data_7CN9
# 
_entry.id   7CN9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.336 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   7CN9         
WWPDB D_1300017699 
EMDB  EMD-30419    
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        'Cryo-EM structure of SARS-CoV-2 Spike ectodomain' 
_pdbx_database_related.db_id          EMD-30419 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        7CN9 
_pdbx_database_status.recvd_initial_deposition_date   2020-07-30 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Ho, M.'    1 ? 
'Chang, Y.' 2 ? 
'Wang, C.'  3 ? 
'Wu, Y.'    4 ? 
'Huang, H.' 5 ? 
'Chen, T.'  6 ? 
'Lo, J.M.'  7 ? 
'Chen, X.'  8 ? 
'Ma, C.'    9 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Cell Rep' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2211-1247 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            32 
_citation.language                  ? 
_citation.page_first                108016 
_citation.page_last                 108016 
_citation.title                     
'A Carbohydrate-Binding Protein from the Edible Lablab Beans Effectively Blocks the Infections of Influenza Viruses and SARS-CoV-2.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.celrep.2020.108016 
_citation.pdbx_database_id_PubMed   32755598 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Liu, Y.M.'            1  ? 
primary 'Shahed-Al-Mahmud, M.' 2  ? 
primary 'Chen, X.'             3  ? 
primary 'Chen, T.H.'           4  ? 
primary 'Liao, K.S.'           5  ? 
primary 'Lo, J.M.'             6  ? 
primary 'Wu, Y.M.'             7  ? 
primary 'Ho, M.C.'             8  ? 
primary 'Wu, C.Y.'             9  ? 
primary 'Wong, C.H.'           10 ? 
primary 'Jan, J.T.'            11 ? 
primary 'Ma, C.'               12 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     7CN9 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.00 
_cell.length_a_esd                 ? 
_cell.length_b                     1.00 
_cell.length_b_esd                 ? 
_cell.length_c                     1.00 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        ? 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         7CN9 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Spike glycoprotein' 124524.914 3  ? 'R682G, R683S, R685G, K986P, V986P' ? ? 
2 branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401    8  ? ? ? ? 
3 branched    man 
'2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose' 570.542    1 
? ?                                   ? ? 
4 branched    man 
'beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 586.542    2  
? ?                                   ? ? 
5 branched    man 
;alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
;
748.682    1  ? ?                                   ? ? 
6 branched    man 
;alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
;
748.682    1  ? ?                                   ? ? 
7 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208    23 ? ?                                   ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'S glycoprotein,E2,Peplomer protein,Spike protein S1, Spike protein S2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;QCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFA
STEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQ
PFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGD
SSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNIT
NLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPG
QTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQ
SYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTT
DAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGA
EHVNNSYECDIPIGAGICASYQTQTNSPGSAGSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTK
TSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPS
KRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAA
LQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAI
SSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFP
QSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIV
NNTVYDP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;QCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFA
STEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQ
PFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGD
SSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNIT
NLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPG
QTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQ
SYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTT
DAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGA
EHVNNSYECDIPIGAGICASYQTQTNSPGSAGSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTK
TSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPS
KRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAA
LQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAI
SSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFP
QSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIV
NNTVYDP
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    GLN n 
1 2    CYS n 
1 3    VAL n 
1 4    ASN n 
1 5    LEU n 
1 6    THR n 
1 7    THR n 
1 8    ARG n 
1 9    THR n 
1 10   GLN n 
1 11   LEU n 
1 12   PRO n 
1 13   PRO n 
1 14   ALA n 
1 15   TYR n 
1 16   THR n 
1 17   ASN n 
1 18   SER n 
1 19   PHE n 
1 20   THR n 
1 21   ARG n 
1 22   GLY n 
1 23   VAL n 
1 24   TYR n 
1 25   TYR n 
1 26   PRO n 
1 27   ASP n 
1 28   LYS n 
1 29   VAL n 
1 30   PHE n 
1 31   ARG n 
1 32   SER n 
1 33   SER n 
1 34   VAL n 
1 35   LEU n 
1 36   HIS n 
1 37   SER n 
1 38   THR n 
1 39   GLN n 
1 40   ASP n 
1 41   LEU n 
1 42   PHE n 
1 43   LEU n 
1 44   PRO n 
1 45   PHE n 
1 46   PHE n 
1 47   SER n 
1 48   ASN n 
1 49   VAL n 
1 50   THR n 
1 51   TRP n 
1 52   PHE n 
1 53   HIS n 
1 54   ALA n 
1 55   ILE n 
1 56   HIS n 
1 57   VAL n 
1 58   SER n 
1 59   GLY n 
1 60   THR n 
1 61   ASN n 
1 62   GLY n 
1 63   THR n 
1 64   LYS n 
1 65   ARG n 
1 66   PHE n 
1 67   ASP n 
1 68   ASN n 
1 69   PRO n 
1 70   VAL n 
1 71   LEU n 
1 72   PRO n 
1 73   PHE n 
1 74   ASN n 
1 75   ASP n 
1 76   GLY n 
1 77   VAL n 
1 78   TYR n 
1 79   PHE n 
1 80   ALA n 
1 81   SER n 
1 82   THR n 
1 83   GLU n 
1 84   LYS n 
1 85   SER n 
1 86   ASN n 
1 87   ILE n 
1 88   ILE n 
1 89   ARG n 
1 90   GLY n 
1 91   TRP n 
1 92   ILE n 
1 93   PHE n 
1 94   GLY n 
1 95   THR n 
1 96   THR n 
1 97   LEU n 
1 98   ASP n 
1 99   SER n 
1 100  LYS n 
1 101  THR n 
1 102  GLN n 
1 103  SER n 
1 104  LEU n 
1 105  LEU n 
1 106  ILE n 
1 107  VAL n 
1 108  ASN n 
1 109  ASN n 
1 110  ALA n 
1 111  THR n 
1 112  ASN n 
1 113  VAL n 
1 114  VAL n 
1 115  ILE n 
1 116  LYS n 
1 117  VAL n 
1 118  CYS n 
1 119  GLU n 
1 120  PHE n 
1 121  GLN n 
1 122  PHE n 
1 123  CYS n 
1 124  ASN n 
1 125  ASP n 
1 126  PRO n 
1 127  PHE n 
1 128  LEU n 
1 129  GLY n 
1 130  VAL n 
1 131  TYR n 
1 132  TYR n 
1 133  HIS n 
1 134  LYS n 
1 135  ASN n 
1 136  ASN n 
1 137  LYS n 
1 138  SER n 
1 139  TRP n 
1 140  MET n 
1 141  GLU n 
1 142  SER n 
1 143  GLU n 
1 144  PHE n 
1 145  ARG n 
1 146  VAL n 
1 147  TYR n 
1 148  SER n 
1 149  SER n 
1 150  ALA n 
1 151  ASN n 
1 152  ASN n 
1 153  CYS n 
1 154  THR n 
1 155  PHE n 
1 156  GLU n 
1 157  TYR n 
1 158  VAL n 
1 159  SER n 
1 160  GLN n 
1 161  PRO n 
1 162  PHE n 
1 163  LEU n 
1 164  MET n 
1 165  ASP n 
1 166  LEU n 
1 167  GLU n 
1 168  GLY n 
1 169  LYS n 
1 170  GLN n 
1 171  GLY n 
1 172  ASN n 
1 173  PHE n 
1 174  LYS n 
1 175  ASN n 
1 176  LEU n 
1 177  ARG n 
1 178  GLU n 
1 179  PHE n 
1 180  VAL n 
1 181  PHE n 
1 182  LYS n 
1 183  ASN n 
1 184  ILE n 
1 185  ASP n 
1 186  GLY n 
1 187  TYR n 
1 188  PHE n 
1 189  LYS n 
1 190  ILE n 
1 191  TYR n 
1 192  SER n 
1 193  LYS n 
1 194  HIS n 
1 195  THR n 
1 196  PRO n 
1 197  ILE n 
1 198  ASN n 
1 199  LEU n 
1 200  VAL n 
1 201  ARG n 
1 202  ASP n 
1 203  LEU n 
1 204  PRO n 
1 205  GLN n 
1 206  GLY n 
1 207  PHE n 
1 208  SER n 
1 209  ALA n 
1 210  LEU n 
1 211  GLU n 
1 212  PRO n 
1 213  LEU n 
1 214  VAL n 
1 215  ASP n 
1 216  LEU n 
1 217  PRO n 
1 218  ILE n 
1 219  GLY n 
1 220  ILE n 
1 221  ASN n 
1 222  ILE n 
1 223  THR n 
1 224  ARG n 
1 225  PHE n 
1 226  GLN n 
1 227  THR n 
1 228  LEU n 
1 229  LEU n 
1 230  ALA n 
1 231  LEU n 
1 232  HIS n 
1 233  ARG n 
1 234  SER n 
1 235  TYR n 
1 236  LEU n 
1 237  THR n 
1 238  PRO n 
1 239  GLY n 
1 240  ASP n 
1 241  SER n 
1 242  SER n 
1 243  SER n 
1 244  GLY n 
1 245  TRP n 
1 246  THR n 
1 247  ALA n 
1 248  GLY n 
1 249  ALA n 
1 250  ALA n 
1 251  ALA n 
1 252  TYR n 
1 253  TYR n 
1 254  VAL n 
1 255  GLY n 
1 256  TYR n 
1 257  LEU n 
1 258  GLN n 
1 259  PRO n 
1 260  ARG n 
1 261  THR n 
1 262  PHE n 
1 263  LEU n 
1 264  LEU n 
1 265  LYS n 
1 266  TYR n 
1 267  ASN n 
1 268  GLU n 
1 269  ASN n 
1 270  GLY n 
1 271  THR n 
1 272  ILE n 
1 273  THR n 
1 274  ASP n 
1 275  ALA n 
1 276  VAL n 
1 277  ASP n 
1 278  CYS n 
1 279  ALA n 
1 280  LEU n 
1 281  ASP n 
1 282  PRO n 
1 283  LEU n 
1 284  SER n 
1 285  GLU n 
1 286  THR n 
1 287  LYS n 
1 288  CYS n 
1 289  THR n 
1 290  LEU n 
1 291  LYS n 
1 292  SER n 
1 293  PHE n 
1 294  THR n 
1 295  VAL n 
1 296  GLU n 
1 297  LYS n 
1 298  GLY n 
1 299  ILE n 
1 300  TYR n 
1 301  GLN n 
1 302  THR n 
1 303  SER n 
1 304  ASN n 
1 305  PHE n 
1 306  ARG n 
1 307  VAL n 
1 308  GLN n 
1 309  PRO n 
1 310  THR n 
1 311  GLU n 
1 312  SER n 
1 313  ILE n 
1 314  VAL n 
1 315  ARG n 
1 316  PHE n 
1 317  PRO n 
1 318  ASN n 
1 319  ILE n 
1 320  THR n 
1 321  ASN n 
1 322  LEU n 
1 323  CYS n 
1 324  PRO n 
1 325  PHE n 
1 326  GLY n 
1 327  GLU n 
1 328  VAL n 
1 329  PHE n 
1 330  ASN n 
1 331  ALA n 
1 332  THR n 
1 333  ARG n 
1 334  PHE n 
1 335  ALA n 
1 336  SER n 
1 337  VAL n 
1 338  TYR n 
1 339  ALA n 
1 340  TRP n 
1 341  ASN n 
1 342  ARG n 
1 343  LYS n 
1 344  ARG n 
1 345  ILE n 
1 346  SER n 
1 347  ASN n 
1 348  CYS n 
1 349  VAL n 
1 350  ALA n 
1 351  ASP n 
1 352  TYR n 
1 353  SER n 
1 354  VAL n 
1 355  LEU n 
1 356  TYR n 
1 357  ASN n 
1 358  SER n 
1 359  ALA n 
1 360  SER n 
1 361  PHE n 
1 362  SER n 
1 363  THR n 
1 364  PHE n 
1 365  LYS n 
1 366  CYS n 
1 367  TYR n 
1 368  GLY n 
1 369  VAL n 
1 370  SER n 
1 371  PRO n 
1 372  THR n 
1 373  LYS n 
1 374  LEU n 
1 375  ASN n 
1 376  ASP n 
1 377  LEU n 
1 378  CYS n 
1 379  PHE n 
1 380  THR n 
1 381  ASN n 
1 382  VAL n 
1 383  TYR n 
1 384  ALA n 
1 385  ASP n 
1 386  SER n 
1 387  PHE n 
1 388  VAL n 
1 389  ILE n 
1 390  ARG n 
1 391  GLY n 
1 392  ASP n 
1 393  GLU n 
1 394  VAL n 
1 395  ARG n 
1 396  GLN n 
1 397  ILE n 
1 398  ALA n 
1 399  PRO n 
1 400  GLY n 
1 401  GLN n 
1 402  THR n 
1 403  GLY n 
1 404  LYS n 
1 405  ILE n 
1 406  ALA n 
1 407  ASP n 
1 408  TYR n 
1 409  ASN n 
1 410  TYR n 
1 411  LYS n 
1 412  LEU n 
1 413  PRO n 
1 414  ASP n 
1 415  ASP n 
1 416  PHE n 
1 417  THR n 
1 418  GLY n 
1 419  CYS n 
1 420  VAL n 
1 421  ILE n 
1 422  ALA n 
1 423  TRP n 
1 424  ASN n 
1 425  SER n 
1 426  ASN n 
1 427  ASN n 
1 428  LEU n 
1 429  ASP n 
1 430  SER n 
1 431  LYS n 
1 432  VAL n 
1 433  GLY n 
1 434  GLY n 
1 435  ASN n 
1 436  TYR n 
1 437  ASN n 
1 438  TYR n 
1 439  LEU n 
1 440  TYR n 
1 441  ARG n 
1 442  LEU n 
1 443  PHE n 
1 444  ARG n 
1 445  LYS n 
1 446  SER n 
1 447  ASN n 
1 448  LEU n 
1 449  LYS n 
1 450  PRO n 
1 451  PHE n 
1 452  GLU n 
1 453  ARG n 
1 454  ASP n 
1 455  ILE n 
1 456  SER n 
1 457  THR n 
1 458  GLU n 
1 459  ILE n 
1 460  TYR n 
1 461  GLN n 
1 462  ALA n 
1 463  GLY n 
1 464  SER n 
1 465  THR n 
1 466  PRO n 
1 467  CYS n 
1 468  ASN n 
1 469  GLY n 
1 470  VAL n 
1 471  GLU n 
1 472  GLY n 
1 473  PHE n 
1 474  ASN n 
1 475  CYS n 
1 476  TYR n 
1 477  PHE n 
1 478  PRO n 
1 479  LEU n 
1 480  GLN n 
1 481  SER n 
1 482  TYR n 
1 483  GLY n 
1 484  PHE n 
1 485  GLN n 
1 486  PRO n 
1 487  THR n 
1 488  ASN n 
1 489  GLY n 
1 490  VAL n 
1 491  GLY n 
1 492  TYR n 
1 493  GLN n 
1 494  PRO n 
1 495  TYR n 
1 496  ARG n 
1 497  VAL n 
1 498  VAL n 
1 499  VAL n 
1 500  LEU n 
1 501  SER n 
1 502  PHE n 
1 503  GLU n 
1 504  LEU n 
1 505  LEU n 
1 506  HIS n 
1 507  ALA n 
1 508  PRO n 
1 509  ALA n 
1 510  THR n 
1 511  VAL n 
1 512  CYS n 
1 513  GLY n 
1 514  PRO n 
1 515  LYS n 
1 516  LYS n 
1 517  SER n 
1 518  THR n 
1 519  ASN n 
1 520  LEU n 
1 521  VAL n 
1 522  LYS n 
1 523  ASN n 
1 524  LYS n 
1 525  CYS n 
1 526  VAL n 
1 527  ASN n 
1 528  PHE n 
1 529  ASN n 
1 530  PHE n 
1 531  ASN n 
1 532  GLY n 
1 533  LEU n 
1 534  THR n 
1 535  GLY n 
1 536  THR n 
1 537  GLY n 
1 538  VAL n 
1 539  LEU n 
1 540  THR n 
1 541  GLU n 
1 542  SER n 
1 543  ASN n 
1 544  LYS n 
1 545  LYS n 
1 546  PHE n 
1 547  LEU n 
1 548  PRO n 
1 549  PHE n 
1 550  GLN n 
1 551  GLN n 
1 552  PHE n 
1 553  GLY n 
1 554  ARG n 
1 555  ASP n 
1 556  ILE n 
1 557  ALA n 
1 558  ASP n 
1 559  THR n 
1 560  THR n 
1 561  ASP n 
1 562  ALA n 
1 563  VAL n 
1 564  ARG n 
1 565  ASP n 
1 566  PRO n 
1 567  GLN n 
1 568  THR n 
1 569  LEU n 
1 570  GLU n 
1 571  ILE n 
1 572  LEU n 
1 573  ASP n 
1 574  ILE n 
1 575  THR n 
1 576  PRO n 
1 577  CYS n 
1 578  SER n 
1 579  PHE n 
1 580  GLY n 
1 581  GLY n 
1 582  VAL n 
1 583  SER n 
1 584  VAL n 
1 585  ILE n 
1 586  THR n 
1 587  PRO n 
1 588  GLY n 
1 589  THR n 
1 590  ASN n 
1 591  THR n 
1 592  SER n 
1 593  ASN n 
1 594  GLN n 
1 595  VAL n 
1 596  ALA n 
1 597  VAL n 
1 598  LEU n 
1 599  TYR n 
1 600  GLN n 
1 601  ASP n 
1 602  VAL n 
1 603  ASN n 
1 604  CYS n 
1 605  THR n 
1 606  GLU n 
1 607  VAL n 
1 608  PRO n 
1 609  VAL n 
1 610  ALA n 
1 611  ILE n 
1 612  HIS n 
1 613  ALA n 
1 614  ASP n 
1 615  GLN n 
1 616  LEU n 
1 617  THR n 
1 618  PRO n 
1 619  THR n 
1 620  TRP n 
1 621  ARG n 
1 622  VAL n 
1 623  TYR n 
1 624  SER n 
1 625  THR n 
1 626  GLY n 
1 627  SER n 
1 628  ASN n 
1 629  VAL n 
1 630  PHE n 
1 631  GLN n 
1 632  THR n 
1 633  ARG n 
1 634  ALA n 
1 635  GLY n 
1 636  CYS n 
1 637  LEU n 
1 638  ILE n 
1 639  GLY n 
1 640  ALA n 
1 641  GLU n 
1 642  HIS n 
1 643  VAL n 
1 644  ASN n 
1 645  ASN n 
1 646  SER n 
1 647  TYR n 
1 648  GLU n 
1 649  CYS n 
1 650  ASP n 
1 651  ILE n 
1 652  PRO n 
1 653  ILE n 
1 654  GLY n 
1 655  ALA n 
1 656  GLY n 
1 657  ILE n 
1 658  CYS n 
1 659  ALA n 
1 660  SER n 
1 661  TYR n 
1 662  GLN n 
1 663  THR n 
1 664  GLN n 
1 665  THR n 
1 666  ASN n 
1 667  SER n 
1 668  PRO n 
1 669  GLY n 
1 670  SER n 
1 671  ALA n 
1 672  GLY n 
1 673  SER n 
1 674  VAL n 
1 675  ALA n 
1 676  SER n 
1 677  GLN n 
1 678  SER n 
1 679  ILE n 
1 680  ILE n 
1 681  ALA n 
1 682  TYR n 
1 683  THR n 
1 684  MET n 
1 685  SER n 
1 686  LEU n 
1 687  GLY n 
1 688  ALA n 
1 689  GLU n 
1 690  ASN n 
1 691  SER n 
1 692  VAL n 
1 693  ALA n 
1 694  TYR n 
1 695  SER n 
1 696  ASN n 
1 697  ASN n 
1 698  SER n 
1 699  ILE n 
1 700  ALA n 
1 701  ILE n 
1 702  PRO n 
1 703  THR n 
1 704  ASN n 
1 705  PHE n 
1 706  THR n 
1 707  ILE n 
1 708  SER n 
1 709  VAL n 
1 710  THR n 
1 711  THR n 
1 712  GLU n 
1 713  ILE n 
1 714  LEU n 
1 715  PRO n 
1 716  VAL n 
1 717  SER n 
1 718  MET n 
1 719  THR n 
1 720  LYS n 
1 721  THR n 
1 722  SER n 
1 723  VAL n 
1 724  ASP n 
1 725  CYS n 
1 726  THR n 
1 727  MET n 
1 728  TYR n 
1 729  ILE n 
1 730  CYS n 
1 731  GLY n 
1 732  ASP n 
1 733  SER n 
1 734  THR n 
1 735  GLU n 
1 736  CYS n 
1 737  SER n 
1 738  ASN n 
1 739  LEU n 
1 740  LEU n 
1 741  LEU n 
1 742  GLN n 
1 743  TYR n 
1 744  GLY n 
1 745  SER n 
1 746  PHE n 
1 747  CYS n 
1 748  THR n 
1 749  GLN n 
1 750  LEU n 
1 751  ASN n 
1 752  ARG n 
1 753  ALA n 
1 754  LEU n 
1 755  THR n 
1 756  GLY n 
1 757  ILE n 
1 758  ALA n 
1 759  VAL n 
1 760  GLU n 
1 761  GLN n 
1 762  ASP n 
1 763  LYS n 
1 764  ASN n 
1 765  THR n 
1 766  GLN n 
1 767  GLU n 
1 768  VAL n 
1 769  PHE n 
1 770  ALA n 
1 771  GLN n 
1 772  VAL n 
1 773  LYS n 
1 774  GLN n 
1 775  ILE n 
1 776  TYR n 
1 777  LYS n 
1 778  THR n 
1 779  PRO n 
1 780  PRO n 
1 781  ILE n 
1 782  LYS n 
1 783  ASP n 
1 784  PHE n 
1 785  GLY n 
1 786  GLY n 
1 787  PHE n 
1 788  ASN n 
1 789  PHE n 
1 790  SER n 
1 791  GLN n 
1 792  ILE n 
1 793  LEU n 
1 794  PRO n 
1 795  ASP n 
1 796  PRO n 
1 797  SER n 
1 798  LYS n 
1 799  PRO n 
1 800  SER n 
1 801  LYS n 
1 802  ARG n 
1 803  SER n 
1 804  PHE n 
1 805  ILE n 
1 806  GLU n 
1 807  ASP n 
1 808  LEU n 
1 809  LEU n 
1 810  PHE n 
1 811  ASN n 
1 812  LYS n 
1 813  VAL n 
1 814  THR n 
1 815  LEU n 
1 816  ALA n 
1 817  ASP n 
1 818  ALA n 
1 819  GLY n 
1 820  PHE n 
1 821  ILE n 
1 822  LYS n 
1 823  GLN n 
1 824  TYR n 
1 825  GLY n 
1 826  ASP n 
1 827  CYS n 
1 828  LEU n 
1 829  GLY n 
1 830  ASP n 
1 831  ILE n 
1 832  ALA n 
1 833  ALA n 
1 834  ARG n 
1 835  ASP n 
1 836  LEU n 
1 837  ILE n 
1 838  CYS n 
1 839  ALA n 
1 840  GLN n 
1 841  LYS n 
1 842  PHE n 
1 843  ASN n 
1 844  GLY n 
1 845  LEU n 
1 846  THR n 
1 847  VAL n 
1 848  LEU n 
1 849  PRO n 
1 850  PRO n 
1 851  LEU n 
1 852  LEU n 
1 853  THR n 
1 854  ASP n 
1 855  GLU n 
1 856  MET n 
1 857  ILE n 
1 858  ALA n 
1 859  GLN n 
1 860  TYR n 
1 861  THR n 
1 862  SER n 
1 863  ALA n 
1 864  LEU n 
1 865  LEU n 
1 866  ALA n 
1 867  GLY n 
1 868  THR n 
1 869  ILE n 
1 870  THR n 
1 871  SER n 
1 872  GLY n 
1 873  TRP n 
1 874  THR n 
1 875  PHE n 
1 876  GLY n 
1 877  ALA n 
1 878  GLY n 
1 879  ALA n 
1 880  ALA n 
1 881  LEU n 
1 882  GLN n 
1 883  ILE n 
1 884  PRO n 
1 885  PHE n 
1 886  ALA n 
1 887  MET n 
1 888  GLN n 
1 889  MET n 
1 890  ALA n 
1 891  TYR n 
1 892  ARG n 
1 893  PHE n 
1 894  ASN n 
1 895  GLY n 
1 896  ILE n 
1 897  GLY n 
1 898  VAL n 
1 899  THR n 
1 900  GLN n 
1 901  ASN n 
1 902  VAL n 
1 903  LEU n 
1 904  TYR n 
1 905  GLU n 
1 906  ASN n 
1 907  GLN n 
1 908  LYS n 
1 909  LEU n 
1 910  ILE n 
1 911  ALA n 
1 912  ASN n 
1 913  GLN n 
1 914  PHE n 
1 915  ASN n 
1 916  SER n 
1 917  ALA n 
1 918  ILE n 
1 919  GLY n 
1 920  LYS n 
1 921  ILE n 
1 922  GLN n 
1 923  ASP n 
1 924  SER n 
1 925  LEU n 
1 926  SER n 
1 927  SER n 
1 928  THR n 
1 929  ALA n 
1 930  SER n 
1 931  ALA n 
1 932  LEU n 
1 933  GLY n 
1 934  LYS n 
1 935  LEU n 
1 936  GLN n 
1 937  ASP n 
1 938  VAL n 
1 939  VAL n 
1 940  ASN n 
1 941  GLN n 
1 942  ASN n 
1 943  ALA n 
1 944  GLN n 
1 945  ALA n 
1 946  LEU n 
1 947  ASN n 
1 948  THR n 
1 949  LEU n 
1 950  VAL n 
1 951  LYS n 
1 952  GLN n 
1 953  LEU n 
1 954  SER n 
1 955  SER n 
1 956  ASN n 
1 957  PHE n 
1 958  GLY n 
1 959  ALA n 
1 960  ILE n 
1 961  SER n 
1 962  SER n 
1 963  VAL n 
1 964  LEU n 
1 965  ASN n 
1 966  ASP n 
1 967  ILE n 
1 968  LEU n 
1 969  SER n 
1 970  ARG n 
1 971  LEU n 
1 972  ASP n 
1 973  PRO n 
1 974  PRO n 
1 975  GLU n 
1 976  ALA n 
1 977  GLU n 
1 978  VAL n 
1 979  GLN n 
1 980  ILE n 
1 981  ASP n 
1 982  ARG n 
1 983  LEU n 
1 984  ILE n 
1 985  THR n 
1 986  GLY n 
1 987  ARG n 
1 988  LEU n 
1 989  GLN n 
1 990  SER n 
1 991  LEU n 
1 992  GLN n 
1 993  THR n 
1 994  TYR n 
1 995  VAL n 
1 996  THR n 
1 997  GLN n 
1 998  GLN n 
1 999  LEU n 
1 1000 ILE n 
1 1001 ARG n 
1 1002 ALA n 
1 1003 ALA n 
1 1004 GLU n 
1 1005 ILE n 
1 1006 ARG n 
1 1007 ALA n 
1 1008 SER n 
1 1009 ALA n 
1 1010 ASN n 
1 1011 LEU n 
1 1012 ALA n 
1 1013 ALA n 
1 1014 THR n 
1 1015 LYS n 
1 1016 MET n 
1 1017 SER n 
1 1018 GLU n 
1 1019 CYS n 
1 1020 VAL n 
1 1021 LEU n 
1 1022 GLY n 
1 1023 GLN n 
1 1024 SER n 
1 1025 LYS n 
1 1026 ARG n 
1 1027 VAL n 
1 1028 ASP n 
1 1029 PHE n 
1 1030 CYS n 
1 1031 GLY n 
1 1032 LYS n 
1 1033 GLY n 
1 1034 TYR n 
1 1035 HIS n 
1 1036 LEU n 
1 1037 MET n 
1 1038 SER n 
1 1039 PHE n 
1 1040 PRO n 
1 1041 GLN n 
1 1042 SER n 
1 1043 ALA n 
1 1044 PRO n 
1 1045 HIS n 
1 1046 GLY n 
1 1047 VAL n 
1 1048 VAL n 
1 1049 PHE n 
1 1050 LEU n 
1 1051 HIS n 
1 1052 VAL n 
1 1053 THR n 
1 1054 TYR n 
1 1055 VAL n 
1 1056 PRO n 
1 1057 ALA n 
1 1058 GLN n 
1 1059 GLU n 
1 1060 LYS n 
1 1061 ASN n 
1 1062 PHE n 
1 1063 THR n 
1 1064 THR n 
1 1065 ALA n 
1 1066 PRO n 
1 1067 ALA n 
1 1068 ILE n 
1 1069 CYS n 
1 1070 HIS n 
1 1071 ASP n 
1 1072 GLY n 
1 1073 LYS n 
1 1074 ALA n 
1 1075 HIS n 
1 1076 PHE n 
1 1077 PRO n 
1 1078 ARG n 
1 1079 GLU n 
1 1080 GLY n 
1 1081 VAL n 
1 1082 PHE n 
1 1083 VAL n 
1 1084 SER n 
1 1085 ASN n 
1 1086 GLY n 
1 1087 THR n 
1 1088 HIS n 
1 1089 TRP n 
1 1090 PHE n 
1 1091 VAL n 
1 1092 THR n 
1 1093 GLN n 
1 1094 ARG n 
1 1095 ASN n 
1 1096 PHE n 
1 1097 TYR n 
1 1098 GLU n 
1 1099 PRO n 
1 1100 GLN n 
1 1101 ILE n 
1 1102 ILE n 
1 1103 THR n 
1 1104 THR n 
1 1105 ASP n 
1 1106 ASN n 
1 1107 THR n 
1 1108 PHE n 
1 1109 VAL n 
1 1110 SER n 
1 1111 GLY n 
1 1112 ASN n 
1 1113 CYS n 
1 1114 ASP n 
1 1115 VAL n 
1 1116 VAL n 
1 1117 ILE n 
1 1118 GLY n 
1 1119 ILE n 
1 1120 VAL n 
1 1121 ASN n 
1 1122 ASN n 
1 1123 THR n 
1 1124 VAL n 
1 1125 TYR n 
1 1126 ASP n 
1 1127 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   1127 
_entity_src_gen.gene_src_common_name               2019-nCoV 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'S, 2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Severe acute respiratory syndrome coronavirus 2' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2697049 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            'HEK293 EBNA' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SPIKE_SARS2 
_struct_ref.pdbx_db_accession          P0DTC2 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;QCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFA
STEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQ
PFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGD
SSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNIT
NLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPG
QTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQ
SYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTT
DAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGA
EHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTK
TSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPS
KRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAA
LQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAI
SSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFP
QSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIV
NNTVYDP
;
_struct_ref.pdbx_align_begin           14 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 7CN9 A 1 ? 1127 ? P0DTC2 14 ? 1140 ? 14 1140 
2 1 7CN9 B 1 ? 1127 ? P0DTC2 14 ? 1140 ? 14 1140 
3 1 7CN9 C 1 ? 1127 ? P0DTC2 14 ? 1140 ? 14 1140 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 7CN9 GLY A 669 ? UNP P0DTC2 ARG 682 'engineered mutation' 682 1  
1 7CN9 SER A 670 ? UNP P0DTC2 ARG 683 'engineered mutation' 683 2  
1 7CN9 GLY A 672 ? UNP P0DTC2 ARG 685 'engineered mutation' 685 3  
1 7CN9 PRO A 973 ? UNP P0DTC2 LYS 986 'engineered mutation' 986 4  
1 7CN9 PRO A 974 ? UNP P0DTC2 VAL 987 'engineered mutation' 987 5  
2 7CN9 GLY B 669 ? UNP P0DTC2 ARG 682 'engineered mutation' 682 6  
2 7CN9 SER B 670 ? UNP P0DTC2 ARG 683 'engineered mutation' 683 7  
2 7CN9 GLY B 672 ? UNP P0DTC2 ARG 685 'engineered mutation' 685 8  
2 7CN9 PRO B 973 ? UNP P0DTC2 LYS 986 'engineered mutation' 986 9  
2 7CN9 PRO B 974 ? UNP P0DTC2 VAL 987 'engineered mutation' 987 10 
3 7CN9 GLY C 669 ? UNP P0DTC2 ARG 682 'engineered mutation' 682 11 
3 7CN9 SER C 670 ? UNP P0DTC2 ARG 683 'engineered mutation' 683 12 
3 7CN9 GLY C 672 ? UNP P0DTC2 ARG 685 'engineered mutation' 685 13 
3 7CN9 PRO C 973 ? UNP P0DTC2 LYS 986 'engineered mutation' 986 14 
3 7CN9 PRO C 974 ? UNP P0DTC2 VAL 987 'engineered mutation' 987 15 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
BMA 'D-saccharide, beta linking'  . beta-D-mannopyranose                     'beta-D-mannose; D-mannose; mannose' 'C6 H12 O6'      
180.156 
CYS 'L-peptide linking'           y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose                     
'alpha-L-fucose; 6-deoxy-alpha-L-galactopyranose; L-fucose; fucose' 'C6 H12 O5'      164.156 
GLN 'L-peptide linking'           y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking'           y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose                    'alpha-D-mannose; D-mannose; mannose' 'C6 H12 O6' 
180.156 
MET 'L-peptide linking'           y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose 
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   7CN9 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.entry_id                                 7CN9 
_refine.pdbx_diffrn_id                           ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            . 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON MICROSCOPY' ? 0.010  ? 25266 ? f_bond_d           ? ? 
'ELECTRON MICROSCOPY' ? 1.096  ? 34438 ? f_angle_d          ? ? 
'ELECTRON MICROSCOPY' ? 13.001 ? 3905  ? f_dihedral_angle_d ? ? 
'ELECTRON MICROSCOPY' ? 0.066  ? 4239  ? f_chiral_restr     ? ? 
'ELECTRON MICROSCOPY' ? 0.007  ? 4316  ? f_plane_restr      ? ? 
# 
_struct.entry_id                     7CN9 
_struct.title                        'Cryo-EM structure of SARS-CoV-2 Spike ectodomain' 
_struct.pdbx_descriptor              'Spike protein S1, Spike protein S2' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        7CN9 
_struct_keywords.text            'SARS-CoV-2, spike, fully glycosylated, VIRAL PROTEIN' 
_struct_keywords.pdbx_keywords   'VIRAL PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 2 ? 
E  N N 2 ? 
F  N N 3 ? 
G  N N 4 ? 
H  N N 2 ? 
I  N N 2 ? 
J  N N 2 ? 
K  N N 2 ? 
L  N N 5 ? 
M  N N 2 ? 
N  N N 2 ? 
O  N N 6 ? 
P  N N 4 ? 
Q  N N 7 ? 
R  N N 7 ? 
S  N N 7 ? 
T  N N 7 ? 
U  N N 7 ? 
V  N N 7 ? 
W  N N 7 ? 
X  N N 7 ? 
Y  N N 7 ? 
Z  N N 7 ? 
AA N N 7 ? 
BA N N 7 ? 
CA N N 7 ? 
DA N N 7 ? 
EA N N 7 ? 
FA N N 7 ? 
GA N N 7 ? 
HA N N 7 ? 
IA N N 7 ? 
JA N N 7 ? 
KA N N 7 ? 
LA N N 7 ? 
MA N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 281 ? LEU A 290  ? ASP A 294 LEU A 303  1 ? 10 
HELX_P HELX_P2  AA2 PHE A 325 ? ASN A 330  ? PHE A 338 ASN A 343  1 ? 6  
HELX_P HELX_P3  AA3 GLU A 393 ? ILE A 397  ? GLU A 406 ILE A 410  5 ? 5  
HELX_P HELX_P4  AA4 LYS A 404 ? ASN A 409  ? LYS A 417 ASN A 422  1 ? 6  
HELX_P HELX_P5  AA5 ASP A 724 ? CYS A 730  ? ASP A 737 CYS A 743  1 ? 7  
HELX_P HELX_P6  AA6 SER A 733 ? LEU A 741  ? SER A 746 LEU A 754  1 ? 9  
HELX_P HELX_P7  AA7 SER A 745 ? ALA A 770  ? SER A 758 ALA A 783  1 ? 26 
HELX_P HELX_P8  AA8 SER A 803 ? ASN A 811  ? SER A 816 ASN A 824  1 ? 9  
HELX_P HELX_P9  AA9 THR A 853 ? SER A 871  ? THR A 866 SER A 884  1 ? 19 
HELX_P HELX_P10 AB1 TRP A 873 ? GLY A 878  ? TRP A 886 GLY A 891  1 ? 6  
HELX_P HELX_P11 AB2 PRO A 884 ? GLY A 897  ? PRO A 897 GLY A 910  1 ? 14 
HELX_P HELX_P12 AB3 GLN A 900 ? SER A 927  ? GLN A 913 SER A 940  1 ? 28 
HELX_P HELX_P13 AB4 LEU A 932 ? LEU A 953  ? LEU A 945 LEU A 966  1 ? 22 
HELX_P HELX_P14 AB5 VAL A 963 ? LEU A 971  ? VAL A 976 LEU A 984  1 ? 9  
HELX_P HELX_P15 AB6 ASP A 972 ? LEU A 1021 ? ASP A 985 LEU A 1034 1 ? 50 
HELX_P HELX_P16 AB7 GLN B 160 ? ASP B 165  ? GLN B 173 ASP B 178  1 ? 6  
HELX_P HELX_P17 AB8 LEU B 283 ? LYS B 291  ? LEU B 296 LYS B 304  1 ? 9  
HELX_P HELX_P18 AB9 ASP B 351 ? ASN B 357  ? ASP B 364 ASN B 370  1 ? 7  
HELX_P HELX_P19 AC1 SER B 370 ? ASN B 375  ? SER B 383 ASN B 388  1 ? 6  
HELX_P HELX_P20 AC2 ASN B 529 ? LEU B 533  ? ASN B 542 LEU B 546  5 ? 5  
HELX_P HELX_P21 AC3 GLY B 588 ? SER B 592  ? GLY B 601 SER B 605  5 ? 5  
HELX_P HELX_P22 AC4 ASP B 724 ? GLY B 731  ? ASP B 737 GLY B 744  1 ? 8  
HELX_P HELX_P23 AC5 SER B 733 ? GLN B 742  ? SER B 746 GLN B 755  1 ? 10 
HELX_P HELX_P24 AC6 SER B 745 ? ALA B 770  ? SER B 758 ALA B 783  1 ? 26 
HELX_P HELX_P25 AC7 SER B 803 ? VAL B 813  ? SER B 816 VAL B 826  1 ? 11 
HELX_P HELX_P26 AC8 THR B 853 ? GLY B 872  ? THR B 866 GLY B 885  1 ? 20 
HELX_P HELX_P27 AC9 TRP B 873 ? GLY B 878  ? TRP B 886 GLY B 891  5 ? 6  
HELX_P HELX_P28 AD1 PRO B 884 ? ILE B 896  ? PRO B 897 ILE B 909  1 ? 13 
HELX_P HELX_P29 AD2 THR B 899 ? THR B 928  ? THR B 912 THR B 941  1 ? 30 
HELX_P HELX_P30 AD3 LEU B 932 ? GLN B 952  ? LEU B 945 GLN B 965  1 ? 21 
HELX_P HELX_P31 AD4 LEU B 953 ? SER B 955  ? LEU B 966 SER B 968  5 ? 3  
HELX_P HELX_P32 AD5 VAL B 963 ? SER B 969  ? VAL B 976 SER B 982  1 ? 7  
HELX_P HELX_P33 AD6 ASP B 972 ? VAL B 1020 ? ASP B 985 VAL B 1033 1 ? 49 
HELX_P HELX_P34 AD7 ASP C 281 ? LYS C 291  ? ASP C 294 LYS C 304  1 ? 11 
HELX_P HELX_P35 AD8 PRO C 324 ? ASN C 330  ? PRO C 337 ASN C 343  1 ? 7  
HELX_P HELX_P36 AD9 TYR C 352 ? SER C 358  ? TYR C 365 SER C 371  1 ? 7  
HELX_P HELX_P37 AE1 THR C 372 ? ASP C 376  ? THR C 385 ASP C 389  5 ? 5  
HELX_P HELX_P38 AE2 GLY C 403 ? ASN C 409  ? GLY C 416 ASN C 422  1 ? 7  
HELX_P HELX_P39 AE3 ASP C 724 ? GLY C 731  ? ASP C 737 GLY C 744  1 ? 8  
HELX_P HELX_P40 AE4 SER C 733 ? LEU C 741  ? SER C 746 LEU C 754  1 ? 9  
HELX_P HELX_P41 AE5 SER C 745 ? ALA C 770  ? SER C 758 ALA C 783  1 ? 26 
HELX_P HELX_P42 AE6 ASN C 788 ? ILE C 792  ? ASN C 801 ILE C 805  5 ? 5  
HELX_P HELX_P43 AE7 SER C 803 ? VAL C 813  ? SER C 816 VAL C 826  1 ? 11 
HELX_P HELX_P44 AE8 THR C 853 ? SER C 871  ? THR C 866 SER C 884  1 ? 19 
HELX_P HELX_P45 AE9 TRP C 873 ? GLY C 878  ? TRP C 886 GLY C 891  1 ? 6  
HELX_P HELX_P46 AF1 PRO C 884 ? GLY C 897  ? PRO C 897 GLY C 910  1 ? 14 
HELX_P HELX_P47 AF2 GLN C 900 ? SER C 927  ? GLN C 913 SER C 940  1 ? 28 
HELX_P HELX_P48 AF3 LEU C 932 ? LEU C 953  ? LEU C 945 LEU C 966  1 ? 22 
HELX_P HELX_P49 AF4 VAL C 963 ? LEU C 971  ? VAL C 976 LEU C 984  1 ? 9  
HELX_P HELX_P50 AF5 ASP C 972 ? LEU C 1021 ? ASP C 985 LEU C 1034 1 ? 50 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 118  SG  ? ? ? 1_555 A  CYS 153  SG ? ? A CYS 131  A CYS 166  1_555 ? ? ? ? ? ? ? 2.021 ? ? 
disulf2  disulf ?    ? A CYS 278  SG  ? ? ? 1_555 A  CYS 288  SG ? ? A CYS 291  A CYS 301  1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf3  disulf ?    ? A CYS 323  SG  ? ? ? 1_555 A  CYS 348  SG ? ? A CYS 336  A CYS 361  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf4  disulf ?    ? A CYS 366  SG  ? ? ? 1_555 A  CYS 419  SG ? ? A CYS 379  A CYS 432  1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf5  disulf ?    ? A CYS 378  SG  ? ? ? 1_555 A  CYS 512  SG ? ? A CYS 391  A CYS 525  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf6  disulf ?    ? A CYS 525  SG  ? ? ? 1_555 A  CYS 577  SG ? ? A CYS 538  A CYS 590  1_555 ? ? ? ? ? ? ? 2.079 ? ? 
disulf7  disulf ?    ? A CYS 604  SG  ? ? ? 1_555 A  CYS 636  SG ? ? A CYS 617  A CYS 649  1_555 ? ? ? ? ? ? ? 2.029 ? ? 
disulf8  disulf ?    ? A CYS 649  SG  ? ? ? 1_555 A  CYS 658  SG ? ? A CYS 662  A CYS 671  1_555 ? ? ? ? ? ? ? 2.024 ? ? 
disulf9  disulf ?    ? A CYS 725  SG  ? ? ? 1_555 A  CYS 747  SG ? ? A CYS 738  A CYS 760  1_555 ? ? ? ? ? ? ? 2.030 ? ? 
disulf10 disulf ?    ? A CYS 730  SG  ? ? ? 1_555 A  CYS 736  SG ? ? A CYS 743  A CYS 749  1_555 ? ? ? ? ? ? ? 2.019 ? ? 
disulf11 disulf ?    ? A CYS 1019 SG  ? ? ? 1_555 A  CYS 1030 SG ? ? A CYS 1032 A CYS 1043 1_555 ? ? ? ? ? ? ? 2.024 ? ? 
disulf12 disulf ?    ? A CYS 1069 SG  ? ? ? 1_555 A  CYS 1113 SG ? ? A CYS 1082 A CYS 1126 1_555 ? ? ? ? ? ? ? 2.028 ? ? 
disulf13 disulf ?    ? B CYS 118  SG  ? ? ? 1_555 B  CYS 153  SG ? ? B CYS 131  B CYS 166  1_555 ? ? ? ? ? ? ? 1.891 ? ? 
disulf14 disulf ?    ? B CYS 278  SG  ? ? ? 1_555 B  CYS 288  SG ? ? B CYS 291  B CYS 301  1_555 ? ? ? ? ? ? ? 2.029 ? ? 
disulf15 disulf ?    ? B CYS 323  SG  ? ? ? 1_555 B  CYS 348  SG ? ? B CYS 336  B CYS 361  1_555 ? ? ? ? ? ? ? 1.931 ? ? 
disulf16 disulf ?    ? B CYS 366  SG  ? ? ? 1_555 B  CYS 419  SG ? ? B CYS 379  B CYS 432  1_555 ? ? ? ? ? ? ? 2.022 ? ? 
disulf17 disulf ?    ? B CYS 378  SG  ? ? ? 1_555 B  CYS 512  SG ? ? B CYS 391  B CYS 525  1_555 ? ? ? ? ? ? ? 2.042 ? ? 
disulf18 disulf ?    ? B CYS 525  SG  ? ? ? 1_555 B  CYS 577  SG ? ? B CYS 538  B CYS 590  1_555 ? ? ? ? ? ? ? 2.264 ? ? 
disulf19 disulf ?    ? B CYS 604  SG  ? ? ? 1_555 B  CYS 636  SG ? ? B CYS 617  B CYS 649  1_555 ? ? ? ? ? ? ? 2.023 ? ? 
disulf20 disulf ?    ? B CYS 649  SG  ? ? ? 1_555 B  CYS 658  SG ? ? B CYS 662  B CYS 671  1_555 ? ? ? ? ? ? ? 2.029 ? ? 
disulf21 disulf ?    ? B CYS 725  SG  ? ? ? 1_555 B  CYS 747  SG ? ? B CYS 738  B CYS 760  1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf22 disulf ?    ? B CYS 730  SG  ? ? ? 1_555 B  CYS 736  SG ? ? B CYS 743  B CYS 749  1_555 ? ? ? ? ? ? ? 2.023 ? ? 
disulf23 disulf ?    ? B CYS 1019 SG  ? ? ? 1_555 B  CYS 1030 SG ? ? B CYS 1032 B CYS 1043 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf24 disulf ?    ? B CYS 1069 SG  ? ? ? 1_555 B  CYS 1113 SG ? ? B CYS 1082 B CYS 1126 1_555 ? ? ? ? ? ? ? 2.029 ? ? 
disulf25 disulf ?    ? C CYS 118  SG  ? ? ? 1_555 C  CYS 153  SG ? ? C CYS 131  C CYS 166  1_555 ? ? ? ? ? ? ? 2.036 ? ? 
disulf26 disulf ?    ? C CYS 278  SG  ? ? ? 1_555 C  CYS 288  SG ? ? C CYS 291  C CYS 301  1_555 ? ? ? ? ? ? ? 2.024 ? ? 
disulf27 disulf ?    ? C CYS 323  SG  ? ? ? 1_555 C  CYS 348  SG ? ? C CYS 336  C CYS 361  1_555 ? ? ? ? ? ? ? 2.023 ? ? 
disulf28 disulf ?    ? C CYS 366  SG  ? ? ? 1_555 C  CYS 419  SG ? ? C CYS 379  C CYS 432  1_555 ? ? ? ? ? ? ? 2.043 ? ? 
disulf29 disulf ?    ? C CYS 378  SG  ? ? ? 1_555 C  CYS 512  SG ? ? C CYS 391  C CYS 525  1_555 ? ? ? ? ? ? ? 2.021 ? ? 
disulf30 disulf ?    ? C CYS 525  SG  ? ? ? 1_555 C  CYS 577  SG ? ? C CYS 538  C CYS 590  1_555 ? ? ? ? ? ? ? 2.039 ? ? 
disulf31 disulf ?    ? C CYS 604  SG  ? ? ? 1_555 C  CYS 636  SG ? ? C CYS 617  C CYS 649  1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf32 disulf ?    ? C CYS 649  SG  ? ? ? 1_555 C  CYS 658  SG ? ? C CYS 662  C CYS 671  1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf33 disulf ?    ? C CYS 730  SG  ? ? ? 1_555 C  CYS 736  SG ? ? C CYS 743  C CYS 749  1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf34 disulf ?    ? C CYS 1019 SG  ? ? ? 1_555 C  CYS 1030 SG ? ? C CYS 1032 C CYS 1043 1_555 ? ? ? ? ? ? ? 2.039 ? ? 
disulf35 disulf ?    ? C CYS 1069 SG  ? ? ? 1_555 C  CYS 1113 SG ? ? C CYS 1082 C CYS 1126 1_555 ? ? ? ? ? ? ? 2.030 ? ? 
covale1  covale one  ? A ASN 109  ND2 ? ? ? 1_555 V  NAG .    C1 ? ? A ASN 122  A NAG 1206 1_555 ? ? ? ? ? ? ? 1.435 ? 
N-Glycosylation 
covale2  covale one  ? A ASN 152  ND2 ? ? ? 1_555 N  NAG .    C1 ? ? A ASN 165  N NAG 1    1_555 ? ? ? ? ? ? ? 1.436 ? 
N-Glycosylation 
covale3  covale one  ? A ASN 269  ND2 ? ? ? 1_555 W  NAG .    C1 ? ? A ASN 282  A NAG 1207 1_555 ? ? ? ? ? ? ? 1.453 ? 
N-Glycosylation 
covale4  covale one  ? A ASN 318  ND2 ? ? ? 1_555 P  NAG .    C1 ? ? A ASN 331  V NAG 1    1_555 ? ? ? ? ? ? ? 1.439 ? 
N-Glycosylation 
covale5  covale one  ? A ASN 603  ND2 ? ? ? 1_555 Q  NAG .    C1 ? ? A ASN 616  A NAG 1201 1_555 ? ? ? ? ? ? ? 1.429 ? 
N-Glycosylation 
covale6  covale one  ? A ASN 644  ND2 ? ? ? 1_555 R  NAG .    C1 ? ? A ASN 657  A NAG 1202 1_555 ? ? ? ? ? ? ? 1.431 ? 
N-Glycosylation 
covale7  covale one  ? A ASN 704  ND2 ? ? ? 1_555 M  NAG .    C1 ? ? A ASN 717  H NAG 1    1_555 ? ? ? ? ? ? ? 1.432 ? 
N-Glycosylation 
covale8  covale one  ? A ASN 788  ND2 ? ? ? 1_555 O  NAG .    C1 ? ? A ASN 801  Q NAG 1    1_555 ? ? ? ? ? ? ? 1.435 ? 
N-Glycosylation 
covale9  covale one  ? A ASN 1061 ND2 ? ? ? 1_555 S  NAG .    C1 ? ? A ASN 1074 A NAG 1203 1_555 ? ? ? ? ? ? ? 1.440 ? 
N-Glycosylation 
covale10 covale one  ? A ASN 1085 ND2 ? ? ? 1_555 T  NAG .    C1 ? ? A ASN 1098 A NAG 1204 1_555 ? ? ? ? ? ? ? 1.444 ? 
N-Glycosylation 
covale11 covale one  ? A ASN 1121 ND2 ? ? ? 1_555 U  NAG .    C1 ? ? A ASN 1134 A NAG 1205 1_555 ? ? ? ? ? ? ? 1.448 ? 
N-Glycosylation 
covale12 covale one  ? B ASN 61   ND2 ? ? ? 1_555 FA NAG .    C1 ? ? B ASN 74   B NAG 1209 1_555 ? ? ? ? ? ? ? 1.439 ? 
N-Glycosylation 
covale13 covale one  ? B ASN 152  ND2 ? ? ? 1_555 EA NAG .    C1 ? ? B ASN 165  B NAG 1208 1_555 ? ? ? ? ? ? ? 1.423 ? 
N-Glycosylation 
covale14 covale one  ? B ASN 221  ND2 ? ? ? 1_555 DA NAG .    C1 ? ? B ASN 234  B NAG 1207 1_555 ? ? ? ? ? ? ? 1.440 ? 
N-Glycosylation 
covale15 covale one  ? B ASN 269  ND2 ? ? ? 1_555 L  NAG .    C1 ? ? B ASN 282  h NAG 1    1_555 ? ? ? ? ? ? ? 1.446 ? 
N-Glycosylation 
covale16 covale one  ? B ASN 318  ND2 ? ? ? 1_555 X  NAG .    C1 ? ? B ASN 331  B NAG 1201 1_555 ? ? ? ? ? ? ? 1.431 ? 
N-Glycosylation 
covale17 covale one  ? B ASN 590  ND2 ? ? ? 1_555 Y  NAG .    C1 ? ? B ASN 603  B NAG 1202 1_555 ? ? ? ? ? ? ? 1.431 ? 
N-Glycosylation 
covale18 covale one  ? B ASN 603  ND2 ? ? ? 1_555 Z  NAG .    C1 ? ? B ASN 616  B NAG 1203 1_555 ? ? ? ? ? ? ? 1.463 ? 
N-Glycosylation 
covale19 covale one  ? B ASN 644  ND2 ? ? ? 1_555 AA NAG .    C1 ? ? B ASN 657  B NAG 1204 1_555 ? ? ? ? ? ? ? 1.435 ? 
N-Glycosylation 
covale20 covale one  ? B ASN 696  ND2 ? ? ? 1_555 BA NAG .    C1 ? ? B ASN 709  B NAG 1205 1_555 ? ? ? ? ? ? ? 1.438 ? 
N-Glycosylation 
covale21 covale one  ? B ASN 704  ND2 ? ? ? 1_555 H  NAG .    C1 ? ? B ASN 717  W NAG 1    1_555 ? ? ? ? ? ? ? 1.423 ? 
N-Glycosylation 
covale22 covale one  ? B ASN 788  ND2 ? ? ? 1_555 K  NAG .    C1 ? ? B ASN 801  f NAG 1    1_555 ? ? ? ? ? ? ? 1.424 ? 
N-Glycosylation 
covale23 covale one  ? B ASN 1061 ND2 ? ? ? 1_555 J  NAG .    C1 ? ? B ASN 1074 d NAG 1    1_555 ? ? ? ? ? ? ? 1.443 ? 
N-Glycosylation 
covale24 covale one  ? B ASN 1085 ND2 ? ? ? 1_555 CA NAG .    C1 ? ? B ASN 1098 B NAG 1206 1_555 ? ? ? ? ? ? ? 1.438 ? 
N-Glycosylation 
covale25 covale one  ? B ASN 1121 ND2 ? ? ? 1_555 I  NAG .    C1 ? ? B ASN 1134 Z NAG 1    1_555 ? ? ? ? ? ? ? 1.441 ? 
N-Glycosylation 
covale26 covale one  ? C ASN 48   ND2 ? ? ? 1_555 LA NAG .    C1 ? ? C ASN 61   C NAG 1206 1_555 ? ? ? ? ? ? ? 1.428 ? 
N-Glycosylation 
covale27 covale one  ? C ASN 152  ND2 ? ? ? 1_555 F  NAG .    C1 ? ? C ASN 165  k NAG 1    1_555 ? ? ? ? ? ? ? 1.448 ? 
N-Glycosylation 
covale28 covale one  ? C ASN 318  ND2 ? ? ? 1_555 MA NAG .    C1 ? ? C ASN 331  C NAG 1207 1_555 ? ? ? ? ? ? ? 1.439 ? 
N-Glycosylation 
covale29 covale one  ? C ASN 590  ND2 ? ? ? 1_555 KA NAG .    C1 ? ? C ASN 603  C NAG 1205 1_555 ? ? ? ? ? ? ? 1.497 ? 
N-Glycosylation 
covale30 covale one  ? C ASN 644  ND2 ? ? ? 1_555 IA NAG .    C1 ? ? C ASN 657  C NAG 1203 1_555 ? ? ? ? ? ? ? 1.471 ? 
N-Glycosylation 
covale31 covale one  ? C ASN 696  ND2 ? ? ? 1_555 HA NAG .    C1 ? ? C ASN 709  C NAG 1202 1_555 ? ? ? ? ? ? ? 1.449 ? 
N-Glycosylation 
covale32 covale one  ? C ASN 704  ND2 ? ? ? 1_555 E  NAG .    C1 ? ? C ASN 717  X NAG 1    1_555 ? ? ? ? ? ? ? 1.376 ? 
N-Glycosylation 
covale33 covale one  ? C ASN 788  ND2 ? ? ? 1_555 G  NAG .    C1 ? ? C ASN 801  p NAG 1    1_555 ? ? ? ? ? ? ? 1.245 ? 
N-Glycosylation 
covale34 covale one  ? C ASN 1061 ND2 ? ? ? 1_555 D  NAG .    C1 ? ? C ASN 1074 E NAG 1    1_555 ? ? ? ? ? ? ? 1.445 ? 
N-Glycosylation 
covale35 covale one  ? C ASN 1121 ND2 ? ? ? 1_555 GA NAG .    C1 ? ? C ASN 1134 C NAG 1201 1_555 ? ? ? ? ? ? ? 1.442 ? 
N-Glycosylation 
covale36 covale both ? D NAG .    O4  ? ? ? 1_555 D  NAG .    C1 ? ? E NAG 1    E NAG 2    1_555 ? ? ? ? ? ? ? 1.430 ? ? 
covale37 covale both ? E NAG .    O4  ? ? ? 1_555 E  NAG .    C1 ? ? X NAG 1    X NAG 2    1_555 ? ? ? ? ? ? ? 1.440 ? ? 
covale38 covale both ? F NAG .    O4  ? ? ? 1_555 F  NAG .    C1 ? ? k NAG 1    k NAG 2    1_555 ? ? ? ? ? ? ? 1.420 ? ? 
covale39 covale both ? F NAG .    O6  ? ? ? 1_555 F  FUC .    C1 ? ? k NAG 1    k FUC 3    1_555 ? ? ? ? ? ? ? 1.450 ? ? 
covale40 covale both ? G NAG .    O4  ? ? ? 1_555 G  NAG .    C1 ? ? p NAG 1    p NAG 2    1_555 ? ? ? ? ? ? ? 1.444 ? ? 
covale41 covale both ? G NAG .    O4  ? ? ? 1_555 G  BMA .    C1 ? ? p NAG 2    p BMA 3    1_555 ? ? ? ? ? ? ? 1.441 ? ? 
covale42 covale both ? H NAG .    O4  ? ? ? 1_555 H  NAG .    C1 ? ? W NAG 1    W NAG 2    1_555 ? ? ? ? ? ? ? 1.437 ? ? 
covale43 covale both ? I NAG .    O4  ? ? ? 1_555 I  NAG .    C1 ? ? Z NAG 1    Z NAG 2    1_555 ? ? ? ? ? ? ? 1.444 ? ? 
covale44 covale both ? J NAG .    O4  ? ? ? 1_555 J  NAG .    C1 ? ? d NAG 1    d NAG 2    1_555 ? ? ? ? ? ? ? 1.435 ? ? 
covale45 covale both ? K NAG .    O4  ? ? ? 1_555 K  NAG .    C1 ? ? f NAG 1    f NAG 2    1_555 ? ? ? ? ? ? ? 1.431 ? ? 
covale46 covale both ? L NAG .    O4  ? ? ? 1_555 L  NAG .    C1 ? ? h NAG 1    h NAG 2    1_555 ? ? ? ? ? ? ? 1.444 ? ? 
covale47 covale both ? L NAG .    O4  ? ? ? 1_555 L  BMA .    C1 ? ? h NAG 2    h BMA 3    1_555 ? ? ? ? ? ? ? 1.439 ? ? 
covale48 covale both ? L BMA .    O6  ? ? ? 1_555 L  MAN .    C1 ? ? h BMA 3    h MAN 4    1_555 ? ? ? ? ? ? ? 1.437 ? ? 
covale49 covale both ? M NAG .    O4  ? ? ? 1_555 M  NAG .    C1 ? ? H NAG 1    H NAG 2    1_555 ? ? ? ? ? ? ? 1.440 ? ? 
covale50 covale both ? N NAG .    O4  ? ? ? 1_555 N  NAG .    C1 ? ? N NAG 1    N NAG 2    1_555 ? ? ? ? ? ? ? 1.458 ? ? 
covale51 covale both ? O NAG .    O4  ? ? ? 1_555 O  NAG .    C1 ? ? Q NAG 1    Q NAG 2    1_555 ? ? ? ? ? ? ? 1.426 ? ? 
covale52 covale both ? O NAG .    O4  ? ? ? 1_555 O  BMA .    C1 ? ? Q NAG 2    Q BMA 3    1_555 ? ? ? ? ? ? ? 1.439 ? ? 
covale53 covale both ? O BMA .    O3  ? ? ? 1_555 O  MAN .    C1 ? ? Q BMA 3    Q MAN 4    1_555 ? ? ? ? ? ? ? 1.437 ? ? 
covale54 covale both ? P NAG .    O4  ? ? ? 1_555 P  NAG .    C1 ? ? V NAG 1    V NAG 2    1_555 ? ? ? ? ? ? ? 1.438 ? ? 
covale55 covale both ? P NAG .    O4  ? ? ? 1_555 P  BMA .    C1 ? ? V NAG 2    V BMA 3    1_555 ? ? ? ? ? ? ? 1.439 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 3 ? 
AA3 ? 4 ? 
AA4 ? 5 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 4 ? 
AA8 ? 2 ? 
AA9 ? 3 ? 
AB1 ? 3 ? 
AB2 ? 2 ? 
AB3 ? 2 ? 
AB4 ? 3 ? 
AB5 ? 2 ? 
AB6 ? 2 ? 
AB7 ? 2 ? 
AB8 ? 2 ? 
AB9 ? 3 ? 
AC1 ? 3 ? 
AC2 ? 3 ? 
AC3 ? 5 ? 
AC4 ? 2 ? 
AC5 ? 2 ? 
AC6 ? 2 ? 
AC7 ? 2 ? 
AC8 ? 3 ? 
AC9 ? 2 ? 
AD1 ? 3 ? 
AD2 ? 2 ? 
AD3 ? 3 ? 
AD4 ? 2 ? 
AD5 ? 2 ? 
AD6 ? 3 ? 
AD7 ? 3 ? 
AD8 ? 2 ? 
AD9 ? 2 ? 
AE1 ? 3 ? 
AE2 ? 2 ? 
AE3 ? 5 ? 
AE4 ? 2 ? 
AE5 ? 2 ? 
AE6 ? 3 ? 
AE7 ? 2 ? 
AE8 ? 3 ? 
AE9 ? 3 ? 
AF1 ? 3 ? 
