235  ? 385 PHE A CG  1 
ATOM   2719  C CD1 . PHE A 1 385 ? 123.66500 143.89900 160.99300 1.000 70.86235  ? 385 PHE A CD1 1 
ATOM   2720  C CD2 . PHE A 1 385 ? 122.28100 145.82700 160.74300 1.000 70.86235  ? 385 PHE A CD2 1 
ATOM   2721  C CE1 . PHE A 1 385 ? 122.55300 143.08600 160.95400 1.000 70.86235  ? 385 PHE A CE1 1 
ATOM   2722  C CE2 . PHE A 1 385 ? 121.16600 145.01600 160.69900 1.000 70.86235  ? 385 PHE A CE2 1 
ATOM   2723  C CZ  . PHE A 1 385 ? 121.30400 143.64300 160.80600 1.000 70.86235  ? 385 PHE A CZ  1 
ATOM   2724  N N   . LEU A 1 386 ? 124.83400 147.27000 157.95700 1.000 68.59538  ? 386 LEU A N   1 
ATOM   2725  C CA  . LEU A 1 386 ? 124.32100 147.50700 156.61900 1.000 68.59538  ? 386 LEU A CA  1 
ATOM   2726  C C   . LEU A 1 386 ? 125.42300 147.49200 155.56800 1.000 68.59538  ? 386 LEU A C   1 
ATOM   2727  O O   . LEU A 1 386 ? 125.33900 148.19600 154.55800 1.000 68.59538  ? 386 LEU A O   1 
ATOM   2728  C CB  . LEU A 1 386 ? 123.51000 148.80800 156.58500 1.000 68.59538  ? 386 LEU A CB  1 
ATOM   2729  C CG  . LEU A 1 386 ? 123.98100 150.14000 157.17400 1.000 68.59538  ? 386 LEU A CG  1 
ATOM   2730  C CD1 . LEU A 1 386 ? 124.86500 150.94700 156.24700 1.000 68.59538  ? 386 LEU A CD1 1 
ATOM   2731  C CD2 . LEU A 1 386 ? 122.76400 150.96000 157.53900 1.000 68.59538  ? 386 LEU A CD2 1 
ATOM   2732  N N   . PHE A 1 387 ? 126.48000 146.73000 155.83600 1.000 68.07113  ? 387 PHE A N   1 
ATOM   2733  C CA  . PHE A 1 387 ? 127.40400 146.22700 154.83500 1.000 68.07113  ? 387 PHE A CA  1 
ATOM   2734  C C   . PHE A 1 387 ? 127.21800 144.73600 154.61300 1.000 68.07113  ? 387 PHE A C   1 
ATOM   2735  O O   . PHE A 1 387 ? 128.09800 144.08900 154.04300 1.000 68.07113  ? 387 PHE A O   1 
ATOM   2736  C CB  . PHE A 1 387 ? 128.84200 146.51100 155.25400 1.000 68.07113  ? 387 PHE A CB  1 
ATOM   2737  C CG  . PHE A 1 387 ? 129.71700 146.95500 154.13400 1.000 68.07113  ? 387 PHE A CG  1 
ATOM   2738  C CD1 . PHE A 1 387 ? 129.75400 148.28600 153.77100 1.000 68.07113  ? 387 PHE A CD1 1 
ATOM   2739  C CD2 . PHE A 1 387 ? 130.50700 146.05400 153.44600 1.000 68.07113  ? 387 PHE A CD2 1 
ATOM   2740  C CE1 . PHE A 1 387 ? 130.56500 148.71500 152.74000 1.000 68.07113  ? 387 PHE A CE1 1 
ATOM   2741  C CE2 . PHE A 1 387 ? 131.32400 146.47100 152.40900 1.000 68.07113  ? 387 PHE A CE2 1 
ATOM   2742  C CZ  . PHE A 1 387 ? 131.35300 147.80400 152.05600 1.000 68.07113  ? 387 PHE A CZ  1 
ATOM   2743  N N   . GLN A 1 388 ? 126.12000 144.16900 155.10400 1.000 68.10408  ? 388 GLN A N   1 
ATOM   2744  C CA  . GLN A 1 388 ? 125.72400 142.80600 154.78200 1.000 68.10408  ? 388 GLN A CA  1 
ATOM   2745  C C   . GLN A 1 388 ? 124.44300 142.80000 153.94300 1.000 68.10408  ? 388 GLN A C   1 
ATOM   2746  O O   . GLN A 1 388 ? 123.49400 142.06900 154.23500 1.000 68.10408  ? 388 GLN A O   1 
ATOM   2747  C CB  . GLN A 1 388 ? 125.58200 141.97500 156.05800 1.000 68.10408  ? 388 GLN A CB  1 
ATOM   2748  C CG  . GLN A 1 388 ? 125.86100 140.46900 155.89000 1.000 68.10408  ? 388 GLN A CG  1 
ATOM   2749  C CD  . GLN A 1 388 ? 124.63500 139.61700 155.61400 1.000 68.10408  ? 388 GLN A CD  1 
ATOM   2750  O OE1 . GLN A 1 388 ? 123.53600 139.90800 156.08600 1.000 68.10408  ? 388 GLN A OE1 1 
ATOM   2751  N NE2 . GLN A 1 388 ? 124.81900 138.56100 154.83700 1.000 68.10408  ? 388 GLN A NE2 1 
ATOM   2752  N N   . LEU A 1 389 ? 124.36400 143.67600 152.93900 1.000 59.85543  ? 389 LEU A N   1 
ATOM   2753  C CA  . LEU A 1 389 ? 123.30900 143.60200 151.92800 1.000 59.85543  ? 389 LEU A CA  1 
ATOM   2754  C C   . LEU A 1 389 ? 123.79300 142.76200 150.74100 1.000 59.85543  ? 389 LEU A C   1 
ATOM   2755  O O   . LEU A 1 389 ? 123.67400 143.11600 149.56900 1.000 59.85543  ? 389 LEU A O   1 
ATOM   2756  C CB  . LEU A 1 389 ? 122.86600 145.00300 151.52100 1.000 59.85543  ? 389 LEU A CB  1 
ATOM   2757  C CG  . LEU A 1 389 ? 123.73400 146.04500 150.80000 1.000 59.85543  ? 389 LEU A CG  1 
ATOM   2758  C CD1 . LEU A 1 389 ? 122.84000 147.03400 150.11500 1.000 59.85543  ? 389 LEU A CD1 1 
ATOM   2759  C CD2 . LEU A 1 389 ? 124.63400 146.78600 151.73500 1.000 59.85543  ? 389 LEU A CD2 1 
ATOM   2760  N N   . VAL A 1 390 ? 124.28900 141.57400 151.06800 1.000 60.02613  ? 390 VAL A N   1 
ATOM   2761  C CA  . VAL A 1 390 ? 124.88200 140.69100 150.07700 1.000 60.02613  ? 390 VAL A CA  1 
ATOM   2762  C C   . VAL A 1 390 ? 123.99900 139.50300 149.74700 1.000 60.02613  ? 390 VAL A C   1 
ATOM   2763  O O   . VAL A 1 390 ? 124.39900 138.65800 148.94500 1.000 60.02613  ? 390 VAL A O   1 
ATOM   2764  C CB  . VAL A 1 390 ? 126.27800 140.21600 150.52200 1.000 60.02613  ? 390 VAL A CB  1 
ATOM   2765  C CG1 . VAL A 1 390 ? 127.14300 141.41100 150.86500 1.000 60.02613  ? 390 VAL A CG1 1 
ATOM   2766  C CG2 . VAL A 1 390 ? 126.16000 139.28400 151.71200 1.000 60.02613  ? 390 VAL A CG2 1 
ATOM   2767  N N   . SER A 1 391 ? 122.80900 139.41000 150.33700 1.000 57.91628  ? 391 SER A N   1 
ATOM   2768  C CA  . SER A 1 391 ? 121.85000 138.36900 149.98800 1.000 57.91628  ? 391 SER A CA  1 
ATOM   2769  C C   . SER A 1 391 ? 120.51400 138.95500 149.54800 1.000 57.91628  ? 391 SER A C   1 
ATOM   2770  O O   . SER A 1 391 ? 119.49900 138.25300 149.55200 1.000 57.91628  ? 391 SER A O   1 
ATOM   2771  C CB  . SER A 1 391 ? 121.65500 137.40700 151.15900 1.000 57.91628  ? 391 SER A CB  1 
ATOM   2772  O OG  . SER A 1 391 ? 122.90600 136.96200 151.64700 1.000 57.91628  ? 391 SER A OG  1 
ATOM   2773  N N   . ASP A 1 392 ? 120.49700 140.23100 149.17300 1.000 54.49479  ? 392 ASP A N   1 
ATOM   2774  C CA  . ASP A 1 392 ? 119.28400 140.86200 148.67500 1.000 54.49479  ? 392 ASP A CA  1 
ATOM   2775  C C   . ASP A 1 392 ? 118.98900 140.36200 147.27300 1.000 54.49479  ? 392 ASP A C   1 
ATOM   2776  O O   . ASP A 1 392 ? 119.75100 140.63100 146.34100 1.000 54.49479  ? 392 ASP A O   1 
ATOM   2777  C CB  . ASP A 1 392 ? 119.43800 142.37700 148.66400 1.000 54.49479  ? 392 ASP A CB  1 
ATOM   2778  C CG  . ASP A 1 392 ? 119.51600 142.95700 150.04300 1.000 54.49479  ? 392 ASP A CG  1 
ATOM   2779  O OD1 . ASP A 1 392 ? 119.48800 142.17400 151.00800 1.000 54.49479  ? 392 ASP A OD1 1 
ATOM   2780  O OD2 . ASP A 1 392 ? 119.60300 144.19400 150.16700 1.000 54.49479  ? 392 ASP A OD2 1 
ATOM   2781  N N   . ILE A 1 393 ? 117.88800 139.63700 147.11700 1.000 46.92478  ? 393 ILE A N   1 
ATOM   2782  C CA  . ILE A 1 393 ? 117.41700 139.24700 145.78500 1.000 46.92478  ? 393 ILE A CA  1 
ATOM   2783  C C   . ILE A 1 393 ? 116.54500 140.40000 145.30900 1.000 46.92478  ? 393 ILE A C   1 
ATOM   2784  O O   . ILE A 1 393 ? 115.31500 140.37200 145.36500 1.000 46.92478  ? 393 ILE A O   1 
ATOM   2785  C CB  . ILE A 1 393 ? 116.68000 137.90800 145.80100 1.000 46.92478  ? 393 ILE A CB  1 
ATOM   2786  N N   . ASP A 1 394 ? 117.20400 141.43900 144.80300 1.000 45.95221  ? 394 ASP A N   1 
ATOM   2787  C CA  . ASP A 1 394 ? 116.50600 142.65800 144.42600 1.000 45.95221  ? 394 ASP A CA  1 
ATOM   2788  C C   . ASP A 1 394 ? 115.91900 142.59300 143.03500 1.000 45.95221  ? 394 ASP A C   1 
ATOM   2789  O O   . ASP A 1 394 ? 115.25100 143.54300 142.61800 1.000 45.95221  ? 394 ASP A O   1 
ATOM   2790  C CB  . ASP A 1 394 ? 117.44500 143.85400 144.51100 1.000 45.95221  ? 394 ASP A CB  1 
ATOM   2791  N N   . ALA A 1 395 ? 116.14700 141.50900 142.30600 1.000 50.16147  ? 395 ALA A N   1 
ATOM   2792  C CA  . ALA A 1 395 ? 115.55800 141.35100 140.98600 1.000 50.16147  ? 395 ALA A CA  1 
ATOM   2793  C C   . ALA A 1 395 ? 114.09100 140.97400 141.13100 1.000 50.16147  ? 395 ALA A C   1 
ATOM   2794  O O   . ALA A 1 395 ? 113.69600 139.83000 140.89000 1.000 50.16147  ? 395 ALA A O   1 
ATOM   2795  C CB  . ALA A 1 395 ? 116.31700 140.30000 140.17900 1.000 50.16147  ? 395 ALA A CB  1 
ATOM   2796  N N   . GLU A 1 396 ? 113.27400 141.93300 141.54700 1.000 42.06971  ? 396 GLU A N   1 
ATOM   2797  C CA  . GLU A 1 396 ? 111.86400 141.63500 141.67100 1.000 42.06971  ? 396 GLU A CA  1 
ATOM   2798  C C   . GLU A 1 396 ? 111.11700 142.05600 140.41800 1.000 42.06971  ? 396 GLU A C   1 
ATOM   2799  O O   . GLU A 1 396 ? 110.73900 141.19300 139.61900 1.000 42.06971  ? 396 GLU A O   1 
ATOM   2800  C CB  . GLU A 1 396 ? 111.30200 142.33500 142.90300 1.000 42.06971  ? 396 GLU A CB  1 
ATOM   2801  N N   . TYR A 1 397 ? 111.03400 143.36500 140.18400 1.000 35.69358  ? 397 TYR A N   1 
ATOM   2802  C CA  . TYR A 1 397 ? 110.28000 143.98400 139.09300 1.000 35.69358  ? 397 TYR A CA  1 
ATOM   2803  C C   . TYR A 1 397 ? 108.89700 143.36800 138.91600 1.000 35.69358  ? 397 TYR A C   1 
ATOM   2804  O O   . TYR A 1 397 ? 108.62000 142.67000 137.94300 1.000 35.69358  ? 397 TYR A O   1 
ATOM   2805  C CB  . TYR A 1 397 ? 111.06400 143.96700 137.79400 1.000 35.69358  ? 397 TYR A CB  1 
ATOM   2806  C CG  . TYR A 1 397 ? 111.80600 145.25500 137.59800 1.000 35.69358  ? 397 TYR A CG  1 
ATOM   2807  C CD1 . TYR A 1 397 ? 111.11700 146.43700 137.39900 1.000 35.69358  ? 397 TYR A CD1 1 
ATOM   2808  C CD2 . TYR A 1 397 ? 113.18800 145.29400 137.62100 1.000 35.69358  ? 397 TYR A CD2 1 
ATOM   2809  C CE1 . TYR A 1 397 ? 111.78100 147.61900 137.22900 1.000 35.69358  ? 397 TYR A CE1 1 
ATOM   2810  C CE2 . TYR A 1 397 ? 113.86300 146.47400 137.44800 1.000 35.69358  ? 397 TYR A CE2 1 
ATOM   2811  C CZ  . TYR A 1 397 ? 113.15400 147.63300 137.25300 1.000 35.69358  ? 397 TYR A CZ  1 
ATOM   2812  O OH  . TYR A 1 397 ? 113.82700 148.81500 137.08200 1.000 35.69358  ? 397 TYR A OH  1 
ATOM   2813  N N   . PHE A 1 398 ? 108.06200 143.58000 139.89500 1.000 35.64374  ? 398 PHE A N   1 
ATOM   2814  C CA  . PHE A 1 398 ? 106.75100 142.96100 139.87000 1.000 35.64374  ? 398 PHE A CA  1 
ATOM   2815  C C   . PHE A 1 398 ? 105.82300 143.70100 138.91000 1.000 35.64374  ? 398 PHE A C   1 
ATOM   2816  O O   . PHE A 1 398 ? 105.87500 144.92700 138.81800 1.000 35.64374  ? 398 PHE A O   1 
ATOM   2817  C CB  . PHE A 1 398 ? 106.14600 142.94600 141.26300 1.000 35.64374  ? 398 PHE A CB  1 
ATOM   2818  C CG  . PHE A 1 398 ? 106.54400 141.75900 142.07500 1.000 35.64374  ? 398 PHE A CG  1 
ATOM   2819  C CD1 . PHE A 1 398 ? 107.83600 141.62500 142.53100 1.000 35.64374  ? 398 PHE A CD1 1 
ATOM   2820  C CD2 . PHE A 1 398 ? 105.62700 140.77300 142.37400 1.000 35.64374  ? 398 PHE A CD2 1 
ATOM   2821  C CE1 . PHE A 1 398 ? 108.21200 140.53400 143.27600 1.000 35.64374  ? 398 PHE A CE1 1 
ATOM   2822  C CE2 . PHE A 1 398 ? 105.99700 139.67900 143.11700 1.000 35.64374  ? 398 PHE A CE2 1 
ATOM   2823  C CZ  . PHE A 1 398 ? 107.29400 139.56200 143.56900 1.000 35.64374  ? 398 PHE A CZ  1 
ATOM   2824  N N   . PRO A 1 399 ? 104.97600 142.98300 138.18300 1.000 36.26388  ? 399 PRO A N   1 
ATOM   2825  C CA  . PRO A 1 399 ? 103.97600 143.63000 137.33700 1.000 36.26388  ? 399 PRO A CA  1 
ATOM   2826  C C   . PRO A 1 399 ? 102.86400 144.23400 138.17200 1.000 36.26388  ? 399 PRO A C   1 
ATOM   2827  O O   . PRO A 1 399 ? 102.79000 143.98300 139.38300 1.000 36.26388  ? 399 PRO A O   1 
ATOM   2828  C CB  . PRO A 1 399 ? 103.46300 142.47000 136.46900 1.000 36.26388  ? 399 PRO A CB  1 
ATOM   2829  C CG  . PRO A 1 399 ? 103.74900 141.26700 137.24700 1.000 36.26388  ? 399 PRO A CG  1 
ATOM   2830  C CD  . PRO A 1 399 ? 105.03100 141.53400 137.94500 1.000 36.26388  ? 399 PRO A CD  1 
ATOM   2831  N N   . PRO A 1 400 ? 101.99800 145.05400 137.58000 1.000 37.43077  ? 400 PRO A N   1 
ATOM   2832  C CA  . PRO A 1 400 ? 100.82900 145.53800 138.31800 1.000 37.43077  ? 400 PRO A CA  1 
ATOM   2833  C C   . PRO A 1 400 ? 99.85000  144.42500 138.64000 1.000 37.43077  ? 400 PRO A C   1 
ATOM   2834  O O   . PRO A 1 400 ? 99.75800  143.42500 137.92400 1.000 37.43077  ? 400 PRO A O   1 
ATOM   2835  C CB  . PRO A 1 400 ? 100.20100 146.55400 137.36100 1.000 37.43077  ? 400 PRO A CB  1 
ATOM   2836  C CG  . PRO A 1 400 ? 100.81100 146.28900 136.05400 1.000 37.43077  ? 400 PRO A CG  1 
ATOM   2837  C CD  . PRO A 1 400 ? 102.18100 145.81800 136.33900 1.000 37.43077  ? 400 PRO A CD  1 
ATOM   2838  N N   . LYS A 1 401 ? 99.13000  144.62200 139.75100 1.000 40.08222  ? 401 LYS A N   1 
ATOM   2839  C CA  . LYS A 1 401 ? 98.08300  143.72400 140.24700 1.000 40.08222  ? 401 LYS A CA  1 
ATOM   2840  C C   . LYS A 1 401 ? 98.60700  142.31400 140.50800 1.000 40.08222  ? 401 LYS A C   1 
ATOM   2841  O O   . LYS A 1 401 ? 97.93900  141.32400 140.21300 1.000 40.08222  ? 401 LYS A O   1 
ATOM   2842  C CB  . LYS A 1 401 ? 96.87800  143.69200 139.30300 1.000 40.08222  ? 401 LYS A CB  1 
ATOM   2843  N N   . GLU A 1 402 ? 99.80700  142.22000 141.07000 1.000 42.74997  ? 402 GLU A N   1 
ATOM   2844  C CA  . GLU A 1 402 ? 100.39600 140.94700 141.45700 1.000 42.74997  ? 402 GLU A CA  1 
ATOM   2845  C C   . GLU A 1 402 ? 100.61400 140.93300 142.95800 1.000 42.74997  ? 402 GLU A C   1 
ATOM   2846  O O   . GLU A 1 402 ? 101.15600 141.88600 143.51900 1.000 42.74997  ? 402 GLU A O   1 
ATOM   2847  C CB  . GLU A 1 402 ? 101.72500 140.69800 140.74300 1.000 42.74997  ? 402 GLU A CB  1 
ATOM   2848  N N   . ASP A 1 403 ? 100.20400 139.84700 143.60400 1.000 46.64157  ? 403 ASP A N   1 
ATOM   2849  C CA  . ASP A 1 403 ? 100.28300 139.72600 145.05300 1.000 46.64157  ? 403 ASP A CA  1 
ATOM   2850  C C   . ASP A 1 403 ? 101.70700 139.37900 145.46300 1.000 46.64157  ? 403 ASP A C   1 
ATOM   2851  O O   . ASP A 1 403 ? 102.25600 138.37000 145.01500 1.000 46.64157  ? 403 ASP A O   1 
ATOM   2852  C CB  . ASP A 1 403 ? 99.31200  138.66400 145.55500 1.000 46.64157  ? 403 ASP A CB  1 
ATOM   2853  C CG  . ASP A 1 403 ? 97.94200  138.79600 144.93700 1.000 46.64157  ? 403 ASP A CG  1 
ATOM   2854  O OD1 . ASP A 1 403 ? 97.60100  139.90300 144.47900 1.000 46.64157  ? 403 ASP A OD1 1 
ATOM   2855  O OD2 . ASP A 1 403 ? 97.20100  137.79400 144.90500 1.000 46.64157  ? 403 ASP A OD2 1 
ATOM   2856  N N   . ILE A 1 404 ? 102.29600 140.20900 146.31600 1.000 43.81185  ? 404 ILE A N   1 
ATOM   2857  C CA  . ILE A 1 404 ? 103.63500 139.95000 146.83200 1.000 43.81185  ? 404 ILE A CA  1 
ATOM   2858  C C   . ILE A 1 404 ? 103.59200 139.07900 148.07400 1.000 43.81185  ? 404 ILE A C   1 
ATOM   2859  O O   . ILE A 1 404 ? 104.37100 138.13600 148.21000 1.000 43.81185  ? 404 ILE A O   1 
ATOM   2860  C CB  . ILE A 1 404 ? 104.34100 141.27800 147.12500 1.000 43.81185  ? 404 ILE A CB  1 
ATOM   2861  C CG1 . ILE A 1 404 ? 104.13700 142.25100 145.97900 1.000 43.81185  ? 404 ILE A CG1 1 
ATOM   2862  C CG2 . ILE A 1 404 ? 105.79800 141.04700 147.38000 1.000 43.81185  ? 404 ILE A CG2 1 
ATOM   2863  C CD1 . ILE A 1 404 ? 104.50500 143.63700 146.35200 1.000 43.81185  ? 404 ILE A CD1 1 
ATOM   2864  N N   . ILE A 1 405 ? 102.68900 139.39800 148.99000 1.000 49.91005  ? 405 ILE A N   1 
ATOM   2865  C CA  . ILE A 1 405 ? 102.55700 138.72400 150.27100 1.000 49.91005  ? 405 ILE A CA  1 
ATOM   2866  C C   . ILE A 1 405 ? 101.08100 138.41800 150.46100 1.000 49.91005  ? 405 ILE A C   1 
ATOM   2867  O O   . ILE A 1 405 ? 100.23300 139.29300 150.26400 1.000 49.91005  ? 405 ILE A O   1 
ATOM   2868  C CB  . ILE A 1 405 ? 103.10200 139.60900 151.41200 1.000 49.91005  ? 405 ILE A CB  1 
ATOM   2869  C CG1 . ILE A 1 405 ? 104.61400 139.51800 151.52400 1.000 49.91005  ? 405 ILE A CG1 1 
ATOM   2870  C CG2 . ILE A 1 405 ? 102.48400 139.28300 152.72800 1.000 49.91005  ? 405 ILE A CG2 1 
ATOM   2871  C CD1 . ILE A 1 405 ? 105.16800 140.51700 152.50200 1.000 49.91005  ? 405 ILE A CD1 1 
ATOM   2872  N N   . LEU A 1 406 ? 100.76700 137.17900 150.81500 1.000 57.23368  ? 406 LEU A N   1 
ATOM   2873  C CA  . LEU A 1 406 ? 99.37800  136.78700 150.98000 1.000 57.23368  ? 406 LEU A CA  1 
ATOM   2874  C C   . LEU A 1 406 ? 98.83800  137.23400 152.33900 1.000 57.23368  ? 406 LEU A C   1 
ATOM   2875  O O   . LEU A 1 406 ? 99.49900  137.93900 153.10200 1.000 57.23368  ? 406 LEU A O   1 
ATOM   2876  C CB  . LEU A 1 406 ? 99.23500  135.28000 150.80900 1.000 57.23368  ? 406 LEU A CB  1 
ATOM   2877  C CG  . LEU A 1 406 ? 99.35700  134.81500 149.36300 1.000 57.23368  ? 406 LEU A CG  1 
ATOM   2878  C CD1 . LEU A 1 406 ? 99.53800  133.31900 149.31900 1.000 57.23368  ? 406 LEU A CD1 1 
ATOM   2879  C CD2 . LEU A 1 406 ? 98.13200  135.23200 148.57600 1.000 57.23368  ? 406 LEU A CD2 1 
ATOM   2880  N N   . GLN A 1 407 ? 97.60500  136.82000 152.63300 1.000 63.64750  ? 407 GLN A N   1 
ATOM   2881  C CA  . GLN A 1 407 ? 96.95500  137.24500 153.86900 1.000 63.64750  ? 407 GLN A CA  1 
ATOM   2882  C C   . GLN A 1 407 ? 97.58200  136.56900 155.08100 1.000 63.64750  ? 407 GLN A C   1 
ATOM   2883  O O   . GLN A 1 407 ? 97.94400  137.23200 156.05700 1.000 63.64750  ? 407 GLN A O   1 
ATOM   2884  C CB  . GLN A 1 407 ? 95.46000  136.95100 153.80100 1.000 63.64750  ? 407 GLN A CB  1 
ATOM   2885  C CG  . GLN A 1 407 ? 94.75800  137.03300 155.13600 1.000 63.64750  ? 407 GLN A CG  1 
ATOM   2886  C CD  . GLN A 1 407 ? 94.71300  138.43800 155.68600 1.000 63.64750  ? 407 GLN A CD  1 
ATOM   2887  O OE1 . GLN A 1 407 ? 95.46300  138.78300 156.59600 1.000 63.64750  ? 407 GLN A OE1 1 
ATOM   2888  N NE2 . GLN A 1 407 ? 93.82400  139.25700 155.14200 1.000 63.64750  ? 407 GLN A NE2 1 
ATOM   2889  N N   . ASN A 1 408 ? 97.72600  135.25000 155.03500 1.000 65.39282  ? 408 ASN A N   1 
ATOM   2890  C CA  . ASN A 1 408 ? 98.40600  134.50000 156.08400 1.000 65.39282  ? 408 ASN A CA  1 
ATOM   2891  C C   . ASN A 1 408 ? 99.44600  133.61600 155.42500 1.000 65.39282  ? 408 ASN A C   1 
ATOM   2892  O O   . ASN A 1 408 ? 99.14000  132.92100 154.45400 1.000 65.39282  ? 408 ASN A O   1 
ATOM   2893  C CB  . ASN A 1 408 ? 97.41900  133.66000 156.89400 1.000 65.39282  ? 408 ASN A CB  1 
ATOM   2894  C CG  . ASN A 1 408 ? 96.13900  134.39700 157.18800 1.000 65.39282  ? 408 ASN A CG  1 
ATOM   2895  O OD1 . ASN A 1 408 ? 95.06100  133.98200 156.77200 1.000 65.39282  ? 408 ASN A OD1 1 
ATOM   2896  N ND2 . ASN A 1 408 ? 96.24900  135.50100 157.91400 1.000 65.39282  ? 408 ASN A ND2 1 
ATOM   2897  N N   . GLU A 1 409 ? 100.66700 133.64400 155.94300 1.000 65.50733  ? 409 GLU A N   1 
ATOM   2898  C CA  . GLU A 1 409 ? 101.74800 132.89300 155.33100 1.000 65.50733  ? 409 GLU A CA  1 
ATOM   2899  C C   . GLU A 1 409 ? 102.83300 132.67500 156.36500 1.000 65.50733  ? 409 GLU A C   1 
ATOM   2900  O O   . GLU A 1 409 ? 102.87300 133.35800 157.39000 1.000 65.50733  ? 409 GLU A O   1 
ATOM   2901  C CB  . GLU A 1 409 ? 102.33100 133.62200 154.11800 1.000 65.50733  ? 409 GLU A CB  1 
ATOM   2902  N N   . ALA A 1 410 ? 103.70400 131.71100 156.08700 1.000 69.29957  ? 410 ALA A N   1 
ATOM   2903  C CA  . ALA A 1 410 ? 104.92300 131.52400 156.85800 1.000 69.29957  ? 410 ALA A CA  1 
ATOM   2904  C C   . ALA A 1 410 ? 105.79600 132.75000 156.62700 1.000 69.29957  ? 410 ALA A C   1 
ATOM   2905  O O   . ALA A 1 410 ? 106.29500 132.95100 155.51500 1.000 69.29957  ? 410 ALA A O   1 
ATOM   2906  C CB  . ALA A 1 410 ? 105.64900 130.24400 156.44600 1.000 69.29957  ? 410 ALA A CB  1 
ATOM   2907  N N   . PRO A 1 411 ? 105.99800 133.58500 157.63500 1.000 65.58323  ? 411 PRO A N   1 
ATOM   2908  C CA  . PRO A 1 411 ? 106.59000 134.90600 157.39200 1.000 65.58323  ? 411 PRO A CA  1 
ATOM   2909  C C   . PRO A 1 411 ? 108.08400 134.84300 157.11300 1.000 65.58323  ? 411 PRO A C   1 
ATOM   2910  O O   . PRO A 1 411 ? 108.91900 135.06100 157.99500 1.000 65.58323  ? 411 PRO A O   1 
ATOM   2911  C CB  . PRO A 1 411 ? 106.27100 135.66200 158.68300 1.000 65.58323  ? 411 PRO A CB  1 
ATOM   2912  C CG  . PRO A 1 411 ? 106.15100 134.62200 159.71800 1.000 65.58323  ? 411 PRO A CG  1 
ATOM   2913  C CD  . PRO A 1 411 ? 105.70200 133.35500 159.06000 1.000 65.58323  ? 411 PRO A CD  1 
ATOM   2914  N N   . THR A 1 412 ? 108.41700 134.55700 155.85700 1.000 63.99402  ? 412 THR A N   1 
ATOM   2915  C CA  . THR A 1 412 ? 109.78000 134.19700 155.49800 1.000 63.99402  ? 412 THR A CA  1 
ATOM   2916  C C   . THR A 1 412 ? 110.65300 135.41600 155.21400 1.000 63.99402  ? 412 THR A C   1 
ATOM   2917  O O   . THR A 1 412 ? 111.87000 135.36000 155.42100 1.000 63.99402  ? 412 THR A O   1 
ATOM   2918  C CB  . THR A 1 412 ? 109.75400 133.26800 154.28300 1.000 63.99402  ? 412 THR A CB  1 
ATOM   2919  O OG1 . THR A 1 412 ? 108.68800 132.32600 154.43700 1.000 63.99402  ? 412 THR A OG1 1 
ATOM   2920  C CG2 . THR A 1 412 ? 111.05400 132.49600 154.16100 1.000 63.99402  ? 412 THR A CG2 1 
ATOM   2921  N N   . ASP A 1 413 ? 110.07200 136.53200 154.77900 1.000 57.31546  ? 413 ASP A N   1 
ATOM   2922  C CA  . ASP A 1 413 ? 110.88800 137.59900 154.22200 1.000 57.31546  ? 413 ASP A CA  1 
ATOM   2923  C C   . ASP A 1 413 ? 110.23800 138.95900 154.40700 1.000 57.31546  ? 413 ASP A C   1 
ATOM   2924  O O   . ASP A 1 413 ? 109.01400 139.08300 154.41800 1.000 57.31546  ? 413 ASP A O   1 
ATOM   2925  C CB  . ASP A 1 413 ? 111.13900 137.33100 152.74100 1.000 57.31546  ? 413 ASP A CB  1 
ATOM   2926  C CG  . ASP A 1 413 ? 109.94100 136.73100 152.05600 1.000 57.31546  ? 413 ASP A CG  1 
ATOM   2927  O OD1 . ASP A 1 413 ? 108.90200 136.55400 152.72700 1.000 57.31546  ? 413 ASP A OD1 1 
ATOM   2928  O OD2 . ASP A 1 413 ? 110.03900 136.40900 150.85600 1.000 57.31546  ? 413 ASP A OD2 1 
ATOM   2929  N N   . LEU A 1 414 ? 111.08200 139.97700 154.55100 1.000 50.75271  ? 414 LEU A N   1 
ATOM   2930  C CA  . LEU A 1 414 ? 110.66600 141.36700 154.46600 1.000 50.75271  ? 414 LEU A CA  1 
ATOM   2931  C C   . LEU A 1 414 ? 111.02200 141.88700 153.08500 1.000 50.75271  ? 414 LEU A C   1 
ATOM   2932  O O   . LEU A 1 414 ? 111.96000 141.39600 152.45500 1.000 50.75271  ? 414 LEU A O   1 
ATOM   2933  C CB  . LEU A 1 414 ? 111.33100 142.23900 155.54200 1.000 50.75271  ? 414 LEU A CB  1 
ATOM   2934  C CG  . LEU A 1 414 ? 112.82800 142.57800 155.58900 1.000 50.75271  ? 414 LEU A CG  1 
ATOM   2935  C CD1 . LEU A 1 414 ? 113.20400 143.84800 154.84100 1.000 50.75271  ? 414 LEU A CD1 1 
ATOM   2936  C CD2 . LEU A 1 414 ? 113.26100 142.73800 157.00800 1.000 50.75271  ? 414 LEU A CD2 1 
ATOM   2937  N N   . TYR A 1 415 ? 110.29400 142.89500 152.62900 1.000 46.73836  ? 415 TYR A N   1 
ATOM   2938  C CA  . TYR A 1 415 ? 110.53400 143.50400 151.33400 1.000 46.73836  ? 415 TYR A CA  1 
ATOM   2939  C C   . TYR A 1 415 ? 110.71200 145.00300 151.50000 1.000 46.73836  ? 415 TYR A C   1 
ATOM   2940  O O   . TYR A 1 415 ? 110.08100 145.62200 152.35500 1.000 46.73836  ? 415 TYR A O   1 
ATOM   2941  C CB  . TYR A 1 415 ? 109.38000 143.23300 150.37400 1.000 46.73836  ? 415 TYR A CB  1 
ATOM   2942  C CG  . TYR A 1 415 ? 109.12700 141.78100 150.06000 1.000 46.73836  ? 415 TYR A CG  1 
ATOM   2943  C CD1 . TYR A 1 415 ? 108.36700 140.99000 150.90000 1.000 46.73836  ? 415 TYR A CD1 1 
ATOM   2944  C CD2 . TYR A 1 415 ? 109.62700 141.21100 148.90300 1.000 46.73836  ? 415 TYR A CD2 1 
ATOM   2945  C CE1 . TYR A 1 415 ? 108.13100 139.67000 150.61000 1.000 46.73836  ? 415 TYR A CE1 1 
ATOM   2946  C CE2 . TYR A 1 415 ? 109.38800 139.89300 148.60300 1.000 46.73836  ? 415 TYR A CE2 1 
ATOM   2947  C CZ  . TYR A 1 415 ? 108.64200 139.12800 149.46200 1.000 46.73836  ? 415 TYR A CZ  1 
ATOM   2948  O OH  . TYR A 1 415 ? 108.40100 137.80900 149.17100 1.000 46.73836  ? 415 TYR A OH  1 
ATOM   2949  N N   . ILE A 1 416 ? 111.56900 145.58500 150.67200 1.000 41.33196  ? 416 ILE A N   1 
ATOM   2950  C CA  . ILE A 1 416 ? 111.83100 147.01700 150.67700 1.000 41.33196  ? 416 ILE A CA  1 
ATOM   2951  C C   . ILE A 1 416 ? 111.49500 147.56100 149.30200 1.000 41.33196  ? 416 ILE A C   1 
ATOM   2952  O O   . ILE A 1 416 ? 112.10300 147.15500 148.30900 1.000 41.33196  ? 416 ILE A O   1 
ATOM   2953  C CB  . ILE A 1 416 ? 113.29300 147.32700 151.03000 1.000 41.33196  ? 416 ILE A CB  1 
ATOM   2954  C CG1 . ILE A 1 416 ? 113.63600 146.77400 152.40500 1.000 41.33196  ? 416 ILE A CG1 1 
ATOM   2955  C CG2 . ILE A 1 416 ? 113.54500 148.80800 150.97600 1.000 41.33196  ? 416 ILE A CG2 1 
ATOM   2956  C CD1 . ILE A 1 416 ? 115.10500 146.71800 152.66300 1.000 41.33196  ? 416 ILE A CD1 1 
ATOM   2957  N N   . LEU A 1 417 ? 110.54800 148.48400 149.24500 1.000 39.93121  ? 417 LEU A N   1 
ATOM   2958  C CA  . LEU A 1 417 ? 110.06700 149.02700 147.98400 1.000 39.93121  ? 417 LEU A CA  1 
ATOM   2959  C C   . LEU A 1 417 ? 111.07200 150.02900 147.43500 1.000 39.93121  ? 417 LEU A C   1 
ATOM   2960  O O   . LEU A 1 417 ? 111.30800 151.07000 148.04700 1.000 39.93121  ? 417 LEU A O   1 
ATOM   2961  C CB  . LEU A 1 417 ? 108.71400 149.69300 148.20100 1.000 39.93121  ? 417 LEU A CB  1 
ATOM   2962  C CG  . LEU A 1 417 ? 107.77200 149.89600 147.02900 1.000 39.93121  ? 417 LEU A CG  1 
ATOM   2963  C CD1 . LEU A 1 417 ? 106.36600 149.80600 147.53900 1.000 39.93121  ? 417 LEU A CD1 1 
ATOM   2964  C CD2 . LEU A 1 417 ? 107.98400 151.22700 146.36700 1.000 39.93121  ? 417 LEU A CD2 1 
ATOM   2965  N N   . VAL A 1 418 ? 111.65100 149.72400 146.27800 1.000 38.83663  ? 418 VAL A N   1 
ATOM   2966  C CA  . VAL A 1 418 ? 112.64300 150.60300 145.66900 1.000 38.83663  ? 418 VAL A CA  1 
ATOM   2967  C C   . VAL A 1 418 ? 111.99000 151.68100 144.81500 1.000 38.83663  ? 418 VAL A C   1 
ATOM   2968  O O   . VAL A 1 418 ? 112.32000 152.86000 144.94500 1.000 38.83663  ? 418 VAL A O   1 
ATOM   2969  C CB  . VAL A 1 418 ? 113.65700 149.78300 144.84800 1.000 38.83663  ? 418 VAL A CB  1 
ATOM   2970  C CG1 . VAL A 1 418 ? 114.72800 150.68400 144.29200 1.000 38.83663  ? 418 VAL A CG1 1 
ATOM   2971  C CG2 . VAL A 1 418 ? 114.27900 148.71000 145.70500 1.000 38.83663  ? 418 VAL A CG2 1 
ATOM   2972  N N   . SER A 1 419 ? 111.05500 151.30300 143.94600 1.000 39.77114  ? 419 SER A N   1 
ATOM   2973  C CA  . SER A 1 419 ? 110.37600 152.26300 143.08500 1.000 39.77114  ? 419 SER A CA  1 
ATOM   2974  C C   . SER A 1 419 ? 109.04300 151.68000 142.65900 1.000 39.77114  ? 419 SER A C   1 
ATOM   2975  O O   . SER A 1 419 ? 109.00200 150.57300 142.12600 1.000 39.77114  ? 419 SER A O   1 
ATOM   2976  C CB  . SER A 1 419 ? 111.21700 152.58900 141.85400 1.000 39.77114  ? 419 SER A CB  1 
ATOM   2977  O OG  . SER A 1 419 ? 111.44800 151.42200 141.08700 1.000 39.77114  ? 419 SER A OG  1 
ATOM   2978  N N   . GLY A 1 420 ? 107.96700 152.42600 142.87300 1.000 41.16924  ? 420 GLY A N   1 
ATOM   2979  C CA  . GLY A 1 420 ? 106.64300 151.94700 142.53400 1.000 41.16924  ? 420 GLY A CA  1 
ATOM   2980  C C   . GLY A 1 420 ? 105.63300 152.28200 143.60700 1.000 41.16924  ? 420 GLY A C   1 
ATOM   2981  O O   . GLY A 1 420 ? 105.80000 153.27700 144.31500 1.000 41.16924  ? 420 GLY A O   1 
ATOM   2982  N N   . ALA A 1 421 ? 104.58900 151.46900 143.74600 1.000 43.55533  ? 421 ALA A N   1 
ATOM   2983  C CA  . ALA A 1 421 ? 103.60000 151.67700 144.79400 1.000 43.55533  ? 421 ALA A CA  1 
ATOM   2984  C C   . ALA A 1 421 ? 102.88900 150.36500 145.07500 1.000 43.55533  ? 421 ALA A C   1 
ATOM   2985  O O   . ALA A 1 421 ? 102.75000 149.52000 144.19100 1.000 43.55533  ? 421 ALA A O   1 
ATOM   2986  C CB  . ALA A 1 421 ? 102.58500 152.75900 144.41300 1.000 43.55533  ? 421 ALA A CB  1 
ATOM   2987  N N   . VAL A 1 422 ? 102.43100 150.21800 146.31900 1.000 47.38496  ? 422 VAL A N   1 
ATOM   2988  C CA  . VAL A 1 422 ? 101.86100 148.98200 146.84300 1.000 47.38496  ? 422 VAL A CA  1 
ATOM   2989  C C   . VAL A 1 422 ? 100.69300 149.34000 147.75300 1.000 47.38496  ? 422 VAL A C   1 
ATOM   2990  O O   . VAL A 1 422 ? 100.77200 150.26900 148.55600 1.000 47.38496  ? 422 VAL A O   1 
ATOM   2991  C CB  . VAL A 1 422 ? 102.94900 148.16400 147.58500 1.000 47.38496  ? 422 VAL A CB  1 
ATOM   2992  C CG1 . VAL A 1 422 ? 102.37900 147.24400 148.61800 1.000 47.38496  ? 422 VAL A CG1 1 
ATOM   2993  C CG2 . VAL A 1 422 ? 103.73600 147.33700 146.59800 1.000 47.38496  ? 422 VAL A CG2 1 
ATOM   2994  N N   . ASP A 1 423 ? 99.59100  148.60100 147.61600 1.000 50.77945  ? 423 ASP A N   1 
ATOM   2995  C CA  . ASP A 1 423 ? 98.38700  148.86700 148.39500 1.000 50.77945  ? 423 ASP A CA  1 
ATOM   2996  C C   . ASP A 1 423 ? 98.04100  147.65400 149.24400 1.000 50.77945  ? 423 ASP A C   1 
ATOM   2997  O O   . ASP A 1 423 ? 97.78700  146.57400 148.70800 1.000 50.77945  ? 423 ASP A O   1 
ATOM   2998  C CB  . ASP A 1 423 ? 97.21400  149.22300 147.48000 1.000 50.77945  ? 423 ASP A CB  1 
ATOM   2999  N N   . PHE A 1 424 ? 98.01600  147.84000 150.56300 1.000 55.94145  ? 424 PHE A N   1 
ATOM   3000  C CA  . PHE A 1 424 ? 97.62900  146.79400 151.49600 1.000 55.94145  ? 424 PHE A CA  1 
ATOM   3001  C C   . PHE A 1 424 ? 96.11700  146.61500 151.51300 1.000 55.94145  ? 424 PHE A C   1 
ATOM   3002  O O   . PHE A 1 424 ? 95.35300  147.53900 151.23100 1.000 55.94145  ? 424 PHE A O   1 
ATOM   3003  C CB  . PHE A 1 424 ? 98.09300  147.12400 152.91100 1.000 55.94145  ? 424 PHE A CB  1 
ATOM   3004  C CG  . PHE A 1 424 ? 99.54500  147.43300 153.01800 1.000 55.94145  ? 424 PHE A CG  1 
ATOM   3005  C CD1 . PHE A 1 424 ? 100.48100 146.60500 152.45200 1.000 55.94145  ? 424 PHE A CD1 1 
ATOM   3006  C CD2 . PHE A 1 424 ? 99.97400  148.55100 153.69700 1.000 55.94145  ? 424 PHE A CD2 1 
ATOM   3007  C CE1 . PHE A 1 424 ? 101.81800 146.88900 152.55600 1.000 55.94145  ? 424 PHE A CE1 1 
ATOM   3008  C CE2 . PHE A 1 424 ? 101.30500 148.84000 153.80500 1.000 55.94145  ? 424 PHE A CE2 1 
ATOM   3009  C CZ  . PHE A 1 424 ? 102.22700 148.00900 153.23700 1.000 55.94145  ? 424 PHE A CZ  1 
ATOM   3010  N N   . THR A 1 425 ? 95.68700  145.40500 151.85800 1.000 62.29341  ? 425 THR A N   1 
ATOM   3011  C CA  . THR A 1 425 ? 94.27100  145.12800 152.03600 1.000 62.29341  ? 425 THR A CA  1 
ATOM   3012  C C   . THR A 1 425 ? 94.09600  144.12000 153.16200 1.000 62.29341  ? 425 THR A C   1 
ATOM   3013  O O   . THR A 1 425 ? 95.05700  143.51200 153.63700 1.000 62.29341  ? 425 THR A O   1 
ATOM   3014  C CB  . THR A 1 425 ? 93.62800  144.60900 150.75300 1.000 62.29341  ? 425 THR A CB  1 
ATOM   3015  O OG1 . THR A 1 425 ? 92.25500  144.29400 151.00500 1.000 62.29341  ? 425 THR A OG1 1 
ATOM   3016  C CG2 . THR A 1 425 ? 94.32200  143.36300 150.29800 1.000 62.29341  ? 425 THR A CG2 1 
ATOM   3017  N N   . VAL A 1 426 ? 92.84600  143.95800 153.59400 1.000 68.40047  ? 426 VAL A N   1 
ATOM   3018  C CA  . VAL A 1 426 ? 92.49900  143.03200 154.66700 1.000 68.40047  ? 426 VAL A CA  1 
ATOM   3019  C C   . VAL A 1 426 ? 91.61600  141.98500 153.98500 1.000 68.40047  ? 426 VAL A C   1 
ATOM   3020  O O   . VAL A 1 426 ? 91.36200  142.09600 152.78200 1.000 68.40047  ? 426 VAL A O   1 
ATOM   3021  C CB  . VAL A 1 426 ? 91.80700  143.77200 155.83600 1.000 68.40047  ? 426 VAL A CB  1 
ATOM   3022  C CG1 . VAL A 1 426 ? 91.85300  142.98000 157.15600 1.000 68.40047  ? 426 VAL A CG1 1 
ATOM   3023  C CG2 . VAL A 1 426 ? 92.41000  145.15600 156.04200 1.000 68.40047  ? 426 VAL A CG2 1 
ATOM   3024  N N   . TYR A 1 427 ? 91.15200  140.97300 154.73100 1.000 72.59701  ? 427 TYR A N   1 
ATOM   3025  C CA  . TYR A 1 427 ? 90.54800  139.73000 154.24800 1.000 72.59701  ? 427 TYR A CA  1 
ATOM   3026  C C   . TYR A 1 427 ? 89.44200  139.85200 153.20000 1.000 72.59701  ? 427 TYR A C   1 
ATOM   3027  O O   . TYR A 1 427 ? 89.30900  138.97300 152.34200 1.000 72.59701  ? 427 TYR A O   1 
ATOM   3028  C CB  . TYR A 1 427 ? 89.99800  138.94500 155.44100 1.000 72.59701  ? 427 TYR A CB  1 
ATOM   3029  N N   . VAL A 1 428 ? 88.63500  140.91000 153.25400 1.000 74.59610  ? 428 VAL A N   1 
ATOM   3030  C CA  . VAL A 1 428 ? 87.58700  141.08300 152.25100 1.000 74.59610  ? 428 VAL A CA  1 
ATOM   3031  C C   . VAL A 1 428 ? 87.88300  142.31600 151.41000 1.000 74.59610  ? 428 VAL A C   1 
ATOM   3032  O O   . VAL A 1 428 ? 88.15900  142.21000 150.21000 1.000 74.59610  ? 428 VAL A O   1 
ATOM   3033  C CB  . VAL A 1 428 ? 86.19200  141.19200 152.89800 1.000 74.59610  ? 428 VAL A CB  1 
ATOM   3034  C CG1 . VAL A 1 428 ? 85.10600  141.06100 151.83800 1.000 74.59610  ? 428 VAL A CG1 1 
ATOM   3035  C CG2 . VAL A 1 428 ? 86.01100  140.14100 153.98600 1.000 74.59610  ? 428 VAL A CG2 1 
ATOM   3036  N N   . ASP A 1 429 ? 87.84000  143.49300 152.04000 1.000 76.17141  ? 429 ASP A N   1 
ATOM   3037  C CA  . ASP A 1 429 ? 88.15300  144.74500 151.35200 1.000 76.17141  ? 429 ASP A CA  1 
ATOM   3038  C C   . ASP A 1 429 ? 88.56000  145.76500 152.41600 1.000 76.17141  ? 429 ASP A C   1 
ATOM   3039  O O   . ASP A 1 429 ? 87.69600  146.36300 153.06200 1.000 76.17141  ? 429 ASP A O   1 
ATOM   3040  C CB  . ASP A 1 429 ? 86.97000  145.24000 150.53400 1.000 76.17141  ? 429 ASP A CB  1 
ATOM   3041  N N   . GLY A 1 430 ? 89.86200  145.95700 152.57800 1.000 69.81486  ? 430 GLY A N   1 
ATOM   3042  C CA  . GLY A 1 430 ? 90.36200  146.98200 153.46900 1.000 69.81486  ? 430 GLY A CA  1 
ATOM   3043  C C   . GLY A 1 430 ? 91.26100  147.92600 152.70900 1.000 69.81486  ? 430 GLY A C   1 
ATOM   3044  O O   . GLY A 1 430 ? 91.34700  147.82300 151.48200 1.000 69.81486  ? 430 GLY A O   1 
ATOM   3045  N N   . HIS A 1 431 ? 91.93900  148.83900 153.40500 1.000 67.62649  ? 431 HIS A N   1 
ATOM   3046  C CA  . HIS A 1 431 ? 92.87000  149.72900 152.72500 1.000 67.62649  ? 431 HIS A CA  1 
ATOM   3047  C C   . HIS A 1 431 ? 93.94600  150.30200 153.63600 1.000 67.62649  ? 431 HIS A C   1 
ATOM   3048  O O   . HIS A 1 431 ? 93.65100  151.00700 154.60400 1.000 67.62649  ? 431 HIS A O   1 
ATOM   3049  C CB  . HIS A 1 431 ? 92.13400  150.89100 152.05800 1.000 67.62649  ? 431 HIS A CB  1 
ATOM   3050  C CG  . HIS A 1 431 ? 92.99800  151.67700 151.12700 1.000 67.62649  ? 431 HIS A CG  1 
ATOM   3051  N ND1 . HIS A 1 431 ? 93.24700  151.27800 149.83300 1.000 67.62649  ? 431 HIS A ND1 1 
ATOM   3052  C CD2 . HIS A 1 431 ? 93.69700  152.82100 151.31100 1.000 67.62649  ? 431 HIS A CD2 1 
ATOM   3053  C CE1 . HIS A 1 431 ? 94.04900  152.15200 149.25300 1.000 67.62649  ? 431 HIS A CE1 1 
ATOM   3054  N NE2 . HIS A 1 431 ? 94.33800  153.09800 150.12800 1.000 67.62649  ? 431 HIS A NE2 1 
ATOM   3055  N N   . ASP A 1 432 ? 95.20000  149.98500 153.32800 1.000 63.31175  ? 432 ASP A N   1 
ATOM   3056  C CA  . ASP A 1 432 ? 96.37100  150.71800 153.78700 1.000 63.31175  ? 432 ASP A CA  1 
ATOM   3057  C C   . ASP A 1 432 ? 97.31400  150.79400 152.59100 1.000 63.31175  ? 432 ASP A C   1 
ATOM   3058  O O   . ASP A 1 432 ? 97.12000  150.08200 151.60500 1.000 63.31175  ? 432 ASP A O   1 
ATOM   3059  C CB  . ASP A 1 432 ? 97.05000  150.04300 154.98700 1.000 63.31175  ? 432 ASP A CB  1 
ATOM   3060  C CG  . ASP A 1 432 ? 96.07200  149.61900 156.07300 1.000 63.31175  ? 432 ASP A CG  1 
ATOM   3061  O OD1 . ASP A 1 432 ? 95.30000  148.66000 155.85700 1.000 63.31175  ? 432 ASP A OD1 1 
ATOM   3062  O OD2 . ASP A 1 432 ? 96.09600  150.23300 157.15700 1.000 63.31175  ? 432 ASP A OD2 1 
ATOM   3063  N N   . GLN A 1 433 ? 98.32600  151.65700 152.66700 1.000 59.33227  ? 433 GLN A N   1 
ATOM   3064  C CA  . GLN A 1 433 ? 99.17400  151.89200 151.50200 1.000 59.33227  ? 433 GLN A CA  1 
ATOM   3065  C C   . GLN A 1 433 ? 100.58900 152.27400 151.91500 1.000 59.33227  ? 433 GLN A C   1 
ATOM   3066  O O   . GLN A 1 433 ? 100.77900 153.12300 152.78900 1.000 59.33227  ? 433 GLN A O   1 
ATOM   3067  C CB  . GLN A 1 433 ? 98.56400  152.98200 150.60800 1.000 59.33227  ? 433 GLN A CB  1 
ATOM   3068  C CG  . GLN A 1 433 ? 99.55700  153.76000 149.76400 1.000 59.33227  ? 433 GLN A CG  1 
ATOM   3069  C CD  . GLN A 1 433 ? 98.90600  154.46200 148.59900 1.000 59.33227  ? 433 GLN A CD  1 
ATOM   3070  O OE1 . GLN A 1 433 ? 97.71900  154.27900 148.33400 1.000 59.33227  ? 433 GLN A OE1 1 
ATOM   3071  N NE2 . GLN A 1 433 ? 99.68100  155.27100 147.89100 1.000 59.33227  ? 433 GLN A NE2 1 
ATOM   3072  N N   . PHE A 1 434 ? 101.57700 151.64300 151.28000 1.000 55.00893  ? 434 PHE A N   1 
ATOM   3073  C CA  . PHE A 1 434 ? 102.98500 151.95300 151.48500 1.000 55.00893  ? 434 PHE A CA  1 
ATOM   3074  C C   . PHE A 1 434 ? 103.47900 152.90400 150.40400 1.000 55.00893  ? 434 PHE A C   1 
ATOM   3075  O O   . PHE A 1 434 ? 103.02000 152.85300 149.26000 1.000 55.00893  ? 434 PHE A O   1 
ATOM   3076  C CB  . PHE A 1 434 ? 103.83900 150.68700 151.47400 1.000 55.00893  ? 434 PHE A CB  1 
ATOM   3077  N N   . GLN A 1 435 ? 104.43000 153.75600 150.77100 1.000 52.96629  ? 435 GLN A N   1 
ATOM   3078  C CA  . GLN A 1 435 ? 104.92600 154.80700 149.89300 1.000 52.96629  ? 435 GLN A CA  1 
ATOM   3079  C C   . GLN A 1 435 ? 106.05000 154.26300 149.01700 1.000 52.96629  ? 435 GLN A C   1 
ATOM   3080  O O   . GLN A 1 435 ? 106.27900 153.05500 148.93400 1.000 52.96629  ? 435 GLN A O   1 
ATOM   3081  C CB  . GLN A 1 435 ? 105.37600 156.01100 150.71400 1.000 52.96629  ? 435 GLN A CB  1 
ATOM   3082  N N   . GLY A 1 436 ? 106.76900 155.15800 148.35300 1.000 44.99106  ? 436 GLY A N   1 
ATOM   3083  C CA  . GLY A 1 436 ? 107.78200 154.79500 147.38900 1.000 44.99106  ? 436 GLY A CA  1 
ATOM   3084  C C   . GLY A 1 436 ? 109.14100 154.42000 147.93500 1.000 44.99106  ? 436 GLY A C   1 
ATOM   3085  O O   . GLY A 1 436 ? 110.06300 154.22500 147.13800 1.000 44.99106  ? 436 GLY A O   1 
ATOM   3086  N N   . LYS A 1 437 ? 109.32400 154.35400 149.26000 1.000 44.62203  ? 437 LYS A N   1 
ATOM   3087  C CA  . LYS A 1 437 ? 110.60100 153.88400 149.78500 1.000 44.62203  ? 437 LYS A CA  1 
ATOM   3088  C C   . LYS A 1 437 ? 110.50000 153.04600 151.05700 1.000 44.62203  ? 437 LYS A C   1 
ATOM   3089  O O   . LYS A 1 437 ? 111.53500 152.82100 151.69600 1.000 44.62203  ? 437 LYS A O   1 
ATOM   3090  C CB  . LYS A 1 437 ? 111.53000 155.06800 150.04400 1.000 44.62203  ? 437 LYS A CB  1 
ATOM   3091  N N   . ALA A 1 438 ? 109.32400 152.57300 151.45000 1.000 46.31791  ? 438 ALA A N   1 
ATOM   3092  C CA  . ALA A 1 438 ? 109.12400 152.03400 152.78700 1.000 46.31791  ? 438 ALA A CA  1 
ATOM   3093  C C   . ALA A 1 438 ? 109.33300 150.52000 152.81700 1.000 46.31791  ? 438 ALA A C   1 
ATOM   3094  O O   . ALA A 1 438 ? 109.72400 149.90100 151.82900 1.000 46.31791  ? 438 ALA A O   1 
ATOM   3095  C CB  . ALA A 1 438 ? 107.73600 152.41700 153.29100 1.000 46.31791  ? 438 ALA A CB  1 
ATOM   3096  N N   . VAL A 1 439 ? 109.07500 149.91500 153.97600 1.000 47.96521  ? 439 VAL A N   1 
ATOM   3097  C CA  . VAL A 1 439 ? 109.19500 148.47900 154.20300 1.000 47.96521  ? 439 VAL A CA  1 
ATOM   3098  C C   . VAL A 1 439 ? 107.79900 147.90500 154.36200 1.000 47.96521  ? 439 VAL A C   1 
ATOM   3099  O O   . VAL A 1 439 ? 106.94700 148.49700 155.02900 1.000 47.96521  ? 439 VAL A O   1 
ATOM   3100  C CB  . VAL A 1 439 ? 110.04200 148.18400 155.45500 1.000 47.96521  ? 439 VAL A CB  1 
ATOM   3101  C CG1 . VAL A 1 439 ? 110.49900 146.74500 155.47000 1.000 47.96521  ? 439 VAL A CG1 1 
ATOM   3102  C CG2 . VAL A 1 439 ? 111.21400 149.12900 155.53300 1.000 47.96521  ? 439 VAL A CG2 1 
ATOM   3103  N N   . ILE A 1 440 ? 107.55300 146.74900 153.74700 1.000 48.25927  ? 440 ILE A N   1 
ATOM   3104  C CA  . ILE A 1 440 ? 106.18300 146.25200 153.67600 1.000 48.25927  ? 440 ILE A CA  1 
ATOM   3105  C C   . ILE A 1 440 ? 106.01100 144.89400 154.34600 1.000 48.25927  ? 440 ILE A C   1 
ATOM   3106  O O   . ILE A 1 440 ? 104.93600 144.29400 154.26200 1.000 48.25927  ? 440 ILE A O   1 
ATOM   3107  C CB  . ILE A 1 440 ? 105.68800 146.18500 152.21600 1.000 48.25927  ? 440 ILE A CB  1 
ATOM   3108  C CG1 . ILE A 1 440 ? 106.45900 145.13800 151.42200 1.000 48.25927  ? 440 ILE A CG1 1 
ATOM   3109  C CG2 . ILE A 1 440 ? 105.81200 147.53000 151.53000 1.000 48.25927  ? 440 ILE A CG2 1 
ATOM   3110  C CD1 . ILE A 1 440 ? 106.04800 145.03200 149.97600 1.000 48.25927  ? 440 ILE A CD1 1 
ATOM   3111  N N   . GLY A 1 441 ? 107.04200 144.39200 155.01900 1.000 51.14125  ? 441 GLY A N   1 
ATOM   3112  C CA  . GLY A 1 441 ? 106.90900 143.07400 155.61700 1.000 51.14125  ? 441 GLY A CA  1 
ATOM   3113  C C   . GLY A 1 441 ? 107.56200 142.85900 156.96700 1.000 51.14125  ? 441 GLY A C   1 
ATOM   3114  O O   . GLY A 1 441 ? 107.90500 141.72600 157.30900 1.000 51.14125  ? 441 GLY A O   1 
ATOM   3115  N N   . GLU A 1 442 ? 107.72000 143.91900 157.75600 1.000 58.46673  ? 442 GLU A N   1 
ATOM   3116  C CA  . GLU A 1 442 ? 108.60300 143.89500 158.91900 1.000 58.46673  ? 442 GLU A CA  1 
ATOM   3117  C C   . GLU A 1 442 ? 108.00700 143.22500 160.15200 1.000 58.46673  ? 442 GLU A C   1 
ATOM   3118  O O   . GLU A 1 442 ? 108.63000 143.24700 161.21600 1.000 58.46673  ? 442 GLU A O   1 
ATOM   3119  C CB  . GLU A 1 442 ? 108.99900 145.32100 159.28000 1.000 58.46673  ? 442 GLU A CB  1 
ATOM   3120  C CG  . GLU A 1 442 ? 107.81600 146.14300 159.73000 1.000 58.46673  ? 442 GLU A CG  1 
ATOM   3121  C CD  . GLU A 1 442 ? 107.29500 147.05500 158.64300 1.000 58.46673  ? 442 GLU A CD  1 
ATOM   3122  O OE1 . GLU A 1 442 ? 107.73200 146.90300 157.48700 1.000 58.46673  ? 442 GLU A OE1 1 
ATOM   3123  O OE2 . GLU A 1 442 ? 106.45500 147.93000 158.94200 1.000 58.46673  ? 442 GLU A OE2 1 
ATOM   3124  N N   . THR A 1 443 ? 106.83100 142.61600 160.04200 1.000 61.54780  ? 443 THR A N   1 
ATOM   3125  C CA  . THR A 1 443 ? 106.16000 142.05300 161.20900 1.000 61.54780  ? 443 THR A CA  1 
ATOM   3126  C C   . THR A 1 443 ? 106.35600 140.53700 161.17300 1.000 61.54780  ? 443 THR A C   1 
ATOM   3127  O O   . THR A 1 443 ? 105.43400 139.74000 161.36000 1.000 61.54780  ? 443 THR A O   1 
ATOM   3128  C CB  . THR A 1 443 ? 104.69200 142.48000 161.22600 1.000 61.54780  ? 443 THR A CB  1 
ATOM   3129  O OG1 . THR A 1 443 ? 104.64300 143.89200 161.01400 1.000 61.54780  ? 443 THR A OG1 1 
ATOM   3130  C CG2 . THR A 1 443 ? 104.06300 142.28000 162.60900 1.000 61.54780  ? 443 THR A CG2 1 
ATOM   3131  N N   . PHE A 1 444 ? 107.57500 140.13300 160.82800 1.000 65.53055  ? 444 PHE A N   1 
ATOM   3132  C CA  . PHE A 1 444 ? 107.98700 138.73900 160.86500 1.000 65.53055  ? 444 PHE A CA  1 
ATOM   3133  C C   . PHE A 1 444 ? 108.99600 138.47300 161.97500 1.000 65.53055  ? 444 PHE A C   1 
ATOM   3134  O O   . PHE A 1 444 ? 109.54200 137.36800 162.05900 1.000 65.53055  ? 444 PHE A O   1 
ATOM   3135  C CB  . PHE A 1 444 ? 108.54700 138.32600 159.50400 1.000 65.53055  ? 444 PHE A CB  1 
ATOM   3136  C CG  . PHE A 1 444 ? 109.98100 138.66000 159.30200 1.000 65.53055  ? 444 PHE A CG  1 
ATOM   3137  C CD1 . PHE A 1 444 ? 110.39000 139.97000 159.19700 1.000 65.53055  ? 444 PHE A CD1 1 
ATOM   3138  C CD2 . PHE A 1 444 ? 110.91900 137.65500 159.17700 1.000 65.53055  ? 444 PHE A CD2 1 
ATOM   3139  C CE1 . PHE A 1 444 ? 111.70400 140.27400 159.00600 1.000 65.53055  ? 444 PHE A CE1 1 
ATOM   3140  C CE2 . PHE A 1 444 ? 112.24300 137.95600 158.97600 1.000 65.53055  ? 444 PHE A CE2 1 
ATOM   3141  C CZ  . PHE A 1 444 ? 112.63400 139.27000 158.88800 1.000 65.53055  ? 444 PHE A CZ  1 
ATOM   3142  N N   . GLY A 1 445 ? 109.24700 139.45800 162.83300 1.000 71.14535  ? 445 GLY A N   1 
ATOM   3143  C CA  . GLY A 1 445 ? 110.07100 139.26800 164.00800 1.000 71.14535  ? 445 GLY A CA  1 
ATOM   3144  C C   . GLY A 1 445 ? 109.45800 139.89900 165.24200 1.000 71.14535  ? 445 GLY A C   1 
ATOM   3145  O O   . GLY A 1 445 ? 110.17600 140.36800 166.12800 1.000 71.14535  ? 445 GLY A O   1 
ATOM   3146  N N   . GLU A 1 446 ? 108.13300 139.91700 165.31200 1.000 75.23700  ? 446 GLU A N   1 
ATOM   3147  C CA  . GLU A 1 446 ? 107.41500 140.62800 166.36500 1.000 75.23700  ? 446 GLU A CA  1 
ATOM   3148  C C   . GLU A 1 446 ? 106.11100 139.88100 166.62200 1.000 75.23700  ? 446 GLU A C   1 
ATOM   3149  O O   . GLU A 1 446 ? 106.02400 138.67700 166.37000 1.000 75.23700  ? 446 GLU A O   1 
ATOM   3150  C CB  . GLU A 1 446 ? 107.20900 142.10400 165.99500 1.000 75.23700  ? 446 GLU A CB  1 
ATOM   3151  C CG  . GLU A 1 446 ? 107.33000 143.03400 167.19000 1.000 75.23700  ? 446 GLU A CG  1 
ATOM   3152  C CD  . GLU A 1 446 ? 107.10700 144.47700 166.82700 1.000 75.23700  ? 446 GLU A CD  1 
ATOM   3153  O OE1 . GLU A 1 446 ? 107.86300 145.00200 165.98400 1.000 75.23700  ? 446 GLU A OE1 1 
ATOM   3154  O OE2 . GLU A 1 446 ? 106.17200 145.08700 167.38700 1.000 75.23700  ? 446 GLU A OE2 1 
ATOM   3155  N N   . VAL A 1 447 ? 105.10600 140.59200 167.15300 1.000 77.54987  ? 447 VAL A N   1 
ATOM   3156  C CA  . VAL A 1 447 ? 103.82100 140.08300 167.64900 1.000 77.54987  ? 447 VAL A CA  1 
ATOM   3157  C C   . VAL A 1 447 ? 103.08300 139.16200 166.66800 1.000 77.54987  ? 447 VAL A C   1 
ATOM   3158  O O   . VAL A 1 447 ? 102.27500 138.32100 167.07800 1.000 77.54987  ? 447 VAL A O   1 
ATOM   3159  C CB  . VAL A 1 447 ? 102.94100 141.28400 168.07100 1.000 77.54987  ? 447 VAL A CB  1 
ATOM   3160  C CG1 . VAL A 1 447 ? 102.46300 142.09600 166.86600 1.000 77.54987  ? 447 VAL A CG1 1 
ATOM   3161  C CG2 . VAL A 1 447 ? 101.78500 140.86800 168.98500 1.000 77.54987  ? 447 VAL A CG2 1 
ATOM   3162  N N   . GLY A 1 448 ? 103.38400 139.27000 165.37600 1.000 72.33980  ? 448 GLY A N   1 
ATOM   3163  C CA  . GLY A 1 448 ? 102.87500 138.32600 164.40400 1.000 72.33980  ? 448 GLY A CA  1 
ATOM   3164  C C   . GLY A 1 448 ? 103.95100 137.49100 163.73700 1.000 72.33980  ? 448 GLY A C   1 
ATOM   3165  O O   . GLY A 1 448 ? 103.91700 137.31400 162.51800 1.000 72.33980  ? 448 GLY A O   1 
ATOM   3166  N N   . VAL A 1 449 ? 104.89000 136.92900 164.50900 1.000 71.24408  ? 449 VAL A N   1 
ATOM   3167  C CA  . VAL A 1 449 ? 106.02200 136.18200 163.95200 1.000 71.24408  ? 449 VAL A CA  1 
ATOM   3168  C C   . VAL A 1 449 ? 105.60700 134.80600 163.44800 1.000 71.24408  ? 449 VAL A C   1 
ATOM   3169  O O   . VAL A 1 449 ? 106.45700 134.01800 163.02300 1.000 71.24408  ? 449 VAL A O   1 
ATOM   3170  C CB  . VAL A 1 449 ? 107.16800 136.02500 164.96800 1.000 71.24408  ? 449 VAL A CB  1 
ATOM   3171  N N   . LEU A 1 450 ? 104.31800 134.48400 163.54100 1.000 72.37657  ? 450 LEU A N   1 
ATOM   3172  C CA  . LEU A 1 450 ? 103.74700 133.31600 162.88700 1.000 72.37657  ? 450 LEU A CA  1 
ATOM   3173  C C   . LEU A 1 450 ? 102.66500 133.68300 161.88000 1.000 72.37657  ? 450 LEU A C   1 
ATOM   3174  O O   . LEU A 1 450 ? 101.96000 132.78700 161.40400 1.000 72.37657  ? 450 LEU A O   1 
ATOM   3175  C CB  . LEU A 1 450 ? 103.16400 132.34400 163.91900 1.000 72.37657  ? 450 LEU A CB  1 
ATOM   3176  C CG  . LEU A 1 450 ? 104.00600 131.86800 165.10100 1.000 72.37657  ? 450 LEU A CG  1 
ATOM   3177  C CD1 . LEU A 1 450 ? 103.26700 130.78600 165.86700 1.000 72.37657  ? 450 LEU A CD1 1 
ATOM   3178  C CD2 . LEU A 1 450 ? 105.35800 131.34600 164.64100 1.000 72.37657  ? 450 LEU A CD2 1 
ATOM   3179  N N   . TYR A 1 451 ? 102.50300 134.96100 161.54200 1.000 66.58713  ? 451 TYR A N   1 
ATOM   3180  C CA  . TYR A 1 451 ? 101.41700 135.34400 160.64900 1.000 66.58713  ? 451 TYR A CA  1 
ATOM   3181  C C   . TYR A 1 451 ? 101.81600 136.58200 159.84900 1.000 66.58713  ? 451 TYR A C   1 
ATOM   3182  O O   . TYR A 1 451 ? 102.98100 136.98800 159.83000 1.000 66.58713  ? 451 TYR A O   1 
ATOM   3183  C CB  . TYR A 1 451 ? 100.12800 135.55900 161.45100 1.000 66.58713  ? 451 TYR A CB  1 
ATOM   3184  N N   . TYR A 1 452 ? 100.83200 137.16200 159.16400 1.000 61.38153  ? 452 TYR A N   1 
ATOM   3185  C CA  . TYR A 1 452 ? 100.96200 138.37000 158.35900 1.000 61.38153  ? 452 TYR A CA  1 
ATOM   3186  C C   . TYR A 1 452 ? 99.71900  139.21800 158.54200 1.000 61.38153  ? 452 TYR A C   1 
ATOM   3187  O O   . TYR A 1 452 ? 98.60300  138.69900 158.47200 1.000 61.38153  ? 452 TYR A O   1 
ATOM   3188  C CB  . TYR A 1 452 ? 101.14300 138.03600 156.87700 1.000 61.38153  ? 452 TYR A CB  1 
ATOM   3189  C CG  . TYR A 1 452 ? 102.56600 137.90700 156.40800 1.000 61.38153  ? 452 TYR A CG  1 
ATOM   3190  C CD1 . TYR A 1 452 ? 103.58300 138.65700 156.97700 1.000 61.38153  ? 452 TYR A CD1 1 
ATOM   3191  C CD2 . TYR A 1 452 ? 102.89700 136.99800 155.41900 1.000 61.38153  ? 452 TYR A CD2 1 
ATOM   3192  C CE1 . TYR A 1 452 ? 104.88300 138.54100 156.53300 1.000 61.38153  ? 452 TYR A CE1 1 
ATOM   3193  C CE2 . TYR A 1 452 ? 104.19100 136.86300 154.97700 1.000 61.38153  ? 452 TYR A CE2 1 
ATOM   3194  C CZ  . TYR A 1 452 ? 105.17900 137.63500 155.53300 1.000 61.38153  ? 452 TYR A CZ  1 
ATOM   3195  O OH  . TYR A 1 452 ? 106.47100 137.48800 155.08500 1.000 61.38153  ? 452 TYR A OH  1 
ATOM   3196  N N   . ARG A 1 453 ? 99.90200  140.50400 158.78700 1.000 58.61127  ? 453 ARG A N   1 
ATOM   3197  C CA  . ARG A 1 453 ? 98.70400  141.31600 158.91000 1.000 58.61127  ? 453 ARG A CA  1 
ATOM   3198  C C   . ARG A 1 453 ? 98.08800  141.62400 157.53900 1.000 58.61127  ? 453 ARG A C   1 
ATOM   3199  O O   . ARG A 1 453 ? 96.94900  141.20300 157.30700 1.000 58.61127  ? 453 ARG A O   1 
ATOM   3200  C CB  . ARG A 1 453 ? 98.98700  142.58200 159.73200 1.000 58.61127  ? 453 ARG A CB  1 
ATOM   3201  N N   . PRO A 1 454 ? 98.76800  142.33000 156.57500 1.000 56.80294  ? 454 PRO A N   1 
ATOM   3202  C CA  . PRO A 1 454 ? 98.06000  142.66400 155.33600 1.000 56.80294  ? 454 PRO A CA  1 
ATOM   3203  C C   . PRO A 1 454 ? 98.25100  141.63200 154.23700 1.000 56.80294  ? 454 PRO A C   1 
ATOM   3204  O O   . PRO A 1 454 ? 98.86200  140.58000 154.44500 1.000 56.80294  ? 454 PRO A O   1 
ATOM   3205  C CB  . PRO A 1 454 ? 98.67600  144.01000 154.95100 1.000 56.80294  ? 454 PRO A CB  1 
ATOM   3206  C CG  . PRO A 1 454 ? 100.06500 143.97900 155.55200 1.000 56.80294  ? 454 PRO A CG  1 
ATOM   3207  C CD  . PRO A 1 454 ? 100.17500 142.76400 156.43100 1.000 56.80294  ? 454 PRO A CD  1 
ATOM   3208  N N   . GLN A 1 455 ? 97.71200  141.92100 153.05900 1.000 53.87262  ? 455 GLN A N   1 
ATOM   3209  C CA  . GLN A 1 455 ? 97.99600  141.16100 151.84400 1.000 53.87262  ? 455 GLN A CA  1 
ATOM   3210  C C   . GLN A 1 455 ? 98.32300  142.15200 150.73700 1.000 53.87262  ? 455 GLN A C   1 
ATOM   3211  O O   . GLN A 1 455 ? 97.45000  142.51000 149.93900 1.000 53.87262  ? 455 GLN A O   1 
ATOM   3212  C CB  . GLN A 1 455 ? 96.81700  140.27100 151.45400 1.000 53.87262  ? 455 GLN A CB  1 
ATOM   3213  N N   . PRO A 1 456 ? 99.57100  142.61500 150.65700 1.000 49.52975  ? 456 PRO A N   1 
ATOM   3214  C CA  . PRO A 1 456 ? 99.91600  143.63700 149.66700 1.000 49.52975  ? 456 PRO A CA  1 
ATOM   3215  C C   . PRO A 1 456 ? 99.94300  143.09800 148.25300 1.000 49.52975  ? 456 PRO A C   1 
ATOM   3216  O O   . PRO A 1 456 ? 100.22000 141.92300 148.01200 1.000 49.52975  ? 456 PRO A O   1 
ATOM   3217  C CB  . PRO A 1 456 ? 101.31400 144.08800 150.09400 1.000 49.52975  ? 456 PRO A CB  1 
ATOM   3218  C CG  . PRO A 1 456 ? 101.84000 143.01100 150.87700 1.000 49.52975  ? 456 PRO A CG  1 
ATOM   3219  C CD  . PRO A 1 456 ? 100.68500 142.38400 151.58400 1.000 49.52975  ? 456 PRO A CD  1 
ATOM   3220  N N   . PHE A 1 457 ? 99.65300  143.99100 147.31400 1.000 45.90109  ? 457 PHE A N   1 
ATOM   3221  C CA  . PHE A 1 457 ? 99.68500  143.66700 145.89800 1.000 45.90109  ? 457 PHE A CA  1 
ATOM   3222  C C   . PHE A 1 457 ? 99.91600  144.95900 145.13100 1.000 45.90109  ? 457 PHE A C   1 
ATOM   3223  O O   . PHE A 1 457 ? 99.36000  145.99800 145.49200 1.000 45.90109  ? 457 PHE A O   1 
ATOM   3224  C CB  . PHE A 1 457 ? 98.40200  142.93900 145.45900 1.000 45.90109  ? 457 PHE A CB  1 
ATOM   3225  C CG  . PHE A 1 457 ? 97.20000  143.81700 145.28600 1.000 45.90109  ? 457 PHE A CG  1 
ATOM   3226  C CD1 . PHE A 1 457 ? 96.65100  144.50600 146.35600 1.000 45.90109  ? 457 PHE A CD1 1 
ATOM   3227  C CD2 . PHE A 1 457 ? 96.58600  143.91600 144.05200 1.000 45.90109  ? 457 PHE A CD2 1 
ATOM   3228  C CE1 . PHE A 1 457 ? 95.53500  145.30500 146.18900 1.000 45.90109  ? 457 PHE A CE1 1 
ATOM   3229  C CE2 . PHE A 1 457 ? 95.46900  144.71200 143.87500 1.000 45.90109  ? 457 PHE A CE2 1 
ATOM   3230  C CZ  . PHE A 1 457 ? 94.94200  145.40600 144.94600 1.000 45.90109  ? 457 PHE A CZ  1 
ATOM   3231  N N   . THR A 1 458 ? 100.77100 144.89800 144.10900 1.000 40.82172  ? 458 THR A N   1 
ATOM   3232  C CA  . THR A 1 458 ? 101.27500 146.08100 143.41900 1.000 40.82172  ? 458 THR A CA  1 
ATOM   3233  C C   . THR A 1 458 ? 100.19500 146.83500 142.66600 1.000 40.82172  ? 458 THR A C   1 
ATOM   3234  O O   . THR A 1 458 ? 99.12000  146.29400 142.40000 1.000 40.82172  ? 458 THR A O   1 
ATOM   3235  C CB  . THR A 1 458 ? 102.36600 145.69400 142.42900 1.000 40.82172  ? 458 THR A CB  1 
ATOM   3236  O OG1 . THR A 1 458 ? 101.86900 144.66900 141.56500 1.000 40.82172  ? 458 THR A OG1 1 
ATOM   3237  C CG2 . THR A 1 458 ? 103.56800 145.18300 143.14400 1.000 40.82172  ? 458 THR A CG2 1 
ATOM   3238  N N   . VAL A 1 459 ? 100.46800 148.09000 142.32100 1.000 42.89335  ? 459 VAL A N   1 
ATOM   3239  C CA  . VAL A 1 459 ? 99.55000  148.83400 141.47100 1.000 42.89335  ? 459 VAL A CA  1 
ATOM   3240  C C   . VAL A 1 459 ? 100.24300 149.37400 140.22300 1.000 42.89335  ? 459 VAL A C   1 
ATOM   3241  O O   . VAL A 1 459 ? 99.70000  149.24400 139.12300 1.000 42.89335  ? 459 VAL A O   1 
ATOM   3242  C CB  . VAL A 1 459 ? 98.82400  149.94400 142.25700 1.000 42.89335  ? 459 VAL A CB  1 
ATOM   3243  C CG1 . VAL A 1 459 ? 97.74100  149.33800 143.12300 1.000 42.89335  ? 459 VAL A CG1 1 
ATOM   3244  C CG2 . VAL A 1 459 ? 99.77800  150.69400 143.15300 1.000 42.89335  ? 459 VAL A CG2 1 
ATOM   3245  N N   . ARG A 1 460 ? 101.41000 150.01000 140.35200 1.000 40.68026  ? 460 ARG A N   1 
ATOM   3246  C CA  . ARG A 1 460 ? 101.99300 150.54100 139.12500 1.000 40.68026  ? 460 ARG A CA  1 
ATOM   3247  C C   . ARG A 1 460 ? 102.92700 149.57700 138.39600 1.000 40.68026  ? 460 ARG A C   1 
ATOM   3248  O O   . ARG A 1 460 ? 102.50800 148.90000 137.45400 1.000 40.68026  ? 460 ARG A O   1 
ATOM   3249  C CB  . ARG A 1 460 ? 102.74600 151.83300 139.44000 1.000 40.68026  ? 460 ARG A CB  1 
ATOM   3250  N N   . THR A 1 461 ? 104.17500 149.48700 138.85800 1.000 39.91241  ? 461 THR A N   1 
ATOM   3251  C CA  . THR A 1 461 ? 105.21100 148.56300 138.39900 1.000 39.91241  ? 461 THR A CA  1 
ATOM   3252  C C   . THR A 1 461 ? 106.33500 148.69100 139.40800 1.000 39.91241  ? 461 THR A C   1 
ATOM   3253  O O   . THR A 1 461 ? 106.94300 149.75900 139.51400 1.000 39.91241  ? 461 THR A O   1 
ATOM   3254  C CB  . THR A 1 461 ? 105.71600 148.88100 136.98400 1.000 39.91241  ? 461 THR A CB  1 
ATOM   3255  O OG1 . THR A 1 461 ? 104.72300 148.49500 136.03100 1.000 39.91241  ? 461 THR A OG1 1 
ATOM   3256  C CG2 . THR A 1 461 ? 106.99900 148.13000 136.66300 1.000 39.91241  ? 461 THR A CG2 1 
ATOM   3257  N N   . THR A 1 462 ? 106.63700 147.64300 140.15100 1.000 38.66137  ? 462 THR A N   1 
ATOM   3258  C CA  . THR A 1 462 ? 107.36300 147.84000 141.38600 1.000 38.66137  ? 462 THR A CA  1 
ATOM   3259  C C   . THR A 1 462 ? 108.59200 146.95700 141.44000 1.000 38.66137  ? 462 THR A C   1 
ATOM   3260  O O   . THR A 1 462 ? 108.53300 145.77300 141.13100 1.000 38.66137  ? 462 THR A O   1 
ATOM   3261  C CB  . THR A 1 462 ? 106.46200 147.54500 142.57100 1.000 38.66137  ? 462 THR A CB  1 
ATOM   3262  O OG1 . THR A 1 462 ? 105.13500 147.96900 142.25300 1.000 38.66137  ? 462 THR A OG1 1 
ATOM   3263  C CG2 . THR A 1 462 ? 106.93000 148.31600 143.76700 1.000 38.66137  ? 462 THR A CG2 1 
ATOM   3264  N N   . GLU A 1 463 ? 109.70300 147.54300 141.87200 1.000 38.03070  ? 463 GLU A N   1 
ATOM   3265  C CA  . GLU A 1 463 ? 110.93500 146.81400 142.13500 1.000 38.03070  ? 463 GLU A CA  1 
ATOM   3266  C C   . GLU A 1 463 ? 111.13000 146.71500 143.64000 1.000 38.03070  ? 463 GLU A C   1 
ATOM   3267  O O   . GLU A 1 463 ? 111.09100 147.73200 144.33600 1.000 38.03070  ? 463 GLU A O   1 
ATOM   3268  C CB  . GLU A 1 463 ? 112.12500 147.51100 141.48900 1.000 38.03070  ? 463 GLU A CB  1 
ATOM   3269  C CG  . GLU A 1 463 ? 113.39600 146.72400 141.57800 1.000 38.03070  ? 463 GLU A CG  1 
ATOM   3270  C CD  . GLU A 1 463 ? 114.59900 147.54200 141.20600 1.000 38.03070  ? 463 GLU A CD  1 
ATOM   3271  O OE1 . GLU A 1 463 ? 114.41800 148.70400 140.79600 1.000 38.03070  ? 463 GLU A OE1 1 
ATOM   3272  O OE2 . GLU A 1 463 ? 115.72600 147.02500 141.32200 1.000 38.03070  ? 463 GLU A OE2 1 
ATOM   3273  N N   . LEU A 1 464 ? 111.33100 145.49900 144.14100 1.000 37.79600  ? 464 LEU A N   1 
ATOM   3274  C CA  . LEU A 1 464 ? 111.46600 145.22000 145.56400 1.000 37.79600  ? 464 LEU A CA  1 
ATOM   3275  C C   . LEU A 1 464 ? 112.86600 144.69400 145.86800 1.000 37.79600  ? 464 LEU A C   1 
ATOM   3276  O O   . LEU A 1 464 ? 113.74100 144.67800 145.00300 1.000 37.79600  ? 464 LEU A O   1 
ATOM   3277  C CB  . LEU A 1 464 ? 110.39600 144.23500 145.99800 1.000 37.79600  ? 464 LEU A CB  1 
ATOM   3278  C CG  . LEU A 1 464 ? 109.03200 144.52900 145.40700 1.000 37.79600  ? 464 LEU A CG  1 
ATOM   3279  C CD1 . LEU A 1 464 ? 108.14700 143.37900 145.69000 1.000 37.79600  ? 464 LEU A CD1 1 
ATOM   3280  C CD2 . LEU A 1 464 ? 108.47100 145.77000 146.01000 1.000 37.79600  ? 464 LEU A CD2 1 
ATOM   3281  N N   . SER A 1 465 ? 113.08900 144.26500 147.11100 1.000 41.24580  ? 465 SER A N   1 
ATOM   3282  C CA  . SER A 1 465 ? 114.42300 143.83000 147.50900 1.000 41.24580  ? 465 SER A CA  1 
ATOM   3283  C C   . SER A 1 465 ? 114.47500 142.44300 148.13200 1.000 41.24580  ? 465 SER A C   1 
ATOM   3284  O O   . SER A 1 465 ? 115.46800 141.74200 147.92300 1.000 41.24580  ? 465 SER A O   1 
ATOM   3285  C CB  . SER A 1 465 ? 115.05500 144.85200 148.45700 1.000 41.24580  ? 465 SER A CB  1 
ATOM   3286  O OG  . SER A 1 465 ? 115.69500 145.87600 147.71800 1.000 41.24580  ? 465 SER A OG  1 
ATOM   3287  N N   . GLN A 1 466 ? 113.46300 142.03300 148.90700 1.000 45.08060  ? 466 GLN A N   1 
ATOM   3288  C CA  . GLN A 1 466 ? 113.33200 140.67800 149.45900 1.000 45.08060  ? 466 GLN A CA  1 
ATOM   3289  C C   . GLN A 1 466 ? 114.51800 140.21900 150.31000 1.000 45.08060  ? 466 GLN A C   1 
ATOM   3290  O O   . GLN A 1 466 ? 115.33900 139.41900 149.85200 1.000 45.08060  ? 466 GLN A O   1 
ATOM   3291  C CB  . GLN A 1 466 ? 113.07900 139.64100 148.35700 1.000 45.08060  ? 466 GLN A CB  1 
ATOM   3292  C CG  . GLN A 1 466 ? 112.55400 138.29200 148.87500 1.000 45.08060  ? 466 GLN A CG  1 
ATOM   3293  C CD  . GLN A 1 466 ? 112.58600 137.19500 147.83300 1.000 45.08060  ? 466 GLN A CD  1 
ATOM   3294  O OE1 . GLN A 1 466 ? 112.93800 137.42400 146.67900 1.000 45.08060  ? 466 GLN A OE1 1 
ATOM   3295  N NE2 . GLN A 1 466 ? 112.24000 135.98500 148.24500 1.000 45.08060  ? 466 GLN A NE2 1 
ATOM   3296  N N   . ILE A 1 467 ? 114.69200 140.78400 151.49500 1.000 49.33580  ? 467 ILE A N   1 
ATOM   3297  C CA  . ILE A 1 467 ? 115.58500 140.18600 152.48200 1.000 49.33580  ? 467 ILE A CA  1 
ATOM   3298  C C   . ILE A 1 467 ? 114.82800 139.08500 153.21200 1.000 49.33580  ? 467 ILE A C   1 
ATOM   3299  O O   . ILE A 1 467 ? 113.72000 139.30800 153.71000 1.000 49.33580  ? 467 ILE A O   1 
ATOM   3300  C CB  . ILE A 1 467 ? 116.10700 141.24700 153.45700 1.000 49.33580  ? 467 ILE A CB  1 
ATOM   3301  C CG1 . ILE A 1 467 ? 116.57800 142.47300 152.68700 1.000 49.33580  ? 467 ILE A CG1 1 
ATOM   3302  C CG2 . ILE A 1 467 ? 117.22900 140.68300 154.28600 1.000 49.33580  ? 467 ILE A CG2 1 
ATOM   3303  C CD1 . ILE A 1 467 ? 117.04100 143.58600 153.57000 1.000 49.33580  ? 467 ILE A CD1 1 
ATOM   3304  N N   . LEU A 1 468 ? 115.41300 137.88900 153.27400 1.000 56.97594  ? 468 LEU A N   1 
ATOM   3305  C CA  . LEU A 1 468 ? 114.65500 136.67900 153.60500 1.000 56.97594  ? 468 LEU A CA  1 
ATOM   3306  C C   . LEU A 1 468 ? 115.30400 135.84500 154.70400 1.000 56.97594  ? 468 LEU A C   1 
ATOM   3307  O O   . LEU A 1 468 ? 116.02400 134.89500 154.38300 1.000 56.97594  ? 468 LEU A O   1 
ATOM   3308  C CB  . LEU A 1 468 ? 114.47100 135.84100 152.34800 1.000 56.97594  ? 468 LEU A CB  1 
ATOM   3309  N N   . ARG A 1 469 ? 115.01500 136.18800 155.96800 1.000 64.31332  ? 469 ARG A N   1 
ATOM   3310  C CA  . ARG A 1 469 ? 115.30700 135.40800 157.17600 1.000 64.31332  ? 469 ARG A CA  1 
ATOM   3311  C C   . ARG A 1 469 ? 116.73500 134.87600 157.27800 1.000 64.31332  ? 469 ARG A C   1 
ATOM   3312  O O   . ARG A 1 469 ? 116.96100 133.78200 157.80500 1.000 64.31332  ? 469 ARG A O   1 
ATOM   3313  C CB  . ARG A 1 469 ? 114.32700 134.23800 157.28500 1.000 64.31332  ? 469 ARG A CB  1 
ATOM   3314  N N   . ILE A 1 470 ? 117.69500 135.61900 156.74000 1.000 67.96322  ? 470 ILE A N   1 
ATOM   3315  C CA  . ILE A 1 470 ? 119.09500 135.23000 156.79700 1.000 67.96322  ? 470 ILE A CA  1 
ATOM   3316  C C   . ILE A 1 470 ? 119.89900 136.44400 157.22400 1.000 67.96322  ? 470 ILE A C   1 
ATOM   3317  O O   . ILE A 1 470 ? 121.09500 136.34400 157.51200 1.000 67.96322  ? 470 ILE A O   1 
ATOM   3318  C CB  . ILE A 1 470 ? 119.58100 134.68100 155.44700 1.000 67.96322  ? 470 ILE A CB  1 
ATOM   3319  N N   . SER A 1 471 ? 119.24800 137.60300 157.25300 1.000 69.98682  ? 471 SER A N   1 
ATOM   3320  C CA  . SER A 1 471 ? 119.86100 138.81800 157.76400 1.000 69.98682  ? 471 SER A CA  1 
ATOM   3321  C C   . SER A 1 471 ? 119.04700 139.48700 158.86000 1.000 69.98682  ? 471 SER A C   1 
ATOM   3322  O O   . SER A 1 471 ? 119.35500 140.62700 159.22100 1.000 69.98682  ? 471 SER A O   1 
ATOM   3323  C CB  . SER A 1 471 ? 120.10200 139.82800 156.63000 1.000 69.98682  ? 471 SER A CB  1 
ATOM   3324  N N   . ARG A 1 472 ? 118.01400 138.83700 159.37600 1.000 73.28603  ? 472 ARG A N   1 
ATOM   3325  C CA  . ARG A 1 472 ? 117.31800 139.30000 160.56500 1.000 73.28603  ? 472 ARG A CA  1 
ATOM   3326  C C   . ARG A 1 472 ? 117.14600 138.21700 161.62100 1.000 73.28603  ? 472 ARG A C   1 
ATOM   3327  O O   . ARG A 1 472 ? 117.21700 138.51900 162.81500 1.000 73.28603  ? 472 ARG A O   1 
ATOM   3328  C CB  . ARG A 1 472 ? 115.94300 139.87300 160.18900 1.000 73.28603  ? 472 ARG A CB  1 
ATOM   3329  N N   . THR A 1 473 ? 116.92500 136.96800 161.21200 1.000 72.14347  ? 473 THR A N   1 
ATOM   3330  C CA  . THR A 1 473 ? 116.86700 135.82600 162.11500 1.000 72.14347  ? 473 THR A CA  1 
ATOM   3331  C C   . THR A 1 473 ? 118.19300 135.08400 162.18700 1.000 72.14347  ? 473 THR A C   1 
ATOM   3332  O O   . THR A 1 473 ? 118.69100 134.81900 163.28500 1.000 72.14347  ? 473 THR A O   1 
ATOM   3333  C CB  . THR A 1 473 ? 115.73900 134.87400 161.68600 1.000 72.14347  ? 473 THR A CB  1 
ATOM   3334  O OG1 . THR A 1 473 ? 114.47500 135.43700 162.05900 1.000 72.14347  ? 473 THR A OG1 1 
ATOM   3335  C CG2 . THR A 1 473 ? 115.87500 133.50200 162.32800 1.000 72.14347  ? 473 THR A CG2 1 
ATOM   3336  N N   . SER A 1 474 ? 118.80900 134.78400 161.04700 1.000 71.01073  ? 474 SER A N   1 
ATOM   3337  C CA  . SER A 1 474 ? 120.13200 134.17800 161.02800 1.000 71.01073  ? 474 SER A CA  1 
ATOM   3338  C C   . SER A 1 474 ? 121.25000 135.21200 161.06800 1.000 71.01073  ? 474 SER A C   1 
ATOM   3339  O O   . SER A 1 474 ? 122.40600 134.87200 160.79400 1.000 71.01073  ? 474 SER A O   1 
ATOM   3340  C CB  . SER A 1 474 ? 120.29200 133.28100 159.80300 1.000 71.01073  ? 474 SER A CB  1 
ATOM   3341  O OG  . SER A 1 474 ? 121.63500 132.85600 159.67000 1.000 71.01073  ? 474 SER A OG  1 
ATOM   3342  N N   . LEU A 1 475 ? 120.93200 136.46500 161.38700 1.000 72.13264  ? 475 LEU A N   1 
ATOM   3343  C CA  . LEU A 1 475 ? 121.93900 137.43600 161.78500 1.000 72.13264  ? 475 LEU A CA  1 
ATOM   3344  C C   . LEU A 1 475 ? 121.63300 138.02300 163.15400 1.000 72.13264  ? 475 LEU A C   1 
ATOM   3345  O O   . LEU A 1 475 ? 121.64600 139.24700 163.32000 1.000 72.13264  ? 475 LEU A O   1 
ATOM   3346  C CB  . LEU A 1 475 ? 122.08600 138.54900 160.75200 1.000 72.13264  ? 475 LEU A CB  1 
ATOM   3347  C CG  . LEU A 1 475 ? 123.52200 139.06800 160.63400 1.000 72.13264  ? 475 LEU A CG  1 
ATOM   3348  C CD1 . LEU A 1 475 ? 124.51100 137.91900 160.51400 1.000 72.13264  ? 475 LEU A CD1 1 
ATOM   3349  C CD2 . LEU A 1 475 ? 123.66000 140.00300 159.46000 1.000 72.13264  ? 475 LEU A CD2 1 
ATOM   3350  N N   . MET A 1 476 ? 121.32400 137.16900 164.13000 1.000 76.63631  ? 476 MET A N   1 
ATOM   3351  C CA  . MET A 1 476 ? 121.29400 137.59200 165.52200 1.000 76.63631  ? 476 MET A CA  1 
ATOM   3352  C C   . MET A 1 476 ? 122.69800 137.88600 166.03000 1.000 76.63631  ? 476 MET A C   1 
ATOM   3353  O O   . MET A 1 476 ? 122.88500 138.70900 166.93200 1.000 76.63631  ? 476 MET A O   1 
ATOM   3354  C CB  . MET A 1 476 ? 120.64700 136.49800 166.37200 1.000 76.63631  ? 476 MET A CB  1 
ATOM   3355  C CG  . MET A 1 476 ? 121.29500 135.13100 166.18200 1.000 76.63631  ? 476 MET A CG  1 
ATOM   3356  S SD  . MET A 1 476 ? 120.71700 133.83000 167.28200 1.000 76.63631  ? 476 MET A SD  1 
ATOM   3357  C CE  . MET A 1 476 ? 121.93700 132.56200 166.94700 1.000 76.63631  ? 476 MET A CE  1 
ATOM   3358  N N   . SER A 1 477 ? 123.70100 137.24900 165.43200 1.000 76.30379  ? 477 SER A N   1 
ATOM   3359  C CA  . SER A 1 477 ? 124.98500 137.04800 166.08000 1.000 76.30379  ? 477 SER A CA  1 
ATOM   3360  C C   . SER A 1 477 ? 125.98800 138.16000 165.82600 1.000 76.30379  ? 477 SER A C   1 
ATOM   3361  O O   . SER A 1 477 ? 126.86600 138.37700 166.66700 1.000 76.30379  ? 477 SER A O   1 
ATOM   3362  C CB  . SER A 1 477 ? 125.58200 135.71800 165.61800 1.000 76.30379  ? 477 SER A CB  1 
ATOM   3363  O OG  . SER A 1 477 ? 124.72900 134.64200 165.96600 1.000 76.30379  ? 477 SER A OG  1 
ATOM   3364  N N   . ALA A 1 478 ? 125.89500 138.86100 164.70000 1.000 76.92878  ? 478 ALA A N   1 
ATOM   3365  C CA  . ALA A 1 478 ? 126.94800 139.81200 164.35600 1.000 76.92878  ? 478 ALA A CA  1 
ATOM   3366  C C   . ALA A 1 478 ? 126.81400 141.09900 165.16000 1.000 76.92878  ? 478 ALA A C   1 
ATOM   3367  O O   . ALA A 1 478 ? 127.64800 141.39700 166.01900 1.000 76.92878  ? 478 ALA A O   1 
ATOM   3368  C CB  . ALA A 1 478 ? 126.92000 140.09900 162.85300 1.000 76.92878  ? 478 ALA A CB  1 
ATOM   3369  N N   . MET A 1 479 ? 125.76400 141.86800 164.90100 1.000 81.76859  ? 479 MET A N   1 
ATOM   3370  C CA  . MET A 1 479 ? 125.51600 143.13700 165.57600 1.000 81.76859  ? 479 MET A CA  1 
ATOM   3371  C C   . MET A 1 479 ? 124.01000 143.34700 165.63800 1.000 81.76859  ? 479 MET A C   1 
ATOM   3372  O O   . MET A 1 479 ? 123.22700 142.44500 165.32600 1.000 81.76859  ? 479 MET A O   1 
ATOM   3373  C CB  . MET A 1 479 ? 126.17300 144.33500 164.86600 1.000 81.76859  ? 479 MET A CB  1 
ATOM   3374  C CG  . MET A 1 479 ? 127.70200 144.46600 164.87300 1.000 81.76859  ? 479 MET A CG  1 
ATOM   3375  S SD  . MET A 1 479 ? 128.60600 143.50400 163.64500 1.000 81.76859  ? 479 MET A SD  1 
ATOM   3376  C CE  . MET A 1 479 ? 128.24500 144.43000 162.17100 1.000 81.76859  ? 479 MET A CE  1 
ATOM   3377  N N   . HIS A 1 480 ? 123.62100 144.56000 166.04700 1.000 80.07807  ? 480 HIS A N   1 
ATOM   3378  C CA  . HIS A 1 480 ? 122.29500 145.14500 165.82500 1.000 80.07807  ? 480 HIS A CA  1 
ATOM   3379  C C   . HIS A 1 480 ? 121.17100 144.32900 166.47600 1.000 80.07807  ? 480 HIS A C   1 
ATOM   3380  O O   . HIS A 1 480 ? 120.32900 143.72100 165.81500 1.000 80.07807  ? 480 HIS A O   1 
ATOM   3381  C CB  . HIS A 1 480 ? 122.03700 145.33300 164.32800 1.000 80.07807  ? 480 HIS A CB  1 
ATOM   3382  N N   . ALA A 1 481 ? 121.18700 144.33200 167.80500 1.000 79.37893  ? 481 ALA A N   1 
ATOM   3383  C CA  . ALA A 1 481 ? 119.97600 143.99300 168.55800 1.000 79.37893  ? 481 ALA A CA  1 
ATOM   3384  C C   . ALA A 1 481 ? 119.07000 145.21900 168.78800 1.000 79.37893  ? 481 ALA A C   1 
ATOM   3385  O O   . ALA A 1 481 ? 118.06200 145.16400 169.50000 1.000 79.37893  ? 481 ALA A O   1 
ATOM   3386  C CB  . ALA A 1 481 ? 120.34600 143.35600 169.89600 1.000 79.37893  ? 481 ALA A CB  1 
ATOM   3387  N N   . HIS A 1 482 ? 119.49800 146.31000 168.15700 1.000 78.61868  ? 482 HIS A N   1 
ATOM   3388  C CA  . HIS A 1 482 ? 118.81400 147.59100 168.14000 1.000 78.61868  ? 482 HIS A CA  1 
ATOM   3389  C C   . HIS A 1 482 ? 117.71300 147.65600 167.08800 1.000 78.61868  ? 482 HIS A C   1 
ATOM   3390  O O   . HIS A 1 482 ? 116.79700 148.47900 167.21400 1.000 78.61868  ? 482 HIS A O   1 
ATOM   3391  C CB  . HIS A 1 482 ? 119.86000 148.68800 167.90300 1.000 78.61868  ? 482 HIS A CB  1 
ATOM   3392  C CG  . HIS A 1 482 ? 119.29100 150.05900 167.73700 1.000 78.61868  ? 482 HIS A CG  1 
ATOM   3393  N ND1 . HIS A 1 482 ? 119.00100 150.59400 166.50200 1.000 78.61868  ? 482 HIS A ND1 1 
ATOM   3394  C CD2 . HIS A 1 482 ? 118.94600 150.99900 168.64600 1.000 78.61868  ? 482 HIS A CD2 1 
ATOM   3395  C CE1 . HIS A 1 482 ? 118.50900 151.80900 166.65600 1.000 78.61868  ? 482 HIS A CE1 1 
ATOM   3396  N NE2 . HIS A 1 482 ? 118.46600 152.07900 167.94700 1.000 78.61868  ? 482 HIS A NE2 1 
ATOM   3397  N N   . ALA A 1 483 ? 117.77200 146.79400 166.06900 1.000 77.23957  ? 483 ALA A N   1 
ATOM   3398  C CA  . ALA A 1 483 ? 116.75700 146.79300 165.01800 1.000 77.23957  ? 483 ALA A CA  1 
ATOM   3399  C C   . ALA A 1 483 ? 115.40500 146.35800 165.56300 1.000 77.23957  ? 483 ALA A C   1 
ATOM   3400  O O   . ALA A 1 483 ? 114.36000 146.85000 165.12900 1.000 77.23957  ? 483 ALA A O   1 
ATOM   3401  C CB  . ALA A 1 483 ? 117.19100 145.88100 163.87200 1.000 77.23957  ? 483 ALA A CB  1 
ATOM   3402  N N   . ASP A 1 484 ? 115.41100 145.45200 166.54100 1.000 73.23891  ? 484 ASP A N   1 
ATOM   3403  C CA  . ASP A 1 484 ? 114.17200 145.02100 167.17100 1.000 73.23891  ? 484 ASP A CA  1 
ATOM   3404  C C   . ASP A 1 484 ? 113.61500 146.07700 168.11200 1.000 73.23891  ? 484 ASP A C   1 
ATOM   3405  O O   . ASP A 1 484 ? 112.45900 145.97300 168.52900 1.000 73.23891  ? 484 ASP A O   1 
ATOM   3406  C CB  . ASP A 1 484 ? 114.40500 143.71300 167.91900 1.000 73.23891  ? 484 ASP A CB  1 
ATOM   3407  C CG  . ASP A 1 484 ? 113.22800 142.78100 167.83000 1.000 73.23891  ? 484 ASP A CG  1 
ATOM   3408  O OD1 . ASP A 1 484 ? 112.17600 143.20700 167.32200 1.000 73.23891  ? 484 ASP A OD1 1 
ATOM   3409  O OD2 . ASP A 1 484 ? 113.35900 141.61500 168.24600 1.000 73.23891  ? 484 ASP A OD2 1 
ATOM   3410  N N   . ASP A 1 485 ? 114.41600 147.07700 168.46700 1.000 75.20674  ? 485 ASP A N   1 
ATOM   3411  C CA  . ASP A 1 485 ? 113.96600 148.20900 169.26400 1.000 75.20674  ? 485 ASP A CA  1 
ATOM   3412  C C   . ASP A 1 485 ? 113.36500 149.28700 168.36900 1.000 75.20674  ? 485 ASP A C   1 
ATOM   3413  O O   . ASP A 1 485 ? 112.38800 149.93700 168.75200 1.000 75.20674  ? 485 ASP A O   1 
ATOM   3414  C CB  . ASP A 1 485 ? 115.15200 148.75800 170.07200 1.000 75.20674  ? 485 ASP A CB  1 
ATOM   3415  C CG  . ASP A 1 485 ? 114.74400 149.64600 171.24500 1.000 75.20674  ? 485 ASP A CG  1 
ATOM   3416  O OD1 . ASP A 1 485 ? 115.53800 149.72300 172.20400 1.000 75.20674  ? 485 ASP A OD1 1 
ATOM   3417  O OD2 . ASP A 1 485 ? 113.66200 150.26200 171.24400 1.000 75.20674  ? 485 ASP A OD2 1 
ATOM   3418  N N   . GLY A 1 486 ? 113.89900 149.45600 167.15800 1.000 71.83163  ? 486 GLY A N   1 
ATOM   3419  C CA  . GLY A 1 486 ? 113.37900 150.45800 166.24500 1.000 71.83163  ? 486 GLY A CA  1 
ATOM   3420  C C   . GLY A 1 486 ? 112.01700 150.12600 165.67300 1.000 71.83163  ? 486 GLY A C   1 
ATOM   3421  O O   . GLY A 1 486 ? 111.34000 151.01700 165.15200 1.000 71.83163  ? 486 GLY A O   1 
ATOM   3422  N N   . ARG A 1 487 ? 111.59500 148.86400 165.76100 1.000 72.77585  ? 487 ARG A N   1 
ATOM   3423  C CA  . ARG A 1 487 ? 110.28900 148.47900 165.24300 1.000 72.77585  ? 487 ARG A CA  1 
ATOM   3424  C C   . ARG A 1 487 ? 109.17700 148.83400 166.21900 1.000 72.77585  ? 487 ARG A C   1 
ATOM   3425  O O   . ARG A 1 487 ? 108.07900 149.21800 165.80300 1.000 72.77585  ? 487 ARG A O   1 
ATOM   3426  C CB  . ARG A 1 487 ? 110.26600 146.98400 164.93000 1.000 72.77585  ? 487 ARG A CB  1 
ATOM   3427  N N   . VAL A 1 488 ? 109.43900 148.71800 167.52400 1.000 73.49986  ? 488 VAL A N   1 
ATOM   3428  C CA  . VAL A 1 488 ? 108.39800 148.96700 168.51500 1.000 73.49986  ? 488 VAL A CA  1 
ATOM   3429  C C   . VAL A 1 488 ? 108.15300 150.46000 168.70200 1.000 73.49986  ? 488 VAL A C   1 
ATOM   3430  O O   . VAL A 1 488 ? 107.11100 150.85400 169.23300 1.000 73.49986  ? 488 VAL A O   1 
ATOM   3431  C CB  . VAL A 1 488 ? 108.75700 148.26900 169.84800 1.000 73.49986  ? 488 VAL A CB  1 
ATOM   3432  C CG1 . VAL A 1 488 ? 109.75300 149.08700 170.65600 1.000 73.49986  ? 488 VAL A CG1 1 
ATOM   3433  C CG2 . VAL A 1 488 ? 107.50800 147.94400 170.65600 1.000 73.49986  ? 488 VAL A CG2 1 
ATOM   3434  N N   . ILE A 1 489 ? 109.08500 151.30900 168.26200 1.000 74.07318  ? 489 ILE A N   1 
ATOM   3435  C CA  . ILE A 1 489 ? 108.85900 152.74700 168.31900 1.000 74.07318  ? 489 ILE A CA  1 
ATOM   3436  C C   . ILE A 1 489 ? 107.83400 153.16400 167.27200 1.000 74.07318  ? 489 ILE A C   1 
ATOM   3437  O O   . ILE A 1 489 ? 106.97100 154.01000 167.53900 1.000 74.07318  ? 489 ILE A O   1 
ATOM   3438  C CB  . ILE A 1 489 ? 110.20200 153.48500 168.16000 1.000 74.07318  ? 489 ILE A CB  1 
ATOM   3439  C CG1 . ILE A 1 489 ? 111.07900 153.23900 169.38900 1.000 74.07318  ? 489 ILE A CG1 1 
ATOM   3440  C CG2 . ILE A 1 489 ? 110.01200 154.98400 167.93300 1.000 74.07318  ? 489 ILE A CG2 1 
ATOM   3441  C CD1 . ILE A 1 489 ? 110.59500 153.93900 170.64500 1.000 74.07318  ? 489 ILE A CD1 1 
ATOM   3442  N N   . MET A 1 490 ? 107.87200 152.54900 166.08800 1.000 71.43775  ? 490 MET A N   1 
ATOM   3443  C CA  . MET A 1 490 ? 106.90000 152.87600 165.05100 1.000 71.43775  ? 490 MET A CA  1 
ATOM   3444  C C   . MET A 1 490 ? 105.50800 152.36200 165.38300 1.000 71.43775  ? 490 MET A C   1 
ATOM   3445  O O   . MET A 1 490 ? 104.51900 152.91500 164.89300 1.000 71.43775  ? 490 MET A O   1 
ATOM   3446  C CB  . MET A 1 490 ? 107.34100 152.31500 163.70200 1.000 71.43775  ? 490 MET A CB  1 
ATOM   3447  C CG  . MET A 1 490 ? 106.88300 153.16000 162.53200 1.000 71.43775  ? 490 MET A CG  1 
ATOM   3448  S SD  . MET A 1 490 ? 106.54700 152.20100 161.04700 1.000 71.43775  ? 490 MET A SD  1 
ATOM   3449  C CE  . MET A 1 490 ? 104.96900 151.46800 161.46300 1.000 71.43775  ? 490 MET A CE  1 
ATOM   3450  N N   . ASN A 1 491 ? 105.40500 151.32000 166.20300 1.000 72.88879  ? 491 ASN A N   1 
ATOM   3451  C CA  . ASN A 1 491 ? 104.10700 150.86500 166.67900 1.000 72.88879  ? 491 ASN A CA  1 
ATOM   3452  C C   . ASN A 1 491 ? 103.63600 151.61900 167.91600 1.000 72.88879  ? 491 ASN A C   1 
ATOM   3453  O O   . ASN A 1 491 ? 102.57200 151.28000 168.44800 1.000 72.88879  ? 491 ASN A O   1 
ATOM   3454  C CB  . ASN A 1 491 ? 104.14400 149.36600 166.98000 1.000 72.88879  ? 491 ASN A CB  1 
ATOM   3455  C CG  . ASN A 1 491 ? 104.59500 148.54500 165.79300 1.000 72.88879  ? 491 ASN A CG  1 
ATOM   3456  O OD1 . ASN A 1 491 ? 105.26800 147.53100 165.95100 1.000 72.88879  ? 491 ASN A OD1 1 
ATOM   3457  N ND2 . ASN A 1 491 ? 104.22200 148.97600 164.59700 1.000 72.88879  ? 491 ASN A ND2 1 
ATOM   3458  N N   . ASN A 1 492 ? 104.40800 152.61000 168.36900 1.000 72.86136  ? 492 ASN A N   1 
ATOM   3459  C CA  . ASN A 1 492 ? 104.11400 153.47600 169.51600 1.000 72.86136  ? 492 ASN A CA  1 
ATOM   3460  C C   . ASN A 1 492 ? 103.87300 152.70100 170.81000 1.000 72.86136  ? 492 ASN A C   1 
ATOM   3461  O O   . ASN A 1 492 ? 104.79100 152.50500 171.60500 1.000 72.86136  ? 492 ASN A O   1 
ATOM   3462  C CB  . ASN A 1 492 ? 102.91600 154.37900 169.20800 1.000 72.86136  ? 492 ASN A CB  1 
ATOM   3463  C CG  . ASN A 1 492 ? 103.11800 155.20100 167.95400 1.000 72.86136  ? 492 ASN A CG  1 
ATOM   3464  O OD1 . ASN A 1 492 ? 104.11400 155.90700 167.81800 1.000 72.86136  ? 492 ASN A OD1 1 
ATOM   3465  N ND2 . ASN A 1 492 ? 102.17400 155.10800 167.02500 1.000 72.86136  ? 492 ASN A ND2 1 
ATOM   3466  N N   . LYS B 1 49  ? 142.78000 79.11000  129.32200 1.000 74.66183  ? 49  LYS B N   1 
ATOM   3467  C CA  . LYS B 1 49  ? 142.93600 77.81900  128.66400 1.000 74.66183  ? 49  LYS B CA  1 
ATOM   3468  C C   . LYS B 1 49  ? 143.98300 77.88100  127.55200 1.000 74.66183  ? 49  LYS B C   1 
ATOM   3469  O O   . LYS B 1 49  ? 145.07900 78.40200  127.74700 1.000 74.66183  ? 49  LYS B O   1 
ATOM   3470  C CB  . LYS B 1 49  ? 141.59700 77.34600  128.09600 1.000 74.66183  ? 49  LYS B CB  1 
ATOM   3471  C CG  . LYS B 1 49  ? 140.54100 77.03500  129.13600 1.000 74.66183  ? 49  LYS B CG  1 
ATOM   3472  C CD  . LYS B 1 49  ? 139.40800 76.23200  128.51700 1.000 74.66183  ? 49  LYS B CD  1 
ATOM   3473  C CE  . LYS B 1 49  ? 138.36500 75.83800  129.55000 1.000 74.66183  ? 49  LYS B CE  1 
ATOM   3474  N NZ  . LYS B 1 49  ? 137.59000 77.01000  130.04000 1.000 74.66183  ? 49  LYS B NZ  1 
ATOM   3475  N N   . HIS B 1 50  ? 143.63600 77.33400  126.38900 1.000 76.35122  ? 50  HIS B N   1 
ATOM   3476  C CA  . HIS B 1 50  ? 144.45800 77.39400  125.18400 1.000 76.35122  ? 50  HIS B CA  1 
ATOM   3477  C C   . HIS B 1 50  ? 143.89100 78.40600  124.19000 1.000 76.35122  ? 50  HIS B C   1 
ATOM   3478  O O   . HIS B 1 50  ? 143.96500 78.22000  122.97500 1.000 76.35122  ? 50  HIS B O   1 
ATOM   3479  C CB  . HIS B 1 50  ? 144.56400 76.01700  124.53900 1.000 76.35122  ? 50  HIS B CB  1 
ATOM   3480  C CG  . HIS B 1 50  ? 143.23800 75.38400  124.25600 1.000 76.35122  ? 50  HIS B CG  1 
ATOM   3481  N ND1 . HIS B 1 50  ? 142.53900 74.66600  125.20300 1.000 76.35122  ? 50  HIS B ND1 1 
ATOM   3482  C CD2 . HIS B 1 50  ? 142.47900 75.36700  123.13600 1.000 76.35122  ? 50  HIS B CD2 1 
ATOM   3483  C CE1 . HIS B 1 50  ? 141.40900 74.23000  124.67600 1.000 76.35122  ? 50  HIS B CE1 1 
ATOM   3484  N NE2 . HIS B 1 50  ? 141.34800 74.64100  123.42200 1.000 76.35122  ? 50  HIS B NE2 1 
ATOM   3485  N N   . ILE B 1 51  ? 143.32400 79.49100  124.71200 1.000 68.99505  ? 51  ILE B N   1 
ATOM   3486  C CA  . ILE B 1 51  ? 142.58300 80.47500  123.93700 1.000 68.99505  ? 51  ILE B CA  1 
ATOM   3487  C C   . ILE B 1 51  ? 143.34900 81.79000  123.95100 1.000 68.99505  ? 51  ILE B C   1 
ATOM   3488  O O   . ILE B 1 51  ? 143.86200 82.21500  124.99000 1.000 68.99505  ? 51  ILE B O   1 
ATOM   3489  C CB  . ILE B 1 51  ? 141.16400 80.64300  124.52400 1.000 68.99505  ? 51  ILE B CB  1 
ATOM   3490  C CG1 . ILE B 1 51  ? 140.45900 79.29200  124.61800 1.000 68.99505  ? 51  ILE B CG1 1 
ATOM   3491  C CG2 . ILE B 1 51  ? 140.33100 81.58800  123.70500 1.000 68.99505  ? 51  ILE B CG2 1 
ATOM   3492  C CD1 . ILE B 1 51  ? 140.31200 78.58700  123.30100 1.000 68.99505  ? 51  ILE B CD1 1 
ATOM   3493  N N   . ILE B 1 52  ? 143.43400 82.43600  122.79000 1.000 63.71221  ? 52  ILE B N   1 
ATOM   3494  C CA  . ILE B 1 52  ? 144.08100 83.73800  122.66500 1.000 63.71221  ? 52  ILE B CA  1 
ATOM   3495  C C   . ILE B 1 52  ? 143.05500 84.82900  122.93900 1.000 63.71221  ? 52  ILE B C   1 
ATOM   3496  O O   . ILE B 1 52  ? 141.94400 84.80600  122.39600 1.000 63.71221  ? 52  ILE B O   1 
ATOM   3497  C CB  . ILE B 1 52  ? 144.74700 83.90600  121.28300 1.000 63.71221  ? 52  ILE B CB  1 
ATOM   3498  C CG1 . ILE B 1 52  ? 145.21100 85.35000  121.04300 1.000 63.71221  ? 52  ILE B CG1 1 
ATOM   3499  C CG2 . ILE B 1 52  ? 143.86300 83.40500  120.15500 1.000 63.71221  ? 52  ILE B CG2 1 
ATOM   3500  C CD1 . ILE B 1 52  ? 146.32200 85.82000  121.96700 1.000 63.71221  ? 52  ILE B CD1 1 
ATOM   3501  N N   . SER B 1 53  ? 143.41500 85.76300  123.81200 1.000 60.45394  ? 53  SER B N   1 
ATOM   3502  C CA  . SER B 1 53  ? 142.60500 86.92300  124.13800 1.000 60.45394  ? 53  SER B CA  1 
ATOM   3503  C C   . SER B 1 53  ? 142.64400 87.91400  122.98100 1.000 60.45394  ? 53  SER B C   1 
ATOM   3504  O O   . SER B 1 53  ? 143.66300 88.02300  122.29800 1.000 60.45394  ? 53  SER B O   1 
ATOM   3505  C CB  . SER B 1 53  ? 143.13100 87.59500  125.39900 1.000 60.45394  ? 53  SER B CB  1 
ATOM   3506  O OG  . SER B 1 53  ? 144.09100 88.58300  125.07600 1.000 60.45394  ? 53  SER B OG  1 
ATOM   3507  N N   . PRO B 1 54  ? 141.56800 88.67600  122.75200 1.000 56.78801  ? 54  PRO B N   1 
ATOM   3508  C CA  . PRO B 1 54  ? 141.56300 89.60700  121.61700 1.000 56.78801  ? 54  PRO B CA  1 
ATOM   3509  C C   . PRO B 1 54  ? 142.37400 90.87200  121.83700 1.000 56.78801  ? 54  PRO B C   1 
ATOM   3510  O O   . PRO B 1 54  ? 141.85700 91.97300  121.64400 1.000 56.78801  ? 54  PRO B O   1 
ATOM   3511  C CB  . PRO B 1 54  ? 140.07700 89.93800  121.45300 1.000 56.78801  ? 54  PRO B CB  1 
ATOM   3512  C CG  . PRO B 1 54  ? 139.52400 89.77400  122.79300 1.000 56.78801  ? 54  PRO B CG  1 
ATOM   3513  C CD  . PRO B 1 54  ? 140.24600 88.60900  123.39200 1.000 56.78801  ? 54  PRO B CD  1 
ATOM   3514  N N   . PHE B 1 55  ? 143.63800 90.73900  122.22500 1.000 59.14188  ? 55  PHE B N   1 
ATOM   3515  C CA  . PHE B 1 55  ? 144.54000 91.86800  122.35500 1.000 59.14188  ? 55  PHE B CA  1 
ATOM   3516  C C   . PHE B 1 55  ? 145.91000 91.46500  121.82100 1.000 59.14188  ? 55  PHE B C   1 
ATOM   3517  O O   . PHE B 1 55  ? 146.13500 90.31500  121.43100 1.000 59.14188  ? 55  PHE B O   1 
ATOM   3518  C CB  . PHE B 1 55  ? 144.62300 92.35400  123.80800 1.000 59.14188  ? 55  PHE B CB  1 
ATOM   3519  C CG  . PHE B 1 55  ? 143.30200 92.81000  124.37100 1.000 59.14188  ? 55  PHE B CG  1 
ATOM   3520  C CD1 . PHE B 1 55  ? 142.72700 93.99900  123.95400 1.000 59.14188  ? 55  PHE B CD1 1 
ATOM   3521  C CD2 . PHE B 1 55  ? 142.63300 92.04500  125.31300 1.000 59.14188  ? 55  PHE B CD2 1 
ATOM   3522  C CE1 . PHE B 1 55  ? 141.50900 94.41500  124.46600 1.000 59.14188  ? 55  PHE B CE1 1 
ATOM   3523  C CE2 . PHE B 1 55  ? 141.41600 92.45900  125.82900 1.000 59.14188  ? 55  PHE B CE2 1 
ATOM   3524  C CZ  . PHE B 1 55  ? 140.85600 93.64300  125.40300 1.000 59.14188  ? 55  PHE B CZ  1 
ATOM   3525  N N   . ASN B 1 56  ? 146.82500 92.44100  121.82800 1.000 63.56474  ? 56  ASN B N   1 
ATOM   3526  C CA  . ASN B 1 56  ? 148.13500 92.50500  121.17800 1.000 63.56474  ? 56  ASN B CA  1 
ATOM   3527  C C   . ASN B 1 56  ? 149.00000 91.27700  121.46000 1.000 63.56474  ? 56  ASN B C   1 
ATOM   3528  O O   . ASN B 1 56  ? 148.79800 90.60600  122.47900 1.000 63.56474  ? 56  ASN B O   1 
ATOM   3529  C CB  . ASN B 1 56  ? 148.84700 93.77500  121.66000 1.000 63.56474  ? 56  ASN B CB  1 
ATOM   3530  C CG  . ASN B 1 56  ? 149.46800 94.57600  120.53000 1.000 63.56474  ? 56  ASN B CG  1 
ATOM   3531  O OD1 . ASN B 1 56  ? 149.06300 94.46400  119.37500 1.000 63.56474  ? 56  ASN B OD1 1 
ATOM   3532  N ND2 . ASN B 1 56  ? 150.46400 95.38400  120.86000 1.000 63.56474  ? 56  ASN B ND2 1 
ATOM   3533  N N   . PRO B 1 57  ? 149.97600 90.93900  120.59800 1.000 65.52333  ? 57  PRO B N   1 
ATOM   3534  C CA  . PRO B 1 57  ? 150.32500 91.45500  119.26700 1.000 65.52333  ? 57  PRO B CA  1 
ATOM   3535  C C   . PRO B 1 57  ? 149.91600 90.58100  118.08700 1.000 65.52333  ? 57  PRO B C   1 
ATOM   3536  O O   . PRO B 1 57  ? 149.81000 91.08100  116.97300 1.000 65.52333  ? 57  PRO B O   1 
ATOM   3537  C CB  . PRO B 1 57  ? 151.84600 91.56300  119.34100 1.000 65.52333  ? 57  PRO B CB  1 
ATOM   3538  C CG  . PRO B 1 57  ? 152.24700 90.43800  120.24100 1.000 65.52333  ? 57  PRO B CG  1 
ATOM   3539  C CD  . PRO B 1 57  ? 151.10400 90.20700  121.20600 1.000 65.52333  ? 57  PRO B CD  1 
ATOM   3540  N N   . ARG B 1 58  ? 149.68100 89.29900  118.33100 1.000 62.37186  ? 58  ARG B N   1 
ATOM   3541  C CA  . ARG B 1 58  ? 149.39600 88.34700  117.27200 1.000 62.37186  ? 58  ARG B CA  1 
ATOM   3542  C C   . ARG B 1 58  ? 147.93500 88.34000  116.85300 1.000 62.37186  ? 58  ARG B C   1 
ATOM   3543  O O   . ARG B 1 58  ? 147.54800 87.49300  116.04300 1.000 62.37186  ? 58  ARG B O   1 
ATOM   3544  C CB  . ARG B 1 58  ? 149.81600 86.94300  117.71100 1.000 62.37186  ? 58  ARG B CB  1 
ATOM   3545  N N   . TYR B 1 59  ? 147.12200 89.23000  117.38500 1.000 58.12680  ? 59  TYR B N   1 
ATOM   3546  C CA  . TYR B 1 59  ? 145.72900 89.30000  116.96800 1.000 58.12680  ? 59  TYR B CA  1 
ATOM   3547  C C   . TYR B 1 59  ? 145.28900 90.70200  116.59700 1.000 58.12680  ? 59  TYR B C   1 
ATOM   3548  O O   . TYR B 1 59  ? 144.44100 90.85500  115.72100 1.000 58.12680  ? 59  TYR B O   1 
ATOM   3549  C CB  . TYR B 1 59  ? 144.81300 88.76000  118.05300 1.000 58.12680  ? 59  TYR B CB  1 
ATOM   3550  C CG  . TYR B 1 59  ? 143.43200 88.48500  117.54200 1.000 58.12680  ? 59  TYR B CG  1 
ATOM   3551  C CD1 . TYR B 1 59  ? 143.17500 87.36200  116.78000 1.000 58.12680  ? 59  TYR B CD1 1 
ATOM   3552  C CD2 . TYR B 1 59  ? 142.38600 89.35300  117.80800 1.000 58.12680  ? 59  TYR B CD2 1 
ATOM   3553  C CE1 . TYR B 1 59  ? 141.91300 87.10400  116.30100 1.000 58.12680  ? 59  TYR B CE1 1 
ATOM   3554  C CE2 . TYR B 1 59  ? 141.12000 89.10400  117.33100 1.000 58.12680  ? 59  TYR B CE2 1 
ATOM   3555  C CZ  . TYR B 1 59  ? 140.89000 87.97800  116.58000 1.000 58.12680  ? 59  TYR B CZ  1 
ATOM   3556  O OH  . TYR B 1 59  ? 139.63000 87.72000  116.10100 1.000 58.12680  ? 59  TYR B OH  1 
ATOM   3557  N N   . ARG B 1 60  ? 145.82300 91.72700  117.24300 1.000 59.35929  ? 60  ARG B N   1 
ATOM   3558  C CA  . ARG B 1 60  ? 145.47100 93.08600  116.86300 1.000 59.35929  ? 60  ARG B CA  1 
ATOM   3559  C C   . ARG B 1 60  ? 146.31600 93.60900  115.71400 1.000 59.35929  ? 60  ARG B C   1 
ATOM   3560  O O   . ARG B 1 60  ? 146.12200 94.75200  115.28900 1.000 59.35929  ? 60  ARG B O   1 
ATOM   3561  C CB  . ARG B 1 60  ? 145.57900 94.02100  118.06500 1.000 59.35929  ? 60  ARG B CB  1 
ATOM   3562  C CG  . ARG B 1 60  ? 144.24400 94.31200  118.70900 1.000 59.35929  ? 60  ARG B CG  1 
ATOM   3563  C CD  . ARG B 1 60  ? 144.37500 95.33500  119.81300 1.000 59.35929  ? 60  ARG B CD  1 
ATOM   3564  N NE  . ARG B 1 60  ? 145.25600 96.43500  119.44100 1.000 59.35929  ? 60  ARG B NE  1 
ATOM   3565  C CZ  . ARG B 1 60  ? 146.27600 96.85200  120.18200 1.000 59.35929  ? 60  ARG B CZ  1 
ATOM   3566  N NH1 . ARG B 1 60  ? 146.54000 96.25800  121.33700 1.000 59.35929  ? 60  ARG B NH1 1 
ATOM   3567  N NH2 . ARG B 1 60  ? 147.02900 97.86300  119.77200 1.000 59.35929  ? 60  ARG B NH2 1 
ATOM   3568  N N   . ALA B 1 61  ? 147.25000 92.80800  115.21300 1.000 60.75841  ? 61  ALA B N   1 
ATOM   3569  C CA  . ALA B 1 61  ? 147.92900 93.06600  113.95200 1.000 60.75841  ? 61  ALA B CA  1 
ATOM   3570  C C   . ALA B 1 61  ? 147.43500 92.16600  112.83600 1.000 60.75841  ? 61  ALA B C   1 
ATOM   3571  O O   . ALA B 1 61  ? 147.56100 92.51300  111.66300 1.000 60.75841  ? 61  ALA B O   1 
ATOM   3572  C CB  . ALA B 1 61  ? 149.44100 92.89400  114.11400 1.000 60.75841  ? 61  ALA B CB  1 
ATOM   3573  N N   . TRP B 1 62  ? 146.87800 91.00800  113.18300 1.000 55.55049  ? 62  TRP B N   1 
ATOM   3574  C CA  . TRP B 1 62  ? 146.19400 90.18800  112.19400 1.000 55.55049  ? 62  TRP B CA  1 
ATOM   3575  C C   . TRP B 1 62  ? 144.85800 90.80300  111.81300 1.000 55.55049  ? 62  TRP B C   1 
ATOM   3576  O O   . TRP B 1 62  ? 144.44100 90.72500  110.65400 1.000 55.55049  ? 62  TRP B O   1 
ATOM   3577  C CB  . TRP B 1 62  ? 146.01300 88.77800  112.74400 1.000 55.55049  ? 62  TRP B CB  1 
ATOM   3578  C CG  . TRP B 1 62  ? 144.90900 87.98200  112.14800 1.000 55.55049  ? 62  TRP B CG  1 
ATOM   3579  C CD1 . TRP B 1 62  ? 143.65800 87.82000  112.65100 1.000 55.55049  ? 62  TRP B CD1 1 
ATOM   3580  C CD2 . TRP B 1 62  ? 144.97000 87.19200  110.96100 1.000 55.55049  ? 62  TRP B CD2 1 
ATOM   3581  N NE1 . TRP B 1 62  ? 142.92600 86.99600  111.84200 1.000 55.55049  ? 62  TRP B NE1 1 
ATOM   3582  C CE2 . TRP B 1 62  ? 143.71100 86.59300  110.79600 1.000 55.55049  ? 62  TRP B CE2 1 
ATOM   3583  C CE3 . TRP B 1 62  ? 145.96500 86.94000  110.01500 1.000 55.55049  ? 62  TRP B CE3 1 
ATOM   3584  C CZ2 . TRP B 1 62  ? 143.41700 85.75800  109.72500 1.000 55.55049  ? 62  TRP B CZ2 1 
ATOM   3585  C CZ3 . TRP B 1 62  ? 145.67200 86.11300  108.95200 1.000 55.55049  ? 62  TRP B CZ3 1 
ATOM   3586  C CH2 . TRP B 1 62  ? 144.40900 85.53100  108.81600 1.000 55.55049  ? 62  TRP B CH2 1 
ATOM   3587  N N   . GLU B 1 63  ? 144.17100 91.42300  112.77400 1.000 57.54756  ? 63  GLU B N   1 
ATOM   3588  C CA  . GLU B 1 63  ? 142.90300 92.07400  112.47000 1.000 57.54756  ? 63  GLU B CA  1 
ATOM   3589  C C   . GLU B 1 63  ? 143.09900 93.34700  111.66700 1.000 57.54756  ? 63  GLU B C   1 
ATOM   3590  O O   . GLU B 1 63  ? 142.19800 93.75400  110.92900 1.000 57.54756  ? 63  GLU B O   1 
ATOM   3591  C CB  . GLU B 1 63  ? 142.14800 92.40800  113.74800 1.000 57.54756  ? 63  GLU B CB  1 
ATOM   3592  C CG  . GLU B 1 63  ? 141.03600 91.45400  114.08300 1.000 57.54756  ? 63  GLU B CG  1 
ATOM   3593  C CD  . GLU B 1 63  ? 140.27400 91.89900  115.30900 1.000 57.54756  ? 63  GLU B CD  1 
ATOM   3594  O OE1 . GLU B 1 63  ? 140.91900 92.18300  116.33900 1.000 57.54756  ? 63  GLU B OE1 1 
ATOM   3595  O OE2 . GLU B 1 63  ? 139.03000 91.97800  115.24000 1.000 57.54756  ? 63  GLU B OE2 1 
ATOM   3596  N N   . MET B 1 64  ? 144.24300 94.00600  111.81700 1.000 57.69101  ? 64  MET B N   1 
ATOM   3597  C CA  . MET B 1 64  ? 144.52900 95.17900  111.00900 1.000 57.69101  ? 64  MET B CA  1 
ATOM   3598  C C   . MET B 1 64  ? 144.92500 94.80700  109.59300 1.000 57.69101  ? 64  MET B C   1 
ATOM   3599  O O   . MET B 1 64  ? 144.87600 95.65900  108.70200 1.000 57.69101  ? 64  MET B O   1 
ATOM   3600  C CB  . MET B 1 64  ? 145.63300 96.01000  111.65900 1.000 57.69101  ? 64  MET B CB  1 
ATOM   3601  C CG  . MET B 1 64  ? 145.59500 97.48800  111.30900 1.000 57.69101  ? 64  MET B CG  1 
ATOM   3602  S SD  . MET B 1 64  ? 144.00800 98.25400  111.67600 1.000 57.69101  ? 64  MET B SD  1 
ATOM   3603  C CE  . MET B 1 64  ? 144.01300 98.21800  113.46300 1.000 57.69101  ? 64  MET B CE  1 
ATOM   3604  N N   . TRP B 1 65  ? 145.30900 93.55700  109.36200 1.000 54.30852  ? 65  TRP B N   1 
ATOM   3605  C CA  . TRP B 1 65  ? 145.62500 93.13300  108.00800 1.000 54.30852  ? 65  TRP B CA  1 
ATOM   3606  C C   . TRP B 1 65  ? 144.37700 92.70900  107.25100 1.000 54.30852  ? 65  TRP B C   1 
ATOM   3607  O O   . TRP B 1 65  ? 144.30700 92.87700  106.03100 1.000 54.30852  ? 65  TRP B O   1 
ATOM   3608  C CB  . TRP B 1 65  ? 146.64200 91.99900  108.02900 1.000 54.30852  ? 65  TRP B CB  1 
ATOM   3609  C CG  . TRP B 1 65  ? 147.23700 91.80200  106.70500 1.000 54.30852  ? 65  TRP B CG  1 
ATOM   3610  C CD1 . TRP B 1 65  ? 147.99600 92.69300  106.01200 1.000 54.30852  ? 65  TRP B CD1 1 
ATOM   3611  C CD2 . TRP B 1 65  ? 147.09800 90.65700  105.87300 1.000 54.30852  ? 65  TRP B CD2 1 
ATOM   3612  N NE1 . TRP B 1 65  ? 148.35500 92.16700  104.79900 1.000 54.30852  ? 65  TRP B NE1 1 
ATOM   3613  C CE2 . TRP B 1 65  ? 147.81300 90.91500  104.68900 1.000 54.30852  ? 65  TRP B CE2 1 
ATOM   3614  C CE3 . TRP B 1 65  ? 146.44300 89.43400  106.01300 1.000 54.30852  ? 65  TRP B CE3 1 
ATOM   3615  C CZ2 . TRP B 1 65  ? 147.89400 89.99800  103.65800 1.000 54.30852  ? 65  TRP B CZ2 1 
ATOM   3616  C CZ3 . TRP B 1 65  ? 146.52500 88.52500  104.98700 1.000 54.30852  ? 65  TRP B CZ3 1 
ATOM   3617  C CH2 . TRP B 1 65  ? 147.24600 88.81200  103.82400 1.000 54.30852  ? 65  TRP B CH2 1 
ATOM   3618  N N   . LEU B 1 66  ? 143.37600 92.17100  107.95100 1.000 49.37842  ? 66  LEU B N   1 
ATOM   3619  C CA  . LEU B 1 66  ? 142.13700 91.80600  107.27700 1.000 49.37842  ? 66  LEU B CA  1 
ATOM   3620  C C   . LEU B 1 66  ? 141.31400 93.02600  106.90000 1.000 49.37842  ? 66  LEU B C   1 
ATOM   3621  O O   . LEU B 1 66  ? 140.41000 92.92300  106.06900 1.000 49.37842  ? 66  LEU B O   1 
ATOM   3622  C CB  . LEU B 1 66  ? 141.29900 90.87700  108.14600 1.000 49.37842  ? 66  LEU B CB  1 
ATOM   3623  C CG  . LEU B 1 66  ? 141.72100 89.41900  108.22100 1.000 49.37842  ? 66  LEU B CG  1 
ATOM   3624  C CD1 . LEU B 1 66  ? 140.65400 88.64200  108.93700 1.000 49.37842  ? 66  LEU B CD1 1 
ATOM   3625  C CD2 . LEU B 1 66  ? 141.94300 88.86000  106.84500 1.000 49.37842  ? 66  LEU B CD2 1 
ATOM   3626  N N   . VAL B 1 67  ? 141.59000 94.17800  107.50700 1.000 47.78425  ? 67  VAL B N   1 
ATOM   3627  C CA  . VAL B 1 67  ? 140.92500 95.40700  107.09300 1.000 47.78425  ? 67  VAL B CA  1 
ATOM   3628  C C   . VAL B 1 67  ? 141.43000 95.84300  105.72500 1.000 47.78425  ? 67  VAL B C   1 