AF2 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? parallel      
AB2 1 2 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC3 4 5 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? parallel      
AC7 1 2 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC9 1 2 ? parallel      
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? parallel      
AD4 1 2 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD6 2 3 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD7 2 3 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE1 2 3 ? anti-parallel 
AE2 1 2 ? parallel      
AE3 1 2 ? anti-parallel 
AE3 2 3 ? anti-parallel 
AE3 3 4 ? anti-parallel 
AE3 4 5 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE6 2 3 ? anti-parallel 
AE7 1 2 ? anti-parallel 
AE8 1 2 ? parallel      
AE8 2 3 ? anti-parallel 
AE9 1 2 ? anti-parallel 
AE9 2 3 ? anti-parallel 
AF1 1 2 ? anti-parallel 
AF1 2 3 ? anti-parallel 
AF2 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 TYR A 15   ? ASN A 17   ? TYR A 28   ASN A 30   
AA1 2 ASN A 48   ? THR A 50   ? ASN A 61   THR A 63   
AA2 1 LEU A 35   ? PHE A 42   ? LEU A 48   PHE A 55   
AA2 2 GLN A 258  ? TYR A 266  ? GLN A 271  TYR A 279  
AA2 3 ILE A 272  ? ASP A 277  ? ILE A 285  ASP A 290  
AA3 1 HIS A 194  ? ILE A 197  ? HIS A 207  ILE A 210  
AA3 2 LYS A 174  ? GLU A 178  ? LYS A 187  GLU A 191  
AA3 3 VAL A 77   ? GLU A 83   ? VAL A 90   GLU A 96   
AA3 4 TYR A 253  ? TYR A 256  ? TYR A 266  TYR A 269  
AA4 1 GLU A 156  ? VAL A 158  ? GLU A 169  VAL A 171  
AA4 2 VAL A 113  ? LYS A 116  ? VAL A 126  LYS A 129  
AA4 3 LEU A 104  ? ASN A 108  ? LEU A 117  ASN A 121  
AA4 4 TRP A 91   ? GLY A 94   ? TRP A 104  GLY A 107  
AA4 5 ARG A 224  ? PHE A 225  ? ARG A 237  PHE A 238  
AA5 1 LYS A 182  ? ASN A 183  ? LYS A 195  ASN A 196  
AA5 2 PHE A 188  ? LYS A 189  ? PHE A 201  LYS A 202  
AA6 1 TYR A 191  ? SER A 192  ? TYR A 204  SER A 205  
AA6 2 GLU A 211  ? PRO A 212  ? GLU A 224  PRO A 225  
AA7 1 GLY A 298  ? SER A 303  ? GLY A 311  SER A 316  
AA7 2 VAL A 582  ? THR A 586  ? VAL A 595  THR A 599  
AA7 3 ALA A 596  ? TYR A 599  ? ALA A 609  TYR A 612  
AA7 4 LEU A 637  ? ILE A 638  ? LEU A 650  ILE A 651  
AA8 1 PHE A 528  ? ASN A 529  ? PHE A 541  ASN A 542  
AA8 2 THR A 534  ? GLY A 535  ? THR A 547  GLY A 548  
AA9 1 VAL A 538  ? THR A 540  ? VAL A 551  THR A 553  
AA9 2 LEU A 572  ? THR A 575  ? LEU A 585  THR A 588  
AA9 3 ALA A 562  ? VAL A 563  ? ALA A 575  VAL A 576  
AB1 1 THR A 559  ? THR A 560  ? THR A 572  THR A 573  
AB1 2 PHE A 552  ? ASP A 555  ? PHE A 565  ASP A 568  
AB1 3 VAL B 29   ? PHE B 30   ? VAL B 42   PHE B 43   
AB2 1 SER A 698  ? ALA A 700  ? SER A 711  ALA A 713  
AB2 2 ASN A 1061 ? THR A 1063 ? ASN A 1074 THR A 1076 
AB3 1 ASN A 704  ? PHE A 705  ? ASN A 717  PHE A 718  
AB3 2 PRO A 1056 ? ALA A 1057 ? PRO A 1069 ALA A 1070 
AB4 1 THR A 711  ? PRO A 715  ? THR A 724  PRO A 728  
AB4 2 GLY A 1046 ? TYR A 1054 ? GLY A 1059 TYR A 1067 
AB4 3 TYR A 1034 ? PRO A 1040 ? TYR A 1047 PRO A 1053 
AB5 1 SER A 722  ? VAL A 723  ? SER A 735  VAL A 736  
AB5 2 LEU A 845  ? THR A 846  ? LEU A 858  THR A 859  
AB6 1 LYS A 1073 ? PRO A 1077 ? LYS A 1086 PRO A 1090 
AB6 2 THR A 1107 ? ASN A 1112 ? THR A 1120 ASN A 1125 
AB7 1 VAL A 1081 ? SER A 1084 ? VAL A 1094 SER A 1097 
AB7 2 TRP A 1089 ? THR A 1092 ? TRP A 1102 THR A 1105 
AB8 1 TYR B 15   ? ASN B 17   ? TYR B 28   ASN B 30   
AB8 2 ASN B 48   ? THR B 50   ? ASN B 61   THR B 63   
AB9 1 LEU B 35   ? HIS B 36   ? LEU B 48   HIS B 49   
AB9 2 GLN B 258  ? TYR B 266  ? GLN B 271  TYR B 279  
AB9 3 GLN B 39   ? PHE B 42   ? GLN B 52   PHE B 55   
AC1 1 LEU B 35   ? HIS B 36   ? LEU B 48   HIS B 49   
AC1 2 GLN B 258  ? TYR B 266  ? GLN B 271  TYR B 279  
AC1 3 ILE B 272  ? ASP B 277  ? ILE B 285  ASP B 290  
AC2 1 PHE B 179  ? PHE B 181  ? PHE B 192  PHE B 194  
AC2 2 VAL B 77   ? ALA B 80   ? VAL B 90   ALA B 93   
AC2 3 TYR B 253  ? TYR B 256  ? TYR B 266  TYR B 269  
AC3 1 GLU B 156  ? SER B 159  ? GLU B 169  SER B 172  
AC3 2 VAL B 113  ? LYS B 116  ? VAL B 126  LYS B 129  
AC3 3 LEU B 104  ? ASN B 108  ? LEU B 117  ASN B 121  
AC3 4 GLY B 90   ? GLY B 94   ? GLY B 103  GLY B 107  
AC3 5 ARG B 224  ? LEU B 228  ? ARG B 237  LEU B 241  
AC4 1 PHE B 188  ? SER B 192  ? PHE B 201  SER B 205  
AC4 2 GLU B 211  ? LEU B 216  ? GLU B 224  LEU B 229  
AC5 1 GLY B 298  ? ILE B 299  ? GLY B 311  ILE B 312  
AC5 2 ILE B 585  ? THR B 586  ? ILE B 598  THR B 599  
AC6 1 GLY B 553  ? ARG B 554  ? GLY B 566  ARG B 567  
AC6 2 PHE C 30   ? ARG C 31   ? PHE C 43   ARG C 44   
AC7 1 VAL B 563  ? ARG B 564  ? VAL B 576  ARG B 577  
AC7 2 ILE B 571  ? LEU B 572  ? ILE B 584  LEU B 585  
AC8 1 TYR B 599  ? GLN B 600  ? TYR B 612  GLN B 613  
AC8 2 GLY B 635  ? LEU B 637  ? GLY B 648  LEU B 650  
AC8 3 PHE B 630  ? THR B 632  ? PHE B 643  THR B 645  
AC9 1 SER B 646  ? TYR B 647  ? SER B 659  TYR B 660  
AC9 2 THR B 683  ? MET B 684  ? THR B 696  MET B 697  
AD1 1 SER B 698  ? PRO B 715  ? SER B 711  PRO B 728  
AD1 2 GLY B 1046 ? THR B 1063 ? GLY B 1059 THR B 1076 
AD1 3 HIS B 1035 ? PHE B 1039 ? HIS B 1048 PHE B 1052 
AD2 1 THR B 721  ? VAL B 723  ? THR B 734  VAL B 736  
AD2 2 LEU B 845  ? VAL B 847  ? LEU B 858  VAL B 860  
AD3 1 LYS B 1073 ? HIS B 1075 ? LYS B 1086 HIS B 1088 
AD3 2 ILE B 1068 ? HIS B 1070 ? ILE B 1081 HIS B 1083 
AD3 3 VAL B 1120 ? ASN B 1121 ? VAL B 1133 ASN B 1134 
AD4 1 VAL B 1081 ? SER B 1084 ? VAL B 1094 SER B 1097 
AD4 2 TRP B 1089 ? THR B 1092 ? TRP B 1102 THR B 1105 
AD5 1 TYR C 15   ? ASN C 17   ? TYR C 28   ASN C 30   
AD5 2 ASN C 48   ? THR C 50   ? ASN C 61   THR C 63   
AD6 1 HIS C 36   ? PHE C 42   ? HIS C 49   PHE C 55   
AD6 2 GLN C 258  ? LEU C 264  ? GLN C 271  LEU C 277  
AD6 3 VAL C 276  ? ASP C 277  ? VAL C 289  ASP C 290  
AD7 1 VAL C 77   ? SER C 81   ? VAL C 90   SER C 94   
AD7 2 LEU C 176  ? ASN C 183  ? LEU C 189  ASN C 196  
AD7 3 PHE C 188  ? THR C 195  ? PHE C 201  THR C 208  
AD8 1 TRP C 91   ? GLY C 94   ? TRP C 104  GLY C 107  
AD8 2 ARG C 224  ? THR C 227  ? ARG C 237  THR C 240  
AD9 1 LEU C 105  ? ASN C 108  ? LEU C 118  ASN C 121  
AD9 2 VAL C 113  ? LYS C 116  ? VAL C 126  LYS C 129  
AE1 1 GLY C 298  ? PHE C 305  ? GLY C 311  PHE C 318  
AE1 2 GLY C 580  ? THR C 586  ? GLY C 593  THR C 599  
AE1 3 ALA C 596  ? LEU C 598  ? ALA C 609  LEU C 611  
AE2 1 ILE C 313  ? ARG C 315  ? ILE C 326  ARG C 328  
AE2 2 PHE C 528  ? PHE C 530  ? PHE C 541  PHE C 543  
AE3 1 ASN C 341  ? ILE C 345  ? ASN C 354  ILE C 358  
AE3 2 VAL C 382  ? ILE C 389  ? VAL C 395  ILE C 402  
AE3 3 TYR C 495  ? SER C 501  ? TYR C 508  SER C 514  
AE3 4 CYS C 419  ? ASN C 424  ? CYS C 432  ASN C 437  
AE3 5 LYS C 365  ? CYS C 366  ? LYS C 378  CYS C 379  
AE4 1 CYS C 378  ? PHE C 379  ? CYS C 391  PHE C 392  
AE4 2 VAL C 511  ? CYS C 512  ? VAL C 524  CYS C 525  
AE5 1 LEU C 439  ? TYR C 440  ? LEU C 452  TYR C 453  
AE5 2 GLN C 480  ? SER C 481  ? GLN C 493  SER C 494  
AE6 1 VAL C 538  ? GLU C 541  ? VAL C 551  GLU C 554  
AE6 2 ILE C 571  ? THR C 575  ? ILE C 584  THR C 588  
AE6 3 ALA C 562  ? ARG C 564  ? ALA C 575  ARG C 577  
AE7 1 GLN C 631  ? THR C 632  ? GLN C 644  THR C 645  
AE7 2 GLY C 635  ? CYS C 636  ? GLY C 648  CYS C 649  
AE8 1 GLU C 641  ? HIS C 642  ? GLU C 654  HIS C 655  
AE8 2 ILE C 680  ? THR C 683  ? ILE C 693  THR C 696  
AE8 3 ILE C 657  ? CYS C 658  ? ILE C 670  CYS C 671  
AE9 1 ASN C 704  ? LEU C 714  ? ASN C 717  LEU C 727  
AE9 2 VAL C 1047 ? ALA C 1057 ? VAL C 1060 ALA C 1070 
AE9 3 TYR C 1034 ? PRO C 1040 ? TYR C 1047 PRO C 1053 
AF1 1 ILE C 1068 ? HIS C 1070 ? ILE C 1081 HIS C 1083 
AF1 2 LYS C 1073 ? PHE C 1076 ? LYS C 1086 PHE C 1089 
AF1 3 PHE C 1108 ? ASN C 1112 ? PHE C 1121 ASN C 1125 
AF2 1 VAL C 1081 ? VAL C 1083 ? VAL C 1094 VAL C 1096 
AF2 2 PHE C 1090 ? THR C 1092 ? PHE C 1103 THR C 1105 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N THR A 16   ? N THR A 29   O VAL A 49   ? O VAL A 62   
AA2 1 2 N PHE A 42   ? N PHE A 55   O GLN A 258  ? O GLN A 271  
AA2 2 3 N LEU A 263  ? N LEU A 276  O VAL A 276  ? O VAL A 289  
AA3 1 2 O THR A 195  ? O THR A 208  N LEU A 176  ? N LEU A 189  
AA3 2 3 O ARG A 177  ? O ARG A 190  N SER A 81   ? N SER A 94   
AA3 3 4 N TYR A 78   ? N TYR A 91   O GLY A 255  ? O GLY A 268  
AA4 1 2 O TYR A 157  ? O TYR A 170  N ILE A 115  ? N ILE A 128  
AA4 2 3 O LYS A 116  ? O LYS A 129  N LEU A 105  ? N LEU A 118  
AA4 3 4 O LEU A 104  ? O LEU A 117  N PHE A 93   ? N PHE A 106  
AA4 4 5 N GLY A 94   ? N GLY A 107  O ARG A 224  ? O ARG A 237  
AA5 1 2 N LYS A 182  ? N LYS A 195  O LYS A 189  ? O LYS A 202  
AA6 1 2 N SER A 192  ? N SER A 205  O GLU A 211  ? O GLU A 224  
AA7 1 2 N SER A 303  ? N SER A 316  O VAL A 582  ? O VAL A 595  
AA7 2 3 N ILE A 585  ? N ILE A 598  O ALA A 596  ? O ALA A 609  
AA7 3 4 N VAL A 597  ? N VAL A 610  O ILE A 638  ? O ILE A 651  
AA8 1 2 N PHE A 528  ? N PHE A 541  O GLY A 535  ? O GLY A 548  
AA9 1 2 N THR A 540  ? N THR A 553  O ASP A 573  ? O ASP A 586  
AA9 2 3 O LEU A 572  ? O LEU A 585  N VAL A 563  ? N VAL A 576  
AB1 1 2 O THR A 559  ? O THR A 572  N ASP A 555  ? N ASP A 568  
AB1 2 3 N PHE A 552  ? N PHE A 565  O PHE B 30   ? O PHE B 43   
AB2 1 2 N ILE A 699  ? N ILE A 712  O PHE A 1062 ? O PHE A 1075 
AB3 1 2 N ASN A 704  ? N ASN A 717  O ALA A 1057 ? O ALA A 1070 
AB4 1 2 N LEU A 714  ? N LEU A 727  O VAL A 1047 ? O VAL A 1060 
AB4 2 3 O TYR A 1054 ? O TYR A 1067 N TYR A 1034 ? N TYR A 1047 
AB5 1 2 N SER A 722  ? N SER A 735  O THR A 846  ? O THR A 859  
AB6 1 2 N ALA A 1074 ? N ALA A 1087 O SER A 1110 ? O SER A 1123 
AB7 1 2 N VAL A 1081 ? N VAL A 1094 O THR A 1092 ? O THR A 1105 
AB8 1 2 N THR B 16   ? N THR B 29   O VAL B 49   ? O VAL B 62   
AB9 1 2 N HIS B 36   ? N HIS B 49   O LEU B 264  ? O LEU B 277  
AB9 2 3 O GLN B 258  ? O GLN B 271  N PHE B 42   ? N PHE B 55   
AC1 1 2 N HIS B 36   ? N HIS B 49   O LEU B 264  ? O LEU B 277  
AC1 2 3 N LEU B 263  ? N LEU B 276  O VAL B 276  ? O VAL B 289  
AC2 1 2 O PHE B 181  ? O PHE B 194  N VAL B 77   ? N VAL B 90   
AC2 2 3 N ALA B 80   ? N ALA B 93   O TYR B 253  ? O TYR B 266  
AC3 1 2 O TYR B 157  ? O TYR B 170  N ILE B 115  ? N ILE B 128  
AC3 2 3 O VAL B 114  ? O VAL B 127  N VAL B 107  ? N VAL B 120  
AC3 3 4 O LEU B 104  ? O LEU B 117  N PHE B 93   ? N PHE B 106  
AC3 4 5 O GLY B 94   ? O GLY B 107  N ARG B 224  ? N ARG B 237  
AC4 1 2 N ILE B 190  ? N ILE B 203  O VAL B 214  ? O VAL B 227  
AC5 1 2 N GLY B 298  ? N GLY B 311  O THR B 586  ? O THR B 599  
AC6 1 2 N ARG B 554  ? N ARG B 567  O PHE C 30   ? O PHE C 43   
AC7 1 2 N VAL B 563  ? N VAL B 576  O LEU B 572  ? O LEU B 585  
AC8 1 2 N TYR B 599  ? N TYR B 612  O CYS B 636  ? O CYS B 649  
AC8 2 3 O GLY B 635  ? O GLY B 648  N THR B 632  ? N THR B 645  
AC9 1 2 N TYR B 647  ? N TYR B 660  O THR B 683  ? O THR B 696  
AD1 1 2 N THR B 706  ? N THR B 719  O VAL B 1055 ? O VAL B 1068 
AD1 2 3 O VAL B 1052 ? O VAL B 1065 N MET B 1037 ? N MET B 1050 
AD2 1 2 N SER B 722  ? N SER B 735  O THR B 846  ? O THR B 859  
AD3 1 2 O LYS B 1073 ? O LYS B 1086 N HIS B 1070 ? N HIS B 1083 
AD3 2 3 N CYS B 1069 ? N CYS B 1082 O VAL B 1120 ? O VAL B 1133 
AD4 1 2 N VAL B 1081 ? N VAL B 1094 O THR B 1092 ? O THR B 1105 
AD5 1 2 N THR C 16   ? N THR C 29   O VAL C 49   ? O VAL C 62   
AD6 1 2 N THR C 38   ? N THR C 51   O PHE C 262  ? O PHE C 275  
AD6 2 3 N LEU C 263  ? N LEU C 276  O VAL C 276  ? O VAL C 289  
AD7 1 2 N VAL C 77   ? N VAL C 90   O PHE C 181  ? O PHE C 194  
AD7 2 3 N GLU C 178  ? N GLU C 191  O LYS C 193  ? O LYS C 206  
AD8 1 2 N ILE C 92   ? N ILE C 105  O GLN C 226  ? O GLN C 239  
AD9 1 2 N LEU C 105  ? N LEU C 118  O LYS C 116  ? O LYS C 129  
AE1 1 2 N PHE C 305  ? N PHE C 318  O GLY C 580  ? O GLY C 593  
AE1 2 3 N ILE C 585  ? N ILE C 598  O ALA C 596  ? O ALA C 609  
AE2 1 2 N ILE C 313  ? N ILE C 326  O ASN C 529  ? O ASN C 542  
AE3 1 2 N LYS C 343  ? N LYS C 356  O ALA C 384  ? O ALA C 397  
AE3 2 3 N ASP C 385  ? N ASP C 398  O VAL C 499  ? O VAL C 512  
AE3 3 4 O VAL C 498  ? O VAL C 511  N ILE C 421  ? N ILE C 434  
AE3 4 5 N VAL C 420  ? N VAL C 433  O LYS C 365  ? O LYS C 378  
AE4 1 2 N PHE C 379  ? N PHE C 392  O VAL C 511  ? O VAL C 524  
AE5 1 2 N TYR C 440  ? N TYR C 453  O GLN C 480  ? O GLN C 493  
AE6 1 2 N VAL C 538  ? N VAL C 551  O THR C 575  ? O THR C 588  
AE6 2 3 O LEU C 572  ? O LEU C 585  N VAL C 563  ? N VAL C 576  
AE7 1 2 N THR C 632  ? N THR C 645  O GLY C 635  ? O GLY C 648  
AE8 1 2 N GLU C 641  ? N GLU C 654  O ALA C 681  ? O ALA C 694  
AE8 2 3 O TYR C 682  ? O TYR C 695  N CYS C 658  ? N CYS C 671  
AE9 1 2 N ASN C 704  ? N ASN C 717  O ALA C 1057 ? O ALA C 1070 
AE9 2 3 O LEU C 1050 ? O LEU C 1063 N PHE C 1039 ? N PHE C 1052 
AF1 1 2 N HIS C 1070 ? N HIS C 1083 O LYS C 1073 ? O LYS C 1086 
AF1 2 3 N ALA C 1074 ? N ALA C 1087 O GLY C 1111 ? O GLY C 1124 
AF2 1 2 N VAL C 1083 ? N VAL C 1096 O PHE C 1090 ? O PHE C 1103 
# 
_atom_sites.entry_id                    7CN9 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . ALA A  1 14   ? 169.560 119.671 182.705 1.00 198.86 ? 27   ALA A N   1 
ATOM   2     C CA  . ALA A  1 14   ? 170.907 120.120 182.384 1.00 198.86 ? 27   ALA A CA  1 
ATOM   3     C C   . ALA A  1 14   ? 170.880 121.525 181.823 1.00 198.86 ? 27   ALA A C   1 
ATOM   4     O O   . ALA A  1 14   ? 170.018 122.322 182.170 1.00 198.86 ? 27   ALA A O   1 
ATOM   5     C CB  . ALA A  1 14   ? 171.558 119.180 181.399 1.00 198.86 ? 27   ALA A CB  1 
ATOM   6     N N   . TYR A  1 15   ? 171.832 121.824 180.950 1.00 200.79 ? 28   TYR A N   1 
ATOM   7     C CA  . TYR A  1 15   ? 171.882 123.141 180.339 1.00 200.79 ? 28   TYR A CA  1 
ATOM   8     C C   . TYR A  1 15   ? 170.856 123.249 179.218 1.00 200.79 ? 28   TYR A C   1 
ATOM   9     O O   . TYR A  1 15   ? 170.769 122.381 178.345 1.00 200.79 ? 28   TYR A O   1 
ATOM   10    C CB  . TYR A  1 15   ? 173.279 123.422 179.797 1.00 200.79 ? 28   TYR A CB  1 
ATOM   11    C CG  . TYR A  1 15   ? 174.281 123.781 180.856 1.00 200.79 ? 28   TYR A CG  1 
ATOM   12    C CD1 . TYR A  1 15   ? 173.952 123.707 182.195 1.00 200.79 ? 28   TYR A CD1 1 
ATOM   13    C CD2 . TYR A  1 15   ? 175.554 124.201 180.516 1.00 200.79 ? 28   TYR A CD2 1 
ATOM   14    C CE1 . TYR A  1 15   ? 174.864 124.034 183.171 1.00 200.79 ? 28   TYR A CE1 1 
ATOM   15    C CE2 . TYR A  1 15   ? 176.475 124.535 181.483 1.00 200.79 ? 28   TYR A CE2 1 
ATOM   16    C CZ  . TYR A  1 15   ? 176.125 124.449 182.815 1.00 200.79 ? 28   TYR A CZ  1 
ATOM   17    O OH  . TYR A  1 15   ? 177.034 124.777 183.799 1.00 200.79 ? 28   TYR A OH  1 
ATOM   18    N N   . THR A  1 16   ? 170.072 124.322 179.250 1.00 199.92 ? 29   THR A N   1 
ATOM   19    C CA  . THR A  1 16   ? 169.137 124.644 178.184 1.00 199.92 ? 29   THR A CA  1 
ATOM   20    C C   . THR A  1 16   ? 169.363 126.085 177.764 1.00 199.92 ? 29   THR A C   1 
ATOM   21    O O   . THR A  1 16   ? 169.625 126.948 178.605 1.00 199.92 ? 29   THR A O   1 
ATOM   22    C CB  . THR A  1 16   ? 167.683 124.468 178.620 1.00 199.92 ? 29   THR A CB  1 
ATOM   23    O OG1 . THR A  1 16   ? 167.538 123.219 179.302 1.00 199.92 ? 29   THR A OG1 1 
ATOM   24    C CG2 . THR A  1 16   ? 166.772 124.482 177.415 1.00 199.92 ? 29   THR A CG2 1 
ATOM   25    N N   . ASN A  1 17   ? 169.263 126.338 176.467 1.00 192.63 ? 30   ASN A N   1 
ATOM   26    C CA  . ASN A  1 17   ? 169.452 127.682 175.943 1.00 192.63 ? 30   ASN A CA  1 
ATOM   27    C C   . ASN A  1 17   ? 168.230 128.533 176.261 1.00 192.63 ? 30   ASN A C   1 
ATOM   28    O O   . ASN A  1 17   ? 167.104 128.167 175.913 1.00 192.63 ? 30   ASN A O   1 
ATOM   29    C CB  . ASN A  1 17   ? 169.694 127.639 174.442 1.00 192.63 ? 30   ASN A CB  1 
ATOM   30    C CG  . ASN A  1 17   ? 170.230 128.936 173.917 1.00 192.63 ? 30   ASN A CG  1 
ATOM   31    O OD1 . ASN A  1 17   ? 170.331 129.916 174.651 1.00 192.63 ? 30   ASN A OD1 1 
ATOM   32    N ND2 . ASN A  1 17   ? 170.568 128.962 172.637 1.00 192.63 ? 30   ASN A ND2 1 
ATOM   33    N N   . SER A  1 18   ? 168.453 129.668 176.914 1.00 189.93 ? 31   SER A N   1 
ATOM   34    C CA  . SER A  1 18   ? 167.375 130.584 177.275 1.00 189.93 ? 31   SER A CA  1 
ATOM   35    C C   . SER A  1 18   ? 166.827 131.217 176.009 1.00 189.93 ? 31   SER A C   1 
ATOM   36    O O   . SER A  1 18   ? 167.495 132.027 175.370 1.00 189.93 ? 31   SER A O   1 
ATOM   37    C CB  . SER A  1 18   ? 167.889 131.653 178.225 1.00 189.93 ? 31   SER A CB  1 
ATOM   38    O OG  . SER A  1 18   ? 168.641 132.613 177.506 1.00 189.93 ? 31   SER A OG  1 
ATOM   39    N N   . PHE A  1 19   ? 165.605 130.860 175.630 1.00 179.78 ? 32   PHE A N   1 
ATOM   40    C CA  . PHE A  1 19   ? 165.091 131.345 174.356 1.00 179.78 ? 32   PHE A CA  1 
ATOM   41    C C   . PHE A  1 19   ? 164.459 132.723 174.494 1.00 179.78 ? 32   PHE A C   1 
ATOM   42    O O   . PHE A  1 19   ? 164.829 133.659 173.778 1.00 179.78 ? 32   PHE A O   1 
ATOM   43    C CB  . PHE A  1 19   ? 164.109 130.340 173.765 1.00 179.78 ? 32   PHE A CB  1 
ATOM   44    C CG  . PHE A  1 19   ? 164.780 129.161 173.140 1.00 179.78 ? 32   PHE A CG  1 
ATOM   45    C CD1 . PHE A  1 19   ? 166.152 129.027 173.200 1.00 179.78 ? 32   PHE A CD1 1 
ATOM   46    C CD2 . PHE A  1 19   ? 164.048 128.193 172.489 1.00 179.78 ? 32   PHE A CD2 1 
ATOM   47    C CE1 . PHE A  1 19   ? 166.777 127.947 172.640 1.00 179.78 ? 32   PHE A CE1 1 
ATOM   48    C CE2 . PHE A  1 19   ? 164.671 127.109 171.922 1.00 179.78 ? 32   PHE A CE2 1 
ATOM   49    C CZ  . PHE A  1 19   ? 166.038 126.987 171.999 1.00 179.78 ? 32   PHE A CZ  1 
ATOM   50    N N   . THR A  1 20   ? 163.489 132.874 175.393 1.00 166.32 ? 33   THR A N   1 
ATOM   51    C CA  . THR A  1 20   ? 162.673 134.077 175.342 1.00 166.32 ? 33   THR A CA  1 
ATOM   52    C C   . THR A  1 20   ? 162.143 134.627 176.664 1.00 166.32 ? 33   THR A C   1 
ATOM   53    O O   . THR A  1 20   ? 161.253 135.476 176.619 1.00 166.32 ? 33   THR A O   1 
ATOM   54    C CB  . THR A  1 20   ? 161.490 133.834 174.401 1.00 166.32 ? 33   THR A CB  1 
ATOM   55    O OG1 . THR A  1 20   ? 160.553 134.912 174.508 1.00 166.32 ? 33   THR A OG1 1 
ATOM   56    C CG2 . THR A  1 20   ? 160.825 132.534 174.753 1.00 166.32 ? 33   THR A CG2 1 
ATOM   57    N N   . ARG A  1 21   ? 162.622 134.197 177.824 1.00 172.07 ? 34   ARG A N   1 
ATOM   58    C CA  . ARG A  1 21   ? 161.978 134.626 179.064 1.00 172.07 ? 34   ARG A CA  1 
ATOM   59    C C   . ARG A  1 21   ? 162.940 135.381 179.977 1.00 172.07 ? 34   ARG A C   1 
ATOM   60    O O   . ARG A  1 21   ? 164.126 135.538 179.685 1.00 172.07 ? 34   ARG A O   1 
ATOM   61    C CB  . ARG A  1 21   ? 161.377 133.433 179.806 1.00 172.07 ? 34   ARG A CB  1 
ATOM   62    C CG  . ARG A  1 21   ? 160.354 132.693 179.002 1.00 172.07 ? 34   ARG A CG  1 
ATOM   63    C CD  . ARG A  1 21   ? 159.363 133.650 178.394 1.00 172.07 ? 34   ARG A CD  1 
ATOM   64    N NE  . ARG A  1 21   ? 158.310 134.013 179.328 1.00 172.07 ? 34   ARG A NE  1 
ATOM   65    C CZ  . ARG A  1 21   ? 157.241 133.261 179.554 1.00 172.07 ? 34   ARG A CZ  1 
ATOM   66    N NH1 . ARG A  1 21   ? 157.102 132.111 178.919 1.00 172.07 ? 34   ARG A NH1 1 
ATOM   67    N NH2 . ARG A  1 21   ? 156.312 133.652 180.413 1.00 172.07 ? 34   ARG A NH2 1 
ATOM   68    N N   . GLY A  1 22   ? 162.392 135.840 181.107 1.00 170.92 ? 35   GLY A N   1 
ATOM   69    C CA  . GLY A  1 22   ? 163.124 136.537 182.153 1.00 170.92 ? 35   GLY A CA  1 
ATOM   70    C C   . GLY A  1 22   ? 162.895 138.038 182.227 1.00 170.92 ? 35   GLY A C   1 
ATOM   71    O O   . GLY A  1 22   ? 163.852 138.789 182.436 1.00 170.92 ? 35   GLY A O   1 
ATOM   72    N N   . VAL A  1 23   ? 161.642 138.494 182.095 1.00 165.06 ? 36   VAL A N   1 
ATOM   73    C CA  . VAL A  1 23   ? 161.336 139.897 181.826 1.00 165.06 ? 36   VAL A CA  1 
ATOM   74    C C   . VAL A  1 23   ? 160.270 140.420 182.777 1.00 165.06 ? 36   VAL A C   1 
ATOM   75    O O   . VAL A  1 23   ? 159.323 139.721 183.137 1.00 165.06 ? 36   VAL A O   1 
ATOM   76    C CB  . VAL A  1 23   ? 160.861 140.104 180.371 1.00 165.06 ? 36   VAL A CB  1 
ATOM   77    C CG1 . VAL A  1 23   ? 159.715 139.170 180.059 1.00 165.06 ? 36   VAL A CG1 1 
ATOM   78    C CG2 . VAL A  1 23   ? 160.436 141.542 180.133 1.00 165.06 ? 36   VAL A CG2 1 
ATOM   79    N N   . TYR A  1 24   ? 160.415 141.685 183.151 1.00 159.11 ? 37   TYR A N   1 
ATOM   80    C CA  . TYR A  1 24   ? 159.388 142.317 183.951 1.00 159.11 ? 37   TYR A CA  1 
ATOM   81    C C   . TYR A  1 24   ? 159.247 143.768 183.528 1.00 159.11 ? 37   TYR A C   1 
ATOM   82    O O   . TYR A  1 24   ? 160.146 144.349 182.918 1.00 159.11 ? 37   TYR A O   1 
ATOM   83    C CB  . TYR A  1 24   ? 159.688 142.160 185.441 1.00 159.11 ? 37   TYR A CB  1 
ATOM   84    C CG  . TYR A  1 24   ? 160.902 142.836 186.051 1.00 159.11 ? 37   TYR A CG  1 
ATOM   85    C CD1 . TYR A  1 24   ? 160.874 144.170 186.414 1.00 159.11 ? 37   TYR A CD1 1 
ATOM   86    C CD2 . TYR A  1 24   ? 162.042 142.111 186.352 1.00 159.11 ? 37   TYR A CD2 1 
ATOM   87    C CE1 . TYR A  1 24   ? 161.950 144.765 187.019 1.00 159.11 ? 37   TYR A CE1 1 
ATOM   88    C CE2 . TYR A  1 24   ? 163.128 142.706 186.948 1.00 159.11 ? 37   TYR A CE2 1 
ATOM   89    C CZ  . TYR A  1 24   ? 163.072 144.030 187.275 1.00 159.11 ? 37   TYR A CZ  1 
ATOM   90    O OH  . TYR A  1 24   ? 164.142 144.626 187.859 1.00 159.11 ? 37   TYR A OH  1 
ATOM   91    N N   . TYR A  1 25   ? 158.084 144.338 183.828 1.00 155.55 ? 38   TYR A N   1 
ATOM   92    C CA  . TYR A  1 25   ? 157.832 145.727 183.486 1.00 155.55 ? 38   TYR A CA  1 
ATOM   93    C C   . TYR A  1 25   ? 158.669 146.638 184.373 1.00 155.55 ? 38   TYR A C   1 
ATOM   94    O O   . TYR A  1 25   ? 158.936 146.309 185.530 1.00 155.55 ? 38   TYR A O   1 
ATOM   95    C CB  . TYR A  1 25   ? 156.360 146.064 183.648 1.00 155.55 ? 38   TYR A CB  1 
ATOM   96    C CG  . TYR A  1 25   ? 155.555 145.845 182.403 1.00 155.55 ? 38   TYR A CG  1 
ATOM   97    C CD1 . TYR A  1 25   ? 155.180 144.574 182.015 1.00 155.55 ? 38   TYR A CD1 1 
ATOM   98    C CD2 . TYR A  1 25   ? 155.165 146.906 181.619 1.00 155.55 ? 38   TYR A CD2 1 
ATOM   99    C CE1 . TYR A  1 25   ? 154.441 144.366 180.880 1.00 155.55 ? 38   TYR A CE1 1 
ATOM   100   C CE2 . TYR A  1 25   ? 154.425 146.709 180.486 1.00 155.55 ? 38   TYR A CE2 1 
ATOM   101   C CZ  . TYR A  1 25   ? 154.066 145.437 180.122 1.00 155.55 ? 38   TYR A CZ  1 
ATOM   102   O OH  . TYR A  1 25   ? 153.335 145.235 178.985 1.00 155.55 ? 38   TYR A OH  1 
ATOM   103   N N   . PRO A  1 26   ? 159.084 147.789 183.853 1.00 159.34 ? 39   PRO A N   1 
ATOM   104   C CA  . PRO A  1 26   ? 160.120 148.585 184.529 1.00 159.34 ? 39   PRO A CA  1 
ATOM   105   C C   . PRO A  1 26   ? 159.790 148.979 185.960 1.00 159.34 ? 39   PRO A C   1 
ATOM   106   O O   . PRO A  1 26   ? 160.497 148.595 186.897 1.00 159.34 ? 39   PRO A O   1 
ATOM   107   C CB  . PRO A  1 26   ? 160.248 149.821 183.628 1.00 159.34 ? 39   PRO A CB  1 
ATOM   108   C CG  . PRO A  1 26   ? 159.051 149.787 182.724 1.00 159.34 ? 39   PRO A CG  1 
ATOM   109   C CD  . PRO A  1 26   ? 158.711 148.358 182.551 1.00 159.34 ? 39   PRO A CD  1 
ATOM   110   N N   . ASP A  1 27   ? 158.725 149.745 186.142 1.00 160.39 ? 40   ASP A N   1 
ATOM   111   C CA  . ASP A  1 27   ? 158.178 150.025 187.464 1.00 160.39 ? 40   ASP A CA  1 
ATOM   112   C C   . ASP A  1 27   ? 156.683 150.243 187.281 1.00 160.39 ? 40   ASP A C   1 
ATOM   113   O O   . ASP A  1 27   ? 156.127 149.920 186.227 1.00 160.39 ? 40   ASP A O   1 
ATOM   114   C CB  . ASP A  1 27   ? 158.891 151.215 188.128 1.00 160.39 ? 40   ASP A CB  1 
ATOM   115   C CG  . ASP A  1 27   ? 158.701 151.236 189.636 1.00 160.39 ? 40   ASP A CG  1 
ATOM   116   O OD1 . ASP A  1 27   ? 157.684 150.685 190.106 1.00 160.39 ? 40   ASP A OD1 1 
ATOM   117   O OD2 . ASP A  1 27   ? 159.560 151.795 190.350 1.00 160.39 ? 40   ASP A OD2 1 
ATOM   118   N N   . LYS A  1 28   ? 156.031 150.826 188.275 1.00 151.17 ? 41   LYS A N   1 
ATOM   119   C CA  . LYS A  1 28   ? 154.602 151.047 188.145 1.00 151.17 ? 41   LYS A CA  1 
ATOM   120   C C   . LYS A  1 28   ? 154.271 152.193 187.187 1.00 151.17 ? 41   LYS A C   1 
ATOM   121   O O   . LYS A  1 28   ? 153.234 152.843 187.354 1.00 151.17 ? 41   LYS A O   1 
ATOM   122   C CB  . LYS A  1 28   ? 153.967 151.262 189.519 1.00 151.17 ? 41   LYS A CB  1 
ATOM   123   C CG  . LYS A  1 28   ? 153.796 149.952 190.290 1.00 151.17 ? 41   LYS A CG  1 
ATOM   124   C CD  . LYS A  1 28   ? 152.883 150.098 191.506 1.00 151.17 ? 41   LYS A CD  1 
ATOM   125   C CE  . LYS A  1 28   ? 151.511 149.459 191.299 1.00 151.17 ? 41   LYS A CE  1 
ATOM   126   N NZ  . LYS A  1 28   ? 151.420 148.072 191.839 1.00 151.17 ? 41   LYS A NZ  1 
ATOM   127   N N   . VAL A  1 29   ? 155.152 152.464 186.214 1.00 149.34 ? 42   VAL A N   1 
ATOM   128   C CA  . VAL A  1 29   ? 154.864 153.403 185.134 1.00 149.34 ? 42   VAL A CA  1 
ATOM   129   C C   . VAL A  1 29   ? 154.006 152.731 184.070 1.00 149.34 ? 42   VAL A C   1 
ATOM   130   O O   . VAL A  1 29   ? 153.909 151.507 183.977 1.00 149.34 ? 42   VAL A O   1 
ATOM   131   C CB  . VAL A  1 29   ? 156.163 153.936 184.514 1.00 149.34 ? 42   VAL A CB  1 
ATOM   132   C CG1 . VAL A  1 29   ? 156.768 152.860 183.669 1.00 149.34 ? 42   VAL A CG1 1 
ATOM   133   C CG2 . VAL A  1 29   ? 155.908 155.176 183.678 1.00 149.34 ? 42   VAL A CG2 1 
ATOM   134   N N   . PHE A  1 30   ? 153.384 153.556 183.248 1.00 141.04 ? 43   PHE A N   1 
ATOM   135   C CA  . PHE A  1 30   ? 152.680 153.100 182.072 1.00 141.04 ? 43   PHE A CA  1 
ATOM   136   C C   . PHE A  1 30   ? 153.222 153.825 180.852 1.00 141.04 ? 43   PHE A C   1 
ATOM   137   O O   . PHE A  1 30   ? 153.843 154.882 180.959 1.00 141.04 ? 43   PHE A O   1 
ATOM   138   C CB  . PHE A  1 30   ? 151.183 153.354 182.191 1.00 141.04 ? 43   PHE A CB  1 
ATOM   139   C CG  . PHE A  1 30   ? 150.428 153.037 180.945 1.00 141.04 ? 43   PHE A CG  1 
ATOM   140   C CD1 . PHE A  1 30   ? 150.040 151.744 180.682 1.00 141.04 ? 43   PHE A CD1 1 
ATOM   141   C CD2 . PHE A  1 30   ? 150.131 154.022 180.022 1.00 141.04 ? 43   PHE A CD2 1 
ATOM   142   C CE1 . PHE A  1 30   ? 149.355 151.441 179.542 1.00 141.04 ? 43   PHE A CE1 1 
ATOM   143   C CE2 . PHE A  1 30   ? 149.455 153.719 178.872 1.00 141.04 ? 43   PHE A CE2 1 
ATOM   144   C CZ  . PHE A  1 30   ? 149.060 152.426 178.634 1.00 141.04 ? 43   PHE A CZ  1 
ATOM   145   N N   . ARG A  1 31   ? 152.989 153.228 179.690 1.00 135.19 ? 44   ARG A N   1 
ATOM   146   C CA  . ARG A  1 31   ? 153.194 153.866 178.399 1.00 135.19 ? 44   ARG A CA  1 
ATOM   147   C C   . ARG A  1 31   ? 152.446 153.036 177.375 1.00 135.19 ? 44   ARG A C   1 
ATOM   148   O O   . ARG A  1 31   ? 151.826 152.026 177.711 1.00 135.19 ? 44   ARG A O   1 
ATOM   149   C CB  . ARG A  1 31   ? 154.670 153.952 178.044 1.00 135.19 ? 44   ARG A CB  1 
ATOM   150   C CG  . ARG A  1 31   ? 155.332 152.606 178.029 1.00 135.19 ? 44   ARG A CG  1 
ATOM   151   C CD  . ARG A  1 31   ? 156.820 152.781 178.049 1.00 135.19 ? 44   ARG A CD  1 
ATOM   152   N NE  . ARG A  1 31   ? 157.281 153.511 179.227 1.00 135.19 ? 44   ARG A NE  1 
ATOM   153   C CZ  . ARG A  1 31   ? 158.019 152.989 180.200 1.00 135.19 ? 44   ARG A CZ  1 
ATOM   154   N NH1 . ARG A  1 31   ? 158.403 151.720 180.149 1.00 135.19 ? 44   ARG A NH1 1 
ATOM   155   N NH2 . ARG A  1 31   ? 158.394 153.750 181.217 1.00 135.19 ? 44   ARG A NH2 1 
ATOM   156   N N   . SER A  1 32   ? 152.534 153.445 176.116 1.00 132.38 ? 45   SER A N   1 
ATOM   157   C CA  . SER A  1 32   ? 151.926 152.654 175.059 1.00 132.38 ? 45   SER A CA  1 
ATOM   158   C C   . SER A  1 32   ? 152.474 153.087 173.714 1.00 132.38 ? 45   SER A C   1 
ATOM   159   O O   . SER A  1 32   ? 152.727 154.271 173.491 1.00 132.38 ? 45   SER A O   1 
ATOM   160   C CB  . SER A  1 32   ? 150.401 152.785 175.051 1.00 132.38 ? 45   SER A CB  1 
ATOM   161   O OG  . SER A  1 32   ? 149.839 151.984 174.027 1.00 132.38 ? 45   SER A OG  1 
ATOM   162   N N   . SER A  1 33   ? 152.628 152.116 172.819 1.00 126.57 ? 46   SER A N   1 
ATOM   163   C CA  . SER A  1 33   ? 152.853 152.383 171.402 1.00 126.57 ? 46   SER A CA  1 
ATOM   164   C C   . SER A  1 33   ? 154.072 153.266 171.180 1.00 126.57 ? 46   SER A C   1 
ATOM   165   O O   . SER A  1 33   ? 154.023 154.251 170.447 1.00 126.57 ? 46   SER A O   1 
ATOM   166   C CB  . SER A  1 33   ? 151.617 153.016 170.769 1.00 126.57 ? 46   SER A CB  1 
ATOM   167   O OG  . SER A  1 33   ? 151.133 154.097 171.548 1.00 126.57 ? 46   SER A OG  1 
ATOM   168   N N   . VAL A  1 34   ? 155.174 152.917 171.825 1.00 132.02 ? 47   VAL A N   1 
ATOM   169   C CA  . VAL A  1 34   ? 156.402 153.689 171.727 1.00 132.02 ? 47   VAL A CA  1 
ATOM   170   C C   . VAL A  1 34   ? 157.594 152.764 171.909 1.00 132.02 ? 47   VAL A C   1 
ATOM   171   O O   . VAL A  1 34   ? 157.453 151.546 172.051 1.00 132.02 ? 47   VAL A O   1 
ATOM   172   C CB  . VAL A  1 34   ? 156.448 154.829 172.761 1.00 132.02 ? 47   VAL A CB  1 
ATOM   173   C CG1 . VAL A  1 34   ? 155.608 156.007 172.308 1.00 132.02 ? 47   VAL A CG1 1 
ATOM   174   C CG2 . VAL A  1 34   ? 155.965 154.321 174.105 1.00 132.02 ? 47   VAL A CG2 1 
ATOM   175   N N   . LEU A  1 35   ? 158.779 153.358 171.868 1.00 129.49 ? 48   LEU A N   1 
ATOM   176   C CA  . LEU A  1 35   ? 160.020 152.675 172.200 1.00 129.49 ? 48   LEU A CA  1 
ATOM   177   C C   . LEU A  1 35   ? 160.589 153.287 173.471 1.00 129.49 ? 48   LEU A C   1 
ATOM   178   O O   . LEU A  1 35   ? 160.404 154.481 173.719 1.00 129.49 ? 48   LEU A O   1 
ATOM   179   C CB  . LEU A  1 35   ? 161.023 152.804 171.059 1.00 129.49 ? 48   LEU A CB  1 
ATOM   180   C CG  . LEU A  1 35   ? 161.991 151.638 170.934 1.00 129.49 ? 48   LEU A CG  1 
ATOM   181   C CD1 . LEU A  1 35   ? 161.221 150.350 170.819 1.00 129.49 ? 48   LEU A CD1 1 
ATOM   182   C CD2 . LEU A  1 35   ? 162.890 151.838 169.733 1.00 129.49 ? 48   LEU A CD2 1 
ATOM   183   N N   . HIS A  1 36   ? 161.258 152.479 174.283 1.00 126.25 ? 49   HIS A N   1 
ATOM   184   C CA  . HIS A  1 36   ? 161.989 153.026 175.412 1.00 126.25 ? 49   HIS A CA  1 
ATOM   185   C C   . HIS A  1 36   ? 162.918 151.980 175.994 1.00 126.25 ? 49   HIS A C   1 
ATOM   186   O O   . HIS A  1 36   ? 162.653 150.780 175.916 1.00 126.25 ? 49   HIS A O   1 
ATOM   187   C CB  . HIS A  1 36   ? 161.060 153.519 176.493 1.00 126.25 ? 49   HIS A CB  1 
ATOM   188   C CG  . HIS A  1 36   ? 161.526 154.781 177.127 1.00 126.25 ? 49   HIS A CG  1 
ATOM   189   N ND1 . HIS A  1 36   ? 161.662 155.954 176.421 1.00 126.25 ? 49   HIS A ND1 1 
ATOM   190   C CD2 . HIS A  1 36   ? 161.903 155.056 178.396 1.00 126.25 ? 49   HIS A CD2 1 
ATOM   191   C CE1 . HIS A  1 36   ? 162.092 156.903 177.231 1.00 126.25 ? 49   HIS A CE1 1 
ATOM   192   N NE2 . HIS A  1 36   ? 162.245 156.385 178.436 1.00 126.25 ? 49   HIS A NE2 1 
ATOM   193   N N   . SER A  1 37   ? 164.008 152.437 176.588 1.00 133.76 ? 50   SER A N   1 
ATOM   194   C CA  . SER A  1 37   ? 164.967 151.509 177.154 1.00 133.76 ? 50   SER A CA  1 
ATOM   195   C C   . SER A  1 37   ? 165.181 151.786 178.625 1.00 133.76 ? 50   SER A C   1 
ATOM   196   O O   . SER A  1 37   ? 164.932 152.886 179.119 1.00 133.76 ? 50   SER A O   1 
ATOM   197   C CB  . SER A  1 37   ? 166.320 151.572 176.465 1.00 133.76 ? 50   SER A CB  1 
ATOM   198   O OG  . SER A  1 37   ? 167.282 150.951 177.301 1.00 133.76 ? 50   SER A OG  1 
ATOM   199   N N   . THR A  1 38   ? 165.643 150.754 179.320 1.00 140.32 ? 51   THR A N   1 
ATOM   200   C CA  . THR A  1 38   ? 166.066 150.878 180.706 1.00 140.32 ? 51   THR A CA  1 
ATOM   201   C C   . THR A  1 38   ? 167.292 150.004 180.899 1.00 140.32 ? 51   THR A C   1 
ATOM   202   O O   . THR A  1 38   ? 167.853 149.464 179.944 1.00 140.32 ? 51   THR A O   1 
ATOM   203   C CB  . THR A  1 38   ? 164.976 150.461 181.701 1.00 140.32 ? 51   THR A CB  1 
ATOM   204   O OG1 . THR A  1 38   ? 165.012 149.040 181.872 1.00 140.32 ? 51   THR A OG1 1 
ATOM   205   C CG2 . THR A  1 38   ? 163.593 150.878 181.230 1.00 140.32 ? 51   THR A CG2 1 
ATOM   206   N N   . GLN A  1 39   ? 167.686 149.845 182.155 1.00 148.46 ? 52   GLN A N   1 
ATOM   207   C CA  . GLN A  1 39   ? 168.782 148.961 182.519 1.00 148.46 ? 52   GLN A CA  1 
ATOM   208   C C   . GLN A  1 39   ? 168.614 148.572 183.976 1.00 148.46 ? 52   GLN A C   1 
ATOM   209   O O   . GLN A  1 39   ? 168.720 149.428 184.858 1.00 148.46 ? 52   GLN A O   1 
ATOM   210   C CB  . GLN A  1 39   ? 170.119 149.644 182.278 1.00 148.46 ? 52   GLN A CB  1 
ATOM   211   C CG  . GLN A  1 39   ? 170.115 151.106 182.625 1.00 148.46 ? 52   GLN A CG  1 
ATOM   212   C CD  . GLN A  1 39   ? 170.725 151.371 183.966 1.00 148.46 ? 52   GLN A CD  1 
ATOM   213   O OE1 . GLN A  1 39   ? 171.558 150.602 184.436 1.00 148.46 ? 52   GLN A OE1 1 
ATOM   214   N NE2 . GLN A  1 39   ? 170.327 152.468 184.593 1.00 148.46 ? 52   GLN A NE2 1 
ATOM   215   N N   . ASP A  1 40   ? 168.241 147.317 184.200 1.00 160.57 ? 53   ASP A N   1 
ATOM   216   C CA  . ASP A  1 40   ? 168.021 146.831 185.583 1.00 160.57 ? 53   ASP A CA  1 
ATOM   217   C C   . ASP A  1 40   ? 168.176 145.312 185.598 1.00 160.57 ? 53   ASP A C   1 
ATOM   218   O O   . ASP A  1 40   ? 168.318 144.704 184.517 1.00 160.57 ? 53   ASP A O   1 
ATOM   219   C CB  . ASP A  1 40   ? 166.656 147.271 186.119 1.00 160.57 ? 53   ASP A CB  1 
ATOM   220   C CG  . ASP A  1 40   ? 166.373 146.778 187.528 1.00 160.57 ? 53   ASP A CG  1 
ATOM   221   O OD1 . ASP A  1 40   ? 167.261 146.123 188.108 1.00 160.57 ? 53   ASP A OD1 1 
ATOM   222   O OD2 . ASP A  1 40   ? 165.266 147.052 188.033 1.00 160.57 ? 53   ASP A OD2 1 
ATOM   223   N N   . LEU A  1 41   ? 168.152 144.736 186.795 1.00 164.44 ? 54   LEU A N   1 
ATOM   224   C CA  . LEU A  1 41   ? 168.294 143.302 186.933 1.00 164.44 ? 54   LEU A CA  1 
ATOM   225   C C   . LEU A  1 41   ? 167.361 142.655 185.920 1.00 164.44 ? 54   LEU A C   1 
ATOM   226   O O   . LEU A  1 41   ? 166.138 142.675 186.081 1.00 164.44 ? 54   LEU A O   1 
ATOM   227   C CB  . LEU A  1 41   ? 167.974 142.871 188.372 1.00 164.44 ? 54   LEU A CB  1 
ATOM   228   C CG  . LEU A  1 41   ? 168.989 143.185 189.484 1.00 164.44 ? 54   LEU A CG  1 
ATOM   229   C CD1 . LEU A  1 41   ? 168.744 144.549 190.108 1.00 164.44 ? 54   LEU A CD1 1 
ATOM   230   C CD2 . LEU A  1 41   ? 168.960 142.107 190.547 1.00 164.44 ? 54   LEU A CD2 1 
ATOM   231   N N   . PHE A  1 42   ? 167.943 142.101 184.864 1.00 162.07 ? 55   PHE A N   1 
ATOM   232   C CA  . PHE A  1 42   ? 167.222 141.483 183.767 1.00 162.07 ? 55   PHE A CA  1 
ATOM   233   C C   . PHE A  1 42   ? 167.912 140.165 183.462 1.00 162.07 ? 55   PHE A C   1 
ATOM   234   O O   . PHE A  1 42   ? 169.044 139.943 183.872 1.00 162.07 ? 55   PHE A O   1 
ATOM   235   C CB  . PHE A  1 42   ? 167.219 142.363 182.504 1.00 162.07 ? 55   PHE A CB  1 
ATOM   236   C CG  . PHE A  1 42   ? 165.956 143.161 182.284 1.00 162.07 ? 55   PHE A CG  1 
ATOM   237   C CD1 . PHE A  1 42   ? 164.731 142.532 182.130 1.00 162.07 ? 55   PHE A CD1 1 
ATOM   238   C CD2 . PHE A  1 42   ? 166.010 144.538 182.158 1.00 162.07 ? 55   PHE A CD2 1 
ATOM   239   C CE1 . PHE A  1 42   ? 163.583 143.265 181.903 1.00 162.07 ? 55   PHE A CE1 1 
ATOM   240   C CE2 . PHE A  1 42   ? 164.865 145.274 181.931 1.00 162.07 ? 55   PHE A CE2 1 
ATOM   241   C CZ  . PHE A  1 42   ? 163.652 144.637 181.804 1.00 162.07 ? 55   PHE A CZ  1 
ATOM   242   N N   . LEU A  1 43   ? 167.232 139.283 182.737 1.00 168.79 ? 56   LEU A N   1 
ATOM   243   C CA  . LEU A  1 43   ? 167.859 138.045 182.294 1.00 168.79 ? 56   LEU A CA  1 
ATOM   244   C C   . LEU A  1 43   ? 168.322 138.178 180.847 1.00 168.79 ? 56   LEU A C   1 
ATOM   245   O O   . LEU A  1 43   ? 167.478 138.199 179.941 1.00 168.79 ? 56   LEU A O   1 
ATOM   246   C CB  . LEU A  1 43   ? 166.894 136.886 182.439 1.00 168.79 ? 56   LEU A CB  1 
ATOM   247   C CG  . LEU A  1 43   ? 167.511 135.528 182.152 1.00 168.79 ? 56   LEU A CG  1 
ATOM   248   C CD1 . LEU A  1 43   ? 166.975 134.508 183.137 1.00 168.79 ? 56   LEU A CD1 1 
ATOM   249   C CD2 . LEU A  1 43   ? 167.189 135.115 180.735 1.00 168.79 ? 56   LEU A CD2 1 
ATOM   250   N N   . PRO A  1 44   ? 169.624 138.251 180.577 1.00 162.91 ? 57   PRO A N   1 
ATOM   251   C CA  . PRO A  1 44   ? 170.071 138.347 179.191 1.00 162.91 ? 57   PRO A CA  1 
ATOM   252   C C   . PRO A  1 44   ? 169.680 137.085 178.453 1.00 162.91 ? 57   PRO A C   1 
ATOM   253   O O   . PRO A  1 44   ? 169.658 135.995 179.023 1.00 162.91 ? 57   PRO A O   1 
ATOM   254   C CB  . PRO A  1 44   ? 171.593 138.476 179.308 1.00 162.91 ? 57   PRO A CB  1 
ATOM   255   C CG  . PRO A  1 44   ? 171.868 138.713 180.731 1.00 162.91 ? 57   PRO A CG  1 
ATOM   256   C CD  . PRO A  1 44   ? 170.757 138.080 181.490 1.00 162.91 ? 57   PRO A CD  1 
ATOM   257   N N   . PHE A  1 45   ? 169.365 137.242 177.177 1.00 176.14 ? 58   PHE A N   1 
ATOM   258   C CA  . PHE A  1 45   ? 168.774 136.166 176.399 1.00 176.14 ? 58   PHE A CA  1 
ATOM   259   C C   . PHE A  1 45   ? 169.827 135.230 175.823 1.00 176.14 ? 58   PHE A C   1 
ATOM   260   O O   . PHE A  1 45   ? 171.014 135.552 175.752 1.00 176.14 ? 58   PHE A O   1 
ATOM   261   C CB  . PHE A  1 45   ? 167.916 136.735 175.278 1.00 176.14 ? 58   PHE A CB  1 
ATOM   262   C CG  . PHE A  1 45   ? 166.495 136.925 175.671 1.00 176.14 ? 58   PHE A CG  1 
ATOM   263   C CD1 . PHE A  1 45   ? 166.169 137.169 176.992 1.00 176.14 ? 58   PHE A CD1 1 
ATOM   264   C CD2 . PHE A  1 45   ? 165.483 136.854 174.737 1.00 176.14 ? 58   PHE A CD2 1 
ATOM   265   C CE1 . PHE A  1 45   ? 164.860 137.341 177.372 1.00 176.14 ? 58   PHE A CE1 1 
ATOM   266   C CE2 . PHE A  1 45   ? 164.172 137.033 175.114 1.00 176.14 ? 58   PHE A CE2 1 
ATOM   267   C CZ  . PHE A  1 45   ? 163.862 137.275 176.434 1.00 176.14 ? 58   PHE A CZ  1 
ATOM   268   N N   . PHE A  1 46   ? 169.364 134.050 175.410 1.00 184.83 ? 59   PHE A N   1 
ATOM   269   C CA  . PHE A  1 46   ? 170.234 133.028 174.841 1.00 184.83 ? 59   PHE A CA  1 
ATOM   270   C C   . PHE A  1 46   ? 171.291 132.600 175.850 1.00 184.83 ? 59   PHE A C   1 
ATOM   271   O O   . PHE A  1 46   ? 172.489 132.636 175.571 1.00 184.83 ? 59   PHE A O   1 
ATOM   272   C CB  . PHE A  1 46   ? 170.871 133.512 173.540 1.00 184.83 ? 59   PHE A CB  1 
ATOM   273   C CG  . PHE A  1 46   ? 169.925 133.541 172.379 1.00 184.83 ? 59   PHE A CG  1 
ATOM   274   C CD1 . PHE A  1 46   ? 168.755 134.272 172.438 1.00 184.83 ? 59   PHE A CD1 1 
ATOM   275   C CD2 . PHE A  1 46   ? 170.222 132.861 171.213 1.00 184.83 ? 59   PHE A CD2 1 
ATOM   276   C CE1 . PHE A  1 46   ? 167.891 134.303 171.368 1.00 184.83 ? 59   PHE A CE1 1 
ATOM   277   C CE2 . PHE A  1 46   ? 169.362 132.894 170.140 1.00 184.83 ? 59   PHE A CE2 1 
ATOM   278   C CZ  . PHE A  1 46   ? 168.196 133.615 170.218 1.00 184.83 ? 59   PHE A CZ  1 
ATOM   279   N N   . SER A  1 47   ? 170.848 132.206 177.041 1.00 187.36 ? 60   SER A N   1 
ATOM   280   C CA  . SER A  1 47   ? 171.740 131.899 178.151 1.00 187.36 ? 60   SER A CA  1 
ATOM   281   C C   . SER A  1 47   ? 171.449 130.512 178.724 1.00 187.36 ? 60   SER A C   1 
ATOM   282   O O   . SER A  1 47   ? 170.612 129.756 178.220 1.00 187.36 ? 60   SER A O   1 
ATOM   283   C CB  . SER A  1 47   ? 171.627 132.972 179.236 1.00 187.36 ? 60   SER A CB  1 
ATOM   284   N N   . ASN A  1 48   ? 172.156 130.192 179.805 1.00 188.50 ? 61   ASN A N   1 
ATOM   285   C CA  . ASN A  1 48   ? 172.067 128.881 180.426 1.00 188.50 ? 61   ASN A CA  1 
ATOM   286   C C   . ASN A  1 48   ? 170.860 128.785 181.340 1.00 188.50 ? 61   ASN A C   1 
ATOM   287   O O   . ASN A  1 48   ? 170.502 129.742 182.029 1.00 188.50 ? 61   ASN A O   1 
ATOM   288   C CB  . ASN A  1 48   ? 173.330 128.586 181.229 1.00 188.50 ? 61   ASN A CB  1 
ATOM   289   C CG  . ASN A  1 48   ? 174.411 127.953 180.395 1.00 188.50 ? 61   ASN A CG  1 
ATOM   290   O OD1 . ASN A  1 48   ? 174.186 126.935 179.744 1.00 188.50 ? 61   ASN A OD1 1 
ATOM   291   N ND2 . ASN A  1 48   ? 175.595 128.552 180.403 1.00 188.50 ? 61   ASN A ND2 1 
ATOM   292   N N   . VAL A  1 49   ? 170.235 127.615 181.340 1.00 193.76 ? 62   VAL A N   1 
ATOM   293   C CA  . VAL A  1 49   ? 169.191 127.288 182.299 1.00 193.76 ? 62   VAL A CA  1 
ATOM   294   C C   . VAL A  1 49   ? 169.451 125.877 182.797 1.00 193.76 ? 62   VAL A C   1 
ATOM   295   O O   . VAL A  1 49   ? 169.458 124.933 182.002 1.00 193.76 ? 62   VAL A O   1 
ATOM   296   C CB  . VAL A  1 49   ? 167.783 127.393 181.691 1.00 193.76 ? 62   VAL A CB  1 
ATOM   297   C CG1 . VAL A  1 49   ? 166.773 126.714 182.586 1.00 193.76 ? 62   VAL A CG1 1 
ATOM   298   C CG2 . VAL A  1 49   ? 167.414 128.838 181.498 1.00 193.76 ? 62   VAL A CG2 1 
ATOM   299   N N   . THR A  1 50   ? 169.678 125.732 184.101 1.00 200.03 ? 63   THR A N   1 
ATOM   300   C CA  . THR A  1 50   ? 169.866 124.414 184.693 1.00 200.03 ? 63   THR A CA  1 
ATOM   301   C C   . THR A  1 50   ? 168.552 123.653 184.624 1.00 200.03 ? 63   THR A C   1 
ATOM   302   O O   . THR A  1 50   ? 167.694 123.813 185.493 1.00 200.03 ? 63   THR A O   1 
ATOM   303   C CB  . THR A  1 50   ? 170.347 124.524 186.148 1.00 200.03 ? 63   THR A CB  1 
ATOM   304   O OG1 . THR A  1 50   ? 171.586 125.242 186.200 1.00 200.03 ? 63   THR A OG1 1 
ATOM   305   C CG2 . THR A  1 50   ? 170.542 123.146 186.766 1.00 200.03 ? 63   THR A CG2 1 
ATOM   306   N N   . TRP A  1 51   ? 168.365 122.852 183.585 1.00 199.53 ? 64   TRP A N   1 
ATOM   307   C CA  . TRP A  1 51   ? 167.169 122.038 183.485 1.00 199.53 ? 64   TRP A CA  1 
ATOM   308   C C   . TRP A  1 51   ? 167.338 120.813 184.358 1.00 199.53 ? 64   TRP A C   1 
ATOM   309   O O   . TRP A  1 51   ? 168.459 120.434 184.701 1.00 199.53 ? 64   TRP A O   1 
ATOM   310   C CB  . TRP A  1 51   ? 166.891 121.619 182.049 1.00 199.53 ? 64   TRP A CB  1 
ATOM   311   C CG  . TRP A  1 51   ? 165.500 121.164 181.884 1.00 199.53 ? 64   TRP A CG  1 
ATOM   312   C CD1 . TRP A  1 51   ? 164.458 121.435 182.708 1.00 199.53 ? 64   TRP A CD1 1 
ATOM   313   C CD2 . TRP A  1 51   ? 164.984 120.343 180.841 1.00 199.53 ? 64   TRP A CD2 1 
ATOM   314   N NE1 . TRP A  1 51   ? 163.317 120.847 182.237 1.00 199.53 ? 64   TRP A NE1 1 
ATOM   315   C CE2 . TRP A  1 51   ? 163.616 120.165 181.090 1.00 199.53 ? 64   TRP A CE2 1 
ATOM   316   C CE3 . TRP A  1 51   ? 165.547 119.739 179.719 1.00 199.53 ? 64   TRP A CE3 1 
ATOM   317   C CZ2 . TRP A  1 51   ? 162.803 119.413 180.261 1.00 199.53 ? 64   TRP A CZ2 1 
ATOM   318   C CZ3 . TRP A  1 51   ? 164.740 118.992 178.899 1.00 199.53 ? 64   TRP A CZ3 1 
ATOM   319   C CH2 . TRP A  1 51   ? 163.383 118.834 179.172 1.00 199.53 ? 64   TRP A CH2 1 
ATOM   320   N N   . PHE A  1 52   ? 166.226 120.205 184.730 1.00 210.34 ? 65   PHE A N   1 
ATOM   321   C CA  . PHE A  1 52   ? 166.267 119.138 185.708 1.00 210.34 ? 65   PHE A CA  1 
ATOM   322   C C   . PHE A  1 52   ? 165.617 117.867 185.186 1.00 210.34 ? 65   PHE A C   1 
ATOM   323   O O   . PHE A  1 52   ? 164.679 117.882 184.385 1.00 210.34 ? 65   PHE A O   1 
ATOM   324   C CB  . PHE A  1 52   ? 165.606 119.583 187.011 1.00 210.34 ? 65   PHE A CB  1 
ATOM   325   C CG  . PHE A  1 52   ? 166.453 120.508 187.822 1.00 210.34 ? 65   PHE A CG  1 
ATOM   326   C CD1 . PHE A  1 52   ? 166.654 121.809 187.421 1.00 210.34 ? 65   PHE A CD1 1 
ATOM   327   C CD2 . PHE A  1 52   ? 167.070 120.067 188.973 1.00 210.34 ? 65   PHE A CD2 1 
ATOM   328   C CE1 . PHE A  1 52   ? 167.435 122.661 188.159 1.00 210.34 ? 65   PHE A CE1 1 
ATOM   329   C CE2 . PHE A  1 52   ? 167.859 120.917 189.711 1.00 210.34 ? 65   PHE A CE2 1 
ATOM   330   C CZ  . PHE A  1 52   ? 168.044 122.216 189.298 1.00 210.34 ? 65   PHE A CZ  1 
ATOM   331   N N   . HIS A  1 53   ? 166.177 116.749 185.657 1.00 229.14 ? 66   HIS A N   1 
ATOM   332   C CA  . HIS A  1 53   ? 165.726 115.365 185.345 1.00 229.14 ? 66   HIS A CA  1 
ATOM   333   C C   . HIS A  1 53   ? 165.804 114.518 186.624 1.00 229.14 ? 66   HIS A C   1 
ATOM   334   O O   . HIS A  1 53   ? 165.410 113.335 186.575 1.00 229.14 ? 66   HIS A O   1 
ATOM   335   C CB  . HIS A  1 53   ? 166.562 114.774 184.202 1.00 229.14 ? 66   HIS A CB  1 
ATOM   336   C CG  . HIS A  1 53   ? 165.823 113.781 183.369 1.00 229.14 ? 66   HIS A CG  1 
ATOM   337   N ND1 . HIS A  1 53   ? 166.422 112.638 182.876 1.00 229.14 ? 66   HIS A ND1 1 
ATOM   338   C CD2 . HIS A  1 53   ? 164.542 113.752 182.942 1.00 229.14 ? 66   HIS A CD2 1 
ATOM   339   C CE1 . HIS A  1 53   ? 165.542 111.947 182.180 1.00 229.14 ? 66   HIS A CE1 1 
ATOM   340   N NE2 . HIS A  1 53   ? 164.380 112.610 182.205 1.00 229.14 ? 66   HIS A NE2 1 
ATOM   341   N N   . ALA A  1 54   ? 166.312 115.116 187.710 1.00 226.59 ? 67   ALA A N   1 
ATOM   342   C CA  . ALA A  1 54   ? 166.448 114.486 189.045 1.00 226.59 ? 67   ALA A CA  1 
ATOM   343   C C   . ALA A  1 54   ? 167.287 113.204 188.978 1.00 226.59 ? 67   ALA A C   1 
ATOM   344   O O   . ALA A  1 54   ? 166.695 112.111 189.066 1.00 226.59 ? 67   ALA A O   1 
ATOM   345   C CB  . ALA A  1 54   ? 165.086 114.232 189.647 1.00 226.59 ? 67   ALA A CB  1 
ATOM   346   N N   . ILE A  1 55   ? 168.611 113.335 188.830 1.00 230.00 ? 68   ILE A N   1 
ATOM   347   C CA  . ILE A  1 55   ? 169.491 112.128 188.824 1.00 230.00 ? 68   ILE A CA  1 
ATOM   348   C C   . ILE A  1 55   ? 170.089 111.947 190.224 1.00 230.00 ? 68   ILE A C   1 
ATOM   349   O O   . ILE A  1 55   ? 171.210 111.410 190.322 1.00 230.00 ? 68   ILE A O   1 
ATOM   350   C CB  . ILE A  1 55   ? 170.588 112.256 187.748 1.00 230.00 ? 68   ILE A CB  1 
ATOM   351   C CG1 . ILE A  1 55   ? 171.520 113.437 188.027 1.00 230.00 ? 68   ILE A CG1 1 
ATOM   352   C CG2 . ILE A  1 55   ? 169.974 112.337 186.359 1.00 230.00 ? 68   ILE A CG2 1 
ATOM   353   C CD1 . ILE A  1 55   ? 172.926 113.034 188.406 1.00 230.00 ? 68   ILE A CD1 1 
ATOM   354   N N   . HIS A  1 56   ? 169.363 112.383 191.259 1.00 225.52 ? 69   HIS A N   1 
ATOM   355   C CA  . HIS A  1 56   ? 169.840 112.259 192.663 1.00 225.52 ? 69   HIS A CA  1 
ATOM   356   C C   . HIS A  1 56   ? 169.488 110.869 193.204 1.00 225.52 ? 69   HIS A C   1 
ATOM   357   O O   . HIS A  1 56   ? 170.042 109.877 192.690 1.00 225.52 ? 69   HIS A O   1 
ATOM   358   C CB  . HIS A  1 56   ? 169.264 113.388 193.529 1.00 225.52 ? 69   HIS A CB  1 
ATOM   359   N N   . VAL A  1 57   ? 168.604 110.811 194.205 1.00 222.06 ? 70   VAL A N   1 
ATOM   360   C CA  . VAL A  1 57   ? 168.178 109.514 194.813 1.00 222.06 ? 70   VAL A CA  1 
ATOM   361   C C   . VAL A  1 57   ? 166.871 109.068 194.148 1.00 222.06 ? 70   VAL A C   1 
ATOM   362   O O   . VAL A  1 57   ? 166.840 108.980 192.905 1.00 222.06 ? 70   VAL A O   1 
ATOM   363   C CB  . VAL A  1 57   ? 168.019 109.635 196.341 1.00 222.06 ? 70   VAL A CB  1 
ATOM   364   C CG1 . VAL A  1 57   ? 169.328 109.366 197.067 1.00 222.06 ? 70   VAL A CG1 1 
ATOM   365   C CG2 . VAL A  1 57   ? 167.449 110.986 196.744 1.00 222.06 ? 70   VAL A CG2 1 
ATOM   366   N N   . SER A  1 58   ? 165.840 108.802 194.955 1.00 220.33 ? 71   SER A N   1 
ATOM   367   C CA  . SER A  1 58   ? 164.517 108.363 194.436 1.00 220.33 ? 71   SER A CA  1 
ATOM   368   C C   . SER A  1 58   ? 163.457 108.533 195.530 1.00 220.33 ? 71   SER A C   1 
ATOM   369   O O   . SER A  1 58   ? 163.820 108.453 196.720 1.00 220.33 ? 71   SER A O   1 
ATOM   370   C CB  . SER A  1 58   ? 164.577 106.939 193.947 1.00 220.33 ? 71   SER A CB  1 
ATOM   371   O OG  . SER A  1 58   ? 165.312 106.126 194.851 1.00 220.33 ? 71   SER A OG  1 
ATOM   372   N N   . GLY A  1 59   ? 162.200 108.761 195.136 1.00 219.86 ? 72   GLY A N   1 
ATOM   373   C CA  . GLY A  1 59   ? 161.133 108.935 196.094 1.00 219.86 ? 72   GLY A CA  1 
ATOM   374   C C   . GLY A  1 59   ? 159.974 108.031 195.742 1.00 219.86 ? 72   GLY A C   1 
ATOM   375   O O   . GLY A  1 59   ? 159.090 108.409 194.970 1.00 219.86 ? 72   GLY A O   1 
ATOM   376   N N   . THR A  1 60   ? 159.955 106.835 196.332 1.00 223.97 ? 73   THR A N   1 
ATOM   377   C CA  . THR A  1 60   ? 158.936 105.847 196.010 1.00 223.97 ? 73   THR A CA  1 
ATOM   378   C C   . THR A  1 60   ? 157.669 106.038 196.824 1.00 223.97 ? 73   THR A C   1 
ATOM   379   O O   . THR A  1 60   ? 156.606 106.273 196.244 1.00 223.97 ? 73   THR A O   1 
ATOM   380   C CB  . THR A  1 60   ? 159.461 104.427 196.250 1.00 223.97 ? 73   THR A CB  1 
ATOM   381   O OG1 . THR A  1 60   ? 159.243 104.063 197.617 1.00 223.97 ? 73   THR A OG1 1 
ATOM   382   C CG2 . THR A  1 60   ? 160.950 104.354 195.960 1.00 223.97 ? 73   THR A CG2 1 
ATOM   383   N N   . ASN A  1 61   ? 157.755 105.939 198.145 1.00 215.12 ? 74   ASN A N   1 
ATOM   384   C CA  . ASN A  1 61   ? 156.640 106.326 198.993 1.00 215.12 ? 74   ASN A CA  1 
ATOM   385   C C   . ASN A  1 61   ? 157.065 107.412 199.975 1.00 215.12 ? 74   ASN A C   1 
ATOM   386   O O   . ASN A  1 61   ? 156.353 108.406 200.158 1.00 215.12 ? 74   ASN A O   1 
ATOM   387   C CB  . ASN A  1 61   ? 156.079 105.104 199.712 1.00 215.12 ? 74   ASN A CB  1 
ATOM   388   C CG  . ASN A  1 61   ? 155.379 104.156 198.768 1.00 215.12 ? 74   ASN A CG  1 
ATOM   389   O OD1 . ASN A  1 61   ? 155.965 103.182 198.299 1.00 215.12 ? 74   ASN A OD1 1 
ATOM   390   N ND2 . ASN A  1 61   ? 154.115 104.438 198.481 1.00 215.12 ? 74   ASN A ND2 1 
ATOM   391   N N   . GLY A  1 62   ? 158.225 107.229 200.607 1.00 211.37 ? 75   GLY A N   1 
ATOM   392   C CA  . GLY A  1 62   ? 158.746 108.192 201.558 1.00 211.37 ? 75   GLY A CA  1 
ATOM   393   C C   . GLY A  1 62   ? 159.793 109.116 200.973 1.00 211.37 ? 75   GLY A C   1 
ATOM   394   O O   . GLY A  1 62   ? 159.584 109.702 199.909 1.00 211.37 ? 75   GLY A O   1 
ATOM   395   N N   . THR A  1 63   ? 160.928 109.253 201.653 1.00 208.79 ? 76   THR A N   1 
ATOM   396   C CA  . THR A  1 63   ? 161.989 110.135 201.193 1.00 208.79 ? 76   THR A CA  1 
ATOM   397   C C   . THR A  1 63   ? 163.331 109.461 201.422 1.00 208.79 ? 76   THR A C   1 
ATOM   398   O O   . THR A  1 63   ? 163.512 108.710 202.383 1.00 208.79 ? 76   THR A O   1 
ATOM   399   C CB  . THR A  1 63   ? 161.967 111.492 201.908 1.00 208.79 ? 76   THR A CB  1 
ATOM   400   O OG1 . THR A  1 63   ? 160.626 111.990 201.956 1.00 208.79 ? 76   THR A OG1 1 
ATOM   401   C CG2 . THR A  1 63   ? 162.844 112.497 201.180 1.00 208.79 ? 76   THR A CG2 1 
ATOM   402   N N   . LYS A  1 64   ? 164.264 109.727 200.516 1.00 212.86 ? 77   LYS A N   1 
ATOM   403   C CA  . LYS A  1 64   ? 165.631 109.243 200.644 1.00 212.86 ? 77   LYS A CA  1 
ATOM   404   C C   . LYS A  1 64   ? 166.590 110.374 200.286 1.00 212.86 ? 77   LYS A C   1 
ATOM   405   O O   . LYS A  1 64   ? 167.570 110.181 199.561 1.00 212.86 ? 77   LYS A O   1 
ATOM   406   C CB  . LYS A  1 64   ? 165.847 107.997 199.779 1.00 212.86 ? 77   LYS A CB  1 
ATOM   407   C CG  . LYS A  1 64   ? 167.208 107.335 199.840 1.00 212.86 ? 77   LYS A CG  1 
ATOM   408   C CD  . LYS A  1 64   ? 167.537 106.757 201.174 1.00 212.86 ? 77   LYS A CD  1 
ATOM   409   C CE  . LYS A  1 64   ? 168.838 106.002 201.049 1.00 212.86 ? 77   LYS A CE  1 
ATOM   410   N NZ  . LYS A  1 64   ? 169.931 106.922 200.628 1.00 212.86 ? 77   LYS A NZ  1 
ATOM   411   N N   . ARG A  1 65   ? 166.301 111.571 200.794 1.00 218.18 ? 78   ARG A N   1 
ATOM   412   C CA  . ARG A  1 65   ? 167.027 112.793 200.473 1.00 218.18 ? 78   ARG A CA  1 
ATOM   413   C C   . ARG A  1 65   ? 168.537 112.584 200.504 1.00 218.18 ? 78   ARG A C   1 
ATOM   414   O O   . ARG A  1 65   ? 169.117 112.293 201.554 1.00 218.18 ? 78   ARG A O   1 
ATOM   415   C CB  . ARG A  1 65   ? 166.605 113.889 201.452 1.00 218.18 ? 78   ARG A CB  1 
ATOM   416   C CG  . ARG A  1 65   ? 166.692 113.442 202.915 1.00 218.18 ? 78   ARG A CG  1 
ATOM   417   C CD  . ARG A  1 65   ? 165.998 114.393 203.879 1.00 218.18 ? 78   ARG A CD  1 
ATOM   418   N NE  . ARG A  1 65   ? 164.547 114.237 203.858 1.00 218.18 ? 78   ARG A NE  1 
ATOM   419   C CZ  . ARG A  1 65   ? 163.869 113.467 204.700 1.00 218.18 ? 78   ARG A CZ  1 
ATOM   420   N NH1 . ARG A  1 65   ? 164.509 112.783 205.637 1.00 218.18 ? 78   ARG A NH1 1 
ATOM   421   N NH2 . ARG A  1 65   ? 162.550 113.386 204.605 1.00 218.18 ? 78   ARG A NH2 1 
ATOM   422   N N   . PHE A  1 66   ? 169.179 112.715 199.346 1.00 221.20 ? 79   PHE A N   1 
ATOM   423   C CA  . PHE A  1 66   ? 170.596 112.402 199.225 1.00 221.20 ? 79   PHE A CA  1 
ATOM   424   C C   . PHE A  1 66   ? 171.449 113.615 198.894 1.00 221.20 ? 79   PHE A C   1 
ATOM   425   O O   . PHE A  1 66   ? 172.493 113.816 199.525 1.00 221.20 ? 79   PHE A O   1 
ATOM   426   C CB  . PHE A  1 66   ? 170.809 111.337 198.153 1.00 221.20 ? 79   PHE A CB  1 
ATOM   427   C CG  . PHE A  1 66   ? 172.199 111.307 197.604 1.00 221.20 ? 79   PHE A CG  1 
ATOM   428   C CD1 . PHE A  1 66   ? 173.233 110.767 198.339 1.00 221.20 ? 79   PHE A CD1 1 
ATOM   429   C CD2 . PHE A  1 66   ? 172.476 111.828 196.356 1.00 221.20 ? 79   PHE A CD2 1 
ATOM   430   C CE1 . PHE A  1 66   ? 174.515 110.739 197.835 1.00 221.20 ? 79   PHE A CE1 1 
ATOM   431   C CE2 . PHE A  1 66   ? 173.751 111.792 195.844 1.00 221.20 ? 79   PHE A CE2 1 
ATOM   432   C CZ  . PHE A  1 66   ? 174.773 111.255 196.587 1.00 221.20 ? 79   PHE A CZ  1 
ATOM   433   N N   . ASP A  1 67   ? 171.040 114.419 197.917 1.00 213.93 ? 80   ASP A N   1 
ATOM   434   C CA  . ASP A  1 67   ? 171.751 115.638 197.556 1.00 213.93 ? 80   ASP A CA  1 
ATOM   435   C C   . ASP A  1 67   ? 170.771 116.802 197.620 1.00 213.93 ? 80   ASP A C   1 
ATOM   436   O O   . ASP A  1 67   ? 169.697 116.746 197.013 1.00 213.93 ? 80   ASP A O   1 
ATOM   437   C CB  . ASP A  1 67   ? 172.382 115.516 196.163 1.00 213.93 ? 80   ASP A CB  1 
ATOM   438   C CG  . ASP A  1 67   ? 173.787 114.938 196.211 1.00 213.93 ? 80   ASP A CG  1 
ATOM   439   O OD1 . ASP A  1 67   ? 174.163 114.396 197.269 1.00 213.93 ? 80   ASP A OD1 1 
ATOM   440   O OD2 . ASP A  1 67   ? 174.514 115.016 195.198 1.00 213.93 ? 80   ASP A OD2 1 
ATOM   441   N N   . ASN A  1 68   ? 171.141 117.850 198.360 1.00 215.74 ? 81   ASN A N   1 
ATOM   442   C CA  . ASN A  1 68   ? 170.221 118.933 198.719 1.00 215.74 ? 81   ASN A CA  1 
ATOM   443   C C   . ASN A  1 68   ? 170.967 120.264 198.698 1.00 215.74 ? 81   ASN A C   1 
ATOM   444   O O   . ASN A  1 68   ? 171.432 120.753 199.734 1.00 215.74 ? 81   ASN A O   1 
ATOM   445   C CB  . ASN A  1 68   ? 169.604 118.662 200.092 1.00 215.74 ? 81   ASN A CB  1 
ATOM   446   C CG  . ASN A  1 68   ? 168.745 117.407 200.107 1.00 215.74 ? 81   ASN A CG  1 
ATOM   447   O OD1 . ASN A  1 68   ? 167.967 117.161 199.188 1.00 215.74 ? 81   ASN A OD1 1 
ATOM   448   N ND2 . ASN A  1 68   ? 168.901 116.598 201.146 1.00 215.74 ? 81   ASN A ND2 1 
ATOM   449   N N   . PRO A  1 69   ? 171.106 120.885 197.510 1.00 206.79 ? 82   PRO A N   1 
ATOM   450   C CA  . PRO A  1 69   ? 171.974 122.066 197.387 1.00 206.79 ? 82   PRO A CA  1 
ATOM   451   C C   . PRO A  1 69   ? 171.259 123.407 197.469 1.00 206.79 ? 82   PRO A C   1 
ATOM   452   O O   . PRO A  1 69   ? 170.071 123.504 197.170 1.00 206.79 ? 82   PRO A O   1 
ATOM   453   C CB  . PRO A  1 69   ? 172.588 121.876 195.997 1.00 206.79 ? 82   PRO A CB  1 
ATOM   454   C CG  . PRO A  1 69   ? 171.464 121.244 195.207 1.00 206.79 ? 82   PRO A CG  1 
ATOM   455   C CD  . PRO A  1 69   ? 170.645 120.411 196.192 1.00 206.79 ? 82   PRO A CD  1 
ATOM   456   N N   . VAL A  1 70   ? 171.998 124.466 197.785 1.00 194.07 ? 83   VAL A N   1 
ATOM   457   C CA  . VAL A  1 70   ? 171.431 125.808 197.806 1.00 194.07 ? 83   VAL A CA  1 
ATOM   458   C C   . VAL A  1 70   ? 172.172 126.660 196.782 1.00 194.07 ? 83   VAL A C   1 
ATOM   459   O O   . VAL A  1 70   ? 173.353 126.429 196.502 1.00 194.07 ? 83   VAL A O   1 
ATOM   460   C CB  . VAL A  1 70   ? 171.510 126.406 199.219 1.00 194.07 ? 83   VAL A CB  1 
ATOM   461   C CG1 . VAL A  1 70   ? 171.125 127.862 199.219 1.00 194.07 ? 83   VAL A CG1 1 
ATOM   462   C CG2 . VAL A  1 70   ? 170.629 125.630 200.155 1.00 194.07 ? 83   VAL A CG2 1 
ATOM   463   N N   . LEU A  1 71   ? 171.493 127.657 196.232 1.00 198.95 ? 84   LEU A N   1 
ATOM   464   C CA  . LEU A  1 71   ? 171.970 128.345 195.043 1.00 198.95 ? 84   LEU A CA  1 
ATOM   465   C C   . LEU A  1 71   ? 172.310 129.799 195.352 1.00 198.95 ? 84   LEU A C   1 
ATOM   466   O O   . LEU A  1 71   ? 171.802 130.363 196.329 1.00 198.95 ? 84   LEU A O   1 
ATOM   467   C CB  . LEU A  1 71   ? 170.910 128.261 193.940 1.00 198.95 ? 84   LEU A CB  1 
ATOM   468   C CG  . LEU A  1 71   ? 170.820 127.029 193.027 1.00 198.95 ? 84   LEU A CG  1 
ATOM   469   C CD1 . LEU A  1 71   ? 170.309 125.795 193.748 1.00 198.95 ? 84   LEU A CD1 1 
ATOM   470   C CD2 . LEU A  1 71   ? 169.910 127.342 191.859 1.00 198.95 ? 84   LEU A CD2 1 
ATOM   471   N N   . PRO A  1 72   ? 173.206 130.412 194.581 1.00 202.52 ? 85   PRO A N   1 
ATOM   472   C CA  . PRO A  1 72   ? 173.436 131.853 194.715 1.00 202.52 ? 85   PRO A CA  1 
ATOM   473   C C   . PRO A  1 72   ? 172.422 132.675 193.937 1.00 202.52 ? 85   PRO A C   1 
ATOM   474   O O   . PRO A  1 72   ? 171.876 132.245 192.920 1.00 202.52 ? 85   PRO A O   1 
ATOM   475   C CB  . PRO A  1 72   ? 174.847 132.045 194.145 1.00 202.52 ? 85   PRO A CB  1 
ATOM   476   C CG  . PRO A  1 72   ? 175.437 130.671 194.077 1.00 202.52 ? 85   PRO A CG  1 
ATOM   477   C CD  . PRO A  1 72   ? 174.283 129.762 193.825 1.00 202.52 ? 85   PRO A CD  1 
ATOM   478   N N   . PHE A  1 73   ? 172.203 133.894 194.425 1.00 191.97 ? 86   PHE A N   1 
ATOM   479   C CA  . PHE A  1 73   ? 171.204 134.787 193.851 1.00 191.97 ? 86   PHE A CA  1 
ATOM   480   C C   . PHE A  1 73   ? 171.634 135.296 192.484 1.00 191.97 ? 86   PHE A C   1 
ATOM   481   O O   . PHE A  1 73   ? 170.791 135.548 191.618 1.00 191.97 ? 86   PHE A O   1 
ATOM   482   C CB  . PHE A  1 73   ? 170.998 135.963 194.786 1.00 191.97 ? 86   PHE A CB  1 
ATOM   483   C CG  . PHE A  1 73   ? 172.135 136.915 194.757 1.00 191.97 ? 86   PHE A CG  1 
ATOM   484   C CD1 . PHE A  1 73   ? 173.402 136.500 195.123 1.00 191.97 ? 86   PHE A CD1 1 
ATOM   485   C CD2 . PHE A  1 73   ? 171.955 138.209 194.351 1.00 191.97 ? 86   PHE A CD2 1 
ATOM   486   C CE1 . PHE A  1 73   ? 174.464 137.354 195.080 1.00 191.97 ? 86   PHE A CE1 1 
ATOM   487   C CE2 . PHE A  1 73   ? 173.018 139.076 194.316 1.00 191.97 ? 86   PHE A CE2 1 
ATOM   488   C CZ  . PHE A  1 73   ? 174.275 138.646 194.681 1.00 191.97 ? 86   PHE A CZ  1 
ATOM   489   N N   . ASN A  1 74   ? 172.937 135.496 192.289 1.00 193.21 ? 87   ASN A N   1 
ATOM   490   C CA  . ASN A  1 74   ? 173.508 135.957 191.020 1.00 193.21 ? 87   ASN A CA  1 
ATOM   491   C C   . ASN A  1 74   ? 172.749 137.158 190.455 1.00 193.21 ? 87   ASN A C   1 
ATOM   492   O O   . ASN A  1 74   ? 172.392 137.194 189.279 1.00 193.21 ? 87   ASN A O   1 
ATOM   493   C CB  . ASN A  1 74   ? 173.562 134.824 189.997 1.00 193.21 ? 87   ASN A CB  1 
ATOM   494   C CG  . ASN A  1 74   ? 174.641 135.034 188.963 1.00 193.21 ? 87   ASN A CG  1 
ATOM   495   O OD1 . ASN A  1 74   ? 175.691 135.594 189.255 1.00 193.21 ? 87   ASN A OD1 1 
ATOM   496   N ND2 . ASN A  1 74   ? 174.391 134.588 187.752 1.00 193.21 ? 87   ASN A ND2 1 
ATOM   497   N N   . ASP A  1 75   ? 172.483 138.137 191.322 1.00 187.80 ? 88   ASP A N   1 
ATOM   498   C CA  . ASP A  1 75   ? 171.867 139.410 190.945 1.00 187.80 ? 88   ASP A CA  1 
ATOM   499   C C   . ASP A  1 75   ? 170.527 139.197 190.240 1.00 187.80 ? 88   ASP A C   1 
ATOM   500   O O   . ASP A  1 75   ? 170.337 139.564 189.084 1.00 187.80 ? 88   ASP A O   1 
ATOM   501   C CB  . ASP A  1 75   ? 172.817 140.235 190.072 1.00 187.80 ? 88   ASP A CB  1 
ATOM   502   C CG  . ASP A  1 75   ? 174.219 140.300 190.637 1.00 187.80 ? 88   ASP A CG  1 
ATOM   503   O OD1 . ASP A  1 75   ? 174.363 140.340 191.872 1.00 187.80 ? 88   ASP A OD1 1 
ATOM   504   O OD2 . ASP A  1 75   ? 175.184 140.310 189.849 1.00 187.80 ? 88   ASP A OD2 1 
ATOM   505   N N   . GLY A  1 76   ? 169.590 138.604 190.963 1.00 183.02 ? 89   GLY A N   1 
ATOM   506   C CA  . GLY A  1 76   ? 168.293 138.336 190.380 1.00 183.02 ? 89   GLY A CA  1 
ATOM   507   C C   . GLY A  1 76   ? 168.209 136.950 189.782 1.00 183.02 ? 89   GLY A C   1 
ATOM   508   O O   . GLY A  1 76   ? 169.096 136.529 189.036 1.00 183.02 ? 89   GLY A O   1 
ATOM   509   N N   . VAL A  1 77   ? 167.135 136.235 190.098 1.00 187.24 ? 90   VAL A N   1 
ATOM   510   C CA  . VAL A  1 77   ? 166.952 134.847 189.700 1.00 187.24 ? 90   VAL A CA  1 
ATOM   511   C C   . VAL A  1 77   ? 165.606 134.719 189.012 1.00 187.24 ? 90   VAL A C   1 
ATOM   512   O O   . VAL A  1 77   ? 164.588 135.160 189.553 1.00 187.24 ? 90   VAL A O   1 
ATOM   513   C CB  . VAL A  1 77   ? 167.015 133.895 190.908 1.00 187.24 ? 90   VAL A CB  1 
ATOM   514   C CG1 . VAL A  1 77   ? 166.461 132.537 190.542 1.00 187.24 ? 90   VAL A CG1 1 
ATOM   515   C CG2 . VAL A  1 77   ? 168.427 133.748 191.391 1.00 187.24 ? 90   VAL A CG2 1 
ATOM   516   N N   . TYR A  1 78   ? 165.597 134.115 187.831 1.00 186.92 ? 91   TYR A N   1 
ATOM   517   C CA  . TYR A  1 78   ? 164.366 133.812 187.127 1.00 186.92 ? 91   TYR A CA  1 
ATOM   518   C C   . TYR A  1 78   ? 164.022 132.335 187.270 1.00 186.92 ? 91   TYR A C   1 
ATOM   519   O O   . TYR A  1 78   ? 164.845 131.466 186.968 1.00 186.92 ? 91   TYR A O   1 
ATOM   520   C CB  . TYR A  1 78   ? 164.498 134.171 185.657 1.00 186.92 ? 91   TYR A CB  1 
ATOM   521   C CG  . TYR A  1 78   ? 163.364 133.621 184.886 1.00 186.92 ? 91   TYR A CG  1 
ATOM   522   C CD1 . TYR A  1 78   ? 162.086 134.089 185.097 1.00 186.92 ? 91   TYR A CD1 1 
ATOM   523   C CD2 . TYR A  1 78   ? 163.557 132.614 183.977 1.00 186.92 ? 91   TYR A CD2 1 
ATOM   524   C CE1 . TYR A  1 78   ? 161.033 133.583 184.413 1.00 186.92 ? 91   TYR A CE1 1 
ATOM   525   C CE2 . TYR A  1 78   ? 162.513 132.099 183.283 1.00 186.92 ? 91   TYR A CE2 1 
ATOM   526   C CZ  . TYR A  1 78   ? 161.252 132.586 183.504 1.00 186.92 ? 91   TYR A CZ  1 
ATOM   527   O OH  . TYR A  1 78   ? 160.202 132.066 182.801 1.00 186.92 ? 91   TYR A OH  1 
ATOM   528   N N   . PHE A  1 79   ? 162.789 132.058 187.708 1.00 193.32 ? 92   PHE A N   1 
ATOM   529   C CA  . PHE A  1 79   ? 162.361 130.733 188.155 1.00 193.32 ? 92   PHE A CA  1 
ATOM   530   C C   . PHE A  1 79   ? 160.995 130.360 187.580 1.00 193.32 ? 92   PHE A C   1 
ATOM   531   O O   . PHE A  1 79   ? 160.106 131.215 187.483 1.00 193.32 ? 92   PHE A O   1 
ATOM   532   C CB  . PHE A  1 79   ? 162.309 130.683 189.680 1.00 193.32 ? 92   PHE A CB  1 
ATOM   533   C CG  . PHE A  1 79   ? 161.342 129.697 190.197 1.00 193.32 ? 92   PHE A CG  1 
ATOM   534   C CD1 . PHE A  1 79   ? 161.656 128.361 190.224 1.00 193.32 ? 92   PHE A CD1 1 
ATOM   535   C CD2 . PHE A  1 79   ? 160.099 130.102 190.623 1.00 193.32 ? 92   PHE A CD2 1 
ATOM   536   C CE1 . PHE A  1 79   ? 160.753 127.444 190.686 1.00 193.32 ? 92   PHE A CE1 1 
ATOM   537   C CE2 . PHE A  1 79   ? 159.195 129.193 191.081 1.00 193.32 ? 92   PHE A CE2 1 
ATOM   538   C CZ  . PHE A  1 79   ? 159.520 127.859 191.117 1.00 193.32 ? 92   PHE A CZ  1 
ATOM   539   N N   . ALA A  1 80   ? 160.816 129.079 187.240 1.00 198.39 ? 93   ALA A N   1 
ATOM   540   C CA  . ALA A  1 80   ? 159.626 128.647 186.514 1.00 198.39 ? 93   ALA A CA  1 
ATOM   541   C C   . ALA A  1 80   ? 159.481 127.128 186.530 1.00 198.39 ? 93   ALA A C   1 
ATOM   542   O O   . ALA A  1 80   ? 160.452 126.394 186.750 1.00 198.39 ? 93   ALA A O   1 
ATOM   543   C CB  . ALA A  1 80   ? 159.667 129.138 185.066 1.00 198.39 ? 93   ALA A CB  1 
ATOM   544   N N   . SER A  1 81   ? 158.255 126.675 186.252 1.00 195.51 ? 94   SER A N   1 
ATOM   545   C CA  . SER A  1 81   ? 157.926 125.256 186.172 1.00 195.51 ? 94   SER A CA  1 
ATOM   546   C C   . SER A  1 81   ? 156.657 125.043 185.354 1.00 195.51 ? 94   SER A C   1 
ATOM   547   O O   . SER A  1 81   ? 155.716 125.836 185.428 1.00 195.51 ? 94   SER A O   1 
ATOM   548   C CB  . SER A  1 81   ? 157.752 124.650 187.564 1.00 195.51 ? 94   SER A CB  1 
ATOM   549   O OG  . SER A  1 81   ? 159.008 124.317 188.125 1.00 195.51 ? 94   SER A OG  1 
ATOM   550   N N   . THR A  1 82   ? 156.638 123.961 184.578 1.00 200.25 ? 95   THR A N   1 
ATOM   551   C CA  . THR A  1 82   ? 155.515 123.601 183.719 1.00 200.25 ? 95   THR A CA  1 
ATOM   552   C C   . THR A  1 82   ? 154.954 122.247 184.140 1.00 200.25 ? 95   THR A C   1 
ATOM   553   O O   . THR A  1 82   ? 155.605 121.216 183.954 1.00 200.25 ? 95   THR A O   1 
ATOM   554   C CB  . THR A  1 82   ? 155.948 123.586 182.245 1.00 200.25 ? 95   THR A CB  1 
ATOM   555   O OG1 . THR A  1 82   ? 154.864 123.146 181.420 1.00 200.25 ? 95   THR A OG1 1 
ATOM   556   C CG2 . THR A  1 82   ? 157.205 122.740 182.002 1.00 200.25 ? 95   THR A CG2 1 
ATOM   557   N N   . GLU A  1 83   ? 153.749 122.243 184.714 1.00 216.88 ? 96   GLU A N   1 
ATOM   558   C CA  . GLU A  1 83   ? 153.264 121.004 185.320 1.00 216.88 ? 96   GLU A CA  1 
ATOM   559   C C   . GLU A  1 83   ? 151.750 120.991 185.473 1.00 216.88 ? 96   GLU A C   1 
ATOM   560   O O   . GLU A  1 83   ? 151.048 121.760 184.818 1.00 216.88 ? 96   GLU A O   1 
ATOM   561   C CB  . GLU A  1 83   ? 153.927 120.797 186.683 1.00 216.88 ? 96   GLU A CB  1 
ATOM   562   C CG  . GLU A  1 83   ? 154.047 119.354 187.198 1.00 216.88 ? 96   GLU A CG  1 
ATOM   563   C CD  . GLU A  1 83   ? 153.016 119.007 188.277 1.00 216.88 ? 96   GLU A CD  1 
ATOM   564   O OE1 . GLU A  1 83   ? 152.377 119.922 188.833 1.00 216.88 ? 96   GLU A OE1 1 
ATOM   565   O OE2 . GLU A  1 83   ? 152.848 117.808 188.579 1.00 216.88 ? 96   GLU A OE2 1 
ATOM   566   N N   . LYS A  1 84   ? 151.237 120.076 186.291 1.00 213.41 ? 97   LYS A N   1 
ATOM   567   C CA  . LYS A  1 84   ? 149.881 120.106 186.807 1.00 213.41 ? 97   LYS A CA  1 
ATOM   568   C C   . LYS A  1 84   ? 149.751 121.322 187.726 1.00 213.41 ? 97   LYS A C   1 
ATOM   569   O O   . LYS A  1 84   ? 150.754 121.932 188.113 1.00 213.41 ? 97   LYS A O   1 
ATOM   570   C CB  . LYS A  1 84   ? 149.571 118.779 187.519 1.00 213.41 ? 97   LYS A CB  1 
ATOM   571   C CG  . LYS A  1 84   ? 148.177 118.701 188.123 1.00 213.41 ? 97   LYS A CG  1 
ATOM   572   C CD  . LYS A  1 84   ? 147.124 118.777 187.038 1.00 213.41 ? 97   LYS A CD  1 
ATOM   573   C CE  . LYS A  1 84   ? 145.726 118.940 187.600 1.00 213.41 ? 97   LYS A CE  1 
ATOM   574   N NZ  . LYS A  1 84   ? 145.466 120.342 188.006 1.00 213.41 ? 97   LYS A NZ  1 
ATOM   575   N N   . SER A  1 85   ? 148.522 121.679 188.088 1.00 212.19 ? 98   SER A N   1 
ATOM   576   C CA  . SER A  1 85   ? 148.296 122.856 188.912 1.00 212.19 ? 98   SER A CA  1 
ATOM   577   C C   . SER A  1 85   ? 149.071 122.823 190.227 1.00 212.19 ? 98   SER A C   1 
ATOM   578   O O   . SER A  1 85   ? 149.218 123.870 190.866 1.00 212.19 ? 98   SER A O   1 
ATOM   579   C CB  . SER A  1 85   ? 146.798 123.007 189.184 1.00 212.19 ? 98   SER A CB  1 
ATOM   580   O OG  . SER A  1 85   ? 146.042 122.749 188.012 1.00 212.19 ? 98   SER A OG  1 
ATOM   581   N N   . ASN A  1 86   ? 149.584 121.661 190.636 1.00 214.47 ? 99   ASN A N   1 
ATOM   582   C CA  . ASN A  1 86   ? 150.283 121.504 191.913 1.00 214.47 ? 99   ASN A CA  1 
ATOM   583   C C   . ASN A  1 86   ? 151.674 120.930 191.655 1.00 214.47 ? 99   ASN A C   1 
ATOM   584   O O   . ASN A  1 86   ? 151.858 119.710 191.665 1.00 214.47 ? 99   ASN A O   1 
ATOM   585   C CB  . ASN A  1 86   ? 149.489 120.616 192.870 1.00 214.47 ? 99   ASN A CB  1 
ATOM   586   C CG  . ASN A  1 86   ? 148.266 121.310 193.435 1.00 214.47 ? 99   ASN A CG  1 
ATOM   587   O OD1 . ASN A  1 86   ? 147.216 120.694 193.607 1.00 214.47 ? 99   ASN A OD1 1 
ATOM   588   N ND2 . ASN A  1 86   ? 148.387 122.602 193.701 1.00 214.47 ? 99   ASN A ND2 1 
ATOM   589   N N   . ILE A  1 87   ? 152.648 121.806 191.416 1.00 209.29 ? 100  ILE A N   1 
ATOM   590   C CA  . ILE A  1 87   ? 154.053 121.410 191.415 1.00 209.29 ? 100  ILE A CA  1 
ATOM   591   C C   . ILE A  1 87   ? 154.855 122.304 192.346 1.00 209.29 ? 100  ILE A C   1 
ATOM   592   O O   . ILE A  1 87   ? 155.612 121.817 193.192 1.00 209.29 ? 100  ILE A O   1 
ATOM   593   C CB  . ILE A  1 87   ? 154.658 121.427 190.004 1.00 209.29 ? 100  ILE A CB  1 
ATOM   594   C CG1 . ILE A  1 87   ? 156.098 120.918 190.051 1.00 209.29 ? 100  ILE A CG1 1 
ATOM   595   C CG2 . ILE A  1 87   ? 154.529 122.802 189.351 1.00 209.29 ? 100  ILE A CG2 1 
ATOM   596   C CD1 . ILE A  1 87   ? 156.215 119.484 190.484 1.00 209.29 ? 100  ILE A CD1 1 
ATOM   597   N N   . ILE A  1 88   ? 154.717 123.614 192.182 1.00 204.69 ? 101  ILE A N   1 
ATOM   598   C CA  . ILE A  1 88   ? 155.502 124.579 192.934 1.00 204.69 ? 101  ILE A CA  1 
ATOM   599   C C   . ILE A  1 88   ? 154.706 124.906 194.190 1.00 204.69 ? 101  ILE A C   1 
ATOM   600   O O   . ILE A  1 88   ? 153.639 125.513 194.129 1.00 204.69 ? 101  ILE A O   1 
ATOM   601   C CB  . ILE A  1 88   ? 155.813 125.822 192.104 1.00 204.69 ? 101  ILE A CB  1 
ATOM   602   C CG1 . ILE A  1 88   ? 156.596 125.424 190.857 1.00 204.69 ? 101  ILE A CG1 1 
ATOM   603   C CG2 . ILE A  1 88   ? 156.616 126.802 192.915 1.00 204.69 ? 101  ILE A CG2 1 
ATOM   604   C CD1 . ILE A  1 88   ? 157.759 124.510 191.148 1.00 204.69 ? 101  ILE A CD1 1 
ATOM   605   N N   . ARG A  1 89   ? 155.227 124.482 195.337 1.00 205.45 ? 102  ARG A N   1 
ATOM   606   C CA  . ARG A  1 89   ? 154.461 124.593 196.568 1.00 205.45 ? 102  ARG A CA  1 
ATOM   607   C C   . ARG A  1 89   ? 154.945 125.764 197.419 1.00 205.45 ? 102  ARG A C   1 
ATOM   608   O O   . ARG A  1 89   ? 154.144 126.593 197.863 1.00 205.45 ? 102  ARG A O   1 
ATOM   609   C CB  . ARG A  1 89   ? 154.541 123.276 197.341 1.00 205.45 ? 102  ARG A CB  1 
ATOM   610   C CG  . ARG A  1 89   ? 154.585 122.007 196.473 1.00 205.45 ? 102  ARG A CG  1 
ATOM   611   C CD  . ARG A  1 89   ? 153.487 121.931 195.422 1.00 205.45 ? 102  ARG A CD  1 
ATOM   612   N NE  . ARG A  1 89   ? 152.180 122.306 195.937 1.00 205.45 ? 102  ARG A NE  1 
ATOM   613   C CZ  . ARG A  1 89   ? 151.297 123.014 195.249 1.00 205.45 ? 102  ARG A CZ  1 
ATOM   614   N NH1 . ARG A  1 89   ? 151.598 123.431 194.031 1.00 205.45 ? 102  ARG A NH1 1 
ATOM   615   N NH2 . ARG A  1 89   ? 150.124 123.319 195.783 1.00 205.45 ? 102  ARG A NH2 1 
ATOM   616   N N   . GLY A  1 90   ? 156.254 125.857 197.646 1.00 196.54 ? 103  GLY A N   1 
ATOM   617   C CA  . GLY A  1 90   ? 156.773 126.904 198.505 1.00 196.54 ? 103  GLY A CA  1 
ATOM   618   C C   . GLY A  1 90   ? 158.123 127.481 198.125 1.00 196.54 ? 103  GLY A C   1 
ATOM   619   O O   . GLY A  1 90   ? 158.627 127.250 197.023 1.00 196.54 ? 103  GLY A O   1 
ATOM   620   N N   . TRP A  1 91   ? 158.707 128.259 199.037 1.00 194.30 ? 104  TRP A N   1 
ATOM   621   C CA  . TRP A  1 91   ? 160.008 128.878 198.831 1.00 194.30 ? 104  TRP A CA  1 
ATOM   622   C C   . TRP A  1 91   ? 160.667 129.131 200.180 1.00 194.30 ? 104  TRP A C   1 
ATOM   623   O O   . TRP A  1 91   ? 159.995 129.455 201.163 1.00 194.30 ? 104  TRP A O   1 
ATOM   624   C CB  . TRP A  1 91   ? 159.891 130.201 198.073 1.00 194.30 ? 104  TRP A CB  1 
ATOM   625   C CG  . TRP A  1 91   ? 159.599 130.054 196.643 1.00 194.30 ? 104  TRP A CG  1 
ATOM   626   C CD1 . TRP A  1 91   ? 160.481 129.759 195.665 1.00 194.30 ? 104  TRP A CD1 1 
ATOM   627   C CD2 . TRP A  1 91   ? 158.330 130.214 196.012 1.00 194.30 ? 104  TRP A CD2 1 
ATOM   628   N NE1 . TRP A  1 91   ? 159.843 129.713 194.454 1.00 194.30 ? 104  TRP A NE1 1 
ATOM   629   C CE2 . TRP A  1 91   ? 158.517 129.991 194.643 1.00 194.30 ? 104  TRP A CE2 1 
ATOM   630   C CE3 . TRP A  1 91   ? 157.051 130.522 196.474 1.00 194.30 ? 104  TRP A CE3 1 
ATOM   631   C CZ2 . TRP A  1 91   ? 157.476 130.065 193.728 1.00 194.30 ? 104  TRP A CZ2 1 
ATOM   632   C CZ3 . TRP A  1 91   ? 156.018 130.595 195.564 1.00 194.30 ? 104  TRP A CZ3 1 
ATOM   633   C CH2 . TRP A  1 91   ? 156.236 130.367 194.208 1.00 194.30 ? 104  TRP A CH2 1 
ATOM   634   N N   . ILE A  1 92   ? 161.994 129.006 200.208 1.00 193.43 ? 105  ILE A N   1 
ATOM   635   C CA  . ILE A  1 92   ? 162.802 129.281 201.395 1.00 193.43 ? 105  ILE A CA  1 
ATOM   636   C C   . ILE A  1 92   ? 163.994 130.107 200.929 1.00 193.43 ? 105  ILE A C   1 
ATOM   637   O O   . ILE A  1 92   ? 164.727 129.682 200.030 1.00 193.43 ? 105  ILE A O   1 
ATOM   638   C CB  . ILE A  1 92   ? 163.278 128.000 202.095 1.00 193.43 ? 105  ILE A CB  1 
ATOM   639   C CG1 . ILE A  1 92   ? 162.086 127.134 202.489 1.00 193.43 ? 105  ILE A CG1 1 
ATOM   640   C CG2 . ILE A  1 92   ? 164.115 128.339 203.318 1.00 193.43 ? 105  ILE A CG2 1 
ATOM   641   C CD1 . ILE A  1 92   ? 161.183 127.789 203.484 1.00 193.43 ? 105  ILE A CD1 1 
ATOM   642   N N   . PHE A  1 93   ? 164.177 131.292 201.507 1.00 196.51 ? 106  PHE A N   1 
ATOM   643   C CA  . PHE A  1 93   ? 165.236 132.198 201.087 1.00 196.51 ? 106  PHE A CA  1 
ATOM   644   C C   . PHE A  1 93   ? 165.968 132.730 202.310 1.00 196.51 ? 106  PHE A C   1 
ATOM   645   O O   . PHE A  1 93   ? 165.390 132.819 203.394 1.00 196.51 ? 106  PHE A O   1 
ATOM   646   C CB  . PHE A  1 93   ? 164.662 133.365 200.278 1.00 196.51 ? 106  PHE A CB  1 
ATOM   647   C CG  . PHE A  1 93   ? 164.202 132.990 198.897 1.00 196.51 ? 106  PHE A CG  1 
ATOM   648   C CD1 . PHE A  1 93   ? 163.107 132.170 198.710 1.00 196.51 ? 106  PHE A CD1 1 
ATOM   649   C CD2 . PHE A  1 93   ? 164.851 133.485 197.786 1.00 196.51 ? 106  PHE A CD2 1 
ATOM   650   C CE1 . PHE A  1 93   ? 162.689 131.833 197.449 1.00 196.51 ? 106  PHE A CE1 1 
ATOM   651   C CE2 . PHE A  1 93   ? 164.429 133.151 196.526 1.00 196.51 ? 106  PHE A CE2 1 
ATOM   652   C CZ  . PHE A  1 93   ? 163.345 132.324 196.358 1.00 196.51 ? 106  PHE A CZ  1 
ATOM   653   N N   . GLY A  1 94   ? 167.230 133.100 202.143 1.00 199.37 ? 107  GLY A N   1 
ATOM   654   C CA  . GLY A  1 94   ? 167.948 133.707 203.246 1.00 199.37 ? 107  GLY A CA  1 
ATOM   655   C C   . GLY A  1 94   ? 169.441 133.710 203.029 1.00 199.37 ? 107  GLY A C   1 
ATOM   656   O O   . GLY A  1 94   ? 169.919 133.891 201.910 1.00 199.37 ? 107  GLY A O   1 
ATOM   657   N N   . THR A  1 95   ? 170.171 133.606 204.139 1.00 198.38 ? 108  THR A N   1 
ATOM   658   C CA  . THR A  1 95   ? 171.617 133.403 204.195 1.00 198.38 ? 108  THR A CA  1 
ATOM   659   C C   . THR A  1 95   ? 172.048 132.281 205.133 1.00 198.38 ? 108  THR A C   1 
ATOM   660   O O   . THR A  1 95   ? 172.937 131.508 204.772 1.00 198.38 ? 108  THR A O   1 
ATOM   661   C CB  . THR A  1 95   ? 172.317 134.709 204.595 1.00 198.38 ? 108  THR A CB  1 
ATOM   662   O OG1 . THR A  1 95   ? 173.724 134.481 204.731 1.00 198.38 ? 108  THR A OG1 1 
ATOM   663   C CG2 . THR A  1 95   ? 171.747 135.249 205.884 1.00 198.38 ? 108  THR A CG2 1 
ATOM   664   N N   . THR A  1 96   ? 171.448 132.176 206.327 1.00 197.43 ? 109  THR A N   1 
ATOM   665   C CA  . THR A  1 96   ? 171.844 131.175 207.317 1.00 197.43 ? 109  THR A CA  1 
ATOM   666   C C   . THR A  1 96   ? 170.661 130.482 207.976 1.00 197.43 ? 109  THR A C   1 
ATOM   667   O O   . THR A  1 96   ? 170.779 129.335 208.414 1.00 197.43 ? 109  THR A O   1 
ATOM   668   C CB  . THR A  1 96   ? 172.716 131.797 208.408 1.00 197.43 ? 109  THR A CB  1 
ATOM   669   O OG1 . THR A  1 96   ? 173.236 130.757 209.243 1.00 197.43 ? 109  THR A OG1 1 
ATOM   670   C CG2 . THR A  1 96   ? 171.912 132.760 209.260 1.00 197.43 ? 109  THR A CG2 1 
ATOM   671   N N   . LEU A  1 97   ? 169.527 131.170 208.066 1.00 188.18 ? 110  LEU A N   1 
ATOM   672   C CA  . LEU A  1 97   ? 168.312 130.585 208.608 1.00 188.18 ? 110  LEU A CA  1 
ATOM   673   C C   . LEU A  1 97   ? 168.543 130.102 210.044 1.00 188.18 ? 110  LEU A C   1 
ATOM   674   O O   . LEU A  1 97   ? 168.688 128.908 210.311 1.00 188.18 ? 110  LEU A O   1 
ATOM   675   C CB  . LEU A  1 97   ? 167.826 129.456 207.698 1.00 188.18 ? 110  LEU A CB  1 
ATOM   676   C CG  . LEU A  1 97   ? 166.696 128.538 208.147 1.00 188.18 ? 110  LEU A CG  1 
ATOM   677   C CD1 . LEU A  1 97   ? 165.473 129.356 208.502 1.00 188.18 ? 110  LEU A CD1 1 
ATOM   678   C CD2 . LEU A  1 97   ? 166.372 127.536 207.062 1.00 188.18 ? 110  LEU A CD2 1 
ATOM   679   N N   . ASP A  1 98   ? 168.648 131.068 210.967 1.00 190.23 ? 111  ASP A N   1 
ATOM   680   C CA  . ASP A  1 98   ? 168.851 130.769 212.388 1.00 190.23 ? 111  ASP A CA  1 
ATOM   681   C C   . ASP A  1 98   ? 168.144 131.778 213.288 1.00 190.23 ? 111  ASP A C   1 
ATOM   682   O O   . ASP A  1 98   ? 167.246 132.499 212.842 1.00 190.23 ? 111  ASP A O   1 
ATOM   683   C CB  . ASP A  1 98   ? 170.349 130.736 212.714 1.00 190.23 ? 111  ASP A CB  1 
ATOM   684   C CG  . ASP A  1 98   ? 170.684 129.821 213.882 1.00 190.23 ? 111  ASP A CG  1 
ATOM   685   O OD1 . ASP A  1 98   ? 170.076 128.736 213.996 1.00 190.23 ? 111  ASP A OD1 1 
ATOM   686   O OD2 . ASP A  1 98   ? 171.583 130.183 214.666 1.00 190.23 ? 111  ASP A OD2 1 
ATOM   687   N N   . SER A  1 99   ? 168.532 131.819 214.563 1.00 188.16 ? 112  SER A N   1 
ATOM   688   C CA  . SER A  1 99   ? 168.044 132.811 215.514 1.00 188.16 ? 112  SER A CA  1 
ATOM   689   C C   . SER A  1 99   ? 168.935 134.047 215.591 1.00 188.16 ? 112  SER A C   1 
ATOM   690   O O   . SER A  1 99   ? 168.862 134.787 216.579 1.00 188.16 ? 112  SER A O   1 
ATOM   691   C CB  . SER A  1 99   ? 167.904 132.196 216.910 1.00 188.16 ? 112  SER A CB  1 
ATOM   692   O OG  . SER A  1 99   ? 167.240 133.088 217.786 1.00 188.16 ? 112  SER A OG  1 
ATOM   693   N N   . LYS A  1 100  ? 169.783 134.272 214.586 1.00 192.89 ? 113  LYS A N   1 
ATOM   694   C CA  . LYS A  1 100  ? 170.627 135.461 214.504 1.00 192.89 ? 113  LYS A CA  1 
ATOM   695   C C   . LYS A  1 100  ? 170.315 136.320 213.280 1.00 192.89 ? 113  LYS A C   1 
ATOM   696   O O   . LYS A  1 100  ? 169.990 137.501 213.427 1.00 192.89 ? 113  LYS A O   1 
ATOM   697   C CB  . LYS A  1 100  ? 172.108 135.056 214.507 1.00 192.89 ? 113  LYS A CB  1 
ATOM   698   C CG  . LYS A  1 100  ? 173.085 136.223 214.484 1.00 192.89 ? 113  LYS A CG  1 
ATOM   699   C CD  . LYS A  1 100  ? 173.025 137.033 215.759 1.00 192.89 ? 113  LYS A CD  1 
ATOM   700   C CE  . LYS A  1 100  ? 173.582 138.430 215.563 1.00 192.89 ? 113  LYS A CE  1 
ATOM   701   N NZ  . LYS A  1 100  ? 172.541 139.375 215.109 1.00 192.89 ? 113  LYS A NZ  1 
ATOM   702   N N   . THR A  1 101  ? 170.385 135.754 212.073 1.00 200.24 ? 114  THR A N   1 
ATOM   703   C CA  . THR A  1 101  ? 170.127 136.495 210.842 1.00 200.24 ? 114  THR A CA  1 
ATOM   704   C C   . THR A  1 101  ? 168.813 136.029 210.229 1.00 200.24 ? 114  THR A C   1 
ATOM   705   O O   . THR A  1 101  ? 168.507 134.832 210.230 1.00 200.24 ? 114  THR A O   1 
ATOM   706   C CB  . THR A  1 101  ? 171.259 136.319 209.821 1.00 200.24 ? 114  THR A CB  1 
ATOM   707   O OG1 . THR A  1 101  ? 172.505 136.702 210.410 1.00 200.24 ? 114  THR A OG1 1 
ATOM   708   C CG2 . THR A  1 101  ? 171.019 137.212 208.615 1.00 200.24 ? 114  THR A CG2 1 
ATOM   709   N N   . GLN A  1 102  ? 168.037 136.980 209.710 1.00 197.24 ? 115  GLN A N   1 
ATOM   710   C CA  . GLN A  1 102  ? 166.688 136.691 209.253 1.00 197.24 ? 115  GLN A CA  1 
ATOM   711   C C   . GLN A  1 102  ? 166.696 136.025 207.883 1.00 197.24 ? 115  GLN A C   1 
ATOM   712   O O   . GLN A  1 102  ? 167.658 136.089 207.116 1.00 197.24 ? 115  GLN A O   1 
ATOM   713   C CB  . GLN A  1 102  ? 165.836 137.960 209.205 1.00 197.24 ? 115  GLN A CB  1 
ATOM   714   N N   . SER A  1 103  ? 165.574 135.385 207.591 1.00 190.24 ? 116  SER A N   1 
ATOM   715   C CA  . SER A  1 103  ? 165.369 134.660 206.358 1.00 190.24 ? 116  SER A CA  1 
ATOM   716   C C   . SER A  1 103  ? 163.950 134.969 205.919 1.00 190.24 ? 116  SER A C   1 
ATOM   717   O O   . SER A  1 103  ? 163.301 135.881 206.440 1.00 190.24 ? 116  SER A O   1 
ATOM   718   C CB  . SER A  1 103  ? 165.585 133.161 206.563 1.00 190.24 ? 116  SER A CB  1 
ATOM   719   O OG  . SER A  1 103  ? 164.358 132.554 206.925 1.00 190.24 ? 116  SER A OG  1 
ATOM   720   N N   . LEU A  1 104  ? 163.444 134.194 204.980 1.00 194.55 ? 117  LEU A N   1 
ATOM   721   C CA  . LEU A  1 104  ? 162.105 134.426 204.488 1.00 194.55 ? 117  LEU A CA  1 
ATOM   722   C C   . LEU A  1 104  ? 161.487 133.118 204.042 1.00 194.55 ? 117  LEU A C   1 
ATOM   723   O O   . LEU A  1 104  ? 162.144 132.291 203.401 1.00 194.55 ? 117  LEU A O   1 
ATOM   724   C CB  . LEU A  1 104  ? 162.101 135.420 203.337 1.00 194.55 ? 117  LEU A CB  1 
ATOM   725   C CG  . LEU A  1 104  ? 160.743 136.086 203.178 1.00 194.55 ? 117  LEU A CG  1 
ATOM   726   C CD1 . LEU A  1 104  ? 160.197 136.401 204.544 1.00 194.55 ? 117  LEU A CD1 1 
ATOM   727   C CD2 . LEU A  1 104  ? 160.875 137.355 202.369 1.00 194.55 ? 117  LEU A CD2 1 
ATOM   728   N N   . LEU A  1 105  ? 160.215 132.947 204.383 1.00 202.35 ? 118  LEU A N   1 
ATOM   729   C CA  . LEU A  1 105  ? 159.478 131.734 204.086 1.00 202.35 ? 118  LEU A CA  1 
ATOM   730   C C   . LEU A  1 105  ? 158.157 132.151 203.465 1.00 202.35 ? 118  LEU A C   1 
ATOM   731   O O   . LEU A  1 105  ? 157.662 133.243 203.750 1.00 202.35 ? 118  LEU A O   1 
ATOM   732   C CB  . LEU A  1 105  ? 159.240 130.916 205.362 1.00 202.35 ? 118  LEU A CB  1 
ATOM   733   C CG  . LEU A  1 105  ? 160.395 130.264 206.136 1.00 202.35 ? 118  LEU A CG  1 
ATOM   734   C CD1 . LEU A  1 105  ? 161.366 131.272 206.729 1.00 202.35 ? 118  LEU A CD1 1 
ATOM   735   C CD2 . LEU A  1 105  ? 159.837 129.380 207.242 1.00 202.35 ? 118  LEU A CD2 1 
ATOM   736   N N   . ILE A  1 106  ? 157.587 131.300 202.618 1.00 207.93 ? 119  ILE A N   1 
ATOM   737   C CA  . ILE A  1 106  ? 156.276 131.547 202.029 1.00 207.93 ? 119  ILE A CA  1 
ATOM   738   C C   . ILE A  1 106  ? 155.480 130.255 202.093 1.00 207.93 ? 119  ILE A C   1 
ATOM   739   O O   . ILE A  1 106  ? 155.712 129.344 201.289 1.00 207.93 ? 119  ILE A O   1 
ATOM   740   C CB  . ILE A  1 106  ? 156.383 132.044 200.584 1.00 207.93 ? 119  ILE A CB  1 
ATOM   741   C CG1 . ILE A  1 106  ? 157.064 133.407 200.553 1.00 207.93 ? 119  ILE A CG1 1 
ATOM   742   C CG2 . ILE A  1 106  ? 155.006 132.108 199.954 1.00 207.93 ? 119  ILE A CG2 1 
ATOM   743   C CD1 . ILE A  1 106  ? 158.558 133.336 200.368 1.00 207.93 ? 119  ILE A CD1 1 
ATOM   744   N N   . VAL A  1 107  ? 154.534 130.178 203.034 1.00 215.63 ? 120  VAL A N   1 
ATOM   745   C CA  . VAL A  1 107  ? 153.823 128.932 203.304 1.00 215.63 ? 120  VAL A CA  1 
ATOM   746   C C   . VAL A  1 107  ? 152.331 129.194 203.449 1.00 215.63 ? 120  VAL A C   1 
ATOM   747   O O   . VAL A  1 107  ? 151.902 130.240 203.940 1.00 215.63 ? 120  VAL A O   1 
ATOM   748   C CB  . VAL A  1 107  ? 154.363 128.211 204.559 1.00 215.63 ? 120  VAL A CB  1 
ATOM   749   C CG1 . VAL A  1 107  ? 153.595 126.922 204.815 1.00 215.63 ? 120  VAL A CG1 1 
ATOM   750   C CG2 . VAL A  1 107  ? 155.839 127.904 204.400 1.00 215.63 ? 120  VAL A CG2 1 
ATOM   751   N N   . ASN A  1 108  ? 151.543 128.225 202.996 1.00 224.40 ? 121  ASN A N   1 
ATOM   752   C CA  . ASN A  1 108  ? 150.090 128.242 203.058 1.00 224.40 ? 121  ASN A CA  1 
ATOM   753   C C   . ASN A  1 108  ? 149.653 127.150 204.020 1.00 224.40 ? 121  ASN A C   1 
ATOM   754   O O   . ASN A  1 108  ? 150.276 126.085 204.076 1.00 224.40 ? 121  ASN A O   1 
ATOM   755   C CB  . ASN A  1 108  ? 149.486 128.008 201.661 1.00 224.40 ? 121  ASN A CB  1 
ATOM   756   C CG  . ASN A  1 108  ? 147.981 128.248 201.604 1.00 224.40 ? 121  ASN A CG  1 
ATOM   757   O OD1 . ASN A  1 108  ? 147.317 128.413 202.630 1.00 224.40 ? 121  ASN A OD1 1 
ATOM   758   N ND2 . ASN A  1 108  ? 147.434 128.251 200.389 1.00 224.40 ? 121  ASN A ND2 1 
ATOM   759   N N   . ASN A  1 109  ? 148.608 127.423 204.794 1.00 232.56 ? 122  ASN A N   1 
ATOM   760   C CA  . ASN A  1 109  ? 147.946 126.392 205.588 1.00 232.56 ? 122  ASN A CA  1 
ATOM   761   C C   . ASN A  1 109  ? 146.644 125.946 204.938 1.00 232.56 ? 122  ASN A C   1 
ATOM   762   O O   . ASN A  1 109  ? 145.639 125.718 205.616 1.00 232.56 ? 122  ASN A O   1 
ATOM   763   C CB  . ASN A  1 109  ? 147.717 126.876 207.013 1.00 232.56 ? 122  ASN A CB  1 
ATOM   764   C CG  . ASN A  1 109  ? 147.006 128.204 207.076 1.00 232.56 ? 122  ASN A CG  1 
ATOM   765   O OD1 . ASN A  1 109  ? 146.813 128.876 206.059 1.00 232.56 ? 122  ASN A OD1 1 
ATOM   766   N ND2 . ASN A  1 109  ? 146.616 128.598 208.284 1.00 232.56 ? 122  ASN A ND2 1 
ATOM   767   N N   . ALA A  1 110  ? 146.644 125.857 203.607 1.00 224.55 ? 123  ALA A N   1 
ATOM   768   C CA  . ALA A  1 110  ? 145.541 125.433 202.749 1.00 224.55 ? 123  ALA A CA  1 
ATOM   769   C C   . ALA A  1 110  ? 144.394 126.423 202.755 1.00 224.55 ? 123  ALA A C   1 
ATOM   770   O O   . ALA A  1 110  ? 143.402 126.204 202.059 1.00 224.55 ? 123  ALA A O   1 
ATOM   771   C CB  . ALA A  1 110  ? 145.001 124.043 203.112 1.00 224.55 ? 123  ALA A CB  1 
ATOM   772   N N   . THR A  1 111  ? 144.481 127.491 203.535 1.00 222.04 ? 124  THR A N   1 
ATOM   773   C CA  . THR A  1 111  ? 143.502 128.562 203.446 1.00 222.04 ? 124  THR A CA  1 
ATOM   774   C C   . THR A  1 111  ? 144.118 129.950 203.500 1.00 222.04 ? 124  THR A C   1 
ATOM   775   O O   . THR A  1 111  ? 143.475 130.905 203.055 1.00 222.04 ? 124  THR A O   1 
ATOM   776   C CB  . THR A  1 111  ? 142.458 128.404 204.556 1.00 222.04 ? 124  THR A CB  1 
ATOM   777   O OG1 . THR A  1 111  ? 141.867 127.104 204.439 1.00 222.04 ? 124  THR A OG1 1 
ATOM   778   C CG2 . THR A  1 111  ? 141.346 129.437 204.433 1.00 222.04 ? 124  THR A CG2 1 
ATOM   779   N N   . ASN A  1 112  ? 145.354 130.107 203.964 1.00 225.36 ? 125  ASN A N   1 
ATOM   780   C CA  . ASN A  1 112  ? 146.010 131.409 203.937 1.00 225.36 ? 125  ASN A CA  1 
ATOM   781   C C   . ASN A  1 112  ? 147.455 131.223 203.496 1.00 225.36 ? 125  ASN A C   1 
ATOM   782   O O   . ASN A  1 112  ? 148.278 130.704 204.256 1.00 225.36 ? 125  ASN A O   1 
ATOM   783   C CB  . ASN A  1 112  ? 145.929 132.101 205.294 1.00 225.36 ? 125  ASN A CB  1 
ATOM   784   C CG  . ASN A  1 112  ? 144.615 132.831 205.492 1.00 225.36 ? 125  ASN A CG  1 
ATOM   785   O OD1 . ASN A  1 112  ? 143.965 133.235 204.530 1.00 225.36 ? 125  ASN A OD1 1 
ATOM   786   N ND2 . ASN A  1 112  ? 144.228 133.022 206.742 1.00 225.36 ? 125  ASN A ND2 1 
ATOM   787   N N   . VAL A  1 113  ? 147.749 131.633 202.259 1.00 210.86 ? 126  VAL A N   1 
ATOM   788   C CA  . VAL A  1 113  ? 149.102 131.631 201.712 1.00 210.86 ? 126  VAL A CA  1 
ATOM   789   C C   . VAL A  1 113  ? 149.853 132.862 202.205 1.00 210.86 ? 126  VAL A C   1 
ATOM   790   O O   . VAL A  1 113  ? 149.786 133.943 201.609 1.00 210.86 ? 126  VAL A O   1 
ATOM   791   C CB  . VAL A  1 113  ? 149.082 131.538 200.171 1.00 210.86 ? 126  VAL A CB  1 
ATOM   792   C CG1 . VAL A  1 113  ? 148.171 132.604 199.550 1.00 210.86 ? 126  VAL A CG1 1 
ATOM   793   C CG2 . VAL A  1 113  ? 150.500 131.646 199.618 1.00 210.86 ? 126  VAL A CG2 1 
ATOM   794   N N   . VAL A  1 114  ? 150.578 132.701 203.306 1.00 208.25 ? 127  VAL A N   1 
ATOM   795   C CA  . VAL A  1 114  ? 151.196 133.808 204.008 1.00 208.25 ? 127  VAL A CA  1 
ATOM   796   C C   . VAL A  1 114  ? 152.699 133.754 203.775 1.00 208.25 ? 127  VAL A C   1 
ATOM   797   O O   . VAL A  1 114  ? 153.237 132.795 203.220 1.00 208.25 ? 127  VAL A O   1 
ATOM   798   C CB  . VAL A  1 114  ? 150.875 133.780 205.512 1.00 208.25 ? 127  VAL A CB  1 
ATOM   799   C CG1 . VAL A  1 114  ? 149.429 134.183 205.758 1.00 208.25 ? 127  VAL A CG1 1 
ATOM   800   C CG2 . VAL A  1 114  ? 151.137 132.396 206.061 1.00 208.25 ? 127  VAL A CG2 1 
ATOM   801   N N   . ILE A  1 115  ? 153.373 134.808 204.221 1.00 197.07 ? 128  ILE A N   1 
ATOM   802   C CA  . ILE A  1 115  ? 154.814 134.947 204.091 1.00 197.07 ? 128  ILE A CA  1 
ATOM   803   C C   . ILE A  1 115  ? 155.384 135.188 205.482 1.00 197.07 ? 128  ILE A C   1 
ATOM   804   O O   . ILE A  1 115  ? 155.105 136.221 206.105 1.00 197.07 ? 128  ILE A O   1 
ATOM   805   C CB  . ILE A  1 115  ? 155.195 136.079 203.127 1.00 197.07 ? 128  ILE A CB  1 
ATOM   806   C CG1 . ILE A  1 115  ? 154.683 135.755 201.724 1.00 197.07 ? 128  ILE A CG1 1 
ATOM   807   C CG2 . ILE A  1 115  ? 156.695 136.249 203.092 1.00 197.07 ? 128  ILE A CG2 1 
ATOM   808   C CD1 . ILE A  1 115  ? 153.273 136.220 201.438 1.00 197.07 ? 128  ILE A CD1 1 
ATOM   809   N N   . LYS A  1 116  ? 156.166 134.231 205.968 1.00 191.00 ? 129  LYS A N   1 
ATOM   810   C CA  . LYS A  1 116  ? 156.696 134.239 207.323 1.00 191.00 ? 129  LYS A CA  1 
ATOM   811   C C   . LYS A  1 116  ? 158.070 134.884 207.334 1.00 191.00 ? 129  LYS A C   1 
ATOM   812   O O   . LYS A  1 116  ? 158.974 134.454 206.607 1.00 191.00 ? 129  LYS A O   1 
ATOM   813   C CB  . LYS A  1 116  ? 156.784 132.820 207.877 1.00 191.00 ? 129  LYS A CB  1 
ATOM   814   C CG  . LYS A  1 116  ? 155.440 132.136 208.063 1.00 191.00 ? 129  LYS A CG  1 
ATOM   815   C CD  . LYS A  1 116  ? 154.375 133.106 208.547 1.00 191.00 ? 129  LYS A CD  1 
ATOM   816   C CE  . LYS A  1 116  ? 153.141 132.378 209.075 1.00 191.00 ? 129  LYS A CE  1 
ATOM   817   N NZ  . LYS A  1 116  ? 152.151 133.302 209.705 1.00 191.00 ? 129  LYS A NZ  1 
ATOM   818   N N   . VAL A  1 117  ? 158.228 135.898 208.174 1.00 180.38 ? 130  VAL A N   1 
ATOM   819   C CA  . VAL A  1 117  ? 159.467 136.654 208.214 1.00 180.38 ? 130  VAL A CA  1 
ATOM   820   C C   . VAL A  1 117  ? 160.164 136.563 209.555 1.00 180.38 ? 130  VAL A C   1 
ATOM   821   O O   . VAL A  1 117  ? 161.374 136.836 209.620 1.00 180.38 ? 130  VAL A O   1 
ATOM   822   C CB  . VAL A  1 117  ? 159.210 138.130 207.866 1.00 180.38 ? 130  VAL A CB  1 
ATOM   823   C CG1 . VAL A  1 117  ? 160.503 138.827 207.520 1.00 180.38 ? 130  VAL A CG1 1 
ATOM   824   C CG2 . VAL A  1 117  ? 158.162 138.250 206.791 1.00 180.38 ? 130  VAL A CG2 1 
ATOM   825   N N   . CYS A  1 118  ? 159.458 136.182 210.620 1.00 172.58 ? 131  CYS A N   1 
ATOM   826   C CA  . CYS A  1 118  ? 160.003 136.248 211.968 1.00 172.58 ? 131  CYS A CA  1 
ATOM   827   C C   . CYS A  1 118  ? 161.289 135.441 212.079 1.00 172.58 ? 131  CYS A C   1 
ATOM   828   O O   . CYS A  1 118  ? 161.552 134.518 211.305 1.00 172.58 ? 131  CYS A O   1 
ATOM   829   C CB  . CYS A  1 118  ? 158.983 135.751 212.992 1.00 172.58 ? 131  CYS A CB  1 
ATOM   830   S SG  . CYS A  1 118  ? 157.675 136.925 213.326 1.00 172.58 ? 131  CYS A SG  1 
ATOM   831   N N   . GLU A  1 119  ? 162.093 135.796 213.071 1.00 175.37 ? 132  GLU A N   1 
ATOM   832   C CA  . GLU A  1 119  ? 163.437 135.257 213.159 1.00 175.37 ? 132  GLU A CA  1 
ATOM   833   C C   . GLU A  1 119  ? 163.368 133.781 213.509 1.00 175.37 ? 132  GLU A C   1 
ATOM   834   O O   . GLU A  1 119  ? 163.647 133.392 214.645 1.00 175.37 ? 132  GLU A O   1 
ATOM   835   C CB  . GLU A  1 119  ? 164.234 136.025 214.203 1.00 175.37 ? 132  GLU A CB  1 
ATOM   836   C CG  . GLU A  1 119  ? 165.719 135.812 214.140 1.00 175.37 ? 132  GLU A CG  1 
ATOM   837   C CD  . GLU A  1 119  ? 166.413 136.878 213.345 1.00 175.37 ? 132  GLU A CD  1 
ATOM   838   O OE1 . GLU A  1 119  ? 165.955 138.037 213.374 1.00 175.37 ? 132  GLU A OE1 1 
ATOM   839   O OE2 . GLU A  1 119  ? 167.424 136.558 212.700 1.00 175.37 ? 132  GLU A OE2 1 
ATOM   840   N N   . PHE A  1 120  ? 162.983 132.953 212.547 1.00 172.16 ? 133  PHE A N   1 
ATOM   841   C CA  . PHE A  1 120  ? 162.740 131.545 212.806 1.00 172.16 ? 133  PHE A CA  1 
ATOM   842   C C   . PHE A  1 120  ? 163.995 130.720 212.551 1.00 172.16 ? 133  PHE A C   1 
ATOM   843   O O   . PHE A  1 120  ? 164.880 131.129 211.796 1.00 172.16 ? 133  PHE A O   1 
ATOM   844   C CB  . PHE A  1 120  ? 161.588 131.038 211.940 1.00 172.16 ? 133  PHE A CB  1 
ATOM   845   C CG  . PHE A  1 120  ? 160.225 131.396 212.471 1.00 172.16 ? 133  PHE A CG  1 
ATOM   846   C CD1 . PHE A  1 120  ? 159.731 130.782 213.599 1.00 172.16 ? 133  PHE A CD1 1 
ATOM   847   C CD2 . PHE A  1 120  ? 159.434 132.331 211.836 1.00 172.16 ? 133  PHE A CD2 1 
ATOM   848   C CE1 . PHE A  1 120  ? 158.480 131.092 214.096 1.00 172.16 ? 133  PHE A CE1 1 
ATOM   849   C CE2 . PHE A  1 120  ? 158.179 132.639 212.327 1.00 172.16 ? 133  PHE A CE2 1 
ATOM   850   C CZ  . PHE A  1 120  ? 157.706 132.022 213.461 1.00 172.16 ? 133  PHE A CZ  1 
ATOM   851   N N   . GLN A  1 121  ? 164.074 129.565 213.209 1.00 173.68 ? 134  GLN A N   1 
ATOM   852   C CA  . GLN A  1 121  ? 165.182 128.646 213.006 1.00 173.68 ? 134  GLN A CA  1 
ATOM   853   C C   . GLN A  1 121  ? 164.933 127.792 211.763 1.00 173.68 ? 134  GLN A C   1 
ATOM   854   O O   . GLN A  1 121  ? 163.996 128.020 210.993 1.00 173.68 ? 134  GLN A O   1 
ATOM   855   C CB  . GLN A  1 121  ? 165.382 127.767 214.240 1.00 173.68 ? 134  GLN A CB  1 
ATOM   856   C CG  . GLN A  1 121  ? 166.041 128.457 215.437 1.00 173.68 ? 134  GLN A CG  1 
ATOM   857   C CD  . GLN A  1 121  ? 165.040 129.111 216.372 1.00 173.68 ? 134  GLN A CD  1 
ATOM   858   O OE1 . GLN A  1 121  ? 163.841 128.865 216.277 1.00 173.68 ? 134  GLN A OE1 1 
ATOM   859   N NE2 . GLN A  1 121  ? 165.532 129.932 217.294 1.00 173.68 ? 134  GLN A NE2 1 
ATOM   860   N N   . PHE A  1 122  ? 165.787 126.786 211.577 1.00 172.81 ? 135  PHE A N   1 
ATOM   861   C CA  . PHE A  1 122  ? 165.717 125.932 210.398 1.00 172.81 ? 135  PHE A CA  1 
ATOM   862   C C   . PHE A  1 122  ? 164.339 125.294 210.266 1.00 172.81 ? 135  PHE A C   1 
ATOM   863   O O   . PHE A  1 122  ? 163.684 124.966 211.258 1.00 172.81 ? 135  PHE A O   1 
ATOM   864   C CB  . PHE A  1 122  ? 166.794 124.848 210.462 1.00 172.81 ? 135  PHE A CB  1 
ATOM   865   N N   . CYS A  1 123  ? 163.892 125.139 209.016 1.00 167.91 ? 136  CYS A N   1 
ATOM   866   C CA  . CYS A  1 123  ? 162.567 124.588 208.729 1.00 167.91 ? 136  CYS A CA  1 
ATOM   867   C C   . CYS A  1 123  ? 162.586 124.045 207.301 1.00 167.91 ? 136  CYS A C   1 
ATOM   868   O O   . CYS A  1 123  ? 162.358 124.803 206.359 1.00 167.91 ? 136  CYS A O   1 
ATOM   869   C CB  . CYS A  1 123  ? 161.502 125.658 208.899 1.00 167.91 ? 136  CYS A CB  1 
ATOM   870   S SG  . CYS A  1 123  ? 159.889 125.235 208.226 1.00 167.91 ? 136  CYS A SG  1 
ATOM   871   N N   . ASN A  1 124  ? 162.837 122.746 207.141 1.00 168.57 ? 137  ASN A N   1 
ATOM   872   C CA  . ASN A  1 124  ? 162.991 122.331 205.755 1.00 168.57 ? 137  ASN A CA  1 
ATOM   873   C C   . ASN A  1 124  ? 161.778 121.584 205.221 1.00 168.57 ? 137  ASN A C   1 
ATOM   874   O O   . ASN A  1 124  ? 161.347 121.858 204.099 1.00 168.57 ? 137  ASN A O   1 
ATOM   875   C CB  . ASN A  1 124  ? 164.268 121.502 205.549 1.00 168.57 ? 137  ASN A CB  1 
ATOM   876   C CG  . ASN A  1 124  ? 164.134 120.058 205.984 1.00 168.57 ? 137  ASN A CG  1 
ATOM   877   O OD1 . ASN A  1 124  ? 163.153 119.660 206.602 1.00 168.57 ? 137  ASN A OD1 1 
ATOM   878   N ND2 . ASN A  1 124  ? 165.120 119.252 205.619 1.00 168.57 ? 137  ASN A ND2 1 
ATOM   879   N N   . ASP A  1 125  ? 161.201 120.651 205.975 1.00 174.25 ? 138  ASP A N   1 
ATOM   880   C CA  . ASP A  1 125  ? 160.115 119.812 205.465 1.00 174.25 ? 138  ASP A CA  1 
ATOM   881   C C   . ASP A  1 125  ? 158.881 119.964 206.341 1.00 174.25 ? 138  ASP A C   1 
ATOM   882   O O   . ASP A  1 125  ? 158.472 119.020 207.027 1.00 174.25 ? 138  ASP A O   1 
ATOM   883   C CB  . ASP A  1 125  ? 160.553 118.352 205.373 1.00 174.25 ? 138  ASP A CB  1 
ATOM   884   C CG  . ASP A  1 125  ? 159.608 117.513 204.539 1.00 174.25 ? 138  ASP A CG  1 
ATOM   885   O OD1 . ASP A  1 125  ? 158.600 118.058 204.043 1.00 174.25 ? 138  ASP A OD1 1 
ATOM   886   O OD2 . ASP A  1 125  ? 159.884 116.308 204.363 1.00 174.25 ? 138  ASP A OD2 1 
ATOM   887   N N   . PRO A  1 126  ? 158.243 121.126 206.317 1.00 169.37 ? 139  PRO A N   1 
ATOM   888   C CA  . PRO A  1 126  ? 157.186 121.430 207.287 1.00 169.37 ? 139  PRO A CA  1 
ATOM   889   C C   . PRO A  1 126  ? 155.790 121.055 206.806 1.00 169.37 ? 139  PRO A C   1 
ATOM   890   O O   . PRO A  1 126  ? 154.966 121.926 206.515 1.00 169.37 ? 139  PRO A O   1 
ATOM   891   C CB  . PRO A  1 126  ? 157.333 122.943 207.476 1.00 169.37 ? 139  PRO A CB  1 
ATOM   892   C CG  . PRO A  1 126  ? 157.757 123.412 206.139 1.00 169.37 ? 139  PRO A CG  1 
ATOM   893   C CD  . PRO A  1 126  ? 158.574 122.309 205.508 1.00 169.37 ? 139  PRO A CD  1 
ATOM   894   N N   . PHE A  1 127  ? 155.515 119.753 206.731 1.00 175.95 ? 140  PHE A N   1 
ATOM   895   C CA  . PHE A  1 127  ? 154.129 119.310 206.602 1.00 175.95 ? 140  PHE A CA  1 
ATOM   896   C C   . PHE A  1 127  ? 153.696 118.461 207.788 1.00 175.95 ? 140  PHE A C   1 
ATOM   897   O O   . PHE A  1 127  ? 152.739 118.807 208.488 1.00 175.95 ? 140  PHE A O   1 
ATOM   898   C CB  . PHE A  1 127  ? 153.931 118.508 205.322 1.00 175.95 ? 140  PHE A CB  1 
ATOM   899   N N   . LEU A  1 128  ? 154.402 117.344 207.991 1.00 177.93 ? 141  LEU A N   1 
ATOM   900   C CA  . LEU A  1 128  ? 154.261 116.422 209.123 1.00 177.93 ? 141  LEU A CA  1 
ATOM   901   C C   . LEU A  1 128  ? 152.795 116.244 209.538 1.00 177.93 ? 141  LEU A C   1 
ATOM   902   O O   . LEU A  1 128  ? 152.349 116.681 210.600 1.00 177.93 ? 141  LEU A O   1 
ATOM   903   C CB  . LEU A  1 128  ? 155.142 116.880 210.287 1.00 177.93 ? 141  LEU A CB  1 
ATOM   904   C CG  . LEU A  1 128  ? 156.608 116.524 210.032 1.00 177.93 ? 141  LEU A CG  1 
ATOM   905   C CD1 . LEU A  1 128  ? 157.459 116.831 211.239 1.00 177.93 ? 141  LEU A CD1 1 
ATOM   906   C CD2 . LEU A  1 128  ? 156.745 115.066 209.639 1.00 177.93 ? 141  LEU A CD2 1 
ATOM   907   N N   . GLY A  1 129  ? 152.057 115.587 208.650 1.00 196.13 ? 142  GLY A N   1 
ATOM   908   C CA  . GLY A  1 129  ? 150.670 115.236 208.890 1.00 196.13 ? 142  GLY A CA  1 
ATOM   909   C C   . GLY A  1 129  ? 150.346 113.964 208.143 1.00 196.13 ? 142  GLY A C   1 
ATOM   910   O O   . GLY A  1 129  ? 151.215 113.369 207.499 1.00 196.13 ? 142  GLY A O   1 
ATOM   911   N N   . VAL A  1 130  ? 149.095 113.533 208.248 1.00 209.29 ? 143  VAL A N   1 
ATOM   912   C CA  . VAL A  1 130  ? 148.631 112.357 207.517 1.00 209.29 ? 143  VAL A CA  1 
ATOM   913   C C   . VAL A  1 130  ? 148.037 112.802 206.187 1.00 209.29 ? 143  VAL A C   1 
ATOM   914   O O   . VAL A  1 130  ? 147.223 113.730 206.141 1.00 209.29 ? 143  VAL A O   1 
ATOM   915   C CB  . VAL A  1 130  ? 147.617 111.544 208.334 1.00 209.29 ? 143  VAL A CB  1 
ATOM   916   C CG1 . VAL A  1 130  ? 146.406 112.381 208.694 1.00 209.29 ? 143  VAL A CG1 1 
ATOM   917   C CG2 . VAL A  1 130  ? 147.192 110.318 207.544 1.00 209.29 ? 143  VAL A CG2 1 
ATOM   918   N N   . TYR A  1 131  ? 148.478 112.175 205.099 1.00 208.78 ? 144  TYR A N   1 
ATOM   919   C CA  . TYR A  1 131  ? 147.937 112.424 203.761 1.00 208.78 ? 144  TYR A CA  1 
ATOM   920   C C   . TYR A  1 131  ? 147.668 111.094 203.068 1.00 208.78 ? 144  TYR A C   1 
ATOM   921   O O   . TYR A  1 131  ? 148.525 110.607 202.327 1.00 208.78 ? 144  TYR A O   1 
ATOM   922   C CB  . TYR A  1 131  ? 148.876 113.273 202.927 1.00 208.78 ? 144  TYR A CB  1 
ATOM   923   C CG  . TYR A  1 131  ? 148.868 114.745 203.238 1.00 208.78 ? 144  TYR A CG  1 
ATOM   924   C CD1 . TYR A  1 131  ? 147.942 115.590 202.656 1.00 208.78 ? 144  TYR A CD1 1 
ATOM   925   C CD2 . TYR A  1 131  ? 149.828 115.297 204.068 1.00 208.78 ? 144  TYR A CD2 1 
ATOM   926   C CE1 . TYR A  1 131  ? 147.951 116.935 202.923 1.00 208.78 ? 144  TYR A CE1 1 
ATOM   927   C CE2 . TYR A  1 131  ? 149.849 116.639 204.332 1.00 208.78 ? 144  TYR A CE2 1 
ATOM   928   C CZ  . TYR A  1 131  ? 148.910 117.452 203.763 1.00 208.78 ? 144  TYR A CZ  1 
ATOM   929   O OH  . TYR A  1 131  ? 148.938 118.794 204.045 1.00 208.78 ? 144  TYR A OH  1 
ATOM   930   N N   . TYR A  1 132  ? 146.482 110.525 203.296 1.00 214.01 ? 145  TYR A N   1 
ATOM   931   C CA  . TYR A  1 132  ? 146.011 109.354 202.551 1.00 214.01 ? 145  TYR A CA  1 
ATOM   932   C C   . TYR A  1 132  ? 147.092 108.285 202.431 1.00 214.01 ? 145  TYR A C   1 
ATOM   933   O O   . TYR A  1 132  ? 147.190 107.571 201.431 1.00 214.01 ? 145  TYR A O   1 
ATOM   934   C CB  . TYR A  1 132  ? 145.506 109.772 201.175 1.00 214.01 ? 145  TYR A CB  1 
ATOM   935   C CG  . TYR A  1 132  ? 144.133 110.382 201.205 1.00 214.01 ? 145  TYR A CG  1 
ATOM   936   C CD1 . TYR A  1 132  ? 143.222 110.029 202.181 1.00 214.01 ? 145  TYR A CD1 1 
ATOM   937   C CD2 . TYR A  1 132  ? 143.763 111.354 200.292 1.00 214.01 ? 145  TYR A CD2 1 
ATOM   938   C CE1 . TYR A  1 132  ? 141.961 110.581 202.210 1.00 214.01 ? 145  TYR A CE1 1 
ATOM   939   C CE2 . TYR A  1 132  ? 142.506 111.929 200.334 1.00 214.01 ? 145  TYR A CE2 1 
ATOM   940   C CZ  . TYR A  1 132  ? 141.611 111.543 201.299 1.00 214.01 ? 145  TYR A CZ  1 
ATOM   941   O OH  . TYR A  1 132  ? 140.353 112.105 201.348 1.00 214.01 ? 145  TYR A OH  1 
ATOM   942   N N   . HIS A  1 133  ? 147.961 108.256 203.449 1.00 214.93 ? 146  HIS A N   1 
ATOM   943   C CA  . HIS A  1 133  ? 149.086 107.287 203.515 1.00 214.93 ? 146  HIS A CA  1 
ATOM   944   C C   . HIS A  1 133  ? 148.529 105.888 203.251 1.00 214.93 ? 146  HIS A C   1 
ATOM   945   O O   . HIS A  1 133  ? 149.020 105.219 202.320 1.00 214.93 ? 146  HIS A O   1 
ATOM   946   C CB  . HIS A  1 133  ? 149.801 107.384 204.869 1.00 214.93 ? 146  HIS A CB  1 
ATOM   947   C CG  . HIS A  1 133  ? 150.950 106.442 205.010 1.00 214.93 ? 146  HIS A CG  1 
ATOM   948   N ND1 . HIS A  1 133  ? 150.805 105.172 205.534 1.00 214.93 ? 146  HIS A ND1 1 
ATOM   949   C CD2 . HIS A  1 133  ? 152.257 106.577 204.698 1.00 214.93 ? 146  HIS A CD2 1 
ATOM   950   C CE1 . HIS A  1 133  ? 151.974 104.565 205.540 1.00 214.93 ? 146  HIS A CE1 1 
ATOM   951   N NE2 . HIS A  1 133  ? 152.882 105.406 205.032 1.00 214.93 ? 146  HIS A NE2 1 
ATOM   952   N N   . LYS A  1 134  ? 147.539 105.475 204.047 1.00 214.20 ? 147  LYS A N   1 
ATOM   953   C CA  . LYS A  1 134  ? 146.916 104.172 203.841 1.00 214.20 ? 147  LYS A CA  1 
ATOM   954   C C   . LYS A  1 134  ? 145.420 104.164 204.155 1.00 214.20 ? 147  LYS A C   1 
ATOM   955   O O   . LYS A  1 134  ? 144.841 103.079 204.285 1.00 214.20 ? 147  LYS A O   1 
ATOM   956   C CB  . LYS A  1 134  ? 147.642 103.124 204.682 1.00 214.20 ? 147  LYS A CB  1 
ATOM   957   C CG  . LYS A  1 134  ? 147.690 101.754 204.056 1.00 214.20 ? 147  LYS A CG  1 
ATOM   958   C CD  . LYS A  1 134  ? 148.566 100.824 204.855 1.00 214.20 ? 147  LYS A CD  1 
ATOM   959   C CE  . LYS A  1 134  ? 148.232 99.385  204.546 1.00 214.20 ? 147  LYS A CE  1 
ATOM   960   N NZ  . LYS A  1 134  ? 149.042 98.450  205.362 1.00 214.20 ? 147  LYS A NZ  1 
ATOM   961   N N   . ASN A  1 135  ? 144.776 105.323 204.286 1.00 225.03 ? 148  ASN A N   1 
ATOM   962   C CA  . ASN A  1 135  ? 143.397 105.362 204.760 1.00 225.03 ? 148  ASN A CA  1 
ATOM   963   C C   . ASN A  1 135  ? 142.651 106.591 204.259 1.00 225.03 ? 148  ASN A C   1 
ATOM   964   O O   . ASN A  1 135  ? 143.120 107.284 203.353 1.00 225.03 ? 148  ASN A O   1 
ATOM   965   C CB  . ASN A  1 135  ? 143.377 105.352 206.283 1.00 225.03 ? 148  ASN A CB  1 
ATOM   966   C CG  . ASN A  1 135  ? 144.007 106.595 206.869 1.00 225.03 ? 148  ASN A CG  1 
ATOM   967   O OD1 . ASN A  1 135  ? 145.229 106.711 206.929 1.00 225.03 ? 148  ASN A OD1 1 
ATOM   968   N ND2 . ASN A  1 135  ? 143.176 107.537 207.298 1.00 225.03 ? 148  ASN A ND2 1 
ATOM   969   N N   . ASN A  1 136  ? 141.493 106.859 204.871 1.00 228.54 ? 149  ASN A N   1 
ATOM   970   C CA  . ASN A  1 136  ? 140.659 108.037 204.509 1.00 228.54 ? 149  ASN A CA  1 
ATOM   971   C C   . ASN A  1 136  ? 140.988 109.192 205.463 1.00 228.54 ? 149  ASN A C   1 
ATOM   972   O O   . ASN A  1 136  ? 140.273 110.213 205.424 1.00 228.54 ? 149  ASN A O   1 
ATOM   973   C CB  . ASN A  1 136  ? 139.165 107.702 204.522 1.00 228.54 ? 149  ASN A CB  1 
ATOM   974   C CG  . ASN A  1 136  ? 138.847 106.394 203.829 1.00 228.54 ? 149  ASN A CG  1 
ATOM   975   O OD1 . ASN A  1 136  ? 139.710 105.798 203.189 1.00 228.54 ? 149  ASN A OD1 1 
ATOM   976   N ND2 . ASN A  1 136  ? 137.610 105.941 203.950 1.00 228.54 ? 149  ASN A ND2 1 
ATOM   977   N N   . LYS A  1 137  ? 142.036 109.027 206.277 1.00 215.71 ? 150  LYS A N   1 
ATOM   978   C CA  . LYS A  1 137  ? 142.457 110.074 207.247 1.00 215.71 ? 150  LYS A CA  1 
ATOM   979   C C   . LYS A  1 137  ? 141.214 110.657 207.929 1.00 215.71 ? 150  LYS A C   1 
ATOM   980   O O   . LYS A  1 137  ? 140.142 110.028 207.841 1.00 215.71 ? 150  LYS A O   1 
ATOM   981   C CB  . LYS A  1 137  ? 143.257 111.170 206.535 1.00 215.71 ? 150  LYS A CB  1 
ATOM   982   C CG  . LYS A  1 137  ? 144.264 110.677 205.505 1.00 215.71 ? 150  LYS A CG  1 
ATOM   983   C CD  . LYS A  1 137  ? 144.110 111.339 204.152 1.00 215.71 ? 150  LYS A CD  1 
ATOM   984   C CE  . LYS A  1 137  ? 143.771 112.811 204.248 1.00 215.71 ? 150  LYS A CE  1 
ATOM   985   N NZ  . LYS A  1 137  ? 144.433 113.597 203.179 1.00 215.71 ? 150  LYS A NZ  1 
ATOM   986   N N   . SER A  1 138  ? 141.365 111.815 208.580 1.00 214.08 ? 151  SER A N   1 
ATOM   987   C CA  . SER A  1 138  ? 140.234 112.480 209.281 1.00 214.08 ? 151  SER A CA  1 
ATOM   988   C C   . SER A  1 138  ? 139.346 113.203 208.262 1.00 214.08 ? 151  SER A C   1 
ATOM   989   O O   . SER A  1 138  ? 138.453 112.550 207.687 1.00 214.08 ? 151  SER A O   1 
ATOM   990   C CB  . SER A  1 138  ? 140.737 113.425 210.341 1.00 214.08 ? 151  SER A CB  1 
ATOM   991   O OG  . SER A  1 138  ? 141.824 112.852 211.053 1.00 214.08 ? 151  SER A OG  1 
ATOM   992   N N   . TRP A  1 139  ? 139.591 114.501 208.054 1.00 211.10 ? 152  TRP A N   1 
ATOM   993   C CA  . TRP A  1 139  ? 138.795 115.309 207.091 1.00 211.10 ? 152  TRP A CA  1 
ATOM   994   C C   . TRP A  1 139  ? 139.698 116.348 206.416 1.00 211.10 ? 152  TRP A C   1 
ATOM   995   O O   . TRP A  1 139  ? 139.392 116.742 205.274 1.00 211.10 ? 152  TRP A O   1 
ATOM   996   C CB  . TRP A  1 139  ? 137.604 115.970 207.796 1.00 211.10 ? 152  TRP A CB  1 
ATOM   997   C CG  . TRP A  1 139  ? 136.447 115.046 208.024 1.00 211.10 ? 152  TRP A CG  1 
ATOM   998   C CD1 . TRP A  1 139  ? 135.921 114.667 209.226 1.00 211.10 ? 152  TRP A CD1 1 
ATOM   999   C CD2 . TRP A  1 139  ? 135.666 114.377 207.018 1.00 211.10 ? 152  TRP A CD2 1 
ATOM   1000  N NE1 . TRP A  1 139  ? 134.869 113.812 209.037 1.00 211.10 ? 152  TRP A NE1 1 
ATOM   1001  C CE2 . TRP A  1 139  ? 134.689 113.614 207.693 1.00 211.10 ? 152  TRP A CE2 1 
ATOM   1002  C CE3 . TRP A  1 139  ? 135.695 114.346 205.619 1.00 211.10 ? 152  TRP A CE3 1 
ATOM   1003  C CZ2 . TRP A  1 139  ? 133.754 112.834 207.014 1.00 211.10 ? 152  TRP A CZ2 1 
ATOM   1004  C CZ3 . TRP A  1 139  ? 134.771 113.575 204.950 1.00 211.10 ? 152  TRP A CZ3 1 
ATOM   1005  C CH2 . TRP A  1 139  ? 133.815 112.830 205.640 1.00 211.10 ? 152  TRP A CH2 1 
ATOM   1006  N N   . MET A  1 140  ? 140.765 116.768 207.103 1.00 210.81 ? 153  MET A N   1 
ATOM   1007  C CA  . MET A  1 140  ? 141.708 117.777 206.547 1.00 210.81 ? 153  MET A CA  1 
ATOM   1008  C C   . MET A  1 140  ? 142.995 117.789 207.379 1.00 210.81 ? 153  MET A C   1 
ATOM   1009  O O   . MET A  1 140  ? 142.911 117.575 208.604 1.00 210.81 ? 153  MET A O   1 
ATOM   1010  C CB  . MET A  1 140  ? 141.082 119.175 206.563 1.00 210.81 ? 153  MET A CB  1 
ATOM   1011  C CG  . MET A  1 140  ? 140.196 119.427 207.769 1.00 210.81 ? 153  MET A CG  1 
ATOM   1012  S SD  . MET A  1 140  ? 140.685 120.901 208.699 1.00 210.81 ? 153  MET A SD  1 
ATOM   1013  C CE  . MET A  1 140  ? 139.157 121.270 209.559 1.00 210.81 ? 153  MET A CE  1 
ATOM   1014  N N   . GLU A  1 141  ? 144.136 118.031 206.725 1.00 213.60 ? 154  GLU A N   1 
ATOM   1015  C CA  . GLU A  1 141  ? 145.431 118.079 207.399 1.00 213.60 ? 154  GLU A CA  1 
ATOM   1016  C C   . GLU A  1 141  ? 146.379 118.972 206.613 1.00 213.60 ? 154  GLU A C   1 
ATOM   1017  O O   . GLU A  1 141  ? 146.673 118.692 205.448 1.00 213.60 ? 154  GLU A O   1 
ATOM   1018  C CB  . GLU A  1 141  ? 146.050 116.683 207.547 1.00 213.60 ? 154  GLU A CB  1 
ATOM   1019  C CG  . GLU A  1 141  ? 145.329 115.716 208.470 1.00 213.60 ? 154  GLU A CG  1 
ATOM   1020  C CD  . GLU A  1 141  ? 144.202 114.968 207.781 1.00 213.60 ? 154  GLU A CD  1 
ATOM   1021  O OE1 . GLU A  1 141  ? 143.880 115.300 206.623 1.00 213.60 ? 154  GLU A OE1 1 
ATOM   1022  O OE2 . GLU A  1 141  ? 143.644 114.035 208.394 1.00 213.60 ? 154  GLU A OE2 1 
ATOM   1023  N N   . SER A  1 142  ? 146.867 120.036 207.254 1.00 209.75 ? 155  SER A N   1 
ATOM   1024  C CA  . SER A  1 142  ? 147.874 120.905 206.642 1.00 209.75 ? 155  SER A CA  1 
ATOM   1025  C C   . SER A  1 142  ? 148.558 121.675 207.770 1.00 209.75 ? 155  SER A C   1 
ATOM   1026  O O   . SER A  1 142  ? 147.940 122.557 208.369 1.00 209.75 ? 155  SER A O   1 
ATOM   1027  C CB  . SER A  1 142  ? 147.244 121.851 205.637 1.00 209.75 ? 155  SER A CB  1 
ATOM   1028  O OG  . SER A  1 142  ? 148.037 123.015 205.481 1.00 209.75 ? 155  SER A OG  1 
ATOM   1029  N N   . GLU A  1 143  ? 149.820 121.352 208.043 1.00 194.55 ? 156  GLU A N   1 
ATOM   1030  C CA  . GLU A  1 143  ? 150.520 121.998 209.147 1.00 194.55 ? 156  GLU A CA  1 
ATOM   1031  C C   . GLU A  1 143  ? 151.998 122.150 208.799 1.00 194.55 ? 156  GLU A C   1 
ATOM   1032  O O   . GLU A  1 143  ? 152.462 121.702 207.746 1.00 194.55 ? 156  GLU A O   1 
ATOM   1033  C CB  . GLU A  1 143  ? 150.336 121.214 210.456 1.00 194.55 ? 156  GLU A CB  1 
ATOM   1034  C CG  . GLU A  1 143  ? 148.997 121.419 211.192 1.00 194.55 ? 156  GLU A CG  1 
ATOM   1035  C CD  . GLU A  1 143  ? 148.681 122.875 211.503 1.00 194.55 ? 156  GLU A CD  1 
ATOM   1036  O OE1 . GLU A  1 143  ? 149.618 123.657 211.756 1.00 194.55 ? 156  GLU A OE1 1 
ATOM   1037  O OE2 . GLU A  1 143  ? 147.486 123.234 211.513 1.00 194.55 ? 156  GLU A OE2 1 
ATOM   1038  N N   . PHE A  1 144  ? 152.734 122.797 209.708 1.00 177.94 ? 157  PHE A N   1 
ATOM   1039  C CA  . PHE A  1 144  ? 154.179 122.956 209.593 1.00 177.94 ? 157  PHE A CA  1 
ATOM   1040  C C   . PHE A  1 144  ? 154.849 122.983 210.972 1.00 177.94 ? 157  PHE A C   1 
ATOM   1041  O O   . PHE A  1 144  ? 154.802 123.991 211.683 1.00 177.94 ? 157  PHE A O   1 
ATOM   1042  C CB  . PHE A  1 144  ? 154.512 124.207 208.765 1.00 177.94 ? 157  PHE A CB  1 
ATOM   1043  C CG  . PHE A  1 144  ? 154.105 125.519 209.389 1.00 177.94 ? 157  PHE A CG  1 
ATOM   1044  C CD1 . PHE A  1 144  ? 152.775 125.887 209.483 1.00 177.94 ? 157  PHE A CD1 1 
ATOM   1045  C CD2 . PHE A  1 144  ? 155.068 126.415 209.819 1.00 177.94 ? 157  PHE A CD2 1 