ATOM   3629  O O   . VAL B 1 67  ? 140.65600 96.30500  104.88000 1.000 47.78425  ? 67  VAL B O   1 
ATOM   3630  C CB  . VAL B 1 67  ? 141.11900 96.48600  108.17200 1.000 47.78425  ? 67  VAL B CB  1 
ATOM   3631  C CG1 . VAL B 1 67  ? 140.71400 97.85500  107.68700 1.000 47.78425  ? 67  VAL B CG1 1 
ATOM   3632  C CG2 . VAL B 1 67  ? 140.30300 96.12100  109.37900 1.000 47.78425  ? 67  VAL B CG2 1 
ATOM   3633  N N   . LEU B 1 68  ? 142.72000 95.63400  105.45200 1.000 47.14961  ? 68  LEU B N   1 
ATOM   3634  C CA  . LEU B 1 68  ? 143.25200 95.96300  104.13500 1.000 47.14961  ? 68  LEU B CA  1 
ATOM   3635  C C   . LEU B 1 68  ? 142.79500 94.97400  103.07200 1.000 47.14961  ? 68  LEU B C   1 
ATOM   3636  O O   . LEU B 1 68  ? 142.89600 95.26500  101.87900 1.000 47.14961  ? 68  LEU B O   1 
ATOM   3637  C CB  . LEU B 1 68  ? 144.77400 96.01800  104.17900 1.000 47.14961  ? 68  LEU B CB  1 
ATOM   3638  C CG  . LEU B 1 68  ? 145.36000 97.17800  104.97700 1.000 47.14961  ? 68  LEU B CG  1 
ATOM   3639  C CD1 . LEU B 1 68  ? 146.86800 97.20500  104.84700 1.000 47.14961  ? 68  LEU B CD1 1 
ATOM   3640  C CD2 . LEU B 1 68  ? 144.76300 98.48900  104.52000 1.000 47.14961  ? 68  LEU B CD2 1 
ATOM   3641  N N   . LEU B 1 69  ? 142.30300 93.80600  103.47200 1.000 47.25304  ? 69  LEU B N   1 
ATOM   3642  C CA  . LEU B 1 69  ? 141.70900 92.89600  102.50800 1.000 47.25304  ? 69  LEU B CA  1 
ATOM   3643  C C   . LEU B 1 69  ? 140.20500 93.06900  102.40600 1.000 47.25304  ? 69  LEU B C   1 
ATOM   3644  O O   . LEU B 1 69  ? 139.55400 92.28900  101.71000 1.000 47.25304  ? 69  LEU B O   1 
ATOM   3645  C CB  . LEU B 1 69  ? 142.03100 91.44900  102.86700 1.000 47.25304  ? 69  LEU B CB  1 
ATOM   3646  C CG  . LEU B 1 69  ? 143.50600 91.06400  102.91200 1.000 47.25304  ? 69  LEU B CG  1 
ATOM   3647  C CD1 . LEU B 1 69  ? 143.62400 89.56300  102.95700 1.000 47.25304  ? 69  LEU B CD1 1 
ATOM   3648  C CD2 . LEU B 1 69  ? 144.26300 91.62100  101.72700 1.000 47.25304  ? 69  LEU B CD2 1 
ATOM   3649  N N   . VAL B 1 70  ? 139.63900 94.04600  103.10900 1.000 45.87998  ? 70  VAL B N   1 
ATOM   3650  C CA  . VAL B 1 70  ? 138.24200 94.40600  102.90300 1.000 45.87998  ? 70  VAL B CA  1 
ATOM   3651  C C   . VAL B 1 70  ? 138.15400 95.66200  102.05000 1.000 45.87998  ? 70  VAL B C   1 
ATOM   3652  O O   . VAL B 1 70  ? 137.28600 95.77600  101.18000 1.000 45.87998  ? 70  VAL B O   1 
ATOM   3653  C CB  . VAL B 1 70  ? 137.53600 94.56500  104.26200 1.000 45.87998  ? 70  VAL B CB  1 
ATOM   3654  C CG1 . VAL B 1 70  ? 136.18700 95.19300  104.11600 1.000 45.87998  ? 70  VAL B CG1 1 
ATOM   3655  C CG2 . VAL B 1 70  ? 137.36300 93.22600  104.90300 1.000 45.87998  ? 70  VAL B CG2 1 
ATOM   3656  N N   . ILE B 1 71  ? 139.08400 96.59600  102.25500 1.000 44.41690  ? 71  ILE B N   1 
ATOM   3657  C CA  . ILE B 1 71  ? 139.16600 97.79500  101.42600 1.000 44.41690  ? 71  ILE B CA  1 
ATOM   3658  C C   . ILE B 1 71  ? 139.49500 97.42600  99.98500  1.000 44.41690  ? 71  ILE B C   1 
ATOM   3659  O O   . ILE B 1 71  ? 138.95500 98.01200  99.03900  1.000 44.41690  ? 71  ILE B O   1 
ATOM   3660  C CB  . ILE B 1 71  ? 140.19800 98.76400  102.02900 1.000 44.41690  ? 71  ILE B CB  1 
ATOM   3661  C CG1 . ILE B 1 71  ? 139.73300 99.20100  103.41200 1.000 44.41690  ? 71  ILE B CG1 1 
ATOM   3662  C CG2 . ILE B 1 71  ? 140.40800 99.97900  101.15300 1.000 44.41690  ? 71  ILE B CG2 1 
ATOM   3663  C CD1 . ILE B 1 71  ? 140.72700 100.05300 104.13700 1.000 44.41690  ? 71  ILE B CD1 1 
ATOM   3664  N N   . TYR B 1 72  ? 140.34200 96.41500  99.79200  1.000 47.34179  ? 72  TYR B N   1 
ATOM   3665  C CA  . TYR B 1 72  ? 140.58100 95.90000  98.44900  1.000 47.34179  ? 72  TYR B CA  1 
ATOM   3666  C C   . TYR B 1 72  ? 139.36600 95.15200  97.92000  1.000 47.34179  ? 72  TYR B C   1 
ATOM   3667  O O   . TYR B 1 72  ? 138.95500 95.35700  96.77600  1.000 47.34179  ? 72  TYR B O   1 
ATOM   3668  C CB  . TYR B 1 72  ? 141.80700 94.99100  98.44500  1.000 47.34179  ? 72  TYR B CB  1 
ATOM   3669  C CG  . TYR B 1 72  ? 141.97500 94.18100  97.18300  1.000 47.34179  ? 72  TYR B CG  1 
ATOM   3670  C CD1 . TYR B 1 72  ? 141.64100 92.83200  97.14500  1.000 47.34179  ? 72  TYR B CD1 1 
ATOM   3671  C CD2 . TYR B 1 72  ? 142.48400 94.76200  96.03200  1.000 47.34179  ? 72  TYR B CD2 1 
ATOM   3672  C CE1 . TYR B 1 72  ? 141.78900 92.09800  95.99600  1.000 47.34179  ? 72  TYR B CE1 1 
ATOM   3673  C CE2 . TYR B 1 72  ? 142.64200 94.03000  94.87700  1.000 47.34179  ? 72  TYR B CE2 1 
ATOM   3674  C CZ  . TYR B 1 72  ? 142.29400 92.70000  94.86800  1.000 47.34179  ? 72  TYR B CZ  1 
ATOM   3675  O OH  . TYR B 1 72  ? 142.44800 91.96500  93.72100  1.000 47.34179  ? 72  TYR B OH  1 
ATOM   3676  N N   . SER B 1 73  ? 138.76600 94.29000  98.74100  1.000 46.80499  ? 73  SER B N   1 
ATOM   3677  C CA  . SER B 1 73  ? 137.71100 93.41800  98.23800  1.000 46.80499  ? 73  SER B CA  1 
ATOM   3678  C C   . SER B 1 73  ? 136.36000 94.11200  98.18600  1.000 46.80499  ? 73  SER B C   1 
ATOM   3679  O O   . SER B 1 73  ? 135.35400 93.47100  97.87500  1.000 46.80499  ? 73  SER B O   1 
ATOM   3680  C CB  . SER B 1 73  ? 137.60700 92.16200  99.09200  1.000 46.80499  ? 73  SER B CB  1 
ATOM   3681  O OG  . SER B 1 73  ? 136.33300 91.56900  98.94700  1.000 46.80499  ? 73  SER B OG  1 
ATOM   3682  N N   . ALA B 1 74  ? 136.30200 95.39600  98.51900  1.000 45.75496  ? 74  ALA B N   1 
ATOM   3683  C CA  . ALA B 1 74  ? 135.12800 96.21400  98.26000  1.000 45.75496  ? 74  ALA B CA  1 
ATOM   3684  C C   . ALA B 1 74  ? 135.38500 97.25100  97.18500  1.000 45.75496  ? 74  ALA B C   1 
ATOM   3685  O O   . ALA B 1 74  ? 134.51000 98.07000  96.90700  1.000 45.75496  ? 74  ALA B O   1 
ATOM   3686  C CB  . ALA B 1 74  ? 134.65500 96.90400  99.53900  1.000 45.75496  ? 74  ALA B CB  1 
ATOM   3687  N N   . TRP B 1 75  ? 136.57100 97.24300  96.58800  1.000 44.33435  ? 75  TRP B N   1 
ATOM   3688  C CA  . TRP B 1 75  ? 136.87700 98.06000  95.42600  1.000 44.33435  ? 75  TRP B CA  1 
ATOM   3689  C C   . TRP B 1 75  ? 136.75100 97.28700  94.12800  1.000 44.33435  ? 75  TRP B C   1 
ATOM   3690  O O   . TRP B 1 75  ? 136.20000 97.80900  93.16100  1.000 44.33435  ? 75  TRP B O   1 
ATOM   3691  C CB  . TRP B 1 75  ? 138.29000 98.63000  95.53500  1.000 44.33435  ? 75  TRP B CB  1 
ATOM   3692  C CG  . TRP B 1 75  ? 138.54300 99.78400  94.63400  1.000 44.33435  ? 75  TRP B CG  1 
ATOM   3693  C CD1 . TRP B 1 75  ? 138.40700 101.09800 94.94200  1.000 44.33435  ? 75  TRP B CD1 1 
ATOM   3694  C CD2 . TRP B 1 75  ? 138.98600 99.73400  93.27300  1.000 44.33435  ? 75  TRP B CD2 1 
ATOM   3695  N NE1 . TRP B 1 75  ? 138.73300 101.87600 93.86100  1.000 44.33435  ? 75  TRP B NE1 1 
ATOM   3696  C CE2 . TRP B 1 75  ? 139.09300 101.06000 92.82300  1.000 44.33435  ? 75  TRP B CE2 1 
ATOM   3697  C CE3 . TRP B 1 75  ? 139.30800 98.69800  92.39500  1.000 44.33435  ? 75  TRP B CE3 1 
ATOM   3698  C CZ2 . TRP B 1 75  ? 139.50300 101.37700 91.53400  1.000 44.33435  ? 75  TRP B CZ2 1 
ATOM   3699  C CZ3 . TRP B 1 75  ? 139.70900 99.01300  91.11900  1.000 44.33435  ? 75  TRP B CZ3 1 
ATOM   3700  C CH2 . TRP B 1 75  ? 139.80500 100.34100 90.70000  1.000 44.33435  ? 75  TRP B CH2 1 
ATOM   3701  N N   . ILE B 1 76  ? 137.24500 96.05300  94.08200  1.000 47.94937  ? 76  ILE B N   1 
ATOM   3702  C CA  . ILE B 1 76  ? 137.17800 95.24300  92.87300  1.000 47.94937  ? 76  ILE B CA  1 
ATOM   3703  C C   . ILE B 1 76  ? 135.90700 94.41500  92.86500  1.000 47.94937  ? 76  ILE B C   1 
ATOM   3704  O O   . ILE B 1 76  ? 135.67600 93.63500  91.93900  1.000 47.94937  ? 76  ILE B O   1 
ATOM   3705  C CB  . ILE B 1 76  ? 138.39600 94.32000  92.74000  1.000 47.94937  ? 76  ILE B CB  1 
ATOM   3706  C CG1 . ILE B 1 76  ? 138.37400 93.29000  93.85900  1.000 47.94937  ? 76  ILE B CG1 1 
ATOM   3707  C CG2 . ILE B 1 76  ? 139.67300 95.11600  92.76100  1.000 47.94937  ? 76  ILE B CG2 1 
ATOM   3708  C CD1 . ILE B 1 76  ? 139.06900 92.00700  93.51600  1.000 47.94937  ? 76  ILE B CD1 1 
ATOM   3709  N N   . CYS B 1 77  ? 135.09400 94.54400  93.89200  1.000 53.12518  ? 77  CYS B N   1 
ATOM   3710  C CA  . CYS B 1 77  ? 133.85600 93.77800  93.89800  1.000 53.12518  ? 77  CYS B CA  1 
ATOM   3711  C C   . CYS B 1 77  ? 132.77800 94.36300  92.98300  1.000 53.12518  ? 77  CYS B C   1 
ATOM   3712  O O   . CYS B 1 77  ? 132.03500 93.57800  92.38400  1.000 53.12518  ? 77  CYS B O   1 
ATOM   3713  C CB  . CYS B 1 77  ? 133.31900 93.61000  95.31800  1.000 53.12518  ? 77  CYS B CB  1 
ATOM   3714  S SG  . CYS B 1 77  ? 132.21000 92.21100  95.48800  1.000 53.12518  ? 77  CYS B SG  1 
ATOM   3715  N N   . PRO B 1 78  ? 132.60500 95.71200  92.84100  1.000 47.67103  ? 78  PRO B N   1 
ATOM   3716  C CA  . PRO B 1 78  ? 131.77300 96.18100  91.72800  1.000 47.67103  ? 78  PRO B CA  1 
ATOM   3717  C C   . PRO B 1 78  ? 132.56900 96.59100  90.49900  1.000 47.67103  ? 78  PRO B C   1 
ATOM   3718  O O   . PRO B 1 78  ? 131.98000 96.91200  89.46500  1.000 47.67103  ? 78  PRO B O   1 
ATOM   3719  C CB  . PRO B 1 78  ? 131.03600 97.37200  92.33600  1.000 47.67103  ? 78  PRO B CB  1 
ATOM   3720  C CG  . PRO B 1 78  ? 132.01300 97.94600  93.22300  1.000 47.67103  ? 78  PRO B CG  1 
ATOM   3721  C CD  . PRO B 1 78  ? 132.77400 96.80700  93.82100  1.000 47.67103  ? 78  PRO B CD  1 
ATOM   3722  N N   . PHE B 1 79  ? 133.89700 96.59100  90.58500  1.000 46.66478  ? 79  PHE B N   1 
ATOM   3723  C CA  . PHE B 1 79  ? 134.70000 97.00400  89.44100  1.000 46.66478  ? 79  PHE B CA  1 
ATOM   3724  C C   . PHE B 1 79  ? 134.85300 95.88200  88.43200  1.000 46.66478  ? 79  PHE B C   1 
ATOM   3725  O O   . PHE B 1 79  ? 134.74700 96.11400  87.22700  1.000 46.66478  ? 79  PHE B O   1 
ATOM   3726  C CB  . PHE B 1 79  ? 136.07000 97.48200  89.89700  1.000 46.66478  ? 79  PHE B CB  1 
ATOM   3727  C CG  . PHE B 1 79  ? 136.96500 97.91500  88.78100  1.000 46.66478  ? 79  PHE B CG  1 
ATOM   3728  C CD1 . PHE B 1 79  ? 136.76200 99.12400  88.15000  1.000 46.66478  ? 79  PHE B CD1 1 
ATOM   3729  C CD2 . PHE B 1 79  ? 138.02300 97.12300  88.37600  1.000 46.66478  ? 79  PHE B CD2 1 
ATOM   3730  C CE1 . PHE B 1 79  ? 137.58900 99.53300  87.13000  1.000 46.66478  ? 79  PHE B CE1 1 
ATOM   3731  C CE2 . PHE B 1 79  ? 138.85400 97.52500  87.35600  1.000 46.66478  ? 79  PHE B CE2 1 
ATOM   3732  C CZ  . PHE B 1 79  ? 138.63700 98.73200  86.73300  1.000 46.66478  ? 79  PHE B CZ  1 
ATOM   3733  N N   . GLN B 1 80  ? 135.12000 94.66500  88.89300  1.000 53.47452  ? 80  GLN B N   1 
ATOM   3734  C CA  . GLN B 1 80  ? 135.13000 93.52600  87.98900  1.000 53.47452  ? 80  GLN B CA  1 
ATOM   3735  C C   . GLN B 1 80  ? 133.72900 93.04800  87.65200  1.000 53.47452  ? 80  GLN B C   1 
ATOM   3736  O O   . GLN B 1 80  ? 133.56600 92.23300  86.74000  1.000 53.47452  ? 80  GLN B O   1 
ATOM   3737  C CB  . GLN B 1 80  ? 135.94700 92.38200  88.58800  1.000 53.47452  ? 80  GLN B CB  1 
ATOM   3738  C CG  . GLN B 1 80  ? 135.17400 91.46600  89.51100  1.000 53.47452  ? 80  GLN B CG  1 
ATOM   3739  C CD  . GLN B 1 80  ? 136.07400 90.47700  90.21100  1.000 53.47452  ? 80  GLN B CD  1 
ATOM   3740  O OE1 . GLN B 1 80  ? 137.25500 90.36200  89.88700  1.000 53.47452  ? 80  GLN B OE1 1 
ATOM   3741  N NE2 . GLN B 1 80  ? 135.52300 89.75600  91.18000  1.000 53.47452  ? 80  GLN B NE2 1 
ATOM   3742  N N   . PHE B 1 81  ? 132.72100 93.54300  88.36200  1.000 52.39405  ? 81  PHE B N   1 
ATOM   3743  C CA  . PHE B 1 81  ? 131.33700 93.25500  88.02900  1.000 52.39405  ? 81  PHE B CA  1 
ATOM   3744  C C   . PHE B 1 81  ? 130.90600 93.95700  86.74900  1.000 52.39405  ? 81  PHE B C   1 
ATOM   3745  O O   . PHE B 1 81  ? 130.00900 93.47200  86.05600  1.000 52.39405  ? 81  PHE B O   1 
ATOM   3746  C CB  . PHE B 1 81  ? 130.46400 93.67200  89.20900  1.000 52.39405  ? 81  PHE B CB  1 
ATOM   3747  C CG  . PHE B 1 81  ? 128.99900 93.47500  89.00300  1.000 52.39405  ? 81  PHE B CG  1 
ATOM   3748  C CD1 . PHE B 1 81  ? 128.44000 92.21600  89.05700  1.000 52.39405  ? 81  PHE B CD1 1 
ATOM   3749  C CD2 . PHE B 1 81  ? 128.17200 94.56100  88.81200  1.000 52.39405  ? 81  PHE B CD2 1 
ATOM   3750  C CE1 . PHE B 1 81  ? 127.08300 92.04500  88.89300  1.000 52.39405  ? 81  PHE B CE1 1 
ATOM   3751  C CE2 . PHE B 1 81  ? 126.81800 94.39200  88.64800  1.000 52.39405  ? 81  PHE B CE2 1 
ATOM   3752  C CZ  . PHE B 1 81  ? 126.27500 93.13200  88.68600  1.000 52.39405  ? 81  PHE B CZ  1 
ATOM   3753  N N   . ALA B 1 82  ? 131.52900 95.08600  86.41400  1.000 49.26415  ? 82  ALA B N   1 
ATOM   3754  C CA  . ALA B 1 82  ? 131.11900 95.87300  85.25800  1.000 49.26415  ? 82  ALA B CA  1 
ATOM   3755  C C   . ALA B 1 82  ? 132.20100 95.98100  84.19200  1.000 49.26415  ? 82  ALA B C   1 
ATOM   3756  O O   . ALA B 1 82  ? 131.96300 95.60000  83.04400  1.000 49.26415  ? 82  ALA B O   1 
ATOM   3757  C CB  . ALA B 1 82  ? 130.69200 97.26800  85.71700  1.000 49.26415  ? 82  ALA B CB  1 
ATOM   3758  N N   . PHE B 1 83  ? 133.38200 96.48900  84.53000  1.000 47.03072  ? 83  PHE B N   1 
ATOM   3759  C CA  . PHE B 1 83  ? 134.35400 96.83800  83.50000  1.000 47.03072  ? 83  PHE B CA  1 
ATOM   3760  C C   . PHE B 1 83  ? 135.14100 95.62200  83.03100  1.000 47.03072  ? 83  PHE B C   1 
ATOM   3761  O O   . PHE B 1 83  ? 135.10500 95.26500  81.85000  1.000 47.03072  ? 83  PHE B O   1 
ATOM   3762  C CB  . PHE B 1 83  ? 135.29300 97.92300  84.01900  1.000 47.03072  ? 83  PHE B CB  1 
ATOM   3763  C CG  . PHE B 1 83  ? 134.60600 99.21400  84.28800  1.000 47.03072  ? 83  PHE B CG  1 
ATOM   3764  C CD1 . PHE B 1 83  ? 134.12700 99.50900  85.54700  1.000 47.03072  ? 83  PHE B CD1 1 
ATOM   3765  C CD2 . PHE B 1 83  ? 134.41300 100.12400 83.27300  1.000 47.03072  ? 83  PHE B CD2 1 
ATOM   3766  C CE1 . PHE B 1 83  ? 133.47900 100.69300 85.78800  1.000 47.03072  ? 83  PHE B CE1 1 
ATOM   3767  C CE2 . PHE B 1 83  ? 133.76100 101.30500 83.50900  1.000 47.03072  ? 83  PHE B CE2 1 
ATOM   3768  C CZ  . PHE B 1 83  ? 133.29900 101.59300 84.76900  1.000 47.03072  ? 83  PHE B CZ  1 
ATOM   3769  N N   . ILE B 1 84  ? 135.85700 94.97200  83.94100  1.000 57.73804  ? 84  ILE B N   1 
ATOM   3770  C CA  . ILE B 1 84  ? 136.64700 93.78700  83.58600  1.000 57.73804  ? 84  ILE B CA  1 
ATOM   3771  C C   . ILE B 1 84  ? 135.69300 92.60500  83.70500  1.000 57.73804  ? 84  ILE B C   1 
ATOM   3772  O O   . ILE B 1 84  ? 135.64700 91.88600  84.70400  1.000 57.73804  ? 84  ILE B O   1 
ATOM   3773  C CB  . ILE B 1 84  ? 137.89200 93.63800  84.46200  1.000 57.73804  ? 84  ILE B CB  1 
ATOM   3774  N N   . THR B 1 85  ? 134.92300 92.39000  82.64600  1.000 68.03023  ? 85  THR B N   1 
ATOM   3775  C CA  . THR B 1 85  ? 133.93800 91.32100  82.61500  1.000 68.03023  ? 85  THR B CA  1 
ATOM   3776  C C   . THR B 1 85  ? 134.50600 90.00800  82.09400  1.000 68.03023  ? 85  THR B C   1 
ATOM   3777  O O   . THR B 1 85  ? 133.74900 89.04700  81.92400  1.000 68.03023  ? 85  THR B O   1 
ATOM   3778  C CB  . THR B 1 85  ? 132.73500 91.73400  81.76200  1.000 68.03023  ? 85  THR B CB  1 
ATOM   3779  N N   . TYR B 1 86  ? 135.80800 89.94300  81.82600  1.000 75.94399  ? 86  TYR B N   1 
ATOM   3780  C CA  . TYR B 1 86  ? 136.40600 88.68000  81.41600  1.000 75.94399  ? 86  TYR B CA  1 
ATOM   3781  C C   . TYR B 1 86  ? 136.73800 87.81500  82.62700  1.000 75.94399  ? 86  TYR B C   1 
ATOM   3782  O O   . TYR B 1 86  ? 136.13300 86.75400  82.82400  1.000 75.94399  ? 86  TYR B O   1 
ATOM   3783  C CB  . TYR B 1 86  ? 137.65800 88.94500  80.57700  1.000 75.94399  ? 86  TYR B CB  1 
ATOM   3784  N N   . LYS B 1 87  ? 137.67100 88.29100  83.46200  1.000 80.38696  ? 87  LYS B N   1 
ATOM   3785  C CA  . LYS B 1 87  ? 138.15100 87.62300  84.68100  1.000 80.38696  ? 87  LYS B CA  1 
ATOM   3786  C C   . LYS B 1 87  ? 138.61400 86.19200  84.40900  1.000 80.38696  ? 87  LYS B C   1 
ATOM   3787  O O   . LYS B 1 87  ? 138.26400 85.25400  85.12800  1.000 80.38696  ? 87  LYS B O   1 
ATOM   3788  C CB  . LYS B 1 87  ? 137.08700 87.65500  85.78200  1.000 80.38696  ? 87  LYS B CB  1 
ATOM   3789  N N   . LYS B 1 88  ? 139.37400 86.02100  83.32500  1.000 78.53803  ? 88  LYS B N   1 
ATOM   3790  C CA  . LYS B 1 88  ? 139.82400 84.69300  82.92800  1.000 78.53803  ? 88  LYS B CA  1 
ATOM   3791  C C   . LYS B 1 88  ? 140.80400 84.06800  83.91600  1.000 78.53803  ? 88  LYS B C   1 
ATOM   3792  O O   . LYS B 1 88  ? 140.43800 83.13900  84.63900  1.000 78.53803  ? 88  LYS B O   1 
ATOM   3793  C CB  . LYS B 1 88  ? 140.46200 84.75600  81.54000  1.000 78.53803  ? 88  LYS B CB  1 
ATOM   3794  N N   . ASP B 1 89  ? 142.04000 84.57900  83.96800  1.000 77.85751  ? 89  ASP B N   1 
ATOM   3795  C CA  . ASP B 1 89  ? 143.03000 84.04600  84.89800  1.000 77.85751  ? 89  ASP B CA  1 
ATOM   3796  C C   . ASP B 1 89  ? 144.01300 85.06500  85.46300  1.000 77.85751  ? 89  ASP B C   1 
ATOM   3797  O O   . ASP B 1 89  ? 144.92500 84.65500  86.18400  1.000 77.85751  ? 89  ASP B O   1 
ATOM   3798  C CB  . ASP B 1 89  ? 143.81100 82.89800  84.23400  1.000 77.85751  ? 89  ASP B CB  1 
ATOM   3799  C CG  . ASP B 1 89  ? 143.42400 81.52800  84.77900  1.000 77.85751  ? 89  ASP B CG  1 
ATOM   3800  O OD1 . ASP B 1 89  ? 142.48400 81.44200  85.59300  1.000 77.85751  ? 89  ASP B OD1 1 
ATOM   3801  O OD2 . ASP B 1 89  ? 144.07100 80.52900  84.39900  1.000 77.85751  ? 89  ASP B OD2 1 
ATOM   3802  N N   . ALA B 1 90  ? 143.88600 86.36000  85.17500  1.000 72.95371  ? 90  ALA B N   1 
ATOM   3803  C CA  . ALA B 1 90  ? 144.93300 87.30100  85.57100  1.000 72.95371  ? 90  ALA B CA  1 
ATOM   3804  C C   . ALA B 1 90  ? 144.77400 87.74900  87.02200  1.000 72.95371  ? 90  ALA B C   1 
ATOM   3805  O O   . ALA B 1 90  ? 145.68000 87.57400  87.84300  1.000 72.95371  ? 90  ALA B O   1 
ATOM   3806  C CB  . ALA B 1 90  ? 144.93400 88.50900  84.63200  1.000 72.95371  ? 90  ALA B CB  1 
ATOM   3807  N N   . ILE B 1 91  ? 143.62200 88.34200  87.34800  1.000 71.84748  ? 91  ILE B N   1 
ATOM   3808  C CA  . ILE B 1 91  ? 143.30100 88.74200  88.71700  1.000 71.84748  ? 91  ILE B CA  1 
ATOM   3809  C C   . ILE B 1 91  ? 142.74500 87.58400  89.53000  1.000 71.84748  ? 91  ILE B C   1 
ATOM   3810  O O   . ILE B 1 91  ? 142.47500 87.74300  90.72800  1.000 71.84748  ? 91  ILE B O   1 
ATOM   3811  C CB  . ILE B 1 91  ? 142.32600 89.93600  88.64800  1.000 71.84748  ? 91  ILE B CB  1 
ATOM   3812  C CG1 . ILE B 1 91  ? 142.53000 90.88700  89.82700  1.000 71.84748  ? 91  ILE B CG1 1 
ATOM   3813  C CG2 . ILE B 1 91  ? 140.87300 89.47400  88.51200  1.000 71.84748  ? 91  ILE B CG2 1 
ATOM   3814  C CD1 . ILE B 1 91  ? 143.81900 91.66100  89.75100  1.000 71.84748  ? 91  ILE B CD1 1 
ATOM   3815  N N   . PHE B 1 92  ? 142.62400 86.40900  88.90900  1.000 72.36846  ? 92  PHE B N   1 
ATOM   3816  C CA  . PHE B 1 92  ? 141.93300 85.26400  89.49000  1.000 72.36846  ? 92  PHE B CA  1 
ATOM   3817  C C   . PHE B 1 92  ? 142.65000 84.70900  90.71200  1.000 72.36846  ? 92  PHE B C   1 
ATOM   3818  O O   . PHE B 1 92  ? 142.00700 84.13400  91.59700  1.000 72.36846  ? 92  PHE B O   1 
ATOM   3819  C CB  . PHE B 1 92  ? 141.80200 84.19600  88.41000  1.000 72.36846  ? 92  PHE B CB  1 
ATOM   3820  C CG  . PHE B 1 92  ? 141.02400 82.99100  88.81700  1.000 72.36846  ? 92  PHE B CG  1 
ATOM   3821  C CD1 . PHE B 1 92  ? 139.64400 83.01200  88.80700  1.000 72.36846  ? 92  PHE B CD1 1 
ATOM   3822  C CD2 . PHE B 1 92  ? 141.67700 81.81600  89.15600  1.000 72.36846  ? 92  PHE B CD2 1 
ATOM   3823  C CE1 . PHE B 1 92  ? 138.92800 81.89400  89.15600  1.000 72.36846  ? 92  PHE B CE1 1 
ATOM   3824  C CE2 . PHE B 1 92  ? 140.96600 80.69500  89.51100  1.000 72.36846  ? 92  PHE B CE2 1 
ATOM   3825  C CZ  . PHE B 1 92  ? 139.59000 80.73200  89.51100  1.000 72.36846  ? 92  PHE B CZ  1 
ATOM   3826  N N   . ILE B 1 93  ? 143.97100 84.86900  90.78800  1.000 70.26745  ? 93  ILE B N   1 
ATOM   3827  C CA  . ILE B 1 93  ? 144.70200 84.30200  91.91500  1.000 70.26745  ? 93  ILE B CA  1 
ATOM   3828  C C   . ILE B 1 93  ? 144.64100 85.22500  93.12800  1.000 70.26745  ? 93  ILE B C   1 
ATOM   3829  O O   . ILE B 1 93  ? 144.68800 84.75800  94.27000  1.000 70.26745  ? 93  ILE B O   1 
ATOM   3830  C CB  . ILE B 1 93  ? 146.15100 83.97000  91.50800  1.000 70.26745  ? 93  ILE B CB  1 
ATOM   3831  C CG1 . ILE B 1 93  ? 146.91800 85.22500  91.08600  1.000 70.26745  ? 93  ILE B CG1 1 
ATOM   3832  C CG2 . ILE B 1 93  ? 146.15800 82.93800  90.39300  1.000 70.26745  ? 93  ILE B CG2 1 
ATOM   3833  C CD1 . ILE B 1 93  ? 148.32900 84.95900  90.60900  1.000 70.26745  ? 93  ILE B CD1 1 
ATOM   3834  N N   . ILE B 1 94  ? 144.51300 86.53700  92.91400  1.000 65.15162  ? 94  ILE B N   1 
ATOM   3835  C CA  . ILE B 1 94  ? 144.44600 87.45700  94.04400  1.000 65.15162  ? 94  ILE B CA  1 
ATOM   3836  C C   . ILE B 1 94  ? 143.08100 87.37500  94.70800  1.000 65.15162  ? 94  ILE B C   1 
ATOM   3837  O O   . ILE B 1 94  ? 142.96900 87.43500  95.93500  1.000 65.15162  ? 94  ILE B O   1 
ATOM   3838  C CB  . ILE B 1 94  ? 144.78400 88.88900  93.59600  1.000 65.15162  ? 94  ILE B CB  1 
ATOM   3839  C CG1 . ILE B 1 94  ? 146.12800 88.90300  92.86900  1.000 65.15162  ? 94  ILE B CG1 1 
ATOM   3840  C CG2 . ILE B 1 94  ? 144.84600 89.82300  94.78600  1.000 65.15162  ? 94  ILE B CG2 1 
ATOM   3841  C CD1 . ILE B 1 94  ? 146.61800 90.28600  92.49800  1.000 65.15162  ? 94  ILE B CD1 1 
ATOM   3842  N N   . ASP B 1 95  ? 142.02900 87.17600  93.92300  1.000 65.81312  ? 95  ASP B N   1 
ATOM   3843  C CA  . ASP B 1 95  ? 140.70300 87.02000  94.50400  1.000 65.81312  ? 95  ASP B CA  1 
ATOM   3844  C C   . ASP B 1 95  ? 140.47000 85.64000  95.10200  1.000 65.81312  ? 95  ASP B C   1 
ATOM   3845  O O   . ASP B 1 95  ? 139.38000 85.39800  95.62700  1.000 65.81312  ? 95  ASP B O   1 
ATOM   3846  C CB  . ASP B 1 95  ? 139.63300 87.31700  93.45400  1.000 65.81312  ? 95  ASP B CB  1 
ATOM   3847  N N   . ASN B 1 96  ? 141.44200 84.73400  95.03100  1.000 66.85509  ? 96  ASN B N   1 
ATOM   3848  C CA  . ASN B 1 96  ? 141.37500 83.44400  95.70500  1.000 66.85509  ? 96  ASN B CA  1 
ATOM   3849  C C   . ASN B 1 96  ? 142.38100 83.31100  96.83300  1.000 66.85509  ? 96  ASN B C   1 
ATOM   3850  O O   . ASN B 1 96  ? 142.16600 82.52400  97.75400  1.000 66.85509  ? 96  ASN B O   1 
ATOM   3851  C CB  . ASN B 1 96  ? 141.59100 82.31200  94.70200  1.000 66.85509  ? 96  ASN B CB  1 
ATOM   3852  C CG  . ASN B 1 96  ? 140.30800 81.87600  94.04500  1.000 66.85509  ? 96  ASN B CG  1 
ATOM   3853  O OD1 . ASN B 1 96  ? 139.26500 81.80300  94.68900  1.000 66.85509  ? 96  ASN B OD1 1 
ATOM   3854  N ND2 . ASN B 1 96  ? 140.37400 81.58500  92.75500  1.000 66.85509  ? 96  ASN B ND2 1 
ATOM   3855  N N   . ILE B 1 97  ? 143.48600 84.05500  96.77100  1.000 62.57823  ? 97  ILE B N   1 
ATOM   3856  C CA  . ILE B 1 97  ? 144.36500 84.19400  97.92900  1.000 62.57823  ? 97  ILE B CA  1 
ATOM   3857  C C   . ILE B 1 97  ? 143.64600 84.96500  99.02800  1.000 62.57823  ? 97  ILE B C   1 
ATOM   3858  O O   . ILE B 1 97  ? 143.66300 84.57500  100.20200 1.000 62.57823  ? 97  ILE B O   1 
ATOM   3859  C CB  . ILE B 1 97  ? 145.68300 84.87500  97.51500  1.000 62.57823  ? 97  ILE B CB  1 
ATOM   3860  C CG1 . ILE B 1 97  ? 146.61400 83.86600  96.85100  1.000 62.57823  ? 97  ILE B CG1 1 
ATOM   3861  C CG2 . ILE B 1 97  ? 146.37800 85.53600  98.69200  1.000 62.57823  ? 97  ILE B CG2 1 
ATOM   3862  C CD1 . ILE B 1 97  ? 147.87300 84.48400  96.30100  1.000 62.57823  ? 97  ILE B CD1 1 
ATOM   3863  N N   . VAL B 1 98  ? 142.97800 86.05700  98.64600  1.000 60.51015  ? 98  VAL B N   1 
ATOM   3864  C CA  . VAL B 1 98  ? 142.20800 86.86800  99.58800  1.000 60.51015  ? 98  VAL B CA  1 
ATOM   3865  C C   . VAL B 1 98  ? 141.03900 86.06800  100.14700 1.000 60.51015  ? 98  VAL B C   1 
ATOM   3866  O O   . VAL B 1 98  ? 140.77800 86.07900  101.35500 1.000 60.51015  ? 98  VAL B O   1 
ATOM   3867  C CB  . VAL B 1 98  ? 141.74500 88.16700  98.90200  1.000 60.51015  ? 98  VAL B CB  1 
ATOM   3868  C CG1 . VAL B 1 98  ? 140.50100 88.74300  99.54500  1.000 60.51015  ? 98  VAL B CG1 1 
ATOM   3869  C CG2 . VAL B 1 98  ? 142.86500 89.18400  98.91500  1.000 60.51015  ? 98  VAL B CG2 1 
ATOM   3870  N N   . ASN B 1 99  ? 140.36800 85.29800  99.29200  1.000 62.35543  ? 99  ASN B N   1 
ATOM   3871  C CA  . ASN B 1 99  ? 139.26000 84.47000  99.75000  1.000 62.35543  ? 99  ASN B CA  1 
ATOM   3872  C C   . ASN B 1 99  ? 139.71700 83.28200  100.58500 1.000 62.35543  ? 99  ASN B C   1 
ATOM   3873  O O   . ASN B 1 99  ? 138.87800 82.61400  101.19400 1.000 62.35543  ? 99  ASN B O   1 
ATOM   3874  C CB  . ASN B 1 99  ? 138.45000 83.97400  98.55700  1.000 62.35543  ? 99  ASN B CB  1 
ATOM   3875  C CG  . ASN B 1 99  ? 137.00400 83.72800  98.90300  1.000 62.35543  ? 99  ASN B CG  1 
ATOM   3876  O OD1 . ASN B 1 99  ? 136.57500 83.97800  100.02400 1.000 62.35543  ? 99  ASN B OD1 1 
ATOM   3877  N ND2 . ASN B 1 99  ? 136.23800 83.24100  97.93700  1.000 62.35543  ? 99  ASN B ND2 1 
ATOM   3878  N N   . GLY B 1 100 ? 141.01600 82.99700  100.62000 1.000 60.05247  ? 100 GLY B N   1 
ATOM   3879  C CA  . GLY B 1 100 ? 141.54800 81.97500  101.49700 1.000 60.05247  ? 100 GLY B CA  1 
ATOM   3880  C C   . GLY B 1 100 ? 141.90200 82.53200  102.85900 1.000 60.05247  ? 100 GLY B C   1 
ATOM   3881  O O   . GLY B 1 100 ? 141.83000 81.82400  103.86500 1.000 60.05247  ? 100 GLY B O   1 
ATOM   3882  N N   . PHE B 1 101 ? 142.27500 83.81300  102.90300 1.000 57.69222  ? 101 PHE B N   1 
ATOM   3883  C CA  . PHE B 1 101 ? 142.59000 84.45100  104.17600 1.000 57.69222  ? 101 PHE B CA  1 
ATOM   3884  C C   . PHE B 1 101 ? 141.33800 84.76800  104.97600 1.000 57.69222  ? 101 PHE B C   1 
ATOM   3885  O O   . PHE B 1 101 ? 141.43100 85.09100  106.16200 1.000 57.69222  ? 101 PHE B O   1 
ATOM   3886  C CB  . PHE B 1 101 ? 143.40000 85.71900  103.94100 1.000 57.69222  ? 101 PHE B CB  1 
ATOM   3887  C CG  . PHE B 1 101 ? 144.84200 85.46000  103.68300 1.000 57.69222  ? 101 PHE B CG  1 
ATOM   3888  C CD1 . PHE B 1 101 ? 145.56100 84.62900  104.51700 1.000 57.69222  ? 101 PHE B CD1 1 
ATOM   3889  C CD2 . PHE B 1 101 ? 145.47500 86.01700  102.59100 1.000 57.69222  ? 101 PHE B CD2 1 
ATOM   3890  C CE1 . PHE B 1 101 ? 146.89700 84.37400  104.27800 1.000 57.69222  ? 101 PHE B CE1 1 
ATOM   3891  C CE2 . PHE B 1 101 ? 146.80700 85.75900  102.34100 1.000 57.69222  ? 101 PHE B CE2 1 
ATOM   3892  C CZ  . PHE B 1 101 ? 147.51900 84.94300  103.18900 1.000 57.69222  ? 101 PHE B CZ  1 
ATOM   3893  N N   . PHE B 1 102 ? 140.17100 84.70600  104.34900 1.000 56.63600  ? 102 PHE B N   1 
ATOM   3894  C CA  . PHE B 1 102 ? 138.91700 84.84900  105.06600 1.000 56.63600  ? 102 PHE B CA  1 
ATOM   3895  C C   . PHE B 1 102 ? 138.30700 83.51100  105.43800 1.000 56.63600  ? 102 PHE B C   1 
ATOM   3896  O O   . PHE B 1 102 ? 137.29500 83.48600  106.14100 1.000 56.63600  ? 102 PHE B O   1 
ATOM   3897  C CB  . PHE B 1 102 ? 137.91900 85.65600  104.23700 1.000 56.63600  ? 102 PHE B CB  1 
ATOM   3898  C CG  . PHE B 1 102 ? 138.14100 87.13100  104.30400 1.000 56.63600  ? 102 PHE B CG  1 
ATOM   3899  C CD1 . PHE B 1 102 ? 139.18100 87.71800  103.61000 1.000 56.63600  ? 102 PHE B CD1 1 
ATOM   3900  C CD2 . PHE B 1 102 ? 137.31500 87.93100  105.06300 1.000 56.63600  ? 102 PHE B CD2 1 
ATOM   3901  C CE1 . PHE B 1 102 ? 139.39300 89.06900  103.66800 1.000 56.63600  ? 102 PHE B CE1 1 
ATOM   3902  C CE2 . PHE B 1 102 ? 137.52300 89.28800  105.12500 1.000 56.63600  ? 102 PHE B CE2 1 
ATOM   3903  C CZ  . PHE B 1 102 ? 138.56500 89.85400  104.42500 1.000 56.63600  ? 102 PHE B CZ  1 
ATOM   3904  N N   . ALA B 1 103 ? 138.88600 82.40800  104.97600 1.000 59.52986  ? 103 ALA B N   1 
ATOM   3905  C CA  . ALA B 1 103 ? 138.48500 81.08800  105.43700 1.000 59.52986  ? 103 ALA B CA  1 
ATOM   3906  C C   . ALA B 1 103 ? 139.27400 80.64800  106.65700 1.000 59.52986  ? 103 ALA B C   1 
ATOM   3907  O O   . ALA B 1 103 ? 138.78600 79.82600  107.43900 1.000 59.52986  ? 103 ALA B O   1 
ATOM   3908  C CB  . ALA B 1 103 ? 138.65800 80.06100  104.31800 1.000 59.52986  ? 103 ALA B CB  1 
ATOM   3909  N N   . ILE B 1 104 ? 140.49300 81.16600  106.81500 1.000 58.54425  ? 104 ILE B N   1 
ATOM   3910  C CA  . ILE B 1 104 ? 141.26000 80.95500  108.03700 1.000 58.54425  ? 104 ILE B CA  1 
ATOM   3911  C C   . ILE B 1 104 ? 140.57100 81.62600  109.21600 1.000 58.54425  ? 104 ILE B C   1 
ATOM   3912  O O   . ILE B 1 104 ? 140.46700 81.05100  110.30600 1.000 58.54425  ? 104 ILE B O   1 
ATOM   3913  C CB  . ILE B 1 104 ? 142.69900 81.46900  107.84300 1.000 58.54425  ? 104 ILE B CB  1 
ATOM   3914  C CG1 . ILE B 1 104 ? 143.43900 80.59000  106.84100 1.000 58.54425  ? 104 ILE B CG1 1 
ATOM   3915  C CG2 . ILE B 1 104 ? 143.45800 81.54400  109.14900 1.000 58.54425  ? 104 ILE B CG2 1 
ATOM   3916  C CD1 . ILE B 1 104 ? 144.77400 81.13900  106.43400 1.000 58.54425  ? 104 ILE B CD1 1 
ATOM   3917  N N   . ASP B 1 105 ? 140.03800 82.83000  109.00000 1.000 60.12809  ? 105 ASP B N   1 
ATOM   3918  C CA  . ASP B 1 105 ? 139.49600 83.60600  110.10900 1.000 60.12809  ? 105 ASP B CA  1 
ATOM   3919  C C   . ASP B 1 105 ? 138.11700 83.11600  110.53100 1.000 60.12809  ? 105 ASP B C   1 
ATOM   3920  O O   . ASP B 1 105 ? 137.60100 83.53300  111.56900 1.000 60.12809  ? 105 ASP B O   1 
ATOM   3921  C CB  . ASP B 1 105 ? 139.44900 85.08300  109.74200 1.000 60.12809  ? 105 ASP B CB  1 
ATOM   3922  C CG  . ASP B 1 105 ? 139.50100 85.97700  110.95600 1.000 60.12809  ? 105 ASP B CG  1 
ATOM   3923  O OD1 . ASP B 1 105 ? 138.42900 86.36100  111.46000 1.000 60.12809  ? 105 ASP B OD1 1 
ATOM   3924  O OD2 . ASP B 1 105 ? 140.61800 86.29700  111.41100 1.000 60.12809  ? 105 ASP B OD2 1 
ATOM   3925  N N   . ILE B 1 106 ? 137.48700 82.25100  109.73900 1.000 60.13175  ? 106 ILE B N   1 
ATOM   3926  C CA  . ILE B 1 106 ? 136.29700 81.56900  110.23900 1.000 60.13175  ? 106 ILE B CA  1 
ATOM   3927  C C   . ILE B 1 106 ? 136.70500 80.52600  111.26900 1.000 60.13175  ? 106 ILE B C   1 
ATOM   3928  O O   . ILE B 1 106 ? 136.03300 80.32900  112.28800 1.000 60.13175  ? 106 ILE B O   1 
ATOM   3929  C CB  . ILE B 1 106 ? 135.50200 80.95200  109.07400 1.000 60.13175  ? 106 ILE B CB  1 
ATOM   3930  C CG1 . ILE B 1 106 ? 135.07400 82.04600  108.09800 1.000 60.13175  ? 106 ILE B CG1 1 
ATOM   3931  C CG2 . ILE B 1 106 ? 134.27500 80.21200  109.58800 1.000 60.13175  ? 106 ILE B CG2 1 
ATOM   3932  C CD1 . ILE B 1 106 ? 134.07900 81.59700  107.04400 1.000 60.13175  ? 106 ILE B CD1 1 
ATOM   3933  N N   . ILE B 1 107 ? 137.84200 79.87100  111.03600 1.000 60.59823  ? 107 ILE B N   1 
ATOM   3934  C CA  . ILE B 1 107 ? 138.36500 78.89500  111.98600 1.000 60.59823  ? 107 ILE B CA  1 
ATOM   3935  C C   . ILE B 1 107 ? 138.89200 79.59800  113.23300 1.000 60.59823  ? 107 ILE B C   1 
ATOM   3936  O O   . ILE B 1 107 ? 138.61900 79.17500  114.36300 1.000 60.59823  ? 107 ILE B O   1 
ATOM   3937  C CB  . ILE B 1 107 ? 139.44900 78.03600  111.30500 1.000 60.59823  ? 107 ILE B CB  1 
ATOM   3938  C CG1 . ILE B 1 107 ? 138.80900 77.00000  110.37900 1.000 60.59823  ? 107 ILE B CG1 1 
ATOM   3939  C CG2 . ILE B 1 107 ? 140.36000 77.35600  112.31700 1.000 60.59823  ? 107 ILE B CG2 1 
ATOM   3940  C CD1 . ILE B 1 107 ? 137.95900 75.98100  111.09800 1.000 60.59823  ? 107 ILE B CD1 1 
ATOM   3941  N N   . LEU B 1 108 ? 139.60400 80.71400  113.04100 1.000 59.66304  ? 108 LEU B N   1 
ATOM   3942  C CA  . LEU B 1 108 ? 140.35500 81.34600  114.12500 1.000 59.66304  ? 108 LEU B CA  1 
ATOM   3943  C C   . LEU B 1 108 ? 139.43900 81.96500  115.17500 1.000 59.66304  ? 108 LEU B C   1 
ATOM   3944  O O   . LEU B 1 108 ? 139.76700 81.96500  116.36600 1.000 59.66304  ? 108 LEU B O   1 
ATOM   3945  C CB  . LEU B 1 108 ? 141.29800 82.40100  113.54700 1.000 59.66304  ? 108 LEU B CB  1 
ATOM   3946  C CG  . LEU B 1 108 ? 142.15900 83.21000  114.51000 1.000 59.66304  ? 108 LEU B CG  1 
ATOM   3947  C CD1 . LEU B 1 108 ? 142.97900 82.28300  115.36500 1.000 59.66304  ? 108 LEU B CD1 1 
ATOM   3948  C CD2 . LEU B 1 108 ? 143.05800 84.15400  113.76000 1.000 59.66304  ? 108 LEU B CD2 1 
ATOM   3949  N N   . THR B 1 109 ? 138.26900 82.46100  114.77100 1.000 60.61319  ? 109 THR B N   1 
ATOM   3950  C CA  . THR B 1 109 ? 137.37800 83.07900  115.74800 1.000 60.61319  ? 109 THR B CA  1 
ATOM   3951  C C   . THR B 1 109 ? 136.47400 82.08000  116.45000 1.000 60.61319  ? 109 THR B C   1 
ATOM   3952  O O   . THR B 1 109 ? 135.40100 82.46400  116.92300 1.000 60.61319  ? 109 THR B O   1 
ATOM   3953  C CB  . THR B 1 109 ? 136.52400 84.16200  115.10700 1.000 60.61319  ? 109 THR B CB  1 
ATOM   3954  O OG1 . THR B 1 109 ? 135.56200 83.56100  114.23600 1.000 60.61319  ? 109 THR B OG1 1 
ATOM   3955  C CG2 . THR B 1 109 ? 137.38700 85.15000  114.36600 1.000 60.61319  ? 109 THR B CG2 1 
ATOM   3956  N N   . PHE B 1 110 ? 136.85900 80.81300  116.50500 1.000 61.00181  ? 110 PHE B N   1 
ATOM   3957  C CA  . PHE B 1 110 ? 136.34900 79.91200  117.52300 1.000 61.00181  ? 110 PHE B CA  1 
ATOM   3958  C C   . PHE B 1 110 ? 137.28700 79.82400  118.71800 1.000 61.00181  ? 110 PHE B C   1 
ATOM   3959  O O   . PHE B 1 110 ? 137.10800 78.95400  119.57400 1.000 61.00181  ? 110 PHE B O   1 
ATOM   3960  C CB  . PHE B 1 110 ? 136.11100 78.52500  116.92600 1.000 61.00181  ? 110 PHE B CB  1 
ATOM   3961  C CG  . PHE B 1 110 ? 134.80600 78.39600  116.20100 1.000 61.00181  ? 110 PHE B CG  1 
ATOM   3962  C CD1 . PHE B 1 110 ? 133.62800 78.20600  116.90000 1.000 61.00181  ? 110 PHE B CD1 1 
ATOM   3963  C CD2 . PHE B 1 110 ? 134.75500 78.46600  114.82300 1.000 61.00181  ? 110 PHE B CD2 1 
ATOM   3964  C CE1 . PHE B 1 110 ? 132.42300 78.08700  116.23600 1.000 61.00181  ? 110 PHE B CE1 1 
ATOM   3965  C CE2 . PHE B 1 110 ? 133.55000 78.34900  114.15400 1.000 61.00181  ? 110 PHE B CE2 1 
ATOM   3966  C CZ  . PHE B 1 110 ? 132.38600 78.16000  114.86300 1.000 61.00181  ? 110 PHE B CZ  1 
ATOM   3967  N N   . PHE B 1 111 ? 138.28300 80.70200  118.78200 1.000 62.77306  ? 111 PHE B N   1 
ATOM   3968  C CA  . PHE B 1 111 ? 139.29700 80.68500  119.82800 1.000 62.77306  ? 111 PHE B CA  1 
ATOM   3969  C C   . PHE B 1 111 ? 139.60600 82.10500  120.29500 1.000 62.77306  ? 111 PHE B C   1 
ATOM   3970  O O   . PHE B 1 111 ? 140.76300 82.48000  120.47100 1.000 62.77306  ? 111 PHE B O   1 
ATOM   3971  C CB  . PHE B 1 111 ? 140.57400 80.00400  119.33800 1.000 62.77306  ? 111 PHE B CB  1 
ATOM   3972  C CG  . PHE B 1 111 ? 140.37900 78.58800  118.87600 1.000 62.77306  ? 111 PHE B CG  1 
ATOM   3973  C CD1 . PHE B 1 111 ? 140.18600 78.30300  117.53700 1.000 62.77306  ? 111 PHE B CD1 1 
ATOM   3974  C CD2 . PHE B 1 111 ? 140.40900 77.54100  119.77800 1.000 62.77306  ? 111 PHE B CD2 1 
ATOM   3975  C CE1 . PHE B 1 111 ? 140.01100 77.00300  117.10700 1.000 62.77306  ? 111 PHE B CE1 1 
ATOM   3976  C CE2 . PHE B 1 111 ? 140.23700 76.23700  119.35400 1.000 62.77306  ? 111 PHE B CE2 1 
ATOM   3977  C CZ  . PHE B 1 111 ? 140.03700 75.97100  118.01700 1.000 62.77306  ? 111 PHE B CZ  1 
ATOM   3978  N N   . VAL B 1 112 ? 138.57600 82.92600  120.50000 1.000 61.73140  ? 112 VAL B N   1 
ATOM   3979  C CA  . VAL B 1 112 ? 138.75800 84.29000  120.98700 1.000 61.73140  ? 112 VAL B CA  1 
ATOM   3980  C C   . VAL B 1 112 ? 137.80600 84.55000  122.14700 1.000 61.73140  ? 112 VAL B C   1 
ATOM   3981  O O   . VAL B 1 112 ? 136.70600 83.99700  122.20500 1.000 61.73140  ? 112 VAL B O   1 
ATOM   3982  C CB  . VAL B 1 112 ? 138.55700 85.33200  119.87200 1.000 61.73140  ? 112 VAL B CB  1 
ATOM   3983  C CG1 . VAL B 1 112 ? 139.76700 85.36800  118.95900 1.000 61.73140  ? 112 VAL B CG1 1 
ATOM   3984  C CG2 . VAL B 1 112 ? 137.30600 85.00600  119.08400 1.000 61.73140  ? 112 VAL B CG2 1 
ATOM   3985  N N   . ALA B 1 113 ? 138.22200 85.43800  123.05600 1.000 59.87938  ? 113 ALA B N   1 
ATOM   3986  C CA  . ALA B 1 113 ? 137.66400 85.44700  124.40600 1.000 59.87938  ? 113 ALA B CA  1 
ATOM   3987  C C   . ALA B 1 113 ? 136.44100 86.35100  124.55400 1.000 59.87938  ? 113 ALA B C   1 
ATOM   3988  O O   . ALA B 1 113 ? 135.64300 86.16000  125.47400 1.000 59.87938  ? 113 ALA B O   1 
ATOM   3989  C CB  . ALA B 1 113 ? 138.74400 85.85500  125.39900 1.000 59.87938  ? 113 ALA B CB  1 
ATOM   3990  N N   . TYR B 1 114 ? 136.34300 87.39100  123.74300 1.000 59.68364  ? 114 TYR B N   1 
ATOM   3991  C CA  . TYR B 1 114 ? 135.17000 88.20700  123.40700 1.000 59.68364  ? 114 TYR B CA  1 
ATOM   3992  C C   . TYR B 1 114 ? 134.62800 89.17400  124.46900 1.000 59.68364  ? 114 TYR B C   1 
ATOM   3993  O O   . TYR B 1 114 ? 133.77700 89.98300  124.08200 1.000 59.68364  ? 114 TYR B O   1 
ATOM   3994  C CB  . TYR B 1 114 ? 133.99600 87.35100  122.87200 1.000 59.68364  ? 114 TYR B CB  1 
ATOM   3995  C CG  . TYR B 1 114 ? 133.04100 86.62200  123.82200 1.000 59.68364  ? 114 TYR B CG  1 
ATOM   3996  C CD1 . TYR B 1 114 ? 131.99300 87.28200  124.46500 1.000 59.68364  ? 114 TYR B CD1 1 
ATOM   3997  C CD2 . TYR B 1 114 ? 133.10900 85.24700  123.96300 1.000 59.68364  ? 114 TYR B CD2 1 
ATOM   3998  C CE1 . TYR B 1 114 ? 131.12300 86.61300  125.28700 1.000 59.68364  ? 114 TYR B CE1 1 
ATOM   3999  C CE2 . TYR B 1 114 ? 132.23600 84.56900  124.78400 1.000 59.68364  ? 114 TYR B CE2 1 
ATOM   4000  C CZ  . TYR B 1 114 ? 131.24300 85.25800  125.43900 1.000 59.68364  ? 114 TYR B CZ  1 
ATOM   4001  O OH  . TYR B 1 114 ? 130.36500 84.59000  126.25600 1.000 59.68364  ? 114 TYR B OH  1 
ATOM   4002  N N   . LEU B 1 115 ? 135.07100 89.15100  125.73500 1.000 55.34236  ? 115 LEU B N   1 
ATOM   4003  C CA  . LEU B 1 115 ? 134.82100 90.21800  126.72600 1.000 55.34236  ? 115 LEU B CA  1 
ATOM   4004  C C   . LEU B 1 115 ? 133.32200 90.44900  126.97000 1.000 55.34236  ? 115 LEU B C   1 
ATOM   4005  O O   . LEU B 1 115 ? 132.70600 91.33900  126.38500 1.000 55.34236  ? 115 LEU B O   1 
ATOM   4006  C CB  . LEU B 1 115 ? 135.53200 91.52000  126.33100 1.000 55.34236  ? 115 LEU B CB  1 
ATOM   4007  C CG  . LEU B 1 115 ? 135.75400 92.59800  127.40400 1.000 55.34236  ? 115 LEU B CG  1 
ATOM   4008  C CD1 . LEU B 1 115 ? 137.06500 93.28500  127.12500 1.000 55.34236  ? 115 LEU B CD1 1 
ATOM   4009  C CD2 . LEU B 1 115 ? 134.66800 93.65100  127.48000 1.000 55.34236  ? 115 LEU B CD2 1 
ATOM   4010  N N   . ASP B 1 116 ? 132.74200 89.54100  127.76500 1.000 54.85399  ? 116 ASP B N   1 
ATOM   4011  C CA  . ASP B 1 116 ? 131.32500 89.47300  128.14100 1.000 54.85399  ? 116 ASP B CA  1 
ATOM   4012  C C   . ASP B 1 116 ? 130.69500 90.82100  128.48200 1.000 54.85399  ? 116 ASP B C   1 
ATOM   4013  O O   . ASP B 1 116 ? 131.34800 91.69900  129.04700 1.000 54.85399  ? 116 ASP B O   1 
ATOM   4014  C CB  . ASP B 1 116 ? 131.18300 88.51600  129.33300 1.000 54.85399  ? 116 ASP B CB  1 
ATOM   4015  C CG  . ASP B 1 116 ? 129.73500 88.11300  129.63300 1.000 54.85399  ? 116 ASP B CG  1 
ATOM   4016  O OD1 . ASP B 1 116 ? 128.86600 88.96100  129.92900 1.000 54.85399  ? 116 ASP B OD1 1 
ATOM   4017  O OD2 . ASP B 1 116 ? 129.46200 86.89800  129.57100 1.000 54.85399  ? 116 ASP B OD2 1 
ATOM   4018  N N   . SER B 1 117 ? 129.41700 90.98200  128.14200 1.000 53.19166  ? 117 SER B N   1 
ATOM   4019  C CA  . SER B 1 117 ? 128.75000 92.27700  128.19800 1.000 53.19166  ? 117 SER B CA  1 
ATOM   4020  C C   . SER B 1 117 ? 128.20000 92.62700  129.57100 1.000 53.19166  ? 117 SER B C   1 
ATOM   4021  O O   . SER B 1 117 ? 128.21900 93.80200  129.95000 1.000 53.19166  ? 117 SER B O   1 
ATOM   4022  C CB  . SER B 1 117 ? 127.60600 92.31600  127.18500 1.000 53.19166  ? 117 SER B CB  1 
ATOM   4023  O OG  . SER B 1 117 ? 126.66700 91.29600  127.46300 1.000 53.19166  ? 117 SER B OG  1 
ATOM   4024  N N   . HIS B 1 118 ? 127.68600 91.65400  130.31600 1.000 52.06243  ? 118 HIS B N   1 
ATOM   4025  C CA  . HIS B 1 118 ? 127.12200 91.92500  131.63000 1.000 52.06243  ? 118 HIS B CA  1 
ATOM   4026  C C   . HIS B 1 118 ? 128.13100 91.76600  132.75600 1.000 52.06243  ? 118 HIS B C   1 
ATOM   4027  O O   . HIS B 1 118 ? 127.84300 92.17200  133.88500 1.000 52.06243  ? 118 HIS B O   1 
ATOM   4028  C CB  . HIS B 1 118 ? 125.92600 91.00700  131.89500 1.000 52.06243  ? 118 HIS B CB  1 
ATOM   4029  C CG  . HIS B 1 118 ? 124.67000 91.44000  131.20800 1.000 52.06243  ? 118 HIS B CG  1 
ATOM   4030  N ND1 . HIS B 1 118 ? 123.48100 90.75600  131.33000 1.000 52.06243  ? 118 HIS B ND1 1 
ATOM   4031  C CD2 . HIS B 1 118 ? 124.41900 92.48700  130.38800 1.000 52.06243  ? 118 HIS B CD2 1 
ATOM   4032  C CE1 . HIS B 1 118 ? 122.55000 91.36300  130.61800 1.000 52.06243  ? 118 HIS B CE1 1 
ATOM   4033  N NE2 . HIS B 1 118 ? 123.09300 92.41600  130.03500 1.000 52.06243  ? 118 HIS B NE2 1 
ATOM   4034  N N   . SER B 1 119 ? 129.29800 91.18900  132.48300 1.000 49.34781  ? 119 SER B N   1 
ATOM   4035  C CA  . SER B 1 119 ? 130.31700 90.99800  133.49900 1.000 49.34781  ? 119 SER B CA  1 
ATOM   4036  C C   . SER B 1 119 ? 131.56700 91.82700  133.27800 1.000 49.34781  ? 119 SER B C   1 
ATOM   4037  O O   . SER B 1 119 ? 132.35400 91.97000  134.21700 1.000 49.34781  ? 119 SER B O   1 
ATOM   4038  C CB  . SER B 1 119 ? 130.72300 89.52300  133.57600 1.000 49.34781  ? 119 SER B CB  1 
ATOM   4039  O OG  . SER B 1 119 ? 131.78300 89.34600  134.49500 1.000 49.34781  ? 119 SER B OG  1 
ATOM   4040  N N   . TYR B 1 120 ? 131.76400 92.35500  132.06500 1.000 44.99757  ? 120 TYR B N   1 
ATOM   4041  C CA  . TYR B 1 120 ? 132.92100 93.16800  131.66900 1.000 44.99757  ? 120 TYR B CA  1 
ATOM   4042  C C   . TYR B 1 120 ? 134.24200 92.43500  131.87600 1.000 44.99757  ? 120 TYR B C   1 
ATOM   4043  O O   . TYR B 1 120 ? 135.27200 93.05200  132.14700 1.000 44.99757  ? 120 TYR B O   1 
ATOM   4044  C CB  . TYR B 1 120 ? 132.92500 94.52200  132.38000 1.000 44.99757  ? 120 TYR B CB  1 
ATOM   4045  C CG  . TYR B 1 120 ? 131.56400 95.16900  132.38700 1.000 44.99757  ? 120 TYR B CG  1 
ATOM   4046  C CD1 . TYR B 1 120 ? 131.05900 95.77300  131.24900 1.000 44.99757  ? 120 TYR B CD1 1 
ATOM   4047  C CD2 . TYR B 1 120 ? 130.77700 95.15800  133.52500 1.000 44.99757  ? 120 TYR B CD2 1 
ATOM   4048  C CE1 . TYR B 1 120 ? 129.81200 96.35600  131.25000 1.000 44.99757  ? 120 TYR B CE1 1 
ATOM   4049  C CE2 . TYR B 1 120 ? 129.53000 95.73600  133.53400 1.000 44.99757  ? 120 TYR B CE2 1 
ATOM   4050  C CZ  . TYR B 1 120 ? 129.05400 96.33300  132.39700 1.000 44.99757  ? 120 TYR B CZ  1 
ATOM   4051  O OH  . TYR B 1 120 ? 127.80900 96.90800  132.41100 1.000 44.99757  ? 120 TYR B OH  1 
ATOM   4052  N N   . LEU B 1 121 ? 134.22000 91.11500  131.73100 1.000 51.03177  ? 121 LEU B N   1 
ATOM   4053  C CA  . LEU B 1 121 ? 135.40000 90.28100  131.86200 1.000 51.03177  ? 121 LEU B CA  1 
ATOM   4054  C C   . LEU B 1 121 ? 135.44800 89.30200  130.70200 1.000 51.03177  ? 121 LEU B C   1 
ATOM   4055  O O   . LEU B 1 121 ? 134.42500 88.99500  130.08500 1.000 51.03177  ? 121 LEU B O   1 
ATOM   4056  C CB  . LEU B 1 121 ? 135.40200 89.51700  133.18700 1.000 51.03177  ? 121 LEU B CB  1 
ATOM   4057  C CG  . LEU B 1 121 ? 135.80700 90.30700  134.42900 1.000 51.03177  ? 121 LEU B CG  1 
ATOM   4058  C CD1 . LEU B 1 121 ? 135.40100 89.56100  135.67700 1.000 51.03177  ? 121 LEU B CD1 1 
ATOM   4059  C CD2 . LEU B 1 121 ? 137.29900 90.56500  134.43200 1.000 51.03177  ? 121 LEU B CD2 1 
ATOM   4060  N N   . LEU B 1 122 ? 136.64700 88.80800  130.41600 1.000 55.42125  ? 122 LEU B N   1 
ATOM   4061  C CA  . LEU B 1 122 ? 136.84500 87.90900  129.28800 1.000 55.42125  ? 122 LEU B CA  1 
ATOM   4062  C C   . LEU B 1 122 ? 136.31000 86.52100  129.60500 1.000 55.42125  ? 122 LEU B C   1 
ATOM   4063  O O   . LEU B 1 122 ? 136.45100 86.02400  130.72300 1.000 55.42125  ? 122 LEU B O   1 
ATOM   4064  C CB  . LEU B 1 122 ? 138.32800 87.83100  128.93700 1.000 55.42125  ? 122 LEU B CB  1 
ATOM   4065  C CG  . LEU B 1 122 ? 138.91400 88.81500  127.92500 1.000 55.42125  ? 122 LEU B CG  1 
ATOM   4066  C CD1 . LEU B 1 122 ? 138.91300 90.23800  128.42200 1.000 55.42125  ? 122 LEU B CD1 1 
ATOM   4067  C CD2 . LEU B 1 122 ? 140.32500 88.40500  127.63500 1.000 55.42125  ? 122 LEU B CD2 1 
ATOM   4068  N N   . VAL B 1 123 ? 135.69300 85.89300  128.61200 1.000 60.54484  ? 123 VAL B N   1 
ATOM   4069  C CA  . VAL B 1 123 ? 135.14100 84.55000  128.74300 1.000 60.54484  ? 123 VAL B CA  1 
ATOM   4070  C C   . VAL B 1 123 ? 136.11500 83.59000  128.07800 1.000 60.54484  ? 123 VAL B C   1 
ATOM   4071  O O   . VAL B 1 123 ? 136.34600 83.66700  126.86700 1.000 60.54484  ? 123 VAL B O   1 
ATOM   4072  C CB  . VAL B 1 123 ? 133.74500 84.44000  128.12000 1.000 60.54484  ? 123 VAL B CB  1 
ATOM   4073  C CG1 . VAL B 1 123 ? 133.33100 82.99200  127.99700 1.000 60.54484  ? 123 VAL B CG1 1 
ATOM   4074  C CG2 . VAL B 1 123 ? 132.74300 85.18600  128.94900 1.000 60.54484  ? 123 VAL B CG2 1 
ATOM   4075  N N   . ASP B 1 124 ? 136.70100 82.69200  128.86200 1.000 69.28489  ? 124 ASP B N   1 
ATOM   4076  C CA  . ASP B 1 124 ? 137.56600 81.64200  128.33600 1.000 69.28489  ? 124 ASP B CA  1 
ATOM   4077  C C   . ASP B 1 124 ? 136.83600 80.32000  128.53200 1.000 69.28489  ? 124 ASP B C   1 
ATOM   4078  O O   . ASP B 1 124 ? 137.05900 79.59500  129.50100 1.000 69.28489  ? 124 ASP B O   1 
ATOM   4079  C CB  . ASP B 1 124 ? 138.91500 81.64600  129.02500 1.000 69.28489  ? 124 ASP B CB  1 
ATOM   4080  C CG  . ASP B 1 124 ? 139.71700 82.88200  128.71500 1.000 69.28489  ? 124 ASP B CG  1 
ATOM   4081  O OD1 . ASP B 1 124 ? 139.30000 83.64200  127.82100 1.000 69.28489  ? 124 ASP B OD1 1 
ATOM   4082  O OD2 . ASP B 1 124 ? 140.76300 83.09600  129.36100 1.000 69.28489  ? 124 ASP B OD2 1 
ATOM   4083  N N   . SER B 1 125 ? 135.96000 80.00900  127.59500 1.000 70.49091  ? 125 SER B N   1 
ATOM   4084  C CA  . SER B 1 125 ? 135.19700 78.76300  127.62500 1.000 70.49091  ? 125 SER B CA  1 
ATOM   4085  C C   . SER B 1 125 ? 134.82600 78.44700  126.19100 1.000 70.49091  ? 125 SER B C   1 
ATOM   4086  O O   . SER B 1 125 ? 133.99900 79.14500  125.58700 1.000 70.49091  ? 125 SER B O   1 
ATOM   4087  C CB  . SER B 1 125 ? 133.95400 78.87000  128.50300 1.000 70.49091  ? 125 SER B CB  1 
ATOM   4088  O OG  . SER B 1 125 ? 132.86100 79.35700  127.75300 1.000 70.49091  ? 125 SER B OG  1 
ATOM   4089  N N   . PRO B 1 126 ? 135.39400 77.38200  125.61300 1.000 70.27434  ? 126 PRO B N   1 
ATOM   4090  C CA  . PRO B 1 126 ? 135.25400 77.15200  124.16900 1.000 70.27434  ? 126 PRO B CA  1 
ATOM   4091  C C   . PRO B 1 126 ? 133.86700 76.71300  123.72600 1.000 70.27434  ? 126 PRO B C   1 
ATOM   4092  O O   . PRO B 1 126 ? 133.60800 76.61700  122.52500 1.000 70.27434  ? 126 PRO B O   1 
ATOM   4093  C CB  . PRO B 1 126 ? 136.29200 76.06000  123.89600 1.000 70.27434  ? 126 PRO B CB  1 
ATOM   4094  C CG  . PRO B 1 126 ? 136.39500 75.33100  125.17900 1.000 70.27434  ? 126 PRO B CG  1 
ATOM   4095  C CD  . PRO B 1 126 ? 136.23800 76.36000  126.25300 1.000 70.27434  ? 126 PRO B CD  1 
ATOM   4096  N N   . LYS B 1 127 ? 132.96600 76.45100  124.66900 1.000 70.69535  ? 127 LYS B N   1 
ATOM   4097  C CA  . LYS B 1 127 ? 131.58400 76.19600  124.29300 1.000 70.69535  ? 127 LYS B CA  1 
ATOM   4098  C C   . LYS B 1 127 ? 130.78200 77.48000  124.14500 1.000 70.69535  ? 127 LYS B C   1 
ATOM   4099  O O   . LYS B 1 127 ? 130.08600 77.65200  123.14100 1.000 70.69535  ? 127 LYS B O   1 
ATOM   4100  C CB  . LYS B 1 127 ? 130.91100 75.27600  125.31100 1.000 70.69535  ? 127 LYS B CB  1 
ATOM   4101  C CG  . LYS B 1 127 ? 129.56600 74.72300  124.84900 1.000 70.69535  ? 127 LYS B CG  1 
ATOM   4102  C CD  . LYS B 1 127 ? 129.64500 74.02800  123.48600 1.000 70.69535  ? 127 LYS B CD  1 
ATOM   4103  C CE  . LYS B 1 127 ? 130.50900 72.76700  123.51300 1.000 70.69535  ? 127 LYS B CE  1 
ATOM   4104  N NZ  . LYS B 1 127 ? 130.44400 72.01100  122.23000 1.000 70.69535  ? 127 LYS B NZ  1 
ATOM   4105  N N   . LYS B 1 128 ? 130.87800 78.39800  125.11000 1.000 69.51545  ? 128 LYS B N   1 
ATOM   4106  C CA  . LYS B 1 128 ? 130.12300 79.64500  125.01500 1.000 69.51545  ? 128 LYS B CA  1 
ATOM   4107  C C   . LYS B 1 128 ? 130.72300 80.58800  123.98000 1.000 69.51545  ? 128 LYS B C   1 
ATOM   4108  O O   . LYS B 1 128 ? 130.03000 81.48100  123.48000 1.000 69.51545  ? 128 LYS B O   1 
ATOM   4109  C CB  . LYS B 1 128 ? 130.05200 80.33300  126.37600 1.000 69.51545  ? 128 LYS B CB  1 
ATOM   4110  C CG  . LYS B 1 128 ? 128.90800 79.86000  127.24800 1.000 69.51545  ? 128 LYS B CG  1 
ATOM   4111  C CD  . LYS B 1 128 ? 129.31700 79.81000  128.70900 1.000 69.51545  ? 128 LYS B CD  1 
ATOM   4112  C CE  . LYS B 1 128 ? 129.69100 81.18800  129.22200 1.000 69.51545  ? 128 LYS B CE  1 
ATOM   4113  N NZ  . LYS B 1 128 ? 128.48900 81.96300  129.62800 1.000 69.51545  ? 128 LYS B NZ  1 
ATOM   4114  N N   . ILE B 1 129 ? 132.01000 80.41700  123.67000 1.000 65.87961  ? 129 ILE B N   1 
ATOM   4115  C CA  . ILE B 1 129 ? 132.60200 81.07500  122.50700 1.000 65.87961  ? 129 ILE B CA  1 
ATOM   4116  C C   . ILE B 1 129 ? 131.90800 80.59800  121.23800 1.000 65.87961  ? 129 ILE B C   1 
ATOM   4117  O O   . ILE B 1 129 ? 131.55600 81.39300  120.35700 1.000 65.87961  ? 129 ILE B O   1 
ATOM   4118  C CB  . ILE B 1 129 ? 134.11700 80.80200  122.45900 1.000 65.87961  ? 129 ILE B CB  1 
ATOM   4119  C CG1 . ILE B 1 129 ? 134.84400 81.60700  123.52600 1.000 65.87961  ? 129 ILE B CG1 1 
ATOM   4120  C CG2 . ILE B 1 129 ? 134.70300 81.13100  121.10900 1.000 65.87961  ? 129 ILE B CG2 1 
ATOM   4121  C CD1 . ILE B 1 129 ? 136.25400 81.14600  123.74900 1.000 65.87961  ? 129 ILE B CD1 1 
ATOM   4122  N N   . ALA B 1 130 ? 131.65100 79.29100  121.16100 1.000 66.74918  ? 130 ALA B N   1 
ATOM   4123  C CA  . ALA B 1 130 ? 131.15300 78.68600  119.93200 1.000 66.74918  ? 130 ALA B CA  1 
ATOM   4124  C C   . ALA B 1 130 ? 129.69200 79.03100  119.68300 1.000 66.74918  ? 130 ALA B C   1 
ATOM   4125  O O   . ALA B 1 130 ? 129.30400 79.30700  118.54500 1.000 66.74918  ? 130 ALA B O   1 
ATOM   4126  C CB  . ALA B 1 130 ? 131.34500 77.17300  119.98600 1.000 66.74918  ? 130 ALA B CB  1 
ATOM   4127  N N   . ILE B 1 131 ? 128.86200 79.02200  120.72900 1.000 65.84180  ? 131 ILE B N   1 
ATOM   4128  C CA  . ILE B 1 131 ? 127.44000 79.30500  120.54200 1.000 65.84180  ? 131 ILE B CA  1 
ATOM   4129  C C   . ILE B 1 131 ? 127.23000 80.77900  120.21400 1.000 65.84180  ? 131 ILE B C   1 
ATOM   4130  O O   . ILE B 1 131 ? 126.29000 81.14500  119.49700 1.000 65.84180  ? 131 ILE B O   1 
ATOM   4131  C CB  . ILE B 1 131 ? 126.63600 78.86800  121.78300 1.000 65.84180  ? 131 ILE B CB  1 
ATOM   4132  C CG1 . ILE B 1 131 ? 126.96700 77.42600  122.15400 1.000 65.84180  ? 131 ILE B CG1 1 
ATOM   4133  C CG2 . ILE B 1 131 ? 125.13700 78.96000  121.55100 1.000 65.84180  ? 131 ILE B CG2 1 
ATOM   4134  C CD1 . ILE B 1 131 ? 126.87600 77.15000  123.63500 1.000 65.84180  ? 131 ILE B CD1 1 
ATOM   4135  N N   . ARG B 1 132 ? 128.12600 81.64200  120.69400 1.000 63.95143  ? 132 ARG B N   1 
ATOM   4136  C CA  . ARG B 1 132 ? 128.02200 83.06100  120.37300 1.000 63.95143  ? 132 ARG B CA  1 
ATOM   4137  C C   . ARG B 1 132 ? 128.37500 83.32400  118.91600 1.000 63.95143  ? 132 ARG B C   1 
ATOM   4138  O O   . ARG B 1 132 ? 127.67700 84.07200  118.22500 1.000 63.95143  ? 132 ARG B O   1 
ATOM   4139  C CB  . ARG B 1 132 ? 128.92000 83.88000  121.29200 1.000 63.95143  ? 132 ARG B CB  1 
ATOM   4140  C CG  . ARG B 1 132 ? 128.85400 85.36300  121.01600 1.000 63.95143  ? 132 ARG B CG  1 
ATOM   4141  C CD  . ARG B 1 132 ? 129.68000 86.13100  122.00200 1.000 63.95143  ? 132 ARG B CD  1 
ATOM   4142  N NE  . ARG B 1 132 ? 129.68700 87.56000  121.72200 1.000 63.95143  ? 132 ARG B NE  1 
ATOM   4143  C CZ  . ARG B 1 132 ? 130.60800 88.17200  120.98700 1.000 63.95143  ? 132 ARG B CZ  1 
ATOM   4144  N NH1 . ARG B 1 132 ? 131.60000 87.48100  120.44700 1.000 63.95143  ? 132 ARG B NH1 1 
ATOM   4145  N NH2 . ARG B 1 132 ? 130.53500 89.47800  120.79000 1.000 63.95143  ? 132 ARG B NH2 1 
ATOM   4146  N N   . TYR B 1 133 ? 129.45200 82.71000  118.42600 1.000 63.64384  ? 133 TYR B N   1 
ATOM   4147  C CA  . TYR B 1 133 ? 129.87200 82.96400  117.05300 1.000 63.64384  ? 133 TYR B CA  1 
ATOM   4148  C C   . TYR B 1 133 ? 128.93400 82.29800  116.05600 1.000 63.64384  ? 133 TYR B C   1 
ATOM   4149  O O   . TYR B 1 133 ? 128.73700 82.79600  114.94300 1.000 63.64384  ? 133 TYR B O   1 
ATOM   4150  C CB  . TYR B 1 133 ? 131.30400 82.49100  116.83700 1.000 63.64384  ? 133 TYR B CB  1 
ATOM   4151  C CG  . TYR B 1 133 ? 131.80800 82.82400  115.46300 1.000 63.64384  ? 133 TYR B CG  1 
ATOM   4152  C CD1 . TYR B 1 133 ? 131.72200 84.11700  114.97500 1.000 63.64384  ? 133 TYR B CD1 1 
ATOM   4153  C CD2 . TYR B 1 133 ? 132.35100 81.85200  114.64700 1.000 63.64384  ? 133 TYR B CD2 1 
ATOM   4154  C CE1 . TYR B 1 133 ? 132.17200 84.43400  113.71800 1.000 63.64384  ? 133 TYR B CE1 1 
ATOM   4155  C CE2 . TYR B 1 133 ? 132.80200 82.16000  113.38400 1.000 63.64384  ? 133 TYR B CE2 1 
ATOM   4156  C CZ  . TYR B 1 133 ? 132.70800 83.45300  112.92800 1.000 63.64384  ? 133 TYR B CZ  1 
ATOM   4157  O OH  . TYR B 1 133 ? 133.15900 83.76900  111.67200 1.000 63.64384  ? 133 TYR B OH  1 
ATOM   4158  N N   . LEU B 1 134 ? 128.33000 81.17600  116.44400 1.000 64.41382  ? 134 LEU B N   1 
ATOM   4159  C CA  . LEU B 1 134 ? 127.41600 80.48600  115.54400 1.000 64.41382  ? 134 LEU B CA  1 
ATOM   4160  C C   . LEU B 1 134 ? 126.04700 81.14900  115.48500 1.000 64.41382  ? 134 LEU B C   1 
ATOM   4161  O O   . LEU B 1 134 ? 125.25700 80.82500  114.59500 1.000 64.41382  ? 134 LEU B O   1 
ATOM   4162  C CB  . LEU B 1 134 ? 127.27700 79.02300  115.95900 1.000 64.41382  ? 134 LEU B CB  1 
ATOM   4163  C CG  . LEU B 1 134 ? 128.45300 78.12400  115.57200 1.000 64.41382  ? 134 LEU B CG  1 
ATOM   4164  C CD1 . LEU B 1 134 ? 128.47400 76.85900  116.40400 1.000 64.41382  ? 134 LEU B CD1 1 
ATOM   4165  C CD2 . LEU B 1 134 ? 128.37100 77.77000  114.11700 1.000 64.41382  ? 134 LEU B CD2 1 
ATOM   4166  N N   . SER B 1 135 ? 125.74700 82.06700  116.40100 1.000 64.91252  ? 135 SER B N   1 
ATOM   4167  C CA  . SER B 1 135 ? 124.44600 82.72100  116.41600 1.000 64.91252  ? 135 SER B CA  1 
ATOM   4168  C C   . SER B 1 135 ? 124.47000 84.13500  115.85400 1.000 64.91252  ? 135 SER B C   1 
ATOM   4169  O O   . SER B 1 135 ? 123.41100 84.65500  115.48800 1.000 64.91252  ? 135 SER B O   1 
ATOM   4170  C CB  . SER B 1 135 ? 123.89300 82.76600  117.84200 1.000 64.91252  ? 135 SER B CB  1 
ATOM   4171  O OG  . SER B 1 135 ? 123.71100 81.46300  118.36000 1.000 64.91252  ? 135 SER B OG  1 
ATOM   4172  N N   . THR B 1 136 ? 125.63300 84.78100  115.79900 1.000 65.46888  ? 136 THR B N   1 
ATOM   4173  C CA  . THR B 1 136 ? 125.72000 86.14600  115.29200 1.000 65.46888  ? 136 THR B CA  1 
ATOM   4174  C C   . THR B 1 136 ? 126.27200 86.22300  113.87200 1.000 65.46888  ? 136 THR B C   1 
ATOM   4175  O O   . THR B 1 136 ? 125.59700 86.72900  112.97200 1.000 65.46888  ? 136 THR B O   1 
ATOM   4176  C CB  . THR B 1 136 ? 126.56400 87.00800  116.24200 1.000 65.46888  ? 136 THR B CB  1 
ATOM   4177  O OG1 . THR B 1 136 ? 127.94100 86.63000  116.14700 1.000 65.46888  ? 136 THR B OG1 1 
ATOM   4178  C CG2 . THR B 1 136 ? 126.08300 86.87100  117.67300 1.000 65.46888  ? 136 THR B CG2 1 
ATOM   4179  N N   . TRP B 1 137 ? 127.48400 85.72700  113.64500 1.000 64.81449  ? 137 TRP B N   1 
ATOM   4180  C CA  . TRP B 1 137 ? 128.17800 85.98000  112.38600 1.000 64.81449  ? 137 TRP B CA  1 
ATOM   4181  C C   . TRP B 1 137 ? 128.79500 84.70600  111.82600 1.000 64.81449  ? 137 TRP B C   1 
ATOM   4182  O O   . TRP B 1 137 ? 129.95900 84.68000  111.42900 1.000 64.81449  ? 137 TRP B O   1 
ATOM   4183  C CB  . TRP B 1 137 ? 129.26500 87.04000  112.54700 1.000 64.81449  ? 137 TRP B CB  1 
ATOM   4184  C CG  . TRP B 1 137 ? 128.81200 88.34800  113.09900 1.000 64.81449  ? 137 TRP B CG  1 
ATOM   4185  C CD1 . TRP B 1 137 ? 129.14500 88.88100  114.30500 1.000 64.81449  ? 137 TRP B CD1 1 
ATOM   4186  C CD2 . TRP B 1 137 ? 127.96300 89.30500  112.45800 1.000 64.81449  ? 137 TRP B CD2 1 
ATOM   4187  N NE1 . TRP B 1 137 ? 128.54900 90.10500  114.46300 1.000 64.81449  ? 137 TRP B NE1 1 
ATOM   4188  C CE2 . TRP B 1 137 ? 127.81800 90.38900  113.34100 1.000 64.81449  ? 137 TRP B CE2 1 
ATOM   4189  C CE3 . TRP B 1 137 ? 127.30800 89.34900  111.22800 1.000 64.81449  ? 137 TRP B CE3 1 
ATOM   4190  C CZ2 . TRP B 1 137 ? 127.04600 91.50100  113.03300 1.000 64.81449  ? 137 TRP B CZ2 1 
ATOM   4191  C CZ3 . TRP B 1 137 ? 126.54300 90.45400  110.92400 1.000 64.81449  ? 137 TRP B CZ3 1 
ATOM   4192  C CH2 . TRP B 1 137 ? 126.41700 91.51400  111.82200 1.000 64.81449  ? 137 TRP B CH2 1 
ATOM   4193  N N   . PHE B 1 138 ? 128.02600 83.62200  111.77800 1.000 66.46272  ? 138 PHE B N   1 
ATOM   4194  C CA  . PHE B 1 138 ? 128.47300 82.42700  111.07500 1.000 66.46272  ? 138 PHE B CA  1 
ATOM   4195  C C   . PHE B 1 138 ? 127.67100 82.19000  109.80600 1.000 66.46272  ? 138 PHE B C   1 
ATOM   4196  O O   . PHE B 1 138 ? 128.25000 81.95600  108.74400 1.000 66.46272  ? 138 PHE B O   1 
ATOM   4197  C CB  . PHE B 1 138 ? 128.40500 81.19000  111.96600 1.000 66.46272  ? 138 PHE B CB  1 
ATOM   4198  C CG  . PHE B 1 138 ? 129.12800 80.01100  111.39300 1.000 66.46272  ? 138 PHE B CG  1 
ATOM   4199  C CD1 . PHE B 1 138 ? 130.50500 79.92800  111.47600 1.000 66.46272  ? 138 PHE B CD1 1 
ATOM   4200  C CD2 . PHE B 1 138 ? 128.43600 79.00000  110.74900 1.000 66.46272  ? 138 PHE B CD2 1 
ATOM   4201  C CE1 . PHE B 1 138 ? 131.17800 78.85100  110.94800 1.000 66.46272  ? 138 PHE B CE1 1 
ATOM   4202  C CE2 . PHE B 1 138 ? 129.10400 77.92100  110.21800 1.000 66.46272  ? 138 PHE B CE2 1 
ATOM   4203  C CZ  . PHE B 1 138 ? 130.47700 77.84700  110.31800 1.000 66.46272  ? 138 PHE B CZ  1 
ATOM   4204  N N   . ALA B 1 139 ? 126.34200 82.26200  109.88500 1.000 70.90913  ? 139 ALA B N   1 
ATOM   4205  C CA  . ALA B 1 139 ? 125.50800 82.13600  108.69600 1.000 70.90913  ? 139 ALA B CA  1 
ATOM   4206  C C   . ALA B 1 139 ? 125.61300 83.34600  107.78400 1.000 70.90913  ? 139 ALA B C   1 
ATOM   4207  O O   . ALA B 1 139 ? 125.13500 83.29000  106.64600 1.000 70.90913  ? 139 ALA B O   1 
ATOM   4208  C CB  . ALA B 1 139 ? 124.05000 81.92000  109.09700 1.000 70.90913  ? 139 ALA B CB  1 
ATOM   4209  N N   . PHE B 1 140 ? 126.21300 84.43000  108.26100 1.000 69.34647  ? 140 PHE B N   1 
ATOM   4210  C CA  . PHE B 1 140 ? 126.49400 85.62900  107.49300 1.000 69.34647  ? 140 PHE B CA  1 
ATOM   4211  C C   . PHE B 1 140 ? 127.89700 85.62700  106.90700 1.000 69.34647  ? 140 PHE B C   1 
ATOM   4212  O O   . PHE B 1 140 ? 128.10200 86.11500  105.79600 1.000 69.34647  ? 140 PHE B O   1 
ATOM   4213  C CB  . PHE B 1 140 ? 126.30000 86.84500  108.40400 1.000 69.34647  ? 140 PHE B CB  1 
ATOM   4214  C CG  . PHE B 1 140 ? 126.37100 88.15700  107.70200 1.000 69.34647  ? 140 PHE B CG  1 
ATOM   4215  C CD1 . PHE B 1 140 ? 127.54300 88.89300  107.70500 1.000 69.34647  ? 140 PHE B CD1 1 
ATOM   4216  C CD2 . PHE B 1 140 ? 125.25900 88.67600  107.07200 1.000 69.34647  ? 140 PHE B CD2 1 
ATOM   4217  C CE1 . PHE B 1 140 ? 127.60900 90.10500  107.07200 1.000 69.34647  ? 140 PHE B CE1 1 
ATOM   4218  C CE2 . PHE B 1 140 ? 125.32000 89.89400  106.43700 1.000 69.34647  ? 140 PHE B CE2 1 
ATOM   4219  C CZ  . PHE B 1 140 ? 126.50000 90.61000  106.43800 1.000 69.34647  ? 140 PHE B CZ  1 
ATOM   4220  N N   . ASP B 1 141 ? 128.87200 85.07700  107.62700 1.000 69.16267  ? 141 ASP B N   1 
ATOM   4221  C CA  . ASP B 1 141 ? 130.26400 85.16200  107.21000 1.000 69.16267  ? 141 ASP B CA  1 
ATOM   4222  C C   . ASP B 1 141 ? 130.75900 83.92000  106.48400 1.000 69.16267  ? 141 ASP B C   1 
ATOM   4223  O O   . ASP B 1 141 ? 131.91700 83.90400  106.05800 1.000 69.16267  ? 141 ASP B O   1 
ATOM   4224  C CB  . ASP B 1 141 ? 131.16400 85.42900  108.41700 1.000 69.16267  ? 141 ASP B CB  1 
ATOM   4225  N N   . VAL B 1 142 ? 129.93700 82.88300  106.33900 1.000 70.90725  ? 142 VAL B N   1 
ATOM   4226  C CA  . VAL B 1 142 ? 130.34200 81.72600  105.55000 1.000 70.90725  ? 142 VAL B CA  1 
ATOM   4227  C C   . VAL B 1 142 ? 129.68900 81.86200  104.18100 1.000 70.90725  ? 142 VAL B C   1 
ATOM   4228  O O   . VAL B 1 142 ? 130.07600 81.18900  103.22100 1.000 70.90725  ? 142 VAL B O   1 
ATOM   4229  C CB  . VAL B 1 142 ? 129.97300 80.39700  106.23900 1.000 70.90725  ? 142 VAL B CB  1 
ATOM   4230  C CG1 . VAL B 1 142 ? 128.50600 80.05700  106.04700 1.000 70.90725  ? 142 VAL B CG1 1 
ATOM   4231  C CG2 . VAL B 1 142 ? 130.87300 79.26700  105.76100 1.000 70.90725  ? 142 VAL B CG2 1 
ATOM   4232  N N   . CYS B 1 143 ? 128.70600 82.75800  104.07500 1.000 73.73293  ? 143 CYS B N   1 
ATOM   4233  C CA  . CYS B 1 143 ? 128.11700 83.07700  102.78400 1.000 73.73293  ? 143 CYS B CA  1 
ATOM   4234  C C   . CYS B 1 143 ? 128.94000 84.09300  102.00600 1.000 73.73293  ? 143 CYS B C   1 
ATOM   4235  O O   . CYS B 1 143 ? 128.59400 84.40300  100.86300 1.000 73.73293  ? 143 CYS B O   1 
ATOM   4236  C CB  . CYS B 1 143 ? 126.69500 83.60000  102.97300 1.000 73.73293  ? 143 CYS B CB  1 
ATOM   4237  S SG  . CYS B 1 143 ? 125.51200 82.33000  103.45400 1.000 73.73293  ? 143 CYS B SG  1 
ATOM   4238  N N   . SER B 1 144 ? 130.00600 84.62100  102.60300 1.000 68.92287  ? 144 SER B N   1 
ATOM   4239  C CA  . SER B 1 144 ? 130.92600 85.53500  101.94400 1.000 68.92287  ? 144 SER B CA  1 
ATOM   4240  C C   . SER B 1 144 ? 132.28900 84.90400  101.71600 1.000 68.92287  ? 144 SER B C   1 
ATOM   4241  O O   . SER B 1 144 ? 133.23700 85.60700  101.35500 1.000 68.92287  ? 144 SER B O   1 
ATOM   4242  C CB  . SER B 1 144 ? 131.07600 86.80900  102.77000 1.000 68.92287  ? 144 SER B CB  1 
ATOM   4243  O OG  . SER B 1 144 ? 129.81300 87.26200  103.21200 1.000 68.92287  ? 144 SER B OG  1 
ATOM   4244  N N   . THR B 1 145 ? 132.41200 83.60300  101.92700 1.000 71.03364  ? 145 THR B N   1 
ATOM   4245  C CA  . THR B 1 145 ? 133.69100 82.91900  101.85200 1.000 71.03364  ? 145 THR B CA  1 
ATOM   4246  C C   . THR B 1 145 ? 133.71500 81.81000  100.81300 1.000 71.03364  ? 145 THR B C   1 
ATOM   4247  O O   . THR B 1 145 ? 134.71700 81.67200  100.10400 1.000 71.03364  ? 145 THR B O   1 
ATOM   4248  C CB  . THR B 1 145 ? 134.04700 82.35300  103.23800 1.000 71.03364  ? 145 THR B CB  1 
ATOM   4249  O OG1 . THR B 1 145 ? 134.10000 83.43100  104.17800 1.000 71.03364  ? 145 THR B OG1 1 
ATOM   4250  C CG2 . THR B 1 145 ? 135.39900 81.65800  103.24200 1.000 71.03364  ? 145 THR B CG2 1 
ATOM   4251  N N   . ALA B 1 146 ? 132.62900 81.05600  100.67000 1.000 78.53668  ? 146 ALA B N   1 
ATOM   4252  C CA  . ALA B 1 146 ? 132.54700 79.97400  99.69700  1.000 78.53668  ? 146 ALA B CA  1 
ATOM   4253  C C   . ALA B 1 146 ? 132.58100 80.53200  98.27900  1.000 78.53668  ? 146 ALA B C   1 
ATOM   4254  O O   . ALA B 1 146 ? 131.76200 81.39900  97.94500  1.000 78.53668  ? 146 ALA B O   1 
ATOM   4255  C CB  . ALA B 1 146 ? 131.27500 79.16300  99.91100  1.000 78.53668  ? 146 ALA B CB  1 
ATOM   4256  N N   . PRO B 1 147 ? 133.50900 80.08800  97.43100  1.000 83.17879  ? 147 PRO B N   1 
ATOM   4257  C CA  . PRO B 1 147 ? 133.63800 80.68800  96.09800  1.000 83.17879  ? 147 PRO B CA  1 
ATOM   4258  C C   . PRO B 1 147 ? 132.54400 80.19400  95.16600  1.000 83.17879  ? 147 PRO B C   1 
ATOM   4259  O O   . PRO B 1 147 ? 132.32600 78.99000  95.01900  1.000 83.17879  ? 147 PRO B O   1 
ATOM   4260  C CB  . PRO B 1 147 ? 135.02500 80.23200  95.63000  1.000 83.17879  ? 147 PRO B CB  1 
ATOM   4261  C CG  . PRO B 1 147 ? 135.67800 79.61000  96.83300  1.000 83.17879  ? 147 PRO B CG  1 
ATOM   4262  C CD  . PRO B 1 147 ? 134.57300 79.10900  97.69200  1.000 83.17879  ? 147 PRO B CD  1 
ATOM   4263  N N   . PHE B 1 148 ? 131.84600 81.14000  94.54500  1.000 86.63565  ? 148 PHE B N   1 
ATOM   4264  C CA  . PHE B 1 148 ? 130.84000 80.84800  93.53700  1.000 86.63565  ? 148 PHE B CA  1 
ATOM   4265  C C   . PHE B 1 148 ? 131.37000 81.05800  92.13000  1.000 86.63565  ? 148 PHE B C   1 
ATOM   4266  O O   . PHE B 1 148 ? 131.17600 80.20900  91.26000  1.000 86.63565  ? 148 PHE B O   1 
ATOM   4267  C CB  . PHE B 1 148 ? 129.59800 81.72000  93.76000  1.000 86.63565  ? 148 PHE B CB  1 
ATOM   4268  C CG  . PHE B 1 148 ? 128.76700 81.30000  94.93300  1.000 86.63565  ? 148 PHE B CG  1 
ATOM   4269  C CD1 . PHE B 1 148 ? 129.08100 81.73400  96.21000  1.000 86.63565  ? 148 PHE B CD1 1 
ATOM   4270  C CD2 . PHE B 1 148 ? 127.67500 80.47100  94.76100  1.000 86.63565  ? 148 PHE B CD2 1 
ATOM   4271  C CE1 . PHE B 1 148 ? 128.32000 81.34900  97.29600  1.000 86.63565  ? 148 PHE B CE1 1 
ATOM   4272  C CE2 . PHE B 1 148 ? 126.90800 80.08000  95.84400  1.000 86.63565  ? 148 PHE B CE2 1 
ATOM   4273  C CZ  . PHE B 1 148 ? 127.23300 80.52100  97.11300  1.000 86.63565  ? 148 PHE B CZ  1 
ATOM   4274  N N   . GLN B 1 149 ? 132.04600 82.18200  91.88100  1.000 88.42586  ? 149 GLN B N   1 
ATOM   4275  C CA  . GLN B 1 149 ? 132.63800 82.39300  90.56000  1.000 88.42586  ? 149 GLN B CA  1 
ATOM   4276  C C   . GLN B 1 149 ? 133.88100 81.53400  90.32200  1.000 88.42586  ? 149 GLN B C   1 
ATOM   4277  O O   . GLN B 1 149 ? 133.96900 80.90500  89.25400  1.000 88.42586  ? 149 GLN B O   1 
ATOM   4278  C CB  . GLN B 1 149 ? 132.88600 83.88800  90.32700  1.000 88.42586  ? 149 GLN B CB  1 
ATOM   4279  N N   . PRO B 1 150 ? 134.89800 81.46100  91.25100  1.000 88.14074  ? 150 PRO B N   1 
ATOM   4280  C CA  . PRO B 1 150 ? 136.03100 80.56500  90.96600  1.000 88.14074  ? 150 PRO B CA  1 
ATOM   4281  C C   . PRO B 1 150 ? 135.69800 79.08400  91.02500  1.000 88.14074  ? 150 PRO B C   1 
ATOM   4282  O O   . PRO B 1 150 ? 136.00700 78.34000  90.09100  1.000 88.14074  ? 150 PRO B O   1 
ATOM   4283  C CB  . PRO B 1 150 ? 137.04900 80.93000  92.05400  1.000 88.14074  ? 150 PRO B CB  1 
ATOM   4284  C CG  . PRO B 1 150 ? 136.69100 82.28300  92.46000  1.000 88.14074  ? 150 PRO B CG  1 
ATOM   4285  C CD  . PRO B 1 150 ? 135.20700 82.24800  92.46300  1.000 88.14074  ? 150 PRO B CD  1 
ATOM   4286  N N   . LEU B 1 151 ? 135.07300 78.64600  92.11700  1.000 93.71501  ? 151 LEU B N   1 
ATOM   4287  C CA  . LEU B 1 151 ? 134.97100 77.21300  92.37500  1.000 93.71501  ? 151 LEU B CA  1 
ATOM   4288  C C   . LEU B 1 151 ? 133.89600 76.56200  91.51900  1.000 93.71501  ? 151 LEU B C   1 
ATOM   4289  O O   . LEU B 1 151 ? 134.08000 75.43900  91.03900  1.000 93.71501  ? 151 LEU B O   1 
ATOM   4290  C CB  . LEU B 1 151 ? 134.70100 76.95900  93.85700  1.000 93.71501  ? 151 LEU B CB  1 
ATOM   4291  N N   . SER B 1 152 ? 132.77100 77.24400  91.30900  1.000 96.27104  ? 152 SER B N   1 
ATOM   4292  C CA  . SER B 1 152 ? 131.73000 76.64800  90.48100  1.000 96.27104  ? 152 SER B CA  1 
ATOM   4293  C C   . SER B 1 152 ? 131.88200 76.99000  89.00700  1.000 96.27104  ? 152 SER B C   1 
ATOM   4294  O O   . SER B 1 152 ? 130.89400 76.93700  88.27000  1.000 96.27104  ? 152 SER B O   1 
ATOM   4295  C CB  . SER B 1 152 ? 130.34600 77.06700  90.97400  1.000 96.27104  ? 152 SER B CB  1 
ATOM   4296  O OG  . SER B 1 152 ? 129.35300 76.72100  90.02900  1.000 96.27104  ? 152 SER B OG  1 
ATOM   4297  N N   . LEU B 1 153 ? 133.08800 77.35600  88.57100  1.000 98.83452  ? 153 LEU B N   1 
ATOM   4298  C CA  . LEU B 1 153 ? 133.42400 77.40600  87.15600  1.000 98.83452  ? 153 LEU B CA  1 
ATOM   4299  C C   . LEU B 1 153 ? 133.45400 76.02100  86.52800  1.000 98.83452  ? 153 LEU B C   1 
ATOM   4300  O O   . LEU B 1 153 ? 133.22500 75.89400  85.32100  1.000 98.83452  ? 153 LEU B O   1 
ATOM   4301  C CB  . LEU B 1 153 ? 134.78200 78.09700  86.99400  1.000 98.83452  ? 153 LEU B CB  1 
ATOM   4302  C CG  . LEU B 1 153 ? 135.44900 78.28300  85.63300  1.000 98.83452  ? 153 LEU B CG  1 
ATOM   4303  C CD1 . LEU B 1 153 ? 134.50100 78.96200  84.66900  1.000 98.83452  ? 153 LEU B CD1 1 
ATOM   4304  C CD2 . LEU B 1 153 ? 136.73300 79.08500  85.78000  1.000 98.83452  ? 153 LEU B CD2 1 
ATOM   4305  N N   . LEU B 1 154 ? 133.69100 74.98200  87.32500  1.000 102.47407 ? 154 LEU B N   1 
ATOM   4306  C CA  . LEU B 1 154 ? 133.94700 73.64100  86.82800  1.000 102.47407 ? 154 LEU B CA  1 
ATOM   4307  C C   . LEU B 1 154 ? 132.68800 72.84700  86.50700  1.000 102.47407 ? 154 LEU B C   1 
ATOM   4308  O O   . LEU B 1 154 ? 132.80400 71.74300  85.96500  1.000 102.47407 ? 154 LEU B O   1 
ATOM   4309  C CB  . LEU B 1 154 ? 134.78500 72.86300  87.84700  1.000 102.47407 ? 154 LEU B CB  1 
ATOM   4310  C CG  . LEU B 1 154 ? 136.14700 73.47300  88.17400  1.000 102.47407 ? 154 LEU B CG  1 
ATOM   4311  C CD1 . LEU B 1 154 ? 136.85600 72.66900  89.24600  1.000 102.47407 ? 154 LEU B CD1 1 
ATOM   4312  C CD2 . LEU B 1 154 ? 136.99900 73.56400  86.92200  1.000 102.47407 ? 154 LEU B CD2 1 
ATOM   4313  N N   . PHE B 1 155 ? 131.49600 73.35300  86.81900  1.000 105.72985 ? 155 PHE B N   1 
ATOM   4314  C CA  . PHE B 1 155 ? 130.30000 72.55300  86.55400  1.000 105.72985 ? 155 PHE B CA  1 
ATOM   4315  C C   . PHE B 1 155 ? 129.89200 72.62200  85.08600  1.000 105.72985 ? 155 PHE B C   1 
ATOM   4316  O O   . PHE B 1 155 ? 129.99200 71.63300  84.35400  1.000 105.72985 ? 155 PHE B O   1 
ATOM   4317  C CB  . PHE B 1 155 ? 129.14300 73.01300  87.44800  1.000 105.72985 ? 155 PHE B CB  1 
ATOM   4318  C CG  . PHE B 1 155 ? 129.16400 72.42700  88.83000  1.000 105.72985 ? 155 PHE B CG  1 
ATOM   4319  C CD1 . PHE B 1 155 ? 130.10300 71.47200  89.18700  1.000 105.72985 ? 155 PHE B CD1 1 
ATOM   4320  C CD2 . PHE B 1 155 ? 128.21700 72.81400  89.76600  1.000 105.72985 ? 155 PHE B CD2 1 
ATOM   4321  C CE1 . PHE B 1 155 ? 130.11200 70.93100  90.45800  1.000 105.72985 ? 155 PHE B CE1 1 
ATOM   4322  C CE2 . PHE B 1 155 ? 128.21700 72.27600  91.03600  1.000 105.72985 ? 155 PHE B CE2 1 
ATOM   4323  C CZ  . PHE B 1 155 ? 129.16500 71.33200  91.38300  1.000 105.72985 ? 155 PHE B CZ  1 
ATOM   4324  N N   . ASN B 1 156 ? 129.43200 73.78800  84.63800  1.000 107.89788 ? 156 ASN B N   1 
ATOM   4325  C CA  . ASN B 1 156 ? 129.05900 73.96000  83.23700  1.000 107.89788 ? 156 ASN B CA  1 
ATOM   4326  C C   . ASN B 1 156 ? 129.44400 75.30100  82.63500  1.000 107.89788 ? 156 ASN B C   1 
ATOM   4327  O O   . ASN B 1 156 ? 129.55700 75.38800  81.40800  1.000 107.89788 ? 156 ASN B O   1 
ATOM   4328  C CB  . ASN B 1 156 ? 127.54900 73.75900  83.06000  1.000 107.89788 ? 156 ASN B CB  1 
ATOM   4329  C CG  . ASN B 1 156 ? 127.19900 73.13200  81.72900  1.000 107.89788 ? 156 ASN B CG  1 
ATOM   4330  O OD1 . ASN B 1 156 ? 128.07900 72.71100  80.97900  1.000 107.89788 ? 156 ASN B OD1 1 
ATOM   4331  N ND2 . ASN B 1 156 ? 125.90900 73.07200  81.42300  1.000 107.89788 ? 156 ASN B ND2 1 
ATOM   4332  N N   . TYR B 1 157 ? 129.65600 76.34200  83.43100  1.000 106.08128 ? 157 TYR B N   1 
ATOM   4333  C CA  . TYR B 1 157 ? 129.58100 77.71500  82.96000  1.000 106.08128 ? 157 TYR B CA  1 
ATOM   4334  C C   . TYR B 1 157 ? 130.95900 78.26600  82.61900  1.000 106.08128 ? 157 TYR B C   1 
ATOM   4335  O O   . TYR B 1 157 ? 131.99200 77.63700  82.85500  1.000 106.08128 ? 157 TYR B O   1 
ATOM   4336  C CB  . TYR B 1 157 ? 128.89600 78.59300  84.01000  1.000 106.08128 ? 157 TYR B CB  1 
ATOM   4337  C CG  . TYR B 1 157 ? 127.60600 78.00900  84.54400  1.000 106.08128 ? 157 TYR B CG  1 
ATOM   4338  C CD1 . TYR B 1 157 ? 127.58600 77.27500  85.72700  1.000 106.08128 ? 157 TYR B CD1 1 
ATOM   4339  C CD2 . TYR B 1 157 ? 126.40800 78.19300  83.86600  1.000 106.08128 ? 157 TYR B CD2 1 
ATOM   4340  C CE1 . TYR B 1 157 ? 126.41000 76.73900  86.21600  1.000 106.08128 ? 157 TYR B CE1 1 
ATOM   4341  C CE2 . TYR B 1 157 ? 125.22600 77.66300  84.35100  1.000 106.08128 ? 157 TYR B CE2 1 
ATOM   4342  C CZ  . TYR B 1 157 ? 125.23400 76.93800  85.52500  1.000 106.08128 ? 157 TYR B CZ  1 
ATOM   4343  O OH  . TYR B 1 157 ? 124.06200 76.41000  86.01000  1.000 106.08128 ? 157 TYR B OH  1 
ATOM   4344  N N   . ASN B 1 158 ? 130.95600 79.47200  82.05000  1.000 102.99890 ? 158 ASN B N   1 
ATOM   4345  C CA  . ASN B 1 158 ? 132.16600 80.14100  81.59500  1.000 102.99890 ? 158 ASN B CA  1 
ATOM   4346  C C   . ASN B 1 158 ? 132.60000 81.26300  82.52900  1.000 102.99890 ? 158 ASN B C   1 
ATOM   4347  O O   . ASN B 1 158 ? 133.37100 82.13800  82.12000  1.000 102.99890 ? 158 ASN B O   1 
ATOM   4348  C CB  . ASN B 1 158 ? 131.96700 80.68500  80.18000  1.000 102.99890 ? 158 ASN B CB  1 
ATOM   4349  N N   . GLY B 1 159 ? 132.12200 81.25700  83.77000  1.000 101.66413 ? 159 GLY B N   1 
ATOM   4350  C CA  . GLY B 1 159 ? 132.53500 82.25500  84.73500  1.000 101.66413 ? 159 GLY B CA  1 
ATOM   4351  C C   . GLY B 1 159 ? 131.84900 83.59300  84.60900  1.000 101.66413 ? 159 GLY B C   1 
ATOM   4352  O O   . GLY B 1 159 ? 132.33800 84.58000  85.16600  1.000 101.66413 ? 159 GLY B O   1 
ATOM   4353  N N   . SER B 1 160 ? 130.72700 83.66000  83.89400  1.000 94.23147  ? 160 SER B N   1 
ATOM   4354  C CA  . SER B 1 160 ? 129.99900 84.91200  83.73500  1.000 94.23147  ? 160 SER B CA  1 
ATOM   4355  C C   . SER B 1 160 ? 128.54900 84.60400  83.40500  1.000 94.23147  ? 160 SER B C   1 
ATOM   4356  O O   . SER B 1 160 ? 128.27100 83.83500  82.48000  1.000 94.23147  ? 160 SER B O   1 
ATOM   4357  C CB  . SER B 1 160 ? 130.61300 85.78200  82.63300  1.000 94.23147  ? 160 SER B CB  1 
ATOM   4358  O OG  . SER B 1 160 ? 129.67000 86.72700  82.15800  1.000 94.23147  ? 160 SER B OG  1 
ATOM   4359  N N   . GLU B 1 161 ? 127.64100 85.21100  84.16200  1.000 85.55065  ? 161 GLU B N   1 
ATOM   4360  C CA  . GLU B 1 161 ? 126.20200 85.19400  83.94400  1.000 85.55065  ? 161 GLU B CA  1 
ATOM   4361  C C   . GLU B 1 161 ? 125.62700 86.29400  84.82000  1.000 85.55065  ? 161 GLU B C   1 
ATOM   4362  O O   . GLU B 1 161 ? 126.31600 86.82200  85.69500  1.000 85.55065  ? 161 GLU B O   1 
ATOM   4363  C CB  . GLU B 1 161 ? 125.56800 83.84300  84.28700  1.000 85.55065  ? 161 GLU B CB  1 
ATOM   4364  N N   . LEU B 1 162 ? 124.36500 86.64500  84.57100  1.000 83.94199  ? 162 LEU B N   1 
ATOM   4365  C CA  . LEU B 1 162 ? 123.73600 87.69500  85.36600  1.000 83.94199  ? 162 LEU B CA  1 
ATOM   4366  C C   . LEU B 1 162 ? 123.45300 87.21300  86.78100  1.000 83.94199  ? 162 LEU B C   1 
ATOM   4367  O O   . LEU B 1 162 ? 123.92900 87.79900  87.75700  1.000 83.94199  ? 162 LEU B O   1 
ATOM   4368  C CB  . LEU B 1 162 ? 122.45000 88.18400  84.70300  1.000 83.94199  ? 162 LEU B CB  1 
ATOM   4369  C CG  . LEU B 1 162 ? 121.80400 89.29200  85.53400  1.000 83.94199  ? 162 LEU B CG  1 
ATOM   4370  C CD1 . LEU B 1 162 ? 122.59900 90.58400  85.41400  1.000 83.94199  ? 162 LEU B CD1 1 
ATOM   4371  C CD2 . LEU B 1 162 ? 120.35200 89.50300  85.14600  1.000 83.94199  ? 162 LEU B CD2 1 
ATOM   4372  N N   . GLY B 1 163 ? 122.70800 86.11900  86.91400  1.000 83.55446  ? 163 GLY B N   1 
ATOM   4373  C CA  . GLY B 1 163 ? 122.36100 85.60300  88.22500  1.000 83.55446  ? 163 GLY B CA  1 
ATOM   4374  C C   . GLY B 1 163 ? 123.40600 84.68900  88.83500  1.000 83.55446  ? 163 GLY B C   1 
ATOM   4375  O O   . GLY B 1 163 ? 123.08500 83.84700  89.67800  1.000 83.55446  ? 163 GLY B O   1 
ATOM   4376  N N   . PHE B 1 164 ? 124.66200 84.84600  88.42000  1.000 82.29224  ? 164 PHE B N   1 
ATOM   4377  C CA  . PHE B 1 164 ? 125.74700 84.01700  88.91900  1.000 82.29224  ? 164 PHE B CA  1 
ATOM   4378  C C   . PHE B 1 164 ? 126.90000 84.88200  89.40400  1.000 82.29224  ? 164 PHE B C   1 
ATOM   4379  O O   . PHE B 1 164 ? 127.66300 84.46900  90.28000  1.000 82.29224  ? 164 PHE B O   1 
ATOM   4380  C CB  . PHE B 1 164 ? 126.22300 83.05400  87.83500  1.000 82.29224  ? 164 PHE B CB  1 
ATOM   4381  C CG  . PHE B 1 164 ? 126.91800 81.84100  88.36500  1.000 82.29224  ? 164 PHE B CG  1 
ATOM   4382  C CD1 . PHE B 1 164 ? 128.29600 81.80900  88.47000  1.000 82.29224  ? 164 PHE B CD1 1 
ATOM   4383  C CD2 . PHE B 1 164 ? 126.19100 80.72900  88.75300  1.000 82.29224  ? 164 PHE B CD2 1 
ATOM   4384  C CE1 . PHE B 1 164 ? 128.93600 80.68900  88.95100  1.000 82.29224  ? 164 PHE B CE1 1 
ATOM   4385  C CE2 . PHE B 1 164 ? 126.82500 79.60800  89.23800  1.000 82.29224  ? 164 PHE B CE2 1 
ATOM   4386  C CZ  . PHE B 1 164 ? 128.19800 79.59000  89.33700  1.000 82.29224  ? 164 PHE B CZ  1 
ATOM   4387  N N   . ARG B 1 165 ? 127.05000 86.07100  88.82700  1.000 71.36512  ? 165 ARG B N   1 
ATOM   4388  C CA  . ARG B 1 165 ? 128.04500 87.01100  89.32200  1.000 71.36512  ? 165 ARG B CA  1 
ATOM   4389  C C   . ARG B 1 165 ? 127.43900 88.04600  90.26000  1.000 71.36512  ? 165 ARG B C   1 
ATOM   4390  O O   . ARG B 1 165 ? 128.18000 88.77400  90.92900  1.000 71.36512  ? 165 ARG B O   1 
ATOM   4391  C CB  . ARG B 1 165 ? 128.76500 87.69000  88.15300  1.000 71.36512  ? 165 ARG B CB  1 
ATOM   4392  C CG  . ARG B 1 165 ? 128.05300 88.89400  87.58200  1.000 71.36512  ? 165 ARG B CG  1 
ATOM   4393  C CD  . ARG B 1 165 ? 128.54500 89.24900  86.18400  1.000 71.36512  ? 165 ARG B CD  1 
ATOM   4394  N NE  . ARG B 1 165 ? 130.00000 89.27500  86.09300  1.000 71.36512  ? 165 ARG B NE  1 
ATOM   4395  C CZ  . ARG B 1 165 ? 130.67300 89.90600  85.13800  1.000 71.36512  ? 165 ARG B CZ  1 
ATOM   4396  N NH1 . ARG B 1 165 ? 130.02200 90.57000  84.19700  1.000 71.36512  ? 165 ARG B NH1 1 
ATOM   4397  N NH2 . ARG B 1 165 ? 131.99600 89.88000  85.12700  1.000 71.36512  ? 165 ARG B NH2 1 
ATOM   4398  N N   . ILE B 1 166 ? 126.10700 88.12300  90.32800  1.000 71.88089  ? 166 ILE B N   1 
ATOM   4399  C CA  . ILE B 1 166 ? 125.44500 88.82500  91.42200  1.000 71.88089  ? 166 ILE B CA  1 
ATOM   4400  C C   . ILE B 1 166 ? 125.66000 88.09200  92.74100  1.000 71.88089  ? 166 ILE B C   1 
ATOM   4401  O O   . ILE B 1 166 ? 125.78200 88.72800  93.79200  1.000 71.88089  ? 166 ILE B O   1 
ATOM   4402  C CB  . ILE B 1 166 ? 123.94900 89.03500  91.07000  1.000 71.88089  ? 166 ILE B CB  1 
ATOM   4403  C CG1 . ILE B 1 166 ? 123.80800 90.14100  90.02900  1.000 71.88089  ? 166 ILE B CG1 1 
ATOM   4404  C CG2 . ILE B 1 166 ? 123.08200 89.36500  92.27200  1.000 71.88089  ? 166 ILE B CG2 1 
ATOM   4405  C CD1 . ILE B 1 166 ? 122.40600 90.30000  89.50200  1.000 71.88089  ? 166 ILE B CD1 1 
ATOM   4406  N N   . LEU B 1 167 ? 125.80200 86.76500  92.70700  1.000 72.75782  ? 167 LEU B N   1 
ATOM   4407  C CA  . LEU B 1 167 ? 126.16300 86.02500  93.91500  1.000 72.75782  ? 167 LEU B CA  1 
ATOM   4408  C C   . LEU B 1 167 ? 127.58600 86.31900  94.37900  1.000 72.75782  ? 167 LEU B C   1 
ATOM   4409  O O   . LEU B 1 167 ? 127.92700 86.01000  95.52400  1.000 72.75782  ? 167 LEU B O   1 
ATOM   4410  C CB  . LEU B 1 167 ? 125.99300 84.52000  93.69800  1.000 72.75782  ? 167 LEU B CB  1 
ATOM   4411  C CG  . LEU B 1 167 ? 124.64600 83.86600  94.03700  1.000 72.75782  ? 167 LEU B CG  1 
ATOM   4412  C CD1 . LEU B 1 167 ? 124.35700 83.98400  95.52500  1.000 72.75782  ? 167 LEU B CD1 1 
ATOM   4413  C CD2 . LEU B 1 167 ? 123.48300 84.41400  93.21800  1.000 72.75782  ? 167 LEU B CD2 1 
ATOM   4414  N N   . SER B 1 168 ? 128.42100 86.91000  93.52600  1.000 67.30310  ? 168 SER B N   1 
ATOM   4415  C CA  . SER B 1 168 ? 129.71700 87.40600  93.96500  1.000 67.30310  ? 168 SER B CA  1 
ATOM   4416  C C   . SER B 1 168 ? 129.64800 88.79900  94.57400  1.000 67.30310  ? 168 SER B C   1 
ATOM   4417  O O   . SER B 1 168 ? 130.69900 89.35200  94.90500  1.000 67.30310  ? 168 SER B O   1 
ATOM   4418  C CB  . SER B 1 168 ? 130.70200 87.41400  92.80200  1.000 67.30310  ? 168 SER B CB  1 
ATOM   4419  O OG  . SER B 1 168 ? 131.84300 88.18600  93.12300  1.000 67.30310  ? 168 SER B OG  1 
ATOM   4420  N N   . MET B 1 169 ? 128.45900 89.38700  94.71400  1.000 63.78391  ? 169 MET B N   1 
ATOM   4421  C CA  . MET B 1 169 ? 128.31200 90.62200  95.47400  1.000 63.78391  ? 169 MET B CA  1 
ATOM   4422  C C   . MET B 1 169 ? 128.21500 90.37500  96.96800  1.000 63.78391  ? 169 MET B C   1 
ATOM   4423  O O   . MET B 1 169 ? 128.15700 91.33900  97.73600  1.000 63.78391  ? 169 MET B O   1 
ATOM   4424  C CB  . MET B 1 169 ? 127.07800 91.40000  95.02700  1.000 63.78391  ? 169 MET B CB  1 
ATOM   4425  C CG  . MET B 1 169 ? 127.30000 92.24600  93.81600  1.000 63.78391  ? 169 MET B CG  1 
ATOM   4426  S SD  . MET B 1 169 ? 128.74700 93.27100  94.04600  1.000 63.78391  ? 169 MET B SD  1 
ATOM   4427  C CE  . MET B 1 169 ? 128.73700 94.13500  92.49300  1.000 63.78391  ? 169 MET B CE  1 
ATOM   4428  N N   . LEU B 1 170 ? 128.19400 89.11400  97.39800  1.000 63.85750  ? 170 LEU B N   1 
ATOM   4429  C CA  . LEU B 1 170 ? 128.24200 88.80200  98.81700  1.000 63.85750  ? 170 LEU B CA  1 
ATOM   4430  C C   . LEU B 1 170 ? 129.62800 88.99800  99.40600  1.000 63.85750  ? 170 LEU B C   1 
ATOM   4431  O O   . LEU B 1 170 ? 129.78000 88.90000  100.62300 1.000 63.85750  ? 170 LEU B O   1 
ATOM   4432  C CB  . LEU B 1 170 ? 127.77100 87.37300  99.05500  1.000 63.85750  ? 170 LEU B CB  1 
ATOM   4433  C CG  . LEU B 1 170 ? 126.42300 87.03300  98.42800  1.000 63.85750  ? 170 LEU B CG  1 
ATOM   4434  C CD1 . LEU B 1 170 ? 126.09900 85.57100  98.64400  1.000 63.85750  ? 170 LEU B CD1 1 
ATOM   4435  C CD2 . LEU B 1 170 ? 125.33600 87.91400  99.00200  1.000 63.85750  ? 170 LEU B CD2 1 
ATOM   4436  N N   . ARG B 1 171 ? 130.63500 89.28500  98.58300  1.000 60.14858  ? 171 ARG B N   1 
ATOM   4437  C CA  . ARG B 1 171 ? 131.92000 89.75500  99.07500  1.000 60.14858  ? 171 ARG B CA  1 
ATOM   4438  C C   . ARG B 1 171 ? 131.89000 91.21900  99.49100  1.000 60.14858  ? 171 ARG B C   1 
ATOM   4439  O O   . ARG B 1 171 ? 132.93100 91.75200  99.88100  1.000 60.14858  ? 171 ARG B O   1 
ATOM   4440  C CB  . ARG B 1 171 ? 132.99300 89.53200  98.01300  1.000 60.14858  ? 171 ARG B CB  1 
ATOM   4441  C CG  . ARG B 1 171 ? 133.32800 88.07100  97.80000  1.000 60.14858  ? 171 ARG B CG  1 
ATOM   4442  C CD  . ARG B 1 171 ? 133.90500 87.81900  96.42200  1.000 60.14858  ? 171 ARG B CD  1 
ATOM   4443  N NE  . ARG B 1 171 ? 135.16400 88.52300  96.20800  1.000 60.14858  ? 171 ARG B NE  1 
ATOM   4444  C CZ  . ARG B 1 171 ? 135.38000 89.38100  95.21700  1.000 60.14858  ? 171 ARG B CZ  1 
ATOM   4445  N NH1 . ARG B 1 171 ? 134.41900 89.64400  94.34600  1.000 60.14858  ? 171 ARG B NH1 1 
ATOM   4446  N NH2 . ARG B 1 171 ? 136.55700 89.97400  95.09700  1.000 60.14858  ? 171 ARG B NH2 1 
ATOM   4447  N N   . LEU B 1 172 ? 130.74400 91.88900  99.38800  1.000 56.77261  ? 172 LEU B N   1 
ATOM   4448  C CA  . LEU B 1 172 ? 130.51900 93.16100  100.05100 1.000 56.77261  ? 172 LEU B CA  1 
ATOM   4449  C C   . LEU B 1 172 ? 129.98000 92.98700  101.45800 1.000 56.77261  ? 172 LEU B C   1 
ATOM   4450  O O   . LEU B 1 172 ? 129.89300 93.97000  102.19700 1.000 56.77261  ? 172 LEU B O   1 
ATOM   4451  C CB  . LEU B 1 172 ? 129.54000 94.02500  99.25200  1.000 56.77261  ? 172 LEU B CB  1 
ATOM   4452  C CG  . LEU B 1 172 ? 130.05700 94.75900  98.01900  1.000 56.77261  ? 172 LEU B CG  1 
ATOM   4453  C CD1 . LEU B 1 172 ? 129.01700 95.74600  97.54600  1.000 56.77261  ? 172 LEU B CD1 1 
ATOM   4454  C CD2 . LEU B 1 172 ? 131.36100 95.46500  98.30600  1.000 56.77261  ? 172 LEU B CD2 1 
ATOM   4455  N N   . TRP B 1 173 ? 129.61000 91.76900  101.84400 1.000 60.21403  ? 173 TRP B N   1 
ATOM   4456  C CA  . TRP B 1 173 ? 129.13300 91.52200  103.19500 1.000 60.21403  ? 173 TRP B CA  1 
ATOM   4457  C C   . TRP B 1 173 ? 130.25600 91.42200  104.20900 1.000 60.21403  ? 173 TRP B C   1 
ATOM   4458  O O   . TRP B 1 173 ? 129.98100 91.38700  105.40800 1.000 60.21403  ? 173 TRP B O   1 
ATOM   4459  C CB  . TRP B 1 173 ? 128.30300 90.24400  103.24500 1.000 60.21403  ? 173 TRP B CB  1 
ATOM   4460  C CG  . TRP B 1 173 ? 126.86800 90.47400  103.00200 1.000 60.21403  ? 173 TRP B CG  1 
ATOM   4461  C CD1 . TRP B 1 173 ? 126.26600 91.66200  102.74100 1.000 60.21403  ? 173 TRP B CD1 1 
ATOM   4462  C CD2 . TRP B 1 173 ? 125.83700 89.48800  102.99300 1.000 60.21403  ? 173 TRP B CD2 1 
ATOM   4463  N NE1 . TRP B 1 173 ? 124.91900 91.48100  102.56900 1.000 60.21403  ? 173 TRP B NE1 1 
ATOM   4464  C CE2 . TRP B 1 173 ? 124.63000 90.15100  102.72000 1.000 60.21403  ? 173 TRP B CE2 1 
ATOM   4465  C CE3 . TRP B 1 173 ? 125.81700 88.10600  103.19000 1.000 60.21403  ? 173 TRP B CE3 1 
ATOM   4466  C CZ2 . TRP B 1 173 ? 123.41400 89.48300  102.63900 1.000 60.21403  ? 173 TRP B CZ2 1 
ATOM   4467  C CZ3 . TRP B 1 173 ? 124.61200 87.44400  103.11000 1.000 60.21403  ? 173 TRP B CZ3 1 
ATOM   4468  C CH2 . TRP B 1 173 ? 123.42600 88.13200  102.83600 1.000 60.21403  ? 173 TRP B CH2 1 
ATOM   4469  N N   . ARG B 1 174 ? 131.50900 91.37900  103.77200 1.000 56.25681  ? 174 ARG B N   1 
ATOM   4470  C CA  . ARG B 1 174 ? 132.63000 91.42200  104.69300 1.000 56.25681  ? 174 ARG B CA  1 
ATOM   4471  C C   . ARG B 1 174 ? 133.03900 92.84400  105.03200 1.000 56.25681  ? 174 ARG B C   1 
ATOM   4472  O O   . ARG B 1 174 ? 134.12200 93.05200  105.58300 1.000 56.25681  ? 174 ARG B O   1 
ATOM   4473  C CB  . ARG B 1 174 ? 133.81500 90.64900  104.12100 1.000 56.25681  ? 174 ARG B CB  1 
ATOM   4474  C CG  . ARG B 1 174 ? 134.32500 91.18100  102.81700 1.000 56.25681  ? 174 ARG B CG  1 
ATOM   4475  C CD  . ARG B 1 174 ? 135.46300 90.33500  102.28900 1.000 56.25681  ? 174 ARG B CD  1 
ATOM   4476  N NE  . ARG B 1 174 ? 135.05900 88.96200  102.01100 1.000 56.25681  ? 174 ARG B NE  1 
ATOM   4477  C CZ  . ARG B 1 174 ? 135.67200 88.17500  101.13400 1.000 56.25681  ? 174 ARG B CZ  1 
ATOM   4478  N NH1 . ARG B 1 174 ? 136.70900 88.63200  100.44900 1.000 56.25681  ? 174 ARG B NH1 1 
ATOM   4479  N NH2 . ARG B 1 174 ? 135.24900 86.93500  100.93900 1.000 56.25681  ? 174 ARG B NH2 1 
ATOM   4480  N N   . LEU B 1 175 ? 132.19200 93.82400  104.72600 1.000 49.25192  ? 175 LEU B N   1 
ATOM   4481  C CA  . LEU B 1 175 ? 132.42400 95.21000  105.09800 1.000 49.25192  ? 175 LEU B CA  1 
ATOM   4482  C C   . LEU B 1 175 ? 132.15500 95.47900  106.56800 1.000 49.25192  ? 175 LEU B C   1 
ATOM   4483  O O   . LEU B 1 175 ? 132.44900 96.58000  107.03800 1.000 49.25192  ? 175 LEU B O   1 
ATOM   4484  C CB  . LEU B 1 175 ? 131.54800 96.13600  104.25900 1.000 49.25192  ? 175 LEU B CB  1 
ATOM   4485  C CG  . LEU B 1 175 ? 132.08300 96.59900  102.91200 1.000 49.25192  ? 175 LEU B CG  1 
ATOM   4486  C CD1 . LEU B 1 175 ? 131.04400 97.45400  102.23800 1.000 49.25192  ? 175 LEU B CD1 1 
ATOM   4487  C CD2 . LEU B 1 175 ? 133.35900 97.36900  103.08500 1.000 49.25192  ? 175 LEU B CD2 1 
ATOM   4488  N N   . ARG B 1 176 ? 131.60500 94.51300  107.30200 1.000 50.49444  ? 176 ARG B N   1 
ATOM   4489  C CA  . ARG B 1 176 ? 131.32000 94.72900  108.71100 1.000 50.49444  ? 176 ARG B CA  1 
ATOM   4490  C C   . ARG B 1 176 ? 132.58200 94.75600  109.55800 1.000 50.49444  ? 176 ARG B C   1 
ATOM   4491  O O   . ARG B 1 176 ? 132.53300 95.22200  110.69700 1.000 50.49444  ? 176 ARG B O   1 
ATOM   4492  C CB  . ARG B 1 176 ? 130.33700 93.66600  109.20800 1.000 50.49444  ? 176 ARG B CB  1 
ATOM   4493  C CG  . ARG B 1 176 ? 130.78600 92.22200  109.07100 1.000 50.49444  ? 176 ARG B CG  1 
ATOM   4494  C CD  . ARG B 1 176 ? 131.33800 91.67000  110.37000 1.000 50.49444  ? 176 ARG B CD  1 
ATOM   4495  N NE  . ARG B 1 176 ? 131.65000 90.25000  110.27900 1.000 50.49444  ? 176 ARG B NE  1 
ATOM   4496  C CZ  . ARG B 1 176 ? 132.26100 89.56400  111.23600 1.000 50.49444  ? 176 ARG B CZ  1 
ATOM   4497  N NH1 . ARG B 1 176 ? 132.62500 90.16800  112.35600 1.000 50.49444  ? 176 ARG B NH1 1 
ATOM   4498  N NH2 . ARG B 1 176 ? 132.51000 88.27600  111.07100 1.000 50.49444  ? 176 ARG B NH2 1 
ATOM   4499  N N   . ARG B 1 177 ? 133.70600 94.26300  109.04000 1.000 47.46128  ? 177 ARG B N   1 
ATOM   4500  C CA  . ARG B 1 177 ? 134.96500 94.39500  109.75800 1.000 47.46128  ? 177 ARG B CA  1 
ATOM   4501  C C   . ARG B 1 177 ? 135.48300 95.82000  109.73900 1.000 47.46128  ? 177 ARG B C   1 
ATOM   4502  O O   . ARG B 1 177 ? 136.25100 96.19800  110.62700 1.000 47.46128  ? 177 ARG B O   1 
ATOM   4503  C CB  . ARG B 1 177 ? 136.01000 93.46400  109.16100 1.000 47.46128  ? 177 ARG B CB  1 
ATOM   4504  C CG  . ARG B 1 177 ? 135.48000 92.09000  108.89800 1.000 47.46128  ? 177 ARG B CG  1 
ATOM   4505  C CD  . ARG B 1 177 ? 136.57600 91.14300  108.49900 1.000 47.46128  ? 177 ARG B CD  1 
ATOM   4506  N NE  . ARG B 1 177 ? 136.11000 89.76600  108.57900 1.000 47.46128  ? 177 ARG B NE  1 
ATOM   4507  C CZ  . ARG B 1 177 ? 136.19400 89.02300  109.67300 1.000 47.46128  ? 177 ARG B CZ  1 
ATOM   4508  N NH1 . ARG B 1 177 ? 136.73800 89.52500  110.77200 1.000 47.46128  ? 177 ARG B NH1 1 
ATOM   4509  N NH2 . ARG B 1 177 ? 135.74100 87.77800  109.66900 1.000 47.46128  ? 177 ARG B NH2 1 
ATOM   4510  N N   . VAL B 1 178 ? 135.09600 96.60700  108.74300 1.000 40.81824  ? 178 VAL B N   1 
ATOM   4511  C CA  . VAL B 1 178 ? 135.46900 98.01200  108.68700 1.000 40.81824  ? 178 VAL B CA  1 
ATOM   4512  C C   . VAL B 1 178 ? 134.48300 98.86300  109.47000 1.000 40.81824  ? 178 VAL B C   1 
ATOM   4513  O O   . VAL B 1 178 ? 134.87900 99.79000  110.17900 1.000 40.81824  ? 178 VAL B O   1 
ATOM   4514  C CB  . VAL B 1 178 ? 135.58100 98.44900  107.21300 1.000 40.81824  ? 178 VAL B CB  1 
ATOM   4515  C CG1 . VAL B 1 178 ? 135.58800 99.95200  107.06300 1.000 40.81824  ? 178 VAL B CG1 1 
ATOM   4516  C CG2 . VAL B 1 178 ? 136.83900 97.88800  106.62300 1.000 40.81824  ? 178 VAL B CG2 1 
ATOM   4517  N N   . SER B 1 179 ? 133.19700 98.52100  109.40800 1.000 39.86803  ? 179 SER B N   1 
ATOM   4518  C CA  . SER B 1 179 ? 132.19500 99.30300  110.11800 1.000 39.86803  ? 179 SER B CA  1 
ATOM   4519  C C   . SER B 1 179 ? 132.27100 99.09600  111.62300 1.000 39.86803  ? 179 SER B C   1 
ATOM   4520  O O   . SER B 1 179 ? 131.92900 100.00300 112.38600 1.000 39.86803  ? 179 SER B O   1 
ATOM   4521  C CB  . SER B 1 179 ? 130.80400 98.95300  109.61600 1.000 39.86803  ? 179 SER B CB  1 
ATOM   4522  O OG  . SER B 1 179 ? 129.82900 99.38800  110.53900 1.000 39.86803  ? 179 SER B OG  1 
ATOM   4523  N N   . SER B 1 180 ? 132.71100 97.92400  112.07100 1.000 38.84953  ? 180 SER B N   1 
ATOM   4524  C CA  . SER B 1 180 ? 132.91900 97.68200  113.49200 1.000 38.84953  ? 180 SER B CA  1 
ATOM   4525  C C   . SER B 1 180 ? 134.31400 98.06200  113.95100 1.000 38.84953  ? 180 SER B C   1 
ATOM   4526  O O   . SER B 1 180 ? 134.66800 97.78400  115.09700 1.000 38.84953  ? 180 SER B O   1 
ATOM   4527  C CB  . SER B 1 180 ? 132.66400 96.21900  113.83700 1.000 38.84953  ? 180 SER B CB  1 
ATOM   4528  O OG  . SER B 1 180 ? 133.68800 95.40400  113.30600 1.000 38.84953  ? 180 SER B OG  1 
ATOM   4529  N N   . LEU B 1 181 ? 135.12200 98.65800  113.08100 1.000 36.33674  ? 181 LEU B N   1 
ATOM   4530  C CA  . LEU B 1 181 ? 136.37200 99.27100  113.50000 1.000 36.33674  ? 181 LEU B CA  1 
ATOM   4531  C C   . LEU B 1 181 ? 136.20700 100.76600 113.70800 1.000 36.33674  ? 181 LEU B C   1 
ATOM   4532  O O   . LEU B 1 181 ? 136.89400 101.35300 114.54400 1.000 36.33674  ? 181 LEU B O   1 
ATOM   4533  C CB  . LEU B 1 181 ? 137.47400 98.97800  112.48000 1.000 36.33674  ? 181 LEU B CB  1 
ATOM   4534  C CG  . LEU B 1 181 ? 138.90400 99.44600  112.74000 1.000 36.33674  ? 181 LEU B CG  1 
ATOM   4535  C CD1 . LEU B 1 181 ? 139.85800 98.38500  112.29700 1.000 36.33674  ? 181 LEU B CD1 1 
ATOM   4536  C CD2 . LEU B 1 181 ? 139.19800 100.70100 111.94900 1.000 36.33674  ? 181 LEU B CD2 1 
ATOM   4537  N N   . PHE B 1 182 ? 135.30000 101.39800 112.96700 1.000 35.07389  ? 182 PHE B N   1 