ATOM   1046  C CE1 . PHE A  1 144  ? 152.414 127.105 210.028 1.00 177.94 ? 157  PHE A CE1 1 
ATOM   1047  C CE2 . PHE A  1 144  ? 154.710 127.630 210.362 1.00 177.94 ? 157  PHE A CE2 1 
ATOM   1048  C CZ  . PHE A  1 144  ? 153.382 127.975 210.466 1.00 177.94 ? 157  PHE A CZ  1 
ATOM   1049  N N   . ARG A  1 145  ? 155.476 121.868 211.353 1.00 176.32 ? 158  ARG A N   1 
ATOM   1050  C CA  . ARG A  1 145  ? 156.070 121.679 212.673 1.00 176.32 ? 158  ARG A CA  1 
ATOM   1051  C C   . ARG A  1 145  ? 157.578 121.534 212.532 1.00 176.32 ? 158  ARG A C   1 
ATOM   1052  O O   . ARG A  1 145  ? 158.086 120.415 212.403 1.00 176.32 ? 158  ARG A O   1 
ATOM   1053  C CB  . ARG A  1 145  ? 155.496 120.432 213.361 1.00 176.32 ? 158  ARG A CB  1 
ATOM   1054  C CG  . ARG A  1 145  ? 155.698 120.367 214.889 1.00 176.32 ? 158  ARG A CG  1 
ATOM   1055  C CD  . ARG A  1 145  ? 156.974 119.628 215.345 1.00 176.32 ? 158  ARG A CD  1 
ATOM   1056  N NE  . ARG A  1 145  ? 156.963 118.186 215.093 1.00 176.32 ? 158  ARG A NE  1 
ATOM   1057  C CZ  . ARG A  1 145  ? 156.395 117.291 215.894 1.00 176.32 ? 158  ARG A CZ  1 
ATOM   1058  N NH1 . ARG A  1 145  ? 155.777 117.687 216.994 1.00 176.32 ? 158  ARG A NH1 1 
ATOM   1059  N NH2 . ARG A  1 145  ? 156.439 116.001 215.594 1.00 176.32 ? 158  ARG A NH2 1 
ATOM   1060  N N   . VAL A  1 146  ? 158.293 122.656 212.553 1.00 164.60 ? 159  VAL A N   1 
ATOM   1061  C CA  . VAL A  1 146  ? 159.733 122.602 212.339 1.00 164.60 ? 159  VAL A CA  1 
ATOM   1062  C C   . VAL A  1 146  ? 160.506 123.320 213.435 1.00 164.60 ? 159  VAL A C   1 
ATOM   1063  O O   . VAL A  1 146  ? 161.295 122.704 214.157 1.00 164.60 ? 159  VAL A O   1 
ATOM   1064  C CB  . VAL A  1 146  ? 160.085 123.188 210.966 1.00 164.60 ? 159  VAL A CB  1 
ATOM   1065  N N   . TYR A  1 147  ? 160.309 124.626 213.545 1.00 161.43 ? 160  TYR A N   1 
ATOM   1066  C CA  . TYR A  1 147  ? 161.006 125.454 214.516 1.00 161.43 ? 160  TYR A CA  1 
ATOM   1067  C C   . TYR A  1 147  ? 160.210 126.732 214.744 1.00 161.43 ? 160  TYR A C   1 
ATOM   1068  O O   . TYR A  1 147  ? 159.251 127.025 214.029 1.00 161.43 ? 160  TYR A O   1 
ATOM   1069  C CB  . TYR A  1 147  ? 162.429 125.765 214.048 1.00 161.43 ? 160  TYR A CB  1 
ATOM   1070  N N   . SER A  1 148  ? 160.618 127.497 215.752 1.00 159.54 ? 161  SER A N   1 
ATOM   1071  C CA  . SER A  1 148  ? 159.928 128.737 216.077 1.00 159.54 ? 161  SER A CA  1 
ATOM   1072  C C   . SER A  1 148  ? 160.761 129.550 217.057 1.00 159.54 ? 161  SER A C   1 
ATOM   1073  O O   . SER A  1 148  ? 161.642 129.030 217.744 1.00 159.54 ? 161  SER A O   1 
ATOM   1074  C CB  . SER A  1 148  ? 158.529 128.469 216.637 1.00 159.54 ? 161  SER A CB  1 
ATOM   1075  O OG  . SER A  1 148  ? 157.611 128.225 215.586 1.00 159.54 ? 161  SER A OG  1 
ATOM   1076  N N   . SER A  1 149  ? 160.462 130.844 217.109 1.00 159.88 ? 162  SER A N   1 
ATOM   1077  C CA  . SER A  1 149  ? 161.054 131.760 218.072 1.00 159.88 ? 162  SER A CA  1 
ATOM   1078  C C   . SER A  1 149  ? 160.112 132.944 218.212 1.00 159.88 ? 162  SER A C   1 
ATOM   1079  O O   . SER A  1 149  ? 159.553 133.412 217.220 1.00 159.88 ? 162  SER A O   1 
ATOM   1080  C CB  . SER A  1 149  ? 162.448 132.228 217.639 1.00 159.88 ? 162  SER A CB  1 
ATOM   1081  O OG  . SER A  1 149  ? 162.818 133.423 218.308 1.00 159.88 ? 162  SER A OG  1 
ATOM   1082  N N   . ALA A  1 150  ? 159.926 133.413 219.442 1.00 150.94 ? 163  ALA A N   1 
ATOM   1083  C CA  . ALA A  1 150  ? 158.988 134.502 219.680 1.00 150.94 ? 163  ALA A CA  1 
ATOM   1084  C C   . ALA A  1 150  ? 159.701 135.838 219.839 1.00 150.94 ? 163  ALA A C   1 
ATOM   1085  O O   . ALA A  1 150  ? 159.077 136.896 219.730 1.00 150.94 ? 163  ALA A O   1 
ATOM   1086  C CB  . ALA A  1 150  ? 158.130 134.203 220.909 1.00 150.94 ? 163  ALA A CB  1 
ATOM   1087  N N   . ASN A  1 151  ? 160.997 135.810 220.126 1.00 150.74 ? 164  ASN A N   1 
ATOM   1088  C CA  . ASN A  1 151  ? 161.739 137.056 220.183 1.00 150.74 ? 164  ASN A CA  1 
ATOM   1089  C C   . ASN A  1 151  ? 162.665 137.162 218.993 1.00 150.74 ? 164  ASN A C   1 
ATOM   1090  O O   . ASN A  1 151  ? 163.144 136.143 218.485 1.00 150.74 ? 164  ASN A O   1 
ATOM   1091  C CB  . ASN A  1 151  ? 162.549 137.156 221.468 1.00 150.74 ? 164  ASN A CB  1 
ATOM   1092  N N   . ASN A  1 152  ? 162.908 138.405 218.564 1.00 162.72 ? 165  ASN A N   1 
ATOM   1093  C CA  . ASN A  1 152  ? 163.890 138.800 217.554 1.00 162.72 ? 165  ASN A CA  1 
ATOM   1094  C C   . ASN A  1 152  ? 163.407 138.643 216.103 1.00 162.72 ? 165  ASN A C   1 
ATOM   1095  O O   . ASN A  1 152  ? 164.149 138.911 215.150 1.00 162.72 ? 165  ASN A O   1 
ATOM   1096  C CB  . ASN A  1 152  ? 165.180 138.043 217.847 1.00 162.72 ? 165  ASN A CB  1 
ATOM   1097  C CG  . ASN A  1 152  ? 165.780 138.483 219.155 1.00 162.72 ? 165  ASN A CG  1 
ATOM   1098  O OD1 . ASN A  1 152  ? 165.724 139.672 219.473 1.00 162.72 ? 165  ASN A OD1 1 
ATOM   1099  N ND2 . ASN A  1 152  ? 166.327 137.556 219.933 1.00 162.72 ? 165  ASN A ND2 1 
ATOM   1100  N N   . CYS A  1 153  ? 162.134 138.291 215.944 1.00 169.45 ? 166  CYS A N   1 
ATOM   1101  C CA  . CYS A  1 153  ? 161.375 138.366 214.709 1.00 169.45 ? 166  CYS A CA  1 
ATOM   1102  C C   . CYS A  1 153  ? 161.429 139.764 214.109 1.00 169.45 ? 166  CYS A C   1 
ATOM   1103  O O   . CYS A  1 153  ? 161.976 140.704 214.686 1.00 169.45 ? 166  CYS A O   1 
ATOM   1104  C CB  . CYS A  1 153  ? 159.923 137.988 214.976 1.00 169.45 ? 166  CYS A CB  1 
ATOM   1105  S SG  . CYS A  1 153  ? 158.741 138.584 213.770 1.00 169.45 ? 166  CYS A SG  1 
ATOM   1106  N N   . THR A  1 154  ? 160.872 139.890 212.909 1.00 177.40 ? 167  THR A N   1 
ATOM   1107  C CA  . THR A  1 154  ? 160.687 141.217 212.339 1.00 177.40 ? 167  THR A CA  1 
ATOM   1108  C C   . THR A  1 154  ? 159.349 141.393 211.621 1.00 177.40 ? 167  THR A C   1 
ATOM   1109  O O   . THR A  1 154  ? 158.840 142.516 211.566 1.00 177.40 ? 167  THR A O   1 
ATOM   1110  C CB  . THR A  1 154  ? 161.843 141.568 211.396 1.00 177.40 ? 167  THR A CB  1 
ATOM   1111  O OG1 . THR A  1 154  ? 161.881 142.987 211.197 1.00 177.40 ? 167  THR A OG1 1 
ATOM   1112  C CG2 . THR A  1 154  ? 161.692 140.875 210.049 1.00 177.40 ? 167  THR A CG2 1 
ATOM   1113  N N   . PHE A  1 155  ? 158.763 140.331 211.061 1.00 180.46 ? 168  PHE A N   1 
ATOM   1114  C CA  . PHE A  1 155  ? 157.538 140.540 210.298 1.00 180.46 ? 168  PHE A CA  1 
ATOM   1115  C C   . PHE A  1 155  ? 156.821 139.229 209.992 1.00 180.46 ? 168  PHE A C   1 
ATOM   1116  O O   . PHE A  1 155  ? 157.327 138.133 210.247 1.00 180.46 ? 168  PHE A O   1 
ATOM   1117  C CB  . PHE A  1 155  ? 157.813 141.288 208.996 1.00 180.46 ? 168  PHE A CB  1 
ATOM   1118  C CG  . PHE A  1 155  ? 156.576 141.719 208.316 1.00 180.46 ? 168  PHE A CG  1 
ATOM   1119  C CD1 . PHE A  1 155  ? 155.679 142.531 208.968 1.00 180.46 ? 168  PHE A CD1 1 
ATOM   1120  C CD2 . PHE A  1 155  ? 156.258 141.243 207.072 1.00 180.46 ? 168  PHE A CD2 1 
ATOM   1121  C CE1 . PHE A  1 155  ? 154.510 142.909 208.365 1.00 180.46 ? 168  PHE A CE1 1 
ATOM   1122  C CE2 . PHE A  1 155  ? 155.095 141.620 206.465 1.00 180.46 ? 168  PHE A CE2 1 
ATOM   1123  C CZ  . PHE A  1 155  ? 154.218 142.455 207.109 1.00 180.46 ? 168  PHE A CZ  1 
ATOM   1124  N N   . GLU A  1 156  ? 155.610 139.378 209.454 1.00 188.96 ? 169  GLU A N   1 
ATOM   1125  C CA  . GLU A  1 156  ? 154.767 138.320 208.922 1.00 188.96 ? 169  GLU A CA  1 
ATOM   1126  C C   . GLU A  1 156  ? 153.682 138.979 208.083 1.00 188.96 ? 169  GLU A C   1 
ATOM   1127  O O   . GLU A  1 156  ? 153.204 140.063 208.420 1.00 188.96 ? 169  GLU A O   1 
ATOM   1128  C CB  . GLU A  1 156  ? 154.148 137.488 210.042 1.00 188.96 ? 169  GLU A CB  1 
ATOM   1129  C CG  . GLU A  1 156  ? 153.451 136.247 209.568 1.00 188.96 ? 169  GLU A CG  1 
ATOM   1130  C CD  . GLU A  1 156  ? 151.998 136.482 209.240 1.00 188.96 ? 169  GLU A CD  1 
ATOM   1131  O OE1 . GLU A  1 156  ? 151.353 135.553 208.715 1.00 188.96 ? 169  GLU A OE1 1 
ATOM   1132  O OE2 . GLU A  1 156  ? 151.501 137.595 209.502 1.00 188.96 ? 169  GLU A OE2 1 
ATOM   1133  N N   . TYR A  1 157  ? 153.268 138.306 207.010 1.00 195.71 ? 170  TYR A N   1 
ATOM   1134  C CA  . TYR A  1 157  ? 152.381 138.942 206.045 1.00 195.71 ? 170  TYR A CA  1 
ATOM   1135  C C   . TYR A  1 157  ? 151.315 137.971 205.559 1.00 195.71 ? 170  TYR A C   1 
ATOM   1136  O O   . TYR A  1 157  ? 151.603 136.810 205.268 1.00 195.71 ? 170  TYR A O   1 
ATOM   1137  C CB  . TYR A  1 157  ? 153.172 139.466 204.845 1.00 195.71 ? 170  TYR A CB  1 
ATOM   1138  C CG  . TYR A  1 157  ? 152.323 139.993 203.717 1.00 195.71 ? 170  TYR A CG  1 
ATOM   1139  C CD1 . TYR A  1 157  ? 151.700 141.226 203.804 1.00 195.71 ? 170  TYR A CD1 1 
ATOM   1140  C CD2 . TYR A  1 157  ? 152.152 139.257 202.564 1.00 195.71 ? 170  TYR A CD2 1 
ATOM   1141  C CE1 . TYR A  1 157  ? 150.931 141.703 202.775 1.00 195.71 ? 170  TYR A CE1 1 
ATOM   1142  C CE2 . TYR A  1 157  ? 151.392 139.726 201.532 1.00 195.71 ? 170  TYR A CE2 1 
ATOM   1143  C CZ  . TYR A  1 157  ? 150.782 140.945 201.639 1.00 195.71 ? 170  TYR A CZ  1 
ATOM   1144  O OH  . TYR A  1 157  ? 150.016 141.393 200.593 1.00 195.71 ? 170  TYR A OH  1 
ATOM   1145  N N   . VAL A  1 158  ? 150.083 138.472 205.447 1.00 197.83 ? 171  VAL A N   1 
ATOM   1146  C CA  . VAL A  1 158  ? 148.973 137.748 204.835 1.00 197.83 ? 171  VAL A CA  1 
ATOM   1147  C C   . VAL A  1 158  ? 148.802 138.268 203.416 1.00 197.83 ? 171  VAL A C   1 
ATOM   1148  O O   . VAL A  1 158  ? 148.848 139.480 203.181 1.00 197.83 ? 171  VAL A O   1 
ATOM   1149  C CB  . VAL A  1 158  ? 147.659 137.894 205.631 1.00 197.83 ? 171  VAL A CB  1 
ATOM   1150  C CG1 . VAL A  1 158  ? 147.714 137.090 206.916 1.00 197.83 ? 171  VAL A CG1 1 
ATOM   1151  C CG2 . VAL A  1 158  ? 147.355 139.355 205.917 1.00 197.83 ? 171  VAL A CG2 1 
ATOM   1152  N N   . SER A  1 159  ? 148.590 137.355 202.475 1.00 202.65 ? 172  SER A N   1 
ATOM   1153  C CA  . SER A  1 159  ? 148.712 137.673 201.063 1.00 202.65 ? 172  SER A CA  1 
ATOM   1154  C C   . SER A  1 159  ? 147.384 137.564 200.332 1.00 202.65 ? 172  SER A C   1 
ATOM   1155  O O   . SER A  1 159  ? 146.430 136.926 200.784 1.00 202.65 ? 172  SER A O   1 
ATOM   1156  C CB  . SER A  1 159  ? 149.728 136.753 200.384 1.00 202.65 ? 172  SER A CB  1 
ATOM   1157  O OG  . SER A  1 159  ? 149.196 135.448 200.255 1.00 202.65 ? 172  SER A OG  1 
ATOM   1158  N N   . GLN A  1 160  ? 147.374 138.190 199.164 1.00 194.20 ? 173  GLN A N   1 
ATOM   1159  C CA  . GLN A  1 160  ? 146.345 138.090 198.145 1.00 194.20 ? 173  GLN A CA  1 
ATOM   1160  C C   . GLN A  1 160  ? 146.511 136.749 197.437 1.00 194.20 ? 173  GLN A C   1 
ATOM   1161  O O   . GLN A  1 160  ? 147.489 136.040 197.705 1.00 194.20 ? 173  GLN A O   1 
ATOM   1162  C CB  . GLN A  1 160  ? 146.470 139.264 197.171 1.00 194.20 ? 173  GLN A CB  1 
ATOM   1163  N N   . PRO A  1 161  ? 145.581 136.345 196.551 1.00 189.58 ? 174  PRO A N   1 
ATOM   1164  C CA  . PRO A  1 161  ? 145.742 135.057 195.862 1.00 189.58 ? 174  PRO A CA  1 
ATOM   1165  C C   . PRO A  1 161  ? 147.077 134.941 195.156 1.00 189.58 ? 174  PRO A C   1 
ATOM   1166  O O   . PRO A  1 161  ? 147.489 135.857 194.442 1.00 189.58 ? 174  PRO A O   1 
ATOM   1167  C CB  . PRO A  1 161  ? 144.576 135.040 194.866 1.00 189.58 ? 174  PRO A CB  1 
ATOM   1168  C CG  . PRO A  1 161  ? 144.013 136.427 194.882 1.00 189.58 ? 174  PRO A CG  1 
ATOM   1169  C CD  . PRO A  1 161  ? 144.284 136.958 196.230 1.00 189.58 ? 174  PRO A CD  1 
ATOM   1170  N N   . PHE A  1 162  ? 147.780 133.835 195.378 1.00 178.24 ? 175  PHE A N   1 
ATOM   1171  C CA  . PHE A  1 162  ? 149.091 133.636 194.782 1.00 178.24 ? 175  PHE A CA  1 
ATOM   1172  C C   . PHE A  1 162  ? 149.111 132.517 193.751 1.00 178.24 ? 175  PHE A C   1 
ATOM   1173  O O   . PHE A  1 162  ? 149.771 132.646 192.718 1.00 178.24 ? 175  PHE A O   1 
ATOM   1174  C CB  . PHE A  1 162  ? 150.119 133.356 195.869 1.00 178.24 ? 175  PHE A CB  1 
ATOM   1175  C CG  . PHE A  1 162  ? 151.522 133.541 195.420 1.00 178.24 ? 175  PHE A CG  1 
ATOM   1176  C CD1 . PHE A  1 162  ? 152.217 132.500 194.845 1.00 178.24 ? 175  PHE A CD1 1 
ATOM   1177  C CD2 . PHE A  1 162  ? 152.149 134.758 195.571 1.00 178.24 ? 175  PHE A CD2 1 
ATOM   1178  C CE1 . PHE A  1 162  ? 153.507 132.662 194.438 1.00 178.24 ? 175  PHE A CE1 1 
ATOM   1179  C CE2 . PHE A  1 162  ? 153.443 134.927 195.167 1.00 178.24 ? 175  PHE A CE2 1 
ATOM   1180  C CZ  . PHE A  1 162  ? 154.125 133.878 194.599 1.00 178.24 ? 175  PHE A CZ  1 
ATOM   1181  N N   . LEU A  1 163  ? 148.433 131.404 194.019 1.00 182.24 ? 176  LEU A N   1 
ATOM   1182  C CA  . LEU A  1 163  ? 148.226 130.371 193.013 1.00 182.24 ? 176  LEU A CA  1 
ATOM   1183  C C   . LEU A  1 163  ? 146.771 130.234 192.593 1.00 182.24 ? 176  LEU A C   1 
ATOM   1184  O O   . LEU A  1 163  ? 146.488 129.534 191.614 1.00 182.24 ? 176  LEU A O   1 
ATOM   1185  C CB  . LEU A  1 163  ? 148.736 129.015 193.505 1.00 182.24 ? 176  LEU A CB  1 
ATOM   1186  C CG  . LEU A  1 163  ? 150.220 128.744 193.289 1.00 182.24 ? 176  LEU A CG  1 
ATOM   1187  C CD1 . LEU A  1 163  ? 151.052 129.398 194.365 1.00 182.24 ? 176  LEU A CD1 1 
ATOM   1188  C CD2 . LEU A  1 163  ? 150.470 127.255 193.230 1.00 182.24 ? 176  LEU A CD2 1 
ATOM   1189  N N   . MET A  1 164  ? 145.846 130.877 193.307 1.00 189.92 ? 177  MET A N   1 
ATOM   1190  C CA  . MET A  1 164  ? 144.431 130.796 192.974 1.00 189.92 ? 177  MET A CA  1 
ATOM   1191  C C   . MET A  1 164  ? 144.195 131.281 191.557 1.00 189.92 ? 177  MET A C   1 
ATOM   1192  O O   . MET A  1 164  ? 143.826 130.498 190.678 1.00 189.92 ? 177  MET A O   1 
ATOM   1193  C CB  . MET A  1 164  ? 143.595 131.629 193.937 1.00 189.92 ? 177  MET A CB  1 
ATOM   1194  C CG  . MET A  1 164  ? 142.119 131.502 193.671 1.00 189.92 ? 177  MET A CG  1 
ATOM   1195  S SD  . MET A  1 164  ? 141.588 129.802 193.913 1.00 189.92 ? 177  MET A SD  1 
ATOM   1196  C CE  . MET A  1 164  ? 141.100 129.351 192.258 1.00 189.92 ? 177  MET A CE  1 
ATOM   1197  N N   . ASP A  1 165  ? 144.425 132.569 191.324 1.00 194.76 ? 178  ASP A N   1 
ATOM   1198  C CA  . ASP A  1 165  ? 144.308 133.111 189.980 1.00 194.76 ? 178  ASP A CA  1 
ATOM   1199  C C   . ASP A  1 165  ? 145.665 133.620 189.518 1.00 194.76 ? 178  ASP A C   1 
ATOM   1200  O O   . ASP A  1 165  ? 145.746 134.563 188.727 1.00 194.76 ? 178  ASP A O   1 
ATOM   1201  C CB  . ASP A  1 165  ? 143.253 134.216 189.929 1.00 194.76 ? 178  ASP A CB  1 
ATOM   1202  C CG  . ASP A  1 165  ? 143.625 135.416 190.758 1.00 194.76 ? 178  ASP A CG  1 
ATOM   1203  O OD1 . ASP A  1 165  ? 143.293 135.421 191.956 1.00 194.76 ? 178  ASP A OD1 1 
ATOM   1204  O OD2 . ASP A  1 165  ? 144.252 136.349 190.218 1.00 194.76 ? 178  ASP A OD2 1 
ATOM   1205  N N   . LEU A  1 166  ? 146.731 133.005 190.016 1.00 184.11 ? 179  LEU A N   1 
ATOM   1206  C CA  . LEU A  1 166  ? 148.077 133.281 189.536 1.00 184.11 ? 179  LEU A CA  1 
ATOM   1207  C C   . LEU A  1 166  ? 148.917 132.017 189.600 1.00 184.11 ? 179  LEU A C   1 
ATOM   1208  O O   . LEU A  1 166  ? 149.280 131.455 188.570 1.00 184.11 ? 179  LEU A O   1 
ATOM   1209  C CB  . LEU A  1 166  ? 148.736 134.394 190.346 1.00 184.11 ? 179  LEU A CB  1 
ATOM   1210  C CG  . LEU A  1 166  ? 148.234 135.822 190.140 1.00 184.11 ? 179  LEU A CG  1 
ATOM   1211  C CD1 . LEU A  1 166  ? 147.179 136.164 191.161 1.00 184.11 ? 179  LEU A CD1 1 
ATOM   1212  C CD2 . LEU A  1 166  ? 149.376 136.808 190.230 1.00 184.11 ? 179  LEU A CD2 1 
ATOM   1213  N N   . GLN A  1 170  ? 143.920 129.004 181.045 1.00 199.06 ? 183  GLN A N   1 
ATOM   1214  C CA  . GLN A  1 170  ? 142.550 128.560 181.417 1.00 199.06 ? 183  GLN A CA  1 
ATOM   1215  C C   . GLN A  1 170  ? 142.162 127.348 180.563 1.00 199.06 ? 183  GLN A C   1 
ATOM   1216  O O   . GLN A  1 170  ? 141.914 127.532 179.355 1.00 199.06 ? 183  GLN A O   1 
ATOM   1217  C CB  . GLN A  1 170  ? 141.550 129.703 181.231 1.00 199.06 ? 183  GLN A CB  1 
ATOM   1218  C CG  . GLN A  1 170  ? 140.105 129.238 181.128 1.00 199.06 ? 183  GLN A CG  1 
ATOM   1219  C CD  . GLN A  1 170  ? 139.133 130.295 181.591 1.00 199.06 ? 183  GLN A CD  1 
ATOM   1220  O OE1 . GLN A  1 170  ? 139.520 131.394 181.980 1.00 199.06 ? 183  GLN A OE1 1 
ATOM   1221  N NE2 . GLN A  1 170  ? 137.852 129.965 181.552 1.00 199.06 ? 183  GLN A NE2 1 
ATOM   1222  N N   . GLY A  1 171  ? 142.116 126.160 181.175 1.00 227.48 ? 184  GLY A N   1 
ATOM   1223  C CA  . GLY A  1 171  ? 141.758 124.922 180.457 1.00 227.48 ? 184  GLY A CA  1 
ATOM   1224  C C   . GLY A  1 171  ? 142.973 124.042 180.217 1.00 227.48 ? 184  GLY A C   1 
ATOM   1225  O O   . GLY A  1 171  ? 143.761 123.854 181.164 1.00 227.48 ? 184  GLY A O   1 
ATOM   1226  N N   . ASN A  1 172  ? 143.117 123.523 178.993 1.00 237.05 ? 185  ASN A N   1 
ATOM   1227  C CA  . ASN A  1 172  ? 144.266 122.647 178.638 1.00 237.05 ? 185  ASN A CA  1 
ATOM   1228  C C   . ASN A  1 172  ? 144.378 121.519 179.670 1.00 237.05 ? 185  ASN A C   1 
ATOM   1229  O O   . ASN A  1 172  ? 143.357 120.850 179.927 1.00 237.05 ? 185  ASN A O   1 
ATOM   1230  C CB  . ASN A  1 172  ? 145.572 123.440 178.534 1.00 237.05 ? 185  ASN A CB  1 
ATOM   1231  C CG  . ASN A  1 172  ? 145.622 124.342 177.319 1.00 237.05 ? 185  ASN A CG  1 
ATOM   1232  O OD1 . ASN A  1 172  ? 144.922 124.107 176.337 1.00 237.05 ? 185  ASN A OD1 1 
ATOM   1233  N ND2 . ASN A  1 172  ? 146.446 125.375 177.377 1.00 237.05 ? 185  ASN A ND2 1 
ATOM   1234  N N   . PHE A  1 173  ? 145.575 121.327 180.233 1.00 217.49 ? 186  PHE A N   1 
ATOM   1235  C CA  . PHE A  1 173  ? 145.811 120.268 181.249 1.00 217.49 ? 186  PHE A CA  1 
ATOM   1236  C C   . PHE A  1 173  ? 147.103 120.575 182.014 1.00 217.49 ? 186  PHE A C   1 
ATOM   1237  O O   . PHE A  1 173  ? 147.354 119.937 183.055 1.00 217.49 ? 186  PHE A O   1 
ATOM   1238  C CB  . PHE A  1 173  ? 145.879 118.890 180.587 1.00 217.49 ? 186  PHE A CB  1 
ATOM   1239  C CG  . PHE A  1 173  ? 146.736 117.885 181.315 1.00 217.49 ? 186  PHE A CG  1 
ATOM   1240  C CD1 . PHE A  1 173  ? 148.117 117.998 181.318 1.00 217.49 ? 186  PHE A CD1 1 
ATOM   1241  C CD2 . PHE A  1 173  ? 146.162 116.825 181.999 1.00 217.49 ? 186  PHE A CD2 1 
ATOM   1242  C CE1 . PHE A  1 173  ? 148.904 117.075 181.988 1.00 217.49 ? 186  PHE A CE1 1 
ATOM   1243  C CE2 . PHE A  1 173  ? 146.950 115.902 182.668 1.00 217.49 ? 186  PHE A CE2 1 
ATOM   1244  C CZ  . PHE A  1 173  ? 148.319 116.028 182.662 1.00 217.49 ? 186  PHE A CZ  1 
ATOM   1245  N N   . LYS A  1 174  ? 147.895 121.523 181.502 1.00 209.38 ? 187  LYS A N   1 
ATOM   1246  C CA  . LYS A  1 174  ? 149.144 121.902 182.135 1.00 209.38 ? 187  LYS A CA  1 
ATOM   1247  C C   . LYS A  1 174  ? 149.232 123.410 182.300 1.00 209.38 ? 187  LYS A C   1 
ATOM   1248  O O   . LYS A  1 174  ? 148.927 124.184 181.392 1.00 209.38 ? 187  LYS A O   1 
ATOM   1249  C CB  . LYS A  1 174  ? 150.337 121.395 181.326 1.00 209.38 ? 187  LYS A CB  1 
ATOM   1250  C CG  . LYS A  1 174  ? 150.999 120.164 181.897 1.00 209.38 ? 187  LYS A CG  1 
ATOM   1251  C CD  . LYS A  1 174  ? 151.488 119.254 180.788 1.00 209.38 ? 187  LYS A CD  1 
ATOM   1252  C CE  . LYS A  1 174  ? 152.160 120.039 179.674 1.00 209.38 ? 187  LYS A CE  1 
ATOM   1253  N NZ  . LYS A  1 174  ? 152.723 119.135 178.632 1.00 209.38 ? 187  LYS A NZ  1 
ATOM   1254  N N   . ASN A  1 175  ? 149.668 123.814 183.483 1.00 198.91 ? 188  ASN A N   1 
ATOM   1255  C CA  . ASN A  1 175  ? 149.844 125.209 183.820 1.00 198.91 ? 188  ASN A CA  1 
ATOM   1256  C C   . ASN A  1 175  ? 151.331 125.518 183.872 1.00 198.91 ? 188  ASN A C   1 
ATOM   1257  O O   . ASN A  1 175  ? 152.156 124.701 184.300 1.00 198.91 ? 188  ASN A O   1 
ATOM   1258  C CB  . ASN A  1 175  ? 149.141 125.542 185.132 1.00 198.91 ? 188  ASN A CB  1 
ATOM   1259  C CG  . ASN A  1 175  ? 147.639 125.323 185.049 1.00 198.91 ? 188  ASN A CG  1 
ATOM   1260  O OD1 . ASN A  1 175  ? 146.943 126.000 184.294 1.00 198.91 ? 188  ASN A OD1 1 
ATOM   1261  N ND2 . ASN A  1 175  ? 147.136 124.366 185.814 1.00 198.91 ? 188  ASN A ND2 1 
ATOM   1262  N N   . LEU A  1 176  ? 151.646 126.723 183.422 1.00 187.42 ? 189  LEU A N   1 
ATOM   1263  C CA  . LEU A  1 176  ? 152.986 127.153 183.063 1.00 187.42 ? 189  LEU A CA  1 
ATOM   1264  C C   . LEU A  1 176  ? 153.258 128.378 183.920 1.00 187.42 ? 189  LEU A C   1 
ATOM   1265  O O   . LEU A  1 176  ? 152.679 129.448 183.703 1.00 187.42 ? 189  LEU A O   1 
ATOM   1266  C CB  . LEU A  1 176  ? 153.051 127.434 181.568 1.00 187.42 ? 189  LEU A CB  1 
ATOM   1267  C CG  . LEU A  1 176  ? 154.354 127.804 180.884 1.00 187.42 ? 189  LEU A CG  1 
ATOM   1268  C CD1 . LEU A  1 176  ? 155.388 126.743 181.114 1.00 187.42 ? 189  LEU A CD1 1 
ATOM   1269  C CD2 . LEU A  1 176  ? 154.106 127.939 179.407 1.00 187.42 ? 189  LEU A CD2 1 
ATOM   1270  N N   . ARG A  1 177  ? 154.100 128.190 184.925 1.00 189.77 ? 190  ARG A N   1 
ATOM   1271  C CA  . ARG A  1 177  ? 154.212 129.094 186.050 1.00 189.77 ? 190  ARG A CA  1 
ATOM   1272  C C   . ARG A  1 177  ? 155.596 129.726 186.071 1.00 189.77 ? 190  ARG A C   1 
ATOM   1273  O O   . ARG A  1 177  ? 156.606 129.027 185.987 1.00 189.77 ? 190  ARG A O   1 
ATOM   1274  C CB  . ARG A  1 177  ? 153.950 128.305 187.330 1.00 189.77 ? 190  ARG A CB  1 
ATOM   1275  N N   . GLU A  1 178  ? 155.642 131.053 186.160 1.00 185.35 ? 191  GLU A N   1 
ATOM   1276  C CA  . GLU A  1 178  ? 156.905 131.770 185.986 1.00 185.35 ? 191  GLU A CA  1 
ATOM   1277  C C   . GLU A  1 178  ? 156.910 132.943 186.946 1.00 185.35 ? 191  GLU A C   1 
ATOM   1278  O O   . GLU A  1 178  ? 156.190 133.916 186.718 1.00 185.35 ? 191  GLU A O   1 
ATOM   1279  C CB  . GLU A  1 178  ? 157.056 132.249 184.554 1.00 185.35 ? 191  GLU A CB  1 
ATOM   1280  C CG  . GLU A  1 178  ? 157.344 131.138 183.588 1.00 185.35 ? 191  GLU A CG  1 
ATOM   1281  C CD  . GLU A  1 178  ? 156.106 130.399 183.130 1.00 185.35 ? 191  GLU A CD  1 
ATOM   1282  O OE1 . GLU A  1 178  ? 154.979 130.864 183.394 1.00 185.35 ? 191  GLU A OE1 1 
ATOM   1283  O OE2 . GLU A  1 178  ? 156.272 129.318 182.544 1.00 185.35 ? 191  GLU A OE2 1 
ATOM   1284  N N   . PHE A  1 179  ? 157.724 132.865 187.996 1.00 180.44 ? 192  PHE A N   1 
ATOM   1285  C CA  . PHE A  1 179  ? 157.543 133.777 189.121 1.00 180.44 ? 192  PHE A CA  1 
ATOM   1286  C C   . PHE A  1 179  ? 158.887 134.181 189.707 1.00 180.44 ? 192  PHE A C   1 
ATOM   1287  O O   . PHE A  1 179  ? 159.618 133.342 190.239 1.00 180.44 ? 192  PHE A O   1 
ATOM   1288  C CB  . PHE A  1 179  ? 156.644 133.125 190.148 1.00 180.44 ? 192  PHE A CB  1 
ATOM   1289  C CG  . PHE A  1 179  ? 155.361 132.649 189.559 1.00 180.44 ? 192  PHE A CG  1 
ATOM   1290  C CD1 . PHE A  1 179  ? 154.492 133.541 188.979 1.00 180.44 ? 192  PHE A CD1 1 
ATOM   1291  C CD2 . PHE A  1 179  ? 155.047 131.318 189.527 1.00 180.44 ? 192  PHE A CD2 1 
ATOM   1292  C CE1 . PHE A  1 179  ? 153.327 133.123 188.408 1.00 180.44 ? 192  PHE A CE1 1 
ATOM   1293  C CE2 . PHE A  1 179  ? 153.870 130.908 188.975 1.00 180.44 ? 192  PHE A CE2 1 
ATOM   1294  C CZ  . PHE A  1 179  ? 153.014 131.803 188.403 1.00 180.44 ? 192  PHE A CZ  1 
ATOM   1295  N N   . VAL A  1 180  ? 159.177 135.474 189.631 1.00 186.51 ? 193  VAL A N   1 
ATOM   1296  C CA  . VAL A  1 180  ? 160.509 135.998 189.876 1.00 186.51 ? 193  VAL A CA  1 
ATOM   1297  C C   . VAL A  1 180  ? 160.513 136.710 191.224 1.00 186.51 ? 193  VAL A C   1 
ATOM   1298  O O   . VAL A  1 180  ? 159.491 136.817 191.896 1.00 186.51 ? 193  VAL A O   1 
ATOM   1299  C CB  . VAL A  1 180  ? 160.964 136.935 188.724 1.00 186.51 ? 193  VAL A CB  1 
ATOM   1300  C CG1 . VAL A  1 180  ? 160.196 138.220 188.763 1.00 186.51 ? 193  VAL A CG1 1 
ATOM   1301  C CG2 . VAL A  1 180  ? 162.457 137.196 188.743 1.00 186.51 ? 193  VAL A CG2 1 
ATOM   1302  N N   . PHE A  1 181  ? 161.686 137.178 191.645 1.00 191.99 ? 194  PHE A N   1 
ATOM   1303  C CA  . PHE A  1 181  ? 161.823 137.890 192.906 1.00 191.99 ? 194  PHE A CA  1 
ATOM   1304  C C   . PHE A  1 181  ? 163.095 138.717 192.883 1.00 191.99 ? 194  PHE A C   1 
ATOM   1305  O O   . PHE A  1 181  ? 164.096 138.303 192.297 1.00 191.99 ? 194  PHE A O   1 
ATOM   1306  C CB  . PHE A  1 181  ? 161.876 136.912 194.065 1.00 191.99 ? 194  PHE A CB  1 
ATOM   1307  C CG  . PHE A  1 181  ? 162.654 135.692 193.752 1.00 191.99 ? 194  PHE A CG  1 
ATOM   1308  C CD1 . PHE A  1 181  ? 164.031 135.707 193.816 1.00 191.99 ? 194  PHE A CD1 1 
ATOM   1309  C CD2 . PHE A  1 181  ? 162.015 134.534 193.362 1.00 191.99 ? 194  PHE A CD2 1 
ATOM   1310  C CE1 . PHE A  1 181  ? 164.759 134.584 193.512 1.00 191.99 ? 194  PHE A CE1 1 
ATOM   1311  C CE2 . PHE A  1 181  ? 162.736 133.403 193.060 1.00 191.99 ? 194  PHE A CE2 1 
ATOM   1312  C CZ  . PHE A  1 181  ? 164.112 133.425 193.135 1.00 191.99 ? 194  PHE A CZ  1 
ATOM   1313  N N   . LYS A  1 182  ? 163.055 139.874 193.535 1.00 175.57 ? 195  LYS A N   1 
ATOM   1314  C CA  . LYS A  1 182  ? 164.246 140.696 193.640 1.00 175.57 ? 195  LYS A CA  1 
ATOM   1315  C C   . LYS A  1 182  ? 164.101 141.652 194.811 1.00 175.57 ? 195  LYS A C   1 
ATOM   1316  O O   . LYS A  1 182  ? 163.000 141.910 195.295 1.00 175.57 ? 195  LYS A O   1 
ATOM   1317  C CB  . LYS A  1 182  ? 164.501 141.470 192.349 1.00 175.57 ? 195  LYS A CB  1 
ATOM   1318  C CG  . LYS A  1 182  ? 163.569 142.641 192.133 1.00 175.57 ? 195  LYS A CG  1 
ATOM   1319  C CD  . LYS A  1 182  ? 163.831 143.299 190.774 1.00 175.57 ? 195  LYS A CD  1 
ATOM   1320  C CE  . LYS A  1 182  ? 165.276 143.763 190.630 1.00 175.57 ? 195  LYS A CE  1 
ATOM   1321  N NZ  . LYS A  1 182  ? 165.463 144.654 189.453 1.00 175.57 ? 195  LYS A NZ  1 
ATOM   1322  N N   . ASN A  1 183  ? 165.235 142.192 195.244 1.00 180.12 ? 196  ASN A N   1 
ATOM   1323  C CA  . ASN A  1 183  ? 165.320 143.077 196.398 1.00 180.12 ? 196  ASN A CA  1 
ATOM   1324  C C   . ASN A  1 183  ? 165.687 144.470 195.911 1.00 180.12 ? 196  ASN A C   1 
ATOM   1325  O O   . ASN A  1 183  ? 166.856 144.739 195.617 1.00 180.12 ? 196  ASN A O   1 
ATOM   1326  C CB  . ASN A  1 183  ? 166.363 142.564 197.383 1.00 180.12 ? 196  ASN A CB  1 
ATOM   1327  C CG  . ASN A  1 183  ? 167.642 142.159 196.694 1.00 180.12 ? 196  ASN A CG  1 
ATOM   1328  O OD1 . ASN A  1 183  ? 167.722 142.188 195.477 1.00 180.12 ? 196  ASN A OD1 1 
ATOM   1329  N ND2 . ASN A  1 183  ? 168.653 141.802 197.463 1.00 180.12 ? 196  ASN A ND2 1 
ATOM   1330  N N   . ILE A  1 184  ? 164.709 145.372 195.854 1.00 179.60 ? 197  ILE A N   1 
ATOM   1331  C CA  . ILE A  1 184  ? 165.004 146.732 195.418 1.00 179.60 ? 197  ILE A CA  1 
ATOM   1332  C C   . ILE A  1 184  ? 165.527 147.527 196.606 1.00 179.60 ? 197  ILE A C   1 
ATOM   1333  O O   . ILE A  1 184  ? 164.811 148.332 197.210 1.00 179.60 ? 197  ILE A O   1 
ATOM   1334  C CB  . ILE A  1 184  ? 163.779 147.400 194.768 1.00 179.60 ? 197  ILE A CB  1 
ATOM   1335  C CG1 . ILE A  1 184  ? 162.565 147.396 195.696 1.00 179.60 ? 197  ILE A CG1 1 
ATOM   1336  C CG2 . ILE A  1 184  ? 163.430 146.690 193.493 1.00 179.60 ? 197  ILE A CG2 1 
ATOM   1337  C CD1 . ILE A  1 184  ? 161.488 148.318 195.244 1.00 179.60 ? 197  ILE A CD1 1 
ATOM   1338  N N   . ASP A  1 185  ? 166.802 147.331 196.919 1.00 184.48 ? 198  ASP A N   1 
ATOM   1339  C CA  . ASP A  1 185  ? 167.421 147.904 198.106 1.00 184.48 ? 198  ASP A CA  1 
ATOM   1340  C C   . ASP A  1 185  ? 166.649 147.498 199.362 1.00 184.48 ? 198  ASP A C   1 
ATOM   1341  O O   . ASP A  1 185  ? 166.300 148.319 200.209 1.00 184.48 ? 198  ASP A O   1 
ATOM   1342  C CB  . ASP A  1 185  ? 167.532 149.427 197.984 1.00 184.48 ? 198  ASP A CB  1 
ATOM   1343  N N   . GLY A  1 186  ? 166.388 146.196 199.470 1.00 183.33 ? 199  GLY A N   1 
ATOM   1344  C CA  . GLY A  1 186  ? 165.774 145.648 200.665 1.00 183.33 ? 199  GLY A CA  1 
ATOM   1345  C C   . GLY A  1 186  ? 164.268 145.552 200.648 1.00 183.33 ? 199  GLY A C   1 
ATOM   1346  O O   . GLY A  1 186  ? 163.648 145.556 201.714 1.00 183.33 ? 199  GLY A O   1 
ATOM   1347  N N   . TYR A  1 187  ? 163.654 145.472 199.472 1.00 177.46 ? 200  TYR A N   1 
ATOM   1348  C CA  . TYR A  1 187  ? 162.210 145.340 199.338 1.00 177.46 ? 200  TYR A CA  1 
ATOM   1349  C C   . TYR A  1 187  ? 161.934 144.447 198.147 1.00 177.46 ? 200  TYR A C   1 
ATOM   1350  O O   . TYR A  1 187  ? 162.616 144.557 197.126 1.00 177.46 ? 200  TYR A O   1 
ATOM   1351  C CB  . TYR A  1 187  ? 161.561 146.697 199.149 1.00 177.46 ? 200  TYR A CB  1 
ATOM   1352  C CG  . TYR A  1 187  ? 162.148 147.713 200.047 1.00 177.46 ? 200  TYR A CG  1 
ATOM   1353  C CD1 . TYR A  1 187  ? 161.819 147.741 201.375 1.00 177.46 ? 200  TYR A CD1 1 
ATOM   1354  C CD2 . TYR A  1 187  ? 163.080 148.608 199.584 1.00 177.46 ? 200  TYR A CD2 1 
ATOM   1355  C CE1 . TYR A  1 187  ? 162.378 148.645 202.224 1.00 177.46 ? 200  TYR A CE1 1 
ATOM   1356  C CE2 . TYR A  1 187  ? 163.641 149.533 200.418 1.00 177.46 ? 200  TYR A CE2 1 
ATOM   1357  C CZ  . TYR A  1 187  ? 163.287 149.550 201.744 1.00 177.46 ? 200  TYR A CZ  1 
ATOM   1358  O OH  . TYR A  1 187  ? 163.849 150.478 202.592 1.00 177.46 ? 200  TYR A OH  1 
ATOM   1359  N N   . PHE A  1 188  ? 160.956 143.562 198.268 1.00 183.07 ? 201  PHE A N   1 
ATOM   1360  C CA  . PHE A  1 188  ? 160.855 142.470 197.310 1.00 183.07 ? 201  PHE A CA  1 
ATOM   1361  C C   . PHE A  1 188  ? 159.885 142.781 196.184 1.00 183.07 ? 201  PHE A C   1 
ATOM   1362  O O   . PHE A  1 188  ? 158.672 142.596 196.323 1.00 183.07 ? 201  PHE A O   1 
ATOM   1363  C CB  . PHE A  1 188  ? 160.479 141.186 198.020 1.00 183.07 ? 201  PHE A CB  1 
ATOM   1364  C CG  . PHE A  1 188  ? 161.659 140.400 198.408 1.00 183.07 ? 201  PHE A CG  1 
ATOM   1365  C CD1 . PHE A  1 188  ? 162.900 141.006 198.439 1.00 183.07 ? 201  PHE A CD1 1 
ATOM   1366  C CD2 . PHE A  1 188  ? 161.553 139.065 198.725 1.00 183.07 ? 201  PHE A CD2 1 
ATOM   1367  C CE1 . PHE A  1 188  ? 164.011 140.297 198.786 1.00 183.07 ? 201  PHE A CE1 1 
ATOM   1368  C CE2 . PHE A  1 188  ? 162.665 138.346 199.080 1.00 183.07 ? 201  PHE A CE2 1 
ATOM   1369  C CZ  . PHE A  1 188  ? 163.897 138.965 199.112 1.00 183.07 ? 201  PHE A CZ  1 
ATOM   1370  N N   . LYS A  1 189  ? 160.440 143.185 195.045 1.00 177.17 ? 202  LYS A N   1 
ATOM   1371  C CA  . LYS A  1 189  ? 159.685 143.285 193.809 1.00 177.17 ? 202  LYS A CA  1 
ATOM   1372  C C   . LYS A  1 189  ? 159.634 141.916 193.169 1.00 177.17 ? 202  LYS A C   1 
ATOM   1373  O O   . LYS A  1 189  ? 160.670 141.328 192.852 1.00 177.17 ? 202  LYS A O   1 
ATOM   1374  C CB  . LYS A  1 189  ? 160.296 144.298 192.847 1.00 177.17 ? 202  LYS A CB  1 
ATOM   1375  C CG  . LYS A  1 189  ? 160.023 145.722 193.246 1.00 177.17 ? 202  LYS A CG  1 
ATOM   1376  C CD  . LYS A  1 189  ? 158.550 145.906 193.544 1.00 177.17 ? 202  LYS A CD  1 
ATOM   1377  C CE  . LYS A  1 189  ? 157.686 145.651 192.325 1.00 177.17 ? 202  LYS A CE  1 
ATOM   1378  N NZ  . LYS A  1 189  ? 156.247 145.693 192.697 1.00 177.17 ? 202  LYS A NZ  1 
ATOM   1379  N N   . ILE A  1 190  ? 158.428 141.404 193.007 1.00 174.17 ? 203  ILE A N   1 
ATOM   1380  C CA  . ILE A  1 190  ? 158.224 140.102 192.413 1.00 174.17 ? 203  ILE A CA  1 
ATOM   1381  C C   . ILE A  1 190  ? 157.261 140.270 191.256 1.00 174.17 ? 203  ILE A C   1 
ATOM   1382  O O   . ILE A  1 190  ? 156.459 141.204 191.211 1.00 174.17 ? 203  ILE A O   1 
ATOM   1383  C CB  . ILE A  1 190  ? 157.678 139.090 193.423 1.00 174.17 ? 203  ILE A CB  1 
ATOM   1384  C CG1 . ILE A  1 190  ? 156.226 139.423 193.729 1.00 174.17 ? 203  ILE A CG1 1 
ATOM   1385  C CG2 . ILE A  1 190  ? 158.502 139.130 194.685 1.00 174.17 ? 203  ILE A CG2 1 
ATOM   1386  C CD1 . ILE A  1 190  ? 155.466 138.275 194.302 1.00 174.17 ? 203  ILE A CD1 1 
ATOM   1387  N N   . TYR A  1 191  ? 157.362 139.354 190.307 1.00 169.80 ? 204  TYR A N   1 
ATOM   1388  C CA  . TYR A  1 191  ? 156.525 139.372 189.124 1.00 169.80 ? 204  TYR A CA  1 
ATOM   1389  C C   . TYR A  1 191  ? 155.977 137.980 188.876 1.00 169.80 ? 204  TYR A C   1 
ATOM   1390  O O   . TYR A  1 191  ? 156.642 136.973 189.149 1.00 169.80 ? 204  TYR A O   1 
ATOM   1391  C CB  . TYR A  1 191  ? 157.291 139.841 187.900 1.00 169.80 ? 204  TYR A CB  1 
ATOM   1392  C CG  . TYR A  1 191  ? 157.534 141.315 187.828 1.00 169.80 ? 204  TYR A CG  1 
ATOM   1393  C CD1 . TYR A  1 191  ? 158.490 141.919 188.620 1.00 169.80 ? 204  TYR A CD1 1 
ATOM   1394  C CD2 . TYR A  1 191  ? 156.832 142.098 186.938 1.00 169.80 ? 204  TYR A CD2 1 
ATOM   1395  C CE1 . TYR A  1 191  ? 158.719 143.269 188.541 1.00 169.80 ? 204  TYR A CE1 1 
ATOM   1396  C CE2 . TYR A  1 191  ? 157.057 143.446 186.840 1.00 169.80 ? 204  TYR A CE2 1 
ATOM   1397  C CZ  . TYR A  1 191  ? 158.003 144.028 187.644 1.00 169.80 ? 204  TYR A CZ  1 
ATOM   1398  O OH  . TYR A  1 191  ? 158.244 145.376 187.558 1.00 169.80 ? 204  TYR A OH  1 
ATOM   1399  N N   . SER A  1 192  ? 154.767 137.942 188.323 1.00 171.84 ? 205  SER A N   1 
ATOM   1400  C CA  . SER A  1 192  ? 154.032 136.706 188.134 1.00 171.84 ? 205  SER A CA  1 
ATOM   1401  C C   . SER A  1 192  ? 153.383 136.676 186.764 1.00 171.84 ? 205  SER A C   1 
ATOM   1402  O O   . SER A  1 192  ? 153.228 137.700 186.097 1.00 171.84 ? 205  SER A O   1 
ATOM   1403  C CB  . SER A  1 192  ? 152.939 136.529 189.184 1.00 171.84 ? 205  SER A CB  1 
ATOM   1404  O OG  . SER A  1 192  ? 151.923 135.680 188.682 1.00 171.84 ? 205  SER A OG  1 
ATOM   1405  N N   . LYS A  1 193  ? 152.996 135.470 186.365 1.00 174.87 ? 206  LYS A N   1 
ATOM   1406  C CA  . LYS A  1 193  ? 152.070 135.261 185.264 1.00 174.87 ? 206  LYS A CA  1 
ATOM   1407  C C   . LYS A  1 193  ? 151.636 133.810 185.277 1.00 174.87 ? 206  LYS A C   1 
ATOM   1408  O O   . LYS A  1 193  ? 152.440 132.921 185.557 1.00 174.87 ? 206  LYS A O   1 
ATOM   1409  C CB  . LYS A  1 193  ? 152.686 135.596 183.903 1.00 174.87 ? 206  LYS A CB  1 
ATOM   1410  C CG  . LYS A  1 193  ? 151.687 135.468 182.763 1.00 174.87 ? 206  LYS A CG  1 
ATOM   1411  C CD  . LYS A  1 193  ? 152.237 136.013 181.475 1.00 174.87 ? 206  LYS A CD  1 
ATOM   1412  C CE  . LYS A  1 193  ? 153.466 135.241 181.071 1.00 174.87 ? 206  LYS A CE  1 
ATOM   1413  N NZ  . LYS A  1 193  ? 153.183 133.791 181.010 1.00 174.87 ? 206  LYS A NZ  1 
ATOM   1414  N N   . HIS A  1 194  ? 150.375 133.582 184.963 1.00 182.76 ? 207  HIS A N   1 
ATOM   1415  C CA  . HIS A  1 194  ? 149.869 132.246 184.710 1.00 182.76 ? 207  HIS A CA  1 
ATOM   1416  C C   . HIS A  1 194  ? 149.902 132.048 183.204 1.00 182.76 ? 207  HIS A C   1 
ATOM   1417  O O   . HIS A  1 194  ? 149.595 132.973 182.448 1.00 182.76 ? 207  HIS A O   1 
ATOM   1418  C CB  . HIS A  1 194  ? 148.462 132.083 185.267 1.00 182.76 ? 207  HIS A CB  1 
ATOM   1419  C CG  . HIS A  1 194  ? 147.918 130.705 185.106 1.00 182.76 ? 207  HIS A CG  1 
ATOM   1420  N ND1 . HIS A  1 194  ? 148.642 129.584 185.442 1.00 182.76 ? 207  HIS A ND1 1 
ATOM   1421  C CD2 . HIS A  1 194  ? 146.722 130.262 184.654 1.00 182.76 ? 207  HIS A CD2 1 
ATOM   1422  C CE1 . HIS A  1 194  ? 147.916 128.509 185.200 1.00 182.76 ? 207  HIS A CE1 1 
ATOM   1423  N NE2 . HIS A  1 194  ? 146.747 128.891 184.722 1.00 182.76 ? 207  HIS A NE2 1 
ATOM   1424  N N   . THR A  1 195  ? 150.303 130.863 182.761 1.00 189.84 ? 208  THR A N   1 
ATOM   1425  C CA  . THR A  1 195  ? 150.393 130.618 181.338 1.00 189.84 ? 208  THR A CA  1 
ATOM   1426  C C   . THR A  1 195  ? 149.795 129.260 181.024 1.00 189.84 ? 208  THR A C   1 
ATOM   1427  O O   . THR A  1 195  ? 149.925 128.343 181.846 1.00 189.84 ? 208  THR A O   1 
ATOM   1428  C CB  . THR A  1 195  ? 151.847 130.672 180.902 1.00 189.84 ? 208  THR A CB  1 
ATOM   1429  O OG1 . THR A  1 195  ? 152.443 131.859 181.429 1.00 189.84 ? 208  THR A OG1 1 
ATOM   1430  C CG2 . THR A  1 195  ? 151.936 130.712 179.399 1.00 189.84 ? 208  THR A CG2 1 
ATOM   1431  N N   . PRO A  1 196  ? 149.113 129.071 179.900 1.00 185.60 ? 209  PRO A N   1 
ATOM   1432  C CA  . PRO A  1 196  ? 148.752 127.709 179.501 1.00 185.60 ? 209  PRO A CA  1 
ATOM   1433  C C   . PRO A  1 196  ? 149.988 126.958 179.041 1.00 185.60 ? 209  PRO A C   1 
ATOM   1434  O O   . PRO A  1 196  ? 150.966 127.557 178.592 1.00 185.60 ? 209  PRO A O   1 
ATOM   1435  C CB  . PRO A  1 196  ? 147.753 127.921 178.360 1.00 185.60 ? 209  PRO A CB  1 
ATOM   1436  C CG  . PRO A  1 196  ? 148.063 129.273 177.842 1.00 185.60 ? 209  PRO A CG  1 
ATOM   1437  C CD  . PRO A  1 196  ? 148.518 130.082 179.014 1.00 185.60 ? 209  PRO A CD  1 
ATOM   1438  N N   . ILE A  1 197  ? 149.948 125.638 179.166 1.00 197.66 ? 210  ILE A N   1 
ATOM   1439  C CA  . ILE A  1 197  ? 151.052 124.787 178.756 1.00 197.66 ? 210  ILE A CA  1 
ATOM   1440  C C   . ILE A  1 197  ? 150.460 123.506 178.206 1.00 197.66 ? 210  ILE A C   1 
ATOM   1441  O O   . ILE A  1 197  ? 149.575 122.908 178.824 1.00 197.66 ? 210  ILE A O   1 
ATOM   1442  C CB  . ILE A  1 197  ? 152.012 124.476 179.917 1.00 197.66 ? 210  ILE A CB  1 
ATOM   1443  N N   . ASN A  1 198  ? 150.912 123.114 177.025 1.00 210.37 ? 211  ASN A N   1 
ATOM   1444  C CA  . ASN A  1 198  ? 150.591 121.816 176.465 1.00 210.37 ? 211  ASN A CA  1 
ATOM   1445  C C   . ASN A  1 198  ? 151.766 121.169 175.760 1.00 210.37 ? 211  ASN A C   1 
ATOM   1446  O O   . ASN A  1 198  ? 151.657 120.005 175.364 1.00 210.37 ? 211  ASN A O   1 
ATOM   1447  C CB  . ASN A  1 198  ? 149.401 121.921 175.503 1.00 210.37 ? 211  ASN A CB  1 
ATOM   1448  C CG  . ASN A  1 198  ? 148.098 122.142 176.230 1.00 210.37 ? 211  ASN A CG  1 
ATOM   1449  O OD1 . ASN A  1 198  ? 147.510 123.217 176.165 1.00 210.37 ? 211  ASN A OD1 1 
ATOM   1450  N ND2 . ASN A  1 198  ? 147.634 121.116 176.928 1.00 210.37 ? 211  ASN A ND2 1 
ATOM   1451  N N   . LEU A  1 199  ? 152.879 121.877 175.592 1.00 210.88 ? 212  LEU A N   1 
ATOM   1452  C CA  . LEU A  1 199  ? 154.127 121.314 175.091 1.00 210.88 ? 212  LEU A CA  1 
ATOM   1453  C C   . LEU A  1 199  ? 155.177 121.575 176.166 1.00 210.88 ? 212  LEU A C   1 
ATOM   1454  O O   . LEU A  1 199  ? 155.779 122.650 176.210 1.00 210.88 ? 212  LEU A O   1 
ATOM   1455  C CB  . LEU A  1 199  ? 154.515 121.926 173.751 1.00 210.88 ? 212  LEU A CB  1 
ATOM   1456  N N   . VAL A  1 200  ? 155.384 120.594 177.040 1.00 210.85 ? 213  VAL A N   1 
ATOM   1457  C CA  . VAL A  1 200  ? 156.295 120.741 178.167 1.00 210.85 ? 213  VAL A CA  1 
ATOM   1458  C C   . VAL A  1 200  ? 157.628 120.036 177.913 1.00 210.85 ? 213  VAL A C   1 
ATOM   1459  O O   . VAL A  1 200  ? 158.397 119.818 178.846 1.00 210.85 ? 213  VAL A O   1 
ATOM   1460  C CB  . VAL A  1 200  ? 155.657 120.254 179.476 1.00 210.85 ? 213  VAL A CB  1 
ATOM   1461  N N   . ARG A  1 201  ? 157.917 119.676 176.666 1.00 205.75 ? 214  ARG A N   1 
ATOM   1462  C CA  . ARG A  1 201  ? 159.177 118.999 176.395 1.00 205.75 ? 214  ARG A CA  1 
ATOM   1463  C C   . ARG A  1 201  ? 160.348 119.969 176.454 1.00 205.75 ? 214  ARG A C   1 
ATOM   1464  O O   . ARG A  1 201  ? 161.440 119.601 176.897 1.00 205.75 ? 214  ARG A O   1 
ATOM   1465  C CB  . ARG A  1 201  ? 159.122 118.303 175.038 1.00 205.75 ? 214  ARG A CB  1 
ATOM   1466  N N   . ASP A  1 202  ? 160.143 121.211 176.026 1.00 204.10 ? 215  ASP A N   1 
ATOM   1467  C CA  . ASP A  1 202  ? 161.225 122.186 176.000 1.00 204.10 ? 215  ASP A CA  1 
ATOM   1468  C C   . ASP A  1 202  ? 160.654 123.563 176.301 1.00 204.10 ? 215  ASP A C   1 
ATOM   1469  O O   . ASP A  1 202  ? 159.456 123.807 176.150 1.00 204.10 ? 215  ASP A O   1 
ATOM   1470  C CB  . ASP A  1 202  ? 161.958 122.172 174.656 1.00 204.10 ? 215  ASP A CB  1 
ATOM   1471  N N   . LEU A  1 203  ? 161.539 124.462 176.730 1.00 196.33 ? 216  LEU A N   1 
ATOM   1472  C CA  . LEU A  1 203  ? 161.128 125.778 177.194 1.00 196.33 ? 216  LEU A CA  1 
ATOM   1473  C C   . LEU A  1 203  ? 160.386 126.515 176.088 1.00 196.33 ? 216  LEU A C   1 
ATOM   1474  O O   . LEU A  1 203  ? 160.849 126.529 174.943 1.00 196.33 ? 216  LEU A O   1 
ATOM   1475  C CB  . LEU A  1 203  ? 162.338 126.589 177.652 1.00 196.33 ? 216  LEU A CB  1 
ATOM   1476  C CG  . LEU A  1 203  ? 162.677 126.400 179.132 1.00 196.33 ? 216  LEU A CG  1 
ATOM   1477  C CD1 . LEU A  1 203  ? 163.848 127.262 179.553 1.00 196.33 ? 216  LEU A CD1 1 
ATOM   1478  C CD2 . LEU A  1 203  ? 161.471 126.711 179.995 1.00 196.33 ? 216  LEU A CD2 1 
ATOM   1479  N N   . PRO A  1 204  ? 159.257 127.137 176.383 1.00 192.11 ? 217  PRO A N   1 
ATOM   1480  C CA  . PRO A  1 204  ? 158.385 127.635 175.325 1.00 192.11 ? 217  PRO A CA  1 
ATOM   1481  C C   . PRO A  1 204  ? 158.930 128.917 174.720 1.00 192.11 ? 217  PRO A C   1 
ATOM   1482  O O   . PRO A  1 204  ? 159.752 129.620 175.307 1.00 192.11 ? 217  PRO A O   1 
ATOM   1483  C CB  . PRO A  1 204  ? 157.072 127.890 176.061 1.00 192.11 ? 217  PRO A CB  1 
ATOM   1484  C CG  . PRO A  1 204  ? 157.514 128.310 177.402 1.00 192.11 ? 217  PRO A CG  1 
ATOM   1485  C CD  . PRO A  1 204  ? 158.781 127.547 177.710 1.00 192.11 ? 217  PRO A CD  1 
ATOM   1486  N N   . GLN A  1 205  ? 158.442 129.211 173.524 1.00 176.09 ? 218  GLN A N   1 
ATOM   1487  C CA  . GLN A  1 205  ? 158.765 130.455 172.847 1.00 176.09 ? 218  GLN A CA  1 
ATOM   1488  C C   . GLN A  1 205  ? 157.821 131.536 173.378 1.00 176.09 ? 218  GLN A C   1 
ATOM   1489  O O   . GLN A  1 205  ? 157.278 131.412 174.478 1.00 176.09 ? 218  GLN A O   1 
ATOM   1490  C CB  . GLN A  1 205  ? 158.703 130.259 171.326 1.00 176.09 ? 218  GLN A CB  1 
ATOM   1491  C CG  . GLN A  1 205  ? 159.721 131.116 170.584 1.00 176.09 ? 218  GLN A CG  1 
ATOM   1492  C CD  . GLN A  1 205  ? 159.610 131.022 169.085 1.00 176.09 ? 218  GLN A CD  1 
ATOM   1493  O OE1 . GLN A  1 205  ? 159.229 129.989 168.545 1.00 176.09 ? 218  GLN A OE1 1 
ATOM   1494  N NE2 . GLN A  1 205  ? 159.938 132.110 168.400 1.00 176.09 ? 218  GLN A NE2 1 
ATOM   1495  N N   . GLY A  1 206  ? 157.645 132.622 172.637 1.00 163.47 ? 219  GLY A N   1 
ATOM   1496  C CA  . GLY A  1 206  ? 156.745 133.679 173.040 1.00 163.47 ? 219  GLY A CA  1 
ATOM   1497  C C   . GLY A  1 206  ? 157.385 134.632 174.028 1.00 163.47 ? 219  GLY A C   1 
ATOM   1498  O O   . GLY A  1 206  ? 158.291 134.287 174.786 1.00 163.47 ? 219  GLY A O   1 
ATOM   1499  N N   . PHE A  1 207  ? 156.900 135.866 174.015 1.00 151.10 ? 220  PHE A N   1 
ATOM   1500  C CA  . PHE A  1 207  ? 157.392 136.859 174.954 1.00 151.10 ? 220  PHE A CA  1 
ATOM   1501  C C   . PHE A  1 207  ? 156.217 137.521 175.644 1.00 151.10 ? 220  PHE A C   1 
ATOM   1502  O O   . PHE A  1 207  ? 155.317 138.038 174.978 1.00 151.10 ? 220  PHE A O   1 
ATOM   1503  C CB  . PHE A  1 207  ? 158.253 137.912 174.263 1.00 151.10 ? 220  PHE A CB  1 
ATOM   1504  C CG  . PHE A  1 207  ? 159.151 138.661 175.203 1.00 151.10 ? 220  PHE A CG  1 
ATOM   1505  C CD1 . PHE A  1 207  ? 160.110 137.995 175.930 1.00 151.10 ? 220  PHE A CD1 1 
ATOM   1506  C CD2 . PHE A  1 207  ? 159.043 140.029 175.356 1.00 151.10 ? 220  PHE A CD2 1 
ATOM   1507  C CE1 . PHE A  1 207  ? 160.940 138.669 176.795 1.00 151.10 ? 220  PHE A CE1 1 
ATOM   1508  C CE2 . PHE A  1 207  ? 159.880 140.709 176.223 1.00 151.10 ? 220  PHE A CE2 1 
ATOM   1509  C CZ  . PHE A  1 207  ? 160.830 140.025 176.934 1.00 151.10 ? 220  PHE A CZ  1 
ATOM   1510  N N   . SER A  1 208  ? 156.230 137.498 176.975 1.00 162.33 ? 221  SER A N   1 
ATOM   1511  C CA  . SER A  1 208  ? 155.216 138.186 177.769 1.00 162.33 ? 221  SER A CA  1 
ATOM   1512  C C   . SER A  1 208  ? 155.815 138.536 179.115 1.00 162.33 ? 221  SER A C   1 
ATOM   1513  O O   . SER A  1 208  ? 156.088 137.642 179.918 1.00 162.33 ? 221  SER A O   1 
ATOM   1514  C CB  . SER A  1 208  ? 153.977 137.333 177.966 1.00 162.33 ? 221  SER A CB  1 
ATOM   1515  O OG  . SER A  1 208  ? 153.275 137.781 179.113 1.00 162.33 ? 221  SER A OG  1 
ATOM   1516  N N   . ALA A  1 209  ? 155.996 139.822 179.370 1.00 163.01 ? 222  ALA A N   1 
ATOM   1517  C CA  . ALA A  1 209  ? 156.500 140.242 180.660 1.00 163.01 ? 222  ALA A CA  1 
ATOM   1518  C C   . ALA A  1 209  ? 155.471 139.935 181.738 1.00 163.01 ? 222  ALA A C   1 
ATOM   1519  O O   . ALA A  1 209  ? 154.347 139.500 181.470 1.00 163.01 ? 222  ALA A O   1 
ATOM   1520  C CB  . ALA A  1 209  ? 156.854 141.724 180.639 1.00 163.01 ? 222  ALA A CB  1 
ATOM   1521  N N   . LEU A  1 210  ? 155.867 140.175 182.976 1.00 171.18 ? 223  LEU A N   1 
ATOM   1522  C CA  . LEU A  1 210  ? 155.057 139.856 184.133 1.00 171.18 ? 223  LEU A CA  1 
ATOM   1523  C C   . LEU A  1 210  ? 154.631 141.155 184.794 1.00 171.18 ? 223  LEU A C   1 
ATOM   1524  O O   . LEU A  1 210  ? 155.261 142.197 184.599 1.00 171.18 ? 223  LEU A O   1 
ATOM   1525  C CB  . LEU A  1 210  ? 155.833 138.981 185.106 1.00 171.18 ? 223  LEU A CB  1 
ATOM   1526  C CG  . LEU A  1 210  ? 156.166 137.546 184.695 1.00 171.18 ? 223  LEU A CG  1 
ATOM   1527  C CD1 . LEU A  1 210  ? 157.190 137.504 183.593 1.00 171.18 ? 223  LEU A CD1 1 
ATOM   1528  C CD2 . LEU A  1 210  ? 156.714 136.795 185.865 1.00 171.18 ? 223  LEU A CD2 1 
ATOM   1529  N N   . GLU A  1 211  ? 153.577 141.106 185.503 1.00 174.72 ? 224  GLU A N   1 
ATOM   1530  C CA  . GLU A  1 211  ? 153.319 142.394 186.124 1.00 174.72 ? 224  GLU A CA  1 
ATOM   1531  C C   . GLU A  1 211  ? 153.773 142.371 187.575 1.00 174.72 ? 224  GLU A C   1 
ATOM   1532  O O   . GLU A  1 211  ? 153.830 141.307 188.195 1.00 174.72 ? 224  GLU A O   1 
ATOM   1533  C CB  . GLU A  1 211  ? 151.839 142.735 186.053 1.00 174.72 ? 224  GLU A CB  1 
ATOM   1534  C CG  . GLU A  1 211  ? 150.967 141.873 186.922 1.00 174.72 ? 224  GLU A CG  1 
ATOM   1535  C CD  . GLU A  1 211  ? 150.581 140.584 186.240 1.00 174.72 ? 224  GLU A CD  1 
ATOM   1536  O OE1 . GLU A  1 211  ? 151.468 139.947 185.635 1.00 174.72 ? 224  GLU A OE1 1 
ATOM   1537  O OE2 . GLU A  1 211  ? 149.392 140.212 186.297 1.00 174.72 ? 224  GLU A OE2 1 
ATOM   1538  N N   . PRO A  1 212  ? 154.137 143.517 188.137 1.00 177.12 ? 225  PRO A N   1 
ATOM   1539  C CA  . PRO A  1 212  ? 154.624 143.524 189.518 1.00 177.12 ? 225  PRO A CA  1 
ATOM   1540  C C   . PRO A  1 212  ? 153.479 143.308 190.483 1.00 177.12 ? 225  PRO A C   1 
ATOM   1541  O O   . PRO A  1 212  ? 152.375 143.817 190.289 1.00 177.12 ? 225  PRO A O   1 
ATOM   1542  C CB  . PRO A  1 212  ? 155.224 144.922 189.672 1.00 177.12 ? 225  PRO A CB  1 
ATOM   1543  C CG  . PRO A  1 212  ? 154.417 145.750 188.755 1.00 177.12 ? 225  PRO A CG  1 
ATOM   1544  C CD  . PRO A  1 212  ? 154.072 144.875 187.577 1.00 177.12 ? 225  PRO A CD  1 
ATOM   1545  N N   . LEU A  1 213  ? 153.743 142.549 191.538 1.00 175.08 ? 226  LEU A N   1 
ATOM   1546  C CA  . LEU A  1 213  ? 152.684 142.211 192.467 1.00 175.08 ? 226  LEU A CA  1 
ATOM   1547  C C   . LEU A  1 213  ? 152.878 142.858 193.829 1.00 175.08 ? 226  LEU A C   1 
ATOM   1548  O O   . LEU A  1 213  ? 151.960 143.515 194.319 1.00 175.08 ? 226  LEU A O   1 
ATOM   1549  C CB  . LEU A  1 213  ? 152.558 140.696 192.606 1.00 175.08 ? 226  LEU A CB  1 
ATOM   1550  C CG  . LEU A  1 213  ? 151.222 140.324 193.237 1.00 175.08 ? 226  LEU A CG  1 
ATOM   1551  C CD1 . LEU A  1 213  ? 150.120 141.201 192.684 1.00 175.08 ? 226  LEU A CD1 1 
ATOM   1552  C CD2 . LEU A  1 213  ? 150.913 138.876 192.953 1.00 175.08 ? 226  LEU A CD2 1 
ATOM   1553  N N   . VAL A  1 214  ? 154.039 142.694 194.465 1.00 183.32 ? 227  VAL A N   1 
ATOM   1554  C CA  . VAL A  1 214  ? 154.207 143.122 195.847 1.00 183.32 ? 227  VAL A CA  1 
ATOM   1555  C C   . VAL A  1 214  ? 155.581 143.726 196.074 1.00 183.32 ? 227  VAL A C   1 
ATOM   1556  O O   . VAL A  1 214  ? 156.427 143.779 195.180 1.00 183.32 ? 227  VAL A O   1 
ATOM   1557  C CB  . VAL A  1 214  ? 154.019 141.968 196.846 1.00 183.32 ? 227  VAL A CB  1 
ATOM   1558  C CG1 . VAL A  1 214  ? 152.669 141.288 196.656 1.00 183.32 ? 227  VAL A CG1 1 
ATOM   1559  C CG2 . VAL A  1 214  ? 155.159 140.992 196.706 1.00 183.32 ? 227  VAL A CG2 1 
ATOM   1560  N N   . ASP A  1 215  ? 155.784 144.177 197.308 1.00 182.19 ? 228  ASP A N   1 
ATOM   1561  C CA  . ASP A  1 215  ? 157.044 144.709 197.793 1.00 182.19 ? 228  ASP A CA  1 
ATOM   1562  C C   . ASP A  1 215  ? 156.985 144.773 199.308 1.00 182.19 ? 228  ASP A C   1 
ATOM   1563  O O   . ASP A  1 215  ? 156.005 145.272 199.865 1.00 182.19 ? 228  ASP A O   1 
ATOM   1564  C CB  . ASP A  1 215  ? 157.309 146.098 197.230 1.00 182.19 ? 228  ASP A CB  1 
ATOM   1565  C CG  . ASP A  1 215  ? 158.579 146.696 197.760 1.00 182.19 ? 228  ASP A CG  1 
ATOM   1566  O OD1 . ASP A  1 215  ? 158.598 147.134 198.930 1.00 182.19 ? 228  ASP A OD1 1 
ATOM   1567  O OD2 . ASP A  1 215  ? 159.561 146.725 196.999 1.00 182.19 ? 228  ASP A OD2 1 
ATOM   1568  N N   . LEU A  1 216  ? 158.029 144.294 199.981 1.00 182.34 ? 229  LEU A N   1 
ATOM   1569  C CA  . LEU A  1 216  ? 157.969 144.286 201.437 1.00 182.34 ? 229  LEU A CA  1 
ATOM   1570  C C   . LEU A  1 216  ? 159.310 144.646 202.059 1.00 182.34 ? 229  LEU A C   1 
ATOM   1571  O O   . LEU A  1 216  ? 160.366 144.258 201.542 1.00 182.34 ? 229  LEU A O   1 
ATOM   1572  C CB  . LEU A  1 216  ? 157.492 142.929 201.967 1.00 182.34 ? 229  LEU A CB  1 
ATOM   1573  C CG  . LEU A  1 216  ? 155.969 142.804 201.892 1.00 182.34 ? 229  LEU A CG  1 
ATOM   1574  C CD1 . LEU A  1 216  ? 155.490 141.447 202.349 1.00 182.34 ? 229  LEU A CD1 1 
ATOM   1575  C CD2 . LEU A  1 216  ? 155.314 143.902 202.707 1.00 182.34 ? 229  LEU A CD2 1 
ATOM   1576  N N   . PRO A  1 217  ? 159.291 145.381 203.159 1.00 187.77 ? 230  PRO A N   1 
ATOM   1577  C CA  . PRO A  1 217  ? 160.520 145.993 203.679 1.00 187.77 ? 230  PRO A CA  1 
ATOM   1578  C C   . PRO A  1 217  ? 161.379 145.081 204.526 1.00 187.77 ? 230  PRO A C   1 
ATOM   1579  O O   . PRO A  1 217  ? 161.245 145.081 205.751 1.00 187.77 ? 230  PRO A O   1 
ATOM   1580  C CB  . PRO A  1 217  ? 159.998 147.167 204.520 1.00 187.77 ? 230  PRO A CB  1 
ATOM   1581  C CG  . PRO A  1 217  ? 158.511 147.150 204.375 1.00 187.77 ? 230  PRO A CG  1 
ATOM   1582  C CD  . PRO A  1 217  ? 158.117 145.792 203.932 1.00 187.77 ? 230  PRO A CD  1 
ATOM   1583  N N   . ILE A  1 218  ? 162.277 144.319 203.915 1.00 198.04 ? 231  ILE A N   1 
ATOM   1584  C CA  . ILE A  1 218  ? 163.030 143.342 204.690 1.00 198.04 ? 231  ILE A CA  1 
ATOM   1585  C C   . ILE A  1 218  ? 164.115 144.007 205.540 1.00 198.04 ? 231  ILE A C   1 
ATOM   1586  O O   . ILE A  1 218  ? 164.051 143.963 206.772 1.00 198.04 ? 231  ILE A O   1 
ATOM   1587  C CB  . ILE A  1 218  ? 163.588 142.234 203.770 1.00 198.04 ? 231  ILE A CB  1 
ATOM   1588  C CG1 . ILE A  1 218  ? 164.531 142.781 202.693 1.00 198.04 ? 231  ILE A CG1 1 
ATOM   1589  C CG2 . ILE A  1 218  ? 162.440 141.477 203.118 1.00 198.04 ? 231  ILE A CG2 1 
ATOM   1590  C CD1 . ILE A  1 218  ? 165.007 141.742 201.713 1.00 198.04 ? 231  ILE A CD1 1 
ATOM   1591  N N   . GLY A  1 219  ? 165.095 144.654 204.917 1.00 206.33 ? 232  GLY A N   1 
ATOM   1592  C CA  . GLY A  1 219  ? 166.189 145.249 205.658 1.00 206.33 ? 232  GLY A CA  1 
ATOM   1593  C C   . GLY A  1 219  ? 167.462 144.432 205.739 1.00 206.33 ? 232  GLY A C   1 
ATOM   1594  O O   . GLY A  1 219  ? 168.420 144.878 206.382 1.00 206.33 ? 232  GLY A O   1 
ATOM   1595  N N   . ILE A  1 220  ? 167.510 143.252 205.112 1.00 209.08 ? 233  ILE A N   1 
ATOM   1596  C CA  . ILE A  1 220  ? 168.740 142.482 204.928 1.00 209.08 ? 233  ILE A CA  1 
ATOM   1597  C C   . ILE A  1 220  ? 168.779 141.930 203.503 1.00 209.08 ? 233  ILE A C   1 
ATOM   1598  O O   . ILE A  1 220  ? 167.910 142.215 202.674 1.00 209.08 ? 233  ILE A O   1 
ATOM   1599  C CB  . ILE A  1 220  ? 168.900 141.341 205.958 1.00 209.08 ? 233  ILE A CB  1 
ATOM   1600  C CG1 . ILE A  1 220  ? 167.627 140.511 206.070 1.00 209.08 ? 233  ILE A CG1 1 
ATOM   1601  C CG2 . ILE A  1 220  ? 169.326 141.882 207.303 1.00 209.08 ? 233  ILE A CG2 1 
ATOM   1602  C CD1 . ILE A  1 220  ? 167.853 139.220 206.775 1.00 209.08 ? 233  ILE A CD1 1 
ATOM   1603  N N   . ASN A  1 221  ? 169.809 141.133 203.223 1.00 213.86 ? 234  ASN A N   1 
ATOM   1604  C CA  . ASN A  1 221  ? 170.109 140.617 201.896 1.00 213.86 ? 234  ASN A CA  1 
ATOM   1605  C C   . ASN A  1 221  ? 169.580 139.197 201.754 1.00 213.86 ? 234  ASN A C   1 
ATOM   1606  O O   . ASN A  1 221  ? 169.133 138.585 202.725 1.00 213.86 ? 234  ASN A O   1 
ATOM   1607  C CB  . ASN A  1 221  ? 171.622 140.637 201.641 1.00 213.86 ? 234  ASN A CB  1 
ATOM   1608  C CG  . ASN A  1 221  ? 172.261 141.951 202.055 1.00 213.86 ? 234  ASN A CG  1 
ATOM   1609  O OD1 . ASN A  1 221  ? 171.677 143.013 201.845 1.00 213.86 ? 234  ASN A OD1 1 
ATOM   1610  N ND2 . ASN A  1 221  ? 173.453 141.897 202.653 1.00 213.86 ? 234  ASN A ND2 1 
ATOM   1611  N N   . ILE A  1 222  ? 169.604 138.686 200.532 1.00 197.88 ? 235  ILE A N   1 
ATOM   1612  C CA  . ILE A  1 222  ? 169.325 137.280 200.270 1.00 197.88 ? 235  ILE A CA  1 
ATOM   1613  C C   . ILE A  1 222  ? 170.576 136.659 199.668 1.00 197.88 ? 235  ILE A C   1 
ATOM   1614  O O   . ILE A  1 222  ? 171.222 137.263 198.805 1.00 197.88 ? 235  ILE A O   1 
ATOM   1615  C CB  . ILE A  1 222  ? 168.104 137.107 199.346 1.00 197.88 ? 235  ILE A CB  1 
ATOM   1616  C CG1 . ILE A  1 222  ? 168.348 137.701 197.950 1.00 197.88 ? 235  ILE A CG1 1 
ATOM   1617  C CG2 . ILE A  1 222  ? 166.906 137.767 199.977 1.00 197.88 ? 235  ILE A CG2 1 
ATOM   1618  C CD1 . ILE A  1 222  ? 167.461 137.122 196.853 1.00 197.88 ? 235  ILE A CD1 1 
ATOM   1619  N N   . THR A  1 223  ? 170.974 135.499 200.176 1.00 195.25 ? 236  THR A N   1 
ATOM   1620  C CA  . THR A  1 223  ? 172.025 134.745 199.512 1.00 195.25 ? 236  THR A CA  1 
ATOM   1621  C C   . THR A  1 223  ? 171.827 133.240 199.592 1.00 195.25 ? 236  THR A C   1 
ATOM   1622  O O   . THR A  1 223  ? 172.543 132.504 198.907 1.00 195.25 ? 236  THR A O   1 
ATOM   1623  C CB  . THR A  1 223  ? 173.391 135.131 200.095 1.00 195.25 ? 236  THR A CB  1 
ATOM   1624  O OG1 . THR A  1 223  ? 173.435 136.550 200.279 1.00 195.25 ? 236  THR A OG1 1 
ATOM   1625  C CG2 . THR A  1 223  ? 174.515 134.739 199.160 1.00 195.25 ? 236  THR A CG2 1 
ATOM   1626  N N   . ARG A  1 224  ? 170.849 132.761 200.354 1.00 192.59 ? 237  ARG A N   1 
ATOM   1627  C CA  . ARG A  1 224  ? 170.667 131.330 200.566 1.00 192.59 ? 237  ARG A CA  1 
ATOM   1628  C C   . ARG A  1 224  ? 169.208 130.985 200.343 1.00 192.59 ? 237  ARG A C   1 
ATOM   1629  O O   . ARG A  1 224  ? 168.329 131.495 201.045 1.00 192.59 ? 237  ARG A O   1 
ATOM   1630  C CB  . ARG A  1 224  ? 171.106 130.910 201.970 1.00 192.59 ? 237  ARG A CB  1 
ATOM   1631  C CG  . ARG A  1 224  ? 170.449 129.650 202.466 1.00 192.59 ? 237  ARG A CG  1 
ATOM   1632  C CD  . ARG A  1 224  ? 171.275 129.023 203.550 1.00 192.59 ? 237  ARG A CD  1 
ATOM   1633  N NE  . ARG A  1 224  ? 172.444 128.333 203.023 1.00 192.59 ? 237  ARG A NE  1 
ATOM   1634  C CZ  . ARG A  1 224  ? 173.669 128.838 203.031 1.00 192.59 ? 237  ARG A CZ  1 
ATOM   1635  N NH1 . ARG A  1 224  ? 173.887 130.042 203.532 1.00 192.59 ? 237  ARG A NH1 1 
ATOM   1636  N NH2 . ARG A  1 224  ? 174.677 128.138 202.538 1.00 192.59 ? 237  ARG A NH2 1 
ATOM   1637  N N   . PHE A  1 225  ? 168.968 130.102 199.380 1.00 193.77 ? 238  PHE A N   1 
ATOM   1638  C CA  . PHE A  1 225  ? 167.624 129.720 198.988 1.00 193.77 ? 238  PHE A CA  1 
ATOM   1639  C C   . PHE A  1 225  ? 167.674 128.357 198.322 1.00 193.77 ? 238  PHE A C   1 
ATOM   1640  O O   . PHE A  1 225  ? 168.506 128.118 197.444 1.00 193.77 ? 238  PHE A O   1 
ATOM   1641  C CB  . PHE A  1 225  ? 167.023 130.767 198.058 1.00 193.77 ? 238  PHE A CB  1 
ATOM   1642  C CG  . PHE A  1 225  ? 167.920 131.142 196.927 1.00 193.77 ? 238  PHE A CG  1 
ATOM   1643  C CD1 . PHE A  1 225  ? 168.890 132.114 197.094 1.00 193.77 ? 238  PHE A CD1 1 
ATOM   1644  C CD2 . PHE A  1 225  ? 167.793 130.533 195.699 1.00 193.77 ? 238  PHE A CD2 1 
ATOM   1645  C CE1 . PHE A  1 225  ? 169.711 132.465 196.063 1.00 193.77 ? 238  PHE A CE1 1 
ATOM   1646  C CE2 . PHE A  1 225  ? 168.614 130.883 194.663 1.00 193.77 ? 238  PHE A CE2 1 
ATOM   1647  C CZ  . PHE A  1 225  ? 169.570 131.850 194.846 1.00 193.77 ? 238  PHE A CZ  1 
ATOM   1648  N N   . GLN A  1 226  ? 166.810 127.462 198.780 1.00 193.55 ? 239  GLN A N   1 
ATOM   1649  C CA  . GLN A  1 226  ? 166.607 126.174 198.134 1.00 193.55 ? 239  GLN A CA  1 
ATOM   1650  C C   . GLN A  1 226  ? 165.193 125.736 198.467 1.00 193.55 ? 239  GLN A C   1 
ATOM   1651  O O   . GLN A  1 226  ? 164.934 125.295 199.589 1.00 193.55 ? 239  GLN A O   1 
ATOM   1652  C CB  . GLN A  1 226  ? 167.618 125.149 198.605 1.00 193.55 ? 239  GLN A CB  1 
ATOM   1653  C CG  . GLN A  1 226  ? 167.225 123.752 198.204 1.00 193.55 ? 239  GLN A CG  1 
ATOM   1654  C CD  . GLN A  1 226  ? 168.060 122.696 198.870 1.00 193.55 ? 239  GLN A CD  1 
ATOM   1655  O OE1 . GLN A  1 226  ? 168.989 123.005 199.606 1.00 193.55 ? 239  GLN A OE1 1 
ATOM   1656  N NE2 . GLN A  1 226  ? 167.756 121.438 198.592 1.00 193.55 ? 239  GLN A NE2 1 
ATOM   1657  N N   . THR A  1 227  ? 164.292 125.855 197.503 1.00 197.11 ? 240  THR A N   1 
ATOM   1658  C CA  . THR A  1 227  ? 162.903 125.491 197.731 1.00 197.11 ? 240  THR A CA  1 
ATOM   1659  C C   . THR A  1 227  ? 162.786 124.038 198.187 1.00 197.11 ? 240  THR A C   1 
ATOM   1660  O O   . THR A  1 227  ? 163.191 123.117 197.473 1.00 197.11 ? 240  THR A O   1 
ATOM   1661  C CB  . THR A  1 227  ? 162.102 125.730 196.452 1.00 197.11 ? 240  THR A CB  1 
ATOM   1662  O OG1 . THR A  1 227  ? 161.910 127.138 196.273 1.00 197.11 ? 240  THR A OG1 1 
ATOM   1663  C CG2 . THR A  1 227  ? 160.762 125.032 196.508 1.00 197.11 ? 240  THR A CG2 1 
ATOM   1664  N N   . LEU A  1 228  ? 162.253 123.841 199.399 1.00 184.72 ? 241  LEU A N   1 
ATOM   1665  C CA  . LEU A  1 228  ? 161.929 122.521 199.929 1.00 184.72 ? 241  LEU A CA  1 
ATOM   1666  C C   . LEU A  1 228  ? 160.437 122.425 200.208 1.00 184.72 ? 241  LEU A C   1 
ATOM   1667  O O   . LEU A  1 228  ? 159.801 123.391 200.636 1.00 184.72 ? 241  LEU A O   1 
ATOM   1668  C CB  . LEU A  1 228  ? 162.708 122.199 201.199 1.00 184.72 ? 241  LEU A CB  1 
ATOM   1669  C CG  . LEU A  1 228  ? 163.914 121.292 200.984 1.00 184.72 ? 241  LEU A CG  1 
ATOM   1670  C CD1 . LEU A  1 228  ? 163.435 119.920 200.551 1.00 184.72 ? 241  LEU A CD1 1 
ATOM   1671  C CD2 . LEU A  1 228  ? 164.847 121.880 199.958 1.00 184.72 ? 241  LEU A CD2 1 
ATOM   1672  N N   . LEU A  1 229  ? 159.889 121.237 199.977 1.00 179.33 ? 242  LEU A N   1 
ATOM   1673  C CA  . LEU A  1 229  ? 158.453 121.044 199.887 1.00 179.33 ? 242  LEU A CA  1 
ATOM   1674  C C   . LEU A  1 229  ? 157.997 119.995 200.894 1.00 179.33 ? 242  LEU A C   1 
ATOM   1675  O O   . LEU A  1 229  ? 158.792 119.414 201.635 1.00 179.33 ? 242  LEU A O   1 
ATOM   1676  C CB  . LEU A  1 229  ? 158.044 120.629 198.463 1.00 179.33 ? 242  LEU A CB  1 
ATOM   1677  C CG  . LEU A  1 229  ? 158.474 121.494 197.269 1.00 179.33 ? 242  LEU A CG  1 
ATOM   1678  C CD1 . LEU A  1 229  ? 157.923 120.942 195.964 1.00 179.33 ? 242  LEU A CD1 1 
ATOM   1679  C CD2 . LEU A  1 229  ? 158.037 122.931 197.456 1.00 179.33 ? 242  LEU A CD2 1 
ATOM   1680  N N   . ALA A  1 230  ? 156.688 119.764 200.899 1.00 177.14 ? 243  ALA A N   1 
ATOM   1681  C CA  . ALA A  1 230  ? 156.027 118.792 201.755 1.00 177.14 ? 243  ALA A CA  1 
ATOM   1682  C C   . ALA A  1 230  ? 155.830 117.472 201.022 1.00 177.14 ? 243  ALA A C   1 
ATOM   1683  O O   . ALA A  1 230  ? 155.616 117.443 199.810 1.00 177.14 ? 243  ALA A O   1 
ATOM   1684  C CB  . ALA A  1 230  ? 154.670 119.335 202.194 1.00 177.14 ? 243  ALA A CB  1 
ATOM   1685  N N   . LEU A  1 231  ? 155.885 116.375 201.763 1.00 182.22 ? 244  LEU A N   1 
ATOM   1686  C CA  . LEU A  1 231  ? 155.570 115.068 201.207 1.00 182.22 ? 244  LEU A CA  1 
ATOM   1687  C C   . LEU A  1 231  ? 154.137 114.721 201.563 1.00 182.22 ? 244  LEU A C   1 
ATOM   1688  O O   . LEU A  1 231  ? 153.698 114.981 202.687 1.00 182.22 ? 244  LEU A O   1 
ATOM   1689  C CB  . LEU A  1 231  ? 156.512 113.985 201.727 1.00 182.22 ? 244  LEU A CB  1 
ATOM   1690  C CG  . LEU A  1 231  ? 156.381 112.646 200.991 1.00 182.22 ? 244  LEU A CG  1 
ATOM   1691  C CD1 . LEU A  1 231  ? 157.720 111.979 200.897 1.00 182.22 ? 244  LEU A CD1 1 
ATOM   1692  C CD2 . LEU A  1 231  ? 155.399 111.705 201.661 1.00 182.22 ? 244  LEU A CD2 1 
ATOM   1693  N N   . HIS A  1 232  ? 153.414 114.127 200.609 1.00 204.63 ? 245  HIS A N   1 
ATOM   1694  C CA  . HIS A  1 232  ? 151.998 113.731 200.837 1.00 204.63 ? 245  HIS A CA  1 
ATOM   1695  C C   . HIS A  1 232  ? 151.485 112.916 199.644 1.00 204.63 ? 245  HIS A C   1 
ATOM   1696  O O   . HIS A  1 232  ? 152.259 112.719 198.687 1.00 204.63 ? 245  HIS A O   1 
ATOM   1697  C CB  . HIS A  1 232  ? 151.131 114.967 201.120 1.00 204.63 ? 245  HIS A CB  1 
ATOM   1698  C CG  . HIS A  1 232  ? 150.935 115.852 199.935 1.00 204.63 ? 245  HIS A CG  1 
ATOM   1699  N ND1 . HIS A  1 232  ? 150.748 115.352 198.661 1.00 204.63 ? 245  HIS A ND1 1 
ATOM   1700  C CD2 . HIS A  1 232  ? 150.891 117.198 199.824 1.00 204.63 ? 245  HIS A CD2 1 
ATOM   1701  C CE1 . HIS A  1 232  ? 150.600 116.352 197.815 1.00 204.63 ? 245  HIS A CE1 1 
ATOM   1702  N NE2 . HIS A  1 232  ? 150.684 117.495 198.504 1.00 204.63 ? 245  HIS A NE2 1 
ATOM   1703  N N   . ARG A  1 233  ? 150.226 112.469 199.705 1.00 204.25 ? 246  ARG A N   1 
ATOM   1704  C CA  . ARG A  1 233  ? 149.613 111.657 198.618 1.00 204.25 ? 246  ARG A CA  1 
ATOM   1705  C C   . ARG A  1 233  ? 148.503 112.467 197.937 1.00 204.25 ? 246  ARG A C   1 
ATOM   1706  O O   . ARG A  1 233  ? 147.318 112.163 198.176 1.00 204.25 ? 246  ARG A O   1 
ATOM   1707  C CB  . ARG A  1 233  ? 149.055 110.351 199.192 1.00 204.25 ? 246  ARG A CB  1 
ATOM   1708  C CG  . ARG A  1 233  ? 150.118 109.404 199.730 1.00 204.25 ? 246  ARG A CG  1 
ATOM   1709  C CD  . ARG A  1 233  ? 150.966 110.037 200.817 1.00 204.25 ? 246  ARG A CD  1 
ATOM   1710  N NE  . ARG A  1 233  ? 151.984 109.128 201.323 1.00 204.25 ? 246  ARG A NE  1 
ATOM   1711  C CZ  . ARG A  1 233  ? 152.871 109.438 202.262 1.00 204.25 ? 246  ARG A CZ  1 
ATOM   1712  N NH1 . ARG A  1 233  ? 152.868 110.644 202.803 1.00 204.25 ? 246  ARG A NH1 1 
ATOM   1713  N NH2 . ARG A  1 233  ? 153.758 108.541 202.656 1.00 204.25 ? 246  ARG A NH2 1 
ATOM   1714  N N   . SER A  1 234  ? 148.884 113.434 197.095 1.00 204.09 ? 247  SER A N   1 
ATOM   1715  C CA  . SER A  1 234  ? 147.908 114.296 196.377 1.00 204.09 ? 247  SER A CA  1 
ATOM   1716  C C   . SER A  1 234  ? 146.915 114.909 197.373 1.00 204.09 ? 247  SER A C   1 
ATOM   1717  O O   . SER A  1 234  ? 147.368 115.506 198.370 1.00 204.09 ? 247  SER A O   1 
ATOM   1718  C CB  . SER A  1 234  ? 147.194 113.522 195.299 1.00 204.09 ? 247  SER A CB  1 
ATOM   1719  O OG  . SER A  1 234  ? 146.088 112.812 195.836 1.00 204.09 ? 247  SER A OG  1 
ATOM   1720  N N   . TYR A  1 235  ? 145.615 114.763 197.098 1.00 204.52 ? 248  TYR A N   1 
ATOM   1721  C CA  . TYR A  1 235  ? 144.566 115.300 197.959 1.00 204.52 ? 248  TYR A CA  1 
ATOM   1722  C C   . TYR A  1 235  ? 143.344 114.410 198.083 1.00 204.52 ? 248  TYR A C   1 
ATOM   1723  O O   . TYR A  1 235  ? 142.536 114.588 198.998 1.00 204.52 ? 248  TYR A O   1 
ATOM   1724  C CB  . TYR A  1 235  ? 144.170 116.688 197.465 1.00 204.52 ? 248  TYR A CB  1 
ATOM   1725  C CG  . TYR A  1 235  ? 144.943 117.789 198.145 1.00 204.52 ? 248  TYR A CG  1 
ATOM   1726  C CD1 . TYR A  1 235  ? 145.329 117.670 199.472 1.00 204.52 ? 248  TYR A CD1 1 
ATOM   1727  C CD2 . TYR A  1 235  ? 145.348 118.913 197.449 1.00 204.52 ? 248  TYR A CD2 1 
ATOM   1728  C CE1 . TYR A  1 235  ? 146.041 118.672 200.103 1.00 204.52 ? 248  TYR A CE1 1 
ATOM   1729  C CE2 . TYR A  1 235  ? 146.071 119.915 198.071 1.00 204.52 ? 248  TYR A CE2 1 
ATOM   1730  C CZ  . TYR A  1 235  ? 146.414 119.793 199.393 1.00 204.52 ? 248  TYR A CZ  1 
ATOM   1731  O OH  . TYR A  1 235  ? 147.137 120.808 199.980 1.00 204.52 ? 248  TYR A OH  1 
ATOM   1732  N N   . LEU A  1 236  ? 143.179 113.480 197.151 1.00 200.73 ? 249  LEU A N   1 
ATOM   1733  C CA  . LEU A  1 236  ? 141.990 112.644 197.097 1.00 200.73 ? 249  LEU A CA  1 
ATOM   1734  C C   . LEU A  1 236  ? 142.321 111.165 197.106 1.00 200.73 ? 249  LEU A C   1 
ATOM   1735  O O   . LEU A  1 236  ? 141.584 110.371 197.693 1.00 200.73 ? 249  LEU A O   1 
ATOM   1736  C CB  . LEU A  1 236  ? 141.142 112.969 195.860 1.00 200.73 ? 249  LEU A CB  1 
ATOM   1737  C CG  . LEU A  1 236  ? 139.966 113.935 196.045 1.00 200.73 ? 249  LEU A CG  1 
ATOM   1738  C CD1 . LEU A  1 236  ? 138.893 113.341 196.953 1.00 200.73 ? 249  LEU A CD1 1 
ATOM   1739  C CD2 . LEU A  1 236  ? 140.438 115.284 196.575 1.00 200.73 ? 249  LEU A CD2 1 
ATOM   1740  N N   . THR A  1 237  ? 143.408 110.779 196.469 1.00 200.39 ? 250  THR A N   1 
ATOM   1741  C CA  . THR A  1 237  ? 143.711 109.369 196.314 1.00 200.39 ? 250  THR A CA  1 
ATOM   1742  C C   . THR A  1 237  ? 145.215 109.144 196.405 1.00 200.39 ? 250  THR A C   1 
ATOM   1743  O O   . THR A  1 237  ? 145.989 110.110 196.372 1.00 200.39 ? 250  THR A O   1 
ATOM   1744  C CB  . THR A  1 237  ? 143.151 108.869 194.984 1.00 200.39 ? 250  THR A CB  1 
ATOM   1745  O OG1 . THR A  1 237  ? 143.335 109.881 193.992 1.00 200.39 ? 250  THR A OG1 1 
ATOM   1746  C CG2 . THR A  1 237  ? 141.672 108.549 195.111 1.00 200.39 ? 250  THR A CG2 1 
ATOM   1747  N N   . PRO A  1 238  ? 145.668 107.890 196.542 1.00 200.16 ? 251  PRO A N   1 
ATOM   1748  C CA  . PRO A  1 238  ? 147.114 107.626 196.594 1.00 200.16 ? 251  PRO A CA  1 
ATOM   1749  C C   . PRO A  1 238  ? 147.793 107.811 195.248 1.00 200.16 ? 251  PRO A C   1 
ATOM   1750  O O   . PRO A  1 238  ? 147.153 108.218 194.275 1.00 200.16 ? 251  PRO A O   1 
ATOM   1751  C CB  . PRO A  1 238  ? 147.187 106.164 197.054 1.00 200.16 ? 251  PRO A CB  1 
ATOM   1752  C CG  . PRO A  1 238  ? 145.859 105.582 196.694 1.00 200.16 ? 251  PRO A CG  1 
ATOM   1753  C CD  . PRO A  1 238  ? 144.879 106.690 196.875 1.00 200.16 ? 251  PRO A CD  1 
ATOM   1754  N N   . GLY A  1 239  ? 149.087 107.509 195.180 1.00 200.97 ? 252  GLY A N   1 
ATOM   1755  C CA  . GLY A  1 239  ? 149.838 107.690 193.956 1.00 200.97 ? 252  GLY A CA  1 
ATOM   1756  C C   . GLY A  1 239  ? 150.065 109.146 193.605 1.00 200.97 ? 252  GLY A C   1 
ATOM   1757  O O   . GLY A  1 239  ? 149.519 109.647 192.618 1.00 200.97 ? 252  GLY A O   1 
ATOM   1758  N N   . ASP A  1 240  ? 150.857 109.845 194.412 1.00 201.93 ? 253  ASP A N   1 
ATOM   1759  C CA  . ASP A  1 240  ? 151.180 111.234 194.122 1.00 201.93 ? 253  ASP A CA  1 
ATOM   1760  C C   . ASP A  1 240  ? 152.613 111.354 193.632 1.00 201.93 ? 253  ASP A C   1 
ATOM   1761  O O   . ASP A  1 240  ? 152.864 111.971 192.593 1.00 201.93 ? 253  ASP A O   1 
ATOM   1762  C CB  . ASP A  1 240  ? 150.983 112.112 195.353 1.00 201.93 ? 253  ASP A CB  1 
ATOM   1763  C CG  . ASP A  1 240  ? 151.107 113.583 195.038 1.00 201.93 ? 253  ASP A CG  1 
ATOM   1764  O OD1 . ASP A  1 240  ? 151.164 113.936 193.844 1.00 201.93 ? 253  ASP A OD1 1 
ATOM   1765  O OD2 . ASP A  1 240  ? 151.177 114.385 195.987 1.00 201.93 ? 253  ASP A OD2 1 
ATOM   1766  N N   . SER A  1 241  ? 153.560 110.788 194.380 1.00 204.29 ? 254  SER A N   1 
ATOM   1767  C CA  . SER A  1 241  ? 154.944 110.790 193.931 1.00 204.29 ? 254  SER A CA  1 
ATOM   1768  C C   . SER A  1 241  ? 155.029 110.029 192.621 1.00 204.29 ? 254  SER A C   1 
ATOM   1769  O O   . SER A  1 241  ? 154.879 108.803 192.587 1.00 204.29 ? 254  SER A O   1 
ATOM   1770  C CB  . SER A  1 241  ? 155.874 110.184 194.980 1.00 204.29 ? 254  SER A CB  1 
ATOM   1771  O OG  . SER A  1 241  ? 156.255 111.160 195.931 1.00 204.29 ? 254  SER A OG  1 
ATOM   1772  N N   . SER A  1 242  ? 155.265 110.764 191.538 1.00 215.33 ? 255  SER A N   1 
ATOM   1773  C CA  . SER A  1 242  ? 155.131 110.252 190.185 1.00 215.33 ? 255  SER A CA  1 
ATOM   1774  C C   . SER A  1 242  ? 156.378 109.528 189.702 1.00 215.33 ? 255  SER A C   1 
ATOM   1775  O O   . SER A  1 242  ? 156.372 108.970 188.602 1.00 215.33 ? 255  SER A O   1 
ATOM   1776  C CB  . SER A  1 242  ? 154.788 111.400 189.235 1.00 215.33 ? 255  SER A CB  1 
ATOM   1777  O OG  . SER A  1 242  ? 153.809 112.257 189.799 1.00 215.33 ? 255  SER A OG  1 
ATOM   1778  N N   . SER A  1 243  ? 157.435 109.502 190.501 1.00 211.95 ? 256  SER A N   1 
ATOM   1779  C CA  . SER A  1 243  ? 158.676 108.865 190.088 1.00 211.95 ? 256  SER A CA  1 
ATOM   1780  C C   . SER A  1 243  ? 158.648 107.397 190.487 1.00 211.95 ? 256  SER A C   1 
ATOM   1781  O O   . SER A  1 243  ? 158.806 107.064 191.666 1.00 211.95 ? 256  SER A O   1 
ATOM   1782  C CB  . SER A  1 243  ? 159.861 109.582 190.719 1.00 211.95 ? 256  SER A CB  1 
ATOM   1783  O OG  . SER A  1 243  ? 159.930 110.926 190.276 1.00 211.95 ? 256  SER A OG  1 
ATOM   1784  N N   . GLY A  1 244  ? 158.447 106.521 189.510 1.00 206.78 ? 257  GLY A N   1 
ATOM   1785  C CA  . GLY A  1 244  ? 158.301 105.107 189.789 1.00 206.78 ? 257  GLY A CA  1 
ATOM   1786  C C   . GLY A  1 244  ? 159.573 104.449 190.272 1.00 206.78 ? 257  GLY A C   1 
ATOM   1787  O O   . GLY A  1 244  ? 159.637 103.960 191.402 1.00 206.78 ? 257  GLY A O   1 
ATOM   1788  N N   . TRP A  1 245  ? 160.597 104.429 189.422 1.00 204.66 ? 258  TRP A N   1 
ATOM   1789  C CA  . TRP A  1 245  ? 161.828 103.715 189.755 1.00 204.66 ? 258  TRP A CA  1 
ATOM   1790  C C   . TRP A  1 245  ? 162.773 104.608 190.553 1.00 204.66 ? 258  TRP A C   1 
ATOM   1791  O O   . TRP A  1 245  ? 163.122 104.297 191.694 1.00 204.66 ? 258  TRP A O   1 
ATOM   1792  C CB  . TRP A  1 245  ? 162.487 103.201 188.471 1.00 204.66 ? 258  TRP A CB  1 
ATOM   1793  C CG  . TRP A  1 245  ? 163.578 102.202 188.686 1.00 204.66 ? 258  TRP A CG  1 
ATOM   1794  C CD1 . TRP A  1 245  ? 164.919 102.435 188.647 1.00 204.66 ? 258  TRP A CD1 1 
ATOM   1795  C CD2 . TRP A  1 245  ? 163.421 100.803 188.954 1.00 204.66 ? 258  TRP A CD2 1 
ATOM   1796  N NE1 . TRP A  1 245  ? 165.609 101.271 188.879 1.00 204.66 ? 258  TRP A NE1 1 
ATOM   1797  C CE2 . TRP A  1 245  ? 164.711 100.254 189.072 1.00 204.66 ? 258  TRP A CE2 1 
ATOM   1798  C CE3 . TRP A  1 245  ? 162.315 99.964  189.110 1.00 204.66 ? 258  TRP A CE3 1 
ATOM   1799  C CZ2 . TRP A  1 245  ? 164.926 98.907  189.338 1.00 204.66 ? 258  TRP A CZ2 1 
ATOM   1800  C CZ3 . TRP A  1 245  ? 162.530 98.628  189.374 1.00 204.66 ? 258  TRP A CZ3 1 
ATOM   1801  C CH2 . TRP A  1 245  ? 163.825 98.112  189.485 1.00 204.66 ? 258  TRP A CH2 1 
ATOM   1802  N N   . THR A  1 246  ? 163.187 105.733 189.972 1.00 202.65 ? 259  THR A N   1 
ATOM   1803  C CA  . THR A  1 246  ? 164.045 106.686 190.668 1.00 202.65 ? 259  THR A CA  1 
ATOM   1804  C C   . THR A  1 246  ? 163.613 108.105 190.343 1.00 202.65 ? 259  THR A C   1 
ATOM   1805  O O   . THR A  1 246  ? 162.487 108.323 189.890 1.00 202.65 ? 259  THR A O   1 
ATOM   1806  C CB  . THR A  1 246  ? 165.518 106.503 190.297 1.00 202.65 ? 259  THR A CB  1 
ATOM   1807  O OG1 . THR A  1 246  ? 165.662 106.548 188.876 1.00 202.65 ? 259  THR A OG1 1 
ATOM   1808  C CG2 . THR A  1 246  ? 166.050 105.185 190.809 1.00 202.65 ? 259  THR A CG2 1 
ATOM   1809  N N   . ALA A  1 247  ? 164.494 109.071 190.591 1.00 209.24 ? 260  ALA A N   1 
ATOM   1810  C CA  . ALA A  1 247  ? 164.318 110.448 190.137 1.00 209.24 ? 260  ALA A CA  1 
ATOM   1811  C C   . ALA A  1 247  ? 163.110 111.112 190.793 1.00 209.24 ? 260  ALA A C   1 
ATOM   1812  O O   . ALA A  1 247  ? 162.156 111.520 190.130 1.00 209.24 ? 260  ALA A O   1 
ATOM   1813  C CB  . ALA A  1 247  ? 164.208 110.514 188.612 1.00 209.24 ? 260  ALA A CB  1 
ATOM   1814  N N   . GLY A  1 248  ? 163.165 111.204 192.120 1.00 207.99 ? 261  GLY A N   1 
ATOM   1815  C CA  . GLY A  1 248  ? 162.180 111.964 192.866 1.00 207.99 ? 261  GLY A CA  1 
ATOM   1816  C C   . GLY A  1 248  ? 161.952 113.322 192.245 1.00 207.99 ? 261  GLY A C   1 
ATOM   1817  O O   . GLY A  1 248  ? 162.910 113.987 191.844 1.00 207.99 ? 261  GLY A O   1 
ATOM   1818  N N   . ALA A  1 249  ? 160.695 113.750 192.174 1.00 204.44 ? 262  ALA A N   1 
ATOM   1819  C CA  . ALA A  1 249  ? 160.327 114.850 191.296 1.00 204.44 ? 262  ALA A CA  1 
ATOM   1820  C C   . ALA A  1 249  ? 161.065 116.122 191.681 1.00 204.44 ? 262  ALA A C   1 
ATOM   1821  O O   . ALA A  1 249  ? 160.729 116.776 192.670 1.00 204.44 ? 262  ALA A O   1 
ATOM   1822  C CB  . ALA A  1 249  ? 158.816 115.073 191.337 1.00 204.44 ? 262  ALA A CB  1 
ATOM   1823  N N   . ALA A  1 250  ? 162.070 116.478 190.888 1.00 200.45 ? 263  ALA A N   1 
ATOM   1824  C CA  . ALA A  1 250  ? 162.930 117.606 191.202 1.00 200.45 ? 263  ALA A CA  1 
ATOM   1825  C C   . ALA A  1 250  ? 163.189 118.432 189.955 1.00 200.45 ? 263  ALA A C   1 
ATOM   1826  O O   . ALA A  1 250  ? 164.340 118.749 189.647 1.00 200.45 ? 263  ALA A O   1 
ATOM   1827  C CB  . ALA A  1 250  ? 164.248 117.124 191.803 1.00 200.45 ? 263  ALA A CB  1 
ATOM   1828  N N   . ALA A  1 251  ? 162.128 118.765 189.226 1.00 207.78 ? 264  ALA A N   1 
ATOM   1829  C CA  . ALA A  1 251  ? 162.219 119.501 187.973 1.00 207.78 ? 264  ALA A CA  1 
ATOM   1830  C C   . ALA A  1 251  ? 161.773 120.947 188.155 1.00 207.78 ? 264  ALA A C   1 
ATOM   1831  O O   . ALA A  1 251  ? 160.681 121.211 188.668 1.00 207.78 ? 264  ALA A O   1 
ATOM   1832  C CB  . ALA A  1 251  ? 161.371 118.834 186.884 1.00 207.78 ? 264  ALA A CB  1 
ATOM   1833  N N   . TYR A  1 252  ? 162.617 121.879 187.716 1.00 204.69 ? 265  TYR A N   1 
ATOM   1834  C CA  . TYR A  1 252  ? 162.296 123.296 187.776 1.00 204.69 ? 265  TYR A CA  1 
ATOM   1835  C C   . TYR A  1 252  ? 163.373 124.062 187.024 1.00 204.69 ? 265  TYR A C   1 
ATOM   1836  O O   . TYR A  1 252  ? 164.562 123.873 187.285 1.00 204.69 ? 265  TYR A O   1 
ATOM   1837  C CB  . TYR A  1 252  ? 162.202 123.774 189.229 1.00 204.69 ? 265  TYR A CB  1 
ATOM   1838  C CG  . TYR A  1 252  ? 163.482 123.622 190.012 1.00 204.69 ? 265  TYR A CG  1 
ATOM   1839  C CD1 . TYR A  1 252  ? 163.958 122.374 190.373 1.00 204.69 ? 265  TYR A CD1 1 
ATOM   1840  C CD2 . TYR A  1 252  ? 164.234 124.729 190.362 1.00 204.69 ? 265  TYR A CD2 1 
ATOM   1841  C CE1 . TYR A  1 252  ? 165.134 122.236 191.082 1.00 204.69 ? 265  TYR A CE1 1 
ATOM   1842  C CE2 . TYR A  1 252  ? 165.410 124.602 191.077 1.00 204.69 ? 265  TYR A CE2 1 
ATOM   1843  C CZ  . TYR A  1 252  ? 165.859 123.354 191.433 1.00 204.69 ? 265  TYR A CZ  1 
ATOM   1844  O OH  . TYR A  1 252  ? 167.035 123.225 192.142 1.00 204.69 ? 265  TYR A OH  1 
ATOM   1845  N N   . TYR A  1 253  ? 162.958 124.935 186.107 1.00 194.08 ? 266  TYR A N   1 
ATOM   1846  C CA  . TYR A  1 253  ? 163.921 125.688 185.310 1.00 194.08 ? 266  TYR A CA  1 
ATOM   1847  C C   . TYR A  1 253  ? 164.515 126.809 186.152 1.00 194.08 ? 266  TYR A C   1 
ATOM   1848  O O   . TYR A  1 253  ? 163.860 127.335 187.056 1.00 194.08 ? 266  TYR A O   1 
ATOM   1849  C CB  . TYR A  1 253  ? 163.266 126.266 184.049 1.00 194.08 ? 266  TYR A CB  1 
ATOM   1850  C CG  . TYR A  1 253  ? 162.948 125.253 182.964 1.00 194.08 ? 266  TYR A CG  1 
ATOM   1851  C CD1 . TYR A  1 253  ? 163.929 124.798 182.102 1.00 194.08 ? 266  TYR A CD1 1 
ATOM   1852  C CD2 . TYR A  1 253  ? 161.664 124.760 182.805 1.00 194.08 ? 266  TYR A CD2 1 
ATOM   1853  C CE1 . TYR A  1 253  ? 163.639 123.885 181.120 1.00 194.08 ? 266  TYR A CE1 1 
ATOM   1854  C CE2 . TYR A  1 253  ? 161.369 123.840 181.827 1.00 194.08 ? 266  TYR A CE2 1 
ATOM   1855  C CZ  . TYR A  1 253  ? 162.359 123.409 180.992 1.00 194.08 ? 266  TYR A CZ  1 
ATOM   1856  O OH  . TYR A  1 253  ? 162.062 122.492 180.020 1.00 194.08 ? 266  TYR A OH  1 
ATOM   1857  N N   . VAL A  1 254  ? 165.764 127.167 185.869 1.00 193.27 ? 267  VAL A N   1 
ATOM   1858  C CA  . VAL A  1 254  ? 166.443 128.238 186.587 1.00 193.27 ? 267  VAL A CA  1 
ATOM   1859  C C   . VAL A  1 254  ? 167.334 129.003 185.622 1.00 193.27 ? 267  VAL A C   1 
ATOM   1860  O O   . VAL A  1 254  ? 168.139 128.400 184.907 1.00 193.27 ? 267  VAL A O   1 
ATOM   1861  C CB  . VAL A  1 254  ? 167.274 127.703 187.764 1.00 193.27 ? 267  VAL A CB  1 
ATOM   1862  C CG1 . VAL A  1 254  ? 168.302 128.734 188.194 1.00 193.27 ? 267  VAL A CG1 1 
ATOM   1863  C CG2 . VAL A  1 254  ? 166.368 127.361 188.920 1.00 193.27 ? 267  VAL A CG2 1 
ATOM   1864  N N   . GLY A  1 255  ? 167.195 130.330 185.610 1.00 198.12 ? 268  GLY A N   1 
ATOM   1865  C CA  . GLY A  1 255  ? 168.113 131.206 184.903 1.00 198.12 ? 268  GLY A CA  1 
ATOM   1866  C C   . GLY A  1 255  ? 168.511 132.371 185.787 1.00 198.12 ? 268  GLY A C   1 
ATOM   1867  O O   . GLY A  1 255  ? 167.804 132.683 186.746 1.00 198.12 ? 268  GLY A O   1 
ATOM   1868  N N   . TYR A  1 256  ? 169.628 133.023 185.507 1.00 193.87 ? 269  TYR A N   1 
ATOM   1869  C CA  . TYR A  1 256  ? 170.068 134.108 186.369 1.00 193.87 ? 269  TYR A CA  1 
ATOM   1870  C C   . TYR A  1 256  ? 169.986 135.441 185.641 1.00 193.87 ? 269  TYR A C   1 
ATOM   1871  O O   . TYR A  1 256  ? 169.946 135.499 184.411 1.00 193.87 ? 269  TYR A O   1 
ATOM   1872  C CB  . TYR A  1 256  ? 171.484 133.863 186.875 1.00 193.87 ? 269  TYR A CB  1 
ATOM   1873  C CG  . TYR A  1 256  ? 171.533 132.803 187.933 1.00 193.87 ? 269  TYR A CG  1 
ATOM   1874  C CD1 . TYR A  1 256  ? 170.388 132.433 188.610 1.00 193.87 ? 269  TYR A CD1 1 
ATOM   1875  C CD2 . TYR A  1 256  ? 172.710 132.156 188.241 1.00 193.87 ? 269  TYR A CD2 1 
ATOM   1876  C CE1 . TYR A  1 256  ? 170.417 131.461 189.570 1.00 193.87 ? 269  TYR A CE1 1 
ATOM   1877  C CE2 . TYR A  1 256  ? 172.751 131.189 189.206 1.00 193.87 ? 269  TYR A CE2 1 
ATOM   1878  C CZ  . TYR A  1 256  ? 171.600 130.841 189.866 1.00 193.87 ? 269  TYR A CZ  1 
ATOM   1879  O OH  . TYR A  1 256  ? 171.631 129.867 190.832 1.00 193.87 ? 269  TYR A OH  1 
ATOM   1880  N N   . LEU A  1 257  ? 169.930 136.511 186.421 1.00 179.00 ? 270  LEU A N   1 
ATOM   1881  C CA  . LEU A  1 257  ? 169.823 137.857 185.888 1.00 179.00 ? 270  LEU A CA  1 
ATOM   1882  C C   . LEU A  1 257  ? 171.092 138.638 186.174 1.00 179.00 ? 270  LEU A C   1 
ATOM   1883  O O   . LEU A  1 257  ? 171.873 138.306 187.063 1.00 179.00 ? 270  LEU A O   1 
ATOM   1884  C CB  . LEU A  1 257  ? 168.624 138.582 186.485 1.00 179.00 ? 270  LEU A CB  1 
ATOM   1885  C CG  . LEU A  1 257  ? 167.285 138.131 185.925 1.00 179.00 ? 270  LEU A CG  1 
ATOM   1886  C CD1 . LEU A  1 257  ? 166.864 136.804 186.523 1.00 179.00 ? 270  LEU A CD1 1 
ATOM   1887  C CD2 . LEU A  1 257  ? 166.245 139.189 186.189 1.00 179.00 ? 270  LEU A CD2 1 
ATOM   1888  N N   . GLN A  1 258  ? 171.296 139.678 185.391 1.00 154.76 ? 271  GLN A N   1 
ATOM   1889  C CA  . GLN A  1 258  ? 172.419 140.581 185.557 1.00 154.76 ? 271  GLN A CA  1 
ATOM   1890  C C   . GLN A  1 258  ? 171.922 141.971 185.222 1.00 154.76 ? 271  GLN A C   1 
ATOM   1891  O O   . GLN A  1 258  ? 170.785 142.142 184.770 1.00 154.76 ? 271  GLN A O   1 
ATOM   1892  C CB  . GLN A  1 258  ? 173.587 140.180 184.655 1.00 154.76 ? 271  GLN A CB  1 
ATOM   1893  C CG  . GLN A  1 258  ? 173.976 138.735 184.798 1.00 154.76 ? 271  GLN A CG  1 
ATOM   1894  C CD  . GLN A  1 258  ? 175.184 138.372 183.988 1.00 154.76 ? 271  GLN A CD  1 
ATOM   1895  O OE1 . GLN A  1 258  ? 176.291 138.832 184.261 1.00 154.76 ? 271  GLN A OE1 1 
ATOM   1896  N NE2 . GLN A  1 258  ? 174.984 137.542 182.975 1.00 154.76 ? 271  GLN A NE2 1 
ATOM   1897  N N   . PRO A  1 259  ? 172.715 142.978 185.469 1.00 143.38 ? 272  PRO A N   1 
ATOM   1898  C CA  . PRO A  1 259  ? 172.328 144.321 185.008 1.00 143.38 ? 272  PRO A CA  1 
ATOM   1899  C C   . PRO A  1 259  ? 172.703 144.625 183.556 1.00 143.38 ? 272  PRO A C   1 
ATOM   1900  O O   . PRO A  1 259  ? 173.626 145.377 183.251 1.00 143.38 ? 272  PRO A O   1 
ATOM   1901  C CB  . PRO A  1 259  ? 173.077 145.230 185.983 1.00 143.38 ? 272  PRO A CB  1 
ATOM   1902  C CG  . PRO A  1 259  ? 174.275 144.445 186.355 1.00 143.38 ? 272  PRO A CG  1 
ATOM   1903  C CD  . PRO A  1 259  ? 173.819 143.028 186.439 1.00 143.38 ? 272  PRO A CD  1 
ATOM   1904  N N   . ARG A  1 260  ? 171.966 144.040 182.613 1.00 139.41 ? 273  ARG A N   1 
ATOM   1905  C CA  . ARG A  1 260  ? 172.092 144.384 181.202 1.00 139.41 ? 273  ARG A CA  1 
ATOM   1906  C C   . ARG A  1 260  ? 170.953 145.318 180.842 1.00 139.41 ? 273  ARG A C   1 
ATOM   1907  O O   . ARG A  1 260  ? 169.802 145.062 181.203 1.00 139.41 ? 273  ARG A O   1 
ATOM   1908  C CB  . ARG A  1 260  ? 172.031 143.158 180.290 1.00 139.41 ? 273  ARG A CB  1 
ATOM   1909  C CG  . ARG A  1 260  ? 172.948 142.028 180.654 1.00 139.41 ? 273  ARG A CG  1 
ATOM   1910  C CD  . ARG A  1 260  ? 174.375 142.478 180.768 1.00 139.41 ? 273  ARG A CD  1 
ATOM   1911  N NE  . ARG A  1 260  ? 174.903 143.017 179.525 1.00 139.41 ? 273  ARG A NE  1 
ATOM   1912  C CZ  . ARG A  1 260  ? 176.066 143.651 179.431 1.00 139.41 ? 273  ARG A CZ  1 
ATOM   1913  N NH1 . ARG A  1 260  ? 176.823 143.810 180.497 1.00 139.41 ? 273  ARG A NH1 1 
ATOM   1914  N NH2 . ARG A  1 260  ? 176.486 144.120 178.272 1.00 139.41 ? 273  ARG A NH2 1 
ATOM   1915  N N   . THR A  1 261  ? 171.266 146.394 180.138 1.00 139.63 ? 274  THR A N   1 
ATOM   1916  C CA  . THR A  1 261  ? 170.198 147.262 179.680 1.00 139.63 ? 274  THR A CA  1 
ATOM   1917  C C   . THR A  1 261  ? 169.341 146.556 178.648 1.00 139.63 ? 274  THR A C   1 
ATOM   1918  O O   . THR A  1 261  ? 169.799 145.683 177.909 1.00 139.63 ? 274  THR A O   1 
ATOM   1919  C CB  . THR A  1 261  ? 170.737 148.547 179.082 1.00 139.63 ? 274  THR A CB  1 
ATOM   1920  O OG1 . THR A  1 261  ? 169.627 149.337 178.639 1.00 139.63 ? 274  THR A OG1 1 
ATOM   1921  C CG2 . THR A  1 261  ? 171.642 148.250 177.928 1.00 139.63 ? 274  THR A CG2 1 
ATOM   1922  N N   . PHE A  1 262  ? 168.080 146.944 178.615 1.00 142.21 ? 275  PHE A N   1 
ATOM   1923  C CA  . PHE A  1 262  ? 167.083 146.361 177.744 1.00 142.21 ? 275  PHE A CA  1 
ATOM   1924  C C   . PHE A  1 262  ? 166.393 147.467 176.963 1.00 142.21 ? 275  PHE A C   1 
ATOM   1925  O O   . PHE A  1 262  ? 166.343 148.627 177.389 1.00 142.21 ? 275  PHE A O   1 
ATOM   1926  C CB  . PHE A  1 262  ? 166.049 145.565 178.548 1.00 142.21 ? 275  PHE A CB  1 
ATOM   1927  C CG  . PHE A  1 262  ? 166.425 144.137 178.795 1.00 142.21 ? 275  PHE A CG  1 
ATOM   1928  C CD1 . PHE A  1 262  ? 167.742 143.757 178.887 1.00 142.21 ? 275  PHE A CD1 1 
ATOM   1929  C CD2 . PHE A  1 262  ? 165.448 143.175 178.929 1.00 142.21 ? 275  PHE A CD2 1 
ATOM   1930  C CE1 . PHE A  1 262  ? 168.073 142.450 179.109 1.00 142.21 ? 275  PHE A CE1 1 
ATOM   1931  C CE2 . PHE A  1 262  ? 165.773 141.869 179.146 1.00 142.21 ? 275  PHE A CE2 1 
ATOM   1932  C CZ  . PHE A  1 262  ? 167.085 141.502 179.237 1.00 142.21 ? 275  PHE A CZ  1 
ATOM   1933  N N   . LEU A  1 263  ? 165.841 147.081 175.815 1.00 126.92 ? 276  LEU A N   1 
ATOM   1934  C CA  . LEU A  1 263  ? 165.092 147.976 174.950 1.00 126.92 ? 276  LEU A CA  1 
ATOM   1935  C C   . LEU A  1 263  ? 163.756 147.321 174.661 1.00 126.92 ? 276  LEU A C   1 
ATOM   1936  O O   . LEU A  1 263  ? 163.713 146.137 174.299 1.00 126.92 ? 276  LEU A O   1 
ATOM   1937  C CB  . LEU A  1 263  ? 165.844 148.249 173.647 1.00 126.92 ? 276  LEU A CB  1 
ATOM   1938  C CG  . LEU A  1 263  ? 165.256 149.277 172.680 1.00 126.92 ? 276  LEU A CG  1 
ATOM   1939  C CD1 . LEU A  1 263  ? 166.381 150.009 171.978 1.00 126.92 ? 276  LEU A CD1 1 
ATOM   1940  C CD2 . LEU A  1 263  ? 164.324 148.642 171.667 1.00 126.92 ? 276  LEU A CD2 1 
ATOM   1941  N N   . LEU A  1 264  ? 162.676 148.089 174.819 1.00 139.10 ? 277  LEU A N   1 
ATOM   1942  C CA  . LEU A  1 264  ? 161.314 147.582 174.765 1.00 139.10 ? 277  LEU A CA  1 
ATOM   1943  C C   . LEU A  1 264  ? 160.444 148.450 173.866 1.00 139.10 ? 277  LEU A C   1 
ATOM   1944  O O   . LEU A  1 264  ? 160.498 149.683 173.939 1.00 139.10 ? 277  LEU A O   1 
ATOM   1945  C CB  . LEU A  1 264  ? 160.702 147.539 176.162 1.00 139.10 ? 277  LEU A CB  1 
ATOM   1946  C CG  . LEU A  1 264  ? 160.900 146.274 176.978 1.00 139.10 ? 277  LEU A CG  1 
ATOM   1947  C CD1 . LEU A  1 264  ? 160.197 145.133 176.295 1.00 139.10 ? 277  LEU A CD1 1 
ATOM   1948  C CD2 . LEU A  1 264  ? 162.361 145.963 177.167 1.00 139.10 ? 277  LEU A CD2 1 
ATOM   1949  N N   . LYS A  1 265  ? 159.629 147.803 173.038 1.00 136.84 ? 278  LYS A N   1 
ATOM   1950  C CA  . LYS A  1 265  ? 158.569 148.456 172.285 1.00 136.84 ? 278  LYS A CA  1 
ATOM   1951  C C   . LYS A  1 265  ? 157.225 148.054 172.868 1.00 136.84 ? 278  LYS A C   1 
ATOM   1952  O O   . LYS A  1 265  ? 156.902 146.865 172.916 1.00 136.84 ? 278  LYS A O   1 
ATOM   1953  C CB  . LYS A  1 265  ? 158.615 148.062 170.813 1.00 136.84 ? 278  LYS A CB  1 
ATOM   1954  C CG  . LYS A  1 265  ? 157.596 148.784 169.960 1.00 136.84 ? 278  LYS A CG  1 
ATOM   1955  C CD  . LYS A  1 265  ? 156.249 148.091 170.000 1.00 136.84 ? 278  LYS A CD  1 
ATOM   1956  C CE  . LYS A  1 265  ? 156.373 146.666 169.566 1.00 136.84 ? 278  LYS A CE  1 
ATOM   1957  N NZ  . LYS A  1 265  ? 155.186 145.886 169.972 1.00 136.84 ? 278  LYS A NZ  1 
ATOM   1958  N N   . TYR A  1 266  ? 156.412 149.037 173.217 1.00 140.95 ? 279  TYR A N   1 
ATOM   1959  C CA  . TYR A  1 266  ? 155.109 148.777 173.806 1.00 140.95 ? 279  TYR A CA  1 
ATOM   1960  C C   . TYR A  1 266  ? 154.030 148.863 172.738 1.00 140.95 ? 279  TYR A C   1 
ATOM   1961  O O   . TYR A  1 266  ? 154.181 149.558 171.733 1.00 140.95 ? 279  TYR A O   1 
ATOM   1962  C CB  . TYR A  1 266  ? 154.808 149.765 174.932 1.00 140.95 ? 279  TYR A CB  1 
ATOM   1963  C CG  . TYR A  1 266  ? 155.702 149.610 176.132 1.00 140.95 ? 279  TYR A CG  1 
ATOM   1964  C CD1 . TYR A  1 266  ? 157.054 149.881 176.048 1.00 140.95 ? 279  TYR A CD1 1 
ATOM   1965  C CD2 . TYR A  1 266  ? 155.195 149.201 177.346 1.00 140.95 ? 279  TYR A CD2 1 
ATOM   1966  C CE1 . TYR A  1 266  ? 157.877 149.741 177.133 1.00 140.95 ? 279  TYR A CE1 1 
ATOM   1967  C CE2 . TYR A  1 266  ? 156.013 149.064 178.442 1.00 140.95 ? 279  TYR A CE2 1 
ATOM   1968  C CZ  . TYR A  1 266  ? 157.355 149.339 178.331 1.00 140.95 ? 279  TYR A CZ  1 
ATOM   1969  O OH  . TYR A  1 266  ? 158.189 149.208 179.417 1.00 140.95 ? 279  TYR A OH  1 
ATOM   1970  N N   . ASN A  1 267  ? 152.940 148.151 172.965 1.00 142.80 ? 280  ASN A N   1 
ATOM   1971  C CA  . ASN A  1 267  ? 151.886 148.035 171.978 1.00 142.80 ? 280  ASN A CA  1 
ATOM   1972  C C   . ASN A  1 267  ? 150.711 148.951 172.304 1.00 142.80 ? 280  ASN A C   1 
ATOM   1973  O O   . ASN A  1 267  ? 150.807 149.875 173.115 1.00 142.80 ? 280  ASN A O   1 
ATOM   1974  C CB  . ASN A  1 267  ? 151.440 146.586 171.864 1.00 142.80 ? 280  ASN A CB  1 
ATOM   1975  C CG  . ASN A  1 267  ? 150.862 146.281 170.518 1.00 142.80 ? 280  ASN A CG  1 
ATOM   1976  O OD1 . ASN A  1 267  ? 150.649 147.185 169.715 1.00 142.80 ? 280  ASN A OD1 1 
ATOM   1977  N ND2 . ASN A  1 267  ? 150.609 145.010 170.251 1.00 142.80 ? 280  ASN A ND2 1 
ATOM   1978  N N   . GLU A  1 268  ? 149.583 148.696 171.641 1.00 142.98 ? 281  GLU A N   1 
ATOM   1979  C CA  . GLU A  1 268  ? 148.416 149.552 171.781 1.00 142.98 ? 281  GLU A CA  1 
ATOM   1980  C C   . GLU A  1 268  ? 147.772 149.428 173.150 1.00 142.98 ? 281  GLU A C   1 
ATOM   1981  O O   . GLU A  1 268  ? 147.182 150.395 173.636 1.00 142.98 ? 281  GLU A O   1 
ATOM   1982  C CB  . GLU A  1 268  ? 147.390 149.211 170.705 1.00 142.98 ? 281  GLU A CB  1 
ATOM   1983  N N   . ASN A  1 269  ? 147.864 148.259 173.781 1.00 151.36 ? 282  ASN A N   1 
ATOM   1984  C CA  . ASN A  1 269  ? 147.133 147.945 175.010 1.00 151.36 ? 282  ASN A CA  1 
ATOM   1985  C C   . ASN A  1 269  ? 148.047 147.949 176.228 1.00 151.36 ? 282  ASN A C   1 
ATOM   1986  O O   . ASN A  1 269  ? 147.957 147.074 177.091 1.00 151.36 ? 282  ASN A O   1 
ATOM   1987  C CB  . ASN A  1 269  ? 146.414 146.602 174.865 1.00 151.36 ? 282  ASN A CB  1 
ATOM   1988  C CG  . ASN A  1 269  ? 145.244 146.450 175.822 1.00 151.36 ? 282  ASN A CG  1 
ATOM   1989  O OD1 . ASN A  1 269  ? 145.262 147.017 176.915 1.00 151.36 ? 282  ASN A OD1 1 
ATOM   1990  N ND2 . ASN A  1 269  ? 144.211 145.685 175.427 1.00 151.36 ? 282  ASN A ND2 1 
ATOM   1991  N N   . GLY A  1 270  ? 148.947 148.923 176.309 1.00 149.53 ? 283  GLY A N   1 
ATOM   1992  C CA  . GLY A  1 270  ? 149.871 148.989 177.423 1.00 149.53 ? 283  GLY A CA  1 
ATOM   1993  C C   . GLY A  1 270  ? 150.691 147.738 177.591 1.00 149.53 ? 283  GLY A C   1 
ATOM   1994  O O   . GLY A  1 270  ? 151.093 147.410 178.708 1.00 149.53 ? 283  GLY A O   1 
ATOM   1995  N N   . THR A  1 271  ? 150.959 147.034 176.502 1.00 141.04 ? 284  THR A N   1 
ATOM   1996  C CA  . THR A  1 271  ? 151.516 145.698 176.554 1.00 141.04 ? 284  THR A CA  1 
ATOM   1997  C C   . THR A  1 271  ? 152.957 145.682 176.065 1.00 141.04 ? 284  THR A C   1 
ATOM   1998  O O   . THR A  1 271  ? 153.312 146.364 175.101 1.00 141.04 ? 284  THR A O   1 
ATOM   1999  C CB  . THR A  1 271  ? 150.670 144.749 175.712 1.00 141.04 ? 284  THR A CB  1 
ATOM   2000  O OG1 . THR A  1 271  ? 149.285 145.021 175.954 1.00 141.04 ? 284  THR A OG1 1 
ATOM   2001  C CG2 . THR A  1 271  ? 150.969 143.311 176.069 1.00 141.04 ? 284  THR A CG2 1 
ATOM   2002  N N   . ILE A  1 272  ? 153.783 144.900 176.750 1.00 143.18 ? 285  ILE A N   1 
ATOM   2003  C CA  . ILE A  1 272  ? 155.137 144.605 176.304 1.00 143.18 ? 285  ILE A CA  1 
ATOM   2004  C C   . ILE A  1 272  ? 155.075 143.447 175.323 1.00 143.18 ? 285  ILE A C   1 
ATOM   2005  O O   . ILE A  1 272  ? 154.389 142.451 175.569 1.00 143.18 ? 285  ILE A O   1 
ATOM   2006  C CB  . ILE A  1 272  ? 156.050 144.273 177.493 1.00 143.18 ? 285  ILE A CB  1 
ATOM   2007  C CG1 . ILE A  1 272  ? 156.625 145.548 178.093 1.00 143.18 ? 285  ILE A CG1 1 
ATOM   2008  C CG2 . ILE A  1 272  ? 157.171 143.364 177.063 1.00 143.18 ? 285  ILE A CG2 1 
ATOM   2009  C CD1 . ILE A  1 272  ? 157.421 145.309 179.351 1.00 143.18 ? 285  ILE A CD1 1 
ATOM   2010  N N   . THR A  1 273  ? 155.764 143.584 174.197 1.00 143.70 ? 286  THR A N   1 
ATOM   2011  C CA  . THR A  1 273  ? 155.691 142.594 173.133 1.00 143.70 ? 286  THR A CA  1 
ATOM   2012  C C   . THR A  1 273  ? 157.037 142.000 172.761 1.00 143.70 ? 286  THR A C   1 
ATOM   2013  O O   . THR A  1 273  ? 157.227 140.786 172.884 1.00 143.70 ? 286  THR A O   1 
ATOM   2014  C CB  . THR A  1 273  ? 155.066 143.230 171.891 1.00 143.70 ? 286  THR A CB  1 
ATOM   2015  O OG1 . THR A  1 273  ? 156.041 144.053 171.246 1.00 143.70 ? 286  THR A OG1 1 
ATOM   2016  C CG2 . THR A  1 273  ? 153.889 144.088 172.283 1.00 143.70 ? 286  THR A CG2 1 
ATOM   2017  N N   . ASP A  1 274  ? 157.983 142.826 172.322 1.00 139.37 ? 287  ASP A N   1 
ATOM   2018  C CA  . ASP A  1 274  ? 159.200 142.350 171.682 1.00 139.37 ? 287  ASP A CA  1 
ATOM   2019  C C   . ASP A  1 274  ? 160.358 143.233 172.107 1.00 139.37 ? 287  ASP A C   1 
ATOM   2020  O O   . ASP A  1 274  ? 160.280 144.459 172.023 1.00 139.37 ? 287  ASP A O   1 
ATOM   2021  C CB  . ASP A  1 274  ? 159.053 142.399 170.173 1.00 139.37 ? 287  ASP A CB  1 
ATOM   2022  C CG  . ASP A  1 274  ? 158.391 143.669 169.727 1.00 139.37 ? 287  ASP A CG  1 
ATOM   2023  O OD1 . ASP A  1 274  ? 158.051 144.477 170.613 1.00 139.37 ? 287  ASP A OD1 1 
ATOM   2024  O OD2 . ASP A  1 274  ? 158.187 143.858 168.516 1.00 139.37 ? 287  ASP A OD2 1 
ATOM   2025  N N   . ALA A  1 275  ? 161.446 142.603 172.531 1.00 134.08 ? 288  ALA A N   1 
ATOM   2026  C CA  . ALA A  1 275  ? 162.493 143.321 173.239 1.00 134.08 ? 288  ALA A CA  1 
ATOM   2027  C C   . ALA A  1 275  ? 163.833 143.003 172.604 1.00 134.08 ? 288  ALA A C   1 
ATOM   2028  O O   . ALA A  1 275  ? 163.925 142.219 171.659 1.00 134.08 ? 288  ALA A O   1 
ATOM   2029  C CB  . ALA A  1 275  ? 162.490 142.964 174.726 1.00 134.08 ? 288  ALA A CB  1 
ATOM   2030  N N   . VAL A  1 276  ? 164.883 143.623 173.138 1.00 124.81 ? 289  VAL A N   1 
ATOM   2031  C CA  . VAL A  1 276  ? 166.212 143.387 172.601 1.00 124.81 ? 289  VAL A CA  1 
ATOM   2032  C C   . VAL A  1 276  ? 167.245 143.877 173.593 1.00 124.81 ? 289  VAL A C   1 
ATOM   2033  O O   . VAL A  1 276  ? 167.003 144.815 174.357 1.00 124.81 ? 289  VAL A O   1 
ATOM   2034  C CB  . VAL A  1 276  ? 166.373 144.094 171.238 1.00 124.81 ? 289  VAL A CB  1 
ATOM   2035  C CG1 . VAL A  1 276  ? 166.142 145.564 171.418 1.00 124.81 ? 289  VAL A CG1 1 
ATOM   2036  C CG2 . VAL A  1 276  ? 167.734 143.825 170.661 1.00 124.81 ? 289  VAL A CG2 1 
ATOM   2037  N N   . ASP A  1 277  ? 168.408 143.244 173.569 1.00 123.73 ? 290  ASP A N   1 
ATOM   2038  C CA  . ASP A  1 277  ? 169.549 143.733 174.312 1.00 123.73 ? 290  ASP A CA  1 
ATOM   2039  C C   . ASP A  1 277  ? 170.131 144.952 173.618 1.00 123.73 ? 290  ASP A C   1 
ATOM   2040  O O   . ASP A  1 277  ? 169.689 145.369 172.546 1.00 123.73 ? 290  ASP A O   1 
ATOM   2041  C CB  . ASP A  1 277  ? 170.610 142.647 174.441 1.00 123.73 ? 290  ASP A CB  1 
ATOM   2042  N N   . CYS A  1 278  ? 171.142 145.536 174.250 1.00 135.79 ? 291  CYS A N   1 
ATOM   2043  C CA  . CYS A  1 278  ? 171.914 146.604 173.645 1.00 135.79 ? 291  CYS A CA  1 
ATOM   2044  C C   . CYS A  1 278  ? 173.349 146.203 173.363 1.00 135.79 ? 291  CYS A C   1 
ATOM   2045  O O   . CYS A  1 278  ? 173.983 146.814 172.503 1.00 135.79 ? 291  CYS A O   1 
ATOM   2046  C CB  . CYS A  1 278  ? 171.906 147.848 174.549 1.00 135.79 ? 291  CYS A CB  1 
ATOM   2047  S SG  . CYS A  1 278  ? 172.522 149.410 173.831 1.00 135.79 ? 291  CYS A SG  1 
ATOM   2048  N N   . ALA A  1 279  ? 173.874 145.196 174.057 1.00 121.43 ? 292  ALA A N   1 
ATOM   2049  C CA  . ALA A  1 279  ? 175.267 144.832 173.858 1.00 121.43 ? 292  ALA A CA  1 
ATOM   2050  C C   . ALA A  1 279  ? 175.522 143.335 173.911 1.00 121.43 ? 292  ALA A C   1 
ATOM   2051  O O   . ALA A  1 279  ? 176.690 142.927 173.906 1.00 121.43 ? 292  ALA A O   1 
ATOM   2052  C CB  . ALA A  1 279  ? 176.146 145.530 174.886 1.00 121.43 ? 292  ALA A CB  1 
ATOM   2053  N N   . LEU A  1 280  ? 174.487 142.505 173.973 1.00 129.23 ? 293  LEU A N   1 
ATOM   2054  C CA  . LEU A  1 280  ? 174.737 141.074 173.965 1.00 129.23 ? 293  LEU A CA  1 
ATOM   2055  C C   . LEU A  1 280  ? 175.452 140.675 172.685 1.00 129.23 ? 293  LEU A C   1 
ATOM   2056  O O   . LEU A  1 280  ? 176.647 140.369 172.722 1.00 129.23 ? 293  LEU A O   1 
ATOM   2057  C CB  . LEU A  1 280  ? 173.441 140.290 174.120 1.00 129.23 ? 293  LEU A CB  1 
ATOM   2058  C CG  . LEU A  1 280  ? 173.027 139.965 175.554 1.00 129.23 ? 293  LEU A CG  1 
ATOM   2059  C CD1 . LEU A  1 280  ? 172.991 141.195 176.447 1.00 129.23 ? 293  LEU A CD1 1 
ATOM   2060  C CD2 . LEU A  1 280  ? 171.692 139.227 175.583 1.00 129.23 ? 293  LEU A CD2 1 
ATOM   2061  N N   . ASP A  1 281  ? 174.750 140.715 171.535 1.00 123.48 ? 294  ASP A N   1 
ATOM   2062  C CA  . ASP A  1 281  ? 175.454 140.447 170.292 1.00 123.48 ? 294  ASP A CA  1 
ATOM   2063  C C   . ASP A  1 281  ? 175.579 141.723 169.486 1.00 123.48 ? 294  ASP A C   1 
ATOM   2064  O O   . ASP A  1 281  ? 174.658 142.546 169.481 1.00 123.48 ? 294  ASP A O   1 
ATOM   2065  C CB  . ASP A  1 281  ? 174.758 139.368 169.456 1.00 123.48 ? 294  ASP A CB  1 
ATOM   2066  C CG  . ASP A  1 281  ? 173.321 139.699 169.143 1.00 123.48 ? 294  ASP A CG  1 
ATOM   2067  O OD1 . ASP A  1 281  ? 172.831 140.766 169.543 1.00 123.48 ? 294  ASP A OD1 1 
ATOM   2068  O OD2 . ASP A  1 281  ? 172.655 138.859 168.518 1.00 123.48 ? 294  ASP A OD2 1 
ATOM   2069  N N   . PRO A  1 282  ? 176.683 141.923 168.817 1.00 116.41 ? 295  PRO A N   1 
ATOM   2070  C CA  . PRO A  1 282  ? 176.925 143.218 168.192 1.00 116.41 ? 295  PRO A CA  1 
ATOM   2071  C C   . PRO A  1 282  ? 175.775 143.672 167.311 1.00 116.41 ? 295  PRO A C   1 
ATOM   2072  O O   . PRO A  1 282  ? 175.728 144.832 166.912 1.00 116.41 ? 295  PRO A O   1 
ATOM   2073  C CB  . PRO A  1 282  ? 178.207 142.974 167.398 1.00 116.41 ? 295  PRO A CB  1 
ATOM   2074  C CG  . PRO A  1 282  ? 178.903 141.941 168.166 1.00 116.41 ? 295  PRO A CG  1 
ATOM   2075  C CD  . PRO A  1 282  ? 177.831 141.023 168.658 1.00 116.41 ? 295  PRO A CD  1 
ATOM   2076  N N   . LEU A  1 283  ? 174.823 142.794 167.012 1.00 116.04 ? 296  LEU A N   1 
ATOM   2077  C CA  . LEU A  1 283  ? 173.624 143.246 166.319 1.00 116.04 ? 296  LEU A CA  1 
ATOM   2078  C C   . LEU A  1 283  ? 172.729 144.057 167.240 1.00 116.04 ? 296  LEU A C   1 
ATOM   2079  O O   . LEU A  1 283  ? 172.186 145.104 166.849 1.00 116.04 ? 296  LEU A O   1 
ATOM   2080  C CB  . LEU A  1 283  ? 172.862 142.054 165.777 1.00 116.04 ? 296  LEU A CB  1 
ATOM   2081  C CG  . LEU A  1 283  ? 171.826 142.489 164.763 1.00 116.04 ? 296  LEU A CG  1 
ATOM   2082  C CD1 . LEU A  1 283  ? 172.522 143.215 163.637 1.00 116.04 ? 296  LEU A CD1 1 
ATOM   2083  C CD2 . LEU A  1 283  ? 171.066 141.282 164.262 1.00 116.04 ? 296  LEU A CD2 1 
ATOM   2084  N N   . SER A  1 284  ? 172.552 143.577 168.467 1.00 122.08 ? 297  SER A N   1 
ATOM   2085  C CA  . SER A  1 284  ? 171.764 144.320 169.433 1.00 122.08 ? 297  SER A CA  1 
ATOM   2086  C C   . SER A  1 284  ? 172.297 145.726 169.587 1.00 122.08 ? 297  SER A C   1 
ATOM   2087  O O   . SER A  1 284  ? 171.549 146.644 169.918 1.00 122.08 ? 297  SER A O   1 
ATOM   2088  C CB  . SER A  1 284  ? 171.775 143.598 170.774 1.00 122.08 ? 297  SER A CB  1 
ATOM   2089  O OG  . SER A  1 284  ? 171.604 142.206 170.580 1.00 122.08 ? 297  SER A OG  1 
ATOM   2090  N N   . GLU A  1 285  ? 173.581 145.915 169.313 1.00 121.47 ? 298  GLU A N   1 
ATOM   2091  C CA  . GLU A  1 285  ? 174.176 147.240 169.375 1.00 121.47 ? 298  GLU A CA  1 
ATOM   2092  C C   . GLU A  1 285  ? 173.425 148.231 168.502 1.00 121.47 ? 298  GLU A C   1 
ATOM   2093  O O   . GLU A  1 285  ? 172.861 149.214 168.998 1.00 121.47 ? 298  GLU A O   1 
ATOM   2094  C CB  . GLU A  1 285  ? 175.631 147.142 168.950 1.00 121.47 ? 298  GLU A CB  1 
ATOM   2095  C CG  . GLU A  1 285  ? 176.563 146.749 170.049 1.00 121.47 ? 298  GLU A CG  1 
ATOM   2096  C CD  . GLU A  1 285  ? 176.458 147.672 171.232 1.00 121.47 ? 298  GLU A CD  1 
ATOM   2097  O OE1 . GLU A  1 285  ? 176.784 147.243 172.353 1.00 121.47 ? 298  GLU A OE1 1 
ATOM   2098  O OE2 . GLU A  1 285  ? 176.082 148.845 171.043 1.00 121.47 ? 298  GLU A OE2 1 
ATOM   2099  N N   . THR A  1 286  ? 173.422 147.996 167.188 1.00 125.57 ? 299  THR A N   1 
ATOM   2100  C CA  . THR A  1 286  ? 172.755 148.925 166.286 1.00 125.57 ? 299  THR A CA  1 
ATOM   2101  C C   . THR A  1 286  ? 171.262 148.931 166.536 1.00 125.57 ? 299  THR A C   1 
ATOM   2102  O O   . THR A  1 286  ? 170.622 149.991 166.482 1.00 125.57 ? 299  THR A O   1 
ATOM   2103  C CB  . THR A  1 286  ? 173.057 148.586 164.823 1.00 125.57 ? 299  THR A CB  1 
ATOM   2104  O OG1 . THR A  1 286  ? 172.244 149.395 163.963 1.00 125.57 ? 299  THR A OG1 1 
ATOM   2105  C CG2 . THR A  1 286  ? 172.806 147.125 164.536 1.00 125.57 ? 299  THR A CG2 1 
ATOM   2106  N N   . LYS A  1 287  ? 170.691 147.763 166.850 1.00 129.11 ? 300  LYS A N   1 
ATOM   2107  C CA  . LYS A  1 287  ? 169.276 147.735 167.192 1.00 129.11 ? 300  LYS A CA  1 
ATOM   2108  C C   . LYS A  1 287  ? 168.983 148.694 168.334 1.00 129.11 ? 300  LYS A C   1 
ATOM   2109  O O   . LYS A  1 287  ? 167.906 149.294 168.400 1.00 129.11 ? 300  LYS A O   1 
ATOM   2110  C CB  . LYS A  1 287  ? 168.854 146.317 167.562 1.00 129.11 ? 300  LYS A CB  1 
ATOM   2111  C CG  . LYS A  1 287  ? 168.839 145.353 166.405 1.00 129.11 ? 300  LYS A CG  1 
ATOM   2112  C CD  . LYS A  1 287  ? 167.453 145.281 165.802 1.00 129.11 ? 300  LYS A CD  1 
ATOM   2113  C CE  . LYS A  1 287  ? 166.452 144.751 166.798 1.00 129.11 ? 300  LYS A CE  1 
ATOM   2114  N NZ  . LYS A  1 287  ? 165.233 144.249 166.127 1.00 129.11 ? 300  LYS A NZ  1 
ATOM   2115  N N   . CYS A  1 288  ? 169.952 148.870 169.225 1.00 128.04 ? 301  CYS A N   1 
ATOM   2116  C CA  . CYS A  1 288  ? 169.752 149.690 170.406 1.00 128.04 ? 301  CYS A CA  1 
ATOM   2117  C C   . CYS A  1 288  ? 169.941 151.161 170.089 1.00 128.04 ? 301  CYS A C   1 
ATOM   2118  O O   . CYS A  1 288  ? 169.083 151.994 170.397 1.00 128.04 ? 301  CYS A O   1 
ATOM   2119  C CB  . CYS A  1 288  ? 170.731 149.231 171.477 1.00 128.04 ? 301  CYS A CB  1 
ATOM   2120  S SG  . CYS A  1 288  ? 170.912 150.257 172.925 1.00 128.04 ? 301  CYS A SG  1 
ATOM   2121  N N   . THR A  1 289  ? 171.090 151.482 169.485 1.00 123.20 ? 302  THR A N   1 
ATOM   2122  C CA  . THR A  1 289  ? 171.435 152.886 169.131 1.00 123.20 ? 302  THR A CA  1 
ATOM   2123  C C   . THR A  1 289  ? 170.677 153.310 167.868 1.00 123.20 ? 302  THR A C   1 
ATOM   2124  O O   . THR A  1 289  ? 170.919 154.436 167.389 1.00 123.20 ? 302  THR A O   1 
ATOM   2125  C CB  . THR A  1 289  ? 172.950 153.056 168.962 1.00 123.20 ? 302  THR A CB  1 
ATOM   2126  O OG1 . THR A  1 289  ? 173.177 154.207 168.148 1.00 123.20 ? 302  THR A OG1 1 
ATOM   2127  C CG2 . THR A  1 289  ? 173.613 151.848 168.339 1.00 123.20 ? 302  THR A CG2 1 
ATOM   2128  N N   . LEU A  1 290  ? 169.801 152.441 167.357 1.00 117.13 ? 303  LEU A N   1 
ATOM   2129  C CA  . LEU A  1 290  ? 169.008 152.755 166.137 1.00 117.13 ? 303  LEU A CA  1 
ATOM   2130  C C   . LEU A  1 290  ? 167.540 152.950 166.530 1.00 117.13 ? 303  LEU A C   1 
ATOM   2131  O O   . LEU A  1 290  ? 166.773 153.485 165.705 1.00 117.13 ? 303  LEU A O   1 
ATOM   2132  C CB  . LEU A  1 290  ? 169.167 151.612 165.130 1.00 117.13 ? 303  LEU A CB  1 
ATOM   2133  C CG  . LEU A  1 290  ? 170.538 151.515 164.463 1.00 117.13 ? 303  LEU A CG  1 
ATOM   2134  C CD1 . LEU A  1 290  ? 170.463 150.695 163.184 1.00 117.13 ? 303  LEU A CD1 1 
ATOM   2135  C CD2 . LEU A  1 290  ? 171.099 152.900 164.176 1.00 117.13 ? 303  LEU A CD2 1 
ATOM   2136  N N   . LYS A  1 291  ? 167.181 152.543 167.751 1.00 121.01 ? 304  LYS A N   1 
ATOM   2137  C CA  . LYS A  1 291  ? 165.785 152.671 168.248 1.00 121.01 ? 304  LYS A CA  1 
ATOM   2138  C C   . LYS A  1 291  ? 164.823 152.121 167.190 1.00 121.01 ? 304  LYS A C   1 
ATOM   2139  O O   . LYS A  1 291  ? 163.782 152.764 166.946 1.00 121.01 ? 304  LYS A O   1 
ATOM   2140  C CB  . LYS A  1 291  ? 165.463 154.128 168.595 1.00 121.01 ? 304  LYS A CB  1 
ATOM   2141  C CG  . LYS A  1 291  ? 166.283 154.723 169.732 1.00 121.01 ? 304  LYS A CG  1 
ATOM   2142  C CD  . LYS A  1 291  ? 167.773 154.711 169.468 1.00 121.01 ? 304  LYS A CD  1 
ATOM   2143  C CE  . LYS A  1 291  ? 168.583 155.282 170.612 1.00 121.01 ? 304  LYS A CE  1 
ATOM   2144  N NZ  . LYS A  1 291  ? 168.370 154.523 171.867 1.00 121.01 ? 304  LYS A NZ  1 
ATOM   2145  N N   . SER A  1 292  ? 165.182 150.992 166.570 1.00 124.73 ? 305  SER A N   1 
ATOM   2146  C CA  . SER A  1 292  ? 164.343 150.373 165.568 1.00 124.73 ? 305  SER A CA  1 
ATOM   2147  C C   . SER A  1 292  ? 164.467 148.876 165.716 1.00 124.73 ? 305  SER A C   1 
ATOM   2148  O O   . SER A  1 292  ? 165.534 148.364 166.057 1.00 124.73 ? 305  SER A O   1 
ATOM   2149  C CB  . SER A  1 292  ? 164.750 150.765 164.150 1.00 124.73 ? 305  SER A CB  1 
ATOM   2150  O OG  . SER A  1 292  ? 164.073 149.956 163.200 1.00 124.73 ? 305  SER A OG  1 
ATOM   2151  N N   . PHE A  1 293  ? 163.384 148.182 165.459 1.00 132.54 ? 306  PHE A N   1 
ATOM   2152  C CA  . PHE A  1 293  ? 163.534 146.763 165.249 1.00 132.54 ? 306  PHE A CA  1 
ATOM   2153  C C   . PHE A  1 293  ? 163.901 146.446 163.819 1.00 132.54 ? 306  PHE A C   1 
ATOM   2154  O O   . PHE A  1 293  ? 163.773 145.297 163.394 1.00 132.54 ? 306  PHE A O   1 
ATOM   2155  C CB  . PHE A  1 293  ? 162.271 146.046 165.690 1.00 132.54 ? 306  PHE A CB  1 
ATOM   2156  C CG  . PHE A  1 293  ? 162.178 145.916 167.170 1.00 132.54 ? 306  PHE A CG  1 
ATOM   2157  C CD1 . PHE A  1 293  ? 161.815 147.001 167.946 1.00 132.54 ? 306  PHE A CD1 1 
ATOM   2158  C CD2 . PHE A  1 293  ? 162.501 144.731 167.799 1.00 132.54 ? 306  PHE A CD2 1 
ATOM   2159  C CE1 . PHE A  1 293  ? 161.741 146.894 169.324 1.00 132.54 ? 306  PHE A CE1 1 
ATOM   2160  C CE2 . PHE A  1 293  ? 162.428 144.617 169.179 1.00 132.54 ? 306  PHE A CE2 1 
ATOM   2161  C CZ  . PHE A  1 293  ? 162.050 145.700 169.938 1.00 132.54 ? 306  PHE A CZ  1 
ATOM   2162  N N   . THR A  1 294  ? 164.350 147.450 163.072 1.00 124.28 ? 307  THR A N   1 
ATOM   2163  C CA  . THR A  1 294  ? 164.850 147.270 161.719 1.00 124.28 ? 307  THR A CA  1 
ATOM   2164  C C   . THR A  1 294  ? 166.124 148.078 161.567 1.00 124.28 ? 307  THR A C   1 
ATOM   2165  O O   . THR A  1 294  ? 166.099 149.304 161.698 1.00 124.28 ? 307  THR A O   1 
ATOM   2166  C CB  . THR A  1 294  ? 163.821 147.719 160.686 1.00 124.28 ? 307  THR A CB  1 
ATOM   2167  O OG1 . THR A  1 294  ? 163.202 148.929 161.135 1.00 124.28 ? 307  THR A OG1 1 
ATOM   2168  C CG2 . THR A  1 294  ? 162.770 146.650 160.473 1.00 124.28 ? 307  THR A CG2 1 
ATOM   2169  N N   . VAL A  1 295  ? 167.212 147.411 161.306 1.00 122.03 ? 308  VAL A N   1 
ATOM   2170  C CA  . VAL A  1 295  ? 168.428 148.092 160.892 1.00 122.03 ? 308  VAL A CA  1 
ATOM   2171  C C   . VAL A  1 295  ? 168.409 148.185 159.381 1.00 122.03 ? 308  VAL A C   1 
ATOM   2172  O O   . VAL A  1 295  ? 167.825 147.343 158.695 1.00 122.03 ? 308  VAL A O   1 
ATOM   2173  C CB  . VAL A  1 295  ? 169.682 147.364 161.400 1.00 122.03 ? 308  VAL A CB  1 
ATOM   2174  C CG1 . VAL A  1 295  ? 169.758 147.500 162.887 1.00 122.03 ? 308  VAL A CG1 1 
ATOM   2175  C CG2 . VAL A  1 295  ? 169.658 145.900 160.987 1.00 122.03 ? 308  VAL A CG2 1 
ATOM   2176  N N   . GLU A  1 296  ? 169.031 149.228 158.852 1.00 120.89 ? 309  GLU A N   1 
ATOM   2177  C CA  . GLU A  1 296  ? 168.980 149.501 157.428 1.00 120.89 ? 309  GLU A CA  1 
ATOM   2178  C C   . GLU A  1 296  ? 170.385 149.498 156.851 1.00 120.89 ? 309  GLU A C   1 
ATOM   2179  O O   . GLU A  1 296  ? 171.375 149.683 157.561 1.00 120.89 ? 309  GLU A O   1 
ATOM   2180  C CB  . GLU A  1 296  ? 168.289 150.834 157.158 1.00 120.89 ? 309  GLU A CB  1 
ATOM   2181  C CG  . GLU A  1 296  ? 166.808 150.785 157.414 1.00 120.89 ? 309  GLU A CG  1 
ATOM   2182  C CD  . GLU A  1 296  ? 166.492 150.552 158.873 1.00 120.89 ? 309  GLU A CD  1 
ATOM   2183  O OE1 . GLU A  1 296  ? 167.325 150.921 159.724 1.00 120.89 ? 309  GLU A OE1 1 
ATOM   2184  O OE2 . GLU A  1 296  ? 165.428 149.978 159.170 1.00 120.89 ? 309  GLU A OE2 1 
ATOM   2185  N N   . LYS A  1 297  ? 170.454 149.355 155.533 1.00 115.01 ? 310  LYS A N   1 
ATOM   2186  C CA  . LYS A  1 297  ? 171.691 148.991 154.860 1.00 115.01 ? 310  LYS A CA  1 
ATOM   2187  C C   . LYS A  1 297  ? 172.779 150.045 155.010 1.00 115.01 ? 310  LYS A C   1 
ATOM   2188  O O   . LYS A  1 297  ? 172.857 150.974 154.202 1.00 115.01 ? 310  LYS A O   1 
ATOM   2189  C CB  . LYS A  1 297  ? 171.399 148.764 153.386 1.00 115.01 ? 310  LYS A CB  1 
ATOM   2190  C CG  . LYS A  1 297  ? 172.425 147.960 152.674 1.00 115.01 ? 310  LYS A CG  1 
ATOM   2191  C CD  . LYS A  1 297  ? 171.898 147.584 151.318 1.00 115.01 ? 310  LYS A CD  1 
ATOM   2192  C CE  . LYS A  1 297  ? 172.897 146.753 150.557 1.00 115.01 ? 310  LYS A CE  1 
ATOM   2193  N NZ  . LYS A  1 297  ? 172.351 146.302 149.251 1.00 115.01 ? 310  LYS A NZ  1 
ATOM   2194  N N   . GLY A  1 298  ? 173.647 149.880 155.999 1.00 111.00 ? 311  GLY A N   1 
ATOM   2195  C CA  . GLY A  1 298  ? 174.696 150.845 156.267 1.00 111.00 ? 311  GLY A CA  1 
ATOM   2196  C C   . GLY A  1 298  ? 175.411 150.530 157.559 1.00 111.00 ? 311  GLY A C   1 
ATOM   2197  O O   . GLY A  1 298  ? 175.017 149.652 158.317 1.00 111.00 ? 311  GLY A O   1 
ATOM   2198  N N   . ILE A  1 299  ? 176.508 151.243 157.780 1.00 102.04 ? 312  ILE A N   1 
ATOM   2199  C CA  . ILE A  1 299  ? 177.291 151.123 159.003 1.00 102.04 ? 312  ILE A CA  1 
ATOM   2200  C C   . ILE A  1 299  ? 176.801 152.179 159.970 1.00 102.04 ? 312  ILE A C   1 
ATOM   2201  O O   . ILE A  1 299  ? 176.274 153.210 159.553 1.00 102.04 ? 312  ILE A O   1 
ATOM   2202  C CB  . ILE A  1 299  ? 178.790 151.295 158.732 1.00 102.04 ? 312  ILE A CB  1 
ATOM   2203  C CG1 . ILE A  1 299  ? 179.589 150.844 159.930 1.00 102.04 ? 312  ILE A CG1 1 
ATOM   2204  C CG2 . ILE A  1 299  ? 179.110 152.730 158.541 1.00 102.04 ? 312  ILE A CG2 1 
ATOM   2205  C CD1 . ILE A  1 299  ? 181.048 150.882 159.710 1.00 102.04 ? 312  ILE A CD1 1 
ATOM   2206  N N   . TYR A  1 300  ? 176.951 151.927 161.261 1.00 104.13 ? 313  TYR A N   1 
ATOM   2207  C CA  . TYR A  1 300  ? 176.449 152.852 162.269 1.00 104.13 ? 313  TYR A CA  1 
ATOM   2208  C C   . TYR A  1 300  ? 177.283 152.653 163.522 1.00 104.13 ? 313  TYR A C   1 
ATOM   2209  O O   . TYR A  1 300  ? 177.126 151.633 164.194 1.00 104.13 ? 313  TYR A O   1 
ATOM   2210  C CB  . TYR A  1 300  ? 174.989 152.577 162.572 1.00 104.13 ? 313  TYR A CB  1 
ATOM   2211  C CG  . TYR A  1 300  ? 174.120 152.383 161.368 1.00 104.13 ? 313  TYR A CG  1 
ATOM   2212  C CD1 . TYR A  1 300  ? 173.598 153.457 160.678 1.00 104.13 ? 313  TYR A CD1 1 
ATOM   2213  C CD2 . TYR A  1 300  ? 173.810 151.121 160.925 1.00 104.13 ? 313  TYR A CD2 1 
ATOM   2214  C CE1 . TYR A  1 300  ? 172.791 153.271 159.573 1.00 104.13 ? 313  TYR A CE1 1 
ATOM   2215  C CE2 . TYR A  1 300  ? 173.003 150.930 159.833 1.00 104.13 ? 313  TYR A CE2 1 
ATOM   2216  C CZ  . TYR A  1 300  ? 172.504 152.002 159.157 1.00 104.13 ? 313  TYR A CZ  1 
ATOM   2217  O OH  . TYR A  1 300  ? 171.701 151.796 158.070 1.00 104.13 ? 313  TYR A OH  1 
ATOM   2218  N N   . GLN A  1 301  ? 178.164 153.590 163.840 1.00 97.04  ? 314  GLN A N   1 
ATOM   2219  C CA  . GLN A  1 301  ? 179.027 153.396 164.999 1.00 97.04  ? 314  GLN A CA  1 
ATOM   2220  C C   . GLN A  1 301  ? 178.205 153.268 166.262 1.00 97.04  ? 314  GLN A C   1 
ATOM   2221  O O   . GLN A  1 301  ? 177.460 154.179 166.623 1.00 97.04  ? 314  GLN A O   1 
ATOM   2222  C CB  . GLN A  1 301  ? 180.006 154.545 165.137 1.00 97.04  ? 314  GLN A CB  1 
ATOM   2223  C CG  . GLN A  1 301  ? 180.500 154.707 166.538 1.00 97.04  ? 314  GLN A CG  1 
ATOM   2224  C CD  . GLN A  1 301  ? 181.499 155.817 166.652 1.00 97.04  ? 314  GLN A CD  1 
ATOM   2225  O OE1 . GLN A  1 301  ? 181.947 156.359 165.650 1.00 97.04  ? 314  GLN A OE1 1 
ATOM   2226  N NE2 . GLN A  1 301  ? 181.829 156.195 167.873 1.00 97.04  ? 314  GLN A NE2 1 
ATOM   2227  N N   . THR A  1 302  ? 178.342 152.137 166.937 1.00 120.59 ? 315  THR A N   1 
ATOM   2228  C CA  . THR A  1 302  ? 177.529 151.868 168.113 1.00 120.59 ? 315  THR A CA  1 