ATOM   4538  C CA  . PHE B 1 182 ? 135.01000 102.80300 113.21400 1.000 35.07389  ? 182 PHE B CA  1 
ATOM   4539  C C   . PHE B 1 182 ? 134.23300 102.97900 114.50800 1.000 35.07389  ? 182 PHE B C   1 
ATOM   4540  O O   . PHE B 1 182 ? 134.30800 104.03300 115.14500 1.000 35.07389  ? 182 PHE B O   1 
ATOM   4541  C CB  . PHE B 1 182 ? 134.23500 103.39300 112.04400 1.000 35.07389  ? 182 PHE B CB  1 
ATOM   4542  C CG  . PHE B 1 182 ? 135.08900 103.74900 110.87700 1.000 35.07389  ? 182 PHE B CG  1 
ATOM   4543  C CD1 . PHE B 1 182 ? 136.14900 104.61600 111.02400 1.000 35.07389  ? 182 PHE B CD1 1 
ATOM   4544  C CD2 . PHE B 1 182 ? 134.82900 103.21800 109.63300 1.000 35.07389  ? 182 PHE B CD2 1 
ATOM   4545  C CE1 . PHE B 1 182 ? 136.93400 104.94500 109.95300 1.000 35.07389  ? 182 PHE B CE1 1 
ATOM   4546  C CE2 . PHE B 1 182 ? 135.60900 103.54300 108.55900 1.000 35.07389  ? 182 PHE B CE2 1 
ATOM   4547  C CZ  . PHE B 1 182 ? 136.66400 104.40700 108.72000 1.000 35.07389  ? 182 PHE B CZ  1 
ATOM   4548  N N   . ALA B 1 183 ? 133.46900 101.96300 114.90600 1.000 35.07440  ? 183 ALA B N   1 
ATOM   4549  C CA  . ALA B 1 183 ? 132.77200 102.02700 116.18300 1.000 35.07440  ? 183 ALA B CA  1 
ATOM   4550  C C   . ALA B 1 183 ? 133.72400 101.80800 117.34300 1.000 35.07440  ? 183 ALA B C   1 
ATOM   4551  O O   . ALA B 1 183 ? 133.47900 102.30000 118.44700 1.000 35.07440  ? 183 ALA B O   1 
ATOM   4552  C CB  . ALA B 1 183 ? 131.64800 100.99700 116.22700 1.000 35.07440  ? 183 ALA B CB  1 
ATOM   4553  N N   . ARG B 1 184 ? 134.80500 101.07000 117.12100 1.000 35.50174  ? 184 ARG B N   1 
ATOM   4554  C CA  . ARG B 1 184 ? 135.76000 100.82100 118.18900 1.000 35.50174  ? 184 ARG B CA  1 
ATOM   4555  C C   . ARG B 1 184 ? 136.72000 101.98900 118.36100 1.000 35.50174  ? 184 ARG B C   1 
ATOM   4556  O O   . ARG B 1 184 ? 137.06100 102.35200 119.49000 1.000 35.50174  ? 184 ARG B O   1 
ATOM   4557  C CB  . ARG B 1 184 ? 136.52000 99.53000  117.90500 1.000 35.50174  ? 184 ARG B CB  1 
ATOM   4558  C CG  . ARG B 1 184 ? 137.64200 99.23400  118.86500 1.000 35.50174  ? 184 ARG B CG  1 
ATOM   4559  C CD  . ARG B 1 184 ? 138.59300 98.22900  118.27200 1.000 35.50174  ? 184 ARG B CD  1 
ATOM   4560  N NE  . ARG B 1 184 ? 137.89600 97.00600  117.90500 1.000 35.50174  ? 184 ARG B NE  1 
ATOM   4561  C CZ  . ARG B 1 184 ? 138.36400 96.12000  117.03800 1.000 35.50174  ? 184 ARG B CZ  1 
ATOM   4562  N NH1 . ARG B 1 184 ? 139.53100 96.32500  116.44700 1.000 35.50174  ? 184 ARG B NH1 1 
ATOM   4563  N NH2 . ARG B 1 184 ? 137.66300 95.03100  116.76100 1.000 35.50174  ? 184 ARG B NH2 1 
ATOM   4564  N N   . LEU B 1 185 ? 137.14600 102.60900 117.26000 1.000 33.09788  ? 185 LEU B N   1 
ATOM   4565  C CA  . LEU B 1 185 ? 138.09700 103.70900 117.34700 1.000 33.09788  ? 185 LEU B CA  1 
ATOM   4566  C C   . LEU B 1 185 ? 137.46900 104.99700 117.85400 1.000 33.09788  ? 185 LEU B C   1 
ATOM   4567  O O   . LEU B 1 185 ? 138.20100 105.92100 118.21400 1.000 33.09788  ? 185 LEU B O   1 
ATOM   4568  C CB  . LEU B 1 185 ? 138.73500 103.97200 115.98900 1.000 33.09788  ? 185 LEU B CB  1 
ATOM   4569  C CG  . LEU B 1 185 ? 139.67300 102.93100 115.39400 1.000 33.09788  ? 185 LEU B CG  1 
ATOM   4570  C CD1 . LEU B 1 185 ? 140.48800 103.56800 114.30300 1.000 33.09788  ? 185 LEU B CD1 1 
ATOM   4571  C CD2 . LEU B 1 185 ? 140.57000 102.34100 116.44800 1.000 33.09788  ? 185 LEU B CD2 1 
ATOM   4572  N N   . GLU B 1 186 ? 136.14000 105.09400 117.87500 1.000 34.10777  ? 186 GLU B N   1 
ATOM   4573  C CA  . GLU B 1 186 ? 135.50500 106.30800 118.36900 1.000 34.10777  ? 186 GLU B CA  1 
ATOM   4574  C C   . GLU B 1 186 ? 135.56300 106.39400 119.88400 1.000 34.10777  ? 186 GLU B C   1 
ATOM   4575  O O   . GLU B 1 186 ? 135.59700 107.49500 120.43900 1.000 34.10777  ? 186 GLU B O   1 
ATOM   4576  C CB  . GLU B 1 186 ? 134.05700 106.37200 117.90800 1.000 34.10777  ? 186 GLU B CB  1 
ATOM   4577  C CG  . GLU B 1 186 ? 133.86400 107.02800 116.57300 1.000 34.10777  ? 186 GLU B CG  1 
ATOM   4578  C CD  . GLU B 1 186 ? 132.46700 106.82400 116.04800 1.000 34.10777  ? 186 GLU B CD  1 
ATOM   4579  O OE1 . GLU B 1 186 ? 131.53300 106.74000 116.87200 1.000 34.10777  ? 186 GLU B OE1 1 
ATOM   4580  O OE2 . GLU B 1 186 ? 132.30100 106.73300 114.81500 1.000 34.10777  ? 186 GLU B OE2 1 
ATOM   4581  N N   . LYS B 1 187 ? 135.57200 105.25500 120.56300 1.000 34.42670  ? 187 LYS B N   1 
ATOM   4582  C CA  . LYS B 1 187 ? 135.64700 105.20600 122.01200 1.000 34.42670  ? 187 LYS B CA  1 
ATOM   4583  C C   . LYS B 1 187 ? 137.06100 104.98400 122.52100 1.000 34.42670  ? 187 LYS B C   1 
ATOM   4584  O O   . LYS B 1 187 ? 137.26800 104.94800 123.73500 1.000 34.42670  ? 187 LYS B O   1 
ATOM   4585  C CB  . LYS B 1 187 ? 134.72400 104.11100 122.53400 1.000 34.42670  ? 187 LYS B CB  1 
ATOM   4586  C CG  . LYS B 1 187 ? 133.37700 104.11000 121.85300 1.000 34.42670  ? 187 LYS B CG  1 
ATOM   4587  C CD  . LYS B 1 187 ? 132.46600 103.06700 122.44500 1.000 34.42670  ? 187 LYS B CD  1 
ATOM   4588  C CE  . LYS B 1 187 ? 132.94900 101.67500 122.11900 1.000 34.42670  ? 187 LYS B CE  1 
ATOM   4589  N NZ  . LYS B 1 187 ? 132.51800 101.26500 120.76300 1.000 34.42670  ? 187 LYS B NZ  1 
ATOM   4590  N N   . ASP B 1 188 ? 138.03400 104.83400 121.63000 1.000 36.29023  ? 188 ASP B N   1 
ATOM   4591  C CA  . ASP B 1 188 ? 139.43200 104.73900 122.02400 1.000 36.29023  ? 188 ASP B CA  1 
ATOM   4592  C C   . ASP B 1 188 ? 139.96200 106.14200 122.27700 1.000 36.29023  ? 188 ASP B C   1 
ATOM   4593  O O   . ASP B 1 188 ? 139.96500 106.97600 121.37000 1.000 36.29023  ? 188 ASP B O   1 
ATOM   4594  C CB  . ASP B 1 188 ? 140.23800 104.04600 120.93200 1.000 36.29023  ? 188 ASP B CB  1 
ATOM   4595  C CG  . ASP B 1 188 ? 141.44200 103.31000 121.46900 1.000 36.29023  ? 188 ASP B CG  1 
ATOM   4596  O OD1 . ASP B 1 188 ? 141.95300 103.69700 122.53800 1.000 36.29023  ? 188 ASP B OD1 1 
ATOM   4597  O OD2 . ASP B 1 188 ? 141.88400 102.34200 120.81900 1.000 36.29023  ? 188 ASP B OD2 1 
ATOM   4598  N N   . ILE B 1 189 ? 140.41800 106.40500 123.50200 1.000 34.81543  ? 189 ILE B N   1 
ATOM   4599  C CA  . ILE B 1 189 ? 140.75800 107.77000 123.88300 1.000 34.81543  ? 189 ILE B CA  1 
ATOM   4600  C C   . ILE B 1 189 ? 142.09300 108.22600 123.32000 1.000 34.81543  ? 189 ILE B C   1 
ATOM   4601  O O   . ILE B 1 189 ? 142.40800 109.41700 123.38900 1.000 34.81543  ? 189 ILE B O   1 
ATOM   4602  C CB  . ILE B 1 189 ? 140.76200 107.91700 125.41000 1.000 34.81543  ? 189 ILE B CB  1 
ATOM   4603  C CG1 . ILE B 1 189 ? 141.67600 106.86400 126.02900 1.000 34.81543  ? 189 ILE B CG1 1 
ATOM   4604  C CG2 . ILE B 1 189 ? 139.36200 107.79000 125.94000 1.000 34.81543  ? 189 ILE B CG2 1 
ATOM   4605  C CD1 . ILE B 1 189 ? 141.74700 106.91500 127.52500 1.000 34.81543  ? 189 ILE B CD1 1 
ATOM   4606  N N   . ARG B 1 190 ? 142.89600 107.32400 122.77100 1.000 38.33579  ? 190 ARG B N   1 
ATOM   4607  C CA  . ARG B 1 190 ? 144.15200 107.72800 122.15900 1.000 38.33579  ? 190 ARG B CA  1 
ATOM   4608  C C   . ARG B 1 190 ? 144.01000 108.04000 120.67900 1.000 38.33579  ? 190 ARG B C   1 
ATOM   4609  O O   . ARG B 1 190 ? 145.01400 108.31700 120.02100 1.000 38.33579  ? 190 ARG B O   1 
ATOM   4610  C CB  . ARG B 1 190 ? 145.21800 106.65300 122.36700 1.000 38.33579  ? 190 ARG B CB  1 
ATOM   4611  C CG  . ARG B 1 190 ? 144.80600 105.28200 121.91400 1.000 38.33579  ? 190 ARG B CG  1 
ATOM   4612  C CD  . ARG B 1 190 ? 145.83500 104.25300 122.31000 1.000 38.33579  ? 190 ARG B CD  1 
ATOM   4613  N NE  . ARG B 1 190 ? 145.96000 103.20400 121.30600 1.000 38.33579  ? 190 ARG B NE  1 
ATOM   4614  C CZ  . ARG B 1 190 ? 145.20800 102.11000 121.27200 1.000 38.33579  ? 190 ARG B CZ  1 
ATOM   4615  N NH1 . ARG B 1 190 ? 144.27200 101.91900 122.19000 1.000 38.33579  ? 190 ARG B NH1 1 
ATOM   4616  N NH2 . ARG B 1 190 ? 145.39200 101.20500 120.32200 1.000 38.33579  ? 190 ARG B NH2 1 
ATOM   4617  N N   . PHE B 1 191 ? 142.79500 108.00300 120.14500 1.000 35.60175  ? 191 PHE B N   1 
ATOM   4618  C CA  . PHE B 1 191 ? 142.50300 108.43500 118.78900 1.000 35.60175  ? 191 PHE B CA  1 
ATOM   4619  C C   . PHE B 1 191 ? 141.58600 109.64700 118.82900 1.000 35.60175  ? 191 PHE B C   1 
ATOM   4620  O O   . PHE B 1 191 ? 140.77800 109.80100 119.74700 1.000 35.60175  ? 191 PHE B O   1 
ATOM   4621  C CB  . PHE B 1 191 ? 141.84500 107.31800 117.98100 1.000 35.60175  ? 191 PHE B CB  1 
ATOM   4622  C CG  . PHE B 1 191 ? 142.76700 106.19200 117.64400 1.000 35.60175  ? 191 PHE B CG  1 
ATOM   4623  C CD1 . PHE B 1 191 ? 143.75800 106.35600 116.69500 1.000 35.60175  ? 191 PHE B CD1 1 
ATOM   4624  C CD2 . PHE B 1 191 ? 142.64400 104.97000 118.27300 1.000 35.60175  ? 191 PHE B CD2 1 
ATOM   4625  C CE1 . PHE B 1 191 ? 144.61000 105.32300 116.38300 1.000 35.60175  ? 191 PHE B CE1 1 
ATOM   4626  C CE2 . PHE B 1 191 ? 143.49300 103.93300 117.96400 1.000 35.60175  ? 191 PHE B CE2 1 
ATOM   4627  C CZ  . PHE B 1 191 ? 144.47600 104.11000 117.01800 1.000 35.60175  ? 191 PHE B CZ  1 
ATOM   4628  N N   . ASN B 1 192 ? 141.71400 110.50800 117.82700 1.000 32.43775  ? 192 ASN B N   1 
ATOM   4629  C CA  . ASN B 1 192 ? 140.88900 111.70100 117.77300 1.000 32.43775  ? 192 ASN B CA  1 
ATOM   4630  C C   . ASN B 1 192 ? 139.45700 111.34500 117.39600 1.000 32.43775  ? 192 ASN B C   1 
ATOM   4631  O O   . ASN B 1 192 ? 139.16600 110.25100 116.91800 1.000 32.43775  ? 192 ASN B O   1 
ATOM   4632  C CB  . ASN B 1 192 ? 141.45500 112.70400 116.77500 1.000 32.43775  ? 192 ASN B CB  1 
ATOM   4633  C CG  . ASN B 1 192 ? 141.16500 114.12800 117.16600 1.000 32.43775  ? 192 ASN B CG  1 
ATOM   4634  O OD1 . ASN B 1 192 ? 140.28700 114.38900 117.97800 1.000 32.43775  ? 192 ASN B OD1 1 
ATOM   4635  N ND2 . ASN B 1 192 ? 141.90300 115.05900 116.59200 1.000 32.43775  ? 192 ASN B ND2 1 
ATOM   4636  N N   . TYR B 1 193 ? 138.55300 112.28200 117.63700 1.000 30.67675  ? 193 TYR B N   1 
ATOM   4637  C CA  . TYR B 1 193 ? 137.14600 112.11300 117.30600 1.000 30.67675  ? 193 TYR B CA  1 
ATOM   4638  C C   . TYR B 1 193 ? 136.71400 112.94900 116.11900 1.000 30.67675  ? 193 TYR B C   1 
ATOM   4639  O O   . TYR B 1 193 ? 135.79200 112.56700 115.40700 1.000 30.67675  ? 193 TYR B O   1 
ATOM   4640  C CB  . TYR B 1 193 ? 136.27700 112.46700 118.51100 1.000 30.67675  ? 193 TYR B CB  1 
ATOM   4641  C CG  . TYR B 1 193 ? 134.82400 112.11900 118.34700 1.000 30.67675  ? 193 TYR B CG  1 
ATOM   4642  C CD1 . TYR B 1 193 ? 134.42000 110.80500 118.24500 1.000 30.67675  ? 193 TYR B CD1 1 
ATOM   4643  C CD2 . TYR B 1 193 ? 133.85800 113.10600 118.30200 1.000 30.67675  ? 193 TYR B CD2 1 
ATOM   4644  C CE1 . TYR B 1 193 ? 133.09800 110.48200 118.10000 1.000 30.67675  ? 193 TYR B CE1 1 
ATOM   4645  C CE2 . TYR B 1 193 ? 132.53400 112.79200 118.15600 1.000 30.67675  ? 193 TYR B CE2 1 
ATOM   4646  C CZ  . TYR B 1 193 ? 132.16000 111.47700 118.05600 1.000 30.67675  ? 193 TYR B CZ  1 
ATOM   4647  O OH  . TYR B 1 193 ? 130.83800 111.14500 117.90900 1.000 30.67675  ? 193 TYR B OH  1 
ATOM   4648  N N   . PHE B 1 194 ? 137.35500 114.08800 115.88200 1.000 35.05685  ? 194 PHE B N   1 
ATOM   4649  C CA  . PHE B 1 194 ? 137.03500 114.85800 114.69400 1.000 35.05685  ? 194 PHE B CA  1 
ATOM   4650  C C   . PHE B 1 194 ? 137.66600 114.28400 113.44200 1.000 35.05685  ? 194 PHE B C   1 
ATOM   4651  O O   . PHE B 1 194 ? 137.20900 114.60500 112.34800 1.000 35.05685  ? 194 PHE B O   1 
ATOM   4652  C CB  . PHE B 1 194 ? 137.48100 116.30500 114.85000 1.000 35.05685  ? 194 PHE B CB  1 
ATOM   4653  C CG  . PHE B 1 194 ? 136.93500 116.97200 116.06300 1.000 35.05685  ? 194 PHE B CG  1 
ATOM   4654  C CD1 . PHE B 1 194 ? 135.63600 117.43200 116.08200 1.000 35.05685  ? 194 PHE B CD1 1 
ATOM   4655  C CD2 . PHE B 1 194 ? 137.72200 117.14700 117.18700 1.000 35.05685  ? 194 PHE B CD2 1 
ATOM   4656  C CE1 . PHE B 1 194 ? 135.13000 118.05300 117.20000 1.000 35.05685  ? 194 PHE B CE1 1 
ATOM   4657  C CE2 . PHE B 1 194 ? 137.21800 117.76400 118.30800 1.000 35.05685  ? 194 PHE B CE2 1 
ATOM   4658  C CZ  . PHE B 1 194 ? 135.92200 118.21600 118.31400 1.000 35.05685  ? 194 PHE B CZ  1 
ATOM   4659  N N   . TRP B 1 195 ? 138.70600 113.46900 113.56200 1.000 35.35371  ? 195 TRP B N   1 
ATOM   4660  C CA  . TRP B 1 195 ? 139.33400 112.88600 112.39000 1.000 35.35371  ? 195 TRP B CA  1 
ATOM   4661  C C   . TRP B 1 195 ? 139.10800 111.39200 112.28600 1.000 35.35371  ? 195 TRP B C   1 
ATOM   4662  O O   . TRP B 1 195 ? 139.78100 110.73300 111.49300 1.000 35.35371  ? 195 TRP B O   1 
ATOM   4663  C CB  . TRP B 1 195 ? 140.82700 113.21000 112.37200 1.000 35.35371  ? 195 TRP B CB  1 
ATOM   4664  C CG  . TRP B 1 195 ? 141.06400 114.69000 112.39100 1.000 35.35371  ? 195 TRP B CG  1 
ATOM   4665  C CD1 . TRP B 1 195 ? 141.62100 115.41200 113.39900 1.000 35.35371  ? 195 TRP B CD1 1 
ATOM   4666  C CD2 . TRP B 1 195 ? 140.71600 115.63700 111.36700 1.000 35.35371  ? 195 TRP B CD2 1 
ATOM   4667  N NE1 . TRP B 1 195 ? 141.65300 116.74300 113.07000 1.000 35.35371  ? 195 TRP B NE1 1 
ATOM   4668  C CE2 . TRP B 1 195 ? 141.10300 116.90600 111.82700 1.000 35.35371  ? 195 TRP B CE2 1 
ATOM   4669  C CE3 . TRP B 1 195 ? 140.12400 115.53100 110.10200 1.000 35.35371  ? 195 TRP B CE3 1 
ATOM   4670  C CZ2 . TRP B 1 195 ? 140.91600 118.05800 111.07200 1.000 35.35371  ? 195 TRP B CZ2 1 
ATOM   4671  C CZ3 . TRP B 1 195 ? 139.93800 116.67300 109.36100 1.000 35.35371  ? 195 TRP B CZ3 1 
ATOM   4672  C CH2 . TRP B 1 195 ? 140.33300 117.91900 109.84600 1.000 35.35371  ? 195 TRP B CH2 1 
ATOM   4673  N N   . ILE B 1 196 ? 138.19400 110.84800 113.07800 1.000 31.84944  ? 196 ILE B N   1 
ATOM   4674  C CA  . ILE B 1 196 ? 137.61500 109.53700 112.83000 1.000 31.84944  ? 196 ILE B CA  1 
ATOM   4675  C C   . ILE B 1 196 ? 136.20700 109.67200 112.27100 1.000 31.84944  ? 196 ILE B C   1 
ATOM   4676  O O   . ILE B 1 196 ? 135.82200 108.94400 111.35500 1.000 31.84944  ? 196 ILE B O   1 
ATOM   4677  C CB  . ILE B 1 196 ? 137.65200 108.70100 114.12800 1.000 31.84944  ? 196 ILE B CB  1 
ATOM   4678  C CG1 . ILE B 1 196 ? 139.07100 108.21000 114.39400 1.000 31.84944  ? 196 ILE B CG1 1 
ATOM   4679  C CG2 . ILE B 1 196 ? 136.71500 107.52200 114.08200 1.000 31.84944  ? 196 ILE B CG2 1 
ATOM   4680  C CD1 . ILE B 1 196 ? 139.60600 107.30100 113.32900 1.000 31.84944  ? 196 ILE B CD1 1 
ATOM   4681  N N   . ARG B 1 197 ? 135.45100 110.64800 112.77000 1.000 31.78284  ? 197 ARG B N   1 
ATOM   4682  C CA  . ARG B 1 197 ? 134.11100 110.89900 112.26000 1.000 31.78284  ? 197 ARG B CA  1 
ATOM   4683  C C   . ARG B 1 197 ? 134.10900 111.45000 110.84400 1.000 31.78284  ? 197 ARG B C   1 
ATOM   4684  O O   . ARG B 1 197 ? 133.14400 111.21700 110.11900 1.000 31.78284  ? 197 ARG B O   1 
ATOM   4685  C CB  . ARG B 1 197 ? 133.36500 111.86500 113.17000 1.000 31.78284  ? 197 ARG B CB  1 
ATOM   4686  C CG  . ARG B 1 197 ? 132.88700 111.25300 114.45600 1.000 31.78284  ? 197 ARG B CG  1 
ATOM   4687  C CD  . ARG B 1 197 ? 132.07700 110.00800 114.21300 1.000 31.78284  ? 197 ARG B CD  1 
ATOM   4688  N NE  . ARG B 1 197 ? 130.83600 110.27700 113.50500 1.000 31.78284  ? 197 ARG B NE  1 
ATOM   4689  C CZ  . ARG B 1 197 ? 129.92700 109.35000 113.24300 1.000 31.78284  ? 197 ARG B CZ  1 
ATOM   4690  N NH1 . ARG B 1 197 ? 130.12600 108.10400 113.63500 1.000 31.78284  ? 197 ARG B NH1 1 
ATOM   4691  N NH2 . ARG B 1 197 ? 128.82200 109.66200 112.59300 1.000 31.78284  ? 197 ARG B NH2 1 
ATOM   4692  N N   . CYS B 1 198 ? 135.15000 112.17000 110.42700 1.000 33.26074  ? 198 CYS B N   1 
ATOM   4693  C CA  . CYS B 1 198 ? 135.22500 112.59800 109.03500 1.000 33.26074  ? 198 CYS B CA  1 
ATOM   4694  C C   . CYS B 1 198 ? 135.79000 111.52600 108.11600 1.000 33.26074  ? 198 CYS B C   1 
ATOM   4695  O O   . CYS B 1 198 ? 135.44700 111.49500 106.93300 1.000 33.26074  ? 198 CYS B O   1 
ATOM   4696  C CB  . CYS B 1 198 ? 136.04600 113.87800 108.90100 1.000 33.26074  ? 198 CYS B CB  1 
ATOM   4697  S SG  . CYS B 1 198 ? 135.40300 115.26500 109.83300 1.000 33.26074  ? 198 CYS B SG  1 
ATOM   4698  N N   . THR B 1 199 ? 136.65200 110.64600 108.62200 1.000 32.60122  ? 199 THR B N   1 
ATOM   4699  C CA  . THR B 1 199 ? 137.08200 109.48900 107.84800 1.000 32.60122  ? 199 THR B CA  1 
ATOM   4700  C C   . THR B 1 199 ? 135.93900 108.51400 107.59500 1.000 32.60122  ? 199 THR B C   1 
ATOM   4701  O O   . THR B 1 199 ? 135.89600 107.88800 106.53200 1.000 32.60122  ? 199 THR B O   1 
ATOM   4702  C CB  . THR B 1 199 ? 138.23700 108.79600 108.57200 1.000 32.60122  ? 199 THR B CB  1 
ATOM   4703  O OG1 . THR B 1 199 ? 139.23100 109.77000 108.90100 1.000 32.60122  ? 199 THR B OG1 1 
ATOM   4704  C CG2 . THR B 1 199 ? 138.88400 107.74100 107.70900 1.000 32.60122  ? 199 THR B CG2 1 
ATOM   4705  N N   . LYS B 1 200 ? 134.99100 108.40600 108.51900 1.000 32.52579  ? 200 LYS B N   1 
ATOM   4706  C CA  . LYS B 1 200 ? 133.79100 107.62200 108.26900 1.000 32.52579  ? 200 LYS B CA  1 
ATOM   4707  C C   . LYS B 1 200 ? 132.86400 108.32800 107.29200 1.000 32.52579  ? 200 LYS B C   1 
ATOM   4708  O O   . LYS B 1 200 ? 132.12200 107.67400 106.55700 1.000 32.52579  ? 200 LYS B O   1 
ATOM   4709  C CB  . LYS B 1 200 ? 133.06900 107.35300 109.58500 1.000 32.52579  ? 200 LYS B CB  1 
ATOM   4710  C CG  . LYS B 1 200 ? 131.99500 106.29600 109.53500 1.000 32.52579  ? 200 LYS B CG  1 
ATOM   4711  C CD  . LYS B 1 200 ? 131.44700 106.06800 110.92100 1.000 32.52579  ? 200 LYS B CD  1 
ATOM   4712  C CE  . LYS B 1 200 ? 130.27400 105.12800 110.90500 1.000 32.52579  ? 200 LYS B CE  1 
ATOM   4713  N NZ  . LYS B 1 200 ? 129.43500 105.29000 112.12200 1.000 32.52579  ? 200 LYS B NZ  1 
ATOM   4714  N N   . LEU B 1 201 ? 132.88400 109.65900 107.26600 1.000 30.72694  ? 201 LEU B N   1 
ATOM   4715  C CA  . LEU B 1 201 ? 132.01900 110.38100 106.34300 1.000 30.72694  ? 201 LEU B CA  1 
ATOM   4716  C C   . LEU B 1 201 ? 132.60800 110.43200 104.94700 1.000 30.72694  ? 201 LEU B C   1 
ATOM   4717  O O   . LEU B 1 201 ? 131.87400 110.62900 103.97900 1.000 30.72694  ? 201 LEU B O   1 
ATOM   4718  C CB  . LEU B 1 201 ? 131.76600 111.80100 106.84000 1.000 30.72694  ? 201 LEU B CB  1 
ATOM   4719  C CG  . LEU B 1 201 ? 130.80100 112.02100 108.00100 1.000 30.72694  ? 201 LEU B CG  1 
ATOM   4720  C CD1 . LEU B 1 201 ? 130.54000 113.50100 108.16200 1.000 30.72694  ? 201 LEU B CD1 1 
ATOM   4721  C CD2 . LEU B 1 201 ? 129.51600 111.25400 107.80500 1.000 30.72694  ? 201 LEU B CD2 1 
ATOM   4722  N N   . ILE B 1 202 ? 133.92200 110.28700 104.82200 1.000 29.96463  ? 202 ILE B N   1 
ATOM   4723  C CA  . ILE B 1 202 ? 134.54100 110.29500 103.50300 1.000 29.96463  ? 202 ILE B CA  1 
ATOM   4724  C C   . ILE B 1 202 ? 134.44700 108.91700 102.86500 1.000 29.96463  ? 202 ILE B C   1 
ATOM   4725  O O   . ILE B 1 202 ? 134.13400 108.79100 101.67700 1.000 29.96463  ? 202 ILE B O   1 
ATOM   4726  C CB  . ILE B 1 202 ? 135.99200 110.79600 103.61700 1.000 29.96463  ? 202 ILE B CB  1 
ATOM   4727  C CG1 . ILE B 1 202 ? 136.01200 112.31100 103.76400 1.000 29.96463  ? 202 ILE B CG1 1 
ATOM   4728  C CG2 . ILE B 1 202 ? 136.82000 110.41400 102.41700 1.000 29.96463  ? 202 ILE B CG2 1 
ATOM   4729  C CD1 . ILE B 1 202 ? 137.37100 112.86900 104.04900 1.000 29.96463  ? 202 ILE B CD1 1 
ATOM   4730  N N   . SER B 1 203 ? 134.64400 107.86300 103.65600 1.000 31.53707  ? 203 SER B N   1 
ATOM   4731  C CA  . SER B 1 203 ? 134.67100 106.51100 103.11300 1.000 31.53707  ? 203 SER B CA  1 
ATOM   4732  C C   . SER B 1 203 ? 133.29000 106.04400 102.67900 1.000 31.53707  ? 203 SER B C   1 
ATOM   4733  O O   . SER B 1 203 ? 133.16800 105.13500 101.85600 1.000 31.53707  ? 203 SER B O   1 
ATOM   4734  C CB  . SER B 1 203 ? 135.24600 105.55600 104.15000 1.000 31.53707  ? 203 SER B CB  1 
ATOM   4735  O OG  . SER B 1 203 ? 136.57200 105.91300 104.47500 1.000 31.53707  ? 203 SER B OG  1 
ATOM   4736  N N   . VAL B 1 204 ? 132.23700 106.65000 103.21900 1.000 30.28656  ? 204 VAL B N   1 
ATOM   4737  C CA  . VAL B 1 204 ? 130.88400 106.28500 102.81400 1.000 30.28656  ? 204 VAL B CA  1 
ATOM   4738  C C   . VAL B 1 204 ? 130.56600 106.87900 101.44600 1.000 30.28656  ? 204 VAL B C   1 
ATOM   4739  O O   . VAL B 1 204 ? 129.98700 106.21300 100.58000 1.000 30.28656  ? 204 VAL B O   1 
ATOM   4740  C CB  . VAL B 1 204 ? 129.87500 106.72300 103.89100 1.000 30.28656  ? 204 VAL B CB  1 
ATOM   4741  C CG1 . VAL B 1 204 ? 128.46600 106.78400 103.35400 1.000 30.28656  ? 204 VAL B CG1 1 
ATOM   4742  C CG2 . VAL B 1 204 ? 129.92200 105.76700 105.04400 1.000 30.28656  ? 204 VAL B CG2 1 
ATOM   4743  N N   . THR B 1 205 ? 130.98600 108.12200 101.20800 1.000 29.93206  ? 205 THR B N   1 
ATOM   4744  C CA  . THR B 1 205 ? 130.67700 108.76200 99.93400  1.000 29.93206  ? 205 THR B CA  1 
ATOM   4745  C C   . THR B 1 205 ? 131.60300 108.28400 98.82500  1.000 29.93206  ? 205 THR B C   1 
ATOM   4746  O O   . THR B 1 205 ? 131.20100 108.22800 97.66000  1.000 29.93206  ? 205 THR B O   1 
ATOM   4747  C CB  . THR B 1 205 ? 130.75400 110.27300 100.06800 1.000 29.93206  ? 205 THR B CB  1 
ATOM   4748  O OG1 . THR B 1 205 ? 132.12200 110.66900 100.17000 1.000 29.93206  ? 205 THR B OG1 1 
ATOM   4749  C CG2 . THR B 1 205 ? 130.02000 110.71100 101.29000 1.000 29.93206  ? 205 THR B CG2 1 
ATOM   4750  N N   . LEU B 1 206 ? 132.85100 107.94500 99.16100  1.000 31.72971  ? 206 LEU B N   1 
ATOM   4751  C CA  . LEU B 1 206 ? 133.75200 107.36100 98.17000  1.000 31.72971  ? 206 LEU B CA  1 
ATOM   4752  C C   . LEU B 1 206 ? 133.27000 105.99200 97.72700  1.000 31.72971  ? 206 LEU B C   1 
ATOM   4753  O O   . LEU B 1 206 ? 133.52800 105.56800 96.59900  1.000 31.72971  ? 206 LEU B O   1 
ATOM   4754  C CB  . LEU B 1 206 ? 135.16300 107.24100 98.73100  1.000 31.72971  ? 206 LEU B CB  1 
ATOM   4755  C CG  . LEU B 1 206 ? 136.03500 108.46600 98.94000  1.000 31.72971  ? 206 LEU B CG  1 
ATOM   4756  C CD1 . LEU B 1 206 ? 137.34900 107.99600 99.51600  1.000 31.72971  ? 206 LEU B CD1 1 
ATOM   4757  C CD2 . LEU B 1 206 ? 136.25300 109.21000 97.65200  1.000 31.72971  ? 206 LEU B CD2 1 
ATOM   4758  N N   . PHE B 1 207 ? 132.57800 105.27800 98.60400  1.000 32.60421  ? 207 PHE B N   1 
ATOM   4759  C CA  . PHE B 1 207 ? 132.00000 104.01100 98.19300  1.000 32.60421  ? 207 PHE B CA  1 
ATOM   4760  C C   . PHE B 1 207 ? 130.69100 104.22000 97.45100  1.000 32.60421  ? 207 PHE B C   1 
ATOM   4761  O O   . PHE B 1 207 ? 130.30400 103.38700 96.63300  1.000 32.60421  ? 207 PHE B O   1 
ATOM   4762  C CB  . PHE B 1 207 ? 131.78900 103.11300 99.40000  1.000 32.60421  ? 207 PHE B CB  1 
ATOM   4763  C CG  . PHE B 1 207 ? 131.42500 101.71600 99.04200  1.000 32.60421  ? 207 PHE B CG  1 
ATOM   4764  C CD1 . PHE B 1 207 ? 132.26400 100.95800 98.25500  1.000 32.60421  ? 207 PHE B CD1 1 
ATOM   4765  C CD2 . PHE B 1 207 ? 130.23800 101.16400 99.47700  1.000 32.60421  ? 207 PHE B CD2 1 
ATOM   4766  C CE1 . PHE B 1 207 ? 131.93200 99.67900  97.91700  1.000 32.60421  ? 207 PHE B CE1 1 
ATOM   4767  C CE2 . PHE B 1 207 ? 129.90200 99.88000  99.14000  1.000 32.60421  ? 207 PHE B CE2 1 
ATOM   4768  C CZ  . PHE B 1 207 ? 130.75100 99.13800  98.36000  1.000 32.60421  ? 207 PHE B CZ  1 
ATOM   4769  N N   . ALA B 1 208 ? 129.99100 105.32000 97.71600  1.000 31.32545  ? 208 ALA B N   1 
ATOM   4770  C CA  . ALA B 1 208 ? 128.72900 105.56100 97.02500  1.000 31.32545  ? 208 ALA B CA  1 
ATOM   4771  C C   . ALA B 1 208 ? 128.96800 106.08600 95.61800  1.000 31.32545  ? 208 ALA B C   1 
ATOM   4772  O O   . ALA B 1 208 ? 128.14600 105.88800 94.72100  1.000 31.32545  ? 208 ALA B O   1 
ATOM   4773  C CB  . ALA B 1 208 ? 127.87000 106.53300 97.82600  1.000 31.32545  ? 208 ALA B CB  1 
ATOM   4774  N N   . ILE B 1 209 ? 130.08500 106.78000 95.41300  1.000 30.88463  ? 209 ILE B N   1 
ATOM   4775  C CA  . ILE B 1 209 ? 130.46300 107.22500 94.07600  1.000 30.88463  ? 209 ILE B CA  1 
ATOM   4776  C C   . ILE B 1 209 ? 130.92000 106.03900 93.24200  1.000 30.88463  ? 209 ILE B C   1 
ATOM   4777  O O   . ILE B 1 209 ? 130.53600 105.88500 92.07800  1.000 30.88463  ? 209 ILE B O   1 
ATOM   4778  C CB  . ILE B 1 209 ? 131.55500 108.30300 94.17500  1.000 30.88463  ? 209 ILE B CB  1 
ATOM   4779  C CG1 . ILE B 1 209 ? 130.96300 109.61500 94.66100  1.000 30.88463  ? 209 ILE B CG1 1 
ATOM   4780  C CG2 . ILE B 1 209 ? 132.26200 108.51000 92.86500  1.000 30.88463  ? 209 ILE B CG2 1 
ATOM   4781  C CD1 . ILE B 1 209 ? 131.96200 110.46700 95.35500  1.000 30.88463  ? 209 ILE B CD1 1 
ATOM   4782  N N   . HIS B 1 210 ? 131.72400 105.16500 93.84300  1.000 34.90273  ? 210 HIS B N   1 
ATOM   4783  C CA  . HIS B 1 210 ? 132.28500 104.02900 93.12400  1.000 34.90273  ? 210 HIS B CA  1 
ATOM   4784  C C   . HIS B 1 210 ? 131.21600 102.99700 92.79300  1.000 34.90273  ? 210 HIS B C   1 
ATOM   4785  O O   . HIS B 1 210 ? 131.10900 102.54700 91.65100  1.000 34.90273  ? 210 HIS B O   1 
ATOM   4786  C CB  . HIS B 1 210 ? 133.39800 103.40700 93.96000  1.000 34.90273  ? 210 HIS B CB  1 
ATOM   4787  C CG  . HIS B 1 210 ? 134.10000 102.27100 93.29300  1.000 34.90273  ? 210 HIS B CG  1 
ATOM   4788  N ND1 . HIS B 1 210 ? 135.26200 102.43700 92.57400  1.000 34.90273  ? 210 HIS B ND1 1 
ATOM   4789  C CD2 . HIS B 1 210 ? 133.82000 100.95000 93.25600  1.000 34.90273  ? 210 HIS B CD2 1 
ATOM   4790  C CE1 . HIS B 1 210 ? 135.65900 101.26700 92.11000  1.000 34.90273  ? 210 HIS B CE1 1 
ATOM   4791  N NE2 . HIS B 1 210 ? 134.80000 100.34800 92.50900  1.000 34.90273  ? 210 HIS B NE2 1 
ATOM   4792  N N   . CYS B 1 211 ? 130.40000 102.62300 93.77600  1.000 36.35926  ? 211 CYS B N   1 
ATOM   4793  C CA  . CYS B 1 211 ? 129.43300 101.55300 93.57100  1.000 36.35926  ? 211 CYS B CA  1 
ATOM   4794  C C   . CYS B 1 211 ? 128.23900 101.99800 92.73900  1.000 36.35926  ? 211 CYS B C   1 
ATOM   4795  O O   . CYS B 1 211 ? 127.46300 101.15100 92.29600  1.000 36.35926  ? 211 CYS B O   1 
ATOM   4796  C CB  . CYS B 1 211 ? 128.98000 101.00900 94.92900  1.000 36.35926  ? 211 CYS B CB  1 
ATOM   4797  S SG  . CYS B 1 211 ? 127.97500 99.51800  94.94600  1.000 36.35926  ? 211 CYS B SG  1 
ATOM   4798  N N   . ALA B 1 212 ? 128.07900 103.29100 92.48100  1.000 32.54481  ? 212 ALA B N   1 
ATOM   4799  C CA  . ALA B 1 212 ? 127.03300 103.75100 91.58700  1.000 32.54481  ? 212 ALA B CA  1 
ATOM   4800  C C   . ALA B 1 212 ? 127.56100 104.30700 90.27900  1.000 32.54481  ? 212 ALA B C   1 
ATOM   4801  O O   . ALA B 1 212 ? 126.76100 104.66200 89.41100  1.000 32.54481  ? 212 ALA B O   1 
ATOM   4802  C CB  . ALA B 1 212 ? 126.17300 104.81200 92.27000  1.000 32.54481  ? 212 ALA B CB  1 
ATOM   4803  N N   . GLY B 1 213 ? 128.87300 104.41900 90.12400  1.000 35.80774  ? 213 GLY B N   1 
ATOM   4804  C CA  . GLY B 1 213 ? 129.46900 104.64600 88.82700  1.000 35.80774  ? 213 GLY B CA  1 
ATOM   4805  C C   . GLY B 1 213 ? 129.80500 103.38600 88.09400  1.000 35.80774  ? 213 GLY B C   1 
ATOM   4806  O O   . GLY B 1 213 ? 130.07900 103.42000 86.89600  1.000 35.80774  ? 213 GLY B O   1 
ATOM   4807  N N   . CYS B 1 214 ? 129.79400 102.26000 88.79700  1.000 38.71015  ? 214 CYS B N   1 
ATOM   4808  C CA  . CYS B 1 214 ? 129.95300 100.95800 88.18100  1.000 38.71015  ? 214 CYS B CA  1 
ATOM   4809  C C   . CYS B 1 214 ? 128.63000 100.24300 87.98300  1.000 38.71015  ? 214 CYS B C   1 
ATOM   4810  O O   . CYS B 1 214 ? 128.57700 99.27700  87.22100  1.000 38.71015  ? 214 CYS B O   1 
ATOM   4811  C CB  . CYS B 1 214 ? 130.87800 100.08400 89.02800  1.000 38.71015  ? 214 CYS B CB  1 
ATOM   4812  S SG  . CYS B 1 214 ? 132.52300 100.77500 89.26500  1.000 38.71015  ? 214 CYS B SG  1 
ATOM   4813  N N   . PHE B 1 215 ? 127.56900 100.68100 88.64600  1.000 39.38890  ? 215 PHE B N   1 
ATOM   4814  C CA  . PHE B 1 215 ? 126.25500 100.10900 88.40800  1.000 39.38890  ? 215 PHE B CA  1 
ATOM   4815  C C   . PHE B 1 215 ? 125.49200 100.85500 87.33100  1.000 39.38890  ? 215 PHE B C   1 
ATOM   4816  O O   . PHE B 1 215 ? 124.42200 100.39800 86.92800  1.000 39.38890  ? 215 PHE B O   1 
ATOM   4817  C CB  . PHE B 1 215 ? 125.41300 100.09900 89.68600  1.000 39.38890  ? 215 PHE B CB  1 
ATOM   4818  C CG  . PHE B 1 215 ? 125.81000 99.04400  90.68600  1.000 39.38890  ? 215 PHE B CG  1 
ATOM   4819  C CD1 . PHE B 1 215 ? 126.83400 98.14600  90.42600  1.000 39.38890  ? 215 PHE B CD1 1 
ATOM   4820  C CD2 . PHE B 1 215 ? 125.14800 98.95800  91.89800  1.000 39.38890  ? 215 PHE B CD2 1 
ATOM   4821  C CE1 . PHE B 1 215 ? 127.19200 97.19600  91.35300  1.000 39.38890  ? 215 PHE B CE1 1 
ATOM   4822  C CE2 . PHE B 1 215 ? 125.50200 98.00500  92.82900  1.000 39.38890  ? 215 PHE B CE2 1 
ATOM   4823  C CZ  . PHE B 1 215 ? 126.52600 97.12300  92.55300  1.000 39.38890  ? 215 PHE B CZ  1 
ATOM   4824  N N   . ASN B 1 216 ? 126.00100 101.99500 86.87700  1.000 39.51667  ? 216 ASN B N   1 
ATOM   4825  C CA  . ASN B 1 216 ? 125.42600 102.72900 85.76200  1.000 39.51667  ? 216 ASN B CA  1 
ATOM   4826  C C   . ASN B 1 216 ? 126.24300 102.57500 84.49600  1.000 39.51667  ? 216 ASN B C   1 
ATOM   4827  O O   . ASN B 1 216 ? 125.86600 103.11700 83.45700  1.000 39.51667  ? 216 ASN B O   1 
ATOM   4828  C CB  . ASN B 1 216 ? 125.29100 104.20500 86.10800  1.000 39.51667  ? 216 ASN B CB  1 
ATOM   4829  C CG  . ASN B 1 216 ? 124.17700 104.87400 85.34600  1.000 39.51667  ? 216 ASN B CG  1 
ATOM   4830  O OD1 . ASN B 1 216 ? 123.06500 104.36200 85.27700  1.000 39.51667  ? 216 ASN B OD1 1 
ATOM   4831  N ND2 . ASN B 1 216 ? 124.47200 106.01700 84.75200  1.000 39.51667  ? 216 ASN B ND2 1 
ATOM   4832  N N   . TYR B 1 217 ? 127.36300 101.87000 84.56300  1.000 43.58217  ? 217 TYR B N   1 
ATOM   4833  C CA  . TYR B 1 217 ? 128.03300 101.41100 83.36100  1.000 43.58217  ? 217 TYR B CA  1 
ATOM   4834  C C   . TYR B 1 217 ? 127.51600 100.06400 82.90200  1.000 43.58217  ? 217 TYR B C   1 
ATOM   4835  O O   . TYR B 1 217 ? 127.57800 99.76600  81.71000  1.000 43.58217  ? 217 TYR B O   1 
ATOM   4836  C CB  . TYR B 1 217 ? 129.53900 101.31900 83.59100  1.000 43.58217  ? 217 TYR B CB  1 
ATOM   4837  C CG  . TYR B 1 217 ? 130.34300 101.15400 82.33300  1.000 43.58217  ? 217 TYR B CG  1 
ATOM   4838  C CD1 . TYR B 1 217 ? 130.65800 102.24600 81.54500  1.000 43.58217  ? 217 TYR B CD1 1 
ATOM   4839  C CD2 . TYR B 1 217 ? 130.79900 99.90700  81.93900  1.000 43.58217  ? 217 TYR B CD2 1 
ATOM   4840  C CE1 . TYR B 1 217 ? 131.40100 102.10000 80.39600  1.000 43.58217  ? 217 TYR B CE1 1 
ATOM   4841  C CE2 . TYR B 1 217 ? 131.54000 99.75000  80.79300  1.000 43.58217  ? 217 TYR B CE2 1 
ATOM   4842  C CZ  . TYR B 1 217 ? 131.83900 100.84800 80.02600  1.000 43.58217  ? 217 TYR B CZ  1 
ATOM   4843  O OH  . TYR B 1 217 ? 132.58200 100.68900 78.88300  1.000 43.58217  ? 217 TYR B OH  1 
ATOM   4844  N N   . LEU B 1 218 ? 127.00000 99.25300  83.82300  1.000 43.95805  ? 218 LEU B N   1 
ATOM   4845  C CA  . LEU B 1 218 ? 126.40300 97.98100  83.44600  1.000 43.95805  ? 218 LEU B CA  1 
ATOM   4846  C C   . LEU B 1 218 ? 125.08100 98.17700  82.71800  1.000 43.95805  ? 218 LEU B C   1 
ATOM   4847  O O   . LEU B 1 218 ? 124.70700 97.34700  81.88700  1.000 43.95805  ? 218 LEU B O   1 
ATOM   4848  C CB  . LEU B 1 218 ? 126.19700 97.12000  84.68400  1.000 43.95805  ? 218 LEU B CB  1 
ATOM   4849  C CG  . LEU B 1 218 ? 126.00300 95.63800  84.41000  1.000 43.95805  ? 218 LEU B CG  1 
ATOM   4850  C CD1 . LEU B 1 218 ? 127.34800 94.96600  84.26100  1.000 43.95805  ? 218 LEU B CD1 1 
ATOM   4851  C CD2 . LEU B 1 218 ? 125.17600 94.99700  85.50000  1.000 43.95805  ? 218 LEU B CD2 1 
ATOM   4852  N N   . ILE B 1 219 ? 124.35600 99.25400  83.02200  1.000 43.26790  ? 219 ILE B N   1 
ATOM   4853  C CA  . ILE B 1 219 ? 123.12100 99.53500  82.30300  1.000 43.26790  ? 219 ILE B CA  1 
ATOM   4854  C C   . ILE B 1 219 ? 123.42500 99.98600  80.88200  1.000 43.26790  ? 219 ILE B C   1 
ATOM   4855  O O   . ILE B 1 219 ? 122.66800 99.69000  79.95200  1.000 43.26790  ? 219 ILE B O   1 
ATOM   4856  C CB  . ILE B 1 219 ? 122.28600 100.58000 83.06400  1.000 43.26790  ? 219 ILE B CB  1 
ATOM   4857  C CG1 . ILE B 1 219 ? 122.18200 100.21400 84.53900  1.000 43.26790  ? 219 ILE B CG1 1 
ATOM   4858  C CG2 . ILE B 1 219 ? 120.89400 100.68300 82.48800  1.000 43.26790  ? 219 ILE B CG2 1 
ATOM   4859  C CD1 . ILE B 1 219 ? 121.40800 98.95400  84.80300  1.000 43.26790  ? 219 ILE B CD1 1 
ATOM   4860  N N   . ALA B 1 220 ? 124.53800 100.68300 80.67900  1.000 45.78686  ? 220 ALA B N   1 
ATOM   4861  C CA  . ALA B 1 220 ? 124.91200 101.13200 79.34600  1.000 45.78686  ? 220 ALA B CA  1 
ATOM   4862  C C   . ALA B 1 220 ? 125.61400 100.04800 78.54400  1.000 45.78686  ? 220 ALA B C   1 
ATOM   4863  O O   . ALA B 1 220 ? 125.39800 99.94000  77.33400  1.000 45.78686  ? 220 ALA B O   1 
ATOM   4864  C CB  . ALA B 1 220 ? 125.81000 102.36500 79.43500  1.000 45.78686  ? 220 ALA B CB  1 
ATOM   4865  N N   . ASP B 1 221 ? 126.45400 99.24100  79.18900  1.000 50.16787  ? 221 ASP B N   1 
ATOM   4866  C CA  . ASP B 1 221 ? 127.20200 98.22000  78.46700  1.000 50.16787  ? 221 ASP B CA  1 
ATOM   4867  C C   . ASP B 1 221 ? 126.34200 97.03000  78.07900  1.000 50.16787  ? 221 ASP B C   1 
ATOM   4868  O O   . ASP B 1 221 ? 126.68200 96.32300  77.12700  1.000 50.16787  ? 221 ASP B O   1 
ATOM   4869  C CB  . ASP B 1 221 ? 128.38000 97.73600  79.30700  1.000 50.16787  ? 221 ASP B CB  1 
ATOM   4870  C CG  . ASP B 1 221 ? 129.57800 97.39000  78.47200  1.000 50.16787  ? 221 ASP B CG  1 
ATOM   4871  O OD1 . ASP B 1 221 ? 129.43600 97.32900  77.23700  1.000 50.16787  ? 221 ASP B OD1 1 
ATOM   4872  O OD2 . ASP B 1 221 ? 130.66400 97.17400  79.04700  1.000 50.16787  ? 221 ASP B OD2 1 
ATOM   4873  N N   . ARG B 1 222 ? 125.24700 96.78700  78.78800  1.000 50.60430  ? 222 ARG B N   1 
ATOM   4874  C CA  . ARG B 1 222 ? 124.39300 95.63300  78.54600  1.000 50.60430  ? 222 ARG B CA  1 
ATOM   4875  C C   . ARG B 1 222 ? 123.03800 96.05300  77.99500  1.000 50.60430  ? 222 ARG B C   1 
ATOM   4876  O O   . ARG B 1 222 ? 122.00000 95.52400  78.39000  1.000 50.60430  ? 222 ARG B O   1 
ATOM   4877  C CB  . ARG B 1 222 ? 124.21600 94.81200  79.81700  1.000 50.60430  ? 222 ARG B CB  1 
ATOM   4878  C CG  . ARG B 1 222 ? 125.47500 94.11200  80.28000  1.000 50.60430  ? 222 ARG B CG  1 
ATOM   4879  C CD  . ARG B 1 222 ? 125.16200 93.05200  81.31700  1.000 50.60430  ? 222 ARG B CD  1 
ATOM   4880  N NE  . ARG B 1 222 ? 124.60900 91.84000  80.71900  1.000 50.60430  ? 222 ARG B NE  1 
ATOM   4881  C CZ  . ARG B 1 222 ? 123.32300 91.50600  80.75200  1.000 50.60430  ? 222 ARG B CZ  1 
ATOM   4882  N NH1 . ARG B 1 222 ? 122.44300 92.29400  81.35500  1.000 50.60430  ? 222 ARG B NH1 1 
ATOM   4883  N NH2 . ARG B 1 222 ? 122.91600 90.38200  80.18100  1.000 50.60430  ? 222 ARG B NH2 1 
ATOM   4884  N N   . TYR B 1 223 ? 123.03300 97.02000  77.08500  1.000 53.29711  ? 223 TYR B N   1 
ATOM   4885  C CA  . TYR B 1 223 ? 121.79800 97.47300  76.47500  1.000 53.29711  ? 223 TYR B CA  1 
ATOM   4886  C C   . TYR B 1 223 ? 121.72400 96.92400  75.06200  1.000 53.29711  ? 223 TYR B C   1 
ATOM   4887  O O   . TYR B 1 223 ? 122.64100 97.18000  74.26600  1.000 53.29711  ? 223 TYR B O   1 
ATOM   4888  C CB  . TYR B 1 223 ? 121.72900 98.99500  76.47100  1.000 53.29711  ? 223 TYR B CB  1 
ATOM   4889  C CG  . TYR B 1 223 ? 120.35900 99.54300  76.17800  1.000 53.29711  ? 223 TYR B CG  1 
ATOM   4890  C CD1 . TYR B 1 223 ? 119.26200 99.12800  76.91100  1.000 53.29711  ? 223 TYR B CD1 1 
ATOM   4891  C CD2 . TYR B 1 223 ? 120.16800 100.50600 75.20500  1.000 53.29711  ? 223 TYR B CD2 1 
ATOM   4892  C CE1 . TYR B 1 223 ? 118.00500 99.62200  76.65500  1.000 53.29711  ? 223 TYR B CE1 1 
ATOM   4893  C CE2 . TYR B 1 223 ? 118.91400 101.01800 74.95100  1.000 53.29711  ? 223 TYR B CE2 1 
ATOM   4894  C CZ  . TYR B 1 223 ? 117.83800 100.56700 75.67600  1.000 53.29711  ? 223 TYR B CZ  1 
ATOM   4895  O OH  . TYR B 1 223 ? 116.58300 101.06400 75.42800  1.000 53.29711  ? 223 TYR B OH  1 
ATOM   4896  N N   . PRO B 1 224 ? 120.68200 96.15600  74.71200  1.000 57.97401  ? 224 PRO B N   1 
ATOM   4897  C CA  . PRO B 1 224 ? 120.69400 95.44400  73.42200  1.000 57.97401  ? 224 PRO B CA  1 
ATOM   4898  C C   . PRO B 1 224 ? 120.51900 96.35400  72.22700  1.000 57.97401  ? 224 PRO B C   1 
ATOM   4899  O O   . PRO B 1 224 ? 120.95500 96.01900  71.12100  1.000 57.97401  ? 224 PRO B O   1 
ATOM   4900  C CB  . PRO B 1 224 ? 119.52100 94.46700  73.56200  1.000 57.97401  ? 224 PRO B CB  1 
ATOM   4901  C CG  . PRO B 1 224 ? 118.58600 95.16000  74.49600  1.000 57.97401  ? 224 PRO B CG  1 
ATOM   4902  C CD  . PRO B 1 224 ? 119.46700 95.85900  75.48900  1.000 57.97401  ? 224 PRO B CD  1 
ATOM   4903  N N   . ASN B 1 225 ? 119.89700 97.50100  72.42600  1.000 59.76413  ? 225 ASN B N   1 
ATOM   4904  C CA  . ASN B 1 225 ? 119.73300 98.50200  71.38500  1.000 59.76413  ? 225 ASN B CA  1 
ATOM   4905  C C   . ASN B 1 225 ? 121.07200 99.20900  71.17500  1.000 59.76413  ? 225 ASN B C   1 
ATOM   4906  O O   . ASN B 1 225 ? 121.99200 99.02400  71.98200  1.000 59.76413  ? 225 ASN B O   1 
ATOM   4907  C CB  . ASN B 1 225 ? 118.61100 99.46600  71.78700  1.000 59.76413  ? 225 ASN B CB  1 
ATOM   4908  N N   . PRO B 1 226 ? 121.24000 100.03100 70.11700  1.000 61.65279  ? 226 PRO B N   1 
ATOM   4909  C CA  . PRO B 1 226 ? 122.50600 100.76500 69.96500  1.000 61.65279  ? 226 PRO B CA  1 
ATOM   4910  C C   . PRO B 1 226 ? 122.70600 101.87300 70.98500  1.000 61.65279  ? 226 PRO B C   1 
ATOM   4911  O O   . PRO B 1 226 ? 121.97500 101.97500 71.97400  1.000 61.65279  ? 226 PRO B O   1 
ATOM   4912  C CB  . PRO B 1 226 ? 122.41100 101.33800 68.54400  1.000 61.65279  ? 226 PRO B CB  1 
ATOM   4913  C CG  . PRO B 1 226 ? 120.96500 101.29400 68.21000  1.000 61.65279  ? 226 PRO B CG  1 
ATOM   4914  C CD  . PRO B 1 226 ? 120.49100 100.04200 68.84700  1.000 61.65279  ? 226 PRO B CD  1 
ATOM   4915  N N   . ARG B 1 227 ? 123.71300 102.71200 70.75200  1.000 57.86854  ? 227 ARG B N   1 
ATOM   4916  C CA  . ARG B 1 227 ? 124.11800 103.72400 71.71700  1.000 57.86854  ? 227 ARG B CA  1 
ATOM   4917  C C   . ARG B 1 227 ? 123.08100 104.83300 71.85100  1.000 57.86854  ? 227 ARG B C   1 
ATOM   4918  O O   . ARG B 1 227 ? 123.27100 105.94900 71.36000  1.000 57.86854  ? 227 ARG B O   1 
ATOM   4919  C CB  . ARG B 1 227 ? 125.46700 104.31500 71.31800  1.000 57.86854  ? 227 ARG B CB  1 
ATOM   4920  N N   . LYS B 1 228 ? 121.97200 104.50400 72.50600  1.000 51.16720  ? 228 LYS B N   1 
ATOM   4921  C CA  . LYS B 1 228 ? 120.98700 105.45100 73.00700  1.000 51.16720  ? 228 LYS B CA  1 
ATOM   4922  C C   . LYS B 1 228 ? 120.97000 105.39000 74.52700  1.000 51.16720  ? 228 LYS B C   1 
ATOM   4923  O O   . LYS B 1 228 ? 119.91700 105.31900 75.15600  1.000 51.16720  ? 228 LYS B O   1 
ATOM   4924  C CB  . LYS B 1 228 ? 119.60100 105.16300 72.43800  1.000 51.16720  ? 228 LYS B CB  1 
ATOM   4925  N N   . THR B 1 229 ? 122.15500 105.35500 75.11500  1.000 47.62922  ? 229 THR B N   1 
ATOM   4926  C CA  . THR B 1 229 ? 122.37000 105.33000 76.54900  1.000 47.62922  ? 229 THR B CA  1 
ATOM   4927  C C   . THR B 1 229 ? 122.92300 106.67800 76.99700  1.000 47.62922  ? 229 THR B C   1 
ATOM   4928  O O   . THR B 1 229 ? 123.01500 107.62400 76.21500  1.000 47.62922  ? 229 THR B O   1 
ATOM   4929  C CB  . THR B 1 229 ? 123.31200 104.18900 76.91900  1.000 47.62922  ? 229 THR B CB  1 
ATOM   4930  O OG1 . THR B 1 229 ? 124.56000 104.37500 76.25000  1.000 47.62922  ? 229 THR B OG1 1 
ATOM   4931  C CG2 . THR B 1 229 ? 122.72700 102.87500 76.48000  1.000 47.62922  ? 229 THR B CG2 1 
ATOM   4932  N N   . TRP B 1 230 ? 123.29300 106.76300 78.27600  1.000 41.41707  ? 230 TRP B N   1 
ATOM   4933  C CA  . TRP B 1 230 ? 123.74900 108.03600 78.82500  1.000 41.41707  ? 230 TRP B CA  1 
ATOM   4934  C C   . TRP B 1 230 ? 125.12200 108.41800 78.29300  1.000 41.41707  ? 230 TRP B C   1 
ATOM   4935  O O   . TRP B 1 230 ? 125.40700 109.60300 78.10000  1.000 41.41707  ? 230 TRP B O   1 
ATOM   4936  C CB  . TRP B 1 230 ? 123.76200 107.97800 80.35300  1.000 41.41707  ? 230 TRP B CB  1 
ATOM   4937  C CG  . TRP B 1 230 ? 124.69600 106.97400 80.93500  1.000 41.41707  ? 230 TRP B CG  1 
ATOM   4938  C CD1 . TRP B 1 230 ? 124.43600 105.66500 81.18000  1.000 41.41707  ? 230 TRP B CD1 1 
ATOM   4939  C CD2 . TRP B 1 230 ? 126.03900 107.20100 81.36000  1.000 41.41707  ? 230 TRP B CD2 1 
ATOM   4940  N NE1 . TRP B 1 230 ? 125.53400 105.05700 81.72400  1.000 41.41707  ? 230 TRP B NE1 1 
ATOM   4941  C CE2 . TRP B 1 230 ? 126.53400 105.98300 81.84400  1.000 41.41707  ? 230 TRP B CE2 1 
ATOM   4942  C CE3 . TRP B 1 230 ? 126.87300 108.31600 81.37200  1.000 41.41707  ? 230 TRP B CE3 1 
ATOM   4943  C CZ2 . TRP B 1 230 ? 127.82200 105.85000 82.33500  1.000 41.41707  ? 230 TRP B CZ2 1 
ATOM   4944  C CZ3 . TRP B 1 230 ? 128.15000 108.18000 81.85400  1.000 41.41707  ? 230 TRP B CZ3 1 
ATOM   4945  C CH2 . TRP B 1 230 ? 128.61300 106.96000 82.33100  1.000 41.41707  ? 230 TRP B CH2 1 
ATOM   4946  N N   . ILE B 1 231 ? 125.97800 107.43400 78.03300  1.000 45.80034  ? 231 ILE B N   1 
ATOM   4947  C CA  . ILE B 1 231 ? 127.33900 107.69700 77.58600  1.000 45.80034  ? 231 ILE B CA  1 
ATOM   4948  C C   . ILE B 1 231 ? 127.37100 107.58300 76.06900  1.000 45.80034  ? 231 ILE B C   1 
ATOM   4949  O O   . ILE B 1 231 ? 128.16900 108.24500 75.39700  1.000 45.80034  ? 231 ILE B O   1 
ATOM   4950  C CB  . ILE B 1 231 ? 128.33500 106.74500 78.28300  1.000 45.80034  ? 231 ILE B CB  1 
ATOM   4951  C CG1 . ILE B 1 231 ? 129.78000 107.00800 77.86100  1.000 45.80034  ? 231 ILE B CG1 1 
ATOM   4952  C CG2 . ILE B 1 231 ? 127.95600 105.29800 78.07600  1.000 45.80034  ? 231 ILE B CG2 1 
ATOM   4953  C CD1 . ILE B 1 231 ? 130.78600 106.19300 78.62400  1.000 45.80034  ? 231 ILE B CD1 1 
ATOM   4954  N N   . GLY B 1 232 ? 126.45500 106.79200 75.50900  1.000 49.59864  ? 232 GLY B N   1 
ATOM   4955  C CA  . GLY B 1 232 ? 126.42400 106.60000 74.07300  1.000 49.59864  ? 232 GLY B CA  1 
ATOM   4956  C C   . GLY B 1 232 ? 125.91000 107.79100 73.29800  1.000 49.59864  ? 232 GLY B C   1 
ATOM   4957  O O   . GLY B 1 232 ? 126.16400 107.88900 72.09600  1.000 49.59864  ? 232 GLY B O   1 
ATOM   4958  N N   . ALA B 1 233 ? 125.19800 108.69900 73.95500  1.000 52.08460  ? 233 ALA B N   1 
ATOM   4959  C CA  . ALA B 1 233 ? 124.65700 109.86300 73.27300  1.000 52.08460  ? 233 ALA B CA  1 
ATOM   4960  C C   . ALA B 1 233 ? 125.70500 110.92800 72.99200  1.000 52.08460  ? 233 ALA B C   1 
ATOM   4961  O O   . ALA B 1 233 ? 125.44400 111.82900 72.19100  1.000 52.08460  ? 233 ALA B O   1 
ATOM   4962  C CB  . ALA B 1 233 ? 123.52200 110.46800 74.09500  1.000 52.08460  ? 233 ALA B CB  1 
ATOM   4963  N N   . VAL B 1 234 ? 126.87400 110.85500 73.62400  1.000 52.12062  ? 234 VAL B N   1 
ATOM   4964  C CA  . VAL B 1 234 ? 127.92900 111.83500 73.39600  1.000 52.12062  ? 234 VAL B CA  1 
ATOM   4965  C C   . VAL B 1 234 ? 129.18700 111.14700 72.86900  1.000 52.12062  ? 234 VAL B C   1 
ATOM   4966  O O   . VAL B 1 234 ? 129.82600 111.63900 71.93300  1.000 52.12062  ? 234 VAL B O   1 
ATOM   4967  C CB  . VAL B 1 234 ? 128.17300 112.67300 74.67100  1.000 52.12062  ? 234 VAL B CB  1 
ATOM   4968  C CG1 . VAL B 1 234 ? 128.35000 111.80300 75.88600  1.000 52.12062  ? 234 VAL B CG1 1 
ATOM   4969  C CG2 . VAL B 1 234 ? 129.37400 113.58700 74.50900  1.000 52.12062  ? 234 VAL B CG2 1 
ATOM   4970  N N   . TYR B 1 235 ? 129.53200 109.98400 73.42200  1.000 52.86391  ? 235 TYR B N   1 
ATOM   4971  C CA  . TYR B 1 235 ? 130.61100 109.14400 72.90600  1.000 52.86391  ? 235 TYR B CA  1 
ATOM   4972  C C   . TYR B 1 235 ? 129.94300 107.92600 72.29000  1.000 52.86391  ? 235 TYR B C   1 
ATOM   4973  O O   . TYR B 1 235 ? 129.55000 107.00000 73.01200  1.000 52.86391  ? 235 TYR B O   1 
ATOM   4974  C CB  . TYR B 1 235 ? 131.58900 108.74700 74.00600  1.000 52.86391  ? 235 TYR B CB  1 
ATOM   4975  C CG  . TYR B 1 235 ? 132.27500 109.91600 74.66200  1.000 52.86391  ? 235 TYR B CG  1 
ATOM   4976  C CD1 . TYR B 1 235 ? 132.70700 111.00200 73.91400  1.000 52.86391  ? 235 TYR B CD1 1 
ATOM   4977  C CD2 . TYR B 1 235 ? 132.48100 109.93900 76.03200  1.000 52.86391  ? 235 TYR B CD2 1 
ATOM   4978  C CE1 . TYR B 1 235 ? 133.33300 112.07700 74.51500  1.000 52.86391  ? 235 TYR B CE1 1 
ATOM   4979  C CE2 . TYR B 1 235 ? 133.10300 111.00700 76.64100  1.000 52.86391  ? 235 TYR B CE2 1 
ATOM   4980  C CZ  . TYR B 1 235 ? 133.52600 112.07200 75.88100  1.000 52.86391  ? 235 TYR B CZ  1 
ATOM   4981  O OH  . TYR B 1 235 ? 134.14600 113.13400 76.49500  1.000 52.86391  ? 235 TYR B OH  1 
ATOM   4982  N N   . PRO B 1 236 ? 129.78400 107.88700 70.96500  1.000 52.68554  ? 236 PRO B N   1 
ATOM   4983  C CA  . PRO B 1 236 ? 128.89200 106.88400 70.36300  1.000 52.68554  ? 236 PRO B CA  1 
ATOM   4984  C C   . PRO B 1 236 ? 129.42500 105.46700 70.39300  1.000 52.68554  ? 236 PRO B C   1 
ATOM   4985  O O   . PRO B 1 236 ? 128.62900 104.52200 70.35900  1.000 52.68554  ? 236 PRO B O   1 
ATOM   4986  C CB  . PRO B 1 236 ? 128.73200 107.38700 68.92200  1.000 52.68554  ? 236 PRO B CB  1 
ATOM   4987  C CG  . PRO B 1 236 ? 129.16300 108.81000 68.95400  1.000 52.68554  ? 236 PRO B CG  1 
ATOM   4988  C CD  . PRO B 1 236 ? 130.23800 108.87100 69.97500  1.000 52.68554  ? 236 PRO B CD  1 
ATOM   4989  N N   . ASN B 1 237 ? 130.74000 105.27400 70.45000  1.000 56.96986  ? 237 ASN B N   1 
ATOM   4990  C CA  . ASN B 1 237 ? 131.29400 103.92600 70.45800  1.000 56.96986  ? 237 ASN B CA  1 
ATOM   4991  C C   . ASN B 1 237 ? 131.59200 103.42000 71.86700  1.000 56.96986  ? 237 ASN B C   1 
ATOM   4992  O O   . ASN B 1 237 ? 131.02000 102.41200 72.29200  1.000 56.96986  ? 237 ASN B O   1 
ATOM   4993  C CB  . ASN B 1 237 ? 132.54800 103.88500 69.57400  1.000 56.96986  ? 237 ASN B CB  1 
ATOM   4994  C CG  . ASN B 1 237 ? 133.40500 105.11900 69.72400  1.000 56.96986  ? 237 ASN B CG  1 
ATOM   4995  O OD1 . ASN B 1 237 ? 133.13800 105.97200 70.56800  1.000 56.96986  ? 237 ASN B OD1 1 
ATOM   4996  N ND2 . ASN B 1 237 ? 134.43800 105.22700 68.89900  1.000 56.96986  ? 237 ASN B ND2 1 
ATOM   4997  N N   . PHE B 1 238 ? 132.52800 104.06900 72.57200  1.000 55.37914  ? 238 PHE B N   1 
ATOM   4998  C CA  . PHE B 1 238 ? 132.92800 103.88300 73.97500  1.000 55.37914  ? 238 PHE B CA  1 
ATOM   4999  C C   . PHE B 1 238 ? 133.23300 102.44300 74.39900  1.000 55.37914  ? 238 PHE B C   1 
ATOM   5000  O O   . PHE B 1 238 ? 133.42500 102.18300 75.58900  1.000 55.37914  ? 238 PHE B O   1 
ATOM   5001  C CB  . PHE B 1 238 ? 131.90300 104.54000 74.93900  1.000 55.37914  ? 238 PHE B CB  1 
ATOM   5002  C CG  . PHE B 1 238 ? 130.58600 103.79500 75.13600  1.000 55.37914  ? 238 PHE B CG  1 
ATOM   5003  C CD1 . PHE B 1 238 ? 130.43400 102.84300 76.13700  1.000 55.37914  ? 238 PHE B CD1 1 
ATOM   5004  C CD2 . PHE B 1 238 ? 129.46600 104.15000 74.41000  1.000 55.37914  ? 238 PHE B CD2 1 
ATOM   5005  C CE1 . PHE B 1 238 ? 129.23600 102.19600 76.32900  1.000 55.37914  ? 238 PHE B CE1 1 
ATOM   5006  C CE2 . PHE B 1 238 ? 128.26100 103.50700 74.60500  1.000 55.37914  ? 238 PHE B CE2 1 
ATOM   5007  C CZ  . PHE B 1 238 ? 128.15000 102.53300 75.56800  1.000 55.37914  ? 238 PHE B CZ  1 
ATOM   5008  N N   . LYS B 1 239 ? 133.36000 101.51900 73.45300  1.000 61.25744  ? 239 LYS B N   1 
ATOM   5009  C CA  . LYS B 1 239 ? 133.52700 100.10200 73.73400  1.000 61.25744  ? 239 LYS B CA  1 
ATOM   5010  C C   . LYS B 1 239 ? 134.64800 99.56500  72.86400  1.000 61.25744  ? 239 LYS B C   1 
ATOM   5011  O O   . LYS B 1 239 ? 134.73400 99.90200  71.67700  1.000 61.25744  ? 239 LYS B O   1 
ATOM   5012  C CB  . LYS B 1 239 ? 132.24500 99.31400  73.46800  1.000 61.25744  ? 239 LYS B CB  1 
ATOM   5013  C CG  . LYS B 1 239 ? 131.08300 99.69200  74.34900  1.000 61.25744  ? 239 LYS B CG  1 
ATOM   5014  C CD  . LYS B 1 239 ? 129.76800 99.27100  73.73300  1.000 61.25744  ? 239 LYS B CD  1 
ATOM   5015  C CE  . LYS B 1 239 ? 129.50700 97.80200  73.95100  1.000 61.25744  ? 239 LYS B CE  1 
ATOM   5016  N NZ  . LYS B 1 239 ? 128.05000 97.52900  74.04000  1.000 61.25744  ? 239 LYS B NZ  1 
ATOM   5017  N N   . GLU B 1 240 ? 135.51700 98.75300  73.48200  1.000 69.65343  ? 240 GLU B N   1 
ATOM   5018  C CA  . GLU B 1 240 ? 136.77700 98.26900  72.89500  1.000 69.65343  ? 240 GLU B CA  1 
ATOM   5019  C C   . GLU B 1 240 ? 137.66100 99.42700  72.43600  1.000 69.65343  ? 240 GLU B C   1 
ATOM   5020  O O   . GLU B 1 240 ? 138.45400 99.29400  71.49900  1.000 69.65343  ? 240 GLU B O   1 
ATOM   5021  C CB  . GLU B 1 240 ? 136.53500 97.27600  71.75000  1.000 69.65343  ? 240 GLU B CB  1 
ATOM   5022  N N   . ALA B 1 241 ? 137.53900 100.56000 73.12100  1.000 67.61167  ? 241 ALA B N   1 
ATOM   5023  C CA  . ALA B 1 241 ? 138.22100 101.79100 72.77900  1.000 67.61167  ? 241 ALA B CA  1 
ATOM   5024  C C   . ALA B 1 241 ? 138.16300 102.70300 73.99500  1.000 67.61167  ? 241 ALA B C   1 
ATOM   5025  O O   . ALA B 1 241 ? 137.66200 102.31700 75.05500  1.000 67.61167  ? 241 ALA B O   1 
ATOM   5026  C CB  . ALA B 1 241 ? 137.58800 102.44800 71.54600  1.000 67.61167  ? 241 ALA B CB  1 
ATOM   5027  N N   . SER B 1 242 ? 138.65900 103.92900 73.81800  1.000 67.34813  ? 242 SER B N   1 
ATOM   5028  C CA  . SER B 1 242 ? 138.59400 105.03000 74.79100  1.000 67.34813  ? 242 SER B CA  1 
ATOM   5029  C C   . SER B 1 242 ? 139.20200 104.67300 76.14800  1.000 67.34813  ? 242 SER B C   1 
ATOM   5030  O O   . SER B 1 242 ? 138.77700 105.21100 77.17300  1.000 67.34813  ? 242 SER B O   1 
ATOM   5031  C CB  . SER B 1 242 ? 137.16400 105.56300 74.97100  1.000 67.34813  ? 242 SER B CB  1 
ATOM   5032  O OG  . SER B 1 242 ? 136.21100 104.56800 75.29900  1.000 67.34813  ? 242 SER B OG  1 
ATOM   5033  N N   . LEU B 1 243 ? 140.20400 103.78200 76.14400  1.000 63.13043  ? 243 LEU B N   1 
ATOM   5034  C CA  . LEU B 1 243 ? 141.12000 103.54700 77.26800  1.000 63.13043  ? 243 LEU B CA  1 
ATOM   5035  C C   . LEU B 1 243 ? 140.37400 103.07500 78.52200  1.000 63.13043  ? 243 LEU B C   1 
ATOM   5036  O O   . LEU B 1 243 ? 140.15100 103.82800 79.46900  1.000 63.13043  ? 243 LEU B O   1 
ATOM   5037  C CB  . LEU B 1 243 ? 141.97300 104.79600 77.53800  1.000 63.13043  ? 243 LEU B CB  1 
ATOM   5038  C CG  . LEU B 1 243 ? 143.10500 104.76700 78.57300  1.000 63.13043  ? 243 LEU B CG  1 
ATOM   5039  C CD1 . LEU B 1 243 ? 143.92200 103.49300 78.42500  1.000 63.13043  ? 243 LEU B CD1 1 
ATOM   5040  C CD2 . LEU B 1 243 ? 143.99300 106.00100 78.45600  1.000 63.13043  ? 243 LEU B CD2 1 
ATOM   5041  N N   . TRP B 1 244 ? 139.91000 101.82300 78.46300  1.000 64.85323  ? 244 TRP B N   1 
ATOM   5042  C CA  . TRP B 1 244 ? 139.14100 101.14200 79.51000  1.000 64.85323  ? 244 TRP B CA  1 
ATOM   5043  C C   . TRP B 1 244 ? 139.66000 101.25500 80.94300  1.000 64.85323  ? 244 TRP B C   1 
ATOM   5044  O O   . TRP B 1 244 ? 138.88500 101.11200 81.89100  1.000 64.85323  ? 244 TRP B O   1 
ATOM   5045  C CB  . TRP B 1 244 ? 139.02900 99.65900  79.16500  1.000 64.85323  ? 244 TRP B CB  1 
ATOM   5046  C CG  . TRP B 1 244 ? 137.75100 99.27500  78.50500  1.000 64.85323  ? 244 TRP B CG  1 
ATOM   5047  C CD1 . TRP B 1 244 ? 136.56700 99.95100  78.54400  1.000 64.85323  ? 244 TRP B CD1 1 
ATOM   5048  C CD2 . TRP B 1 244 ? 137.53000 98.11900  77.69400  1.000 64.85323  ? 244 TRP B CD2 1 
ATOM   5049  N NE1 . TRP B 1 244 ? 135.61800 99.27800  77.81600  1.000 64.85323  ? 244 TRP B NE1 1 
ATOM   5050  C CE2 . TRP B 1 244 ? 136.18600 98.15100  77.28000  1.000 64.85323  ? 244 TRP B CE2 1 
ATOM   5051  C CE3 . TRP B 1 244 ? 138.34100 97.05700  77.27800  1.000 64.85323  ? 244 TRP B CE3 1 
ATOM   5052  C CZ2 . TRP B 1 244 ? 135.63300 97.16100  76.46800  1.000 64.85323  ? 244 TRP B CZ2 1 
ATOM   5053  C CZ3 . TRP B 1 244 ? 137.79100 96.07700  76.47500  1.000 64.85323  ? 244 TRP B CZ3 1 
ATOM   5054  C CH2 . TRP B 1 244 ? 136.45100 96.13600  76.07800  1.000 64.85323  ? 244 TRP B CH2 1 
ATOM   5055  N N   . ASN B 1 245 ? 140.95500 101.50500 81.12700  1.000 62.33254  ? 245 ASN B N   1 
ATOM   5056  C CA  . ASN B 1 245 ? 141.49100 101.69800 82.46800  1.000 62.33254  ? 245 ASN B CA  1 
ATOM   5057  C C   . ASN B 1 245 ? 141.21600 103.12700 82.92900  1.000 62.33254  ? 245 ASN B C   1 
ATOM   5058  O O   . ASN B 1 245 ? 141.45500 103.46800 84.09000  1.000 62.33254  ? 245 ASN B O   1 
ATOM   5059  C CB  . ASN B 1 245 ? 142.99400 101.38500 82.50200  1.000 62.33254  ? 245 ASN B CB  1 
ATOM   5060  C CG  . ASN B 1 245 ? 143.51400 101.09500 83.91100  1.000 62.33254  ? 245 ASN B CG  1 
ATOM   5061  O OD1 . ASN B 1 245 ? 142.75600 101.07000 84.88200  1.000 62.33254  ? 245 ASN B OD1 1 
ATOM   5062  N ND2 . ASN B 1 245 ? 144.82000 100.87400 84.02100  1.000 62.33254  ? 245 ASN B ND2 1 
ATOM   5063  N N   . ARG B 1 246 ? 140.70800 103.97300 82.03700  1.000 52.06417  ? 246 ARG B N   1 
ATOM   5064  C CA  . ARG B 1 246 ? 140.25800 105.30700 82.41300  1.000 52.06417  ? 246 ARG B CA  1 
ATOM   5065  C C   . ARG B 1 246 ? 138.74100 105.32800 82.28400  1.000 52.06417  ? 246 ARG B C   1 
ATOM   5066  O O   . ARG B 1 246 ? 138.18200 105.67900 81.24200  1.000 52.06417  ? 246 ARG B O   1 
ATOM   5067  C CB  . ARG B 1 246 ? 140.91900 106.37100 81.58500  1.000 52.06417  ? 246 ARG B CB  1 
ATOM   5068  C CG  . ARG B 1 246 ? 142.41400 106.50400 81.84900  1.000 52.06417  ? 246 ARG B CG  1 
ATOM   5069  C CD  . ARG B 1 246 ? 142.74900 106.44000 83.33100  1.000 52.06417  ? 246 ARG B CD  1 
ATOM   5070  N NE  . ARG B 1 246 ? 142.65000 107.73500 83.98700  1.000 52.06417  ? 246 ARG B NE  1 
ATOM   5071  C CZ  . ARG B 1 246 ? 142.56200 107.89500 85.30200  1.000 52.06417  ? 246 ARG B CZ  1 
ATOM   5072  N NH1 . ARG B 1 246 ? 142.55300 106.84200 86.10500  1.000 52.06417  ? 246 ARG B NH1 1 
ATOM   5073  N NH2 . ARG B 1 246 ? 142.47700 109.10900 85.81500  1.000 52.06417  ? 246 ARG B NH2 1 
ATOM   5074  N N   . TYR B 1 247 ? 138.08400 104.94100 83.37900  1.000 43.33012  ? 247 TYR B N   1 
ATOM   5075  C CA  . TYR B 1 247 ? 136.63900 104.96700 83.56100  1.000 43.33012  ? 247 TYR B CA  1 
ATOM   5076  C C   . TYR B 1 247 ? 136.17500 106.24100 84.24800  1.000 43.33012  ? 247 TYR B C   1 
ATOM   5077  O O   . TYR B 1 247 ? 135.12900 106.24100 84.90200  1.000 43.33012  ? 247 TYR B O   1 
ATOM   5078  C CB  . TYR B 1 247 ? 136.19500 103.73200 84.35000  1.000 43.33012  ? 247 TYR B CB  1 
ATOM   5079  C CG  . TYR B 1 247 ? 136.51000 103.72200 85.83400  1.000 43.33012  ? 247 TYR B CG  1 
ATOM   5080  C CD1 . TYR B 1 247 ? 137.81500 103.69000 86.29900  1.000 43.33012  ? 247 TYR B CD1 1 
ATOM   5081  C CD2 . TYR B 1 247 ? 135.49000 103.66600 86.76600  1.000 43.33012  ? 247 TYR B CD2 1 
ATOM   5082  C CE1 . TYR B 1 247 ? 138.08800 103.66800 87.64500  1.000 43.33012  ? 247 TYR B CE1 1 
ATOM   5083  C CE2 . TYR B 1 247 ? 135.76000 103.62200 88.10900  1.000 43.33012  ? 247 TYR B CE2 1 
ATOM   5084  C CZ  . TYR B 1 247 ? 137.05400 103.63400 88.54000  1.000 43.33012  ? 247 TYR B CZ  1 
ATOM   5085  O OH  . TYR B 1 247 ? 137.31100 103.60100 89.88200  1.000 43.33012  ? 247 TYR B OH  1 
ATOM   5086  N N   . VAL B 1 248 ? 136.92300 107.33300 84.07200  1.000 38.10804  ? 248 VAL B N   1 
ATOM   5087  C CA  . VAL B 1 248 ? 136.65500 108.61600 84.71200  1.000 38.10804  ? 248 VAL B CA  1 
ATOM   5088  C C   . VAL B 1 248 ? 135.31600 109.18900 84.28000  1.000 38.10804  ? 248 VAL B C   1 
ATOM   5089  O O   . VAL B 1 248 ? 134.69900 109.96400 85.01600  1.000 38.10804  ? 248 VAL B O   1 
ATOM   5090  C CB  . VAL B 1 248 ? 137.81200 109.58000 84.39100  1.000 38.10804  ? 248 VAL B CB  1 
ATOM   5091  C CG1 . VAL B 1 248 ? 137.82400 110.74600 85.33000  1.000 38.10804  ? 248 VAL B CG1 1 
ATOM   5092  C CG2 . VAL B 1 248 ? 139.11700 108.85000 84.47200  1.000 38.10804  ? 248 VAL B CG2 1 
ATOM   5093  N N   . THR B 1 249 ? 134.84300 108.81500 83.09100  1.000 37.59026  ? 249 THR B N   1 
ATOM   5094  C CA  . THR B 1 249 ? 133.54300 109.26800 82.61100  1.000 37.59026  ? 249 THR B CA  1 
ATOM   5095  C C   . THR B 1 249 ? 132.41400 108.72200 83.47600  1.000 37.59026  ? 249 THR B C   1 
ATOM   5096  O O   . THR B 1 249 ? 131.42400 109.41600 83.72400  1.000 37.59026  ? 249 THR B O   1 
ATOM   5097  C CB  . THR B 1 249 ? 133.36500 108.84100 81.15600  1.000 37.59026  ? 249 THR B CB  1 
ATOM   5098  O OG1 . THR B 1 249 ? 134.49300 109.27900 80.39500  1.000 37.59026  ? 249 THR B OG1 1 
ATOM   5099  C CG2 . THR B 1 249 ? 132.13100 109.46200 80.56100  1.000 37.59026  ? 249 THR B CG2 1 
ATOM   5100  N N   . ALA B 1 250 ? 132.56000 107.49300 83.97400  1.000 35.01839  ? 250 ALA B N   1 
ATOM   5101  C CA  . ALA B 1 250 ? 131.50700 106.90300 84.79000  1.000 35.01839  ? 250 ALA B CA  1 
ATOM   5102  C C   . ALA B 1 250 ? 131.50300 107.46900 86.20100  1.000 35.01839  ? 250 ALA B C   1 
ATOM   5103  O O   . ALA B 1 250 ? 130.45200 107.50900 86.84200  1.000 35.01839  ? 250 ALA B O   1 
ATOM   5104  C CB  . ALA B 1 250 ? 131.66100 105.39000 84.82800  1.000 35.01839  ? 250 ALA B CB  1 
ATOM   5105  N N   . LEU B 1 251 ? 132.65800 107.89700 86.70400  1.000 32.54341  ? 251 LEU B N   1 
ATOM   5106  C CA  . LEU B 1 251 ? 132.70000 108.60400 87.97900  1.000 32.54341  ? 251 LEU B CA  1 
ATOM   5107  C C   . LEU B 1 251 ? 132.31600 110.06500 87.84200  1.000 32.54341  ? 251 LEU B C   1 
ATOM   5108  O O   . LEU B 1 251 ? 131.79700 110.65100 88.79400  1.000 32.54341  ? 251 LEU B O   1 
ATOM   5109  C CB  . LEU B 1 251 ? 134.08100 108.48300 88.61400  1.000 32.54341  ? 251 LEU B CB  1 
ATOM   5110  C CG  . LEU B 1 251 ? 134.20400 107.52500 89.78900  1.000 32.54341  ? 251 LEU B CG  1 
ATOM   5111  C CD1 . LEU B 1 251 ? 133.72400 106.16300 89.43900  1.000 32.54341  ? 251 LEU B CD1 1 
ATOM   5112  C CD2 . LEU B 1 251 ? 135.64500 107.46200 90.19900  1.000 32.54341  ? 251 LEU B CD2 1 
ATOM   5113  N N   . TYR B 1 252 ? 132.56800 110.67500 86.68400  1.000 33.30394  ? 252 TYR B N   1 
ATOM   5114  C CA  . TYR B 1 252 ? 132.15800 112.05800 86.47900  1.000 33.30394  ? 252 TYR B CA  1 
ATOM   5115  C C   . TYR B 1 252 ? 130.64500 112.17400 86.42700  1.000 33.30394  ? 252 TYR B C   1 
ATOM   5116  O O   . TYR B 1 252 ? 130.08200 113.19400 86.83200  1.000 33.30394  ? 252 TYR B O   1 
ATOM   5117  C CB  . TYR B 1 252 ? 132.78500 112.60000 85.20100  1.000 33.30394  ? 252 TYR B CB  1 
ATOM   5118  C CG  . TYR B 1 252 ? 132.32900 113.97400 84.79200  1.000 33.30394  ? 252 TYR B CG  1 
ATOM   5119  C CD1 . TYR B 1 252 ? 132.80800 115.09800 85.43500  1.000 33.30394  ? 252 TYR B CD1 1 
ATOM   5120  C CD2 . TYR B 1 252 ? 131.43900 114.14800 83.74100  1.000 33.30394  ? 252 TYR B CD2 1 
ATOM   5121  C CE1 . TYR B 1 252 ? 132.40600 116.34900 85.05700  1.000 33.30394  ? 252 TYR B CE1 1 
ATOM   5122  C CE2 . TYR B 1 252 ? 131.02900 115.39800 83.36100  1.000 33.30394  ? 252 TYR B CE2 1 
ATOM   5123  C CZ  . TYR B 1 252 ? 131.51800 116.49100 84.02100  1.000 33.30394  ? 252 TYR B CZ  1 
ATOM   5124  O OH  . TYR B 1 252 ? 131.11800 117.74200 83.64300  1.000 33.30394  ? 252 TYR B OH  1 
ATOM   5125  N N   . TRP B 1 253 ? 129.96600 111.13700 85.93900  1.000 32.09176  ? 253 TRP B N   1 
ATOM   5126  C CA  . TRP B 1 253 ? 128.51200 111.13800 85.99600  1.000 32.09176  ? 253 TRP B CA  1 
ATOM   5127  C C   . TRP B 1 253 ? 128.01800 110.98900 87.42700  1.000 32.09176  ? 253 TRP B C   1 
ATOM   5128  O O   . TRP B 1 253 ? 127.04400 111.63700 87.81400  1.000 32.09176  ? 253 TRP B O   1 
ATOM   5129  C CB  . TRP B 1 253 ? 127.93800 110.02800 85.12400  1.000 32.09176  ? 253 TRP B CB  1 
ATOM   5130  C CG  . TRP B 1 253 ? 126.45600 109.92900 85.24400  1.000 32.09176  ? 253 TRP B CG  1 
ATOM   5131  C CD1 . TRP B 1 253 ? 125.53300 110.66000 84.56900  1.000 32.09176  ? 253 TRP B CD1 1 
ATOM   5132  C CD2 . TRP B 1 253 ? 125.72200 109.05900 86.11000  1.000 32.09176  ? 253 TRP B CD2 1 
ATOM   5133  N NE1 . TRP B 1 253 ? 124.26800 110.29900 84.95100  1.000 32.09176  ? 253 TRP B NE1 1 
ATOM   5134  C CE2 . TRP B 1 253 ? 124.35900 109.32000 85.90400  1.000 32.09176  ? 253 TRP B CE2 1 
ATOM   5135  C CE3 . TRP B 1 253 ? 126.08800 108.09300 87.04900  1.000 32.09176  ? 253 TRP B CE3 1 
ATOM   5136  C CZ2 . TRP B 1 253 ? 123.36100 108.64600 86.59600  1.000 32.09176  ? 253 TRP B CZ2 1 
ATOM   5137  C CZ3 . TRP B 1 253 ? 125.09600 107.42800 87.73500  1.000 32.09176  ? 253 TRP B CZ3 1 
ATOM   5138  C CH2 . TRP B 1 253 ? 123.75100 107.70700 87.50800  1.000 32.09176  ? 253 TRP B CH2 1 
ATOM   5139  N N   . SER B 1 254 ? 128.66700 110.14400 88.22900  1.000 29.09387  ? 254 SER B N   1 
ATOM   5140  C CA  . SER B 1 254 ? 128.14900 109.85100 89.56200  1.000 29.09387  ? 254 SER B CA  1 
ATOM   5141  C C   . SER B 1 254 ? 128.38100 111.00300 90.52400  1.000 29.09387  ? 254 SER B C   1 
ATOM   5142  O O   . SER B 1 254 ? 127.54000 111.27600 91.38100  1.000 29.09387  ? 254 SER B O   1 
ATOM   5143  C CB  . SER B 1 254 ? 128.77600 108.58000 90.10600  1.000 29.09387  ? 254 SER B CB  1 
ATOM   5144  O OG  . SER B 1 254 ? 128.05700 107.45800 89.65400  1.000 29.09387  ? 254 SER B OG  1 
ATOM   5145  N N   . ILE B 1 255 ? 129.51700 111.69000 90.40700  1.000 28.47056  ? 255 ILE B N   1 
ATOM   5146  C CA  . ILE B 1 255 ? 129.76200 112.84200 91.26100  1.000 28.47056  ? 255 ILE B CA  1 
ATOM   5147  C C   . ILE B 1 255 ? 128.87600 114.02200 90.86700  1.000 28.47056  ? 255 ILE B C   1 
ATOM   5148  O O   . ILE B 1 255 ? 128.58900 114.88200 91.69900  1.000 28.47056  ? 255 ILE B O   1 
ATOM   5149  C CB  . ILE B 1 255 ? 131.27000 113.17700 91.23600  1.000 28.47056  ? 255 ILE B CB  1 
ATOM   5150  C CG1 . ILE B 1 255 ? 131.65700 114.18400 92.31100  1.000 28.47056  ? 255 ILE B CG1 1 
ATOM   5151  C CG2 . ILE B 1 255 ? 131.68200 113.74900 89.91700  1.000 28.47056  ? 255 ILE B CG2 1 
ATOM   5152  C CD1 . ILE B 1 255 ? 131.49500 113.70500 93.69300  1.000 28.47056  ? 255 ILE B CD1 1 
ATOM   5153  N N   . THR B 1 256 ? 128.37300 114.05800 89.63400  1.000 30.23565  ? 256 THR B N   1 
ATOM   5154  C CA  . THR B 1 256 ? 127.54600 115.17700 89.19900  1.000 30.23565  ? 256 THR B CA  1 
ATOM   5155  C C   . THR B 1 256 ? 126.12600 115.08800 89.74000  1.000 30.23565  ? 256 THR B C   1 
ATOM   5156  O O   . THR B 1 256 ? 125.49200 116.12000 89.97400  1.000 30.23565  ? 256 THR B O   1 
ATOM   5157  C CB  . THR B 1 256 ? 127.53600 115.24000 87.67500  1.000 30.23565  ? 256 THR B CB  1 
ATOM   5158  O OG1 . THR B 1 256 ? 128.87000 115.07200 87.19800  1.000 30.23565  ? 256 THR B OG1 1 
ATOM   5159  C CG2 . THR B 1 256 ? 127.04700 116.57000 87.19400  1.000 30.23565  ? 256 THR B CG2 1 
ATOM   5160  N N   . THR B 1 257 ? 125.61300 113.88500 89.96900  1.000 28.90490  ? 257 THR B N   1 
ATOM   5161  C CA  . THR B 1 257 ? 124.27600 113.74200 90.52200  1.000 28.90490  ? 257 THR B CA  1 
ATOM   5162  C C   . THR B 1 257 ? 124.26500 113.55200 92.02900  1.000 28.90490  ? 257 THR B C   1 
ATOM   5163  O O   . THR B 1 257 ? 123.26600 113.89200 92.66700  1.000 28.90490  ? 257 THR B O   1 
ATOM   5164  C CB  . THR B 1 257 ? 123.55200 112.56100 89.88200  1.000 28.90490  ? 257 THR B CB  1 
ATOM   5165  O OG1 . THR B 1 257 ? 123.91200 111.36800 90.57300  1.000 28.90490  ? 257 THR B OG1 1 
ATOM   5166  C CG2 . THR B 1 257 ? 123.96300 112.41900 88.45800  1.000 28.90490  ? 257 THR B CG2 1 
ATOM   5167  N N   . LEU B 1 258 ? 125.33600 113.01200 92.60900  1.000 28.59845  ? 258 LEU B N   1 
ATOM   5168  C CA  . LEU B 1 258 ? 125.39500 112.83400 94.05400  1.000 28.59845  ? 258 LEU B CA  1 
ATOM   5169  C C   . LEU B 1 258 ? 125.56500 114.16400 94.76600  1.000 28.59845  ? 258 LEU B C   1 
ATOM   5170  O O   . LEU B 1 258 ? 125.00500 114.36700 95.84700  1.000 28.59845  ? 258 LEU B O   1 
ATOM   5171  C CB  . LEU B 1 258 ? 126.52500 111.87300 94.41400  1.000 28.59845  ? 258 LEU B CB  1 
ATOM   5172  C CG  . LEU B 1 258 ? 126.73200 111.35900 95.83400  1.000 28.59845  ? 258 LEU B CG  1 
ATOM   5173  C CD1 . LEU B 1 258 ? 127.18000 109.92800 95.74100  1.000 28.59845  ? 258 LEU B CD1 1 
ATOM   5174  C CD2 . LEU B 1 258 ? 127.79100 112.15600 96.55500  1.000 28.59845  ? 258 LEU B CD2 1 
ATOM   5175  N N   . THR B 1 259 ? 126.33100 115.07900 94.18100  1.000 27.04337  ? 259 THR B N   1 
ATOM   5176  C CA  . THR B 1 259 ? 126.41200 116.43200 94.70400  1.000 27.04337  ? 259 THR B CA  1 
ATOM   5177  C C   . THR B 1 259 ? 125.28300 117.30800 94.21800  1.000 27.04337  ? 259 THR B C   1 
ATOM   5178  O O   . THR B 1 259 ? 125.24100 118.47800 94.60500  1.000 27.04337  ? 259 THR B O   1 
ATOM   5179  C CB  . THR B 1 259 ? 127.73400 117.07000 94.31700  1.000 27.04337  ? 259 THR B CB  1 
ATOM   5180  O OG1 . THR B 1 259 ? 127.75600 117.27800 92.90500  1.000 27.04337  ? 259 THR B OG1 1 
ATOM   5181  C CG2 . THR B 1 259 ? 128.86500 116.17100 94.69400  1.000 27.04337  ? 259 THR B CG2 1 
ATOM   5182  N N   . THR B 1 260 ? 124.38400 116.75600 93.39900  1.000 27.39538  ? 260 THR B N   1 
ATOM   5183  C CA  . THR B 1 260 ? 123.23600 117.44400 92.79700  1.000 27.39538  ? 260 THR B CA  1 
ATOM   5184  C C   . THR B 1 260 ? 123.65100 118.69200 92.03300  1.000 27.39538  ? 260 THR B C   1 
ATOM   5185  O O   . THR B 1 260 ? 122.96600 119.71400 92.07900  1.000 27.39538  ? 260 THR B O   1 
ATOM   5186  C CB  . THR B 1 260 ? 122.15700 117.79300 93.82600  1.000 27.39538  ? 260 THR B CB  1 
ATOM   5187  O OG1 . THR B 1 260 ? 122.64400 118.79000 94.72900  1.000 27.39538  ? 260 THR B OG1 1 
ATOM   5188  C CG2 . THR B 1 260 ? 121.75400 116.56600 94.61100  1.000 27.39538  ? 260 THR B CG2 1 
ATOM   5189  N N   . THR B 1 261 ? 124.77800 118.63300 91.32700  1.000 27.17121  ? 261 THR B N   1 
ATOM   5190  C CA  . THR B 1 261 ? 125.11100 119.74900 90.44900  1.000 27.17121  ? 261 THR B CA  1 
ATOM   5191  C C   . THR B 1 261 ? 124.26300 119.66500 89.19100  1.000 27.17121  ? 261 THR B C   1 
ATOM   5192  O O   . THR B 1 261 ? 123.36400 120.48200 88.97600  1.000 27.17121  ? 261 THR B O   1 
ATOM   5193  C CB  . THR B 1 261 ? 126.59700 119.73200 90.09500  1.000 27.17121  ? 261 THR B CB  1 
ATOM   5194  O OG1 . THR B 1 261 ? 127.36900 119.52500 91.27700  1.000 27.17121  ? 261 THR B OG1 1 
ATOM   5195  C CG2 . THR B 1 261 ? 126.99400 121.03600 89.47700  1.000 27.17121  ? 261 THR B CG2 1 
ATOM   5196  N N   . GLY B 1 262 ? 124.52600 118.66900 88.35800  1.000 30.97766  ? 262 GLY B N   1 
ATOM   5197  C CA  . GLY B 1 262 ? 123.63300 118.34200 87.27400  1.000 30.97766  ? 262 GLY B CA  1 
ATOM   5198  C C   . GLY B 1 262 ? 123.97300 119.20500 86.08600  1.000 30.97766  ? 262 GLY B C   1 
ATOM   5199  O O   . GLY B 1 262 ? 123.55300 120.36300 86.04100  1.000 30.97766  ? 262 GLY B O   1 
ATOM   5200  N N   . TYR B 1 263 ? 124.69300 118.67800 85.10600  1.000 34.43138  ? 263 TYR B N   1 
ATOM   5201  C CA  . TYR B 1 263 ? 124.96600 119.49800 83.93700  1.000 34.43138  ? 263 TYR B CA  1 
ATOM   5202  C C   . TYR B 1 263 ? 124.00600 119.19500 82.80500  1.000 34.43138  ? 263 TYR B C   1 
ATOM   5203  O O   . TYR B 1 263 ? 123.64400 120.09400 82.04300  1.000 34.43138  ? 263 TYR B O   1 
ATOM   5204  C CB  . TYR B 1 263 ? 126.39700 119.29700 83.45700  1.000 34.43138  ? 263 TYR B CB  1 
ATOM   5205  C CG  . TYR B 1 263 ? 127.45000 119.82600 84.38600  1.000 34.43138  ? 263 TYR B CG  1 
ATOM   5206  C CD1 . TYR B 1 263 ? 127.52600 121.17300 84.69600  1.000 34.43138  ? 263 TYR B CD1 1 
ATOM   5207  C CD2 . TYR B 1 263 ? 128.39300 118.98000 84.92000  1.000 34.43138  ? 263 TYR B CD2 1 
ATOM   5208  C CE1 . TYR B 1 263 ? 128.50500 121.64600 85.53900  1.000 34.43138  ? 263 TYR B CE1 1 
ATOM   5209  C CE2 . TYR B 1 263 ? 129.36300 119.43900 85.75500  1.000 34.43138  ? 263 TYR B CE2 1 
ATOM   5210  C CZ  . TYR B 1 263 ? 129.41900 120.76500 86.05800  1.000 34.43138  ? 263 TYR B CZ  1 
ATOM   5211  O OH  . TYR B 1 263 ? 130.41000 121.18400 86.89500  1.000 34.43138  ? 263 TYR B OH  1 
ATOM   5212  N N   . GLY B 1 264 ? 123.58500 117.94600 82.68200  1.000 38.18000  ? 264 GLY B N   1 
ATOM   5213  C CA  . GLY B 1 264 ? 122.67500 117.55400 81.63500  1.000 38.18000  ? 264 GLY B CA  1 
ATOM   5214  C C   . GLY B 1 264 ? 123.34700 117.06600 80.38000  1.000 38.18000  ? 264 GLY B C   1 
ATOM   5215  O O   . GLY B 1 264 ? 122.64800 116.74200 79.41500  1.000 38.18000  ? 264 GLY B O   1 
ATOM   5216  N N   . ASP B 1 265 ? 124.67700 117.02100 80.35400  1.000 39.76302  ? 265 ASP B N   1 
ATOM   5217  C CA  . ASP B 1 265 ? 125.37300 116.43100 79.21900  1.000 39.76302  ? 265 ASP B CA  1 
ATOM   5218  C C   . ASP B 1 265 ? 125.31700 114.90900 79.27300  1.000 39.76302  ? 265 ASP B C   1 
ATOM   5219  O O   . ASP B 1 265 ? 125.21700 114.24400 78.23600  1.000 39.76302  ? 265 ASP B O   1 
ATOM   5220  C CB  . ASP B 1 265 ? 126.80700 116.95400 79.16500  1.000 39.76302  ? 265 ASP B CB  1 
ATOM   5221  C CG  . ASP B 1 265 ? 127.50900 116.87000 80.49700  1.000 39.76302  ? 265 ASP B CG  1 
ATOM   5222  O OD1 . ASP B 1 265 ? 126.87100 116.45800 81.48200  1.000 39.76302  ? 265 ASP B OD1 1 
ATOM   5223  O OD2 . ASP B 1 265 ? 128.69700 117.24000 80.56600  1.000 39.76302  ? 265 ASP B OD2 1 
ATOM   5224  N N   . PHE B 1 266 ? 125.36600 114.34100 80.47400  1.000 38.99939  ? 266 PHE B N   1 
ATOM   5225  C CA  . PHE B 1 266 ? 125.06800 112.93000 80.69600  1.000 38.99939  ? 266 PHE B CA  1 
ATOM   5226  C C   . PHE B 1 266 ? 123.75300 112.84300 81.45800  1.000 38.99939  ? 266 PHE B C   1 
ATOM   5227  O O   . PHE B 1 266 ? 123.68700 113.22400 82.62900  1.000 38.99939  ? 266 PHE B O   1 
ATOM   5228  C CB  . PHE B 1 266 ? 126.17400 112.23700 81.48500  1.000 38.99939  ? 266 PHE B CB  1 
ATOM   5229  C CG  . PHE B 1 266 ? 127.51800 112.26800 80.83200  1.000 38.99939  ? 266 PHE B CG  1 
ATOM   5230  C CD1 . PHE B 1 266 ? 127.87600 111.31100 79.90700  1.000 38.99939  ? 266 PHE B CD1 1 
ATOM   5231  C CD2 . PHE B 1 266 ? 128.43900 113.23100 81.17600  1.000 38.99939  ? 266 PHE B CD2 1 
ATOM   5232  C CE1 . PHE B 1 266 ? 129.12000 111.32700 79.32900  1.000 38.99939  ? 266 PHE B CE1 1 
ATOM   5233  C CE2 . PHE B 1 266 ? 129.68400 113.25300 80.59100  1.000 38.99939  ? 266 PHE B CE2 1 
ATOM   5234  C CZ  . PHE B 1 266 ? 130.01900 112.30100 79.66500  1.000 38.99939  ? 266 PHE B CZ  1 
ATOM   5235  N N   . HIS B 1 267 ? 122.70800 112.34200 80.80700  1.000 40.16216  ? 267 HIS B N   1 
ATOM   5236  C CA  . HIS B 1 267 ? 121.43700 112.11600 81.47600  1.000 40.16216  ? 267 HIS B CA  1 
ATOM   5237  C C   . HIS B 1 267 ? 120.83300 110.82100 80.95600  1.000 40.16216  ? 267 HIS B C   1 
ATOM   5238  O O   . HIS B 1 267 ? 121.35300 110.19900 80.02900  1.000 40.16216  ? 267 HIS B O   1 
ATOM   5239  C CB  . HIS B 1 267 ? 120.48300 113.29700 81.28400  1.000 40.16216  ? 267 HIS B CB  1 
ATOM   5240  C CG  . HIS B 1 267 ? 120.27700 113.68900 79.85800  1.000 40.16216  ? 267 HIS B CG  1 
ATOM   5241  N ND1 . HIS B 1 267 ? 120.85500 114.80800 79.30300  1.000 40.16216  ? 267 HIS B ND1 1 
ATOM   5242  C CD2 . HIS B 1 267 ? 119.54000 113.12100 78.87600  1.000 40.16216  ? 267 HIS B CD2 1 
ATOM   5243  C CE1 . HIS B 1 267 ? 120.49400 114.90600 78.03700  1.000 40.16216  ? 267 HIS B CE1 1 
ATOM   5244  N NE2 . HIS B 1 267 ? 119.69700 113.89400 77.75300  1.000 40.16216  ? 267 HIS B NE2 1 
ATOM   5245  N N   . ALA B 1 268 ? 119.72200 110.41400 81.55800  1.000 40.61071  ? 268 ALA B N   1 
ATOM   5246  C CA  . ALA B 1 268 ? 119.07700 109.16200 81.19600  1.000 40.61071  ? 268 ALA B CA  1 
ATOM   5247  C C   . ALA B 1 268 ? 118.33500 109.29100 79.87300  1.000 40.61071  ? 268 ALA B C   1 
ATOM   5248  O O   . ALA B 1 268 ? 117.64900 110.28400 79.62200  1.000 40.61071  ? 268 ALA B O   1 
ATOM   5249  C CB  . ALA B 1 268 ? 118.10800 108.73100 82.29100  1.000 40.61071  ? 268 ALA B CB  1 
ATOM   5250  N N   . GLU B 1 269 ? 118.46900 108.27300 79.03100  1.000 44.18359  ? 269 GLU B N   1 
ATOM   5251  C CA  . GLU B 1 269 ? 117.85100 108.25800 77.71300  1.000 44.18359  ? 269 GLU B CA  1 
ATOM   5252  C C   . GLU B 1 269 ? 116.80000 107.17100 77.56900  1.000 44.18359  ? 269 GLU B C   1 
ATOM   5253  O O   . GLU B 1 269 ? 115.68100 107.45000 77.13300  1.000 44.18359  ? 269 GLU B O   1 
ATOM   5254  C CB  . GLU B 1 269 ? 118.92700 108.07100 76.64000  1.000 44.18359  ? 269 GLU B CB  1 
ATOM   5255  C CG  . GLU B 1 269 ? 120.08400 109.04600 76.72700  1.000 44.18359  ? 269 GLU B CG  1 
ATOM   5256  C CD  . GLU B 1 269 ? 119.95100 110.21500 75.77800  1.000 44.18359  ? 269 GLU B CD  1 
ATOM   5257  O OE1 . GLU B 1 269 ? 119.24600 110.08100 74.76000  1.000 44.18359  ? 269 GLU B OE1 1 
ATOM   5258  O OE2 . GLU B 1 269 ? 120.57000 111.26400 76.03800  1.000 44.18359  ? 269 GLU B OE2 1 
ATOM   5259  N N   . ASN B 1 270 ? 117.12800 105.95400 77.91800  1.000 44.74100  ? 270 ASN B N   1 
ATOM   5260  C CA  . ASN B 1 270 ? 116.24900 104.80000 77.88300  1.000 44.74100  ? 270 ASN B CA  1 
ATOM   5261  C C   . ASN B 1 270 ? 115.53000 104.63100 79.21600  1.000 44.74100  ? 270 ASN B C   1 
ATOM   5262  O O   . ASN B 1 270 ? 115.98300 105.14300 80.24000  1.000 44.74100  ? 270 ASN B O   1 
ATOM   5263  C CB  . ASN B 1 270 ? 117.06700 103.55700 77.53100  1.000 44.74100  ? 270 ASN B CB  1 
ATOM   5264  C CG  . ASN B 1 270 ? 118.32000 103.43300 78.35900  1.000 44.74100  ? 270 ASN B CG  1 
ATOM   5265  O OD1 . ASN B 1 270 ? 118.57400 104.24700 79.23500  1.000 44.74100  ? 270 ASN B OD1 1 
ATOM   5266  N ND2 . ASN B 1 270 ? 119.11900 102.41600 78.07900  1.000 44.74100  ? 270 ASN B ND2 1 
ATOM   5267  N N   . PRO B 1 271 ? 114.38900 103.93300 79.25000  1.000 42.69233  ? 271 PRO B N   1 
ATOM   5268  C CA  . PRO B 1 271 ? 113.67400 103.75700 80.52500  1.000 42.69233  ? 271 PRO B CA  1 
ATOM   5269  C C   . PRO B 1 271 ? 114.31800 102.78300 81.50100  1.000 42.69233  ? 271 PRO B C   1 
ATOM   5270  O O   . PRO B 1 271 ? 113.74500 102.55300 82.57000  1.000 42.69233  ? 271 PRO B O   1 
ATOM   5271  C CB  . PRO B 1 271 ? 112.29900 103.24300 80.08200  1.000 42.69233  ? 271 PRO B CB  1 
ATOM   5272  C CG  . PRO B 1 271 ? 112.15300 103.72100 78.69700  1.000 42.69233  ? 271 PRO B CG  1 
ATOM   5273  C CD  . PRO B 1 271 ? 113.51600 103.61200 78.11000  1.000 42.69233  ? 271 PRO B CD  1 
ATOM   5274  N N   . ARG B 1 272 ? 115.46300 102.18400 81.18300  1.000 45.65652  ? 272 ARG B N   1 
ATOM   5275  C CA  . ARG B 1 272 ? 116.23100 101.46200 82.18700  1.000 45.65652  ? 272 ARG B CA  1 
ATOM   5276  C C   . ARG B 1 272 ? 117.04400 102.40800 83.05400  1.000 45.65652  ? 272 ARG B C   1 
ATOM   5277  O O   . ARG B 1 272 ? 117.20200 102.16800 84.25200  1.000 45.65652  ? 272 ARG B O   1 
ATOM   5278  C CB  . ARG B 1 272 ? 117.17400 100.45700 81.52800  1.000 45.65652  ? 272 ARG B CB  1 
ATOM   5279  C CG  . ARG B 1 272 ? 116.49200 99.30500  80.83600  1.000 45.65652  ? 272 ARG B CG  1 
ATOM   5280  C CD  . ARG B 1 272 ? 117.52300 98.28900  80.39400  1.000 45.65652  ? 272 ARG B CD  1 
ATOM   5281  N NE  . ARG B 1 272 ? 116.98500 97.32800  79.44100  1.000 45.65652  ? 272 ARG B NE  1 
ATOM   5282  C CZ  . ARG B 1 272 ? 117.67100 96.29600  78.96800  1.000 45.65652  ? 272 ARG B CZ  1 
ATOM   5283  N NH1 . ARG B 1 272 ? 118.91900 96.09700  79.36600  1.000 45.65652  ? 272 ARG B NH1 1 
ATOM   5284  N NH2 . ARG B 1 272 ? 117.11400 95.46400  78.10100  1.000 45.65652  ? 272 ARG B NH2 1 
ATOM   5285  N N   . GLU B 1 273 ? 117.56900 103.48100 82.46600  1.000 41.17038  ? 273 GLU B N   1 
ATOM   5286  C CA  . GLU B 1 273 ? 118.33800 104.43900 83.24500  1.000 41.17038  ? 273 GLU B CA  1 
ATOM   5287  C C   . GLU B 1 273 ? 117.43800 105.43600 83.95300  1.000 41.17038  ? 273 GLU B C   1 
ATOM   5288  O O   . GLU B 1 273 ? 117.88100 106.11100 84.88400  1.000 41.17038  ? 273 GLU B O   1 
ATOM   5289  C CB  . GLU B 1 273 ? 119.32600 105.17300 82.35100  1.000 41.17038  ? 273 GLU B CB  1 
ATOM   5290  C CG  . GLU B 1 273 ? 120.51400 104.34400 81.96700  1.000 41.17038  ? 273 GLU B CG  1 
ATOM   5291  C CD  . GLU B 1 273 ? 121.20600 104.86900 80.73900  1.000 41.17038  ? 273 GLU B CD  1 
ATOM   5292  O OE1 . GLU B 1 273 ? 121.01400 106.05600 80.41500  1.000 41.17038  ? 273 GLU B OE1 1 
ATOM   5293  O OE2 . GLU B 1 273 ? 121.93100 104.09400 80.08800  1.000 41.17038  ? 273 GLU B OE2 1 
ATOM   5294  N N   . MET B 1 274 ? 116.18700 105.56100 83.52400  1.000 37.52893  ? 274 MET B N   1 
ATOM   5295  C CA  . MET B 1 274 ? 115.26000 106.40100 84.26700  1.000 37.52893  ? 274 MET B CA  1 
ATOM   5296  C C   . MET B 1 274 ? 114.83900 105.72900 85.56400  1.000 37.52893  ? 274 MET B C   1 
ATOM   5297  O O   . MET B 1 274 ? 114.53800 106.40700 86.54700  1.000 37.52893  ? 274 MET B O   1 
ATOM   5298  C CB  . MET B 1 274 ? 114.04600 106.73400 83.41000  1.000 37.52893  ? 274 MET B CB  1 
ATOM   5299  C CG  . MET B 1 274 ? 114.28600 107.85900 82.44300  1.000 37.52893  ? 274 MET B CG  1 
ATOM   5300  S SD  . MET B 1 274 ? 112.81700 108.28000 81.51600  1.000 37.52893  ? 274 MET B SD  1 
ATOM   5301  C CE  . MET B 1 274 ? 113.47800 109.54100 80.44400  1.000 37.52893  ? 274 MET B CE  1 
ATOM   5302  N N   . LEU B 1 275 ? 114.80400 104.39700 85.58800  1.000 38.59690  ? 275 LEU B N   1 
ATOM   5303  C CA  . LEU B 1 275 ? 114.54600 103.69900 86.84200  1.000 38.59690  ? 275 LEU B CA  1 
ATOM   5304  C C   . LEU B 1 275 ? 115.74400 103.77300 87.77000  1.000 38.59690  ? 275 LEU B C   1 
ATOM   5305  O O   . LEU B 1 275 ? 115.58700 103.90200 88.98700  1.000 38.59690  ? 275 LEU B O   1 
ATOM   5306  C CB  . LEU B 1 275 ? 114.17800 102.24200 86.59300  1.000 38.59690  ? 275 LEU B CB  1 
ATOM   5307  C CG  . LEU B 1 275 ? 112.74700 101.95900 86.19000  1.000 38.59690  ? 275 LEU B CG  1 
ATOM   5308  C CD1 . LEU B 1 275 ? 112.60300 100.50600 85.82200  1.000 38.59690  ? 275 LEU B CD1 1 
ATOM   5309  C CD2 . LEU B 1 275 ? 111.87800 102.28100 87.37400  1.000 38.59690  ? 275 LEU B CD2 1 
ATOM   5310  N N   . PHE B 1 276 ? 116.95200 103.66500 87.22000  1.000 37.76406  ? 276 PHE B N   1 
ATOM   5311  C CA  . PHE B 1 276 ? 118.12500 103.67400 88.08100  1.000 37.76406  ? 276 PHE B CA  1 
ATOM   5312  C C   . PHE B 1 276 ? 118.39000 105.06600 88.62700  1.000 37.76406  ? 276 PHE B C   1 
ATOM   5313  O O   . PHE B 1 276 ? 118.87000 105.21100 89.75400  1.000 37.76406  ? 276 PHE B O   1 
ATOM   5314  C CB  . PHE B 1 276 ? 119.35100 103.15500 87.34100  1.000 37.76406  ? 276 PHE B CB  1 
ATOM   5315  C CG  . PHE B 1 276 ? 120.57500 103.08000 88.20300  1.000 37.76406  ? 276 PHE B CG  1 
ATOM   5316  C CD1 . PHE B 1 276 ? 120.71500 102.06900 89.13400  1.000 37.76406  ? 276 PHE B CD1 1 
ATOM   5317  C CD2 . PHE B 1 276 ? 121.57300 104.03200 88.10200  1.000 37.76406  ? 276 PHE B CD2 1 
ATOM   5318  C CE1 . PHE B 1 276 ? 121.83000 102.00300 89.93800  1.000 37.76406  ? 276 PHE B CE1 1 
ATOM   5319  C CE2 . PHE B 1 276 ? 122.68800 103.96900 88.90500  1.000 37.76406  ? 276 PHE B CE2 1 
ATOM   5320  C CZ  . PHE B 1 276 ? 122.81500 102.95300 89.82300  1.000 37.76406  ? 276 PHE B CZ  1 
ATOM   5321  N N   . ASP B 1 277 ? 118.07600 106.10300 87.85200  1.000 37.36797  ? 277 ASP B N   1 
ATOM   5322  C CA  . ASP B 1 277 ? 118.28100 107.45600 88.34600  1.000 37.36797  ? 277 ASP B CA  1 
ATOM   5323  C C   . ASP B 1 277 ? 117.25000 107.83600 89.39200  1.000 37.36797  ? 277 ASP B C   1 
ATOM   5324  O O   . ASP B 1 277 ? 117.51500 108.70600 90.21800  1.000 37.36797  ? 277 ASP B O   1 
ATOM   5325  C CB  . ASP B 1 277 ? 118.25300 108.45800 87.20200  1.000 37.36797  ? 277 ASP B CB  1 
ATOM   5326  C CG  . ASP B 1 277 ? 119.57000 108.53800 86.47900  1.000 37.36797  ? 277 ASP B CG  1 
ATOM   5327  O OD1 . ASP B 1 277 ? 120.26300 107.50600 86.40900  1.000 37.36797  ? 277 ASP B OD1 1 
ATOM   5328  O OD2 . ASP B 1 277 ? 119.92100 109.63000 85.98900  1.000 37.36797  ? 277 ASP B OD2 1 
ATOM   5329  N N   . ILE B 1 278 ? 116.07800 107.20900 89.37900  1.000 35.28184  ? 278 ILE B N   1 
ATOM   5330  C CA  . ILE B 1 278 ? 115.10100 107.47600 90.42800  1.000 35.28184  ? 278 ILE B CA  1 
ATOM   5331  C C   . ILE B 1 278 ? 115.54800 106.83100 91.73300  1.000 35.28184  ? 278 ILE B C   1 
ATOM   5332  O O   . ILE B 1 278 ? 115.52100 107.45800 92.79600  1.000 35.28184  ? 278 ILE B O   1 
ATOM   5333  C CB  . ILE B 1 278 ? 113.70400 107.00200 89.99300  1.000 35.28184  ? 278 ILE B CB  1 
ATOM   5334  C CG1 . ILE B 1 278 ? 113.11400 107.98400 88.99700  1.000 35.28184  ? 278 ILE B CG1 1 
ATOM   5335  C CG2 . ILE B 1 278 ? 112.76400 106.90900 91.16500  1.000 35.28184  ? 278 ILE B CG2 1 
ATOM   5336  C CD1 . ILE B 1 278 ? 111.88000 107.48000 88.34200  1.000 35.28184  ? 278 ILE B CD1 1 
ATOM   5337  N N   . PHE B 1 279 ? 116.01600 105.58700 91.66500  1.000 36.74890  ? 279 PHE B N   1 
ATOM   5338  C CA  . PHE B 1 279 ? 116.48800 104.91400 92.86800  1.000 36.74890  ? 279 PHE B CA  1 
ATOM   5339  C C   . PHE B 1 279 ? 117.82500 105.45000 93.35200  1.000 36.74890  ? 279 PHE B C   1 
ATOM   5340  O O   . PHE B 1 279 ? 118.18000 105.22100 94.50900  1.000 36.74890  ? 279 PHE B O   1 
ATOM   5341  C CB  . PHE B 1 279 ? 116.59100 103.41400 92.62500  1.000 36.74890  ? 279 PHE B CB  1 
ATOM   5342  C CG  . PHE B 1 279 ? 115.27000 102.75200 92.39600  1.000 36.74890  ? 279 PHE B CG  1 
ATOM   5343  C CD1 . PHE B 1 279 ? 114.17000 103.10000 93.15800  1.000 36.74890  ? 279 PHE B CD1 1 
ATOM   5344  C CD2 . PHE B 1 279 ? 115.12300 101.78900 91.41500  1.000 36.74890  ? 279 PHE B CD2 1 
ATOM   5345  C CE1 . PHE B 1 279 ? 112.94800 102.50200 92.94700  1.000 36.74890  ? 279 PHE B CE1 1 
ATOM   5346  C CE2 . PHE B 1 279 ? 113.90400 101.18500 91.20000  1.000 36.74890  ? 279 PHE B CE2 1 
ATOM   5347  C CZ  . PHE B 1 279 ? 112.81500 101.54400 91.96800  1.000 36.74890  ? 279 PHE B CZ  1 
ATOM   5348  N N   . PHE B 1 280 ? 118.57600 106.14700 92.50400  1.000 32.93180  ? 280 PHE B N   1 
ATOM   5349  C CA  . PHE B 1 280 ? 119.82000 106.76300 92.94200  1.000 32.93180  ? 280 PHE B CA  1 
ATOM   5350  C C   . PHE B 1 280 ? 119.60300 108.17000 93.47500  1.000 32.93180  ? 280 PHE B C   1 
ATOM   5351  O O   . PHE B 1 280 ? 120.23500 108.55800 94.45900  1.000 32.93180  ? 280 PHE B O   1 
ATOM   5352  C CB  . PHE B 1 280 ? 120.83300 106.78800 91.80000  1.000 32.93180  ? 280 PHE B CB  1 
ATOM   5353  C CG  . PHE B 1 280 ? 122.20000 107.22500 92.21300  1.000 32.93180  ? 280 PHE B CG  1 
ATOM   5354  C CD1 . PHE B 1 280 ? 122.74100 106.80800 93.41200  1.000 32.93180  ? 280 PHE B CD1 1 
ATOM   5355  C CD2 . PHE B 1 280 ? 122.95100 108.04900 91.39800  1.000 32.93180  ? 280 PHE B CD2 1 
ATOM   5356  C CE1 . PHE B 1 280 ? 124.00000 107.21700 93.79400  1.000 32.93180  ? 280 PHE B CE1 1 
ATOM   5357  C CE2 . PHE B 1 280 ? 124.20900 108.45000 91.77400  1.000 32.93180  ? 280 PHE B CE2 1 
ATOM   5358  C CZ  . PHE B 1 280 ? 124.73200 108.03800 92.97100  1.000 32.93180  ? 280 PHE B CZ  1 
ATOM   5359  N N   . MET B 1 281 ? 118.71500 108.94800 92.86100  1.000 33.20434  ? 281 MET B N   1 
ATOM   5360  C CA  . MET B 1 281 ? 118.47100 110.29300 93.35700  1.000 33.20434  ? 281 MET B CA  1 
ATOM   5361  C C   . MET B 1 281 ? 117.57700 110.32000 94.58500  1.000 33.20434  ? 281 MET B C   1 
ATOM   5362  O O   . MET B 1 281 ? 117.42700 111.38300 95.19000  1.000 33.20434  ? 281 MET B O   1 
ATOM   5363  C CB  . MET B 1 281 ? 117.87100 111.17100 92.26200  1.000 33.20434  ? 281 MET B CB  1 
ATOM   5364  C CG  . MET B 1 281 ? 118.86500 111.56500 91.19700  1.000 33.20434  ? 281 MET B CG  1 
ATOM   5365  S SD  . MET B 1 281 ? 118.26000 112.82500 90.07500  1.000 33.20434  ? 281 MET B SD  1 
ATOM   5366  C CE  . MET B 1 281 ? 117.36100 111.82000 88.91400  1.000 33.20434  ? 281 MET B CE  1 
ATOM   5367  N N   . MET B 1 282 ? 116.97300 109.19800 94.96500  1.000 36.90341  ? 282 MET B N   1 
ATOM   5368  C CA  . MET B 1 282 ? 116.37200 109.10800 96.28800  1.000 36.90341  ? 282 MET B CA  1 
ATOM   5369  C C   . MET B 1 282 ? 117.39200 108.70900 97.33700  1.000 36.90341  ? 282 MET B C   1 
ATOM   5370  O O   . MET B 1 282 ? 117.21700 109.02700 98.51500  1.000 36.90341  ? 282 MET B O   1 
ATOM   5371  C CB  . MET B 1 282 ? 115.22100 108.11200 96.28900  1.000 36.90341  ? 282 MET B CB  1 
ATOM   5372  C CG  . MET B 1 282 ? 114.02200 108.57100 95.50500  1.000 36.90341  ? 282 MET B CG  1 
ATOM   5373  S SD  . MET B 1 282 ? 112.63600 107.42900 95.61400  1.000 36.90341  ? 282 MET B SD  1 
ATOM   5374  C CE  . MET B 1 282 ? 113.46800 105.84300 95.62200  1.000 36.90341  ? 282 MET B CE  1 
ATOM   5375  N N   . PHE B 1 283 ? 118.45100 108.01400 96.93300  1.000 32.34993  ? 283 PHE B N   1 
ATOM   5376  C CA  . PHE B 1 283 ? 119.54300 107.72500 97.84900  1.000 32.34993  ? 283 PHE B CA  1 
ATOM   5377  C C   . PHE B 1 283 ? 120.35000 108.97800 98.15400  1.000 32.34993  ? 283 PHE B C   1 
ATOM   5378  O O   . PHE B 1 283 ? 120.85100 109.13700 99.26900  1.000 32.34993  ? 283 PHE B O   1 
ATOM   5379  C CB  . PHE B 1 283 ? 120.43700 106.64000 97.25600  1.000 32.34993  ? 283 PHE B CB  1 
ATOM   5380  C CG  . PHE B 1 283 ? 121.62500 106.30200 98.09800  1.000 32.34993  ? 283 PHE B CG  1 
ATOM   5381  C CD1 . PHE B 1 283 ? 121.48600 105.51700 99.22500  1.000 32.34993  ? 283 PHE B CD1 1 
ATOM   5382  C CD2 . PHE B 1 283 ? 122.88500 106.75400 97.75500  1.000 32.34993  ? 283 PHE B CD2 1 
ATOM   5383  C CE1 . PHE B 1 283 ? 122.57600 105.20100 100.00000 1.000 32.34993  ? 283 PHE B CE1 1 
ATOM   5384  C CE2 . PHE B 1 283 ? 123.97800 106.44200 98.53000  1.000 32.34993  ? 283 PHE B CE2 1 
ATOM   5385  C CZ  . PHE B 1 283 ? 123.82100 105.66500 99.65100  1.000 32.34993  ? 283 PHE B CZ  1 
ATOM   5386  N N   . ASN B 1 284 ? 120.47900 109.88400 97.18500  1.000 31.59749  ? 284 ASN B N   1 
ATOM   5387  C CA  . ASN B 1 284 ? 121.29000 111.07600 97.40100  1.000 31.59749  ? 284 ASN B CA  1 
ATOM   5388  C C   . ASN B 1 284 ? 120.56200 112.12200 98.22500  1.000 31.59749  ? 284 ASN B C   1 
ATOM   5389  O O   . ASN B 1 284 ? 121.19800 113.03900 98.74700  1.000 31.59749  ? 284 ASN B O   1 
ATOM   5390  C CB  . ASN B 1 284 ? 121.71400 111.67400 96.07100  1.000 31.59749  ? 284 ASN B CB  1 
ATOM   5391  C CG  . ASN B 1 284 ? 122.45600 110.69600 95.22100  1.000 31.59749  ? 284 ASN B CG  1 
ATOM   5392  O OD1 . ASN B 1 284 ? 122.25800 110.63800 94.01500  1.000 31.59749  ? 284 ASN B OD1 1 
ATOM   5393  N ND2 . ASN B 1 284 ? 123.31300 109.90600 95.84300  1.000 31.59749  ? 284 ASN B ND2 1 
ATOM   5394  N N   . LEU B 1 285 ? 119.23800 112.03000 98.33200  1.000 30.05336  ? 285 LEU B N   1 
ATOM   5395  C CA  . LEU B 1 285 ? 118.53600 112.83500 99.32300  1.000 30.05336  ? 285 LEU B CA  1 
ATOM   5396  C C   . LEU B 1 285 ? 118.88300 112.37300 100.72800 1.000 30.05336  ? 285 LEU B C   1 
ATOM   5397  O O   . LEU B 1 285 ? 119.11700 113.18900 101.62300 1.000 30.05336  ? 285 LEU B O   1 
ATOM   5398  C CB  . LEU B 1 285 ? 117.03000 112.75900 99.10400  1.000 30.05336  ? 285 LEU B CB  1 
ATOM   5399  C CG  . LEU B 1 285 ? 116.34300 113.91200 98.39600  1.000 30.05336  ? 285 LEU B CG  1 
ATOM   5400  C CD1 . LEU B 1 285 ? 114.92400 113.51600 98.10200  1.000 30.05336  ? 285 LEU B CD1 1 
ATOM   5401  C CD2 . LEU B 1 285 ? 116.37600 115.14000 99.26100  1.000 30.05336  ? 285 LEU B CD2 1 
ATOM   5402  N N   . GLY B 1 286 ? 118.92100 111.06000 100.93900 1.000 30.56636  ? 286 GLY B N   1 
ATOM   5403  C CA  . GLY B 1 286 ? 119.24900 110.54400 102.25200 1.000 30.56636  ? 286 GLY B CA  1 
ATOM   5404  C C   . GLY B 1 286 ? 120.72400 110.62200 102.57100 1.000 30.56636  ? 286 GLY B C   1 
ATOM   5405  O O   . GLY B 1 286 ? 121.10700 110.58400 103.74000 1.000 30.56636  ? 286 GLY B O   1 
ATOM   5406  N N   . LEU B 1 287 ? 121.57000 110.72700 101.54900 1.000 30.30531  ? 287 LEU B N   1 
ATOM   5407  C CA  . LEU B 1 287 ? 123.00400 110.79400 101.79300 1.000 30.30531  ? 287 LEU B CA  1 
ATOM   5408  C C   . LEU B 1 287 ? 123.43100 112.20100 102.18100 1.000 30.30531  ? 287 LEU B C   1 
ATOM   5409  O O   . LEU B 1 287 ? 124.14300 112.38800 103.17100 1.000 30.30531  ? 287 LEU B O   1 
ATOM   5410  C CB  . LEU B 1 287 ? 123.77400 110.32300 100.56600 1.000 30.30531  ? 287 LEU B CB  1 
ATOM   5411  C CG  . LEU B 1 287 ? 125.26100 110.07500 100.80400 1.000 30.30531  ? 287 LEU B CG  1 
ATOM   5412  C CD1 . LEU B 1 287 ? 125.45700 108.78600 101.55800 1.000 30.30531  ? 287 LEU B CD1 1 
ATOM   5413  C CD2 . LEU B 1 287 ? 126.01900 110.04500 99.49700  1.000 30.30531  ? 287 LEU B CD2 1 
ATOM   5414  N N   . THR B 1 288 ? 123.00900 113.20900 101.41600 1.000 29.10046  ? 288 THR B N   1 
ATOM   5415  C CA  . THR B 1 288 ? 123.46200 114.56500 101.70400 1.000 29.10046  ? 288 THR B CA  1 
ATOM   5416  C C   . THR B 1 288 ? 122.72000 115.17700 102.88000 1.000 29.10046  ? 288 THR B C   1 
ATOM   5417  O O   . THR B 1 288 ? 123.15800 116.19800 103.41200 1.000 29.10046  ? 288 THR B O   1 
ATOM   5418  C CB  . THR B 1 288 ? 123.31600 115.46200 100.48300 1.000 29.10046  ? 288 THR B CB  1 
ATOM   5419  O OG1 . THR B 1 288 ? 121.93000 115.71800 100.24600 1.000 29.10046  ? 288 THR B OG1 1 
ATOM   5420  C CG2 . THR B 1 288 ? 123.94500 114.81700 99.26300  1.000 29.10046  ? 288 THR B CG2 1 
ATOM   5421  N N   . ALA B 1 289 ? 121.60100 114.59100 103.29700 1.000 28.68736  ? 289 ALA B N   1 
ATOM   5422  C CA  . ALA B 1 289 ? 121.00200 115.00100 104.55900 1.000 28.68736  ? 289 ALA B CA  1 
ATOM   5423  C C   . ALA B 1 289 ? 121.64500 114.30700 105.74400 1.000 28.68736  ? 289 ALA B C   1 
ATOM   5424  O O   . ALA B 1 289 ? 121.36000 114.67200 106.88500 1.000 28.68736  ? 289 ALA B O   1 
ATOM   5425  C CB  . ALA B 1 289 ? 119.50400 114.72400 104.56000 1.000 28.68736  ? 289 ALA B CB  1 
ATOM   5426  N N   . TYR B 1 290 ? 122.49400 113.31700 105.49500 1.000 29.00658  ? 290 TYR B N   1 
ATOM   5427  C CA  . TYR B 1 290 ? 123.25300 112.62600 106.52200 1.000 29.00658  ? 290 TYR B CA  1 
ATOM   5428  C C   . TYR B 1 290 ? 124.64200 113.22500 106.68100 1.000 29.00658  ? 290 TYR B C   1 
ATOM   5429  O O   . TYR B 1 290 ? 125.19200 113.21500 107.78100 1.000 29.00658  ? 290 TYR B O   1 
ATOM   5430  C CB  . TYR B 1 290 ? 123.32600 111.13600 106.17700 1.000 29.00658  ? 290 TYR B CB  1 
ATOM   5431  C CG  . TYR B 1 290 ? 124.40500 110.33100 106.86000 1.000 29.00658  ? 290 TYR B CG  1 
ATOM   5432  C CD1 . TYR B 1 290 ? 124.21900 109.83000 108.13800 1.000 29.00658  ? 290 TYR B CD1 1 
ATOM   5433  C CD2 . TYR B 1 290 ? 125.59200 110.03100 106.20600 1.000 29.00658  ? 290 TYR B CD2 1 
ATOM   5434  C CE1 . TYR B 1 290 ? 125.19500 109.08000 108.75400 1.000 29.00658  ? 290 TYR B CE1 1 
ATOM   5435  C CE2 . TYR B 1 290 ? 126.57100 109.29100 106.81600 1.000 29.00658  ? 290 TYR B CE2 1 
ATOM   5436  C CZ  . TYR B 1 290 ? 126.36900 108.81800 108.08800 1.000 29.00658  ? 290 TYR B CZ  1 
ATOM   5437  O OH  . TYR B 1 290 ? 127.35200 108.07400 108.69200 1.000 29.00658  ? 290 TYR B OH  1 
ATOM   5438  N N   . LEU B 1 291 ? 125.22200 113.75700 105.60500 1.000 27.78336  ? 291 LEU B N   1 
ATOM   5439  C CA  . LEU B 1 291 ? 126.51600 114.41800 105.72700 1.000 27.78336  ? 291 LEU B CA  1 
ATOM   5440  C C   . LEU B 1 291 ? 126.36800 115.80500 106.32600 1.000 27.78336  ? 291 LEU B C   1 
ATOM   5441  O O   . LEU B 1 291 ? 127.21900 116.24500 107.10400 1.000 27.78336  ? 291 LEU B O   1 
ATOM   5442  C CB  . LEU B 1 291 ? 127.19800 114.51700 104.36800 1.000 27.78336  ? 291 LEU B CB  1 
ATOM   5443  C CG  . LEU B 1 291 ? 127.31600 113.26800 103.51300 1.000 27.78336  ? 291 LEU B CG  1 
ATOM   5444  C CD1 . LEU B 1 291 ? 127.89100 113.65700 102.18300 1.000 27.78336  ? 291 LEU B CD1 1 
ATOM   5445  C CD2 . LEU B 1 291 ? 128.18500 112.24800 104.19000 1.000 27.78336  ? 291 LEU B CD2 1 
ATOM   5446  N N   . ILE B 1 292 ? 125.30600 116.51900 105.95500 1.000 26.70797  ? 292 ILE B N   1 
ATOM   5447  C CA  . ILE B 1 292 ? 125.07900 117.85300 106.49400 1.000 26.70797  ? 292 ILE B CA  1 