ATOM   2229  C C   . THR A  1 302  ? 178.257 152.136 169.420 1.00 120.59 ? 315  THR A C   1 
ATOM   2230  O O   . THR A  1 302  ? 177.622 152.517 170.405 1.00 120.59 ? 315  THR A O   1 
ATOM   2231  C CB  . THR A  1 302  ? 177.038 150.418 168.103 1.00 120.59 ? 315  THR A CB  1 
ATOM   2232  O OG1 . THR A  1 302  ? 176.033 150.234 169.109 1.00 120.59 ? 315  THR A OG1 1 
ATOM   2233  C CG2 . THR A  1 302  ? 178.184 149.476 168.381 1.00 120.59 ? 315  THR A CG2 1 
ATOM   2234  N N   . SER A  1 303  ? 179.565 151.935 169.469 1.00 110.21 ? 316  SER A N   1 
ATOM   2235  C CA  . SER A  1 303  ? 180.318 152.181 170.683 1.00 110.21 ? 316  SER A CA  1 
ATOM   2236  C C   . SER A  1 303  ? 181.791 152.101 170.344 1.00 110.21 ? 316  SER A C   1 
ATOM   2237  O O   . SER A  1 303  ? 182.188 152.079 169.176 1.00 110.21 ? 316  SER A O   1 
ATOM   2238  C CB  . SER A  1 303  ? 179.973 151.179 171.780 1.00 110.21 ? 316  SER A CB  1 
ATOM   2239  O OG  . SER A  1 303  ? 180.837 150.069 171.686 1.00 110.21 ? 316  SER A OG  1 
ATOM   2240  N N   . ASN A  1 304  ? 182.599 152.040 171.374 1.00 119.47 ? 317  ASN A N   1 
ATOM   2241  C CA  . ASN A  1 304  ? 184.027 152.076 171.187 1.00 119.47 ? 317  ASN A CA  1 
ATOM   2242  C C   . ASN A  1 304  ? 184.571 150.932 172.001 1.00 119.47 ? 317  ASN A C   1 
ATOM   2243  O O   . ASN A  1 304  ? 183.816 150.053 172.418 1.00 119.47 ? 317  ASN A O   1 
ATOM   2244  C CB  . ASN A  1 304  ? 184.568 153.405 171.661 1.00 119.47 ? 317  ASN A CB  1 
ATOM   2245  C CG  . ASN A  1 304  ? 183.593 154.515 171.424 1.00 119.47 ? 317  ASN A CG  1 
ATOM   2246  O OD1 . ASN A  1 304  ? 183.660 155.201 170.415 1.00 119.47 ? 317  ASN A OD1 1 
ATOM   2247  N ND2 . ASN A  1 304  ? 182.647 154.678 172.340 1.00 119.47 ? 317  ASN A ND2 1 
ATOM   2248  N N   . PHE A  1 305  ? 185.869 150.927 172.235 1.00 126.77 ? 318  PHE A N   1 
ATOM   2249  C CA  . PHE A  1 305  ? 186.419 150.005 173.204 1.00 126.77 ? 318  PHE A CA  1 
ATOM   2250  C C   . PHE A  1 305  ? 187.713 150.598 173.719 1.00 126.77 ? 318  PHE A C   1 
ATOM   2251  O O   . PHE A  1 305  ? 188.284 151.498 173.108 1.00 126.77 ? 318  PHE A O   1 
ATOM   2252  C CB  . PHE A  1 305  ? 186.675 148.653 172.581 1.00 126.77 ? 318  PHE A CB  1 
ATOM   2253  C CG  . PHE A  1 305  ? 187.920 148.623 171.827 1.00 126.77 ? 318  PHE A CG  1 
ATOM   2254  C CD1 . PHE A  1 305  ? 188.039 149.367 170.683 1.00 126.77 ? 318  PHE A CD1 1 
ATOM   2255  C CD2 . PHE A  1 305  ? 188.996 147.912 172.285 1.00 126.77 ? 318  PHE A CD2 1 
ATOM   2256  C CE1 . PHE A  1 305  ? 189.193 149.368 169.987 1.00 126.77 ? 318  PHE A CE1 1 
ATOM   2257  C CE2 . PHE A  1 305  ? 190.160 147.909 171.596 1.00 126.77 ? 318  PHE A CE2 1 
ATOM   2258  C CZ  . PHE A  1 305  ? 190.264 148.639 170.443 1.00 126.77 ? 318  PHE A CZ  1 
ATOM   2259  N N   . ARG A  1 306  ? 188.167 150.091 174.857 1.00 137.90 ? 319  ARG A N   1 
ATOM   2260  C CA  . ARG A  1 306  ? 189.459 150.468 175.403 1.00 137.90 ? 319  ARG A CA  1 
ATOM   2261  C C   . ARG A  1 306  ? 190.209 149.209 175.761 1.00 137.90 ? 319  ARG A C   1 
ATOM   2262  O O   . ARG A  1 306  ? 189.753 148.430 176.603 1.00 137.90 ? 319  ARG A O   1 
ATOM   2263  C CB  . ARG A  1 306  ? 189.328 151.346 176.636 1.00 137.90 ? 319  ARG A CB  1 
ATOM   2264  C CG  . ARG A  1 306  ? 188.877 152.719 176.313 1.00 137.90 ? 319  ARG A CG  1 
ATOM   2265  C CD  . ARG A  1 306  ? 187.390 152.751 176.311 1.00 137.90 ? 319  ARG A CD  1 
ATOM   2266  N NE  . ARG A  1 306  ? 186.908 154.065 175.949 1.00 137.90 ? 319  ARG A NE  1 
ATOM   2267  C CZ  . ARG A  1 306  ? 185.641 154.434 176.049 1.00 137.90 ? 319  ARG A CZ  1 
ATOM   2268  N NH1 . ARG A  1 306  ? 185.282 155.657 175.695 1.00 137.90 ? 319  ARG A NH1 1 
ATOM   2269  N NH2 . ARG A  1 306  ? 184.735 153.577 176.498 1.00 137.90 ? 319  ARG A NH2 1 
ATOM   2270  N N   . VAL A  1 307  ? 191.366 149.026 175.144 1.00 148.09 ? 320  VAL A N   1 
ATOM   2271  C CA  . VAL A  1 307  ? 192.182 147.888 175.502 1.00 148.09 ? 320  VAL A CA  1 
ATOM   2272  C C   . VAL A  1 307  ? 192.434 148.056 176.986 1.00 148.09 ? 320  VAL A C   1 
ATOM   2273  O O   . VAL A  1 307  ? 193.161 148.953 177.419 1.00 148.09 ? 320  VAL A O   1 
ATOM   2274  C CB  . VAL A  1 307  ? 193.465 147.823 174.659 1.00 148.09 ? 320  VAL A CB  1 
ATOM   2275  C CG1 . VAL A  1 307  ? 194.184 149.165 174.648 1.00 148.09 ? 320  VAL A CG1 1 
ATOM   2276  C CG2 . VAL A  1 307  ? 194.375 146.745 175.197 1.00 148.09 ? 320  VAL A CG2 1 
ATOM   2277  N N   . GLN A  1 308  ? 191.764 147.245 177.772 1.00 165.01 ? 321  GLN A N   1 
ATOM   2278  C CA  . GLN A  1 308  ? 191.666 147.530 179.184 1.00 165.01 ? 321  GLN A CA  1 
ATOM   2279  C C   . GLN A  1 308  ? 193.020 147.347 179.844 1.00 165.01 ? 321  GLN A C   1 
ATOM   2280  O O   . GLN A  1 308  ? 193.580 146.246 179.803 1.00 165.01 ? 321  GLN A O   1 
ATOM   2281  C CB  . GLN A  1 308  ? 190.623 146.641 179.840 1.00 165.01 ? 321  GLN A CB  1 
ATOM   2282  C CG  . GLN A  1 308  ? 189.251 147.289 179.932 1.00 165.01 ? 321  GLN A CG  1 
ATOM   2283  C CD  . GLN A  1 308  ? 189.206 148.445 180.924 1.00 165.01 ? 321  GLN A CD  1 
ATOM   2284  O OE1 . GLN A  1 308  ? 190.194 148.739 181.598 1.00 165.01 ? 321  GLN A OE1 1 
ATOM   2285  N NE2 . GLN A  1 308  ? 188.051 149.099 181.024 1.00 165.01 ? 321  GLN A NE2 1 
ATOM   2286  N N   . PRO A  1 309  ? 193.590 148.390 180.430 1.00 174.74 ? 322  PRO A N   1 
ATOM   2287  C CA  . PRO A  1 309  ? 194.855 148.234 181.145 1.00 174.74 ? 322  PRO A CA  1 
ATOM   2288  C C   . PRO A  1 309  ? 194.717 147.288 182.328 1.00 174.74 ? 322  PRO A C   1 
ATOM   2289  O O   . PRO A  1 309  ? 193.646 147.146 182.921 1.00 174.74 ? 322  PRO A O   1 
ATOM   2290  C CB  . PRO A  1 309  ? 195.183 149.659 181.598 1.00 174.74 ? 322  PRO A CB  1 
ATOM   2291  C CG  . PRO A  1 309  ? 193.895 150.393 181.511 1.00 174.74 ? 322  PRO A CG  1 
ATOM   2292  C CD  . PRO A  1 309  ? 193.143 149.787 180.392 1.00 174.74 ? 322  PRO A CD  1 
ATOM   2293  N N   . THR A  1 310  ? 195.828 146.644 182.670 1.00 178.54 ? 323  THR A N   1 
ATOM   2294  C CA  . THR A  1 310  ? 195.849 145.563 183.640 1.00 178.54 ? 323  THR A CA  1 
ATOM   2295  C C   . THR A  1 310  ? 196.755 145.900 184.818 1.00 178.54 ? 323  THR A C   1 
ATOM   2296  O O   . THR A  1 310  ? 197.891 146.345 184.634 1.00 178.54 ? 323  THR A O   1 
ATOM   2297  C CB  . THR A  1 310  ? 196.317 144.264 182.977 1.00 178.54 ? 323  THR A CB  1 
ATOM   2298  O OG1 . THR A  1 310  ? 196.457 143.245 183.967 1.00 178.54 ? 323  THR A OG1 1 
ATOM   2299  C CG2 . THR A  1 310  ? 197.648 144.463 182.268 1.00 178.54 ? 323  THR A CG2 1 
ATOM   2300  N N   . GLU A  1 311  ? 196.239 145.680 186.032 1.00 191.17 ? 324  GLU A N   1 
ATOM   2301  C CA  . GLU A  1 311  ? 197.017 145.730 187.275 1.00 191.17 ? 324  GLU A CA  1 
ATOM   2302  C C   . GLU A  1 311  ? 197.674 147.098 187.478 1.00 191.17 ? 324  GLU A C   1 
ATOM   2303  O O   . GLU A  1 311  ? 198.882 147.278 187.318 1.00 191.17 ? 324  GLU A O   1 
ATOM   2304  C CB  . GLU A  1 311  ? 198.070 144.618 187.321 1.00 191.17 ? 324  GLU A CB  1 
ATOM   2305  C CG  . GLU A  1 311  ? 198.740 144.457 188.685 1.00 191.17 ? 324  GLU A CG  1 
ATOM   2306  C CD  . GLU A  1 311  ? 197.830 143.854 189.734 1.00 191.17 ? 324  GLU A CD  1 
ATOM   2307  O OE1 . GLU A  1 311  ? 196.864 144.528 190.146 1.00 191.17 ? 324  GLU A OE1 1 
ATOM   2308  O OE2 . GLU A  1 311  ? 198.095 142.711 190.160 1.00 191.17 ? 324  GLU A OE2 1 
ATOM   2309  N N   . SER A  1 312  ? 196.828 148.070 187.793 1.00 189.74 ? 325  SER A N   1 
ATOM   2310  C CA  . SER A  1 312  ? 197.321 149.397 188.120 1.00 189.74 ? 325  SER A CA  1 
ATOM   2311  C C   . SER A  1 312  ? 198.398 149.323 189.186 1.00 189.74 ? 325  SER A C   1 
ATOM   2312  O O   . SER A  1 312  ? 198.194 148.748 190.256 1.00 189.74 ? 325  SER A O   1 
ATOM   2313  C CB  . SER A  1 312  ? 196.181 150.283 188.611 1.00 189.74 ? 325  SER A CB  1 
ATOM   2314  O OG  . SER A  1 312  ? 196.682 151.318 189.438 1.00 189.74 ? 325  SER A OG  1 
ATOM   2315  N N   . ILE A  1 313  ? 199.552 149.904 188.883 1.00 185.89 ? 326  ILE A N   1 
ATOM   2316  C CA  . ILE A  1 313  ? 200.606 150.090 189.860 1.00 185.89 ? 326  ILE A CA  1 
ATOM   2317  C C   . ILE A  1 313  ? 200.744 151.581 190.100 1.00 185.89 ? 326  ILE A C   1 
ATOM   2318  O O   . ILE A  1 313  ? 200.057 152.397 189.491 1.00 185.89 ? 326  ILE A O   1 
ATOM   2319  C CB  . ILE A  1 313  ? 201.947 149.486 189.413 1.00 185.89 ? 326  ILE A CB  1 
ATOM   2320  C CG1 . ILE A  1 313  ? 202.686 150.448 188.491 1.00 185.89 ? 326  ILE A CG1 1 
ATOM   2321  C CG2 . ILE A  1 313  ? 201.712 148.191 188.681 1.00 185.89 ? 326  ILE A CG2 1 
ATOM   2322  C CD1 . ILE A  1 313  ? 204.139 150.124 188.364 1.00 185.89 ? 326  ILE A CD1 1 
ATOM   2323  N N   . VAL A  1 314  ? 201.641 151.930 191.010 1.00 198.02 ? 327  VAL A N   1 
ATOM   2324  C CA  . VAL A  1 314  ? 201.955 153.322 191.285 1.00 198.02 ? 327  VAL A CA  1 
ATOM   2325  C C   . VAL A  1 314  ? 203.406 153.402 191.719 1.00 198.02 ? 327  VAL A C   1 
ATOM   2326  O O   . VAL A  1 314  ? 203.853 152.617 192.559 1.00 198.02 ? 327  VAL A O   1 
ATOM   2327  C CB  . VAL A  1 314  ? 201.025 153.919 192.355 1.00 198.02 ? 327  VAL A CB  1 
ATOM   2328  C CG1 . VAL A  1 314  ? 201.025 153.051 193.600 1.00 198.02 ? 327  VAL A CG1 1 
ATOM   2329  C CG2 . VAL A  1 314  ? 201.460 155.331 192.688 1.00 198.02 ? 327  VAL A CG2 1 
ATOM   2330  N N   . ARG A  1 315  ? 204.146 154.327 191.125 1.00 193.03 ? 328  ARG A N   1 
ATOM   2331  C CA  . ARG A  1 315  ? 205.525 154.536 191.522 1.00 193.03 ? 328  ARG A CA  1 
ATOM   2332  C C   . ARG A  1 315  ? 205.729 155.980 191.930 1.00 193.03 ? 328  ARG A C   1 
ATOM   2333  O O   . ARG A  1 315  ? 204.800 156.790 191.879 1.00 193.03 ? 328  ARG A O   1 
ATOM   2334  C CB  . ARG A  1 315  ? 206.472 154.167 190.396 1.00 193.03 ? 328  ARG A CB  1 
ATOM   2335  C CG  . ARG A  1 315  ? 206.160 152.838 189.785 1.00 193.03 ? 328  ARG A CG  1 
ATOM   2336  C CD  . ARG A  1 315  ? 207.396 152.183 189.247 1.00 193.03 ? 328  ARG A CD  1 
ATOM   2337  N NE  . ARG A  1 315  ? 208.283 151.772 190.316 1.00 193.03 ? 328  ARG A NE  1 
ATOM   2338  C CZ  . ARG A  1 315  ? 209.278 152.518 190.774 1.00 193.03 ? 328  ARG A CZ  1 
ATOM   2339  N NH1 . ARG A  1 315  ? 209.513 153.717 190.253 1.00 193.03 ? 328  ARG A NH1 1 
ATOM   2340  N NH2 . ARG A  1 315  ? 210.032 152.063 191.758 1.00 193.03 ? 328  ARG A NH2 1 
ATOM   2341  N N   . PHE A  1 316  ? 206.943 156.293 192.398 1.00 206.00 ? 329  PHE A N   1 
ATOM   2342  C CA  . PHE A  1 316  ? 207.250 157.672 192.862 1.00 206.00 ? 329  PHE A CA  1 
ATOM   2343  C C   . PHE A  1 316  ? 208.757 157.950 192.793 1.00 206.00 ? 329  PHE A C   1 
ATOM   2344  O O   . PHE A  1 316  ? 209.378 157.667 191.749 1.00 206.00 ? 329  PHE A O   1 
ATOM   2345  C CB  . PHE A  1 316  ? 206.704 157.899 194.274 1.00 206.00 ? 329  PHE A CB  1 
ATOM   2346  C CG  . PHE A  1 316  ? 205.216 157.699 194.416 1.00 206.00 ? 329  PHE A CG  1 
ATOM   2347  C CD1 . PHE A  1 316  ? 204.694 156.456 194.734 1.00 206.00 ? 329  PHE A CD1 1 
ATOM   2348  C CD2 . PHE A  1 316  ? 204.337 158.754 194.230 1.00 206.00 ? 329  PHE A CD2 1 
ATOM   2349  C CE1 . PHE A  1 316  ? 203.326 156.273 194.864 1.00 206.00 ? 329  PHE A CE1 1 
ATOM   2350  C CE2 . PHE A  1 316  ? 202.970 158.570 194.360 1.00 206.00 ? 329  PHE A CE2 1 
ATOM   2351  C CZ  . PHE A  1 316  ? 202.466 157.330 194.677 1.00 206.00 ? 329  PHE A CZ  1 
ATOM   2352  N N   . PRO A  1 317  ? 209.409 158.588 193.924 1.00 203.05 ? 330  PRO A N   1 
ATOM   2353  C CA  . PRO A  1 317  ? 210.934 159.164 194.408 1.00 203.05 ? 330  PRO A CA  1 
ATOM   2354  C C   . PRO A  1 317  ? 211.965 158.154 194.933 1.00 203.05 ? 330  PRO A C   1 
ATOM   2355  O O   . PRO A  1 317  ? 211.875 157.781 196.090 1.00 203.05 ? 330  PRO A O   1 
ATOM   2356  C CB  . PRO A  1 317  ? 210.637 160.228 195.474 1.00 203.05 ? 330  PRO A CB  1 
ATOM   2357  C CG  . PRO A  1 317  ? 209.132 160.322 195.488 1.00 203.05 ? 330  PRO A CG  1 
ATOM   2358  C CD  . PRO A  1 317  ? 208.663 158.925 195.141 1.00 203.05 ? 330  PRO A CD  1 
ATOM   2359  N N   . ASN A  1 318  ? 212.918 157.774 194.071 1.00 212.32 ? 331  ASN A N   1 
ATOM   2360  C CA  . ASN A  1 318  ? 214.045 156.849 194.381 1.00 212.32 ? 331  ASN A CA  1 
ATOM   2361  C C   . ASN A  1 318  ? 213.582 155.679 195.261 1.00 212.32 ? 331  ASN A C   1 
ATOM   2362  O O   . ASN A  1 318  ? 212.653 154.957 194.847 1.00 212.32 ? 331  ASN A O   1 
ATOM   2363  C CB  . ASN A  1 318  ? 215.232 157.603 194.991 1.00 212.32 ? 331  ASN A CB  1 
ATOM   2364  C CG  . ASN A  1 318  ? 216.570 156.945 194.721 1.00 212.32 ? 331  ASN A CG  1 
ATOM   2365  O OD1 . ASN A  1 318  ? 217.611 157.458 195.126 1.00 212.32 ? 331  ASN A OD1 1 
ATOM   2366  N ND2 . ASN A  1 318  ? 216.554 155.808 194.044 1.00 212.32 ? 331  ASN A ND2 1 
ATOM   2367  N N   . ILE A  1 319  ? 214.212 155.515 196.431 1.00 231.21 ? 332  ILE A N   1 
ATOM   2368  C CA  . ILE A  1 319  ? 213.895 154.405 197.380 1.00 231.21 ? 332  ILE A CA  1 
ATOM   2369  C C   . ILE A  1 319  ? 213.009 154.946 198.511 1.00 231.21 ? 332  ILE A C   1 
ATOM   2370  O O   . ILE A  1 319  ? 212.731 156.163 198.516 1.00 231.21 ? 332  ILE A O   1 
ATOM   2371  C CB  . ILE A  1 319  ? 215.199 153.767 197.908 1.00 231.21 ? 332  ILE A CB  1 
ATOM   2372  C CG1 . ILE A  1 319  ? 215.027 152.285 198.253 1.00 231.21 ? 332  ILE A CG1 1 
ATOM   2373  C CG2 . ILE A  1 319  ? 215.773 154.567 199.068 1.00 231.21 ? 332  ILE A CG2 1 
ATOM   2374  C CD1 . ILE A  1 319  ? 216.274 151.635 198.808 1.00 231.21 ? 332  ILE A CD1 1 
ATOM   2375  N N   . THR A  1 320  ? 212.584 154.069 199.427 1.00 254.43 ? 333  THR A N   1 
ATOM   2376  C CA  . THR A  1 320  ? 211.726 154.444 200.534 1.00 254.43 ? 333  THR A CA  1 
ATOM   2377  C C   . THR A  1 320  ? 212.486 154.285 201.841 1.00 254.43 ? 333  THR A C   1 
ATOM   2378  O O   . THR A  1 320  ? 212.743 153.159 202.277 1.00 254.43 ? 333  THR A O   1 
ATOM   2379  C CB  . THR A  1 320  ? 210.490 153.553 200.530 1.00 254.43 ? 333  THR A CB  1 
ATOM   2380  O OG1 . THR A  1 320  ? 210.909 152.186 200.456 1.00 254.43 ? 333  THR A OG1 1 
ATOM   2381  C CG2 . THR A  1 320  ? 209.669 153.828 199.298 1.00 254.43 ? 333  THR A CG2 1 
ATOM   2382  N N   . ASN A  1 321  ? 212.827 155.396 202.479 1.00 275.36 ? 334  ASN A N   1 
ATOM   2383  C CA  . ASN A  1 321  ? 213.461 155.248 203.781 1.00 275.36 ? 334  ASN A CA  1 
ATOM   2384  C C   . ASN A  1 321  ? 212.957 156.265 204.795 1.00 275.36 ? 334  ASN A C   1 
ATOM   2385  O O   . ASN A  1 321  ? 212.078 157.079 204.491 1.00 275.36 ? 334  ASN A O   1 
ATOM   2386  C CB  . ASN A  1 321  ? 214.981 155.343 203.663 1.00 275.36 ? 334  ASN A CB  1 
ATOM   2387  C CG  . ASN A  1 321  ? 215.637 153.985 203.594 1.00 275.36 ? 334  ASN A CG  1 
ATOM   2388  O OD1 . ASN A  1 321  ? 215.098 152.992 204.086 1.00 275.36 ? 334  ASN A OD1 1 
ATOM   2389  N ND2 . ASN A  1 321  ? 216.830 153.940 203.027 1.00 275.36 ? 334  ASN A ND2 1 
ATOM   2390  N N   . LEU A  1 322  ? 213.525 156.209 206.004 1.00 280.61 ? 335  LEU A N   1 
ATOM   2391  C CA  . LEU A  1 322  ? 213.139 157.039 207.136 1.00 280.61 ? 335  LEU A CA  1 
ATOM   2392  C C   . LEU A  1 322  ? 214.350 157.838 207.589 1.00 280.61 ? 335  LEU A C   1 
ATOM   2393  O O   . LEU A  1 322  ? 215.488 157.576 207.190 1.00 280.61 ? 335  LEU A O   1 
ATOM   2394  C CB  . LEU A  1 322  ? 212.562 156.184 208.272 1.00 280.61 ? 335  LEU A CB  1 
ATOM   2395  C CG  . LEU A  1 322  ? 213.378 154.967 208.721 1.00 280.61 ? 335  LEU A CG  1 
ATOM   2396  C CD1 . LEU A  1 322  ? 214.458 155.312 209.723 1.00 280.61 ? 335  LEU A CD1 1 
ATOM   2397  C CD2 . LEU A  1 322  ? 212.468 153.890 209.276 1.00 280.61 ? 335  LEU A CD2 1 
ATOM   2398  N N   . CYS A  1 323  ? 214.095 158.823 208.410 1.00 284.00 ? 336  CYS A N   1 
ATOM   2399  C CA  . CYS A  1 323  ? 215.147 159.712 208.866 1.00 284.00 ? 336  CYS A CA  1 
ATOM   2400  C C   . CYS A  1 323  ? 215.578 159.269 210.268 1.00 284.00 ? 336  CYS A C   1 
ATOM   2401  O O   . CYS A  1 323  ? 214.996 158.313 210.795 1.00 284.00 ? 336  CYS A O   1 
ATOM   2402  C CB  . CYS A  1 323  ? 214.616 161.135 208.771 1.00 284.00 ? 336  CYS A CB  1 
ATOM   2403  S SG  . CYS A  1 323  ? 213.830 161.412 207.185 1.00 284.00 ? 336  CYS A SG  1 
ATOM   2404  N N   . PRO A  1 324  ? 216.581 159.913 210.927 1.00 286.47 ? 337  PRO A N   1 
ATOM   2405  C CA  . PRO A  1 324  ? 217.291 159.221 212.018 1.00 286.47 ? 337  PRO A CA  1 
ATOM   2406  C C   . PRO A  1 324  ? 216.473 159.005 213.277 1.00 286.47 ? 337  PRO A C   1 
ATOM   2407  O O   . PRO A  1 324  ? 216.402 159.892 214.131 1.00 286.47 ? 337  PRO A O   1 
ATOM   2408  C CB  . PRO A  1 324  ? 218.476 160.149 212.301 1.00 286.47 ? 337  PRO A CB  1 
ATOM   2409  C CG  . PRO A  1 324  ? 217.971 161.484 211.938 1.00 286.47 ? 337  PRO A CG  1 
ATOM   2410  C CD  . PRO A  1 324  ? 217.135 161.267 210.720 1.00 286.47 ? 337  PRO A CD  1 
ATOM   2411  N N   . PHE A  1 325  ? 215.809 157.857 213.388 1.00 293.09 ? 338  PHE A N   1 
ATOM   2412  C CA  . PHE A  1 325  ? 215.093 157.514 214.609 1.00 293.09 ? 338  PHE A CA  1 
ATOM   2413  C C   . PHE A  1 325  ? 215.840 156.575 215.552 1.00 293.09 ? 338  PHE A C   1 
ATOM   2414  O O   . PHE A  1 325  ? 215.380 156.369 216.682 1.00 293.09 ? 338  PHE A O   1 
ATOM   2415  C CB  . PHE A  1 325  ? 213.729 156.919 214.277 1.00 293.09 ? 338  PHE A CB  1 
ATOM   2416  C CG  . PHE A  1 325  ? 212.664 157.941 214.178 1.00 293.09 ? 338  PHE A CG  1 
ATOM   2417  C CD1 . PHE A  1 325  ? 212.982 159.277 214.308 1.00 293.09 ? 338  PHE A CD1 1 
ATOM   2418  C CD2 . PHE A  1 325  ? 211.344 157.578 214.041 1.00 293.09 ? 338  PHE A CD2 1 
ATOM   2419  C CE1 . PHE A  1 325  ? 212.010 160.234 214.244 1.00 293.09 ? 338  PHE A CE1 1 
ATOM   2420  C CE2 . PHE A  1 325  ? 210.362 158.532 213.982 1.00 293.09 ? 338  PHE A CE2 1 
ATOM   2421  C CZ  . PHE A  1 325  ? 210.694 159.863 214.084 1.00 293.09 ? 338  PHE A CZ  1 
ATOM   2422  N N   . GLY A  1 326  ? 216.971 156.003 215.138 1.00 301.81 ? 339  GLY A N   1 
ATOM   2423  C CA  . GLY A  1 326  ? 217.748 155.193 216.066 1.00 301.81 ? 339  GLY A CA  1 
ATOM   2424  C C   . GLY A  1 326  ? 218.228 156.001 217.255 1.00 301.81 ? 339  GLY A C   1 
ATOM   2425  O O   . GLY A  1 326  ? 217.948 155.665 218.406 1.00 301.81 ? 339  GLY A O   1 
ATOM   2426  N N   . GLU A  1 327  ? 218.912 157.109 216.987 1.00 298.78 ? 340  GLU A N   1 
ATOM   2427  C CA  . GLU A  1 327  ? 219.305 158.067 218.013 1.00 298.78 ? 340  GLU A CA  1 
ATOM   2428  C C   . GLU A  1 327  ? 218.137 158.780 218.591 1.00 298.78 ? 340  GLU A C   1 
ATOM   2429  O O   . GLU A  1 327  ? 218.276 159.667 219.431 1.00 298.78 ? 340  GLU A O   1 
ATOM   2430  C CB  . GLU A  1 327  ? 220.299 159.076 217.438 1.00 298.78 ? 340  GLU A CB  1 
ATOM   2431  N N   . VAL A  1 328  ? 216.954 158.406 218.117 1.00 297.50 ? 341  VAL A N   1 
ATOM   2432  C CA  . VAL A  1 328  ? 215.716 158.824 218.734 1.00 297.50 ? 341  VAL A CA  1 
ATOM   2433  C C   . VAL A  1 328  ? 215.017 157.671 219.437 1.00 297.50 ? 341  VAL A C   1 
ATOM   2434  O O   . VAL A  1 328  ? 214.287 157.905 220.406 1.00 297.50 ? 341  VAL A O   1 
ATOM   2435  C CB  . VAL A  1 328  ? 214.787 159.474 217.689 1.00 297.50 ? 341  VAL A CB  1 
ATOM   2436  C CG1 . VAL A  1 328  ? 213.457 159.871 218.302 1.00 297.50 ? 341  VAL A CG1 1 
ATOM   2437  C CG2 . VAL A  1 328  ? 215.466 160.682 217.079 1.00 297.50 ? 341  VAL A CG2 1 
ATOM   2438  N N   . PHE A  1 329  ? 215.242 156.431 219.008 1.00 298.35 ? 342  PHE A N   1 
ATOM   2439  C CA  . PHE A  1 329  ? 214.570 155.317 219.660 1.00 298.35 ? 342  PHE A CA  1 
ATOM   2440  C C   . PHE A  1 329  ? 215.460 154.103 219.906 1.00 298.35 ? 342  PHE A C   1 
ATOM   2441  O O   . PHE A  1 329  ? 214.937 153.048 220.287 1.00 298.35 ? 342  PHE A O   1 
ATOM   2442  C CB  . PHE A  1 329  ? 213.341 154.903 218.854 1.00 298.35 ? 342  PHE A CB  1 
ATOM   2443  C CG  . PHE A  1 329  ? 212.089 155.600 219.282 1.00 298.35 ? 342  PHE A CG  1 
ATOM   2444  C CD1 . PHE A  1 329  ? 211.867 156.917 218.936 1.00 298.35 ? 342  PHE A CD1 1 
ATOM   2445  C CD2 . PHE A  1 329  ? 211.140 154.943 220.042 1.00 298.35 ? 342  PHE A CD2 1 
ATOM   2446  C CE1 . PHE A  1 329  ? 210.724 157.569 219.336 1.00 298.35 ? 342  PHE A CE1 1 
ATOM   2447  C CE2 . PHE A  1 329  ? 209.987 155.589 220.442 1.00 298.35 ? 342  PHE A CE2 1 
ATOM   2448  C CZ  . PHE A  1 329  ? 209.779 156.904 220.089 1.00 298.35 ? 342  PHE A CZ  1 
ATOM   2449  N N   . ASN A  1 330  ? 216.775 154.197 219.701 1.00 313.00 ? 343  ASN A N   1 
ATOM   2450  C CA  . ASN A  1 330  ? 217.646 153.087 220.064 1.00 313.00 ? 343  ASN A CA  1 
ATOM   2451  C C   . ASN A  1 330  ? 219.009 153.491 220.616 1.00 313.00 ? 343  ASN A C   1 
ATOM   2452  O O   . ASN A  1 330  ? 219.857 152.611 220.790 1.00 313.00 ? 343  ASN A O   1 
ATOM   2453  C CB  . ASN A  1 330  ? 217.836 152.142 218.867 1.00 313.00 ? 343  ASN A CB  1 
ATOM   2454  C CG  . ASN A  1 330  ? 216.883 150.956 218.909 1.00 313.00 ? 343  ASN A CG  1 
ATOM   2455  O OD1 . ASN A  1 330  ? 216.519 150.479 219.981 1.00 313.00 ? 343  ASN A OD1 1 
ATOM   2456  N ND2 . ASN A  1 330  ? 216.479 150.477 217.743 1.00 313.00 ? 343  ASN A ND2 1 
ATOM   2457  N N   . ALA A  1 331  ? 219.261 154.771 220.885 1.00 302.84 ? 344  ALA A N   1 
ATOM   2458  C CA  . ALA A  1 331  ? 220.478 155.166 221.587 1.00 302.84 ? 344  ALA A CA  1 
ATOM   2459  C C   . ALA A  1 331  ? 220.300 154.990 223.094 1.00 302.84 ? 344  ALA A C   1 
ATOM   2460  O O   . ALA A  1 331  ? 219.205 155.186 223.630 1.00 302.84 ? 344  ALA A O   1 
ATOM   2461  C CB  . ALA A  1 331  ? 220.849 156.613 221.264 1.00 302.84 ? 344  ALA A CB  1 
ATOM   2462  N N   . THR A  1 332  ? 221.392 154.625 223.779 1.00 301.45 ? 345  THR A N   1 
ATOM   2463  C CA  . THR A  1 332  ? 221.312 154.186 225.171 1.00 301.45 ? 345  THR A CA  1 
ATOM   2464  C C   . THR A  1 332  ? 221.116 155.330 226.157 1.00 301.45 ? 345  THR A C   1 
ATOM   2465  O O   . THR A  1 332  ? 220.702 155.080 227.291 1.00 301.45 ? 345  THR A O   1 
ATOM   2466  C CB  . THR A  1 332  ? 222.563 153.394 225.557 1.00 301.45 ? 345  THR A CB  1 
ATOM   2467  O OG1 . THR A  1 332  ? 222.244 152.502 226.626 1.00 301.45 ? 345  THR A OG1 1 
ATOM   2468  C CG2 . THR A  1 332  ? 223.669 154.324 226.019 1.00 301.45 ? 345  THR A CG2 1 
ATOM   2469  N N   . ARG A  1 333  ? 221.403 156.566 225.766 1.00 299.77 ? 346  ARG A N   1 
ATOM   2470  C CA  . ARG A  1 333  ? 221.123 157.731 226.591 1.00 299.77 ? 346  ARG A CA  1 
ATOM   2471  C C   . ARG A  1 333  ? 220.015 158.554 225.948 1.00 299.77 ? 346  ARG A C   1 
ATOM   2472  O O   . ARG A  1 333  ? 219.709 158.407 224.762 1.00 299.77 ? 346  ARG A O   1 
ATOM   2473  C CB  . ARG A  1 333  ? 222.377 158.589 226.788 1.00 299.77 ? 346  ARG A CB  1 
ATOM   2474  N N   . PHE A  1 334  ? 219.412 159.426 226.746 1.00 295.70 ? 347  PHE A N   1 
ATOM   2475  C CA  . PHE A  1 334  ? 218.263 160.201 226.301 1.00 295.70 ? 347  PHE A CA  1 
ATOM   2476  C C   . PHE A  1 334  ? 218.295 161.553 227.000 1.00 295.70 ? 347  PHE A C   1 
ATOM   2477  O O   . PHE A  1 334  ? 219.331 161.982 227.514 1.00 295.70 ? 347  PHE A O   1 
ATOM   2478  C CB  . PHE A  1 334  ? 216.956 159.453 226.590 1.00 295.70 ? 347  PHE A CB  1 
ATOM   2479  C CG  . PHE A  1 334  ? 216.411 158.672 225.421 1.00 295.70 ? 347  PHE A CG  1 
ATOM   2480  C CD1 . PHE A  1 334  ? 216.852 157.386 225.161 1.00 295.70 ? 347  PHE A CD1 1 
ATOM   2481  C CD2 . PHE A  1 334  ? 215.419 159.206 224.618 1.00 295.70 ? 347  PHE A CD2 1 
ATOM   2482  C CE1 . PHE A  1 334  ? 216.337 156.662 224.111 1.00 295.70 ? 347  PHE A CE1 1 
ATOM   2483  C CE2 . PHE A  1 334  ? 214.901 158.483 223.569 1.00 295.70 ? 347  PHE A CE2 1 
ATOM   2484  C CZ  . PHE A  1 334  ? 215.362 157.209 223.317 1.00 295.70 ? 347  PHE A CZ  1 
ATOM   2485  N N   . ALA A  1 335  ? 217.155 162.229 227.005 1.00 287.00 ? 348  ALA A N   1 
ATOM   2486  C CA  . ALA A  1 335  ? 217.000 163.497 227.695 1.00 287.00 ? 348  ALA A CA  1 
ATOM   2487  C C   . ALA A  1 335  ? 216.031 163.341 228.861 1.00 287.00 ? 348  ALA A C   1 
ATOM   2488  O O   . ALA A  1 335  ? 215.320 162.339 228.982 1.00 287.00 ? 348  ALA A O   1 
ATOM   2489  C CB  . ALA A  1 335  ? 216.524 164.587 226.733 1.00 287.00 ? 348  ALA A CB  1 
ATOM   2490  N N   . SER A  1 336  ? 216.015 164.353 229.724 1.00 295.04 ? 349  SER A N   1 
ATOM   2491  C CA  . SER A  1 336  ? 215.386 164.293 231.034 1.00 295.04 ? 349  SER A CA  1 
ATOM   2492  C C   . SER A  1 336  ? 214.212 165.262 231.131 1.00 295.04 ? 349  SER A C   1 
ATOM   2493  O O   . SER A  1 336  ? 213.734 165.802 230.130 1.00 295.04 ? 349  SER A O   1 
ATOM   2494  C CB  . SER A  1 336  ? 216.428 164.578 232.118 1.00 295.04 ? 349  SER A CB  1 
ATOM   2495  N N   . VAL A  1 337  ? 213.723 165.449 232.359 1.00 296.86 ? 350  VAL A N   1 
ATOM   2496  C CA  . VAL A  1 337  ? 212.731 166.486 232.630 1.00 296.86 ? 350  VAL A CA  1 
ATOM   2497  C C   . VAL A  1 337  ? 213.244 167.839 232.162 1.00 296.86 ? 350  VAL A C   1 
ATOM   2498  O O   . VAL A  1 337  ? 212.469 168.705 231.739 1.00 296.86 ? 350  VAL A O   1 
ATOM   2499  C CB  . VAL A  1 337  ? 212.386 166.509 234.133 1.00 296.86 ? 350  VAL A CB  1 
ATOM   2500  C CG1 . VAL A  1 337  ? 211.483 167.679 234.465 1.00 296.86 ? 350  VAL A CG1 1 
ATOM   2501  C CG2 . VAL A  1 337  ? 211.743 165.224 234.545 1.00 296.86 ? 350  VAL A CG2 1 
ATOM   2502  N N   . TYR A  1 338  ? 214.557 168.043 232.230 1.00 306.54 ? 351  TYR A N   1 
ATOM   2503  C CA  . TYR A  1 338  ? 215.159 169.336 231.943 1.00 306.54 ? 351  TYR A CA  1 
ATOM   2504  C C   . TYR A  1 338  ? 215.960 169.375 230.647 1.00 306.54 ? 351  TYR A C   1 
ATOM   2505  O O   . TYR A  1 338  ? 216.586 170.403 230.373 1.00 306.54 ? 351  TYR A O   1 
ATOM   2506  C CB  . TYR A  1 338  ? 216.063 169.766 233.104 1.00 306.54 ? 351  TYR A CB  1 
ATOM   2507  C CG  . TYR A  1 338  ? 217.234 168.835 233.381 1.00 306.54 ? 351  TYR A CG  1 
ATOM   2508  C CD1 . TYR A  1 338  ? 217.064 167.678 234.132 1.00 306.54 ? 351  TYR A CD1 1 
ATOM   2509  C CD2 . TYR A  1 338  ? 218.513 169.127 232.913 1.00 306.54 ? 351  TYR A CD2 1 
ATOM   2510  C CE1 . TYR A  1 338  ? 218.126 166.830 234.396 1.00 306.54 ? 351  TYR A CE1 1 
ATOM   2511  C CE2 . TYR A  1 338  ? 219.583 168.283 233.175 1.00 306.54 ? 351  TYR A CE2 1 
ATOM   2512  C CZ  . TYR A  1 338  ? 219.381 167.137 233.916 1.00 306.54 ? 351  TYR A CZ  1 
ATOM   2513  O OH  . TYR A  1 338  ? 220.433 166.291 234.180 1.00 306.54 ? 351  TYR A OH  1 
ATOM   2514  N N   . ALA A  1 339  ? 215.961 168.297 229.840 1.00 306.11 ? 352  ALA A N   1 
ATOM   2515  C CA  . ALA A  1 339  ? 216.792 168.234 228.634 1.00 306.11 ? 352  ALA A CA  1 
ATOM   2516  C C   . ALA A  1 339  ? 216.039 167.950 227.336 1.00 306.11 ? 352  ALA A C   1 
ATOM   2517  O O   . ALA A  1 339  ? 216.677 167.846 226.284 1.00 306.11 ? 352  ALA A O   1 
ATOM   2518  C CB  . ALA A  1 339  ? 217.893 167.173 228.795 1.00 306.11 ? 352  ALA A CB  1 
ATOM   2519  N N   . TRP A  1 340  ? 214.719 167.814 227.376 1.00 298.02 ? 353  TRP A N   1 
ATOM   2520  C CA  . TRP A  1 340  ? 213.953 167.449 226.196 1.00 298.02 ? 353  TRP A CA  1 
ATOM   2521  C C   . TRP A  1 340  ? 213.705 168.679 225.339 1.00 298.02 ? 353  TRP A C   1 
ATOM   2522  O O   . TRP A  1 340  ? 213.199 169.694 225.829 1.00 298.02 ? 353  TRP A O   1 
ATOM   2523  C CB  . TRP A  1 340  ? 212.632 166.811 226.614 1.00 298.02 ? 353  TRP A CB  1 
ATOM   2524  C CG  . TRP A  1 340  ? 211.960 165.955 225.580 1.00 298.02 ? 353  TRP A CG  1 
ATOM   2525  C CD1 . TRP A  1 340  ? 210.793 166.226 224.937 1.00 298.02 ? 353  TRP A CD1 1 
ATOM   2526  C CD2 . TRP A  1 340  ? 212.397 164.675 225.091 1.00 298.02 ? 353  TRP A CD2 1 
ATOM   2527  N NE1 . TRP A  1 340  ? 210.476 165.205 224.075 1.00 298.02 ? 353  TRP A NE1 1 
ATOM   2528  C CE2 . TRP A  1 340  ? 211.447 164.242 224.149 1.00 298.02 ? 353  TRP A CE2 1 
ATOM   2529  C CE3 . TRP A  1 340  ? 213.496 163.856 225.360 1.00 298.02 ? 353  TRP A CE3 1 
ATOM   2530  C CZ2 . TRP A  1 340  ? 211.562 163.027 223.476 1.00 298.02 ? 353  TRP A CZ2 1 
ATOM   2531  C CZ3 . TRP A  1 340  ? 213.611 162.652 224.685 1.00 298.02 ? 353  TRP A CZ3 1 
ATOM   2532  C CH2 . TRP A  1 340  ? 212.649 162.250 223.756 1.00 298.02 ? 353  TRP A CH2 1 
ATOM   2533  N N   . ASN A  1 341  ? 214.071 168.584 224.061 1.00 284.69 ? 354  ASN A N   1 
ATOM   2534  C CA  . ASN A  1 341  ? 213.862 169.637 223.072 1.00 284.69 ? 354  ASN A CA  1 
ATOM   2535  C C   . ASN A  1 341  ? 212.800 169.212 222.071 1.00 284.69 ? 354  ASN A C   1 
ATOM   2536  O O   . ASN A  1 341  ? 212.814 168.083 221.574 1.00 284.69 ? 354  ASN A O   1 
ATOM   2537  C CB  . ASN A  1 341  ? 215.162 169.972 222.331 1.00 284.69 ? 354  ASN A CB  1 
ATOM   2538  C CG  . ASN A  1 341  ? 214.927 170.686 221.019 1.00 284.69 ? 354  ASN A CG  1 
ATOM   2539  O OD1 . ASN A  1 341  ? 213.979 171.453 220.865 1.00 284.69 ? 354  ASN A OD1 1 
ATOM   2540  N ND2 . ASN A  1 341  ? 215.813 170.452 220.068 1.00 284.69 ? 354  ASN A ND2 1 
ATOM   2541  N N   . ARG A  1 342  ? 211.893 170.127 221.767 1.00 272.67 ? 355  ARG A N   1 
ATOM   2542  C CA  . ARG A  1 342  ? 210.808 169.826 220.849 1.00 272.67 ? 355  ARG A CA  1 
ATOM   2543  C C   . ARG A  1 342  ? 211.419 169.694 219.465 1.00 272.67 ? 355  ARG A C   1 
ATOM   2544  O O   . ARG A  1 342  ? 211.652 170.689 218.778 1.00 272.67 ? 355  ARG A O   1 
ATOM   2545  C CB  . ARG A  1 342  ? 209.755 170.925 220.908 1.00 272.67 ? 355  ARG A CB  1 
ATOM   2546  C CG  . ARG A  1 342  ? 209.533 171.469 222.312 1.00 272.67 ? 355  ARG A CG  1 
ATOM   2547  C CD  . ARG A  1 342  ? 208.902 170.430 223.220 1.00 272.67 ? 355  ARG A CD  1 
ATOM   2548  N NE  . ARG A  1 342  ? 207.455 170.400 223.066 1.00 272.67 ? 355  ARG A NE  1 
ATOM   2549  C CZ  . ARG A  1 342  ? 206.617 171.086 223.831 1.00 272.67 ? 355  ARG A CZ  1 
ATOM   2550  N NH1 . ARG A  1 342  ? 207.091 171.833 224.819 1.00 272.67 ? 355  ARG A NH1 1 
ATOM   2551  N NH2 . ARG A  1 342  ? 205.311 171.011 223.618 1.00 272.67 ? 355  ARG A NH2 1 
ATOM   2552  N N   . LYS A  1 343  ? 211.696 168.462 219.057 1.00 273.72 ? 356  LYS A N   1 
ATOM   2553  C CA  . LYS A  1 343  ? 212.393 168.185 217.808 1.00 273.72 ? 356  LYS A CA  1 
ATOM   2554  C C   . LYS A  1 343  ? 211.396 168.096 216.659 1.00 273.72 ? 356  LYS A C   1 
ATOM   2555  O O   . LYS A  1 343  ? 210.196 167.912 216.880 1.00 273.72 ? 356  LYS A O   1 
ATOM   2556  C CB  . LYS A  1 343  ? 213.186 166.880 217.908 1.00 273.72 ? 356  LYS A CB  1 
ATOM   2557  C CG  . LYS A  1 343  ? 213.922 166.689 219.225 1.00 273.72 ? 356  LYS A CG  1 
ATOM   2558  C CD  . LYS A  1 343  ? 215.202 167.491 219.268 1.00 273.72 ? 356  LYS A CD  1 
ATOM   2559  C CE  . LYS A  1 343  ? 215.969 167.235 220.541 1.00 273.72 ? 356  LYS A CE  1 
ATOM   2560  N NZ  . LYS A  1 343  ? 215.845 165.826 220.970 1.00 273.72 ? 356  LYS A NZ  1 
ATOM   2561  N N   . ARG A  1 344  ? 211.892 168.252 215.432 1.00 267.29 ? 357  ARG A N   1 
ATOM   2562  C CA  . ARG A  1 344  ? 211.084 168.044 214.233 1.00 267.29 ? 357  ARG A CA  1 
ATOM   2563  C C   . ARG A  1 344  ? 211.975 167.607 213.083 1.00 267.29 ? 357  ARG A C   1 
ATOM   2564  O O   . ARG A  1 344  ? 212.712 168.418 212.512 1.00 267.29 ? 357  ARG A O   1 
ATOM   2565  C CB  . ARG A  1 344  ? 210.316 169.299 213.847 1.00 267.29 ? 357  ARG A CB  1 
ATOM   2566  C CG  . ARG A  1 344  ? 209.746 169.245 212.442 1.00 267.29 ? 357  ARG A CG  1 
ATOM   2567  C CD  . ARG A  1 344  ? 208.929 170.475 212.216 1.00 267.29 ? 357  ARG A CD  1 
ATOM   2568  N NE  . ARG A  1 344  ? 208.649 170.720 210.815 1.00 267.29 ? 357  ARG A NE  1 
ATOM   2569  C CZ  . ARG A  1 344  ? 209.492 171.336 210.002 1.00 267.29 ? 357  ARG A CZ  1 
ATOM   2570  N NH1 . ARG A  1 344  ? 210.667 171.746 210.460 1.00 267.29 ? 357  ARG A NH1 1 
ATOM   2571  N NH2 . ARG A  1 344  ? 209.157 171.540 208.738 1.00 267.29 ? 357  ARG A NH2 1 
ATOM   2572  N N   . ILE A  1 345  ? 211.889 166.338 212.725 1.00 267.42 ? 358  ILE A N   1 
ATOM   2573  C CA  . ILE A  1 345  ? 212.681 165.797 211.637 1.00 267.42 ? 358  ILE A CA  1 
ATOM   2574  C C   . ILE A  1 345  ? 211.824 165.782 210.382 1.00 267.42 ? 358  ILE A C   1 
ATOM   2575  O O   . ILE A  1 345  ? 210.742 165.186 210.355 1.00 267.42 ? 358  ILE A O   1 
ATOM   2576  C CB  . ILE A  1 345  ? 213.220 164.399 211.970 1.00 267.42 ? 358  ILE A CB  1 
ATOM   2577  C CG1 . ILE A  1 345  ? 213.966 163.829 210.766 1.00 267.42 ? 358  ILE A CG1 1 
ATOM   2578  C CG2 . ILE A  1 345  ? 212.105 163.480 212.450 1.00 267.42 ? 358  ILE A CG2 1 
ATOM   2579  C CD1 . ILE A  1 345  ? 215.211 164.603 210.399 1.00 267.42 ? 358  ILE A CD1 1 
ATOM   2580  N N   . SER A  1 346  ? 212.303 166.469 209.358 1.00 261.99 ? 359  SER A N   1 
ATOM   2581  C CA  . SER A  1 346  ? 211.745 166.450 208.013 1.00 261.99 ? 359  SER A CA  1 
ATOM   2582  C C   . SER A  1 346  ? 212.880 166.857 207.082 1.00 261.99 ? 359  SER A C   1 
ATOM   2583  O O   . SER A  1 346  ? 214.054 166.753 207.450 1.00 261.99 ? 359  SER A O   1 
ATOM   2584  C CB  . SER A  1 346  ? 210.510 167.348 207.917 1.00 261.99 ? 359  SER A CB  1 
ATOM   2585  O OG  . SER A  1 346  ? 209.326 166.636 208.233 1.00 261.99 ? 359  SER A OG  1 
ATOM   2586  N N   . ASN A  1 347  ? 212.550 167.311 205.876 1.00 254.63 ? 360  ASN A N   1 
ATOM   2587  C CA  . ASN A  1 347  ? 213.576 167.678 204.902 1.00 254.63 ? 360  ASN A CA  1 
ATOM   2588  C C   . ASN A  1 347  ? 214.510 166.489 204.658 1.00 254.63 ? 360  ASN A C   1 
ATOM   2589  O O   . ASN A  1 347  ? 215.727 166.555 204.850 1.00 254.63 ? 360  ASN A O   1 
ATOM   2590  C CB  . ASN A  1 347  ? 214.363 168.912 205.359 1.00 254.63 ? 360  ASN A CB  1 
ATOM   2591  C CG  . ASN A  1 347  ? 213.772 170.201 204.845 1.00 254.63 ? 360  ASN A CG  1 
ATOM   2592  O OD1 . ASN A  1 347  ? 212.854 170.188 204.034 1.00 254.63 ? 360  ASN A OD1 1 
ATOM   2593  N ND2 . ASN A  1 347  ? 214.309 171.324 205.298 1.00 254.63 ? 360  ASN A ND2 1 
ATOM   2594  N N   . CYS A  1 348  ? 213.901 165.384 204.237 1.00 262.28 ? 361  CYS A N   1 
ATOM   2595  C CA  . CYS A  1 348  ? 214.525 164.069 204.215 1.00 262.28 ? 361  CYS A CA  1 
ATOM   2596  C C   . CYS A  1 348  ? 213.520 163.087 203.633 1.00 262.28 ? 361  CYS A C   1 
ATOM   2597  O O   . CYS A  1 348  ? 212.312 163.349 203.622 1.00 262.28 ? 361  CYS A O   1 
ATOM   2598  C CB  . CYS A  1 348  ? 214.957 163.655 205.623 1.00 262.28 ? 361  CYS A CB  1 
ATOM   2599  S SG  . CYS A  1 348  ? 215.329 161.922 205.913 1.00 262.28 ? 361  CYS A SG  1 
ATOM   2600  N N   . VAL A  1 349  ? 214.027 161.952 203.154 1.00 260.58 ? 362  VAL A N   1 
ATOM   2601  C CA  . VAL A  1 349  ? 213.151 160.909 202.635 1.00 260.58 ? 362  VAL A CA  1 
ATOM   2602  C C   . VAL A  1 349  ? 212.270 160.455 203.792 1.00 260.58 ? 362  VAL A C   1 
ATOM   2603  O O   . VAL A  1 349  ? 212.739 159.830 204.748 1.00 260.58 ? 362  VAL A O   1 
ATOM   2604  C CB  . VAL A  1 349  ? 213.957 159.759 201.988 1.00 260.58 ? 362  VAL A CB  1 
ATOM   2605  C CG1 . VAL A  1 349  ? 215.053 159.257 202.909 1.00 260.58 ? 362  VAL A CG1 1 
ATOM   2606  C CG2 . VAL A  1 349  ? 213.040 158.604 201.597 1.00 260.58 ? 362  VAL A CG2 1 
ATOM   2607  N N   . ALA A  1 350  ? 210.988 160.802 203.728 1.00 257.00 ? 363  ALA A N   1 
ATOM   2608  C CA  . ALA A  1 350  ? 210.126 160.863 204.903 1.00 257.00 ? 363  ALA A CA  1 
ATOM   2609  C C   . ALA A  1 350  ? 209.119 159.719 204.899 1.00 257.00 ? 363  ALA A C   1 
ATOM   2610  O O   . ALA A  1 350  ? 208.133 159.757 204.159 1.00 257.00 ? 363  ALA A O   1 
ATOM   2611  C CB  . ALA A  1 350  ? 209.418 162.213 204.955 1.00 257.00 ? 363  ALA A CB  1 
ATOM   2612  N N   . ASP A  1 351  ? 209.363 158.713 205.743 1.00 263.08 ? 364  ASP A N   1 
ATOM   2613  C CA  . ASP A  1 351  ? 208.405 157.630 205.992 1.00 263.08 ? 364  ASP A CA  1 
ATOM   2614  C C   . ASP A  1 351  ? 208.578 157.184 207.443 1.00 263.08 ? 364  ASP A C   1 
ATOM   2615  O O   . ASP A  1 351  ? 209.629 156.652 207.808 1.00 263.08 ? 364  ASP A O   1 
ATOM   2616  C CB  . ASP A  1 351  ? 208.605 156.457 205.041 1.00 263.08 ? 364  ASP A CB  1 
ATOM   2617  C CG  . ASP A  1 351  ? 207.825 156.602 203.767 1.00 263.08 ? 364  ASP A CG  1 
ATOM   2618  O OD1 . ASP A  1 351  ? 206.899 157.429 203.731 1.00 263.08 ? 364  ASP A OD1 1 
ATOM   2619  O OD2 . ASP A  1 351  ? 208.098 155.838 202.826 1.00 263.08 ? 364  ASP A OD2 1 
ATOM   2620  N N   . TYR A  1 352  ? 207.549 157.390 208.258 1.00 267.98 ? 365  TYR A N   1 
ATOM   2621  C CA  . TYR A  1 352  ? 207.578 156.999 209.661 1.00 267.98 ? 365  TYR A CA  1 
ATOM   2622  C C   . TYR A  1 352  ? 206.431 156.056 210.012 1.00 267.98 ? 365  TYR A C   1 
ATOM   2623  O O   . TYR A  1 352  ? 205.793 156.199 211.052 1.00 267.98 ? 365  TYR A O   1 
ATOM   2624  C CB  . TYR A  1 352  ? 207.540 158.228 210.561 1.00 267.98 ? 365  TYR A CB  1 
ATOM   2625  C CG  . TYR A  1 352  ? 208.673 159.194 210.340 1.00 267.98 ? 365  TYR A CG  1 
ATOM   2626  C CD1 . TYR A  1 352  ? 209.900 158.762 209.867 1.00 267.98 ? 365  TYR A CD1 1 
ATOM   2627  C CD2 . TYR A  1 352  ? 208.516 160.539 210.610 1.00 267.98 ? 365  TYR A CD2 1 
ATOM   2628  C CE1 . TYR A  1 352  ? 210.933 159.643 209.659 1.00 267.98 ? 365  TYR A CE1 1 
ATOM   2629  C CE2 . TYR A  1 352  ? 209.545 161.427 210.411 1.00 267.98 ? 365  TYR A CE2 1 
ATOM   2630  C CZ  . TYR A  1 352  ? 210.750 160.975 209.936 1.00 267.98 ? 365  TYR A CZ  1 
ATOM   2631  O OH  . TYR A  1 352  ? 211.774 161.863 209.735 1.00 267.98 ? 365  TYR A OH  1 
ATOM   2632  N N   . SER A  1 353  ? 206.153 155.075 209.159 1.00 259.89 ? 366  SER A N   1 
ATOM   2633  C CA  . SER A  1 353  ? 205.034 154.168 209.381 1.00 259.89 ? 366  SER A CA  1 
ATOM   2634  C C   . SER A  1 353  ? 205.471 152.799 209.878 1.00 259.89 ? 366  SER A C   1 
ATOM   2635  O O   . SER A  1 353  ? 204.685 151.849 209.821 1.00 259.89 ? 366  SER A O   1 
ATOM   2636  C CB  . SER A  1 353  ? 204.213 154.013 208.102 1.00 259.89 ? 366  SER A CB  1 
ATOM   2637  O OG  . SER A  1 353  ? 205.048 153.846 206.972 1.00 259.89 ? 366  SER A OG  1 
ATOM   2638  N N   . VAL A  1 354  ? 206.698 152.674 210.364 1.00 252.21 ? 367  VAL A N   1 
ATOM   2639  C CA  . VAL A  1 354  ? 207.212 151.380 210.788 1.00 252.21 ? 367  VAL A CA  1 
ATOM   2640  C C   . VAL A  1 354  ? 207.599 151.444 212.263 1.00 252.21 ? 367  VAL A C   1 
ATOM   2641  O O   . VAL A  1 354  ? 208.549 150.786 212.704 1.00 252.21 ? 367  VAL A O   1 
ATOM   2642  C CB  . VAL A  1 354  ? 208.390 150.962 209.895 1.00 252.21 ? 367  VAL A CB  1 
ATOM   2643  C CG1 . VAL A  1 354  ? 207.869 150.477 208.546 1.00 252.21 ? 367  VAL A CG1 1 
ATOM   2644  C CG2 . VAL A  1 354  ? 209.329 152.138 209.700 1.00 252.21 ? 367  VAL A CG2 1 
ATOM   2645  N N   . LEU A  1 355  ? 206.852 152.236 213.034 1.00 260.66 ? 368  LEU A N   1 
ATOM   2646  C CA  . LEU A  1 355  ? 207.125 152.474 214.445 1.00 260.66 ? 368  LEU A CA  1 
ATOM   2647  C C   . LEU A  1 355  ? 206.379 151.510 215.360 1.00 260.66 ? 368  LEU A C   1 
ATOM   2648  O O   . LEU A  1 355  ? 206.381 151.700 216.579 1.00 260.66 ? 368  LEU A O   1 
ATOM   2649  C CB  . LEU A  1 355  ? 206.775 153.917 214.810 1.00 260.66 ? 368  LEU A CB  1 
ATOM   2650  C CG  . LEU A  1 355  ? 205.294 154.281 214.972 1.00 260.66 ? 368  LEU A CG  1 
ATOM   2651  C CD1 . LEU A  1 355  ? 205.168 155.622 215.657 1.00 260.66 ? 368  LEU A CD1 1 
ATOM   2652  C CD2 . LEU A  1 355  ? 204.544 154.306 213.654 1.00 260.66 ? 368  LEU A CD2 1 
ATOM   2653  N N   . TYR A  1 356  ? 205.734 150.487 214.804 1.00 265.69 ? 369  TYR A N   1 
ATOM   2654  C CA  . TYR A  1 356  ? 205.079 149.485 215.634 1.00 265.69 ? 369  TYR A CA  1 
ATOM   2655  C C   . TYR A  1 356  ? 205.317 148.080 215.098 1.00 265.69 ? 369  TYR A C   1 
ATOM   2656  O O   . TYR A  1 356  ? 204.395 147.260 215.061 1.00 265.69 ? 369  TYR A O   1 
ATOM   2657  C CB  . TYR A  1 356  ? 203.577 149.752 215.759 1.00 265.69 ? 369  TYR A CB  1 
ATOM   2658  C CG  . TYR A  1 356  ? 202.982 149.270 217.072 1.00 265.69 ? 369  TYR A CG  1 
ATOM   2659  C CD1 . TYR A  1 356  ? 203.005 150.069 218.212 1.00 265.69 ? 369  TYR A CD1 1 
ATOM   2660  C CD2 . TYR A  1 356  ? 202.416 148.005 217.178 1.00 265.69 ? 369  TYR A CD2 1 
ATOM   2661  C CE1 . TYR A  1 356  ? 202.462 149.622 219.410 1.00 265.69 ? 369  TYR A CE1 1 
ATOM   2662  C CE2 . TYR A  1 356  ? 201.881 147.554 218.373 1.00 265.69 ? 369  TYR A CE2 1 
ATOM   2663  C CZ  . TYR A  1 356  ? 201.909 148.364 219.479 1.00 265.69 ? 369  TYR A CZ  1 
ATOM   2664  O OH  . TYR A  1 356  ? 201.377 147.901 220.650 1.00 265.69 ? 369  TYR A OH  1 
ATOM   2665  N N   . ASN A  1 357  ? 206.528 147.789 214.673 1.00 271.86 ? 370  ASN A N   1 
ATOM   2666  C CA  . ASN A  1 357  ? 206.829 146.425 214.265 1.00 271.86 ? 370  ASN A CA  1 
ATOM   2667  C C   . ASN A  1 357  ? 207.214 145.503 215.432 1.00 271.86 ? 370  ASN A C   1 
ATOM   2668  O O   . ASN A  1 357  ? 207.691 144.411 215.104 1.00 271.86 ? 370  ASN A O   1 
ATOM   2669  C CB  . ASN A  1 357  ? 207.947 146.426 213.223 1.00 271.86 ? 370  ASN A CB  1 
ATOM   2670  C CG  . ASN A  1 357  ? 209.039 147.418 213.547 1.00 271.86 ? 370  ASN A CG  1 
ATOM   2671  O OD1 . ASN A  1 357  ? 208.853 148.306 214.373 1.00 271.86 ? 370  ASN A OD1 1 
ATOM   2672  N ND2 . ASN A  1 357  ? 210.198 147.249 212.927 1.00 271.86 ? 370  ASN A ND2 1 
ATOM   2673  N N   . SER A  1 358  ? 207.051 145.829 216.715 1.00 283.76 ? 371  SER A N   1 
ATOM   2674  C CA  . SER A  1 358  ? 207.525 144.990 217.812 1.00 283.76 ? 371  SER A CA  1 
ATOM   2675  C C   . SER A  1 358  ? 206.395 144.688 218.792 1.00 283.76 ? 371  SER A C   1 
ATOM   2676  O O   . SER A  1 358  ? 205.269 145.172 218.651 1.00 283.76 ? 371  SER A O   1 
ATOM   2677  C CB  . SER A  1 358  ? 208.700 145.651 218.547 1.00 283.76 ? 371  SER A CB  1 
ATOM   2678  O OG  . SER A  1 358  ? 209.936 145.382 217.904 1.00 283.76 ? 371  SER A OG  1 
ATOM   2679  N N   . ALA A  1 359  ? 206.720 143.869 219.803 1.00 281.10 ? 372  ALA A N   1 
ATOM   2680  C CA  . ALA A  1 359  ? 205.757 143.387 220.795 1.00 281.10 ? 372  ALA A CA  1 
ATOM   2681  C C   . ALA A  1 359  ? 206.177 143.657 222.239 1.00 281.10 ? 372  ALA A C   1 
ATOM   2682  O O   . ALA A  1 359  ? 205.466 143.250 223.167 1.00 281.10 ? 372  ALA A O   1 
ATOM   2683  C CB  . ALA A  1 359  ? 205.509 141.886 220.610 1.00 281.10 ? 372  ALA A CB  1 
ATOM   2684  N N   . SER A  1 360  ? 207.305 144.322 222.461 1.00 271.23 ? 373  SER A N   1 
ATOM   2685  C CA  . SER A  1 360  ? 207.701 144.719 223.802 1.00 271.23 ? 373  SER A CA  1 
ATOM   2686  C C   . SER A  1 360  ? 206.978 145.969 224.272 1.00 271.23 ? 373  SER A C   1 
ATOM   2687  O O   . SER A  1 360  ? 207.415 146.591 225.243 1.00 271.23 ? 373  SER A O   1 
ATOM   2688  C CB  . SER A  1 360  ? 209.212 144.940 223.861 1.00 271.23 ? 373  SER A CB  1 
ATOM   2689  O OG  . SER A  1 360  ? 209.538 146.282 223.556 1.00 271.23 ? 373  SER A OG  1 
ATOM   2690  N N   . PHE A  1 361  ? 205.905 146.362 223.595 1.00 272.39 ? 374  PHE A N   1 
ATOM   2691  C CA  . PHE A  1 361  ? 205.104 147.513 223.983 1.00 272.39 ? 374  PHE A CA  1 
ATOM   2692  C C   . PHE A  1 361  ? 203.939 147.032 224.849 1.00 272.39 ? 374  PHE A C   1 
ATOM   2693  O O   . PHE A  1 361  ? 203.881 145.869 225.258 1.00 272.39 ? 374  PHE A O   1 
ATOM   2694  C CB  . PHE A  1 361  ? 204.618 148.273 222.745 1.00 272.39 ? 374  PHE A CB  1 
ATOM   2695  C CG  . PHE A  1 361  ? 205.725 148.820 221.876 1.00 272.39 ? 374  PHE A CG  1 
ATOM   2696  C CD1 . PHE A  1 361  ? 207.014 148.956 222.354 1.00 272.39 ? 374  PHE A CD1 1 
ATOM   2697  C CD2 . PHE A  1 361  ? 205.465 149.192 220.571 1.00 272.39 ? 374  PHE A CD2 1 
ATOM   2698  C CE1 . PHE A  1 361  ? 208.015 149.455 221.544 1.00 272.39 ? 374  PHE A CE1 1 
ATOM   2699  C CE2 . PHE A  1 361  ? 206.459 149.691 219.765 1.00 272.39 ? 374  PHE A CE2 1 
ATOM   2700  C CZ  . PHE A  1 361  ? 207.734 149.823 220.251 1.00 272.39 ? 374  PHE A CZ  1 
ATOM   2701  N N   . SER A  1 362  ? 202.988 147.920 225.133 1.00 278.42 ? 375  SER A N   1 
ATOM   2702  C CA  . SER A  1 362  ? 201.863 147.601 226.002 1.00 278.42 ? 375  SER A CA  1 
ATOM   2703  C C   . SER A  1 362  ? 200.583 147.272 225.248 1.00 278.42 ? 375  SER A C   1 
ATOM   2704  O O   . SER A  1 362  ? 200.028 146.185 225.432 1.00 278.42 ? 375  SER A O   1 
ATOM   2705  C CB  . SER A  1 362  ? 201.614 148.762 226.972 1.00 278.42 ? 375  SER A CB  1 
ATOM   2706  O OG  . SER A  1 362  ? 201.741 150.006 226.314 1.00 278.42 ? 375  SER A OG  1 
ATOM   2707  N N   . THR A  1 363  ? 200.091 148.180 224.402 1.00 268.30 ? 376  THR A N   1 
ATOM   2708  C CA  . THR A  1 363  ? 198.832 147.981 223.689 1.00 268.30 ? 376  THR A CA  1 
ATOM   2709  C C   . THR A  1 363  ? 199.012 148.295 222.206 1.00 268.30 ? 376  THR A C   1 
ATOM   2710  O O   . THR A  1 363  ? 199.950 148.989 221.807 1.00 268.30 ? 376  THR A O   1 
ATOM   2711  C CB  . THR A  1 363  ? 197.706 148.848 224.280 1.00 268.30 ? 376  THR A CB  1 
ATOM   2712  O OG1 . THR A  1 363  ? 198.223 150.135 224.638 1.00 268.30 ? 376  THR A OG1 1 
ATOM   2713  C CG2 . THR A  1 363  ? 197.100 148.185 225.503 1.00 268.30 ? 376  THR A CG2 1 
ATOM   2714  N N   . PHE A  1 364  ? 198.103 147.766 221.383 1.00 239.81 ? 377  PHE A N   1 
ATOM   2715  C CA  . PHE A  1 364  ? 198.105 148.008 219.938 1.00 239.81 ? 377  PHE A CA  1 
ATOM   2716  C C   . PHE A  1 364  ? 196.835 148.783 219.588 1.00 239.81 ? 377  PHE A C   1 
ATOM   2717  O O   . PHE A  1 364  ? 195.825 148.220 219.159 1.00 239.81 ? 377  PHE A O   1 
ATOM   2718  C CB  . PHE A  1 364  ? 198.219 146.703 219.153 1.00 239.81 ? 377  PHE A CB  1 
ATOM   2719  C CG  . PHE A  1 364  ? 197.376 145.589 219.690 1.00 239.81 ? 377  PHE A CG  1 
ATOM   2720  C CD1 . PHE A  1 364  ? 197.807 144.830 220.760 1.00 239.81 ? 377  PHE A CD1 1 
ATOM   2721  C CD2 . PHE A  1 364  ? 196.169 145.275 219.095 1.00 239.81 ? 377  PHE A CD2 1 
ATOM   2722  C CE1 . PHE A  1 364  ? 197.035 143.805 221.247 1.00 239.81 ? 377  PHE A CE1 1 
ATOM   2723  C CE2 . PHE A  1 364  ? 195.397 144.249 219.573 1.00 239.81 ? 377  PHE A CE2 1 
ATOM   2724  C CZ  . PHE A  1 364  ? 195.829 143.511 220.652 1.00 239.81 ? 377  PHE A CZ  1 
ATOM   2725  N N   . LYS A  1 365  ? 196.914 150.097 219.770 1.00 240.54 ? 378  LYS A N   1 
ATOM   2726  C CA  . LYS A  1 365  ? 195.840 151.059 219.573 1.00 240.54 ? 378  LYS A CA  1 
ATOM   2727  C C   . LYS A  1 365  ? 196.415 152.411 219.968 1.00 240.54 ? 378  LYS A C   1 
ATOM   2728  O O   . LYS A  1 365  ? 197.404 152.482 220.698 1.00 240.54 ? 378  LYS A O   1 
ATOM   2729  C CB  . LYS A  1 365  ? 194.608 150.711 220.416 1.00 240.54 ? 378  LYS A CB  1 
ATOM   2730  C CG  . LYS A  1 365  ? 193.371 151.554 220.176 1.00 240.54 ? 378  LYS A CG  1 
ATOM   2731  C CD  . LYS A  1 365  ? 192.729 151.217 218.859 1.00 240.54 ? 378  LYS A CD  1 
ATOM   2732  C CE  . LYS A  1 365  ? 191.489 152.047 218.618 1.00 240.54 ? 378  LYS A CE  1 
ATOM   2733  N NZ  . LYS A  1 365  ? 190.406 151.686 219.555 1.00 240.54 ? 378  LYS A NZ  1 
ATOM   2734  N N   . CYS A  1 366  ? 195.794 153.482 219.489 1.00 257.01 ? 379  CYS A N   1 
ATOM   2735  C CA  . CYS A  1 366  ? 196.258 154.830 219.799 1.00 257.01 ? 379  CYS A CA  1 
ATOM   2736  C C   . CYS A  1 366  ? 195.034 155.733 219.912 1.00 257.01 ? 379  CYS A C   1 
ATOM   2737  O O   . CYS A  1 366  ? 193.911 155.257 220.106 1.00 257.01 ? 379  CYS A O   1 
ATOM   2738  C CB  . CYS A  1 366  ? 197.271 155.315 218.749 1.00 257.01 ? 379  CYS A CB  1 
ATOM   2739  S SG  . CYS A  1 366  ? 198.928 154.527 218.780 1.00 257.01 ? 379  CYS A SG  1 
ATOM   2740  N N   . TYR A  1 367  ? 195.238 157.050 219.812 1.00 258.55 ? 380  TYR A N   1 
ATOM   2741  C CA  . TYR A  1 367  ? 194.116 157.987 219.759 1.00 258.55 ? 380  TYR A CA  1 
ATOM   2742  C C   . TYR A  1 367  ? 194.372 159.049 218.696 1.00 258.55 ? 380  TYR A C   1 
ATOM   2743  O O   . TYR A  1 367  ? 195.321 159.830 218.805 1.00 258.55 ? 380  TYR A O   1 
ATOM   2744  C CB  . TYR A  1 367  ? 193.820 158.615 221.143 1.00 258.55 ? 380  TYR A CB  1 
ATOM   2745  C CG  . TYR A  1 367  ? 194.770 159.665 221.727 1.00 258.55 ? 380  TYR A CG  1 
ATOM   2746  C CD1 . TYR A  1 367  ? 196.050 159.332 222.160 1.00 258.55 ? 380  TYR A CD1 1 
ATOM   2747  C CD2 . TYR A  1 367  ? 194.345 160.983 221.909 1.00 258.55 ? 380  TYR A CD2 1 
ATOM   2748  C CE1 . TYR A  1 367  ? 196.896 160.296 222.715 1.00 258.55 ? 380  TYR A CE1 1 
ATOM   2749  C CE2 . TYR A  1 367  ? 195.182 161.946 222.463 1.00 258.55 ? 380  TYR A CE2 1 
ATOM   2750  C CZ  . TYR A  1 367  ? 196.453 161.598 222.861 1.00 258.55 ? 380  TYR A CZ  1 
ATOM   2751  O OH  . TYR A  1 367  ? 197.277 162.557 223.404 1.00 258.55 ? 380  TYR A OH  1 
ATOM   2752  N N   . GLY A  1 368  ? 193.531 159.055 217.656 1.00 247.37 ? 381  GLY A N   1 
ATOM   2753  C CA  . GLY A  1 368  ? 193.584 160.041 216.595 1.00 247.37 ? 381  GLY A CA  1 
ATOM   2754  C C   . GLY A  1 368  ? 194.638 159.807 215.538 1.00 247.37 ? 381  GLY A C   1 
ATOM   2755  O O   . GLY A  1 368  ? 194.857 160.695 214.701 1.00 247.37 ? 381  GLY A O   1 
ATOM   2756  N N   . VAL A  1 369  ? 195.293 158.644 215.545 1.00 239.02 ? 382  VAL A N   1 
ATOM   2757  C CA  . VAL A  1 369  ? 196.404 158.385 214.639 1.00 239.02 ? 382  VAL A CA  1 
ATOM   2758  C C   . VAL A  1 369  ? 195.951 158.494 213.177 1.00 239.02 ? 382  VAL A C   1 
ATOM   2759  O O   . VAL A  1 369  ? 194.775 158.295 212.846 1.00 239.02 ? 382  VAL A O   1 
ATOM   2760  C CB  . VAL A  1 369  ? 196.997 156.999 214.955 1.00 239.02 ? 382  VAL A CB  1 
ATOM   2761  C CG1 . VAL A  1 369  ? 195.956 155.908 214.737 1.00 239.02 ? 382  VAL A CG1 1 
ATOM   2762  C CG2 . VAL A  1 369  ? 198.267 156.731 214.156 1.00 239.02 ? 382  VAL A CG2 1 
ATOM   2763  N N   . SER A  1 370  ? 196.896 158.831 212.297 1.00 237.12 ? 383  SER A N   1 
ATOM   2764  C CA  . SER A  1 370  ? 196.616 159.116 210.891 1.00 237.12 ? 383  SER A CA  1 
ATOM   2765  C C   . SER A  1 370  ? 197.491 158.259 209.987 1.00 237.12 ? 383  SER A C   1 
ATOM   2766  O O   . SER A  1 370  ? 198.512 158.725 209.468 1.00 237.12 ? 383  SER A O   1 
ATOM   2767  C CB  . SER A  1 370  ? 196.839 160.596 210.599 1.00 237.12 ? 383  SER A CB  1 
ATOM   2768  O OG  . SER A  1 370  ? 198.035 161.032 211.213 1.00 237.12 ? 383  SER A OG  1 
ATOM   2769  N N   . PRO A  1 371  ? 197.132 156.993 209.794 1.00 241.62 ? 384  PRO A N   1 
ATOM   2770  C CA  . PRO A  1 371  ? 197.828 156.163 208.801 1.00 241.62 ? 384  PRO A CA  1 
ATOM   2771  C C   . PRO A  1 371  ? 197.179 156.192 207.424 1.00 241.62 ? 384  PRO A C   1 
ATOM   2772  O O   . PRO A  1 371  ? 197.388 155.263 206.639 1.00 241.62 ? 384  PRO A O   1 
ATOM   2773  C CB  . PRO A  1 371  ? 197.750 154.755 209.407 1.00 241.62 ? 384  PRO A CB  1 
ATOM   2774  C CG  . PRO A  1 371  ? 197.155 154.940 210.786 1.00 241.62 ? 384  PRO A CG  1 
ATOM   2775  C CD  . PRO A  1 371  ? 196.317 156.162 210.684 1.00 241.62 ? 384  PRO A CD  1 
ATOM   2776  N N   . THR A  1 372  ? 196.361 157.210 207.132 1.00 246.76 ? 385  THR A N   1 
ATOM   2777  C CA  . THR A  1 372  ? 195.487 157.168 205.958 1.00 246.76 ? 385  THR A CA  1 
ATOM   2778  C C   . THR A  1 372  ? 196.281 157.085 204.652 1.00 246.76 ? 385  THR A C   1 
ATOM   2779  O O   . THR A  1 372  ? 196.085 156.160 203.857 1.00 246.76 ? 385  THR A O   1 
ATOM   2780  C CB  . THR A  1 372  ? 194.510 158.359 205.975 1.00 246.76 ? 385  THR A CB  1 
ATOM   2781  O OG1 . THR A  1 372  ? 193.496 158.172 204.981 1.00 246.76 ? 385  THR A OG1 1 
ATOM   2782  C CG2 . THR A  1 372  ? 195.193 159.716 205.788 1.00 246.76 ? 385  THR A CG2 1 
ATOM   2783  N N   . LYS A  1 373  ? 197.183 158.037 204.405 1.00 247.95 ? 386  LYS A N   1 
ATOM   2784  C CA  . LYS A  1 373  ? 198.062 157.994 203.241 1.00 247.95 ? 386  LYS A CA  1 
ATOM   2785  C C   . LYS A  1 373  ? 199.503 158.272 203.629 1.00 247.95 ? 386  LYS A C   1 
ATOM   2786  O O   . LYS A  1 373  ? 200.324 158.640 202.784 1.00 247.95 ? 386  LYS A O   1 
ATOM   2787  C CB  . LYS A  1 373  ? 197.591 158.975 202.169 1.00 247.95 ? 386  LYS A CB  1 
ATOM   2788  C CG  . LYS A  1 373  ? 196.386 158.481 201.377 1.00 247.95 ? 386  LYS A CG  1 
ATOM   2789  C CD  . LYS A  1 373  ? 196.656 157.130 200.729 1.00 247.95 ? 386  LYS A CD  1 
ATOM   2790  C CE  . LYS A  1 373  ? 195.377 156.330 200.585 1.00 247.95 ? 386  LYS A CE  1 
ATOM   2791  N NZ  . LYS A  1 373  ? 194.253 157.183 200.120 1.00 247.95 ? 386  LYS A NZ  1 
ATOM   2792  N N   . LEU A  1 374  ? 199.814 158.074 204.906 1.00 255.01 ? 387  LEU A N   1 
ATOM   2793  C CA  . LEU A  1 374  ? 201.137 158.335 205.449 1.00 255.01 ? 387  LEU A CA  1 
ATOM   2794  C C   . LEU A  1 374  ? 202.230 157.603 204.682 1.00 255.01 ? 387  LEU A C   1 
ATOM   2795  O O   . LEU A  1 374  ? 203.385 158.043 204.708 1.00 255.01 ? 387  LEU A O   1 
ATOM   2796  C CB  . LEU A  1 374  ? 201.136 157.934 206.934 1.00 255.01 ? 387  LEU A CB  1 
ATOM   2797  C CG  . LEU A  1 374  ? 202.226 158.344 207.920 1.00 255.01 ? 387  LEU A CG  1 
ATOM   2798  C CD1 . LEU A  1 374  ? 201.625 158.450 209.294 1.00 255.01 ? 387  LEU A CD1 1 
ATOM   2799  C CD2 . LEU A  1 374  ? 203.373 157.369 207.939 1.00 255.01 ? 387  LEU A CD2 1 
ATOM   2800  N N   . ASN A  1 375  ? 201.890 156.513 203.988 1.00 252.35 ? 388  ASN A N   1 
ATOM   2801  C CA  . ASN A  1 375  ? 202.901 155.709 203.311 1.00 252.35 ? 388  ASN A CA  1 
ATOM   2802  C C   . ASN A  1 375  ? 203.724 156.569 202.371 1.00 252.35 ? 388  ASN A C   1 
ATOM   2803  O O   . ASN A  1 375  ? 204.953 156.468 202.325 1.00 252.35 ? 388  ASN A O   1 
ATOM   2804  C CB  . ASN A  1 375  ? 202.237 154.570 202.543 1.00 252.35 ? 388  ASN A CB  1 
ATOM   2805  C CG  . ASN A  1 375  ? 201.098 155.049 201.689 1.00 252.35 ? 388  ASN A CG  1 
ATOM   2806  O OD1 . ASN A  1 375  ? 200.747 156.225 201.716 1.00 252.35 ? 388  ASN A OD1 1 
ATOM   2807  N ND2 . ASN A  1 375  ? 200.518 154.144 200.913 1.00 252.35 ? 388  ASN A ND2 1 
ATOM   2808  N N   . ASP A  1 376  ? 203.056 157.429 201.615 1.00 247.19 ? 389  ASP A N   1 
ATOM   2809  C CA  . ASP A  1 376  ? 203.729 158.348 200.716 1.00 247.19 ? 389  ASP A CA  1 
ATOM   2810  C C   . ASP A  1 376  ? 203.211 159.771 200.849 1.00 247.19 ? 389  ASP A C   1 
ATOM   2811  O O   . ASP A  1 376  ? 203.396 160.577 199.934 1.00 247.19 ? 389  ASP A O   1 
ATOM   2812  C CB  . ASP A  1 376  ? 203.590 157.880 199.267 1.00 247.19 ? 389  ASP A CB  1 
ATOM   2813  C CG  . ASP A  1 376  ? 204.507 156.727 198.934 1.00 247.19 ? 389  ASP A CG  1 
ATOM   2814  O OD1 . ASP A  1 376  ? 205.446 156.464 199.708 1.00 247.19 ? 389  ASP A OD1 1 
ATOM   2815  O OD2 . ASP A  1 376  ? 204.295 156.085 197.885 1.00 247.19 ? 389  ASP A OD2 1 
ATOM   2816  N N   . LEU A  1 377  ? 202.554 160.100 201.951 1.00 250.38 ? 390  LEU A N   1 
ATOM   2817  C CA  . LEU A  1 377  ? 202.205 161.490 202.172 1.00 250.38 ? 390  LEU A CA  1 
ATOM   2818  C C   . LEU A  1 377  ? 203.473 162.309 202.417 1.00 250.38 ? 390  LEU A C   1 
ATOM   2819  O O   . LEU A  1 377  ? 204.595 161.867 202.159 1.00 250.38 ? 390  LEU A O   1 
ATOM   2820  C CB  . LEU A  1 377  ? 201.245 161.615 203.353 1.00 250.38 ? 390  LEU A CB  1 
ATOM   2821  C CG  . LEU A  1 377  ? 199.755 161.679 203.031 1.00 250.38 ? 390  LEU A CG  1 
ATOM   2822  C CD1 . LEU A  1 377  ? 198.930 161.692 204.308 1.00 250.38 ? 390  LEU A CD1 1 
ATOM   2823  C CD2 . LEU A  1 377  ? 199.453 162.890 202.172 1.00 250.38 ? 390  LEU A CD2 1 
ATOM   2824  N N   . CYS A  1 378  ? 203.281 163.541 202.872 1.00 262.85 ? 391  CYS A N   1 
ATOM   2825  C CA  . CYS A  1 378  ? 204.350 164.340 203.460 1.00 262.85 ? 391  CYS A CA  1 
ATOM   2826  C C   . CYS A  1 378  ? 203.955 164.897 204.830 1.00 262.85 ? 391  CYS A C   1 
ATOM   2827  O O   . CYS A  1 378  ? 202.784 165.147 205.130 1.00 262.85 ? 391  CYS A O   1 
ATOM   2828  C CB  . CYS A  1 378  ? 204.798 165.438 202.492 1.00 262.85 ? 391  CYS A CB  1 
ATOM   2829  S SG  . CYS A  1 378  ? 203.595 165.859 201.267 1.00 262.85 ? 391  CYS A SG  1 
ATOM   2830  N N   . PHE A  1 379  ? 204.976 165.062 205.675 1.00 261.17 ? 392  PHE A N   1 
ATOM   2831  C CA  . PHE A  1 379  ? 204.824 165.355 207.097 1.00 261.17 ? 392  PHE A CA  1 
ATOM   2832  C C   . PHE A  1 379  ? 205.386 166.752 207.317 1.00 261.17 ? 392  PHE A C   1 
ATOM   2833  O O   . PHE A  1 379  ? 206.606 166.946 207.331 1.00 261.17 ? 392  PHE A O   1 
ATOM   2834  C CB  . PHE A  1 379  ? 205.547 164.318 207.946 1.00 261.17 ? 392  PHE A CB  1 
ATOM   2835  C CG  . PHE A  1 379  ? 205.438 162.920 207.405 1.00 261.17 ? 392  PHE A CG  1 
ATOM   2836  C CD1 . PHE A  1 379  ? 204.321 162.149 207.656 1.00 261.17 ? 392  PHE A CD1 1 
ATOM   2837  C CD2 . PHE A  1 379  ? 206.445 162.387 206.621 1.00 261.17 ? 392  PHE A CD2 1 
ATOM   2838  C CE1 . PHE A  1 379  ? 204.223 160.874 207.148 1.00 261.17 ? 392  PHE A CE1 1 
ATOM   2839  C CE2 . PHE A  1 379  ? 206.346 161.112 206.113 1.00 261.17 ? 392  PHE A CE2 1 
ATOM   2840  C CZ  . PHE A  1 379  ? 205.237 160.354 206.377 1.00 261.17 ? 392  PHE A CZ  1 
ATOM   2841  N N   . THR A  1 380  ? 204.484 167.721 207.458 1.00 265.21 ? 393  THR A N   1 
ATOM   2842  C CA  . THR A  1 380  ? 204.908 169.099 207.661 1.00 265.21 ? 393  THR A CA  1 
ATOM   2843  C C   . THR A  1 380  ? 205.726 169.240 208.939 1.00 265.21 ? 393  THR A C   1 
ATOM   2844  O O   . THR A  1 380  ? 206.851 169.755 208.916 1.00 265.21 ? 393  THR A O   1 
ATOM   2845  C CB  . THR A  1 380  ? 203.688 170.032 207.661 1.00 265.21 ? 393  THR A CB  1 
ATOM   2846  O OG1 . THR A  1 380  ? 204.100 171.372 207.962 1.00 265.21 ? 393  THR A OG1 1 
ATOM   2847  C CG2 . THR A  1 380  ? 202.598 169.572 208.636 1.00 265.21 ? 393  THR A CG2 1 
ATOM   2848  N N   . ASN A  1 381  ? 205.188 168.776 210.063 1.00 264.62 ? 394  ASN A N   1 
ATOM   2849  C CA  . ASN A  1 381  ? 205.835 169.007 211.340 1.00 264.62 ? 394  ASN A CA  1 
ATOM   2850  C C   . ASN A  1 381  ? 205.458 167.894 212.302 1.00 264.62 ? 394  ASN A C   1 
ATOM   2851  O O   . ASN A  1 381  ? 204.360 167.336 212.238 1.00 264.62 ? 394  ASN A O   1 
ATOM   2852  C CB  . ASN A  1 381  ? 205.449 170.375 211.905 1.00 264.62 ? 394  ASN A CB  1 
ATOM   2853  C CG  . ASN A  1 381  ? 205.590 171.484 210.881 1.00 264.62 ? 394  ASN A CG  1 
ATOM   2854  O OD1 . ASN A  1 381  ? 206.687 171.974 210.635 1.00 264.62 ? 394  ASN A OD1 1 
ATOM   2855  N ND2 . ASN A  1 381  ? 204.486 171.853 210.248 1.00 264.62 ? 394  ASN A ND2 1 
ATOM   2856  N N   . VAL A  1 382  ? 206.392 167.577 213.194 1.00 264.60 ? 395  VAL A N   1 
ATOM   2857  C CA  . VAL A  1 382  ? 206.188 166.598 214.253 1.00 264.60 ? 395  VAL A CA  1 
ATOM   2858  C C   . VAL A  1 382  ? 206.609 167.227 215.572 1.00 264.60 ? 395  VAL A C   1 
ATOM   2859  O O   . VAL A  1 382  ? 207.631 167.918 215.642 1.00 264.60 ? 395  VAL A O   1 
ATOM   2860  C CB  . VAL A  1 382  ? 206.969 165.296 213.985 1.00 264.60 ? 395  VAL A CB  1 
ATOM   2861  C CG1 . VAL A  1 382  ? 206.851 164.354 215.154 1.00 264.60 ? 395  VAL A CG1 1 
ATOM   2862  C CG2 . VAL A  1 382  ? 206.437 164.627 212.744 1.00 264.60 ? 395  VAL A CG2 1 
ATOM   2863  N N   . TYR A  1 383  ? 205.819 166.993 216.617 1.00 269.16 ? 396  TYR A N   1 
ATOM   2864  C CA  . TYR A  1 383  ? 206.070 167.586 217.930 1.00 269.16 ? 396  TYR A CA  1 
ATOM   2865  C C   . TYR A  1 383  ? 205.948 166.498 218.994 1.00 269.16 ? 396  TYR A C   1 
ATOM   2866  O O   . TYR A  1 383  ? 204.838 166.077 219.334 1.00 269.16 ? 396  TYR A O   1 
ATOM   2867  C CB  . TYR A  1 383  ? 205.102 168.726 218.201 1.00 269.16 ? 396  TYR A CB  1 
ATOM   2868  C CG  . TYR A  1 383  ? 205.343 169.950 217.362 1.00 269.16 ? 396  TYR A CG  1 
ATOM   2869  C CD1 . TYR A  1 383  ? 206.617 170.474 217.217 1.00 269.16 ? 396  TYR A CD1 1 
ATOM   2870  C CD2 . TYR A  1 383  ? 204.289 170.614 216.759 1.00 269.16 ? 396  TYR A CD2 1 
ATOM   2871  C CE1 . TYR A  1 383  ? 206.839 171.607 216.465 1.00 269.16 ? 396  TYR A CE1 1 
ATOM   2872  C CE2 . TYR A  1 383  ? 204.498 171.749 216.010 1.00 269.16 ? 396  TYR A CE2 1 
ATOM   2873  C CZ  . TYR A  1 383  ? 205.775 172.243 215.864 1.00 269.16 ? 396  TYR A CZ  1 
ATOM   2874  O OH  . TYR A  1 383  ? 205.985 173.376 215.113 1.00 269.16 ? 396  TYR A OH  1 
ATOM   2875  N N   . ALA A  1 384  ? 207.086 166.067 219.533 1.00 281.62 ? 397  ALA A N   1 
ATOM   2876  C CA  . ALA A  1 384  ? 207.135 165.043 220.569 1.00 281.62 ? 397  ALA A CA  1 
ATOM   2877  C C   . ALA A  1 384  ? 207.702 165.653 221.840 1.00 281.62 ? 397  ALA A C   1 
ATOM   2878  O O   . ALA A  1 384  ? 208.878 166.033 221.875 1.00 281.62 ? 397  ALA A O   1 
ATOM   2879  C CB  . ALA A  1 384  ? 207.977 163.846 220.130 1.00 281.62 ? 397  ALA A CB  1 
ATOM   2880  N N   . ASP A  1 385  ? 206.866 165.744 222.881 1.00 292.76 ? 398  ASP A N   1 
ATOM   2881  C CA  . ASP A  1 385  ? 207.242 166.306 224.179 1.00 292.76 ? 398  ASP A CA  1 
ATOM   2882  C C   . ASP A  1 385  ? 206.933 165.293 225.276 1.00 292.76 ? 398  ASP A C   1 
ATOM   2883  O O   . ASP A  1 385  ? 205.804 165.244 225.777 1.00 292.76 ? 398  ASP A O   1 
ATOM   2884  C CB  . ASP A  1 385  ? 206.507 167.622 224.441 1.00 292.76 ? 398  ASP A CB  1 
ATOM   2885  N N   . SER A  1 386  ? 207.937 164.498 225.654 1.00 298.12 ? 399  SER A N   1 
ATOM   2886  C CA  . SER A  1 386  ? 207.833 163.548 226.759 1.00 298.12 ? 399  SER A CA  1 
ATOM   2887  C C   . SER A  1 386  ? 209.235 163.215 227.252 1.00 298.12 ? 399  SER A C   1 
ATOM   2888  O O   . SER A  1 386  ? 210.232 163.604 226.645 1.00 298.12 ? 399  SER A O   1 
ATOM   2889  C CB  . SER A  1 386  ? 207.096 162.267 226.356 1.00 298.12 ? 399  SER A CB  1 
ATOM   2890  O OG  . SER A  1 386  ? 207.194 161.287 227.379 1.00 298.12 ? 399  SER A OG  1 
ATOM   2891  N N   . PHE A  1 387  ? 209.298 162.493 228.365 1.00 293.92 ? 400  PHE A N   1 
ATOM   2892  C CA  . PHE A  1 387  ? 210.570 162.157 228.988 1.00 293.92 ? 400  PHE A CA  1 
ATOM   2893  C C   . PHE A  1 387  ? 210.391 160.873 229.791 1.00 293.92 ? 400  PHE A C   1 
ATOM   2894  O O   . PHE A  1 387  ? 209.339 160.233 229.736 1.00 293.92 ? 400  PHE A O   1 
ATOM   2895  C CB  . PHE A  1 387  ? 211.104 163.349 229.811 1.00 293.92 ? 400  PHE A CB  1 
ATOM   2896  C CG  . PHE A  1 387  ? 210.063 164.023 230.683 1.00 293.92 ? 400  PHE A CG  1 
ATOM   2897  C CD1 . PHE A  1 387  ? 209.249 165.017 230.156 1.00 293.92 ? 400  PHE A CD1 1 
ATOM   2898  C CD2 . PHE A  1 387  ? 209.921 163.690 232.020 1.00 293.92 ? 400  PHE A CD2 1 
ATOM   2899  C CE1 . PHE A  1 387  ? 208.292 165.648 230.937 1.00 293.92 ? 400  PHE A CE1 1 
ATOM   2900  C CE2 . PHE A  1 387  ? 208.968 164.328 232.814 1.00 293.92 ? 400  PHE A CE2 1 
ATOM   2901  C CZ  . PHE A  1 387  ? 208.151 165.303 232.266 1.00 293.92 ? 400  PHE A CZ  1 
ATOM   2902  N N   . VAL A  1 388  ? 211.436 160.483 230.522 1.00 284.42 ? 401  VAL A N   1 
ATOM   2903  C CA  . VAL A  1 388  ? 211.528 159.138 231.102 1.00 284.42 ? 401  VAL A CA  1 
ATOM   2904  C C   . VAL A  1 388  ? 210.700 159.091 232.387 1.00 284.42 ? 401  VAL A C   1 
ATOM   2905  O O   . VAL A  1 388  ? 211.204 159.353 233.477 1.00 284.42 ? 401  VAL A O   1 
ATOM   2906  C CB  . VAL A  1 388  ? 212.981 158.728 231.354 1.00 284.42 ? 401  VAL A CB  1 
ATOM   2907  C CG1 . VAL A  1 388  ? 213.038 157.301 231.846 1.00 284.42 ? 401  VAL A CG1 1 
ATOM   2908  C CG2 . VAL A  1 388  ? 213.812 158.877 230.089 1.00 284.42 ? 401  VAL A CG2 1 
ATOM   2909  N N   . ILE A  1 389  ? 209.426 158.733 232.266 1.00 291.34 ? 402  ILE A N   1 
ATOM   2910  C CA  . ILE A  1 389  ? 208.565 158.524 233.427 1.00 291.34 ? 402  ILE A CA  1 
ATOM   2911  C C   . ILE A  1 389  ? 208.009 157.110 233.349 1.00 291.34 ? 402  ILE A C   1 
ATOM   2912  O O   . ILE A  1 389  ? 208.342 156.353 232.434 1.00 291.34 ? 402  ILE A O   1 
ATOM   2913  C CB  . ILE A  1 389  ? 207.458 159.596 233.496 1.00 291.34 ? 402  ILE A CB  1 
ATOM   2914  C CG1 . ILE A  1 389  ? 208.079 160.979 233.336 1.00 291.34 ? 402  ILE A CG1 1 
ATOM   2915  C CG2 . ILE A  1 389  ? 206.706 159.589 234.811 1.00 291.34 ? 402  ILE A CG2 1 
ATOM   2916  C CD1 . ILE A  1 389  ? 208.921 161.398 234.524 1.00 291.34 ? 402  ILE A CD1 1 
ATOM   2917  N N   . ARG A  1 390  ? 207.221 156.717 234.338 1.00 297.93 ? 403  ARG A N   1 
ATOM   2918  C CA  . ARG A  1 390  ? 206.537 155.443 234.284 1.00 297.93 ? 403  ARG A CA  1 
ATOM   2919  C C   . ARG A  1 390  ? 205.354 155.542 233.335 1.00 297.93 ? 403  ARG A C   1 
ATOM   2920  O O   . ARG A  1 390  ? 204.988 156.617 232.855 1.00 297.93 ? 403  ARG A O   1 
ATOM   2921  C CB  . ARG A  1 390  ? 206.078 155.018 235.675 1.00 297.93 ? 403  ARG A CB  1 
ATOM   2922  N N   . GLY A  1 391  ? 204.745 154.398 233.069 1.00 306.43 ? 404  GLY A N   1 
ATOM   2923  C CA  . GLY A  1 391  ? 203.657 154.352 232.126 1.00 306.43 ? 404  GLY A CA  1 
ATOM   2924  C C   . GLY A  1 391  ? 202.407 154.993 232.677 1.00 306.43 ? 404  GLY A C   1 
ATOM   2925  O O   . GLY A  1 391  ? 202.029 156.088 232.249 1.00 306.43 ? 404  GLY A O   1 
ATOM   2926  N N   . ASP A  1 392  ? 201.783 154.341 233.664 1.00 307.97 ? 405  ASP A N   1 
ATOM   2927  C CA  . ASP A  1 392  ? 200.480 154.774 234.155 1.00 307.97 ? 405  ASP A CA  1 
ATOM   2928  C C   . ASP A  1 392  ? 200.495 156.207 234.659 1.00 307.97 ? 405  ASP A C   1 
ATOM   2929  O O   . ASP A  1 392  ? 199.430 156.742 234.983 1.00 307.97 ? 405  ASP A O   1 
ATOM   2930  C CB  . ASP A  1 392  ? 199.992 153.832 235.255 1.00 307.97 ? 405  ASP A CB  1 
ATOM   2931  N N   . GLU A  1 393  ? 201.663 156.846 234.693 1.00 310.53 ? 406  GLU A N   1 
ATOM   2932  C CA  . GLU A  1 393  ? 201.804 158.256 235.022 1.00 310.53 ? 406  GLU A CA  1 
ATOM   2933  C C   . GLU A  1 393  ? 201.311 159.166 233.908 1.00 310.53 ? 406  GLU A C   1 
ATOM   2934  O O   . GLU A  1 393  ? 201.638 160.357 233.909 1.00 310.53 ? 406  GLU A O   1 
ATOM   2935  C CB  . GLU A  1 393  ? 203.267 158.577 235.338 1.00 310.53 ? 406  GLU A CB  1 
ATOM   2936  N N   . VAL A  1 394  ? 200.537 158.630 232.960 1.00 314.67 ? 407  VAL A N   1 
ATOM   2937  C CA  . VAL A  1 394  ? 200.129 159.389 231.781 1.00 314.67 ? 407  VAL A CA  1 
ATOM   2938  C C   . VAL A  1 394  ? 198.869 160.209 231.992 1.00 314.67 ? 407  VAL A C   1 
ATOM   2939  O O   . VAL A  1 394  ? 198.305 160.710 231.011 1.00 314.67 ? 407  VAL A O   1 
ATOM   2940  C CB  . VAL A  1 394  ? 199.910 158.452 230.575 1.00 314.67 ? 407  VAL A CB  1 
ATOM   2941  N N   . ARG A  1 395  ? 198.391 160.354 233.227 1.00 317.57 ? 408  ARG A N   1 
ATOM   2942  C CA  . ARG A  1 395  ? 197.188 161.136 233.472 1.00 317.57 ? 408  ARG A CA  1 
ATOM   2943  C C   . ARG A  1 395  ? 197.487 162.564 233.930 1.00 317.57 ? 408  ARG A C   1 
ATOM   2944  O O   . ARG A  1 395  ? 196.614 163.213 234.516 1.00 317.57 ? 408  ARG A O   1 
ATOM   2945  C CB  . ARG A  1 395  ? 196.288 160.428 234.489 1.00 317.57 ? 408  ARG A CB  1 
ATOM   2946  C CG  . ARG A  1 395  ? 194.807 160.813 234.372 1.00 317.57 ? 408  ARG A CG  1 
ATOM   2947  C CD  . ARG A  1 395  ? 193.955 160.173 235.456 1.00 317.57 ? 408  ARG A CD  1 
ATOM   2948  N NE  . ARG A  1 395  ? 192.617 160.757 235.516 1.00 317.57 ? 408  ARG A NE  1 
ATOM   2949  C CZ  . ARG A  1 395  ? 191.571 160.309 234.831 1.00 317.57 ? 408  ARG A CZ  1 
ATOM   2950  N NH1 . ARG A  1 395  ? 191.698 159.260 234.033 1.00 317.57 ? 408  ARG A NH1 1 
ATOM   2951  N NH2 . ARG A  1 395  ? 190.395 160.906 234.951 1.00 317.57 ? 408  ARG A NH2 1 
ATOM   2952  N N   . GLN A  1 396  ? 198.686 163.077 233.673 1.00 314.06 ? 409  GLN A N   1 
ATOM   2953  C CA  . GLN A  1 396  ? 198.955 164.470 234.002 1.00 314.06 ? 409  GLN A CA  1 
ATOM   2954  C C   . GLN A  1 396  ? 198.773 165.397 232.811 1.00 314.06 ? 409  GLN A C   1 
ATOM   2955  O O   . GLN A  1 396  ? 198.905 166.616 232.964 1.00 314.06 ? 409  GLN A O   1 
ATOM   2956  C CB  . GLN A  1 396  ? 200.368 164.626 234.571 1.00 314.06 ? 409  GLN A CB  1 
ATOM   2957  C CG  . GLN A  1 396  ? 201.482 164.641 233.552 1.00 314.06 ? 409  GLN A CG  1 
ATOM   2958  C CD  . GLN A  1 396  ? 201.932 166.049 233.218 1.00 314.06 ? 409  GLN A CD  1 
ATOM   2959  O OE1 . GLN A  1 396  ? 201.775 166.971 234.019 1.00 314.06 ? 409  GLN A OE1 1 
ATOM   2960  N NE2 . GLN A  1 396  ? 202.508 166.218 232.038 1.00 314.06 ? 409  GLN A NE2 1 
ATOM   2961  N N   . ILE A  1 397  ? 198.467 164.849 231.636 1.00 315.05 ? 410  ILE A N   1 
ATOM   2962  C CA  . ILE A  1 397  ? 198.261 165.638 230.428 1.00 315.05 ? 410  ILE A CA  1 
ATOM   2963  C C   . ILE A  1 397  ? 196.885 166.296 230.475 1.00 315.05 ? 410  ILE A C   1 
ATOM   2964  O O   . ILE A  1 397  ? 195.893 165.742 229.989 1.00 315.05 ? 410  ILE A O   1 
ATOM   2965  C CB  . ILE A  1 397  ? 198.456 164.766 229.165 1.00 315.05 ? 410  ILE A CB  1 
ATOM   2966  C CG1 . ILE A  1 397  ? 197.654 163.463 229.253 1.00 315.05 ? 410  ILE A CG1 1 
ATOM   2967  C CG2 . ILE A  1 397  ? 199.927 164.447 228.939 1.00 315.05 ? 410  ILE A CG2 1 
ATOM   2968  C CD1 . ILE A  1 397  ? 197.699 162.628 228.003 1.00 315.05 ? 410  ILE A CD1 1 
ATOM   2969  N N   . ALA A  1 398  ? 196.820 167.502 231.050 1.00 313.62 ? 411  ALA A N   1 
ATOM   2970  C CA  . ALA A  1 398  ? 195.555 168.211 231.151 1.00 313.62 ? 411  ALA A CA  1 
ATOM   2971  C C   . ALA A  1 398  ? 195.830 169.698 231.269 1.00 313.62 ? 411  ALA A C   1 
ATOM   2972  O O   . ALA A  1 398  ? 196.702 170.089 232.056 1.00 313.62 ? 411  ALA A O   1 
ATOM   2973  C CB  . ALA A  1 398  ? 194.736 167.726 232.351 1.00 313.62 ? 411  ALA A CB  1 
ATOM   2974  N N   . PRO A  1 399  ? 195.141 170.544 230.499 1.00 308.27 ? 412  PRO A N   1 
ATOM   2975  C CA  . PRO A  1 399  ? 195.329 171.998 230.606 1.00 308.27 ? 412  PRO A CA  1 
ATOM   2976  C C   . PRO A  1 399  ? 194.595 172.530 231.828 1.00 308.27 ? 412  PRO A C   1 
ATOM   2977  O O   . PRO A  1 399  ? 193.509 172.054 232.165 1.00 308.27 ? 412  PRO A O   1 
ATOM   2978  C CB  . PRO A  1 399  ? 194.720 172.530 229.304 1.00 308.27 ? 412  PRO A CB  1 
ATOM   2979  C CG  . PRO A  1 399  ? 193.669 171.539 228.972 1.00 308.27 ? 412  PRO A CG  1 
ATOM   2980  C CD  . PRO A  1 399  ? 194.164 170.195 229.454 1.00 308.27 ? 412  PRO A CD  1 
ATOM   2981  N N   . GLY A  1 400  ? 195.199 173.506 232.501 1.00 306.21 ? 413  GLY A N   1 
ATOM   2982  C CA  . GLY A  1 400  ? 194.610 174.064 233.705 1.00 306.21 ? 413  GLY A CA  1 
ATOM   2983  C C   . GLY A  1 400  ? 194.437 173.036 234.794 1.00 306.21 ? 413  GLY A C   1 
ATOM   2984  O O   . GLY A  1 400  ? 193.455 173.087 235.542 1.00 306.21 ? 413  GLY A O   1 
ATOM   2985  N N   . GLN A  1 401  ? 195.367 172.093 234.896 1.00 304.75 ? 414  GLN A N   1 
ATOM   2986  C CA  . GLN A  1 401  ? 195.231 170.921 235.740 1.00 304.75 ? 414  GLN A CA  1 
ATOM   2987  C C   . GLN A  1 401  ? 195.991 171.102 237.052 1.00 304.75 ? 414  GLN A C   1 
ATOM   2988  O O   . GLN A  1 401  ? 196.465 172.187 237.388 1.00 304.75 ? 414  GLN A O   1 
ATOM   2989  C CB  . GLN A  1 401  ? 195.716 169.678 234.997 1.00 304.75 ? 414  GLN A CB  1 
ATOM   2990  N N   . THR A  1 402  ? 196.119 170.004 237.792 1.00 298.46 ? 415  THR A N   1 
ATOM   2991  C CA  . THR A  1 402  ? 196.626 170.010 239.157 1.00 298.46 ? 415  THR A CA  1 
ATOM   2992  C C   . THR A  1 402  ? 198.150 170.004 239.170 1.00 298.46 ? 415  THR A C   1 
ATOM   2993  O O   . THR A  1 402  ? 198.780 169.288 238.385 1.00 298.46 ? 415  THR A O   1 
ATOM   2994  C CB  . THR A  1 402  ? 196.089 168.799 239.919 1.00 298.46 ? 415  THR A CB  1 
ATOM   2995  N N   . GLY A  1 403  ? 198.731 170.795 240.065 1.00 297.77 ? 416  GLY A N   1 
ATOM   2996  C CA  . GLY A  1 403  ? 200.166 170.838 240.268 1.00 297.77 ? 416  GLY A CA  1 
ATOM   2997  C C   . GLY A  1 403  ? 200.702 172.256 240.225 1.00 297.77 ? 416  GLY A C   1 
ATOM   2998  O O   . GLY A  1 403  ? 199.994 173.233 240.457 1.00 297.77 ? 416  GLY A O   1 
ATOM   2999  N N   . LYS A  1 404  ? 202.004 172.340 239.957 1.00 292.79 ? 417  LYS A N   1 
ATOM   3000  C CA  . LYS A  1 404  ? 202.591 173.603 239.523 1.00 292.79 ? 417  LYS A CA  1 
ATOM   3001  C C   . LYS A  1 404  ? 202.607 173.694 237.994 1.00 292.79 ? 417  LYS A C   1 
ATOM   3002  O O   . LYS A  1 404  ? 202.065 174.639 237.398 1.00 292.79 ? 417  LYS A O   1 
ATOM   3003  C CB  . LYS A  1 404  ? 204.000 173.742 240.103 1.00 292.79 ? 417  LYS A CB  1 
ATOM   3004  N N   . ILE A  1 405  ? 203.196 172.682 237.345 1.00 288.02 ? 418  ILE A N   1 
ATOM   3005  C CA  . ILE A  1 405  ? 203.413 172.613 235.900 1.00 288.02 ? 418  ILE A CA  1 
ATOM   3006  C C   . ILE A  1 405  ? 202.115 172.758 235.124 1.00 288.02 ? 418  ILE A C   1 
ATOM   3007  O O   . ILE A  1 405  ? 201.877 173.784 234.477 1.00 288.02 ? 418  ILE A O   1 
ATOM   3008  C CB  . ILE A  1 405  ? 204.111 171.294 235.518 1.00 288.02 ? 418  ILE A CB  1 
ATOM   3009  C CG1 . ILE A  1 405  ? 205.553 171.310 236.003 1.00 288.02 ? 418  ILE A CG1 1 
ATOM   3010  C CG2 . ILE A  1 405  ? 204.089 171.082 234.024 1.00 288.02 ? 418  ILE A CG2 1 
ATOM   3011  C CD1 . ILE A  1 405  ? 206.356 172.382 235.357 1.00 288.02 ? 418  ILE A CD1 1 
ATOM   3012  N N   . ALA A  1 406  ? 201.260 171.738 235.196 1.00 294.51 ? 419  ALA A N   1 
ATOM   3013  C CA  . ALA A  1 406  ? 200.061 171.715 234.374 1.00 294.51 ? 419  ALA A CA  1 
ATOM   3014  C C   . ALA A  1 406  ? 199.075 172.813 234.741 1.00 294.51 ? 419  ALA A C   1 
ATOM   3015  O O   . ALA A  1 406  ? 198.079 172.985 234.031 1.00 294.51 ? 419  ALA A O   1 
ATOM   3016  C CB  . ALA A  1 406  ? 199.389 170.346 234.474 1.00 294.51 ? 419  ALA A CB  1 
ATOM   3017  N N   . ASP A  1 407  ? 199.319 173.558 235.818 1.00 293.88 ? 420  ASP A N   1 
ATOM   3018  C CA  . ASP A  1 407  ? 198.394 174.596 236.253 1.00 293.88 ? 420  ASP A CA  1 
ATOM   3019  C C   . ASP A  1 407  ? 198.822 175.984 235.797 1.00 293.88 ? 420  ASP A C   1 
ATOM   3020  O O   . ASP A  1 407  ? 198.124 176.624 235.004 1.00 293.88 ? 420  ASP A O   1 
ATOM   3021  C CB  . ASP A  1 407  ? 198.268 174.575 237.780 1.00 293.88 ? 420  ASP A CB  1 
ATOM   3022  N N   . TYR A  1 408  ? 199.977 176.458 236.262 1.00 292.11 ? 421  TYR A N   1 
ATOM   3023  C CA  . TYR A  1 408  ? 200.344 177.848 236.019 1.00 292.11 ? 421  TYR A CA  1 
ATOM   3024  C C   . TYR A  1 408  ? 201.684 177.954 235.308 1.00 292.11 ? 421  TYR A C   1 
ATOM   3025  O O   . TYR A  1 408  ? 202.254 179.047 235.226 1.00 292.11 ? 421  TYR A O   1 
ATOM   3026  C CB  . TYR A  1 408  ? 200.385 178.644 237.328 1.00 292.11 ? 421  TYR A CB  1 
ATOM   3027  C CG  . TYR A  1 408  ? 199.034 179.071 237.872 1.00 292.11 ? 421  TYR A CG  1 
ATOM   3028  C CD1 . TYR A  1 408  ? 197.862 178.773 237.195 1.00 292.11 ? 421  TYR A CD1 1 
ATOM   3029  C CD2 . TYR A  1 408  ? 198.939 179.802 239.052 1.00 292.11 ? 421  TYR A CD2 1 
ATOM   3030  C CE1 . TYR A  1 408  ? 196.633 179.167 237.688 1.00 292.11 ? 421  TYR A CE1 1 
ATOM   3031  C CE2 . TYR A  1 408  ? 197.714 180.206 239.546 1.00 292.11 ? 421  TYR A CE2 1 
ATOM   3032  C CZ  . TYR A  1 408  ? 196.565 179.884 238.859 1.00 292.11 ? 421  TYR A CZ  1 
ATOM   3033  O OH  . TYR A  1 408  ? 195.337 180.277 239.334 1.00 292.11 ? 421  TYR A OH  1 
ATOM   3034  N N   . ASN A  1 409  ? 202.181 176.844 234.772 1.00 292.87 ? 422  ASN A N   1 
ATOM   3035  C CA  . ASN A  1 409  ? 203.529 176.781 234.230 1.00 292.87 ? 422  ASN A CA  1 
ATOM   3036  C C   . ASN A  1 409  ? 203.599 176.379 232.762 1.00 292.87 ? 422  ASN A C   1 
ATOM   3037  O O   . ASN A  1 409  ? 204.633 176.626 232.129 1.00 292.87 ? 422  ASN A O   1 
ATOM   3038  C CB  . ASN A  1 409  ? 204.373 175.795 235.052 1.00 292.87 ? 422  ASN A CB  1 
ATOM   3039  C CG  . ASN A  1 409  ? 204.684 176.310 236.440 1.00 292.87 ? 422  ASN A CG  1 
ATOM   3040  O OD1 . ASN A  1 409  ? 203.786 176.643 237.207 1.00 292.87 ? 422  ASN A OD1 1 
ATOM   3041  N ND2 . ASN A  1 409  ? 205.961 176.341 236.783 1.00 292.87 ? 422  ASN A ND2 1 
ATOM   3042  N N   . TYR A  1 410  ? 202.548 175.787 232.196 1.00 300.92 ? 423  TYR A N   1 
ATOM   3043  C CA  . TYR A  1 410  ? 202.629 175.216 230.855 1.00 300.92 ? 423  TYR A CA  1 
ATOM   3044  C C   . TYR A  1 410  ? 201.257 175.337 230.207 1.00 300.92 ? 423  TYR A C   1 
ATOM   3045  O O   . TYR A  1 410  ? 200.328 174.614 230.579 1.00 300.92 ? 423  TYR A O   1 
ATOM   3046  C CB  . TYR A  1 410  ? 203.095 173.765 230.935 1.00 300.92 ? 423  TYR A CB  1 
ATOM   3047  C CG  . TYR A  1 410  ? 203.456 173.088 229.633 1.00 300.92 ? 423  TYR A CG  1 
ATOM   3048  C CD1 . TYR A  1 410  ? 204.533 173.524 228.877 1.00 300.92 ? 423  TYR A CD1 1 
ATOM   3049  C CD2 . TYR A  1 410  ? 202.777 171.952 229.213 1.00 300.92 ? 423  TYR A CD2 1 
ATOM   3050  C CE1 . TYR A  1 410  ? 204.880 172.888 227.711 1.00 300.92 ? 423  TYR A CE1 1 
ATOM   3051  C CE2 . TYR A  1 410  ? 203.119 171.307 228.054 1.00 300.92 ? 423  TYR A CE2 1 
ATOM   3052  C CZ  . TYR A  1 410  ? 204.170 171.778 227.305 1.00 300.92 ? 423  TYR A CZ  1 
ATOM   3053  O OH  . TYR A  1 410  ? 204.512 171.133 226.141 1.00 300.92 ? 423  TYR A OH  1 
ATOM   3054  N N   . LYS A  1 411  ? 201.128 176.269 229.264 1.00 308.65 ? 424  LYS A N   1 
ATOM   3055  C CA  . LYS A  1 411  ? 199.901 176.473 228.498 1.00 308.65 ? 424  LYS A CA  1 
ATOM   3056  C C   . LYS A  1 411  ? 200.229 176.253 227.029 1.00 308.65 ? 424  LYS A C   1 
ATOM   3057  O O   . LYS A  1 411  ? 200.886 177.092 226.406 1.00 308.65 ? 424  LYS A O   1 
ATOM   3058  C CB  . LYS A  1 411  ? 199.332 177.873 228.724 1.00 308.65 ? 424  LYS A CB  1 
ATOM   3059  N N   . LEU A  1 412  ? 199.791 175.125 226.479 1.00 313.07 ? 425  LEU A N   1 
ATOM   3060  C CA  . LEU A  1 412  ? 200.055 174.811 225.087 1.00 313.07 ? 425  LEU A CA  1 
ATOM   3061  C C   . LEU A  1 412  ? 198.735 174.674 224.341 1.00 313.07 ? 425  LEU A C   1 
ATOM   3062  O O   . LEU A  1 412  ? 197.816 174.011 224.844 1.00 313.07 ? 425  LEU A O   1 
ATOM   3063  C CB  . LEU A  1 412  ? 200.879 173.508 224.959 1.00 313.07 ? 425  LEU A CB  1 
ATOM   3064  C CG  . LEU A  1 412  ? 201.624 173.238 223.643 1.00 313.07 ? 425  LEU A CG  1 
ATOM   3065  C CD1 . LEU A  1 412  ? 202.806 174.183 223.468 1.00 313.07 ? 425  LEU A CD1 1 
ATOM   3066  C CD2 . LEU A  1 412  ? 202.086 171.790 223.556 1.00 313.07 ? 425  LEU A CD2 1 
ATOM   3067  N N   . PRO A  1 413  ? 198.587 175.287 223.165 1.00 310.74 ? 426  PRO A N   1 
ATOM   3068  C CA  . PRO A  1 413  ? 197.351 175.118 222.396 1.00 310.74 ? 426  PRO A CA  1 
ATOM   3069  C C   . PRO A  1 413  ? 197.255 173.701 221.868 1.00 310.74 ? 426  PRO A C   1 
ATOM   3070  O O   . PRO A  1 413  ? 198.254 172.997 221.718 1.00 310.74 ? 426  PRO A O   1 
ATOM   3071  C CB  . PRO A  1 413  ? 197.496 176.130 221.261 1.00 310.74 ? 426  PRO A CB  1 
ATOM   3072  C CG  . PRO A  1 413  ? 198.956 176.238 221.069 1.00 310.74 ? 426  PRO A CG  1 
ATOM   3073  C CD  . PRO A  1 413  ? 199.572 176.103 222.434 1.00 310.74 ? 426  PRO A CD  1 
ATOM   3074  N N   . ASP A  1 414  ? 196.022 173.294 221.574 1.00 298.18 ? 427  ASP A N   1 
ATOM   3075  C CA  . ASP A  1 414  ? 195.761 171.920 221.170 1.00 298.18 ? 427  ASP A CA  1 
ATOM   3076  C C   . ASP A  1 414  ? 196.676 171.520 220.020 1.00 298.18 ? 427  ASP A C   1 
ATOM   3077  O O   . ASP A  1 414  ? 197.177 172.362 219.272 1.00 298.18 ? 427  ASP A O   1 
ATOM   3078  C CB  . ASP A  1 414  ? 194.298 171.752 220.761 1.00 298.18 ? 427  ASP A CB  1 
ATOM   3079  N N   . ASP A  1 415  ? 196.914 170.221 219.896 1.00 272.37 ? 428  ASP A N   1 
ATOM   3080  C CA  . ASP A  1 415  ? 197.845 169.729 218.898 1.00 272.37 ? 428  ASP A CA  1 
ATOM   3081  C C   . ASP A  1 415  ? 197.308 168.421 218.344 1.00 272.37 ? 428  ASP A C   1 
ATOM   3082  O O   . ASP A  1 415  ? 196.193 167.997 218.664 1.00 272.37 ? 428  ASP A O   1 
ATOM   3083  C CB  . ASP A  1 415  ? 199.250 169.574 219.493 1.00 272.37 ? 428  ASP A CB  1 
ATOM   3084  N N   . PHE A  1 416  ? 198.104 167.790 217.497 1.00 260.73 ? 429  PHE A N   1 
ATOM   3085  C CA  . PHE A  1 416  ? 197.725 166.529 216.890 1.00 260.73 ? 429  PHE A CA  1 
ATOM   3086  C C   . PHE A  1 416  ? 197.945 165.385 217.863 1.00 260.73 ? 429  PHE A C   1 
ATOM   3087  O O   . PHE A  1 416  ? 198.707 165.483 218.828 1.00 260.73 ? 429  PHE A O   1 
ATOM   3088  C CB  . PHE A  1 416  ? 198.499 166.288 215.590 1.00 260.73 ? 429  PHE A CB  1 
ATOM   3089  C CG  . PHE A  1 416  ? 197.735 166.664 214.360 1.00 260.73 ? 429  PHE A CG  1 
ATOM   3090  C CD1 . PHE A  1 416  ? 196.654 165.905 213.954 1.00 260.73 ? 429  PHE A CD1 1 
ATOM   3091  C CD2 . PHE A  1 416  ? 198.057 167.799 213.649 1.00 260.73 ? 429  PHE A CD2 1 
ATOM   3092  C CE1 . PHE A  1 416  ? 195.936 166.250 212.852 1.00 260.73 ? 429  PHE A CE1 1 
ATOM   3093  C CE2 . PHE A  1 416  ? 197.341 168.150 212.549 1.00 260.73 ? 429  PHE A CE2 1 
ATOM   3094  C CZ  . PHE A  1 416  ? 196.277 167.376 212.147 1.00 260.73 ? 429  PHE A CZ  1 
ATOM   3095  N N   . THR A  1 417  ? 197.265 164.282 217.580 1.00 255.59 ? 430  THR A N   1 
ATOM   3096  C CA  . THR A  1 417  ? 197.111 163.180 218.516 1.00 255.59 ? 430  THR A CA  1 
ATOM   3097  C C   . THR A  1 417  ? 197.632 161.904 217.869 1.00 255.59 ? 430  THR A C   1 
ATOM   3098  O O   . THR A  1 417  ? 196.896 161.233 217.139 1.00 255.59 ? 430  THR A O   1 
ATOM   3099  C CB  . THR A  1 417  ? 195.642 163.034 218.908 1.00 255.59 ? 430  THR A CB  1 
ATOM   3100  O OG1 . THR A  1 417  ? 194.931 162.416 217.834 1.00 255.59 ? 430  THR A OG1 1 
ATOM   3101  C CG2 . THR A  1 417  ? 195.019 164.395 219.160 1.00 255.59 ? 430  THR A CG2 1 
ATOM   3102  N N   . GLY A  1 418  ? 198.908 161.584 218.096 1.00 263.57 ? 431  GLY A N   1 
ATOM   3103  C CA  . GLY A  1 418  ? 199.384 160.261 217.736 1.00 263.57 ? 431  GLY A CA  1 
ATOM   3104  C C   . GLY A  1 418  ? 198.945 159.167 218.694 1.00 263.57 ? 431  GLY A C   1 
ATOM   3105  O O   . GLY A  1 418  ? 198.007 158.428 218.380 1.00 263.57 ? 431  GLY A O   1 
ATOM   3106  N N   . CYS A  1 419  ? 199.597 159.074 219.867 1.00 275.33 ? 432  CYS A N   1 
ATOM   3107  C CA  . CYS A  1 419  ? 199.150 158.273 221.012 1.00 275.33 ? 432  CYS A CA  1 
ATOM   3108  C C   . CYS A  1 419  ? 200.111 158.333 222.196 1.00 275.33 ? 432  CYS A C   1 
ATOM   3109  O O   . CYS A  1 419  ? 201.136 159.020 222.141 1.00 275.33 ? 432  CYS A O   1 
ATOM   3110  C CB  . CYS A  1 419  ? 198.912 156.807 220.646 1.00 275.33 ? 432  CYS A CB  1 
ATOM   3111  S SG  . CYS A  1 419  ? 200.109 155.950 219.622 1.00 275.33 ? 432  CYS A SG  1 
ATOM   3112  N N   . VAL A  1 420  ? 199.777 157.611 223.271 1.00 279.45 ? 433  VAL A N   1 
ATOM   3113  C CA  . VAL A  1 420  ? 200.614 157.480 224.469 1.00 279.45 ? 433  VAL A CA  1 
ATOM   3114  C C   . VAL A  1 420  ? 200.818 155.988 224.754 1.00 279.45 ? 433  VAL A C   1 
ATOM   3115  O O   . VAL A  1 420  ? 199.912 155.306 225.243 1.00 279.45 ? 433  VAL A O   1 
ATOM   3116  C CB  . VAL A  1 420  ? 200.023 158.229 225.682 1.00 279.45 ? 433  VAL A CB  1 
ATOM   3117  C CG1 . VAL A  1 420  ? 198.615 157.732 226.074 1.00 279.45 ? 433  VAL A CG1 1 
ATOM   3118  C CG2 . VAL A  1 420  ? 200.960 158.137 226.876 1.00 279.45 ? 433  VAL A CG2 1 
ATOM   3119  N N   . ILE A  1 421  ? 201.998 155.464 224.406 1.00 280.40 ? 434  ILE A N   1 
ATOM   3120  C CA  . ILE A  1 421  ? 202.356 154.064 224.624 1.00 280.40 ? 434  ILE A CA  1 
ATOM   3121  C C   . ILE A  1 421  ? 203.846 153.998 224.942 1.00 280.40 ? 434  ILE A C   1 
ATOM   3122  O O   . ILE A  1 421  ? 204.625 154.864 224.549 1.00 280.40 ? 434  ILE A O   1 
ATOM   3123  C CB  . ILE A  1 421  ? 202.035 153.167 223.407 1.00 280.40 ? 434  ILE A CB  1 
ATOM   3124  C CG1 . ILE A  1 421  ? 200.604 153.370 222.925 1.00 280.40 ? 434  ILE A CG1 1 
ATOM   3125  C CG2 . ILE A  1 421  ? 202.215 151.695 223.736 1.00 280.40 ? 434  ILE A CG2 1 
ATOM   3126  C CD1 . ILE A  1 421  ? 200.344 152.731 221.597 1.00 280.40 ? 434  ILE A CD1 1 
ATOM   3127  N N   . ALA A  1 422  ? 204.243 152.947 225.647 1.00 285.51 ? 435  ALA A N   1 
ATOM   3128  C CA  . ALA A  1 422  ? 205.615 152.787 226.098 1.00 285.51 ? 435  ALA A CA  1 
ATOM   3129  C C   . ALA A  1 422  ? 206.410 151.891 225.159 1.00 285.51 ? 435  ALA A C   1 
ATOM   3130  O O   . ALA A  1 422  ? 205.862 151.023 224.474 1.00 285.51 ? 435  ALA A O   1 
ATOM   3131  C CB  . ALA A  1 422  ? 205.657 152.211 227.516 1.00 285.51 ? 435  ALA A CB  1 
ATOM   3132  N N   . TRP A  1 423  ? 207.722 152.113 225.148 1.00 289.88 ? 436  TRP A N   1 
ATOM   3133  C CA  . TRP A  1 423  ? 208.690 151.267 224.462 1.00 289.88 ? 436  TRP A CA  1 
ATOM   3134  C C   . TRP A  1 423  ? 209.633 150.667 225.505 1.00 289.88 ? 436  TRP A C   1 
ATOM   3135  O O   . TRP A  1 423  ? 209.368 150.745 226.709 1.00 289.88 ? 436  TRP A O   1 
ATOM   3136  C CB  . TRP A  1 423  ? 209.432 152.053 223.383 1.00 289.88 ? 436  TRP A CB  1 
ATOM   3137  C CG  . TRP A  1 423  ? 210.563 152.884 223.874 1.00 289.88 ? 436  TRP A CG  1 
ATOM   3138  C CD1 . TRP A  1 423  ? 211.881 152.558 223.844 1.00 289.88 ? 436  TRP A CD1 1 
ATOM   3139  C CD2 . TRP A  1 423  ? 210.486 154.197 224.433 1.00 289.88 ? 436  TRP A CD2 1 
ATOM   3140  N NE1 . TRP A  1 423  ? 212.634 153.579 224.363 1.00 289.88 ? 436  TRP A NE1 1 
ATOM   3141  C CE2 . TRP A  1 423  ? 211.800 154.600 224.729 1.00 289.88 ? 436  TRP A CE2 1 
ATOM   3142  C CE3 . TRP A  1 423  ? 209.437 155.071 224.711 1.00 289.88 ? 436  TRP A CE3 1 
ATOM   3143  C CZ2 . TRP A  1 423  ? 212.090 155.837 225.291 1.00 289.88 ? 436  TRP A CZ2 1 
ATOM   3144  C CZ3 . TRP A  1 423  ? 209.730 156.294 225.271 1.00 289.88 ? 436  TRP A CZ3 1 
ATOM   3145  C CH2 . TRP A  1 423  ? 211.040 156.666 225.557 1.00 289.88 ? 436  TRP A CH2 1 
ATOM   3146  N N   . ASN A  1 424  ? 210.725 150.042 225.047 1.00 296.29 ? 437  ASN A N   1 
ATOM   3147  C CA  . ASN A  1 424  ? 211.608 149.339 225.975 1.00 296.29 ? 437  ASN A CA  1 
ATOM   3148  C C   . ASN A  1 424  ? 212.105 150.308 227.045 1.00 296.29 ? 437  ASN A C   1 
ATOM   3149  O O   . ASN A  1 424  ? 212.688 151.352 226.735 1.00 296.29 ? 437  ASN A O   1 
ATOM   3150  C CB  . ASN A  1 424  ? 212.780 148.678 225.239 1.00 296.29 ? 437  ASN A CB  1 
ATOM   3151  C CG  . ASN A  1 424  ? 213.982 149.588 225.087 1.00 296.29 ? 437  ASN A CG  1 
ATOM   3152  O OD1 . ASN A  1 424  ? 213.913 150.618 224.427 1.00 296.29 ? 437  ASN A OD1 1 
ATOM   3153  N ND2 . ASN A  1 424  ? 215.089 149.216 225.718 1.00 296.29 ? 437  ASN A ND2 1 
ATOM   3154  N N   . SER A  1 425  ? 211.814 149.990 228.312 1.00 298.59 ? 438  SER A N   1 
ATOM   3155  C CA  . SER A  1 425  ? 212.061 150.920 229.406 1.00 298.59 ? 438  SER A CA  1 
ATOM   3156  C C   . SER A  1 425  ? 212.781 150.282 230.587 1.00 298.59 ? 438  SER A C   1 
ATOM   3157  O O   . SER A  1 425  ? 213.043 150.973 231.578 1.00 298.59 ? 438  SER A O   1 
ATOM   3158  C CB  . SER A  1 425  ? 210.745 151.537 229.881 1.00 298.59 ? 438  SER A CB  1 
ATOM   3159  O OG  . SER A  1 425  ? 210.986 152.656 230.713 1.00 298.59 ? 438  SER A OG  1 
ATOM   3160  N N   . ASN A  1 426  ? 213.120 148.996 230.510 1.00 293.70 ? 439  ASN A N   1 
ATOM   3161  C CA  . ASN A  1 426  ? 213.788 148.314 231.610 1.00 293.70 ? 439  ASN A CA  1 
ATOM   3162  C C   . ASN A  1 426  ? 215.289 148.175 231.409 1.00 293.70 ? 439  ASN A C   1 
ATOM   3163  O O   . ASN A  1 426  ? 216.047 148.393 232.358 1.00 293.70 ? 439  ASN A O   1 
ATOM   3164  C CB  . ASN A  1 426  ? 213.179 146.925 231.820 1.00 293.70 ? 439  ASN A CB  1 
ATOM   3165  C CG  . ASN A  1 426  ? 213.430 146.386 233.211 1.00 293.70 ? 439  ASN A CG  1 
ATOM   3166  O OD1 . ASN A  1 426  ? 214.020 147.064 234.049 1.00 293.70 ? 439  ASN A OD1 1 
ATOM   3167  N ND2 . ASN A  1 426  ? 212.983 145.161 233.464 1.00 293.70 ? 439  ASN A ND2 1 
ATOM   3168  N N   . ASN A  1 427  ? 215.739 147.841 230.196 1.00 292.16 ? 440  ASN A N   1 
ATOM   3169  C CA  . ASN A  1 427  ? 217.165 147.718 229.907 1.00 292.16 ? 440  ASN A CA  1 
ATOM   3170  C C   . ASN A  1 427  ? 217.934 149.004 230.174 1.00 292.16 ? 440  ASN A C   1 
ATOM   3171  O O   . ASN A  1 427  ? 219.168 148.974 230.213 1.00 292.16 ? 440  ASN A O   1 
ATOM   3172  C CB  . ASN A  1 427  ? 217.372 147.296 228.449 1.00 292.16 ? 440  ASN A CB  1 
ATOM   3173  C CG  . ASN A  1 427  ? 217.365 145.789 228.263 1.00 292.16 ? 440  ASN A CG  1 
ATOM   3174  O OD1 . ASN A  1 427  ? 216.370 145.209 227.828 1.00 292.16 ? 440  ASN A OD1 1 
ATOM   3175  N ND2 . ASN A  1 427  ? 218.488 145.150 228.573 1.00 292.16 ? 440  ASN A ND2 1 
ATOM   3176  N N   . LEU A  1 428  ? 217.239 150.123 230.353 1.00 297.60 ? 441  LEU A N   1 
ATOM   3177  C CA  . LEU A  1 428  ? 217.873 151.391 230.668 1.00 297.60 ? 441  LEU A CA  1 
ATOM   3178  C C   . LEU A  1 428  ? 217.731 151.792 232.126 1.00 297.60 ? 441  LEU A C   1 
ATOM   3179  O O   . LEU A  1 428  ? 218.556 152.561 232.620 1.00 297.60 ? 441  LEU A O   1 
ATOM   3180  C CB  . LEU A  1 428  ? 217.295 152.507 229.788 1.00 297.60 ? 441  LEU A CB  1 
ATOM   3181  N N   . ASP A  1 429  ? 216.717 151.286 232.830 1.00 293.83 ? 442  ASP A N   1 
ATOM   3182  C CA  . ASP A  1 429  ? 216.546 151.634 234.235 1.00 293.83 ? 442  ASP A CA  1 
ATOM   3183  C C   . ASP A  1 429  ? 216.426 150.368 235.072 1.00 293.83 ? 442  ASP A C   1 
ATOM   3184  O O   . ASP A  1 429  ? 215.532 150.237 235.912 1.00 293.83 ? 442  ASP A O   1 
ATOM   3185  C CB  . ASP A  1 429  ? 215.333 152.533 234.426 1.00 293.83 ? 442  ASP A CB  1 
ATOM   3186  C CG  . ASP A  1 429  ? 215.552 153.572 235.490 1.00 293.83 ? 442  ASP A CG  1 
ATOM   3187  O OD1 . ASP A  1 429  ? 216.680 153.644 236.014 1.00 293.83 ? 442  ASP A OD1 1 
ATOM   3188  O OD2 . ASP A  1 429  ? 214.603 154.318 235.799 1.00 293.83 ? 442  ASP A OD2 1 
ATOM   3189  N N   . SER A  1 430  ? 217.332 149.437 234.825 1.00 298.50 ? 443  SER A N   1 
ATOM   3190  C CA  . SER A  1 430  ? 217.588 148.246 235.617 1.00 298.50 ? 443  SER A CA  1 
ATOM   3191  C C   . SER A  1 430  ? 218.979 148.427 236.197 1.00 298.50 ? 443  SER A C   1 
ATOM   3192  O O   . SER A  1 430  ? 219.527 149.532 236.156 1.00 298.50 ? 443  SER A O   1 
ATOM   3193  C CB  . SER A  1 430  ? 217.474 146.973 234.783 1.00 298.50 ? 443  SER A CB  1 
ATOM   3194  O OG  . SER A  1 430  ? 218.110 145.891 235.438 1.00 298.50 ? 443  SER A OG  1 
ATOM   3195  N N   . ARG A  1 441  ? 213.669 173.161 236.174 1.00 263.41 ? 454  ARG A N   1 
ATOM   3196  C CA  . ARG A  1 441  ? 213.602 174.624 236.225 1.00 263.41 ? 454  ARG A CA  1 
ATOM   3197  C C   . ARG A  1 441  ? 212.388 175.093 235.417 1.00 263.41 ? 454  ARG A C   1 
ATOM   3198  O O   . ARG A  1 441  ? 212.500 175.483 234.259 1.00 263.41 ? 454  ARG A O   1 
ATOM   3199  C CB  . ARG A  1 441  ? 214.864 175.263 235.648 1.00 263.41 ? 454  ARG A CB  1 
ATOM   3200  C CG  . ARG A  1 441  ? 216.177 174.886 236.274 1.00 263.41 ? 454  ARG A CG  1 
ATOM   3201  C CD  . ARG A  1 441  ? 217.271 175.300 235.309 1.00 263.41 ? 454  ARG A CD  1 
ATOM   3202  N NE  . ARG A  1 441  ? 218.584 175.432 235.921 1.00 263.41 ? 454  ARG A NE  1 
ATOM   3203  C CZ  . ARG A  1 441  ? 219.623 175.982 235.307 1.00 263.41 ? 454  ARG A CZ  1 
ATOM   3204  N NH1 . ARG A  1 441  ? 219.486 176.452 234.081 1.00 263.41 ? 454  ARG A NH1 1 
ATOM   3205  N NH2 . ARG A  1 441  ? 220.793 176.070 235.915 1.00 263.41 ? 454  ARG A NH2 1 
ATOM   3206  N N   . LEU A  1 442  ? 211.203 175.096 236.024 1.00 261.00 ? 455  LEU A N   1 
ATOM   3207  C CA  . LEU A  1 442  ? 210.017 175.498 235.281 1.00 261.00 ? 455  LEU A CA  1 
ATOM   3208  C C   . LEU A  1 442  ? 209.071 176.428 236.026 1.00 261.00 ? 455  LEU A C   1 
ATOM   3209  O O   . LEU A  1 442  ? 207.903 176.519 235.640 1.00 261.00 ? 455  LEU A O   1 
ATOM   3210  C CB  . LEU A  1 442  ? 209.234 174.271 234.788 1.00 261.00 ? 455  LEU A CB  1 
ATOM   3211  C CG  . LEU A  1 442  ? 209.668 173.665 233.449 1.00 261.00 ? 455  LEU A CG  1 
ATOM   3212  C CD1 . LEU A  1 442  ? 209.166 172.237 233.272 1.00 261.00 ? 455  LEU A CD1 1 
ATOM   3213  C CD2 . LEU A  1 442  ? 209.180 174.536 232.309 1.00 261.00 ? 455  LEU A CD2 1 
ATOM   3214  N N   . PHE A  1 443  ? 209.514 177.092 237.087 1.00 249.20 ? 456  PHE A N   1 
ATOM   3215  C CA  . PHE A  1 443  ? 208.846 178.292 237.576 1.00 249.20 ? 456  PHE A CA  1 
ATOM   3216  C C   . PHE A  1 443  ? 209.893 179.243 238.127 1.00 249.20 ? 456  PHE A C   1 
ATOM   3217  O O   . PHE A  1 443  ? 210.888 178.803 238.710 1.00 249.20 ? 456  PHE A O   1 
ATOM   3218  C CB  . PHE A  1 443  ? 207.812 177.999 238.656 1.00 249.20 ? 456  PHE A CB  1 
ATOM   3219  C CG  . PHE A  1 443  ? 206.866 179.144 238.900 1.00 249.20 ? 456  PHE A CG  1 
ATOM   3220  C CD1 . PHE A  1 443  ? 205.768 179.341 238.087 1.00 249.20 ? 456  PHE A CD1 1 
ATOM   3221  C CD2 . PHE A  1 443  ? 207.112 180.060 239.903 1.00 249.20 ? 456  PHE A CD2 1 
ATOM   3222  C CE1 . PHE A  1 443  ? 204.906 180.401 238.307 1.00 249.20 ? 456  PHE A CE1 1 
ATOM   3223  C CE2 . PHE A  1 443  ? 206.253 181.122 240.118 1.00 249.20 ? 456  PHE A CE2 1 
ATOM   3224  C CZ  . PHE A  1 443  ? 205.154 181.292 239.319 1.00 249.20 ? 456  PHE A CZ  1 
ATOM   3225  N N   . ARG A  1 444  ? 209.666 180.537 237.943 1.00 250.59 ? 457  ARG A N   1 
ATOM   3226  C CA  . ARG A  1 444  ? 210.504 181.567 238.533 1.00 250.59 ? 457  ARG A CA  1 
ATOM   3227  C C   . ARG A  1 444  ? 209.633 182.786 238.798 1.00 250.59 ? 457  ARG A C   1 
ATOM   3228  O O   . ARG A  1 444  ? 208.401 182.704 238.782 1.00 250.59 ? 457  ARG A O   1 
ATOM   3229  C CB  . ARG A  1 444  ? 211.710 181.883 237.639 1.00 250.59 ? 457  ARG A CB  1 
ATOM   3230  C CG  . ARG A  1 444  ? 212.923 180.998 237.897 1.00 250.59 ? 457  ARG A CG  1 
ATOM   3231  C CD  . ARG A  1 444  ? 214.057 181.314 236.945 1.00 250.59 ? 457  ARG A CD  1 
ATOM   3232  N NE  . ARG A  1 444  ? 214.618 182.648 237.133 1.00 250.59 ? 457  ARG A NE  1 
ATOM   3233  C CZ  . ARG A  1 444  ? 215.803 182.884 237.682 1.00 250.59 ? 457  ARG A CZ  1 
ATOM   3234  N NH1 . ARG A  1 444  ? 216.555 181.872 238.086 1.00 250.59 ? 457  ARG A NH1 1 
ATOM   3235  N NH2 . ARG A  1 444  ? 216.245 184.127 237.810 1.00 250.59 ? 457  ARG A NH2 1 
ATOM   3236  N N   . LYS A  1 445  ? 210.302 183.909 239.046 1.00 263.65 ? 458  LYS A N   1 
ATOM   3237  C CA  . LYS A  1 445  ? 209.731 185.193 239.466 1.00 263.65 ? 458  LYS A CA  1 
ATOM   3238  C C   . LYS A  1 445  ? 208.232 185.393 239.254 1.00 263.65 ? 458  LYS A C   1 
ATOM   3239  O O   . LYS A  1 445  ? 207.725 185.247 238.150 1.00 263.65 ? 458  LYS A O   1 
ATOM   3240  C CB  . LYS A  1 445  ? 210.497 186.309 238.757 1.00 263.65 ? 458  LYS A CB  1 
ATOM   3241  C CG  . LYS A  1 445  ? 211.932 185.914 238.457 1.00 263.65 ? 458  LYS A CG  1 
ATOM   3242  C CD  . LYS A  1 445  ? 212.811 187.103 238.152 1.00 263.65 ? 458  LYS A CD  1 
ATOM   3243  C CE  . LYS A  1 445  ? 214.244 186.651 237.960 1.00 263.65 ? 458  LYS A CE  1 
ATOM   3244  N NZ  . LYS A  1 445  ? 215.207 187.773 238.096 1.00 263.65 ? 458  LYS A NZ  1 
ATOM   3245  N N   . PRO A  1 478  ? 209.254 177.862 243.512 1.00 259.58 ? 491  PRO A N   1 
ATOM   3246  C CA  . PRO A  1 478  ? 209.797 177.715 242.161 1.00 259.58 ? 491  PRO A CA  1 
ATOM   3247  C C   . PRO A  1 478  ? 210.793 176.574 242.023 1.00 259.58 ? 491  PRO A C   1 
ATOM   3248  O O   . PRO A  1 478  ? 211.920 176.801 241.585 1.00 259.58 ? 491  PRO A O   1 
ATOM   3249  C CB  . PRO A  1 478  ? 210.485 179.058 241.919 1.00 259.58 ? 491  PRO A CB  1 
ATOM   3250  C CG  . PRO A  1 478  ? 210.832 179.547 243.262 1.00 259.58 ? 491  PRO A CG  1 
ATOM   3251  C CD  . PRO A  1 478  ? 209.693 179.121 244.135 1.00 259.58 ? 491  PRO A CD  1 
ATOM   3252  N N   . LEU A  1 479  ? 210.375 175.372 242.410 1.00 279.40 ? 492  LEU A N   1 
ATOM   3253  C CA  . LEU A  1 479  ? 211.146 174.155 242.158 1.00 279.40 ? 492  LEU A CA  1 
ATOM   3254  C C   . LEU A  1 479  ? 210.286 172.972 242.565 1.00 279.40 ? 492  LEU A C   1 
ATOM   3255  O O   . LEU A  1 479  ? 209.688 172.993 243.645 1.00 279.40 ? 492  LEU A O   1 
ATOM   3256  C CB  . LEU A  1 479  ? 212.467 174.153 242.930 1.00 279.40 ? 492  LEU A CB  1 
ATOM   3257  N N   . GLN A  1 480  ? 210.203 171.955 241.710 1.00 281.31 ? 493  GLN A N   1 
ATOM   3258  C CA  . GLN A  1 480  ? 209.509 170.725 242.058 1.00 281.31 ? 493  GLN A CA  1 
ATOM   3259  C C   . GLN A  1 480  ? 210.291 169.529 241.536 1.00 281.31 ? 493  GLN A C   1 
ATOM   3260  O O   . GLN A  1 480  ? 211.282 169.669 240.817 1.00 281.31 ? 493  GLN A O   1 
ATOM   3261  C CB  . GLN A  1 480  ? 208.074 170.708 241.518 1.00 281.31 ? 493  GLN A CB  1 
ATOM   3262  N N   . SER A  1 481  ? 209.821 168.341 241.902 1.00 284.10 ? 494  SER A N   1 
ATOM   3263  C CA  . SER A  1 481  ? 210.506 167.093 241.608 1.00 284.10 ? 494  SER A CA  1 
ATOM   3264  C C   . SER A  1 481  ? 209.579 166.173 240.825 1.00 284.10 ? 494  SER A C   1 
ATOM   3265  O O   . SER A  1 481  ? 208.384 166.073 241.112 1.00 284.10 ? 494  SER A O   1 
ATOM   3266  C CB  . SER A  1 481  ? 210.976 166.411 242.903 1.00 284.10 ? 494  SER A CB  1 
ATOM   3267  O OG  . SER A  1 481  ? 209.879 166.028 243.718 1.00 284.10 ? 494  SER A OG  1 
ATOM   3268  N N   . TYR A  1 482  ? 210.147 165.481 239.835 1.00 277.18 ? 495  TYR A N   1 
ATOM   3269  C CA  . TYR A  1 482  ? 209.396 164.577 238.967 1.00 277.18 ? 495  TYR A CA  1 
ATOM   3270  C C   . TYR A  1 482  ? 209.758 163.138 239.319 1.00 277.18 ? 495  TYR A C   1 
ATOM   3271  O O   . TYR A  1 482  ? 210.796 162.863 239.922 1.00 277.18 ? 495  TYR A O   1 
ATOM   3272  C CB  . TYR A  1 482  ? 209.647 164.874 237.475 1.00 277.18 ? 495  TYR A CB  1 
ATOM   3273  C CG  . TYR A  1 482  ? 208.643 165.840 236.878 1.00 277.18 ? 495  TYR A CG  1 
ATOM   3274  C CD1 . TYR A  1 482  ? 207.368 165.419 236.550 1.00 277.18 ? 495  TYR A CD1 1 
ATOM   3275  C CD2 . TYR A  1 482  ? 208.968 167.167 236.658 1.00 277.18 ? 495  TYR A CD2 1 
ATOM   3276  C CE1 . TYR A  1 482  ? 206.453 166.284 236.034 1.00 277.18 ? 495  TYR A CE1 1 
ATOM   3277  C CE2 . TYR A  1 482  ? 208.057 168.040 236.135 1.00 277.18 ? 495  TYR A CE2 1 
ATOM   3278  C CZ  . TYR A  1 482  ? 206.800 167.590 235.828 1.00 277.18 ? 495  TYR A CZ  1 
ATOM   3279  O OH  . TYR A  1 482  ? 205.867 168.439 235.301 1.00 277.18 ? 495  TYR A OH  1 
ATOM   3280  N N   . GLY A  1 483  ? 208.889 162.213 238.930 1.00 283.99 ? 496  GLY A N   1 
ATOM   3281  C CA  . GLY A  1 483  ? 209.004 160.849 239.396 1.00 283.99 ? 496  GLY A CA  1 
ATOM   3282  C C   . GLY A  1 483  ? 210.095 160.036 238.736 1.00 283.99 ? 496  GLY A C   1 
ATOM   3283  O O   . GLY A  1 483  ? 209.806 159.025 238.092 1.00 283.99 ? 496  GLY A O   1 
ATOM   3284  N N   . PHE A  1 484  ? 211.351 160.448 238.897 1.00 293.14 ? 497  PHE A N   1 
ATOM   3285  C CA  . PHE A  1 484  ? 212.471 159.618 238.465 1.00 293.14 ? 497  PHE A CA  1 
ATOM   3286  C C   . PHE A  1 484  ? 212.411 158.304 239.228 1.00 293.14 ? 497  PHE A C   1 
ATOM   3287  O O   . PHE A  1 484  ? 212.455 158.302 240.461 1.00 293.14 ? 497  PHE A O   1 
ATOM   3288  C CB  . PHE A  1 484  ? 213.798 160.327 238.711 1.00 293.14 ? 497  PHE A CB  1 
ATOM   3289  C CG  . PHE A  1 484  ? 213.910 161.658 238.036 1.00 293.14 ? 497  PHE A CG  1 
ATOM   3290  C CD1 . PHE A  1 484  ? 213.403 162.794 238.633 1.00 293.14 ? 497  PHE A CD1 1 
ATOM   3291  C CD2 . PHE A  1 484  ? 214.526 161.772 236.802 1.00 293.14 ? 497  PHE A CD2 1 
ATOM   3292  C CE1 . PHE A  1 484  ? 213.502 164.020 238.014 1.00 293.14 ? 497  PHE A CE1 1 
ATOM   3293  C CE2 . PHE A  1 484  ? 214.636 162.998 236.177 1.00 293.14 ? 497  PHE A CE2 1 
ATOM   3294  C CZ  . PHE A  1 484  ? 214.120 164.123 236.782 1.00 293.14 ? 497  PHE A CZ  1 
ATOM   3295  N N   . GLN A  1 485  ? 212.319 157.195 238.503 1.00 295.92 ? 498  GLN A N   1 
ATOM   3296  C CA  . GLN A  1 485  ? 211.947 155.903 239.077 1.00 295.92 ? 498  GLN A CA  1 
ATOM   3297  C C   . GLN A  1 485  ? 212.777 155.543 240.309 1.00 295.92 ? 498  GLN A C   1 
ATOM   3298  O O   . GLN A  1 485  ? 213.966 155.220 240.172 1.00 295.92 ? 498  GLN A O   1 
ATOM   3299  C CB  . GLN A  1 485  ? 212.103 154.819 238.015 1.00 295.92 ? 498  GLN A CB  1 
ATOM   3300  N N   . PRO A  1 486  ? 212.194 155.573 241.525 1.00 300.34 ? 499  PRO A N   1 
ATOM   3301  C CA  . PRO A  1 486  ? 212.953 155.173 242.717 1.00 300.34 ? 499  PRO A CA  1 
ATOM   3302  C C   . PRO A  1 486  ? 213.254 153.684 242.743 1.00 300.34 ? 499  PRO A C   1 
ATOM   3303  O O   . PRO A  1 486  ? 214.398 153.283 242.974 1.00 300.34 ? 499  PRO A O   1 
ATOM   3304  C CB  . PRO A  1 486  ? 212.034 155.578 243.880 1.00 300.34 ? 499  PRO A CB  1 
ATOM   3305  C CG  . PRO A  1 486  ? 210.989 156.466 243.282 1.00 300.34 ? 499  PRO A CG  1 
ATOM   3306  C CD  . PRO A  1 486  ? 210.832 156.003 241.873 1.00 300.34 ? 499  PRO A CD  1 
ATOM   3307  N N   . THR A  1 487  ? 212.240 152.855 242.512 1.00 295.86 ? 500  THR A N   1 
ATOM   3308  C CA  . THR A  1 487  ? 212.374 151.413 242.641 1.00 295.86 ? 500  THR A CA  1 
ATOM   3309  C C   . THR A  1 487  ? 211.555 150.680 241.587 1.00 295.86 ? 500  THR A C   1 
ATOM   3310  O O   . THR A  1 487  ? 210.838 151.277 240.782 1.00 295.86 ? 500  THR A O   1 
ATOM   3311  C CB  . THR A  1 487  ? 211.949 150.961 244.036 1.00 295.86 ? 500  THR A CB  1 
ATOM   3312  O OG1 . THR A  1 487  ? 212.180 149.554 244.165 1.00 295.86 ? 500  THR A OG1 1 
ATOM   3313  C CG2 . THR A  1 487  ? 210.472 151.252 244.256 1.00 295.86 ? 500  THR A CG2 1 
ATOM   3314  N N   . ASN A  1 488  ? 211.656 149.355 241.629 1.00 289.53 ? 501  ASN A N   1 
ATOM   3315  C CA  . ASN A  1 488  ? 210.896 148.460 240.768 1.00 289.53 ? 501  ASN A CA  1 
ATOM   3316  C C   . ASN A  1 488  ? 209.513 148.270 241.368 1.00 289.53 ? 501  ASN A C   1 
ATOM   3317  O O   . ASN A  1 488  ? 209.385 147.737 242.474 1.00 289.53 ? 501  ASN A O   1 
ATOM   3318  C CB  . ASN A  1 488  ? 211.604 147.112 240.630 1.00 289.53 ? 501  ASN A CB  1 
ATOM   3319  C CG  . ASN A  1 488  ? 210.703 146.021 240.060 1.00 289.53 ? 501  ASN A CG  1 
ATOM   3320  O OD1 . ASN A  1 488  ? 209.691 146.295 239.417 1.00 289.53 ? 501  ASN A OD1 1 
ATOM   3321  N ND2 . ASN A  1 488  ? 211.077 144.771 240.300 1.00 289.53 ? 501  ASN A ND2 1 
ATOM   3322  N N   . GLY A  1 489  ? 208.482 148.691 240.643 1.00 293.55 ? 502  GLY A N   1 
ATOM   3323  C CA  . GLY A  1 489  ? 207.148 148.536 241.178 1.00 293.55 ? 502  GLY A CA  1 
ATOM   3324  C C   . GLY A  1 489  ? 206.002 148.542 240.192 1.00 293.55 ? 502  GLY A C   1 
ATOM   3325  O O   . GLY A  1 489  ? 206.111 148.043 239.071 1.00 293.55 ? 502  GLY A O   1 
ATOM   3326  N N   . VAL A  1 490  ? 204.880 149.096 240.638 1.00 294.22 ? 503  VAL A N   1 
ATOM   3327  C CA  . VAL A  1 490  ? 203.662 149.218 239.852 1.00 294.22 ? 503  VAL A CA  1 
ATOM   3328  C C   . VAL A  1 490  ? 203.272 150.683 239.930 1.00 294.22 ? 503  VAL A C   1 
ATOM   3329  O O   . VAL A  1 490  ? 202.417 151.164 239.181 1.00 294.22 ? 503  VAL A O   1 
ATOM   3330  C CB  . VAL A  1 490  ? 202.562 148.275 240.382 1.00 294.22 ? 503  VAL A CB  1 
ATOM   3331  C CG1 . VAL A  1 490  ? 201.176 148.624 239.837 1.00 294.22 ? 503  VAL A CG1 1 
ATOM   3332  C CG2 . VAL A  1 490  ? 202.915 146.834 240.058 1.00 294.22 ? 503  VAL A CG2 1 
ATOM   3333  N N   . GLY A  1 491  ? 203.935 151.417 240.811 1.00 297.18 ? 504  GLY A N   1 
ATOM   3334  C CA  . GLY A  1 491  ? 203.658 152.831 240.894 1.00 297.18 ? 504  GLY A CA  1 
ATOM   3335  C C   . GLY A  1 491  ? 204.657 153.667 240.130 1.00 297.18 ? 504  GLY A C   1 
ATOM   3336  O O   . GLY A  1 491  ? 204.280 154.670 239.522 1.00 297.18 ? 504  GLY A O   1 
ATOM   3337  N N   . TYR A  1 492  ? 205.918 153.235 240.097 1.00 296.76 ? 505  TYR A N   1 
ATOM   3338  C CA  . TYR A  1 492  ? 206.986 154.039 239.510 1.00 296.76 ? 505  TYR A CA  1 
ATOM   3339  C C   . TYR A  1 492  ? 207.993 153.258 238.683 1.00 296.76 ? 505  TYR A C   1 
ATOM   3340  O O   . TYR A  1 492  ? 209.059 153.808 238.390 1.00 296.76 ? 505  TYR A O   1 
ATOM   3341  C CB  . TYR A  1 492  ? 207.733 154.798 240.611 1.00 296.76 ? 505  TYR A CB  1 
ATOM   3342  C CG  . TYR A  1 492  ? 206.990 156.001 241.154 1.00 296.76 ? 505  TYR A CG  1 
ATOM   3343  C CD1 . TYR A  1 492  ? 206.068 156.687 240.379 1.00 296.76 ? 505  TYR A CD1 1 
ATOM   3344  C CD2 . TYR A  1 492  ? 207.183 156.424 242.461 1.00 296.76 ? 505  TYR A CD2 1 
ATOM   3345  C CE1 . TYR A  1 492  ? 205.383 157.783 240.877 1.00 296.76 ? 505  TYR A CE1 1 
ATOM   3346  C CE2 . TYR A  1 492  ? 206.501 157.514 242.972 1.00 296.76 ? 505  TYR A CE2 1 
ATOM   3347  C CZ  . TYR A  1 492  ? 205.602 158.193 242.178 1.00 296.76 ? 505  TYR A CZ  1 
ATOM   3348  O OH  . TYR A  1 492  ? 204.922 159.277 242.696 1.00 296.76 ? 505  TYR A OH  1 
ATOM   3349  N N   . GLN A  1 493  ? 207.718 152.010 238.319 1.00 304.95 ? 506  GLN A N   1 
ATOM   3350  C CA  . GLN A  1 493  ? 208.628 151.238 237.481 1.00 304.95 ? 506  GLN A CA  1 
ATOM   3351  C C   . GLN A  1 493  ? 208.877 151.957 236.157 1.00 304.95 ? 506  GLN A C   1 
ATOM   3352  O O   . GLN A  1 493  ? 207.956 152.560 235.597 1.00 304.95 ? 506  GLN A O   1 
ATOM   3353  C CB  . GLN A  1 493  ? 208.041 149.851 237.218 1.00 304.95 ? 506  GLN A CB  1 
ATOM   3354  C CG  . GLN A  1 493  ? 208.977 148.864 236.557 1.00 304.95 ? 506  GLN A CG  1 
ATOM   3355  C CD  . GLN A  1 493  ? 209.059 149.057 235.073 1.00 304.95 ? 506  GLN A CD  1 
ATOM   3356  O OE1 . GLN A  1 493  ? 208.131 149.569 234.455 1.00 304.95 ? 506  GLN A OE1 1 
ATOM   3357  N NE2 . GLN A  1 493  ? 210.176 148.658 234.487 1.00 304.95 ? 506  GLN A NE2 1 
ATOM   3358  N N   . PRO A  1 494  ? 210.094 151.904 235.619 1.00 304.08 ? 507  PRO A N   1 
ATOM   3359  C CA  . PRO A  1 494  ? 210.373 152.617 234.367 1.00 304.08 ? 507  PRO A CA  1 
ATOM   3360  C C   . PRO A  1 494  ? 209.547 152.077 233.206 1.00 304.08 ? 507  PRO A C   1 
ATOM   3361  O O   . PRO A  1 494  ? 209.739 150.945 232.760 1.00 304.08 ? 507  PRO A O   1 
ATOM   3362  C CB  . PRO A  1 494  ? 211.873 152.381 234.155 1.00 304.08 ? 507  PRO A CB  1 
ATOM   3363  C CG  . PRO A  1 494  ? 212.202 151.206 235.016 1.00 304.08 ? 507  PRO A CG  1 
ATOM   3364  C CD  . PRO A  1 494  ? 211.324 151.351 236.203 1.00 304.08 ? 507  PRO A CD  1 
ATOM   3365  N N   . TYR A  1 495  ? 208.620 152.908 232.720 1.00 297.06 ? 508  TYR A N   1 
ATOM   3366  C CA  . TYR A  1 495  ? 207.864 152.611 231.503 1.00 297.06 ? 508  TYR A CA  1 
ATOM   3367  C C   . TYR A  1 495  ? 207.795 153.913 230.711 1.00 297.06 ? 508  TYR A C   1 
ATOM   3368  O O   . TYR A  1 495  ? 206.855 154.691 230.889 1.00 297.06 ? 508  TYR A O   1 
ATOM   3369  C CB  . TYR A  1 495  ? 206.478 152.084 231.818 1.00 297.06 ? 508  TYR A CB  1 
ATOM   3370  C CG  . TYR A  1 495  ? 206.414 150.600 232.029 1.00 297.06 ? 508  TYR A CG  1 
ATOM   3371  C CD1 . TYR A  1 495  ? 207.273 149.748 231.351 1.00 297.06 ? 508  TYR A CD1 1 
ATOM   3372  C CD2 . TYR A  1 495  ? 205.506 150.049 232.920 1.00 297.06 ? 508  TYR A CD2 1 
ATOM   3373  C CE1 . TYR A  1 495  ? 207.217 148.387 231.545 1.00 297.06 ? 508  TYR A CE1 1 
ATOM   3374  C CE2 . TYR A  1 495  ? 205.443 148.691 233.124 1.00 297.06 ? 508  TYR A CE2 1 
ATOM   3375  C CZ  . TYR A  1 495  ? 206.301 147.862 232.434 1.00 297.06 ? 508  TYR A CZ  1 
ATOM   3376  O OH  . TYR A  1 495  ? 206.243 146.501 232.633 1.00 297.06 ? 508  TYR A OH  1 
ATOM   3377  N N   . ARG A  1 496  ? 208.778 154.134 229.848 1.00 296.52 ? 509  ARG A N   1 
ATOM   3378  C CA  . ARG A  1 496  ? 208.915 155.423 229.189 1.00 296.52 ? 509  ARG A CA  1 
ATOM   3379  C C   . ARG A  1 496  ? 208.106 155.489 227.898 1.00 296.52 ? 509  ARG A C   1 
ATOM   3380  O O   . ARG A  1 496  ? 207.977 154.508 227.163 1.00 296.52 ? 509  ARG A O   1 
ATOM   3381  C CB  . ARG A  1 496  ? 210.380 155.732 228.900 1.00 296.52 ? 509  ARG A CB  1 
ATOM   3382  C CG  . ARG A  1 496  ? 211.132 154.582 228.307 1.00 296.52 ? 509  ARG A CG  1 
ATOM   3383  C CD  . ARG A  1 496  ? 212.608 154.712 228.593 1.00 296.52 ? 509  ARG A CD  1 
ATOM   3384  N NE  . ARG A  1 496  ? 212.955 154.321 229.951 1.00 296.52 ? 509  ARG A NE  1 
ATOM   3385  C CZ  . ARG A  1 496  ? 214.179 154.431 230.451 1.00 296.52 ? 509  ARG A CZ  1 
ATOM   3386  N NH1 . ARG A  1 496  ? 214.422 154.052 231.694 1.00 296.52 ? 509  ARG A NH1 1 
ATOM   3387  N NH2 . ARG A  1 496  ? 215.157 154.936 229.710 1.00 296.52 ? 509  ARG A NH2 1 
ATOM   3388  N N   . VAL A  1 497  ? 207.567 156.676 227.635 1.00 287.97 ? 510  VAL A N   1 
ATOM   3389  C CA  . VAL A  1 497  ? 206.671 156.941 226.520 1.00 287.97 ? 510  VAL A CA  1 
ATOM   3390  C C   . VAL A  1 497  ? 207.129 158.228 225.851 1.00 287.97 ? 510  VAL A C   1 
ATOM   3391  O O   . VAL A  1 497  ? 207.499 159.188 226.535 1.00 287.97 ? 510  VAL A O   1 
ATOM   3392  C CB  . VAL A  1 497  ? 205.209 157.080 226.996 1.00 287.97 ? 510  VAL A CB  1 
ATOM   3393  C CG1 . VAL A  1 497  ? 204.313 157.565 225.875 1.00 287.97 ? 510  VAL A CG1 1 
ATOM   3394  C CG2 . VAL A  1 497  ? 204.706 155.784 227.586 1.00 287.97 ? 510  VAL A CG2 1 
ATOM   3395  N N   . VAL A  1 498  ? 207.119 158.245 224.519 1.00 285.96 ? 511  VAL A N   1 
ATOM   3396  C CA  . VAL A  1 498  ? 207.316 159.462 223.737 1.00 285.96 ? 511  VAL A CA  1 
ATOM   3397  C C   . VAL A  1 498  ? 206.045 159.714 222.939 1.00 285.96 ? 511  VAL A C   1 
ATOM   3398  O O   . VAL A  1 498  ? 205.736 158.968 222.003 1.00 285.96 ? 511  VAL A O   1 
ATOM   3399  C CB  . VAL A  1 498  ? 208.537 159.362 222.802 1.00 285.96 ? 511  VAL A CB  1 
ATOM   3400  C CG1 . VAL A  1 498  ? 208.494 160.463 221.761 1.00 285.96 ? 511  VAL A CG1 1 
ATOM   3401  C CG2 . VAL A  1 498  ? 209.828 159.453 223.597 1.00 285.96 ? 511  VAL A CG2 1 
ATOM   3402  N N   . VAL A  1 499  ? 205.315 160.764 223.308 1.00 283.75 ? 512  VAL A N   1 
ATOM   3403  C CA  . VAL A  1 499  ? 204.062 161.130 222.658 1.00 283.75 ? 512  VAL A CA  1 
ATOM   3404  C C   . VAL A  1 499  ? 204.372 162.201 221.620 1.00 283.75 ? 512  VAL A C   1 
ATOM   3405  O O   . VAL A  1 499  ? 205.365 162.925 221.735 1.00 283.75 ? 512  VAL A O   1 
ATOM   3406  C CB  . VAL A  1 499  ? 203.011 161.609 223.688 1.00 283.75 ? 512  VAL A CB  1 
ATOM   3407  C CG1 . VAL A  1 499  ? 201.697 162.005 223.018 1.00 283.75 ? 512  VAL A CG1 1 
ATOM   3408  C CG2 . VAL A  1 499  ? 202.765 160.530 224.721 1.00 283.75 ? 512  VAL A CG2 1 
ATOM   3409  N N   . LEU A  1 500  ? 203.533 162.282 220.588 1.00 276.24 ? 513  LEU A N   1 
ATOM   3410  C CA  . LEU A  1 500  ? 203.831 163.045 219.385 1.00 276.24 ? 513  LEU A CA  1 
ATOM   3411  C C   . LEU A  1 500  ? 202.713 164.026 219.049 1.00 276.24 ? 513  LEU A C   1 
ATOM   3412  O O   . LEU A  1 500  ? 201.600 163.935 219.573 1.00 276.24 ? 513  LEU A O   1 