ATOM   5448  C C   . ILE B 1 292 ? 124.67700 117.77000 107.95900 1.000 26.70797  ? 292 ILE B C   1 
ATOM   5449  O O   . ILE B 1 292 ? 125.14100 118.56000 108.78700 1.000 26.70797  ? 292 ILE B O   1 
ATOM   5450  C CB  . ILE B 1 292 ? 124.02800 118.58600 105.64100 1.000 26.70797  ? 292 ILE B CB  1 
ATOM   5451  C CG1 . ILE B 1 292 ? 124.62300 118.98300 104.29600 1.000 26.70797  ? 292 ILE B CG1 1 
ATOM   5452  C CG2 . ILE B 1 292 ? 123.53700 119.82700 106.31800 1.000 26.70797  ? 292 ILE B CG2 1 
ATOM   5453  C CD1 . ILE B 1 292 ? 123.62500 119.60000 103.36100 1.000 26.70797  ? 292 ILE B CD1 1 
ATOM   5454  N N   . GLY B 1 293 ? 123.86200 116.77700 108.31300 1.000 26.28252  ? 293 GLY B N   1 
ATOM   5455  C CA  . GLY B 1 293 ? 123.47400 116.60300 109.70200 1.000 26.28252  ? 293 GLY B CA  1 
ATOM   5456  C C   . GLY B 1 293 ? 124.61100 116.12800 110.58400 1.000 26.28252  ? 293 GLY B C   1 
ATOM   5457  O O   . GLY B 1 293 ? 124.60800 116.36100 111.79200 1.000 26.28252  ? 293 GLY B O   1 
ATOM   5458  N N   . ASN B 1 294 ? 125.60100 115.45800 109.99500 1.000 27.95631  ? 294 ASN B N   1 
ATOM   5459  C CA  . ASN B 1 294 ? 126.75200 115.01100 110.77200 1.000 27.95631  ? 294 ASN B CA  1 
ATOM   5460  C C   . ASN B 1 294 ? 127.79700 116.10600 110.90400 1.000 27.95631  ? 294 ASN B C   1 
ATOM   5461  O O   . ASN B 1 294 ? 128.44700 116.22600 111.94500 1.000 27.95631  ? 294 ASN B O   1 
ATOM   5462  C CB  . ASN B 1 294 ? 127.36400 113.76500 110.14900 1.000 27.95631  ? 294 ASN B CB  1 
ATOM   5463  C CG  . ASN B 1 294 ? 126.83700 112.50600 110.76400 1.000 27.95631  ? 294 ASN B CG  1 
ATOM   5464  O OD1 . ASN B 1 294 ? 126.04500 111.79600 110.16800 1.000 27.95631  ? 294 ASN B OD1 1 
ATOM   5465  N ND2 . ASN B 1 294 ? 127.28800 112.21200 111.96600 1.000 27.95631  ? 294 ASN B ND2 1 
ATOM   5466  N N   . MET B 1 295 ? 127.99000 116.90800 109.85800 1.000 27.74553  ? 295 MET B N   1 
ATOM   5467  C CA  . MET B 1 295 ? 128.93000 118.01500 109.97400 1.000 27.74553  ? 295 MET B CA  1 
ATOM   5468  C C   . MET B 1 295 ? 128.36800 119.13700 110.83500 1.000 27.74553  ? 295 MET B C   1 
ATOM   5469  O O   . MET B 1 295 ? 129.13400 119.90000 111.42800 1.000 27.74553  ? 295 MET B O   1 
ATOM   5470  C CB  . MET B 1 295 ? 129.31100 118.53700 108.59500 1.000 27.74553  ? 295 MET B CB  1 
ATOM   5471  C CG  . MET B 1 295 ? 130.62800 119.29500 108.57000 1.000 27.74553  ? 295 MET B CG  1 
ATOM   5472  S SD  . MET B 1 295 ? 132.07600 118.24900 108.76500 1.000 27.74553  ? 295 MET B SD  1 
ATOM   5473  C CE  . MET B 1 295 ? 132.35300 117.73500 107.07200 1.000 27.74553  ? 295 MET B CE  1 
ATOM   5474  N N   . THR B 1 296 ? 127.04400 119.25300 110.92300 1.000 26.39415  ? 296 THR B N   1 
ATOM   5475  C CA  . THR B 1 296 ? 126.44100 120.18000 111.87400 1.000 26.39415  ? 296 THR B CA  1 
ATOM   5476  C C   . THR B 1 296 ? 126.68400 119.71600 113.30100 1.000 26.39415  ? 296 THR B C   1 
ATOM   5477  O O   . THR B 1 296 ? 126.88000 120.52900 114.20800 1.000 26.39415  ? 296 THR B O   1 
ATOM   5478  C CB  . THR B 1 296 ? 124.94800 120.30500 111.59800 1.000 26.39415  ? 296 THR B CB  1 
ATOM   5479  O OG1 . THR B 1 296 ? 124.74600 120.55300 110.20700 1.000 26.39415  ? 296 THR B OG1 1 
ATOM   5480  C CG2 . THR B 1 296 ? 124.34800 121.43600 112.37600 1.000 26.39415  ? 296 THR B CG2 1 
ATOM   5481  N N   . ASN B 1 297 ? 126.68900 118.40200 113.51400 1.000 28.75865  ? 297 ASN B N   1 
ATOM   5482  C CA  . ASN B 1 297 ? 127.00700 117.85100 114.82500 1.000 28.75865  ? 297 ASN B CA  1 
ATOM   5483  C C   . ASN B 1 297 ? 128.48100 118.03600 115.15800 1.000 28.75865  ? 297 ASN B C   1 
ATOM   5484  O O   . ASN B 1 297 ? 128.85200 118.14400 116.32900 1.000 28.75865  ? 297 ASN B O   1 
ATOM   5485  C CB  . ASN B 1 297 ? 126.62400 116.37100 114.85200 1.000 28.75865  ? 297 ASN B CB  1 
ATOM   5486  C CG  . ASN B 1 297 ? 126.88000 115.72100 116.18600 1.000 28.75865  ? 297 ASN B CG  1 
ATOM   5487  O OD1 . ASN B 1 297 ? 126.56900 116.28300 117.23100 1.000 28.75865  ? 297 ASN B OD1 1 
ATOM   5488  N ND2 . ASN B 1 297 ? 127.44900 114.52300 116.15800 1.000 28.75865  ? 297 ASN B ND2 1 
ATOM   5489  N N   . LEU B 1 298 ? 129.33700 118.09000 114.13700 1.000 28.03283  ? 298 LEU B N   1 
ATOM   5490  C CA  . LEU B 1 298 ? 130.76700 118.22200 114.38400 1.000 28.03283  ? 298 LEU B CA  1 
ATOM   5491  C C   . LEU B 1 298 ? 131.16500 119.67200 114.60900 1.000 28.03283  ? 298 LEU B C   1 
ATOM   5492  O O   . LEU B 1 298 ? 132.07600 119.95000 115.39300 1.000 28.03283  ? 298 LEU B O   1 
ATOM   5493  C CB  . LEU B 1 298 ? 131.55700 117.63200 113.22300 1.000 28.03283  ? 298 LEU B CB  1 
ATOM   5494  C CG  . LEU B 1 298 ? 131.68300 116.11500 113.22700 1.000 28.03283  ? 298 LEU B CG  1 
ATOM   5495  C CD1 . LEU B 1 298 ? 132.45700 115.66700 112.02300 1.000 28.03283  ? 298 LEU B CD1 1 
ATOM   5496  C CD2 . LEU B 1 298 ? 132.35500 115.65300 114.49500 1.000 28.03283  ? 298 LEU B CD2 1 
ATOM   5497  N N   . VAL B 1 299 ? 130.50900 120.60700 113.92000 1.000 27.60122  ? 299 VAL B N   1 
ATOM   5498  C CA  . VAL B 1 299 ? 130.79600 122.02600 114.11500 1.000 27.60122  ? 299 VAL B CA  1 
ATOM   5499  C C   . VAL B 1 299 ? 130.34400 122.47700 115.49700 1.000 27.60122  ? 299 VAL B C   1 
ATOM   5500  O O   . VAL B 1 299 ? 131.01800 123.27700 116.15600 1.000 27.60122  ? 299 VAL B O   1 
ATOM   5501  C CB  . VAL B 1 299 ? 130.15100 122.84100 112.98200 1.000 27.60122  ? 299 VAL B CB  1 
ATOM   5502  C CG1 . VAL B 1 299 ? 130.14300 124.31000 113.28400 1.000 27.60122  ? 299 VAL B CG1 1 
ATOM   5503  C CG2 . VAL B 1 299 ? 130.92600 122.62000 111.71400 1.000 27.60122  ? 299 VAL B CG2 1 
ATOM   5504  N N   . VAL B 1 300 ? 129.23400 121.92800 115.98300 1.000 29.22539  ? 300 VAL B N   1 
ATOM   5505  C CA  . VAL B 1 300 ? 128.80300 122.19800 117.35100 1.000 29.22539  ? 300 VAL B CA  1 
ATOM   5506  C C   . VAL B 1 300 ? 129.79100 121.60000 118.35200 1.000 29.22539  ? 300 VAL B C   1 
ATOM   5507  O O   . VAL B 1 300 ? 130.11800 122.22400 119.36500 1.000 29.22539  ? 300 VAL B O   1 
ATOM   5508  C CB  . VAL B 1 300 ? 127.36600 121.68200 117.54700 1.000 29.22539  ? 300 VAL B CB  1 
ATOM   5509  C CG1 . VAL B 1 300 ? 126.98000 121.61500 119.01000 1.000 29.22539  ? 300 VAL B CG1 1 
ATOM   5510  C CG2 . VAL B 1 300 ? 126.39800 122.57300 116.79100 1.000 29.22539  ? 300 VAL B CG2 1 
ATOM   5511  N N   . HIS B 1 301 ? 130.34000 120.42300 118.05200 1.000 32.62094  ? 301 HIS B N   1 
ATOM   5512  C CA  . HIS B 1 301 ? 131.40100 119.87500 118.89500 1.000 32.62094  ? 301 HIS B CA  1 
ATOM   5513  C C   . HIS B 1 301 ? 132.72200 120.61400 118.69800 1.000 32.62094  ? 301 HIS B C   1 
ATOM   5514  O O   . HIS B 1 301 ? 133.56600 120.61400 119.59800 1.000 32.62094  ? 301 HIS B O   1 
ATOM   5515  C CB  . HIS B 1 301 ? 131.58200 118.38500 118.60900 1.000 32.62094  ? 301 HIS B CB  1 
ATOM   5516  C CG  . HIS B 1 301 ? 132.27600 117.63100 119.70300 1.000 32.62094  ? 301 HIS B CG  1 
ATOM   5517  N ND1 . HIS B 1 301 ? 133.27100 116.71000 119.45700 1.000 32.62094  ? 301 HIS B ND1 1 
ATOM   5518  C CD2 . HIS B 1 301 ? 132.10000 117.64000 121.04400 1.000 32.62094  ? 301 HIS B CD2 1 
ATOM   5519  C CE1 . HIS B 1 301 ? 133.69300 116.20000 120.60000 1.000 32.62094  ? 301 HIS B CE1 1 
ATOM   5520  N NE2 . HIS B 1 301 ? 132.99600 116.74500 121.57800 1.000 32.62094  ? 301 HIS B NE2 1 
ATOM   5521  N N   . TRP B 1 302 ? 132.92700 121.22900 117.52900 1.000 34.80470  ? 302 TRP B N   1 
ATOM   5522  C CA  . TRP B 1 302 ? 134.11800 122.04300 117.29200 1.000 34.80470  ? 302 TRP B CA  1 
ATOM   5523  C C   . TRP B 1 302 ? 134.10100 123.29100 118.15900 1.000 34.80470  ? 302 TRP B C   1 
ATOM   5524  O O   . TRP B 1 302 ? 134.99900 123.51300 118.97700 1.000 34.80470  ? 302 TRP B O   1 
ATOM   5525  C CB  . TRP B 1 302 ? 134.19700 122.46600 115.82200 1.000 34.80470  ? 302 TRP B CB  1 
ATOM   5526  C CG  . TRP B 1 302 ? 135.02900 121.63900 114.88700 1.000 34.80470  ? 302 TRP B CG  1 
ATOM   5527  C CD1 . TRP B 1 302 ? 134.58200 120.94700 113.79600 1.000 34.80470  ? 302 TRP B CD1 1 
ATOM   5528  C CD2 . TRP B 1 302 ? 136.44900 121.46300 114.91400 1.000 34.80470  ? 302 TRP B CD2 1 
ATOM   5529  N NE1 . TRP B 1 302 ? 135.62900 120.33000 113.16200 1.000 34.80470  ? 302 TRP B NE1 1 
ATOM   5530  C CE2 . TRP B 1 302 ? 136.78800 120.63300 113.82700 1.000 34.80470  ? 302 TRP B CE2 1 
ATOM   5531  C CE3 . TRP B 1 302 ? 137.46500 121.91300 115.75700 1.000 34.80470  ? 302 TRP B CE3 1 
ATOM   5532  C CZ2 . TRP B 1 302 ? 138.10100 120.24900 113.56400 1.000 34.80470  ? 302 TRP B CZ2 1 
ATOM   5533  C CZ3 . TRP B 1 302 ? 138.76600 121.52500 115.49300 1.000 34.80470  ? 302 TRP B CZ3 1 
ATOM   5534  C CH2 . TRP B 1 302 ? 139.07100 120.70400 114.40800 1.000 34.80470  ? 302 TRP B CH2 1 
ATOM   5535  N N   . THR B 1 303 ? 133.07200 124.11600 117.99300 1.000 32.10728  ? 303 THR B N   1 
ATOM   5536  C CA  . THR B 1 303 ? 133.05000 125.48700 118.48400 1.000 32.10728  ? 303 THR B CA  1 
ATOM   5537  C C   . THR B 1 303 ? 132.08000 125.67300 119.64200 1.000 32.10728  ? 303 THR B C   1 
ATOM   5538  O O   . THR B 1 303 ? 131.35700 126.66100 119.69800 1.000 32.10728  ? 303 THR B O   1 
ATOM   5539  C CB  . THR B 1 303 ? 132.67600 126.45300 117.36600 1.000 32.10728  ? 303 THR B CB  1 
ATOM   5540  O OG1 . THR B 1 303 ? 131.31200 126.23700 116.99800 1.000 32.10728  ? 303 THR B OG1 1 
ATOM   5541  C CG2 . THR B 1 303 ? 133.53900 126.21200 116.15400 1.000 32.10728  ? 303 THR B CG2 1 
ATOM   5542  N N   . SER B 1 304 ? 132.02500 124.72400 120.56800 1.000 33.89264  ? 304 SER B N   1 
ATOM   5543  C CA  . SER B 1 304 ? 131.19300 124.92300 121.74500 1.000 33.89264  ? 304 SER B CA  1 
ATOM   5544  C C   . SER B 1 304 ? 131.94000 125.60200 122.87700 1.000 33.89264  ? 304 SER B C   1 
ATOM   5545  O O   . SER B 1 304 ? 131.30400 126.16900 123.76500 1.000 33.89264  ? 304 SER B O   1 
ATOM   5546  C CB  . SER B 1 304 ? 130.62800 123.59500 122.24800 1.000 33.89264  ? 304 SER B CB  1 
ATOM   5547  O OG  . SER B 1 304 ? 131.65500 122.74900 122.71900 1.000 33.89264  ? 304 SER B OG  1 
ATOM   5548  N N   . ARG B 1 305 ? 133.26800 125.56400 122.87600 1.000 37.34756  ? 305 ARG B N   1 
ATOM   5549  C CA  . ARG B 1 305 ? 134.00700 126.20100 123.95700 1.000 37.34756  ? 305 ARG B CA  1 
ATOM   5550  C C   . ARG B 1 305 ? 134.02700 127.71400 123.78900 1.000 37.34756  ? 305 ARG B C   1 
ATOM   5551  O O   . ARG B 1 305 ? 133.83900 128.45800 124.75300 1.000 37.34756  ? 305 ARG B O   1 
ATOM   5552  C CB  . ARG B 1 305 ? 135.42600 125.64100 124.02300 1.000 37.34756  ? 305 ARG B CB  1 
ATOM   5553  C CG  . ARG B 1 305 ? 135.50100 124.19600 124.47700 1.000 37.34756  ? 305 ARG B CG  1 
ATOM   5554  C CD  . ARG B 1 305 ? 136.93800 123.76100 124.70300 1.000 37.34756  ? 305 ARG B CD  1 
ATOM   5555  N NE  . ARG B 1 305 ? 137.51100 124.32700 125.92400 1.000 37.34756  ? 305 ARG B NE  1 
ATOM   5556  C CZ  . ARG B 1 305 ? 138.37200 125.34100 125.95600 1.000 37.34756  ? 305 ARG B CZ  1 
ATOM   5557  N NH1 . ARG B 1 305 ? 138.76500 125.92100 124.83100 1.000 37.34756  ? 305 ARG B NH1 1 
ATOM   5558  N NH2 . ARG B 1 305 ? 138.83800 125.77900 127.11700 1.000 37.34756  ? 305 ARG B NH2 1 
ATOM   5559  N N   . THR B 1 306 ? 134.24300 128.18900 122.56600 1.000 32.51207  ? 306 THR B N   1 
ATOM   5560  C CA  . THR B 1 306 ? 134.30500 129.62300 122.32200 1.000 32.51207  ? 306 THR B CA  1 
ATOM   5561  C C   . THR B 1 306 ? 132.92800 130.25400 122.21400 1.000 32.51207  ? 306 THR B C   1 
ATOM   5562  O O   . THR B 1 306 ? 132.80900 131.47500 122.30500 1.000 32.51207  ? 306 THR B O   1 
ATOM   5563  C CB  . THR B 1 306 ? 135.10700 129.88800 121.05300 1.000 32.51207  ? 306 THR B CB  1 
ATOM   5564  O OG1 . THR B 1 306 ? 136.14700 128.91300 120.95500 1.000 32.51207  ? 306 THR B OG1 1 
ATOM   5565  C CG2 . THR B 1 306 ? 135.76400 131.25500 121.09900 1.000 32.51207  ? 306 THR B CG2 1 
ATOM   5566  N N   . ARG B 1 307 ? 131.87700 129.46800 122.04100 1.000 33.36455  ? 307 ARG B N   1 
ATOM   5567  C CA  . ARG B 1 307 ? 130.54100 130.02400 121.91600 1.000 33.36455  ? 307 ARG B CA  1 
ATOM   5568  C C   . ARG B 1 307 ? 129.85600 130.21800 123.25500 1.000 33.36455  ? 307 ARG B C   1 
ATOM   5569  O O   . ARG B 1 307 ? 129.16600 131.21900 123.44800 1.000 33.36455  ? 307 ARG B O   1 
ATOM   5570  C CB  . ARG B 1 307 ? 129.68400 129.12500 121.03400 1.000 33.36455  ? 307 ARG B CB  1 
ATOM   5571  C CG  . ARG B 1 307 ? 128.37700 129.72000 120.60800 1.000 33.36455  ? 307 ARG B CG  1 
ATOM   5572  C CD  . ARG B 1 307 ? 127.70800 128.82700 119.59300 1.000 33.36455  ? 307 ARG B CD  1 
ATOM   5573  N NE  . ARG B 1 307 ? 127.92300 127.41200 119.88000 1.000 33.36455  ? 307 ARG B NE  1 
ATOM   5574  C CZ  . ARG B 1 307 ? 127.17000 126.69100 120.70200 1.000 33.36455  ? 307 ARG B CZ  1 
ATOM   5575  N NH1 . ARG B 1 307 ? 127.44100 125.41200 120.90100 1.000 33.36455  ? 307 ARG B NH1 1 
ATOM   5576  N NH2 . ARG B 1 307 ? 126.14900 127.25100 121.32900 1.000 33.36455  ? 307 ARG B NH2 1 
ATOM   5577  N N   . THR B 1 308 ? 130.03000 129.28800 124.19400 1.000 32.83683  ? 308 THR B N   1 
ATOM   5578  C CA  . THR B 1 308 ? 129.45800 129.49000 125.51900 1.000 32.83683  ? 308 THR B CA  1 
ATOM   5579  C C   . THR B 1 308 ? 130.31500 130.42700 126.35400 1.000 32.83683  ? 308 THR B C   1 
ATOM   5580  O O   . THR B 1 308 ? 129.86700 130.91600 127.39400 1.000 32.83683  ? 308 THR B O   1 
ATOM   5581  C CB  . THR B 1 308 ? 129.27700 128.16100 126.23600 1.000 32.83683  ? 308 THR B CB  1 
ATOM   5582  O OG1 . THR B 1 308 ? 130.55000 127.68600 126.67500 1.000 32.83683  ? 308 THR B OG1 1 
ATOM   5583  C CG2 . THR B 1 308 ? 128.62300 127.14400 125.32700 1.000 32.83683  ? 308 THR B CG2 1 
ATOM   5584  N N   . PHE B 1 309 ? 131.55600 130.67300 125.93700 1.000 30.51155  ? 309 PHE B N   1 
ATOM   5585  C CA  . PHE B 1 309 ? 132.32000 131.75400 126.54200 1.000 30.51155  ? 309 PHE B CA  1 
ATOM   5586  C C   . PHE B 1 309 ? 131.78900 133.10300 126.09300 1.000 30.51155  ? 309 PHE B C   1 
ATOM   5587  O O   . PHE B 1 309 ? 131.71000 134.04200 126.88700 1.000 30.51155  ? 309 PHE B O   1 
ATOM   5588  C CB  . PHE B 1 309 ? 133.79800 131.61900 126.19700 1.000 30.51155  ? 309 PHE B CB  1 
ATOM   5589  C CG  . PHE B 1 309 ? 134.57800 132.89500 126.33800 1.000 30.51155  ? 309 PHE B CG  1 
ATOM   5590  C CD1 . PHE B 1 309 ? 134.78900 133.46800 127.57800 1.000 30.51155  ? 309 PHE B CD1 1 
ATOM   5591  C CD2 . PHE B 1 309 ? 135.12100 133.51000 125.23100 1.000 30.51155  ? 309 PHE B CD2 1 
ATOM   5592  C CE1 . PHE B 1 309 ? 135.50700 134.63100 127.69700 1.000 30.51155  ? 309 PHE B CE1 1 
ATOM   5593  C CE2 . PHE B 1 309 ? 135.84100 134.67400 125.35500 1.000 30.51155  ? 309 PHE B CE2 1 
ATOM   5594  C CZ  . PHE B 1 309 ? 136.03200 135.23200 126.58500 1.000 30.51155  ? 309 PHE B CZ  1 
ATOM   5595  N N   . ARG B 1 310 ? 131.40100 133.21800 124.82500 1.000 30.84412  ? 310 ARG B N   1 
ATOM   5596  C CA  . ARG B 1 310 ? 130.88300 134.48800 124.33800 1.000 30.84412  ? 310 ARG B CA  1 
ATOM   5597  C C   . ARG B 1 310 ? 129.42800 134.68000 124.72900 1.000 30.84412  ? 310 ARG B C   1 
ATOM   5598  O O   . ARG B 1 310 ? 128.87400 135.76100 124.52300 1.000 30.84412  ? 310 ARG B O   1 
ATOM   5599  C CB  . ARG B 1 310 ? 131.03700 134.58000 122.82500 1.000 30.84412  ? 310 ARG B CB  1 
ATOM   5600  C CG  . ARG B 1 310 ? 132.45500 134.71800 122.33300 1.000 30.84412  ? 310 ARG B CG  1 
ATOM   5601  C CD  . ARG B 1 310 ? 133.18500 135.84200 123.00300 1.000 30.84412  ? 310 ARG B CD  1 
ATOM   5602  N NE  . ARG B 1 310 ? 132.72300 137.13900 122.54200 1.000 30.84412  ? 310 ARG B NE  1 
ATOM   5603  C CZ  . ARG B 1 310 ? 133.38700 137.89700 121.68500 1.000 30.84412  ? 310 ARG B CZ  1 
ATOM   5604  N NH1 . ARG B 1 310 ? 134.53600 137.47900 121.18900 1.000 30.84412  ? 310 ARG B NH1 1 
ATOM   5605  N NH2 . ARG B 1 310 ? 132.90100 139.06900 121.32000 1.000 30.84412  ? 310 ARG B NH2 1 
ATOM   5606  N N   . ASP B 1 311 ? 128.78900 133.64300 125.26700 1.000 32.92744  ? 311 ASP B N   1 
ATOM   5607  C CA  . ASP B 1 311 ? 127.45700 133.80400 125.83500 1.000 32.92744  ? 311 ASP B CA  1 
ATOM   5608  C C   . ASP B 1 311 ? 127.52700 134.41200 127.22600 1.000 32.92744  ? 311 ASP B C   1 
ATOM   5609  O O   . ASP B 1 311 ? 126.68600 135.23900 127.59200 1.000 32.92744  ? 311 ASP B O   1 
ATOM   5610  C CB  . ASP B 1 311 ? 126.74400 132.45800 125.88900 1.000 32.92744  ? 311 ASP B CB  1 
ATOM   5611  C CG  . ASP B 1 311 ? 125.77000 132.27000 124.75400 1.000 32.92744  ? 311 ASP B CG  1 
ATOM   5612  O OD1 . ASP B 1 311 ? 125.60400 133.21500 123.95900 1.000 32.92744  ? 311 ASP B OD1 1 
ATOM   5613  O OD2 . ASP B 1 311 ? 125.16800 131.18100 124.65500 1.000 32.92744  ? 311 ASP B OD2 1 
ATOM   5614  N N   . SER B 1 312 ? 128.51800 134.00400 128.01900 1.000 30.93426  ? 312 SER B N   1 
ATOM   5615  C CA  . SER B 1 312 ? 128.61300 134.46800 129.39700 1.000 30.93426  ? 312 SER B CA  1 
ATOM   5616  C C   . SER B 1 312 ? 129.22100 135.85800 129.47700 1.000 30.93426  ? 312 SER B C   1 
ATOM   5617  O O   . SER B 1 312 ? 128.96900 136.59300 130.43500 1.000 30.93426  ? 312 SER B O   1 
ATOM   5618  C CB  . SER B 1 312 ? 129.43100 133.48400 130.22100 1.000 30.93426  ? 312 SER B CB  1 
ATOM   5619  O OG  . SER B 1 312 ? 130.80200 133.60500 129.91300 1.000 30.93426  ? 312 SER B OG  1 
ATOM   5620  N N   . VAL B 1 313 ? 130.04300 136.22900 128.49800 1.000 29.58173  ? 313 VAL B N   1 
ATOM   5621  C CA  . VAL B 1 313 ? 130.52200 137.60500 128.41200 1.000 29.58173  ? 313 VAL B CA  1 
ATOM   5622  C C   . VAL B 1 313 ? 129.38500 138.52700 128.00300 1.000 29.58173  ? 313 VAL B C   1 
ATOM   5623  O O   . VAL B 1 313 ? 129.24100 139.63500 128.53100 1.000 29.58173  ? 313 VAL B O   1 
ATOM   5624  C CB  . VAL B 1 313 ? 131.71200 137.68300 127.44100 1.000 29.58173  ? 313 VAL B CB  1 
ATOM   5625  C CG1 . VAL B 1 313 ? 132.00100 139.09800 127.02800 1.000 29.58173  ? 313 VAL B CG1 1 
ATOM   5626  C CG2 . VAL B 1 313 ? 132.92300 137.10800 128.09400 1.000 29.58173  ? 313 VAL B CG2 1 
ATOM   5627  N N   . ARG B 1 314 ? 128.53700 138.06500 127.08600 1.000 31.96209  ? 314 ARG B N   1 
ATOM   5628  C CA  . ARG B 1 314 ? 127.38700 138.84900 126.65500 1.000 31.96209  ? 314 ARG B CA  1 
ATOM   5629  C C   . ARG B 1 314 ? 126.37700 139.01300 127.77800 1.000 31.96209  ? 314 ARG B C   1 
ATOM   5630  O O   . ARG B 1 314 ? 125.79400 140.08800 127.94600 1.000 31.96209  ? 314 ARG B O   1 
ATOM   5631  C CB  . ARG B 1 314 ? 126.74300 138.18100 125.44600 1.000 31.96209  ? 314 ARG B CB  1 
ATOM   5632  C CG  . ARG B 1 314 ? 125.47800 138.82800 124.94900 1.000 31.96209  ? 314 ARG B CG  1 
ATOM   5633  C CD  . ARG B 1 314 ? 124.99700 138.16000 123.67800 1.000 31.96209  ? 314 ARG B CD  1 
ATOM   5634  N NE  . ARG B 1 314 ? 124.66900 136.75400 123.88700 1.000 31.96209  ? 314 ARG B NE  1 
ATOM   5635  C CZ  . ARG B 1 314 ? 124.00200 136.00900 123.01300 1.000 31.96209  ? 314 ARG B CZ  1 
ATOM   5636  N NH1 . ARG B 1 314 ? 123.58800 136.53700 121.87400 1.000 31.96209  ? 314 ARG B NH1 1 
ATOM   5637  N NH2 . ARG B 1 314 ? 123.74200 134.73900 123.27900 1.000 31.96209  ? 314 ARG B NH2 1 
ATOM   5638  N N   . ALA B 1 315 ? 126.18000 137.96700 128.58000 1.000 33.23207  ? 315 ALA B N   1 
ATOM   5639  C CA  . ALA B 1 315 ? 125.19900 138.03400 129.65400 1.000 33.23207  ? 315 ALA B CA  1 
ATOM   5640  C C   . ALA B 1 315 ? 125.67500 138.90200 130.80600 1.000 33.23207  ? 315 ALA B C   1 
ATOM   5641  O O   . ALA B 1 315 ? 124.85300 139.40200 131.57700 1.000 33.23207  ? 315 ALA B O   1 
ATOM   5642  C CB  . ALA B 1 315 ? 124.87300 136.63200 130.15400 1.000 33.23207  ? 315 ALA B CB  1 
ATOM   5643  N N   . ALA B 1 316 ? 126.98200 139.09000 130.94700 1.000 33.44570  ? 316 ALA B N   1 
ATOM   5644  C CA  . ALA B 1 316 ? 127.53100 139.96700 131.97000 1.000 33.44570  ? 316 ALA B CA  1 
ATOM   5645  C C   . ALA B 1 316 ? 127.77200 141.37900 131.47000 1.000 33.44570  ? 316 ALA B C   1 
ATOM   5646  O O   . ALA B 1 316 ? 128.14500 142.24100 132.26600 1.000 33.44570  ? 316 ALA B O   1 
ATOM   5647  C CB  . ALA B 1 316 ? 128.83800 139.40000 132.51400 1.000 33.44570  ? 316 ALA B CB  1 
ATOM   5648  N N   . SER B 1 317 ? 127.60000 141.62900 130.17800 1.000 36.19479  ? 317 SER B N   1 
ATOM   5649  C CA  . SER B 1 317 ? 127.56400 142.98800 129.66500 1.000 36.19479  ? 317 SER B CA  1 
ATOM   5650  C C   . SER B 1 317 ? 126.14500 143.50400 129.52400 1.000 36.19479  ? 317 SER B C   1 
ATOM   5651  O O   . SER B 1 317 ? 125.93400 144.71900 129.49400 1.000 36.19479  ? 317 SER B O   1 
ATOM   5652  C CB  . SER B 1 317 ? 128.27300 143.06700 128.31700 1.000 36.19479  ? 317 SER B CB  1 
ATOM   5653  O OG  . SER B 1 317 ? 129.67300 143.06000 128.49200 1.000 36.19479  ? 317 SER B OG  1 
ATOM   5654  N N   . GLU B 1 318 ? 125.16800 142.60400 129.42000 1.000 39.81060  ? 318 GLU B N   1 
ATOM   5655  C CA  . GLU B 1 318 ? 123.77700 143.01600 129.53800 1.000 39.81060  ? 318 GLU B CA  1 
ATOM   5656  C C   . GLU B 1 318 ? 123.43900 143.38200 130.97200 1.000 39.81060  ? 318 GLU B C   1 
ATOM   5657  O O   . GLU B 1 318 ? 122.59500 144.24900 131.21500 1.000 39.81060  ? 318 GLU B O   1 
ATOM   5658  C CB  . GLU B 1 318 ? 122.85100 141.90500 129.05700 1.000 39.81060  ? 318 GLU B CB  1 
ATOM   5659  C CG  . GLU B 1 318 ? 122.70600 141.80900 127.56000 1.000 39.81060  ? 318 GLU B CG  1 
ATOM   5660  C CD  . GLU B 1 318 ? 122.22900 140.44400 127.11800 1.000 39.81060  ? 318 GLU B CD  1 
ATOM   5661  O OE1 . GLU B 1 318 ? 122.54500 140.03800 125.98200 1.000 39.81060  ? 318 GLU B OE1 1 
ATOM   5662  O OE2 . GLU B 1 318 ? 121.53800 139.77400 127.91400 1.000 39.81060  ? 318 GLU B OE2 1 
ATOM   5663  N N   . PHE B 1 319 ? 124.07800 142.72400 131.93600 1.000 39.94847  ? 319 PHE B N   1 
ATOM   5664  C CA  . PHE B 1 319 ? 123.77500 142.99400 133.33400 1.000 39.94847  ? 319 PHE B CA  1 
ATOM   5665  C C   . PHE B 1 319 ? 124.38200 144.31200 133.78500 1.000 39.94847  ? 319 PHE B C   1 
ATOM   5666  O O   . PHE B 1 319 ? 123.77100 145.05300 134.55900 1.000 39.94847  ? 319 PHE B O   1 
ATOM   5667  C CB  . PHE B 1 319 ? 124.27700 141.85100 134.21100 1.000 39.94847  ? 319 PHE B CB  1 
ATOM   5668  C CG  . PHE B 1 319 ? 124.12900 142.11000 135.67400 1.000 39.94847  ? 319 PHE B CG  1 
ATOM   5669  C CD1 . PHE B 1 319 ? 122.88900 142.04000 136.27200 1.000 39.94847  ? 319 PHE B CD1 1 
ATOM   5670  C CD2 . PHE B 1 319 ? 125.22700 142.42700 136.45200 1.000 39.94847  ? 319 PHE B CD2 1 
ATOM   5671  C CE1 . PHE B 1 319 ? 122.74400 142.27900 137.61400 1.000 39.94847  ? 319 PHE B CE1 1 
ATOM   5672  C CE2 . PHE B 1 319 ? 125.08500 142.67300 137.79500 1.000 39.94847  ? 319 PHE B CE2 1 
ATOM   5673  C CZ  . PHE B 1 319 ? 123.84300 142.59900 138.37500 1.000 39.94847  ? 319 PHE B CZ  1 
ATOM   5674  N N   . ALA B 1 320 ? 125.58300 144.61900 133.32500 1.000 43.00924  ? 320 ALA B N   1 
ATOM   5675  C CA  . ALA B 1 320 ? 126.24700 145.84100 133.74400 1.000 43.00924  ? 320 ALA B CA  1 
ATOM   5676  C C   . ALA B 1 320 ? 125.81600 147.05200 132.94100 1.000 43.00924  ? 320 ALA B C   1 
ATOM   5677  O O   . ALA B 1 320 ? 126.33500 148.14500 133.17300 1.000 43.00924  ? 320 ALA B O   1 
ATOM   5678  C CB  . ALA B 1 320 ? 127.75900 145.67300 133.64500 1.000 43.00924  ? 320 ALA B CB  1 
ATOM   5679  N N   . SER B 1 321 ? 124.89900 146.88800 131.99700 1.000 44.75056  ? 321 SER B N   1 
ATOM   5680  C CA  . SER B 1 321 ? 124.36800 147.99800 131.22600 1.000 44.75056  ? 321 SER B CA  1 
ATOM   5681  C C   . SER B 1 321 ? 122.94000 148.34400 131.59000 1.000 44.75056  ? 321 SER B C   1 
ATOM   5682  O O   . SER B 1 321 ? 122.54500 149.49900 131.44900 1.000 44.75056  ? 321 SER B O   1 
ATOM   5683  C CB  . SER B 1 321 ? 124.43200 147.68900 129.72900 1.000 44.75056  ? 321 SER B CB  1 
ATOM   5684  O OG  . SER B 1 321 ? 123.85100 148.73400 128.97700 1.000 44.75056  ? 321 SER B OG  1 
ATOM   5685  N N   . ARG B 1 322 ? 122.16000 147.36700 132.04800 1.000 44.12069  ? 322 ARG B N   1 
ATOM   5686  C CA  . ARG B 1 322 ? 120.81800 147.65700 132.52900 1.000 44.12069  ? 322 ARG B CA  1 
ATOM   5687  C C   . ARG B 1 322 ? 120.85200 148.40700 133.84600 1.000 44.12069  ? 322 ARG B C   1 
ATOM   5688  O O   . ARG B 1 322 ? 119.99100 149.25500 134.10100 1.000 44.12069  ? 322 ARG B O   1 
ATOM   5689  C CB  . ARG B 1 322 ? 120.03200 146.36500 132.69700 1.000 44.12069  ? 322 ARG B CB  1 
ATOM   5690  C CG  . ARG B 1 322 ? 119.51700 145.78400 131.41400 1.000 44.12069  ? 322 ARG B CG  1 
ATOM   5691  C CD  . ARG B 1 322 ? 118.53300 144.69200 131.71500 1.000 44.12069  ? 322 ARG B CD  1 
ATOM   5692  N NE  . ARG B 1 322 ? 119.14700 143.64500 132.51600 1.000 44.12069  ? 322 ARG B NE  1 
ATOM   5693  C CZ  . ARG B 1 322 ? 119.30600 142.39600 132.10100 1.000 44.12069  ? 322 ARG B CZ  1 
ATOM   5694  N NH1 . ARG B 1 322 ? 118.88500 142.04200 130.89700 1.000 44.12069  ? 322 ARG B NH1 1 
ATOM   5695  N NH2 . ARG B 1 322 ? 119.87700 141.49900 132.89100 1.000 44.12069  ? 322 ARG B NH2 1 
ATOM   5696  N N   . ASN B 1 323 ? 121.83200 148.11100 134.69400 1.000 44.98113  ? 323 ASN B N   1 
ATOM   5697  C CA  . ASN B 1 323 ? 121.91600 148.68100 136.02700 1.000 44.98113  ? 323 ASN B CA  1 
ATOM   5698  C C   . ASN B 1 323 ? 122.79900 149.91400 136.08800 1.000 44.98113  ? 323 ASN B C   1 
ATOM   5699  O O   . ASN B 1 323 ? 122.96100 150.48100 137.17200 1.000 44.98113  ? 323 ASN B O   1 
ATOM   5700  C CB  . ASN B 1 323 ? 122.41300 147.62600 137.00500 1.000 44.98113  ? 323 ASN B CB  1 
ATOM   5701  C CG  . ASN B 1 323 ? 121.56400 146.38900 136.97700 1.000 44.98113  ? 323 ASN B CG  1 
ATOM   5702  O OD1 . ASN B 1 323 ? 120.60600 146.30700 136.22000 1.000 44.98113  ? 323 ASN B OD1 1 
ATOM   5703  N ND2 . ASN B 1 323 ? 121.90400 145.41900 137.80000 1.000 44.98113  ? 323 ASN B ND2 1 
ATOM   5704  N N   . GLN B 1 324 ? 123.35400 150.33300 134.94400 1.000 50.09222  ? 324 GLN B N   1 
ATOM   5705  C CA  . GLN B 1 324 ? 124.17000 151.54500 134.79700 1.000 50.09222  ? 324 GLN B CA  1 
ATOM   5706  C C   . GLN B 1 324 ? 125.36300 151.54000 135.74600 1.000 50.09222  ? 324 GLN B C   1 
ATOM   5707  O O   . GLN B 1 324 ? 125.60800 152.50300 136.47200 1.000 50.09222  ? 324 GLN B O   1 
ATOM   5708  C CB  . GLN B 1 324 ? 123.32600 152.80600 134.98100 1.000 50.09222  ? 324 GLN B CB  1 
ATOM   5709  C CG  . GLN B 1 324 ? 122.04900 152.81500 134.16300 1.000 50.09222  ? 324 GLN B CG  1 
ATOM   5710  C CD  . GLN B 1 324 ? 121.09700 153.90900 134.58800 1.000 50.09222  ? 324 GLN B CD  1 
ATOM   5711  O OE1 . GLN B 1 324 ? 121.46600 154.81100 135.33800 1.000 50.09222  ? 324 GLN B OE1 1 
ATOM   5712  N NE2 . GLN B 1 324 ? 119.86200 153.83400 134.11700 1.000 50.09222  ? 324 GLN B NE2 1 
ATOM   5713  N N   . LEU B 1 325 ? 126.09200 150.42800 135.75000 1.000 49.97016  ? 325 LEU B N   1 
ATOM   5714  C CA  . LEU B 1 325 ? 127.23300 150.26900 136.63400 1.000 49.97016  ? 325 LEU B CA  1 
ATOM   5715  C C   . LEU B 1 325 ? 128.36400 151.20200 136.20600 1.000 49.97016  ? 325 LEU B C   1 
ATOM   5716  O O   . LEU B 1 325 ? 128.47100 151.55500 135.02900 1.000 49.97016  ? 325 LEU B O   1 
ATOM   5717  C CB  . LEU B 1 325 ? 127.71300 148.82100 136.61200 1.000 49.97016  ? 325 LEU B CB  1 
ATOM   5718  C CG  . LEU B 1 325 ? 126.95600 147.85400 137.51100 1.000 49.97016  ? 325 LEU B CG  1 
ATOM   5719  C CD1 . LEU B 1 325 ? 127.51100 146.46300 137.37000 1.000 49.97016  ? 325 LEU B CD1 1 
ATOM   5720  C CD2 . LEU B 1 325 ? 127.06100 148.31200 138.93100 1.000 49.97016  ? 325 LEU B CD2 1 
ATOM   5721  N N   . PRO B 1 326 ? 129.20300 151.64300 137.14100 1.000 53.85663  ? 326 PRO B N   1 
ATOM   5722  C CA  . PRO B 1 326 ? 130.36800 152.43800 136.75100 1.000 53.85663  ? 326 PRO B CA  1 
ATOM   5723  C C   . PRO B 1 326 ? 131.39400 151.58300 136.03600 1.000 53.85663  ? 326 PRO B C   1 
ATOM   5724  O O   . PRO B 1 326 ? 131.39000 150.35500 136.13000 1.000 53.85663  ? 326 PRO B O   1 
ATOM   5725  C CB  . PRO B 1 326 ? 130.91000 152.95700 138.08500 1.000 53.85663  ? 326 PRO B CB  1 
ATOM   5726  C CG  . PRO B 1 326 ? 130.41600 152.00300 139.08600 1.000 53.85663  ? 326 PRO B CG  1 
ATOM   5727  C CD  . PRO B 1 326 ? 129.07900 151.54800 138.60400 1.000 53.85663  ? 326 PRO B CD  1 
ATOM   5728  N N   . HIS B 1 327 ? 132.29300 152.25600 135.31700 1.000 55.37873  ? 327 HIS B N   1 
ATOM   5729  C CA  . HIS B 1 327 ? 133.28100 151.54500 134.51800 1.000 55.37873  ? 327 HIS B CA  1 
ATOM   5730  C C   . HIS B 1 327 ? 134.34200 150.87500 135.37800 1.000 55.37873  ? 327 HIS B C   1 
ATOM   5731  O O   . HIS B 1 327 ? 135.05600 149.99000 134.90300 1.000 55.37873  ? 327 HIS B O   1 
ATOM   5732  C CB  . HIS B 1 327 ? 133.93700 152.50400 133.52900 1.000 55.37873  ? 327 HIS B CB  1 
ATOM   5733  C CG  . HIS B 1 327 ? 134.52200 151.82400 132.33300 1.000 55.37873  ? 327 HIS B CG  1 
ATOM   5734  N ND1 . HIS B 1 327 ? 133.75500 151.39500 131.27200 1.000 55.37873  ? 327 HIS B ND1 1 
ATOM   5735  C CD2 . HIS B 1 327 ? 135.79800 151.48500 132.03600 1.000 55.37873  ? 327 HIS B CD2 1 
ATOM   5736  C CE1 . HIS B 1 327 ? 134.53300 150.82700 130.37000 1.000 55.37873  ? 327 HIS B CE1 1 
ATOM   5737  N NE2 . HIS B 1 327 ? 135.77800 150.86700 130.80900 1.000 55.37873  ? 327 HIS B NE2 1 
ATOM   5738  N N   . ASP B 1 328 ? 134.46400 151.27600 136.63900 1.000 56.62936  ? 328 ASP B N   1 
ATOM   5739  C CA  . ASP B 1 328 ? 135.50300 150.74000 137.50400 1.000 56.62936  ? 328 ASP B CA  1 
ATOM   5740  C C   . ASP B 1 328 ? 135.13700 149.40100 138.12700 1.000 56.62936  ? 328 ASP B C   1 
ATOM   5741  O O   . ASP B 1 328 ? 136.02000 148.74000 138.68000 1.000 56.62936  ? 328 ASP B O   1 
ATOM   5742  C CB  . ASP B 1 328 ? 135.83300 151.75200 138.60000 1.000 56.62936  ? 328 ASP B CB  1 
ATOM   5743  C CG  . ASP B 1 328 ? 136.21200 153.11000 138.03900 1.000 56.62936  ? 328 ASP B CG  1 
ATOM   5744  O OD1 . ASP B 1 328 ? 137.38000 153.52100 138.20600 1.000 56.62936  ? 328 ASP B OD1 1 
ATOM   5745  O OD2 . ASP B 1 328 ? 135.34500 153.76500 137.42100 1.000 56.62936  ? 328 ASP B OD2 1 
ATOM   5746  N N   . ILE B 1 329 ? 133.87500 148.98900 138.06200 1.000 50.73448  ? 329 ILE B N   1 
ATOM   5747  C CA  . ILE B 1 329 ? 133.45300 147.68100 138.53600 1.000 50.73448  ? 329 ILE B CA  1 
ATOM   5748  C C   . ILE B 1 329 ? 133.03800 146.78000 137.37700 1.000 50.73448  ? 329 ILE B C   1 
ATOM   5749  O O   . ILE B 1 329 ? 133.06200 145.55300 137.49300 1.000 50.73448  ? 329 ILE B O   1 
ATOM   5750  C CB  . ILE B 1 329 ? 132.32400 147.82300 139.58800 1.000 50.73448  ? 329 ILE B CB  1 
ATOM   5751  C CG1 . ILE B 1 329 ? 132.02200 146.50600 140.30800 1.000 50.73448  ? 329 ILE B CG1 1 
ATOM   5752  C CG2 . ILE B 1 329 ? 131.06300 148.35800 138.96700 1.000 50.73448  ? 329 ILE B CG2 1 
ATOM   5753  C CD1 . ILE B 1 329 ? 133.22800 145.88200 140.96000 1.000 50.73448  ? 329 ILE B CD1 1 
ATOM   5754  N N   . GLN B 1 330 ? 132.72200 147.37200 136.22600 1.000 49.55493  ? 330 GLN B N   1 
ATOM   5755  C CA  . GLN B 1 330 ? 132.45500 146.57500 135.03700 1.000 49.55493  ? 330 GLN B CA  1 
ATOM   5756  C C   . GLN B 1 330 ? 133.72900 145.93200 134.50800 1.000 49.55493  ? 330 GLN B C   1 
ATOM   5757  O O   . GLN B 1 330 ? 133.69100 144.83000 133.95400 1.000 49.55493  ? 330 GLN B O   1 
ATOM   5758  C CB  . GLN B 1 330 ? 131.80800 147.44600 133.97000 1.000 49.55493  ? 330 GLN B CB  1 
ATOM   5759  C CG  . GLN B 1 330 ? 131.23900 146.67800 132.81400 1.000 49.55493  ? 330 GLN B CG  1 
ATOM   5760  C CD  . GLN B 1 330 ? 130.39400 147.54600 131.92200 1.000 49.55493  ? 330 GLN B CD  1 
ATOM   5761  O OE1 . GLN B 1 330 ? 130.44100 148.77200 132.00800 1.000 49.55493  ? 330 GLN B OE1 1 
ATOM   5762  N NE2 . GLN B 1 330 ? 129.61400 146.91800 131.05200 1.000 49.55493  ? 330 GLN B NE2 1 
ATOM   5763  N N   . ASP B 1 331 ? 134.87200 146.59600 134.68300 1.000 49.73894  ? 331 ASP B N   1 
ATOM   5764  C CA  . ASP B 1 331 ? 136.13200 146.01100 134.23800 1.000 49.73894  ? 331 ASP B CA  1 
ATOM   5765  C C   . ASP B 1 331 ? 136.58100 144.88600 135.15600 1.000 49.73894  ? 331 ASP B C   1 
ATOM   5766  O O   . ASP B 1 331 ? 137.36500 144.02400 134.74900 1.000 49.73894  ? 331 ASP B O   1 
ATOM   5767  C CB  . ASP B 1 331 ? 137.21800 147.07500 134.15300 1.000 49.73894  ? 331 ASP B CB  1 
ATOM   5768  C CG  . ASP B 1 331 ? 136.88600 148.16100 133.17200 1.000 49.73894  ? 331 ASP B CG  1 
ATOM   5769  O OD1 . ASP B 1 331 ? 137.60300 149.18300 133.15500 1.000 49.73894  ? 331 ASP B OD1 1 
ATOM   5770  O OD2 . ASP B 1 331 ? 135.90600 147.99800 132.41900 1.000 49.73894  ? 331 ASP B OD2 1 
ATOM   5771  N N   . GLN B 1 332 ? 136.12100 144.88500 136.40300 1.000 45.65086  ? 332 GLN B N   1 
ATOM   5772  C CA  . GLN B 1 332 ? 136.51900 143.82100 137.31200 1.000 45.65086  ? 332 GLN B CA  1 
ATOM   5773  C C   . GLN B 1 332 ? 135.74900 142.54300 137.03300 1.000 45.65086  ? 332 GLN B C   1 
ATOM   5774  O O   . GLN B 1 332 ? 136.26600 141.44200 137.24500 1.000 45.65086  ? 332 GLN B O   1 
ATOM   5775  C CB  . GLN B 1 332 ? 136.31600 144.25900 138.75700 1.000 45.65086  ? 332 GLN B CB  1 
ATOM   5776  C CG  . GLN B 1 332 ? 137.39900 145.16200 139.28000 1.000 45.65086  ? 332 GLN B CG  1 
ATOM   5777  C CD  . GLN B 1 332 ? 137.27100 145.38700 140.76000 1.000 45.65086  ? 332 GLN B CD  1 
ATOM   5778  O OE1 . GLN B 1 332 ? 136.56600 144.65300 141.44800 1.000 45.65086  ? 332 GLN B OE1 1 
ATOM   5779  N NE2 . GLN B 1 332 ? 137.94500 146.40900 141.26300 1.000 45.65086  ? 332 GLN B NE2 1 
ATOM   5780  N N   . MET B 1 333 ? 134.51200 142.66300 136.55900 1.000 40.43254  ? 333 MET B N   1 
ATOM   5781  C CA  . MET B 1 333 ? 133.72500 141.47300 136.28200 1.000 40.43254  ? 333 MET B CA  1 
ATOM   5782  C C   . MET B 1 333 ? 133.95500 140.93900 134.88100 1.000 40.43254  ? 333 MET B C   1 
ATOM   5783  O O   . MET B 1 333 ? 133.61000 139.78900 134.61500 1.000 40.43254  ? 333 MET B O   1 
ATOM   5784  C CB  . MET B 1 333 ? 132.23600 141.75100 136.49600 1.000 40.43254  ? 333 MET B CB  1 
ATOM   5785  C CG  . MET B 1 333 ? 131.57400 142.53700 135.39900 1.000 40.43254  ? 333 MET B CG  1 
ATOM   5786  S SD  . MET B 1 333 ? 129.87400 142.95900 135.78800 1.000 40.43254  ? 333 MET B SD  1 
ATOM   5787  C CE  . MET B 1 333 ? 129.26600 141.37900 136.34500 1.000 40.43254  ? 333 MET B CE  1 
ATOM   5788  N N   . LEU B 1 334 ? 134.53300 141.73400 133.98700 1.000 37.96747  ? 334 LEU B N   1 
ATOM   5789  C CA  . LEU B 1 334 ? 134.79000 141.27500 132.63000 1.000 37.96747  ? 334 LEU B CA  1 
ATOM   5790  C C   . LEU B 1 334 ? 136.20200 140.74400 132.46500 1.000 37.96747  ? 334 LEU B C   1 
ATOM   5791  O O   . LEU B 1 334 ? 136.43200 139.85500 131.64400 1.000 37.96747  ? 334 LEU B O   1 
ATOM   5792  C CB  . LEU B 1 334 ? 134.54300 142.40400 131.63400 1.000 37.96747  ? 334 LEU B CB  1 
ATOM   5793  C CG  . LEU B 1 334 ? 133.09900 142.53400 131.17300 1.000 37.96747  ? 334 LEU B CG  1 
ATOM   5794  C CD1 . LEU B 1 334 ? 132.95200 143.73300 130.27600 1.000 37.96747  ? 334 LEU B CD1 1 
ATOM   5795  C CD2 . LEU B 1 334 ? 132.68000 141.28200 130.45300 1.000 37.96747  ? 334 LEU B CD2 1 
ATOM   5796  N N   . SER B 1 335 ? 137.15700 141.27300 133.22700 1.000 38.05739  ? 335 SER B N   1 
ATOM   5797  C CA  . SER B 1 335 ? 138.50000 140.71200 133.20700 1.000 38.05739  ? 335 SER B CA  1 
ATOM   5798  C C   . SER B 1 335 ? 138.56100 139.39000 133.94600 1.000 38.05739  ? 335 SER B C   1 
ATOM   5799  O O   . SER B 1 335 ? 139.49400 138.61100 133.74200 1.000 38.05739  ? 335 SER B O   1 
ATOM   5800  C CB  . SER B 1 335 ? 139.49500 141.69000 133.81600 1.000 38.05739  ? 335 SER B CB  1 
ATOM   5801  O OG  . SER B 1 335 ? 139.27800 142.99700 133.32700 1.000 38.05739  ? 335 SER B OG  1 
ATOM   5802  N N   . HIS B 1 336 ? 137.58900 139.11800 134.81400 1.000 37.26542  ? 336 HIS B N   1 
ATOM   5803  C CA  . HIS B 1 336 ? 137.60600 137.85900 135.54100 1.000 37.26542  ? 336 HIS B CA  1 
ATOM   5804  C C   . HIS B 1 336 ? 137.07600 136.71800 134.68800 1.000 37.26542  ? 336 HIS B C   1 
ATOM   5805  O O   . HIS B 1 336 ? 137.56100 135.58800 134.79600 1.000 37.26542  ? 336 HIS B O   1 
ATOM   5806  C CB  . HIS B 1 336 ? 136.80000 137.97300 136.82600 1.000 37.26542  ? 336 HIS B CB  1 
ATOM   5807  C CG  . HIS B 1 336 ? 136.75200 136.69800 137.60300 1.000 37.26542  ? 336 HIS B CG  1 
ATOM   5808  N ND1 . HIS B 1 336 ? 137.80600 136.26100 138.37300 1.000 37.26542  ? 336 HIS B ND1 1 
ATOM   5809  C CD2 . HIS B 1 336 ? 135.79400 135.74800 137.69900 1.000 37.26542  ? 336 HIS B CD2 1 
ATOM   5810  C CE1 . HIS B 1 336 ? 137.49300 135.10300 138.92400 1.000 37.26542  ? 336 HIS B CE1 1 
ATOM   5811  N NE2 . HIS B 1 336 ? 136.27700 134.77000 138.53200 1.000 37.26542  ? 336 HIS B NE2 1 
ATOM   5812  N N   . ILE B 1 337 ? 136.07300 136.98500 133.84800 1.000 33.85713  ? 337 ILE B N   1 
ATOM   5813  C CA  . ILE B 1 337 ? 135.52300 135.94800 132.97700 1.000 33.85713  ? 337 ILE B CA  1 
ATOM   5814  C C   . ILE B 1 337 ? 136.53500 135.56200 131.91000 1.000 33.85713  ? 337 ILE B C   1 
ATOM   5815  O O   . ILE B 1 337 ? 136.65900 134.38800 131.54300 1.000 33.85713  ? 337 ILE B O   1 
ATOM   5816  C CB  . ILE B 1 337 ? 134.19800 136.42700 132.35900 1.000 33.85713  ? 337 ILE B CB  1 
ATOM   5817  C CG1 . ILE B 1 337 ? 133.20100 136.75400 133.45300 1.000 33.85713  ? 337 ILE B CG1 1 
ATOM   5818  C CG2 . ILE B 1 337 ? 133.58700 135.36900 131.48400 1.000 33.85713  ? 337 ILE B CG2 1 
ATOM   5819  C CD1 . ILE B 1 337 ? 131.96700 137.40600 132.94600 1.000 33.85713  ? 337 ILE B CD1 1 
ATOM   5820  N N   . CYS B 1 338 ? 137.29900 136.53800 131.42200 1.000 34.19377  ? 338 CYS B N   1 
ATOM   5821  C CA  . CYS B 1 338 ? 138.29700 136.26700 130.39600 1.000 34.19377  ? 338 CYS B CA  1 
ATOM   5822  C C   . CYS B 1 338 ? 139.46100 135.46100 130.95300 1.000 34.19377  ? 338 CYS B C   1 
ATOM   5823  O O   . CYS B 1 338 ? 140.05400 134.64300 130.24700 1.000 34.19377  ? 338 CYS B O   1 
ATOM   5824  C CB  . CYS B 1 338 ? 138.79600 137.57900 129.80500 1.000 34.19377  ? 338 CYS B CB  1 
ATOM   5825  S SG  . CYS B 1 338 ? 137.55800 138.47300 128.87900 1.000 34.19377  ? 338 CYS B SG  1 
ATOM   5826  N N   . LEU B 1 339 ? 139.80800 135.68200 132.22000 1.000 32.78261  ? 339 LEU B N   1 
ATOM   5827  C CA  . LEU B 1 339 ? 140.92700 134.95200 132.80500 1.000 32.78261  ? 339 LEU B CA  1 
ATOM   5828  C C   . LEU B 1 339 ? 140.48500 133.59700 133.33500 1.000 32.78261  ? 339 LEU B C   1 
ATOM   5829  O O   . LEU B 1 339 ? 141.29000 132.66500 133.42000 1.000 32.78261  ? 339 LEU B O   1 
ATOM   5830  C CB  . LEU B 1 339 ? 141.57800 135.77600 133.90900 1.000 32.78261  ? 339 LEU B CB  1 
ATOM   5831  C CG  . LEU B 1 339 ? 142.93400 135.30300 134.42600 1.000 32.78261  ? 339 LEU B CG  1 
ATOM   5832  C CD1 . LEU B 1 339 ? 143.83300 134.87600 133.30500 1.000 32.78261  ? 339 LEU B CD1 1 
ATOM   5833  C CD2 . LEU B 1 339 ? 143.59000 136.39600 135.18100 1.000 32.78261  ? 339 LEU B CD2 1 
ATOM   5834  N N   . LYS B 1 340 ? 139.21100 133.46400 133.69800 1.000 34.63004  ? 340 LYS B N   1 
ATOM   5835  C CA  . LYS B 1 340 ? 138.69700 132.15700 134.08600 1.000 34.63004  ? 340 LYS B CA  1 
ATOM   5836  C C   . LYS B 1 340 ? 138.61200 131.23000 132.88400 1.000 34.63004  ? 340 LYS B C   1 
ATOM   5837  O O   . LYS B 1 340 ? 138.73900 130.01100 133.02100 1.000 34.63004  ? 340 LYS B O   1 
ATOM   5838  C CB  . LYS B 1 340 ? 137.33000 132.30900 134.74400 1.000 34.63004  ? 340 LYS B CB  1 
ATOM   5839  C CG  . LYS B 1 340 ? 136.85900 131.09500 135.49900 1.000 34.63004  ? 340 LYS B CG  1 
ATOM   5840  C CD  . LYS B 1 340 ? 135.50400 131.34500 136.12000 1.000 34.63004  ? 340 LYS B CD  1 
ATOM   5841  C CE  . LYS B 1 340 ? 134.93700 130.07900 136.72100 1.000 34.63004  ? 340 LYS B CE  1 
ATOM   5842  N NZ  . LYS B 1 340 ? 133.59200 130.30000 137.30900 1.000 34.63004  ? 340 LYS B NZ  1 
ATOM   5843  N N   . PHE B 1 341 ? 138.41200 131.79000 131.69500 1.000 33.07013  ? 341 PHE B N   1 
ATOM   5844  C CA  . PHE B 1 341 ? 138.35200 130.97000 130.49400 1.000 33.07013  ? 341 PHE B CA  1 
ATOM   5845  C C   . PHE B 1 341 ? 139.74000 130.54000 130.04800 1.000 33.07013  ? 341 PHE B C   1 
ATOM   5846  O O   . PHE B 1 341 ? 139.91500 129.43200 129.53300 1.000 33.07013  ? 341 PHE B O   1 
ATOM   5847  C CB  . PHE B 1 341 ? 137.64600 131.73800 129.38400 1.000 33.07013  ? 341 PHE B CB  1 
ATOM   5848  C CG  . PHE B 1 341 ? 137.56200 130.99300 128.09100 1.000 33.07013  ? 341 PHE B CG  1 
ATOM   5849  C CD1 . PHE B 1 341 ? 136.73600 129.89200 127.96400 1.000 33.07013  ? 341 PHE B CD1 1 
ATOM   5850  C CD2 . PHE B 1 341 ? 138.30200 131.40100 126.99500 1.000 33.07013  ? 341 PHE B CD2 1 
ATOM   5851  C CE1 . PHE B 1 341 ? 136.65600 129.20900 126.77600 1.000 33.07013  ? 341 PHE B CE1 1 
ATOM   5852  C CE2 . PHE B 1 341 ? 138.22300 130.72000 125.80300 1.000 33.07013  ? 341 PHE B CE2 1 
ATOM   5853  C CZ  . PHE B 1 341 ? 137.39900 129.62300 125.69600 1.000 33.07013  ? 341 PHE B CZ  1 
ATOM   5854  N N   . LYS B 1 342 ? 140.73800 131.40300 130.23100 1.000 33.10062  ? 342 LYS B N   1 
ATOM   5855  C CA  . LYS B 1 342 ? 142.08600 131.08200 129.77900 1.000 33.10062  ? 342 LYS B CA  1 
ATOM   5856  C C   . LYS B 1 342 ? 142.72700 130.02100 130.65300 1.000 33.10062  ? 342 LYS B C   1 
ATOM   5857  O O   . LYS B 1 342 ? 143.52000 129.20700 130.17100 1.000 33.10062  ? 342 LYS B O   1 
ATOM   5858  C CB  . LYS B 1 342 ? 142.95400 132.33300 129.77900 1.000 33.10062  ? 342 LYS B CB  1 
ATOM   5859  C CG  . LYS B 1 342 ? 142.95900 133.09600 128.48800 1.000 33.10062  ? 342 LYS B CG  1 
ATOM   5860  C CD  . LYS B 1 342 ? 143.50700 134.49000 128.69800 1.000 33.10062  ? 342 LYS B CD  1 
ATOM   5861  C CE  . LYS B 1 342 ? 144.89600 134.45900 129.30400 1.000 33.10062  ? 342 LYS B CE  1 
ATOM   5862  N NZ  . LYS B 1 342 ? 145.35400 135.82500 129.67000 1.000 33.10062  ? 342 LYS B NZ  1 
ATOM   5863  N N   . THR B 1 343 ? 142.40500 130.01700 131.94300 1.000 36.40262  ? 343 THR B N   1 
ATOM   5864  C CA  . THR B 1 343 ? 143.10100 129.18100 132.90800 1.000 36.40262  ? 343 THR B CA  1 
ATOM   5865  C C   . THR B 1 343 ? 142.25800 128.01900 133.41000 1.000 36.40262  ? 343 THR B C   1 
ATOM   5866  O O   . THR B 1 343 ? 142.72900 126.88500 133.43500 1.000 36.40262  ? 343 THR B O   1 
ATOM   5867  C CB  . THR B 1 343 ? 143.56200 130.02700 134.09300 1.000 36.40262  ? 343 THR B CB  1 
ATOM   5868  O OG1 . THR B 1 343 ? 142.42100 130.48200 134.82100 1.000 36.40262  ? 343 THR B OG1 1 
ATOM   5869  C CG2 . THR B 1 343 ? 144.34100 131.21900 133.60700 1.000 36.40262  ? 343 THR B CG2 1 
ATOM   5870  N N   . GLU B 1 344 ? 141.02500 128.27200 133.82200 1.000 39.53353  ? 344 GLU B N   1 
ATOM   5871  C CA  . GLU B 1 344 ? 140.19700 127.22200 134.39800 1.000 39.53353  ? 344 GLU B CA  1 
ATOM   5872  C C   . GLU B 1 344 ? 139.38400 126.47800 133.36800 1.000 39.53353  ? 344 GLU B C   1 
ATOM   5873  O O   . GLU B 1 344 ? 138.49600 125.71600 133.75200 1.000 39.53353  ? 344 GLU B O   1 
ATOM   5874  C CB  . GLU B 1 344 ? 139.26700 127.80100 135.46500 1.000 39.53353  ? 344 GLU B CB  1 
ATOM   5875  N N   . GLY B 1 345 ? 139.66100 126.67100 132.08500 1.000 40.74771  ? 345 GLY B N   1 
ATOM   5876  C CA  . GLY B 1 345 ? 138.89600 125.98600 131.06200 1.000 40.74771  ? 345 GLY B CA  1 
ATOM   5877  C C   . GLY B 1 345 ? 137.47800 126.50600 130.98500 1.000 40.74771  ? 345 GLY B C   1 
ATOM   5878  O O   . GLY B 1 345 ? 137.21300 127.69900 131.15400 1.000 40.74771  ? 345 GLY B O   1 
ATOM   5879  N N   . LEU B 1 346 ? 136.54400 125.59500 130.74000 1.000 45.02937  ? 346 LEU B N   1 
ATOM   5880  C CA  . LEU B 1 346 ? 135.13100 125.93100 130.65800 1.000 45.02937  ? 346 LEU B CA  1 
ATOM   5881  C C   . LEU B 1 346 ? 134.33400 125.28600 131.78200 1.000 45.02937  ? 346 LEU B C   1 
ATOM   5882  O O   . LEU B 1 346 ? 133.60700 125.97200 132.50400 1.000 45.02937  ? 346 LEU B O   1 
ATOM   5883  C CB  . LEU B 1 346 ? 134.57300 125.51000 129.29500 1.000 45.02937  ? 346 LEU B CB  1 
ATOM   5884  C CG  . LEU B 1 346 ? 133.20600 126.08200 128.94100 1.000 45.02937  ? 346 LEU B CG  1 
ATOM   5885  C CD1 . LEU B 1 346 ? 133.34100 127.53700 128.56200 1.000 45.02937  ? 346 LEU B CD1 1 
ATOM   5886  C CD2 . LEU B 1 346 ? 132.57700 125.28400 127.81800 1.000 45.02937  ? 346 LEU B CD2 1 
ATOM   5887  N N   . LYS B 1 347 ? 134.45300 123.97000 131.95000 1.000 49.67290  ? 347 LYS B N   1 
ATOM   5888  C CA  . LYS B 1 347 ? 133.76100 123.24300 133.01600 1.000 49.67290  ? 347 LYS B CA  1 
ATOM   5889  C C   . LYS B 1 347 ? 134.81400 122.41300 133.74500 1.000 49.67290  ? 347 LYS B C   1 
ATOM   5890  O O   . LYS B 1 347 ? 135.03800 121.24600 133.41500 1.000 49.67290  ? 347 LYS B O   1 
ATOM   5891  C CB  . LYS B 1 347 ? 132.64100 122.37800 132.46000 1.000 49.67290  ? 347 LYS B CB  1 
ATOM   5892  N N   . GLN B 1 348 ? 135.46400 123.02900 134.72900 1.000 47.97750  ? 348 GLN B N   1 
ATOM   5893  C CA  . GLN B 1 348 ? 136.45200 122.34100 135.54800 1.000 47.97750  ? 348 GLN B CA  1 
ATOM   5894  C C   . GLN B 1 348 ? 135.83900 121.84900 136.85300 1.000 47.97750  ? 348 GLN B C   1 
ATOM   5895  O O   . GLN B 1 348 ? 136.19300 120.77400 137.34600 1.000 47.97750  ? 348 GLN B O   1 
ATOM   5896  C CB  . GLN B 1 348 ? 137.63600 123.26900 135.82100 1.000 47.97750  ? 348 GLN B CB  1 
ATOM   5897  C CG  . GLN B 1 348 ? 138.68500 122.69800 136.73500 1.000 47.97750  ? 348 GLN B CG  1 
ATOM   5898  C CD  . GLN B 1 348 ? 139.73300 123.70600 137.11000 1.000 47.97750  ? 348 GLN B CD  1 
ATOM   5899  O OE1 . GLN B 1 348 ? 140.61300 124.02400 136.31600 1.000 47.97750  ? 348 GLN B OE1 1 
ATOM   5900  N NE2 . GLN B 1 348 ? 139.64500 124.22500 138.32700 1.000 47.97750  ? 348 GLN B NE2 1 
ATOM   5901  N N   . GLN B 1 349 ? 134.90200 122.61400 137.41300 1.000 49.22859  ? 349 GLN B N   1 
ATOM   5902  C CA  . GLN B 1 349 ? 134.22300 122.17300 138.62300 1.000 49.22859  ? 349 GLN B CA  1 
ATOM   5903  C C   . GLN B 1 349 ? 133.31100 120.99000 138.34900 1.000 49.22859  ? 349 GLN B C   1 
ATOM   5904  O O   . GLN B 1 349 ? 133.10000 120.15500 139.23100 1.000 49.22859  ? 349 GLN B O   1 
ATOM   5905  C CB  . GLN B 1 349 ? 133.42700 123.32500 139.23400 1.000 49.22859  ? 349 GLN B CB  1 
ATOM   5906  N N   . GLU B 1 350 ? 132.76600 120.89300 137.13700 1.000 48.22904  ? 350 GLU B N   1 
ATOM   5907  C CA  . GLU B 1 350 ? 131.98000 119.72200 136.77700 1.000 48.22904  ? 350 GLU B CA  1 
ATOM   5908  C C   . GLU B 1 350 ? 132.85700 118.54200 136.39800 1.000 48.22904  ? 350 GLU B C   1 
ATOM   5909  O O   . GLU B 1 350 ? 132.37400 117.40900 136.38200 1.000 48.22904  ? 350 GLU B O   1 
ATOM   5910  C CB  . GLU B 1 350 ? 131.02900 120.05300 135.63000 1.000 48.22904  ? 350 GLU B CB  1 
ATOM   5911  N N   . THR B 1 351 ? 134.12900 118.78200 136.08400 1.000 47.42131  ? 351 THR B N   1 
ATOM   5912  C CA  . THR B 1 351 ? 135.04700 117.69500 135.77100 1.000 47.42131  ? 351 THR B CA  1 
ATOM   5913  C C   . THR B 1 351 ? 135.39500 116.89800 137.01700 1.000 47.42131  ? 351 THR B C   1 
ATOM   5914  O O   . THR B 1 351 ? 135.20300 115.68000 137.05800 1.000 47.42131  ? 351 THR B O   1 
ATOM   5915  C CB  . THR B 1 351 ? 136.31900 118.25100 135.13100 1.000 47.42131  ? 351 THR B CB  1 
ATOM   5916  O OG1 . THR B 1 351 ? 136.01600 118.75100 133.82500 1.000 47.42131  ? 351 THR B OG1 1 
ATOM   5917  C CG2 . THR B 1 351 ? 137.38700 117.17800 135.02700 1.000 47.42131  ? 351 THR B CG2 1 
ATOM   5918  N N   . LEU B 1 352 ? 135.89800 117.57600 138.04600 1.000 48.01072  ? 352 LEU B N   1 
ATOM   5919  C CA  . LEU B 1 352 ? 136.32200 116.93700 139.28200 1.000 48.01072  ? 352 LEU B CA  1 
ATOM   5920  C C   . LEU B 1 352 ? 135.23600 116.93400 140.34900 1.000 48.01072  ? 352 LEU B C   1 
ATOM   5921  O O   . LEU B 1 352 ? 135.54100 116.90000 141.54300 1.000 48.01072  ? 352 LEU B O   1 
ATOM   5922  C CB  . LEU B 1 352 ? 137.60900 117.58900 139.78700 1.000 48.01072  ? 352 LEU B CB  1 
ATOM   5923  C CG  . LEU B 1 352 ? 137.74800 119.10900 139.86900 1.000 48.01072  ? 352 LEU B CG  1 
ATOM   5924  C CD1 . LEU B 1 352 ? 137.22600 119.70700 141.16200 1.000 48.01072  ? 352 LEU B CD1 1 
ATOM   5925  C CD2 . LEU B 1 352 ? 139.20300 119.46500 139.67400 1.000 48.01072  ? 352 LEU B CD2 1 
ATOM   5926  N N   . ASN B 1 353 ? 133.97400 116.97200 139.94500 1.000 50.09644  ? 353 ASN B N   1 
ATOM   5927  C CA  . ASN B 1 353 ? 132.87300 116.58000 140.80500 1.000 50.09644  ? 353 ASN B CA  1 
ATOM   5928  C C   . ASN B 1 353 ? 132.39200 115.17800 140.49200 1.000 50.09644  ? 353 ASN B C   1 
ATOM   5929  O O   . ASN B 1 353 ? 131.42700 114.71500 141.10200 1.000 50.09644  ? 353 ASN B O   1 
ATOM   5930  C CB  . ASN B 1 353 ? 131.70600 117.55800 140.67100 1.000 50.09644  ? 353 ASN B CB  1 
ATOM   5931  C CG  . ASN B 1 353 ? 131.77000 118.68300 141.67600 1.000 50.09644  ? 353 ASN B CG  1 
ATOM   5932  O OD1 . ASN B 1 353 ? 132.48000 118.59800 142.67300 1.000 50.09644  ? 353 ASN B OD1 1 
ATOM   5933  N ND2 . ASN B 1 353 ? 131.02200 119.74700 141.41900 1.000 50.09644  ? 353 ASN B ND2 1 
ATOM   5934  N N   . ASN B 1 354 ? 133.03000 114.50500 139.53600 1.000 49.65232  ? 354 ASN B N   1 
ATOM   5935  C CA  . ASN B 1 354 ? 132.69500 113.13900 139.17700 1.000 49.65232  ? 354 ASN B CA  1 
ATOM   5936  C C   . ASN B 1 354 ? 133.75400 112.13000 139.58400 1.000 49.65232  ? 354 ASN B C   1 
ATOM   5937  O O   . ASN B 1 354 ? 133.45700 110.93400 139.61600 1.000 49.65232  ? 354 ASN B O   1 
ATOM   5938  C CB  . ASN B 1 354 ? 132.46100 113.02800 137.66600 1.000 49.65232  ? 354 ASN B CB  1 
ATOM   5939  C CG  . ASN B 1 354 ? 131.20500 113.73600 137.22200 1.000 49.65232  ? 354 ASN B CG  1 
ATOM   5940  O OD1 . ASN B 1 354 ? 131.26100 114.73400 136.51100 1.000 49.65232  ? 354 ASN B OD1 1 
ATOM   5941  N ND2 . ASN B 1 354 ? 130.05800 113.21800 137.63700 1.000 49.65232  ? 354 ASN B ND2 1 
ATOM   5942  N N   . LEU B 1 355 ? 134.97000 112.57400 139.87300 1.000 48.91823  ? 355 LEU B N   1 
ATOM   5943  C CA  . LEU B 1 355 ? 135.97200 111.68400 140.43200 1.000 48.91823  ? 355 LEU B CA  1 
ATOM   5944  C C   . LEU B 1 355 ? 135.55900 111.28800 141.84600 1.000 48.91823  ? 355 LEU B C   1 
ATOM   5945  O O   . LEU B 1 355 ? 135.09900 112.14300 142.61100 1.000 48.91823  ? 355 LEU B O   1 
ATOM   5946  C CB  . LEU B 1 355 ? 137.33100 112.37100 140.44300 1.000 48.91823  ? 355 LEU B CB  1 
ATOM   5947  C CG  . LEU B 1 355 ? 137.72700 112.92300 139.08600 1.000 48.91823  ? 355 LEU B CG  1 
ATOM   5948  C CD1 . LEU B 1 355 ? 138.84600 113.92300 139.25200 1.000 48.91823  ? 355 LEU B CD1 1 
ATOM   5949  C CD2 . LEU B 1 355 ? 138.14400 111.78400 138.18700 1.000 48.91823  ? 355 LEU B CD2 1 
ATOM   5950  N N   . PRO B 1 356 ? 135.67700 110.00000 142.21500 1.000 48.35897  ? 356 PRO B N   1 
ATOM   5951  C CA  . PRO B 1 356 ? 134.92600 109.48700 143.37100 1.000 48.35897  ? 356 PRO B CA  1 
ATOM   5952  C C   . PRO B 1 356 ? 135.26500 110.05000 144.75000 1.000 48.35897  ? 356 PRO B C   1 
ATOM   5953  O O   . PRO B 1 356 ? 134.47100 110.82300 145.29300 1.000 48.35897  ? 356 PRO B O   1 
ATOM   5954  C CB  . PRO B 1 356 ? 135.22800 107.98400 143.32000 1.000 48.35897  ? 356 PRO B CB  1 
ATOM   5955  C CG  . PRO B 1 356 ? 136.48900 107.86900 142.54200 1.000 48.35897  ? 356 PRO B CG  1 
ATOM   5956  C CD  . PRO B 1 356 ? 136.45100 108.94900 141.54000 1.000 48.35897  ? 356 PRO B CD  1 
ATOM   5957  N N   . LYS B 1 357 ? 136.40700 109.69400 145.33600 1.000 50.29732  ? 357 LYS B N   1 
ATOM   5958  C CA  . LYS B 1 357 ? 136.83100 110.34500 146.57000 1.000 50.29732  ? 357 LYS B CA  1 
ATOM   5959  C C   . LYS B 1 357 ? 138.34200 110.44200 146.66900 1.000 50.29732  ? 357 LYS B C   1 
ATOM   5960  O O   . LYS B 1 357 ? 138.87300 111.32400 147.34700 1.000 50.29732  ? 357 LYS B O   1 
ATOM   5961  C CB  . LYS B 1 357 ? 136.27500 109.60400 147.78500 1.000 50.29732  ? 357 LYS B CB  1 
ATOM   5962  N N   . ALA B 1 358 ? 139.04000 109.52600 146.00800 1.000 50.23896  ? 358 ALA B N   1 
ATOM   5963  C CA  . ALA B 1 358 ? 140.47100 109.36300 146.19300 1.000 50.23896  ? 358 ALA B CA  1 
ATOM   5964  C C   . ALA B 1 358 ? 141.28100 109.73300 144.97100 1.000 50.23896  ? 358 ALA B C   1 
ATOM   5965  O O   . ALA B 1 358 ? 142.48700 109.94400 145.08700 1.000 50.23896  ? 358 ALA B O   1 
ATOM   5966  C CB  . ALA B 1 358 ? 140.79600 107.91900 146.58100 1.000 50.23896  ? 358 ALA B CB  1 
ATOM   5967  N N   . ILE B 1 359 ? 140.65200 109.79000 143.79800 1.000 49.39468  ? 359 ILE B N   1 
ATOM   5968  C CA  . ILE B 1 359 ? 141.29700 110.42400 142.65700 1.000 49.39468  ? 359 ILE B CA  1 
ATOM   5969  C C   . ILE B 1 359 ? 141.35600 111.92300 142.87900 1.000 49.39468  ? 359 ILE B C   1 
ATOM   5970  O O   . ILE B 1 359 ? 142.34800 112.57800 142.54600 1.000 49.39468  ? 359 ILE B O   1 
ATOM   5971  C CB  . ILE B 1 359 ? 140.55900 110.07700 141.35300 1.000 49.39468  ? 359 ILE B CB  1 
ATOM   5972  C CG1 . ILE B 1 359 ? 140.17300 108.59900 141.31600 1.000 49.39468  ? 359 ILE B CG1 1 
ATOM   5973  C CG2 . ILE B 1 359 ? 141.41500 110.42600 140.16600 1.000 49.39468  ? 359 ILE B CG2 1 
ATOM   5974  C CD1 . ILE B 1 359 ? 141.33700 107.66200 141.16900 1.000 49.39468  ? 359 ILE B CD1 1 
ATOM   5975  N N   . ARG B 1 360 ? 140.29900 112.48400 143.46700 1.000 51.72384  ? 360 ARG B N   1 
ATOM   5976  C CA  . ARG B 1 360 ? 140.24600 113.91800 143.71900 1.000 51.72384  ? 360 ARG B CA  1 
ATOM   5977  C C   . ARG B 1 360 ? 141.19400 114.32000 144.83800 1.000 51.72384  ? 360 ARG B C   1 
ATOM   5978  O O   . ARG B 1 360 ? 141.88300 115.34000 144.74600 1.000 51.72384  ? 360 ARG B O   1 
ATOM   5979  C CB  . ARG B 1 360 ? 138.82000 114.32300 144.05900 1.000 51.72384  ? 360 ARG B CB  1 
ATOM   5980  C CG  . ARG B 1 360 ? 138.48600 115.74500 143.71800 1.000 51.72384  ? 360 ARG B CG  1 
ATOM   5981  C CD  . ARG B 1 360 ? 137.14500 116.09800 144.29700 1.000 51.72384  ? 360 ARG B CD  1 
ATOM   5982  N NE  . ARG B 1 360 ? 136.19900 115.00500 144.11500 1.000 51.72384  ? 360 ARG B NE  1 
ATOM   5983  C CZ  . ARG B 1 360 ? 135.01200 114.94400 144.70400 1.000 51.72384  ? 360 ARG B CZ  1 
ATOM   5984  N NH1 . ARG B 1 360 ? 134.62400 115.91600 145.51600 1.000 51.72384  ? 360 ARG B NH1 1 
ATOM   5985  N NH2 . ARG B 1 360 ? 134.21300 113.91000 144.48200 1.000 51.72384  ? 360 ARG B NH2 1 
ATOM   5986  N N   . SER B 1 361 ? 141.24600 113.52700 145.90800 1.000 50.76801  ? 361 SER B N   1 
ATOM   5987  C CA  . SER B 1 361 ? 142.10900 113.84000 147.03800 1.000 50.76801  ? 361 SER B CA  1 
ATOM   5988  C C   . SER B 1 361 ? 143.56900 113.51800 146.77800 1.000 50.76801  ? 361 SER B C   1 
ATOM   5989  O O   . SER B 1 361 ? 144.41500 113.88800 147.59400 1.000 50.76801  ? 361 SER B O   1 
ATOM   5990  C CB  . SER B 1 361 ? 141.63800 113.09000 148.27800 1.000 50.76801  ? 361 SER B CB  1 
ATOM   5991  O OG  . SER B 1 361 ? 140.36300 113.54600 148.68400 1.000 50.76801  ? 361 SER B OG  1 
ATOM   5992  N N   . SER B 1 362 ? 143.88800 112.82800 145.69000 1.000 50.88933  ? 362 SER B N   1 
ATOM   5993  C CA  . SER B 1 362 ? 145.27700 112.66100 145.29500 1.000 50.88933  ? 362 SER B CA  1 
ATOM   5994  C C   . SER B 1 362 ? 145.71600 113.71400 144.29500 1.000 50.88933  ? 362 SER B C   1 
ATOM   5995  O O   . SER B 1 362 ? 146.91900 113.93900 144.13300 1.000 50.88933  ? 362 SER B O   1 
ATOM   5996  C CB  . SER B 1 362 ? 145.49900 111.27200 144.70300 1.000 50.88933  ? 362 SER B CB  1 
ATOM   5997  O OG  . SER B 1 362 ? 146.87600 110.95200 144.67500 1.000 50.88933  ? 362 SER B OG  1 
ATOM   5998  N N   . ILE B 1 363 ? 144.76700 114.34300 143.60200 1.000 50.57769  ? 363 ILE B N   1 
ATOM   5999  C CA  . ILE B 1 363 ? 145.08600 115.51000 142.78500 1.000 50.57769  ? 363 ILE B CA  1 
ATOM   6000  C C   . ILE B 1 363 ? 145.49700 116.66600 143.68300 1.000 50.57769  ? 363 ILE B C   1 
ATOM   6001  O O   . ILE B 1 363 ? 146.52000 117.32200 143.45800 1.000 50.57769  ? 363 ILE B O   1 
ATOM   6002  C CB  . ILE B 1 363 ? 143.88700 115.88000 141.89300 1.000 50.57769  ? 363 ILE B CB  1 
ATOM   6003  C CG1 . ILE B 1 363 ? 143.76600 114.90900 140.72700 1.000 50.57769  ? 363 ILE B CG1 1 
ATOM   6004  C CG2 . ILE B 1 363 ? 144.01700 117.28100 141.35400 1.000 50.57769  ? 363 ILE B CG2 1 
ATOM   6005  C CD1 . ILE B 1 363 ? 142.40000 114.89400 140.11400 1.000 50.57769  ? 363 ILE B CD1 1 
ATOM   6006  N N   . ALA B 1 364 ? 144.74200 116.88100 144.76200 1.000 53.09802  ? 364 ALA B N   1 
ATOM   6007  C CA  . ALA B 1 364 ? 145.00800 117.99000 145.66700 1.000 53.09802  ? 364 ALA B CA  1 
ATOM   6008  C C   . ALA B 1 364 ? 146.17800 117.72900 146.60900 1.000 53.09802  ? 364 ALA B C   1 
ATOM   6009  O O   . ALA B 1 364 ? 146.44900 118.56200 147.47400 1.000 53.09802  ? 364 ALA B O   1 
ATOM   6010  C CB  . ALA B 1 364 ? 143.75400 118.30200 146.47800 1.000 53.09802  ? 364 ALA B CB  1 
ATOM   6011  N N   . ASN B 1 365 ? 146.86500 116.59500 146.48300 1.000 55.43010  ? 365 ASN B N   1 
ATOM   6012  C CA  . ASN B 1 365 ? 148.04200 116.33000 147.29900 1.000 55.43010  ? 365 ASN B CA  1 
ATOM   6013  C C   . ASN B 1 365 ? 149.32000 116.36700 146.48000 1.000 55.43010  ? 365 ASN B C   1 
ATOM   6014  O O   . ASN B 1 365 ? 150.40400 116.53500 147.04000 1.000 55.43010  ? 365 ASN B O   1 
ATOM   6015  C CB  . ASN B 1 365 ? 147.92000 114.97900 148.00200 1.000 55.43010  ? 365 ASN B CB  1 
ATOM   6016  C CG  . ASN B 1 365 ? 146.96600 115.02000 149.16800 1.000 55.43010  ? 365 ASN B CG  1 
ATOM   6017  O OD1 . ASN B 1 365 ? 146.60200 113.98700 149.72500 1.000 55.43010  ? 365 ASN B OD1 1 
ATOM   6018  N ND2 . ASN B 1 365 ? 146.54300 116.21600 149.53800 1.000 55.43010  ? 365 ASN B ND2 1 
ATOM   6019  N N   . TYR B 1 366 ? 149.23300 116.17400 145.16800 1.000 55.09177  ? 366 TYR B N   1 
ATOM   6020  C CA  . TYR B 1 366 ? 150.35600 116.56300 144.32800 1.000 55.09177  ? 366 TYR B CA  1 
ATOM   6021  C C   . TYR B 1 366 ? 150.36600 118.06900 144.14500 1.000 55.09177  ? 366 TYR B C   1 
ATOM   6022  O O   . TYR B 1 366 ? 151.42600 118.70300 144.16400 1.000 55.09177  ? 366 TYR B O   1 
ATOM   6023  C CB  . TYR B 1 366 ? 150.28700 115.85700 142.97500 1.000 55.09177  ? 366 TYR B CB  1 
ATOM   6024  C CG  . TYR B 1 366 ? 151.44200 116.19600 142.06400 1.000 55.09177  ? 366 TYR B CG  1 
ATOM   6025  C CD1 . TYR B 1 366 ? 151.30600 117.14300 141.05800 1.000 55.09177  ? 366 TYR B CD1 1 
ATOM   6026  C CD2 . TYR B 1 366 ? 152.66900 115.57100 142.21300 1.000 55.09177  ? 366 TYR B CD2 1 
ATOM   6027  C CE1 . TYR B 1 366 ? 152.35900 117.46200 140.23300 1.000 55.09177  ? 366 TYR B CE1 1 
ATOM   6028  C CE2 . TYR B 1 366 ? 153.73000 115.87900 141.38700 1.000 55.09177  ? 366 TYR B CE2 1 
ATOM   6029  C CZ  . TYR B 1 366 ? 153.56800 116.82500 140.39900 1.000 55.09177  ? 366 TYR B CZ  1 
ATOM   6030  O OH  . TYR B 1 366 ? 154.62300 117.13700 139.57400 1.000 55.09177  ? 366 TYR B OH  1 
ATOM   6031  N N   . LEU B 1 367 ? 149.18800 118.65100 143.97200 1.000 54.46687  ? 367 LEU B N   1 
ATOM   6032  C CA  . LEU B 1 367 ? 149.03000 120.08000 143.77200 1.000 54.46687  ? 367 LEU B CA  1 
ATOM   6033  C C   . LEU B 1 367 ? 148.94000 120.76800 145.12300 1.000 54.46687  ? 367 LEU B C   1 
ATOM   6034  O O   . LEU B 1 367 ? 148.17000 120.33700 145.98700 1.000 54.46687  ? 367 LEU B O   1 
ATOM   6035  C CB  . LEU B 1 367 ? 147.76900 120.36300 142.96200 1.000 54.46687  ? 367 LEU B CB  1 
ATOM   6036  C CG  . LEU B 1 367 ? 147.85300 120.66800 141.47800 1.000 54.46687  ? 367 LEU B CG  1 
ATOM   6037  C CD1 . LEU B 1 367 ? 148.62300 119.59800 140.76000 1.000 54.46687  ? 367 LEU B CD1 1 
ATOM   6038  C CD2 . LEU B 1 367 ? 146.44600 120.74700 140.95200 1.000 54.46687  ? 367 LEU B CD2 1 
ATOM   6039  N N   . PHE B 1 368 ? 149.70500 121.85200 145.27500 1.000 58.26467  ? 368 PHE B N   1 
ATOM   6040  C CA  . PHE B 1 368 ? 149.70700 122.79200 146.41200 1.000 58.26467  ? 368 PHE B CA  1 
ATOM   6041  C C   . PHE B 1 368 ? 149.70700 122.12300 147.79300 1.000 58.26467  ? 368 PHE B C   1 
ATOM   6042  O O   . PHE B 1 368 ? 149.13700 122.63500 148.75500 1.000 58.26467  ? 368 PHE B O   1 
ATOM   6043  C CB  . PHE B 1 368 ? 148.57200 123.83200 146.30200 1.000 58.26467  ? 368 PHE B CB  1 
ATOM   6044  C CG  . PHE B 1 368 ? 147.18600 123.26700 146.08000 1.000 58.26467  ? 368 PHE B CG  1 
ATOM   6045  C CD1 . PHE B 1 368 ? 146.42700 122.79200 147.13600 1.000 58.26467  ? 368 PHE B CD1 1 
ATOM   6046  C CD2 . PHE B 1 368 ? 146.63300 123.25000 144.80800 1.000 58.26467  ? 368 PHE B CD2 1 
ATOM   6047  C CE1 . PHE B 1 368 ? 145.16100 122.29100 146.92500 1.000 58.26467  ? 368 PHE B CE1 1 
ATOM   6048  C CE2 . PHE B 1 368 ? 145.36900 122.74100 144.59500 1.000 58.26467  ? 368 PHE B CE2 1 
ATOM   6049  C CZ  . PHE B 1 368 ? 144.63000 122.27100 145.65400 1.000 58.26467  ? 368 PHE B CZ  1 
ATOM   6050  N N   . PHE B 1 369 ? 150.37400 120.97700 147.89900 1.000 60.99844  ? 369 PHE B N   1 
ATOM   6051  C CA  . PHE B 1 369 ? 150.63600 120.42100 149.22400 1.000 60.99844  ? 369 PHE B CA  1 
ATOM   6052  C C   . PHE B 1 369 ? 151.84500 121.06300 149.90100 1.000 60.99844  ? 369 PHE B C   1 
ATOM   6053  O O   . PHE B 1 369 ? 151.76000 121.33800 151.10100 1.000 60.99844  ? 369 PHE B O   1 
ATOM   6054  C CB  . PHE B 1 369 ? 150.79500 118.90300 149.18400 1.000 60.99844  ? 369 PHE B CB  1 
ATOM   6055  C CG  . PHE B 1 369 ? 151.25100 118.30900 150.48100 1.000 60.99844  ? 369 PHE B CG  1 
ATOM   6056  C CD1 . PHE B 1 369 ? 150.39000 118.24100 151.56100 1.000 60.99844  ? 369 PHE B CD1 1 
ATOM   6057  C CD2 . PHE B 1 369 ? 152.53500 117.80100 150.61800 1.000 60.99844  ? 369 PHE B CD2 1 
ATOM   6058  C CE1 . PHE B 1 369 ? 150.80100 117.68800 152.75400 1.000 60.99844  ? 369 PHE B CE1 1 
ATOM   6059  C CE2 . PHE B 1 369 ? 152.95300 117.24700 151.81200 1.000 60.99844  ? 369 PHE B CE2 1 
ATOM   6060  C CZ  . PHE B 1 369 ? 152.08500 117.19000 152.88000 1.000 60.99844  ? 369 PHE B CZ  1 
ATOM   6061  N N   . PRO B 1 370 ? 152.99900 121.34600 149.21300 1.000 60.84527  ? 370 PRO B N   1 
ATOM   6062  C CA  . PRO B 1 370 ? 154.02600 122.14900 149.89300 1.000 60.84527  ? 370 PRO B CA  1 
ATOM   6063  C C   . PRO B 1 370 ? 153.76300 123.64500 149.84500 1.000 60.84527  ? 370 PRO B C   1 
ATOM   6064  O O   . PRO B 1 370 ? 154.68000 124.44200 150.05100 1.000 60.84527  ? 370 PRO B O   1 
ATOM   6065  C CB  . PRO B 1 370 ? 155.31400 121.79100 149.14100 1.000 60.84527  ? 370 PRO B CB  1 
ATOM   6066  C CG  . PRO B 1 370 ? 154.99800 120.55300 148.39800 1.000 60.84527  ? 370 PRO B CG  1 
ATOM   6067  C CD  . PRO B 1 370 ? 153.58800 120.74500 148.00000 1.000 60.84527  ? 370 PRO B CD  1 
ATOM   6068  N N   . ILE B 1 371 ? 152.53300 124.04000 149.53900 1.000 58.23529  ? 371 ILE B N   1 
ATOM   6069  C CA  . ILE B 1 371 ? 152.11400 125.43100 149.61600 1.000 58.23529  ? 371 ILE B CA  1 
ATOM   6070  C C   . ILE B 1 371 ? 151.45000 125.65200 150.96500 1.000 58.23529  ? 371 ILE B C   1 
ATOM   6071  O O   . ILE B 1 371 ? 151.72900 126.63800 151.65500 1.000 58.23529  ? 371 ILE B O   1 
ATOM   6072  C CB  . ILE B 1 371 ? 151.17200 125.78400 148.45300 1.000 58.23529  ? 371 ILE B CB  1 
ATOM   6073  C CG1 . ILE B 1 371 ? 151.93100 125.71200 147.13400 1.000 58.23529  ? 371 ILE B CG1 1 
ATOM   6074  C CG2 . ILE B 1 371 ? 150.58400 127.16600 148.63400 1.000 58.23529  ? 371 ILE B CG2 1 
ATOM   6075  C CD1 . ILE B 1 371 ? 153.12100 126.63100 147.07500 1.000 58.23529  ? 371 ILE B CD1 1 
ATOM   6076  N N   . VAL B 1 372 ? 150.59100 124.71900 151.36600 1.000 57.43080  ? 372 VAL B N   1 
ATOM   6077  C CA  . VAL B 1 372 ? 149.86700 124.82400 152.62700 1.000 57.43080  ? 372 VAL B CA  1 
ATOM   6078  C C   . VAL B 1 372 ? 150.72900 124.22800 153.73300 1.000 57.43080  ? 372 VAL B C   1 
ATOM   6079  O O   . VAL B 1 372 ? 150.41400 124.35200 154.92100 1.000 57.43080  ? 372 VAL B O   1 
ATOM   6080  C CB  . VAL B 1 372 ? 148.49700 124.12800 152.53100 1.000 57.43080  ? 372 VAL B CB  1 
ATOM   6081  C CG1 . VAL B 1 372 ? 148.64200 122.63500 152.70500 1.000 57.43080  ? 372 VAL B CG1 1 
ATOM   6082  C CG2 . VAL B 1 372 ? 147.50600 124.70400 153.52400 1.000 57.43080  ? 372 VAL B CG2 1 
ATOM   6083  N N   . HIS B 1 373 ? 151.83500 123.59000 153.35400 1.000 62.99560  ? 373 HIS B N   1 
ATOM   6084  C CA  . HIS B 1 373 ? 152.71000 122.98200 154.34900 1.000 62.99560  ? 373 HIS B CA  1 
ATOM   6085  C C   . HIS B 1 373 ? 153.51000 124.03400 155.10300 1.000 62.99560  ? 373 HIS B C   1 
ATOM   6086  O O   . HIS B 1 373 ? 153.35800 124.19500 156.31700 1.000 62.99560  ? 373 HIS B O   1 
ATOM   6087  C CB  . HIS B 1 373 ? 153.65300 121.98800 153.68100 1.000 62.99560  ? 373 HIS B CB  1 
ATOM   6088  C CG  . HIS B 1 373 ? 154.53200 121.25600 154.64100 1.000 62.99560  ? 373 HIS B CG  1 
ATOM   6089  N ND1 . HIS B 1 373 ? 154.03500 120.40200 155.59900 1.000 62.99560  ? 373 HIS B ND1 1 
ATOM   6090  C CD2 . HIS B 1 373 ? 155.87700 121.24900 154.79000 1.000 62.99560  ? 373 HIS B CD2 1 
ATOM   6091  C CE1 . HIS B 1 373 ? 155.03600 119.89900 156.29900 1.000 62.99560  ? 373 HIS B CE1 1 
ATOM   6092  N NE2 . HIS B 1 373 ? 156.16400 120.39700 155.82800 1.000 62.99560  ? 373 HIS B NE2 1 
ATOM   6093  N N   . ASN B 1 374 ? 154.35900 124.77200 154.39700 1.000 62.13327  ? 374 ASN B N   1 
ATOM   6094  C CA  . ASN B 1 374 ? 155.32600 125.64700 155.05100 1.000 62.13327  ? 374 ASN B CA  1 
ATOM   6095  C C   . ASN B 1 374 ? 154.81300 127.08600 155.08500 1.000 62.13327  ? 374 ASN B C   1 
ATOM   6096  O O   . ASN B 1 374 ? 155.38100 128.00300 154.49700 1.000 62.13327  ? 374 ASN B O   1 
ATOM   6097  C CB  . ASN B 1 374 ? 156.68400 125.53600 154.36500 1.000 62.13327  ? 374 ASN B CB  1 
ATOM   6098  C CG  . ASN B 1 374 ? 156.58900 125.59200 152.85800 1.000 62.13327  ? 374 ASN B CG  1 
ATOM   6099  O OD1 . ASN B 1 374 ? 155.57800 126.00900 152.30300 1.000 62.13327  ? 374 ASN B OD1 1 
ATOM   6100  N ND2 . ASN B 1 374 ? 157.64300 125.15100 152.18500 1.000 62.13327  ? 374 ASN B ND2 1 
ATOM   6101  N N   . ILE B 1 375 ? 153.70700 127.26500 155.80000 1.000 61.09578  ? 375 ILE B N   1 
ATOM   6102  C CA  . ILE B 1 375 ? 153.26000 128.58500 156.22100 1.000 61.09578  ? 375 ILE B CA  1 
ATOM   6103  C C   . ILE B 1 375 ? 153.21000 128.58500 157.74000 1.000 61.09578  ? 375 ILE B C   1 
ATOM   6104  O O   . ILE B 1 375 ? 153.24000 127.52800 158.37800 1.000 61.09578  ? 375 ILE B O   1 
ATOM   6105  C CB  . ILE B 1 375 ? 151.89500 128.97800 155.62100 1.000 61.09578  ? 375 ILE B CB  1 
ATOM   6106  C CG1 . ILE B 1 375 ? 150.79400 128.04900 156.11400 1.000 61.09578  ? 375 ILE B CG1 1 
ATOM   6107  C CG2 . ILE B 1 375 ? 151.95800 128.96400 154.11000 1.000 61.09578  ? 375 ILE B CG2 1 
ATOM   6108  C CD1 . ILE B 1 375 ? 149.43500 128.46900 155.65800 1.000 61.09578  ? 375 ILE B CD1 1 
ATOM   6109  N N   . TYR B 1 376 ? 153.13900 129.78200 158.32500 1.000 63.74428  ? 376 TYR B N   1 
ATOM   6110  C CA  . TYR B 1 376 ? 153.32000 129.90100 159.76700 1.000 63.74428  ? 376 TYR B CA  1 
ATOM   6111  C C   . TYR B 1 376 ? 152.08900 129.44200 160.53700 1.000 63.74428  ? 376 TYR B C   1 
ATOM   6112  O O   . TYR B 1 376 ? 152.19900 129.00500 161.68700 1.000 63.74428  ? 376 TYR B O   1 
ATOM   6113  C CB  . TYR B 1 376 ? 153.67800 131.34100 160.13400 1.000 63.74428  ? 376 TYR B CB  1 
ATOM   6114  C CG  . TYR B 1 376 ? 152.50000 132.27800 160.18600 1.000 63.74428  ? 376 TYR B CG  1 
ATOM   6115  C CD1 . TYR B 1 376 ? 151.93300 132.64700 161.39900 1.000 63.74428  ? 376 TYR B CD1 1 
ATOM   6116  C CD2 . TYR B 1 376 ? 151.95700 132.79600 159.02600 1.000 63.74428  ? 376 TYR B CD2 1 
ATOM   6117  C CE1 . TYR B 1 376 ? 150.86100 133.48900 161.45000 1.000 63.74428  ? 376 TYR B CE1 1 
ATOM   6118  C CE2 . TYR B 1 376 ? 150.88300 133.64900 159.07000 1.000 63.74428  ? 376 TYR B CE2 1 
ATOM   6119  C CZ  . TYR B 1 376 ? 150.34300 133.98800 160.28600 1.000 63.74428  ? 376 TYR B CZ  1 
ATOM   6120  O OH  . TYR B 1 376 ? 149.27800 134.84000 160.34800 1.000 63.74428  ? 376 TYR B OH  1 
ATOM   6121  N N   . LEU B 1 377 ? 150.90500 129.55400 159.93300 1.000 61.39455  ? 377 LEU B N   1 
ATOM   6122  C CA  . LEU B 1 377 ? 149.68200 129.21100 160.64700 1.000 61.39455  ? 377 LEU B CA  1 
ATOM   6123  C C   . LEU B 1 377 ? 149.54800 127.71300 160.85800 1.000 61.39455  ? 377 LEU B C   1 
ATOM   6124  O O   . LEU B 1 377 ? 148.85400 127.28500 161.78600 1.000 61.39455  ? 377 LEU B O   1 
ATOM   6125  C CB  . LEU B 1 377 ? 148.46900 129.74800 159.89400 1.000 61.39455  ? 377 LEU B CB  1 
ATOM   6126  C CG  . LEU B 1 377 ? 147.22500 129.98800 160.74000 1.000 61.39455  ? 377 LEU B CG  1 
ATOM   6127  C CD1 . LEU B 1 377 ? 147.51600 131.01400 161.80300 1.000 61.39455  ? 377 LEU B CD1 1 
ATOM   6128  C CD2 . LEU B 1 377 ? 146.07500 130.43600 159.87000 1.000 61.39455  ? 377 LEU B CD2 1 
ATOM   6129  N N   . PHE B 1 378 ? 150.20000 126.90800 160.02400 1.000 62.36445  ? 378 PHE B N   1 
ATOM   6130  C CA  . PHE B 1 378 ? 150.34500 125.47900 160.25500 1.000 62.36445  ? 378 PHE B CA  1 
ATOM   6131  C C   . PHE B 1 378 ? 151.84100 125.17200 160.22500 1.000 62.36445  ? 378 PHE B C   1 
ATOM   6132  O O   . PHE B 1 378 ? 152.39400 124.77100 159.20100 1.000 62.36445  ? 378 PHE B O   1 
ATOM   6133  C CB  . PHE B 1 378 ? 149.58000 124.65700 159.21700 1.000 62.36445  ? 378 PHE B CB  1 
ATOM   6134  C CG  . PHE B 1 378 ? 148.25800 125.24500 158.82800 1.000 62.36445  ? 378 PHE B CG  1 
ATOM   6135  C CD1 . PHE B 1 378 ? 147.20600 125.27700 159.72200 1.000 62.36445  ? 378 PHE B CD1 1 
ATOM   6136  C CD2 . PHE B 1 378 ? 148.06500 125.75300 157.56300 1.000 62.36445  ? 378 PHE B CD2 1 
ATOM   6137  C CE1 . PHE B 1 378 ? 145.98700 125.81700 159.35800 1.000 62.36445  ? 378 PHE B CE1 1 
ATOM   6138  C CE2 . PHE B 1 378 ? 146.85300 126.29700 157.19700 1.000 62.36445  ? 378 PHE B CE2 1 
ATOM   6139  C CZ  . PHE B 1 378 ? 145.81400 126.32600 158.09500 1.000 62.36445  ? 378 PHE B CZ  1 
ATOM   6140  N N   . GLN B 1 379 ? 152.49600 125.36800 161.36300 1.000 69.44703  ? 379 GLN B N   1 
ATOM   6141  C CA  . GLN B 1 379 ? 153.90700 125.05500 161.52800 1.000 69.44703  ? 379 GLN B CA  1 
ATOM   6142  C C   . GLN B 1 379 ? 154.05900 124.21900 162.78500 1.000 69.44703  ? 379 GLN B C   1 
ATOM   6143  O O   . GLN B 1 379 ? 153.59100 124.61400 163.85600 1.000 69.44703  ? 379 GLN B O   1 
ATOM   6144  C CB  . GLN B 1 379 ? 154.75800 126.32200 161.62100 1.000 69.44703  ? 379 GLN B CB  1 
ATOM   6145  N N   . GLY B 1 380 ? 154.69300 123.06000 162.64900 1.000 73.20515  ? 380 GLY B N   1 
ATOM   6146  C CA  . GLY B 1 380 ? 154.81700 122.14600 163.76600 1.000 73.20515  ? 380 GLY B CA  1 
ATOM   6147  C C   . GLY B 1 380 ? 153.54900 121.36200 164.03400 1.000 73.20515  ? 380 GLY B C   1 
ATOM   6148  O O   . GLY B 1 380 ? 153.42000 120.71700 165.07800 1.000 73.20515  ? 380 GLY B O   1 
ATOM   6149  N N   . VAL B 1 381 ? 152.60400 121.41200 163.09800 1.000 75.77889  ? 381 VAL B N   1 
ATOM   6150  C CA  . VAL B 1 381 ? 151.38700 120.62400 163.21400 1.000 75.77889  ? 381 VAL B CA  1 
ATOM   6151  C C   . VAL B 1 381 ? 151.59900 119.27900 162.51800 1.000 75.77889  ? 381 VAL B C   1 
ATOM   6152  O O   . VAL B 1 381 ? 152.50300 119.11500 161.69400 1.000 75.77889  ? 381 VAL B O   1 
ATOM   6153  C CB  . VAL B 1 381 ? 150.18900 121.40600 162.63200 1.000 75.77889  ? 381 VAL B CB  1 
ATOM   6154  C CG1 . VAL B 1 381 ? 150.26100 121.47700 161.12100 1.000 75.77889  ? 381 VAL B CG1 1 
ATOM   6155  C CG2 . VAL B 1 381 ? 148.83000 120.90300 163.14600 1.000 75.77889  ? 381 VAL B CG2 1 
ATOM   6156  N N   . SER B 1 382 ? 150.77900 118.29400 162.88800 1.000 78.17467  ? 382 SER B N   1 
ATOM   6157  C CA  . SER B 1 382 ? 150.94100 116.92100 162.43500 1.000 78.17467  ? 382 SER B CA  1 
ATOM   6158  C C   . SER B 1 382 ? 150.67500 116.78900 160.93600 1.000 78.17467  ? 382 SER B C   1 
ATOM   6159  O O   . SER B 1 382 ? 150.12300 117.67800 160.28800 1.000 78.17467  ? 382 SER B O   1 
ATOM   6160  C CB  . SER B 1 382 ? 150.00100 115.99900 163.20700 1.000 78.17467  ? 382 SER B CB  1 
ATOM   6161  O OG  . SER B 1 382 ? 148.69200 116.54000 163.25300 1.000 78.17467  ? 382 SER B OG  1 
ATOM   6162  N N   . ARG B 1 383 ? 151.08500 115.64300 160.39000 1.000 76.84685  ? 383 ARG B N   1 
ATOM   6163  C CA  . ARG B 1 383 ? 150.89400 115.35200 158.97300 1.000 76.84685  ? 383 ARG B CA  1 
ATOM   6164  C C   . ARG B 1 383 ? 149.42300 115.15600 158.63200 1.000 76.84685  ? 383 ARG B C   1 
ATOM   6165  O O   . ARG B 1 383 ? 148.95800 115.61600 157.58500 1.000 76.84685  ? 383 ARG B O   1 
ATOM   6166  C CB  . ARG B 1 383 ? 151.70100 114.11000 158.59200 1.000 76.84685  ? 383 ARG B CB  1 
ATOM   6167  C CG  . ARG B 1 383 ? 151.51800 113.64300 157.16500 1.000 76.84685  ? 383 ARG B CG  1 
ATOM   6168  C CD  . ARG B 1 383 ? 152.23800 114.55500 156.19700 1.000 76.84685  ? 383 ARG B CD  1 
ATOM   6169  N NE  . ARG B 1 383 ? 153.68700 114.41800 156.28700 1.000 76.84685  ? 383 ARG B NE  1 
ATOM   6170  C CZ  . ARG B 1 383 ? 154.40100 113.56800 155.55800 1.000 76.84685  ? 383 ARG B CZ  1 
ATOM   6171  N NH1 . ARG B 1 383 ? 153.79900 112.77500 154.68400 1.000 76.84685  ? 383 ARG B NH1 1 
ATOM   6172  N NH2 . ARG B 1 383 ? 155.71700 113.51100 155.70300 1.000 76.84685  ? 383 ARG B NH2 1 
ATOM   6173  N N   . ASN B 1 384 ? 148.67100 114.51300 159.51800 1.000 73.50969  ? 384 ASN B N   1 
ATOM   6174  C CA  . ASN B 1 384 ? 147.28900 114.16900 159.22400 1.000 73.50969  ? 384 ASN B CA  1 
ATOM   6175  C C   . ASN B 1 384 ? 146.34300 115.35700 159.27700 1.000 73.50969  ? 384 ASN B C   1 
ATOM   6176  O O   . ASN B 1 384 ? 145.20600 115.21800 158.82000 1.000 73.50969  ? 384 ASN B O   1 
ATOM   6177  C CB  . ASN B 1 384 ? 146.80600 113.08600 160.18800 1.000 73.50969  ? 384 ASN B CB  1 
ATOM   6178  N N   . PHE B 1 385 ? 146.74700 116.50400 159.82500 1.000 73.41271  ? 385 PHE B N   1 
ATOM   6179  C CA  . PHE B 1 385 ? 145.86400 117.66500 159.77400 1.000 73.41271  ? 385 PHE B CA  1 
ATOM   6180  C C   . PHE B 1 385 ? 146.01100 118.42500 158.46400 1.000 73.41271  ? 385 PHE B C   1 
ATOM   6181  O O   . PHE B 1 385 ? 145.01900 118.88900 157.89500 1.000 73.41271  ? 385 PHE B O   1 
ATOM   6182  C CB  . PHE B 1 385 ? 146.12000 118.61600 160.94000 1.000 73.41271  ? 385 PHE B CB  1 
ATOM   6183  C CG  . PHE B 1 385 ? 145.24600 119.83600 160.90600 1.000 73.41271  ? 385 PHE B CG  1 
ATOM   6184  C CD1 . PHE B 1 385 ? 143.86500 119.71400 160.99600 1.000 73.41271  ? 385 PHE B CD1 1 
ATOM   6185  C CD2 . PHE B 1 385 ? 145.79500 121.09500 160.74700 1.000 73.41271  ? 385 PHE B CD2 1 
ATOM   6186  C CE1 . PHE B 1 385 ? 143.05300 120.82700 160.95600 1.000 73.41271  ? 385 PHE B CE1 1 
ATOM   6187  C CE2 . PHE B 1 385 ? 144.98600 122.21200 160.70200 1.000 73.41271  ? 385 PHE B CE2 1 
ATOM   6188  C CZ  . PHE B 1 385 ? 143.61300 122.07500 160.80800 1.000 73.41271  ? 385 PHE B CZ  1 
ATOM   6189  N N   . LEU B 1 386 ? 147.23700 118.53800 157.96400 1.000 70.95948  ? 386 LEU B N   1 
ATOM   6190  C CA  . LEU B 1 386 ? 147.47600 119.05100 156.62600 1.000 70.95948  ? 386 LEU B CA  1 
ATOM   6191  C C   . LEU B 1 386 ? 147.46000 117.94800 155.57500 1.000 70.95948  ? 386 LEU B C   1 
ATOM   6192  O O   . LEU B 1 386 ? 148.16400 118.03000 154.56600 1.000 70.95948  ? 386 LEU B O   1 
ATOM   6193  C CB  . LEU B 1 386 ? 148.77700 119.86000 156.59100 1.000 70.95948  ? 386 LEU B CB  1 
ATOM   6194  C CG  . LEU B 1 386 ? 150.10900 119.38800 157.18200 1.000 70.95948  ? 386 LEU B CG  1 
ATOM   6195  C CD1 . LEU B 1 386 ? 150.91500 118.50200 156.25600 1.000 70.95948  ? 386 LEU B CD1 1 
ATOM   6196  C CD2 . LEU B 1 386 ? 150.93000 120.60300 157.54700 1.000 70.95948  ? 386 LEU B CD2 1 
ATOM   6197  N N   . PHE B 1 387 ? 146.69600 116.89200 155.84300 1.000 70.08736  ? 387 PHE B N   1 
ATOM   6198  C CA  . PHE B 1 387 ? 146.19300 115.96800 154.84300 1.000 70.08736  ? 387 PHE B CA  1 
ATOM   6199  C C   . PHE B 1 387 ? 144.70200 116.15500 154.61900 1.000 70.08736  ? 387 PHE B C   1 
ATOM   6200  O O   . PHE B 1 387 ? 144.05400 115.27600 154.05000 1.000 70.08736  ? 387 PHE B O   1 
ATOM   6201  C CB  . PHE B 1 387 ? 146.47400 114.53000 155.26300 1.000 70.08736  ? 387 PHE B CB  1 
ATOM   6202  C CG  . PHE B 1 387 ? 146.91800 113.65300 154.14400 1.000 70.08736  ? 387 PHE B CG  1 
ATOM   6203  C CD1 . PHE B 1 387 ? 148.25000 113.61400 153.78200 1.000 70.08736  ? 387 PHE B CD1 1 
ATOM   6204  C CD2 . PHE B 1 387 ? 146.01700 112.86400 153.45500 1.000 70.08736  ? 387 PHE B CD2 1 
ATOM   6205  C CE1 . PHE B 1 387 ? 148.67900 112.80200 152.75200 1.000 70.08736  ? 387 PHE B CE1 1 
ATOM   6206  C CE2 . PHE B 1 387 ? 146.43300 112.04600 152.42000 1.000 70.08736  ? 387 PHE B CE2 1 
ATOM   6207  C CZ  . PHE B 1 387 ? 147.76600 112.01500 152.06700 1.000 70.08736  ? 387 PHE B CZ  1 
ATOM   6208  N N   . GLN B 1 388 ? 144.13600 117.25400 155.11000 1.000 69.93246  ? 388 GLN B N   1 
ATOM   6209  C CA  . GLN B 1 388 ? 142.77400 117.65300 154.78600 1.000 69.93246  ? 388 GLN B CA  1 
ATOM   6210  C C   . GLN B 1 388 ? 142.77000 118.93200 153.94600 1.000 69.93246  ? 388 GLN B C   1 
ATOM   6211  O O   . GLN B 1 388 ? 142.04100 119.88300 154.23700 1.000 69.93246  ? 388 GLN B O   1 
ATOM   6212  C CB  . GLN B 1 388 ? 141.94200 117.79600 156.06100 1.000 69.93246  ? 388 GLN B CB  1 
ATOM   6213  C CG  . GLN B 1 388 ? 140.43600 117.52000 155.89200 1.000 69.93246  ? 388 GLN B CG  1 
ATOM   6214  C CD  . GLN B 1 388 ? 139.58600 118.74600 155.61500 1.000 69.93246  ? 388 GLN B CD  1 
ATOM   6215  O OE1 . GLN B 1 388 ? 139.87700 119.84500 156.08600 1.000 69.93246  ? 388 GLN B OE1 1 
ATOM   6216  N NE2 . GLN B 1 388 ? 138.53000 118.56200 154.83800 1.000 69.93246  ? 388 GLN B NE2 1 
ATOM   6217  N N   . LEU B 1 389 ? 143.64700 119.00900 152.94300 1.000 60.58340  ? 389 LEU B N   1 
ATOM   6218  C CA  . LEU B 1 389 ? 143.57500 120.06400 151.93100 1.000 60.58340  ? 389 LEU B CA  1 
ATOM   6219  C C   . LEU B 1 389 ? 142.73500 119.58100 150.74400 1.000 60.58340  ? 389 LEU B C   1 
ATOM   6220  O O   . LEU B 1 389 ? 143.09000 119.69900 149.57100 1.000 60.58340  ? 389 LEU B O   1 
ATOM   6221  C CB  . LEU B 1 389 ? 144.97700 120.50500 151.52400 1.000 60.58340  ? 389 LEU B CB  1 
ATOM   6222  C CG  . LEU B 1 389 ? 146.01800 119.63500 150.80500 1.000 60.58340  ? 389 LEU B CG  1 
ATOM   6223  C CD1 . LEU B 1 389 ? 147.00900 120.52700 150.12000 1.000 60.58340  ? 389 LEU B CD1 1 
ATOM   6224  C CD2 . LEU B 1 389 ? 146.75700 118.73500 151.74100 1.000 60.58340  ? 389 LEU B CD2 1 
ATOM   6225  N N   . VAL B 1 390 ? 141.54600 119.08600 151.07000 1.000 60.40309  ? 390 VAL B N   1 
ATOM   6226  C CA  . VAL B 1 390 ? 140.66300 118.49400 150.07900 1.000 60.40309  ? 390 VAL B CA  1 
ATOM   6227  C C   . VAL B 1 390 ? 139.47700 119.37800 149.74800 1.000 60.40309  ? 390 VAL B C   1 
ATOM   6228  O O   . VAL B 1 390 ? 138.63100 118.97900 148.94500 1.000 60.40309  ? 390 VAL B O   1 
ATOM   6229  C CB  . VAL B 1 390 ? 140.18600 117.09900 150.52400 1.000 60.40309  ? 390 VAL B CB  1 
ATOM   6230  C CG1 . VAL B 1 390 ? 141.38000 116.23200 150.86900 1.000 60.40309  ? 390 VAL B CG1 1 
ATOM   6231  C CG2 . VAL B 1 390 ? 139.25400 117.21900 151.71400 1.000 60.40309  ? 390 VAL B CG2 1 
ATOM   6232  N N   . SER B 1 391 ? 139.38500 120.56800 150.33700 1.000 58.00709  ? 391 SER B N   1 
ATOM   6233  C CA  . SER B 1 391 ? 138.34500 121.52800 149.98600 1.000 58.00709  ? 391 SER B CA  1 
ATOM   6234  C C   . SER B 1 391 ? 138.93300 122.86300 149.54500 1.000 58.00709  ? 391 SER B C   1 
ATOM   6235  O O   . SER B 1 391 ? 138.23300 123.87900 149.54800 1.000 58.00709  ? 391 SER B O   1 
ATOM   6236  C CB  . SER B 1 391 ? 137.38300 121.72600 151.15600 1.000 58.00709  ? 391 SER B CB  1 
ATOM   6237  O OG  . SER B 1 391 ? 136.93500 120.47500 151.64500 1.000 58.00709  ? 391 SER B OG  1 
ATOM   6238  N N   . ASP B 1 392 ? 140.21000 122.87900 149.17100 1.000 54.69184  ? 392 ASP B N   1 
ATOM   6239  C CA  . ASP B 1 392 ? 140.84200 124.09000 148.67300 1.000 54.69184  ? 392 ASP B CA  1 
ATOM   6240  C C   . ASP B 1 392 ? 140.34400 124.38500 147.27000 1.000 54.69184  ? 392 ASP B C   1 
ATOM   6241  O O   . ASP B 1 392 ? 140.61300 123.62200 146.33900 1.000 54.69184  ? 392 ASP B O   1 
ATOM   6242  C CB  . ASP B 1 392 ? 142.35700 123.93500 148.66300 1.000 54.69184  ? 392 ASP B CB  1 
ATOM   6243  C CG  . ASP B 1 392 ? 142.93700 123.85700 150.04300 1.000 54.69184  ? 392 ASP B CG  1 
ATOM   6244  O OD1 . ASP B 1 392 ? 142.15300 123.88600 151.00700 1.000 54.69184  ? 392 ASP B OD1 1 
ATOM   6245  O OD2 . ASP B 1 392 ? 144.17300 123.76900 150.16800 1.000 54.69184  ? 392 ASP B OD2 1 
ATOM   6246  N N   . ILE B 1 393 ? 139.62100 125.48700 147.11300 1.000 46.94601  ? 393 ILE B N   1 
ATOM   6247  C CA  . ILE B 1 393 ? 139.23200 125.95700 145.78000 1.000 46.94601  ? 393 ILE B CA  1 
ATOM   6248  C C   . ILE B 1 393 ? 140.38700 126.82800 145.30400 1.000 46.94601  ? 393 ILE B C   1 
ATOM   6249  O O   . ILE B 1 393 ? 140.36000 128.05800 145.36000 1.000 46.94601  ? 393 ILE B O   1 
ATOM   6250  C CB  . ILE B 1 393 ? 137.89400 126.69600 145.79500 1.000 46.94601  ? 393 ILE B CB  1 
ATOM   6251  N N   . ASP B 1 394 ? 141.42500 126.16700 144.80000 1.000 45.78125  ? 394 ASP B N   1 
ATOM   6252  C CA  . ASP B 1 394 ? 142.64500 126.86300 144.42400 1.000 45.78125  ? 394 ASP B CA  1 
ATOM   6253  C C   . ASP B 1 394 ? 142.58300 127.44900 143.03100 1.000 45.78125  ? 394 ASP B C   1 
ATOM   6254  O O   . ASP B 1 394 ? 143.53400 128.11500 142.61500 1.000 45.78125  ? 394 ASP B O   1 
ATOM   6255  C CB  . ASP B 1 394 ? 143.84000 125.92300 144.51000 1.000 45.78125  ? 394 ASP B CB  1 
ATOM   6256  N N   . ALA B 1 395 ? 141.49800 127.22200 142.30200 1.000 49.78629  ? 395 ALA B N   1 
ATOM   6257  C CA  . ALA B 1 395 ? 141.34200 127.81000 140.98100 1.000 49.78629  ? 395 ALA B CA  1 
ATOM   6258  C C   . ALA B 1 395 ? 140.96700 129.27800 141.12600 1.000 49.78629  ? 395 ALA B C   1 
ATOM   6259  O O   . ALA B 1 395 ? 139.82400 129.67400 140.88400 1.000 49.78629  ? 395 ALA B O   1 
ATOM   6260  C CB  . ALA B 1 395 ? 140.29000 127.05200 140.17500 1.000 49.78629  ? 395 ALA B CB  1 
ATOM   6261  N N   . GLU B 1 396 ? 141.92600 130.09400 141.54200 1.000 42.06255  ? 396 GLU B N   1 
ATOM   6262  C CA  . GLU B 1 396 ? 141.63000 131.50400 141.66400 1.000 42.06255  ? 396 GLU B CA  1 
ATOM   6263  C C   . GLU B 1 396 ? 142.05300 132.24900 140.41000 1.000 42.06255  ? 396 GLU B C   1 
ATOM   6264  O O   . GLU B 1 396 ? 141.19100 132.62900 139.61100 1.000 42.06255  ? 396 GLU B O   1 
ATOM   6265  C CB  . GLU B 1 396 ? 142.33000 132.06600 142.89600 1.000 42.06255  ? 396 GLU B CB  1 
ATOM   6266  N N   . TYR B 1 397 ? 143.36200 132.33100 140.17800 1.000 35.77875  ? 397 TYR B N   1 
ATOM   6267  C CA  . TYR B 1 397 ? 143.98300 133.08400 139.08600 1.000 35.77875  ? 397 TYR B CA  1 
ATOM   6268  C C   . TYR B 1 397 ? 143.36900 134.46700 138.90800 1.000 35.77875  ? 397 TYR B C   1 
ATOM   6269  O O   . TYR B 1 397 ? 142.67200 134.74400 137.93500 1.000 35.77875  ? 397 TYR B O   1 
ATOM   6270  C CB  . TYR B 1 397 ? 143.96600 132.29800 137.78800 1.000 35.77875  ? 397 TYR B CB  1 
ATOM   6271  C CG  . TYR B 1 397 ? 145.25400 131.55400 137.59300 1.000 35.77875  ? 397 TYR B CG  1 
ATOM   6272  C CD1 . TYR B 1 397 ? 146.43700 132.24200 137.39600 1.000 35.77875  ? 397 TYR B CD1 1 
ATOM   6273  C CD2 . TYR B 1 397 ? 145.29100 130.17300 137.61800 1.000 35.77875  ? 397 TYR B CD2 1 
ATOM   6274  C CE1 . TYR B 1 397 ? 147.61800 131.57600 137.22700 1.000 35.77875  ? 397 TYR B CE1 1 
ATOM   6275  C CE2 . TYR B 1 397 ? 146.47000 129.49600 137.44600 1.000 35.77875  ? 397 TYR B CE2 1 
ATOM   6276  C CZ  . TYR B 1 397 ? 147.63000 130.20300 137.25200 1.000 35.77875  ? 397 TYR B CZ  1 
ATOM   6277  O OH  . TYR B 1 397 ? 148.81100 129.52800 137.08200 1.000 35.77875  ? 397 TYR B OH  1 
ATOM   6278  N N   . PHE B 1 398 ? 143.58100 135.30200 139.88600 1.000 36.32535  ? 398 PHE B N   1 
ATOM   6279  C CA  . PHE B 1 398 ? 142.96400 136.61400 139.86000 1.000 36.32535  ? 398 PHE B CA  1 
ATOM   6280  C C   . PHE B 1 398 ? 143.70700 137.54100 138.90100 1.000 36.32535  ? 398 PHE B C   1 
ATOM   6281  O O   . PHE B 1 398 ? 144.93200 137.48700 138.81000 1.000 36.32535  ? 398 PHE B O   1 
ATOM   6282  C CB  . PHE B 1 398 ? 142.94900 137.22000 141.25300 1.000 36.32535  ? 398 PHE B CB  1 
ATOM   6283  C CG  . PHE B 1 398 ? 141.76100 136.82500 142.06400 1.000 36.32535  ? 398 PHE B CG  1 
ATOM   6284  C CD1 . PHE B 1 398 ? 141.62500 135.53300 142.52100 1.000 36.32535  ? 398 PHE B CD1 1 
ATOM   6285  C CD2 . PHE B 1 398 ? 140.77700 137.74300 142.36200 1.000 36.32535  ? 398 PHE B CD2 1 
ATOM   6286  C CE1 . PHE B 1 398 ? 140.53300 135.15900 143.26600 1.000 36.32535  ? 398 PHE B CE1 1 
ATOM   6287  C CE2 . PHE B 1 398 ? 139.68100 137.37500 143.10500 1.000 36.32535  ? 398 PHE B CE2 1 
ATOM   6288  C CZ  . PHE B 1 398 ? 139.56200 136.07800 143.55700 1.000 36.32535  ? 398 PHE B CZ  1 
ATOM   6289  N N   . PRO B 1 399 ? 142.99000 138.38800 138.17200 1.000 37.04885  ? 399 PRO B N   1 
ATOM   6290  C CA  . PRO B 1 399 ? 143.63800 139.38600 137.32500 1.000 37.04885  ? 399 PRO B CA  1 
ATOM   6291  C C   . PRO B 1 399 ? 144.24400 140.49800 138.16100 1.000 37.04885  ? 399 PRO B C   1 
ATOM   6292  O O   . PRO B 1 399 ? 143.99200 140.57300 139.37100 1.000 37.04885  ? 399 PRO B O   1 
ATOM   6293  C CB  . PRO B 1 399 ? 142.48000 139.90100 136.45700 1.000 37.04885  ? 399 PRO B CB  1 
ATOM   6294  C CG  . PRO B 1 399 ? 141.27600 139.61700 137.23400 1.000 37.04885  ? 399 PRO B CG  1 
ATOM   6295  C CD  . PRO B 1 399 ? 141.54100 138.33500 137.93300 1.000 37.04885  ? 399 PRO B CD  1 
ATOM   6296  N N   . PRO B 1 400 ? 145.06600 141.36300 137.56800 1.000 38.46136  ? 400 PRO B N   1 
ATOM   6297  C CA  . PRO B 1 400 ? 145.55000 142.53100 138.30600 1.000 38.46136  ? 400 PRO B CA  1 
ATOM   6298  C C   . PRO B 1 400 ? 144.43800 143.51200 138.62700 1.000 38.46136  ? 400 PRO B C   1 
ATOM   6299  O O   . PRO B 1 400 ? 143.43900 143.60500 137.91000 1.000 38.46136  ? 400 PRO B O   1 
ATOM   6300  C CB  . PRO B 1 400 ? 146.56800 143.15800 137.34900 1.000 38.46136  ? 400 PRO B CB  1 
ATOM   6301  C CG  . PRO B 1 400 ? 146.30300 142.54700 136.04300 1.000 38.46136  ? 400 PRO B CG  1 
ATOM   6302  C CD  . PRO B 1 400 ? 145.83000 141.17800 136.32900 1.000 38.46136  ? 400 PRO B CD  1 
ATOM   6303  N N   . LYS B 1 401 ? 144.63600 144.23300 139.73700 1.000 40.79282  ? 401 LYS B N   1 
ATOM   6304  C CA  . LYS B 1 401 ? 143.73800 145.28200 140.23100 1.000 40.79282  ? 401 LYS B CA  1 
ATOM   6305  C C   . LYS B 1 401 ? 142.32800 144.76000 140.49200 1.000 40.79282  ? 401 LYS B C   1 
ATOM   6306  O O   . LYS B 1 401 ? 141.33900 145.42800 140.19600 1.000 40.79282  ? 401 LYS B O   1 
ATOM   6307  C CB  . LYS B 1 401 ? 143.70900 146.48600 139.28700 1.000 40.79282  ? 401 LYS B CB  1 
ATOM   6308  N N   . GLU B 1 402 ? 142.23100 143.56000 141.05500 1.000 43.60464  ? 402 GLU B N   1 
ATOM   6309  C CA  . GLU B 1 402 ? 140.95700 142.97300 141.44100 1.000 43.60464  ? 402 GLU B CA  1 
ATOM   6310  C C   . GLU B 1 402 ? 140.94200 142.75600 142.94300 1.000 43.60464  ? 402 GLU B C   1 
ATOM   6311  O O   . GLU B 1 402 ? 141.89400 142.21400 143.50400 1.000 43.60464  ? 402 GLU B O   1 
ATOM   6312  C CB  . GLU B 1 402 ? 140.70700 141.64400 140.72800 1.000 43.60464  ? 402 GLU B CB  1 
ATOM   6313  N N   . ASP B 1 403 ? 139.85600 143.16800 143.58800 1.000 46.87170  ? 403 ASP B N   1 
ATOM   6314  C CA  . ASP B 1 403 ? 139.73400 143.09000 145.03600 1.000 46.87170  ? 403 ASP B CA  1 
ATOM   6315  C C   . ASP B 1 403 ? 139.38500 141.66700 145.44700 1.000 46.87170  ? 403 ASP B C   1 
ATOM   6316  O O   . ASP B 1 403 ? 138.37500 141.11900 144.99900 1.000 46.87170  ? 403 ASP B O   1 
ATOM   6317  C CB  . ASP B 1 403 ? 138.67300 144.06300 145.53700 1.000 46.87170  ? 403 ASP B CB  1 
ATOM   6318  C CG  . ASP B 1 403 ? 138.80700 145.43200 144.91800 1.000 46.87170  ? 403 ASP B CG  1 
ATOM   6319  O OD1 . ASP B 1 403 ? 139.91500 145.77200 144.46100 1.000 46.87170  ? 403 ASP B OD1 1 
ATOM   6320  O OD2 . ASP B 1 403 ? 137.80600 146.17500 144.88500 1.000 46.87170  ? 403 ASP B OD2 1 
ATOM   6321  N N   . ILE B 1 404 ? 140.21300 141.07700 146.30100 1.000 44.56081  ? 404 ILE B N   1 
ATOM   6322  C CA  . ILE B 1 404 ? 139.95200 139.73900 146.81800 1.000 44.56081  ? 404 ILE B CA  1 
ATOM   6323  C C   . ILE B 1 404 ? 139.08100 139.78500 148.06000 1.000 44.56081  ? 404 ILE B C   1 
ATOM   6324  O O   . ILE B 1 404 ? 138.13600 139.00600 148.19500 1.000 44.56081  ? 404 ILE B O   1 
ATOM   6325  C CB  . ILE B 1 404 ? 141.27900 139.03200 147.11200 1.000 44.56081  ? 404 ILE B CB  1 
ATOM   6326  C CG1 . ILE B 1 404 ? 142.25300 139.23400 145.96700 1.000 44.56081  ? 404 ILE B CG1 1 
ATOM   6327  C CG2 . ILE B 1 404 ? 141.04600 137.57500 147.36800 1.000 44.56081  ? 404 ILE B CG2 1 
ATOM   6328  C CD1 . ILE B 1 404 ? 143.63900 138.86400 146.34100 1.000 44.56081  ? 404 ILE B CD1 1 
ATOM   6329  N N   . ILE B 1 405 ? 139.40000 140.68700 148.97500 1.000 50.67605  ? 405 ILE B N   1 
ATOM   6330  C CA  . ILE B 1 405 ? 138.72500 140.82200 150.25500 1.000 50.67605  ? 405 ILE B CA  1 
ATOM   6331  C C   . ILE B 1 405 ? 138.42100 142.29800 150.44400 1.000 50.67605  ? 405 ILE B C   1 
ATOM   6332  O O   . ILE B 1 405 ? 139.29700 143.14400 150.24700 1.000 50.67605  ? 405 ILE B O   1 
ATOM   6333  C CB  . ILE B 1 405 ? 139.60900 140.27600 151.39700 1.000 50.67605  ? 405 ILE B CB  1 
ATOM   6334  C CG1 . ILE B 1 405 ? 139.51600 138.76400 151.51000 1.000 50.67605  ? 405 ILE B CG1 1 
ATOM   6335  C CG2 . ILE B 1 405 ? 139.28200 140.89600 152.71300 1.000 50.67605  ? 405 ILE B CG2 1 
ATOM   6336  C CD1 . ILE B 1 405 ? 140.51300 138.21000 152.49000 1.000 50.67605  ? 405 ILE B CD1 1 
ATOM   6337  N N   . LEU B 1 406 ? 137.18200 142.61400 150.79700 1.000 58.04669  ? 406 LEU B N   1 
ATOM   6338  C CA  . LEU B 1 406 ? 136.79200 144.00400 150.96100 1.000 58.04669  ? 406 LEU B CA  1 
ATOM   6339  C C   . LEU B 1 406 ? 137.23900 144.54300 152.31900 1.000 58.04669  ? 406 LEU B C   1 
ATOM   6340  O O   . LEU B 1 406 ? 137.94200 143.88200 153.08300 1.000 58.04669  ? 406 LEU B O   1 
ATOM   6341  C CB  . LEU B 1 406 ? 135.28600 144.14800 150.78800 1.000 58.04669  ? 406 LEU B CB  1 
ATOM   6342  C CG  . LEU B 1 406 ? 134.82100 144.02600 149.34200 1.000 58.04669  ? 406 LEU B CG  1 
ATOM   6343  C CD1 . LEU B 1 406 ? 133.32500 143.84600 149.29700 1.000 58.04669  ? 406 LEU B CD1 1 
ATOM   6344  C CD2 . LEU B 1 406 ? 135.24100 145.25000 148.55400 1.000 58.04669  ? 406 LEU B CD2 1 
ATOM   6345  N N   . GLN B 1 407 ? 136.82600 145.77800 152.61200 1.000 64.03300  ? 407 GLN B N   1 
ATOM   6346  C CA  . GLN B 1 407 ? 137.25100 146.42700 153.84800 1.000 64.03300  ? 407 GLN B CA  1 
ATOM   6347  C C   . GLN B 1 407 ? 136.57400 145.80300 155.06000 1.000 64.03300  ? 407 GLN B C   1 
ATOM   6348  O O   . GLN B 1 407 ? 137.23500 145.44100 156.03700 1.000 64.03300  ? 407 GLN B O   1 
ATOM   6349  C CB  . GLN B 1 407 ? 136.95900 147.92300 153.77900 1.000 64.03300  ? 407 GLN B CB  1 
ATOM   6350  C CG  . GLN B 1 407 ? 137.04000 148.62600 155.11400 1.000 64.03300  ? 407 GLN B CG  1 
ATOM   6351  C CD  . GLN B 1 407 ? 138.44500 148.67000 155.66400 1.000 64.03300  ? 407 GLN B CD  1 
ATOM   6352  O OE1 . GLN B 1 407 ? 138.78900 147.92000 156.57500 1.000 64.03300  ? 407 GLN B OE1 1 
ATOM   6353  N NE2 . GLN B 1 407 ? 139.26600 149.55700 155.12000 1.000 64.03300  ? 407 GLN B NE2 1 
ATOM   6354  N N   . ASN B 1 408 ? 135.25400 145.66000 155.01300 1.000 65.01560  ? 408 ASN B N   1 
ATOM   6355  C CA  . ASN B 1 408 ? 134.50300 144.98200 156.06200 1.000 65.01560  ? 408 ASN B CA  1 
ATOM   6356  C C   . ASN B 1 408 ? 133.61700 143.94300 155.40300 1.000 65.01560  ? 408 ASN B C   1 
ATOM   6357  O O   . ASN B 1 408 ? 132.92300 144.24900 154.43200 1.000 65.01560  ? 408 ASN B O   1 
ATOM   6358  C CB  . ASN B 1 408 ? 133.66300 145.97100 156.87000 1.000 65.01560  ? 408 ASN B CB  1 
ATOM   6359  C CG  . ASN B 1 408 ? 134.40200 147.25000 157.16500 1.000 65.01560  ? 408 ASN B CG  1 
ATOM   6360  O OD1 . ASN B 1 408 ? 133.98900 148.32800 156.74800 1.000 65.01560  ? 408 ASN B OD1 1 
ATOM   6361  N ND2 . ASN B 1 408 ? 135.50500 147.13900 157.89100 1.000 65.01560  ? 408 ASN B ND2 1 
ATOM   6362  N N   . GLU B 1 409 ? 133.64400 142.72200 155.92200 1.000 64.65132  ? 409 GLU B N   1 
ATOM   6363  C CA  . GLU B 1 409 ? 132.89200 141.64100 155.31000 1.000 64.65132  ? 409 GLU B CA  1 
ATOM   6364  C C   . GLU B 1 409 ? 132.67100 140.55800 156.34500 1.000 64.65132  ? 409 GLU B C   1 
ATOM   6365  O O   . GLU B 1 409 ? 133.35300 140.51700 157.37100 1.000 64.65132  ? 409 GLU B O   1 
ATOM   6366  C CB  . GLU B 1 409 ? 133.62100 141.05600 154.09900 1.000 64.65132  ? 409 GLU B CB  1 
ATOM   6367  N N   . ALA B 1 410 ? 131.70600 139.68800 156.06700 1.000 68.87631  ? 410 ALA B N   1 
ATOM   6368  C CA  . ALA B 1 410 ? 131.51800 138.46900 156.83900 1.000 68.87631  ? 410 ALA B CA  1 
ATOM   6369  C C   . ALA B 1 410 ? 132.74200 137.59500 156.60900 1.000 68.87631  ? 410 ALA B C   1 
ATOM   6370  O O   . ALA B 1 410 ? 132.94400 137.09400 155.49800 1.000 68.87631  ? 410 ALA B O   1 
ATOM   6371  C CB  . ALA B 1 410 ? 130.23700 137.74500 156.42600 1.000 68.87631  ? 410 ALA B CB  1 
ATOM   6372  N N   . PRO B 1 411 ? 133.57600 137.39300 157.61800 1.000 64.90652  ? 411 PRO B N   1 
ATOM   6373  C CA  . PRO B 1 411 ? 134.89700 136.79800 157.37600 1.000 64.90652  ? 411 PRO B CA  1 
ATOM   6374  C C   . PRO B 1 411 ? 134.83300 135.30400 157.09900 1.000 64.90652  ? 411 PRO B C   1 
ATOM   6375  O O   . PRO B 1 411 ? 135.04800 134.47000 157.98100 1.000 64.90652  ? 411 PRO B O   1 
ATOM   6376  C CB  . PRO B 1 411 ? 135.65200 137.11800 158.66700 1.000 64.90652  ? 411 PRO B CB  1 
ATOM   6377  C CG  . PRO B 1 411 ? 134.61200 137.24000 159.70200 1.000 64.90652  ? 411 PRO B CG  1 
ATOM   6378  C CD  . PRO B 1 411 ? 133.34600 137.69000 159.04300 1.000 64.90652  ? 411 PRO B CD  1 
ATOM   6379  N N   . THR B 1 412 ? 134.54600 134.97100 155.84200 1.000 63.81005  ? 412 THR B N   1 
ATOM   6380  C CA  . THR B 1 412 ? 134.18500 133.60800 155.48400 1.000 63.81005  ? 412 THR B CA  1 
ATOM   6381  C C   . THR B 1 412 ? 135.40400 132.73300 155.20200 1.000 63.81005  ? 412 THR B C   1 
ATOM   6382  O O   . THR B 1 412 ? 135.34500 131.51600 155.41000 1.000 63.81005  ? 412 THR B O   1 
ATOM   6383  C CB  . THR B 1 412 ? 133.25700 133.63400 154.26800 1.000 63.81005  ? 412 THR B CB  1 
ATOM   6384  O OG1 . THR B 1 412 ? 132.31700 134.70100 154.42100 1.000 63.81005  ? 412 THR B OG1 1 
ATOM   6385  C CG2 . THR B 1 412 ? 132.48300 132.33500 154.14700 1.000 63.81005  ? 412 THR B CG2 1 
ATOM   6386  N N   . ASP B 1 413 ? 136.52000 133.31300 154.76700 1.000 57.68070  ? 413 ASP B N   1 
ATOM   6387  C CA  . ASP B 1 413 ? 137.58700 132.49500 154.21100 1.000 57.68070  ? 413 ASP B CA  1 
ATOM   6388  C C   . ASP B 1 413 ? 138.94800 133.14300 154.39700 1.000 57.68070  ? 413 ASP B C   1 
ATOM   6389  O O   . ASP B 1 413 ? 139.07300 134.36700 154.40800 1.000 57.68070  ? 413 ASP B O   1 
ATOM   6390  C CB  . ASP B 1 413 ? 137.31900 132.24300 152.73000 1.000 57.68070  ? 413 ASP B CB  1 
ATOM   6391  C CG  . ASP B 1 413 ? 136.72100 133.44200 152.04400 1.000 57.68070  ? 413 ASP B CG  1 
ATOM   6392  O OD1 . ASP B 1 413 ? 136.54600 134.48100 152.71400 1.000 57.68070  ? 413 ASP B OD1 1 
ATOM   6393  O OD2 . ASP B 1 413 ? 136.40000 133.34200 150.84400 1.000 57.68070  ? 413 ASP B OD2 1 
ATOM   6394  N N   . LEU B 1 414 ? 139.96400 132.29800 154.54200 1.000 51.19441  ? 414 LEU B N   1 
ATOM   6395  C CA  . LEU B 1 414 ? 141.35500 132.71200 154.45800 1.000 51.19441  ? 414 LEU B CA  1 
ATOM   6396  C C   . LEU B 1 414 ? 141.87500 132.35500 153.07700 1.000 51.19441  ? 414 LEU B C   1 
ATOM   6397  O O   . LEU B 1 414 ? 141.38300 131.41700 152.44800 1.000 51.19441  ? 414 LEU B O   1 
ATOM   6398  C CB  . LEU B 1 414 ? 142.22500 132.04700 155.53500 1.000 51.19441  ? 414 LEU B CB  1 
ATOM   6399  C CG  . LEU B 1 414 ? 142.56200 130.54900 155.58300 1.000 51.19441  ? 414 LEU B CG  1 
ATOM   6400  C CD1 . LEU B 1 414 ? 143.83200 130.17100 154.83600 1.000 51.19441  ? 414 LEU B CD1 1 
ATOM   6401  C CD2 . LEU B 1 414 ? 142.72100 130.11700 157.00300 1.000 51.19441  ? 414 LEU B CD2 1 
ATOM   6402  N N   . TYR B 1 415 ? 142.88500 133.08000 152.62200 1.000 47.50347  ? 415 TYR B N   1 
ATOM   6403  C CA  . TYR B 1 415 ? 143.49400 132.83900 151.32800 1.000 47.50347  ? 415 TYR B CA  1 
ATOM   6404  C C   . TYR B 1 415 ? 144.99300 132.65900 151.49500 1.000 47.50347  ? 415 TYR B C   1 
ATOM   6405  O O   . TYR B 1 415 ? 145.61200 133.29000 152.35000 1.000 47.50347  ? 415 TYR B O   1 
ATOM   6406  C CB  . TYR B 1 415 ? 143.22500 133.99200 150.36700 1.000 47.50347  ? 415 TYR B CB  1 
ATOM   6407  C CG  . TYR B 1 415 ? 141.77400 134.24700 150.05100 1.000 47.50347  ? 415 TYR B CG  1 
ATOM   6408  C CD1 . TYR B 1 415 ? 140.98300 135.00900 150.89000 1.000 47.50347  ? 415 TYR B CD1 1 
ATOM   6409  C CD2 . TYR B 1 415 ? 141.20400 133.74700 148.89400 1.000 47.50347  ? 415 TYR B CD2 1 
ATOM   6410  C CE1 . TYR B 1 415 ? 139.66300 135.24700 150.59900 1.000 47.50347  ? 415 TYR B CE1 1 
ATOM   6411  C CE2 . TYR B 1 415 ? 139.88700 133.98800 148.59300 1.000 47.50347  ? 415 TYR B CE2 1 
ATOM   6412  C CZ  . TYR B 1 415 ? 139.12200 134.73500 149.45100 1.000 47.50347  ? 415 TYR B CZ  1 
ATOM   6413  O OH  . TYR B 1 415 ? 137.80300 134.97800 149.15900 1.000 47.50347  ? 415 TYR B OH  1 
ATOM   6414  N N   . ILE B 1 416 ? 145.57400 131.80100 150.66800 1.000 42.40611  ? 416 ILE B N   1 
ATOM   6415  C CA  . ILE B 1 416 ? 147.00600 131.53700 150.67400 1.000 42.40611  ? 416 ILE B CA  1 
ATOM   6416  C C   . ILE B 1 416 ? 147.55200 131.87100 149.29900 1.000 42.40611  ? 416 ILE B C   1 
ATOM   6417  O O   . ILE B 1 416 ? 147.14600 131.26300 148.30600 1.000 42.40611  ? 416 ILE B O   1 
ATOM   6418  C CB  . ILE B 1 416 ? 147.31400 130.07500 151.02800 1.000 42.40611  ? 416 ILE B CB  1 
ATOM   6419  C CG1 . ILE B 1 416 ? 146.75900 129.73300 152.40300 1.000 42.40611  ? 416 ILE B CG1 1 
ATOM   6420  C CG2 . ILE B 1 416 ? 148.79400 129.82100 150.97500 1.000 42.40611  ? 416 ILE B CG2 1 
ATOM   6421  C CD1 . ILE B 1 416 ? 146.70100 128.26500 152.66200 1.000 42.40611  ? 416 ILE B CD1 1 
ATOM   6422  N N   . LEU B 1 417 ? 148.47600 132.81700 149.24200 1.000 40.70345  ? 417 LEU B N   1 
ATOM   6423  C CA  . LEU B 1 417 ? 149.02000 133.29600 147.98200 1.000 40.70345  ? 417 LEU B CA  1 
ATOM   6424  C C   . LEU B 1 417 ? 150.02100 132.28900 147.43400 1.000 40.70345  ? 417 LEU B C   1 
ATOM   6425  O O   . LEU B 1 417 ? 151.06200 132.05300 148.04700 1.000 40.70345  ? 417 LEU B O   1 
ATOM   6426  C CB  . LEU B 1 417 ? 149.68800 134.64900 148.19800 1.000 40.70345  ? 417 LEU B CB  1 
ATOM   6427  C CG  . LEU B 1 417 ? 149.89300 135.58900 147.02500 1.000 40.70345  ? 417 LEU B CG  1 
ATOM   6428  C CD1 . LEU B 1 417 ? 149.80500 136.99500 147.53400 1.000 40.70345  ? 417 LEU B CD1 1 
ATOM   6429  C CD2 . LEU B 1 417 ? 151.22400 135.37600 146.36500 1.000 40.70345  ? 417 LEU B CD2 1 
ATOM   6430  N N   . VAL B 1 418 ? 149.71700 131.71000 146.27700 1.000 39.96190  ? 418 VAL B N   1 
ATOM   6431  C CA  . VAL B 1 418 ? 150.59500 130.71700 145.66900 1.000 39.96190  ? 418 VAL B CA  1 
ATOM   6432  C C   . VAL B 1 418 ? 151.67400 131.36800 144.81600 1.000 39.96190  ? 418 VAL B C   1 
ATOM   6433  O O   . VAL B 1 418 ? 152.85300 131.03600 144.94700 1.000 39.96190  ? 418 VAL B O   1 
ATOM   6434  C CB  . VAL B 1 418 ? 149.77400 129.70300 144.84900 1.000 39.96190  ? 418 VAL B CB  1 
ATOM   6435  C CG1 . VAL B 1 418 ? 150.67300 128.63000 144.29400 1.000 39.96190  ? 418 VAL B CG1 1 
ATOM   6436  C CG2 . VAL B 1 418 ? 148.69900 129.08300 145.70500 1.000 39.96190  ? 418 VAL B CG2 1 
ATOM   6437  N N   . SER B 1 419 ? 151.29800 132.30200 143.94600 1.000 41.05177  ? 419 SER B N   1 
ATOM   6438  C CA  . SER B 1 419 ? 152.25900 132.97900 143.08500 1.000 41.05177  ? 419 SER B CA  1 
ATOM   6439  C C   . SER B 1 419 ? 151.67800 134.31300 142.65700 1.000 41.05177  ? 419 SER B C   1 
ATOM   6440  O O   . SER B 1 419 ? 150.57200 134.35500 142.12300 1.000 41.05177  ? 419 SER B O   1 
ATOM   6441  C CB  . SER B 1 419 ? 152.58500 132.13700 141.85500 1.000 41.05177  ? 419 SER B CB  1 
ATOM   6442  O OG  . SER B 1 419 ? 151.41900 131.90700 141.08700 1.000 41.05177  ? 419 SER B OG  1 
ATOM   6443  N N   . GLY B 1 420 ? 152.42600 135.38800 142.87100 1.000 42.67205  ? 420 GLY B N   1 
ATOM   6444  C CA  . GLY B 1 420 ? 151.94800 136.71200 142.53100 1.000 42.67205  ? 420 GLY B CA  1 
ATOM   6445  C C   . GLY B 1 420 ? 152.28400 137.72300 143.60300 1.000 42.67205  ? 420 GLY B C   1 
ATOM   6446  O O   . GLY B 1 420 ? 153.27800 137.55500 144.31200 1.000 42.67205  ? 420 GLY B O   1 
ATOM   6447  N N   . ALA B 1 421 ? 151.47200 138.76800 143.74100 1.000 45.02215  ? 421 ALA B N   1 
ATOM   6448  C CA  . ALA B 1 421 ? 151.68100 139.75700 144.78800 1.000 45.02215  ? 421 ALA B CA  1 
ATOM   6449  C C   . ALA B 1 421 ? 150.37000 140.47100 145.06900 1.000 45.02215  ? 421 ALA B C   1 
ATOM   6450  O O   . ALA B 1 421 ? 149.52600 140.61000 144.18400 1.000 45.02215  ? 421 ALA B O   1 
ATOM   6451  C CB  . ALA B 1 421 ? 152.76400 140.77100 144.40700 1.000 45.02215  ? 421 ALA B CB  1 
ATOM   6452  N N   . VAL B 1 422 ? 150.22200 140.93000 146.31200 1.000 48.51207  ? 422 VAL B N   1 
ATOM   6453  C CA  . VAL B 1 422 ? 148.98700 141.50100 146.83400 1.000 48.51207  ? 422 VAL B CA  1 
ATOM   6454  C C   . VAL B 1 422 ? 149.34500 142.66900 147.74400 1.000 48.51207  ? 422 VAL B C   1 
ATOM   6455  O O   . VAL B 1 422 ? 150.27400 142.59000 148.54800 1.000 48.51207  ? 422 VAL B O   1 
ATOM   6456  C CB  . VAL B 1 422 ? 148.16700 140.41500 147.57600 1.000 48.51207  ? 422 VAL B CB  1 
ATOM   6457  C CG1 . VAL B 1 422 ? 147.24700 140.98700 148.60800 1.000 48.51207  ? 422 VAL B CG1 1 
ATOM   6458  C CG2 . VAL B 1 422 ? 147.34000 139.62800 146.58900 1.000 48.51207  ? 422 VAL B CG2 1 
ATOM   6459  N N   . ASP B 1 423 ? 148.60800 143.77300 147.60500 1.000 51.47894  ? 423 ASP B N   1 
ATOM   6460  C CA  . ASP B 1 423 ? 148.87500 144.97700 148.38300 1.000 51.47894  ? 423 ASP B CA  1 
ATOM   6461  C C   . ASP B 1 423 ? 147.66200 145.32500 149.23200 1.000 51.47894  ? 423 ASP B C   1 
ATOM   6462  O O   . ASP B 1 423 ? 146.58200 145.58000 148.69400 1.000 51.47894  ? 423 ASP B O   1 
ATOM   6463  C CB  . ASP B 1 423 ? 149.23300 146.14800 147.46800 1.000 51.47894  ? 423 ASP B CB  1 
ATOM   6464  N N   . PHE B 1 424 ? 147.84700 145.35000 150.55100 1.000 56.89039  ? 424 PHE B N   1 
ATOM   6465  C CA  . PHE B 1 424 ? 146.80100 145.73900 151.48300 1.000 56.89039  ? 424 PHE B CA  1 
ATOM   6466  C C   . PHE B 1 424 ? 146.62400 147.25200 151.49900 1.000 56.89039  ? 424 PHE B C   1 
ATOM   6467  O O   . PHE B 1 424 ? 147.54900 148.01400 151.21600 1.000 56.89039  ? 424 PHE B O   1 
ATOM   6468  C CB  . PHE B 1 424 ? 147.12900 145.27700 152.89800 1.000 56.89039  ? 424 PHE B CB  1 
ATOM   6469  C CG  . PHE B 1 424 ? 147.43600 143.82400 153.00700 1.000 56.89039  ? 424 PHE B CG  1 
ATOM   6470  C CD1 . PHE B 1 424 ? 146.60800 142.88900 152.44100 1.000 56.89039  ? 424 PHE B CD1 1 
ATOM   6471  C CD2 . PHE B 1 424 ? 148.55300 143.39400 153.68700 1.000 56.89039  ? 424 PHE B CD2 1 
ATOM   6472  C CE1 . PHE B 1 424 ? 146.89000 141.55100 152.54600 1.000 56.89039  ? 424 PHE B CE1 1 
ATOM   6473  C CE2 . PHE B 1 424 ? 148.84000 142.06300 153.79600 1.000 56.89039  ? 424 PHE B CE2 1 
ATOM   6474  C CZ  . PHE B 1 424 ? 148.00800 141.14100 153.22800 1.000 56.89039  ? 424 PHE B CZ  1 
ATOM   6475  N N   . THR B 1 425 ? 145.41400 147.68300 151.84200 1.000 63.09533  ? 425 THR B N   1 
ATOM   6476  C CA  . THR B 1 425 ? 145.13900 149.10000 152.01900 1.000 63.09533  ? 425 THR B CA  1 
ATOM   6477  C C   . THR B 1 425 ? 144.13000 149.27700 153.14400 1.000 63.09533  ? 425 THR B C   1 
ATOM   6478  O O   . THR B 1 425 ? 143.52100 148.31800 153.61900 1.000 63.09533  ? 425 THR B O   1 
ATOM   6479  C CB  . THR B 1 425 ? 144.62200 149.74300 150.73500 1.000 63.09533  ? 425 THR B CB  1 
ATOM   6480  O OG1 . THR B 1 425 ? 144.30900 151.11700 150.98600 1.000 63.09533  ? 425 THR B OG1 1 
ATOM   6481  C CG2 . THR B 1 425 ? 143.37500 149.05000 150.28000 1.000 63.09533  ? 425 THR B CG2 1 
ATOM   6482  N N   . VAL B 1 426 ? 143.96900 150.52800 153.57500 1.000 68.72925  ? 426 VAL B N   1 
ATOM   6483  C CA  . VAL B 1 426 ? 143.04300 150.87600 154.64700 1.000 68.72925  ? 426 VAL B CA  1 
ATOM   6484  C C   . VAL B 1 426 ? 141.99800 151.76100 153.96400 1.000 68.72925  ? 426 VAL B C   1 
ATOM   6485  O O   . VAL B 1 426 ? 142.11000 152.01400 152.76000 1.000 68.72925  ? 426 VAL B O   1 
ATOM   6486  C CB  . VAL B 1 426 ? 143.78300 151.56800 155.81700 1.000 68.72925  ? 426 VAL B CB  1 
ATOM   6487  C CG1 . VAL B 1 426 ? 142.99000 151.52500 157.13500 1.000 68.72925  ? 426 VAL B CG1 1 
ATOM   6488  C CG2 . VAL B 1 426 ? 145.16600 150.96400 156.02300 1.000 68.72925  ? 426 VAL B CG2 1 
ATOM   6489  N N   . TYR B 1 427 ? 140.98600 152.22600 154.70900 1.000 72.49539  ? 427 TYR B N   1 
ATOM   6490  C CA  . TYR B 1 427 ? 139.74400 152.83200 154.22400 1.000 72.49539  ? 427 TYR B CA  1 
ATOM   6491  C C   . TYR B 1 427 ? 139.86800 153.93700 153.17500 1.000 72.49539  ? 427 TYR B C   1 
ATOM   6492  O O   . TYR B 1 427 ? 138.99000 154.07000 152.31700 1.000 72.49539  ? 427 TYR B O   1 
ATOM   6493  C CB  . TYR B 1 427 ? 138.95900 153.38300 155.41600 1.000 72.49539  ? 427 TYR B CB  1 
ATOM   6494  N N   . VAL B 1 428 ? 140.92800 154.74300 153.22900 1.000 74.77428  ? 428 VAL B N   1 
ATOM   6495  C CA  . VAL B 1 428 ? 141.10200 155.79000 152.22700 1.000 74.77428  ? 428 VAL B CA  1 
ATOM   6496  C C   . VAL B 1 428 ? 142.33600 155.49100 151.38700 1.000 74.77428  ? 428 VAL B C   1 
ATOM   6497  O O   . VAL B 1 428 ? 142.23000 155.21500 150.18700 1.000 74.77428  ? 428 VAL B O   1 
ATOM   6498  C CB  . VAL B 1 428 ? 141.21200 157.18500 152.87200 1.000 74.77428  ? 428 VAL B CB  1 
ATOM   6499  C CG1 . VAL B 1 428 ? 141.08300 158.27000 151.81100 1.000 74.77428  ? 428 VAL B CG1 1 
ATOM   6500  C CG2 . VAL B 1 428 ? 140.16100 157.36800 153.95900 1.000 74.77428  ? 428 VAL B CG2 1 
ATOM   6501  N N   . ASP B 1 429 ? 143.51300 155.53400 152.01700 1.000 75.59882  ? 429 ASP B N   1 
ATOM   6502  C CA  . ASP B 1 429 ? 144.76500 155.21800 151.33000 1.000 75.59882  ? 429 ASP B CA  1 
ATOM   6503  C C   . ASP B 1 429 ? 145.78300 154.81100 152.39500 1.000 75.59882  ? 429 ASP B C   1 
ATOM   6504  O O   . ASP B 1 429 ? 146.38200 155.67400 153.04100 1.000 75.59882  ? 429 ASP B O   1 
ATOM   6505  C CB  . ASP B 1 429 ? 145.26100 156.40000 150.51200 1.000 75.59882  ? 429 ASP B CB  1 
ATOM   6506  N N   . GLY B 1 430 ? 145.97300 153.50900 152.55900 1.000 69.69389  ? 430 GLY B N   1 
ATOM   6507  C CA  . GLY B 1 430 ? 146.99700 153.00700 153.45100 1.000 69.69389  ? 430 GLY B CA  1 
ATOM   6508  C C   . GLY B 1 430 ? 147.94000 152.10700 152.69200 1.000 69.69389  ? 430 GLY B C   1 
ATOM   6509  O O   . GLY B 1 430 ? 147.83800 152.02000 151.46500 1.000 69.69389  ? 430 GLY B O   1 
ATOM   6510  N N   . HIS B 1 431 ? 148.85200 151.42900 153.38900 1.000 67.46453  ? 431 HIS B N   1 
ATOM   6511  C CA  . HIS B 1 431 ? 149.74100 150.49600 152.71000 1.000 67.46453  ? 431 HIS B CA  1 
ATOM   6512  C C   . HIS B 1 431 ? 150.31200 149.41900 153.62200 1.000 67.46453  ? 431 HIS B C   1 
ATOM   6513  O O   . HIS B 1 431 ? 151.01600 149.71400 154.59100 1.000 67.46453  ? 431 HIS B O   1 
ATOM   6514  C CB  . HIS B 1 431 ? 150.90400 151.23000 152.04400 1.000 67.46453  ? 431 HIS B CB  1 
ATOM   6515  C CG  . HIS B 1 431 ? 151.69000 150.36400 151.11400 1.000 67.46453  ? 431 HIS B CG  1 
ATOM   6516  N ND1 . HIS B 1 431 ? 151.29200 150.11500 149.81900 1.000 67.46453  ? 431 HIS B ND1 1 
ATOM   6517  C CD2 . HIS B 1 431 ? 152.83300 149.66400 151.29900 1.000 67.46453  ? 431 HIS B CD2 1 
ATOM   6518  C CE1 . HIS B 1 431 ? 152.16600 149.31100 149.24100 1.000 67.46453  ? 431 HIS B CE1 1 
ATOM   6519  N NE2 . HIS B 1 431 ? 153.11000 149.02200 150.11700 1.000 67.46453  ? 431 HIS B NE2 1 
ATOM   6520  N N   . ASP B 1 432 ? 149.99300 148.16600 153.31500 1.000 64.00750  ? 432 ASP B N   1 
ATOM   6521  C CA  . ASP B 1 432 ? 150.72400 146.99500 153.77600 1.000 64.00750  ? 432 ASP B CA  1 
ATOM   6522  C C   . ASP B 1 432 ? 150.80000 146.05000 152.58100 1.000 64.00750  ? 432 ASP B C   1 
ATOM   6523  O O   . ASP B 1 432 ? 150.08900 146.24400 151.59300 1.000 64.00750  ? 432 ASP B O   1 
ATOM   6524  C CB  . ASP B 1 432 ? 150.04800 146.31700 154.97500 1.000 64.00750  ? 432 ASP B CB  1 
ATOM   6525  C CG  . ASP B 1 432 ? 149.62400 147.29600 156.06000 1.000 64.00750  ? 432 ASP B CG  1 
ATOM   6526  O OD1 . ASP B 1 432 ? 148.66600 148.06900 155.84300 1.000 64.00750  ? 432 ASP B OD1 1 
ATOM   6527  O OD2 . ASP B 1 432 ? 150.23800 147.27200 157.14500 1.000 64.00750  ? 432 ASP B OD2 1 
ATOM   6528  N N   . GLN B 1 433 ? 151.66200 145.03700 152.65800 1.000 59.49421  ? 433 GLN B N   1 
ATOM   6529  C CA  . GLN B 1 433 ? 151.89700 144.18800 151.49400 1.000 59.49421  ? 433 GLN B CA  1 
ATOM   6530  C C   . GLN B 1 433 ? 152.27700 142.77300 151.90800 1.000 59.49421  ? 433 GLN B C   1 
ATOM   6531  O O   . GLN B 1 433 ? 153.12500 142.58200 152.78200 1.000 59.49421  ? 433 GLN B O   1 
ATOM   6532  C CB  . GLN B 1 433 ? 152.98800 144.79600 150.60000 1.000 59.49421  ? 433 GLN B CB  1 
ATOM   6533  C CG  . GLN B 1 433 ? 153.76600 143.80200 149.75700 1.000 59.49421  ? 433 GLN B CG  1 
ATOM   6534  C CD  . GLN B 1 433 ? 154.46900 144.45100 148.59200 1.000 59.49421  ? 433 GLN B CD  1 
ATOM   6535  O OE1 . GLN B 1 433 ? 154.28800 145.63700 148.32600 1.000 59.49421  ? 433 GLN B OE1 1 
ATOM   6536  N NE2 . GLN B 1 433 ? 155.27800 143.67400 147.88500 1.000 59.49421  ? 433 GLN B NE2 1 
ATOM   6537  N N   . PHE B 1 434 ? 151.64500 141.78500 151.27400 1.000 55.97881  ? 434 PHE B N   1 
ATOM   6538  C CA  . PHE B 1 434 ? 151.95300 140.37700 151.47900 1.000 55.97881  ? 434 PHE B CA  1 
ATOM   6539  C C   . PHE B 1 434 ? 152.90400 139.88100 150.39900 1.000 55.97881  ? 434 PHE B C   1 
ATOM   6540  O O   . PHE B 1 434 ? 152.85500 140.34000 149.25500 1.000 55.97881  ? 434 PHE B O   1 
ATOM   6541  C CB  . PHE B 1 434 ? 150.68600 139.52500 151.46800 1.000 55.97881  ? 434 PHE B CB  1 
ATOM   6542  N N   . GLN B 1 435 ? 153.75400 138.92900 150.76800 1.000 53.68859  ? 435 GLN B N   1 
ATOM   6543  C CA  . GLN B 1 435 ? 154.80500 138.43100 149.89000 1.000 53.68859  ? 435 GLN B CA  1 
ATOM   6544  C C   . GLN B 1 435 ? 154.26000 137.30700 149.01500 1.000 53.68859  ? 435 GLN B C   1 
ATOM   6545  O O   . GLN B 1 435 ? 153.05200 137.08000 148.93100 1.000 53.68859  ? 435 GLN B O   1 
ATOM   6546  C CB  . GLN B 1 435 ? 156.00800 137.98000 150.71300 1.000 53.68859  ? 435 GLN B CB  1 
ATOM   6547  N N   . GLY B 1 436 ? 155.15500 136.58700 148.35200 1.000 45.48337  ? 436 GLY B N   1 
ATOM   6548  C CA  . GLY B 1 436 ? 154.79100 135.57400 147.38900 1.000 45.48337  ? 436 GLY B CA  1 
ATOM   6549  C C   . GLY B 1 436 ? 154.41500 134.21500 147.93600 1.000 45.48337  ? 436 GLY B C   1 
ATOM   6550  O O   . GLY B 1 436 ? 154.21900 133.29300 147.13900 1.000 45.48337  ? 436 GLY B O   1 
ATOM   6551  N N   . LYS B 1 437 ? 154.34700 134.03400 149.26100 1.000 45.45298  ? 437 LYS B N   1 
ATOM   6552  C CA  . LYS B 1 437 ? 153.87500 132.75700 149.78600 1.000 45.45298  ? 437 LYS B CA  1 
ATOM   6553  C C   . LYS B 1 437 ? 153.03600 132.86000 151.05700 1.000 45.45298  ? 437 LYS B C   1 
ATOM   6554  O O   . LYS B 1 437 ? 152.81000 131.82600 151.69700 1.000 45.45298  ? 437 LYS B O   1 
ATOM   6555  C CB  . LYS B 1 437 ? 155.05800 131.82700 150.04700 1.000 45.45298  ? 437 LYS B CB  1 
ATOM   6556  N N   . ALA B 1 438 ? 152.56400 134.03700 151.45000 1.000 47.41510  ? 438 ALA B N   1 
ATOM   6557  C CA  . ALA B 1 438 ? 152.02500 134.23900 152.78600 1.000 47.41510  ? 438 ALA B CA  1 
ATOM   6558  C C   . ALA B 1 438 ? 150.51100 134.03200 152.81500 1.000 47.41510  ? 438 ALA B C   1 
ATOM   6559  O O   . ALA B 1 438 ? 149.89200 133.64100 151.82600 1.000 47.41510  ? 438 ALA B O   1 
ATOM   6560  C CB  . ALA B 1 438 ? 152.40900 135.62600 153.28900 1.000 47.41510  ? 438 ALA B CB  1 
ATOM   6561  N N   . VAL B 1 439 ? 149.90500 134.29200 153.97300 1.000 49.87181  ? 439 VAL B N   1 
ATOM   6562  C CA  . VAL B 1 439 ? 148.46900 134.17300 154.19900 1.000 49.87181  ? 439 VAL B CA  1 
ATOM   6563  C C   . VAL B 1 439 ? 147.89700 135.57000 154.35600 1.000 49.87181  ? 439 VAL B C   1 
ATOM   6564  O O   . VAL B 1 439 ? 148.48900 136.42200 155.02300 1.000 49.87181  ? 439 VAL B O   1 
ATOM   6565  C CB  . VAL B 1 439 ? 148.17200 133.32700 155.45100 1.000 49.87181  ? 439 VAL B CB  1 
ATOM   6566  C CG1 . VAL B 1 439 ? 146.73200 132.87300 155.46600 1.000 49.87181  ? 439 VAL B CG1 1 
ATOM   6567  C CG2 . VAL B 1 439 ? 149.11500 132.15500 155.53100 1.000 49.87181  ? 439 VAL B CG2 1 
ATOM   6568  N N   . ILE B 1 440 ? 146.74100 135.81700 153.74100 1.000 49.93089  ? 440 ILE B N   1 
ATOM   6569  C CA  . ILE B 1 440 ? 146.24600 137.18800 153.66800 1.000 49.93089  ? 440 ILE B CA  1 
ATOM   6570  C C   . ILE B 1 440 ? 144.88800 137.36200 154.33800 1.000 49.93089  ? 440 ILE B C   1 
ATOM   6571  O O   . ILE B 1 440 ? 144.29000 138.43800 154.25200 1.000 49.93089  ? 440 ILE B O   1 
ATOM   6572  C CB  . ILE B 1 440 ? 146.18100 137.68200 152.20800 1.000 49.93089  ? 440 ILE B CB  1 
ATOM   6573  C CG1 . ILE B 1 440 ? 145.13300 136.91200 151.41400 1.000 49.93089  ? 440 ILE B CG1 1 
ATOM   6574  C CG2 . ILE B 1 440 ? 147.52600 137.55600 151.52300 1.000 49.93089  ? 440 ILE B CG2 1 
ATOM   6575  C CD1 . ILE B 1 440 ? 145.02900 137.32100 149.96800 1.000 49.93089  ? 440 ILE B CD1 1 
ATOM   6576  N N   . GLY B 1 441 ? 144.38400 136.33300 155.01100 1.000 53.04691  ? 441 GLY B N   1 
ATOM   6577  C CA  . GLY B 1 441 ? 143.06600 136.46700 155.60700 1.000 53.04691  ? 441 GLY B CA  1 
ATOM   6578  C C   . GLY B 1 441 ? 142.84800 135.81600 156.95800 1.000 53.04691  ? 441 GLY B C   1 
ATOM   6579  O O   . GLY B 1 441 ? 141.71500 135.47400 157.30000 1.000 53.04691  ? 441 GLY B O   1 
ATOM   6580  N N   . GLU B 1 442 ? 143.90800 135.65700 157.74800 1.000 59.94184  ? 442 GLU B N   1 
ATOM   6581  C CA  . GLU B 1 442 ? 143.88200 134.77500 158.91100 1.000 59.94184  ? 442 GLU B CA  1 
ATOM   6582  C C   . GLU B 1 442 ? 143.21200 135.37200 160.14400 1.000 59.94184  ? 442 GLU B C   1 
ATOM   6583  O O   . GLU B 1 442 ? 143.23200 134.75000 161.20800 1.000 59.94184  ? 442 GLU B O   1 
ATOM   6584  C CB  . GLU B 1 442 ? 145.30700 134.37700 159.27400 1.000 59.94184  ? 442 GLU B CB  1 
ATOM   6585  C CG  . GLU B 1 442 ? 146.13100 135.55900 159.72300 1.000 59.94184  ? 442 GLU B CG  1 
ATOM   6586  C CD  . GLU B 1 442 ? 147.04400 136.07900 158.63700 1.000 59.94184  ? 442 GLU B CD  1 
ATOM   6587  O OE1 . GLU B 1 442 ? 146.89200 135.64100 157.48100 1.000 59.94184  ? 442 GLU B OE1 1 
ATOM   6588  O OE2 . GLU B 1 442 ? 147.92000 136.91700 158.93600 1.000 59.94184  ? 442 GLU B OE2 1 
ATOM   6589  N N   . THR B 1 443 ? 142.60500 136.54900 160.03300 1.000 62.56059  ? 443 THR B N   1 
ATOM   6590  C CA  . THR B 1 443 ? 142.04100 137.22200 161.19900 1.000 62.56059  ? 443 THR B CA  1 
ATOM   6591  C C   . THR B 1 443 ? 140.52500 137.02700 161.16100 1.000 62.56059  ? 443 THR B C   1 
ATOM   6592  O O   . THR B 1 443 ? 139.72900 137.95100 161.34700 1.000 62.56059  ? 443 THR B O   1 
ATOM   6593  C CB  . THR B 1 443 ? 142.47100 138.69000 161.21500 1.000 62.56059  ? 443 THR B CB  1 
ATOM   6594  O OG1 . THR B 1 443 ? 143.88300 138.73600 161.00400 1.000 62.56059  ? 443 THR B OG1 1 
ATOM   6595  C CG2 . THR B 1 443 ? 142.27000 139.31900 162.59700 1.000 62.56059  ? 443 THR B CG2 1 
ATOM   6596  N N   . PHE B 1 444 ? 140.12000 135.80900 160.81700 1.000 66.52608  ? 444 PHE B N   1 
ATOM   6597  C CA  . PHE B 1 444 ? 138.72500 135.39900 160.85300 1.000 66.52608  ? 444 PHE B CA  1 
ATOM   6598  C C   . PHE B 1 444 ? 138.45700 134.39100 161.96300 1.000 66.52608  ? 444 PHE B C   1 
ATOM   6599  O O   . PHE B 1 444 ? 137.35200 133.84600 162.04700 1.000 66.52608  ? 444 PHE B O   1 
ATOM   6600  C CB  . PHE B 1 444 ? 138.31300 134.83900 159.49300 1.000 66.52608  ? 444 PHE B CB  1 
ATOM   6601  C CG  . PHE B 1 444 ? 138.64500 133.40400 159.29200 1.000 66.52608  ? 444 PHE B CG  1 
ATOM   6602  C CD1 . PHE B 1 444 ? 139.95500 132.99300 159.18800 1.000 66.52608  ? 444 PHE B CD1 1 
ATOM   6603  C CD2 . PHE B 1 444 ? 137.63900 132.46700 159.16700 1.000 66.52608  ? 444 PHE B CD2 1 
ATOM   6604  C CE1 . PHE B 1 444 ? 140.25700 131.67800 158.99800 1.000 66.52608  ? 444 PHE B CE1 1 
ATOM   6605  C CE2 . PHE B 1 444 ? 137.93800 131.14300 158.96700 1.000 66.52608  ? 444 PHE B CE2 1 
ATOM   6606  C CZ  . PHE B 1 444 ? 139.25200 130.75000 158.88000 1.000 66.52608  ? 444 PHE B CZ  1 
ATOM   6607  N N   . GLY B 1 445 ? 139.44200 134.13900 162.82200 1.000 71.88191  ? 445 GLY B N   1 
ATOM   6608  C CA  . GLY B 1 445 ? 139.25000 133.31700 163.99800 1.000 71.88191  ? 445 GLY B CA  1 
ATOM   6609  C C   . GLY B 1 445 ? 139.88000 133.93000 165.23200 1.000 71.88191  ? 445 GLY B C   1 
ATOM   6610  O O   . GLY B 1 445 ? 140.34800 133.21200 166.11900 1.000 71.88191  ? 445 GLY B O   1 
ATOM   6611  N N   . GLU B 1 446 ? 139.90000 135.25400 165.30100 1.000 75.37466  ? 446 GLU B N   1 
ATOM   6612  C CA  . GLU B 1 446 ? 140.61200 135.97300 166.35400 1.000 75.37466  ? 446 GLU B CA  1 
ATOM   6613  C C   . GLU B 1 446 ? 139.86600 137.27800 166.60900 1.000 75.37466  ? 446 GLU B C   1 
ATOM   6614  O O   . GLU B 1 446 ? 138.66200 137.36600 166.35600 1.000 75.37466  ? 446 GLU B O   1 
ATOM   6615  C CB  . GLU B 1 446 ? 142.08800 136.17700 165.98500 1.000 75.37466  ? 446 GLU B CB  1 
ATOM   6616  C CG  . GLU B 1 446 ? 143.01600 136.05500 167.18000 1.000 75.37466  ? 446 GLU B CG  1 
ATOM   6617  C CD  . GLU B 1 446 ? 144.46100 136.27500 166.81900 1.000 75.37466  ? 446 GLU B CD  1 
ATOM   6618  O OE1 . GLU B 1 446 ? 144.98500 135.51800 165.97600 1.000 75.37466  ? 446 GLU B OE1 1 
ATOM   6619  O OE2 . GLU B 1 446 ? 145.07100 137.21000 167.37800 1.000 75.37466  ? 446 GLU B OE2 1 
ATOM   6620  N N   . VAL B 1 447 ? 140.57800 138.28200 167.14100 1.000 77.94814  ? 447 VAL B N   1 
ATOM   6621  C CA  . VAL B 1 447 ? 140.07000 139.56800 167.63600 1.000 77.94814  ? 447 VAL B CA  1 
ATOM   6622  C C   . VAL B 1 447 ? 139.15000 140.30600 166.65300 1.000 77.94814  ? 447 VAL B C   1 
ATOM   6623  O O   . VAL B 1 447 ? 138.31100 141.11600 167.06200 1.000 77.94814  ? 447 VAL B O   1 
ATOM   6624  C CB  . VAL B 1 447 ? 141.27200 140.44700 168.05800 1.000 77.94814  ? 447 VAL B CB  1 
ATOM   6625  C CG1 . VAL B 1 447 ? 142.08500 140.92300 166.85300 1.000 77.94814  ? 447 VAL B CG1 1 
ATOM   6626  C CG2 . VAL B 1 447 ? 140.85600 141.60400 168.97000 1.000 77.94814  ? 447 VAL B CG2 1 
ATOM   6627  N N   . GLY B 1 448 ? 139.25900 140.00500 165.36100 1.000 73.10280  ? 448 GLY B N   1 
ATOM   6628  C CA  . GLY B 1 448 ? 138.31700 140.51400 164.38800 1.000 73.10280  ? 448 GLY B CA  1 
ATOM   6629  C C   . GLY B 1 448 ? 137.48000 139.43800 163.72100 1.000 73.10280  ? 448 GLY B C   1 
ATOM   6630  O O   . GLY B 1 448 ? 137.30500 139.47200 162.50200 1.000 73.10280  ? 448 GLY B O   1 
ATOM   6631  N N   . VAL B 1 449 ? 136.91700 138.50000 164.49400 1.000 70.97942  ? 449 VAL B N   1 
ATOM   6632  C CA  . VAL B 1 449 ? 136.16800 137.36900 163.93700 1.000 70.97942  ? 449 VAL B CA  1 
ATOM   6633  C C   . VAL B 1 449 ? 134.79400 137.78600 163.43200 1.000 70.97942  ? 449 VAL B C   1 
ATOM   6634  O O   . VAL B 1 449 ? 134.00500 136.93700 163.00700 1.000 70.97942  ? 449 VAL B O   1 
ATOM   6635  C CB  . VAL B 1 449 ? 136.00900 136.22400 164.95300 1.000 70.97942  ? 449 VAL B CB  1 
ATOM   6636  N N   . LEU B 1 450 ? 134.47300 139.07500 163.52400 1.000 71.76976  ? 450 LEU B N   1 
ATOM   6637  C CA  . LEU B 1 450 ? 133.30600 139.64700 162.86900 1.000 71.76976  ? 450 LEU B CA  1 
ATOM   6638  C C   . LEU B 1 450 ? 133.67600 140.72800 161.86100 1.000 71.76976  ? 450 LEU B C   1 
ATOM   6639  O O   . LEU B 1 450 ? 132.78100 141.43400 161.38300 1.000 71.76976  ? 450 LEU B O   1 
ATOM   6640  C CB  . LEU B 1 450 ? 132.33400 140.23200 163.89900 1.000 71.76976  ? 450 LEU B CB  1 
ATOM   6641  C CG  . LEU B 1 450 ? 131.85600 139.39100 165.08200 1.000 71.76976  ? 450 LEU B CG  1 
ATOM   6642  C CD1 . LEU B 1 450 ? 130.77500 140.13300 165.84600 1.000 71.76976  ? 450 LEU B CD1 1 
ATOM   6643  C CD2 . LEU B 1 450 ? 131.33300 138.04000 164.62200 1.000 71.76976  ? 450 LEU B CD2 1 
ATOM   6644  N N   . TYR B 1 451 ? 134.95400 140.88800 161.52300 1.000 65.59959  ? 451 TYR B N   1 
ATOM   6645  C CA  . TYR B 1 451 ? 135.34000 141.97400 160.63000 1.000 65.59959  ? 451 TYR B CA  1 
ATOM   6646  C C   . TYR B 1 451 ? 136.57800 141.57200 159.83100 1.000 65.59959  ? 451 TYR B C   1 
ATOM   6647  O O   . TYR B 1 451 ? 136.98200 140.40600 159.81300 1.000 65.59959  ? 451 TYR B O   1 
ATOM   6648  C CB  . TYR B 1 451 ? 135.55500 143.26300 161.43200 1.000 65.59959  ? 451 TYR B CB  1 
ATOM   6649  N N   . TYR B 1 452 ? 137.15900 142.55400 159.14600 1.000 60.59411  ? 452 TYR B N   1 
ATOM   6650  C CA  . TYR B 1 452 ? 138.36800 142.42200 158.34100 1.000 60.59411  ? 452 TYR B CA  1 
ATOM   6651  C C   . TYR B 1 452 ? 139.21700 143.66500 158.52400 1.000 60.59411  ? 452 TYR B C   1 
ATOM   6652  O O   . TYR B 1 452 ? 138.70000 144.78100 158.45300 1.000 60.59411  ? 452 TYR B O   1 
ATOM   6653  C CB  . TYR B 1 452 ? 138.03400 142.24100 156.86000 1.000 60.59411  ? 452 TYR B CB  1 
ATOM   6654  C CG  . TYR B 1 452 ? 137.90300 140.81700 156.39100 1.000 60.59411  ? 452 TYR B CG  1 
ATOM   6655  C CD1 . TYR B 1 452 ? 138.65200 139.80000 156.96200 1.000 60.59411  ? 452 TYR B CD1 1 
ATOM   6656  C CD2 . TYR B 1 452 ? 136.99500 140.48700 155.40300 1.000 60.59411  ? 452 TYR B CD2 1 
ATOM   6657  C CE1 . TYR B 1 452 ? 138.53500 138.50000 156.51900 1.000 60.59411  ? 452 TYR B CE1 1 
ATOM   6658  C CE2 . TYR B 1 452 ? 136.85800 139.19400 154.96100 1.000 60.59411  ? 452 TYR B CE2 1 
ATOM   6659  C CZ  . TYR B 1 452 ? 137.62900 138.20400 155.51800 1.000 60.59411  ? 452 TYR B CZ  1 
ATOM   6660  O OH  . TYR B 1 452 ? 137.48100 136.91200 155.07100 1.000 60.59411  ? 452 TYR B OH  1 
ATOM   6661  N N   . ARG B 1 453 ? 140.50200 143.48000 158.77000 1.000 58.29291  ? 453 ARG B N   1 
ATOM   6662  C CA  . ARG B 1 453 ? 141.31600 144.67700 158.89300 1.000 58.29291  ? 453 ARG B CA  1 
ATOM   6663  C C   . ARG B 1 453 ? 141.62600 145.29200 157.52200 1.000 58.29291  ? 453 ARG B C   1 
ATOM   6664  O O   . ARG B 1 453 ? 141.20600 146.43100 157.28900 1.000 58.29291  ? 453 ARG B O   1 
ATOM   6665  C CB  . ARG B 1 453 ? 142.58100 144.39300 159.71600 1.000 58.29291  ? 453 ARG B CB  1 
ATOM   6666  N N   . PRO B 1 454 ? 142.33100 144.61000 156.55900 1.000 56.92345  ? 454 PRO B N   1 
ATOM   6667  C CA  . PRO B 1 454 ? 142.66700 145.31700 155.32000 1.000 56.92345  ? 454 PRO B CA  1 
ATOM   6668  C C   . PRO B 1 454 ? 141.63600 145.12600 154.22000 1.000 56.92345  ? 454 PRO B C   1 
ATOM   6669  O O   . PRO B 1 454 ? 140.58300 144.51700 154.42800 1.000 56.92345  ? 454 PRO B O   1 
ATOM   6670  C CB  . PRO B 1 454 ? 144.01300 144.69900 154.93600 1.000 56.92345  ? 454 PRO B CB  1 
ATOM   6671  C CG  . PRO B 1 454 ? 143.98000 143.31000 155.53800 1.000 56.92345  ? 454 PRO B CG  1 
ATOM   6672  C CD  . PRO B 1 454 ? 142.76400 143.20300 156.41700 1.000 56.92345  ? 454 PRO B CD  1 
ATOM   6673  N N   . GLN B 1 455 ? 141.92700 145.66400 153.04200 1.000 54.64476  ? 455 GLN B N   1 
ATOM   6674  C CA  . GLN B 1 455 ? 141.16700 145.38000 151.82600 1.000 54.64476  ? 455 GLN B CA  1 
ATOM   6675  C C   . GLN B 1 455 ? 142.15800 145.05100 150.72100 1.000 54.64476  ? 455 GLN B C   1 
ATOM   6676  O O   . GLN B 1 455 ? 142.51900 145.92300 149.92300 1.000 54.64476  ? 455 GLN B O   1 
ATOM   6677  C CB  . GLN B 1 455 ? 140.27900 146.56000 151.43600 1.000 54.64476  ? 455 GLN B CB  1 
ATOM   6678  N N   . PRO B 1 456 ? 142.62000 143.80200 150.64200 1.000 50.37597  ? 456 PRO B N   1 
ATOM   6679  C CA  . PRO B 1 456 ? 143.64200 143.45500 149.65300 1.000 50.37597  ? 456 PRO B CA  1 
ATOM   6680  C C   . PRO B 1 456 ? 143.10400 143.42800 148.23900 1.000 50.37597  ? 456 PRO B C   1 
ATOM   6681  O O   . PRO B 1 456 ? 141.92900 143.15300 147.99700 1.000 50.37597  ? 456 PRO B O   1 
ATOM   6682  C CB  . PRO B 1 456 ? 144.09100 142.05700 150.08200 1.000 50.37597  ? 456 PRO B CB  1 
ATOM   6683  C CG  . PRO B 1 456 ? 143.01300 141.53300 150.86300 1.000 50.37597  ? 456 PRO B CG  1 
ATOM   6684  C CD  . PRO B 1 456 ? 142.38600 142.68900 151.57000 1.000 50.37597  ? 456 PRO B CD  1 
ATOM   6685  N N   . PHE B 1 457 ? 143.99800 143.71600 147.30000 1.000 46.26449  ? 457 PHE B N   1 
ATOM   6686  C CA  . PHE B 1 457 ? 143.67500 143.68300 145.88400 1.000 46.26449  ? 457 PHE B CA  1 
ATOM   6687  C C   . PHE B 1 457 ? 144.96800 143.45100 145.11800 1.000 46.26449  ? 457 PHE B C   1 
ATOM   6688  O O   . PHE B 1 457 ? 146.00700 144.00500 145.47900 1.000 46.26449  ? 457 PHE B O   1 
ATOM   6689  C CB  . PHE B 1 457 ? 142.94900 144.96700 145.44400 1.000 46.26449  ? 457 PHE B CB  1 
ATOM   6690  C CG  . PHE B 1 457 ? 143.82900 146.16800 145.27100 1.000 46.26449  ? 457 PHE B CG  1 
ATOM   6691  C CD1 . PHE B 1 457 ? 144.51800 146.71700 146.34000 1.000 46.26449  ? 457 PHE B CD1 1 
ATOM   6692  C CD2 . PHE B 1 457 ? 143.92900 146.78100 144.03500 1.000 46.26449  ? 457 PHE B CD2 1 
ATOM   6693  C CE1 . PHE B 1 457 ? 145.31900 147.83200 146.17400 1.000 46.26449  ? 457 PHE B CE1 1 
ATOM   6694  C CE2 . PHE B 1 457 ? 144.72700 147.89700 143.85800 1.000 46.26449  ? 457 PHE B CE2 1 
ATOM   6695  C CZ  . PHE B 1 457 ? 145.42200 148.42300 144.93000 1.000 46.26449  ? 457 PHE B CZ  1 
ATOM   6696  N N   . THR B 1 458 ? 144.90600 142.59500 144.09700 1.000 41.85293  ? 458 THR B N   1 
ATOM   6697  C CA  . THR B 1 458 ? 146.08900 142.08900 143.40700 1.000 41.85293  ? 458 THR B CA  1 
ATOM   6698  C C   . THR B 1 458 ? 146.84500 143.16700 142.65400 1.000 41.85293  ? 458 THR B C   1 
ATOM   6699  O O   . THR B 1 458 ? 146.30500 144.24300 142.38800 1.000 41.85293  ? 458 THR B O   1 
ATOM   6700  C CB  . THR B 1 458 ? 145.70100 140.99800 142.41800 1.000 41.85293  ? 458 THR B CB  1 
ATOM   6701  O OG1 . THR B 1 458 ? 144.67700 141.49500 141.55300 1.000 41.85293  ? 458 THR B OG1 1 
ATOM   6702  C CG2 . THR B 1 458 ? 145.18800 139.79700 143.13400 1.000 41.85293  ? 458 THR B CG2 1 
ATOM   6703  N N   . VAL B 1 459 ? 148.10000 142.89200 142.31000 1.000 43.88804  ? 459 VAL B N   1 
ATOM   6704  C CA  . VAL B 1 459 ? 148.84600 143.80900 141.46100 1.000 43.88804  ? 459 VAL B CA  1 
ATOM   6705  C C   . VAL B 1 459 ? 149.38600 143.11400 140.21400 1.000 43.88804  ? 459 VAL B C   1 
ATOM   6706  O O   . VAL B 1 459 ? 149.25700 143.65600 139.11300 1.000 43.88804  ? 459 VAL B O   1 
ATOM   6707  C CB  . VAL B 1 459 ? 149.95600 144.53300 142.24700 1.000 43.88804  ? 459 VAL B CB  1 
ATOM   6708  C CG1 . VAL B 1 459 ? 149.35100 145.61800 143.11200 1.000 43.88804  ? 459 VAL B CG1 1 
ATOM   6709  C CG2 . VAL B 1 459 ? 150.70400 143.58000 143.14500 1.000 43.88804  ? 459 VAL B CG2 1 
ATOM   6710  N N   . ARG B 1 460 ? 150.02000 141.94600 140.34400 1.000 42.33944  ? 460 ARG B N   1 
ATOM   6711  C CA  . ARG B 1 460 ? 150.55100 141.36200 139.11800 1.000 42.33944  ? 460 ARG B CA  1 
ATOM   6712  C C   . ARG B 1 460 ? 149.58700 140.42900 138.38900 1.000 42.33944  ? 460 ARG B C   1 
ATOM   6713  O O   . ARG B 1 460 ? 148.91100 140.84700 137.44600 1.000 42.33944  ? 460 ARG B O   1 
ATOM   6714  C CB  . ARG B 1 460 ? 151.84200 140.60700 139.43400 1.000 42.33944  ? 460 ARG B CB  1 
ATOM   6715  N N   . THR B 1 461 ? 149.49400 139.18200 138.85200 1.000 41.86684  ? 461 THR B N   1 
ATOM   6716  C CA  . THR B 1 461 ? 148.57000 138.14500 138.39200 1.000 41.86684  ? 461 THR B CA  1 
ATOM   6717  C C   . THR B 1 461 ? 148.69500 137.02300 139.40300 1.000 41.86684  ? 461 THR B C   1 
ATOM   6718  O O   . THR B 1 461 ? 149.76300 136.41300 139.51000 1.000 41.86684  ? 461 THR B O   1 
ATOM   6719  C CB  . THR B 1 461 ? 148.88800 137.63900 136.97800 1.000 41.86684  ? 461 THR B CB  1 
ATOM   6720  O OG1 . THR B 1 461 ? 148.50400 138.63200 136.02400 1.000 41.86684  ? 461 THR B OG1 1 
ATOM   6721  C CG2 . THR B 1 461 ? 148.13500 136.35700 136.65700 1.000 41.86684  ? 461 THR B CG2 1 
ATOM   6722  N N   . THR B 1 462 ? 147.64600 136.72300 140.14500 1.000 39.56891  ? 462 THR B N   1 
ATOM   6723  C CA  . THR B 1 462 ? 147.84200 135.99700 141.38100 1.000 39.56891  ? 462 THR B CA  1 
ATOM   6724  C C   . THR B 1 462 ? 146.95700 134.76900 141.43500 1.000 39.56891  ? 462 THR B C   1 
ATOM   6725  O O   . THR B 1 462 ? 145.77300 134.83000 141.12400 1.000 39.56891  ? 462 THR B O   1 
ATOM   6726  C CB  . THR B 1 462 ? 147.54700 136.89900 142.56400 1.000 39.56891  ? 462 THR B CB  1 
ATOM   6727  O OG1 . THR B 1 462 ? 147.97200 138.22600 142.24500 1.000 39.56891  ? 462 THR B OG1 1 
ATOM   6728  C CG2 . THR B 1 462 ? 148.31700 136.43100 143.76100 1.000 39.56891  ? 462 THR B CG2 1 
ATOM   6729  N N   . GLU B 1 463 ? 147.54100 133.65800 141.86800 1.000 38.55331  ? 463 GLU B N   1 
ATOM   6730  C CA  . GLU B 1 463 ? 146.81000 132.42700 142.13100 1.000 38.55331  ? 463 GLU B CA  1 
ATOM   6731  C C   . GLU B 1 463 ? 146.71000 132.23400 143.63600 1.000 38.55331  ? 463 GLU B C   1 
ATOM   6732  O O   . GLU B 1 463 ? 147.72600 132.27200 144.33300 1.000 38.55331  ? 463 GLU B O   1 
ATOM   6733  C CB  . GLU B 1 463 ? 147.50700 131.23600 141.48600 1.000 38.55331  ? 463 GLU B CB  1 
ATOM   6734  C CG  . GLU B 1 463 ? 146.71700 129.96500 141.57600 1.000 38.55331  ? 463 GLU B CG  1 
ATOM   6735  C CD  . GLU B 1 463 ? 147.53400 128.76100 141.20500 1.000 38.55331  ? 463 GLU B CD  1 
ATOM   6736  O OE1 . GLU B 1 463 ? 148.69700 128.94000 140.79600 1.000 38.55331  ? 463 GLU B OE1 1 
ATOM   6737  O OE2 . GLU B 1 463 ? 147.01600 127.63500 141.32200 1.000 38.55331  ? 463 GLU B OE2 1 
ATOM   6738  N N   . LEU B 1 464 ? 145.49300 132.03400 144.13700 1.000 38.37440  ? 464 LEU B N   1 
ATOM   6739  C CA  . LEU B 1 464 ? 145.21400 131.90100 145.55900 1.000 38.37440  ? 464 LEU B CA  1 
ATOM   6740  C C   . LEU B 1 464 ? 144.68600 130.50100 145.86400 1.000 38.37440  ? 464 LEU B C   1 
ATOM   6741  O O   . LEU B 1 464 ? 144.66900 129.62600 145.00000 1.000 38.37440  ? 464 LEU B O   1 
ATOM   6742  C CB  . LEU B 1 464 ? 144.23000 132.97200 145.99200 1.000 38.37440  ? 464 LEU B CB  1 
ATOM   6743  C CG  . LEU B 1 464 ? 144.52500 134.33500 145.40100 1.000 38.37440  ? 464 LEU B CG  1 
ATOM   6744  C CD1 . LEU B 1 464 ? 143.37600 135.22200 145.68200 1.000 38.37440  ? 464 LEU B CD1 1 
ATOM   6745  C CD2 . LEU B 1 464 ? 145.76700 134.89500 146.00400 1.000 38.37440  ? 464 LEU B CD2 1 
ATOM   6746  N N   . SER B 1 465 ? 144.25400 130.28000 147.10700 1.000 41.79334  ? 465 SER B N   1 
ATOM   6747  C CA  . SER B 1 465 ? 143.81800 128.94700 147.50600 1.000 41.79334  ? 465 SER B CA  1 
ATOM   6748  C C   . SER B 1 465 ? 142.43000 128.89700 148.12700 1.000 41.79334  ? 465 SER B C   1 
ATOM   6749  O O   . SER B 1 465 ? 141.72800 127.90400 147.91900 1.000 41.79334  ? 465 SER B O   1 
ATOM   6750  C CB  . SER B 1 465 ? 144.83900 128.31400 148.45500 1.000 41.79334  ? 465 SER B CB  1 
ATOM   6751  O OG  . SER B 1 465 ? 145.86200 127.67200 147.71700 1.000 41.79334  ? 465 SER B OG  1 
ATOM   6752  N N   . GLN B 1 466 ? 142.02200 129.91000 148.90100 1.000 45.48069  ? 466 GLN B N   1 
ATOM   6753  C CA  . GLN B 1 466 ? 140.66600 130.04300 149.45300 1.000 45.48069  ? 466 GLN B CA  1 
ATOM   6754  C C   . GLN B 1 466 ? 140.20500 128.85800 150.30400 1.000 45.48069  ? 466 GLN B C   1 
ATOM   6755  O O   . GLN B 1 466 ? 139.40400 128.03800 149.84600 1.000 45.48069  ? 466 GLN B O   1 
ATOM   6756  C CB  . GLN B 1 466 ? 139.63000 130.29700 148.35000 1.000 45.48069  ? 466 GLN B CB  1 
ATOM   6757  C CG  . GLN B 1 466 ? 138.28100 130.82400 148.86600 1.000 45.48069  ? 466 GLN B CG  1 
ATOM   6758  C CD  . GLN B 1 466 ? 137.18500 130.79300 147.82300 1.000 45.48069  ? 466 GLN B CD  1 
ATOM   6759  O OE1 . GLN B 1 466 ? 137.41500 130.43900 146.66900 1.000 45.48069  ? 466 GLN B OE1 1 
ATOM   6760  N NE2 . GLN B 1 466 ? 135.97500 131.14100 148.23400 1.000 45.48069  ? 466 GLN B NE2 1 
ATOM   6761  N N   . ILE B 1 467 ? 140.76900 128.68500 151.49000 1.000 49.77483  ? 467 ILE B N   1 
ATOM   6762  C CA  . ILE B 1 467 ? 140.16900 127.79300 152.47700 1.000 49.77483  ? 467 ILE B CA  1 
ATOM   6763  C C   . ILE B 1 467 ? 139.06800 128.55200 153.20500 1.000 49.77483  ? 467 ILE B C   1 
ATOM   6764  O O   . ILE B 1 467 ? 139.29200 129.66000 153.70300 1.000 49.77483  ? 467 ILE B O   1 
ATOM   6765  C CB  . ILE B 1 467 ? 141.22800 127.27000 153.45300 1.000 49.77483  ? 467 ILE B CB  1 
ATOM   6766  C CG1 . ILE B 1 467 ? 142.45400 126.79700 152.68400 1.000 49.77483  ? 467 ILE B CG1 1 
ATOM   6767  C CG2 . ILE B 1 467 ? 140.66200 126.15000 154.28300 1.000 49.77483  ? 467 ILE B CG2 1 
ATOM   6768  C CD1 . ILE B 1 467 ? 143.56600 126.33300 153.56900 1.000 49.77483  ? 467 ILE B CD1 1 
ATOM   6769  N N   . LEU B 1 468 ? 137.87100 127.96900 153.26700 1.000 58.60827  ? 468 LEU B N   1 
ATOM   6770  C CA  . LEU B 1 468 ? 136.66200 128.72800 153.59600 1.000 58.60827  ? 468 LEU B CA  1 
ATOM   6771  C C   . LEU B 1 468 ? 135.82600 128.08100 154.69500 1.000 58.60827  ? 468 LEU B C   1 
ATOM   6772  O O   . LEU B 1 468 ? 134.87600 127.36200 154.37400 1.000 58.60827  ? 468 LEU B O   1 
ATOM   6773  C CB  . LEU B 1 468 ? 135.82500 128.91300 152.33900 1.000 58.60827  ? 468 LEU B CB  1 
ATOM   6774  N N   . ARG B 1 469 ? 136.16900 128.37100 155.96000 1.000 65.73977  ? 469 ARG B N   1 
ATOM   6775  C CA  . ARG B 1 469 ? 135.38700 128.08100 157.16700 1.000 65.73977  ? 469 ARG B CA  1 
ATOM   6776  C C   . ARG B 1 469 ? 134.85400 126.65300 157.27000 1.000 65.73977  ? 469 ARG B C   1 
ATOM   6777  O O   . ARG B 1 469 ? 133.75900 126.42900 157.79600 1.000 65.73977  ? 469 ARG B O   1 
ATOM   6778  C CB  . ARG B 1 469 ? 134.21900 129.06200 157.27400 1.000 65.73977  ? 469 ARG B CB  1 
ATOM   6779  N N   . ILE B 1 470 ? 135.59600 125.69200 156.73300 1.000 69.37574  ? 470 ILE B N   1 
ATOM   6780  C CA  . ILE B 1 470 ? 135.20500 124.29300 156.79100 1.000 69.37574  ? 470 ILE B CA  1 
ATOM   6781  C C   . ILE B 1 470 ? 136.41800 123.48700 157.21900 1.000 69.37574  ? 470 ILE B C   1 
ATOM   6782  O O   . ILE B 1 470 ? 136.31600 122.29200 157.50800 1.000 69.37574  ? 470 ILE B O   1 
ATOM   6783  C CB  . ILE B 1 470 ? 134.65600 123.80700 155.44100 1.000 69.37574  ? 470 ILE B CB  1 
ATOM   6784  N N   . SER B 1 471 ? 137.57700 124.13700 157.24900 1.000 71.38928  ? 471 SER B N   1 
ATOM   6785  C CA  . SER B 1 471 ? 138.79100 123.52300 157.76000 1.000 71.38928  ? 471 SER B CA  1 
ATOM   6786  C C   . SER B 1 471 ? 139.46100 124.33600 158.85600 1.000 71.38928  ? 471 SER B C   1 
ATOM   6787  O O   . SER B 1 471 ? 140.60000 124.02800 159.21800 1.000 71.38928  ? 471 SER B O   1 
ATOM   6788  C CB  . SER B 1 471 ? 139.80100 123.28000 156.62800 1.000 71.38928  ? 471 SER B CB  1 
ATOM   6789  N N   . ARG B 1 472 ? 138.81200 125.37100 159.37200 1.000 74.89574  ? 472 ARG B N   1 
ATOM   6790  C CA  . ARG B 1 472 ? 139.27500 126.06700 160.56100 1.000 74.89574  ? 472 ARG B CA  1 
ATOM   6791  C C   . ARG B 1 472 ? 138.19100 126.24200 161.61500 1.000 74.89574  ? 472 ARG B C   1 
ATOM   6792  O O   . ARG B 1 472 ? 138.49200 126.17000 162.81000 1.000 74.89574  ? 472 ARG B O   1 
ATOM   6793  C CB  . ARG B 1 472 ? 139.85000 127.44100 160.18400 1.000 74.89574  ? 472 ARG B CB  1 
ATOM   6794  N N   . THR B 1 473 ? 136.94200 126.46300 161.20500 1.000 74.10115  ? 473 THR B N   1 
ATOM   6795  C CA  . THR B 1 473 ? 135.80000 126.52400 162.10800 1.000 74.10115  ? 473 THR B CA  1 
ATOM   6796  C C   . THR B 1 473 ? 135.05600 125.19900 162.18000 1.000 74.10115  ? 473 THR B C   1 
ATOM   6797  O O   . THR B 1 473 ? 134.79000 124.70200 163.27800 1.000 74.10115  ? 473 THR B O   1 
ATOM   6798  C CB  . THR B 1 473 ? 134.85000 127.65200 161.67700 1.000 74.10115  ? 473 THR B CB  1 
ATOM   6799  O OG1 . THR B 1 473 ? 135.41400 128.91600 162.05000 1.000 74.10115  ? 473 THR B OG1 1 
ATOM   6800  C CG2 . THR B 1 473 ? 133.47700 127.51800 162.31800 1.000 74.10115  ? 473 THR B CG2 1 
ATOM   6801  N N   . SER B 1 474 ? 134.75600 124.58200 161.04000 1.000 73.02819  ? 474 SER B N   1 
ATOM   6802  C CA  . SER B 1 474 ? 134.14900 123.26000 161.02200 1.000 73.02819  ? 474 SER B CA  1 
ATOM   6803  C C   . SER B 1 474 ? 135.18100 122.14000 161.06300 1.000 73.02819  ? 474 SER B C   1 
ATOM   6804  O O   . SER B 1 474 ? 134.83900 120.98500 160.79000 1.000 73.02819  ? 474 SER B O   1 
ATOM   6805  C CB  . SER B 1 474 ? 133.25200 123.10000 159.79600 1.000 73.02819  ? 474 SER B CB  1 
ATOM   6806  O OG  . SER B 1 474 ? 132.82500 121.75800 159.66300 1.000 73.02819  ? 474 SER B OG  1 
ATOM   6807  N N   . LEU B 1 475 ? 136.43400 122.45700 161.38300 1.000 73.97612  ? 475 LEU B N   1 
ATOM   6808  C CA  . LEU B 1 475 ? 137.40400 121.44900 161.78300 1.000 73.97612  ? 475 LEU B CA  1 
ATOM   6809  C C   . LEU B 1 475 ? 137.99000 121.75500 163.15100 1.000 73.97612  ? 475 LEU B C   1 
ATOM   6810  O O   . LEU B 1 475 ? 139.21400 121.74100 163.31900 1.000 73.97612  ? 475 LEU B O   1 
ATOM   6811  C CB  . LEU B 1 475 ? 138.51700 121.30000 160.75000 1.000 73.97612  ? 475 LEU B CB  1 
ATOM   6812  C CG  . LEU B 1 475 ? 139.03400 119.86400 160.63400 1.000 73.97612  ? 475 LEU B CG  1 
ATOM   6813  C CD1 . LEU B 1 475 ? 137.88400 118.87600 160.51400 1.000 73.97612  ? 475 LEU B CD1 1 
ATOM   6814  C CD2 . LEU B 1 475 ? 139.97000 119.72400 159.46000 1.000 73.97612  ? 475 LEU B CD2 1 
ATOM   6815  N N   . MET B 1 476 ? 137.13600 122.06600 164.12600 1.000 77.43245  ? 476 MET B N   1 
ATOM   6816  C CA  . MET B 1 476 ? 137.55800 122.09700 165.51800 1.000 77.43245  ? 476 MET B CA  1 
ATOM   6817  C C   . MET B 1 476 ? 137.85000 120.69300 166.02800 1.000 77.43245  ? 476 MET B C   1 
ATOM   6818  O O   . MET B 1 476 ? 138.67200 120.50600 166.93100 1.000 77.43245  ? 476 MET B O   1 
ATOM   6819  C CB  . MET B 1 476 ? 136.46400 122.74600 166.36700 1.000 77.43245  ? 476 MET B CB  1 
ATOM   6820  C CG  . MET B 1 476 ? 135.09600 122.10000 166.17700 1.000 77.43245  ? 476 MET B CG  1 
ATOM   6821  S SD  . MET B 1 476 ? 133.79600 122.68000 167.27600 1.000 77.43245  ? 476 MET B SD  1 
ATOM   6822  C CE  . MET B 1 476 ? 132.52600 121.46100 166.94000 1.000 77.43245  ? 476 MET B CE  1 
ATOM   6823  N N   . SER B 1 477 ? 137.21100 119.69000 165.43000 1.000 78.04209  ? 477 SER B N   1 
ATOM   6824  C CA  . SER B 1 477 ? 137.00800 118.40700 166.07900 1.000 78.04209  ? 477 SER B CA  1 
ATOM   6825  C C   . SER B 1 477 ? 138.11900 117.40300 165.82700 1.000 78.04209  ? 477 SER B C   1 
ATOM   6826  O O   . SER B 1 477 ? 138.33500 116.52500 166.66900 1.000 78.04209  ? 477 SER B O   1 
ATOM   6827  C CB  . SER B 1 477 ? 135.67800 117.81100 165.61700 1.000 78.04209  ? 477 SER B CB  1 
ATOM   6828  O OG  . SER B 1 477 ? 134.60200 118.66600 165.96300 1.000 78.04209  ? 477 SER B OG  1 
ATOM   6829  N N   . ALA B 1 478 ? 138.82100 117.49400 164.70100 1.000 79.23426  ? 478 ALA B N   1 
ATOM   6830  C CA  . ALA B 1 478 ? 139.77100 116.43900 164.35900 1.000 79.23426  ? 478 ALA B CA  1 
ATOM   6831  C C   . ALA B 1 478 ? 141.05800 116.57200 165.16300 1.000 79.23426  ? 478 ALA B C   1 
ATOM   6832  O O   . ALA B 1 478 ? 141.35400 115.73800 166.02300 1.000 79.23426  ? 478 ALA B O   1 
ATOM   6833  C CB  . ALA B 1 478 ? 140.05900 116.46600 162.85600 1.000 79.23426  ? 478 ALA B CB  1 
ATOM   6834  N N   . MET B 1 479 ? 141.82800 117.62100 164.90400 1.000 84.14589  ? 479 MET B N   1 
ATOM   6835  C CA  . MET B 1 479 ? 143.09800 117.86700 165.58000 1.000 84.14589  ? 479 MET B CA  1 
ATOM   6836  C C   . MET B 1 479 ? 143.30900 119.37300 165.64100 1.000 84.14589  ? 479 MET B C   1 
ATOM   6837  O O   . MET B 1 479 ? 142.40800 120.15700 165.32800 1.000 84.14589  ? 479 MET B O   1 
ATOM   6838  C CB  . MET B 1 479 ? 144.29500 117.20800 164.87100 1.000 84.14589  ? 479 MET B CB  1 
ATOM   6839  C CG  . MET B 1 479 ? 144.42400 115.68000 164.88000 1.000 84.14589  ? 479 MET B CG  1 
ATOM   6840  S SD  . MET B 1 479 ? 143.46200 114.77500 163.65200 1.000 84.14589  ? 479 MET B SD  1 
ATOM   6841  C CE  . MET B 1 479 ? 144.39000 115.13400 162.17800 1.000 84.14589  ? 479 MET B CE  1 
ATOM   6842  N N   . HIS B 1 480 ? 144.52200 119.76100 166.05100 1.000 82.60208  ? 480 HIS B N   1 
ATOM   6843  C CA  . HIS B 1 480 ? 145.10900 121.08600 165.82800 1.000 82.60208  ? 480 HIS B CA  1 
ATOM   6844  C C   . HIS B 1 480 ? 144.29400 122.21200 166.47800 1.000 82.60208  ? 480 HIS B C   1 
ATOM   6845  O O   . HIS B 1 480 ? 143.68800 123.05400 165.81600 1.000 82.60208  ? 480 HIS B O   1 
ATOM   6846  C CB  . HIS B 1 480 ? 145.29900 121.34200 164.33100 1.000 82.60208  ? 480 HIS B CB  1 
ATOM   6847  N N   . ALA B 1 481 ? 144.29600 122.19700 167.80700 1.000 80.51451  ? 481 ALA B N   1 
ATOM   6848  C CA  . ALA B 1 481 ? 143.95800 123.40800 168.55900 1.000 80.51451  ? 481 ALA B CA  1 
ATOM   6849  C C   . ALA B 1 481 ? 145.18500 124.31300 168.78900 1.000 80.51451  ? 481 ALA B C   1 
ATOM   6850  O O   . ALA B 1 481 ? 145.13100 125.32200 169.50000 1.000 80.51451  ? 481 ALA B O   1 
ATOM   6851  C CB  . ALA B 1 481 ? 143.31900 123.04000 169.89700 1.000 80.51451  ? 481 ALA B CB  1 
ATOM   6852  N N   . HIS B 1 482 ? 146.27600 123.88400 168.15900 1.000 79.40001  ? 482 HIS B N   1 
ATOM   6853  C CA  . HIS B 1 482 ? 147.55800 124.56600 168.14300 1.000 79.40001  ? 482 HIS B CA  1 
ATOM   6854  C C   . HIS B 1 482 ? 147.62600 125.66600 167.09000 1.000 79.40001  ? 482 HIS B C   1 
ATOM   6855  O O   . HIS B 1 482 ? 148.44900 126.58100 167.21600 1.000 79.40001  ? 482 HIS B O   1 
ATOM   6856  C CB  . HIS B 1 482 ? 148.65400 123.51800 167.90700 1.000 79.40001  ? 482 HIS B CB  1 
ATOM   6857  C CG  . HIS B 1 482 ? 150.02500 124.08600 167.74200 1.000 79.40001  ? 482 HIS B CG  1 
ATOM   6858  N ND1 . HIS B 1 482 ? 150.56200 124.37300 166.50700 1.000 79.40001  ? 482 HIS B ND1 1 
ATOM   6859  C CD2 . HIS B 1 482 ? 150.96600 124.42900 168.65100 1.000 79.40001  ? 482 HIS B CD2 1 
ATOM   6860  C CE1 . HIS B 1 482 ? 151.77700 124.86400 166.66100 1.000 79.40001  ? 482 HIS B CE1 1 
ATOM   6861  N NE2 . HIS B 1 482 ? 152.04700 124.90800 167.95300 1.000 79.40001  ? 482 HIS B NE2 1 
ATOM   6862  N N   . ALA B 1 483 ? 146.76300 125.60700 166.07000 1.000 77.48283  ? 483 ALA B N   1 
ATOM   6863  C CA  . ALA B 1 483 ? 146.76500 126.62100 165.01900 1.000 77.48283  ? 483 ALA B CA  1 
ATOM   6864  C C   . ALA B 1 483 ? 146.33100 127.97400 165.56300 1.000 77.48283  ? 483 ALA B C   1 
ATOM   6865  O O   . ALA B 1 483 ? 146.82500 129.01900 165.12800 1.000 77.48283  ? 483 ALA B O   1 
ATOM   6866  C CB  . ALA B 1 483 ? 145.85400 126.18700 163.87200 1.000 77.48283  ? 483 ALA B CB  1 
ATOM   6867  N N   . ASP B 1 484 ? 145.42500 127.97000 166.54000 1.000 73.36616  ? 484 ASP B N   1 
ATOM   6868  C CA  . ASP B 1 484 ? 144.99500 129.21000 167.16900 1.000 73.36616  ? 484 ASP B CA  1 
ATOM   6869  C C   . ASP B 1 484 ? 146.05000 129.76700 168.10900 1.000 73.36616  ? 484 ASP B C   1 
ATOM   6870  O O   . ASP B 1 484 ? 145.94800 130.92300 168.52500 1.000 73.36616  ? 484 ASP B O   1 
ATOM   6871  C CB  . ASP B 1 484 ? 143.68600 128.98000 167.91600 1.000 73.36616  ? 484 ASP B CB  1 
ATOM   6872  C CG  . ASP B 1 484 ? 142.75600 130.15700 167.82500 1.000 73.36616  ? 484 ASP B CG  1 
ATOM   6873  O OD1 . ASP B 1 484 ? 143.18400 131.20900 167.31600 1.000 73.36616  ? 484 ASP B OD1 1 
ATOM   6874  O OD2 . ASP B 1 484 ? 141.58900 130.02900 168.24100 1.000 73.36616  ? 484 ASP B OD2 1 
ATOM   6875  N N   . ASP B 1 485 ? 147.05000 128.96400 168.46600 1.000 75.83681  ? 485 ASP B N   1 
ATOM   6876  C CA  . ASP B 1 485 ? 148.18200 129.41300 169.26300 1.000 75.83681  ? 485 ASP B CA  1 
ATOM   6877  C C   . ASP B 1 485 ? 149.26100 130.01300 168.36900 1.000 75.83681  ? 485 ASP B C   1 
ATOM   6878  O O   . ASP B 1 485 ? 149.91200 130.98900 168.75100 1.000 75.83681  ? 485 ASP B O   1 
ATOM   6879  C CB  . ASP B 1 485 ? 148.72800 128.22700 170.07200 1.000 75.83681  ? 485 ASP B CB  1 
ATOM   6880  C CG  . ASP B 1 485 ? 149.61600 128.63500 171.24600 1.000 75.83681  ? 485 ASP B CG  1 
ATOM   6881  O OD1 . ASP B 1 485 ? 149.69100 127.84100 172.20600 1.000 75.83681  ? 485 ASP B OD1 1 
ATOM   6882  O OD2 . ASP B 1 485 ? 150.23300 129.71600 171.24500 1.000 75.83681  ? 485 ASP B OD2 1 
ATOM   6883  N N   . GLY B 1 486 ? 149.43000 129.47700 167.15800 1.000 72.18477  ? 486 GLY B N   1 
ATOM   6884  C CA  . GLY B 1 486 ? 150.43300 129.99600 166.24500 1.000 72.18477  ? 486 GLY B CA  1 
ATOM   6885  C C   . GLY B 1 486 ? 150.10300 131.35800 165.67300 1.000 72.18477  ? 486 GLY B C   1 
ATOM   6886  O O   . GLY B 1 486 ? 150.99600 132.03300 165.15100 1.000 72.18477  ? 486 GLY B O   1 
ATOM   6887  N N   . ARG B 1 487 ? 148.84300 131.78100 165.75900 1.000 72.93419  ? 487 ARG B N   1 
ATOM   6888  C CA  . ARG B 1 487 ? 148.45900 133.08700 165.24000 1.000 72.93419  ? 487 ARG B CA  1 
ATOM   6889  C C   . ARG B 1 487 ? 148.81500 134.20000 166.21500 1.000 72.93419  ? 487 ARG B C   1 
ATOM   6890  O O   . ARG B 1 487 ? 149.20100 135.29600 165.79900 1.000 72.93419  ? 487 ARG B O   1 
ATOM   6891  C CB  . ARG B 1 487 ? 146.96400 133.11200 164.92600 1.000 72.93419  ? 487 ARG B CB  1 
ATOM   6892  N N   . VAL B 1 488 ? 148.69700 133.93800 167.52000 1.000 73.81644  ? 488 VAL B N   1 
ATOM   6893  C CA  . VAL B 1 488 ? 148.94800 134.98000 168.51100 1.000 73.81644  ? 488 VAL B CA  1 
ATOM   6894  C C   . VAL B 1 488 ? 150.44100 135.22300 168.69900 1.000 73.81644  ? 488 VAL B C   1 
ATOM   6895  O O   . VAL B 1 488 ? 150.83600 136.26600 169.22900 1.000 73.81644  ? 488 VAL B O   1 
ATOM   6896  C CB  . VAL B 1 488 ? 148.24800 134.62300 169.84300 1.000 73.81644  ? 488 VAL B CB  1 
ATOM   6897  C CG1 . VAL B 1 488 ? 149.06400 133.62700 170.65300 1.000 73.81644  ? 488 VAL B CG1 1 
ATOM   6898  C CG2 . VAL B 1 488 ? 147.92400 135.87300 170.65100 1.000 73.81644  ? 488 VAL B CG2 1 
ATOM   6899  N N   . ILE B 1 489 ? 151.28800 134.29000 168.26000 1.000 74.33813  ? 489 ILE B N   1 
ATOM   6900  C CA  . ILE B 1 489 ? 152.72600 134.51400 168.31800 1.000 74.33813  ? 489 ILE B CA  1 
ATOM   6901  C C   . ILE B 1 489 ? 153.14600 135.53800 167.27100 1.000 74.33813  ? 489 ILE B C   1 
ATOM   6902  O O   . ILE B 1 489 ? 153.99300 136.40000 167.53800 1.000 74.33813  ? 489 ILE B O   1 
ATOM   6903  C CB  . ILE B 1 489 ? 153.46300 133.17000 168.16000 1.000 74.33813  ? 489 ILE B CB  1 
ATOM   6904  C CG1 . ILE B 1 489 ? 153.21500 132.29400 169.39000 1.000 74.33813  ? 489 ILE B CG1 1 
ATOM   6905  C CG2 . ILE B 1 489 ? 154.96300 133.35800 167.93400 1.000 74.33813  ? 489 ILE B CG2 1 
ATOM   6906  C CD1 . ILE B 1 489 ? 153.91500 132.77800 170.64600 1.000 74.33813  ? 489 ILE B CD1 1 
ATOM   6907  N N   . MET B 1 490 ? 152.53100 135.50000 166.08600 1.000 71.36566  ? 490 MET B N   1 
ATOM   6908  C CA  . MET B 1 490 ? 152.86000 136.47100 165.04800 1.000 71.36566  ? 490 MET B CA  1 
ATOM   6909  C C   . MET B 1 490 ? 152.34900 137.86300 165.37900 1.000 71.36566  ? 490 MET B C   1 
ATOM   6910  O O   . MET B 1 490 ? 152.90300 138.85100 164.88900 1.000 71.36566  ? 490 MET B O   1 
ATOM   6911  C CB  . MET B 1 490 ? 152.30100 136.02900 163.70000 1.000 71.36566  ? 490 MET B CB  1 
ATOM   6912  C CG  . MET B 1 490 ? 153.14700 136.48600 162.53000 1.000 71.36566  ? 490 MET B CG  1 
ATOM   6913  S SD  . MET B 1 490 ? 152.18900 136.82200 161.04400 1.000 71.36566  ? 490 MET B SD  1 
ATOM   6914  C CE  . MET B 1 490 ? 151.45700 138.40100 161.45900 1.000 71.36566  ? 490 MET B CE  1 
ATOM   6915  N N   . ASN B 1 491 ? 151.30600 137.96800 166.19800 1.000 72.71157  ? 491 ASN B N   1 
ATOM   6916  C CA  . ASN B 1 491 ? 150.85200 139.26800 166.67400 1.000 72.71157  ? 491 ASN B CA  1 
ATOM   6917  C C   . ASN B 1 491 ? 151.60600 139.73800 167.91000 1.000 72.71157  ? 491 ASN B C   1 
ATOM   6918  O O   . ASN B 1 491 ? 151.26800 140.80300 168.44100 1.000 72.71157  ? 491 ASN B O   1 
ATOM   6919  C CB  . ASN B 1 491 ? 149.35300 139.23200 166.97300 1.000 72.71157  ? 491 ASN B CB  1 
ATOM   6920  C CG  . ASN B 1 491 ? 148.53200 138.78200 165.78600 1.000 72.71157  ? 491 ASN B CG  1 
ATOM   6921  O OD1 . ASN B 1 491 ? 147.51700 138.11000 165.94300 1.000 72.71157  ? 491 ASN B OD1 1 
ATOM   6922  N ND2 . ASN B 1 491 ? 148.96400 139.15300 164.59000 1.000 72.71157  ? 491 ASN B ND2 1 
ATOM   6923  N N   . ASN B 1 492 ? 152.59600 138.96500 168.36500 1.000 72.60528  ? 492 ASN B N   1 
ATOM   6924  C CA  . ASN B 1 492 ? 153.46100 139.25900 169.51200 1.000 72.60528  ? 492 ASN B CA  1 
ATOM   6925  C C   . ASN B 1 492 ? 152.68500 139.50200 170.80500 1.000 72.60528  ? 492 ASN B C   1 
ATOM   6926  O O   . ASN B 1 492 ? 152.48800 138.58500 171.60100 1.000 72.60528  ? 492 ASN B O   1 
ATOM   6927  C CB  . ASN B 1 492 ? 154.36600 140.45600 169.20400 1.000 72.60528  ? 492 ASN B CB  1 
ATOM   6928  C CG  . ASN B 1 492 ? 155.18800 140.25200 167.95100 1.000 72.60528  ? 492 ASN B CG  1 
ATOM   6929  O OD1 . ASN B 1 492 ? 155.89400 139.25500 167.81600 1.000 72.60528  ? 492 ASN B OD1 1 
ATOM   6930  N ND2 . ASN B 1 492 ? 155.09800 141.19500 167.02100 1.000 72.60528  ? 492 ASN B ND2 1 
ATOM   6931  N N   . LYS C 1 49  ? 79.11300  100.56900 129.34900 1.000 74.89626  ? 49  LYS C N   1 
ATOM   6932  C CA  . LYS C 1 49  ? 77.82200  100.41300 128.69200 1.000 74.89626  ? 49  LYS C CA  1 
ATOM   6933  C C   . LYS C 1 49  ? 77.88400  99.36500  127.58000 1.000 74.89626  ? 49  LYS C C   1 
ATOM   6934  O O   . LYS C 1 49  ? 78.40600  98.27000  127.77500 1.000 74.89626  ? 49  LYS C O   1 
ATOM   6935  C CB  . LYS C 1 49  ? 77.34900  101.75100 128.12400 1.000 74.89626  ? 49  LYS C CB  1 
ATOM   6936  C CG  . LYS C 1 49  ? 77.03800  102.80800 129.16300 1.000 74.89626  ? 49  LYS C CG  1 
ATOM   6937  C CD  . LYS C 1 49  ? 76.23500  103.94000 128.54500 1.000 74.89626  ? 49  LYS C CD  1 
ATOM   6938  C CE  . LYS C 1 49  ? 75.84100  104.98400 129.57700 1.000 74.89626  ? 49  LYS C CE  1 
ATOM   6939  N NZ  . LYS C 1 49  ? 77.01300  105.75800 130.06700 1.000 74.89626  ? 49  LYS C NZ  1 
ATOM   6940  N N   . HIS C 1 50  ? 77.33700  99.71300  126.41700 1.000 76.70693  ? 50  HIS C N   1 
ATOM   6941  C CA  . HIS C 1 50  ? 77.39700  98.89100  125.21200 1.000 76.70693  ? 50  HIS C CA  1 
ATOM   6942  C C   . HIS C 1 50  ? 78.40900  99.45700  124.21800 1.000 76.70693  ? 50  HIS C C   1 
ATOM   6943  O O   . HIS C 1 50  ? 78.22300  99.38400  123.00200 1.000 76.70693  ? 50  HIS C O   1 
ATOM   6944  C CB  . HIS C 1 50  ? 76.02000  98.78400  124.56700 1.000 76.70693  ? 50  HIS C CB  1 
ATOM   6945  C CG  . HIS C 1 50  ? 75.38600  100.11000 124.28500 1.000 76.70693  ? 50  HIS C CG  1 
ATOM   6946  N ND1 . HIS C 1 50  ? 74.66900  100.80900 125.23100 1.000 76.70693  ? 50  HIS C ND1 1 
ATOM   6947  C CD2 . HIS C 1 50  ? 75.36900  100.86900 123.16400 1.000 76.70693  ? 50  HIS C CD2 1 
ATOM   6948  C CE1 . HIS C 1 50  ? 74.23300  101.93900 124.70400 1.000 76.70693  ? 50  HIS C CE1 1 
ATOM   6949  N NE2 . HIS C 1 50  ? 74.64400  102.00000 123.45000 1.000 76.70693  ? 50  HIS C NE2 1 
ATOM   6950  N N   . ILE C 1 51  ? 79.49300  100.02400 124.74000 1.000 68.89166  ? 51  ILE C N   1 
ATOM   6951  C CA  . ILE C 1 51  ? 80.47700  100.76600 123.96400 1.000 68.89166  ? 51  ILE C CA  1 
ATOM   6952  C C   . ILE C 1 51  ? 81.79200  100.00000 123.97800 1.000 68.89166  ? 51  ILE C C   1 
ATOM   6953  O O   . ILE C 1 51  ? 82.21800  99.48700  125.01800 1.000 68.89166  ? 51  ILE C O   1 
ATOM   6954  C CB  . ILE C 1 51  ? 80.64500  102.18500 124.55100 1.000 68.89166  ? 51  ILE C CB  1 
ATOM   6955  C CG1 . ILE C 1 51  ? 79.29500  102.89000 124.64500 1.000 68.89166  ? 51  ILE C CG1 1 
ATOM   6956  C CG2 . ILE C 1 51  ? 81.59100  103.01800 123.73200 1.000 68.89166  ? 51  ILE C CG2 1 
ATOM   6957  C CD1 . ILE C 1 51  ? 78.58900  103.03700 123.32800 1.000 68.89166  ? 51  ILE C CD1 1 
ATOM   6958  N N   . ILE C 1 52  ? 82.43900  99.91500  122.81700 1.000 64.35019  ? 52  ILE C N   1 
ATOM   6959  C CA  . ILE C 1 52  ? 83.74000  99.26800  122.69100 1.000 64.35019  ? 52  ILE C CA  1 
ATOM   6960  C C   . ILE C 1 52  ? 84.83100  100.29500 122.96600 1.000 64.35019  ? 52  ILE C C   1 
ATOM   6961  O O   . ILE C 1 52  ? 84.80900  101.40500 122.42200 1.000 64.35019  ? 52  ILE C O   1 
ATOM   6962  C CB  . ILE C 1 52  ? 83.90900  98.60200  121.30900 1.000 64.35019  ? 52  ILE C CB  1 
ATOM   6963  C CG1 . ILE C 1 52  ? 85.35200  98.13800  121.07000 1.000 64.35019  ? 52  ILE C CG1 1 
ATOM   6964  C CG2 . ILE C 1 52  ? 83.40700  99.48600  120.18200 1.000 64.35019  ? 52  ILE C CG2 1 
ATOM   6965  C CD1 . ILE C 1 52  ? 85.82300  97.02800  121.99400 1.000 64.35019  ? 52  ILE C CD1 1 
ATOM   6966  N N   . SER C 1 53  ? 85.76500  99.93400  123.83900 1.000 61.41422  ? 53  SER C N   1 
ATOM   6967  C CA  . SER C 1 53  ? 86.92600  100.74400 124.16400 1.000 61.41422  ? 53  SER C CA  1 
ATOM   6968  C C   . SER C 1 53  ? 87.91700  100.70600 123.00700 1.000 61.41422  ? 53  SER C C   1 
ATOM   6969  O O   . SER C 1 53  ? 88.02600  99.68600  122.32500 1.000 61.41422  ? 53  SER C O   1 
ATOM   6970  C CB  . SER C 1 53  ? 87.59800  100.21900 125.42500 1.000 61.41422  ? 53  SER C CB  1 
ATOM   6971  O OG  . SER C 1 53  ? 88.58600  99.25900  125.10200 1.000 61.41422  ? 53  SER C OG  1 
ATOM   6972  N N   . PRO C 1 54  ? 88.67800  101.78100 122.77900 1.000 58.04203  ? 54  PRO C N   1 
ATOM   6973  C CA  . PRO C 1 54  ? 89.60900  101.78700 121.64300 1.000 58.04203  ? 54  PRO C CA  1 
ATOM   6974  C C   . PRO C 1 54  ? 90.87400  100.97600 121.86300 1.000 58.04203  ? 54  PRO C C   1 
ATOM   6975  O O   . PRO C 1 54  ? 91.97500  101.49300 121.66900 1.000 58.04203  ? 54  PRO C O   1 
ATOM   6976  C CB  . PRO C 1 54  ? 89.94000  103.27300 121.47900 1.000 58.04203  ? 54  PRO C CB  1 
ATOM   6977  C CG  . PRO C 1 54  ? 89.77600  103.82500 122.81900 1.000 58.04203  ? 54  PRO C CG  1 
ATOM   6978  C CD  . PRO C 1 54  ? 88.61100  103.10400 123.41800 1.000 58.04203  ? 54  PRO C CD  1 
ATOM   6979  N N   . PHE C 1 55  ? 90.74200  99.71200  122.25000 1.000 60.21168  ? 55  PHE C N   1 
ATOM   6980  C CA  . PHE C 1 55  ? 91.87000  98.81000  122.38100 1.000 60.21168  ? 55  PHE C CA  1 
ATOM   6981  C C   . PHE C 1 55  ? 91.46800  97.44000  121.84700 1.000 60.21168  ? 55  PHE C C   1 
ATOM   6982  O O   . PHE C 1 55  ? 90.31800  97.21500  121.45700 1.000 60.21168  ? 55  PHE C O   1 
ATOM   6983  C CB  . PHE C 1 55  ? 92.35700  98.72700  123.83400 1.000 60.21168  ? 55  PHE C CB  1 
ATOM   6984  C CG  . PHE C 1 55  ? 92.81200  100.04800 124.39700 1.000 60.21168  ? 55  PHE C CG  1 
ATOM   6985  C CD1 . PHE C 1 55  ? 94.00100  100.62300 123.98000 1.000 60.21168  ? 55  PHE C CD1 1 
ATOM   6986  C CD2 . PHE C 1 55  ? 92.04800  100.71700 125.33900 1.000 60.21168  ? 55  PHE C CD2 1 
ATOM   6987  C CE1 . PHE C 1 55  ? 94.41700  101.84200 124.49100 1.000 60.21168  ? 55  PHE C CE1 1 
ATOM   6988  C CE2 . PHE C 1 55  ? 92.46200  101.93400 125.85400 1.000 60.21168  ? 55  PHE C CE2 1 
ATOM   6989  C CZ  . PHE C 1 55  ? 93.64600  102.49500 125.42800 1.000 60.21168  ? 55  PHE C CZ  1 
ATOM   6990  N N   . ASN C 1 56  ? 92.44400  96.52500  121.85300 1.000 64.35151  ? 56  ASN C N   1 
ATOM   6991  C CA  . ASN C 1 56  ? 92.50700  95.21500  121.20400 1.000 64.35151  ? 56  ASN C CA  1 
ATOM   6992  C C   . ASN C 1 56  ? 91.28000  94.35000  121.48600 1.000 64.35151  ? 56  ASN C C   1 
ATOM   6993  O O   . ASN C 1 56  ? 90.60900  94.55200  122.50500 1.000 64.35151  ? 56  ASN C O   1 
ATOM   6994  C CB  . ASN C 1 56  ? 93.77800  94.50300  121.68600 1.000 64.35151  ? 56  ASN C CB  1 
ATOM   6995  C CG  . ASN C 1 56  ? 94.57800  93.88200  120.55500 1.000 64.35151  ? 56  ASN C CG  1 
ATOM   6996  O OD1 . ASN C 1 56  ? 94.46700  94.28700  119.40000 1.000 64.35151  ? 56  ASN C OD1 1 
ATOM   6997  N ND2 . ASN C 1 56  ? 95.38700  92.88600  120.88600 1.000 64.35151  ? 56  ASN C ND2 1 
ATOM   6998  N N   . PRO C 1 57  ? 90.94200  93.37400  120.62400 1.000 66.15102  ? 57  PRO C N   1 
ATOM   6999  C CA  . PRO C 1 57  ? 91.45800  93.02500  119.29300 1.000 66.15102  ? 57  PRO C CA  1 
ATOM   7000  C C   . PRO C 1 57  ? 90.58400  93.43400  118.11400 1.000 66.15102  ? 57  PRO C C   1 
ATOM   7001  O O   . PRO C 1 57  ? 91.08300  93.54000  116.99900 1.000 66.15102  ? 57  PRO C O   1 
ATOM   7002  C CB  . PRO C 1 57  ? 91.56600  91.50400  119.36800 1.000 66.15102  ? 57  PRO C CB  1 
ATOM   7003  C CG  . PRO C 1 57  ? 90.44200  91.10300  120.26800 1.000 66.15102  ? 57  PRO C CG  1 
ATOM   7004  C CD  . PRO C 1 57  ? 90.21000  92.24600  121.23300 1.000 66.15102  ? 57  PRO C CD  1 
ATOM   7005  N N   . ARG C 1 58  ? 89.30100  93.66900  118.35800 1.000 62.60678  ? 58  ARG C N   1 
ATOM   7006  C CA  . ARG C 1 58  ? 88.34900  93.95300  117.29800 1.000 62.60678  ? 58  ARG C CA  1 
ATOM   7007  C C   . ARG C 1 58  ? 88.34200  95.41400  116.87900 1.000 62.60678  ? 58  ARG C C   1 
ATOM   7008  O O   . ARG C 1 58  ? 87.49500  95.80200  116.07000 1.000 62.60678  ? 58  ARG C O   1 
ATOM   7009  C CB  . ARG C 1 58  ? 86.94600  93.53300  117.73800 1.000 62.60678  ? 58  ARG C CB  1 
ATOM   7010  N N   . TYR C 1 59  ? 89.23300  96.22800  117.41100 1.000 58.58392  ? 59  TYR C N   1 
ATOM   7011  C CA  . TYR C 1 59  ? 89.30200  97.62000  116.99500 1.000 58.58392  ? 59  TYR C CA  1 
ATOM   7012  C C   . TYR C 1 59  ? 90.70400  98.06100  116.62300 1.000 58.58392  ? 59  TYR C C   1 
ATOM   7013  O O   . TYR C 1 59  ? 90.85600  98.90800  115.74700 1.000 58.58392  ? 59  TYR C O   1 
ATOM   7014  C CB  . TYR C 1 59  ? 88.76200  98.53700  118.07900 1.000 58.58392  ? 59  TYR C CB  1 
ATOM   7015  C CG  . TYR C 1 59  ? 88.48700  99.91800  117.56800 1.000 58.58392  ? 59  TYR C CG  1 
ATOM   7016  C CD1 . TYR C 1 59  ? 87.36400  100.17500 116.80600 1.000 58.58392  ? 59  TYR C CD1 1 
ATOM   7017  C CD2 . TYR C 1 59  ? 89.35400  100.96300 117.83400 1.000 58.58392  ? 59  TYR C CD2 1 
ATOM   7018  C CE1 . TYR C 1 59  ? 87.10500  101.43600 116.32800 1.000 58.58392  ? 59  TYR C CE1 1 
ATOM   7019  C CE2 . TYR C 1 59  ? 89.10500  102.23000 117.35700 1.000 58.58392  ? 59  TYR C CE2 1 
ATOM   7020  C CZ  . TYR C 1 59  ? 87.97900  102.45900 116.60600 1.000 58.58392  ? 59  TYR C CZ  1 
ATOM   7021  O OH  . TYR C 1 59  ? 87.72100  103.72000 116.12700 1.000 58.58392  ? 59  TYR C OH  1 
ATOM   7022  N N   . ARG C 1 60  ? 91.72900  97.52700  117.26900 1.000 59.47775  ? 60  ARG C N   1 
ATOM   7023  C CA  . ARG C 1 60  ? 93.08800  97.87900  116.88800 1.000 59.47775  ? 60  ARG C CA  1 
ATOM   7024  C C   . ARG C 1 60  ? 93.61100  97.03400  115.73900 1.000 59.47775  ? 60  ARG C C   1 
ATOM   7025  O O   . ARG C 1 60  ? 94.75300  97.22800  115.31400 1.000 59.47775  ? 60  ARG C O   1 
ATOM   7026  C CB  . ARG C 1 60  ? 94.02300  97.77100  118.09000 1.000 59.47775  ? 60  ARG C CB  1 
ATOM   7027  C CG  . ARG C 1 60  ? 94.31400  99.10700  118.73400 1.000 59.47775  ? 60  ARG C CG  1 
ATOM   7028  C CD  . ARG C 1 60  ? 95.33700  98.97600  119.83800 1.000 59.47775  ? 60  ARG C CD  1 
ATOM   7029  N NE  . ARG C 1 60  ? 96.43700  98.09400  119.46600 1.000 59.47775  ? 60  ARG C NE  1 
ATOM   7030  C CZ  . ARG C 1 60  ? 96.85400  97.07400  120.20700 1.000 59.47775  ? 60  ARG C CZ  1 
ATOM   7031  N NH1 . ARG C 1 60  ? 96.26000  96.81000  121.36200 1.000 59.47775  ? 60  ARG C NH1 1 
ATOM   7032  N NH2 . ARG C 1 60  ? 97.86600  96.32100  119.79700 1.000 59.47775  ? 60  ARG C NH2 1 
ATOM   7033  N N   . ALA C 1 61  ? 92.80900  96.10000  115.23900 1.000 61.04953  ? 61  ALA C N   1 
ATOM   7034  C CA  . ALA C 1 61  ? 93.06800  95.42100  113.97800 1.000 61.04953  ? 61  ALA C CA  1 
ATOM   7035  C C   . ALA C 1 61  ? 92.16800  95.91500  112.86200 1.000 61.04953  ? 61  ALA C C   1 
ATOM   7036  O O   . ALA C 1 61  ? 92.51500  95.78900  111.68900 1.000 61.04953  ? 61  ALA C O   1 
ATOM   7037  C CB  . ALA C 1 61  ? 92.89600  93.90900  114.14000 1.000 61.04953  ? 61  ALA C CB  1 
ATOM   7038  N N   . TRP C 1 62  ? 91.00900  96.47100  113.20900 1.000 56.65676  ? 62  TRP C N   1 
ATOM   7039  C CA  . TRP C 1 62  ? 90.18900  97.15600  112.22000 1.000 56.65676  ? 62  TRP C CA  1 
ATOM   7040  C C   . TRP C 1 62  ? 90.80400  98.49200  111.83900 1.000 56.65676  ? 62  TRP C C   1 
ATOM   7041  O O   . TRP C 1 62  ? 90.72600  98.90800  110.68000 1.000 56.65676  ? 62  TRP C O   1 
ATOM   7042  C CB  . TRP C 1 62  ? 88.78000  97.33600  112.77000 1.000 56.65676  ? 62  TRP C CB  1 
ATOM   7043  C CG  . TRP C 1 62  ? 87.98300  98.44000  112.17400 1.000 56.65676  ? 62  TRP C CG  1 
ATOM   7044  C CD1 . TRP C 1 62  ? 87.82100  99.69100  112.67700 1.000 56.65676  ? 62  TRP C CD1 1 
ATOM   7045  C CD2 . TRP C 1 62  ? 87.19300  98.37900  110.98700 1.000 56.65676  ? 62  TRP C CD2 1 
ATOM   7046  N NE1 . TRP C 1 62  ? 86.99600  100.42300 111.86800 1.000 56.65676  ? 62  TRP C NE1 1 
ATOM   7047  C CE2 . TRP C 1 62  ? 86.59400  99.63800  110.82200 1.000 56.65676  ? 62  TRP C CE2 1 
ATOM   7048  C CE3 . TRP C 1 62  ? 86.94000  97.38400  110.04100 1.000 56.65676  ? 62  TRP C CE3 1 
ATOM   7049  C CZ2 . TRP C 1 62  ? 85.75900  99.93200  109.75200 1.000 56.65676  ? 62  TRP C CZ2 1 
ATOM   7050  C CZ3 . TRP C 1 62  ? 86.11400  97.67700  108.97900 1.000 56.65676  ? 62  TRP C CZ3 1 
ATOM   7051  C CH2 . TRP C 1 62  ? 85.53200  98.94000  108.84200 1.000 56.65676  ? 62  TRP C CH2 1 
ATOM   7052  N N   . GLU C 1 63  ? 91.42400  99.17900  112.80000 1.000 58.42776  ? 63  GLU C N   1 
ATOM   7053  C CA  . GLU C 1 63  ? 92.07500  100.44600 112.49600 1.000 58.42776  ? 63  GLU C CA  1 
ATOM   7054  C C   . GLU C 1 63  ? 93.34800  100.25100 111.69300 1.000 58.42776  ? 63  GLU C C   1 
ATOM   7055  O O   . GLU C 1 63  ? 93.75500  101.15100 110.95400 1.000 58.42776  ? 63  GLU C O   1 
ATOM   7056  C CB  . GLU C 1 63  ? 92.40900  101.20200 113.77300 1.000 58.42776  ? 63  GLU C CB  1 
ATOM   7057  C CG  . GLU C 1 63  ? 91.45500  102.31300 114.10800 1.000 58.42776  ? 63  GLU C CG  1 
ATOM   7058  C CD  . GLU C 1 63  ? 91.90000  103.07500 115.33500 1.000 58.42776  ? 63  GLU C CD  1 
ATOM   7059  O OE1 . GLU C 1 63  ? 92.18400  102.43100 116.36400 1.000 58.42776  ? 63  GLU C OE1 1 
ATOM   7060  O OE2 . GLU C 1 63  ? 91.97900  104.31900 115.26600 1.000 58.42776  ? 63  GLU C OE2 1 
ATOM   7061  N N   . MET C 1 64  ? 94.00700  99.10700  111.84300 1.000 58.56741  ? 64  MET C N   1 
ATOM   7062  C CA  . MET C 1 64  ? 95.17900  98.82100  111.03400 1.000 58.56741  ? 64  MET C CA  1 
ATOM   7063  C C   . MET C 1 64  ? 94.80800  98.42500  109.61800 1.000 58.56741  ? 64  MET C C   1 
ATOM   7064  O O   . MET C 1 64  ? 95.65900  98.47400  108.72700 1.000 58.56741  ? 64  MET C O   1 
ATOM   7065  C CB  . MET C 1 64  ? 96.01100  97.71700  111.68400 1.000 58.56741  ? 64  MET C CB  1 
ATOM   7066  C CG  . MET C 1 64  ? 97.48900  97.75600  111.33300 1.000 58.56741  ? 64  MET C CG  1 
ATOM   7067  S SD  . MET C 1 64  ? 98.25400  99.34300  111.70100 1.000 58.56741  ? 64  MET C SD  1 
ATOM   7068  C CE  . MET C 1 64  ? 98.22000  99.33800  113.48800 1.000 58.56741  ? 64  MET C CE  1 
ATOM   7069  N N   . TRP C 1 65  ? 93.55700  98.04100  109.38700 1.000 55.41786  ? 65  TRP C N   1 
ATOM   7070  C CA  . TRP C 1 65  ? 93.13400  97.72500  108.03300 1.000 55.41786  ? 65  TRP C CA  1 
ATOM   7071  C C   . TRP C 1 65  ? 92.71000  98.97200  107.27600 1.000 55.41786  ? 65  TRP C C   1 
ATOM   7072  O O   . TRP C 1 65  ? 92.87700  99.04200  106.05700 1.000 55.41786  ? 65  TRP C O   1 
ATOM   7073  C CB  . TRP C 1 65  ? 92.00000  96.70800  108.05400 1.000 55.41786  ? 65  TRP C CB  1 
ATOM   7074  C CG  . TRP C 1 65  ? 91.80200  96.11200  106.73100 1.000 55.41786  ? 65  TRP C CG  1 
ATOM   7075  C CD1 . TRP C 1 65  ? 92.69300  95.35300  106.03800 1.000 55.41786  ? 65  TRP C CD1 1 
ATOM   7076  C CD2 . TRP C 1 65  ? 90.65800  96.25100  105.89900 1.000 55.41786  ? 65  TRP C CD2 1 
ATOM   7077  N NE1 . TRP C 1 65  ? 92.16700  94.99400  104.82500 1.000 55.41786  ? 65  TRP C NE1 1 
ATOM   7078  C CE2 . TRP C 1 65  ? 90.91500  95.53600  104.71500 1.000 55.41786  ? 65  TRP C CE2 1 
ATOM   7079  C CE3 . TRP C 1 65  ? 89.43500  96.90600  106.03900 1.000 55.41786  ? 65  TRP C CE3 1 
ATOM   7080  C CZ2 . TRP C 1 65  ? 89.99800  95.45500  103.68400 1.000 55.41786  ? 65  TRP C CZ2 1 
ATOM   7081  C CZ3 . TRP C 1 65  ? 88.52500  96.82400  105.01300 1.000 55.41786  ? 65  TRP C CZ3 1 
ATOM   7082  C CH2 . TRP C 1 65  ? 88.81200  96.10300  103.85100 1.000 55.41786  ? 65  TRP C CH2 1 
ATOM   7083  N N   . LEU C 1 66  ? 92.17100  99.97300  107.97600 1.000 49.87536  ? 66  LEU C N   1 
ATOM   7084  C CA  . LEU C 1 66  ? 91.80600  101.21300 107.30200 1.000 49.87536  ? 66  LEU C CA  1 
ATOM   7085  C C   . LEU C 1 66  ? 93.02600  102.03600 106.92500 1.000 49.87536  ? 66  LEU C C   1 
ATOM   7086  O O   . LEU C 1 66  ? 92.92300  102.93900 106.09400 1.000 49.87536  ? 66  LEU C O   1 
ATOM   7087  C CB  . LEU C 1 66  ? 90.87700  102.05000 108.17200 1.000 49.87536  ? 66  LEU C CB  1 
ATOM   7088  C CG  . LEU C 1 66  ? 89.41900  101.62800 108.24700 1.000 49.87536  ? 66  LEU C CG  1 
ATOM   7089  C CD1 . LEU C 1 66  ? 88.64200  102.69500 108.96300 1.000 49.87536  ? 66  LEU C CD1 1 
ATOM   7090  C CD2 . LEU C 1 66  ? 88.86000  101.40600 106.87100 1.000 49.87536  ? 66  LEU C CD2 1 
ATOM   7091  N N   . VAL C 1 67  ? 94.17800  101.76000 107.53200 1.000 48.41417  ? 67  VAL C N   1 
ATOM   7092  C CA  . VAL C 1 67  ? 95.40700  102.42500 107.11800 1.000 48.41417  ? 67  VAL C CA  1 
ATOM   7093  C C   . VAL C 1 67  ? 95.84200  101.91900 105.75000 1.000 48.41417  ? 67  VAL C C   1 
ATOM   7094  O O   . VAL C 1 67  ? 96.30500  102.69400 104.90500 1.000 48.41417  ? 67  VAL C O   1 
ATOM   7095  C CB  . VAL C 1 67  ? 96.48600  102.23100 108.19700 1.000 48.41417  ? 67  VAL C CB  1 
ATOM   7096  C CG1 . VAL C 1 67  ? 97.85500  102.63600 107.71200 1.000 48.41417  ? 67  VAL C CG1 1 
ATOM   7097  C CG2 . VAL C 1 67  ? 96.12200  103.04700 109.40400 1.000 48.41417  ? 67  VAL C CG2 1 
ATOM   7098  N N   . LEU C 1 68  ? 95.63400  100.63000 105.47800 1.000 47.84628  ? 68  LEU C N   1 
ATOM   7099  C CA  . LEU C 1 68  ? 95.96200  100.09700 104.16000 1.000 47.84628  ? 68  LEU C CA  1 
ATOM   7100  C C   . LEU C 1 68  ? 94.97300  100.55500 103.09700 1.000 47.84628  ? 68  LEU C C   1 
ATOM   7101  O O   . LEU C 1 68  ? 95.26400  100.45300 101.90400 1.000 47.84628  ? 68  LEU C O   1 
ATOM   7102  C CB  . LEU C 1 68  ? 96.01800  98.57600  104.20500 1.000 47.84628  ? 68  LEU C CB  1 
ATOM   7103  C CG  . LEU C 1 68  ? 97.17800  97.98900  105.00200 1.000 47.84628  ? 68  LEU C CG  1 
ATOM   7104  C CD1 . LEU C 1 68  ? 97.20500  96.48200  104.87200 1.000 47.84628  ? 68  LEU C CD1 1 
ATOM   7105  C CD2 . LEU C 1 68  ? 98.48900  98.58800  104.54500 1.000 47.84628  ? 68  LEU C CD2 1 
ATOM   7106  N N   . LEU C 1 69  ? 93.80500  101.04600 103.49700 1.000 48.22269  ? 69  LEU C N   1 
ATOM   7107  C CA  . LEU C 1 69  ? 92.89500  101.64100 102.53400 1.000 48.22269  ? 69  LEU C CA  1 
ATOM   7108  C C   . LEU C 1 69  ? 93.06800  103.14400 102.43200 1.000 48.22269  ? 69  LEU C C   1 
ATOM   7109  O O   . LEU C 1 69  ? 92.28800  103.79500 101.73600 1.000 48.22269  ? 69  LEU C O   1 
ATOM   7110  C CB  . LEU C 1 69  ? 91.44900  101.31800 102.89300 1.000 48.22269  ? 69  LEU C CB  1 
ATOM   7111  C CG  . LEU C 1 69  ? 91.06400  99.84300  102.93800 1.000 48.22269  ? 69  LEU C CG  1 
ATOM   7112  C CD1 . LEU C 1 69  ? 89.56300  99.72500  102.98300 1.000 48.22269  ? 69  LEU C CD1 1 
ATOM   7113  C CD2 . LEU C 1 69  ? 91.62100  99.08600  101.75300 1.000 48.22269  ? 69  LEU C CD2 1 
ATOM   7114  N N   . VAL C 1 70  ? 94.04500  103.71000 103.13500 1.000 46.46303  ? 70  VAL C N   1 
ATOM   7115  C CA  . VAL C 1 70  ? 94.40500  105.10700 102.92800 1.000 46.46303  ? 70  VAL C CA  1 
ATOM   7116  C C   . VAL C 1 70  ? 95.66100  105.19600 102.07500 1.000 46.46303  ? 70  VAL C C   1 
ATOM   7117  O O   . VAL C 1 70  ? 95.77400  106.06400 101.20400 1.000 46.46303  ? 70  VAL C O   1 
ATOM   7118  C CB  . VAL C 1 70  ? 94.56400  105.81400 104.28700 1.000 46.46303  ? 70  VAL C CB  1 
ATOM   7119  C CG1 . VAL C 1 70  ? 95.19200  107.16200 104.14100 1.000 46.46303  ? 70  VAL C CG1 1 
ATOM   7120  C CG2 . VAL C 1 70  ? 93.22600  105.98600 104.92800 1.000 46.46303  ? 70  VAL C CG2 1 
ATOM   7121  N N   . ILE C 1 71  ? 96.59500  104.26600 102.28000 1.000 44.66548  ? 71  ILE C N   1 
ATOM   7122  C CA  . ILE C 1 71  ? 97.79400  104.18300 101.45000 1.000 44.66548  ? 71  ILE C CA  1 
ATOM   7123  C C   . ILE C 1 71  ? 97.42500  103.85500 100.00900 1.000 44.66548  ? 71  ILE C C   1 
ATOM   7124  O O   . ILE C 1 71  ? 98.01000  104.39500 99.06400  1.000 44.66548  ? 71  ILE C O   1 
ATOM   7125  C CB  . ILE C 1 71  ? 98.76300  103.15200 102.05300 1.000 44.66548  ? 71  ILE C CB  1 
ATOM   7126  C CG1 . ILE C 1 71  ? 99.20000  103.61800 103.43600 1.000 44.66548  ? 71  ILE C CG1 1 
ATOM   7127  C CG2 . ILE C 1 71  ? 99.97800  102.94200 101.17700 1.000 44.66548  ? 71  ILE C CG2 1 
ATOM   7128  C CD1 . ILE C 1 71  ? 100.05200 102.62300 104.16200 1.000 44.66548  ? 71  ILE C CD1 1 
ATOM   7129  N N   . TYR C 1 72  ? 96.41400  103.00700 99.81700  1.000 47.48352  ? 72  TYR C N   1 
ATOM   7130  C CA  . TYR C 1 72  ? 95.89900  102.76900 98.47400  1.000 47.48352  ? 72  TYR C CA  1 
ATOM   7131  C C   . TYR C 1 72  ? 95.15000  103.98300 97.94500  1.000 47.48352  ? 72  TYR C C   1 
ATOM   7132  O O   . TYR C 1 72  ? 95.35500  104.39400 96.80100  1.000 47.48352  ? 72  TYR C O   1 
ATOM   7133  C CB  . TYR C 1 72  ? 94.99000  101.54300 98.47000  1.000 47.48352  ? 72  TYR C CB  1 
ATOM   7134  C CG  . TYR C 1 72  ? 94.18000  101.37400 97.20800  1.000 47.48352  ? 72  TYR C CG  1 
ATOM   7135  C CD1 . TYR C 1 72  ? 92.83100  101.70800 97.17000  1.000 47.48352  ? 72  TYR C CD1 1 
ATOM   7136  C CD2 . TYR C 1 72  ? 94.76000  100.86500 96.05700  1.000 47.48352  ? 72  TYR C CD2 1 
ATOM   7137  C CE1 . TYR C 1 72  ? 92.09600  101.56000 96.02100  1.000 47.48352  ? 72  TYR C CE1 1 
ATOM   7138  C CE2 . TYR C 1 72  ? 94.02900  100.70700 94.90300  1.000 47.48352  ? 72  TYR C CE2 1 
ATOM   7139  C CZ  . TYR C 1 72  ? 92.69900  101.05500 94.89400  1.000 47.48352  ? 72  TYR C CZ  1 
ATOM   7140  O OH  . TYR C 1 72  ? 91.96400  100.90100 93.74600  1.000 47.48352  ? 72  TYR C OH  1 
ATOM   7141  N N   . SER C 1 73  ? 94.28800  104.58300 98.76600  1.000 46.62632  ? 73  SER C N   1 
ATOM   7142  C CA  . SER C 1 73  ? 93.41600  105.63800 98.26400  1.000 46.62632  ? 73  SER C CA  1 
ATOM   7143  C C   . SER C 1 73  ? 94.11000  106.98900 98.21100  1.000 46.62632  ? 73  SER C C   1 
ATOM   7144  O O   . SER C 1 73  ? 93.46900  107.99600 97.90000  1.000 46.62632  ? 73  SER C O   1 
ATOM   7145  C CB  . SER C 1 73  ? 92.16000  105.74200 99.11800  1.000 46.62632  ? 73  SER C CB  1 
ATOM   7146  O OG  . SER C 1 73  ? 91.56800  107.01600 98.97200  1.000 46.62632  ? 73  SER C OG  1 
ATOM   7147  N N   . ALA C 1 74  ? 95.39400  107.04800 98.54400  1.000 45.42944  ? 74  ALA C N   1 
ATOM   7148  C CA  . ALA C 1 74  ? 96.21200  108.22200 98.28500  1.000 45.42944  ? 74  ALA C CA  1 
ATOM   7149  C C   . ALA C 1 74  ? 97.24900  107.96400 97.20900  1.000 45.42944  ? 74  ALA C C   1 
ATOM   7150  O O   . ALA C 1 74  ? 98.06800  108.84000 96.93200  1.000 45.42944  ? 74  ALA C O   1 
ATOM   7151  C CB  . ALA C 1 74  ? 96.90200  108.69400 99.56300  1.000 45.42944  ? 74  ALA C CB  1 
ATOM   7152  N N   . TRP C 1 75  ? 97.24100  106.77900 96.61300  1.000 44.09040  ? 75  TRP C N   1 
ATOM   7153  C CA  . TRP C 1 75  ? 98.05800  106.47300 95.45100  1.000 44.09040  ? 75  TRP C CA  1 
ATOM   7154  C C   . TRP C 1 75  ? 97.28500  106.59900 94.15300  1.000 44.09040  ? 75  TRP C C   1 
ATOM   7155  O O   . TRP C 1 75  ? 97.80600  107.15000 93.18600  1.000 44.09040  ? 75  TRP C O   1 
ATOM   7156  C CB  . TRP C 1 75  ? 98.62800  105.06000 95.55900  1.000 44.09040  ? 75  TRP C CB  1 
ATOM   7157  C CG  . TRP C 1 75  ? 99.78100  104.80700 94.65800  1.000 44.09040  ? 75  TRP C CG  1 
ATOM   7158  C CD1 . TRP C 1 75  ? 101.09600 104.94300 94.96600  1.000 44.09040  ? 75  TRP C CD1 1 
ATOM   7159  C CD2 . TRP C 1 75  ? 99.73200  104.36300 93.29800  1.000 44.09040  ? 75  TRP C CD2 1 
ATOM   7160  N NE1 . TRP C 1 75  ? 101.87400 104.61700 93.88500  1.000 44.09040  ? 75  TRP C NE1 1 
ATOM   7161  C CE2 . TRP C 1 75  ? 101.05800 104.25700 92.84700  1.000 44.09040  ? 75  TRP C CE2 1 
ATOM   7162  C CE3 . TRP C 1 75  ? 98.69500  104.04200 92.41900  1.000 44.09040  ? 75  TRP C CE3 1 
ATOM   7163  C CZ2 . TRP C 1 75  ? 101.37400 103.84600 91.55900  1.000 44.09040  ? 75  TRP C CZ2 1 
ATOM   7164  C CZ3 . TRP C 1 75  ? 99.01100  103.64100 91.14300  1.000 44.09040  ? 75  TRP C CZ3 1 
ATOM   7165  C CH2 . TRP C 1 75  ? 100.33800 103.54500 90.72400  1.000 44.09040  ? 75  TRP C CH2 1 
ATOM   7166  N N   . ILE C 1 76  ? 96.05100  106.10400 94.10700  1.000 48.33432  ? 76  ILE C N   1 
ATOM   7167  C CA  . ILE C 1 76  ? 95.24100  106.17100 92.89800  1.000 48.33432  ? 76  ILE C CA  1 
ATOM   7168  C C   . ILE C 1 76  ? 94.41200  107.44200 92.89000  1.000 48.33432  ? 76  ILE C C   1 
ATOM   7169  O O   . ILE C 1 76  ? 93.63200  107.67300 91.96400  1.000 48.33432  ? 76  ILE C O   1 
ATOM   7170  C CB  . ILE C 1 76  ? 94.31800  104.95300 92.76500  1.000 48.33432  ? 76  ILE C CB  1 
ATOM   7171  C CG1 . ILE C 1 76  ? 93.28700  104.97500 93.88400  1.000 48.33432  ? 76  ILE C CG1 1 
ATOM   7172  C CG2 . ILE C 1 76  ? 95.11300  103.67600 92.78600  1.000 48.33432  ? 76  ILE C CG2 1 
ATOM   7173  C CD1 . ILE C 1 76  ? 92.00500  104.28000 93.54200  1.000 48.33432  ? 76  ILE C CD1 1 
ATOM   7174  N N   . CYS C 1 77  ? 94.54200  108.25500 93.91700  1.000 52.78338  ? 77  CYS C N   1 
ATOM   7175  C CA  . CYS C 1 77  ? 93.77500  109.49300 93.92300  1.000 52.78338  ? 77  CYS C CA  1 
ATOM   7176  C C   . CYS C 1 77  ? 94.36000  110.57100 93.00700  1.000 52.78338  ? 77  CYS C C   1 
ATOM   7177  O O   . CYS C 1 77  ? 93.57500  111.31400 92.40900  1.000 52.78338  ? 77  CYS C O   1 
ATOM   7178  C CB  . CYS C 1 77  ? 93.60800  110.03000 95.34300  1.000 52.78338  ? 77  CYS C CB  1 
ATOM   7179  S SG  . CYS C 1 77  ? 92.20800  111.13900 95.51400  1.000 52.78338  ? 77  CYS C SG  1 
ATOM   7180  N N   . PRO C 1 78  ? 95.70900  110.74400 92.86500  1.000 47.65650  ? 78  PRO C N   1 
ATOM   7181  C CA  . PRO C 1 78  ? 96.17800  111.57600 91.75200  1.000 47.65650  ? 78  PRO C CA  1 
ATOM   7182  C C   . PRO C 1 78  ? 96.58800  110.78100 90.52300  1.000 47.65650  ? 78  PRO C C   1 
ATOM   7183  O O   . PRO C 1 78  ? 96.90800  111.36900 89.49000  1.000 47.65650  ? 78  PRO C O   1 
ATOM   7184  C CB  . PRO C 1 78  ? 97.36800  112.31400 92.36000  1.000 47.65650  ? 78  PRO C CB  1 
ATOM   7185  C CG  . PRO C 1 78  ? 97.94300  111.33600 93.24800  1.000 47.65650  ? 78  PRO C CG  1 
ATOM   7186  C CD  . PRO C 1 78  ? 96.80400  110.57500 93.84500  1.000 47.65650  ? 78  PRO C CD  1 
ATOM   7187  N N   . PHE C 1 79  ? 96.58800  109.45200 90.61000  1.000 46.41741  ? 79  PHE C N   1 
ATOM   7188  C CA  . PHE C 1 79  ? 97.00100  108.64900 89.46500  1.000 46.41741  ? 79  PHE C CA  1 
ATOM   7189  C C   . PHE C 1 79  ? 95.87800  108.49600 88.45700  1.000 46.41741  ? 79  PHE C C   1 
ATOM   7190  O O   . PHE C 1 79  ? 96.11100  108.60200 87.25100  1.000 46.41741  ? 79  PHE C O   1 
ATOM   7191  C CB  . PHE C 1 79  ? 97.47800  107.27900 89.92100  1.000 46.41741  ? 79  PHE C CB  1 
ATOM   7192  C CG  . PHE C 1 79  ? 97.91200  106.38500 88.80500  1.000 46.41741  ? 79  PHE C CG  1 
ATOM   7193  C CD1 . PHE C 1 79  ? 99.12100  106.58800 88.17500  1.000 46.41741  ? 79  PHE C CD1 1 
ATOM   7194  C CD2 . PHE C 1 79  ? 97.12000  105.32600 88.40100  1.000 46.41741  ? 79  PHE C CD2 1 
ATOM   7195  C CE1 . PHE C 1 79  ? 99.53000  105.76000 87.15500  1.000 46.41741  ? 79  PHE C CE1 1 
ATOM   7196  C CE2 . PHE C 1 79  ? 97.52200  104.49500 87.38100  1.000 46.41741  ? 79  PHE C CE2 1 
ATOM   7197  C CZ  . PHE C 1 79  ? 98.72800  104.71200 86.75800  1.000 46.41741  ? 79  PHE C CZ  1 
ATOM   7198  N N   . GLN C 1 80  ? 94.66200  108.22900 88.91800  1.000 53.61742  ? 80  GLN C N   1 
ATOM   7199  C CA  . GLN C 1 80  ? 93.52300  108.21800 88.01400  1.000 53.61742  ? 80  GLN C CA  1 
ATOM   7200  C C   . GLN C 1 80  ? 93.04500  109.62000 87.67700  1.000 53.61742  ? 80  GLN C C   1 
ATOM   7201  O O   . GLN C 1 80  ? 92.22900  109.78300 86.76600  1.000 53.61742  ? 80  GLN C O   1 
ATOM   7202  C CB  . GLN C 1 80  ? 92.37900  107.40100 88.61300  1.000 53.61742  ? 80  GLN C CB  1 
ATOM   7203  C CG  . GLN C 1 80  ? 91.46300  108.17400 89.53700  1.000 53.61742  ? 80  GLN C CG  1 
ATOM   7204  C CD  . GLN C 1 80  ? 90.47400  107.27500 90.23700  1.000 53.61742  ? 80  GLN C CD  1 
ATOM   7205  O OE1 . GLN C 1 80  ? 90.35900  106.09400 89.91300  1.000 53.61742  ? 80  GLN C OE1 1 
ATOM   7206  N NE2 . GLN C 1 80  ? 89.75300  107.82500 91.20600  1.000 53.61742  ? 80  GLN C NE2 1 
ATOM   7207  N N   . PHE C 1 81  ? 93.53900  110.62700 88.38700  1.000 52.80672  ? 81  PHE C N   1 
ATOM   7208  C CA  . PHE C 1 81  ? 93.25100  112.01200 88.05400  1.000 52.80672  ? 81  PHE C CA  1 
ATOM   7209  C C   . PHE C 1 81  ? 93.95300  112.44200 86.77400  1.000 52.80672  ? 81  PHE C C   1 
ATOM   7210  O O   . PHE C 1 81  ? 93.46700  113.34000 86.08000  1.000 52.80672  ? 81  PHE C O   1 
ATOM   7211  C CB  . PHE C 1 81  ? 93.66800  112.88500 89.23300  1.000 52.80672  ? 81  PHE C CB  1 
ATOM   7212  C CG  . PHE C 1 81  ? 93.47100  114.35000 89.02800  1.000 52.80672  ? 81  PHE C CG  1 
ATOM   7213  C CD1 . PHE C 1 81  ? 92.21200  114.90900 89.08200  1.000 52.80672  ? 81  PHE C CD1 1 
ATOM   7214  C CD2 . PHE C 1 81  ? 94.55700  115.17700 88.83700  1.000 52.80672  ? 81  PHE C CD2 1 
ATOM   7215  C CE1 . PHE C 1 81  ? 92.04100  116.26500 88.91800  1.000 52.80672  ? 81  PHE C CE1 1 
ATOM   7216  C CE2 . PHE C 1 81  ? 94.38800  116.53100 88.67300  1.000 52.80672  ? 81  PHE C CE2 1 
ATOM   7217  C CZ  . PHE C 1 81  ? 93.12700  117.07400 88.71000  1.000 52.80672  ? 81  PHE C CZ  1 
ATOM   7218  N N   . ALA C 1 82  ? 95.08200  111.82000 86.43900  1.000 49.07431  ? 82  ALA C N   1 
ATOM   7219  C CA  . ALA C 1 82  ? 95.86900  112.23000 85.28200  1.000 49.07431  ? 82  ALA C CA  1 
ATOM   7220  C C   . ALA C 1 82  ? 95.97600  111.14800 84.21700  1.000 49.07431  ? 82  ALA C C   1 
ATOM   7221  O O   . ALA C 1 82  ? 95.59500  111.38600 83.06900  1.000 49.07431  ? 82  ALA C O   1 
ATOM   7222  C CB  . ALA C 1 82  ? 97.26300  112.65700 85.74100  1.000 49.07431  ? 82  ALA C CB  1 
ATOM   7223  N N   . PHE C 1 83  ? 96.48500  109.96700 84.55400  1.000 46.46320  ? 83  PHE C N   1 
ATOM   7224  C CA  . PHE C 1 83  ? 96.83300  108.99500 83.52400  1.000 46.46320  ? 83  PHE C CA  1 
ATOM   7225  C C   . PHE C 1 83  ? 95.61800  108.20800 83.05600  1.000 46.46320  ? 83  PHE C C   1 
ATOM   7226  O O   . PHE C 1 83  ? 95.26100  108.24300 81.87500  1.000 46.46320  ? 83  PHE C O   1 
ATOM   7227  C CB  . PHE C 1 83  ? 97.91900  108.05600 84.04300  1.000 46.46320  ? 83  PHE C CB  1 
ATOM   7228  C CG  . PHE C 1 83  ? 99.21000  108.74300 84.31200  1.000 46.46320  ? 83  PHE C CG  1 
ATOM   7229  C CD1 . PHE C 1 83  ? 99.50500  109.22300 85.57100  1.000 46.46320  ? 83  PHE C CD1 1 
ATOM   7230  C CD2 . PHE C 1 83  ? 100.11900 108.93700 83.29700  1.000 46.46320  ? 83  PHE C CD2 1 
ATOM   7231  C CE1 . PHE C 1 83  ? 100.68900 109.87000 85.81200  1.000 46.46320  ? 83  PHE C CE1 1 
ATOM   7232  C CE2 . PHE C 1 83  ? 101.30100 109.58800 83.53300  1.000 46.46320  ? 83  PHE C CE2 1 
ATOM   7233  C CZ  . PHE C 1 83  ? 101.58800 110.05100 84.79300  1.000 46.46320  ? 83  PHE C CZ  1 
ATOM   7234  N N   . ILE C 1 84  ? 94.96800  107.49200 83.96600  1.000 57.22396  ? 84  ILE C N   1 
ATOM   7235  C CA  . ILE C 1 84  ? 93.78300  106.70200 83.61100  1.000 57.22396  ? 84  ILE C CA  1 
ATOM   7236  C C   . ILE C 1 84  ? 92.60100  107.65500 83.73100  1.000 57.22396  ? 84  ILE C C   1 
ATOM   7237  O O   . ILE C 1 84  ? 91.88200  107.70100 84.72900  1.000 57.22396  ? 84  ILE C O   1 
ATOM   7238  C CB  . ILE C 1 84  ? 93.63400  105.45600 84.48700  1.000 57.22396  ? 84  ILE C CB  1 
ATOM   7239  N N   . THR C 1 85  ? 92.38600  108.42500 82.67100  1.000 67.84415  ? 85  THR C N   1 
ATOM   7240  C CA  . THR C 1 85  ? 91.31600  109.41000 82.64100  1.000 67.84415  ? 85  THR C CA  1 
ATOM   7241  C C   . THR C 1 85  ? 90.00400  108.84200 82.12000  1.000 67.84415  ? 85  THR C C   1 
ATOM   7242  O O   . THR C 1 85  ? 89.04200  109.59900 81.95000  1.000 67.84415  ? 85  THR C O   1 
ATOM   7243  C CB  . THR C 1 85  ? 91.72900  110.61300 81.78700  1.000 67.84415  ? 85  THR C CB  1 
ATOM   7244  N N   . TYR C 1 86  ? 89.93900  107.54000 81.85200  1.000 75.27064  ? 86  TYR C N   1 
ATOM   7245  C CA  . TYR C 1 86  ? 88.67500  106.94200 81.44200  1.000 75.27064  ? 86  TYR C CA  1 
ATOM   7246  C C   . TYR C 1 86  ? 87.81000  106.61000 82.65300  1.000 75.27064  ? 86  TYR C C   1 
ATOM   7247  O O   . TYR C 1 86  ? 86.75000  107.21500 82.85000  1.000 75.27064  ? 86  TYR C O   1 
ATOM   7248  C CB  . TYR C 1 86  ? 88.94100  105.68900 80.60200  1.000 75.27064  ? 86  TYR C CB  1 
ATOM   7249  N N   . LYS C 1 87  ? 88.28700  105.67700 83.48800  1.000 78.96291  ? 87  LYS C N   1 
ATOM   7250  C CA  . LYS C 1 87  ? 87.61900  105.19700 84.70700  1.000 78.96291  ? 87  LYS C CA  1 
ATOM   7251  C C   . LYS C 1 87  ? 86.18800  104.73400 84.43500  1.000 78.96291  ? 87  LYS C C   1 
ATOM   7252  O O   . LYS C 1 87  ? 85.25000  105.08300 85.15500  1.000 78.96291  ? 87  LYS C O   1 
ATOM   7253  C CB  . LYS C 1 87  ? 87.65200  106.26100 85.80800  1.000 78.96291  ? 87  LYS C CB  1 
ATOM   7254  N N   . LYS C 1 88  ? 86.01800  103.97400 83.35200  1.000 77.79724  ? 88  LYS C N   1 
ATOM   7255  C CA  . LYS C 1 88  ? 84.68900  103.52400 82.95500  1.000 77.79724  ? 88  LYS C CA  1 
ATOM   7256  C C   . LYS C 1 88  ? 84.06500  102.54400 83.94200  1.000 77.79724  ? 88  LYS C C   1 
ATOM   7257  O O   . LYS C 1 88  ? 83.13500  102.90900 84.66600  1.000 77.79724  ? 88  LYS C O   1 
ATOM   7258  C CB  . LYS C 1 88  ? 84.75200  102.88500 81.56600  1.000 77.79724  ? 88  LYS C CB  1 
ATOM   7259  N N   . ASP C 1 89  ? 84.57600  101.30800 83.99500  1.000 76.14139  ? 89  ASP C N   1 
ATOM   7260  C CA  . ASP C 1 89  ? 84.04300  100.31700 84.92500  1.000 76.14139  ? 89  ASP C CA  1 
ATOM   7261  C C   . ASP C 1 89  ? 85.06200  99.33500  85.49000  1.000 76.14139  ? 89  ASP C C   1 
ATOM   7262  O O   . ASP C 1 89  ? 84.65200  98.42300  86.21100  1.000 76.14139  ? 89  ASP C O   1 
ATOM   7263  C CB  . ASP C 1 89  ? 82.89500  99.53600  84.26100  1.000 76.14139  ? 89  ASP C CB  1 
ATOM   7264  C CG  . ASP C 1 89  ? 81.52500  99.92400  84.80600  1.000 76.14139  ? 89  ASP C CG  1 
ATOM   7265  O OD1 . ASP C 1 89  ? 81.43900  100.86300 85.62000  1.000 76.14139  ? 89  ASP C OD1 1 
ATOM   7266  O OD2 . ASP C 1 89  ? 80.52600  99.27600  84.42700  1.000 76.14139  ? 89  ASP C OD2 1 
ATOM   7267  N N   . ALA C 1 90  ? 86.35700  99.46200  85.20100  1.000 70.99557  ? 90  ALA C N   1 
ATOM   7268  C CA  . ALA C 1 90  ? 87.29800  98.41500  85.59800  1.000 70.99557  ? 90  ALA C CA  1 
ATOM   7269  C C   . ALA C 1 90  ? 87.74600  98.57400  87.04800  1.000 70.99557  ? 90  ALA C C   1 
ATOM   7270  O O   . ALA C 1 90  ? 87.57200  97.66800  87.86900  1.000 70.99557  ? 90  ALA C O   1 
ATOM   7271  C CB  . ALA C 1 90  ? 88.50600  98.41400  84.65800  1.000 70.99557  ? 90  ALA C CB  1 
ATOM   7272  N N   . ILE C 1 91  ? 88.33900  99.72600  87.37400  1.000 70.15926  ? 91  ILE C N   1 
ATOM   7273  C CA  . ILE C 1 91  ? 88.74000  100.04700 88.74400  1.000 70.15926  ? 91  ILE C CA  1 
ATOM   7274  C C   . ILE C 1 91  ? 87.58200  100.60300 89.55700  1.000 70.15926  ? 91  ILE C C   1 
ATOM   7275  O O   . ILE C 1 91  ? 87.74100  100.87300 90.75400  1.000 70.15926  ? 91  ILE C O   1 
ATOM   7276  C CB  . ILE C 1 91  ? 89.93400  101.02200 88.67400  1.000 70.15926  ? 91  ILE C CB  1 
ATOM   7277  C CG1 . ILE C 1 91  ? 90.88400  100.81800 89.85200  1.000 70.15926  ? 91  ILE C CG1 1 
ATOM   7278  C CG2 . ILE C 1 91  ? 89.47100  102.47500 88.53800  1.000 70.15926  ? 91  ILE C CG2 1 
ATOM   7279  C CD1 . ILE C 1 91  ? 91.65900  99.53000  89.77700  1.000 70.15926  ? 91  ILE C CD1 1 
ATOM   7280  N N   . PHE C 1 92  ? 86.40600  100.72400 88.93600  1.000 71.98119  ? 92  PHE C N   1 
ATOM   7281  C CA  . PHE C 1 92  ? 85.26200  101.41500 89.51600  1.000 71.98119  ? 92  PHE C CA  1 
ATOM   7282  C C   . PHE C 1 92  ? 84.70700  100.69800 90.73900  1.000 71.98119  ? 92  PHE C C   1 
ATOM   7283  O O   . PHE C 1 92  ? 84.13200  101.34000 91.62300  1.000 71.98119  ? 92  PHE C O   1 
ATOM   7284  C CB  . PHE C 1 92  ? 84.19300  101.54600 88.43700  1.000 71.98119  ? 92  PHE C CB  1 
ATOM   7285  C CG  . PHE C 1 92  ? 82.98900  102.32300 88.84400  1.000 71.98119  ? 92  PHE C CG  1 
ATOM   7286  C CD1 . PHE C 1 92  ? 83.00900  103.70400 88.83300  1.000 71.98119  ? 92  PHE C CD1 1 
ATOM   7287  C CD2 . PHE C 1 92  ? 81.81400  101.67100 89.18300  1.000 71.98119  ? 92  PHE C CD2 1 
ATOM   7288  C CE1 . PHE C 1 92  ? 81.89100  104.42000 89.18300  1.000 71.98119  ? 92  PHE C CE1 1 
ATOM   7289  C CE2 . PHE C 1 92  ? 80.69200  102.38200 89.53800  1.000 71.98119  ? 92  PHE C CE2 1 
ATOM   7290  C CZ  . PHE C 1 92  ? 80.72900  103.75800 89.53800  1.000 71.98119  ? 92  PHE C CZ  1 
ATOM   7291  N N   . ILE C 1 93  ? 84.86700  99.37700  90.81500  1.000 69.26936  ? 93  ILE C N   1 
ATOM   7292  C CA  . ILE C 1 93  ? 84.30100  98.64600  91.94200  1.000 69.26936  ? 93  ILE C CA  1 
ATOM   7293  C C   . ILE C 1 93  ? 85.22300  98.70700  93.15500  1.000 69.26936  ? 93  ILE C C   1 
ATOM   7294  O O   . ILE C 1 93  ? 84.75600  98.66000  94.29700  1.000 69.26936  ? 93  ILE C O   1 
ATOM   7295  C CB  . ILE C 1 93  ? 83.96800  97.19700  91.53500  1.000 69.26936  ? 93  ILE C CB  1 
ATOM   7296  C CG1 . ILE C 1 93  ? 85.22400  96.43000  91.11300  1.000 69.26936  ? 93  ILE C CG1 1 
ATOM   7297  C CG2 . ILE C 1 93  ? 82.93600  97.19000  90.42000  1.000 69.26936  ? 93  ILE C CG2 1 
ATOM   7298  C CD1 . ILE C 1 93  ? 84.95700  95.01900  90.63600  1.000 69.26936  ? 93  ILE C CD1 1 
ATOM   7299  N N   . ILE C 1 94  ? 86.53500  98.83500  92.94100  1.000 64.09824  ? 94  ILE C N   1 
ATOM   7300  C CA  . ILE C 1 94  ? 87.45600  98.90300  94.07000  1.000 64.09824  ? 94  ILE C CA  1 
ATOM   7301  C C   . ILE C 1 94  ? 87.37400  100.26800 94.73500  1.000 64.09824  ? 94  ILE C C   1 
ATOM   7302  O O   . ILE C 1 94  ? 87.43300  100.38000 95.96100  1.000 64.09824  ? 94  ILE C O   1 
ATOM   7303  C CB  . ILE C 1 94  ? 88.88700  98.56400  93.62200  1.000 64.09824  ? 94  ILE C CB  1 
ATOM   7304  C CG1 . ILE C 1 94  ? 88.90200  97.22100  92.89600  1.000 64.09824  ? 94  ILE C CG1 1 
ATOM   7305  C CG2 . ILE C 1 94  ? 89.82100  98.50300  94.81200  1.000 64.09824  ? 94  ILE C CG2 1 
ATOM   7306  C CD1 . ILE C 1 94  ? 90.28400  96.73100  92.52500  1.000 64.09824  ? 94  ILE C CD1 1 
ATOM   7307  N N   . ASP C 1 95  ? 87.17400  101.32000 93.94900  1.000 64.25997  ? 95  ASP C N   1 
ATOM   7308  C CA  . ASP C 1 95  ? 87.01900  102.64500 94.53000  1.000 64.25997  ? 95  ASP C CA  1 
ATOM   7309  C C   . ASP C 1 95  ? 85.63800  102.87800 95.12900  1.000 64.25997  ? 95  ASP C C   1 
ATOM   7310  O O   . ASP C 1 95  ? 85.39600  103.96800 95.65400  1.000 64.25997  ? 95  ASP C O   1 
ATOM   7311  C CB  . ASP C 1 95  ? 87.31400  103.71500 93.48000  1.000 64.25997  ? 95  ASP C CB  1 
ATOM   7312  N N   . ASN C 1 96  ? 84.73300  101.90700 95.05800  1.000 66.21481  ? 96  ASN C N   1 
ATOM   7313  C CA  . ASN C 1 96  ? 83.44200  101.97300 95.73200  1.000 66.21481  ? 96  ASN C CA  1 
ATOM   7314  C C   . ASN C 1 96  ? 83.31000  100.96700 96.86000  1.000 66.21481  ? 96  ASN C C   1 
ATOM   7315  O O   . ASN C 1 96  ? 82.52300  101.18200 97.78100  1.000 66.21481  ? 96  ASN C O   1 
ATOM   7316  C CB  . ASN C 1 96  ? 82.31000  101.75700 94.72900  1.000 66.21481  ? 96  ASN C CB  1 
ATOM   7317  C CG  . ASN C 1 96  ? 81.87400  103.04000 94.07200  1.000 66.21481  ? 96  ASN C CG  1 
ATOM   7318  O OD1 . ASN C 1 96  ? 81.80100  104.08300 94.71600  1.000 66.21481  ? 96  ASN C OD1 1 
ATOM   7319  N ND2 . ASN C 1 96  ? 81.58300  102.97400 92.78200  1.000 66.21481  ? 96  ASN C ND2 1 
ATOM   7320  N N   . ILE C 1 97  ? 84.05400  99.86200  96.79700  1.000 62.40293  ? 97  ILE C N   1 
ATOM   7321  C CA  . ILE C 1 97  ? 84.19300  98.98300  97.95600  1.000 62.40293  ? 97  ILE C CA  1 
ATOM   7322  C C   . ILE C 1 97  ? 84.96400  99.70200  99.05500  1.000 62.40293  ? 97  ILE C C   1 
ATOM   7323  O O   . ILE C 1 97  ? 84.57500  99.68500  100.22900 1.000 62.40293  ? 97  ILE C O   1 
ATOM   7324  C CB  . ILE C 1 97  ? 84.87400  97.66600  97.54100  1.000 62.40293  ? 97  ILE C CB  1 
ATOM   7325  C CG1 . ILE C 1 97  ? 83.86500  96.73400  96.87800  1.000 62.40293  ? 97  ILE C CG1 1 
ATOM   7326  C CG2 . ILE C 1 97  ? 85.53500  96.97000  98.71900  1.000 62.40293  ? 97  ILE C CG2 1 
ATOM   7327  C CD1 . ILE C 1 97  ? 84.48300  95.47500  96.32800  1.000 62.40293  ? 97  ILE C CD1 1 
ATOM   7328  N N   . VAL C 1 98  ? 86.05600  100.37000 98.67300  1.000 60.17746  ? 98  VAL C N   1 
ATOM   7329  C CA  . VAL C 1 98  ? 86.86700  101.14000 99.61400  1.000 60.17746  ? 98  VAL C CA  1 
ATOM   7330  C C   . VAL C 1 98  ? 86.06700  102.30900 100.17400 1.000 60.17746  ? 98  VAL C C   1 
ATOM   7331  O O   . VAL C 1 98  ? 86.07800  102.57100 101.38100 1.000 60.17746  ? 98  VAL C O   1 
ATOM   7332  C CB  . VAL C 1 98  ? 88.16600  101.60400 98.92800  1.000 60.17746  ? 98  VAL C CB  1 
ATOM   7333  C CG1 . VAL C 1 98  ? 88.74200  102.84700 99.57100  1.000 60.17746  ? 98  VAL C CG1 1 
ATOM   7334  C CG2 . VAL C 1 98  ? 89.18300  100.48400 98.94100  1.000 60.17746  ? 98  VAL C CG2 1 
ATOM   7335  N N   . ASN C 1 99  ? 85.29700  102.98100 99.31900  1.000 62.54255  ? 99  ASN C N   1 
ATOM   7336  C CA  . ASN C 1 99  ? 84.46800  104.08900 99.77600  1.000 62.54255  ? 99  ASN C CA  1 
ATOM   7337  C C   . ASN C 1 99  ? 83.28100  103.63100 100.61200 1.000 62.54255  ? 99  ASN C C   1 
ATOM   7338  O O   . ASN C 1 99  ? 82.61300  104.47000 101.22100 1.000 62.54255  ? 99  ASN C O   1 
ATOM   7339  C CB  . ASN C 1 99  ? 83.97300  104.89800 98.58300  1.000 62.54255  ? 99  ASN C CB  1 
ATOM   7340  C CG  . ASN C 1 99  ? 83.72600  106.34400 98.92900  1.000 62.54255  ? 99  ASN C CG  1 
ATOM   7341  O OD1 . ASN C 1 99  ? 83.97700  106.77300 100.05100 1.000 62.54255  ? 99  ASN C OD1 1 
ATOM   7342  N ND2 . ASN C 1 99  ? 83.23900  107.11000 97.96400  1.000 62.54255  ? 99  ASN C ND2 1 
ATOM   7343  N N   . GLY C 1 100 ? 82.99600  102.33200 100.64700 1.000 60.20433  ? 100 GLY C N   1 
ATOM   7344  C CA  . GLY C 1 100 ? 81.97400  101.80000 101.52400 1.000 60.20433  ? 100 GLY C CA  1 
ATOM   7345  C C   . GLY C 1 100 ? 82.53100  101.44600 102.88600 1.000 60.20433  ? 100 GLY C C   1 
ATOM   7346  O O   . GLY C 1 100 ? 81.82400  101.51800 103.89200 1.000 60.20433  ? 100 GLY C O   1 
ATOM   7347  N N   . PHE C 1 101 ? 83.81300  101.07400 102.93000 1.000 58.20187  ? 101 PHE C N   1 
ATOM   7348  C CA  . PHE C 1 101 ? 84.45000  100.75800 104.20300 1.000 58.20187  ? 101 PHE C CA  1 
ATOM   7349  C C   . PHE C 1 101 ? 84.76800  102.01000 105.00200 1.000 58.20187  ? 101 PHE C C   1 
ATOM   7350  O O   . PHE C 1 101 ? 85.09100  101.91800 106.18900 1.000 58.20187  ? 101 PHE C O   1 
ATOM   7351  C CB  . PHE C 1 101 ? 85.71900  99.94800  103.96800 1.000 58.20187  ? 101 PHE C CB  1 
ATOM   7352  C CG  . PHE C 1 101 ? 85.45900  98.50700  103.71000 1.000 58.20187  ? 101 PHE C CG  1 
ATOM   7353  C CD1 . PHE C 1 101 ? 84.62900  97.78700  104.54400 1.000 58.20187  ? 101 PHE C CD1 1 
ATOM   7354  C CD2 . PHE C 1 101 ? 86.01700  97.87400  102.61800 1.000 58.20187  ? 101 PHE C CD2 1 
ATOM   7355  C CE1 . PHE C 1 101 ? 84.37400  96.45200  104.30500 1.000 58.20187  ? 101 PHE C CE1 1 
ATOM   7356  C CE2 . PHE C 1 101 ? 85.75900  96.54100  102.36800 1.000 58.20187  ? 101 PHE C CE2 1 
ATOM   7357  C CZ  . PHE C 1 101 ? 84.94300  95.82900  103.21600 1.000 58.20187  ? 101 PHE C CZ  1 
ATOM   7358  N N   . PHE C 1 102 ? 84.70500  103.17800 104.37600 1.000 57.06671  ? 102 PHE C N   1 
ATOM   7359  C CA  . PHE C 1 102 ? 84.84900  104.43200 105.09200 1.000 57.06671  ? 102 PHE C CA  1 
ATOM   7360  C C   . PHE C 1 102 ? 83.51100  105.04100 105.46500 1.000 57.06671  ? 102 PHE C C   1 
ATOM   7361  O O   . PHE C 1 102 ? 83.48500  106.05300 106.16700 1.000 57.06671  ? 102 PHE C O   1 
ATOM   7362  C CB  . PHE C 1 102 ? 85.65500  105.43000 104.26400 1.000 57.06671  ? 102 PHE C CB  1 
ATOM   7363  C CG  . PHE C 1 102 ? 87.13100  105.20800 104.33000 1.000 57.06671  ? 102 PHE C CG  1 
ATOM   7364  C CD1 . PHE C 1 102 ? 87.71800  104.16800 103.63600 1.000 57.06671  ? 102 PHE C CD1 1 
ATOM   7365  C CD2 . PHE C 1 102 ? 87.93000  106.03400 105.08900 1.000 57.06671  ? 102 PHE C CD2 1 
ATOM   7366  C CE1 . PHE C 1 102 ? 89.06800  103.95600 103.69400 1.000 57.06671  ? 102 PHE C CE1 1 
ATOM   7367  C CE2 . PHE C 1 102 ? 89.28800  105.82600 105.15100 1.000 57.06671  ? 102 PHE C CE2 1 
ATOM   7368  C CZ  . PHE C 1 102 ? 89.85300  104.78400 104.45100 1.000 57.06671  ? 102 PHE C CZ  1 
ATOM   7369  N N   . ALA C 1 103 ? 82.40700  104.46200 105.00200 1.000 59.57521  ? 103 ALA C N   1 
ATOM   7370  C CA  . ALA C 1 103 ? 81.08700  104.86300 105.46400 1.000 59.57521  ? 103 ALA C CA  1 
ATOM   7371  C C   . ALA C 1 103 ? 80.64700  104.07400 106.68400 1.000 59.57521  ? 103 ALA C C   1 
ATOM   7372  O O   . ALA C 1 103 ? 79.82500  104.56200 107.46600 1.000 59.57521  ? 103 ALA C O   1 
ATOM   7373  C CB  . ALA C 1 103 ? 80.06000  104.69000 104.34600 1.000 59.57521  ? 103 ALA C CB  1 
ATOM   7374  N N   . ILE C 1 104 ? 81.16600  102.85500 106.84200 1.000 59.53453  ? 104 ILE C N   1 
ATOM   7375  C CA  . ILE C 1 104 ? 80.95500  102.08900 108.06400 1.000 59.53453  ? 104 ILE C CA  1 
ATOM   7376  C C   . ILE C 1 104 ? 81.62600  102.77800 109.24300 1.000 59.53453  ? 104 ILE C C   1 
ATOM   7377  O O   . ILE C 1 104 ? 81.05200  102.88200 110.33300 1.000 59.53453  ? 104 ILE C O   1 
ATOM   7378  C CB  . ILE C 1 104 ? 81.46900  100.64900 107.87000 1.000 59.53453  ? 104 ILE C CB  1 
ATOM   7379  C CG1 . ILE C 1 104 ? 80.59000  99.90900  106.86800 1.000 59.53453  ? 104 ILE C CG1 1 
ATOM   7380  C CG2 . ILE C 1 104 ? 81.54500  99.89000  109.17600 1.000 59.53453  ? 104 ILE C CG2 1 
ATOM   7381  C CD1 . ILE C 1 104 ? 81.13900  98.57400  106.46100 1.000 59.53453  ? 104 ILE C CD1 1 
ATOM   7382  N N   . ASP C 1 105 ? 82.83000  103.31100 109.02700 1.000 60.83723  ? 105 ASP C N   1 
ATOM   7383  C CA  . ASP C 1 105 ? 83.60600  103.85200 110.13600 1.000 60.83723  ? 105 ASP C CA  1 
ATOM   7384  C C   . ASP C 1 105 ? 83.11600  105.23200 110.55700 1.000 60.83723  ? 105 ASP C C   1 
ATOM   7385  O O   . ASP C 1 105 ? 83.53300  105.74700 111.59600 1.000 60.83723  ? 105 ASP C O   1 
ATOM   7386  C CB  . ASP C 1 105 ? 85.08300  103.89900 109.76900 1.000 60.83723  ? 105 ASP C CB  1 
ATOM   7387  C CG  . ASP C 1 105 ? 85.97700  103.84700 110.98300 1.000 60.83723  ? 105 ASP C CG  1 
ATOM   7388  O OD1 . ASP C 1 105 ? 86.36100  104.92000 111.48600 1.000 60.83723  ? 105 ASP C OD1 1 
ATOM   7389  O OD2 . ASP C 1 105 ? 86.29700  102.73100 111.43800 1.000 60.83723  ? 105 ASP C OD2 1 
ATOM   7390  N N   . ILE C 1 106 ? 82.25100  105.86100 109.76500 1.000 60.64145  ? 106 ILE C N   1 
ATOM   7391  C CA  . ILE C 1 106 ? 81.56900  107.05200 110.26600 1.000 60.64145  ? 106 ILE C CA  1 
ATOM   7392  C C   . ILE C 1 106 ? 80.52600  106.64300 111.29600 1.000 60.64145  ? 106 ILE C C   1 
ATOM   7393  O O   . ILE C 1 106 ? 80.32900  107.31500 112.31500 1.000 60.64145  ? 106 ILE C O   1 
ATOM   7394  C CB  . ILE C 1 106 ? 80.95100  107.84700 109.10100 1.000 60.64145  ? 106 ILE C CB  1 
ATOM   7395  C CG1 . ILE C 1 106 ? 82.04500  108.27500 108.12400 1.000 60.64145  ? 106 ILE C CG1 1 
ATOM   7396  C CG2 . ILE C 1 106 ? 80.21100  109.07300 109.61500 1.000 60.64145  ? 106 ILE C CG2 1 
ATOM   7397  C CD1 . ILE C 1 106 ? 81.59600  109.26900 107.07000 1.000 60.64145  ? 106 ILE C CD1 1 
ATOM   7398  N N   . ILE C 1 107 ? 79.87100  105.50600 111.06300 1.000 60.76486  ? 107 ILE C N   1 
ATOM   7399  C CA  . ILE C 1 107 ? 78.89600  104.98300 112.01300 1.000 60.76486  ? 107 ILE C CA  1 
ATOM   7400  C C   . ILE C 1 107 ? 79.59800  104.45700 113.26100 1.000 60.76486  ? 107 ILE C C   1 
ATOM   7401  O O   . ILE C 1 107 ? 79.17500  104.72900 114.39100 1.000 60.76486  ? 107 ILE C O   1 
ATOM   7402  C CB  . ILE C 1 107 ? 78.03600  103.89900 111.33300 1.000 60.76486  ? 107 ILE C CB  1 
ATOM   7403  C CG1 . ILE C 1 107 ? 77.00000  104.53800 110.40700 1.000 60.76486  ? 107 ILE C CG1 1 
ATOM   7404  C CG2 . ILE C 1 107 ? 77.35700  102.98800 112.34500 1.000 60.76486  ? 107 ILE C CG2 1 
ATOM   7405  C CD1 . ILE C 1 107 ? 75.98100  105.38900 111.12500 1.000 60.76486  ? 107 ILE C CD1 1 
ATOM   7406  N N   . LEU C 1 108 ? 80.71500  103.74400 113.06900 1.000 59.98160  ? 108 LEU C N   1 
ATOM   7407  C CA  . LEU C 1 108 ? 81.34700  102.99400 114.15200 1.000 59.98160  ? 108 LEU C CA  1 
ATOM   7408  C C   . LEU C 1 108 ? 81.96600  103.90900 115.20200 1.000 59.98160  ? 108 LEU C C   1 
ATOM   7409  O O   . LEU C 1 108 ? 81.96600  103.58200 116.39300 1.000 59.98160  ? 108 LEU C O   1 
ATOM   7410  C CB  . LEU C 1 108 ? 82.40100  102.05100 113.57400 1.000 59.98160  ? 108 LEU C CB  1 
ATOM   7411  C CG  . LEU C 1 108 ? 83.21100  101.19000 114.53700 1.000 59.98160  ? 108 LEU C CG  1 
ATOM   7412  C CD1 . LEU C 1 108 ? 82.28400  100.37000 115.39200 1.000 59.98160  ? 108 LEU C CD1 1 
ATOM   7413  C CD2 . LEU C 1 108 ? 84.15500  100.29100 113.78700 1.000 59.98160  ? 108 LEU C CD2 1 
ATOM   7414  N N   . THR C 1 109 ? 82.46100  105.08000 114.79800 1.000 61.17691  ? 109 THR C N   1 
ATOM   7415  C CA  . THR C 1 109 ? 83.08000  105.97100 115.77500 1.000 61.17691  ? 109 THR C CA  1 
ATOM   7416  C C   . THR C 1 109 ? 82.08100  106.87500 116.47700 1.000 61.17691  ? 109 THR C C   1 
ATOM   7417  O O   . THR C 1 109 ? 82.46500  107.94800 116.94900 1.000 61.17691  ? 109 THR C O   1 
ATOM   7418  C CB  . THR C 1 109 ? 84.16300  106.82500 115.13400 1.000 61.17691  ? 109 THR C CB  1 
ATOM   7419  O OG1 . THR C 1 109 ? 83.56200  107.78600 114.26200 1.000 61.17691  ? 109 THR C OG1 1 
ATOM   7420  C CG2 . THR C 1 109 ? 85.15100  105.96100 114.39200 1.000 61.17691  ? 109 THR C CG2 1 
ATOM   7421  N N   . PHE C 1 110 ? 80.81400  106.49000 116.53200 1.000 61.06084  ? 110 PHE C N   1 
ATOM   7422  C CA  . PHE C 1 110 ? 79.91300  107.00000 117.55000 1.000 61.06084  ? 110 PHE C CA  1 
ATOM   7423  C C   . PHE C 1 110 ? 79.82500  106.06200 118.74500 1.000 61.06084  ? 110 PHE C C   1 
ATOM   7424  O O   . PHE C 1 110 ? 78.95600  106.24100 119.60100 1.000 61.06084  ? 110 PHE C O   1 
ATOM   7425  C CB  . PHE C 1 110 ? 78.52500  107.23700 116.95400 1.000 61.06084  ? 110 PHE C CB  1 
ATOM   7426  C CG  . PHE C 1 110 ? 78.39700  108.54200 116.22800 1.000 61.06084  ? 110 PHE C CG  1 
ATOM   7427  C CD1 . PHE C 1 110 ? 78.20600  109.72000 116.92700 1.000 61.06084  ? 110 PHE C CD1 1 
ATOM   7428  C CD2 . PHE C 1 110 ? 78.46700  108.59300 114.85000 1.000 61.06084  ? 110 PHE C CD2 1 
ATOM   7429  C CE1 . PHE C 1 110 ? 78.08800  110.92600 116.26300 1.000 61.06084  ? 110 PHE C CE1 1 
ATOM   7430  C CE2 . PHE C 1 110 ? 78.34900  109.79800 114.18100 1.000 61.06084  ? 110 PHE C CE2 1 
ATOM   7431  C CZ  . PHE C 1 110 ? 78.16000  110.96200 114.89000 1.000 61.06084  ? 110 PHE C CZ  1 
ATOM   7432  N N   . PHE C 1 111 ? 80.70300  105.06600 118.80900 1.000 62.58611  ? 111 PHE C N   1 
ATOM   7433  C CA  . PHE C 1 111 ? 80.68600  104.05200 119.85500 1.000 62.58611  ? 111 PHE C CA  1 
ATOM   7434  C C   . PHE C 1 111 ? 82.10600  103.74200 120.32200 1.000 62.58611  ? 111 PHE C C   1 
ATOM   7435  O O   . PHE C 1 111 ? 82.48200  102.58600 120.49800 1.000 62.58611  ? 111 PHE C O   1 
ATOM   7436  C CB  . PHE C 1 111 ? 80.00500  102.77400 119.36500 1.000 62.58611  ? 111 PHE C CB  1 
ATOM   7437  C CG  . PHE C 1 111 ? 78.58900  102.96900 118.90400 1.000 62.58611  ? 111 PHE C CG  1 
ATOM   7438  C CD1 . PHE C 1 111 ? 78.30400  103.16300 117.56400 1.000 62.58611  ? 111 PHE C CD1 1 
ATOM   7439  C CD2 . PHE C 1 111 ? 77.54200  102.93900 119.80600 1.000 62.58611  ? 111 PHE C CD2 1 
ATOM   7440  C CE1 . PHE C 1 111 ? 77.00400  103.33700 117.13500 1.000 62.58611  ? 111 PHE C CE1 1 
ATOM   7441  C CE2 . PHE C 1 111 ? 76.23800  103.11200 119.38200 1.000 62.58611  ? 111 PHE C CE2 1 
ATOM   7442  C CZ  . PHE C 1 111 ? 75.97200  103.31100 118.04500 1.000 62.58611  ? 111 PHE C CZ  1 
ATOM   7443  N N   . VAL C 1 112 ? 82.92700  104.77300 120.52700 1.000 62.55810  ? 112 VAL C N   1 
ATOM   7444  C CA  . VAL C 1 112 ? 84.29200  104.59100 121.01300 1.000 62.55810  ? 112 VAL C CA  1 
ATOM   7445  C C   . VAL C 1 112 ? 84.55100  105.54300 122.17400 1.000 62.55810  ? 112 VAL C C   1 
ATOM   7446  O O   . VAL C 1 112 ? 83.99800  106.64400 122.23100 1.000 62.55810  ? 112 VAL C O   1 
ATOM   7447  C CB  . VAL C 1 112 ? 85.33300  104.79200 119.89800 1.000 62.55810  ? 112 VAL C CB  1 
ATOM   7448  C CG1 . VAL C 1 112 ? 85.37000  103.58200 118.98600 1.000 62.55810  ? 112 VAL C CG1 1 
ATOM   7449  C CG2 . VAL C 1 112 ? 85.00800  106.04300 119.11000 1.000 62.55810  ? 112 VAL C CG2 1 
ATOM   7450  N N   . ALA C 1 113 ? 85.44000  105.12800 123.08200 1.000 61.63243  ? 113 ALA C N   1 
ATOM   7451  C CA  . ALA C 1 113 ? 85.44900  105.68600 124.43200 1.000 61.63243  ? 113 ALA C CA  1 
ATOM   7452  C C   . ALA C 1 113 ? 86.35300  106.90800 124.58100 1.000 61.63243  ? 113 ALA C C   1 
ATOM   7453  O O   . ALA C 1 113 ? 86.16200  107.70700 125.50000 1.000 61.63243  ? 113 ALA C O   1 
ATOM   7454  C CB  . ALA C 1 113 ? 85.85700  104.60500 125.42500 1.000 61.63243  ? 113 ALA C CB  1 
ATOM   7455  N N   . TYR C 1 114 ? 87.39300  107.00700 123.76900 1.000 60.61763  ? 114 TYR C N   1 
ATOM   7456  C CA  . TYR C 1 114 ? 88.20800  108.18000 123.43300 1.000 60.61763  ? 114 TYR C CA  1 
ATOM   7457  C C   . TYR C 1 114 ? 89.17600  108.72200 124.49500 1.000 60.61763  ? 114 TYR C C   1 
ATOM   7458  O O   . TYR C 1 114 ? 89.98400  109.57300 124.10700 1.000 60.61763  ? 114 TYR C O   1 
ATOM   7459  C CB  . TYR C 1 114 ? 87.35300  109.35400 122.89800 1.000 60.61763  ? 114 TYR C CB  1 
ATOM   7460  C CG  . TYR C 1 114 ? 86.62300  110.30900 123.84800 1.000 60.61763  ? 114 TYR C CG  1 
ATOM   7461  C CD1 . TYR C 1 114 ? 87.28300  111.35600 124.49100 1.000 60.61763  ? 114 TYR C CD1 1 
ATOM   7462  C CD2 . TYR C 1 114 ? 85.24800  110.24100 123.98900 1.000 60.61763  ? 114 TYR C CD2 1 
ATOM   7463  C CE1 . TYR C 1 114 ? 86.61500  112.22700 125.31300 1.000 60.61763  ? 114 TYR C CE1 1 
ATOM   7464  C CE2 . TYR C 1 114 ? 84.57100  111.11400 124.81100 1.000 60.61763  ? 114 TYR C CE2 1 
ATOM   7465  C CZ  . TYR C 1 114 ? 85.25900  112.10600 125.46500 1.000 60.61763  ? 114 TYR C CZ  1 
ATOM   7466  O OH  . TYR C 1 114 ? 84.59100  112.98500 126.28200 1.000 60.61763  ? 114 TYR C OH  1 
ATOM   7467  N N   . LEU C 1 115 ? 89.15300  108.27900 125.76100 1.000 57.01152  ? 115 LEU C N   1 
ATOM   7468  C CA  . LEU C 1 115 ? 90.22000  108.53000 126.75200 1.000 57.01152  ? 115 LEU C CA  1 
ATOM   7469  C C   . LEU C 1 115 ? 90.45100  110.02900 126.99600 1.000 57.01152  ? 115 LEU C C   1 
ATOM   7470  O O   . LEU C 1 115 ? 91.34100  110.64400 126.41000 1.000 57.01152  ? 115 LEU C O   1 
ATOM   7471  C CB  . LEU C 1 115 ? 91.52200  107.81800 126.35600 1.000 57.01152  ? 115 LEU C CB  1 
ATOM   7472  C CG  . LEU C 1 115 ? 92.60000  107.59600 127.43000 1.000 57.01152  ? 115 LEU C CG  1 
ATOM   7473  C CD1 . LEU C 1 115 ? 93.28800  106.28500 127.15000 1.000 57.01152  ? 115 LEU C CD1 1 
ATOM   7474  C CD2 . LEU C 1 115 ? 93.65300  108.68200 127.50500 1.000 57.01152  ? 115 LEU C CD2 1 
ATOM   7475  N N   . ASP C 1 116 ? 89.54300  110.60800 127.79000 1.000 56.11785  ? 116 ASP C N   1 
ATOM   7476  C CA  . ASP C 1 116 ? 89.47400  112.02500 128.16600 1.000 56.11785  ? 116 ASP C CA  1 
ATOM   7477  C C   . ASP C 1 116 ? 90.82300  112.65600 128.50700 1.000 56.11785  ? 116 ASP C C   1 
ATOM   7478  O O   . ASP C 1 116 ? 91.70100  112.00200 129.07200 1.000 56.11785  ? 116 ASP C O   1 
ATOM   7479  C CB  . ASP C 1 116 ? 88.51800  112.16700 129.35800 1.000 56.11785  ? 116 ASP C CB  1 
ATOM   7480  C CG  . ASP C 1 116 ? 88.11400  113.61500 129.65800 1.000 56.11785  ? 116 ASP C CG  1 
ATOM   7481  O OD1 . ASP C 1 116 ? 88.96300  114.48400 129.95400 1.000 56.11785  ? 116 ASP C OD1 1 
ATOM   7482  O OD2 . ASP C 1 116 ? 86.90000  113.88700 129.59700 1.000 56.11785  ? 116 ASP C OD2 1 
ATOM   7483  N N   . SER C 1 117 ? 90.98400  113.93400 128.16700 1.000 54.78938  ? 117 SER C N   1 
ATOM   7484  C CA  . SER C 1 117 ? 92.27900  114.60100 128.22300 1.000 54.78938  ? 117 SER C CA  1 
ATOM   7485  C C   . SER C 1 117 ? 92.62900  115.15000 129.59600 1.000 54.78938  ? 117 SER C C   1 
ATOM   7486  O O   . SER C 1 117 ? 93.80400  115.13100 129.97400 1.000 54.78938  ? 117 SER C O   1 
ATOM   7487  C CB  . SER C 1 117 ? 92.31700  115.74500 127.21000 1.000 54.78938  ? 117 SER C CB  1 
ATOM   7488  O OG  . SER C 1 117 ? 91.29700  116.68300 127.48800 1.000 54.78938  ? 117 SER C OG  1 
ATOM   7489  N N   . HIS C 1 118 ? 91.65600  115.66400 130.34100 1.000 53.49420  ? 118 HIS C N   1 
ATOM   7490  C CA  . HIS C 1 118 ? 91.92700  116.22800 131.65500 1.000 53.49420  ? 118 HIS C CA  1 
ATOM   7491  C C   . HIS C 1 118 ? 91.76800  115.22000 132.78100 1.000 53.49420  ? 118 HIS C C   1 
ATOM   7492  O O   . HIS C 1 118 ? 92.17500  115.50800 133.91000 1.000 53.49420  ? 118 HIS C O   1 
ATOM   7493  C CB  . HIS C 1 118 ? 91.00900  117.42400 131.92000 1.000 53.49420  ? 118 HIS C CB  1 
ATOM   7494  C CG  . HIS C 1 118 ? 91.44200  118.68000 131.23300 1.000 53.49420  ? 118 HIS C CG  1 
ATOM   7495  N ND1 . HIS C 1 118 ? 90.75700  119.86900 131.35500 1.000 53.49420  ? 118 HIS C ND1 1 
ATOM   7496  C CD2 . HIS C 1 118 ? 92.48900  118.93200 130.41300 1.000 53.49420  ? 118 HIS C CD2 1 
ATOM   7497  C CE1 . HIS C 1 118 ? 91.36500  120.80000 130.64200 1.000 53.49420  ? 118 HIS C CE1 1 
ATOM   7498  N NE2 . HIS C 1 118 ? 92.41800  120.25700 130.06000 1.000 53.49420  ? 118 HIS C NE2 1 
ATOM   7499  N N   . SER C 1 119 ? 91.19100  114.05200 132.50800 1.000 50.40554  ? 119 SER C N   1 
ATOM   7500  C CA  . SER C 1 119 ? 91.00000  113.03400 133.52500 1.000 50.40554  ? 119 SER C CA  1 
ATOM   7501  C C   . SER C 1 119 ? 91.83000  111.78400 133.30300 1.000 50.40554  ? 119 SER C C   1 
ATOM   7502  O O   . SER C 1 119 ? 91.97300  110.99700 134.24200 1.000 50.40554  ? 119 SER C O   1 
ATOM   7503  C CB  . SER C 1 119 ? 89.52500  112.62800 133.60200 1.000 50.40554  ? 119 SER C CB  1 
ATOM   7504  O OG  . SER C 1 119 ? 89.34900  111.56800 134.52000 1.000 50.40554  ? 119 SER C OG  1 
ATOM   7505  N N   . TYR C 1 120 ? 92.35800  111.58600 132.09000 1.000 45.70112  ? 120 TYR C N   1 
ATOM   7506  C CA  . TYR C 1 120 ? 93.17000  110.42900 131.69400 1.000 45.70112  ? 120 TYR C CA  1 
ATOM   7507  C C   . TYR C 1 120 ? 92.43800  109.10800 131.90100 1.000 45.70112  ? 120 TYR C C   1 
ATOM   7508  O O   . TYR C 1 120 ? 93.05400  108.07900 132.17300 1.000 45.70112  ? 120 TYR C O   1 
ATOM   7509  C CB  . TYR C 1 120 ? 94.52400  110.42600 132.40500 1.000 45.70112  ? 120 TYR C CB  1 
ATOM   7510  C CG  . TYR C 1 120 ? 95.17100  111.78700 132.41200 1.000 45.70112  ? 120 TYR C CG  1 
ATOM   7511  C CD1 . TYR C 1 120 ? 95.77500  112.29200 131.27300 1.000 45.70112  ? 120 TYR C CD1 1 
ATOM   7512  C CD2 . TYR C 1 120 ? 95.16100  112.57400 133.54900 1.000 45.70112  ? 120 TYR C CD2 1 
ATOM   7513  C CE1 . TYR C 1 120 ? 96.35800  113.53900 131.27400 1.000 45.70112  ? 120 TYR C CE1 1 
ATOM   7514  C CE2 . TYR C 1 120 ? 95.73900  113.82100 133.55800 1.000 45.70112  ? 120 TYR C CE2 1 
ATOM   7515  C CZ  . TYR C 1 120 ? 96.33500  114.29700 132.42100 1.000 45.70112  ? 120 TYR C CZ  1 
ATOM   7516  O OH  . TYR C 1 120 ? 96.91000  115.54200 132.43500 1.000 45.70112  ? 120 TYR C OH  1 
ATOM   7517  N N   . LEU C 1 121 ? 91.11800  109.13100 131.75700 1.000 52.27353  ? 121 LEU C N   1 
ATOM   7518  C CA  . LEU C 1 121 ? 90.28400  107.95100 131.88800 1.000 52.27353  ? 121 LEU C CA  1 
ATOM   7519  C C   . LEU C 1 121 ? 89.30400  107.90300 130.72700 1.000 52.27353  ? 121 LEU C C   1 
ATOM   7520  O O   . LEU C 1 121 ? 88.99800  108.92500 130.11100 1.000 52.27353  ? 121 LEU C O   1 
ATOM   7521  C CB  . LEU C 1 121 ? 89.52000  107.94800 133.21300 1.000 52.27353  ? 121 LEU C CB  1 
ATOM   7522  C CG  . LEU C 1 121 ? 90.31000  107.54300 134.45500 1.000 52.27353  ? 121 LEU C CG  1 
ATOM   7523  C CD1 . LEU C 1 121 ? 89.56500  107.95000 135.70200 1.000 52.27353  ? 121 LEU C CD1 1 
ATOM   7524  C CD2 . LEU C 1 121 ? 90.56800  106.05100 134.45800 1.000 52.27353  ? 121 LEU C CD2 1 
ATOM   7525  N N   . LEU C 1 122 ? 88.81100  106.70300 130.44200 1.000 57.57040  ? 122 LEU C N   1 
ATOM   7526  C CA  . LEU C 1 122 ? 87.91200  106.50500 129.31400 1.000 57.57040  ? 122 LEU C CA  1 
ATOM   7527  C C   . LEU C 1 122 ? 86.52300  107.04000 129.63100 1.000 57.57040  ? 122 LEU C C   1 
ATOM   7528  O O   . LEU C 1 122 ? 86.02700  106.89900 130.75000 1.000 57.57040  ? 122 LEU C O   1 
ATOM   7529  C CB  . LEU C 1 122 ? 87.83300  105.02200 128.96300 1.000 57.57040  ? 122 LEU C CB  1 
ATOM   7530  C CG  . LEU C 1 122 ? 88.81800  104.43600 127.95100 1.000 57.57040  ? 122 LEU C CG  1 
ATOM   7531  C CD1 . LEU C 1 122 ? 90.24100  104.43700 128.44800 1.000 57.57040  ? 122 LEU C CD1 1 
ATOM   7532  C CD2 . LEU C 1 122 ? 88.40800  103.02500 127.66100 1.000 57.57040  ? 122 LEU C CD2 1 
ATOM   7533  N N   . VAL C 1 123 ? 85.89500  107.65700 128.63800 1.000 62.40314  ? 123 VAL C N   1 
ATOM   7534  C CA  . VAL C 1 123 ? 84.55300  108.20800 128.77000 1.000 62.40314  ? 123 VAL C CA  1 
ATOM   7535  C C   . VAL C 1 123 ? 83.59300  107.23400 128.10500 1.000 62.40314  ? 123 VAL C C   1 
ATOM   7536  O O   . VAL C 1 123 ? 83.66900  107.00300 126.89300 1.000 62.40314  ? 123 VAL C O   1 
ATOM   7537  C CB  . VAL C 1 123 ? 84.44200  109.60500 128.14600 1.000 62.40314  ? 123 VAL C CB  1 
ATOM   7538  C CG1 . VAL C 1 123 ? 82.99400  110.01800 128.02400 1.000 62.40314  ? 123 VAL C CG1 1 
ATOM   7539  C CG2 . VAL C 1 123 ? 85.18800  110.60700 128.97500 1.000 62.40314  ? 123 VAL C CG2 1 
ATOM   7540  N N   . ASP C 1 124 ? 82.69500  106.64900 128.88900 1.000 70.64398  ? 124 ASP C N   1 
ATOM   7541  C CA  . ASP C 1 124 ? 81.64500  105.78300 128.36300 1.000 70.64398  ? 124 ASP C CA  1 
ATOM   7542  C C   . ASP C 1 124 ? 80.32200  106.51300 128.55900 1.000 70.64398  ? 124 ASP C C   1 
ATOM   7543  O O   . ASP C 1 124 ? 79.59800  106.29000 129.52800 1.000 70.64398  ? 124 ASP C O   1 
ATOM   7544  C CB  . ASP C 1 124 ? 81.64900  104.43400 129.05200 1.000 70.64398  ? 124 ASP C CB  1 
ATOM   7545  C CG  . ASP C 1 124 ? 82.88500  103.63200 128.74200 1.000 70.64398  ? 124 ASP C CG  1 
ATOM   7546  O OD1 . ASP C 1 124 ? 83.64500  104.04900 127.84800 1.000 70.64398  ? 124 ASP C OD1 1 
ATOM   7547  O OD2 . ASP C 1 124 ? 83.09900  102.58600 129.38800 1.000 70.64398  ? 124 ASP C OD2 1 
ATOM   7548  N N   . SER C 1 125 ? 80.01100  107.38900 127.62200 1.000 70.62363  ? 125 SER C N   1 
ATOM   7549  C CA  . SER C 1 125 ? 78.76500  108.15200 127.65200 1.000 70.62363  ? 125 SER C CA  1 
ATOM   7550  C C   . SER C 1 125 ? 78.44900  108.52300 126.21800 1.000 70.62363  ? 125 SER C C   1 
ATOM   7551  O O   . SER C 1 125 ? 79.14700  109.35000 125.61500 1.000 70.62363  ? 125 SER C O   1 
ATOM   7552  C CB  . SER C 1 125 ? 78.87200  109.39400 128.53000 1.000 70.62363  ? 125 SER C CB  1 
ATOM   7553  O OG  . SER C 1 125 ? 79.35900  110.48700 127.78000 1.000 70.62363  ? 125 SER C OG  1 
ATOM   7554  N N   . PRO C 1 126 ? 77.38400  107.95500 125.64100 1.000 70.26699  ? 126 PRO C N   1 
ATOM   7555  C CA  . PRO C 1 126 ? 77.15400  108.09500 124.19600 1.000 70.26699  ? 126 PRO C CA  1 
ATOM   7556  C C   . PRO C 1 126 ? 76.71500  109.48200 123.75400 1.000 70.26699  ? 126 PRO C C   1 
ATOM   7557  O O   . PRO C 1 126 ? 76.61800  109.74100 122.55200 1.000 70.26699  ? 126 PRO C O   1 
ATOM   7558  C CB  . PRO C 1 126 ? 76.06200  107.05700 123.92400 1.000 70.26699  ? 126 PRO C CB  1 
ATOM   7559  C CG  . PRO C 1 126 ? 75.33300  106.95300 125.20600 1.000 70.26699  ? 126 PRO C CG  1 
ATOM   7560  C CD  . PRO C 1 126 ? 76.36200  107.11100 126.28100 1.000 70.26699  ? 126 PRO C CD  1 
ATOM   7561  N N   . LYS C 1 127 ? 76.45200  110.38200 124.69600 1.000 70.79103  ? 127 LYS C N   1 
ATOM   7562  C CA  . LYS C 1 127 ? 76.19700  111.76400 124.32000 1.000 70.79103  ? 127 LYS C CA  1 
ATOM   7563  C C   . LYS C 1 127 ? 77.48100  112.56600 124.17200 1.000 70.79103  ? 127 LYS C C   1 
ATOM   7564  O O   . LYS C 1 127 ? 77.65300  113.26300 123.16800 1.000 70.79103  ? 127 LYS C O   1 
ATOM   7565  C CB  . LYS C 1 127 ? 75.27700  112.43800 125.33900 1.000 70.79103  ? 127 LYS C CB  1 
ATOM   7566  C CG  . LYS C 1 127 ? 74.72400  113.78200 124.87600 1.000 70.79103  ? 127 LYS C CG  1 
ATOM   7567  C CD  . LYS C 1 127 ? 74.02900  113.70300 123.51400 1.000 70.79103  ? 127 LYS C CD  1 
ATOM   7568  C CE  . LYS C 1 127 ? 72.76800  112.83900 123.54100 1.000 70.79103  ? 127 LYS C CE  1 
ATOM   7569  N NZ  . LYS C 1 127 ? 72.01200  112.90400 122.25800 1.000 70.79103  ? 127 LYS C NZ  1 
ATOM   7570  N N   . LYS C 1 128 ? 78.40000  112.47100 125.13800 1.000 69.74067  ? 128 LYS C N   1 
ATOM   7571  C CA  . LYS C 1 128 ? 79.64600  113.22500 125.04200 1.000 69.74067  ? 128 LYS C CA  1 
ATOM   7572  C C   . LYS C 1 128 ? 80.58900  112.62600 124.00600 1.000 69.74067  ? 128 LYS C C   1 
ATOM   7573  O O   . LYS C 1 128 ? 81.48200  113.31900 123.50700 1.000 69.74067  ? 128 LYS C O   1 
ATOM   7574  C CB  . LYS C 1 128 ? 80.33400  113.29600 126.40300 1.000 69.74067  ? 128 LYS C CB  1 
ATOM   7575  C CG  . LYS C 1 128 ? 79.86100  114.44100 127.27500 1.000 69.74067  ? 128 LYS C CG  1 
ATOM   7576  C CD  . LYS C 1 128 ? 79.81200  114.03200 128.73600 1.000 69.74067  ? 128 LYS C CD  1 
ATOM   7577  C CE  . LYS C 1 128 ? 81.18900  113.65800 129.24800 1.000 69.74067  ? 128 LYS C CE  1 
ATOM   7578  N NZ  . LYS C 1 128 ? 81.96500  114.86000 129.65500 1.000 69.74067  ? 128 LYS C NZ  1 
ATOM   7579  N N   . ILE C 1 129 ? 80.41800  111.33800 123.69600 1.000 66.80103  ? 129 ILE C N   1 
ATOM   7580  C CA  . ILE C 1 129 ? 81.07600  110.74700 122.53400 1.000 66.80103  ? 129 ILE C CA  1 
ATOM   7581  C C   . ILE C 1 129 ? 80.59900  111.44000 121.26500 1.000 66.80103  ? 129 ILE C C   1 
ATOM   7582  O O   . ILE C 1 129 ? 81.39400  111.79300 120.38400 1.000 66.80103  ? 129 ILE C O   1 
ATOM   7583  C CB  . ILE C 1 129 ? 80.80300  109.23200 122.48600 1.000 66.80103  ? 129 ILE C CB  1 
ATOM   7584  C CG1 . ILE C 1 129 ? 81.60900  108.50500 123.55300 1.000 66.80103  ? 129 ILE C CG1 1 
ATOM   7585  C CG2 . ILE C 1 129 ? 81.13200  108.64600 121.13500 1.000 66.80103  ? 129 ILE C CG2 1 
ATOM   7586  C CD1 . ILE C 1 129 ? 81.14800  107.09500 123.77500 1.000 66.80103  ? 129 ILE C CD1 1 
ATOM   7587  N N   . ALA C 1 130 ? 79.29200  111.69800 121.18800 1.000 67.66196  ? 130 ALA C N   1 
ATOM   7588  C CA  . ALA C 1 130 ? 78.68600  112.19500 119.95900 1.000 67.66196  ? 130 ALA C CA  1 
ATOM   7589  C C   . ALA C 1 130 ? 79.03200  113.65700 119.71000 1.000 67.66196  ? 130 ALA C C   1 
ATOM   7590  O O   . ALA C 1 130 ? 79.30700  114.04400 118.57200 1.000 67.66196  ? 130 ALA C O   1 
ATOM   7591  C CB  . ALA C 1 130 ? 77.17400  112.00400 120.01300 1.000 67.66196  ? 130 ALA C CB  1 
ATOM   7592  N N   . ILE C 1 131 ? 79.02200  114.48600 120.75600 1.000 67.12566  ? 131 ILE C N   1 
ATOM   7593  C CA  . ILE C 1 131 ? 79.30500  115.90900 120.56800 1.000 67.12566  ? 131 ILE C CA  1 
ATOM   7594  C C   . ILE C 1 131 ? 80.77900  116.11900 120.24000 1.000 67.12566  ? 131 ILE C C   1 
ATOM   7595  O O   . ILE C 1 131 ? 81.14500  117.05900 119.52300 1.000 67.12566  ? 131 ILE C O   1 
ATOM   7596  C CB  . ILE C 1 131 ? 78.86800  116.71200 121.81000 1.000 67.12566  ? 131 ILE C CB  1 
ATOM   7597  C CG1 . ILE C 1 131 ? 77.42700  116.38100 122.18100 1.000 67.12566  ? 131 ILE C CG1 1 
ATOM   7598  C CG2 . ILE C 1 131 ? 78.96000  118.21200 121.57800 1.000 67.12566  ? 131 ILE C CG2 1 
ATOM   7599  C CD1 . ILE C 1 131 ? 77.15100  116.47300 123.66200 1.000 67.12566  ? 131 ILE C CD1 1 
ATOM   7600  N N   . ARG C 1 132 ? 81.64200  115.22300 120.72000 1.000 64.91579  ? 132 ARG C N   1 
ATOM   7601  C CA  . ARG C 1 132 ? 83.06100  115.32700 120.39900 1.000 64.91579  ? 132 ARG C CA  1 
ATOM   7602  C C   . ARG C 1 132 ? 83.32400  114.97400 118.94200 1.000 64.91579  ? 132 ARG C C   1 
ATOM   7603  O O   . ARG C 1 132 ? 84.07200  115.67200 118.25100 1.000 64.91579  ? 132 ARG C O   1 
ATOM   7604  C CB  . ARG C 1 132 ? 83.88100  114.42900 121.31800 1.000 64.91579  ? 132 ARG C CB  1 
ATOM   7605  C CG  . ARG C 1 132 ? 85.36400  114.49500 121.04200 1.000 64.91579  ? 132 ARG C CG  1 
ATOM   7606  C CD  . ARG C 1 132 ? 86.13100  113.67000 122.02800 1.000 64.91579  ? 132 ARG C CD  1 
ATOM   7607  N NE  . ARG C 1 132 ? 87.56100  113.66300 121.74800 1.000 64.91579  ? 132 ARG C NE  1 
ATOM   7608  C CZ  . ARG C 1 132 ? 88.17300  112.74200 121.01300 1.000 64.91579  ? 132 ARG C CZ  1 
ATOM   7609  N NH1 . ARG C 1 132 ? 87.48200  111.75000 120.47300 1.000 64.91579  ? 132 ARG C NH1 1 
ATOM   7610  N NH2 . ARG C 1 132 ? 89.47900  112.81400 120.81500 1.000 64.91579  ? 132 ARG C NH2 1 
ATOM   7611  N N   . TYR C 1 133 ? 82.71000  113.89700 118.45200 1.000 64.51712  ? 133 TYR C N   1 
ATOM   7612  C CA  . TYR C 1 133 ? 82.96400  113.47700 117.07900 1.000 64.51712  ? 133 TYR C CA  1 
ATOM   7613  C C   . TYR C 1 133 ? 82.29800  114.41400 116.08300 1.000 64.51712  ? 133 TYR C C   1 
ATOM   7614  O O   . TYR C 1 133 ? 82.79600  114.61200 114.97000 1.000 64.51712  ? 133 TYR C O   1 
ATOM   7615  C CB  . TYR C 1 133 ? 82.49200  112.04400 116.86300 1.000 64.51712  ? 133 TYR C CB  1 
ATOM   7616  C CG  . TYR C 1 133 ? 82.82400  111.54100 115.48900 1.000 64.51712  ? 133 TYR C CG  1 
ATOM   7617  C CD1 . TYR C 1 133 ? 84.11700  111.62700 115.00200 1.000 64.51712  ? 133 TYR C CD1 1 
ATOM   7618  C CD2 . TYR C 1 133 ? 81.85200  110.99700 114.67400 1.000 64.51712  ? 133 TYR C CD2 1 
ATOM   7619  C CE1 . TYR C 1 133 ? 84.43400  111.17600 113.74500 1.000 64.51712  ? 133 TYR C CE1 1 
ATOM   7620  C CE2 . TYR C 1 133 ? 82.16000  110.54600 113.41100 1.000 64.51712  ? 133 TYR C CE2 1 
ATOM   7621  C CZ  . TYR C 1 133 ? 83.45200  110.64000 112.95400 1.000 64.51712  ? 133 TYR C CZ  1 
ATOM   7622  O OH  . TYR C 1 133 ? 83.76800  110.19000 111.69800 1.000 64.51712  ? 133 TYR C OH  1 
ATOM   7623  N N   . LEU C 1 134 ? 81.17500  115.01800 116.47000 1.000 64.64044  ? 134 LEU C N   1 
ATOM   7624  C CA  . LEU C 1 134 ? 80.48600  115.93300 115.57100 1.000 64.64044  ? 134 LEU C CA  1 
ATOM   7625  C C   . LEU C 1 134 ? 81.14800  117.30200 115.51200 1.000 64.64044  ? 134 LEU C C   1 
ATOM   7626  O O   . LEU C 1 134 ? 80.82400  118.09200 114.62100 1.000 64.64044  ? 134 LEU C O   1 
ATOM   7627  C CB  . LEU C 1 134 ? 79.02300  116.07100 115.98600 1.000 64.64044  ? 134 LEU C CB  1 
ATOM   7628  C CG  . LEU C 1 134 ? 78.12300  114.89500 115.59800 1.000 64.64044  ? 134 LEU C CG  1 
ATOM   7629  C CD1 . LEU C 1 134 ? 76.85900  114.87400 116.43100 1.000 64.64044  ? 134 LEU C CD1 1 
ATOM   7630  C CD2 . LEU C 1 134 ? 77.76900  114.97700 114.14400 1.000 64.64044  ? 134 LEU C CD2 1 
ATOM   7631  N N   . SER C 1 135 ? 82.06600  117.60200 116.42700 1.000 65.56311  ? 135 SER C N   1 
ATOM   7632  C CA  . SER C 1 135 ? 82.72000  118.90200 116.44200 1.000 65.56311  ? 135 SER C CA  1 
ATOM   7633  C C   . SER C 1 135 ? 84.13400  118.87900 115.88000 1.000 65.56311  ? 135 SER C C   1 
ATOM   7634  O O   . SER C 1 135 ? 84.65400  119.93800 115.51300 1.000 65.56311  ? 135 SER C O   1 
ATOM   7635  C CB  . SER C 1 135 ? 82.76600  119.45600 117.86800 1.000 65.56311  ? 135 SER C CB  1 
ATOM   7636  O OG  . SER C 1 135 ? 81.46300  119.63700 118.38700 1.000 65.56311  ? 135 SER C OG  1 
ATOM   7637  N N   . THR C 1 136 ? 84.78100  117.71600 115.82400 1.000 65.60575  ? 136 THR C N   1 
ATOM   7638  C CA  . THR C 1 136 ? 86.14500  117.62900 115.31800 1.000 65.60575  ? 136 THR C CA  1 
ATOM   7639  C C   . THR C 1 136 ? 86.22200  117.07700 113.89800 1.000 65.60575  ? 136 THR C C   1 
ATOM   7640  O O   . THR C 1 136 ? 86.72800  117.75200 112.99800 1.000 65.60575  ? 136 THR C O   1 
ATOM   7641  C CB  . THR C 1 136 ? 87.00800  116.78500 116.26700 1.000 65.60575  ? 136 THR C CB  1 
ATOM   7642  O OG1 . THR C 1 136 ? 86.63000  115.40800 116.17300 1.000 65.60575  ? 136 THR C OG1 1 
ATOM   7643  C CG2 . THR C 1 136 ? 86.87100  117.26600 117.69900 1.000 65.60575  ? 136 THR C CG2 1 
ATOM   7644  N N   . TRP C 1 137 ? 85.72700  115.86500 113.67100 1.000 65.33052  ? 137 TRP C N   1 
ATOM   7645  C CA  . TRP C 1 137 ? 85.97900  115.17100 112.41100 1.000 65.33052  ? 137 TRP C CA  1 
ATOM   7646  C C   . TRP C 1 137 ? 84.70500  114.55400 111.85200 1.000 65.33052  ? 137 TRP C C   1 
ATOM   7647  O O   . TRP C 1 137 ? 84.68000  113.39000 111.45500 1.000 65.33052  ? 137 TRP C O   1 
ATOM   7648  C CB  . TRP C 1 137 ? 87.03900  114.08400 112.57300 1.000 65.33052  ? 137 TRP C CB  1 
ATOM   7649  C CG  . TRP C 1 137 ? 88.34800  114.53700 113.12400 1.000 65.33052  ? 137 TRP C CG  1 
ATOM   7650  C CD1 . TRP C 1 137 ? 88.88100  114.20400 114.33100 1.000 65.33052  ? 137 TRP C CD1 1 
ATOM   7651  C CD2 . TRP C 1 137 ? 89.30500  115.38600 112.48300 1.000 65.33052  ? 137 TRP C CD2 1 
ATOM   7652  N NE1 . TRP C 1 137 ? 90.10500  114.80100 114.48800 1.000 65.33052  ? 137 TRP C NE1 1 
ATOM   7653  C CE2 . TRP C 1 137 ? 90.38800  115.53200 113.36600 1.000 65.33052  ? 137 TRP C CE2 1 
ATOM   7654  C CE3 . TRP C 1 137 ? 89.34800  116.04100 111.25300 1.000 65.33052  ? 137 TRP C CE3 1 
ATOM   7655  C CZ2 . TRP C 1 137 ? 91.50000  116.30400 113.05800 1.000 65.33052  ? 137 TRP C CZ2 1 
ATOM   7656  C CZ3 . TRP C 1 137 ? 90.45300  116.80700 110.94900 1.000 65.33052  ? 137 TRP C CZ3 1 
ATOM   7657  C CH2 . TRP C 1 137 ? 91.51300  116.93200 111.84700 1.000 65.33052  ? 137 TRP C CH2 1 
ATOM   7658  N N   . PHE C 1 138 ? 83.62100  115.32200 111.80400 1.000 67.16270  ? 138 PHE C N   1 
ATOM   7659  C CA  . PHE C 1 138 ? 82.42600  114.87500 111.10200 1.000 67.16270  ? 138 PHE C CA  1 
ATOM   7660  C C   . PHE C 1 138 ? 82.18900  115.67800 109.83200 1.000 67.16270  ? 138 PHE C C   1 
ATOM   7661  O O   . PHE C 1 138 ? 81.95500  115.09800 108.77000 1.000 67.16270  ? 138 PHE C O   1 
ATOM   7662  C CB  . PHE C 1 138 ? 81.18900  114.94300 111.99200 1.000 67.16270  ? 138 PHE C CB  1 
ATOM   7663  C CG  . PHE C 1 138 ? 80.01000  114.22000 111.41900 1.000 67.16270  ? 138 PHE C CG  1 
ATOM   7664  C CD1 . PHE C 1 138 ? 79.92700  112.84300 111.50300 1.000 67.16270  ? 138 PHE C CD1 1 
ATOM   7665  C CD2 . PHE C 1 138 ? 78.99900  114.91200 110.77600 1.000 67.16270  ? 138 PHE C CD2 1 
ATOM   7666  C CE1 . PHE C 1 138 ? 78.85000  112.17000 110.97500 1.000 67.16270  ? 138 PHE C CE1 1 
ATOM   7667  C CE2 . PHE C 1 138 ? 77.92000  114.24400 110.24500 1.000 67.16270  ? 138 PHE C CE2 1 
ATOM   7668  C CZ  . PHE C 1 138 ? 77.84700  112.87100 110.34500 1.000 67.16270  ? 138 PHE C CZ  1 
ATOM   7669  N N   . ALA C 1 139 ? 82.26100  117.00700 109.91100 1.000 71.57020  ? 139 ALA C N   1 
ATOM   7670  C CA  . ALA C 1 139 ? 82.13500  117.84000 108.72200 1.000 71.57020  ? 139 ALA C CA  1 
ATOM   7671  C C   . ALA C 1 139 ? 83.34400  117.73600 107.81000 1.000 71.57020  ? 139 ALA C C   1 
ATOM   7672  O O   . ALA C 1 139 ? 83.28900  118.21400 106.67200 1.000 71.57020  ? 139 ALA C O   1 
ATOM   7673  C CB  . ALA C 1 139 ? 81.91800  119.29900 109.12300 1.000 71.57020  ? 139 ALA C CB  1 
ATOM   7674  N N   . PHE C 1 140 ? 84.42800  117.13600 108.28700 1.000 70.01840  ? 140 PHE C N   1 
ATOM   7675  C CA  . PHE C 1 140 ? 85.62700  116.85500 107.51900 1.000 70.01840  ? 140 PHE C CA  1 
ATOM   7676  C C   . PHE C 1 140 ? 85.62500  115.45200 106.93300 1.000 70.01840  ? 140 PHE C C   1 
ATOM   7677  O O   . PHE C 1 140 ? 86.11300  115.24700 105.82100 1.000 70.01840  ? 140 PHE C O   1 
ATOM   7678  C CB  . PHE C 1 140 ? 86.84400  117.04900 108.43000 1.000 70.01840  ? 140 PHE C CB  1 
ATOM   7679  C CG  . PHE C 1 140 ? 88.15600  116.97800 107.72800 1.000 70.01840  ? 140 PHE C CG  1 
ATOM   7680  C CD1 . PHE C 1 140 ? 88.89100  115.80600 107.73000 1.000 70.01840  ? 140 PHE C CD1 1 
ATOM   7681  C CD2 . PHE C 1 140 ? 88.67400  118.09000 107.09800 1.000 70.01840  ? 140 PHE C CD2 1 
ATOM   7682  C CE1 . PHE C 1 140 ? 90.10400  115.74000 107.09800 1.000 70.01840  ? 140 PHE C CE1 1 
ATOM   7683  C CE2 . PHE C 1 140 ? 89.89200  118.02900 106.46200 1.000 70.01840  ? 140 PHE C CE2 1 
ATOM   7684  C CZ  . PHE C 1 140 ? 90.60800  116.84900 106.46300 1.000 70.01840  ? 140 PHE C CZ  1 
ATOM   7685  N N   . ASP C 1 141 ? 85.07600  114.47700 107.65300 1.000 70.05191  ? 141 ASP C N   1 
ATOM   7686  C CA  . ASP C 1 141 ? 85.16100  113.08500 107.23600 1.000 70.05191  ? 141 ASP C CA  1 
ATOM   7687  C C   . ASP C 1 141 ? 83.91900  112.58900 106.51100 1.000 70.05191  ? 141 ASP C C   1 
ATOM   7688  O O   . ASP C 1 141 ? 83.90300  111.43100 106.08400 1.000 70.05191  ? 141 ASP C O   1 
ATOM   7689  C CB  . ASP C 1 141 ? 85.42800  112.18500 108.44300 1.000 70.05191  ? 141 ASP C CB  1 
ATOM   7690  N N   . VAL C 1 142 ? 82.88200  113.41100 106.36600 1.000 71.66686  ? 142 VAL C N   1 
ATOM   7691  C CA  . VAL C 1 142 ? 81.72400  113.00700 105.57600 1.000 71.66686  ? 142 VAL C CA  1 
ATOM   7692  C C   . VAL C 1 142 ? 81.86000  113.65900 104.20700 1.000 71.66686  ? 142 VAL C C   1 
ATOM   7693  O O   . VAL C 1 142 ? 81.18700  113.27200 103.24700 1.000 71.66686  ? 142 VAL C O   1 
ATOM   7694  C CB  . VAL C 1 142 ? 80.39600  113.37500 106.26600 1.000 71.66686  ? 142 VAL C CB  1 
ATOM   7695  C CG1 . VAL C 1 142 ? 80.05600  114.84200 106.07400 1.000 71.66686  ? 142 VAL C CG1 1 
ATOM   7696  C CG2 . VAL C 1 142 ? 79.26600  112.47500 105.78800 1.000 71.66686  ? 142 VAL C CG2 1 
ATOM   7697  N N   . CYS C 1 143 ? 82.75600  114.64200 104.10200 1.000 73.20970  ? 143 CYS C N   1 
ATOM   7698  C CA  . CYS C 1 143 ? 83.07500  115.23200 102.81000 1.000 73.20970  ? 143 CYS C CA  1 
ATOM   7699  C C   . CYS C 1 143 ? 84.09000  114.40800 102.03300 1.000 73.20970  ? 143 CYS C C   1 
ATOM   7700  O O   . CYS C 1 143 ? 84.40000  114.75500 100.88900 1.000 73.20970  ? 143 CYS C O   1 
ATOM   7701  C CB  . CYS C 1 143 ? 83.59800  116.65300 102.99900 1.000 73.20970  ? 143 CYS C CB  1 
ATOM   7702  S SG  . CYS C 1 143 ? 82.32700  117.83700 103.48100 1.000 73.20970  ? 143 CYS C SG  1 
ATOM   7703  N N   . SER C 1 144 ? 84.61900  113.34200 102.62900 1.000 69.43222  ? 144 SER C N   1 
ATOM   7704  C CA  . SER C 1 144 ? 85.53300  112.42200 101.97000 1.000 69.43222  ? 144 SER C CA  1 
ATOM   7705  C C   . SER C 1 144 ? 84.90300  111.05900 101.74200 1.000 69.43222  ? 144 SER C C   1 
ATOM   7706  O O   . SER C 1 144 ? 85.60500  110.11100 101.38100 1.000 69.43222  ? 144 SER C O   1 
ATOM   7707  C CB  . SER C 1 144 ? 86.80700  112.27200 102.79600 1.000 69.43222  ? 144 SER C CB  1 
ATOM   7708  O OG  . SER C 1 144 ? 87.26100  113.53600 103.23700 1.000 69.43222  ? 144 SER C OG  1 
ATOM   7709  N N   . THR C 1 145 ? 83.60200  110.93600 101.95300 1.000 71.39415  ? 145 THR C N   1 
ATOM   7710  C CA  . THR C 1 145 ? 82.91800  109.65700 101.87900 1.000 71.39415  ? 145 THR C CA  1 
ATOM   7711  C C   . THR C 1 145 ? 81.80800  109.63300 100.83900 1.000 71.39415  ? 145 THR C C   1 
ATOM   7712  O O   . THR C 1 145 ? 81.67000  108.63100 100.13000 1.000 71.39415  ? 145 THR C O   1 
ATOM   7713  C CB  . THR C 1 145 ? 82.35100  109.30100 103.26500 1.000 71.39415  ? 145 THR C CB  1 
ATOM   7714  O OG1 . THR C 1 145 ? 83.43000  109.24800 104.20500 1.000 71.39415  ? 145 THR C OG1 1 
ATOM   7715  C CG2 . THR C 1 145 ? 81.65700  107.94900 103.26800 1.000 71.39415  ? 145 THR C CG2 1 
ATOM   7716  N N   . ALA C 1 146 ? 81.05400  110.71900 100.69700 1.000 79.11209  ? 146 ALA C N   1 
ATOM   7717  C CA  . ALA C 1 146 ? 79.97200  110.80000 99.72400  1.000 79.11209  ? 146 ALA C CA  1 
ATOM   7718  C C   . ALA C 1 146 ? 80.52900  110.76600 98.30600  1.000 79.11209  ? 146 ALA C C   1 
ATOM   7719  O O   . ALA C 1 146 ? 81.39700  111.58600 97.97100  1.000 79.11209  ? 146 ALA C O   1 
ATOM   7720  C CB  . ALA C 1 146 ? 79.16100  112.07300 99.93800  1.000 79.11209  ? 146 ALA C CB  1 
ATOM   7721  N N   . PRO C 1 147 ? 80.08500  109.83900 97.45800  1.000 83.92853  ? 147 PRO C N   1 
ATOM   7722  C CA  . PRO C 1 147 ? 80.68500  109.71000 96.12500  1.000 83.92853  ? 147 PRO C CA  1 
ATOM   7723  C C   . PRO C 1 147 ? 80.19100  110.80400 95.19200  1.000 83.92853  ? 147 PRO C C   1 
ATOM   7724  O O   . PRO C 1 147 ? 78.98700  111.02100 95.04600  1.000 83.92853  ? 147 PRO C O   1 
ATOM   7725  C CB  . PRO C 1 147 ? 80.22900  108.32200 95.65700  1.000 83.92853  ? 147 PRO C CB  1 
ATOM   7726  C CG  . PRO C 1 147 ? 79.60800  107.66900 96.86000  1.000 83.92853  ? 147 PRO C CG  1 
ATOM   7727  C CD  . PRO C 1 147 ? 79.10700  108.77500 97.71900  1.000 83.92853  ? 147 PRO C CD  1 
ATOM   7728  N N   . PHE C 1 148 ? 81.13700  111.50100 94.57200  1.000 87.32015  ? 148 PHE C N   1 
ATOM   7729  C CA  . PHE C 1 148 ? 80.84500  112.50700 93.56400  1.000 87.32015  ? 148 PHE C CA  1 
ATOM   7730  C C   . PHE C 1 148 ? 81.05500  111.97700 92.15600  1.000 87.32015  ? 148 PHE C C   1 
ATOM   7731  O O   . PHE C 1 148 ? 80.20600  112.17100 91.28700  1.000 87.32015  ? 148 PHE C O   1 
ATOM   7732  C CB  . PHE C 1 148 ? 81.71700  113.75000 93.78600  1.000 87.32015  ? 148 PHE C CB  1 
ATOM   7733  C CG  . PHE C 1 148 ? 81.29700  114.58000 94.95900  1.000 87.32015  ? 148 PHE C CG  1 
ATOM   7734  C CD1 . PHE C 1 148 ? 81.73100  114.26700 96.23600  1.000 87.32015  ? 148 PHE C CD1 1 
ATOM   7735  C CD2 . PHE C 1 148 ? 80.46700  115.67300 94.78800  1.000 87.32015  ? 148 PHE C CD2 1 
ATOM   7736  C CE1 . PHE C 1 148 ? 81.34600  115.02700 97.32300  1.000 87.32015  ? 148 PHE C CE1 1 
ATOM   7737  C CE2 . PHE C 1 148 ? 80.07700  116.43900 95.87000  1.000 87.32015  ? 148 PHE C CE2 1 
ATOM   7738  C CZ  . PHE C 1 148 ? 80.51800  116.11500 97.14000  1.000 87.32015  ? 148 PHE C CZ  1 
ATOM   7739  N N   . GLN C 1 149 ? 82.17900  111.30100 91.90800  1.000 90.38779  ? 149 GLN C N   1 
ATOM   7740  C CA  . GLN C 1 149 ? 82.39000  110.71000 90.58700  1.000 90.38779  ? 149 GLN C CA  1 
ATOM   7741  C C   . GLN C 1 149 ? 81.53100  109.46600 90.34900  1.000 90.38779  ? 149 GLN C C   1 
ATOM   7742  O O   . GLN C 1 149 ? 80.90200  109.37800 89.28000  1.000 90.38779  ? 149 GLN C O   1 
ATOM   7743  C CB  . GLN C 1 149 ? 83.88500  110.46200 90.35300  1.000 90.38779  ? 149 GLN C CB  1 
ATOM   7744  N N   . PRO C 1 150 ? 81.45800  108.44900 91.27800  1.000 89.96349  ? 150 PRO C N   1 
ATOM   7745  C CA  . PRO C 1 150 ? 80.56200  107.31700 90.99300  1.000 89.96349  ? 150 PRO C CA  1 
ATOM   7746  C C   . PRO C 1 150 ? 79.08100  107.64900 91.05200  1.000 89.96349  ? 150 PRO C C   1 
ATOM   7747  O O   . PRO C 1 150 ? 78.33700  107.34000 90.11800  1.000 89.96349  ? 150 PRO C O   1 
ATOM   7748  C CB  . PRO C 1 150 ? 80.92800  106.29800 92.08000  1.000 89.96349  ? 150 PRO C CB  1 
ATOM   7749  C CG  . PRO C 1 150 ? 82.28000  106.65700 92.48700  1.000 89.96349  ? 150 PRO C CG  1 
ATOM   7750  C CD  . PRO C 1 150 ? 82.24600  108.14000 92.48900  1.000 89.96349  ? 150 PRO C CD  1 
ATOM   7751  N N   . LEU C 1 151 ? 78.64300  108.27400 92.14400  1.000 95.60072  ? 151 LEU C N   1 
ATOM   7752  C CA  . LEU C 1 151 ? 77.21000  108.37600 92.40200  1.000 95.60072  ? 151 LEU C CA  1 
ATOM   7753  C C   . LEU C 1 151 ? 76.55900  109.45100 91.54600  1.000 95.60072  ? 151 LEU C C   1 
ATOM   7754  O O   . LEU C 1 151 ? 75.43500  109.26700 91.06700  1.000 95.60072  ? 151 LEU C O   1 
ATOM   7755  C CB  . LEU C 1 151 ? 76.95600  108.64600 93.88400  1.000 95.60072  ? 151 LEU C CB  1 
ATOM   7756  N N   . SER C 1 152 ? 77.24000  110.57600 91.33600  1.000 98.42504  ? 152 SER C N   1 
ATOM   7757  C CA  . SER C 1 152 ? 76.64500  111.61700 90.50800  1.000 98.42504  ? 152 SER C CA  1 
ATOM   7758  C C   . SER C 1 152 ? 76.98700  111.46500 89.03400  1.000 98.42504  ? 152 SER C C   1 
ATOM   7759  O O   . SER C 1 152 ? 76.93300  112.45300 88.29700  1.000 98.42504  ? 152 SER C O   1 
ATOM   7760  C CB  . SER C 1 152 ? 77.06300  113.00100 91.00200  1.000 98.42504  ? 152 SER C CB  1 
ATOM   7761  O OG  . SER C 1 152 ? 76.71700  113.99400 90.05600  1.000 98.42504  ? 152 SER C OG  1 
ATOM   7762  N N   . LEU C 1 153 ? 77.35300  110.25900 88.59900  1.000 100.93589 ? 153 LEU C N   1 
ATOM   7763  C CA  . LEU C 1 153 ? 77.40200  109.92300 87.18400  1.000 100.93589 ? 153 LEU C CA  1 
ATOM   7764  C C   . LEU C 1 153 ? 76.01700  109.89200 86.55600  1.000 100.93589 ? 153 LEU C C   1 
ATOM   7765  O O   . LEU C 1 153 ? 75.89000  110.12200 85.34800  1.000 100.93589 ? 153 LEU C O   1 
ATOM   7766  C CB  . LEU C 1 153 ? 78.09300  108.56500 87.02100  1.000 100.93589 ? 153 LEU C CB  1 
ATOM   7767  C CG  . LEU C 1 153 ? 78.27900  107.89800 85.66000  1.000 100.93589 ? 153 LEU C CG  1 
ATOM   7768  C CD1 . LEU C 1 153 ? 78.95700  108.84600 84.69600  1.000 100.93589 ? 153 LEU C CD1 1 
ATOM   7769  C CD2 . LEU C 1 153 ? 79.08200  106.61400 85.80700  1.000 100.93589 ? 153 LEU C CD2 1 
ATOM   7770  N N   . LEU C 1 154 ? 74.97900  109.65600 87.35300  1.000 105.09776 ? 154 LEU C N   1 
ATOM   7771  C CA  . LEU C 1 154 ? 73.63700  109.39900 86.85600  1.000 105.09776 ? 154 LEU C CA  1 
ATOM   7772  C C   . LEU C 1 154 ? 72.84300  110.65800 86.53500  1.000 105.09776 ? 154 LEU C C   1 
ATOM   7773  O O   . LEU C 1 154 ? 71.73900  110.54300 85.99300  1.000 105.09776 ? 154 LEU C O   1 
ATOM   7774  C CB  . LEU C 1 154 ? 72.85900  108.56200 87.87500  1.000 105.09776 ? 154 LEU C CB  1 
ATOM   7775  C CG  . LEU C 1 154 ? 73.47000  107.19900 88.20200  1.000 105.09776 ? 154 LEU C CG  1 
ATOM   7776  C CD1 . LEU C 1 154 ? 72.66600  106.49100 89.27400  1.000 105.09776 ? 154 LEU C CD1 1 
ATOM   7777  C CD2 . LEU C 1 154 ? 73.56000  106.34700 86.95000  1.000 105.09776 ? 154 LEU C CD2 1 
ATOM   7778  N N   . PHE C 1 155 ? 73.34900  111.85100 86.84600  1.000 110.20748 ? 155 PHE C N   1 
ATOM   7779  C CA  . PHE C 1 155 ? 72.54900  113.04600 86.58200  1.000 110.20748 ? 155 PHE C CA  1 
ATOM   7780  C C   . PHE C 1 155 ? 72.61800  113.45400 85.11400  1.000 110.20748 ? 155 PHE C C   1 
ATOM   7781  O O   . PHE C 1 155 ? 71.62900  113.35400 84.38200  1.000 110.20748 ? 155 PHE C O   1 
ATOM   7782  C CB  . PHE C 1 155 ? 73.00900  114.20300 87.47500  1.000 110.20748 ? 155 PHE C CB  1 
ATOM   7783  C CG  . PHE C 1 155 ? 72.42300  114.18300 88.85800  1.000 110.20748 ? 155 PHE C CG  1 
ATOM   7784  C CD1 . PHE C 1 155 ? 71.46800  113.24300 89.21500  1.000 110.20748 ? 155 PHE C CD1 1 
ATOM   7785  C CD2 . PHE C 1 155 ? 72.81000  115.13000 89.79300  1.000 110.20748 ? 155 PHE C CD2 1 
ATOM   7786  C CE1 . PHE C 1 155 ? 70.92700  113.23500 90.48600  1.000 110.20748 ? 155 PHE C CE1 1 
ATOM   7787  C CE2 . PHE C 1 155 ? 72.27200  115.13000 91.06400  1.000 110.20748 ? 155 PHE C CE2 1 
ATOM   7788  C CZ  . PHE C 1 155 ? 71.32800  114.18100 91.41100  1.000 110.20748 ? 155 PHE C CZ  1 
ATOM   7789  N N   . ASN C 1 156 ? 73.78300  113.91400 84.66600  1.000 112.14876 ? 156 ASN C N   1 
ATOM   7790  C CA  . ASN C 1 156 ? 73.95500  114.28700 83.26500  1.000 112.14876 ? 156 ASN C CA  1 
ATOM   7791  C C   . ASN C 1 156 ? 75.29600  113.90200 82.66300  1.000 112.14876 ? 156 ASN C C   1 
ATOM   7792  O O   . ASN C 1 156 ? 75.38300  113.79000 81.43500  1.000 112.14876 ? 156 ASN C O   1 
ATOM   7793  C CB  . ASN C 1 156 ? 73.75400  115.79700 83.08800  1.000 112.14876 ? 156 ASN C CB  1 
ATOM   7794  C CG  . ASN C 1 156 ? 73.12700  116.14700 81.75600  1.000 112.14876 ? 156 ASN C CG  1 
ATOM   7795  O OD1 . ASN C 1 156 ? 72.70600  115.26700 81.00700  1.000 112.14876 ? 156 ASN C OD1 1 
ATOM   7796  N ND2 . ASN C 1 156 ? 73.06600  117.43700 81.45000  1.000 112.14876 ? 156 ASN C ND2 1 
ATOM   7797  N N   . TYR C 1 157 ? 76.33700  113.69100 83.45900  1.000 108.89536 ? 157 TYR C N   1 
ATOM   7798  C CA  . TYR C 1 157 ? 77.71000  113.76600 82.98700  1.000 108.89536 ? 157 TYR C CA  1 
ATOM   7799  C C   . TYR C 1 157 ? 78.26200  112.38800 82.64600  1.000 108.89536 ? 157 TYR C C   1 
ATOM   7800  O O   . TYR C 1 157 ? 77.63300  111.35500 82.88200  1.000 108.89536 ? 157 TYR C O   1 
ATOM   7801  C CB  . TYR C 1 157 ? 78.58800  114.45100 84.03700  1.000 108.89536 ? 157 TYR C CB  1 
ATOM   7802  C CG  . TYR C 1 157 ? 78.00400  115.74100 84.57100  1.000 108.89536 ? 157 TYR C CG  1 
ATOM   7803  C CD1 . TYR C 1 157 ? 77.27000  115.76100 85.75400  1.000 108.89536 ? 157 TYR C CD1 1 
ATOM   7804  C CD2 . TYR C 1 157 ? 78.18800  116.93900 83.89300  1.000 108.89536 ? 157 TYR C CD2 1 
ATOM   7805  C CE1 . TYR C 1 157 ? 76.73400  116.93700 86.24300  1.000 108.89536 ? 157 TYR C CE1 1 
ATOM   7806  C CE2 . TYR C 1 157 ? 77.65800  118.12100 84.37800  1.000 108.89536 ? 157 TYR C CE2 1 
ATOM   7807  C CZ  . TYR C 1 157 ? 76.93300  118.11300 85.55200  1.000 108.89536 ? 157 TYR C CZ  1 
ATOM   7808  O OH  . TYR C 1 157 ? 76.40400  119.28400 86.03700  1.000 108.89536 ? 157 TYR C OH  1 
ATOM   7809  N N   . ASN C 1 158 ? 79.46700  112.39100 82.07700  1.000 105.03916 ? 158 ASN C N   1 
ATOM   7810  C CA  . ASN C 1 158 ? 80.13600  111.18100 81.62200  1.000 105.03916 ? 158 ASN C CA  1 
ATOM   7811  C C   . ASN C 1 158 ? 81.25800  110.74700 82.55600  1.000 105.03916 ? 158 ASN C C   1 
ATOM   7812  O O   . ASN C 1 158 ? 82.13300  109.97700 82.14700  1.000 105.03916 ? 158 ASN C O   1 
ATOM   7813  C CB  . ASN C 1 158 ? 80.68000  111.38000 80.20700  1.000 105.03916 ? 158 ASN C CB  1 
ATOM   7814  N N   . GLY C 1 159 ? 81.25300  111.22500 83.79700  1.000 102.28351 ? 159 GLY C N   1 
ATOM   7815  C CA  . GLY C 1 159 ? 82.25000  110.81300 84.76200  1.000 102.28351 ? 159 GLY C CA  1 
ATOM   7816  C C   . GLY C 1 159 ? 83.58800  111.49900 84.63500  1.000 102.28351 ? 159 GLY C C   1 
ATOM   7817  O O   . GLY C 1 159 ? 84.57600  111.00900 85.19200  1.000 102.28351 ? 159 GLY C O   1 
ATOM   7818  N N   . SER C 1 160 ? 83.65600  112.62000 83.92000  1.000 95.14464  ? 160 SER C N   1 
ATOM   7819  C CA  . SER C 1 160 ? 84.90700  113.34800 83.76100  1.000 95.14464  ? 160 SER C CA  1 
ATOM   7820  C C   . SER C 1 160 ? 84.59900  114.79800 83.43100  1.000 95.14464  ? 160 SER C C   1 
ATOM   7821  O O   . SER C 1 160 ? 83.83000  115.07600 82.50600  1.000 95.14464  ? 160 SER C O   1 
ATOM   7822  C CB  . SER C 1 160 ? 85.77800  112.73500 82.65900  1.000 95.14464  ? 160 SER C CB  1 
ATOM   7823  O OG  . SER C 1 160 ? 86.72200  113.67700 82.18400  1.000 95.14464  ? 160 SER C OG  1 
ATOM   7824  N N   . GLU C 1 161 ? 85.20600  115.70600 84.18800  1.000 86.63452  ? 161 GLU C N   1 
ATOM   7825  C CA  . GLU C 1 161 ? 85.18900  117.14500 83.97000  1.000 86.63452  ? 161 GLU C CA  1 
ATOM   7826  C C   . GLU C 1 161 ? 86.28900  117.72100 84.84600  1.000 86.63452  ? 161 GLU C C   1 
ATOM   7827  O O   . GLU C 1 161 ? 86.81700  117.03200 85.72100  1.000 86.63452  ? 161 GLU C O   1 
ATOM   7828  C CB  . GLU C 1 161 ? 83.83800  117.78000 84.31300  1.000 86.63452  ? 161 GLU C CB  1 
ATOM   7829  N N   . LEU C 1 162 ? 86.64000  118.98300 84.59700  1.000 85.57945  ? 162 LEU C N   1 
ATOM   7830  C CA  . LEU C 1 162 ? 87.69000  119.61200 85.39100  1.000 85.57945  ? 162 LEU C CA  1 
ATOM   7831  C C   . LEU C 1 162 ? 87.20800  119.89500 86.80700  1.000 85.57945  ? 162 LEU C C   1 
ATOM   7832  O O   . LEU C 1 162 ? 87.79500  119.41900 87.78200  1.000 85.57945  ? 162 LEU C O   1 
ATOM   7833  C CB  . LEU C 1 162 ? 88.17800  120.89800 84.72900  1.000 85.57945  ? 162 LEU C CB  1 
ATOM   7834  C CG  . LEU C 1 162 ? 89.28600  121.54500 85.55900  1.000 85.57945  ? 162 LEU C CG  1 
ATOM   7835  C CD1 . LEU C 1 162 ? 90.57900  120.74900 85.43900  1.000 85.57945  ? 162 LEU C CD1 1 
ATOM   7836  C CD2 . LEU C 1 162 ? 89.49800  122.99600 85.17100  1.000 85.57945  ? 162 LEU C CD2 1 
ATOM   7837  N N   . GLY C 1 163 ? 86.11400  120.64000 86.94000  1.000 85.36002  ? 163 GLY C N   1 
ATOM   7838  C CA  . GLY C 1 163 ? 85.59800  120.98700 88.25100  1.000 85.36002  ? 163 GLY C CA  1 
ATOM   7839  C C   . GLY C 1 163 ? 84.68500  119.94200 88.86100  1.000 85.36002  ? 163 GLY C C   1 
ATOM   7840  O O   . GLY C 1 163 ? 83.84200  120.26300 89.70400  1.000 85.36002  ? 163 GLY C O   1 
ATOM   7841  N N   . PHE C 1 164 ? 84.84100  118.68600 88.44500  1.000 83.02314  ? 164 PHE C N   1 
ATOM   7842  C CA  . PHE C 1 164 ? 84.01200  117.60000 88.94500  1.000 83.02314  ? 164 PHE C CA  1 
ATOM   7843  C C   . PHE C 1 164 ? 84.87700  116.44800 89.43000  1.000 83.02314  ? 164 PHE C C   1 
ATOM   7844  O O   . PHE C 1 164 ? 84.46500  115.68500 90.30600  1.000 83.02314  ? 164 PHE C O   1 
ATOM   7845  C CB  . PHE C 1 164 ? 83.05000  117.12500 87.86100  1.000 83.02314  ? 164 PHE C CB  1 
ATOM   7846  C CG  . PHE C 1 164 ? 81.83700  116.43000 88.39100  1.000 83.02314  ? 164 PHE C CG  1 
ATOM   7847  C CD1 . PHE C 1 164 ? 81.80500  115.05100 88.49600  1.000 83.02314  ? 164 PHE C CD1 1 
ATOM   7848  C CD2 . PHE C 1 164 ? 80.72400  117.15700 88.77900  1.000 83.02314  ? 164 PHE C CD2 1 
ATOM   7849  C CE1 . PHE C 1 164 ? 80.68500  114.41100 88.97800  1.000 83.02314  ? 164 PHE C CE1 1 
ATOM   7850  C CE2 . PHE C 1 164 ? 79.60400  116.52300 89.26400  1.000 83.02314  ? 164 PHE C CE2 1 
ATOM   7851  C CZ  . PHE C 1 164 ? 79.58500  115.14900 89.36400  1.000 83.02314  ? 164 PHE C CZ  1 
ATOM   7852  N N   . ARG C 1 165 ? 86.06700  116.29800 88.85300  1.000 71.85555  ? 165 ARG C N   1 
ATOM   7853  C CA  . ARG C 1 165 ? 87.00600  115.30300 89.34800  1.000 71.85555  ? 165 ARG C CA  1 
ATOM   7854  C C   . ARG C 1 165 ? 88.04200  115.90900 90.28500  1.000 71.85555  ? 165 ARG C C   1 
ATOM   7855  O O   . ARG C 1 165 ? 88.77000  115.16900 90.95400  1.000 71.85555  ? 165 ARG C O   1 
ATOM   7856  C CB  . ARG C 1 165 ? 87.68600  114.58300 88.17800  1.000 71.85555  ? 165 ARG C CB  1 
ATOM   7857  C CG  . ARG C 1 165 ? 88.89000  115.29500 87.60700  1.000 71.85555  ? 165 ARG C CG  1 
ATOM   7858  C CD  . ARG C 1 165 ? 89.24500  114.80300 86.21000  1.000 71.85555  ? 165 ARG C CD  1 
ATOM   7859  N NE  . ARG C 1 165 ? 89.27100  113.34900 86.11900  1.000 71.85555  ? 165 ARG C NE  1 
ATOM   7860  C CZ  . ARG C 1 165 ? 89.90200  112.67600 85.16400  1.000 71.85555  ? 165 ARG C CZ  1 
ATOM   7861  N NH1 . ARG C 1 165 ? 90.56500  113.32700 84.22200  1.000 71.85555  ? 165 ARG C NH1 1 
ATOM   7862  N NH2 . ARG C 1 165 ? 89.87500  111.35200 85.15200  1.000 71.85555  ? 165 ARG C NH2 1 
ATOM   7863  N N   . ILE C 1 166 ? 88.11900  117.24100 90.35400  1.000 71.98088  ? 166 ILE C N   1 
ATOM   7864  C CA  . ILE C 1 166 ? 88.82100  117.90300 91.44700  1.000 71.98088  ? 166 ILE C CA  1 
ATOM   7865  C C   . ILE C 1 166 ? 88.08800  117.68900 92.76700  1.000 71.98088  ? 166 ILE C C   1 
ATOM   7866  O O   . ILE C 1 166 ? 88.72400  117.56600 93.81700  1.000 71.98088  ? 166 ILE C O   1 
ATOM   7867  C CB  . ILE C 1 166 ? 89.03100  119.39900 91.09600  1.000 71.98088  ? 166 ILE C CB  1 
ATOM   7868  C CG1 . ILE C 1 166 ? 90.13700  119.54000 90.05400  1.000 71.98088  ? 166 ILE C CG1 1 
ATOM   7869  C CG2 . ILE C 1 166 ? 89.36100  120.26700 92.29700  1.000 71.98088  ? 166 ILE C CG2 1 
ATOM   7870  C CD1 . ILE C 1 166 ? 90.29500  120.94300 89.52700  1.000 71.98088  ? 166 ILE C CD1 1 
ATOM   7871  N N   . LEU C 1 167 ? 86.76100  117.54600 92.73300  1.000 72.52066  ? 167 LEU C N   1 
ATOM   7872  C CA  . LEU C 1 167 ? 86.02100  117.18500 93.94100  1.000 72.52066  ? 167 LEU C CA  1 
ATOM   7873  C C   . LEU C 1 167 ? 86.31600  115.76200 94.40500  1.000 72.52066  ? 167 LEU C C   1 
ATOM   7874  O O   . LEU C 1 167 ? 86.00700  115.42100 95.55000  1.000 72.52066  ? 167 LEU C O   1 
ATOM   7875  C CB  . LEU C 1 167 ? 84.51600  117.35500 93.72400  1.000 72.52066  ? 167 LEU C CB  1 
ATOM   7876  C CG  . LEU C 1 167 ? 83.86200  118.70200 94.06300  1.000 72.52066  ? 167 LEU C CG  1 
ATOM   7877  C CD1 . LEU C 1 167 ? 83.98100  118.99100 95.55100  1.000 72.52066  ? 167 LEU C CD1 1 
ATOM   7878  C CD2 . LEU C 1 167 ? 84.41000  119.86500 93.24400  1.000 72.52066  ? 167 LEU C CD2 1 
ATOM   7879  N N   . SER C 1 168 ? 86.90700  114.92700 93.55200  1.000 67.45793  ? 168 SER C N   1 
ATOM   7880  C CA  . SER C 1 168 ? 87.40300  113.63100 93.99100  1.000 67.45793  ? 168 SER C CA  1 
ATOM   7881  C C   . SER C 1 168 ? 88.79500  113.70100 94.59900  1.000 67.45793  ? 168 SER C C   1 
ATOM   7882  O O   . SER C 1 168 ? 89.34900  112.64900 94.93000  1.000 67.45793  ? 168 SER C O   1 
ATOM   7883  C CB  . SER C 1 168 ? 87.41000  112.64600 92.82700  1.000 67.45793  ? 168 SER C CB  1 
ATOM   7884  O OG  . SER C 1 168 ? 88.18200  111.50500 93.14900  1.000 67.45793  ? 168 SER C OG  1 
ATOM   7885  N N   . MET C 1 169 ? 89.38400  114.89000 94.73900  1.000 64.19865  ? 169 MET C N   1 
ATOM   7886  C CA  . MET C 1 169 ? 90.61800  115.03600 95.50000  1.000 64.19865  ? 169 MET C CA  1 
ATOM   7887  C C   . MET C 1 169 ? 90.37200  115.13400 96.99300  1.000 64.19865  ? 169 MET C C   1 
ATOM   7888  O O   . MET C 1 169 ? 91.33600  115.19200 97.76100  1.000 64.19865  ? 169 MET C O   1 
ATOM   7889  C CB  . MET C 1 169 ? 91.39700  116.27100 95.05200  1.000 64.19865  ? 169 MET C CB  1 
ATOM   7890  C CG  . MET C 1 169 ? 92.24200  116.04900 93.84100  1.000 64.19865  ? 169 MET C CG  1 
ATOM   7891  S SD  . MET C 1 169 ? 93.26800  114.60200 94.07100  1.000 64.19865  ? 169 MET C SD  1 
ATOM   7892  C CE  . MET C 1 169 ? 94.13200  114.61200 92.51800  1.000 64.19865  ? 169 MET C CE  1 
ATOM   7893  N N   . LEU C 1 170 ? 89.11100  115.15500 97.42400  1.000 63.62184  ? 170 LEU C N   1 
ATOM   7894  C CA  . LEU C 1 170 ? 88.80000  115.10600 98.84200  1.000 63.62184  ? 170 LEU C CA  1 
ATOM   7895  C C   . LEU C 1 170 ? 88.99500  113.72000 99.43100  1.000 63.62184  ? 170 LEU C C   1 
ATOM   7896  O O   . LEU C 1 170 ? 88.89800  113.56800 100.64900 1.000 63.62184  ? 170 LEU C O   1 
ATOM   7897  C CB  . LEU C 1 170 ? 87.37000  115.57700 99.08000  1.000 63.62184  ? 170 LEU C CB  1 
ATOM   7898  C CG  . LEU C 1 170 ? 87.03000  116.92600 98.45400  1.000 63.62184  ? 170 LEU C CG  1 
ATOM   7899  C CD1 . LEU C 1 170 ? 85.56800  117.24900 98.67000  1.000 63.62184  ? 170 LEU C CD1 1 
ATOM   7900  C CD2 . LEU C 1 170 ? 87.91000  118.01300 99.02700  1.000 63.62184  ? 170 LEU C CD2 1 
ATOM   7901  N N   . ARG C 1 171 ? 89.28200  112.71400 98.60800  1.000 60.11191  ? 171 ARG C N   1 
ATOM   7902  C CA  . ARG C 1 171 ? 89.75300  111.42900 99.10000  1.000 60.11191  ? 171 ARG C CA  1 
ATOM   7903  C C   . ARG C 1 171 ? 91.21700  111.45900 99.51600  1.000 60.11191  ? 171 ARG C C   1 
ATOM   7904  O O   . ARG C 1 171 ? 91.75000  110.41800 99.90600  1.000 60.11191  ? 171 ARG C O   1 
ATOM   7905  C CB  . ARG C 1 171 ? 89.53000  110.35600 98.03800  1.000 60.11191  ? 171 ARG C CB  1 
ATOM   7906  C CG  . ARG C 1 171 ? 88.06900  110.02000 97.82600  1.000 60.11191  ? 171 ARG C CG  1 
ATOM   7907  C CD  . ARG C 1 171 ? 87.81700  109.44300 96.44700  1.000 60.11191  ? 171 ARG C CD  1 
ATOM   7908  N NE  . ARG C 1 171 ? 88.52100  108.18400 96.23400  1.000 60.11191  ? 171 ARG C NE  1 
ATOM   7909  C CZ  . ARG C 1 171 ? 89.37900  107.96900 95.24300  1.000 60.11191  ? 171 ARG C CZ  1 
ATOM   7910  N NH1 . ARG C 1 171 ? 89.64100  108.93000 94.37100  1.000 60.11191  ? 171 ARG C NH1 1 
ATOM   7911  N NH2 . ARG C 1 171 ? 89.97100  106.79200 95.12200  1.000 60.11191  ? 171 ARG C NH2 1 
ATOM   7912  N N   . LEU C 1 172 ? 91.88600  112.60500 99.41300  1.000 56.69832  ? 172 LEU C N   1 
ATOM   7913  C CA  . LEU C 1 172 ? 93.15900  112.83000 100.07600 1.000 56.69832  ? 172 LEU C CA  1 
ATOM   7914  C C   . LEU C 1 172 ? 92.98500  113.36900 101.48300 1.000 56.69832  ? 172 LEU C C   1 
ATOM   7915  O O   . LEU C 1 172 ? 93.96800  113.45600 102.22200 1.000 56.69832  ? 172 LEU C O   1 
ATOM   7916  C CB  . LEU C 1 172 ? 94.02200  113.80900 99.27700  1.000 56.69832  ? 172 LEU C CB  1 
ATOM   7917  C CG  . LEU C 1 172 ? 94.75700  113.29200 98.04300  1.000 56.69832  ? 172 LEU C CG  1 
ATOM   7918  C CD1 . LEU C 1 172 ? 95.74300  114.33200 97.57100  1.000 56.69832  ? 172 LEU C CD1 1 
ATOM   7919  C CD2 . LEU C 1 172 ? 95.46300  111.98900 98.33100  1.000 56.69832  ? 172 LEU C CD2 1 
ATOM   7920  N N   . TRP C 1 173 ? 91.76700  113.73900 101.86900 1.000 60.15036  ? 173 TRP C N   1 
ATOM   7921  C CA  . TRP C 1 173 ? 91.52000  114.21700 103.22000 1.000 60.15036  ? 173 TRP C CA  1 
ATOM   7922  C C   . TRP C 1 173 ? 91.42000  113.09300 104.23400 1.000 60.15036  ? 173 TRP C C   1 
ATOM   7923  O O   . TRP C 1 173 ? 91.38600  113.36900 105.43300 1.000 60.15036  ? 173 TRP C O   1 
ATOM   7924  C CB  . TRP C 1 173 ? 90.24200  115.04600 103.27000 1.000 60.15036  ? 173 TRP C CB  1 
ATOM   7925  C CG  . TRP C 1 173 ? 90.47100  116.48100 103.02700 1.000 60.15036  ? 173 TRP C CG  1 
ATOM   7926  C CD1 . TRP C 1 173 ? 91.66000  117.08300 102.76500 1.000 60.15036  ? 173 TRP C CD1 1 
ATOM   7927  C CD2 . TRP C 1 173 ? 89.48500  117.51200 103.01800 1.000 60.15036  ? 173 TRP C CD2 1 
ATOM   7928  N NE1 . TRP C 1 173 ? 91.47800  118.43000 102.59400 1.000 60.15036  ? 173 TRP C NE1 1 
ATOM   7929  C CE2 . TRP C 1 173 ? 90.14900  118.71900 102.74500 1.000 60.15036  ? 173 TRP C CE2 1 
ATOM   7930  C CE3 . TRP C 1 173 ? 88.10300  117.53200 103.21500 1.000 60.15036  ? 173 TRP C CE3 1 
ATOM   7931  C CZ2 . TRP C 1 173 ? 89.48000  119.93400 102.66400 1.000 60.15036  ? 173 TRP C CZ2 1 
ATOM   7932  C CZ3 . TRP C 1 173 ? 87.44100  118.73700 103.13600 1.000 60.15036  ? 173 TRP C CZ3 1 
ATOM   7933  C CH2 . TRP C 1 173 ? 88.12900  119.92200 102.86200 1.000 60.15036  ? 173 TRP C CH2 1 
ATOM   7934  N N   . ARG C 1 174 ? 91.37800  111.84000 103.79700 1.000 56.36911  ? 174 ARG C N   1 
ATOM   7935  C CA  . ARG C 1 174 ? 91.42100  110.72000 104.71800 1.000 56.36911  ? 174 ARG C CA  1 
ATOM   7936  C C   . ARG C 1 174 ? 92.84300  110.31000 105.05700 1.000 56.36911  ? 174 ARG C C   1 
ATOM   7937  O O   . ARG C 1 174 ? 93.05100  109.22800 105.60800 1.000 56.36911  ? 174 ARG C O   1 
ATOM   7938  C CB  . ARG C 1 174 ? 90.64700  109.53400 104.14700 1.000 56.36911  ? 174 ARG C CB  1 
ATOM   7939  C CG  . ARG C 1 174 ? 91.17900  109.02400 102.84300 1.000 56.36911  ? 174 ARG C CG  1 
ATOM   7940  C CD  . ARG C 1 174 ? 90.33400  107.88700 102.31400 1.000 56.36911  ? 174 ARG C CD  1 
ATOM   7941  N NE  . ARG C 1 174 ? 88.96000  108.29000 102.03700 1.000 56.36911  ? 174 ARG C NE  1 
ATOM   7942  C CZ  . ARG C 1 174 ? 88.17400  107.67700 101.16000 1.000 56.36911  ? 174 ARG C CZ  1 
ATOM   7943  N NH1 . ARG C 1 174 ? 88.63000  106.63900 100.47500 1.000 56.36911  ? 174 ARG C NH1 1 
ATOM   7944  N NH2 . ARG C 1 174 ? 86.93400  108.10000 100.96500 1.000 56.36911  ? 174 ARG C NH2 1 
ATOM   7945  N N   . LEU C 1 175 ? 93.82300  111.15800 104.75100 1.000 49.18116  ? 175 LEU C N   1 
ATOM   7946  C CA  . LEU C 1 175 ? 95.20900  110.92600 105.12300 1.000 49.18116  ? 175 LEU C CA  1 
ATOM   7947  C C   . LEU C 1 175 ? 95.47800  111.19500 106.59200 1.000 49.18116  ? 175 LEU C C   1 
ATOM   7948  O O   . LEU C 1 175 ? 96.57900  110.90100 107.06200 1.000 49.18116  ? 175 LEU C O   1 
ATOM   7949  C CB  . LEU C 1 175 ? 96.13400  111.80200 104.28400 1.000 49.18116  ? 175 LEU C CB  1 
ATOM   7950  C CG  . LEU C 1 175 ? 96.59700  111.26700 102.93600 1.000 49.18116  ? 175 LEU C CG  1 
ATOM   7951  C CD1 . LEU C 1 175 ? 97.45200  112.30600 102.26200 1.000 49.18116  ? 175 LEU C CD1 1 
ATOM   7952  C CD2 . LEU C 1 175 ? 97.36800  109.99100 103.10900 1.000 49.18116  ? 175 LEU C CD2 1 
ATOM   7953  N N   . ARG C 1 176 ? 94.51100  111.74500 107.32600 1.000 50.33292  ? 176 ARG C N   1 
ATOM   7954  C CA  . ARG C 1 176 ? 94.72800  112.03000 108.73600 1.000 50.33292  ? 176 ARG C CA  1 
ATOM   7955  C C   . ARG C 1 176 ? 94.75500  110.76800 109.58200 1.000 50.33292  ? 176 ARG C C   1 
ATOM   7956  O O   . ARG C 1 176 ? 95.22200  110.81700 110.72100 1.000 50.33292  ? 176 ARG C O   1 
ATOM   7957  C CB  . ARG C 1 176 ? 93.66500  113.01300 109.23300 1.000 50.33292  ? 176 ARG C CB  1 
ATOM   7958  C CG  . ARG C 1 176 ? 92.22100  112.56300 109.09600 1.000 50.33292  ? 176 ARG C CG  1 
ATOM   7959  C CD  . ARG C 1 176 ? 91.66900  112.01100 110.39500 1.000 50.33292  ? 176 ARG C CD  1 
ATOM   7960  N NE  . ARG C 1 176 ? 90.24900  111.69900 110.30400 1.000 50.33292  ? 176 ARG C NE  1 
ATOM   7961  C CZ  . ARG C 1 176 ? 89.56400  111.08800 111.26100 1.000 50.33292  ? 176 ARG C CZ  1 
ATOM   7962  N NH1 . ARG C 1 176 ? 90.16800  110.72500 112.38100 1.000 50.33292  ? 176 ARG C NH1 1 
ATOM   7963  N NH2 . ARG C 1 176 ? 88.27600  110.83900 111.09700 1.000 50.33292  ? 176 ARG C NH2 1 
ATOM   7964  N N   . ARG C 1 177 ? 94.26300  109.64400 109.06500 1.000 47.62716  ? 177 ARG C N   1 
ATOM   7965  C CA  . ARG C 1 177 ? 94.39500  108.38500 109.78300 1.000 47.62716  ? 177 ARG C CA  1 
ATOM   7966  C C   . ARG C 1 177 ? 95.81900  107.86700 109.76400 1.000 47.62716  ? 177 ARG C C   1 
ATOM   7967  O O   . ARG C 1 177 ? 96.19800  107.09900 110.65200 1.000 47.62716  ? 177 ARG C O   1 
ATOM   7968  C CB  . ARG C 1 177 ? 93.46400  107.34000 109.18600 1.000 47.62716  ? 177 ARG C CB  1 
ATOM   7969  C CG  . ARG C 1 177 ? 92.08900  107.86900 108.92300 1.000 47.62716  ? 177 ARG C CG  1 
ATOM   7970  C CD  . ARG C 1 177 ? 91.14200  106.77300 108.52400 1.000 47.62716  ? 177 ARG C CD  1 
ATOM   7971  N NE  . ARG C 1 177 ? 89.76600  107.23900 108.60400 1.000 47.62716  ? 177 ARG C NE  1 
ATOM   7972  C CZ  . ARG C 1 177 ? 89.02200  107.15500 109.69900 1.000 47.62716  ? 177 ARG C CZ  1 
ATOM   7973  N NH1 . ARG C 1 177 ? 89.52500  106.61200 110.79800 1.000 47.62716  ? 177 ARG C NH1 1 
ATOM   7974  N NH2 . ARG C 1 177 ? 87.77800  107.60800 109.69500 1.000 47.62716  ? 177 ARG C NH2 1 
ATOM   7975  N N   . VAL C 1 178 ? 96.60600  108.25400 108.76700 1.000 40.75964  ? 178 VAL C N   1 
ATOM   7976  C CA  . VAL C 1 178 ? 98.01200  107.88100 108.71200 1.000 40.75964  ? 178 VAL C CA  1 
ATOM   7977  C C   . VAL C 1 178 ? 98.86300  108.86800 109.49400 1.000 40.75964  ? 178 VAL C C   1 
ATOM   7978  O O   . VAL C 1 178 ? 99.79000  108.47200 110.20300 1.000 40.75964  ? 178 VAL C O   1 
ATOM   7979  C CB  . VAL C 1 178 ? 98.44900  107.76900 107.23700 1.000 40.75964  ? 178 VAL C CB  1 
ATOM   7980  C CG1 . VAL C 1 178 ? 99.95200  107.76200 107.08700 1.000 40.75964  ? 178 VAL C CG1 1 
ATOM   7981  C CG2 . VAL C 1 178 ? 97.88700  106.51100 106.64800 1.000 40.75964  ? 178 VAL C CG2 1 
ATOM   7982  N N   . SER C 1 179 ? 98.52100  110.15300 109.43200 1.000 39.55240  ? 179 SER C N   1 
ATOM   7983  C CA  . SER C 1 179 ? 99.30200  111.15500 110.14300 1.000 39.55240  ? 179 SER C CA  1 
ATOM   7984  C C   . SER C 1 179 ? 99.09500  111.08000 111.64700 1.000 39.55240  ? 179 SER C C   1 
ATOM   7985  O O   . SER C 1 179 ? 100.00300 111.42100 112.41000 1.000 39.55240  ? 179 SER C O   1 
ATOM   7986  C CB  . SER C 1 179 ? 98.95200  112.54700 109.64000 1.000 39.55240  ? 179 SER C CB  1 
ATOM   7987  O OG  . SER C 1 179 ? 99.38700  113.52100 110.56300 1.000 39.55240  ? 179 SER C OG  1 
ATOM   7988  N N   . SER C 1 180 ? 97.92400  110.63900 112.09600 1.000 38.52597  ? 180 SER C N   1 
ATOM   7989  C CA  . SER C 1 180 ? 97.68200  110.43200 113.51600 1.000 38.52597  ? 180 SER C CA  1 
ATOM   7990  C C   . SER C 1 180 ? 98.06200  109.03600 113.97500 1.000 38.52597  ? 180 SER C C   1 
ATOM   7991  O O   . SER C 1 180 ? 97.78400  108.68200 115.12200 1.000 38.52597  ? 180 SER C O   1 
ATOM   7992  C CB  . SER C 1 180 ? 96.21900  110.68600 113.86100 1.000 38.52597  ? 180 SER C CB  1 
ATOM   7993  O OG  . SER C 1 180 ? 95.40400  109.66200 113.33100 1.000 38.52597  ? 180 SER C OG  1 
ATOM   7994  N N   . LEU C 1 181 ? 98.65800  108.22900 113.10500 1.000 36.38004  ? 181 LEU C N   1 
ATOM   7995  C CA  . LEU C 1 181 ? 99.27100  106.97900 113.52500 1.000 36.38004  ? 181 LEU C CA  1 
ATOM   7996  C C   . LEU C 1 181 ? 100.76600 107.14400 113.73200 1.000 36.38004  ? 181 LEU C C   1 
ATOM   7997  O O   . LEU C 1 181 ? 101.35300 106.45700 114.56800 1.000 36.38004  ? 181 LEU C O   1 
ATOM   7998  C CB  . LEU C 1 181 ? 98.97800  105.87700 112.50400 1.000 36.38004  ? 181 LEU C CB  1 
ATOM   7999  C CG  . LEU C 1 181 ? 99.44700  104.44600 112.76500 1.000 36.38004  ? 181 LEU C CG  1 
ATOM   8000  C CD1 . LEU C 1 181 ? 98.38600  103.49200 112.32200 1.000 36.38004  ? 181 LEU C CD1 1 
ATOM   8001  C CD2 . LEU C 1 181 ? 100.70100 104.15200 111.97400 1.000 36.38004  ? 181 LEU C CD2 1 
ATOM   8002  N N   . PHE C 1 182 ? 101.39800 108.05100 112.99100 1.000 34.86996  ? 182 PHE C N   1 
ATOM   8003  C CA  . PHE C 1 182 ? 102.80300 108.34100 113.23800 1.000 34.86996  ? 182 PHE C CA  1 
ATOM   8004  C C   . PHE C 1 182 ? 102.98000 109.11800 114.53100 1.000 34.86996  ? 182 PHE C C   1 
ATOM   8005  O O   . PHE C 1 182 ? 104.03300 109.04300 115.16900 1.000 34.86996  ? 182 PHE C O   1 
ATOM   8006  C CB  . PHE C 1 182 ? 103.39300 109.11600 112.06800 1.000 34.86996  ? 182 PHE C CB  1 
ATOM   8007  C CG  . PHE C 1 182 ? 103.74800 108.26200 110.90100 1.000 34.86996  ? 182 PHE C CG  1 
ATOM   8008  C CD1 . PHE C 1 182 ? 104.61600 107.20200 111.04800 1.000 34.86996  ? 182 PHE C CD1 1 
ATOM   8009  C CD2 . PHE C 1 182 ? 103.21700 108.52200 109.65700 1.000 34.86996  ? 182 PHE C CD2 1 
ATOM   8010  C CE1 . PHE C 1 182 ? 104.94500 106.41700 109.97600 1.000 34.86996  ? 182 PHE C CE1 1 
ATOM   8011  C CE2 . PHE C 1 182 ? 103.54200 107.74200 108.58300 1.000 34.86996  ? 182 PHE C CE2 1 
ATOM   8012  C CZ  . PHE C 1 182 ? 104.40600 106.68700 108.74300 1.000 34.86996  ? 182 PHE C CZ  1 
ATOM   8013  N N   . ALA C 1 183 ? 101.96300 109.88200 114.93000 1.000 34.76287  ? 183 ALA C N   1 
ATOM   8014  C CA  . ALA C 1 183 ? 102.02700 110.57900 116.20700 1.000 34.76287  ? 183 ALA C CA  1 
ATOM   8015  C C   . ALA C 1 183 ? 101.80900 109.62700 117.36700 1.000 34.76287  ? 183 ALA C C   1 
ATOM   8016  O O   . ALA C 1 183 ? 102.30100 109.87200 118.47100 1.000 34.76287  ? 183 ALA C O   1 
ATOM   8017  C CB  . ALA C 1 183 ? 100.99700 111.70200 116.25100 1.000 34.76287  ? 183 ALA C CB  1 
ATOM   8018  N N   . ARG C 1 184 ? 101.07100 108.54600 117.14500 1.000 35.83263  ? 184 ARG C N   1 
ATOM   8019  C CA  . ARG C 1 184 ? 100.82200 107.59000 118.21300 1.000 35.83263  ? 184 ARG C CA  1 
ATOM   8020  C C   . ARG C 1 184 ? 101.99000 106.63100 118.38500 1.000 35.83263  ? 184 ARG C C   1 
ATOM   8021  O O   . ARG C 1 184 ? 102.35300 106.29100 119.51400 1.000 35.83263  ? 184 ARG C O   1 
ATOM   8022  C CB  . ARG C 1 184 ? 99.53100  106.83000 117.93000 1.000 35.83263  ? 184 ARG C CB  1 
ATOM   8023  C CG  . ARG C 1 184 ? 99.23500  105.70900 118.89000 1.000 35.83263  ? 184 ARG C CG  1 
ATOM   8024  C CD  . ARG C 1 184 ? 98.23000  104.75800 118.29600 1.000 35.83263  ? 184 ARG C CD  1 
ATOM   8025  N NE  . ARG C 1 184 ? 97.00700  105.45400 117.92900 1.000 35.83263  ? 184 ARG C NE  1 
ATOM   8026  C CZ  . ARG C 1 184 ? 96.12100  104.98700 117.06300 1.000 35.83263  ? 184 ARG C CZ  1 
ATOM   8027  N NH1 . ARG C 1 184 ? 96.32700  103.82000 116.47200 1.000 35.83263  ? 184 ARG C NH1 1 
ATOM   8028  N NH2 . ARG C 1 184 ? 95.03200  105.68700 116.78600 1.000 35.83263  ? 184 ARG C NH2 1 
ATOM   8029  N N   . LEU C 1 185 ? 102.61000 106.20500 117.28400 1.000 33.06896  ? 185 LEU C N   1 
ATOM   8030  C CA  . LEU C 1 185 ? 103.71000 105.25400 117.37100 1.000 33.06896  ? 185 LEU C CA  1 
ATOM   8031  C C   . LEU C 1 185 ? 104.99800 105.88200 117.87700 1.000 33.06896  ? 185 LEU C C   1 
ATOM   8032  O O   . LEU C 1 185 ? 105.92200 105.15000 118.23700 1.000 33.06896  ? 185 LEU C O   1 
ATOM   8033  C CB  . LEU C 1 185 ? 103.97200 104.61600 116.01300 1.000 33.06896  ? 185 LEU C CB  1 
ATOM   8034  C CG  . LEU C 1 185 ? 102.93200 103.67800 115.41800 1.000 33.06896  ? 185 LEU C CG  1 
ATOM   8035  C CD1 . LEU C 1 185 ? 103.56900 102.86300 114.32700 1.000 33.06896  ? 185 LEU C CD1 1 
ATOM   8036  C CD2 . LEU C 1 185 ? 102.34200 102.78100 116.47200 1.000 33.06896  ? 185 LEU C CD2 1 
ATOM   8037  N N   . GLU C 1 186 ? 105.09500 107.21100 117.89800 1.000 33.71770  ? 186 GLU C N   1 
ATOM   8038  C CA  . GLU C 1 186 ? 106.30900 107.84700 118.39300 1.000 33.71770  ? 186 GLU C CA  1 
ATOM   8039  C C   . GLU C 1 186 ? 106.39500 107.78800 119.90700 1.000 33.71770  ? 186 GLU C C   1 
ATOM   8040  O O   . GLU C 1 186 ? 107.49600 107.75500 120.46300 1.000 33.71770  ? 186 GLU C O   1 
ATOM   8041  C CB  . GLU C 1 186 ? 106.37300 109.29400 117.93100 1.000 33.71770  ? 186 GLU C CB  1 
ATOM   8042  C CG  . GLU C 1 186 ? 107.02800 109.48800 116.59600 1.000 33.71770  ? 186 GLU C CG  1 
ATOM   8043  C CD  . GLU C 1 186 ? 106.82400 110.88500 116.07100 1.000 33.71770  ? 186 GLU C CD  1 
ATOM   8044  O OE1 . GLU C 1 186 ? 106.74000 111.81900 116.89500 1.000 33.71770  ? 186 GLU C OE1 1 
ATOM   8045  O OE2 . GLU C 1 186 ? 106.73300 111.05000 114.83800 1.000 33.71770  ? 186 GLU C OE2 1 
ATOM   8046  N N   . LYS C 1 187 ? 105.25600 107.78000 120.58600 1.000 33.67137  ? 187 LYS C N   1 
ATOM   8047  C CA  . LYS C 1 187 ? 105.20700 107.70500 122.03500 1.000 33.67137  ? 187 LYS C CA  1 
ATOM   8048  C C   . LYS C 1 187 ? 104.98500 106.29000 122.54400 1.000 33.67137  ? 187 LYS C C   1 
ATOM   8049  O O   . LYS C 1 187 ? 104.95000 106.08300 123.75800 1.000 33.67137  ? 187 LYS C O   1 
ATOM   8050  C CB  . LYS C 1 187 ? 104.11200 108.62800 122.55800 1.000 33.67137  ? 187 LYS C CB  1 
ATOM   8051  C CG  . LYS C 1 187 ? 104.11100 109.97400 121.87700 1.000 33.67137  ? 187 LYS C CG  1 
ATOM   8052  C CD  . LYS C 1 187 ? 103.06900 110.88600 122.46900 1.000 33.67137  ? 187 LYS C CD  1 
ATOM   8053  C CE  . LYS C 1 187 ? 101.67600 110.40200 122.14300 1.000 33.67137  ? 187 LYS C CE  1 
ATOM   8054  N NZ  . LYS C 1 187 ? 101.26600 110.83300 120.78700 1.000 33.67137  ? 187 LYS C NZ  1 
ATOM   8055  N N   . ASP C 1 188 ? 104.83500 105.31700 121.65400 1.000 36.01069  ? 188 ASP C N   1 
ATOM   8056  C CA  . ASP C 1 188 ? 104.74100 103.92000 122.04800 1.000 36.01069  ? 188 ASP C CA  1 
ATOM   8057  C C   . ASP C 1 188 ? 106.14400 103.39000 122.30000 1.000 36.01069  ? 188 ASP C C   1 
ATOM   8058  O O   . ASP C 1 188 ? 106.97800 103.38700 121.39300 1.000 36.01069  ? 188 ASP C O   1 
ATOM   8059  C CB  . ASP C 1 188 ? 104.04800 103.11400 120.95600 1.000 36.01069  ? 188 ASP C CB  1 
ATOM   8060  C CG  . ASP C 1 188 ? 103.31200 101.91000 121.49300 1.000 36.01069  ? 188 ASP C CG  1 
ATOM   8061  O OD1 . ASP C 1 188 ? 103.69900 101.39800 122.56200 1.000 36.01069  ? 188 ASP C OD1 1 
ATOM   8062  O OD2 . ASP C 1 188 ? 102.34400 101.46700 120.84300 1.000 36.01069  ? 188 ASP C OD2 1 
ATOM   8063  N N   . ILE C 1 189 ? 106.40700 102.93400 123.52600 1.000 34.94122  ? 189 ILE C N   1 
ATOM   8064  C CA  . ILE C 1 189 ? 107.77300 102.59400 123.90600 1.000 34.94122  ? 189 ILE C CA  1 
ATOM   8065  C C   . ILE C 1 189 ? 108.22800 101.25900 123.34300 1.000 34.94122  ? 189 ILE C C   1 
ATOM   8066  O O   . ILE C 1 189 ? 109.41900 100.94500 123.41300 1.000 34.94122  ? 189 ILE C O   1 
ATOM   8067  C CB  . ILE C 1 189 ? 107.92000 102.59000 125.43400 1.000 34.94122  ? 189 ILE C CB  1 
ATOM   8068  C CG1 . ILE C 1 189 ? 106.86700 101.67600 126.05200 1.000 34.94122  ? 189 ILE C CG1 1 
ATOM   8069  C CG2 . ILE C 1 189 ? 107.79200 103.99000 125.96300 1.000 34.94122  ? 189 ILE C CG2 1 
ATOM   8070  C CD1 . ILE C 1 189 ? 106.91800 101.60500 127.54800 1.000 34.94122  ? 189 ILE C CD1 1 
ATOM   8071  N N   . ARG C 1 190 ? 107.32700 100.45600 122.79400 1.000 38.51396  ? 190 ARG C N   1 
ATOM   8072  C CA  . ARG C 1 190 ? 107.73100 99.20000  122.18200 1.000 38.51396  ? 190 ARG C CA  1 
ATOM   8073  C C   . ARG C 1 190 ? 108.04200 99.34200  120.70200 1.000 38.51396  ? 190 ARG C C   1 
ATOM   8074  O O   . ARG C 1 190 ? 108.32000 98.33700  120.04500 1.000 38.51396  ? 190 ARG C O   1 
ATOM   8075  C CB  . ARG C 1 190 ? 106.65500 98.13400  122.39100 1.000 38.51396  ? 190 ARG C CB  1 
ATOM   8076  C CG  . ARG C 1 190 ? 105.28400 98.54600  121.93800 1.000 38.51396  ? 190 ARG C CG  1 
ATOM   8077  C CD  . ARG C 1 190 ? 104.25500 97.51700  122.33400 1.000 38.51396  ? 190 ARG C CD  1 
ATOM   8078  N NE  . ARG C 1 190 ? 103.20600 97.39100  121.33000 1.000 38.51396  ? 190 ARG C NE  1 
ATOM   8079  C CZ  . ARG C 1 190 ? 102.11300 98.14400  121.29600 1.000 38.51396  ? 190 ARG C CZ  1 
ATOM   8080  N NH1 . ARG C 1 190 ? 101.92100 99.07900  122.21400 1.000 38.51396  ? 190 ARG C NH1 1 
ATOM   8081  N NH2 . ARG C 1 190 ? 101.20800 97.95900  120.34600 1.000 38.51396  ? 190 ARG C NH2 1 
ATOM   8082  N N   . PHE C 1 191 ? 108.00500 100.55700 120.16800 1.000 35.62694  ? 191 PHE C N   1 
ATOM   8083  C CA  . PHE C 1 191 ? 108.43600 100.84800 118.81200 1.000 35.62694  ? 191 PHE C CA  1 
ATOM   8084  C C   . PHE C 1 191 ? 109.64800 101.76600 118.85200 1.000 35.62694  ? 191 PHE C C   1 
ATOM   8085  O O   . PHE C 1 191 ? 109.80200 102.57400 119.77000 1.000 35.62694  ? 191 PHE C O   1 
ATOM   8086  C CB  . PHE C 1 191 ? 107.32000 101.50700 118.00400 1.000 35.62694  ? 191 PHE C CB  1 
ATOM   8087  C CG  . PHE C 1 191 ? 106.19400 100.58400 117.66800 1.000 35.62694  ? 191 PHE C CG  1 
ATOM   8088  C CD1 . PHE C 1 191 ? 106.35800 99.59400  116.71900 1.000 35.62694  ? 191 PHE C CD1 1 
ATOM   8089  C CD2 . PHE C 1 191 ? 104.97200 100.70700 118.29700 1.000 35.62694  ? 191 PHE C CD2 1 
ATOM   8090  C CE1 . PHE C 1 191 ? 105.32500 98.74200  116.40700 1.000 35.62694  ? 191 PHE C CE1 1 
ATOM   8091  C CE2 . PHE C 1 191 ? 103.93400 99.85800  117.98800 1.000 35.62694  ? 191 PHE C CE2 1 
ATOM   8092  C CZ  . PHE C 1 191 ? 104.11200 98.87500  117.04200 1.000 35.62694  ? 191 PHE C CZ  1 
ATOM   8093  N N   . ASN C 1 192 ? 110.51000 101.63800 117.85000 1.000 32.92480  ? 192 ASN C N   1 
ATOM   8094  C CA  . ASN C 1 192 ? 111.70300 102.46300 117.79600 1.000 32.92480  ? 192 ASN C CA  1 
ATOM   8095  C C   . ASN C 1 192 ? 111.34600 103.89500 117.41900 1.000 32.92480  ? 192 ASN C C   1 
ATOM   8096  O O   . ASN C 1 192 ? 110.25200 104.18600 116.94100 1.000 32.92480  ? 192 ASN C O   1 
ATOM   8097  C CB  . ASN C 1 192 ? 112.70500 101.89800 116.79800 1.000 32.92480  ? 192 ASN C CB  1 
ATOM   8098  C CG  . ASN C 1 192 ? 114.12900 102.18700 117.18800 1.000 32.92480  ? 192 ASN C CG  1 
ATOM   8099  O OD1 . ASN C 1 192 ? 114.39000 103.06600 118.00100 1.000 32.92480  ? 192 ASN C OD1 1 
ATOM   8100  N ND2 . ASN C 1 192 ? 115.06100 101.45000 116.61400 1.000 32.92480  ? 192 ASN C ND2 1 
ATOM   8101  N N   . TYR C 1 193 ? 112.28300 104.80000 117.65900 1.000 31.00138  ? 193 TYR C N   1 
ATOM   8102  C CA  . TYR C 1 193 ? 112.11400 106.20600 117.32900 1.000 31.00138  ? 193 TYR C CA  1 
ATOM   8103  C C   . TYR C 1 193 ? 112.95000 106.63800 116.14100 1.000 31.00138  ? 193 TYR C C   1 
ATOM   8104  O O   . TYR C 1 193 ? 112.56700 107.56000 115.43000 1.000 31.00138  ? 193 TYR C O   1 
ATOM   8105  C CB  . TYR C 1 193 ? 112.46800 107.07500 118.53300 1.000 31.00138  ? 193 TYR C CB  1 
ATOM   8106  C CG  . TYR C 1 193 ? 112.12000 108.52800 118.36900 1.000 31.00138  ? 193 TYR C CG  1 
ATOM   8107  C CD1 . TYR C 1 193 ? 110.80500 108.93200 118.26800 1.000 31.00138  ? 193 TYR C CD1 1 
ATOM   8108  C CD2 . TYR C 1 193 ? 113.10700 109.49500 118.32400 1.000 31.00138  ? 193 TYR C CD2 1 
ATOM   8109  C CE1 . TYR C 1 193 ? 110.48200 110.25400 118.12300 1.000 31.00138  ? 193 TYR C CE1 1 
ATOM   8110  C CE2 . TYR C 1 193 ? 112.79200 110.81900 118.17800 1.000 31.00138  ? 193 TYR C CE2 1 
ATOM   8111  C CZ  . TYR C 1 193 ? 111.47800 111.19200 118.07800 1.000 31.00138  ? 193 TYR C CZ  1 
ATOM   8112  O OH  . TYR C 1 193 ? 111.14500 112.51500 117.93100 1.000 31.00138  ? 193 TYR C OH  1 
ATOM   8113  N N   . PHE C 1 194 ? 114.08900 105.99700 115.90400 1.000 35.39440  ? 194 PHE C N   1 
ATOM   8114  C CA  . PHE C 1 194 ? 114.85900 106.31800 114.71600 1.000 35.39440  ? 194 PHE C CA  1 
ATOM   8115  C C   . PHE C 1 194 ? 114.28400 105.68700 113.46400 1.000 35.39440  ? 194 PHE C C   1 
ATOM   8116  O O   . PHE C 1 194 ? 114.60500 106.14300 112.37000 1.000 35.39440  ? 194 PHE C O   1 
ATOM   8117  C CB  . PHE C 1 194 ? 116.30600 105.87200 114.87200 1.000 35.39440  ? 194 PHE C CB  1 
ATOM   8118  C CG  . PHE C 1 194 ? 116.97300 106.41800 116.08500 1.000 35.39440  ? 194 PHE C CG  1 
ATOM   8119  C CD1 . PHE C 1 194 ? 117.43200 107.71700 116.10400 1.000 35.39440  ? 194 PHE C CD1 1 
ATOM   8120  C CD2 . PHE C 1 194 ? 117.14800 105.63100 117.20900 1.000 35.39440  ? 194 PHE C CD2 1 
ATOM   8121  C CE1 . PHE C 1 194 ? 118.05300 108.22300 117.22100 1.000 35.39440  ? 194 PHE C CE1 1 
ATOM   8122  C CE2 . PHE C 1 194 ? 117.76600 106.13500 118.33000 1.000 35.39440  ? 194 PHE C CE2 1 
ATOM   8123  C CZ  . PHE C 1 194 ? 118.21700 107.43100 118.33500 1.000 35.39440  ? 194 PHE C CZ  1 
ATOM   8124  N N   . TRP C 1 195 ? 113.46900 104.64600 113.58500 1.000 35.77854  ? 195 TRP C N   1 
ATOM   8125  C CA  . TRP C 1 195 ? 112.88700 104.01900 112.41200 1.000 35.77854  ? 195 TRP C CA  1 
ATOM   8126  C C   . TRP C 1 195 ? 111.39200 104.24400 112.30800 1.000 35.77854  ? 195 TRP C C   1 
ATOM   8127  O O   . TRP C 1 195 ? 110.73400 103.57100 111.51600 1.000 35.77854  ? 195 TRP C O   1 
ATOM   8128  C CB  . TRP C 1 195 ? 113.21000 102.52500 112.39500 1.000 35.77854  ? 195 TRP C CB  1 
ATOM   8129  C CG  . TRP C 1 195 ? 114.69000 102.28800 112.41400 1.000 35.77854  ? 195 TRP C CG  1 
ATOM   8130  C CD1 . TRP C 1 195 ? 115.41200 101.73200 113.42200 1.000 35.77854  ? 195 TRP C CD1 1 
ATOM   8131  C CD2 . TRP C 1 195 ? 115.63700 102.63600 111.38900 1.000 35.77854  ? 195 TRP C CD2 1 
ATOM   8132  N NE1 . TRP C 1 195 ? 116.74400 101.69900 113.09200 1.000 35.77854  ? 195 TRP C NE1 1 
ATOM   8133  C CE2 . TRP C 1 195 ? 116.90700 102.24900 111.84800 1.000 35.77854  ? 195 TRP C CE2 1 
ATOM   8134  C CE3 . TRP C 1 195 ? 115.53100 103.22800 110.12400 1.000 35.77854  ? 195 TRP C CE3 1 
ATOM   8135  C CZ2 . TRP C 1 195 ? 118.05800 102.43700 111.09400 1.000 35.77854  ? 195 TRP C CZ2 1 
ATOM   8136  C CZ3 . TRP C 1 195 ? 116.67300 103.41400 109.38300 1.000 35.77854  ? 195 TRP C CZ3 1 
ATOM   8137  C CH2 . TRP C 1 195 ? 117.91900 103.01900 109.86700 1.000 35.77854  ? 195 TRP C CH2 1 
ATOM   8138  N N   . ILE C 1 196 ? 110.84900 105.15800 113.10100 1.000 31.90233  ? 196 ILE C N   1 
ATOM   8139  C CA  . ILE C 1 196 ? 109.53700 105.73700 112.85200 1.000 31.90233  ? 196 ILE C CA  1 
ATOM   8140  C C   . ILE C 1 196 ? 109.67200 107.14400 112.29300 1.000 31.90233  ? 196 ILE C C   1 
ATOM   8141  O O   . ILE C 1 196 ? 108.94400 107.53000 111.37800 1.000 31.90233  ? 196 ILE C O   1 
ATOM   8142  C CB  . ILE C 1 196 ? 108.70200 105.70000 114.15100 1.000 31.90233  ? 196 ILE C CB  1 
ATOM   8143  C CG1 . ILE C 1 196 ? 108.21100 104.28100 114.41700 1.000 31.90233  ? 196 ILE C CG1 1 
ATOM   8144  C CG2 . ILE C 1 196 ? 107.52200 106.63600 114.10600 1.000 31.90233  ? 196 ILE C CG2 1 
ATOM   8145  C CD1 . ILE C 1 196 ? 107.30200 103.74500 113.35300 1.000 31.90233  ? 196 ILE C CD1 1 
ATOM   8146  N N   . ARG C 1 197 ? 110.64800 107.90100 112.79300 1.000 31.49392  ? 197 ARG C N   1 
ATOM   8147  C CA  . ARG C 1 197 ? 110.89900 109.24000 112.28300 1.000 31.49392  ? 197 ARG C CA  1 
ATOM   8148  C C   . ARG C 1 197 ? 111.45000 109.24200 110.86600 1.000 31.49392  ? 197 ARG C C   1 
ATOM   8149  O O   . ARG C 1 197 ? 111.21600 110.20800 110.14200 1.000 31.49392  ? 197 ARG C O   1 
ATOM   8150  C CB  . ARG C 1 197 ? 111.86500 109.98700 113.19300 1.000 31.49392  ? 197 ARG C CB  1 
ATOM   8151  C CG  . ARG C 1 197 ? 111.25300 110.46500 114.47900 1.000 31.49392  ? 197 ARG C CG  1 
ATOM   8152  C CD  . ARG C 1 197 ? 110.00700 111.27400 114.23500 1.000 31.49392  ? 197 ARG C CD  1 
ATOM   8153  N NE  . ARG C 1 197 ? 110.27700 112.51600 113.52700 1.000 31.49392  ? 197 ARG C NE  1 
ATOM   8154  C CZ  . ARG C 1 197 ? 109.34900 113.42400 113.26500 1.000 31.49392  ? 197 ARG C CZ  1 
ATOM   8155  N NH1 . ARG C 1 197 ? 108.10400 113.22600 113.65800 1.000 31.49392  ? 197 ARG C NH1 1 
ATOM   8156  N NH2 . ARG C 1 197 ? 109.66100 114.52900 112.61500 1.000 31.49392  ? 197 ARG C NH2 1 
ATOM   8157  N N   . CYS C 1 198 ? 112.17000 108.20200 110.45000 1.000 33.21588  ? 198 CYS C N   1 
ATOM   8158  C CA  . CYS C 1 198 ? 112.59800 108.12700 109.05700 1.000 33.21588  ? 198 CYS C CA  1 
ATOM   8159  C C   . CYS C 1 198 ? 111.52500 107.56200 108.13900 1.000 33.21588  ? 198 CYS C C   1 
ATOM   8160  O O   . CYS C 1 198 ? 111.49500 107.90500 106.95500 1.000 33.21588  ? 198 CYS C O   1 
ATOM   8161  C CB  . CYS C 1 198 ? 113.87800 107.30600 108.92300 1.000 33.21588  ? 198 CYS C CB  1 
ATOM   8162  S SG  . CYS C 1 198 ? 115.26500 107.94900 109.85500 1.000 33.21588  ? 198 CYS C SG  1 
ATOM   8163  N N   . THR C 1 199 ? 110.64600 106.70000 108.64500 1.000 32.37648  ? 199 THR C N   1 
ATOM   8164  C CA  . THR C 1 199 ? 109.48900 106.27000 107.87100 1.000 32.37648  ? 199 THR C CA  1 
ATOM   8165  C C   . THR C 1 199 ? 108.51400 107.41200 107.61700 1.000 32.37648  ? 199 THR C C   1 
ATOM   8166  O O   . THR C 1 199 ? 107.88700 107.45500 106.55500 1.000 32.37648  ? 199 THR C O   1 
ATOM   8167  C CB  . THR C 1 199 ? 108.79600 105.11400 108.59500 1.000 32.37648  ? 199 THR C CB  1 
ATOM   8168  O OG1 . THR C 1 199 ? 109.77000 104.12100 108.92400 1.000 32.37648  ? 199 THR C OG1 1 
ATOM   8169  C CG2 . THR C 1 199 ? 107.74100 104.46700 107.73200 1.000 32.37648  ? 199 THR C CG2 1 
ATOM   8170  N N   . LYS C 1 200 ? 108.40500 108.36000 108.54200 1.000 32.15226  ? 200 LYS C N   1 
ATOM   8171  C CA  . LYS C 1 200 ? 107.62100 109.56100 108.29200 1.000 32.15226  ? 200 LYS C CA  1 
ATOM   8172  C C   . LYS C 1 200 ? 108.32700 110.48800 107.31500 1.000 32.15226  ? 200 LYS C C   1 
ATOM   8173  O O   . LYS C 1 200 ? 107.67300 111.22900 106.58000 1.000 32.15226  ? 200 LYS C O   1 
ATOM   8174  C CB  . LYS C 1 200 ? 107.35300 110.28200 109.60800 1.000 32.15226  ? 200 LYS C CB  1 
ATOM   8175  C CG  . LYS C 1 200 ? 106.29500 111.35600 109.55800 1.000 32.15226  ? 200 LYS C CG  1 
ATOM   8176  C CD  . LYS C 1 200 ? 106.06800 111.90400 110.94500 1.000 32.15226  ? 200 LYS C CD  1 
ATOM   8177  C CE  . LYS C 1 200 ? 105.12700 113.07700 110.92800 1.000 32.15226  ? 200 LYS C CE  1 
ATOM   8178  N NZ  . LYS C 1 200 ? 105.28900 113.91600 112.14500 1.000 32.15226  ? 200 LYS C NZ  1 
ATOM   8179  N N   . LEU C 1 201 ? 109.65800 110.46800 107.28900 1.000 30.42104  ? 201 LEU C N   1 
ATOM   8180  C CA  . LEU C 1 201 ? 110.38000 111.33300 106.36600 1.000 30.42104  ? 201 LEU C CA  1 
ATOM   8181  C C   . LEU C 1 201 ? 110.43000 110.74400 104.97000 1.000 30.42104  ? 201 LEU C C   1 
ATOM   8182  O O   . LEU C 1 201 ? 110.62700 111.47700 104.00100 1.000 30.42104  ? 201 LEU C O   1 
ATOM   8183  C CB  . LEU C 1 201 ? 111.80000 111.58600 106.86200 1.000 30.42104  ? 201 LEU C CB  1 
ATOM   8184  C CG  . LEU C 1 201 ? 112.02000 112.55000 108.02300 1.000 30.42104  ? 201 LEU C CG  1 
ATOM   8185  C CD1 . LEU C 1 201 ? 113.50000 112.81200 108.18400 1.000 30.42104  ? 201 LEU C CD1 1 
ATOM   8186  C CD2 . LEU C 1 201 ? 111.25300 113.83600 107.82800 1.000 30.42104  ? 201 LEU C CD2 1 
ATOM   8187  N N   . ILE C 1 202 ? 110.28600 109.42900 104.84400 1.000 29.30025  ? 202 ILE C N   1 
ATOM   8188  C CA  . ILE C 1 202 ? 110.29400 108.81100 103.52600 1.000 29.30025  ? 202 ILE C CA  1 
ATOM   8189  C C   . ILE C 1 202 ? 108.91500 108.90400 102.88800 1.000 29.30025  ? 202 ILE C C   1 
ATOM   8190  O O   . ILE C 1 202 ? 108.78900 109.21700 101.70000 1.000 29.30025  ? 202 ILE C O   1 
ATOM   8191  C CB  . ILE C 1 202 ? 110.79500 107.35900 103.64000 1.000 29.30025  ? 202 ILE C CB  1 
ATOM   8192  C CG1 . ILE C 1 202 ? 112.31000 107.33900 103.78700 1.000 29.30025  ? 202 ILE C CG1 1 
ATOM   8193  C CG2 . ILE C 1 202 ? 110.41300 106.53100 102.43900 1.000 29.30025  ? 202 ILE C CG2 1 
ATOM   8194  C CD1 . ILE C 1 202 ? 112.86800 105.98100 104.07200 1.000 29.30025  ? 202 ILE C CD1 1 
ATOM   8195  N N   . SER C 1 203 ? 107.86200 108.70700 103.67900 1.000 31.05959  ? 203 SER C N   1 
ATOM   8196  C CA  . SER C 1 203 ? 106.50900 108.68000 103.13600 1.000 31.05959  ? 203 SER C CA  1 
ATOM   8197  C C   . SER C 1 203 ? 106.04300 110.06100 102.70200 1.000 31.05959  ? 203 SER C C   1 
ATOM   8198  O O   . SER C 1 203 ? 105.13300 110.18300 101.87900 1.000 31.05959  ? 203 SER C O   1 
ATOM   8199  C CB  . SER C 1 203 ? 105.55500 108.10500 104.17300 1.000 31.05959  ? 203 SER C CB  1 
ATOM   8200  O OG  . SER C 1 203 ? 105.91200 106.77900 104.49800 1.000 31.05959  ? 203 SER C OG  1 
ATOM   8201  N N   . VAL C 1 204 ? 106.64800 111.11400 103.24200 1.000 29.59017  ? 204 VAL C N   1 
ATOM   8202  C CA  . VAL C 1 204 ? 106.28300 112.46700 102.83700 1.000 29.59017  ? 204 VAL C CA  1 
ATOM   8203  C C   . VAL C 1 204 ? 106.87600 112.78500 101.46900 1.000 29.59017  ? 204 VAL C C   1 
ATOM   8204  O O   . VAL C 1 204 ? 106.21100 113.36300 100.60300 1.000 29.59017  ? 204 VAL C O   1 
ATOM   8205  C CB  . VAL C 1 204 ? 106.72100 113.47600 103.91400 1.000 29.59017  ? 204 VAL C CB  1 
ATOM   8206  C CG1 . VAL C 1 204 ? 106.78200 114.88500 103.37600 1.000 29.59017  ? 204 VAL C CG1 1 
ATOM   8207  C CG2 . VAL C 1 204 ? 105.76500 113.42900 105.06700 1.000 29.59017  ? 204 VAL C CG2 1 
ATOM   8208  N N   . THR C 1 205 ? 108.11900 112.36500 101.23000 1.000 29.06809  ? 205 THR C N   1 
ATOM   8209  C CA  . THR C 1 205 ? 108.76000 112.67400 99.95700  1.000 29.06809  ? 205 THR C CA  1 
ATOM   8210  C C   . THR C 1 205 ? 108.28100 111.74800 98.84800  1.000 29.06809  ? 205 THR C C   1 
ATOM   8211  O O   . THR C 1 205 ? 108.22500 112.15000 97.68300  1.000 29.06809  ? 205 THR C O   1 
ATOM   8212  C CB  . THR C 1 205 ? 110.27100 112.59800 100.09000 1.000 29.06809  ? 205 THR C CB  1 
ATOM   8213  O OG1 . THR C 1 205 ? 110.66700 111.22900 100.19200 1.000 29.06809  ? 205 THR C OG1 1 
ATOM   8214  C CG2 . THR C 1 205 ? 110.70900 113.33200 101.31200 1.000 29.06809  ? 205 THR C CG2 1 
ATOM   8215  N N   . LEU C 1 206 ? 107.94300 110.50000 99.18300  1.000 30.83912  ? 206 LEU C N   1 
ATOM   8216  C CA  . LEU C 1 206 ? 107.35900 109.59900 98.19300  1.000 30.83912  ? 206 LEU C CA  1 
ATOM   8217  C C   . LEU C 1 206 ? 105.99000 110.08100 97.75000  1.000 30.83912  ? 206 LEU C C   1 
ATOM   8218  O O   . LEU C 1 206 ? 105.56600 109.82300 96.62200  1.000 30.83912  ? 206 LEU C O   1 
ATOM   8219  C CB  . LEU C 1 206 ? 107.23900 108.18800 98.75400  1.000 30.83912  ? 206 LEU C CB  1 
ATOM   8220  C CG  . LEU C 1 206 ? 108.46400 107.31500 98.96300  1.000 30.83912  ? 206 LEU C CG  1 
ATOM   8221  C CD1 . LEU C 1 206 ? 107.99400 106.00200 99.53900  1.000 30.83912  ? 206 LEU C CD1 1 
ATOM   8222  C CD2 . LEU C 1 206 ? 109.20800 107.09800 97.67500  1.000 30.83912  ? 206 LEU C CD2 1 
ATOM   8223  N N   . PHE C 1 207 ? 105.27500 110.77300 98.62700  1.000 31.84373  ? 207 PHE C N   1 
ATOM   8224  C CA  . PHE C 1 207 ? 104.00900 111.35000 98.21600  1.000 31.84373  ? 207 PHE C CA  1 
ATOM   8225  C C   . PHE C 1 207 ? 104.21700 112.65900 97.47400  1.000 31.84373  ? 207 PHE C C   1 
ATOM   8226  O O   . PHE C 1 207 ? 103.38500 113.04700 96.65600  1.000 31.84373  ? 207 PHE C O   1 
ATOM   8227  C CB  . PHE C 1 207 ? 103.11000 111.56100 99.42400  1.000 31.84373  ? 207 PHE C CB  1 
ATOM   8228  C CG  . PHE C 1 207 ? 101.71400 111.92600 99.06500  1.000 31.84373  ? 207 PHE C CG  1 
ATOM   8229  C CD1 . PHE C 1 207 ? 100.95600 111.08600 98.27900  1.000 31.84373  ? 207 PHE C CD1 1 
ATOM   8230  C CD2 . PHE C 1 207 ? 101.16200 113.11200 99.50100  1.000 31.84373  ? 207 PHE C CD2 1 
ATOM   8231  C CE1 . PHE C 1 207 ? 99.67600  111.41800 97.94100  1.000 31.84373  ? 207 PHE C CE1 1 
ATOM   8232  C CE2 . PHE C 1 207 ? 99.87800  113.44800 99.16400  1.000 31.84373  ? 207 PHE C CE2 1 
ATOM   8233  C CZ  . PHE C 1 207 ? 99.13500  112.59900 98.38400  1.000 31.84373  ? 207 PHE C CZ  1 
ATOM   8234  N N   . ALA C 1 208 ? 105.31700 113.36000 97.73900  1.000 30.33448  ? 208 ALA C N   1 
ATOM   8235  C CA  . ALA C 1 208 ? 105.55800 114.62200 97.04800  1.000 30.33448  ? 208 ALA C CA  1 
ATOM   8236  C C   . ALA C 1 208 ? 106.08300 114.38200 95.64100  1.000 30.33448  ? 208 ALA C C   1 
ATOM   8237  O O   . ALA C 1 208 ? 105.88400 115.20400 94.74400  1.000 30.33448  ? 208 ALA C O   1 
ATOM   8238  C CB  . ALA C 1 208 ? 106.53000 115.48100 97.84900  1.000 30.33448  ? 208 ALA C CB  1 
ATOM   8239  N N   . ILE C 1 209 ? 106.77700 113.26600 95.43600  1.000 30.13634  ? 209 ILE C N   1 
ATOM   8240  C CA  . ILE C 1 209 ? 107.22200 112.88800 94.09900  1.000 30.13634  ? 209 ILE C CA  1 
ATOM   8241  C C   . ILE C 1 209 ? 106.03500 112.43000 93.26500  1.000 30.13634  ? 209 ILE C C   1 
ATOM   8242  O O   . ILE C 1 209 ? 105.88200 112.81400 92.10100  1.000 30.13634  ? 209 ILE C O   1 
ATOM   8243  C CB  . ILE C 1 209 ? 108.30000 111.79500 94.19800  1.000 30.13634  ? 209 ILE C CB  1 
ATOM   8244  C CG1 . ILE C 1 209 ? 109.61200 112.38800 94.68300  1.000 30.13634  ? 209 ILE C CG1 1 
ATOM   8245  C CG2 . ILE C 1 209 ? 108.50700 111.08900 92.88700  1.000 30.13634  ? 209 ILE C CG2 1 
ATOM   8246  C CD1 . ILE C 1 209 ? 110.46400 111.38900 95.37800  1.000 30.13634  ? 209 ILE C CD1 1 
ATOM   8247  N N   . HIS C 1 210 ? 105.16200 111.62600 93.86600  1.000 33.97106  ? 210 HIS C N   1 
ATOM   8248  C CA  . HIS C 1 210 ? 104.02600 111.06500 93.14800  1.000 33.97106  ? 210 HIS C CA  1 
ATOM   8249  C C   . HIS C 1 210 ? 102.99400 112.13400 92.81700  1.000 33.97106  ? 210 HIS C C   1 
ATOM   8250  O O   . HIS C 1 210 ? 102.54300 112.24100 91.67400  1.000 33.97106  ? 210 HIS C O   1 
ATOM   8251  C CB  . HIS C 1 210 ? 103.40400 109.95200 93.98300  1.000 33.97106  ? 210 HIS C CB  1 
ATOM   8252  C CG  . HIS C 1 210 ? 102.26800 109.25000 93.31700  1.000 33.97106  ? 210 HIS C CG  1 
ATOM   8253  N ND1 . HIS C 1 210 ? 102.43400 108.08800 92.59800  1.000 33.97106  ? 210 HIS C ND1 1 
ATOM   8254  C CD2 . HIS C 1 210 ? 100.94700 109.53000 93.28000  1.000 33.97106  ? 210 HIS C CD2 1 
ATOM   8255  C CE1 . HIS C 1 210 ? 101.26400 107.69100 92.13400  1.000 33.97106  ? 210 HIS C CE1 1 
ATOM   8256  N NE2 . HIS C 1 210 ? 100.34600 108.55000 92.53300  1.000 33.97106  ? 210 HIS C NE2 1 
ATOM   8257  N N   . CYS C 1 211 ? 102.62000 112.95000 93.80000  1.000 35.79444  ? 211 CYS C N   1 
ATOM   8258  C CA  . CYS C 1 211 ? 101.55000 113.91700 93.59500  1.000 35.79444  ? 211 CYS C CA  1 
ATOM   8259  C C   . CYS C 1 211 ? 101.99500 115.11100 92.76200  1.000 35.79444  ? 211 CYS C C   1 
ATOM   8260  O O   . CYS C 1 211 ? 101.14700 115.88700 92.32000  1.000 35.79444  ? 211 CYS C O   1 
ATOM   8261  C CB  . CYS C 1 211 ? 101.00600 114.37000 94.95300  1.000 35.79444  ? 211 CYS C CB  1 
ATOM   8262  S SG  . CYS C 1 211 ? 99.51500  115.37500 94.97000  1.000 35.79444  ? 211 CYS C SG  1 
ATOM   8263  N N   . ALA C 1 212 ? 103.28700 115.27100 92.50400  1.000 32.45366  ? 212 ALA C N   1 
ATOM   8264  C CA  . ALA C 1 212 ? 103.74700 116.31700 91.61000  1.000 32.45366  ? 212 ALA C CA  1 
ATOM   8265  C C   . ALA C 1 212 ? 104.30300 115.78900 90.30200  1.000 32.45366  ? 212 ALA C C   1 
ATOM   8266  O O   . ALA C 1 212 ? 104.65800 116.58900 89.43400  1.000 32.45366  ? 212 ALA C O   1 
ATOM   8267  C CB  . ALA C 1 212 ? 104.80800 117.17700 92.29300  1.000 32.45366  ? 212 ALA C CB  1 
ATOM   8268  N N   . GLY C 1 213 ? 104.41500 114.47700 90.14700  1.000 35.68372  ? 213 GLY C N   1 
ATOM   8269  C CA  . GLY C 1 213 ? 104.64200 113.88100 88.85100  1.000 35.68372  ? 213 GLY C CA  1 
ATOM   8270  C C   . GLY C 1 213 ? 103.38200 113.54500 88.11800  1.000 35.68372  ? 213 GLY C C   1 
ATOM   8271  O O   . GLY C 1 213 ? 103.41600 113.27100 86.92000  1.000 35.68372  ? 213 GLY C O   1 
ATOM   8272  N N   . CYS C 1 214 ? 102.25600 113.55600 88.82100  1.000 39.06879  ? 214 CYS C N   1 
ATOM   8273  C CA  . CYS C 1 214 ? 100.95400 113.39700 88.20500  1.000 39.06879  ? 214 CYS C CA  1 
ATOM   8274  C C   . CYS C 1 214 ? 100.23800 114.71900 88.00700  1.000 39.06879  ? 214 CYS C C   1 
ATOM   8275  O O   . CYS C 1 214 ? 99.27300  114.77300 87.24500  1.000 39.06879  ? 214 CYS C O   1 
ATOM   8276  C CB  . CYS C 1 214 ? 100.08000 112.47100 89.05200  1.000 39.06879  ? 214 CYS C CB  1 
ATOM   8277  S SG  . CYS C 1 214 ? 100.77200 110.82700 89.28900  1.000 39.06879  ? 214 CYS C SG  1 
ATOM   8278  N N   . PHE C 1 215 ? 100.67700 115.78000 88.67000  1.000 39.68110  ? 215 PHE C N   1 
ATOM   8279  C CA  . PHE C 1 215 ? 100.10500 117.09500 88.43200  1.000 39.68110  ? 215 PHE C CA  1 
ATOM   8280  C C   . PHE C 1 215 ? 100.85000 117.85800 87.35400  1.000 39.68110  ? 215 PHE C C   1 
ATOM   8281  O O   . PHE C 1 215 ? 100.39300 118.92800 86.95100  1.000 39.68110  ? 215 PHE C O   1 
ATOM   8282  C CB  . PHE C 1 215 ? 100.09500 117.93600 89.71000  1.000 39.68110  ? 215 PHE C CB  1 
ATOM   8283  C CG  . PHE C 1 215 ? 99.04000  117.54000 90.71000  1.000 39.68110  ? 215 PHE C CG  1 
ATOM   8284  C CD1 . PHE C 1 215 ? 98.14200  116.51600 90.45000  1.000 39.68110  ? 215 PHE C CD1 1 
ATOM   8285  C CD2 . PHE C 1 215 ? 98.95400  118.20100 91.92200  1.000 39.68110  ? 215 PHE C CD2 1 
ATOM   8286  C CE1 . PHE C 1 215 ? 97.19200  116.15700 91.37700  1.000 39.68110  ? 215 PHE C CE1 1 
ATOM   8287  C CE2 . PHE C 1 215 ? 98.00100  117.84700 92.85300  1.000 39.68110  ? 215 PHE C CE2 1 
ATOM   8288  C CZ  . PHE C 1 215 ? 97.11900  116.82400 92.57800  1.000 39.68110  ? 215 PHE C CZ  1 
ATOM   8289  N N   . ASN C 1 216 ? 101.99100 117.34800 86.90000  1.000 39.93264  ? 216 ASN C N   1 
ATOM   8290  C CA  . ASN C 1 216 ? 102.72400 117.92300 85.78600  1.000 39.93264  ? 216 ASN C CA  1 
ATOM   8291  C C   . ASN C 1 216 ? 102.57000 117.10700 84.52000  1.000 39.93264  ? 216 ASN C C   1 
ATOM   8292  O O   . ASN C 1 216 ? 103.11200 117.48300 83.48000  1.000 39.93264  ? 216 ASN C O   1 
ATOM   8293  C CB  . ASN C 1 216 ? 104.20100 118.05900 86.13100  1.000 39.93264  ? 216 ASN C CB  1 
ATOM   8294  C CG  . ASN C 1 216 ? 104.86900 119.17300 85.36900  1.000 39.93264  ? 216 ASN C CG  1 
ATOM   8295  O OD1 . ASN C 1 216 ? 104.35700 120.28500 85.30000  1.000 39.93264  ? 216 ASN C OD1 1 
ATOM   8296  N ND2 . ASN C 1 216 ? 106.01200 118.87800 84.77500  1.000 39.93264  ? 216 ASN C ND2 1 
ATOM   8297  N N   . TYR C 1 217 ? 101.86500 115.98600 84.58600  1.000 43.09113  ? 217 TYR C N   1 
ATOM   8298  C CA  . TYR C 1 217 ? 101.40600 115.31600 83.38500  1.000 43.09113  ? 217 TYR C CA  1 
ATOM   8299  C C   . TYR C 1 217 ? 100.05900 115.83300 82.92600  1.000 43.09113  ? 217 TYR C C   1 
ATOM   8300  O O   . TYR C 1 217 ? 99.76100  115.77200 81.73400  1.000 43.09113  ? 217 TYR C O   1 
ATOM   8301  C CB  . TYR C 1 217 ? 101.31400 113.81100 83.61500  1.000 43.09113  ? 217 TYR C CB  1 
ATOM   8302  C CG  . TYR C 1 217 ? 101.14900 113.00600 82.35700  1.000 43.09113  ? 217 TYR C CG  1 
ATOM   8303  C CD1 . TYR C 1 217 ? 102.24100 112.69200 81.56800  1.000 43.09113  ? 217 TYR C CD1 1 
ATOM   8304  C CD2 . TYR C 1 217 ? 99.90200  112.55100 81.96300  1.000 43.09113  ? 217 TYR C CD2 1 
ATOM   8305  C CE1 . TYR C 1 217 ? 102.09500 111.94800 80.41900  1.000 43.09113  ? 217 TYR C CE1 1 
ATOM   8306  C CE2 . TYR C 1 217 ? 99.74500  111.80900 80.81700  1.000 43.09113  ? 217 TYR C CE2 1 
ATOM   8307  C CZ  . TYR C 1 217 ? 100.84300 111.51000 80.05000  1.000 43.09113  ? 217 TYR C CZ  1 
ATOM   8308  O OH  . TYR C 1 217 ? 100.68400 110.76700 78.90700  1.000 43.09113  ? 217 TYR C OH  1 
ATOM   8309  N N   . LEU C 1 218 ? 99.24800  116.34900 83.84600  1.000 44.24150  ? 218 LEU C N   1 
ATOM   8310  C CA  . LEU C 1 218 ? 97.97600  116.94600 83.47000  1.000 44.24150  ? 218 LEU C CA  1 
ATOM   8311  C C   . LEU C 1 218 ? 98.17200  118.26800 82.74200  1.000 44.24150  ? 218 LEU C C   1 
ATOM   8312  O O   . LEU C 1 218 ? 97.34200  118.64200 81.91100  1.000 44.24150  ? 218 LEU C O   1 
ATOM   8313  C CB  . LEU C 1 218 ? 97.11500  117.15200 84.70800  1.000 44.24150  ? 218 LEU C CB  1 
ATOM   8314  C CG  . LEU C 1 218 ? 95.63300  117.34600 84.43400  1.000 44.24150  ? 218 LEU C CG  1 
ATOM   8315  C CD1 . LEU C 1 218 ? 94.96100  116.00100 84.28500  1.000 44.24150  ? 218 LEU C CD1 1 
ATOM   8316  C CD2 . LEU C 1 218 ? 94.99200  118.17300 85.52500  1.000 44.24150  ? 218 LEU C CD2 1 
ATOM   8317  N N   . ILE C 1 219 ? 99.24800  118.99300 83.04600  1.000 42.96929  ? 219 ILE C N   1 
ATOM   8318  C CA  . ILE C 1 219 ? 99.52900  120.22900 82.32600  1.000 42.96929  ? 219 ILE C CA  1 
ATOM   8319  C C   . ILE C 1 219 ? 99.98000  119.92400 80.90500  1.000 42.96929  ? 219 ILE C C   1 
ATOM   8320  O O   . ILE C 1 219 ? 99.68300  120.68100 79.97600  1.000 42.96929  ? 219 ILE C O   1 
ATOM   8321  C CB  . ILE C 1 219 ? 100.57500 121.06400 83.08800  1.000 42.96929  ? 219 ILE C CB  1 
ATOM   8322  C CG1 . ILE C 1 219 ? 100.20800 121.16700 84.56200  1.000 42.96929  ? 219 ILE C CG1 1 
ATOM   8323  C CG2 . ILE C 1 219 ? 100.67700 122.45500 82.51200  1.000 42.96929  ? 219 ILE C CG2 1 
ATOM   8324  C CD1 . ILE C 1 219 ? 98.94900  121.94200 84.82700  1.000 42.96929  ? 219 ILE C CD1 1 
ATOM   8325  N N   . ALA C 1 220 ? 100.67700 118.81100 80.70200  1.000 45.65118  ? 220 ALA C N   1 
ATOM   8326  C CA  . ALA C 1 220 ? 101.12600 118.43700 79.36900  1.000 45.65118  ? 220 ALA C CA  1 
ATOM   8327  C C   . ALA C 1 220 ? 100.04200 117.73500 78.56700  1.000 45.65118  ? 220 ALA C C   1 
ATOM   8328  O O   . ALA C 1 220 ? 99.93400  117.95100 77.35800  1.000 45.65118  ? 220 ALA C O   1 
ATOM   8329  C CB  . ALA C 1 220 ? 102.35900 117.53900 79.45900  1.000 45.65118  ? 220 ALA C CB  1 
ATOM   8330  N N   . ASP C 1 221 ? 99.23500  116.89500 79.21300  1.000 50.26552  ? 221 ASP C N   1 
ATOM   8331  C CA  . ASP C 1 221 ? 98.21400  116.14700 78.49100  1.000 50.26552  ? 221 ASP C CA  1 
ATOM   8332  C C   . ASP C 1 221 ? 97.02400  117.00700 78.10400  1.000 50.26552  ? 221 ASP C C   1 
ATOM   8333  O O   . ASP C 1 221 ? 96.31700  116.66600 77.15200  1.000 50.26552  ? 221 ASP C O   1 
ATOM   8334  C CB  . ASP C 1 221 ? 97.73000  114.96900 79.33100  1.000 50.26552  ? 221 ASP C CB  1 
ATOM   8335  C CG  . ASP C 1 221 ? 97.38400  113.77000 78.49600  1.000 50.26552  ? 221 ASP C CG  1 
ATOM   8336  O OD1 . ASP C 1 221 ? 97.32300  113.91300 77.26100  1.000 50.26552  ? 221 ASP C OD1 1 
ATOM   8337  O OD2 . ASP C 1 221 ? 97.16800  112.68500 79.07200  1.000 50.26552  ? 221 ASP C OD2 1 
ATOM   8338  N N   . ARG C 1 222 ? 96.78100  118.10100 78.81200  1.000 51.54676  ? 222 ARG C N   1 
ATOM   8339  C CA  . ARG C 1 222 ? 95.62700  118.95500 78.57000  1.000 51.54676  ? 222 ARG C CA  1 
ATOM   8340  C C   . ARG C 1 222 ? 96.04600  120.31000 78.02000  1.000 51.54676  ? 222 ARG C C   1 
ATOM   8341  O O   . ARG C 1 222 ? 95.51800  121.34800 78.41400  1.000 51.54676  ? 222 ARG C O   1 
ATOM   8342  C CB  . ARG C 1 222 ? 94.80600  119.13300 79.84100  1.000 51.54676  ? 222 ARG C CB  1 
ATOM   8343  C CG  . ARG C 1 222 ? 94.10600  117.87400 80.30500  1.000 51.54676  ? 222 ARG C CG  1 
ATOM   8344  C CD  . ARG C 1 222 ? 93.04600  118.18700 81.34200  1.000 51.54676  ? 222 ARG C CD  1 
ATOM   8345  N NE  . ARG C 1 222 ? 91.83400  118.73900 80.74400  1.000 51.54676  ? 222 ARG C NE  1 
ATOM   8346  C CZ  . ARG C 1 222 ? 91.50000  120.02500 80.77700  1.000 51.54676  ? 222 ARG C CZ  1 
ATOM   8347  N NH1 . ARG C 1 222 ? 92.28800  120.90500 81.37900  1.000 51.54676  ? 222 ARG C NH1 1 
ATOM   8348  N NH2 . ARG C 1 222 ? 90.37600  120.43200 80.20600  1.000 51.54676  ? 222 ARG C NH2 1 
ATOM   8349  N N   . TYR C 1 223 ? 97.01300  120.31500 77.10900  1.000 54.33840  ? 223 TYR C N   1 
ATOM   8350  C CA  . TYR C 1 223 ? 97.46600  121.55100 76.49900  1.000 54.33840  ? 223 TYR C CA  1 
ATOM   8351  C C   . TYR C 1 223 ? 96.91700  121.62400 75.08600  1.000 54.33840  ? 223 TYR C C   1 
ATOM   8352  O O   . TYR C 1 223 ? 97.17300  120.70700 74.29000  1.000 54.33840  ? 223 TYR C O   1 
ATOM   8353  C CB  . TYR C 1 223 ? 98.98800  121.61900 76.49500  1.000 54.33840  ? 223 TYR C CB  1 
ATOM   8354  C CG  . TYR C 1 223 ? 99.53600  122.99000 76.20200  1.000 54.33840  ? 223 TYR C CG  1 
ATOM   8355  C CD1 . TYR C 1 223 ? 99.12100  124.08700 76.93500  1.000 54.33840  ? 223 TYR C CD1 1 
ATOM   8356  C CD2 . TYR C 1 223 ? 100.49900 123.18100 75.22800  1.000 54.33840  ? 223 TYR C CD2 1 
ATOM   8357  C CE1 . TYR C 1 223 ? 99.61500  125.34400 76.67800  1.000 54.33840  ? 223 TYR C CE1 1 
ATOM   8358  C CE2 . TYR C 1 223 ? 101.01000 124.43500 74.97400  1.000 54.33840  ? 223 TYR C CE2 1 
ATOM   8359  C CZ  . TYR C 1 223 ? 100.56000 125.51100 75.69900  1.000 54.33840  ? 223 TYR C CZ  1 
ATOM   8360  O OH  . TYR C 1 223 ? 101.05600 126.76600 75.45200  1.000 54.33840  ? 223 TYR C OH  1 
ATOM   8361  N N   . PRO C 1 224 ? 96.14900  122.66600 74.73600  1.000 59.62138  ? 224 PRO C N   1 
ATOM   8362  C CA  . PRO C 1 224 ? 95.43600  122.65400 73.44600  1.000 59.62138  ? 224 PRO C CA  1 
ATOM   8363  C C   . PRO C 1 224 ? 96.34700  122.83000 72.25100  1.000 59.62138  ? 224 PRO C C   1 
ATOM   8364  O O   . PRO C 1 224 ? 96.01200  122.39300 71.14500  1.000 59.62138  ? 224 PRO C O   1 
ATOM   8365  C CB  . PRO C 1 224 ? 94.46000  123.82700 73.58600  1.000 59.62138  ? 224 PRO C CB  1 
ATOM   8366  C CG  . PRO C 1 224 ? 95.15300  124.76200 74.52000  1.000 59.62138  ? 224 PRO C CG  1 
ATOM   8367  C CD  . PRO C 1 224 ? 95.85200  123.88200 75.51300  1.000 59.62138  ? 224 PRO C CD  1 
ATOM   8368  N N   . ASN C 1 225 ? 97.49400  123.45100 72.44900  1.000 60.58277  ? 225 ASN C N   1 
ATOM   8369  C CA  . ASN C 1 225 ? 98.49400  123.61600 71.40800  1.000 60.58277  ? 225 ASN C CA  1 
ATOM   8370  C C   . ASN C 1 225 ? 99.20100  122.27700 71.19900  1.000 60.58277  ? 225 ASN C C   1 
ATOM   8371  O O   . ASN C 1 225 ? 99.01700  121.35700 72.00600  1.000 60.58277  ? 225 ASN C O   1 
ATOM   8372  C CB  . ASN C 1 225 ? 99.45800  124.73800 71.81000  1.000 60.58277  ? 225 ASN C CB  1 
ATOM   8373  N N   . PRO C 1 226 ? 100.02400 122.10900 70.14100  1.000 61.55566  ? 226 PRO C N   1 
ATOM   8374  C CA  . PRO C 1 226 ? 100.75700 120.84300 69.98800  1.000 61.55566  ? 226 PRO C CA  1 
ATOM   8375  C C   . PRO C 1 226 ? 101.86500 120.64300 71.00800  1.000 61.55566  ? 226 PRO C C   1 
ATOM   8376  O O   . PRO C 1 226 ? 101.96700 121.37400 71.99700  1.000 61.55566  ? 226 PRO C O   1 
ATOM   8377  C CB  . PRO C 1 226 ? 101.33000 120.93800 68.56700  1.000 61.55566  ? 226 PRO C CB  1 
ATOM   8378  C CG  . PRO C 1 226 ? 101.28600 122.38400 68.23300  1.000 61.55566  ? 226 PRO C CG  1 
ATOM   8379  C CD  . PRO C 1 226 ? 100.03400 122.85800 68.87000  1.000 61.55566  ? 226 PRO C CD  1 
ATOM   8380  N N   . ARG C 1 227 ? 102.70500 119.63600 70.77500  1.000 57.92306  ? 227 ARG C N   1 
ATOM   8381  C CA  . ARG C 1 227 ? 103.71700 119.23100 71.74000  1.000 57.92306  ? 227 ARG C CA  1 
ATOM   8382  C C   . ARG C 1 227 ? 104.82600 120.26800 71.87400  1.000 57.92306  ? 227 ARG C C   1 
ATOM   8383  O O   . ARG C 1 227 ? 105.94200 120.07800 71.38300  1.000 57.92306  ? 227 ARG C O   1 
ATOM   8384  C CB  . ARG C 1 227 ? 104.30800 117.88300 71.34100  1.000 57.92306  ? 227 ARG C CB  1 
ATOM   8385  N N   . LYS C 1 228 ? 104.49700 121.37700 72.52900  1.000 51.36335  ? 228 LYS C N   1 
ATOM   8386  C CA  . LYS C 1 228 ? 105.44400 122.36300 73.03000  1.000 51.36335  ? 228 LYS C CA  1 
ATOM   8387  C C   . LYS C 1 228 ? 105.38300 122.37900 74.55000  1.000 51.36335  ? 228 LYS C C   1 
ATOM   8388  O O   . LYS C 1 228 ? 105.31100 123.43200 75.17900  1.000 51.36335  ? 228 LYS C O   1 
ATOM   8389  C CB  . LYS C 1 228 ? 105.15600 123.74800 72.46100  1.000 51.36335  ? 228 LYS C CB  1 
ATOM   8390  N N   . THR C 1 229 ? 105.34800 121.19400 75.13800  1.000 47.69835  ? 229 THR C N   1 
ATOM   8391  C CA  . THR C 1 229 ? 105.32300 120.98000 76.57200  1.000 47.69835  ? 229 THR C CA  1 
ATOM   8392  C C   . THR C 1 229 ? 106.67200 120.42700 77.02000  1.000 47.69835  ? 229 THR C C   1 
ATOM   8393  O O   . THR C 1 229 ? 107.61800 120.33500 76.23700  1.000 47.69835  ? 229 THR C O   1 
ATOM   8394  C CB  . THR C 1 229 ? 104.18300 120.03800 76.94200  1.000 47.69835  ? 229 THR C CB  1 
ATOM   8395  O OG1 . THR C 1 229 ? 104.36900 118.78900 76.27300  1.000 47.69835  ? 229 THR C OG1 1 
ATOM   8396  C CG2 . THR C 1 229 ? 102.86900 120.62300 76.50300  1.000 47.69835  ? 229 THR C CG2 1 
ATOM   8397  N N   . TRP C 1 230 ? 106.75700 120.05700 78.29800  1.000 41.76782  ? 230 TRP C N   1 
ATOM   8398  C CA  . TRP C 1 230 ? 108.02900 119.60100 78.84800  1.000 41.76782  ? 230 TRP C CA  1 
ATOM   8399  C C   . TRP C 1 230 ? 108.41200 118.22800 78.31500  1.000 41.76782  ? 230 TRP C C   1 
ATOM   8400  O O   . TRP C 1 230 ? 109.59700 117.94300 78.12300  1.000 41.76782  ? 230 TRP C O   1 
ATOM   8401  C CB  . TRP C 1 230 ? 107.97200 119.58800 80.37500  1.000 41.76782  ? 230 TRP C CB  1 
ATOM   8402  C CG  . TRP C 1 230 ? 106.96800 118.65400 80.95700  1.000 41.76782  ? 230 TRP C CG  1 
ATOM   8403  C CD1 . TRP C 1 230 ? 105.65900 118.91400 81.20300  1.000 41.76782  ? 230 TRP C CD1 1 
ATOM   8404  C CD2 . TRP C 1 230 ? 107.19600 117.31100 81.38300  1.000 41.76782  ? 230 TRP C CD2 1 
ATOM   8405  N NE1 . TRP C 1 230 ? 105.05200 117.81600 81.74700  1.000 41.76782  ? 230 TRP C NE1 1 
ATOM   8406  C CE2 . TRP C 1 230 ? 105.97800 116.81600 81.86700  1.000 41.76782  ? 230 TRP C CE2 1 
ATOM   8407  C CE3 . TRP C 1 230 ? 108.31100 116.47700 81.39400  1.000 41.76782  ? 230 TRP C CE3 1 
ATOM   8408  C CZ2 . TRP C 1 230 ? 105.84500 115.52800 82.35800  1.000 41.76782  ? 230 TRP C CZ2 1 
ATOM   8409  C CZ3 . TRP C 1 230 ? 108.17500 115.20000 81.87700  1.000 41.76782  ? 230 TRP C CZ3 1 
ATOM   8410  C CH2 . TRP C 1 230 ? 106.95500 114.73700 82.35400  1.000 41.76782  ? 230 TRP C CH2 1 
ATOM   8411  N N   . ILE C 1 231 ? 107.42800 117.37200 78.05600  1.000 46.12849  ? 231 ILE C N   1 
ATOM   8412  C CA  . ILE C 1 231 ? 107.69100 116.01100 77.60900  1.000 46.12849  ? 231 ILE C CA  1 
ATOM   8413  C C   . ILE C 1 231 ? 107.57600 115.97900 76.09200  1.000 46.12849  ? 231 ILE C C   1 
ATOM   8414  O O   . ILE C 1 231 ? 108.23900 115.18100 75.42000  1.000 46.12849  ? 231 ILE C O   1 
ATOM   8415  C CB  . ILE C 1 231 ? 106.73900 115.01500 78.30600  1.000 46.12849  ? 231 ILE C CB  1 
ATOM   8416  C CG1 . ILE C 1 231 ? 107.00200 113.57000 77.88400  1.000 46.12849  ? 231 ILE C CG1 1 
ATOM   8417  C CG2 . ILE C 1 231 ? 105.29200 115.39400 78.09900  1.000 46.12849  ? 231 ILE C CG2 1 
ATOM   8418  C CD1 . ILE C 1 231 ? 106.18800 112.56300 78.64700  1.000 46.12849  ? 231 ILE C CD1 1 
ATOM   8419  N N   . GLY C 1 232 ? 106.78600 116.89500 75.53200  1.000 49.71149  ? 232 GLY C N   1 
ATOM   8420  C CA  . GLY C 1 232 ? 106.59400 116.92500 74.09600  1.000 49.71149  ? 232 GLY C CA  1 
ATOM   8421  C C   . GLY C 1 232 ? 107.78400 117.44000 73.32100  1.000 49.71149  ? 232 GLY C C   1 
ATOM   8422  O O   . GLY C 1 232 ? 107.88200 117.18600 72.11800  1.000 49.71149  ? 232 GLY C O   1 
ATOM   8423  N N   . ALA C 1 233 ? 108.69200 118.15200 73.97700  1.000 52.07171  ? 233 ALA C N   1 
ATOM   8424  C CA  . ALA C 1 233 ? 109.85600 118.69300 73.29600  1.000 52.07171  ? 233 ALA C CA  1 
ATOM   8425  C C   . ALA C 1 233 ? 110.92100 117.64500 73.01400  1.000 52.07171  ? 233 ALA C C   1 
ATOM   8426  O O   . ALA C 1 233 ? 111.82200 117.90700 72.21300  1.000 52.07171  ? 233 ALA C O   1 
ATOM   8427  C CB  . ALA C 1 233 ? 110.46100 119.82800 74.11700  1.000 52.07171  ? 233 ALA C CB  1 
ATOM   8428  N N   . VAL C 1 234 ? 110.84900 116.47600 73.64600  1.000 52.43036  ? 234 VAL C N   1 
ATOM   8429  C CA  . VAL C 1 234 ? 111.82900 115.42100 73.41800  1.000 52.43036  ? 234 VAL C CA  1 
ATOM   8430  C C   . VAL C 1 234 ? 111.14000 114.16300 72.89100  1.000 52.43036  ? 234 VAL C C   1 
ATOM   8431  O O   . VAL C 1 234 ? 111.63300 113.52400 71.95500  1.000 52.43036  ? 234 VAL C O   1 
ATOM   8432  C CB  . VAL C 1 234 ? 112.66700 115.17700 74.69300  1.000 52.43036  ? 234 VAL C CB  1 
ATOM   8433  C CG1 . VAL C 1 234 ? 111.79700 115.00100 75.90800  1.000 52.43036  ? 234 VAL C CG1 1 
ATOM   8434  C CG2 . VAL C 1 234 ? 113.58100 113.97700 74.53100  1.000 52.43036  ? 234 VAL C CG2 1 
ATOM   8435  N N   . TYR C 1 235 ? 109.97800 113.81800 73.44400  1.000 54.07041  ? 235 TYR C N   1 
ATOM   8436  C CA  . TYR C 1 235 ? 109.13800 112.73900 72.92900  1.000 54.07041  ? 235 TYR C CA  1 
ATOM   8437  C C   . TYR C 1 235 ? 107.91900 113.40700 72.31200  1.000 54.07041  ? 235 TYR C C   1 
ATOM   8438  O O   . TYR C 1 235 ? 106.99400 113.80000 73.03500  1.000 54.07041  ? 235 TYR C O   1 
ATOM   8439  C CB  . TYR C 1 235 ? 108.74100 111.76100 74.02900  1.000 54.07041  ? 235 TYR C CB  1 
ATOM   8440  C CG  . TYR C 1 235 ? 109.91100 111.07600 74.68400  1.000 54.07041  ? 235 TYR C CG  1 
ATOM   8441  C CD1 . TYR C 1 235 ? 110.99600 110.64300 73.93700  1.000 54.07041  ? 235 TYR C CD1 1 
ATOM   8442  C CD2 . TYR C 1 235 ? 109.93400 110.86900 76.05400  1.000 54.07041  ? 235 TYR C CD2 1 
ATOM   8443  C CE1 . TYR C 1 235 ? 112.07100 110.01700 74.53800  1.000 54.07041  ? 235 TYR C CE1 1 
ATOM   8444  C CE2 . TYR C 1 235 ? 111.00100 110.24700 76.66300  1.000 54.07041  ? 235 TYR C CE2 1 
ATOM   8445  C CZ  . TYR C 1 235 ? 112.06600 109.82400 75.90300  1.000 54.07041  ? 235 TYR C CZ  1 
ATOM   8446  O OH  . TYR C 1 235 ? 113.12800 109.20400 76.51700  1.000 54.07041  ? 235 TYR C OH  1 
ATOM   8447  N N   . PRO C 1 236 ? 107.88000 113.56600 70.98800  1.000 54.14152  ? 236 PRO C N   1 
ATOM   8448  C CA  . PRO C 1 236 ? 106.87700 114.45700 70.38600  1.000 54.14152  ? 236 PRO C CA  1 
ATOM   8449  C C   . PRO C 1 236 ? 105.46000 113.92400 70.41600  1.000 54.14152  ? 236 PRO C C   1 
ATOM   8450  O O   . PRO C 1 236 ? 104.51500 114.72000 70.38200  1.000 54.14152  ? 236 PRO C O   1 
ATOM   8451  C CB  . PRO C 1 236 ? 107.38000 114.61700 68.94500  1.000 54.14152  ? 236 PRO C CB  1 
ATOM   8452  C CG  . PRO C 1 236 ? 108.80300 114.18700 68.97600  1.000 54.14152  ? 236 PRO C CG  1 
ATOM   8453  C CD  . PRO C 1 236 ? 108.86400 113.11100 69.99800  1.000 54.14152  ? 236 PRO C CD  1 
ATOM   8454  N N   . ASN C 1 237 ? 105.26700 112.60900 70.47300  1.000 57.60174  ? 237 ASN C N   1 
ATOM   8455  C CA  . ASN C 1 237 ? 103.91900 112.05500 70.48100  1.000 57.60174  ? 237 ASN C CA  1 
ATOM   8456  C C   . ASN C 1 237 ? 103.41400 111.75700 71.89000  1.000 57.60174  ? 237 ASN C C   1 
ATOM   8457  O O   . ASN C 1 237 ? 102.40600 112.32900 72.31600  1.000 57.60174  ? 237 ASN C O   1 
ATOM   8458  C CB  . ASN C 1 237 ? 103.87800 110.80100 69.59700  1.000 57.60174  ? 237 ASN C CB  1 
ATOM   8459  C CG  . ASN C 1 237 ? 105.11300 109.94400 69.74700  1.000 57.60174  ? 237 ASN C CG  1 
ATOM   8460  O OD1 . ASN C 1 237 ? 105.96600 110.21100 70.59100  1.000 57.60174  ? 237 ASN C OD1 1 
ATOM   8461  N ND2 . ASN C 1 237 ? 105.22100 108.91100 68.92200  1.000 57.60174  ? 237 ASN C ND2 1 
ATOM   8462  N N   . PHE C 1 238 ? 104.06300 110.82200 72.59600  1.000 55.58538  ? 238 PHE C N   1 
ATOM   8463  C CA  . PHE C 1 238 ? 103.87700 110.42100 73.99800  1.000 55.58538  ? 238 PHE C CA  1 
ATOM   8464  C C   . PHE C 1 238 ? 102.43700 110.11600 74.42300  1.000 55.58538  ? 238 PHE C C   1 
ATOM   8465  O O   . PHE C 1 238 ? 102.17800 109.92400 75.61300  1.000 55.58538  ? 238 PHE C O   1 
ATOM   8466  C CB  . PHE C 1 238 ? 104.53500 111.44600 74.96200  1.000 55.58538  ? 238 PHE C CB  1 
ATOM   8467  C CG  . PHE C 1 238 ? 103.78900 112.76400 75.15900  1.000 55.58538  ? 238 PHE C CG  1 
ATOM   8468  C CD1 . PHE C 1 238 ? 102.83700 112.91500 76.16000  1.000 55.58538  ? 238 PHE C CD1 1 
ATOM   8469  C CD2 . PHE C 1 238 ? 104.14400 113.88400 74.43300  1.000 55.58538  ? 238 PHE C CD2 1 
ATOM   8470  C CE1 . PHE C 1 238 ? 102.19000 114.11300 76.35300  1.000 55.58538  ? 238 PHE C CE1 1 
ATOM   8471  C CE2 . PHE C 1 238 ? 103.50100 115.08800 74.62900  1.000 55.58538  ? 238 PHE C CE2 1 
ATOM   8472  C CZ  . PHE C 1 238 ? 102.52700 115.20000 75.59100  1.000 55.58538  ? 238 PHE C CZ  1 
ATOM   8473  N N   . LYS C 1 239 ? 101.51400 109.98900 73.47700  1.000 61.43582  ? 239 LYS C N   1 
ATOM   8474  C CA  . LYS C 1 239 ? 100.09700 109.82100 73.75800  1.000 61.43582  ? 239 LYS C CA  1 
ATOM   8475  C C   . LYS C 1 239 ? 99.55900  108.70000 72.88800  1.000 61.43582  ? 239 LYS C C   1 
ATOM   8476  O O   . LYS C 1 239 ? 99.89600  108.61400 71.70200  1.000 61.43582  ? 239 LYS C O   1 
ATOM   8477  C CB  . LYS C 1 239 ? 99.30900  111.10400 73.49300  1.000 61.43582  ? 239 LYS C CB  1 
ATOM   8478  C CG  . LYS C 1 239 ? 99.68600  112.26500 74.37300  1.000 61.43582  ? 239 LYS C CG  1 
ATOM   8479  C CD  . LYS C 1 239 ? 99.26500  113.58100 73.75700  1.000 61.43582  ? 239 LYS C CD  1 
ATOM   8480  C CE  . LYS C 1 239 ? 97.79500  113.84200 73.97500  1.000 61.43582  ? 239 LYS C CE  1 
ATOM   8481  N NZ  . LYS C 1 239 ? 97.52200  115.29900 74.06400  1.000 61.43582  ? 239 LYS C NZ  1 
ATOM   8482  N N   . GLU C 1 240 ? 98.74700  107.83200 73.50600  1.000 67.66575  ? 240 GLU C N   1 
ATOM   8483  C CA  . GLU C 1 240 ? 98.26400  106.57100 72.92000  1.000 67.66575  ? 240 GLU C CA  1 
ATOM   8484  C C   . GLU C 1 240 ? 99.42200  105.68700 72.46000  1.000 67.66575  ? 240 GLU C C   1 
ATOM   8485  O O   . GLU C 1 240 ? 99.28800  104.89500 71.52300  1.000 67.66575  ? 240 GLU C O   1 
ATOM   8486  C CB  . GLU C 1 240 ? 97.27000  106.81400 71.77500  1.000 67.66575  ? 240 GLU C CB  1 
ATOM   8487  N N   . ALA C 1 241 ? 100.55500 105.81000 73.14500  1.000 65.81214  ? 241 ALA C N   1 
ATOM   8488  C CA  . ALA C 1 241 ? 101.78600 105.12800 72.80300  1.000 65.81214  ? 241 ALA C CA  1 
ATOM   8489  C C   . ALA C 1 241 ? 102.69700 105.18600 74.01900  1.000 65.81214  ? 241 ALA C C   1 
ATOM   8490  O O   . ALA C 1 241 ? 102.31200 105.68700 75.07900  1.000 65.81214  ? 241 ALA C O   1 
ATOM   8491  C CB  . ALA C 1 241 ? 102.44300 105.76100 71.57000  1.000 65.81214  ? 241 ALA C CB  1 
ATOM   8492  N N   . SER C 1 242 ? 103.92400 104.69100 73.84200  1.000 65.22039  ? 242 SER C N   1 
ATOM   8493  C CA  . SER C 1 242 ? 105.02500 104.75500 74.81500  1.000 65.22039  ? 242 SER C CA  1 
ATOM   8494  C C   . SER C 1 242 ? 104.66800 104.14700 76.17200  1.000 65.22039  ? 242 SER C C   1 
ATOM   8495  O O   . SER C 1 242 ? 105.20600 104.57200 77.19700  1.000 65.22039  ? 242 SER C O   1 
ATOM   8496  C CB  . SER C 1 242 ? 105.55800 106.18500 74.99400  1.000 65.22039  ? 242 SER C CB  1 
ATOM   8497  O OG  . SER C 1 242 ? 104.56300 107.13800 75.32200  1.000 65.22039  ? 242 SER C OG  1 
ATOM   8498  N N   . LEU C 1 243 ? 103.77800 103.14600 76.16800  1.000 60.73534  ? 243 LEU C N   1 
ATOM   8499  C CA  . LEU C 1 243 ? 103.54300 102.23000 77.29200  1.000 60.73534  ? 243 LEU C CA  1 
ATOM   8500  C C   . LEU C 1 243 ? 103.07000 102.97600 78.54600  1.000 60.73534  ? 243 LEU C C   1 
ATOM   8501  O O   . LEU C 1 243 ? 103.82400 103.19900 79.49300  1.000 60.73534  ? 243 LEU C O   1 
ATOM   8502  C CB  . LEU C 1 243 ? 104.79200 101.37700 77.56200  1.000 60.73534  ? 243 LEU C CB  1 
ATOM   8503  C CG  . LEU C 1 243 ? 104.76300 100.24500 78.59700  1.000 60.73534  ? 243 LEU C CG  1 
ATOM   8504  C CD1 . LEU C 1 243 ? 103.48900 99.42700  78.44900  1.000 60.73534  ? 243 LEU C CD1 1 
ATOM   8505  C CD2 . LEU C 1 243 ? 105.99700 99.35600  78.48000  1.000 60.73534  ? 243 LEU C CD2 1 
ATOM   8506  N N   . TRP C 1 244 ? 101.81800 103.43900 78.48700  1.000 62.38022  ? 244 TRP C N   1 
ATOM   8507  C CA  . TRP C 1 244 ? 101.13800 104.20800 79.53400  1.000 62.38022  ? 244 TRP C CA  1 
ATOM   8508  C C   . TRP C 1 244 ? 101.25100 103.68900 80.96700  1.000 62.38022  ? 244 TRP C C   1 
ATOM   8509  O O   . TRP C 1 244 ? 101.10800 104.46500 81.91500  1.000 62.38022  ? 244 TRP C O   1 
ATOM   8510  C CB  . TRP C 1 244 ? 99.65500  104.32000 79.19000  1.000 62.38022  ? 244 TRP C CB  1 
ATOM   8511  C CG  . TRP C 1 244 ? 99.27100  105.59800 78.52900  1.000 62.38022  ? 244 TRP C CG  1 
ATOM   8512  C CD1 . TRP C 1 244 ? 99.94600  106.78200 78.56800  1.000 62.38022  ? 244 TRP C CD1 1 
ATOM   8513  C CD2 . TRP C 1 244 ? 98.11500  105.81800 77.71900  1.000 62.38022  ? 244 TRP C CD2 1 
ATOM   8514  N NE1 . TRP C 1 244 ? 99.27300  107.73100 77.84100  1.000 62.38022  ? 244 TRP C NE1 1 
ATOM   8515  C CE2 . TRP C 1 244 ? 98.14600  107.16300 77.30500  1.000 62.38022  ? 244 TRP C CE2 1 
ATOM   8516  C CE3 . TRP C 1 244 ? 97.05200  105.00700 77.30300  1.000 62.38022  ? 244 TRP C CE3 1 
ATOM   8517  C CZ2 . TRP C 1 244 ? 97.15600  107.71500 76.49300  1.000 62.38022  ? 244 TRP C CZ2 1 
ATOM   8518  C CZ3 . TRP C 1 244 ? 96.07200  105.55700 76.50000  1.000 62.38022  ? 244 TRP C CZ3 1 
ATOM   8519  C CH2 . TRP C 1 244 ? 96.13100  106.89800 76.10300  1.000 62.38022  ? 244 TRP C CH2 1 
ATOM   8520  N N   . ASN C 1 245 ? 101.50100 102.39500 81.15100  1.000 59.73872  ? 245 ASN C N   1 
ATOM   8521  C CA  . ASN C 1 245 ? 101.69400 101.85900 82.49200  1.000 59.73872  ? 245 ASN C CA  1 
ATOM   8522  C C   . ASN C 1 245 ? 103.12400 102.13300 82.95300  1.000 59.73872  ? 245 ASN C C   1 
ATOM   8523  O O   . ASN C 1 245 ? 103.46500 101.89500 84.11400  1.000 59.73872  ? 245 ASN C O   1 
ATOM   8524  C CB  . ASN C 1 245 ? 101.38100 100.35500 82.52600  1.000 59.73872  ? 245 ASN C CB  1 
ATOM   8525  C CG  . ASN C 1 245 ? 101.09200 99.83500  83.93600  1.000 59.73872  ? 245 ASN C CG  1 
ATOM   8526  O OD1 . ASN C 1 245 ? 101.06700 100.59400 84.90600  1.000 59.73872  ? 245 ASN C OD1 1 
ATOM   8527  N ND2 . ASN C 1 245 ? 100.87100 98.53000  84.04500  1.000 59.73872  ? 245 ASN C ND2 1 
ATOM   8528  N N   . ARG C 1 246 ? 103.96900 102.64200 82.06100  1.000 50.17746  ? 246 ARG C N   1 
ATOM   8529  C CA  . ARG C 1 246 ? 105.30300 103.09200 82.43700  1.000 50.17746  ? 246 ARG C CA  1 
ATOM   8530  C C   . ARG C 1 246 ? 105.32400 104.60800 82.30800  1.000 50.17746  ? 246 ARG C C   1 
ATOM   8531  O O   . ARG C 1 246 ? 105.67500 105.16800 81.26500  1.000 50.17746  ? 246 ARG C O   1 
ATOM   8532  C CB  . ARG C 1 246 ? 106.36800 102.43100 81.60800  1.000 50.17746  ? 246 ARG C CB  1 
ATOM   8533  C CG  . ARG C 1 246 ? 106.50000 100.93600 81.87300  1.000 50.17746  ? 246 ARG C CG  1 
ATOM   8534  C CD  . ARG C 1 246 ? 106.43700 100.60100 83.35400  1.000 50.17746  ? 246 ARG C CD  1 
ATOM   8535  N NE  . ARG C 1 246 ? 107.73200 100.70000 84.01000  1.000 50.17746  ? 246 ARG C NE  1 
ATOM   8536  C CZ  . ARG C 1 246 ? 107.89200 100.78800 85.32500  1.000 50.17746  ? 246 ARG C CZ  1 
ATOM   8537  N NH1 . ARG C 1 246 ? 106.83900 100.79700 86.12800  1.000 50.17746  ? 246 ARG C NH1 1 
ATOM   8538  N NH2 . ARG C 1 246 ? 109.10600 100.87400 85.83800  1.000 50.17746  ? 246 ARG C NH2 1 
ATOM   8539  N N   . TYR C 1 247 ? 104.93700 105.26600 83.40200  1.000 42.39388  ? 247 TYR C N   1 
ATOM   8540  C CA  . TYR C 1 247 ? 104.96300 106.71100 83.58400  1.000 42.39388  ? 247 TYR C CA  1 
ATOM   8541  C C   . TYR C 1 247 ? 106.23700 107.17500 84.27100  1.000 42.39388  ? 247 TYR C C   1 
ATOM   8542  O O   . TYR C 1 247 ? 106.23700 108.22100 84.92500  1.000 42.39388  ? 247 TYR C O   1 
ATOM   8543  C CB  . TYR C 1 247 ? 103.72800 107.15400 84.37300  1.000 42.39388  ? 247 TYR C CB  1 
ATOM   8544  C CG  . TYR C 1 247 ? 103.71800 106.84000 85.85800  1.000 42.39388  ? 247 TYR C CG  1 
ATOM   8545  C CD1 . TYR C 1 247 ? 103.68600 105.53500 86.32300  1.000 42.39388  ? 247 TYR C CD1 1 
ATOM   8546  C CD2 . TYR C 1 247 ? 103.66200 107.86000 86.79000  1.000 42.39388  ? 247 TYR C CD2 1 
ATOM   8547  C CE1 . TYR C 1 247 ? 103.66500 105.26200 87.66900  1.000 42.39388  ? 247 TYR C CE1 1 
ATOM   8548  C CE2 . TYR C 1 247 ? 103.61900 107.58900 88.13300  1.000 42.39388  ? 247 TYR C CE2 1 
ATOM   8549  C CZ  . TYR C 1 247 ? 103.63100 106.29600 88.56400  1.000 42.39388  ? 247 TYR C CZ  1 
ATOM   8550  O OH  . TYR C 1 247 ? 103.59800 106.03900 89.90500  1.000 42.39388  ? 247 TYR C OH  1 
ATOM   8551  N N   . VAL C 1 248 ? 107.32900 106.42800 84.09500  1.000 37.64714  ? 248 VAL C N   1 
ATOM   8552  C CA  . VAL C 1 248 ? 108.61200 106.69500 84.73500  1.000 37.64714  ? 248 VAL C CA  1 
ATOM   8553  C C   . VAL C 1 248 ? 109.18500 108.03400 84.30300  1.000 37.64714  ? 248 VAL C C   1 
ATOM   8554  O O   . VAL C 1 248 ? 109.96000 108.65100 85.03900  1.000 37.64714  ? 248 VAL C O   1 
ATOM   8555  C CB  . VAL C 1 248 ? 109.57600 105.53900 84.41400  1.000 37.64714  ? 248 VAL C CB  1 
ATOM   8556  C CG1 . VAL C 1 248 ? 110.74200 105.52600 85.35300  1.000 37.64714  ? 248 VAL C CG1 1 
ATOM   8557  C CG2 . VAL C 1 248 ? 108.84600 104.23400 84.49500  1.000 37.64714  ? 248 VAL C CG2 1 
ATOM   8558  N N   . THR C 1 249 ? 108.81000 108.50800 83.11400  1.000 36.88728  ? 249 THR C N   1 
ATOM   8559  C CA  . THR C 1 249 ? 109.26300 109.80700 82.63400  1.000 36.88728  ? 249 THR C CA  1 
ATOM   8560  C C   . THR C 1 249 ? 108.71700 110.93600 83.49900  1.000 36.88728  ? 249 THR C C   1 
ATOM   8561  O O   . THR C 1 249 ? 109.41100 111.92700 83.74700  1.000 36.88728  ? 249 THR C O   1 
ATOM   8562  C CB  . THR C 1 249 ? 108.83600 109.98500 81.17900  1.000 36.88728  ? 249 THR C CB  1 
ATOM   8563  O OG1 . THR C 1 249 ? 109.27400 108.85800 80.41700  1.000 36.88728  ? 249 THR C OG1 1 
ATOM   8564  C CG2 . THR C 1 249 ? 109.45700 111.21900 80.58400  1.000 36.88728  ? 249 THR C CG2 1 
ATOM   8565  N N   . ALA C 1 250 ? 107.48900 110.79000 83.99700  1.000 34.51680  ? 250 ALA C N   1 
ATOM   8566  C CA  . ALA C 1 250 ? 106.89800 111.84300 84.81300  1.000 34.51680  ? 250 ALA C CA  1 
ATOM   8567  C C   . ALA C 1 250 ? 107.46500 111.84700 86.22300  1.000 34.51680  ? 250 ALA C C   1 
ATOM   8568  O O   . ALA C 1 250 ? 107.50400 112.89800 86.86500  1.000 34.51680  ? 250 ALA C O   1 
ATOM   8569  C CB  . ALA C 1 250 ? 105.38500 111.68900 84.85100  1.000 34.51680  ? 250 ALA C CB  1 
ATOM   8570  N N   . LEU C 1 251 ? 107.89300 110.69200 86.72700  1.000 32.46956  ? 251 LEU C N   1 
ATOM   8571  C CA  . LEU C 1 251 ? 108.60000 110.65000 88.00200  1.000 32.46956  ? 251 LEU C CA  1 
ATOM   8572  C C   . LEU C 1 251 ? 110.06100 111.03400 87.86500  1.000 32.46956  ? 251 LEU C C   1 
ATOM   8573  O O   . LEU C 1 251 ? 110.64700 111.55400 88.81600  1.000 32.46956  ? 251 LEU C O   1 
ATOM   8574  C CB  . LEU C 1 251 ? 108.47900 109.26900 88.63700  1.000 32.46956  ? 251 LEU C CB  1 
ATOM   8575  C CG  . LEU C 1 251 ? 107.52200 109.14700 89.81200  1.000 32.46956  ? 251 LEU C CG  1 
ATOM   8576  C CD1 . LEU C 1 251 ? 106.15900 109.62600 89.46200  1.000 32.46956  ? 251 LEU C CD1 1 
ATOM   8577  C CD2 . LEU C 1 251 ? 107.45800 107.70600 90.22200  1.000 32.46956  ? 251 LEU C CD2 1 
ATOM   8578  N N   . TYR C 1 252 ? 110.67100 110.78300 86.70700  1.000 32.86726  ? 252 TYR C N   1 
ATOM   8579  C CA  . TYR C 1 252 ? 112.05400 111.19300 86.50100  1.000 32.86726  ? 252 TYR C CA  1 
ATOM   8580  C C   . TYR C 1 252 ? 112.17000 112.70600 86.44900  1.000 32.86726  ? 252 TYR C C   1 
ATOM   8581  O O   . TYR C 1 252 ? 113.19000 113.26800 86.85400  1.000 32.86726  ? 252 TYR C O   1 
ATOM   8582  C CB  . TYR C 1 252 ? 112.59600 110.56600 85.22400  1.000 32.86726  ? 252 TYR C CB  1 
ATOM   8583  C CG  . TYR C 1 252 ? 113.97000 111.02200 84.81400  1.000 32.86726  ? 252 TYR C CG  1 
ATOM   8584  C CD1 . TYR C 1 252 ? 115.09400 110.54300 85.45700  1.000 32.86726  ? 252 TYR C CD1 1 
ATOM   8585  C CD2 . TYR C 1 252 ? 114.14400 111.91200 83.76300  1.000 32.86726  ? 252 TYR C CD2 1 
ATOM   8586  C CE1 . TYR C 1 252 ? 116.34500 110.94600 85.07900  1.000 32.86726  ? 252 TYR C CE1 1 
ATOM   8587  C CE2 . TYR C 1 252 ? 115.39300 112.32200 83.38300  1.000 32.86726  ? 252 TYR C CE2 1 
ATOM   8588  C CZ  . TYR C 1 252 ? 116.48700 111.83300 84.04300  1.000 32.86726  ? 252 TYR C CZ  1 
ATOM   8589  O OH  . TYR C 1 252 ? 117.73800 112.23300 83.66400  1.000 32.86726  ? 252 TYR C OH  1 
ATOM   8590  N N   . TRP C 1 253 ? 111.13200 113.38500 85.96200  1.000 32.29299  ? 253 TRP C N   1 
ATOM   8591  C CA  . TRP C 1 253 ? 111.13300 114.83800 86.01900  1.000 32.29299  ? 253 TRP C CA  1 
ATOM   8592  C C   . TRP C 1 253 ? 110.98500 115.33300 87.44900  1.000 32.29299  ? 253 TRP C C   1 
ATOM   8593  O O   . TRP C 1 253 ? 111.63200 116.30600 87.83600  1.000 32.29299  ? 253 TRP C O   1 
ATOM   8594  C CB  . TRP C 1 253 ? 110.02300 115.41300 85.14600  1.000 32.29299  ? 253 TRP C CB  1 
ATOM   8595  C CG  . TRP C 1 253 ? 109.92400 116.89400 85.26600  1.000 32.29299  ? 253 TRP C CG  1 
ATOM   8596  C CD1 . TRP C 1 253 ? 110.65500 117.81800 84.59100  1.000 32.29299  ? 253 TRP C CD1 1 
ATOM   8597  C CD2 . TRP C 1 253 ? 109.05400 117.62900 86.13200  1.000 32.29299  ? 253 TRP C CD2 1 
ATOM   8598  N NE1 . TRP C 1 253 ? 110.29400 119.08200 84.97400  1.000 32.29299  ? 253 TRP C NE1 1 
ATOM   8599  C CE2 . TRP C 1 253 ? 109.31500 118.99200 85.92600  1.000 32.29299  ? 253 TRP C CE2 1 
ATOM   8600  C CE3 . TRP C 1 253 ? 108.08900 117.26300 87.07200  1.000 32.29299  ? 253 TRP C CE3 1 
ATOM   8601  C CZ2 . TRP C 1 253 ? 108.64100 119.99000 86.61900  1.000 32.29299  ? 253 TRP C CZ2 1 
ATOM   8602  C CZ3 . TRP C 1 253 ? 107.42300 118.25400 87.75700  1.000 32.29299  ? 253 TRP C CZ3 1 
ATOM   8603  C CH2 . TRP C 1 253 ? 107.70200 119.60000 87.53000  1.000 32.29299  ? 253 TRP C CH2 1 
ATOM   8604  N N   . SER C 1 254 ? 110.14000 114.68400 88.25100  1.000 29.18533  ? 254 SER C N   1 
ATOM   8605  C CA  . SER C 1 254 ? 109.84700 115.20100 89.58400  1.000 29.18533  ? 254 SER C CA  1 
ATOM   8606  C C   . SER C 1 254 ? 110.99900 114.97000 90.54600  1.000 29.18533  ? 254 SER C C   1 
ATOM   8607  O O   . SER C 1 254 ? 111.27200 115.81100 91.40300  1.000 29.18533  ? 254 SER C O   1 
ATOM   8608  C CB  . SER C 1 254 ? 108.57600 114.57400 90.12900  1.000 29.18533  ? 254 SER C CB  1 
ATOM   8609  O OG  . SER C 1 254 ? 107.45400 115.29400 89.67600  1.000 29.18533  ? 254 SER C OG  1 
ATOM   8610  N N   . ILE C 1 255 ? 111.68600 113.83400 90.42900  1.000 28.70894  ? 255 ILE C N   1 
ATOM   8611  C CA  . ILE C 1 255 ? 112.83900 113.58900 91.28300  1.000 28.70894  ? 255 ILE C CA  1 
ATOM   8612  C C   . ILE C 1 255 ? 114.01800 114.47500 90.88800  1.000 28.70894  ? 255 ILE C C   1 
ATOM   8613  O O   . ILE C 1 255 ? 114.87800 114.76200 91.72100  1.000 28.70894  ? 255 ILE C O   1 
ATOM   8614  C CB  . ILE C 1 255 ? 113.17300 112.08100 91.25800  1.000 28.70894  ? 255 ILE C CB  1 
ATOM   8615  C CG1 . ILE C 1 255 ? 114.18100 111.69400 92.33300  1.000 28.70894  ? 255 ILE C CG1 1 
ATOM   8616  C CG2 . ILE C 1 255 ? 113.74600 111.66900 89.93900  1.000 28.70894  ? 255 ILE C CG2 1 
ATOM   8617  C CD1 . ILE C 1 255 ? 113.70200 111.85700 93.71500  1.000 28.70894  ? 255 ILE C CD1 1 
ATOM   8618  N N   . THR C 1 256 ? 114.05400 114.97900 89.65600  1.000 30.17322  ? 256 THR C N   1 
ATOM   8619  C CA  . THR C 1 256 ? 115.17200 115.80500 89.22100  1.000 30.17322  ? 256 THR C CA  1 
ATOM   8620  C C   . THR C 1 256 ? 115.08400 117.22500 89.76100  1.000 30.17322  ? 256 THR C C   1 
ATOM   8621  O O   . THR C 1 256 ? 116.11600 117.86000 89.99600  1.000 30.17322  ? 256 THR C O   1 
ATOM   8622  C CB  . THR C 1 256 ? 115.23500 115.81500 87.69700  1.000 30.17322  ? 256 THR C CB  1 
ATOM   8623  O OG1 . THR C 1 256 ? 115.06700 114.48100 87.22000  1.000 30.17322  ? 256 THR C OG1 1 
ATOM   8624  C CG2 . THR C 1 256 ? 116.56500 116.30400 87.21500  1.000 30.17322  ? 256 THR C CG2 1 
ATOM   8625  N N   . THR C 1 257 ? 113.88100 117.73800 89.99100  1.000 29.48370  ? 257 THR C N   1 
ATOM   8626  C CA  . THR C 1 257 ? 113.73800 119.07500 90.54400  1.000 29.48370  ? 257 THR C CA  1 
ATOM   8627  C C   . THR C 1 257 ? 113.54800 119.08700 92.05100  1.000 29.48370  ? 257 THR C C   1 
ATOM   8628  O O   . THR C 1 257 ? 113.88800 120.08600 92.68900  1.000 29.48370  ? 257 THR C O   1 
ATOM   8629  C CB  . THR C 1 257 ? 112.55700 119.79900 89.90400  1.000 29.48370  ? 257 THR C CB  1 
ATOM   8630  O OG1 . THR C 1 257 ? 111.36300 119.43900 90.59500  1.000 29.48370  ? 257 THR C OG1 1 
ATOM   8631  C CG2 . THR C 1 257 ? 112.41400 119.38800 88.48000  1.000 29.48370  ? 257 THR C CG2 1 
ATOM   8632  N N   . LEU C 1 258 ? 113.00800 118.01500 92.63000  1.000 28.94905  ? 258 LEU C N   1 
ATOM   8633  C CA  . LEU C 1 258 ? 112.83000 117.95700 94.07600  1.000 28.94905  ? 258 LEU C CA  1 
ATOM   8634  C C   . LEU C 1 258 ? 114.16000 117.78600 94.78800  1.000 28.94905  ? 258 LEU C C   1 
ATOM   8635  O O   . LEU C 1 258 ? 114.36400 118.34600 95.86800  1.000 28.94905  ? 258 LEU C O   1 
ATOM   8636  C CB  . LEU C 1 258 ? 111.86900 116.82600 94.43600  1.000 28.94905  ? 258 LEU C CB  1 
ATOM   8637  C CG  . LEU C 1 258 ? 111.35600 116.61900 95.85600  1.000 28.94905  ? 258 LEU C CG  1 
ATOM   8638  C CD1 . LEU C 1 258 ? 109.92500 116.17100 95.76400  1.000 28.94905  ? 258 LEU C CD1 1 
ATOM   8639  C CD2 . LEU C 1 258 ? 112.15300 115.56000 96.57700  1.000 28.94905  ? 258 LEU C CD2 1 
ATOM   8640  N N   . THR C 1 259 ? 115.07500 117.02000 94.20300  1.000 27.40164  ? 259 THR C N   1 
ATOM   8641  C CA  . THR C 1 259 ? 116.42900 116.94000 94.72600  1.000 27.40164  ? 259 THR C CA  1 
ATOM   8642  C C   . THR C 1 259 ? 117.30400 118.06900 94.24000  1.000 27.40164  ? 259 THR C C   1 
ATOM   8643  O O   . THR C 1 259 ? 118.47400 118.11100 94.62600  1.000 27.40164  ? 259 THR C O   1 
ATOM   8644  C CB  . THR C 1 259 ? 117.06700 115.61800 94.33800  1.000 27.40164  ? 259 THR C CB  1 
ATOM   8645  O OG1 . THR C 1 259 ? 117.27400 115.59500 92.92700  1.000 27.40164  ? 259 THR C OG1 1 
ATOM   8646  C CG2 . THR C 1 259 ? 116.16700 114.48700 94.71500  1.000 27.40164  ? 259 THR C CG2 1 
ATOM   8647  N N   . THR C 1 260 ? 116.75200 118.96800 93.42000  1.000 27.65550  ? 260 THR C N   1 
ATOM   8648  C CA  . THR C 1 260 ? 117.44000 120.11600 92.81800  1.000 27.65550  ? 260 THR C CA  1 
ATOM   8649  C C   . THR C 1 260 ? 118.68800 119.70100 92.05400  1.000 27.65550  ? 260 THR C C   1 
ATOM   8650  O O   . THR C 1 260 ? 119.71000 120.38600 92.10000  1.000 27.65550  ? 260 THR C O   1 
ATOM   8651  C CB  . THR C 1 260 ? 117.78900 121.19500 93.84700  1.000 27.65550  ? 260 THR C CB  1 
ATOM   8652  O OG1 . THR C 1 260 ? 118.78700 120.70800 94.74900  1.000 27.65550  ? 260 THR C OG1 1 
ATOM   8653  C CG2 . THR C 1 260 ? 116.56200 121.59800 94.63200  1.000 27.65550  ? 260 THR C CG2 1 
ATOM   8654  N N   . THR C 1 261 ? 118.62800 118.57300 91.34800  1.000 27.15385  ? 261 THR C N   1 
ATOM   8655  C CA  . THR C 1 261 ? 119.74400 118.24100 90.47000  1.000 27.15385  ? 261 THR C CA  1 
ATOM   8656  C C   . THR C 1 261 ? 119.66000 119.08900 89.21200  1.000 27.15385  ? 261 THR C C   1 
ATOM   8657  O O   . THR C 1 261 ? 120.47700 119.98800 88.99700  1.000 27.15385  ? 261 THR C O   1 
ATOM   8658  C CB  . THR C 1 261 ? 119.72700 116.75500 90.11600  1.000 27.15385  ? 261 THR C CB  1 
ATOM   8659  O OG1 . THR C 1 261 ? 119.52100 115.98300 91.29800  1.000 27.15385  ? 261 THR C OG1 1 
ATOM   8660  C CG2 . THR C 1 261 ? 121.03200 116.35800 89.49800  1.000 27.15385  ? 261 THR C CG2 1 
ATOM   8661  N N   . GLY C 1 262 ? 118.66400 118.82600 88.37900  1.000 30.91755  ? 262 GLY C N   1 
ATOM   8662  C CA  . GLY C 1 262 ? 118.33700 119.71800 87.29500  1.000 30.91755  ? 262 GLY C CA  1 
ATOM   8663  C C   . GLY C 1 262 ? 119.20000 119.37800 86.10700  1.000 30.91755  ? 262 GLY C C   1 
ATOM   8664  O O   . GLY C 1 262 ? 120.35800 119.79800 86.06200  1.000 30.91755  ? 262 GLY C O   1 
ATOM   8665  N N   . TYR C 1 263 ? 118.67300 118.65900 85.12700  1.000 34.50802  ? 263 TYR C N   1 
ATOM   8666  C CA  . TYR C 1 263 ? 119.49200 118.38500 83.95800  1.000 34.50802  ? 263 TYR C CA  1 
ATOM   8667  C C   . TYR C 1 263 ? 119.19000 119.34600 82.82600  1.000 34.50802  ? 263 TYR C C   1 
ATOM   8668  O O   . TYR C 1 263 ? 120.08800 119.70800 82.06400  1.000 34.50802  ? 263 TYR C O   1 
ATOM   8669  C CB  . TYR C 1 263 ? 119.29200 116.95400 83.47800  1.000 34.50802  ? 263 TYR C CB  1 
ATOM   8670  C CG  . TYR C 1 263 ? 119.82100 115.90100 84.40700  1.000 34.50802  ? 263 TYR C CG  1 
ATOM   8671  C CD1 . TYR C 1 263 ? 121.16800 115.82500 84.71700  1.000 34.50802  ? 263 TYR C CD1 1 
ATOM   8672  C CD2 . TYR C 1 263 ? 118.97500 114.95900 84.94100  1.000 34.50802  ? 263 TYR C CD2 1 
ATOM   8673  C CE1 . TYR C 1 263 ? 121.64200 114.84700 85.55900  1.000 34.50802  ? 263 TYR C CE1 1 
ATOM   8674  C CE2 . TYR C 1 263 ? 119.43400 113.98900 85.77600  1.000 34.50802  ? 263 TYR C CE2 1 
ATOM   8675  C CZ  . TYR C 1 263 ? 120.76100 113.93200 86.07900  1.000 34.50802  ? 263 TYR C CZ  1 
ATOM   8676  O OH  . TYR C 1 263 ? 121.18000 112.94200 86.91600  1.000 34.50802  ? 263 TYR C OH  1 
ATOM   8677  N N   . GLY C 1 264 ? 117.94000 119.76700 82.70300  1.000 38.32853  ? 264 GLY C N   1 
ATOM   8678  C CA  . GLY C 1 264 ? 117.54800 120.67600 81.65700  1.000 38.32853  ? 264 GLY C CA  1 
ATOM   8679  C C   . GLY C 1 264 ? 117.06000 120.00500 80.40100  1.000 38.32853  ? 264 GLY C C   1 
ATOM   8680  O O   . GLY C 1 264 ? 116.73600 120.70300 79.43600  1.000 38.32853  ? 264 GLY C O   1 
ATOM   8681  N N   . ASP C 1 265 ? 117.01500 118.67400 80.37600  1.000 40.05129  ? 265 ASP C N   1 
ATOM   8682  C CA  . ASP C 1 265 ? 116.42500 117.97800 79.24000  1.000 40.05129  ? 265 ASP C CA  1 
ATOM   8683  C C   . ASP C 1 265 ? 114.90300 118.03300 79.29500  1.000 40.05129  ? 265 ASP C C   1 
ATOM   8684  O O   . ASP C 1 265 ? 114.23800 118.13400 78.25800  1.000 40.05129  ? 265 ASP C O   1 
ATOM   8685  C CB  . ASP C 1 265 ? 116.94800 116.54400 79.18700  1.000 40.05129  ? 265 ASP C CB  1 
ATOM   8686  C CG  . ASP C 1 265 ? 116.86400 115.84200 80.51800  1.000 40.05129  ? 265 ASP C CG  1 
ATOM   8687  O OD1 . ASP C 1 265 ? 116.45300 116.48000 81.50300  1.000 40.05129  ? 265 ASP C OD1 1 
ATOM   8688  O OD2 . ASP C 1 265 ? 117.23500 114.65400 80.58800  1.000 40.05129  ? 265 ASP C OD2 1 
ATOM   8689  N N   . PHE C 1 266 ? 114.33500 117.98500 80.49600  1.000 39.19907  ? 266 PHE C N   1 
ATOM   8690  C CA  . PHE C 1 266 ? 112.92400 118.28200 80.71700  1.000 39.19907  ? 266 PHE C CA  1 
ATOM   8691  C C   . PHE C 1 266 ? 112.83800 119.59800 81.48000  1.000 39.19907  ? 266 PHE C C   1 
ATOM   8692  O O   . PHE C 1 266 ? 113.21800 119.66400 82.65000  1.000 39.19907  ? 266 PHE C O   1 
ATOM   8693  C CB  . PHE C 1 266 ? 112.23200 117.17700 81.50700  1.000 39.19907  ? 266 PHE C CB  1 
ATOM   8694  C CG  . PHE C 1 266 ? 112.26300 115.83300 80.85400  1.000 39.19907  ? 266 PHE C CG  1 
ATOM   8695  C CD1 . PHE C 1 266 ? 111.30600 115.47400 79.93000  1.000 39.19907  ? 266 PHE C CD1 1 
ATOM   8696  C CD2 . PHE C 1 266 ? 113.22500 114.91100 81.19800  1.000 39.19907  ? 266 PHE C CD2 1 
ATOM   8697  C CE1 . PHE C 1 266 ? 111.32200 114.23100 79.35200  1.000 39.19907  ? 266 PHE C CE1 1 
ATOM   8698  C CE2 . PHE C 1 266 ? 113.24800 113.66600 80.61300  1.000 39.19907  ? 266 PHE C CE2 1 
ATOM   8699  C CZ  . PHE C 1 266 ? 112.29600 113.33100 79.68700  1.000 39.19907  ? 266 PHE C CZ  1 
ATOM   8700  N N   . HIS C 1 267 ? 112.33600 120.64300 80.82900  1.000 40.35090  ? 267 HIS C N   1 
ATOM   8701  C CA  . HIS C 1 267 ? 112.10900 121.91300 81.49800  1.000 40.35090  ? 267 HIS C CA  1 
ATOM   8702  C C   . HIS C 1 267 ? 110.81500 122.51800 80.97800  1.000 40.35090  ? 267 HIS C C   1 
ATOM   8703  O O   . HIS C 1 267 ? 110.19300 121.99700 80.05100  1.000 40.35090  ? 267 HIS C O   1 
ATOM   8704  C CB  . HIS C 1 267 ? 113.29100 122.86700 81.30600  1.000 40.35090  ? 267 HIS C CB  1 
ATOM   8705  C CG  . HIS C 1 267 ? 113.68200 123.07400 79.87900  1.000 40.35090  ? 267 HIS C CG  1 
ATOM   8706  N ND1 . HIS C 1 267 ? 114.80100 122.49500 79.32400  1.000 40.35090  ? 267 HIS C ND1 1 
ATOM   8707  C CD2 . HIS C 1 267 ? 113.11400 123.81000 78.89700  1.000 40.35090  ? 267 HIS C CD2 1 
ATOM   8708  C CE1 . HIS C 1 267 ? 114.89900 122.85600 78.05800  1.000 40.35090  ? 267 HIS C CE1 1 
ATOM   8709  N NE2 . HIS C 1 267 ? 113.88700 123.65400 77.77400  1.000 40.35090  ? 267 HIS C NE2 1 
ATOM   8710  N N   . ALA C 1 268 ? 110.40800 123.62900 81.58000  1.000 41.14185  ? 268 ALA C N   1 
ATOM   8711  C CA  . ALA C 1 268 ? 109.15600 124.27300 81.21800  1.000 41.14185  ? 268 ALA C CA  1 
ATOM   8712  C C   . ALA C 1 268 ? 109.28500 125.01500 79.89500  1.000 41.14185  ? 268 ALA C C   1 
ATOM   8713  O O   . ALA C 1 268 ? 110.27800 125.70100 79.64400  1.000 41.14185  ? 268 ALA C O   1 
ATOM   8714  C CB  . ALA C 1 268 ? 108.72500 125.24200 82.31300  1.000 41.14185  ? 268 ALA C CB  1 
ATOM   8715  N N   . GLU C 1 269 ? 108.26600 124.88200 79.05400  1.000 44.78474  ? 269 GLU C N   1 
ATOM   8716  C CA  . GLU C 1 269 ? 108.25100 125.49900 77.73500  1.000 44.78474  ? 269 GLU C CA  1 
ATOM   8717  C C   . GLU C 1 269 ? 107.16300 126.55000 77.59200  1.000 44.78474  ? 269 GLU C C   1 
ATOM   8718  O O   . GLU C 1 269 ? 107.44200 127.66900 77.15500  1.000 44.78474  ? 269 GLU C O   1 
ATOM   8719  C CB  . GLU C 1 269 ? 108.06400 124.42300 76.66200  1.000 44.78474  ? 269 GLU C CB  1 
ATOM   8720  C CG  . GLU C 1 269 ? 109.03900 123.26600 76.74900  1.000 44.78474  ? 269 GLU C CG  1 
ATOM   8721  C CD  . GLU C 1 269 ? 110.20800 123.39900 75.80000  1.000 44.78474  ? 269 GLU C CD  1 
ATOM   8722  O OE1 . GLU C 1 269 ? 110.07400 124.10400 74.78200  1.000 44.78474  ? 269 GLU C OE1 1 
ATOM   8723  O OE2 . GLU C 1 269 ? 111.25700 122.78000 76.06000  1.000 44.78474  ? 269 GLU C OE2 1 
ATOM   8724  N N   . ASN C 1 270 ? 105.94700 126.22200 77.94100  1.000 45.69982  ? 270 ASN C N   1 
ATOM   8725  C CA  . ASN C 1 270 ? 104.79300 127.10000 77.90500  1.000 45.69982  ? 270 ASN C CA  1 
ATOM   8726  C C   . ASN C 1 270 ? 104.62400 127.82000 79.23900  1.000 45.69982  ? 270 ASN C C   1 
ATOM   8727  O O   . ASN C 1 270 ? 105.13600 127.36600 80.26200  1.000 45.69982  ? 270 ASN C O   1 
ATOM   8728  C CB  . ASN C 1 270 ? 103.55000 126.28300 77.55400  1.000 45.69982  ? 270 ASN C CB  1 
ATOM   8729  C CG  . ASN C 1 270 ? 103.42600 125.03000 78.38200  1.000 45.69982  ? 270 ASN C CG  1 
ATOM   8730  O OD1 . ASN C 1 270 ? 104.24000 124.77500 79.25800  1.000 45.69982  ? 270 ASN C OD1 1 
ATOM   8731  N ND2 . ASN C 1 270 ? 102.40900 124.23100 78.10200  1.000 45.69982  ? 270 ASN C ND2 1 
ATOM   8732  N N   . PRO C 1 271 ? 103.92600 128.96100 79.27300  1.000 43.83413  ? 271 PRO C N   1 
ATOM   8733  C CA  . PRO C 1 271 ? 103.75000 129.67600 80.54700  1.000 43.83413  ? 271 PRO C CA  1 
ATOM   8734  C C   . PRO C 1 271 ? 102.77600 129.03200 81.52400  1.000 43.83413  ? 271 PRO C C   1 
ATOM   8735  O O   . PRO C 1 271 ? 102.54600 129.60400 82.59300  1.000 43.83413  ? 271 PRO C O   1 
ATOM   8736  C CB  . PRO C 1 271 ? 103.23600 131.05100 80.10500  1.000 43.83413  ? 271 PRO C CB  1 
ATOM   8737  C CG  . PRO C 1 271 ? 103.71400 131.19600 78.72000  1.000 43.83413  ? 271 PRO C CG  1 
ATOM   8738  C CD  . PRO C 1 271 ? 103.60400 129.83300 78.13200  1.000 43.83413  ? 271 PRO C CD  1 
ATOM   8739  N N   . ARG C 1 272 ? 102.17700 127.88700 81.20600  1.000 46.38407  ? 272 ARG C N   1 
ATOM   8740  C CA  . ARG C 1 272 ? 101.45500 127.11800 82.21000  1.000 46.38407  ? 272 ARG C CA  1 
ATOM   8741  C C   . ARG C 1 272 ? 102.40200 126.30600 83.07700  1.000 46.38407  ? 272 ARG C C   1 
ATOM   8742  O O   . ARG C 1 272 ? 102.16200 126.14700 84.27500  1.000 46.38407  ? 272 ARG C O   1 
ATOM   8743  C CB  . ARG C 1 272 ? 100.45100 126.17600 81.55100  1.000 46.38407  ? 272 ARG C CB  1 
ATOM   8744  C CG  . ARG C 1 272 ? 99.29800  126.85700 80.85900  1.000 46.38407  ? 272 ARG C CG  1 
ATOM   8745  C CD  . ARG C 1 272 ? 98.28300  125.82600 80.41800  1.000 46.38407  ? 272 ARG C CD  1 
ATOM   8746  N NE  . ARG C 1 272 ? 97.32100  126.36400 79.46500  1.000 46.38407  ? 272 ARG C NE  1 
ATOM   8747  C CZ  . ARG C 1 272 ? 96.28900  125.67800 78.99200  1.000 46.38407  ? 272 ARG C CZ  1 
ATOM   8748  N NH1 . ARG C 1 272 ? 96.09000  124.43000 79.39000  1.000 46.38407  ? 272 ARG C NH1 1 
ATOM   8749  N NH2 . ARG C 1 272 ? 95.45700  126.23400 78.12500  1.000 46.38407  ? 272 ARG C NH2 1 
ATOM   8750  N N   . GLU C 1 273 ? 103.47400 125.78000 82.48900  1.000 41.63614  ? 273 GLU C N   1 
ATOM   8751  C CA  . GLU C 1 273 ? 104.43300 125.01200 83.26800  1.000 41.63614  ? 273 GLU C CA  1 
ATOM   8752  C C   . GLU C 1 273 ? 105.43000 125.91200 83.97500  1.000 41.63614  ? 273 GLU C C   1 
ATOM   8753  O O   . GLU C 1 273 ? 106.10500 125.46900 84.90700  1.000 41.63614  ? 273 GLU C O   1 
ATOM   8754  C CB  . GLU C 1 273 ? 105.16700 124.02400 82.37400  1.000 41.63614  ? 273 GLU C CB  1 
ATOM   8755  C CG  . GLU C 1 273 ? 104.33700 122.83600 81.98900  1.000 41.63614  ? 273 GLU C CG  1 
ATOM   8756  C CD  . GLU C 1 273 ? 104.86300 122.14400 80.76200  1.000 41.63614  ? 273 GLU C CD  1 
ATOM   8757  O OE1 . GLU C 1 273 ? 106.04900 122.33500 80.43700  1.000 41.63614  ? 273 GLU C OE1 1 
ATOM   8758  O OE2 . GLU C 1 273 ? 104.08800 121.41900 80.11100  1.000 41.63614  ? 273 GLU C OE2 1 
ATOM   8759  N N   . MET C 1 274 ? 105.55500 127.16300 83.54700  1.000 38.33942  ? 274 MET C N   1 
ATOM   8760  C CA  . MET C 1 274 ? 106.39500 128.09000 84.28900  1.000 38.33942  ? 274 MET C CA  1 
ATOM   8761  C C   . MET C 1 274 ? 105.72300 128.51100 85.58600  1.000 38.33942  ? 274 MET C C   1 
ATOM   8762  O O   . MET C 1 274 ? 106.40100 128.81200 86.57000  1.000 38.33942  ? 274 MET C O   1 
ATOM   8763  C CB  . MET C 1 274 ? 106.72700 129.30400 83.43200  1.000 38.33942  ? 274 MET C CB  1 
ATOM   8764  C CG  . MET C 1 274 ? 107.85200 129.06400 82.46500  1.000 38.33942  ? 274 MET C CG  1 
ATOM   8765  S SD  . MET C 1 274 ? 108.27300 130.53300 81.53800  1.000 38.33942  ? 274 MET C SD  1 
ATOM   8766  C CE  . MET C 1 274 ? 109.53400 129.87200 80.46600  1.000 38.33942  ? 274 MET C CE  1 
ATOM   8767  N N   . LEU C 1 275 ? 104.39100 128.54600 85.61100  1.000 39.71189  ? 275 LEU C N   1 
ATOM   8768  C CA  . LEU C 1 275 ? 103.69300 128.80400 86.86500  1.000 39.71189  ? 275 LEU C CA  1 
ATOM   8769  C C   . LEU C 1 275 ? 103.76700 127.60600 87.79300  1.000 39.71189  ? 275 LEU C C   1 
ATOM   8770  O O   . LEU C 1 275 ? 103.89700 127.76300 89.01000  1.000 39.71189  ? 275 LEU C O   1 
ATOM   8771  C CB  . LEU C 1 275 ? 102.23600 129.17200 86.61600  1.000 39.71189  ? 275 LEU C CB  1 
ATOM   8772  C CG  . LEU C 1 275 ? 101.95300 130.60300 86.21300  1.000 39.71189  ? 275 LEU C CG  1 
ATOM   8773  C CD1 . LEU C 1 275 ? 100.50000 130.74600 85.84500  1.000 39.71189  ? 275 LEU C CD1 1 
ATOM   8774  C CD2 . LEU C 1 275 ? 102.27500 131.47100 87.39700  1.000 39.71189  ? 275 LEU C CD2 1 
ATOM   8775  N N   . PHE C 1 276 ? 103.65900 126.39800 87.24300  1.000 38.67259  ? 276 PHE C N   1 
ATOM   8776  C CA  . PHE C 1 276 ? 103.66900 125.22500 88.10400  1.000 38.67259  ? 276 PHE C CA  1 
ATOM   8777  C C   . PHE C 1 276 ? 105.06000 124.96100 88.65000  1.000 38.67259  ? 276 PHE C C   1 
ATOM   8778  O O   . PHE C 1 276 ? 105.20600 124.48000 89.77600  1.000 38.67259  ? 276 PHE C O   1 
ATOM   8779  C CB  . PHE C 1 276 ? 103.14900 123.99900 87.36400  1.000 38.67259  ? 276 PHE C CB  1 
ATOM   8780  C CG  . PHE C 1 276 ? 103.07400 122.77500 88.22600  1.000 38.67259  ? 276 PHE C CG  1 
ATOM   8781  C CD1 . PHE C 1 276 ? 102.06400 122.63500 89.15800  1.000 38.67259  ? 276 PHE C CD1 1 
ATOM   8782  C CD2 . PHE C 1 276 ? 104.02700 121.77700 88.12500  1.000 38.67259  ? 276 PHE C CD2 1 
ATOM   8783  C CE1 . PHE C 1 276 ? 101.99800 121.52000 89.96100  1.000 38.67259  ? 276 PHE C CE1 1 
ATOM   8784  C CE2 . PHE C 1 276 ? 103.96400 120.66200 88.92800  1.000 38.67259  ? 276 PHE C CE2 1 
ATOM   8785  C CZ  . PHE C 1 276 ? 102.94900 120.53500 89.84600  1.000 38.67259  ? 276 PHE C CZ  1 
ATOM   8786  N N   . ASP C 1 277 ? 106.09700 125.27400 87.87400  1.000 38.09963  ? 277 ASP C N   1 
ATOM   8787  C CA  . ASP C 1 277 ? 107.45100 125.06900 88.36900  1.000 38.09963  ? 277 ASP C CA  1 
ATOM   8788  C C   . ASP C 1 277 ? 107.83100 126.10000 89.41400  1.000 38.09963  ? 277 ASP C C   1 
ATOM   8789  O O   . ASP C 1 277 ? 108.70100 125.83600 90.24000  1.000 38.09963  ? 277 ASP C O   1 
ATOM   8790  C CB  . ASP C 1 277 ? 108.45200 125.09800 87.22400  1.000 38.09963  ? 277 ASP C CB  1 
ATOM   8791  C CG  . ASP C 1 277 ? 108.53200 123.78000 86.50100  1.000 38.09963  ? 277 ASP C CG  1 
ATOM   8792  O OD1 . ASP C 1 277 ? 107.50100 123.08700 86.43200  1.000 38.09963  ? 277 ASP C OD1 1 
ATOM   8793  O OD2 . ASP C 1 277 ? 109.62500 123.42900 86.01100  1.000 38.09963  ? 277 ASP C OD2 1 
ATOM   8794  N N   . ILE C 1 278 ? 107.20400 127.27300 89.40200  1.000 36.46349  ? 278 ILE C N   1 
ATOM   8795  C CA  . ILE C 1 278 ? 107.47000 128.25000 90.45100  1.000 36.46349  ? 278 ILE C CA  1 
ATOM   8796  C C   . ILE C 1 278 ? 106.82600 127.80300 91.75500  1.000 36.46349  ? 278 ILE C C   1 
ATOM   8797  O O   . ILE C 1 278 ? 107.45300 127.82900 92.81800  1.000 36.46349  ? 278 ILE C O   1 
ATOM   8798  C CB  . ILE C 1 278 ? 106.99600 129.64600 90.01500  1.000 36.46349  ? 278 ILE C CB  1 
ATOM   8799  C CG1 . ILE C 1 278 ? 107.97900 130.23600 89.01900  1.000 36.46349  ? 278 ILE C CG1 1 
ATOM   8800  C CG2 . ILE C 1 278 ? 106.90400 130.58700 91.18700  1.000 36.46349  ? 278 ILE C CG2 1 
ATOM   8801  C CD1 . ILE C 1 278 ? 107.47400 131.47100 88.36400  1.000 36.46349  ? 278 ILE C CD1 1 
ATOM   8802  N N   . PHE C 1 279 ? 105.58200 127.33400 91.68800  1.000 38.15487  ? 279 PHE C N   1 
ATOM   8803  C CA  . PHE C 1 279 ? 104.90900 126.86200 92.89000  1.000 38.15487  ? 279 PHE C CA  1 
ATOM   8804  C C   . PHE C 1 279 ? 105.44500 125.52500 93.37500  1.000 38.15487  ? 279 PHE C C   1 
ATOM   8805  O O   . PHE C 1 279 ? 105.21600 125.17000 94.53200  1.000 38.15487  ? 279 PHE C O   1 
ATOM   8806  C CB  . PHE C 1 279 ? 103.40900 126.75900 92.64800  1.000 38.15487  ? 279 PHE C CB  1 
ATOM   8807  C CG  . PHE C 1 279 ? 102.74700 128.08000 92.41900  1.000 38.15487  ? 279 PHE C CG  1 
ATOM   8808  C CD1 . PHE C 1 279 ? 103.09500 129.18000 93.18100  1.000 38.15487  ? 279 PHE C CD1 1 
ATOM   8809  C CD2 . PHE C 1 279 ? 101.78300 128.22700 91.43800  1.000 38.15487  ? 279 PHE C CD2 1 
ATOM   8810  C CE1 . PHE C 1 279 ? 102.49600 130.40200 92.97000  1.000 38.15487  ? 279 PHE C CE1 1 
ATOM   8811  C CE2 . PHE C 1 279 ? 101.18000 129.44600 91.22300  1.000 38.15487  ? 279 PHE C CE2 1 
ATOM   8812  C CZ  . PHE C 1 279 ? 101.53900 130.53500 91.99100  1.000 38.15487  ? 279 PHE C CZ  1 
ATOM   8813  N N   . PHE C 1 280 ? 106.14200 124.77400 92.52700  1.000 33.59955  ? 280 PHE C N   1 
ATOM   8814  C CA  . PHE C 1 280 ? 106.75800 123.53000 92.96500  1.000 33.59955  ? 280 PHE C CA  1 
ATOM   8815  C C   . PHE C 1 280 ? 108.16600 123.74800 93.49700  1.000 33.59955  ? 280 PHE C C   1 
ATOM   8816  O O   . PHE C 1 280 ? 108.55400 123.11600 94.48100  1.000 33.59955  ? 280 PHE C O   1 
ATOM   8817  C CB  . PHE C 1 280 ? 106.78300 122.51700 91.82200  1.000 33.59955  ? 280 PHE C CB  1 
ATOM   8818  C CG  . PHE C 1 280 ? 107.22000 121.15000 92.23600  1.000 33.59955  ? 280 PHE C CG  1 
ATOM   8819  C CD1 . PHE C 1 280 ? 106.80300 120.60900 93.43400  1.000 33.59955  ? 280 PHE C CD1 1 
ATOM   8820  C CD2 . PHE C 1 280 ? 108.04500 120.40000 91.42000  1.000 33.59955  ? 280 PHE C CD2 1 
ATOM   8821  C CE1 . PHE C 1 280 ? 107.21300 119.35100 93.81700  1.000 33.59955  ? 280 PHE C CE1 1 
ATOM   8822  C CE2 . PHE C 1 280 ? 108.44600 119.14100 91.79700  1.000 33.59955  ? 280 PHE C CE2 1 
ATOM   8823  C CZ  . PHE C 1 280 ? 108.03400 118.61800 92.99300  1.000 33.59955  ? 280 PHE C CZ  1 
ATOM   8824  N N   . MET C 1 281 ? 108.94400 124.63500 92.88300  1.000 33.35361  ? 281 MET C N   1 
ATOM   8825  C CA  . MET C 1 281 ? 110.28900 124.88000 93.37900  1.000 33.35361  ? 281 MET C CA  1 
ATOM   8826  C C   . MET C 1 281 ? 110.31600 125.77400 94.60600  1.000 33.35361  ? 281 MET C C   1 
ATOM   8827  O O   . MET C 1 281 ? 111.37800 125.92400 95.21200  1.000 33.35361  ? 281 MET C O   1 
ATOM   8828  C CB  . MET C 1 281 ? 111.16600 125.48000 92.28400  1.000 33.35361  ? 281 MET C CB  1 
ATOM   8829  C CG  . MET C 1 281 ? 111.56000 124.48500 91.21900  1.000 33.35361  ? 281 MET C CG  1 
ATOM   8830  S SD  . MET C 1 281 ? 112.82000 125.09100 90.09700  1.000 33.35361  ? 281 MET C SD  1 
ATOM   8831  C CE  . MET C 1 281 ? 111.81400 125.99000 88.93600  1.000 33.35361  ? 281 MET C CE  1 
ATOM   8832  N N   . MET C 1 282 ? 109.19300 126.37800 94.98700  1.000 37.43297  ? 282 MET C N   1 
ATOM   8833  C CA  . MET C 1 282 ? 109.10300 126.97900 96.31000  1.000 37.43297  ? 282 MET C CA  1 
ATOM   8834  C C   . MET C 1 282 ? 108.70400 125.95900 97.35900  1.000 37.43297  ? 282 MET C C   1 
ATOM   8835  O O   . MET C 1 282 ? 109.02300 126.13400 98.53700  1.000 37.43297  ? 282 MET C O   1 
ATOM   8836  C CB  . MET C 1 282 ? 108.10800 128.13000 96.31100  1.000 37.43297  ? 282 MET C CB  1 
ATOM   8837  C CG  . MET C 1 282 ? 108.56600 129.32900 95.52700  1.000 37.43297  ? 282 MET C CG  1 
ATOM   8838  S SD  . MET C 1 282 ? 107.42400 130.71500 95.63700  1.000 37.43297  ? 282 MET C SD  1 
ATOM   8839  C CE  . MET C 1 282 ? 105.83800 129.88300 95.64500  1.000 37.43297  ? 282 MET C CE  1 
ATOM   8840  N N   . PHE C 1 283 ? 108.01000 124.90000 96.95500  1.000 32.86166  ? 283 PHE C N   1 
ATOM   8841  C CA  . PHE C 1 283 ? 107.72200 123.80800 97.87100  1.000 32.86166  ? 283 PHE C CA  1 
ATOM   8842  C C   . PHE C 1 283 ? 108.97400 123.00100 98.17600  1.000 32.86166  ? 283 PHE C C   1 
ATOM   8843  O O   . PHE C 1 283 ? 109.13300 122.50000 99.29100  1.000 32.86166  ? 283 PHE C O   1 
ATOM   8844  C CB  . PHE C 1 283 ? 106.63600 122.91400 97.27900  1.000 32.86166  ? 283 PHE C CB  1 
ATOM   8845  C CG  . PHE C 1 283 ? 106.29800 121.72600 98.12100  1.000 32.86166  ? 283 PHE C CG  1 
ATOM   8846  C CD1 . PHE C 1 283 ? 105.51400 121.86500 99.24800  1.000 32.86166  ? 283 PHE C CD1 1 
ATOM   8847  C CD2 . PHE C 1 283 ? 106.75000 120.46500 97.77800  1.000 32.86166  ? 283 PHE C CD2 1 
ATOM   8848  C CE1 . PHE C 1 283 ? 105.19800 120.77500 100.02300 1.000 32.86166  ? 283 PHE C CE1 1 
ATOM   8849  C CE2 . PHE C 1 283 ? 106.43800 119.37300 98.55200  1.000 32.86166  ? 283 PHE C CE2 1 
ATOM   8850  C CZ  . PHE C 1 283 ? 105.66200 119.53000 99.67400  1.000 32.86166  ? 283 PHE C CZ  1 
ATOM   8851  N N   . ASN C 1 284 ? 109.88000 122.87200 97.20800  1.000 32.18993  ? 284 ASN C N   1 
ATOM   8852  C CA  . ASN C 1 284 ? 111.07200 122.06100 97.42300  1.000 32.18993  ? 284 ASN C CA  1 
ATOM   8853  C C   . ASN C 1 284 ? 112.11800 122.79000 98.24700  1.000 32.18993  ? 284 ASN C C   1 
ATOM   8854  O O   . ASN C 1 284 ? 113.03500 122.15400 98.76900  1.000 32.18993  ? 284 ASN C O   1 
ATOM   8855  C CB  . ASN C 1 284 ? 111.67000 121.63700 96.09300  1.000 32.18993  ? 284 ASN C CB  1 
ATOM   8856  C CG  . ASN C 1 284 ? 110.69200 120.89600 95.24300  1.000 32.18993  ? 284 ASN C CG  1 
ATOM   8857  O OD1 . ASN C 1 284 ? 110.63400 121.09300 94.03700  1.000 32.18993  ? 284 ASN C OD1 1 
ATOM   8858  N ND2 . ASN C 1 284 ? 109.90200 120.03800 95.86600  1.000 32.18993  ? 284 ASN C ND2 1 
ATOM   8859  N N   . LEU C 1 285 ? 112.02600 124.11300 98.35400  1.000 30.74618  ? 285 LEU C N   1 
ATOM   8860  C CA  . LEU C 1 285 ? 112.83100 124.81600 99.34400  1.000 30.74618  ? 285 LEU C CA  1 
ATOM   8861  C C   . LEU C 1 285 ? 112.37000 124.46800 100.74900 1.000 30.74618  ? 285 LEU C C   1 
ATOM   8862  O O   . LEU C 1 285 ? 113.18500 124.23400 101.64500 1.000 30.74618  ? 285 LEU C O   1 
ATOM   8863  C CB  . LEU C 1 285 ? 112.75500 126.32200 99.12600  1.000 30.74618  ? 285 LEU C CB  1 
ATOM   8864  C CG  . LEU C 1 285 ? 113.90800 127.00900 98.41800  1.000 30.74618  ? 285 LEU C CG  1 
ATOM   8865  C CD1 . LEU C 1 285 ? 113.51200 128.42700 98.12400  1.000 30.74618  ? 285 LEU C CD1 1 
ATOM   8866  C CD2 . LEU C 1 285 ? 115.13600 126.97600 99.28200  1.000 30.74618  ? 285 LEU C CD2 1 
ATOM   8867  N N   . GLY C 1 286 ? 111.05600 124.43000 100.96100 1.000 31.07779  ? 286 GLY C N   1 
ATOM   8868  C CA  . GLY C 1 286 ? 110.54100 124.10200 102.27300 1.000 31.07779  ? 286 GLY C CA  1 
ATOM   8869  C C   . GLY C 1 286 ? 110.61900 122.62800 102.59300 1.000 31.07779  ? 286 GLY C C   1 
ATOM   8870  O O   . GLY C 1 286 ? 110.58100 122.24400 103.76200 1.000 31.07779  ? 286 GLY C O   1 
ATOM   8871  N N   . LEU C 1 287 ? 110.72400 121.78200 101.57100 1.000 30.88401  ? 287 LEU C N   1 
ATOM   8872  C CA  . LEU C 1 287 ? 110.79100 120.34700 101.81500 1.000 30.88401  ? 287 LEU C CA  1 
ATOM   8873  C C   . LEU C 1 287 ? 112.19800 119.92000 102.20200 1.000 30.88401  ? 287 LEU C C   1 
ATOM   8874  O O   . LEU C 1 287 ? 112.38600 119.20900 103.19300 1.000 30.88401  ? 287 LEU C O   1 
ATOM   8875  C CB  . LEU C 1 287 ? 110.31900 119.57700 100.58800 1.000 30.88401  ? 287 LEU C CB  1 
ATOM   8876  C CG  . LEU C 1 287 ? 110.07200 118.09000 100.82600 1.000 30.88401  ? 287 LEU C CG  1 
ATOM   8877  C CD1 . LEU C 1 287 ? 108.78300 117.89400 101.58100 1.000 30.88401  ? 287 LEU C CD1 1 
ATOM   8878  C CD2 . LEU C 1 287 ? 110.04200 117.33200 99.51900  1.000 30.88401  ? 287 LEU C CD2 1 
ATOM   8879  N N   . THR C 1 288 ? 113.20600 120.34200 101.43800 1.000 29.68847  ? 288 THR C N   1 
ATOM   8880  C CA  . THR C 1 288 ? 114.56200 119.89000 101.72600 1.000 29.68847  ? 288 THR C CA  1 
ATOM   8881  C C   . THR C 1 288 ? 115.17400 120.63200 102.90200 1.000 29.68847  ? 288 THR C C   1 
ATOM   8882  O O   . THR C 1 288 ? 116.19500 120.19400 103.43300 1.000 29.68847  ? 288 THR C O   1 
ATOM   8883  C CB  . THR C 1 288 ? 115.45900 120.03600 100.50500 1.000 29.68847  ? 288 THR C CB  1 
ATOM   8884  O OG1 . THR C 1 288 ? 115.71400 121.42200 100.26700 1.000 29.68847  ? 288 THR C OG1 1 
ATOM   8885  C CG2 . THR C 1 288 ? 114.81400 119.40700 99.28400  1.000 29.68847  ? 288 THR C CG2 1 
ATOM   8886  N N   . ALA C 1 289 ? 114.58800 121.75100 103.31900 1.000 28.82903  ? 289 ALA C N   1 
ATOM   8887  C CA  . ALA C 1 289 ? 114.99800 122.35000 104.58100 1.000 28.82903  ? 289 ALA C CA  1 
ATOM   8888  C C   . ALA C 1 289 ? 114.30400 121.70700 105.76500 1.000 28.82903  ? 289 ALA C C   1 
ATOM   8889  O O   . ALA C 1 289 ? 114.67000 121.99200 106.90700 1.000 28.82903  ? 289 ALA C O   1 
ATOM   8890  C CB  . ALA C 1 289 ? 114.72100 123.84800 104.58200 1.000 28.82903  ? 289 ALA C CB  1 
ATOM   8891  N N   . TYR C 1 290 ? 113.31500 120.85800 105.51700 1.000 29.02261  ? 290 TYR C N   1 
ATOM   8892  C CA  . TYR C 1 290 ? 112.62400 120.09900 106.54400 1.000 29.02261  ? 290 TYR C CA  1 
ATOM   8893  C C   . TYR C 1 290 ? 113.22300 118.71000 106.70300 1.000 29.02261  ? 290 TYR C C   1 
ATOM   8894  O O   . TYR C 1 290 ? 113.21300 118.15900 107.80300 1.000 29.02261  ? 290 TYR C O   1 
ATOM   8895  C CB  . TYR C 1 290 ? 111.13300 120.02600 106.19900 1.000 29.02261  ? 290 TYR C CB  1 
ATOM   8896  C CG  . TYR C 1 290 ? 110.32900 118.94700 106.88200 1.000 29.02261  ? 290 TYR C CG  1 
ATOM   8897  C CD1 . TYR C 1 290 ? 109.82900 119.13300 108.16000 1.000 29.02261  ? 290 TYR C CD1 1 
ATOM   8898  C CD2 . TYR C 1 290 ? 110.02900 117.76000 106.22800 1.000 29.02261  ? 290 TYR C CD2 1 
ATOM   8899  C CE1 . TYR C 1 290 ? 109.07800 118.15600 108.77600 1.000 29.02261  ? 290 TYR C CE1 1 
ATOM   8900  C CE2 . TYR C 1 290 ? 109.28900 116.78000 106.83900 1.000 29.02261  ? 290 TYR C CE2 1 
ATOM   8901  C CZ  . TYR C 1 290 ? 108.81700 116.98200 108.11000 1.000 29.02261  ? 290 TYR C CZ  1 
ATOM   8902  O OH  . TYR C 1 290 ? 108.07200 116.00000 108.71400 1.000 29.02261  ? 290 TYR C OH  1 
ATOM   8903  N N   . LEU C 1 291 ? 113.75400 118.13000 105.62700 1.000 27.96819  ? 291 LEU C N   1 
ATOM   8904  C CA  . LEU C 1 291 ? 114.41600 116.83600 105.74900 1.000 27.96819  ? 291 LEU C CA  1 
ATOM   8905  C C   . LEU C 1 291 ? 115.80300 116.98400 106.34700 1.000 27.96819  ? 291 LEU C C   1 
ATOM   8906  O O   . LEU C 1 291 ? 116.24400 116.13300 107.12600 1.000 27.96819  ? 291 LEU C O   1 
ATOM   8907  C CB  . LEU C 1 291 ? 114.51500 116.15400 104.39000 1.000 27.96819  ? 291 LEU C CB  1 
ATOM   8908  C CG  . LEU C 1 291 ? 113.26500 116.03500 103.53500 1.000 27.96819  ? 291 LEU C CG  1 
ATOM   8909  C CD1 . LEU C 1 291 ? 113.65400 115.46100 102.20500 1.000 27.96819  ? 291 LEU C CD1 1 
ATOM   8910  C CD2 . LEU C 1 291 ? 112.24600 115.16700 104.21200 1.000 27.96819  ? 291 LEU C CD2 1 
ATOM   8911  N N   . ILE C 1 292 ? 116.51700 118.04600 105.97600 1.000 27.10106  ? 292 ILE C N   1 
ATOM   8912  C CA  . ILE C 1 292 ? 117.85100 118.27400 106.51500 1.000 27.10106  ? 292 ILE C CA  1 
ATOM   8913  C C   . ILE C 1 292 ? 117.76800 118.67500 107.98000 1.000 27.10106  ? 292 ILE C C   1 
ATOM   8914  O O   . ILE C 1 292 ? 118.55800 118.21200 108.80800 1.000 27.10106  ? 292 ILE C O   1 
ATOM   8915  C CB  . ILE C 1 292 ? 118.58400 119.32400 105.66200 1.000 27.10106  ? 292 ILE C CB  1 
ATOM   8916  C CG1 . ILE C 1 292 ? 118.98000 118.73000 104.31700 1.000 27.10106  ? 292 ILE C CG1 1 
ATOM   8917  C CG2 . ILE C 1 292 ? 119.82500 119.81600 106.33900 1.000 27.10106  ? 292 ILE C CG2 1 
ATOM   8918  C CD1 . ILE C 1 292 ? 119.59700 119.72800 103.38200 1.000 27.10106  ? 292 ILE C CD1 1 
ATOM   8919  N N   . GLY C 1 293 ? 116.77500 119.49100 108.33400 1.000 26.70483  ? 293 GLY C N   1 
ATOM   8920  C CA  . GLY C 1 293 ? 116.60200 119.87900 109.72400 1.000 26.70483  ? 293 GLY C CA  1 
ATOM   8921  C C   . GLY C 1 293 ? 116.12700 118.74100 110.60500 1.000 26.70483  ? 293 GLY C C   1 
ATOM   8922  O O   . GLY C 1 293 ? 116.36000 118.74500 111.81300 1.000 26.70483  ? 293 GLY C O   1 
ATOM   8923  N N   . ASN C 1 294 ? 115.45600 117.75200 110.01600 1.000 28.17612  ? 294 ASN C N   1 
ATOM   8924  C CA  . ASN C 1 294 ? 115.01000 116.60000 110.79300 1.000 28.17612  ? 294 ASN C CA  1 
ATOM   8925  C C   . ASN C 1 294 ? 116.10500 115.55500 110.92500 1.000 28.17612  ? 294 ASN C C   1 
ATOM   8926  O O   . ASN C 1 294 ? 116.22500 114.90500 111.96600 1.000 28.17612  ? 294 ASN C O   1 
ATOM   8927  C CB  . ASN C 1 294 ? 113.76400 115.98800 110.17100 1.000 28.17612  ? 294 ASN C CB  1 
ATOM   8928  C CG  . ASN C 1 294 ? 112.50500 116.51500 110.78600 1.000 28.17612  ? 294 ASN C CG  1 
ATOM   8929  O OD1 . ASN C 1 294 ? 111.79500 117.30700 110.19000 1.000 28.17612  ? 294 ASN C OD1 1 
ATOM   8930  N ND2 . ASN C 1 294 ? 112.21100 116.06400 111.98800 1.000 28.17612  ? 294 ASN C ND2 1 
ATOM   8931  N N   . MET C 1 295 ? 116.90700 115.36200 109.87900 1.000 28.09929  ? 295 MET C N   1 
ATOM   8932  C CA  . MET C 1 295 ? 118.01400 114.42300 109.99600 1.000 28.09929  ? 295 MET C CA  1 
ATOM   8933  C C   . MET C 1 295 ? 119.13600 114.98500 110.85600 1.000 28.09929  ? 295 MET C C   1 
ATOM   8934  O O   . MET C 1 295 ? 119.89900 114.21900 111.44900 1.000 28.09929  ? 295 MET C O   1 
ATOM   8935  C CB  . MET C 1 295 ? 118.53600 114.04100 108.61700 1.000 28.09929  ? 295 MET C CB  1 
ATOM   8936  C CG  . MET C 1 295 ? 119.29400 112.72400 108.59100 1.000 28.09929  ? 295 MET C CG  1 
ATOM   8937  S SD  . MET C 1 295 ? 118.24800 111.27700 108.78600 1.000 28.09929  ? 295 MET C SD  1 
ATOM   8938  C CE  . MET C 1 295 ? 117.73400 110.99900 107.09400 1.000 28.09929  ? 295 MET C CE  1 
ATOM   8939  N N   . THR C 1 296 ? 119.25200 116.30800 110.94400 1.000 27.19962  ? 296 THR C N   1 
ATOM   8940  C CA  . THR C 1 296 ? 120.17900 116.91200 111.89500 1.000 27.19962  ? 296 THR C CA  1 
ATOM   8941  C C   . THR C 1 296 ? 119.71500 116.66900 113.32200 1.000 27.19962  ? 296 THR C C   1 
ATOM   8942  O O   . THR C 1 296 ? 120.52900 116.47300 114.22900 1.000 27.19962  ? 296 THR C O   1 
ATOM   8943  C CB  . THR C 1 296 ? 120.30300 118.40500 111.61900 1.000 27.19962  ? 296 THR C CB  1 
ATOM   8944  O OG1 . THR C 1 296 ? 120.55200 118.60700 110.22700 1.000 27.19962  ? 296 THR C OG1 1 
ATOM   8945  C CG2 . THR C 1 296 ? 121.43500 119.00500 112.39700 1.000 27.19962  ? 296 THR C CG2 1 
ATOM   8946  N N   . ASN C 1 297 ? 118.40200 116.66400 113.53600 1.000 29.16903  ? 297 ASN C N   1 
ATOM   8947  C CA  . ASN C 1 297 ? 117.85000 116.34600 114.84600 1.000 29.16903  ? 297 ASN C CA  1 
ATOM   8948  C C   . ASN C 1 297 ? 118.03600 114.87200 115.17900 1.000 29.16903  ? 297 ASN C C   1 
ATOM   8949  O O   . ASN C 1 297 ? 118.14400 114.50100 116.35000 1.000 29.16903  ? 297 ASN C O   1 
ATOM   8950  C CB  . ASN C 1 297 ? 116.37000 116.72900 114.87300 1.000 29.16903  ? 297 ASN C CB  1 
ATOM   8951  C CG  . ASN C 1 297 ? 115.72000 116.47200 116.20700 1.000 29.16903  ? 297 ASN C CG  1 
ATOM   8952  O OD1 . ASN C 1 297 ? 116.28300 116.78400 117.25200 1.000 29.16903  ? 297 ASN C OD1 1 
ATOM   8953  N ND2 . ASN C 1 297 ? 114.52200 115.90300 116.18000 1.000 29.16903  ? 297 ASN C ND2 1 
ATOM   8954  N N   . LEU C 1 298 ? 118.08900 114.01600 114.15900 1.000 28.66072  ? 298 LEU C N   1 
ATOM   8955  C CA  . LEU C 1 298 ? 118.22200 112.58600 114.40500 1.000 28.66072  ? 298 LEU C CA  1 
ATOM   8956  C C   . LEU C 1 298 ? 119.67200 112.18800 114.63000 1.000 28.66072  ? 298 LEU C C   1 
ATOM   8957  O O   . LEU C 1 298 ? 119.95000 111.27700 115.41400 1.000 28.66072  ? 298 LEU C O   1 
ATOM   8958  C CB  . LEU C 1 298 ? 117.63200 111.79600 113.24400 1.000 28.66072  ? 298 LEU C CB  1 
ATOM   8959  C CG  . LEU C 1 298 ? 116.11500 111.67000 113.24900 1.000 28.66072  ? 298 LEU C CG  1 
ATOM   8960  C CD1 . LEU C 1 298 ? 115.66600 110.89500 112.04400 1.000 28.66072  ? 298 LEU C CD1 1 
ATOM   8961  C CD2 . LEU C 1 298 ? 115.65300 110.99800 114.51700 1.000 28.66072  ? 298 LEU C CD2 1 
ATOM   8962  N N   . VAL C 1 299 ? 120.60700 112.84400 113.94100 1.000 28.14833  ? 299 VAL C N   1 
ATOM   8963  C CA  . VAL C 1 299 ? 122.02600 112.55800 114.13600 1.000 28.14833  ? 299 VAL C CA  1 
ATOM   8964  C C   . VAL C 1 299 ? 122.47700 113.00900 115.51700 1.000 28.14833  ? 299 VAL C C   1 
ATOM   8965  O O   . VAL C 1 299 ? 123.27700 112.33500 116.17600 1.000 28.14833  ? 299 VAL C O   1 
ATOM   8966  C CB  . VAL C 1 299 ? 122.84100 113.20200 113.00200 1.000 28.14833  ? 299 VAL C CB  1 
ATOM   8967  C CG1 . VAL C 1 299 ? 124.30900 113.21000 113.30400 1.000 28.14833  ? 299 VAL C CG1 1 
ATOM   8968  C CG2 . VAL C 1 299 ? 122.62000 112.42700 111.73500 1.000 28.14833  ? 299 VAL C CG2 1 
ATOM   8969  N N   . VAL C 1 300 ? 121.92700 114.11900 116.00400 1.000 29.28494  ? 300 VAL C N   1 
ATOM   8970  C CA  . VAL C 1 300 ? 122.19800 114.55000 117.37100 1.000 29.28494  ? 300 VAL C CA  1 
ATOM   8971  C C   . VAL C 1 300 ? 121.60100 113.56300 118.37300 1.000 29.28494  ? 300 VAL C C   1 
ATOM   8972  O O   . VAL C 1 300 ? 122.22500 113.23500 119.38600 1.000 29.28494  ? 300 VAL C O   1 
ATOM   8973  C CB  . VAL C 1 300 ? 121.68200 115.98700 117.56800 1.000 29.28494  ? 300 VAL C CB  1 
ATOM   8974  C CG1 . VAL C 1 300 ? 121.61500 116.37400 119.03000 1.000 29.28494  ? 300 VAL C CG1 1 
ATOM   8975  C CG2 . VAL C 1 300 ? 122.57300 116.95500 116.81100 1.000 29.28494  ? 300 VAL C CG2 1 
ATOM   8976  N N   . HIS C 1 301 ? 120.42300 113.01300 118.07300 1.000 32.44375  ? 301 HIS C N   1 
ATOM   8977  C CA  . HIS C 1 301 ? 119.87600 111.95200 118.91700 1.000 32.44375  ? 301 HIS C CA  1 
ATOM   8978  C C   . HIS C 1 301 ? 120.61500 110.63100 118.72000 1.000 32.44375  ? 301 HIS C C   1 
ATOM   8979  O O   . HIS C 1 301 ? 120.61500 109.78800 119.61900 1.000 32.44375  ? 301 HIS C O   1 
ATOM   8980  C CB  . HIS C 1 301 ? 118.38500 111.77100 118.63100 1.000 32.44375  ? 301 HIS C CB  1 
ATOM   8981  C CG  . HIS C 1 301 ? 117.63200 111.07700 119.72400 1.000 32.44375  ? 301 HIS C CG  1 
ATOM   8982  N ND1 . HIS C 1 301 ? 116.71100 110.08200 119.47900 1.000 32.44375  ? 301 HIS C ND1 1 
ATOM   8983  C CD2 . HIS C 1 301 ? 117.64100 111.25300 121.06600 1.000 32.44375  ? 301 HIS C CD2 1 
ATOM   8984  C CE1 . HIS C 1 301 ? 116.20100 109.66000 120.62100 1.000 32.44375  ? 301 HIS C CE1 1 
ATOM   8985  N NE2 . HIS C 1 301 ? 116.74600 110.35700 121.60000 1.000 32.44375  ? 301 HIS C NE2 1 
ATOM   8986  N N   . TRP C 1 302 ? 121.22900 110.42700 117.55000 1.000 34.59047  ? 302 TRP C N   1 
ATOM   8987  C CA  . TRP C 1 302 ? 122.04300 109.23600 117.31300 1.000 34.59047  ? 302 TRP C CA  1 
ATOM   8988  C C   . TRP C 1 302 ? 123.29100 109.25200 118.18000 1.000 34.59047  ? 302 TRP C C   1 
ATOM   8989  O O   . TRP C 1 302 ? 123.51400 108.35500 118.99800 1.000 34.59047  ? 302 TRP C O   1 
ATOM   8990  C CB  . TRP C 1 302 ? 122.46700 109.15600 115.84300 1.000 34.59047  ? 302 TRP C CB  1 
ATOM   8991  C CG  . TRP C 1 302 ? 121.63900 108.32400 114.90800 1.000 34.59047  ? 302 TRP C CG  1 
ATOM   8992  C CD1 . TRP C 1 302 ? 120.94700 108.77100 113.81700 1.000 34.59047  ? 302 TRP C CD1 1 
ATOM   8993  C CD2 . TRP C 1 302 ? 121.46300 106.90400 114.93500 1.000 34.59047  ? 302 TRP C CD2 1 
ATOM   8994  N NE1 . TRP C 1 302 ? 120.33000 107.72300 113.18300 1.000 34.59047  ? 302 TRP C NE1 1 
ATOM   8995  C CE2 . TRP C 1 302 ? 120.63400 106.56500 113.84800 1.000 34.59047  ? 302 TRP C CE2 1 
ATOM   8996  C CE3 . TRP C 1 302 ? 121.91400 105.88800 115.77800 1.000 34.59047  ? 302 TRP C CE3 1 
ATOM   8997  C CZ2 . TRP C 1 302 ? 120.24900 105.25200 113.58500 1.000 34.59047  ? 302 TRP C CZ2 1 
ATOM   8998  C CZ3 . TRP C 1 302 ? 121.52600 104.58700 115.51500 1.000 34.59047  ? 302 TRP C CZ3 1 
ATOM   8999  C CH2 . TRP C 1 302 ? 120.70500 104.28200 114.42900 1.000 34.59047  ? 302 TRP C CH2 1 
ATOM   9000  N N   . THR C 1 303 ? 124.11600 110.28100 118.01400 1.000 32.01877  ? 303 THR C N   1 
ATOM   9001  C CA  . THR C 1 303 ? 125.48800 110.30400 118.50400 1.000 32.01877  ? 303 THR C CA  1 
ATOM   9002  C C   . THR C 1 303 ? 125.67300 111.27400 119.66200 1.000 32.01877  ? 303 THR C C   1 
ATOM   9003  O O   . THR C 1 303 ? 126.66200 111.99700 119.71800 1.000 32.01877  ? 303 THR C O   1 
ATOM   9004  C CB  . THR C 1 303 ? 126.45300 110.67800 117.38600 1.000 32.01877  ? 303 THR C CB  1 
ATOM   9005  O OG1 . THR C 1 303 ? 126.23700 112.04200 117.01800 1.000 32.01877  ? 303 THR C OG1 1 
ATOM   9006  C CG2 . THR C 1 303 ? 126.21300 109.81500 116.17500 1.000 32.01877  ? 303 THR C CG2 1 
ATOM   9007  N N   . SER C 1 304 ? 124.72500 111.32900 120.58900 1.000 33.96143  ? 304 SER C N   1 
ATOM   9008  C CA  . SER C 1 304 ? 124.92400 112.16100 121.76500 1.000 33.96143  ? 304 SER C CA  1 
ATOM   9009  C C   . SER C 1 304 ? 125.60300 111.41400 122.89700 1.000 33.96143  ? 304 SER C C   1 
ATOM   9010  O O   . SER C 1 304 ? 126.17000 112.05000 123.78500 1.000 33.96143  ? 304 SER C O   1 
ATOM   9011  C CB  . SER C 1 304 ? 123.59600 112.72600 122.26900 1.000 33.96143  ? 304 SER C CB  1 
ATOM   9012  O OG  . SER C 1 304 ? 122.75000 111.69900 122.73900 1.000 33.96143  ? 304 SER C OG  1 
ATOM   9013  N N   . ARG C 1 305 ? 125.56500 110.08600 122.89700 1.000 37.42428  ? 305 ARG C N   1 
ATOM   9014  C CA  . ARG C 1 305 ? 126.20200 109.34700 123.97700 1.000 37.42428  ? 305 ARG C CA  1 
ATOM   9015  C C   . ARG C 1 305 ? 127.71600 109.32700 123.80900 1.000 37.42428  ? 305 ARG C C   1 
ATOM   9016  O O   . ARG C 1 305 ? 128.46000 109.51500 124.77300 1.000 37.42428  ? 305 ARG C O   1 
ATOM   9017  C CB  . ARG C 1 305 ? 125.64300 107.92800 124.04400 1.000 37.42428  ? 305 ARG C CB  1 
ATOM   9018  C CG  . ARG C 1 305 ? 124.19700 107.85300 124.49800 1.000 37.42428  ? 305 ARG C CG  1 
ATOM   9019  C CD  . ARG C 1 305 ? 123.76300 106.41600 124.72400 1.000 37.42428  ? 305 ARG C CD  1 
ATOM   9020  N NE  . ARG C 1 305 ? 124.32900 105.84300 125.94500 1.000 37.42428  ? 305 ARG C NE  1 
ATOM   9021  C CZ  . ARG C 1 305 ? 125.34300 104.98200 125.97700 1.000 37.42428  ? 305 ARG C CZ  1 
ATOM   9022  N NH1 . ARG C 1 305 ? 125.92400 104.59000 124.85200 1.000 37.42428  ? 305 ARG C NH1 1 
ATOM   9023  N NH2 . ARG C 1 305 ? 125.78200 104.51600 127.13700 1.000 37.42428  ? 305 ARG C NH2 1 
ATOM   9024  N N   . THR C 1 306 ? 128.19100 109.11200 122.58600 1.000 31.81897  ? 306 THR C N   1 
ATOM   9025  C CA  . THR C 1 306 ? 129.62500 109.05000 122.34200 1.000 31.81897  ? 306 THR C CA  1 
ATOM   9026  C C   . THR C 1 306 ? 130.25500 110.42600 122.23300 1.000 31.81897  ? 306 THR C C   1 
ATOM   9027  O O   . THR C 1 306 ? 131.47600 110.54600 122.32500 1.000 31.81897  ? 306 THR C O   1 
ATOM   9028  C CB  . THR C 1 306 ? 129.88900 108.24800 121.07300 1.000 31.81897  ? 306 THR C CB  1 
ATOM   9029  O OG1 . THR C 1 306 ? 128.91400 107.20700 120.97500 1.000 31.81897  ? 306 THR C OG1 1 
ATOM   9030  C CG2 . THR C 1 306 ? 131.25600 107.59000 121.11800 1.000 31.81897  ? 306 THR C CG2 1 
ATOM   9031  N N   . ARG C 1 307 ? 129.46900 111.47700 122.06100 1.000 32.74092  ? 307 ARG C N   1 
ATOM   9032  C CA  . ARG C 1 307 ? 130.02500 112.81400 121.93500 1.000 32.74092  ? 307 ARG C CA  1 
ATOM   9033  C C   . ARG C 1 307 ? 130.21900 113.49800 123.27400 1.000 32.74092  ? 307 ARG C C   1 
ATOM   9034  O O   . ARG C 1 307 ? 131.21900 114.18800 123.46700 1.000 32.74092  ? 307 ARG C O   1 
ATOM   9035  C CB  . ARG C 1 307 ? 129.12600 113.67000 121.05300 1.000 32.74092  ? 307 ARG C CB  1 
ATOM   9036  C CG  . ARG C 1 307 ? 129.72000 114.97700 120.62700 1.000 32.74092  ? 307 ARG C CG  1 
ATOM   9037  C CD  . ARG C 1 307 ? 128.82700 115.64600 119.61200 1.000 32.74092  ? 307 ARG C CD  1 
ATOM   9038  N NE  . ARG C 1 307 ? 127.41200 115.43100 119.90000 1.000 32.74092  ? 307 ARG C NE  1 
ATOM   9039  C CZ  . ARG C 1 307 ? 126.69200 116.18400 120.72200 1.000 32.74092  ? 307 ARG C CZ  1 
ATOM   9040  N NH1 . ARG C 1 307 ? 125.41300 115.91200 120.92100 1.000 32.74092  ? 307 ARG C NH1 1 
ATOM   9041  N NH2 . ARG C 1 307 ? 127.25100 117.20500 121.34800 1.000 32.74092  ? 307 ARG C NH2 1 
ATOM   9042  N N   . THR C 1 308 ? 129.29000 113.32500 124.21300 1.000 32.14646  ? 308 THR C N   1 
ATOM   9043  C CA  . THR C 1 308 ? 129.49100 113.89600 125.53800 1.000 32.14646  ? 308 THR C CA  1 
ATOM   9044  C C   . THR C 1 308 ? 130.42800 113.03900 126.37400 1.000 32.14646  ? 308 THR C C   1 
ATOM   9045  O O   . THR C 1 308 ? 130.91700 113.48800 127.41400 1.000 32.14646  ? 308 THR C O   1 
ATOM   9046  C CB  . THR C 1 308 ? 128.16200 114.07700 126.25600 1.000 32.14646  ? 308 THR C CB  1 
ATOM   9047  O OG1 . THR C 1 308 ? 127.68700 112.80400 126.69500 1.000 32.14646  ? 308 THR C OG1 1 
ATOM   9048  C CG2 . THR C 1 308 ? 127.14500 114.73100 125.34700 1.000 32.14646  ? 308 THR C CG2 1 
ATOM   9049  N N   . PHE C 1 309 ? 130.67400 111.79900 125.95600 1.000 30.10389  ? 309 PHE C N   1 
ATOM   9050  C CA  . PHE C 1 309 ? 131.75600 111.03500 126.56200 1.000 30.10389  ? 309 PHE C CA  1 
ATOM   9051  C C   . PHE C 1 309 ? 133.10500 111.56600 126.11200 1.000 30.10389  ? 309 PHE C C   1 
ATOM   9052  O O   . PHE C 1 309 ? 134.04400 111.64600 126.90600 1.000 30.10389  ? 309 PHE C O   1 
ATOM   9053  C CB  . PHE C 1 309 ? 131.62100 109.55700 126.21600 1.000 30.10389  ? 309 PHE C CB  1 
ATOM   9054  C CG  . PHE C 1 309 ? 132.89700 108.77700 126.35800 1.000 30.10389  ? 309 PHE C CG  1 
ATOM   9055  C CD1 . PHE C 1 309 ? 133.47000 108.56600 127.59700 1.000 30.10389  ? 309 PHE C CD1 1 
ATOM   9056  C CD2 . PHE C 1 309 ? 133.51200 108.23400 125.25000 1.000 30.10389  ? 309 PHE C CD2 1 
ATOM   9057  C CE1 . PHE C 1 309 ? 134.63400 107.84800 127.71600 1.000 30.10389  ? 309 PHE C CE1 1 
ATOM   9058  C CE2 . PHE C 1 309 ? 134.67600 107.51400 125.37400 1.000 30.10389  ? 309 PHE C CE2 1 
ATOM   9059  C CZ  . PHE C 1 309 ? 135.23400 107.32300 126.60400 1.000 30.10389  ? 309 PHE C CZ  1 
ATOM   9060  N N   . ARG C 1 310 ? 133.22000 111.95400 124.84400 1.000 30.74852  ? 310 ARG C N   1 
ATOM   9061  C CA  . ARG C 1 310 ? 134.48900 112.47200 124.35700 1.000 30.74852  ? 310 ARG C CA  1 
ATOM   9062  C C   . ARG C 1 310 ? 134.68100 113.92700 124.74800 1.000 30.74852  ? 310 ARG C C   1 
ATOM   9063  O O   . ARG C 1 310 ? 135.76200 114.48100 124.54200 1.000 30.74852  ? 310 ARG C O   1 
ATOM   9064  C CB  . ARG C 1 310 ? 134.58100 112.31800 122.84400 1.000 30.74852  ? 310 ARG C CB  1 
ATOM   9065  C CG  . ARG C 1 310 ? 134.71900 110.90000 122.35200 1.000 30.74852  ? 310 ARG C CG  1 
ATOM   9066  C CD  . ARG C 1 310 ? 135.84300 110.17000 123.02200 1.000 30.74852  ? 310 ARG C CD  1 
ATOM   9067  N NE  . ARG C 1 310 ? 137.14100 110.63200 122.56100 1.000 30.74852  ? 310 ARG C NE  1 
ATOM   9068  C CZ  . ARG C 1 310 ? 137.89900 109.96800 121.70400 1.000 30.74852  ? 310 ARG C CZ  1 
ATOM   9069  N NH1 . ARG C 1 310 ? 137.48000 108.81900 121.20800 1.000 30.74852  ? 310 ARG C NH1 1 
ATOM   9070  N NH2 . ARG C 1 310 ? 139.07000 110.45500 121.33900 1.000 30.74852  ? 310 ARG C NH2 1 
ATOM   9071  N N   . ASP C 1 311 ? 133.64400 114.56600 125.28600 1.000 32.60084  ? 311 ASP C N   1 
ATOM   9072  C CA  . ASP C 1 311 ? 133.80500 115.89800 125.85400 1.000 32.60084  ? 311 ASP C CA  1 
ATOM   9073  C C   . ASP C 1 311 ? 134.41400 115.82900 127.24500 1.000 32.60084  ? 311 ASP C C   1 
ATOM   9074  O O   . ASP C 1 311 ? 135.24000 116.66900 127.61100 1.000 32.60084  ? 311 ASP C O   1 
ATOM   9075  C CB  . ASP C 1 311 ? 132.45900 116.61100 125.90800 1.000 32.60084  ? 311 ASP C CB  1 
ATOM   9076  C CG  . ASP C 1 311 ? 132.27100 117.58400 124.77300 1.000 32.60084  ? 311 ASP C CG  1 
ATOM   9077  O OD1 . ASP C 1 311 ? 133.21500 117.75100 123.97800 1.000 32.60084  ? 311 ASP C OD1 1 
ATOM   9078  O OD2 . ASP C 1 311 ? 131.18200 118.18600 124.67400 1.000 32.60084  ? 311 ASP C OD2 1 
ATOM   9079  N N   . SER C 1 312 ? 134.00600 114.83700 128.03800 1.000 30.18274  ? 312 SER C N   1 
ATOM   9080  C CA  . SER C 1 312 ? 134.47000 114.74200 129.41600 1.000 30.18274  ? 312 SER C CA  1 
ATOM   9081  C C   . SER C 1 312 ? 135.86000 114.13400 129.49600 1.000 30.18274  ? 312 SER C C   1 
ATOM   9082  O O   . SER C 1 312 ? 136.59500 114.38600 130.45300 1.000 30.18274  ? 312 SER C O   1 
ATOM   9083  C CB  . SER C 1 312 ? 133.48600 113.92400 130.24000 1.000 30.18274  ? 312 SER C CB  1 
ATOM   9084  O OG  . SER C 1 312 ? 133.60700 112.55300 129.93200 1.000 30.18274  ? 312 SER C OG  1 
ATOM   9085  N N   . VAL C 1 313 ? 136.23100 113.31200 128.51700 1.000 29.50525  ? 313 VAL C N   1 
ATOM   9086  C CA  . VAL C 1 313 ? 137.60600 112.83400 128.43100 1.000 29.50525  ? 313 VAL C CA  1 
ATOM   9087  C C   . VAL C 1 313 ? 138.52900 113.97100 128.02100 1.000 29.50525  ? 313 VAL C C   1 
ATOM   9088  O O   . VAL C 1 313 ? 139.63700 114.11500 128.54900 1.000 29.50525  ? 313 VAL C O   1 
ATOM   9089  C CB  . VAL C 1 313 ? 137.68400 111.64400 127.45900 1.000 29.50525  ? 313 VAL C CB  1 
ATOM   9090  C CG1 . VAL C 1 313 ? 139.10000 111.35400 127.04600 1.000 29.50525  ? 313 VAL C CG1 1 
ATOM   9091  C CG2 . VAL C 1 313 ? 137.11000 110.43200 128.11200 1.000 29.50525  ? 313 VAL C CG2 1 
ATOM   9092  N N   . ARG C 1 314 ? 138.06600 114.81900 127.10400 1.000 31.97503  ? 314 ARG C N   1 
ATOM   9093  C CA  . ARG C 1 314 ? 138.85100 115.96800 126.67300 1.000 31.97503  ? 314 ARG C CA  1 
ATOM   9094  C C   . ARG C 1 314 ? 139.01400 116.97900 127.79600 1.000 31.97503  ? 314 ARG C C   1 
ATOM   9095  O O   . ARG C 1 314 ? 140.08900 117.56200 127.96400 1.000 31.97503  ? 314 ARG C O   1 
ATOM   9096  C CB  . ARG C 1 314 ? 138.18200 116.61300 125.46400 1.000 31.97503  ? 314 ARG C CB  1 
ATOM   9097  C CG  . ARG C 1 314 ? 138.82800 117.87700 124.96700 1.000 31.97503  ? 314 ARG C CG  1 
ATOM   9098  C CD  . ARG C 1 314 ? 138.16100 118.35800 123.69600 1.000 31.97503  ? 314 ARG C CD  1 
ATOM   9099  N NE  . ARG C 1 314 ? 136.75500 118.68600 123.90500 1.000 31.97503  ? 314 ARG C NE  1 
ATOM   9100  C CZ  . ARG C 1 314 ? 136.00900 119.35300 123.03200 1.000 31.97503  ? 314 ARG C CZ  1 
ATOM   9101  N NH1 . ARG C 1 314 ? 136.53700 119.76800 121.89200 1.000 31.97503  ? 314 ARG C NH1 1 
ATOM   9102  N NH2 . ARG C 1 314 ? 134.73900 119.61300 123.29800 1.000 31.97503  ? 314 ARG C NH2 1 
ATOM   9103  N N   . ALA C 1 315 ? 137.96800 117.17500 128.59800 1.000 33.39188  ? 315 ALA C N   1 
ATOM   9104  C CA  . ALA C 1 315 ? 138.03500 118.15700 129.67200 1.000 33.39188  ? 315 ALA C CA  1 
ATOM   9105  C C   . ALA C 1 315 ? 138.90400 117.68100 130.82400 1.000 33.39188  ? 315 ALA C C   1 
ATOM   9106  O O   . ALA C 1 315 ? 139.40400 118.50300 131.59500 1.000 33.39188  ? 315 ALA C O   1 
ATOM   9107  C CB  . ALA C 1 315 ? 136.63300 118.48300 130.17300 1.000 33.39188  ? 315 ALA C CB  1 
ATOM   9108  N N   . ALA C 1 316 ? 139.09200 116.37400 130.96500 1.000 33.52075  ? 316 ALA C N   1 
ATOM   9109  C CA  . ALA C 1 316 ? 139.96900 115.82600 131.98800 1.000 33.52075  ? 316 ALA C CA  1 
ATOM   9110  C C   . ALA C 1 316 ? 141.38100 115.58400 131.48800 1.000 33.52075  ? 316 ALA C C   1 
ATOM   9111  O O   . ALA C 1 316 ? 142.24400 115.21200 132.28300 1.000 33.52075  ? 316 ALA C O   1 
ATOM   9112  C CB  . ALA C 1 316 ? 139.40200 114.51800 132.53200 1.000 33.52075  ? 316 ALA C CB  1 
ATOM   9113  N N   . SER C 1 317 ? 141.63100 115.75600 130.19600 1.000 36.56601  ? 317 SER C N   1 
ATOM   9114  C CA  . SER C 1 317 ? 142.99000 115.79200 129.68300 1.000 36.56601  ? 317 SER C CA  1 
ATOM   9115  C C   . SER C 1 317 ? 143.50500 117.21100 129.54200 1.000 36.56601  ? 317 SER C C   1 
ATOM   9116  O O   . SER C 1 317 ? 144.72000 117.42200 129.51200 1.000 36.56601  ? 317 SER C O   1 
ATOM   9117  C CB  . SER C 1 317 ? 143.06800 115.08300 128.33500 1.000 36.56601  ? 317 SER C CB  1 
ATOM   9118  O OG  . SER C 1 317 ? 143.06200 113.68400 128.51000 1.000 36.56601  ? 317 SER C OG  1 
ATOM   9119  N N   . GLU C 1 318 ? 142.60600 118.18800 129.43700 1.000 39.98098  ? 318 GLU C N   1 
ATOM   9120  C CA  . GLU C 1 318 ? 143.01700 119.58000 129.55500 1.000 39.98098  ? 318 GLU C CA  1 
ATOM   9121  C C   . GLU C 1 318 ? 143.38400 119.91700 130.98900 1.000 39.98098  ? 318 GLU C C   1 
ATOM   9122  O O   . GLU C 1 318 ? 144.25000 120.76100 131.23200 1.000 39.98098  ? 318 GLU C O   1 
ATOM   9123  C CB  . GLU C 1 318 ? 141.90600 120.50600 129.07500 1.000 39.98098  ? 318 GLU C CB  1 
ATOM   9124  C CG  . GLU C 1 318 ? 141.81000 120.65000 127.57800 1.000 39.98098  ? 318 GLU C CG  1 
ATOM   9125  C CD  . GLU C 1 318 ? 140.44500 121.12700 127.13600 1.000 39.98098  ? 318 GLU C CD  1 
ATOM   9126  O OE1 . GLU C 1 318 ? 140.03900 120.81100 125.99900 1.000 39.98098  ? 318 GLU C OE1 1 
ATOM   9127  O OE2 . GLU C 1 318 ? 139.77500 121.81800 127.93100 1.000 39.98098  ? 318 GLU C OE2 1 
ATOM   9128  N N   . PHE C 1 319 ? 142.72500 119.27800 131.95400 1.000 41.03341  ? 319 PHE C N   1 
ATOM   9129  C CA  . PHE C 1 319 ? 142.99600 119.58200 133.35200 1.000 41.03341  ? 319 PHE C CA  1 
ATOM   9130  C C   . PHE C 1 319 ? 144.31400 118.97500 133.80200 1.000 41.03341  ? 319 PHE C C   1 
ATOM   9131  O O   . PHE C 1 319 ? 145.05500 119.58600 134.57600 1.000 41.03341  ? 319 PHE C O   1 
ATOM   9132  C CB  . PHE C 1 319 ? 141.85300 119.07900 134.22900 1.000 41.03341  ? 319 PHE C CB  1 
ATOM   9133  C CG  . PHE C 1 319 ? 142.11200 119.22700 135.69200 1.000 41.03341  ? 319 PHE C CG  1 
ATOM   9134  C CD1 . PHE C 1 319 ? 142.04200 120.46800 136.28900 1.000 41.03341  ? 319 PHE C CD1 1 
ATOM   9135  C CD2 . PHE C 1 319 ? 142.43000 118.13000 136.47000 1.000 41.03341  ? 319 PHE C CD2 1 
ATOM   9136  C CE1 . PHE C 1 319 ? 142.28100 120.61200 137.63200 1.000 41.03341  ? 319 PHE C CE1 1 
ATOM   9137  C CE2 . PHE C 1 319 ? 142.67500 118.27200 137.81200 1.000 41.03341  ? 319 PHE C CE2 1 
ATOM   9138  C CZ  . PHE C 1 319 ? 142.60200 119.51400 138.39300 1.000 41.03341  ? 319 PHE C CZ  1 
ATOM   9139  N N   . ALA C 1 320 ? 144.62100 117.77400 133.34200 1.000 43.56424  ? 320 ALA C N   1 
ATOM   9140  C CA  . ALA C 1 320 ? 145.84300 117.11000 133.76200 1.000 43.56424  ? 320 ALA C CA  1 
ATOM   9141  C C   . ALA C 1 320 ? 147.05400 117.54100 132.95800 1.000 43.56424  ? 320 ALA C C   1 
ATOM   9142  O O   . ALA C 1 320 ? 148.14700 117.02200 133.19000 1.000 43.56424  ? 320 ALA C O   1 
ATOM   9143  C CB  . ALA C 1 320 ? 145.67500 115.59800 133.66200 1.000 43.56424  ? 320 ALA C CB  1 
ATOM   9144  N N   . SER C 1 321 ? 146.88900 118.45800 132.01400 1.000 45.19879  ? 321 SER C N   1 
ATOM   9145  C CA  . SER C 1 321 ? 148.00000 118.98900 131.24300 1.000 45.19879  ? 321 SER C CA  1 
ATOM   9146  C C   . SER C 1 321 ? 148.34500 120.41700 131.60700 1.000 45.19879  ? 321 SER C C   1 
ATOM   9147  O O   . SER C 1 321 ? 149.50100 120.81200 131.46500 1.000 45.19879  ? 321 SER C O   1 
ATOM   9148  C CB  . SER C 1 321 ? 147.69000 118.92500 129.74600 1.000 45.19879  ? 321 SER C CB  1 
ATOM   9149  O OG  . SER C 1 321 ? 148.73500 119.50600 128.99300 1.000 45.19879  ? 321 SER C OG  1 
ATOM   9150  N N   . ARG C 1 322 ? 147.36800 121.19700 132.06500 1.000 44.69952  ? 322 ARG C N   1 
ATOM   9151  C CA  . ARG C 1 322 ? 147.65800 122.53900 132.54500 1.000 44.69952  ? 322 ARG C CA  1 
ATOM   9152  C C   . ARG C 1 322 ? 148.40900 122.50500 133.86300 1.000 44.69952  ? 322 ARG C C   1 
ATOM   9153  O O   . ARG C 1 322 ? 149.25600 123.36600 134.11700 1.000 44.69952  ? 322 ARG C O   1 
ATOM   9154  C CB  . ARG C 1 322 ? 146.36600 123.32500 132.71400 1.000 44.69952  ? 322 ARG C CB  1 
ATOM   9155  C CG  . ARG C 1 322 ? 145.78500 123.83900 131.43100 1.000 44.69952  ? 322 ARG C CG  1 
ATOM   9156  C CD  . ARG C 1 322 ? 144.69300 124.82400 131.73200 1.000 44.69952  ? 322 ARG C CD  1 
ATOM   9157  N NE  . ARG C 1 322 ? 143.64600 124.21000 132.53400 1.000 44.69952  ? 322 ARG C NE  1 
ATOM   9158  C CZ  . ARG C 1 322 ? 142.39700 124.05000 132.11900 1.000 44.69952  ? 322 ARG C CZ  1 
ATOM   9159  N NH1 . ARG C 1 322 ? 142.04300 124.47100 130.91400 1.000 44.69952  ? 322 ARG C NH1 1 
ATOM   9160  N NH2 . ARG C 1 322 ? 141.50100 123.48000 132.90800 1.000 44.69952  ? 322 ARG C NH2 1 
ATOM   9161  N N   . ASN C 1 323 ? 148.11300 121.52600 134.71000 1.000 46.29512  ? 323 ASN C N   1 
ATOM   9162  C CA  . ASN C 1 323 ? 148.68300 121.44100 136.04400 1.000 46.29512  ? 323 ASN C CA  1 
ATOM   9163  C C   . ASN C 1 323 ? 149.91600 120.55800 136.10400 1.000 46.29512  ? 323 ASN C C   1 
ATOM   9164  O O   . ASN C 1 323 ? 150.48300 120.39600 137.18800 1.000 46.29512  ? 323 ASN C O   1 
ATOM   9165  C CB  . ASN C 1 323 ? 147.62800 120.94500 137.02200 1.000 46.29512  ? 323 ASN C CB  1 
ATOM   9166  C CG  . ASN C 1 323 ? 146.39100 121.79300 136.99400 1.000 46.29512  ? 323 ASN C CG  1 
ATOM   9167  O OD1 . ASN C 1 323 ? 146.30800 122.75100 136.23600 1.000 46.29512  ? 323 ASN C OD1 1 
ATOM   9168  N ND2 . ASN C 1 323 ? 145.42100 121.45300 137.81700 1.000 46.29512  ? 323 ASN C ND2 1 
ATOM   9169  N N   . GLN C 1 324 ? 150.33500 120.00300 134.96100 1.000 50.77318  ? 324 GLN C N   1 
ATOM   9170  C CA  . GLN C 1 324 ? 151.54700 119.18800 134.81400 1.000 50.77318  ? 324 GLN C CA  1 
ATOM   9171  C C   . GLN C 1 324 ? 151.54200 117.99500 135.76200 1.000 50.77318  ? 324 GLN C C   1 
ATOM   9172  O O   . GLN C 1 324 ? 152.50600 117.74900 136.48800 1.000 50.77318  ? 324 GLN C O   1 
ATOM   9173  C CB  . GLN C 1 324 ? 152.80800 120.03200 134.99700 1.000 50.77318  ? 324 GLN C CB  1 
ATOM   9174  C CG  . GLN C 1 324 ? 152.81600 121.30900 134.17900 1.000 50.77318  ? 324 GLN C CG  1 
ATOM   9175  C CD  . GLN C 1 324 ? 153.91100 122.26100 134.60400 1.000 50.77318  ? 324 GLN C CD  1 
ATOM   9176  O OE1 . GLN C 1 324 ? 154.81200 121.89200 135.35400 1.000 50.77318  ? 324 GLN C OE1 1 
ATOM   9177  N NE2 . GLN C 1 324 ? 153.83500 123.49600 134.13200 1.000 50.77318  ? 324 GLN C NE2 1 
ATOM   9178  N N   . LEU C 1 325 ? 150.43100 117.26500 135.76600 1.000 50.25439  ? 325 LEU C N   1 
ATOM   9179  C CA  . LEU C 1 325 ? 150.27100 116.12500 136.65000 1.000 50.25439  ? 325 LEU C CA  1 
ATOM   9180  C C   . LEU C 1 325 ? 151.20500 114.99400 136.22300 1.000 50.25439  ? 325 LEU C C   1 
ATOM   9181  O O   . LEU C 1 325 ? 151.55700 114.88600 135.04500 1.000 50.25439  ? 325 LEU C O   1 
ATOM   9182  C CB  . LEU C 1 325 ? 148.82300 115.64400 136.62900 1.000 50.25439  ? 325 LEU C CB  1 
ATOM   9183  C CG  . LEU C 1 325 ? 147.85700 116.40100 137.52800 1.000 50.25439  ? 325 LEU C CG  1 
ATOM   9184  C CD1 . LEU C 1 325 ? 146.46500 115.84600 137.38700 1.000 50.25439  ? 325 LEU C CD1 1 
ATOM   9185  C CD2 . LEU C 1 325 ? 148.31500 116.29700 138.94800 1.000 50.25439  ? 325 LEU C CD2 1 
ATOM   9186  N N   . PRO C 1 326 ? 151.64500 114.15400 137.15800 1.000 54.20859  ? 326 PRO C N   1 
ATOM   9187  C CA  . PRO C 1 326 ? 152.44100 112.99000 136.76800 1.000 54.20859  ? 326 PRO C CA  1 
ATOM   9188  C C   . PRO C 1 326 ? 151.58600 111.96300 136.05200 1.000 54.20859  ? 326 PRO C C   1 
ATOM   9189  O O   . PRO C 1 326 ? 150.35800 111.96700 136.14700 1.000 54.20859  ? 326 PRO C O   1 
ATOM   9190  C CB  . PRO C 1 326 ? 152.96000 112.44800 138.10200 1.000 54.20859  ? 326 PRO C CB  1 
ATOM   9191  C CG  . PRO C 1 326 ? 152.00700 112.94200 139.10200 1.000 54.20859  ? 326 PRO C CG  1 
ATOM   9192  C CD  . PRO C 1 326 ? 151.55100 114.27800 138.62100 1.000 54.20859  ? 326 PRO C CD  1 
ATOM   9193  N N   . HIS C 1 327 ? 152.25900 111.06500 135.33400 1.000 55.17837  ? 327 HIS C N   1 
ATOM   9194  C CA  . HIS C 1 327 ? 151.54800 110.07600 134.53500 1.000 55.17837  ? 327 HIS C CA  1 
ATOM   9195  C C   . HIS C 1 327 ? 150.87900 109.01500 135.39500 1.000 55.17837  ? 327 HIS C C   1 
ATOM   9196  O O   . HIS C 1 327 ? 149.99300 108.30200 134.92000 1.000 55.17837  ? 327 HIS C O   1 
ATOM   9197  C CB  . HIS C 1 327 ? 152.50700 109.42000 133.54500 1.000 55.17837  ? 327 HIS C CB  1 
ATOM   9198  C CG  . HIS C 1 327 ? 151.82600 108.83600 132.35000 1.000 55.17837  ? 327 HIS C CG  1 
ATOM   9199  N ND1 . HIS C 1 327 ? 151.39800 109.60300 131.28900 1.000 55.17837  ? 327 HIS C ND1 1 
ATOM   9200  C CD2 . HIS C 1 327 ? 151.48800 107.55900 132.05200 1.000 55.17837  ? 327 HIS C CD2 1 
ATOM   9201  C CE1 . HIS C 1 327 ? 150.82900 108.82400 130.38600 1.000 55.17837  ? 327 HIS C CE1 1 
ATOM   9202  N NE2 . HIS C 1 327 ? 150.87000 107.57900 130.82600 1.000 55.17837  ? 327 HIS C NE2 1 
ATOM   9203  N N   . ASP C 1 328 ? 151.28000 108.89400 136.65600 1.000 55.90335  ? 328 ASP C N   1 
ATOM   9204  C CA  . ASP C 1 328 ? 150.74300 107.85400 137.52100 1.000 55.90335  ? 328 ASP C CA  1 
ATOM   9205  C C   . ASP C 1 328 ? 149.40500 108.22000 138.14400 1.000 55.90335  ? 328 ASP C C   1 
ATOM   9206  O O   . ASP C 1 328 ? 148.74400 107.33800 138.69700 1.000 55.90335  ? 328 ASP C O   1 
ATOM   9207  C CB  . ASP C 1 328 ? 151.75500 107.52500 138.61700 1.000 55.90335  ? 328 ASP C CB  1 
ATOM   9208  C CG  . ASP C 1 328 ? 153.11400 107.14500 138.05500 1.000 55.90335  ? 328 ASP C CG  1 
ATOM   9209  O OD1 . ASP C 1 328 ? 153.52500 105.97800 138.22200 1.000 55.90335  ? 328 ASP C OD1 1 
ATOM   9210  O OD2 . ASP C 1 328 ? 153.76800 108.01200 137.43700 1.000 55.90335  ? 328 ASP C OD2 1 
ATOM   9211  N N   . ILE C 1 329 ? 148.99200 109.48300 138.07900 1.000 50.52878  ? 329 ILE C N   1 
ATOM   9212  C CA  . ILE C 1 329 ? 147.68400 109.90400 138.55400 1.000 50.52878  ? 329 ILE C CA  1 
ATOM   9213  C C   . ILE C 1 329 ? 146.78300 110.31900 137.39500 1.000 50.52878  ? 329 ILE C C   1 
ATOM   9214  O O   . ILE C 1 329 ? 145.55600 110.29500 137.51100 1.000 50.52878  ? 329 ILE C O   1 
ATOM   9215  C CB  . ILE C 1 329 ? 147.82700 111.03400 139.60500 1.000 50.52878  ? 329 ILE C CB  1 
ATOM   9216  C CG1 . ILE C 1 329 ? 146.51000 111.33500 140.32500 1.000 50.52878  ? 329 ILE C CG1 1 
ATOM   9217  C CG2 . ILE C 1 329 ? 148.36100 112.29400 138.98400 1.000 50.52878  ? 329 ILE C CG2 1 
ATOM   9218  C CD1 . ILE C 1 329 ? 145.88600 110.13000 140.97700 1.000 50.52878  ? 329 ILE C CD1 1 
ATOM   9219  N N   . GLN C 1 330 ? 147.37500 110.63500 136.24300 1.000 49.96169  ? 330 GLN C N   1 
ATOM   9220  C CA  . GLN C 1 330 ? 146.57800 110.90200 135.05400 1.000 49.96169  ? 330 GLN C CA  1 
ATOM   9221  C C   . GLN C 1 330 ? 145.93500 109.62800 134.52600 1.000 49.96169  ? 330 GLN C C   1 
ATOM   9222  O O   . GLN C 1 330 ? 144.83300 109.66500 133.97200 1.000 49.96169  ? 330 GLN C O   1 
ATOM   9223  C CB  . GLN C 1 330 ? 147.44900 111.54900 133.98700 1.000 49.96169  ? 330 GLN C CB  1 
ATOM   9224  C CG  . GLN C 1 330 ? 146.68100 112.11800 132.83100 1.000 49.96169  ? 330 GLN C CG  1 
ATOM   9225  C CD  . GLN C 1 330 ? 147.54800 112.96300 131.93900 1.000 49.96169  ? 330 GLN C CD  1 
ATOM   9226  O OE1 . GLN C 1 330 ? 148.77400 112.91600 132.02500 1.000 49.96169  ? 330 GLN C OE1 1 
ATOM   9227  N NE2 . GLN C 1 330 ? 146.92000 113.74300 131.07000 1.000 49.96169  ? 330 GLN C NE2 1 
ATOM   9228  N N   . ASP C 1 331 ? 146.59900 108.48500 134.70100 1.000 50.15412  ? 331 ASP C N   1 
ATOM   9229  C CA  . ASP C 1 331 ? 146.01400 107.22500 134.25600 1.000 50.15412  ? 331 ASP C CA  1 
ATOM   9230  C C   . ASP C 1 331 ? 144.89000 106.77500 135.17300 1.000 50.15412  ? 331 ASP C C   1 
ATOM   9231  O O   . ASP C 1 331 ? 144.02800 105.99200 134.76700 1.000 50.15412  ? 331 ASP C O   1 
ATOM   9232  C CB  . ASP C 1 331 ? 147.07800 106.13900 134.17100 1.000 50.15412  ? 331 ASP C CB  1 
ATOM   9233  C CG  . ASP C 1 331 ? 148.16400 106.47100 133.18900 1.000 50.15412  ? 331 ASP C CG  1 
ATOM   9234  O OD1 . ASP C 1 331 ? 149.18600 105.75400 133.17300 1.000 50.15412  ? 331 ASP C OD1 1 
ATOM   9235  O OD2 . ASP C 1 331 ? 148.00100 107.45100 132.43600 1.000 50.15412  ? 331 ASP C OD2 1 
ATOM   9236  N N   . GLN C 1 332 ? 144.88900 107.23600 136.42000 1.000 45.00576  ? 332 GLN C N   1 
ATOM   9237  C CA  . GLN C 1 332 ? 143.82500 106.83800 137.33000 1.000 45.00576  ? 332 GLN C CA  1 
ATOM   9238  C C   . GLN C 1 332 ? 142.54600 107.60700 137.05100 1.000 45.00576  ? 332 GLN C C   1 
ATOM   9239  O O   . GLN C 1 332 ? 141.44600 107.09100 137.26300 1.000 45.00576  ? 332 GLN C O   1 
ATOM   9240  C CB  . GLN C 1 332 ? 144.26300 107.04100 138.77400 1.000 45.00576  ? 332 GLN C CB  1 
ATOM   9241  C CG  . GLN C 1 332 ? 145.16600 105.95800 139.29800 1.000 45.00576  ? 332 GLN C CG  1 
ATOM   9242  C CD  . GLN C 1 332 ? 145.39100 106.08700 140.77700 1.000 45.00576  ? 332 GLN C CD  1 
ATOM   9243  O OE1 . GLN C 1 332 ? 144.65700 106.79100 141.46600 1.000 45.00576  ? 332 GLN C OE1 1 
ATOM   9244  N NE2 . GLN C 1 332 ? 146.41300 105.41200 141.28000 1.000 45.00576  ? 332 GLN C NE2 1 
ATOM   9245  N N   . MET C 1 333 ? 142.66600 108.84400 136.57700 1.000 40.05389  ? 333 MET C N   1 
ATOM   9246  C CA  . MET C 1 333 ? 141.47600 109.63100 136.30000 1.000 40.05389  ? 333 MET C CA  1 
ATOM   9247  C C   . MET C 1 333 ? 140.94200 109.40200 134.90000 1.000 40.05389  ? 333 MET C C   1 
ATOM   9248  O O   . MET C 1 333 ? 139.79200 109.74600 134.63300 1.000 40.05389  ? 333 MET C O   1 
ATOM   9249  C CB  . MET C 1 333 ? 141.75400 111.12000 136.51400 1.000 40.05389  ? 333 MET C CB  1 
ATOM   9250  C CG  . MET C 1 333 ? 142.54000 111.78200 135.41700 1.000 40.05389  ? 333 MET C CG  1 
ATOM   9251  S SD  . MET C 1 333 ? 142.96200 113.48300 135.80600 1.000 40.05389  ? 333 MET C SD  1 
ATOM   9252  C CE  . MET C 1 333 ? 141.38200 114.09100 136.36300 1.000 40.05389  ? 333 MET C CE  1 
ATOM   9253  N N   . LEU C 1 334 ? 141.73700 108.82300 134.00500 1.000 37.21149  ? 334 LEU C N   1 
ATOM   9254  C CA  . LEU C 1 334 ? 141.27800 108.56600 132.64800 1.000 37.21149  ? 334 LEU C CA  1 
ATOM   9255  C C   . LEU C 1 334 ? 140.74700 107.15400 132.48300 1.000 37.21149  ? 334 LEU C C   1 
ATOM   9256  O O   . LEU C 1 334 ? 139.85800 106.92400 131.66300 1.000 37.21149  ? 334 LEU C O   1 
ATOM   9257  C CB  . LEU C 1 334 ? 142.40600 108.81300 131.65200 1.000 37.21149  ? 334 LEU C CB  1 
ATOM   9258  C CG  . LEU C 1 334 ? 142.53600 110.25800 131.19100 1.000 37.21149  ? 334 LEU C CG  1 
ATOM   9259  C CD1 . LEU C 1 334 ? 143.73600 110.40400 130.29400 1.000 37.21149  ? 334 LEU C CD1 1 
ATOM   9260  C CD2 . LEU C 1 334 ? 141.28500 110.67600 130.47100 1.000 37.21149  ? 334 LEU C CD2 1 
ATOM   9261  N N   . SER C 1 335 ? 141.27600 106.19900 133.24500 1.000 36.77686  ? 335 SER C N   1 
ATOM   9262  C CA  . SER C 1 335 ? 140.71500 104.85600 133.22500 1.000 36.77686  ? 335 SER C CA  1 
ATOM   9263  C C   . SER C 1 335 ? 139.39300 104.79500 133.96500 1.000 36.77686  ? 335 SER C C   1 
ATOM   9264  O O   . SER C 1 335 ? 138.61400 103.86200 133.76100 1.000 36.77686  ? 335 SER C O   1 
ATOM   9265  C CB  . SER C 1 335 ? 141.69300 103.86200 133.83400 1.000 36.77686  ? 335 SER C CB  1 
ATOM   9266  O OG  . SER C 1 335 ? 143.00000 104.07900 133.34500 1.000 36.77686  ? 335 SER C OG  1 
ATOM   9267  N N   . HIS C 1 336 ? 139.12200 105.76700 134.83200 1.000 36.42606  ? 336 HIS C N   1 
ATOM   9268  C CA  . HIS C 1 336 ? 137.86300 105.75000 135.56000 1.000 36.42606  ? 336 HIS C CA  1 
ATOM   9269  C C   . HIS C 1 336 ? 136.72100 106.28000 134.70700 1.000 36.42606  ? 336 HIS C C   1 
ATOM   9270  O O   . HIS C 1 336 ? 135.59200 105.79500 134.81500 1.000 36.42606  ? 336 HIS C O   1 
ATOM   9271  C CB  . HIS C 1 336 ? 137.97600 106.55700 136.84500 1.000 36.42606  ? 336 HIS C CB  1 
ATOM   9272  C CG  . HIS C 1 336 ? 136.70200 106.60400 137.62200 1.000 36.42606  ? 336 HIS C CG  1 
ATOM   9273  N ND1 . HIS C 1 336 ? 136.26500 105.55000 138.39200 1.000 36.42606  ? 336 HIS C ND1 1 
ATOM   9274  C CD2 . HIS C 1 336 ? 135.75200 107.56200 137.71800 1.000 36.42606  ? 336 HIS C CD2 1 
ATOM   9275  C CE1 . HIS C 1 336 ? 135.10700 105.86300 138.94300 1.000 36.42606  ? 336 HIS C CE1 1 
ATOM   9276  N NE2 . HIS C 1 336 ? 134.77400 107.07900 138.55100 1.000 36.42606  ? 336 HIS C NE2 1 
ATOM   9277  N N   . ILE C 1 337 ? 136.98900 107.28300 133.86700 1.000 33.14389  ? 337 ILE C N   1 
ATOM   9278  C CA  . ILE C 1 337 ? 135.95100 107.83300 132.99600 1.000 33.14389  ? 337 ILE C CA  1 
ATOM   9279  C C   . ILE C 1 337 ? 135.56500 106.82000 131.92900 1.000 33.14389  ? 337 ILE C C   1 
ATOM   9280  O O   . ILE C 1 337 ? 134.39100 106.69700 131.56200 1.000 33.14389  ? 337 ILE C O   1 
ATOM   9281  C CB  . ILE C 1 337 ? 136.42900 109.15800 132.37800 1.000 33.14389  ? 337 ILE C CB  1 
ATOM   9282  C CG1 . ILE C 1 337 ? 136.75700 110.15500 133.47200 1.000 33.14389  ? 337 ILE C CG1 1 
ATOM   9283  C CG2 . ILE C 1 337 ? 135.37100 109.76900 131.50300 1.000 33.14389  ? 337 ILE C CG2 1 
ATOM   9284  C CD1 . ILE C 1 337 ? 137.40900 111.38900 132.96500 1.000 33.14389  ? 337 ILE C CD1 1 
ATOM   9285  N N   . CYS C 1 338 ? 136.54000 106.05600 131.44100 1.000 33.84364  ? 338 CYS C N   1 
ATOM   9286  C CA  . CYS C 1 338 ? 136.27000 105.05900 130.41500 1.000 33.84364  ? 338 CYS C CA  1 
ATOM   9287  C C   . CYS C 1 338 ? 135.46400 103.89500 130.97200 1.000 33.84364  ? 338 CYS C C   1 
ATOM   9288  O O   . CYS C 1 338 ? 134.64600 103.30100 130.26600 1.000 33.84364  ? 338 CYS C O   1 
ATOM   9289  C CB  . CYS C 1 338 ? 137.58200 104.56000 129.82400 1.000 33.84364  ? 338 CYS C CB  1 
ATOM   9290  S SG  . CYS C 1 338 ? 138.47600 105.79700 128.89700 1.000 33.84364  ? 338 CYS C SG  1 
ATOM   9291  N N   . LEU C 1 339 ? 135.68500 103.54700 132.24000 1.000 32.44839  ? 339 LEU C N   1 
ATOM   9292  C CA  . LEU C 1 339 ? 134.95500 102.42900 132.82500 1.000 32.44839  ? 339 LEU C CA  1 
ATOM   9293  C C   . LEU C 1 339 ? 133.60100 102.87100 133.35500 1.000 32.44839  ? 339 LEU C C   1 
ATOM   9294  O O   . LEU C 1 339 ? 132.66900 102.06600 133.44000 1.000 32.44839  ? 339 LEU C O   1 
ATOM   9295  C CB  . LEU C 1 339 ? 135.78000 101.77800 133.92900 1.000 32.44839  ? 339 LEU C CB  1 
ATOM   9296  C CG  . LEU C 1 339 ? 135.30700 100.42100 134.44600 1.000 32.44839  ? 339 LEU C CG  1 
ATOM   9297  C CD1 . LEU C 1 339 ? 134.88000 99.52200  133.32500 1.000 32.44839  ? 339 LEU C CD1 1 
ATOM   9298  C CD2 . LEU C 1 339 ? 136.40000 99.76600  135.20000 1.000 32.44839  ? 339 LEU C CD2 1 
ATOM   9299  N N   . LYS C 1 340 ? 133.46700 104.14400 133.71700 1.000 34.29922  ? 340 LYS C N   1 
ATOM   9300  C CA  . LYS C 1 340 ? 132.16100 104.65800 134.10500 1.000 34.29922  ? 340 LYS C CA  1 
ATOM   9301  C C   . LYS C 1 340 ? 131.23300 104.74300 132.90400 1.000 34.29922  ? 340 LYS C C   1 
ATOM   9302  O O   . LYS C 1 340 ? 130.01400 104.61600 133.04100 1.000 34.29922  ? 340 LYS C O   1 
ATOM   9303  C CB  . LYS C 1 340 ? 132.31200 106.02500 134.76300 1.000 34.29922  ? 340 LYS C CB  1 
ATOM   9304  C CG  . LYS C 1 340 ? 131.09800 106.49600 135.51900 1.000 34.29922  ? 340 LYS C CG  1 
ATOM   9305  C CD  . LYS C 1 340 ? 131.34900 107.85100 136.14000 1.000 34.29922  ? 340 LYS C CD  1 
ATOM   9306  C CE  . LYS C 1 340 ? 130.08300 108.41800 136.74100 1.000 34.29922  ? 340 LYS C CE  1 
ATOM   9307  N NZ  . LYS C 1 340 ? 130.30300 109.76300 137.32800 1.000 34.29922  ? 340 LYS C NZ  1 
ATOM   9308  N N   . PHE C 1 341 ? 131.79400 104.94300 131.71400 1.000 32.80703  ? 341 PHE C N   1 
ATOM   9309  C CA  . PHE C 1 341 ? 130.97300 105.00300 130.51400 1.000 32.80703  ? 341 PHE C CA  1 
ATOM   9310  C C   . PHE C 1 341 ? 130.54300 103.61500 130.06800 1.000 32.80703  ? 341 PHE C C   1 
ATOM   9311  O O   . PHE C 1 341 ? 129.43500 103.44000 129.55300 1.000 32.80703  ? 341 PHE C O   1 
ATOM   9312  C CB  . PHE C 1 341 ? 131.74000 105.70900 129.40400 1.000 32.80703  ? 341 PHE C CB  1 
ATOM   9313  C CG  . PHE C 1 341 ? 130.99600 105.79300 128.11100 1.000 32.80703  ? 341 PHE C CG  1 
ATOM   9314  C CD1 . PHE C 1 341 ? 129.89400 106.61900 127.98400 1.000 32.80703  ? 341 PHE C CD1 1 
ATOM   9315  C CD2 . PHE C 1 341 ? 131.40400 105.05300 127.01500 1.000 32.80703  ? 341 PHE C CD2 1 
ATOM   9316  C CE1 . PHE C 1 341 ? 129.21100 106.69800 126.79600 1.000 32.80703  ? 341 PHE C CE1 1 
ATOM   9317  C CE2 . PHE C 1 341 ? 130.72300 105.13200 125.82300 1.000 32.80703  ? 341 PHE C CE2 1 
ATOM   9318  C CZ  . PHE C 1 341 ? 129.62500 105.95600 125.71600 1.000 32.80703  ? 341 PHE C CZ  1 
ATOM   9319  N N   . LYS C 1 342 ? 131.40600 102.61700 130.25000 1.000 32.78013  ? 342 LYS C N   1 
ATOM   9320  C CA  . LYS C 1 342 ? 131.08500 101.26800 129.79900 1.000 32.78013  ? 342 LYS C CA  1 
ATOM   9321  C C   . LYS C 1 342 ? 130.02500 100.62700 130.67300 1.000 32.78013  ? 342 LYS C C   1 
ATOM   9322  O O   . LYS C 1 342 ? 129.21000 99.83500  130.19100 1.000 32.78013  ? 342 LYS C O   1 
ATOM   9323  C CB  . LYS C 1 342 ? 132.33600 100.40100 129.79900 1.000 32.78013  ? 342 LYS C CB  1 
ATOM   9324  C CG  . LYS C 1 342 ? 133.09900 100.39600 128.50800 1.000 32.78013  ? 342 LYS C CG  1 
ATOM   9325  C CD  . LYS C 1 342 ? 134.49300 99.84800  128.71700 1.000 32.78013  ? 342 LYS C CD  1 
ATOM   9326  C CE  . LYS C 1 342 ? 134.46300 98.45900  129.32400 1.000 32.78013  ? 342 LYS C CE  1 
ATOM   9327  N NZ  . LYS C 1 342 ? 135.82800 98.00200  129.68900 1.000 32.78013  ? 342 LYS C NZ  1 
ATOM   9328  N N   . THR C 1 343 ? 130.02100 100.94900 131.96300 1.000 36.19414  ? 343 THR C N   1 
ATOM   9329  C CA  . THR C 1 343 ? 129.18400 100.25300 132.92800 1.000 36.19414  ? 343 THR C CA  1 
ATOM   9330  C C   . THR C 1 343 ? 128.02300 101.09600 133.43100 1.000 36.19414  ? 343 THR C C   1 
ATOM   9331  O O   . THR C 1 343 ? 126.88900 100.62500 133.45500 1.000 36.19414  ? 343 THR C O   1 
ATOM   9332  C CB  . THR C 1 343 ? 130.03100 99.79300  134.11300 1.000 36.19414  ? 343 THR C CB  1 
ATOM   9333  O OG1 . THR C 1 343 ? 130.48600 100.93400 134.84100 1.000 36.19414  ? 343 THR C OG1 1 
ATOM   9334  C CG2 . THR C 1 343 ? 131.22300 99.01400  133.62800 1.000 36.19414  ? 343 THR C CG2 1 
ATOM   9335  N N   . GLU C 1 344 ? 128.27600 102.33000 133.84300 1.000 39.14141  ? 344 GLU C N   1 
ATOM   9336  C CA  . GLU C 1 344 ? 127.22600 103.15700 134.41900 1.000 39.14141  ? 344 GLU C CA  1 
ATOM   9337  C C   . GLU C 1 344 ? 126.48200 103.97100 133.38900 1.000 39.14141  ? 344 GLU C C   1 
ATOM   9338  O O   . GLU C 1 344 ? 125.71900 104.85900 133.77200 1.000 39.14141  ? 344 GLU C O   1 
ATOM   9339  C CB  . GLU C 1 344 ? 127.80500 104.08800 135.48600 1.000 39.14141  ? 344 GLU C CB  1 
ATOM   9340  N N   . GLY C 1 345 ? 126.67400 103.69400 132.10500 1.000 41.00233  ? 345 GLY C N   1 
ATOM   9341  C CA  . GLY C 1 345 ? 125.98900 104.45900 131.08300 1.000 41.00233  ? 345 GLY C CA  1 
ATOM   9342  C C   . GLY C 1 345 ? 126.50900 105.87700 131.00600 1.000 41.00233  ? 345 GLY C C   1 
ATOM   9343  O O   . GLY C 1 345 ? 127.70200 106.14100 131.17400 1.000 41.00233  ? 345 GLY C O   1 
ATOM   9344  N N   . LEU C 1 346 ? 125.59800 106.81100 130.76000 1.000 45.73139  ? 346 LEU C N   1 
ATOM   9345  C CA  . LEU C 1 346 ? 125.93400 108.22300 130.67800 1.000 45.73139  ? 346 LEU C CA  1 
ATOM   9346  C C   . LEU C 1 346 ? 125.28800 109.02100 131.80300 1.000 45.73139  ? 346 LEU C C   1 
ATOM   9347  O O   . LEU C 1 346 ? 125.97500 109.74800 132.52500 1.000 45.73139  ? 346 LEU C O   1 
ATOM   9348  C CB  . LEU C 1 346 ? 125.51200 108.78100 129.31600 1.000 45.73139  ? 346 LEU C CB  1 
ATOM   9349  C CG  . LEU C 1 346 ? 126.08400 110.14900 128.96100 1.000 45.73139  ? 346 LEU C CG  1 
ATOM   9350  C CD1 . LEU C 1 346 ? 127.53900 110.01400 128.58200 1.000 45.73139  ? 346 LEU C CD1 1 
ATOM   9351  C CD2 . LEU C 1 346 ? 125.28500 110.77700 127.83900 1.000 45.73139  ? 346 LEU C CD2 1 
ATOM   9352  N N   . LYS C 1 347 ? 123.97300 108.90200 131.97100 1.000 50.02708  ? 347 LYS C N   1 
ATOM   9353  C CA  . LYS C 1 347 ? 123.24600 109.59300 133.03600 1.000 50.02708  ? 347 LYS C CA  1 
ATOM   9354  C C   . LYS C 1 347 ? 122.41600 108.54000 133.76600 1.000 50.02708  ? 347 LYS C C   1 
ATOM   9355  O O   . LYS C 1 347 ? 121.24900 108.31600 133.43600 1.000 50.02708  ? 347 LYS C O   1 
ATOM   9356  C CB  . LYS C 1 347 ? 122.38000 110.71400 132.48000 1.000 50.02708  ? 347 LYS C CB  1 
ATOM   9357  N N   . GLN C 1 348 ? 123.03300 107.89000 134.75000 1.000 47.76079  ? 348 GLN C N   1 
ATOM   9358  C CA  . GLN C 1 348 ? 122.34400 106.90200 135.56900 1.000 47.76079  ? 348 GLN C CA  1 
ATOM   9359  C C   . GLN C 1 348 ? 121.85200 107.51500 136.87400 1.000 47.76079  ? 348 GLN C C   1 
ATOM   9360  O O   . GLN C 1 348 ? 120.77800 107.16100 137.36700 1.000 47.76079  ? 348 GLN C O   1 
ATOM   9361  C CB  . GLN C 1 348 ? 123.27300 105.71800 135.84200 1.000 47.76079  ? 348 GLN C CB  1 
ATOM   9362  C CG  . GLN C 1 348 ? 122.70200 104.66900 136.75600 1.000 47.76079  ? 348 GLN C CG  1 
ATOM   9363  C CD  . GLN C 1 348 ? 123.71000 103.62100 137.13100 1.000 47.76079  ? 348 GLN C CD  1 
ATOM   9364  O OE1 . GLN C 1 348 ? 124.02800 102.74100 136.33700 1.000 47.76079  ? 348 GLN C OE1 1 
ATOM   9365  N NE2 . GLN C 1 348 ? 124.22900 103.71000 138.34700 1.000 47.76079  ? 348 GLN C NE2 1 
ATOM   9366  N N   . GLN C 1 349 ? 122.61800 108.45200 137.43400 1.000 48.93116  ? 349 GLN C N   1 
ATOM   9367  C CA  . GLN C 1 349 ? 122.17700 109.13100 138.64400 1.000 48.93116  ? 349 GLN C CA  1 
ATOM   9368  C C   . GLN C 1 349 ? 120.99400 110.04300 138.37000 1.000 48.93116  ? 349 GLN C C   1 
ATOM   9369  O O   . GLN C 1 349 ? 120.15900 110.25400 139.25200 1.000 48.93116  ? 349 GLN C O   1 
ATOM   9370  C CB  . GLN C 1 349 ? 123.32900 109.92800 139.25500 1.000 48.93116  ? 349 GLN C CB  1 
ATOM   9371  N N   . GLU C 1 350 ? 120.89700 110.58800 137.15800 1.000 47.60814  ? 350 GLU C N   1 
ATOM   9372  C CA  . GLU C 1 350 ? 119.72500 111.37400 136.79800 1.000 47.60814  ? 350 GLU C CA  1 
ATOM   9373  C C   . GLU C 1 350 ? 118.54500 110.49700 136.41900 1.000 47.60814  ? 350 GLU C C   1 
ATOM   9374  O O   . GLU C 1 350 ? 117.41200 110.98000 136.40400 1.000 47.60814  ? 350 GLU C O   1 
ATOM   9375  C CB  . GLU C 1 350 ? 120.05600 112.32500 135.65100 1.000 47.60814  ? 350 GLU C CB  1 
ATOM   9376  N N   . THR C 1 351 ? 118.78600 109.22500 136.10600 1.000 47.02711  ? 351 THR C N   1 
ATOM   9377  C CA  . THR C 1 351 ? 117.69800 108.30600 135.79300 1.000 47.02711  ? 351 THR C CA  1 
ATOM   9378  C C   . THR C 1 351 ? 116.90200 107.95900 137.03800 1.000 47.02711  ? 351 THR C C   1 
ATOM   9379  O O   . THR C 1 351 ? 115.68400 108.15100 137.07900 1.000 47.02711  ? 351 THR C O   1 
ATOM   9380  C CB  . THR C 1 351 ? 118.25400 107.03500 135.15300 1.000 47.02711  ? 351 THR C CB  1 
ATOM   9381  O OG1 . THR C 1 351 ? 118.75500 107.33700 133.84700 1.000 47.02711  ? 351 THR C OG1 1 
ATOM   9382  C CG2 . THR C 1 351 ? 117.18200 105.96600 135.04800 1.000 47.02711  ? 351 THR C CG2 1 
ATOM   9383  N N   . LEU C 1 352 ? 117.58000 107.45600 138.06800 1.000 47.53906  ? 352 LEU C N   1 
ATOM   9384  C CA  . LEU C 1 352 ? 116.94100 107.03200 139.30400 1.000 47.53906  ? 352 LEU C CA  1 
ATOM   9385  C C   . LEU C 1 352 ? 116.93800 108.11700 140.37000 1.000 47.53906  ? 352 LEU C C   1 
ATOM   9386  O O   . LEU C 1 352 ? 116.90400 107.81300 141.56500 1.000 47.53906  ? 352 LEU C O   1 
ATOM   9387  C CB  . LEU C 1 352 ? 117.59300 105.74400 139.80800 1.000 47.53906  ? 352 LEU C CB  1 
ATOM   9388  C CG  . LEU C 1 352 ? 119.11300 105.60600 139.89000 1.000 47.53906  ? 352 LEU C CG  1 
ATOM   9389  C CD1 . LEU C 1 352 ? 119.71200 106.12800 141.18300 1.000 47.53906  ? 352 LEU C CD1 1 
ATOM   9390  C CD2 . LEU C 1 352 ? 119.46900 104.15100 139.69500 1.000 47.53906  ? 352 LEU C CD2 1 
ATOM   9391  N N   . ASN C 1 353 ? 116.97600 109.37900 139.96700 1.000 49.41544  ? 353 ASN C N   1 
ATOM   9392  C CA  . ASN C 1 353 ? 116.58400 110.48100 140.82700 1.000 49.41544  ? 353 ASN C CA  1 
ATOM   9393  C C   . ASN C 1 353 ? 115.18200 110.96100 140.51400 1.000 49.41544  ? 353 ASN C C   1 
ATOM   9394  O O   . ASN C 1 353 ? 114.71800 111.92600 141.12400 1.000 49.41544  ? 353 ASN C O   1 
ATOM   9395  C CB  . ASN C 1 353 ? 117.56200 111.64800 140.69200 1.000 49.41544  ? 353 ASN C CB  1 
ATOM   9396  C CG  . ASN C 1 353 ? 118.68700 111.58400 141.69700 1.000 49.41544  ? 353 ASN C CG  1 
ATOM   9397  O OD1 . ASN C 1 353 ? 118.60300 110.87400 142.69500 1.000 49.41544  ? 353 ASN C OD1 1 
ATOM   9398  N ND2 . ASN C 1 353 ? 119.75100 112.33200 141.44000 1.000 49.41544  ? 353 ASN C ND2 1 
ATOM   9399  N N   . ASN C 1 354 ? 114.50800 110.32300 139.55800 1.000 48.75953  ? 354 ASN C N   1 
ATOM   9400  C CA  . ASN C 1 354 ? 113.14200 110.65900 139.19900 1.000 48.75953  ? 354 ASN C CA  1 
ATOM   9401  C C   . ASN C 1 354 ? 112.13400 109.59900 139.60600 1.000 48.75953  ? 354 ASN C C   1 
ATOM   9402  O O   . ASN C 1 354 ? 110.93700 109.89600 139.63800 1.000 48.75953  ? 354 ASN C O   1 
ATOM   9403  C CB  . ASN C 1 354 ? 113.03100 110.89200 137.68800 1.000 48.75953  ? 354 ASN C CB  1 
ATOM   9404  C CG  . ASN C 1 354 ? 113.73900 112.14800 137.24400 1.000 48.75953  ? 354 ASN C CG  1 
ATOM   9405  O OD1 . ASN C 1 354 ? 114.73700 112.09200 136.53200 1.000 48.75953  ? 354 ASN C OD1 1 
ATOM   9406  N ND2 . ASN C 1 354 ? 113.22100 113.29500 137.65900 1.000 48.75953  ? 354 ASN C ND2 1 
ATOM   9407  N N   . LEU C 1 355 ? 112.57800 108.38300 139.89500 1.000 48.52226  ? 355 LEU C N   1 
ATOM   9408  C CA  . LEU C 1 355 ? 111.68800 107.38100 140.45400 1.000 48.52226  ? 355 LEU C CA  1 
ATOM   9409  C C   . LEU C 1 355 ? 111.29300 107.79400 141.86900 1.000 48.52226  ? 355 LEU C C   1 
ATOM   9410  O O   . LEU C 1 355 ? 112.14800 108.25500 142.63300 1.000 48.52226  ? 355 LEU C O   1 
ATOM   9411  C CB  . LEU C 1 355 ? 112.37500 106.02200 140.46500 1.000 48.52226  ? 355 LEU C CB  1 
ATOM   9412  C CG  . LEU C 1 355 ? 112.92800 105.62600 139.10800 1.000 48.52226  ? 355 LEU C CG  1 
ATOM   9413  C CD1 . LEU C 1 355 ? 113.92700 104.50800 139.27400 1.000 48.52226  ? 355 LEU C CD1 1 
ATOM   9414  C CD2 . LEU C 1 355 ? 111.78800 105.20900 138.21000 1.000 48.52226  ? 355 LEU C CD2 1 
ATOM   9415  N N   . PRO C 1 356 ? 110.00400 107.67600 142.23700 1.000 48.32406  ? 356 PRO C N   1 
ATOM   9416  C CA  . PRO C 1 356 ? 109.49100 108.42700 143.39400 1.000 48.32406  ? 356 PRO C CA  1 
ATOM   9417  C C   . PRO C 1 356 ? 110.05400 108.08800 144.77300 1.000 48.32406  ? 356 PRO C C   1 
ATOM   9418  O O   . PRO C 1 356 ? 110.82800 108.88300 145.31600 1.000 48.32406  ? 356 PRO C O   1 
ATOM   9419  C CB  . PRO C 1 356 ? 107.98800 108.12500 143.34300 1.000 48.32406  ? 356 PRO C CB  1 
ATOM   9420  C CG  . PRO C 1 356 ? 107.87300 106.86400 142.56500 1.000 48.32406  ? 356 PRO C CG  1 
ATOM   9421  C CD  . PRO C 1 356 ? 108.95400 106.90200 141.56300 1.000 48.32406  ? 356 PRO C CD  1 
ATOM   9422  N N   . LYS C 1 357 ? 109.69900 106.94600 145.35900 1.000 50.33407  ? 357 LYS C N   1 
ATOM   9423  C CA  . LYS C 1 357 ? 110.35000 106.52300 146.59200 1.000 50.33407  ? 357 LYS C CA  1 
ATOM   9424  C C   . LYS C 1 357 ? 110.44700 105.01100 146.69200 1.000 50.33407  ? 357 LYS C C   1 
ATOM   9425  O O   . LYS C 1 357 ? 111.32900 104.48100 147.36900 1.000 50.33407  ? 357 LYS C O   1 
ATOM   9426  C CB  . LYS C 1 357 ? 109.60900 107.07800 147.80800 1.000 50.33407  ? 357 LYS C CB  1 
ATOM   9427  N N   . ALA C 1 358 ? 109.53200 104.31300 146.03100 1.000 50.21388  ? 358 ALA C N   1 
ATOM   9428  C CA  . ALA C 1 358 ? 109.36800 102.88200 146.21600 1.000 50.21388  ? 358 ALA C CA  1 
ATOM   9429  C C   . ALA C 1 358 ? 109.73900 102.07300 144.99400 1.000 50.21388  ? 358 ALA C C   1 
ATOM   9430  O O   . ALA C 1 358 ? 109.95000 100.86600 145.11100 1.000 50.21388  ? 358 ALA C O   1 
ATOM   9431  C CB  . ALA C 1 358 ? 107.92500 102.55700 146.60500 1.000 50.21388  ? 358 ALA C CB  1 
ATOM   9432  N N   . ILE C 1 359 ? 109.79600 102.70100 143.82100 1.000 49.53435  ? 359 ILE C N   1 
ATOM   9433  C CA  . ILE C 1 359 ? 110.42900 102.05600 142.68000 1.000 49.53435  ? 359 ILE C CA  1 
ATOM   9434  C C   . ILE C 1 359 ? 111.92800 101.99700 142.90100 1.000 49.53435  ? 359 ILE C C   1 
ATOM   9435  O O   . ILE C 1 359 ? 112.58400 101.00600 142.56900 1.000 49.53435  ? 359 ILE C O   1 
ATOM   9436  C CB  . ILE C 1 359 ? 110.08100 102.79400 141.37600 1.000 49.53435  ? 359 ILE C CB  1 
ATOM   9437  C CG1 . ILE C 1 359 ? 108.60400 103.18000 141.33900 1.000 49.53435  ? 359 ILE C CG1 1 
ATOM   9438  C CG2 . ILE C 1 359 ? 110.43100 101.93800 140.18900 1.000 49.53435  ? 359 ILE C CG2 1 
ATOM   9439  C CD1 . ILE C 1 359 ? 107.66700 102.01600 141.19200 1.000 49.53435  ? 359 ILE C CD1 1 
ATOM   9440  N N   . ARG C 1 360 ? 112.48900 103.05400 143.49000 1.000 51.51277  ? 360 ARG C N   1 
ATOM   9441  C CA  . ARG C 1 360 ? 113.92300 103.10800 143.74100 1.000 51.51277  ? 360 ARG C CA  1 
ATOM   9442  C C   . ARG C 1 360 ? 114.32600 102.16000 144.86100 1.000 51.51277  ? 360 ARG C C   1 
ATOM   9443  O O   . ARG C 1 360 ? 115.34600 101.47000 144.76800 1.000 51.51277  ? 360 ARG C O   1 
ATOM   9444  C CB  . ARG C 1 360 ? 114.32800 104.53400 144.08100 1.000 51.51277  ? 360 ARG C CB  1 
ATOM   9445  C CG  . ARG C 1 360 ? 115.75000 104.86700 143.74000 1.000 51.51277  ? 360 ARG C CG  1 
ATOM   9446  C CD  . ARG C 1 360 ? 116.10200 106.20900 144.31900 1.000 51.51277  ? 360 ARG C CD  1 
ATOM   9447  N NE  . ARG C 1 360 ? 115.01000 107.15500 144.13700 1.000 51.51277  ? 360 ARG C NE  1 
ATOM   9448  C CZ  . ARG C 1 360 ? 114.94800 108.34200 144.72600 1.000 51.51277  ? 360 ARG C CZ  1 
ATOM   9449  N NH1 . ARG C 1 360 ? 115.92100 108.73000 145.53800 1.000 51.51277  ? 360 ARG C NH1 1 
ATOM   9450  N NH2 . ARG C 1 360 ? 113.91500 109.14000 144.50400 1.000 51.51277  ? 360 ARG C NH2 1 
ATOM   9451  N N   . SER C 1 361 ? 113.53300 102.10800 145.93000 1.000 50.79872  ? 361 SER C N   1 
ATOM   9452  C CA  . SER C 1 361 ? 113.84600 101.24500 147.06100 1.000 50.79872  ? 361 SER C CA  1 
ATOM   9453  C C   . SER C 1 361 ? 113.52400 99.78400  146.80100 1.000 50.79872  ? 361 SER C C   1 
ATOM   9454  O O   . SER C 1 361 ? 113.89400 98.93800  147.61600 1.000 50.79872  ? 361 SER C O   1 
ATOM   9455  C CB  . SER C 1 361 ? 113.09600 101.71600 148.30000 1.000 50.79872  ? 361 SER C CB  1 
ATOM   9456  O OG  . SER C 1 361 ? 113.55200 102.99000 148.70600 1.000 50.79872  ? 361 SER C OG  1 
ATOM   9457  N N   . SER C 1 362 ? 112.83400 99.46600  145.71300 1.000 50.41179  ? 362 SER C N   1 
ATOM   9458  C CA  . SER C 1 362 ? 112.66700 98.07700  145.31800 1.000 50.41179  ? 362 SER C CA  1 
ATOM   9459  C C   . SER C 1 362 ? 113.72000 97.63700  144.31800 1.000 50.41179  ? 362 SER C C   1 
ATOM   9460  O O   . SER C 1 362 ? 113.94500 96.43400  144.15600 1.000 50.41179  ? 362 SER C O   1 
ATOM   9461  C CB  . SER C 1 362 ? 111.27800 97.85400  144.72600 1.000 50.41179  ? 362 SER C CB  1 
ATOM   9462  O OG  . SER C 1 362 ? 110.95800 96.47700  144.69800 1.000 50.41179  ? 362 SER C OG  1 
ATOM   9463  N N   . ILE C 1 363 ? 114.34900 98.58700  143.62400 1.000 50.35920  ? 363 ILE C N   1 
ATOM   9464  C CA  . ILE C 1 363 ? 115.51500 98.26800  142.80700 1.000 50.35920  ? 363 ILE C CA  1 
ATOM   9465  C C   . ILE C 1 363 ? 116.67100 97.85700  143.70500 1.000 50.35920  ? 363 ILE C C   1 
ATOM   9466  O O   . ILE C 1 363 ? 117.32800 96.83400  143.48000 1.000 50.35920  ? 363 ILE C O   1 
ATOM   9467  C CB  . ILE C 1 363 ? 115.88600 99.46600  141.91500 1.000 50.35920  ? 363 ILE C CB  1 
ATOM   9468  C CG1 . ILE C 1 363 ? 114.91400 99.58800  140.74900 1.000 50.35920  ? 363 ILE C CG1 1 
ATOM   9469  C CG2 . ILE C 1 363 ? 117.28600 99.33700  141.37600 1.000 50.35920  ? 363 ILE C CG2 1 
ATOM   9470  C CD1 . ILE C 1 363 ? 114.89800 100.95300 140.13600 1.000 50.35920  ? 363 ILE C CD1 1 
ATOM   9471  N N   . ALA C 1 364 ? 116.88600 98.61200  144.78400 1.000 52.53229  ? 364 ALA C N   1 
ATOM   9472  C CA  . ALA C 1 364 ? 117.99600 98.34600  145.68900 1.000 52.53229  ? 364 ALA C CA  1 
ATOM   9473  C C   . ALA C 1 364 ? 117.73500 97.17700  146.63100 1.000 52.53229  ? 364 ALA C C   1 
ATOM   9474  O O   . ALA C 1 364 ? 118.56900 96.90500  147.49600 1.000 52.53229  ? 364 ALA C O   1 
ATOM   9475  C CB  . ALA C 1 364 ? 118.30800 99.60000  146.50000 1.000 52.53229  ? 364 ALA C CB  1 
ATOM   9476  N N   . ASN C 1 365 ? 116.60200 96.48900  146.50500 1.000 54.85177  ? 365 ASN C N   1 
ATOM   9477  C CA  . ASN C 1 365 ? 116.33600 95.31200  147.32100 1.000 54.85177  ? 365 ASN C CA  1 
ATOM   9478  C C   . ASN C 1 365 ? 116.37400 94.03400  146.50300 1.000 54.85177  ? 365 ASN C C   1 
ATOM   9479  O O   . ASN C 1 365 ? 116.54200 92.95000  147.06200 1.000 54.85177  ? 365 ASN C O   1 
ATOM   9480  C CB  . ASN C 1 365 ? 114.98600 95.43400  148.02400 1.000 54.85177  ? 365 ASN C CB  1 
ATOM   9481  C CG  . ASN C 1 365 ? 115.02600 96.38800  149.19100 1.000 54.85177  ? 365 ASN C CG  1 
ATOM   9482  O OD1 . ASN C 1 365 ? 113.99400 96.75200  149.74800 1.000 54.85177  ? 365 ASN C OD1 1 
ATOM   9483  N ND2 . ASN C 1 365 ? 116.22200 96.81200  149.56000 1.000 54.85177  ? 365 ASN C ND2 1 
ATOM   9484  N N   . TYR C 1 366 ? 116.18000 94.12100  145.19000 1.000 54.68734  ? 366 TYR C N   1 
ATOM   9485  C CA  . TYR C 1 366 ? 116.56900 92.99800  144.35000 1.000 54.68734  ? 366 TYR C CA  1 
ATOM   9486  C C   . TYR C 1 366 ? 118.07500 92.98800  144.16800 1.000 54.68734  ? 366 TYR C C   1 
ATOM   9487  O O   . TYR C 1 366 ? 118.70900 91.92800  144.18600 1.000 54.68734  ? 366 TYR C O   1 
ATOM   9488  C CB  . TYR C 1 366 ? 115.86400 93.06600  142.99800 1.000 54.68734  ? 366 TYR C CB  1 
ATOM   9489  C CG  . TYR C 1 366 ? 116.20200 91.91200  142.08600 1.000 54.68734  ? 366 TYR C CG  1 
ATOM   9490  C CD1 . TYR C 1 366 ? 117.14900 92.04800  141.08000 1.000 54.68734  ? 366 TYR C CD1 1 
ATOM   9491  C CD2 . TYR C 1 366 ? 115.57800 90.68500  142.23600 1.000 54.68734  ? 366 TYR C CD2 1 
ATOM   9492  C CE1 . TYR C 1 366 ? 117.46800 90.99500  140.25600 1.000 54.68734  ? 366 TYR C CE1 1 
ATOM   9493  C CE2 . TYR C 1 366 ? 115.88600 89.62400  141.40900 1.000 54.68734  ? 366 TYR C CE2 1 
ATOM   9494  C CZ  . TYR C 1 366 ? 116.83100 89.78500  140.42200 1.000 54.68734  ? 366 TYR C CZ  1 
ATOM   9495  O OH  . TYR C 1 366 ? 117.14300 88.73100  139.59700 1.000 54.68734  ? 366 TYR C OH  1 
ATOM   9496  N N   . LEU C 1 367 ? 118.65700 94.16600  143.99400 1.000 53.64144  ? 367 LEU C N   1 
ATOM   9497  C CA  . LEU C 1 367 ? 120.08600 94.32400  143.79400 1.000 53.64144  ? 367 LEU C CA  1 
ATOM   9498  C C   . LEU C 1 367 ? 120.77400 94.41500  145.14500 1.000 53.64144  ? 367 LEU C C   1 
ATOM   9499  O O   . LEU C 1 367 ? 120.34300 95.18400  146.00900 1.000 53.64144  ? 367 LEU C O   1 
ATOM   9500  C CB  . LEU C 1 367 ? 120.36900 95.58600  142.98400 1.000 53.64144  ? 367 LEU C CB  1 
ATOM   9501  C CG  . LEU C 1 367 ? 120.67300 95.50100  141.50000 1.000 53.64144  ? 367 LEU C CG  1 
ATOM   9502  C CD1 . LEU C 1 367 ? 119.60400 94.73100  140.78200 1.000 53.64144  ? 367 LEU C CD1 1 
ATOM   9503  C CD2 . LEU C 1 367 ? 120.75200 96.90800  140.97400 1.000 53.64144  ? 367 LEU C CD2 1 
ATOM   9504  N N   . PHE C 1 368 ? 121.85800 93.65000  145.29700 1.000 56.97484  ? 368 PHE C N   1 
ATOM   9505  C CA  . PHE C 1 368 ? 122.79900 93.64800  146.43400 1.000 56.97484  ? 368 PHE C CA  1 
ATOM   9506  C C   . PHE C 1 368 ? 122.13000 93.64800  147.81400 1.000 56.97484  ? 368 PHE C C   1 
ATOM   9507  O O   . PHE C 1 368 ? 122.64200 94.21800  148.77700 1.000 56.97484  ? 368 PHE C O   1 
ATOM   9508  C CB  . PHE C 1 368 ? 123.83800 94.78200  146.32400 1.000 56.97484  ? 368 PHE C CB  1 
ATOM   9509  C CG  . PHE C 1 368 ? 123.27300 96.16900  146.10100 1.000 56.97484  ? 368 PHE C CG  1 
ATOM   9510  C CD1 . PHE C 1 368 ? 122.79800 96.92700  147.15800 1.000 56.97484  ? 368 PHE C CD1 1 
ATOM   9511  C CD2 . PHE C 1 368 ? 123.25600 96.72200  144.83000 1.000 56.97484  ? 368 PHE C CD2 1 
ATOM   9512  C CE1 . PHE C 1 368 ? 122.29700 98.19400  146.94700 1.000 56.97484  ? 368 PHE C CE1 1 
ATOM   9513  C CE2 . PHE C 1 368 ? 122.74700 97.98600  144.61600 1.000 56.97484  ? 368 PHE C CE2 1 
ATOM   9514  C CZ  . PHE C 1 368 ? 122.27700 98.72500  145.67500 1.000 56.97484  ? 368 PHE C CZ  1 
ATOM   9515  N N   . PHE C 1 369 ? 120.98400 92.98100  147.92100 1.000 59.44313  ? 369 PHE C N   1 
ATOM   9516  C CA  . PHE C 1 369 ? 120.42800 92.71900  149.24600 1.000 59.44313  ? 369 PHE C CA  1 
ATOM   9517  C C   . PHE C 1 369 ? 121.07100 91.50900  149.92300 1.000 59.44313  ? 369 PHE C C   1 
ATOM   9518  O O   . PHE C 1 369 ? 121.34600 91.59500  151.12300 1.000 59.44313  ? 369 PHE C O   1 
ATOM   9519  C CB  . PHE C 1 369 ? 118.91000 92.56000  149.20600 1.000 59.44313  ? 369 PHE C CB  1 
ATOM   9520  C CG  . PHE C 1 369 ? 118.31600 92.10400  150.50400 1.000 59.44313  ? 369 PHE C CG  1 
ATOM   9521  C CD1 . PHE C 1 369 ? 118.24900 92.96500  151.58300 1.000 59.44313  ? 369 PHE C CD1 1 
ATOM   9522  C CD2 . PHE C 1 369 ? 117.80800 90.81900  150.64000 1.000 59.44313  ? 369 PHE C CD2 1 
ATOM   9523  C CE1 . PHE C 1 369 ? 117.69600 92.55300  152.77600 1.000 59.44313  ? 369 PHE C CE1 1 
ATOM   9524  C CE2 . PHE C 1 369 ? 117.25400 90.40100  151.83500 1.000 59.44313  ? 369 PHE C CE2 1 
ATOM   9525  C CZ  . PHE C 1 369 ? 117.19800 91.27000  152.90200 1.000 59.44313  ? 369 PHE C CZ  1 
ATOM   9526  N N   . PRO C 1 370 ? 121.35400 90.35600  149.23500 1.000 58.72740  ? 370 PRO C N   1 
ATOM   9527  C CA  . PRO C 1 370 ? 122.15700 89.32900  149.91500 1.000 58.72740  ? 370 PRO C CA  1 
ATOM   9528  C C   . PRO C 1 370 ? 123.65300 89.59200  149.86600 1.000 58.72740  ? 370 PRO C C   1 
ATOM   9529  O O   . PRO C 1 370 ? 124.45000 88.67500  150.07300 1.000 58.72740  ? 370 PRO C O   1 
ATOM   9530  C CB  . PRO C 1 370 ? 121.79800 88.04000  149.16300 1.000 58.72740  ? 370 PRO C CB  1 
ATOM   9531  C CG  . PRO C 1 370 ? 120.56100 88.35600  148.42000 1.000 58.72740  ? 370 PRO C CG  1 
ATOM   9532  C CD  . PRO C 1 370 ? 120.75200 89.76700  148.02200 1.000 58.72740  ? 370 PRO C CD  1 
ATOM   9533  N N   . ILE C 1 371 ? 124.04800 90.82200  149.56000 1.000 56.60068  ? 371 ILE C N   1 
ATOM   9534  C CA  . ILE C 1 371 ? 125.43800 91.24100  149.63700 1.000 56.60068  ? 371 ILE C CA  1 
ATOM   9535  C C   . ILE C 1 371 ? 125.66000 91.90500  150.98700 1.000 56.60068  ? 371 ILE C C   1 
ATOM   9536  O O   . ILE C 1 371 ? 126.64600 91.62700  151.67600 1.000 56.60068  ? 371 ILE C O   1 
ATOM   9537  C CB  . ILE C 1 371 ? 125.79100 92.18300  148.47500 1.000 56.60068  ? 371 ILE C CB  1 
ATOM   9538  C CG1 . ILE C 1 371 ? 125.71900 91.42400  147.15500 1.000 56.60068  ? 371 ILE C CG1 1 
ATOM   9539  C CG2 . ILE C 1 371 ? 127.17300 92.77100  148.65500 1.000 56.60068  ? 371 ILE C CG2 1 
ATOM   9540  C CD1 . ILE C 1 371 ? 126.63800 90.23400  147.09600 1.000 56.60068  ? 371 ILE C CD1 1 
ATOM   9541  N N   . VAL C 1 372 ? 124.72700 92.76400  151.38800 1.000 55.91893  ? 372 VAL C N   1 
ATOM   9542  C CA  . VAL C 1 372 ? 124.83200 93.48800  152.64800 1.000 55.91893  ? 372 VAL C CA  1 
ATOM   9543  C C   . VAL C 1 372 ? 124.23600 92.62600  153.75400 1.000 55.91893  ? 372 VAL C C   1 
ATOM   9544  O O   . VAL C 1 372 ? 124.36000 92.94100  154.94300 1.000 55.91893  ? 372 VAL C O   1 
ATOM   9545  C CB  . VAL C 1 372 ? 124.13500 94.85900  152.55200 1.000 55.91893  ? 372 VAL C CB  1 
ATOM   9546  C CG1 . VAL C 1 372 ? 122.64200 94.71300  152.72600 1.000 55.91893  ? 372 VAL C CG1 1 
ATOM   9547  C CG2 . VAL C 1 372 ? 124.71100 95.85000  153.54500 1.000 55.91893  ? 372 VAL C CG2 1 
ATOM   9548  N N   . HIS C 1 373 ? 123.59800 91.52000  153.37500 1.000 60.98808  ? 373 HIS C N   1 
ATOM   9549  C CA  . HIS C 1 373 ? 122.99000 90.64500  154.37100 1.000 60.98808  ? 373 HIS C CA  1 
ATOM   9550  C C   . HIS C 1 373 ? 124.04200 89.84500  155.12400 1.000 60.98808  ? 373 HIS C C   1 
ATOM   9551  O O   . HIS C 1 373 ? 124.20300 89.99800  156.33900 1.000 60.98808  ? 373 HIS C O   1 
ATOM   9552  C CB  . HIS C 1 373 ? 121.99600 89.70200  153.70200 1.000 60.98808  ? 373 HIS C CB  1 
ATOM   9553  C CG  . HIS C 1 373 ? 121.26400 88.82300  154.66300 1.000 60.98808  ? 373 HIS C CG  1 
ATOM   9554  N ND1 . HIS C 1 373 ? 120.41000 89.32000  155.62100 1.000 60.98808  ? 373 HIS C ND1 1 
ATOM   9555  C CD2 . HIS C 1 373 ? 121.25700 87.47800  154.81200 1.000 60.98808  ? 373 HIS C CD2 1 
ATOM   9556  C CE1 . HIS C 1 373 ? 119.90800 88.31900  156.32100 1.000 60.98808  ? 373 HIS C CE1 1 
ATOM   9557  N NE2 . HIS C 1 373 ? 120.40600 87.19100  155.85000 1.000 60.98808  ? 373 HIS C NE2 1 
ATOM   9558  N N   . ASN C 1 374 ? 124.78100 88.99600  154.41800 1.000 60.22176  ? 374 ASN C N   1 
ATOM   9559  C CA  . ASN C 1 374 ? 125.65600 88.03000  155.07200 1.000 60.22176  ? 374 ASN C CA  1 
ATOM   9560  C C   . ASN C 1 374 ? 127.09400 88.54300  155.10600 1.000 60.22176  ? 374 ASN C C   1 
ATOM   9561  O O   . ASN C 1 374 ? 128.01100 87.97500  154.51800 1.000 60.22176  ? 374 ASN C O   1 
ATOM   9562  C CB  . ASN C 1 374 ? 125.54500 86.67100  154.38600 1.000 60.22176  ? 374 ASN C CB  1 
ATOM   9563  C CG  . ASN C 1 374 ? 125.60000 86.76600  152.88000 1.000 60.22176  ? 374 ASN C CG  1 
ATOM   9564  O OD1 . ASN C 1 374 ? 126.01700 87.77700  152.32400 1.000 60.22176  ? 374 ASN C OD1 1 
ATOM   9565  N ND2 . ASN C 1 374 ? 125.16000 85.71200  152.20700 1.000 60.22176  ? 374 ASN C ND2 1 
ATOM   9566  N N   . ILE C 1 375 ? 127.27400 89.64800  155.82100 1.000 59.76976  ? 375 ILE C N   1 
ATOM   9567  C CA  . ILE C 1 375 ? 128.59300 90.09600  156.24100 1.000 59.76976  ? 375 ILE C CA  1 
ATOM   9568  C C   . ILE C 1 375 ? 128.59300 90.14600  157.76100 1.000 59.76976  ? 375 ILE C C   1 
ATOM   9569  O O   . ILE C 1 375 ? 127.53700 90.11600  158.39900 1.000 59.76976  ? 375 ILE C O   1 
ATOM   9570  C CB  . ILE C 1 375 ? 128.98600 91.46100  155.64100 1.000 59.76976  ? 375 ILE C CB  1 
ATOM   9571  C CG1 . ILE C 1 375 ? 128.05700 92.56100  156.13500 1.000 59.76976  ? 375 ILE C CG1 1 
ATOM   9572  C CG2 . ILE C 1 375 ? 128.97200 91.39800  154.13100 1.000 59.76976  ? 375 ILE C CG2 1 
ATOM   9573  C CD1 . ILE C 1 375 ? 128.47700 93.92100  155.67800 1.000 59.76976  ? 375 ILE C CD1 1 
ATOM   9574  N N   . TYR C 1 376 ? 129.79000 90.21700  158.34500 1.000 63.18759  ? 376 TYR C N   1 
ATOM   9575  C CA  . TYR C 1 376 ? 129.91000 90.03600  159.78800 1.000 63.18759  ? 376 TYR C CA  1 
ATOM   9576  C C   . TYR C 1 376 ? 129.45000 91.26700  160.55700 1.000 63.18759  ? 376 TYR C C   1 
ATOM   9577  O O   . TYR C 1 376 ? 129.01400 91.15800  161.70700 1.000 63.18759  ? 376 TYR C O   1 
ATOM   9578  C CB  . TYR C 1 376 ? 131.35000 89.67900  160.15500 1.000 63.18759  ? 376 TYR C CB  1 
ATOM   9579  C CG  . TYR C 1 376 ? 132.28700 90.85600  160.20700 1.000 63.18759  ? 376 TYR C CG  1 
ATOM   9580  C CD1 . TYR C 1 376 ? 132.65600 91.42300  161.41900 1.000 63.18759  ? 376 TYR C CD1 1 
ATOM   9581  C CD2 . TYR C 1 376 ? 132.80500 91.40000  159.04600 1.000 63.18759  ? 376 TYR C CD2 1 
ATOM   9582  C CE1 . TYR C 1 376 ? 133.49800 92.49500  161.47000 1.000 63.18759  ? 376 TYR C CE1 1 
ATOM   9583  C CE2 . TYR C 1 376 ? 133.65800 92.47300  159.09000 1.000 63.18759  ? 376 TYR C CE2 1 
ATOM   9584  C CZ  . TYR C 1 376 ? 133.99600 93.01400  160.30500 1.000 63.18759  ? 376 TYR C CZ  1 
ATOM   9585  O OH  . TYR C 1 376 ? 134.84800 94.07800  160.36800 1.000 63.18759  ? 376 TYR C OH  1 
ATOM   9586  N N   . LEU C 1 377 ? 129.56200 92.45100  159.95300 1.000 60.59160  ? 377 LEU C N   1 
ATOM   9587  C CA  . LEU C 1 377 ? 129.22000 93.67400  160.66700 1.000 60.59160  ? 377 LEU C CA  1 
ATOM   9588  C C   . LEU C 1 377 ? 127.72200 93.80800  160.87900 1.000 60.59160  ? 377 LEU C C   1 
ATOM   9589  O O   . LEU C 1 377 ? 127.29400 94.50200  161.80700 1.000 60.59160  ? 377 LEU C O   1 
ATOM   9590  C CB  . LEU C 1 377 ? 129.75600 94.88700  159.91500 1.000 60.59160  ? 377 LEU C CB  1 
ATOM   9591  C CG  . LEU C 1 377 ? 129.99700 96.13100  160.76100 1.000 60.59160  ? 377 LEU C CG  1 
ATOM   9592  C CD1 . LEU C 1 377 ? 131.02300 95.84000  161.82300 1.000 60.59160  ? 377 LEU C CD1 1 
ATOM   9593  C CD2 . LEU C 1 377 ? 130.44400 97.28100  159.89000 1.000 60.59160  ? 377 LEU C CD2 1 
ATOM   9594  N N   . PHE C 1 378 ? 126.91700 93.15600  160.04500 1.000 61.19049  ? 378 PHE C N   1 
ATOM   9595  C CA  . PHE C 1 378 ? 125.48800 93.01000  160.27700 1.000 61.19049  ? 378 PHE C CA  1 
ATOM   9596  C C   . PHE C 1 378 ? 125.18100 91.51500  160.24600 1.000 61.19049  ? 378 PHE C C   1 
ATOM   9597  O O   . PHE C 1 378 ? 124.78000 90.96200  159.22300 1.000 61.19049  ? 378 PHE C O   1 
ATOM   9598  C CB  . PHE C 1 378 ? 124.66500 93.77500  159.23800 1.000 61.19049  ? 378 PHE C CB  1 
ATOM   9599  C CG  . PHE C 1 378 ? 125.25300 95.09800  158.84900 1.000 61.19049  ? 378 PHE C CG  1 
ATOM   9600  C CD1 . PHE C 1 378 ? 125.28500 96.14900  159.74300 1.000 61.19049  ? 378 PHE C CD1 1 
ATOM   9601  C CD2 . PHE C 1 378 ? 125.76100 95.29100  157.58400 1.000 61.19049  ? 378 PHE C CD2 1 
ATOM   9602  C CE1 . PHE C 1 378 ? 125.82500 97.36900  159.37900 1.000 61.19049  ? 378 PHE C CE1 1 
ATOM   9603  C CE2 . PHE C 1 378 ? 126.30500 96.50200  157.21700 1.000 61.19049  ? 378 PHE C CE2 1 
ATOM   9604  C CZ  . PHE C 1 378 ? 126.33400 97.54200  158.11600 1.000 61.19049  ? 378 PHE C CZ  1 
ATOM   9605  N N   . GLN C 1 379 ? 125.37700 90.86000  161.38400 1.000 68.52361  ? 379 GLN C N   1 
ATOM   9606  C CA  . GLN C 1 379 ? 125.06400 89.44900  161.54900 1.000 68.52361  ? 379 GLN C CA  1 
ATOM   9607  C C   . GLN C 1 379 ? 124.22800 89.29600  162.80600 1.000 68.52361  ? 379 GLN C C   1 
ATOM   9608  O O   . GLN C 1 379 ? 124.62400 89.76500  163.87700 1.000 68.52361  ? 379 GLN C O   1 
ATOM   9609  C CB  . GLN C 1 379 ? 126.33100 88.59800  161.64300 1.000 68.52361  ? 379 GLN C CB  1 
ATOM   9610  N N   . GLY C 1 380 ? 123.06900 88.66300  162.67100 1.000 73.24532  ? 380 GLY C N   1 
ATOM   9611  C CA  . GLY C 1 380 ? 122.15600 88.53800  163.78700 1.000 73.24532  ? 380 GLY C CA  1 
ATOM   9612  C C   . GLY C 1 380 ? 121.37200 89.80600  164.05600 1.000 73.24532  ? 380 GLY C C   1 
ATOM   9613  O O   . GLY C 1 380 ? 120.72700 89.93500  165.10000 1.000 73.24532  ? 380 GLY C O   1 
ATOM   9614  N N   . VAL C 1 381 ? 121.42100 90.75100  163.11900 1.000 73.87244  ? 381 VAL C N   1 
ATOM   9615  C CA  . VAL C 1 381 ? 120.63300 91.96800  163.23600 1.000 73.87244  ? 381 VAL C CA  1 
ATOM   9616  C C   . VAL C 1 381 ? 119.28800 91.75600  162.54000 1.000 73.87244  ? 381 VAL C C   1 
ATOM   9617  O O   . VAL C 1 381 ? 119.12400 90.85200  161.71600 1.000 73.87244  ? 381 VAL C O   1 
ATOM   9618  C CB  . VAL C 1 381 ? 121.41500 93.16600  162.65300 1.000 73.87244  ? 381 VAL C CB  1 
ATOM   9619  C CG1 . VAL C 1 381 ? 121.48600 93.09400  161.14300 1.000 73.87244  ? 381 VAL C CG1 1 
ATOM   9620  C CG2 . VAL C 1 381 ? 120.91200 94.52500  163.16800 1.000 73.87244  ? 381 VAL C CG2 1 
ATOM   9621  N N   . SER C 1 382 ? 118.30300 92.57500  162.91000 1.000 75.90368  ? 382 SER C N   1 
ATOM   9622  C CA  . SER C 1 382 ? 116.93000 92.41300  162.45800 1.000 75.90368  ? 382 SER C CA  1 
ATOM   9623  C C   . SER C 1 382 ? 116.79800 92.68000  160.95800 1.000 75.90368  ? 382 SER C C   1 
ATOM   9624  O O   . SER C 1 382 ? 117.68700 93.23100  160.31000 1.000 75.90368  ? 382 SER C O   1 
ATOM   9625  C CB  . SER C 1 382 ? 116.00800 93.35300  163.22900 1.000 75.90368  ? 382 SER C CB  1 
ATOM   9626  O OG  . SER C 1 382 ? 116.54900 94.66200  163.27500 1.000 75.90368  ? 382 SER C OG  1 
ATOM   9627  N N   . ARG C 1 383 ? 115.65100 92.26900  160.41300 1.000 74.00688  ? 383 ARG C N   1 
ATOM   9628  C CA  . ARG C 1 383 ? 115.36000 92.46000  158.99600 1.000 74.00688  ? 383 ARG C CA  1 
ATOM   9629  C C   . ARG C 1 383 ? 115.16500 93.93100  158.65500 1.000 74.00688  ? 383 ARG C C   1 
ATOM   9630  O O   . ARG C 1 383 ? 115.62500 94.39700  157.60700 1.000 74.00688  ? 383 ARG C O   1 
ATOM   9631  C CB  . ARG C 1 383 ? 114.11800 91.65400  158.61500 1.000 74.00688  ? 383 ARG C CB  1 
ATOM   9632  C CG  . ARG C 1 383 ? 113.65100 91.83600  157.18800 1.000 74.00688  ? 383 ARG C CG  1 
ATOM   9633  C CD  . ARG C 1 383 ? 114.56300 91.11700  156.22000 1.000 74.00688  ? 383 ARG C CD  1 
ATOM   9634  N NE  . ARG C 1 383 ? 114.42700 89.66700  156.31000 1.000 74.00688  ? 383 ARG C NE  1 
ATOM   9635  C CZ  . ARG C 1 383 ? 113.57700 88.95300  155.58100 1.000 74.00688  ? 383 ARG C CZ  1 
ATOM   9636  N NH1 . ARG C 1 383 ? 112.78300 89.55500  154.70700 1.000 74.00688  ? 383 ARG C NH1 1 
ATOM   9637  N NH2 . ARG C 1 383 ? 113.51900 87.63700  155.72600 1.000 74.00688  ? 383 ARG C NH2 1 
ATOM   9638  N N   . ASN C 1 384 ? 114.52100 94.68300  159.54100 1.000 70.64080  ? 384 ASN C N   1 
ATOM   9639  C CA  . ASN C 1 384 ? 114.17700 96.06500  159.24700 1.000 70.64080  ? 384 ASN C CA  1 
ATOM   9640  C C   . ASN C 1 384 ? 115.36500 97.01100  159.30000 1.000 70.64080  ? 384 ASN C C   1 
ATOM   9641  O O   . ASN C 1 384 ? 115.22600 98.14900  158.84200 1.000 70.64080  ? 384 ASN C O   1 
ATOM   9642  C CB  . ASN C 1 384 ? 113.09400 96.54800  160.21100 1.000 70.64080  ? 384 ASN C CB  1 
ATOM   9643  N N   . PHE C 1 385 ? 116.51200 96.60700  159.84700 1.000 70.76440  ? 385 PHE C N   1 
ATOM   9644  C CA  . PHE C 1 385 ? 117.67300 97.49100  159.79700 1.000 70.76440  ? 385 PHE C CA  1 
ATOM   9645  C C   . PHE C 1 385 ? 118.43300 97.34400  158.48600 1.000 70.76440  ? 385 PHE C C   1 
ATOM   9646  O O   . PHE C 1 385 ? 118.89700 98.33600  157.91600 1.000 70.76440  ? 385 PHE C O   1 
ATOM   9647  C CB  . PHE C 1 385 ? 118.62500 97.23400  160.96200 1.000 70.76440  ? 385 PHE C CB  1 
ATOM   9648  C CG  . PHE C 1 385 ? 119.84400 98.10900  160.92800 1.000 70.76440  ? 385 PHE C CG  1 
ATOM   9649  C CD1 . PHE C 1 385 ? 119.72200 99.49000  161.01800 1.000 70.76440  ? 385 PHE C CD1 1 
ATOM   9650  C CD2 . PHE C 1 385 ? 121.10300 97.56000  160.76800 1.000 70.76440  ? 385 PHE C CD2 1 
ATOM   9651  C CE1 . PHE C 1 385 ? 120.83500 100.30200 160.97800 1.000 70.76440  ? 385 PHE C CE1 1 
ATOM   9652  C CE2 . PHE C 1 385 ? 122.22000 98.36900  160.72300 1.000 70.76440  ? 385 PHE C CE2 1 
ATOM   9653  C CZ  . PHE C 1 385 ? 122.08300 99.74300  160.82900 1.000 70.76440  ? 385 PHE C CZ  1 
ATOM   9654  N N   . LEU C 1 386 ? 118.54600 96.11800  157.98600 1.000 68.73072  ? 386 LEU C N   1 
ATOM   9655  C CA  . LEU C 1 386 ? 119.05900 95.87900  156.64800 1.000 68.73072  ? 386 LEU C CA  1 
ATOM   9656  C C   . LEU C 1 386 ? 117.95500 95.89500  155.59800 1.000 68.73072  ? 386 LEU C C   1 
ATOM   9657  O O   . LEU C 1 386 ? 118.03800 95.19000  154.58800 1.000 68.73072  ? 386 LEU C O   1 
ATOM   9658  C CB  . LEU C 1 386 ? 119.86800 94.57800  156.61300 1.000 68.73072  ? 386 LEU C CB  1 
ATOM   9659  C CG  . LEU C 1 386 ? 119.39600 93.24600  157.20400 1.000 68.73072  ? 386 LEU C CG  1 
ATOM   9660  C CD1 . LEU C 1 386 ? 118.51000 92.44000  156.27900 1.000 68.73072  ? 386 LEU C CD1 1 
ATOM   9661  C CD2 . LEU C 1 386 ? 120.61200 92.42500  157.56900 1.000 68.73072  ? 386 LEU C CD2 1 
ATOM   9662  N N   . PHE C 1 387 ? 116.89900 96.65800  155.86600 1.000 68.07394  ? 387 PHE C N   1 
ATOM   9663  C CA  . PHE C 1 387 ? 115.97500 97.16200  154.86500 1.000 68.07394  ? 387 PHE C CA  1 
ATOM   9664  C C   . PHE C 1 387 ? 116.16200 98.65300  154.64100 1.000 68.07394  ? 387 PHE C C   1 
ATOM   9665  O O   . PHE C 1 387 ? 115.28300 99.30000  154.07200 1.000 68.07394  ? 387 PHE C O   1 
ATOM   9666  C CB  . PHE C 1 387 ? 114.53700 96.88000  155.28500 1.000 68.07394  ? 387 PHE C CB  1 
ATOM   9667  C CG  . PHE C 1 387 ? 113.66000 96.43600  154.16600 1.000 68.07394  ? 387 PHE C CG  1 
ATOM   9668  C CD1 . PHE C 1 387 ? 113.62200 95.10400  153.80500 1.000 68.07394  ? 387 PHE C CD1 1 
ATOM   9669  C CD2 . PHE C 1 387 ? 112.87100 97.33700  153.47800 1.000 68.07394  ? 387 PHE C CD2 1 
ATOM   9670  C CE1 . PHE C 1 387 ? 112.81000 94.67500  152.77500 1.000 68.07394  ? 387 PHE C CE1 1 
ATOM   9671  C CE2 . PHE C 1 387 ? 112.05300 96.92100  152.44200 1.000 68.07394  ? 387 PHE C CE2 1 
ATOM   9672  C CZ  . PHE C 1 387 ? 112.02200 95.58800  152.09000 1.000 68.07394  ? 387 PHE C CZ  1 
ATOM   9673  N N   . GLN C 1 388 ? 117.26200 99.21800  155.13200 1.000 68.22325  ? 388 GLN C N   1 
ATOM   9674  C CA  . GLN C 1 388 ? 117.66000 100.58000 154.80800 1.000 68.22325  ? 388 GLN C CA  1 
ATOM   9675  C C   . GLN C 1 388 ? 118.93900 100.58500 153.96800 1.000 68.22325  ? 388 GLN C C   1 
ATOM   9676  O O   . GLN C 1 388 ? 119.89000 101.31400 154.25900 1.000 68.22325  ? 388 GLN C O   1 
ATOM   9677  C CB  . GLN C 1 388 ? 117.80300 101.41300 156.08300 1.000 68.22325  ? 388 GLN C CB  1 
ATOM   9678  C CG  . GLN C 1 388 ? 117.52600 102.91800 155.91400 1.000 68.22325  ? 388 GLN C CG  1 
ATOM   9679  C CD  . GLN C 1 388 ? 118.75300 103.76900 155.63600 1.000 68.22325  ? 388 GLN C CD  1 
ATOM   9680  O OE1 . GLN C 1 388 ? 119.85200 103.47700 156.10800 1.000 68.22325  ? 388 GLN C OE1 1 
ATOM   9681  N NE2 . GLN C 1 388 ? 118.56900 104.82500 154.85900 1.000 68.22325  ? 388 GLN C NE2 1 
ATOM   9682  N N   . LEU C 1 389 ? 119.01600 99.70700  152.96500 1.000 59.83484  ? 389 LEU C N   1 
ATOM   9683  C CA  . LEU C 1 389 ? 120.07100 99.78000  151.95300 1.000 59.83484  ? 389 LEU C CA  1 
ATOM   9684  C C   . LEU C 1 389 ? 119.58700 100.61900 150.76600 1.000 59.83484  ? 389 LEU C C   1 
ATOM   9685  O O   . LEU C 1 389 ? 119.70500 100.26400 149.59300 1.000 59.83484  ? 389 LEU C O   1 
ATOM   9686  C CB  . LEU C 1 389 ? 120.51100 98.37800  151.54600 1.000 59.83484  ? 389 LEU C CB  1 
ATOM   9687  C CG  . LEU C 1 389 ? 119.64200 97.33600  150.82600 1.000 59.83484  ? 389 LEU C CG  1 
ATOM   9688  C CD1 . LEU C 1 389 ? 120.53400 96.34500  150.14200 1.000 59.83484  ? 389 LEU C CD1 1 
ATOM   9689  C CD2 . LEU C 1 389 ? 118.74200 96.59700  151.76300 1.000 59.83484  ? 389 LEU C CD2 1 
ATOM   9690  N N   . VAL C 1 390 ? 119.09200 101.80800 151.09200 1.000 59.94666  ? 390 VAL C N   1 
ATOM   9691  C CA  . VAL C 1 390 ? 118.50000 102.69100 150.10100 1.000 59.94666  ? 390 VAL C CA  1 
ATOM   9692  C C   . VAL C 1 390 ? 119.38400 103.87700 149.76900 1.000 59.94666  ? 390 VAL C C   1 
ATOM   9693  O O   . VAL C 1 390 ? 118.98400 104.72300 148.96700 1.000 59.94666  ? 390 VAL C O   1 
ATOM   9694  C CB  . VAL C 1 390 ? 117.10500 103.16800 150.54600 1.000 59.94666  ? 390 VAL C CB  1 
ATOM   9695  C CG1 . VAL C 1 390 ? 116.23800 101.97400 150.89100 1.000 59.94666  ? 390 VAL C CG1 1 
ATOM   9696  C CG2 . VAL C 1 390 ? 117.22500 104.10100 151.73600 1.000 59.94666  ? 390 VAL C CG2 1 
ATOM   9697  N N   . SER C 1 391 ? 120.57400 103.97000 150.35800 1.000 58.01103  ? 391 SER C N   1 
ATOM   9698  C CA  . SER C 1 391 ? 121.53400 105.01000 150.00700 1.000 58.01103  ? 391 SER C CA  1 
ATOM   9699  C C   . SER C 1 391 ? 122.86900 104.42100 149.56600 1.000 58.01103  ? 391 SER C C   1 
ATOM   9700  O O   . SER C 1 391 ? 123.88500 105.12200 149.56900 1.000 58.01103  ? 391 SER C O   1 
ATOM   9701  C CB  . SER C 1 391 ? 121.73200 105.97200 151.17800 1.000 58.01103  ? 391 SER C CB  1 
ATOM   9702  O OG  . SER C 1 391 ? 120.48100 106.41900 151.66600 1.000 58.01103  ? 391 SER C OG  1 
ATOM   9703  N N   . ASP C 1 392 ? 122.88500 103.14500 149.19200 1.000 54.11327  ? 392 ASP C N   1 
ATOM   9704  C CA  . ASP C 1 392 ? 124.09600 102.51300 148.69400 1.000 54.11327  ? 392 ASP C CA  1 
ATOM   9705  C C   . ASP C 1 392 ? 124.39100 103.01100 147.29100 1.000 54.11327  ? 392 ASP C C   1 
ATOM   9706  O O   . ASP C 1 392 ? 123.62700 102.74200 146.36000 1.000 54.11327  ? 392 ASP C O   1 
ATOM   9707  C CB  . ASP C 1 392 ? 123.94100 100.99800 148.68400 1.000 54.11327  ? 392 ASP C CB  1 
ATOM   9708  C CG  . ASP C 1 392 ? 123.86300 100.41800 150.06400 1.000 54.11327  ? 392 ASP C CG  1 
ATOM   9709  O OD1 . ASP C 1 392 ? 123.89200 101.20200 151.02800 1.000 54.11327  ? 392 ASP C OD1 1 
ATOM   9710  O OD2 . ASP C 1 392 ? 123.77500 99.18200  150.18900 1.000 54.11327  ? 392 ASP C OD2 1 
ATOM   9711  N N   . ILE C 1 393 ? 125.49300 103.73400 147.13400 1.000 46.61181  ? 393 ILE C N   1 
ATOM   9712  C CA  . ILE C 1 393 ? 125.96200 104.12300 145.80100 1.000 46.61181  ? 393 ILE C CA  1 
ATOM   9713  C C   . ILE C 1 393 ? 126.83300 102.96800 145.32500 1.000 46.61181  ? 393 ILE C C   1 
ATOM   9714  O O   . ILE C 1 393 ? 128.06300 102.99500 145.38000 1.000 46.61181  ? 393 ILE C O   1 
ATOM   9715  C CB  . ILE C 1 393 ? 126.70200 105.46100 145.81600 1.000 46.61181  ? 393 ILE C CB  1 
ATOM   9716  N N   . ASP C 1 394 ? 126.17200 101.93000 144.82000 1.000 45.26820  ? 394 ASP C N   1 
ATOM   9717  C CA  . ASP C 1 394 ? 126.86800 100.71000 144.44400 1.000 45.26820  ? 394 ASP C CA  1 
ATOM   9718  C C   . ASP C 1 394 ? 127.45500 100.77200 143.05200 1.000 45.26820  ? 394 ASP C C   1 
ATOM   9719  O O   . ASP C 1 394 ? 128.12000 99.82100  142.63500 1.000 45.26820  ? 394 ASP C O   1 
ATOM   9720  C CB  . ASP C 1 394 ? 125.92800 99.51500  144.53100 1.000 45.26820  ? 394 ASP C CB  1 
ATOM   9721  N N   . ALA C 1 395 ? 127.22700 101.85700 142.32200 1.000 49.77779  ? 395 ALA C N   1 
ATOM   9722  C CA  . ALA C 1 395 ? 127.81500 102.01300 141.00200 1.000 49.77779  ? 395 ALA C CA  1 
ATOM   9723  C C   . ALA C 1 395 ? 129.28300 102.38800 141.14600 1.000 49.77779  ? 395 ALA C C   1 
ATOM   9724  O O   . ALA C 1 395 ? 129.67900 103.53100 140.90400 1.000 49.77779  ? 395 ALA C O   1 
ATOM   9725  C CB  . ALA C 1 395 ? 127.05600 103.06500 140.19500 1.000 49.77779  ? 395 ALA C CB  1 
ATOM   9726  N N   . GLU C 1 396 ? 130.09900 101.42900 141.56200 1.000 41.86373  ? 396 GLU C N   1 
ATOM   9727  C CA  . GLU C 1 396 ? 131.50900 101.72500 141.68400 1.000 41.86373  ? 396 GLU C CA  1 
ATOM   9728  C C   . GLU C 1 396 ? 132.25400 101.30200 140.43000 1.000 41.86373  ? 396 GLU C C   1 
ATOM   9729  O O   . GLU C 1 396 ? 132.63300 102.16500 139.63100 1.000 41.86373  ? 396 GLU C O   1 
ATOM   9730  C CB  . GLU C 1 396 ? 132.07200 101.02600 142.91600 1.000 41.86373  ? 396 GLU C CB  1 
ATOM   9731  N N   . TYR C 1 397 ? 132.33600 99.99300  140.19800 1.000 35.28438  ? 397 TYR C N   1 
ATOM   9732  C CA  . TYR C 1 397 ? 133.08800 99.37200  139.10600 1.000 35.28438  ? 397 TYR C CA  1 
ATOM   9733  C C   . TYR C 1 397 ? 134.47200 99.98700  138.92800 1.000 35.28438  ? 397 TYR C C   1 
ATOM   9734  O O   . TYR C 1 397 ? 134.74900 100.68300 137.95400 1.000 35.28438  ? 397 TYR C O   1 
ATOM   9735  C CB  . TYR C 1 397 ? 132.30300 99.38900  137.80800 1.000 35.28438  ? 397 TYR C CB  1 
ATOM   9736  C CG  . TYR C 1 397 ? 131.55900 98.10100  137.61300 1.000 35.28438  ? 397 TYR C CG  1 
ATOM   9737  C CD1 . TYR C 1 397 ? 132.24600 96.91800  137.41600 1.000 35.28438  ? 397 TYR C CD1 1 
ATOM   9738  C CD2 . TYR C 1 397 ? 130.17700 98.06400  137.63800 1.000 35.28438  ? 397 TYR C CD2 1 
ATOM   9739  C CE1 . TYR C 1 397 ? 131.58100 95.73700  137.24700 1.000 35.28438  ? 397 TYR C CE1 1 
ATOM   9740  C CE2 . TYR C 1 397 ? 129.50100 96.88500  137.46700 1.000 35.28438  ? 397 TYR C CE2 1 
ATOM   9741  C CZ  . TYR C 1 397 ? 130.20800 95.72600  137.27200 1.000 35.28438  ? 397 TYR C CZ  1 
ATOM   9742  O OH  . TYR C 1 397 ? 129.53400 94.54400  137.10300 1.000 35.28438  ? 397 TYR C OH  1 
ATOM   9743  N N   . PHE C 1 398 ? 135.30700 99.77500  139.90600 1.000 35.12548  ? 398 PHE C N   1 
ATOM   9744  C CA  . PHE C 1 398 ? 136.61900 100.39200 139.87900 1.000 35.12548  ? 398 PHE C CA  1 
ATOM   9745  C C   . PHE C 1 398 ? 137.54600 99.64900  138.92000 1.000 35.12548  ? 398 PHE C C   1 
ATOM   9746  O O   . PHE C 1 398 ? 137.49200 98.42400  138.82900 1.000 35.12548  ? 398 PHE C O   1 
ATOM   9747  C CB  . PHE C 1 398 ? 137.22500 100.40700 141.27200 1.000 35.12548  ? 398 PHE C CB  1 
ATOM   9748  C CG  . PHE C 1 398 ? 136.83000 101.59500 142.08300 1.000 35.12548  ? 398 PHE C CG  1 
ATOM   9749  C CD1 . PHE C 1 398 ? 135.53800 101.73100 142.54000 1.000 35.12548  ? 398 PHE C CD1 1 
ATOM   9750  C CD2 . PHE C 1 398 ? 137.74800 102.58000 142.38100 1.000 35.12548  ? 398 PHE C CD2 1 
ATOM   9751  C CE1 . PHE C 1 398 ? 135.16400 102.82300 143.28500 1.000 35.12548  ? 398 PHE C CE1 1 
ATOM   9752  C CE2 . PHE C 1 398 ? 137.38000 103.67600 143.12400 1.000 35.12548  ? 398 PHE C CE2 1 
ATOM   9753  C CZ  . PHE C 1 398 ? 136.08300 103.79400 143.57600 1.000 35.12548  ? 398 PHE C CZ  1 
ATOM   9754  N N   . PRO C 1 399 ? 138.39300 100.36600 138.19100 1.000 35.58335  ? 399 PRO C N   1 
ATOM   9755  C CA  . PRO C 1 399 ? 139.39100 99.71800  137.34400 1.000 35.58335  ? 399 PRO C CA  1 
ATOM   9756  C C   . PRO C 1 399 ? 140.50300 99.11300  138.18000 1.000 35.58335  ? 399 PRO C C   1 
ATOM   9757  O O   . PRO C 1 399 ? 140.57800 99.36400  139.39000 1.000 35.58335  ? 399 PRO C O   1 
ATOM   9758  C CB  . PRO C 1 399 ? 139.90500 100.87600 136.47500 1.000 35.58335  ? 399 PRO C CB  1 
ATOM   9759  C CG  . PRO C 1 399 ? 139.62100 102.08000 137.25300 1.000 35.58335  ? 399 PRO C CG  1 
ATOM   9760  C CD  . PRO C 1 399 ? 138.33900 101.81500 137.95200 1.000 35.58335  ? 399 PRO C CD  1 
ATOM   9761  N N   . PRO C 1 400 ? 141.36800 98.29100  137.58700 1.000 36.88998  ? 400 PRO C N   1 
ATOM   9762  C CA  . PRO C 1 400 ? 142.53600 97.80600  138.32400 1.000 36.88998  ? 400 PRO C CA  1 
ATOM   9763  C C   . PRO C 1 400 ? 143.51700 98.91900  138.64500 1.000 36.88998  ? 400 PRO C C   1 
ATOM   9764  O O   . PRO C 1 400 ? 143.61000 99.91800  137.92800 1.000 36.88998  ? 400 PRO C O   1 
ATOM   9765  C CB  . PRO C 1 400 ? 143.16300 96.78900  137.36800 1.000 36.88998  ? 400 PRO C CB  1 
ATOM   9766  C CG  . PRO C 1 400 ? 142.55200 97.05400  136.06200 1.000 36.88998  ? 400 PRO C CG  1 
ATOM   9767  C CD  . PRO C 1 400 ? 141.18300 97.52700  136.34700 1.000 36.88998  ? 400 PRO C CD  1 
ATOM   9768  N N   . LYS C 1 401 ? 144.23800 98.72100  139.75500 1.000 39.54883  ? 401 LYS C N   1 
ATOM   9769  C CA  . LYS C 1 401 ? 145.28700 99.61900  140.24900 1.000 39.54883  ? 401 LYS C CA  1 
ATOM   9770  C C   . LYS C 1 401 ? 144.76500 101.02900 140.51000 1.000 39.54883  ? 401 LYS C C   1 
ATOM   9771  O O   . LYS C 1 401 ? 145.43300 102.01800 140.21300 1.000 39.54883  ? 401 LYS C O   1 
ATOM   9772  C CB  . LYS C 1 401 ? 146.49000 99.64800  139.30400 1.000 39.54883  ? 401 LYS C CB  1 
ATOM   9773  N N   . GLU C 1 402 ? 143.56500 101.12500 141.07300 1.000 42.38501  ? 402 GLU C N   1 
ATOM   9774  C CA  . GLU C 1 402 ? 142.97800 102.40000 141.45900 1.000 42.38501  ? 402 GLU C CA  1 
ATOM   9775  C C   . GLU C 1 402 ? 142.76100 102.41500 142.96100 1.000 42.38501  ? 402 GLU C C   1 
ATOM   9776  O O   . GLU C 1 402 ? 142.21900 101.46300 143.52300 1.000 42.38501  ? 402 GLU C O   1 
ATOM   9777  C CB  . GLU C 1 402 ? 141.64800 102.65000 140.74600 1.000 42.38501  ? 402 GLU C CB  1 
ATOM   9778  N N   . ASP C 1 403 ? 143.17300 103.50100 143.60600 1.000 46.53435  ? 403 ASP C N   1 
ATOM   9779  C CA  . ASP C 1 403 ? 143.09500 103.62300 145.05500 1.000 46.53435  ? 403 ASP C CA  1 
ATOM   9780  C C   . ASP C 1 403 ? 141.67200 103.97200 145.46500 1.000 46.53435  ? 403 ASP C C   1 
ATOM   9781  O O   . ASP C 1 403 ? 141.12400 104.98200 145.01700 1.000 46.53435  ? 403 ASP C O   1 
ATOM   9782  C CB  . ASP C 1 403 ? 144.06800 104.68500 145.55500 1.000 46.53435  ? 403 ASP C CB  1 
ATOM   9783  C CG  . ASP C 1 403 ? 145.43700 104.55000 144.93600 1.000 46.53435  ? 403 ASP C CG  1 
ATOM   9784  O OD1 . ASP C 1 403 ? 145.77700 103.44300 144.47800 1.000 46.53435  ? 403 ASP C OD1 1 
ATOM   9785  O OD2 . ASP C 1 403 ? 146.18000 105.55100 144.90200 1.000 46.53435  ? 403 ASP C OD2 1 
ATOM   9786  N N   . ILE C 1 404 ? 141.08300 103.14400 146.32000 1.000 44.05019  ? 404 ILE C N   1 
ATOM   9787  C CA  . ILE C 1 404 ? 139.74500 103.40400 146.83700 1.000 44.05019  ? 404 ILE C CA  1 
ATOM   9788  C C   . ILE C 1 404 ? 139.79000 104.27600 148.07800 1.000 44.05019  ? 404 ILE C C   1 
ATOM   9789  O O   . ILE C 1 404 ? 139.01200 105.22000 148.21300 1.000 44.05019  ? 404 ILE C O   1 
ATOM   9790  C CB  . ILE C 1 404 ? 139.03800 102.07700 147.13100 1.000 44.05019  ? 404 ILE C CB  1 
ATOM   9791  C CG1 . ILE C 1 404 ? 139.24000 101.10400 145.98600 1.000 44.05019  ? 404 ILE C CG1 1 
ATOM   9792  C CG2 . ILE C 1 404 ? 137.58100 102.31100 147.38700 1.000 44.05019  ? 404 ILE C CG2 1 
ATOM   9793  C CD1 . ILE C 1 404 ? 138.87000 99.71800  146.36000 1.000 44.05019  ? 404 ILE C CD1 1 
ATOM   9794  N N   . ILE C 1 405 ? 140.69300 103.95700 148.99400 1.000 50.70245  ? 405 ILE C N   1 
ATOM   9795  C CA  . ILE C 1 405 ? 140.82800 104.63200 150.27400 1.000 50.70245  ? 405 ILE C CA  1 
ATOM   9796  C C   . ILE C 1 405 ? 142.30400 104.93600 150.46200 1.000 50.70245  ? 405 ILE C C   1 
ATOM   9797  O O   . ILE C 1 405 ? 143.15000 104.06000 150.26600 1.000 50.70245  ? 405 ILE C O   1 
ATOM   9798  C CB  . ILE C 1 405 ? 140.28200 103.74800 151.41600 1.000 50.70245  ? 405 ILE C CB  1 
ATOM   9799  C CG1 . ILE C 1 405 ? 138.77000 103.84100 151.52900 1.000 50.70245  ? 405 ILE C CG1 1 
ATOM   9800  C CG2 . ILE C 1 405 ? 140.90200 104.07500 152.73100 1.000 50.70245  ? 405 ILE C CG2 1 
ATOM   9801  C CD1 . ILE C 1 405 ? 138.21600 102.84400 152.50800 1.000 50.70245  ? 405 ILE C CD1 1 
ATOM   9802  N N   . LEU C 1 406 ? 142.62000 106.17500 150.81500 1.000 57.95306  ? 406 LEU C N   1 
ATOM   9803  C CA  . LEU C 1 406 ? 144.00900 106.56500 150.97900 1.000 57.95306  ? 406 LEU C CA  1 
ATOM   9804  C C   . LEU C 1 406 ? 144.54900 106.11800 152.33700 1.000 57.95306  ? 406 LEU C C   1 
ATOM   9805  O O   . LEU C 1 406 ? 143.88800 105.41600 153.10100 1.000 57.95306  ? 406 LEU C O   1 
ATOM   9806  C CB  . LEU C 1 406 ? 144.15300 108.07200 150.80600 1.000 57.95306  ? 406 LEU C CB  1 
ATOM   9807  C CG  . LEU C 1 406 ? 144.03100 108.53600 149.35900 1.000 57.95306  ? 406 LEU C CG  1 
ATOM   9808  C CD1 . LEU C 1 406 ? 143.85100 110.03200 149.31500 1.000 57.95306  ? 406 LEU C CD1 1 
ATOM   9809  C CD2 . LEU C 1 406 ? 145.25500 108.11700 148.57200 1.000 57.95306  ? 406 LEU C CD2 1 
ATOM   9810  N N   . GLN C 1 407 ? 145.78400 106.53200 152.63000 1.000 64.46374  ? 407 GLN C N   1 
ATOM   9811  C CA  . GLN C 1 407 ? 146.43400 106.10600 153.86600 1.000 64.46374  ? 407 GLN C CA  1 
ATOM   9812  C C   . GLN C 1 407 ? 145.80900 106.78400 155.07800 1.000 64.46374  ? 407 GLN C C   1 
ATOM   9813  O O   . GLN C 1 407 ? 145.44700 106.12300 156.05500 1.000 64.46374  ? 407 GLN C O   1 
ATOM   9814  C CB  . GLN C 1 407 ? 147.93000 106.39900 153.79600 1.000 64.46374  ? 407 GLN C CB  1 
ATOM   9815  C CG  . GLN C 1 407 ? 148.63200 106.31800 155.13100 1.000 64.46374  ? 407 GLN C CG  1 
ATOM   9816  C CD  . GLN C 1 407 ? 148.67600 104.91300 155.68200 1.000 64.46374  ? 407 GLN C CD  1 
ATOM   9817  O OE1 . GLN C 1 407 ? 147.92700 104.56900 156.59200 1.000 64.46374  ? 407 GLN C OE1 1 
ATOM   9818  N NE2 . GLN C 1 407 ? 149.56300 104.09200 155.13700 1.000 64.46374  ? 407 GLN C NE2 1 
ATOM   9819  N N   . ASN C 1 408 ? 145.66600 108.10400 155.03100 1.000 66.21714  ? 408 ASN C N   1 
ATOM   9820  C CA  . ASN C 1 408 ? 144.98900 108.85500 156.07900 1.000 66.21714  ? 408 ASN C CA  1 
ATOM   9821  C C   . ASN C 1 408 ? 143.94900 109.74000 155.42100 1.000 66.21714  ? 408 ASN C C   1 
ATOM   9822  O O   . ASN C 1 408 ? 144.25500 110.43400 154.44900 1.000 66.21714  ? 408 ASN C O   1 
ATOM   9823  C CB  . ASN C 1 408 ? 145.97700 109.69500 156.88800 1.000 66.21714  ? 408 ASN C CB  1 
ATOM   9824  C CG  . ASN C 1 408 ? 147.25600 108.95600 157.18200 1.000 66.21714  ? 408 ASN C CG  1 
ATOM   9825  O OD1 . ASN C 1 408 ? 148.33500 109.37000 156.76500 1.000 66.21714  ? 408 ASN C OD1 1 
ATOM   9826  N ND2 . ASN C 1 408 ? 147.14600 107.85300 157.90900 1.000 66.21714  ? 408 ASN C ND2 1 
ATOM   9827  N N   . GLU C 1 409 ? 142.72800 109.71400 155.94000 1.000 66.12266  ? 409 GLU C N   1 
ATOM   9828  C CA  . GLU C 1 409 ? 141.64700 110.46500 155.32800 1.000 66.12266  ? 409 GLU C CA  1 
ATOM   9829  C C   . GLU C 1 409 ? 140.56400 110.68600 156.36300 1.000 66.12266  ? 409 GLU C C   1 
ATOM   9830  O O   . GLU C 1 409 ? 140.52400 110.00400 157.38900 1.000 66.12266  ? 409 GLU C O   1 
ATOM   9831  C CB  . GLU C 1 409 ? 141.06200 109.73600 154.11700 1.000 66.12266  ? 409 GLU C CB  1 
ATOM   9832  N N   . ALA C 1 410 ? 139.69400 111.65100 156.08500 1.000 69.98353  ? 410 ALA C N   1 
ATOM   9833  C CA  . ALA C 1 410 ? 138.47500 111.83900 156.85700 1.000 69.98353  ? 410 ALA C CA  1 
ATOM   9834  C C   . ALA C 1 410 ? 137.60100 110.61500 156.62800 1.000 69.98353  ? 410 ALA C C   1 
ATOM   9835  O O   . ALA C 1 410 ? 137.10000 110.41300 155.51600 1.000 69.98353  ? 410 ALA C O   1 
ATOM   9836  C CB  . ALA C 1 410 ? 137.75100 113.12000 156.44400 1.000 69.98353  ? 410 ALA C CB  1 
ATOM   9837  N N   . PRO C 1 411 ? 137.39900 109.78100 157.63700 1.000 66.13393  ? 411 PRO C N   1 
ATOM   9838  C CA  . PRO C 1 411 ? 136.80500 108.46000 157.39500 1.000 66.13393  ? 411 PRO C CA  1 
ATOM   9839  C C   . PRO C 1 411 ? 135.31100 108.52400 157.11800 1.000 66.13393  ? 411 PRO C C   1 
ATOM   9840  O O   . PRO C 1 411 ? 134.47600 108.30800 158.00000 1.000 66.13393  ? 411 PRO C O   1 
ATOM   9841  C CB  . PRO C 1 411 ? 137.12400 107.70500 158.68600 1.000 66.13393  ? 411 PRO C CB  1 
ATOM   9842  C CG  . PRO C 1 411 ? 137.24700 108.74500 159.72100 1.000 66.13393  ? 411 PRO C CG  1 
ATOM   9843  C CD  . PRO C 1 411 ? 137.69600 110.01100 159.06200 1.000 66.13393  ? 411 PRO C CD  1 
ATOM   9844  N N   . THR C 1 412 ? 134.97700 108.81000 155.86100 1.000 64.38047  ? 412 THR C N   1 
ATOM   9845  C CA  . THR C 1 412 ? 133.61400 109.17100 155.50300 1.000 64.38047  ? 412 THR C CA  1 
ATOM   9846  C C   . THR C 1 412 ? 132.73900 107.95300 155.22100 1.000 64.38047  ? 412 THR C C   1 
ATOM   9847  O O   . THR C 1 412 ? 131.52200 108.01100 155.42900 1.000 64.38047  ? 412 THR C O   1 
ATOM   9848  C CB  . THR C 1 412 ? 133.64000 110.10000 154.28800 1.000 64.38047  ? 412 THR C CB  1 
ATOM   9849  O OG1 . THR C 1 412 ? 134.70700 111.04000 154.44000 1.000 64.38047  ? 412 THR C OG1 1 
ATOM   9850  C CG2 . THR C 1 412 ? 132.34100 110.87300 154.16600 1.000 64.38047  ? 412 THR C CG2 1 
ATOM   9851  N N   . ASP C 1 413 ? 133.31900 106.83600 154.78700 1.000 57.90547  ? 413 ASP C N   1 
ATOM   9852  C CA  . ASP C 1 413 ? 132.50100 105.76900 154.23100 1.000 57.90547  ? 413 ASP C CA  1 
ATOM   9853  C C   . ASP C 1 413 ? 133.14900 104.40900 154.41600 1.000 57.90547  ? 413 ASP C C   1 
ATOM   9854  O O   . ASP C 1 413 ? 134.37400 104.28300 154.42700 1.000 57.90547  ? 413 ASP C O   1 
ATOM   9855  C CB  . ASP C 1 413 ? 132.24900 106.03700 152.75000 1.000 57.90547  ? 413 ASP C CB  1 
ATOM   9856  C CG  . ASP C 1 413 ? 133.44700 106.63500 152.06400 1.000 57.90547  ? 413 ASP C CG  1 
ATOM   9857  O OD1 . ASP C 1 413 ? 134.48700 106.81100 152.73400 1.000 57.90547  ? 413 ASP C OD1 1 
ATOM   9858  O OD2 . ASP C 1 413 ? 133.34800 106.95600 150.86300 1.000 57.90547  ? 413 ASP C OD2 1 
ATOM   9859  N N   . LEU C 1 414 ? 132.30500 103.39200 154.56200 1.000 51.06693  ? 414 LEU C N   1 
ATOM   9860  C CA  . LEU C 1 414 ? 132.71900 102.00200 154.47800 1.000 51.06693  ? 414 LEU C CA  1 
ATOM   9861  C C   . LEU C 1 414 ? 132.36100 101.48100 153.09700 1.000 51.06693  ? 414 LEU C C   1 
ATOM   9862  O O   . LEU C 1 414 ? 131.42300 101.97300 152.46800 1.000 51.06693  ? 414 LEU C O   1 
ATOM   9863  C CB  . LEU C 1 414 ? 132.05400 101.13100 155.55500 1.000 51.06693  ? 414 LEU C CB  1 
ATOM   9864  C CG  . LEU C 1 414 ? 130.55600 100.79400 155.60300 1.000 51.06693  ? 414 LEU C CG  1 
ATOM   9865  C CD1 . LEU C 1 414 ? 130.17800 99.52400  154.85700 1.000 51.06693  ? 414 LEU C CD1 1 
ATOM   9866  C CD2 . LEU C 1 414 ? 130.12400 100.63600 157.02300 1.000 51.06693  ? 414 LEU C CD2 1 
ATOM   9867  N N   . TYR C 1 415 ? 133.08700 100.47100 152.64100 1.000 46.90904  ? 415 TYR C N   1 
ATOM   9868  C CA  . TYR C 1 415 ? 132.84500 99.86200  151.34700 1.000 46.90904  ? 415 TYR C CA  1 
ATOM   9869  C C   . TYR C 1 415 ? 132.66600 98.36400  151.51500 1.000 46.90904  ? 415 TYR C C   1 
ATOM   9870  O O   . TYR C 1 415 ? 133.29700 97.74400  152.37000 1.000 46.90904  ? 415 TYR C O   1 
ATOM   9871  C CB  . TYR C 1 415 ? 133.99900 100.13100 150.38600 1.000 46.90904  ? 415 TYR C CB  1 
ATOM   9872  C CG  . TYR C 1 415 ? 134.25300 101.58200 150.07100 1.000 46.90904  ? 415 TYR C CG  1 
ATOM   9873  C CD1 . TYR C 1 415 ? 135.01500 102.37400 150.91000 1.000 46.90904  ? 415 TYR C CD1 1 
ATOM   9874  C CD2 . TYR C 1 415 ? 133.75300 102.15200 148.91400 1.000 46.90904  ? 415 TYR C CD2 1 
ATOM   9875  C CE1 . TYR C 1 415 ? 135.25300 103.69300 150.61900 1.000 46.90904  ? 415 TYR C CE1 1 
ATOM   9876  C CE2 . TYR C 1 415 ? 133.99300 103.46900 148.61200 1.000 46.90904  ? 415 TYR C CE2 1 
ATOM   9877  C CZ  . TYR C 1 415 ? 134.74100 104.23500 149.47000 1.000 46.90904  ? 415 TYR C CZ  1 
ATOM   9878  O OH  . TYR C 1 415 ? 134.98400 105.55300 149.17800 1.000 46.90904  ? 415 TYR C OH  1 
ATOM   9879  N N   . ILE C 1 416 ? 131.80700 97.78200  150.68800 1.000 40.96569  ? 416 ILE C N   1 
ATOM   9880  C CA  . ILE C 1 416 ? 131.54400 96.35000  150.69400 1.000 40.96569  ? 416 ILE C CA  1 
ATOM   9881  C C   . ILE C 1 416 ? 131.87700 95.80400  149.31900 1.000 40.96569  ? 416 ILE C C   1 
ATOM   9882  O O   . ILE C 1 416 ? 131.26900 96.21000  148.32600 1.000 40.96569  ? 416 ILE C O   1 
ATOM   9883  C CB  . ILE C 1 416 ? 130.08200 96.04200  151.04900 1.000 40.96569  ? 416 ILE C CB  1 
ATOM   9884  C CG1 . ILE C 1 416 ? 129.74000 96.59700  152.42300 1.000 40.96569  ? 416 ILE C CG1 1 
ATOM   9885  C CG2 . ILE C 1 416 ? 129.82800 94.56100  150.99600 1.000 40.96569  ? 416 ILE C CG2 1 
ATOM   9886  C CD1 . ILE C 1 416 ? 128.27200 96.65400  152.68300 1.000 40.96569  ? 416 ILE C CD1 1 
ATOM   9887  N N   . LEU C 1 417 ? 132.82400 94.88000  149.26200 1.000 39.57919  ? 417 LEU C N   1 
ATOM   9888  C CA  . LEU C 1 417 ? 133.30300 94.33600  148.00200 1.000 39.57919  ? 417 LEU C CA  1 
ATOM   9889  C C   . LEU C 1 417 ? 132.29600 93.33500  147.45400 1.000 39.57919  ? 417 LEU C C   1 
ATOM   9890  O O   . LEU C 1 417 ? 132.06000 92.29400  148.06700 1.000 39.57919  ? 417 LEU C O   1 
ATOM   9891  C CB  . LEU C 1 417 ? 134.65600 93.66900  148.21800 1.000 39.57919  ? 417 LEU C CB  1 
ATOM   9892  C CG  . LEU C 1 417 ? 135.59600 93.46300  147.04400 1.000 39.57919  ? 417 LEU C CG  1 
ATOM   9893  C CD1 . LEU C 1 417 ? 137.00200 93.55200  147.55400 1.000 39.57919  ? 417 LEU C CD1 1 
ATOM   9894  C CD2 . LEU C 1 417 ? 135.38200 92.13200  146.38500 1.000 39.57919  ? 417 LEU C CD2 1 
ATOM   9895  N N   . VAL C 1 418 ? 131.71700 93.63900  146.29700 1.000 38.07753  ? 418 VAL C N   1 
ATOM   9896  C CA  . VAL C 1 418 ? 130.72300 92.76100  145.68900 1.000 38.07753  ? 418 VAL C CA  1 
ATOM   9897  C C   . VAL C 1 418 ? 131.37400 91.68100  144.83600 1.000 38.07753  ? 418 VAL C C   1 
ATOM   9898  O O   . VAL C 1 418 ? 131.04300 90.50300  144.96700 1.000 38.07753  ? 418 VAL C O   1 
ATOM   9899  C CB  . VAL C 1 418 ? 129.70900 93.58100  144.86900 1.000 38.07753  ? 418 VAL C CB  1 
ATOM   9900  C CG1 . VAL C 1 418 ? 128.63700 92.68200  144.31500 1.000 38.07753  ? 418 VAL C CG1 1 
ATOM   9901  C CG2 . VAL C 1 418 ? 129.08900 94.65600  145.72500 1.000 38.07753  ? 418 VAL C CG2 1 
ATOM   9902  N N   . SER C 1 419 ? 132.30900 92.05800  143.96600 1.000 39.02933  ? 419 SER C N   1 
ATOM   9903  C CA  . SER C 1 419 ? 132.98600 91.09600  143.10500 1.000 39.02933  ? 419 SER C CA  1 
ATOM   9904  C C   . SER C 1 419 ? 134.32000 91.67800  142.67700 1.000 39.02933  ? 419 SER C C   1 
ATOM   9905  O O   . SER C 1 419 ? 134.36100 92.78400  142.14300 1.000 39.02933  ? 419 SER C O   1 
ATOM   9906  C CB  . SER C 1 419 ? 132.14300 90.77100  141.87500 1.000 39.02933  ? 419 SER C CB  1 
ATOM   9907  O OG  . SER C 1 419 ? 131.91300 91.93700  141.10700 1.000 39.02933  ? 419 SER C OG  1 
ATOM   9908  N N   . GLY C 1 420 ? 135.39400 90.93000  142.89100 1.000 40.88652  ? 420 GLY C N   1 
ATOM   9909  C CA  . GLY C 1 420 ? 136.71800 91.40800  142.55000 1.000 40.88652  ? 420 GLY C CA  1 
ATOM   9910  C C   . GLY C 1 420 ? 137.72900 91.07300  143.62300 1.000 40.88652  ? 420 GLY C C   1 
ATOM   9911  O O   . GLY C 1 420 ? 137.56200 90.07800  144.33200 1.000 40.88652  ? 420 GLY C O   1 
ATOM   9912  N N   . ALA C 1 421 ? 138.77400 91.88400  143.76000 1.000 43.49307  ? 421 ALA C N   1 
ATOM   9913  C CA  . ALA C 1 421 ? 139.76400 91.67500  144.80700 1.000 43.49307  ? 421 ALA C CA  1 
ATOM   9914  C C   . ALA C 1 421 ? 140.47700 92.98700  145.08800 1.000 43.49307  ? 421 ALA C C   1 
ATOM   9915  O O   . ALA C 1 421 ? 140.61600 93.83100  144.20300 1.000 43.49307  ? 421 ALA C O   1 
ATOM   9916  C CB  . ALA C 1 421 ? 140.77800 90.59200  144.42600 1.000 43.49307  ? 421 ALA C CB  1 
ATOM   9917  N N   . VAL C 1 422 ? 140.93600 93.13500  146.33100 1.000 47.73579  ? 422 VAL C N   1 
ATOM   9918  C CA  . VAL C 1 422 ? 141.50800 94.37000  146.85300 1.000 47.73579  ? 422 VAL C CA  1 
ATOM   9919  C C   . VAL C 1 422 ? 142.67600 94.01200  147.76300 1.000 47.73579  ? 422 VAL C C   1 
ATOM   9920  O O   . VAL C 1 422 ? 142.59700 93.08300  148.56600 1.000 47.73579  ? 422 VAL C O   1 
ATOM   9921  C CB  . VAL C 1 422 ? 140.42100 95.19000  147.59500 1.000 47.73579  ? 422 VAL C CB  1 
ATOM   9922  C CG1 . VAL C 1 422 ? 140.99300 96.11000  148.62700 1.000 47.73579  ? 422 VAL C CG1 1 
ATOM   9923  C CG2 . VAL C 1 422 ? 139.63400 96.01700  146.60800 1.000 47.73579  ? 422 VAL C CG2 1 
ATOM   9924  N N   . ASP C 1 423 ? 143.77900 94.74900  147.62400 1.000 51.39475  ? 423 ASP C N   1 
ATOM   9925  C CA  . ASP C 1 423 ? 144.98400 94.48200  148.40200 1.000 51.39475  ? 423 ASP C CA  1 
ATOM   9926  C C   . ASP C 1 423 ? 145.33200 95.69500  149.25000 1.000 51.39475  ? 423 ASP C C   1 
ATOM   9927  O O   . ASP C 1 423 ? 145.58600 96.77500  148.71300 1.000 51.39475  ? 423 ASP C O   1 
ATOM   9928  C CB  . ASP C 1 423 ? 146.15500 94.12400  147.48600 1.000 51.39475  ? 423 ASP C CB  1 
ATOM   9929  N N   . PHE C 1 424 ? 145.35700 95.51100  150.56900 1.000 56.75933  ? 424 PHE C N   1 
ATOM   9930  C CA  . PHE C 1 424 ? 145.74600 96.55700  151.50100 1.000 56.75933  ? 424 PHE C CA  1 
ATOM   9931  C C   . PHE C 1 424 ? 147.25900 96.73400  151.51700 1.000 56.75933  ? 424 PHE C C   1 
ATOM   9932  O O   . PHE C 1 424 ? 148.02100 95.80900  151.23400 1.000 56.75933  ? 424 PHE C O   1 
ATOM   9933  C CB  . PHE C 1 424 ? 145.28400 96.22900  152.91600 1.000 56.75933  ? 424 PHE C CB  1 
ATOM   9934  C CG  . PHE C 1 424 ? 143.83100 95.92100  153.02500 1.000 56.75933  ? 424 PHE C CG  1 
ATOM   9935  C CD1 . PHE C 1 424 ? 142.89600 96.75000  152.45900 1.000 56.75933  ? 424 PHE C CD1 1 
ATOM   9936  C CD2 . PHE C 1 424 ? 143.40200 94.80500  153.70600 1.000 56.75933  ? 424 PHE C CD2 1 
ATOM   9937  C CE1 . PHE C 1 424 ? 141.55900 96.46700  152.56400 1.000 56.75933  ? 424 PHE C CE1 1 
ATOM   9938  C CE2 . PHE C 1 424 ? 142.07000 94.51700  153.81500 1.000 56.75933  ? 424 PHE C CE2 1 
ATOM   9939  C CZ  . PHE C 1 424 ? 141.14900 95.34900  153.24700 1.000 56.75933  ? 424 PHE C CZ  1 
ATOM   9940  N N   . THR C 1 425 ? 147.69000 97.94400  151.86000 1.000 63.25406  ? 425 THR C N   1 
ATOM   9941  C CA  . THR C 1 425 ? 149.10700 98.21900  152.03700 1.000 63.25406  ? 425 THR C CA  1 
ATOM   9942  C C   . THR C 1 425 ? 149.28400 99.22800  153.16100 1.000 63.25406  ? 425 THR C C   1 
ATOM   9943  O O   . THR C 1 425 ? 148.32500 99.83700  153.63600 1.000 63.25406  ? 425 THR C O   1 
ATOM   9944  C CB  . THR C 1 425 ? 149.74900 98.73600  150.75300 1.000 63.25406  ? 425 THR C CB  1 
ATOM   9945  O OG1 . THR C 1 425 ? 151.12300 99.05000  151.00300 1.000 63.25406  ? 425 THR C OG1 1 
ATOM   9946  C CG2 . THR C 1 425 ? 149.05600 99.98300  150.29700 1.000 63.25406  ? 425 THR C CG2 1 
ATOM   9947  N N   . VAL C 1 426 ? 150.53500 99.38900  153.59200 1.000 68.71011  ? 426 VAL C N   1 
ATOM   9948  C CA  . VAL C 1 426 ? 150.88300 100.31500 154.66400 1.000 68.71011  ? 426 VAL C CA  1 
ATOM   9949  C C   . VAL C 1 426 ? 151.76800 101.36100 153.98100 1.000 68.71011  ? 426 VAL C C   1 
ATOM   9950  O O   . VAL C 1 426 ? 152.02100 101.24900 152.77700 1.000 68.71011  ? 426 VAL C O   1 
ATOM   9951  C CB  . VAL C 1 426 ? 151.57500 99.57500  155.83400 1.000 68.71011  ? 426 VAL C CB  1 
ATOM   9952  C CG1 . VAL C 1 426 ? 151.53200 100.36900 157.15200 1.000 68.71011  ? 426 VAL C CG1 1 
ATOM   9953  C CG2 . VAL C 1 426 ? 150.97100 98.19200  156.04100 1.000 68.71011  ? 426 VAL C CG2 1 
ATOM   9954  N N   . TYR C 1 427 ? 152.23300 102.37200 154.72500 1.000 72.76957  ? 427 TYR C N   1 
ATOM   9955  C CA  . TYR C 1 427 ? 152.83900 103.61500 154.24100 1.000 72.76957  ? 427 TYR C CA  1 
ATOM   9956  C C   . TYR C 1 427 ? 153.94300 103.49100 153.19200 1.000 72.76957  ? 427 TYR C C   1 
ATOM   9957  O O   . TYR C 1 427 ? 154.07600 104.36900 152.33400 1.000 72.76957  ? 427 TYR C O   1 
ATOM   9958  C CB  . TYR C 1 427 ? 153.39000 104.40000 155.43300 1.000 72.76957  ? 427 TYR C CB  1 
ATOM   9959  N N   . VAL C 1 428 ? 154.74900 102.43100 153.24600 1.000 75.48301  ? 428 VAL C N   1 
ATOM   9960  C CA  . VAL C 1 428 ? 155.79600 102.25700 152.24300 1.000 75.48301  ? 428 VAL C CA  1 
ATOM   9961  C C   . VAL C 1 428 ? 155.49800 101.02300 151.40300 1.000 75.48301  ? 428 VAL C C   1 
ATOM   9962  O O   . VAL C 1 428 ? 155.22100 101.12900 150.20300 1.000 75.48301  ? 428 VAL C O   1 
ATOM   9963  C CB  . VAL C 1 428 ? 157.19200 102.14700 152.88900 1.000 75.48301  ? 428 VAL C CB  1 
ATOM   9964  C CG1 . VAL C 1 428 ? 158.27600 102.27600 151.82700 1.000 75.48301  ? 428 VAL C CG1 1 
ATOM   9965  C CG2 . VAL C 1 428 ? 157.37500 103.19800 153.97600 1.000 75.48301  ? 428 VAL C CG2 1 
ATOM   9966  N N   . ASP C 1 429 ? 155.54000 99.84600  152.03400 1.000 77.04435  ? 429 ASP C N   1 
ATOM   9967  C CA  . ASP C 1 429 ? 155.22500 98.59400  151.34700 1.000 77.04435  ? 429 ASP C CA  1 
ATOM   9968  C C   . ASP C 1 429 ? 154.81800 97.57600  152.41200 1.000 77.04435  ? 429 ASP C C   1 
ATOM   9969  O O   . ASP C 1 429 ? 155.68100 96.97700  153.05800 1.000 77.04435  ? 429 ASP C O   1 
ATOM   9970  C CB  . ASP C 1 429 ? 156.40600 98.09700  150.52800 1.000 77.04435  ? 429 ASP C CB  1 
ATOM   9971  N N   . GLY C 1 430 ? 153.51600 97.38500  152.57600 1.000 70.85607  ? 430 GLY C N   1 
ATOM   9972  C CA  . GLY C 1 430 ? 153.01500 96.36200  153.46800 1.000 70.85607  ? 430 GLY C CA  1 
ATOM   9973  C C   . GLY C 1 430 ? 152.11400 95.41800  152.70900 1.000 70.85607  ? 430 GLY C C   1 
ATOM   9974  O O   . GLY C 1 430 ? 152.02800 95.52000  151.48200 1.000 70.85607  ? 430 GLY C O   1 
ATOM   9975  N N   . HIS C 1 431 ? 151.43600 94.50700  153.40700 1.000 68.86491  ? 431 HIS C N   1 
ATOM   9976  C CA  . HIS C 1 431 ? 150.50400 93.61700  152.72800 1.000 68.86491  ? 431 HIS C CA  1 
ATOM   9977  C C   . HIS C 1 431 ? 149.42700 93.04600  153.64000 1.000 68.86491  ? 431 HIS C C   1 
ATOM   9978  O O   . HIS C 1 431 ? 149.72200 92.34200  154.60900 1.000 68.86491  ? 431 HIS C O   1 
ATOM   9979  C CB  . HIS C 1 431 ? 151.23700 92.45400  152.06100 1.000 68.86491  ? 431 HIS C CB  1 
ATOM   9980  C CG  . HIS C 1 431 ? 150.37100 91.66900  151.13100 1.000 68.86491  ? 431 HIS C CG  1 
ATOM   9981  N ND1 . HIS C 1 431 ? 150.12200 92.06600  149.83700 1.000 68.86491  ? 431 HIS C ND1 1 
ATOM   9982  C CD2 . HIS C 1 431 ? 149.67100 90.52500  151.31700 1.000 68.86491  ? 431 HIS C CD2 1 
ATOM   9983  C CE1 . HIS C 1 431 ? 149.31800 91.19200  149.25900 1.000 68.86491  ? 431 HIS C CE1 1 
ATOM   9984  N NE2 . HIS C 1 431 ? 149.02900 90.24800  150.13500 1.000 68.86491  ? 431 HIS C NE2 1 
ATOM   9985  N N   . ASP C 1 432 ? 148.17400 93.36500  153.33300 1.000 64.27811  ? 432 ASP C N   1 
ATOM   9986  C CA  . ASP C 1 432 ? 147.00200 92.63400  153.79400 1.000 64.27811  ? 432 ASP C CA  1 
ATOM   9987  C C   . ASP C 1 432 ? 146.05800 92.55800  152.59900 1.000 64.27811  ? 432 ASP C C   1 
ATOM   9988  O O   . ASP C 1 432 ? 146.25200 93.26800  151.61100 1.000 64.27811  ? 432 ASP C O   1 
ATOM   9989  C CB  . ASP C 1 432 ? 146.32500 93.31000  154.99300 1.000 64.27811  ? 432 ASP C CB  1 
ATOM   9990  C CG  . ASP C 1 432 ? 147.30400 93.73400  156.07800 1.000 64.27811  ? 432 ASP C CG  1 
ATOM   9991  O OD1 . ASP C 1 432 ? 148.07700 94.69200  155.86100 1.000 64.27811  ? 432 ASP C OD1 1 
ATOM   9992  O OD2 . ASP C 1 432 ? 147.28000 93.12000  157.16300 1.000 64.27811  ? 432 ASP C OD2 1 
ATOM   9993  N N   . GLN C 1 433 ? 145.04400 91.69500  152.67600 1.000 60.68081  ? 433 GLN C N   1 
ATOM   9994  C CA  . GLN C 1 433 ? 144.19600 91.46100  151.51300 1.000 60.68081  ? 433 GLN C CA  1 
ATOM   9995  C C   . GLN C 1 433 ? 142.78100 91.08000  151.92700 1.000 60.68081  ? 433 GLN C C   1 
ATOM   9996  O O   . GLN C 1 433 ? 142.59000 90.23200  152.80100 1.000 60.68081  ? 433 GLN C O   1 
ATOM   99