ATOM   3413  C CB  . LEU A  1 500  ? 204.052 162.100 218.204 1.00 276.24 ? 513  LEU A CB  1 
ATOM   3414  C CG  . LEU A  1 500  ? 204.941 160.887 218.491 1.00 276.24 ? 513  LEU A CG  1 
ATOM   3415  C CD1 . LEU A  1 500  ? 204.113 159.652 218.863 1.00 276.24 ? 513  LEU A CD1 1 
ATOM   3416  C CD2 . LEU A  1 500  ? 205.848 160.606 217.305 1.00 276.24 ? 513  LEU A CD2 1 
ATOM   3417  N N   . SER A  1 501  ? 203.027 164.977 218.167 1.00 267.62 ? 514  SER A N   1 
ATOM   3418  C CA  . SER A  1 501  ? 202.049 165.926 217.651 1.00 267.62 ? 514  SER A CA  1 
ATOM   3419  C C   . SER A  1 501  ? 202.511 166.483 216.308 1.00 267.62 ? 514  SER A C   1 
ATOM   3420  O O   . SER A  1 501  ? 203.704 166.700 216.096 1.00 267.62 ? 514  SER A O   1 
ATOM   3421  C CB  . SER A  1 501  ? 201.818 167.075 218.640 1.00 267.62 ? 514  SER A CB  1 
ATOM   3422  O OG  . SER A  1 501  ? 201.645 166.587 219.956 1.00 267.62 ? 514  SER A OG  1 
ATOM   3423  N N   . PHE A  1 502  ? 201.557 166.712 215.406 1.00 259.34 ? 515  PHE A N   1 
ATOM   3424  C CA  . PHE A  1 502  ? 201.777 167.362 214.121 1.00 259.34 ? 515  PHE A CA  1 
ATOM   3425  C C   . PHE A  1 502  ? 201.188 168.764 214.144 1.00 259.34 ? 515  PHE A C   1 
ATOM   3426  O O   . PHE A  1 502  ? 200.381 169.113 215.006 1.00 259.34 ? 515  PHE A O   1 
ATOM   3427  C CB  . PHE A  1 502  ? 201.158 166.549 212.986 1.00 259.34 ? 515  PHE A CB  1 
ATOM   3428  C CG  . PHE A  1 502  ? 201.511 165.111 213.036 1.00 259.34 ? 515  PHE A CG  1 
ATOM   3429  C CD1 . PHE A  1 502  ? 202.836 164.718 213.085 1.00 259.34 ? 515  PHE A CD1 1 
ATOM   3430  C CD2 . PHE A  1 502  ? 200.527 164.149 213.053 1.00 259.34 ? 515  PHE A CD2 1 
ATOM   3431  C CE1 . PHE A  1 502  ? 203.173 163.389 213.139 1.00 259.34 ? 515  PHE A CE1 1 
ATOM   3432  C CE2 . PHE A  1 502  ? 200.858 162.817 213.106 1.00 259.34 ? 515  PHE A CE2 1 
ATOM   3433  C CZ  . PHE A  1 502  ? 202.184 162.435 213.149 1.00 259.34 ? 515  PHE A CZ  1 
ATOM   3434  N N   . GLU A  1 503  ? 201.588 169.570 213.176 1.00 259.45 ? 516  GLU A N   1 
ATOM   3435  C CA  . GLU A  1 503  ? 201.268 170.986 213.209 1.00 259.45 ? 516  GLU A CA  1 
ATOM   3436  C C   . GLU A  1 503  ? 199.866 171.247 212.686 1.00 259.45 ? 516  GLU A C   1 
ATOM   3437  O O   . GLU A  1 503  ? 199.254 170.405 212.030 1.00 259.45 ? 516  GLU A O   1 
ATOM   3438  C CB  . GLU A  1 503  ? 202.270 171.783 212.378 1.00 259.45 ? 516  GLU A CB  1 
ATOM   3439  N N   . LEU A  1 504  ? 199.352 172.428 213.012 1.00 258.70 ? 517  LEU A N   1 
ATOM   3440  C CA  . LEU A  1 504  ? 198.257 173.017 212.247 1.00 258.70 ? 517  LEU A CA  1 
ATOM   3441  C C   . LEU A  1 504  ? 198.817 173.884 211.121 1.00 258.70 ? 517  LEU A C   1 
ATOM   3442  O O   . LEU A  1 504  ? 198.374 175.002 210.867 1.00 258.70 ? 517  LEU A O   1 
ATOM   3443  C CB  . LEU A  1 504  ? 197.324 173.809 213.162 1.00 258.70 ? 517  LEU A CB  1 
ATOM   3444  C CG  . LEU A  1 504  ? 197.705 175.157 213.795 1.00 258.70 ? 517  LEU A CG  1 
ATOM   3445  C CD1 . LEU A  1 504  ? 196.460 175.908 214.234 1.00 258.70 ? 517  LEU A CD1 1 
ATOM   3446  C CD2 . LEU A  1 504  ? 198.648 174.991 214.970 1.00 258.70 ? 517  LEU A CD2 1 
ATOM   3447  N N   . LEU A  1 505  ? 199.804 173.330 210.418 1.00 249.63 ? 518  LEU A N   1 
ATOM   3448  C CA  . LEU A  1 505  ? 200.507 174.011 209.333 1.00 249.63 ? 518  LEU A CA  1 
ATOM   3449  C C   . LEU A  1 505  ? 201.031 175.376 209.790 1.00 249.63 ? 518  LEU A C   1 
ATOM   3450  O O   . LEU A  1 505  ? 200.526 176.433 209.417 1.00 249.63 ? 518  LEU A O   1 
ATOM   3451  C CB  . LEU A  1 505  ? 199.612 174.146 208.094 1.00 249.63 ? 518  LEU A CB  1 
ATOM   3452  C CG  . LEU A  1 505  ? 199.562 172.980 207.098 1.00 249.63 ? 518  LEU A CG  1 
ATOM   3453  C CD1 . LEU A  1 505  ? 198.676 173.317 205.908 1.00 249.63 ? 518  LEU A CD1 1 
ATOM   3454  C CD2 . LEU A  1 505  ? 200.955 172.614 206.632 1.00 249.63 ? 518  LEU A CD2 1 
ATOM   3455  N N   . HIS A  1 506  ? 202.046 175.317 210.649 1.00 252.47 ? 519  HIS A N   1 
ATOM   3456  C CA  . HIS A  1 506  ? 202.857 176.499 210.909 1.00 252.47 ? 519  HIS A CA  1 
ATOM   3457  C C   . HIS A  1 506  ? 203.935 176.694 209.850 1.00 252.47 ? 519  HIS A C   1 
ATOM   3458  O O   . HIS A  1 506  ? 204.445 177.808 209.692 1.00 252.47 ? 519  HIS A O   1 
ATOM   3459  C CB  . HIS A  1 506  ? 203.500 176.410 212.292 1.00 252.47 ? 519  HIS A CB  1 
ATOM   3460  N N   . ALA A  1 507  ? 204.289 175.630 209.129 1.00 249.34 ? 520  ALA A N   1 
ATOM   3461  C CA  . ALA A  1 507  ? 205.183 175.662 208.003 1.00 249.34 ? 520  ALA A CA  1 
ATOM   3462  C C   . ALA A  1 507  ? 204.763 174.452 207.185 1.00 249.34 ? 520  ALA A C   1 
ATOM   3463  O O   . ALA A  1 507  ? 204.683 173.347 207.744 1.00 249.34 ? 520  ALA A O   1 
ATOM   3464  C CB  . ALA A  1 507  ? 206.660 175.569 208.375 1.00 249.34 ? 520  ALA A CB  1 
ATOM   3465  N N   . PRO A  1 508  ? 204.482 174.622 205.892 1.00 255.14 ? 521  PRO A N   1 
ATOM   3466  C CA  . PRO A  1 508  ? 204.023 173.499 205.063 1.00 255.14 ? 521  PRO A CA  1 
ATOM   3467  C C   . PRO A  1 508  ? 205.019 172.349 205.047 1.00 255.14 ? 521  PRO A C   1 
ATOM   3468  O O   . PRO A  1 508  ? 206.093 172.392 205.651 1.00 255.14 ? 521  PRO A O   1 
ATOM   3469  C CB  . PRO A  1 508  ? 203.870 174.121 203.672 1.00 255.14 ? 521  PRO A CB  1 
ATOM   3470  C CG  . PRO A  1 508  ? 203.647 175.565 203.935 1.00 255.14 ? 521  PRO A CG  1 
ATOM   3471  C CD  . PRO A  1 508  ? 204.452 175.897 205.155 1.00 255.14 ? 521  PRO A CD  1 
ATOM   3472  N N   . ALA A  1 509  ? 204.636 171.292 204.336 1.00 256.38 ? 522  ALA A N   1 
ATOM   3473  C CA  . ALA A  1 509  ? 205.435 170.079 204.307 1.00 256.38 ? 522  ALA A CA  1 
ATOM   3474  C C   . ALA A  1 509  ? 206.813 170.343 203.708 1.00 256.38 ? 522  ALA A C   1 
ATOM   3475  O O   . ALA A  1 509  ? 207.055 171.345 203.026 1.00 256.38 ? 522  ALA A O   1 
ATOM   3476  C CB  . ALA A  1 509  ? 204.717 168.984 203.522 1.00 256.38 ? 522  ALA A CB  1 
ATOM   3477  N N   . THR A  1 510  ? 207.728 169.416 203.985 1.00 253.52 ? 523  THR A N   1 
ATOM   3478  C CA  . THR A  1 510  ? 209.113 169.519 203.546 1.00 253.52 ? 523  THR A CA  1 
ATOM   3479  C C   . THR A  1 510  ? 209.395 168.657 202.316 1.00 253.52 ? 523  THR A C   1 
ATOM   3480  O O   . THR A  1 510  ? 209.761 169.175 201.257 1.00 253.52 ? 523  THR A O   1 
ATOM   3481  C CB  . THR A  1 510  ? 210.027 169.111 204.704 1.00 253.52 ? 523  THR A CB  1 
ATOM   3482  O OG1 . THR A  1 510  ? 209.527 167.903 205.278 1.00 253.52 ? 523  THR A OG1 1 
ATOM   3483  C CG2 . THR A  1 510  ? 210.034 170.184 205.764 1.00 253.52 ? 523  THR A CG2 1 
ATOM   3484  N N   . VAL A  1 511  ? 209.216 167.343 202.438 1.00 253.06 ? 524  VAL A N   1 
ATOM   3485  C CA  . VAL A  1 511  ? 209.533 166.378 201.388 1.00 253.06 ? 524  VAL A CA  1 
ATOM   3486  C C   . VAL A  1 511  ? 208.445 165.314 201.406 1.00 253.06 ? 524  VAL A C   1 
ATOM   3487  O O   . VAL A  1 511  ? 208.035 164.868 202.482 1.00 253.06 ? 524  VAL A O   1 
ATOM   3488  C CB  . VAL A  1 511  ? 210.925 165.744 201.598 1.00 253.06 ? 524  VAL A CB  1 
ATOM   3489  C CG1 . VAL A  1 511  ? 211.027 164.420 200.869 1.00 253.06 ? 524  VAL A CG1 1 
ATOM   3490  C CG2 . VAL A  1 511  ? 212.023 166.688 201.135 1.00 253.06 ? 524  VAL A CG2 1 
ATOM   3491  N N   . CYS A  1 512  ? 207.977 164.903 200.235 1.00 254.26 ? 525  CYS A N   1 
ATOM   3492  C CA  . CYS A  1 512  ? 206.790 164.065 200.189 1.00 254.26 ? 525  CYS A CA  1 
ATOM   3493  C C   . CYS A  1 512  ? 207.149 162.666 199.695 1.00 254.26 ? 525  CYS A C   1 
ATOM   3494  O O   . CYS A  1 512  ? 208.282 162.392 199.290 1.00 254.26 ? 525  CYS A O   1 
ATOM   3495  C CB  . CYS A  1 512  ? 205.705 164.733 199.343 1.00 254.26 ? 525  CYS A CB  1 
ATOM   3496  S SG  . CYS A  1 512  ? 203.987 164.425 199.883 1.00 254.26 ? 525  CYS A SG  1 
ATOM   3497  N N   . GLY A  1 513  ? 206.147 161.792 199.714 1.00 243.23 ? 526  GLY A N   1 
ATOM   3498  C CA  . GLY A  1 513  ? 206.335 160.361 199.739 1.00 243.23 ? 526  GLY A CA  1 
ATOM   3499  C C   . GLY A  1 513  ? 207.221 159.748 198.679 1.00 243.23 ? 526  GLY A C   1 
ATOM   3500  O O   . GLY A  1 513  ? 207.347 160.245 197.559 1.00 243.23 ? 526  GLY A O   1 
ATOM   3501  N N   . PRO A  1 514  ? 207.863 158.649 199.037 1.00 237.50 ? 527  PRO A N   1 
ATOM   3502  C CA  . PRO A  1 514  ? 208.762 157.945 198.120 1.00 237.50 ? 527  PRO A CA  1 
ATOM   3503  C C   . PRO A  1 514  ? 208.032 156.878 197.308 1.00 237.50 ? 527  PRO A C   1 
ATOM   3504  O O   . PRO A  1 514  ? 206.815 156.762 197.328 1.00 237.50 ? 527  PRO A O   1 
ATOM   3505  C CB  . PRO A  1 514  ? 209.791 157.332 199.067 1.00 237.50 ? 527  PRO A CB  1 
ATOM   3506  C CG  . PRO A  1 514  ? 209.039 157.100 200.323 1.00 237.50 ? 527  PRO A CG  1 
ATOM   3507  C CD  . PRO A  1 514  ? 207.897 158.074 200.391 1.00 237.50 ? 527  PRO A CD  1 
ATOM   3508  N N   . LYS A  1 515  ? 208.813 156.106 196.555 1.00 217.78 ? 528  LYS A N   1 
ATOM   3509  C CA  . LYS A  1 515  ? 208.259 155.055 195.708 1.00 217.78 ? 528  LYS A CA  1 
ATOM   3510  C C   . LYS A  1 515  ? 207.827 153.883 196.574 1.00 217.78 ? 528  LYS A C   1 
ATOM   3511  O O   . LYS A  1 515  ? 208.417 152.802 196.557 1.00 217.78 ? 528  LYS A O   1 
ATOM   3512  C CB  . LYS A  1 515  ? 209.270 154.615 194.661 1.00 217.78 ? 528  LYS A CB  1 
ATOM   3513  N N   . LYS A  1 516  ? 206.746 154.087 197.318 1.00 217.37 ? 529  LYS A N   1 
ATOM   3514  C CA  . LYS A  1 516  ? 206.141 152.945 197.985 1.00 217.37 ? 529  LYS A CA  1 
ATOM   3515  C C   . LYS A  1 516  ? 205.524 152.076 196.909 1.00 217.37 ? 529  LYS A C   1 
ATOM   3516  O O   . LYS A  1 516  ? 204.303 151.918 196.850 1.00 217.37 ? 529  LYS A O   1 
ATOM   3517  C CB  . LYS A  1 516  ? 205.088 153.371 199.004 1.00 217.37 ? 529  LYS A CB  1 
ATOM   3518  N N   . SER A  1 517  ? 206.363 151.511 196.055 1.00 198.83 ? 530  SER A N   1 
ATOM   3519  C CA  . SER A  1 517  ? 205.914 150.996 194.782 1.00 198.83 ? 530  SER A CA  1 
ATOM   3520  C C   . SER A  1 517  ? 206.311 149.546 194.609 1.00 198.83 ? 530  SER A C   1 
ATOM   3521  O O   . SER A  1 517  ? 207.187 149.024 195.299 1.00 198.83 ? 530  SER A O   1 
ATOM   3522  C CB  . SER A  1 517  ? 206.503 151.801 193.627 1.00 198.83 ? 530  SER A CB  1 
ATOM   3523  O OG  . SER A  1 517  ? 205.800 151.521 192.432 1.00 198.83 ? 530  SER A OG  1 
ATOM   3524  N N   . THR A  1 518  ? 205.653 148.915 193.652 1.00 192.71 ? 531  THR A N   1 
ATOM   3525  C CA  . THR A  1 518  ? 206.125 147.658 193.106 1.00 192.71 ? 531  THR A CA  1 
ATOM   3526  C C   . THR A  1 518  ? 207.110 147.980 191.988 1.00 192.71 ? 531  THR A C   1 
ATOM   3527  O O   . THR A  1 518  ? 207.554 149.118 191.819 1.00 192.71 ? 531  THR A O   1 
ATOM   3528  C CB  . THR A  1 518  ? 204.954 146.812 192.625 1.00 192.71 ? 531  THR A CB  1 
ATOM   3529  O OG1 . THR A  1 518  ? 204.599 147.210 191.297 1.00 192.71 ? 531  THR A OG1 1 
ATOM   3530  C CG2 . THR A  1 518  ? 203.757 147.011 193.542 1.00 192.71 ? 531  THR A CG2 1 
ATOM   3531  N N   . ASN A  1 519  ? 207.452 146.980 191.202 1.00 186.34 ? 532  ASN A N   1 
ATOM   3532  C CA  . ASN A  1 519  ? 208.500 147.114 190.210 1.00 186.34 ? 532  ASN A CA  1 
ATOM   3533  C C   . ASN A  1 519  ? 207.916 147.569 188.873 1.00 186.34 ? 532  ASN A C   1 
ATOM   3534  O O   . ASN A  1 519  ? 206.822 148.135 188.803 1.00 186.34 ? 532  ASN A O   1 
ATOM   3535  C CB  . ASN A  1 519  ? 209.254 145.798 190.122 1.00 186.34 ? 532  ASN A CB  1 
ATOM   3536  C CG  . ASN A  1 519  ? 209.577 145.245 191.484 1.00 186.34 ? 532  ASN A CG  1 
ATOM   3537  O OD1 . ASN A  1 519  ? 208.746 144.587 192.107 1.00 186.34 ? 532  ASN A OD1 1 
ATOM   3538  N ND2 . ASN A  1 519  ? 210.778 145.527 191.969 1.00 186.34 ? 532  ASN A ND2 1 
ATOM   3539  N N   . LEU A  1 520  ? 208.665 147.352 187.799 1.00 176.28 ? 533  LEU A N   1 
ATOM   3540  C CA  . LEU A  1 520  ? 208.325 147.865 186.484 1.00 176.28 ? 533  LEU A CA  1 
ATOM   3541  C C   . LEU A  1 520  ? 207.387 146.934 185.737 1.00 176.28 ? 533  LEU A C   1 
ATOM   3542  O O   . LEU A  1 520  ? 207.133 145.797 186.141 1.00 176.28 ? 533  LEU A O   1 
ATOM   3543  C CB  . LEU A  1 520  ? 209.583 148.079 185.651 1.00 176.28 ? 533  LEU A CB  1 
ATOM   3544  C CG  . LEU A  1 520  ? 210.474 149.216 186.128 1.00 176.28 ? 533  LEU A CG  1 
ATOM   3545  C CD1 . LEU A  1 520  ? 211.518 149.521 185.081 1.00 176.28 ? 533  LEU A CD1 1 
ATOM   3546  C CD2 . LEU A  1 520  ? 209.633 150.438 186.435 1.00 176.28 ? 533  LEU A CD2 1 
ATOM   3547  N N   . VAL A  1 521  ? 206.880 147.447 184.619 1.00 169.93 ? 534  VAL A N   1 
ATOM   3548  C CA  . VAL A  1 521  ? 205.986 146.735 183.721 1.00 169.93 ? 534  VAL A CA  1 
ATOM   3549  C C   . VAL A  1 521  ? 206.346 147.133 182.296 1.00 169.93 ? 534  VAL A C   1 
ATOM   3550  O O   . VAL A  1 521  ? 207.114 148.064 182.068 1.00 169.93 ? 534  VAL A O   1 
ATOM   3551  C CB  . VAL A  1 521  ? 204.510 147.040 184.023 1.00 169.93 ? 534  VAL A CB  1 
ATOM   3552  C CG1 . VAL A  1 521  ? 204.079 146.347 185.311 1.00 169.93 ? 534  VAL A CG1 1 
ATOM   3553  C CG2 . VAL A  1 521  ? 204.325 148.532 184.145 1.00 169.93 ? 534  VAL A CG2 1 
ATOM   3554  N N   . LYS A  1 522  ? 205.790 146.408 181.330 1.00 146.60 ? 535  LYS A N   1 
ATOM   3555  C CA  . LYS A  1 522  ? 206.203 146.579 179.948 1.00 146.60 ? 535  LYS A CA  1 
ATOM   3556  C C   . LYS A  1 522  ? 205.080 146.177 179.005 1.00 146.60 ? 535  LYS A C   1 
ATOM   3557  O O   . LYS A  1 522  ? 204.293 145.276 179.303 1.00 146.60 ? 535  LYS A O   1 
ATOM   3558  C CB  . LYS A  1 522  ? 207.445 145.742 179.633 1.00 146.60 ? 535  LYS A CB  1 
ATOM   3559  C CG  . LYS A  1 522  ? 208.718 146.241 180.254 1.00 146.60 ? 535  LYS A CG  1 
ATOM   3560  C CD  . LYS A  1 522  ? 209.028 147.637 179.794 1.00 146.60 ? 535  LYS A CD  1 
ATOM   3561  C CE  . LYS A  1 522  ? 210.233 148.160 180.522 1.00 146.60 ? 535  LYS A CE  1 
ATOM   3562  N NZ  . LYS A  1 522  ? 210.764 149.380 179.885 1.00 146.60 ? 535  LYS A NZ  1 
ATOM   3563  N N   . ASN A  1 523  ? 205.008 146.882 177.872 1.00 151.96 ? 536  ASN A N   1 
ATOM   3564  C CA  . ASN A  1 523  ? 204.285 146.474 176.654 1.00 151.96 ? 536  ASN A CA  1 
ATOM   3565  C C   . ASN A  1 523  ? 202.831 146.081 176.897 1.00 151.96 ? 536  ASN A C   1 
ATOM   3566  O O   . ASN A  1 523  ? 202.179 145.532 176.005 1.00 151.96 ? 536  ASN A O   1 
ATOM   3567  C CB  . ASN A  1 523  ? 205.013 145.338 175.925 1.00 151.96 ? 536  ASN A CB  1 
ATOM   3568  C CG  . ASN A  1 523  ? 206.009 145.844 174.894 1.00 151.96 ? 536  ASN A CG  1 
ATOM   3569  O OD1 . ASN A  1 523  ? 207.215 145.652 175.026 1.00 151.96 ? 536  ASN A OD1 1 
ATOM   3570  N ND2 . ASN A  1 523  ? 205.500 146.472 173.845 1.00 151.96 ? 536  ASN A ND2 1 
ATOM   3571  N N   . LYS A  1 524  ? 202.283 146.357 178.071 1.00 165.81 ? 537  LYS A N   1 
ATOM   3572  C CA  . LYS A  1 524  ? 200.858 146.170 178.304 1.00 165.81 ? 537  LYS A CA  1 
ATOM   3573  C C   . LYS A  1 524  ? 200.377 147.406 179.032 1.00 165.81 ? 537  LYS A C   1 
ATOM   3574  O O   . LYS A  1 524  ? 200.895 147.715 180.107 1.00 165.81 ? 537  LYS A O   1 
ATOM   3575  C CB  . LYS A  1 524  ? 200.579 144.910 179.124 1.00 165.81 ? 537  LYS A CB  1 
ATOM   3576  C CG  . LYS A  1 524  ? 201.465 144.733 180.339 1.00 165.81 ? 537  LYS A CG  1 
ATOM   3577  C CD  . LYS A  1 524  ? 201.350 143.336 180.906 1.00 165.81 ? 537  LYS A CD  1 
ATOM   3578  C CE  . LYS A  1 524  ? 201.943 142.325 179.961 1.00 165.81 ? 537  LYS A CE  1 
ATOM   3579  N NZ  . LYS A  1 524  ? 203.385 142.593 179.755 1.00 165.81 ? 537  LYS A NZ  1 
ATOM   3580  N N   . CYS A  1 525  ? 199.489 148.168 178.387 1.00 168.24 ? 538  CYS A N   1 
ATOM   3581  C CA  . CYS A  1 525  ? 198.977 149.455 178.936 1.00 168.24 ? 538  CYS A CA  1 
ATOM   3582  C C   . CYS A  1 525  ? 198.620 149.315 180.420 1.00 168.24 ? 538  CYS A C   1 
ATOM   3583  O O   . CYS A  1 525  ? 197.813 148.423 180.749 1.00 168.24 ? 538  CYS A O   1 
ATOM   3584  C CB  . CYS A  1 525  ? 197.751 149.923 178.161 1.00 168.24 ? 538  CYS A CB  1 
ATOM   3585  S SG  . CYS A  1 525  ? 197.817 151.673 177.695 1.00 168.24 ? 538  CYS A SG  1 
ATOM   3586  N N   . VAL A  1 526  ? 199.200 150.165 181.278 1.00 172.60 ? 539  VAL A N   1 
ATOM   3587  C CA  . VAL A  1 526  ? 198.866 150.115 182.690 1.00 172.60 ? 539  VAL A CA  1 
ATOM   3588  C C   . VAL A  1 526  ? 198.637 151.533 183.175 1.00 172.60 ? 539  VAL A C   1 
ATOM   3589  O O   . VAL A  1 526  ? 199.542 152.373 183.156 1.00 172.60 ? 539  VAL A O   1 
ATOM   3590  C CB  . VAL A  1 526  ? 199.963 149.410 183.504 1.00 172.60 ? 539  VAL A CB  1 
ATOM   3591  C CG1 . VAL A  1 526  ? 199.991 147.941 183.176 1.00 172.60 ? 539  VAL A CG1 1 
ATOM   3592  C CG2 . VAL A  1 526  ? 201.310 150.011 183.205 1.00 172.60 ? 539  VAL A CG2 1 
ATOM   3593  N N   . ASN A  1 527  ? 197.415 151.815 183.576 1.00 180.07 ? 540  ASN A N   1 
ATOM   3594  C CA  . ASN A  1 527  ? 197.152 153.056 184.270 1.00 180.07 ? 540  ASN A CA  1 
ATOM   3595  C C   . ASN A  1 527  ? 198.004 153.097 185.523 1.00 180.07 ? 540  ASN A C   1 
ATOM   3596  O O   . ASN A  1 527  ? 197.794 152.306 186.444 1.00 180.07 ? 540  ASN A O   1 
ATOM   3597  C CB  . ASN A  1 527  ? 195.671 153.143 184.606 1.00 180.07 ? 540  ASN A CB  1 
ATOM   3598  C CG  . ASN A  1 527  ? 195.142 151.852 185.192 1.00 180.07 ? 540  ASN A CG  1 
ATOM   3599  O OD1 . ASN A  1 527  ? 195.882 150.881 185.349 1.00 180.07 ? 540  ASN A OD1 1 
ATOM   3600  N ND2 . ASN A  1 527  ? 193.855 151.827 185.509 1.00 180.07 ? 540  ASN A ND2 1 
ATOM   3601  N N   . PHE A  1 528  ? 199.005 153.976 185.549 1.00 181.84 ? 541  PHE A N   1 
ATOM   3602  C CA  . PHE A  1 528  ? 199.827 154.108 186.745 1.00 181.84 ? 541  PHE A CA  1 
ATOM   3603  C C   . PHE A  1 528  ? 199.995 155.575 187.098 1.00 181.84 ? 541  PHE A C   1 
ATOM   3604  O O   . PHE A  1 528  ? 199.716 156.467 186.292 1.00 181.84 ? 541  PHE A O   1 
ATOM   3605  C CB  . PHE A  1 528  ? 201.210 153.463 186.606 1.00 181.84 ? 541  PHE A CB  1 
ATOM   3606  C CG  . PHE A  1 528  ? 202.114 154.178 185.667 1.00 181.84 ? 541  PHE A CG  1 
ATOM   3607  C CD1 . PHE A  1 528  ? 202.940 155.192 186.118 1.00 181.84 ? 541  PHE A CD1 1 
ATOM   3608  C CD2 . PHE A  1 528  ? 202.143 153.834 184.331 1.00 181.84 ? 541  PHE A CD2 1 
ATOM   3609  C CE1 . PHE A  1 528  ? 203.765 155.855 185.256 1.00 181.84 ? 541  PHE A CE1 1 
ATOM   3610  C CE2 . PHE A  1 528  ? 202.977 154.490 183.460 1.00 181.84 ? 541  PHE A CE2 1 
ATOM   3611  C CZ  . PHE A  1 528  ? 203.792 155.504 183.927 1.00 181.84 ? 541  PHE A CZ  1 
ATOM   3612  N N   . ASN A  1 529  ? 200.472 155.809 188.312 1.00 184.23 ? 542  ASN A N   1 
ATOM   3613  C CA  . ASN A  1 529  ? 200.483 157.129 188.909 1.00 184.23 ? 542  ASN A CA  1 
ATOM   3614  C C   . ASN A  1 529  ? 201.878 157.484 189.398 1.00 184.23 ? 542  ASN A C   1 
ATOM   3615  O O   . ASN A  1 529  ? 202.531 156.718 190.108 1.00 184.23 ? 542  ASN A O   1 
ATOM   3616  C CB  . ASN A  1 529  ? 199.484 157.192 190.063 1.00 184.23 ? 542  ASN A CB  1 
ATOM   3617  C CG  . ASN A  1 529  ? 198.174 156.509 189.726 1.00 184.23 ? 542  ASN A CG  1 
ATOM   3618  O OD1 . ASN A  1 529  ? 197.235 157.143 189.249 1.00 184.23 ? 542  ASN A OD1 1 
ATOM   3619  N ND2 . ASN A  1 529  ? 198.108 155.205 189.964 1.00 184.23 ? 542  ASN A ND2 1 
ATOM   3620  N N   . PHE A  1 530  ? 202.324 158.667 188.994 1.00 180.24 ? 543  PHE A N   1 
ATOM   3621  C CA  . PHE A  1 530  ? 203.563 159.234 189.501 1.00 180.24 ? 543  PHE A CA  1 
ATOM   3622  C C   . PHE A  1 530  ? 203.294 160.474 190.328 1.00 180.24 ? 543  PHE A C   1 
ATOM   3623  O O   . PHE A  1 530  ? 204.240 161.211 190.631 1.00 180.24 ? 543  PHE A O   1 
ATOM   3624  C CB  . PHE A  1 530  ? 204.514 159.586 188.364 1.00 180.24 ? 543  PHE A CB  1 
ATOM   3625  C CG  . PHE A  1 530  ? 205.236 158.414 187.809 1.00 180.24 ? 543  PHE A CG  1 
ATOM   3626  C CD1 . PHE A  1 530  ? 205.032 157.161 188.333 1.00 180.24 ? 543  PHE A CD1 1 
ATOM   3627  C CD2 . PHE A  1 530  ? 206.132 158.563 186.777 1.00 180.24 ? 543  PHE A CD2 1 
ATOM   3628  C CE1 . PHE A  1 530  ? 205.701 156.084 187.834 1.00 180.24 ? 543  PHE A CE1 1 
ATOM   3629  C CE2 . PHE A  1 530  ? 206.803 157.480 186.281 1.00 180.24 ? 543  PHE A CE2 1 
ATOM   3630  C CZ  . PHE A  1 530  ? 206.587 156.241 186.804 1.00 180.24 ? 543  PHE A CZ  1 
ATOM   3631  N N   . ASN A  1 531  ? 202.037 160.723 190.692 1.00 186.32 ? 544  ASN A N   1 
ATOM   3632  C CA  . ASN A  1 531  ? 201.636 161.966 191.338 1.00 186.32 ? 544  ASN A CA  1 
ATOM   3633  C C   . ASN A  1 531  ? 202.195 163.161 190.568 1.00 186.32 ? 544  ASN A C   1 
ATOM   3634  O O   . ASN A  1 531  ? 203.054 163.900 191.050 1.00 186.32 ? 544  ASN A O   1 
ATOM   3635  C CB  . ASN A  1 531  ? 202.067 161.991 192.808 1.00 186.32 ? 544  ASN A CB  1 
ATOM   3636  N N   . GLY A  1 532  ? 201.723 163.322 189.339 1.00 180.58 ? 545  GLY A N   1 
ATOM   3637  C CA  . GLY A  1 532  ? 202.185 164.395 188.483 1.00 180.58 ? 545  GLY A CA  1 
ATOM   3638  C C   . GLY A  1 532  ? 202.308 163.948 187.042 1.00 180.58 ? 545  GLY A C   1 
ATOM   3639  O O   . GLY A  1 532  ? 202.442 164.766 186.127 1.00 180.58 ? 545  GLY A O   1 
ATOM   3640  N N   . LEU A  1 533  ? 202.273 162.634 186.835 1.00 164.86 ? 546  LEU A N   1 
ATOM   3641  C CA  . LEU A  1 533  ? 202.323 162.018 185.528 1.00 164.86 ? 546  LEU A CA  1 
ATOM   3642  C C   . LEU A  1 533  ? 201.417 160.794 185.612 1.00 164.86 ? 546  LEU A C   1 
ATOM   3643  O O   . LEU A  1 533  ? 201.846 159.675 185.878 1.00 164.86 ? 546  LEU A O   1 
ATOM   3644  C CB  . LEU A  1 533  ? 203.751 161.621 185.157 1.00 164.86 ? 546  LEU A CB  1 
ATOM   3645  C CG  . LEU A  1 533  ? 204.705 162.732 184.770 1.00 164.86 ? 546  LEU A CG  1 
ATOM   3646  C CD1 . LEU A  1 533  ? 206.022 162.109 184.370 1.00 164.86 ? 546  LEU A CD1 1 
ATOM   3647  C CD2 . LEU A  1 533  ? 204.090 163.524 183.646 1.00 164.86 ? 546  LEU A CD2 1 
ATOM   3648  N N   . THR A  1 534  ? 200.128 160.993 185.393 1.00 165.99 ? 547  THR A N   1 
ATOM   3649  C CA  . THR A  1 534  ? 199.234 159.854 185.487 1.00 165.99 ? 547  THR A CA  1 
ATOM   3650  C C   . THR A  1 534  ? 199.461 158.922 184.304 1.00 165.99 ? 547  THR A C   1 
ATOM   3651  O O   . THR A  1 534  ? 198.957 159.164 183.206 1.00 165.99 ? 547  THR A O   1 
ATOM   3652  C CB  . THR A  1 534  ? 197.790 160.328 185.567 1.00 165.99 ? 547  THR A CB  1 
ATOM   3653  O OG1 . THR A  1 534  ? 196.912 159.224 185.334 1.00 165.99 ? 547  THR A OG1 1 
ATOM   3654  C CG2 . THR A  1 534  ? 197.528 161.446 184.570 1.00 165.99 ? 547  THR A CG2 1 
ATOM   3655  N N   . GLY A  1 535  ? 200.207 157.845 184.517 1.00 172.01 ? 548  GLY A N   1 
ATOM   3656  C CA  . GLY A  1 535  ? 200.683 157.046 183.404 1.00 172.01 ? 548  GLY A CA  1 
ATOM   3657  C C   . GLY A  1 535  ? 199.663 156.041 182.927 1.00 172.01 ? 548  GLY A C   1 
ATOM   3658  O O   . GLY A  1 535  ? 199.367 155.071 183.624 1.00 172.01 ? 548  GLY A O   1 
ATOM   3659  N N   . THR A  1 536  ? 199.097 156.282 181.747 1.00 172.30 ? 549  THR A N   1 
ATOM   3660  C CA  . THR A  1 536  ? 198.007 155.469 181.218 1.00 172.30 ? 549  THR A CA  1 
ATOM   3661  C C   . THR A  1 536  ? 198.194 155.284 179.719 1.00 172.30 ? 549  THR A C   1 
ATOM   3662  O O   . THR A  1 536  ? 198.013 156.228 178.945 1.00 172.30 ? 549  THR A O   1 
ATOM   3663  C CB  . THR A  1 536  ? 196.658 156.121 181.502 1.00 172.30 ? 549  THR A CB  1 
ATOM   3664  O OG1 . THR A  1 536  ? 196.578 157.347 180.769 1.00 172.30 ? 549  THR A OG1 1 
ATOM   3665  C CG2 . THR A  1 536  ? 196.483 156.394 182.996 1.00 172.30 ? 549  THR A CG2 1 
ATOM   3666  N N   . GLY A  1 537  ? 198.513 154.063 179.316 1.00 163.57 ? 550  GLY A N   1 
ATOM   3667  C CA  . GLY A  1 537  ? 198.942 153.691 177.989 1.00 163.57 ? 550  GLY A CA  1 
ATOM   3668  C C   . GLY A  1 537  ? 200.097 152.729 178.097 1.00 163.57 ? 550  GLY A C   1 
ATOM   3669  O O   . GLY A  1 537  ? 200.656 152.505 179.173 1.00 163.57 ? 550  GLY A O   1 
ATOM   3670  N N   . VAL A  1 538  ? 200.447 152.112 176.985 1.00 161.44 ? 551  VAL A N   1 
ATOM   3671  C CA  . VAL A  1 538  ? 201.558 151.177 176.983 1.00 161.44 ? 551  VAL A CA  1 
ATOM   3672  C C   . VAL A  1 538  ? 202.872 151.921 177.177 1.00 161.44 ? 551  VAL A C   1 
ATOM   3673  O O   . VAL A  1 538  ? 202.972 153.131 176.968 1.00 161.44 ? 551  VAL A O   1 
ATOM   3674  C CB  . VAL A  1 538  ? 201.573 150.361 175.689 1.00 161.44 ? 551  VAL A CB  1 
ATOM   3675  C CG1 . VAL A  1 538  ? 200.575 149.242 175.766 1.00 161.44 ? 551  VAL A CG1 1 
ATOM   3676  C CG2 . VAL A  1 538  ? 201.241 151.270 174.524 1.00 161.44 ? 551  VAL A CG2 1 
ATOM   3677  N N   . LEU A  1 539  ? 203.890 151.181 177.596 1.00 159.52 ? 552  LEU A N   1 
ATOM   3678  C CA  . LEU A  1 539  ? 205.235 151.711 177.765 1.00 159.52 ? 552  LEU A CA  1 
ATOM   3679  C C   . LEU A  1 539  ? 206.101 151.304 176.585 1.00 159.52 ? 552  LEU A C   1 
ATOM   3680  O O   . LEU A  1 539  ? 206.080 150.145 176.161 1.00 159.52 ? 552  LEU A O   1 
ATOM   3681  C CB  . LEU A  1 539  ? 205.868 151.218 179.063 1.00 159.52 ? 552  LEU A CB  1 
ATOM   3682  C CG  . LEU A  1 539  ? 204.998 151.295 180.312 1.00 159.52 ? 552  LEU A CG  1 
ATOM   3683  C CD1 . LEU A  1 539  ? 205.696 150.646 181.477 1.00 159.52 ? 552  LEU A CD1 1 
ATOM   3684  C CD2 . LEU A  1 539  ? 204.673 152.722 180.641 1.00 159.52 ? 552  LEU A CD2 1 
ATOM   3685  N N   . THR A  1 540  ? 206.863 152.259 176.065 1.00 162.27 ? 553  THR A N   1 
ATOM   3686  C CA  . THR A  1 540  ? 207.757 152.051 174.943 1.00 162.27 ? 553  THR A CA  1 
ATOM   3687  C C   . THR A  1 540  ? 209.093 152.731 175.223 1.00 162.27 ? 553  THR A C   1 
ATOM   3688  O O   . THR A  1 540  ? 209.215 153.614 176.089 1.00 162.27 ? 553  THR A O   1 
ATOM   3689  C CB  . THR A  1 540  ? 207.146 152.584 173.643 1.00 162.27 ? 553  THR A CB  1 
ATOM   3690  O OG1 . THR A  1 540  ? 207.954 152.175 172.535 1.00 162.27 ? 553  THR A OG1 1 
ATOM   3691  C CG2 . THR A  1 540  ? 207.066 154.107 173.670 1.00 162.27 ? 553  THR A CG2 1 
ATOM   3692  N N   . GLU A  1 541  ? 210.090 152.313 174.451 1.00 153.17 ? 554  GLU A N   1 
ATOM   3693  C CA  . GLU A  1 541  ? 211.449 152.791 174.628 1.00 153.17 ? 554  GLU A CA  1 
ATOM   3694  C C   . GLU A  1 541  ? 211.503 154.310 174.583 1.00 153.17 ? 554  GLU A C   1 
ATOM   3695  O O   . GLU A  1 541  ? 210.752 154.952 173.850 1.00 153.17 ? 554  GLU A O   1 
ATOM   3696  C CB  . GLU A  1 541  ? 212.336 152.200 173.541 1.00 153.17 ? 554  GLU A CB  1 
ATOM   3697  C CG  . GLU A  1 541  ? 213.764 152.043 173.947 1.00 153.17 ? 554  GLU A CG  1 
ATOM   3698  C CD  . GLU A  1 541  ? 214.501 153.352 173.892 1.00 153.17 ? 554  GLU A CD  1 
ATOM   3699  O OE1 . GLU A  1 541  ? 214.037 154.263 173.180 1.00 153.17 ? 554  GLU A OE1 1 
ATOM   3700  O OE2 . GLU A  1 541  ? 215.538 153.480 174.570 1.00 153.17 ? 554  GLU A OE2 1 
ATOM   3701  N N   . SER A  1 542  ? 212.394 154.882 175.383 1.00 162.51 ? 555  SER A N   1 
ATOM   3702  C CA  . SER A  1 542  ? 212.609 156.319 175.438 1.00 162.51 ? 555  SER A CA  1 
ATOM   3703  C C   . SER A  1 542  ? 214.001 156.657 174.927 1.00 162.51 ? 555  SER A C   1 
ATOM   3704  O O   . SER A  1 542  ? 215.002 156.272 175.535 1.00 162.51 ? 555  SER A O   1 
ATOM   3705  C CB  . SER A  1 542  ? 212.452 156.830 176.865 1.00 162.51 ? 555  SER A CB  1 
ATOM   3706  O OG  . SER A  1 542  ? 213.468 156.294 177.684 1.00 162.51 ? 555  SER A OG  1 
ATOM   3707  N N   . ASN A  1 543  ? 214.062 157.402 173.821 1.00 164.44 ? 556  ASN A N   1 
ATOM   3708  C CA  . ASN A  1 543  ? 215.327 157.761 173.196 1.00 164.44 ? 556  ASN A CA  1 
ATOM   3709  C C   . ASN A  1 543  ? 215.716 159.216 173.402 1.00 164.44 ? 556  ASN A C   1 
ATOM   3710  O O   . ASN A  1 543  ? 216.881 159.561 173.177 1.00 164.44 ? 556  ASN A O   1 
ATOM   3711  C CB  . ASN A  1 543  ? 215.291 157.470 171.686 1.00 164.44 ? 556  ASN A CB  1 
ATOM   3712  C CG  . ASN A  1 543  ? 214.095 158.103 170.993 1.00 164.44 ? 556  ASN A CG  1 
ATOM   3713  O OD1 . ASN A  1 543  ? 214.037 159.320 170.822 1.00 164.44 ? 556  ASN A OD1 1 
ATOM   3714  N ND2 . ASN A  1 543  ? 213.141 157.277 170.577 1.00 164.44 ? 556  ASN A ND2 1 
ATOM   3715  N N   . LYS A  1 544  ? 214.787 160.075 173.810 1.00 160.53 ? 557  LYS A N   1 
ATOM   3716  C CA  . LYS A  1 544  ? 215.126 161.447 174.143 1.00 160.53 ? 557  LYS A CA  1 
ATOM   3717  C C   . LYS A  1 544  ? 215.979 161.482 175.400 1.00 160.53 ? 557  LYS A C   1 
ATOM   3718  O O   . LYS A  1 544  ? 216.078 160.502 176.142 1.00 160.53 ? 557  LYS A O   1 
ATOM   3719  C CB  . LYS A  1 544  ? 213.870 162.275 174.377 1.00 160.53 ? 557  LYS A CB  1 
ATOM   3720  C CG  . LYS A  1 544  ? 213.222 161.975 175.706 1.00 160.53 ? 557  LYS A CG  1 
ATOM   3721  C CD  . LYS A  1 544  ? 212.133 162.966 176.014 1.00 160.53 ? 557  LYS A CD  1 
ATOM   3722  C CE  . LYS A  1 544  ? 210.933 162.794 175.108 1.00 160.53 ? 557  LYS A CE  1 
ATOM   3723  N NZ  . LYS A  1 544  ? 210.094 161.629 175.492 1.00 160.53 ? 557  LYS A NZ  1 
ATOM   3724  N N   . LYS A  1 545  ? 216.598 162.629 175.646 1.00 144.98 ? 558  LYS A N   1 
ATOM   3725  C CA  . LYS A  1 545  ? 217.459 162.775 176.803 1.00 144.98 ? 558  LYS A CA  1 
ATOM   3726  C C   . LYS A  1 545  ? 217.134 164.045 177.566 1.00 144.98 ? 558  LYS A C   1 
ATOM   3727  O O   . LYS A  1 545  ? 216.615 165.016 177.013 1.00 144.98 ? 558  LYS A O   1 
ATOM   3728  C CB  . LYS A  1 545  ? 218.906 162.773 176.402 1.00 144.98 ? 558  LYS A CB  1 
ATOM   3729  C CG  . LYS A  1 545  ? 219.290 161.513 175.681 1.00 144.98 ? 558  LYS A CG  1 
ATOM   3730  C CD  . LYS A  1 545  ? 220.753 161.258 175.825 1.00 144.98 ? 558  LYS A CD  1 
ATOM   3731  C CE  . LYS A  1 545  ? 221.275 160.551 174.611 1.00 144.98 ? 558  LYS A CE  1 
ATOM   3732  N NZ  . LYS A  1 545  ? 222.525 161.218 174.212 1.00 144.98 ? 558  LYS A NZ  1 
ATOM   3733  N N   . PHE A  1 546  ? 217.455 164.014 178.845 1.00 145.49 ? 559  PHE A N   1 
ATOM   3734  C CA  . PHE A  1 546  ? 217.007 164.991 179.814 1.00 145.49 ? 559  PHE A CA  1 
ATOM   3735  C C   . PHE A  1 546  ? 218.179 165.611 180.548 1.00 145.49 ? 559  PHE A C   1 
ATOM   3736  O O   . PHE A  1 546  ? 219.339 165.499 180.150 1.00 145.49 ? 559  PHE A O   1 
ATOM   3737  C CB  . PHE A  1 546  ? 216.066 164.344 180.821 1.00 145.49 ? 559  PHE A CB  1 
ATOM   3738  C CG  . PHE A  1 546  ? 214.664 164.296 180.365 1.00 145.49 ? 559  PHE A CG  1 
ATOM   3739  C CD1 . PHE A  1 546  ? 214.341 164.700 179.091 1.00 145.49 ? 559  PHE A CD1 1 
ATOM   3740  C CD2 . PHE A  1 546  ? 213.658 163.908 181.223 1.00 145.49 ? 559  PHE A CD2 1 
ATOM   3741  C CE1 . PHE A  1 546  ? 213.058 164.674 178.668 1.00 145.49 ? 559  PHE A CE1 1 
ATOM   3742  C CE2 . PHE A  1 546  ? 212.360 163.892 180.803 1.00 145.49 ? 559  PHE A CE2 1 
ATOM   3743  C CZ  . PHE A  1 546  ? 212.057 164.273 179.523 1.00 145.49 ? 559  PHE A CZ  1 
ATOM   3744  N N   . LEU A  1 547  ? 217.838 166.282 181.626 1.00 141.93 ? 560  LEU A N   1 
ATOM   3745  C CA  . LEU A  1 547  ? 218.767 166.741 182.635 1.00 141.93 ? 560  LEU A CA  1 
ATOM   3746  C C   . LEU A  1 547  ? 218.055 166.682 183.980 1.00 141.93 ? 560  LEU A C   1 
ATOM   3747  O O   . LEU A  1 547  ? 216.837 166.471 184.015 1.00 141.93 ? 560  LEU A O   1 
ATOM   3748  C CB  . LEU A  1 547  ? 219.240 168.145 182.301 1.00 141.93 ? 560  LEU A CB  1 
ATOM   3749  C CG  . LEU A  1 547  ? 220.417 168.191 181.347 1.00 141.93 ? 560  LEU A CG  1 
ATOM   3750  C CD1 . LEU A  1 547  ? 221.027 169.566 181.376 1.00 141.93 ? 560  LEU A CD1 1 
ATOM   3751  C CD2 . LEU A  1 547  ? 221.428 167.144 181.750 1.00 141.93 ? 560  LEU A CD2 1 
ATOM   3752  N N   . PRO A  1 548  ? 218.768 166.823 185.108 1.00 140.10 ? 561  PRO A N   1 
ATOM   3753  C CA  . PRO A  1 548  ? 218.090 166.844 186.410 1.00 140.10 ? 561  PRO A CA  1 
ATOM   3754  C C   . PRO A  1 548  ? 216.931 167.817 186.455 1.00 140.10 ? 561  PRO A C   1 
ATOM   3755  O O   . PRO A  1 548  ? 215.922 167.552 187.112 1.00 140.10 ? 561  PRO A O   1 
ATOM   3756  C CB  . PRO A  1 548  ? 219.204 167.265 187.370 1.00 140.10 ? 561  PRO A CB  1 
ATOM   3757  C CG  . PRO A  1 548  ? 220.417 166.701 186.768 1.00 140.10 ? 561  PRO A CG  1 
ATOM   3758  C CD  . PRO A  1 548  ? 220.231 166.768 185.269 1.00 140.10 ? 561  PRO A CD  1 
ATOM   3759  N N   . PHE A  1 549  ? 217.042 168.929 185.741 1.00 144.71 ? 562  PHE A N   1 
ATOM   3760  C CA  . PHE A  1 549  ? 215.932 169.861 185.648 1.00 144.71 ? 562  PHE A CA  1 
ATOM   3761  C C   . PHE A  1 549  ? 214.825 169.335 184.763 1.00 144.71 ? 562  PHE A C   1 
ATOM   3762  O O   . PHE A  1 549  ? 213.811 170.011 184.598 1.00 144.71 ? 562  PHE A O   1 
ATOM   3763  C CB  . PHE A  1 549  ? 216.405 171.235 185.146 1.00 144.71 ? 562  PHE A CB  1 
ATOM   3764  C CG  . PHE A  1 549  ? 216.565 171.348 183.635 1.00 144.71 ? 562  PHE A CG  1 
ATOM   3765  C CD1 . PHE A  1 549  ? 217.753 171.002 183.017 1.00 144.71 ? 562  PHE A CD1 1 
ATOM   3766  C CD2 . PHE A  1 549  ? 215.543 171.849 182.843 1.00 144.71 ? 562  PHE A CD2 1 
ATOM   3767  C CE1 . PHE A  1 549  ? 217.907 171.124 181.644 1.00 144.71 ? 562  PHE A CE1 1 
ATOM   3768  C CE2 . PHE A  1 549  ? 215.696 171.969 181.468 1.00 144.71 ? 562  PHE A CE2 1 
ATOM   3769  C CZ  . PHE A  1 549  ? 216.879 171.607 180.876 1.00 144.71 ? 562  PHE A CZ  1 
ATOM   3770  N N   . GLN A  1 550  ? 214.983 168.140 184.211 1.00 144.00 ? 563  GLN A N   1 
ATOM   3771  C CA  . GLN A  1 550  ? 214.002 167.561 183.308 1.00 144.00 ? 563  GLN A CA  1 
ATOM   3772  C C   . GLN A  1 550  ? 213.449 166.300 183.946 1.00 144.00 ? 563  GLN A C   1 
ATOM   3773  O O   . GLN A  1 550  ? 214.134 165.275 183.991 1.00 144.00 ? 563  GLN A O   1 
ATOM   3774  C CB  . GLN A  1 550  ? 214.627 167.235 181.950 1.00 144.00 ? 563  GLN A CB  1 
ATOM   3775  C CG  . GLN A  1 550  ? 215.436 168.341 181.297 1.00 144.00 ? 563  GLN A CG  1 
ATOM   3776  C CD  . GLN A  1 550  ? 214.612 169.157 180.332 1.00 144.00 ? 563  GLN A CD  1 
ATOM   3777  O OE1 . GLN A  1 550  ? 213.427 169.392 180.550 1.00 144.00 ? 563  GLN A OE1 1 
ATOM   3778  N NE2 . GLN A  1 550  ? 215.230 169.572 179.241 1.00 144.00 ? 563  GLN A NE2 1 
ATOM   3779  N N   . GLN A  1 551  ? 212.221 166.374 184.446 1.00 146.83 ? 564  GLN A N   1 
ATOM   3780  C CA  . GLN A  1 551  ? 211.533 165.165 184.859 1.00 146.83 ? 564  GLN A CA  1 
ATOM   3781  C C   . GLN A  1 551  ? 210.608 164.619 183.800 1.00 146.83 ? 564  GLN A C   1 
ATOM   3782  O O   . GLN A  1 551  ? 210.814 163.499 183.341 1.00 146.83 ? 564  GLN A O   1 
ATOM   3783  C CB  . GLN A  1 551  ? 210.707 165.406 186.122 1.00 146.83 ? 564  GLN A CB  1 
ATOM   3784  C CG  . GLN A  1 551  ? 210.360 164.125 186.877 1.00 146.83 ? 564  GLN A CG  1 
ATOM   3785  C CD  . GLN A  1 551  ? 209.181 163.359 186.288 1.00 146.83 ? 564  GLN A CD  1 
ATOM   3786  O OE1 . GLN A  1 551  ? 208.512 163.830 185.384 1.00 146.83 ? 564  GLN A OE1 1 
ATOM   3787  N NE2 . GLN A  1 551  ? 208.920 162.176 186.822 1.00 146.83 ? 564  GLN A NE2 1 
ATOM   3788  N N   . PHE A  1 552  ? 209.593 165.370 183.404 1.00 140.93 ? 565  PHE A N   1 
ATOM   3789  C CA  . PHE A  1 552  ? 208.698 164.894 182.370 1.00 140.93 ? 565  PHE A CA  1 
ATOM   3790  C C   . PHE A  1 552  ? 208.800 165.802 181.166 1.00 140.93 ? 565  PHE A C   1 
ATOM   3791  O O   . PHE A  1 552  ? 208.979 167.014 181.297 1.00 140.93 ? 565  PHE A O   1 
ATOM   3792  C CB  . PHE A  1 552  ? 207.237 164.824 182.816 1.00 140.93 ? 565  PHE A CB  1 
ATOM   3793  C CG  . PHE A  1 552  ? 206.818 165.911 183.749 1.00 140.93 ? 565  PHE A CG  1 
ATOM   3794  C CD1 . PHE A  1 552  ? 206.832 167.224 183.352 1.00 140.93 ? 565  PHE A CD1 1 
ATOM   3795  C CD2 . PHE A  1 552  ? 206.408 165.620 185.030 1.00 140.93 ? 565  PHE A CD2 1 
ATOM   3796  C CE1 . PHE A  1 552  ? 206.444 168.222 184.220 1.00 140.93 ? 565  PHE A CE1 1 
ATOM   3797  C CE2 . PHE A  1 552  ? 206.013 166.606 185.891 1.00 140.93 ? 565  PHE A CE2 1 
ATOM   3798  C CZ  . PHE A  1 552  ? 206.032 167.910 185.491 1.00 140.93 ? 565  PHE A CZ  1 
ATOM   3799  N N   . GLY A  1 553  ? 208.706 165.196 179.996 1.00 143.20 ? 566  GLY A N   1 
ATOM   3800  C CA  . GLY A  1 553  ? 208.671 165.950 178.769 1.00 143.20 ? 566  GLY A CA  1 
ATOM   3801  C C   . GLY A  1 553  ? 207.493 165.547 177.917 1.00 143.20 ? 566  GLY A C   1 
ATOM   3802  O O   . GLY A  1 553  ? 207.436 164.425 177.410 1.00 143.20 ? 566  GLY A O   1 
ATOM   3803  N N   . ARG A  1 554  ? 206.541 166.452 177.758 1.00 145.74 ? 567  ARG A N   1 
ATOM   3804  C CA  . ARG A  1 554  ? 205.424 166.239 176.863 1.00 145.74 ? 567  ARG A CA  1 
ATOM   3805  C C   . ARG A  1 554  ? 205.845 166.720 175.489 1.00 145.74 ? 567  ARG A C   1 
ATOM   3806  O O   . ARG A  1 554  ? 206.881 167.369 175.329 1.00 145.74 ? 567  ARG A O   1 
ATOM   3807  C CB  . ARG A  1 554  ? 204.175 166.971 177.355 1.00 145.74 ? 567  ARG A CB  1 
ATOM   3808  C CG  . ARG A  1 554  ? 204.301 168.463 177.386 1.00 145.74 ? 567  ARG A CG  1 
ATOM   3809  C CD  . ARG A  1 554  ? 203.316 169.079 178.383 1.00 145.74 ? 567  ARG A CD  1 
ATOM   3810  N NE  . ARG A  1 554  ? 203.393 168.481 179.716 1.00 145.74 ? 567  ARG A NE  1 
ATOM   3811  C CZ  . ARG A  1 554  ? 203.001 169.086 180.832 1.00 145.74 ? 567  ARG A CZ  1 
ATOM   3812  N NH1 . ARG A  1 554  ? 202.521 170.316 180.798 1.00 145.74 ? 567  ARG A NH1 1 
ATOM   3813  N NH2 . ARG A  1 554  ? 203.105 168.463 181.989 1.00 145.74 ? 567  ARG A NH2 1 
ATOM   3814  N N   . ASP A  1 555  ? 205.036 166.407 174.490 1.00 147.59 ? 568  ASP A N   1 
ATOM   3815  C CA  . ASP A  1 555  ? 205.376 166.800 173.133 1.00 147.59 ? 568  ASP A CA  1 
ATOM   3816  C C   . ASP A  1 555  ? 204.254 167.657 172.579 1.00 147.59 ? 568  ASP A C   1 
ATOM   3817  O O   . ASP A  1 555  ? 203.305 167.955 173.308 1.00 147.59 ? 568  ASP A O   1 
ATOM   3818  C CB  . ASP A  1 555  ? 205.626 165.573 172.262 1.00 147.59 ? 568  ASP A CB  1 
ATOM   3819  C CG  . ASP A  1 555  ? 204.732 164.418 172.633 1.00 147.59 ? 568  ASP A CG  1 
ATOM   3820  O OD1 . ASP A  1 555  ? 203.752 164.648 173.367 1.00 147.59 ? 568  ASP A OD1 1 
ATOM   3821  O OD2 . ASP A  1 555  ? 205.005 163.283 172.193 1.00 147.59 ? 568  ASP A OD2 1 
ATOM   3822  N N   . ILE A  1 556  ? 204.346 168.047 171.305 1.00 140.97 ? 569  ILE A N   1 
ATOM   3823  C CA  . ILE A  1 556  ? 203.465 169.078 170.769 1.00 140.97 ? 569  ILE A CA  1 
ATOM   3824  C C   . ILE A  1 556  ? 202.013 168.674 170.965 1.00 140.97 ? 569  ILE A C   1 
ATOM   3825  O O   . ILE A  1 556  ? 201.678 167.485 170.938 1.00 140.97 ? 569  ILE A O   1 
ATOM   3826  C CB  . ILE A  1 556  ? 203.803 169.343 169.298 1.00 140.97 ? 569  ILE A CB  1 
ATOM   3827  C CG1 . ILE A  1 556  ? 202.990 170.519 168.773 1.00 140.97 ? 569  ILE A CG1 1 
ATOM   3828  C CG2 . ILE A  1 556  ? 203.575 168.095 168.495 1.00 140.97 ? 569  ILE A CG2 1 
ATOM   3829  C CD1 . ILE A  1 556  ? 203.023 171.714 169.659 1.00 140.97 ? 569  ILE A CD1 1 
ATOM   3830  N N   . ALA A  1 557  ? 201.152 169.676 171.167 1.00 139.65 ? 570  ALA A N   1 
ATOM   3831  C CA  . ALA A  1 557  ? 199.839 169.524 171.796 1.00 139.65 ? 570  ALA A CA  1 
ATOM   3832  C C   . ALA A  1 557  ? 199.983 169.227 173.287 1.00 139.65 ? 570  ALA A C   1 
ATOM   3833  O O   . ALA A  1 557  ? 199.049 168.752 173.933 1.00 139.65 ? 570  ALA A O   1 
ATOM   3834  C CB  . ALA A  1 557  ? 198.986 168.460 171.106 1.00 139.65 ? 570  ALA A CB  1 
ATOM   3835  N N   . ASP A  1 558  ? 201.169 169.519 173.823 1.00 141.07 ? 571  ASP A N   1 
ATOM   3836  C CA  . ASP A  1 558  ? 201.501 169.402 175.248 1.00 141.07 ? 571  ASP A CA  1 
ATOM   3837  C C   . ASP A  1 558  ? 200.838 168.185 175.882 1.00 141.07 ? 571  ASP A C   1 
ATOM   3838  O O   . ASP A  1 558  ? 199.954 168.288 176.734 1.00 141.07 ? 571  ASP A O   1 
ATOM   3839  C CB  . ASP A  1 558  ? 201.165 170.687 176.001 1.00 141.07 ? 571  ASP A CB  1 
ATOM   3840  C CG  . ASP A  1 558  ? 202.341 171.666 176.044 1.00 141.07 ? 571  ASP A CG  1 
ATOM   3841  O OD1 . ASP A  1 558  ? 203.505 171.212 176.016 1.00 141.07 ? 571  ASP A OD1 1 
ATOM   3842  O OD2 . ASP A  1 558  ? 202.109 172.889 176.126 1.00 141.07 ? 571  ASP A OD2 1 
ATOM   3843  N N   . THR A  1 559  ? 201.262 167.012 175.423 1.00 147.81 ? 572  THR A N   1 
ATOM   3844  C CA  . THR A  1 559  ? 200.707 165.741 175.881 1.00 147.81 ? 572  THR A CA  1 
ATOM   3845  C C   . THR A  1 559  ? 201.812 164.956 176.585 1.00 147.81 ? 572  THR A C   1 
ATOM   3846  O O   . THR A  1 559  ? 202.805 164.564 175.970 1.00 147.81 ? 572  THR A O   1 
ATOM   3847  C CB  . THR A  1 559  ? 200.110 164.978 174.707 1.00 147.81 ? 572  THR A CB  1 
ATOM   3848  O OG1 . THR A  1 559  ? 199.410 165.902 173.867 1.00 147.81 ? 572  THR A OG1 1 
ATOM   3849  C CG2 . THR A  1 559  ? 199.134 163.933 175.197 1.00 147.81 ? 572  THR A CG2 1 
ATOM   3850  N N   . THR A  1 560  ? 201.639 164.743 177.884 1.00 146.66 ? 573  THR A N   1 
ATOM   3851  C CA  . THR A  1 560  ? 202.681 164.180 178.734 1.00 146.66 ? 573  THR A CA  1 
ATOM   3852  C C   . THR A  1 560  ? 202.966 162.735 178.354 1.00 146.66 ? 573  THR A C   1 
ATOM   3853  O O   . THR A  1 560  ? 202.039 161.930 178.242 1.00 146.66 ? 573  THR A O   1 
ATOM   3854  C CB  . THR A  1 560  ? 202.237 164.261 180.186 1.00 146.66 ? 573  THR A CB  1 
ATOM   3855  O OG1 . THR A  1 560  ? 200.969 163.613 180.317 1.00 146.66 ? 573  THR A OG1 1 
ATOM   3856  C CG2 . THR A  1 560  ? 202.079 165.706 180.604 1.00 146.66 ? 573  THR A CG2 1 
ATOM   3857  N N   . ASP A  1 561  ? 204.244 162.397 178.153 1.00 157.87 ? 574  ASP A N   1 
ATOM   3858  C CA  . ASP A  1 561  ? 204.566 161.006 177.858 1.00 157.87 ? 574  ASP A CA  1 
ATOM   3859  C C   . ASP A  1 561  ? 205.896 160.489 178.400 1.00 157.87 ? 574  ASP A C   1 
ATOM   3860  O O   . ASP A  1 561  ? 206.181 159.306 178.209 1.00 157.87 ? 574  ASP A O   1 
ATOM   3861  C CB  . ASP A  1 561  ? 204.521 160.784 176.334 1.00 157.87 ? 574  ASP A CB  1 
ATOM   3862  C CG  . ASP A  1 561  ? 205.562 161.606 175.574 1.00 157.87 ? 574  ASP A CG  1 
ATOM   3863  O OD1 . ASP A  1 561  ? 206.518 162.123 176.191 1.00 157.87 ? 574  ASP A OD1 1 
ATOM   3864  O OD2 . ASP A  1 561  ? 205.426 161.718 174.338 1.00 157.87 ? 574  ASP A OD2 1 
ATOM   3865  N N   . ALA A  1 562  ? 206.716 161.297 179.065 1.00 166.68 ? 575  ALA A N   1 
ATOM   3866  C CA  . ALA A  1 562  ? 208.090 160.886 179.353 1.00 166.68 ? 575  ALA A CA  1 
ATOM   3867  C C   . ALA A  1 562  ? 208.269 160.669 180.850 1.00 166.68 ? 575  ALA A C   1 
ATOM   3868  O O   . ALA A  1 562  ? 208.642 161.567 181.604 1.00 166.68 ? 575  ALA A O   1 
ATOM   3869  C CB  . ALA A  1 562  ? 209.068 161.922 178.820 1.00 166.68 ? 575  ALA A CB  1 
ATOM   3870  N N   . VAL A  1 563  ? 208.019 159.437 181.281 1.00 176.39 ? 576  VAL A N   1 
ATOM   3871  C CA  . VAL A  1 563  ? 208.029 159.160 182.713 1.00 176.39 ? 576  VAL A CA  1 
ATOM   3872  C C   . VAL A  1 563  ? 209.467 158.913 183.154 1.00 176.39 ? 576  VAL A C   1 
ATOM   3873  O O   . VAL A  1 563  ? 210.246 158.247 182.467 1.00 176.39 ? 576  VAL A O   1 
ATOM   3874  C CB  . VAL A  1 563  ? 207.116 157.985 183.080 1.00 176.39 ? 576  VAL A CB  1 
ATOM   3875  C CG1 . VAL A  1 563  ? 205.804 158.063 182.307 1.00 176.39 ? 576  VAL A CG1 1 
ATOM   3876  C CG2 . VAL A  1 563  ? 207.816 156.622 182.956 1.00 176.39 ? 576  VAL A CG2 1 
ATOM   3877  N N   . ARG A  1 564  ? 209.810 159.458 184.318 1.00 184.93 ? 577  ARG A N   1 
ATOM   3878  C CA  . ARG A  1 564  ? 211.179 159.406 184.809 1.00 184.93 ? 577  ARG A CA  1 
ATOM   3879  C C   . ARG A  1 564  ? 211.633 157.984 185.074 1.00 184.93 ? 577  ARG A C   1 
ATOM   3880  O O   . ARG A  1 564  ? 212.744 157.595 184.697 1.00 184.93 ? 577  ARG A O   1 
ATOM   3881  C CB  . ARG A  1 564  ? 211.297 160.238 186.080 1.00 184.93 ? 577  ARG A CB  1 
ATOM   3882  C CG  . ARG A  1 564  ? 212.669 160.214 186.680 1.00 184.93 ? 577  ARG A CG  1 
ATOM   3883  C CD  . ARG A  1 564  ? 213.662 160.937 185.796 1.00 184.93 ? 577  ARG A CD  1 
ATOM   3884  N NE  . ARG A  1 564  ? 214.315 160.049 184.840 1.00 184.93 ? 577  ARG A NE  1 
ATOM   3885  C CZ  . ARG A  1 564  ? 215.104 160.474 183.863 1.00 184.93 ? 577  ARG A CZ  1 
ATOM   3886  N NH1 . ARG A  1 564  ? 215.328 161.770 183.708 1.00 184.93 ? 577  ARG A NH1 1 
ATOM   3887  N NH2 . ARG A  1 564  ? 215.675 159.607 183.047 1.00 184.93 ? 577  ARG A NH2 1 
ATOM   3888  N N   . ASP A  1 565  ? 210.790 157.228 185.782 1.00 197.66 ? 578  ASP A N   1 
ATOM   3889  C CA  . ASP A  1 565  ? 211.187 155.865 186.220 1.00 197.66 ? 578  ASP A CA  1 
ATOM   3890  C C   . ASP A  1 565  ? 212.206 156.085 187.344 1.00 197.66 ? 578  ASP A C   1 
ATOM   3891  O O   . ASP A  1 565  ? 213.365 155.648 187.197 1.00 197.66 ? 578  ASP A O   1 
ATOM   3892  C CB  . ASP A  1 565  ? 211.753 155.045 185.058 1.00 197.66 ? 578  ASP A CB  1 
ATOM   3893  C CG  . ASP A  1 565  ? 211.843 153.559 185.358 1.00 197.66 ? 578  ASP A CG  1 
ATOM   3894  O OD1 . ASP A  1 565  ? 211.470 153.165 186.481 1.00 197.66 ? 578  ASP A OD1 1 
ATOM   3895  O OD2 . ASP A  1 565  ? 212.285 152.808 184.467 1.00 197.66 ? 578  ASP A OD2 1 
ATOM   3896  N N   . PRO A  1 566  ? 211.805 156.739 188.460 1.00 196.34 ? 579  PRO A N   1 
ATOM   3897  C CA  . PRO A  1 566  ? 212.706 157.090 189.580 1.00 196.34 ? 579  PRO A CA  1 
ATOM   3898  C C   . PRO A  1 566  ? 213.489 155.989 190.316 1.00 196.34 ? 579  PRO A C   1 
ATOM   3899  O O   . PRO A  1 566  ? 214.399 156.336 191.048 1.00 196.34 ? 579  PRO A O   1 
ATOM   3900  C CB  . PRO A  1 566  ? 211.779 157.783 190.593 1.00 196.34 ? 579  PRO A CB  1 
ATOM   3901  C CG  . PRO A  1 566  ? 210.622 158.277 189.760 1.00 196.34 ? 579  PRO A CG  1 
ATOM   3902  C CD  . PRO A  1 566  ? 210.438 157.203 188.709 1.00 196.34 ? 579  PRO A CD  1 
ATOM   3903  N N   . GLN A  1 567  ? 213.165 154.718 190.060 1.00 199.31 ? 580  GLN A N   1 
ATOM   3904  C CA  . GLN A  1 567  ? 213.834 153.581 190.751 1.00 199.31 ? 580  GLN A CA  1 
ATOM   3905  C C   . GLN A  1 567  ? 215.268 153.376 190.246 1.00 199.31 ? 580  GLN A C   1 
ATOM   3906  O O   . GLN A  1 567  ? 216.057 152.753 190.984 1.00 199.31 ? 580  GLN A O   1 
ATOM   3907  C CB  . GLN A  1 567  ? 213.040 152.287 190.565 1.00 199.31 ? 580  GLN A CB  1 
ATOM   3908  C CG  . GLN A  1 567  ? 213.636 151.095 191.298 1.00 199.31 ? 580  GLN A CG  1 
ATOM   3909  C CD  . GLN A  1 567  ? 213.779 151.349 192.778 1.00 199.31 ? 580  GLN A CD  1 
ATOM   3910  O OE1 . GLN A  1 567  ? 213.437 152.417 193.281 1.00 199.31 ? 580  GLN A OE1 1 
ATOM   3911  N NE2 . GLN A  1 567  ? 214.290 150.359 193.493 1.00 199.31 ? 580  GLN A NE2 1 
ATOM   3912  N N   . THR A  1 568  ? 215.587 153.840 189.034 1.00 199.30 ? 581  THR A N   1 
ATOM   3913  C CA  . THR A  1 568  ? 216.957 153.628 188.490 1.00 199.30 ? 581  THR A CA  1 
ATOM   3914  C C   . THR A  1 568  ? 217.442 154.865 187.726 1.00 199.30 ? 581  THR A C   1 
ATOM   3915  O O   . THR A  1 568  ? 218.625 154.855 187.336 1.00 199.30 ? 581  THR A O   1 
ATOM   3916  C CB  . THR A  1 568  ? 217.013 152.388 187.589 1.00 199.30 ? 581  THR A CB  1 
ATOM   3917  O OG1 . THR A  1 568  ? 215.937 152.472 186.654 1.00 199.30 ? 581  THR A OG1 1 
ATOM   3918  C CG2 . THR A  1 568  ? 216.923 151.088 188.358 1.00 199.30 ? 581  THR A CG2 1 
ATOM   3919  N N   . LEU A  1 569  ? 216.553 155.852 187.539 1.00 198.95 ? 582  LEU A N   1 
ATOM   3920  C CA  . LEU A  1 569  ? 216.769 157.145 186.818 1.00 198.95 ? 582  LEU A CA  1 
ATOM   3921  C C   . LEU A  1 569  ? 216.905 156.935 185.300 1.00 198.95 ? 582  LEU A C   1 
ATOM   3922  O O   . LEU A  1 569  ? 217.751 157.610 184.679 1.00 198.95 ? 582  LEU A O   1 
ATOM   3923  C CB  . LEU A  1 569  ? 217.916 157.971 187.418 1.00 198.95 ? 582  LEU A CB  1 
ATOM   3924  C CG  . LEU A  1 569  ? 218.175 159.320 186.748 1.00 198.95 ? 582  LEU A CG  1 
ATOM   3925  C CD1 . LEU A  1 569  ? 216.923 160.183 186.765 1.00 198.95 ? 582  LEU A CD1 1 
ATOM   3926  C CD2 . LEU A  1 569  ? 219.331 160.045 187.420 1.00 198.95 ? 582  LEU A CD2 1 
ATOM   3927  N N   . GLU A  1 570  ? 216.111 156.010 184.750 1.00 191.05 ? 583  GLU A N   1 
ATOM   3928  C CA  . GLU A  1 570  ? 216.013 155.731 183.328 1.00 191.05 ? 583  GLU A CA  1 
ATOM   3929  C C   . GLU A  1 570  ? 214.617 156.123 182.898 1.00 191.05 ? 583  GLU A C   1 
ATOM   3930  O O   . GLU A  1 570  ? 213.650 155.424 183.203 1.00 191.05 ? 583  GLU A O   1 
ATOM   3931  C CB  . GLU A  1 570  ? 216.289 154.266 183.023 1.00 191.05 ? 583  GLU A CB  1 
ATOM   3932  C CG  . GLU A  1 570  ? 217.573 153.765 183.635 1.00 191.05 ? 583  GLU A CG  1 
ATOM   3933  C CD  . GLU A  1 570  ? 218.725 154.733 183.462 1.00 191.05 ? 583  GLU A CD  1 
ATOM   3934  O OE1 . GLU A  1 570  ? 218.874 155.307 182.367 1.00 191.05 ? 583  GLU A OE1 1 
ATOM   3935  O OE2 . GLU A  1 570  ? 219.480 154.938 184.432 1.00 191.05 ? 583  GLU A OE2 1 
ATOM   3936  N N   . ILE A  1 571  ? 214.526 157.237 182.193 1.00 173.25 ? 584  ILE A N   1 
ATOM   3937  C CA  . ILE A  1 571  ? 213.274 157.706 181.634 1.00 173.25 ? 584  ILE A CA  1 
ATOM   3938  C C   . ILE A  1 571  ? 212.746 156.562 180.783 1.00 173.25 ? 584  ILE A C   1 
ATOM   3939  O O   . ILE A  1 571  ? 213.520 155.759 180.251 1.00 173.25 ? 584  ILE A O   1 
ATOM   3940  C CB  . ILE A  1 571  ? 213.508 158.986 180.810 1.00 173.25 ? 584  ILE A CB  1 
ATOM   3941  C CG1 . ILE A  1 571  ? 212.238 159.810 180.643 1.00 173.25 ? 584  ILE A CG1 1 
ATOM   3942  C CG2 . ILE A  1 571  ? 214.148 158.668 179.470 1.00 173.25 ? 584  ILE A CG2 1 
ATOM   3943  C CD1 . ILE A  1 571  ? 211.951 160.675 181.812 1.00 173.25 ? 584  ILE A CD1 1 
ATOM   3944  N N   . LEU A  1 572  ? 211.431 156.450 180.672 1.00 165.34 ? 585  LEU A N   1 
ATOM   3945  C CA  . LEU A  1 572  ? 210.864 155.453 179.777 1.00 165.34 ? 585  LEU A CA  1 
ATOM   3946  C C   . LEU A  1 572  ? 209.547 155.974 179.249 1.00 165.34 ? 585  LEU A C   1 
ATOM   3947  O O   . LEU A  1 572  ? 208.676 156.347 180.035 1.00 165.34 ? 585  LEU A O   1 
ATOM   3948  C CB  . LEU A  1 572  ? 210.641 154.128 180.484 1.00 165.34 ? 585  LEU A CB  1 
ATOM   3949  C CG  . LEU A  1 572  ? 210.094 153.114 179.492 1.00 165.34 ? 585  LEU A CG  1 
ATOM   3950  C CD1 . LEU A  1 572  ? 211.252 152.378 178.862 1.00 165.34 ? 585  LEU A CD1 1 
ATOM   3951  C CD2 . LEU A  1 572  ? 209.130 152.166 180.155 1.00 165.34 ? 585  LEU A CD2 1 
ATOM   3952  N N   . ASP A  1 573  ? 209.368 156.002 177.939 1.00 165.92 ? 586  ASP A N   1 
ATOM   3953  C CA  . ASP A  1 573  ? 208.258 156.778 177.418 1.00 165.92 ? 586  ASP A CA  1 
ATOM   3954  C C   . ASP A  1 573  ? 206.989 155.939 177.363 1.00 165.92 ? 586  ASP A C   1 
ATOM   3955  O O   . ASP A  1 573  ? 207.009 154.718 177.518 1.00 165.92 ? 586  ASP A O   1 
ATOM   3956  C CB  . ASP A  1 573  ? 208.613 157.372 176.059 1.00 165.92 ? 586  ASP A CB  1 
ATOM   3957  C CG  . ASP A  1 573  ? 209.197 158.761 176.186 1.00 165.92 ? 586  ASP A CG  1 
ATOM   3958  O OD1 . ASP A  1 573  ? 208.417 159.715 176.386 1.00 165.92 ? 586  ASP A OD1 1 
ATOM   3959  O OD2 . ASP A  1 573  ? 210.430 158.909 176.090 1.00 165.92 ? 586  ASP A OD2 1 
ATOM   3960  N N   . ILE A  1 574  ? 205.861 156.626 177.187 1.00 163.40 ? 587  ILE A N   1 
ATOM   3961  C CA  . ILE A  1 574  ? 204.551 155.994 177.206 1.00 163.40 ? 587  ILE A CA  1 
ATOM   3962  C C   . ILE A  1 574  ? 203.772 156.414 175.961 1.00 163.40 ? 587  ILE A C   1 
ATOM   3963  O O   . ILE A  1 574  ? 204.194 157.271 175.186 1.00 163.40 ? 587  ILE A O   1 
ATOM   3964  C CB  . ILE A  1 574  ? 203.762 156.307 178.499 1.00 163.40 ? 587  ILE A CB  1 
ATOM   3965  C CG1 . ILE A  1 574  ? 203.384 157.778 178.592 1.00 163.40 ? 587  ILE A CG1 1 
ATOM   3966  C CG2 . ILE A  1 574  ? 204.577 155.963 179.719 1.00 163.40 ? 587  ILE A CG2 1 
ATOM   3967  C CD1 . ILE A  1 574  ? 202.812 158.148 179.942 1.00 163.40 ? 587  ILE A CD1 1 
ATOM   3968  N N   . THR A  1 575  ? 202.639 155.751 175.757 1.00 165.13 ? 588  THR A N   1 
ATOM   3969  C CA  . THR A  1 575  ? 201.822 155.979 174.598 1.00 165.13 ? 588  THR A CA  1 
ATOM   3970  C C   . THR A  1 575  ? 200.390 155.627 174.979 1.00 165.13 ? 588  THR A C   1 
ATOM   3971  O O   . THR A  1 575  ? 200.172 154.663 175.730 1.00 165.13 ? 588  THR A O   1 
ATOM   3972  C CB  . THR A  1 575  ? 202.313 155.125 173.428 1.00 165.13 ? 588  THR A CB  1 
ATOM   3973  O OG1 . THR A  1 575  ? 203.612 155.579 173.026 1.00 165.13 ? 588  THR A OG1 1 
ATOM   3974  C CG2 . THR A  1 575  ? 201.354 155.189 172.249 1.00 165.13 ? 588  THR A CG2 1 
ATOM   3975  N N   . PRO A  1 576  ? 199.404 156.395 174.528 1.00 160.62 ? 589  PRO A N   1 
ATOM   3976  C CA  . PRO A  1 576  ? 198.008 156.001 174.754 1.00 160.62 ? 589  PRO A CA  1 
ATOM   3977  C C   . PRO A  1 576  ? 197.735 154.645 174.124 1.00 160.62 ? 589  PRO A C   1 
ATOM   3978  O O   . PRO A  1 576  ? 197.879 154.472 172.912 1.00 160.62 ? 589  PRO A O   1 
ATOM   3979  C CB  . PRO A  1 576  ? 197.215 157.113 174.061 1.00 160.62 ? 589  PRO A CB  1 
ATOM   3980  C CG  . PRO A  1 576  ? 198.190 157.786 173.161 1.00 160.62 ? 589  PRO A CG  1 
ATOM   3981  C CD  . PRO A  1 576  ? 199.505 157.682 173.832 1.00 160.62 ? 589  PRO A CD  1 
ATOM   3982  N N   . CYS A  1 577  ? 197.356 153.667 174.956 1.00 166.11 ? 590  CYS A N   1 
ATOM   3983  C CA  . CYS A  1 577  ? 197.057 152.351 174.399 1.00 166.11 ? 590  CYS A CA  1 
ATOM   3984  C C   . CYS A  1 577  ? 195.823 152.442 173.517 1.00 166.11 ? 590  CYS A C   1 
ATOM   3985  O O   . CYS A  1 577  ? 194.695 152.532 174.009 1.00 166.11 ? 590  CYS A O   1 
ATOM   3986  C CB  . CYS A  1 577  ? 196.888 151.285 175.487 1.00 166.11 ? 590  CYS A CB  1 
ATOM   3987  S SG  . CYS A  1 577  ? 195.872 151.624 176.961 1.00 166.11 ? 590  CYS A SG  1 
ATOM   3988  N N   . SER A  1 578  ? 196.048 152.386 172.209 1.00 158.45 ? 591  SER A N   1 
ATOM   3989  C CA  . SER A  1 578  ? 195.122 152.887 171.210 1.00 158.45 ? 591  SER A CA  1 
ATOM   3990  C C   . SER A  1 578  ? 193.803 152.132 171.236 1.00 158.45 ? 591  SER A C   1 
ATOM   3991  O O   . SER A  1 578  ? 193.645 151.108 171.905 1.00 158.45 ? 591  SER A O   1 
ATOM   3992  C CB  . SER A  1 578  ? 195.732 152.786 169.814 1.00 158.45 ? 591  SER A CB  1 
ATOM   3993  O OG  . SER A  1 578  ? 195.444 151.530 169.223 1.00 158.45 ? 591  SER A OG  1 
ATOM   3994  N N   . PHE A  1 579  ? 192.850 152.671 170.487 1.00 134.84 ? 592  PHE A N   1 
ATOM   3995  C CA  . PHE A  1 579  ? 191.559 152.044 170.245 1.00 134.84 ? 592  PHE A CA  1 
ATOM   3996  C C   . PHE A  1 579  ? 190.811 152.916 169.248 1.00 134.84 ? 592  PHE A C   1 
ATOM   3997  O O   . PHE A  1 579  ? 191.200 154.055 168.976 1.00 134.84 ? 592  PHE A O   1 
ATOM   3998  C CB  . PHE A  1 579  ? 190.776 151.865 171.538 1.00 134.84 ? 592  PHE A CB  1 
ATOM   3999  C CG  . PHE A  1 579  ? 190.656 153.106 172.339 1.00 134.84 ? 592  PHE A CG  1 
ATOM   4000  C CD1 . PHE A  1 579  ? 189.611 153.974 172.134 1.00 134.84 ? 592  PHE A CD1 1 
ATOM   4001  C CD2 . PHE A  1 579  ? 191.594 153.411 173.295 1.00 134.84 ? 592  PHE A CD2 1 
ATOM   4002  C CE1 . PHE A  1 579  ? 189.499 155.116 172.878 1.00 134.84 ? 592  PHE A CE1 1 
ATOM   4003  C CE2 . PHE A  1 579  ? 191.488 154.554 174.033 1.00 134.84 ? 592  PHE A CE2 1 
ATOM   4004  C CZ  . PHE A  1 579  ? 190.437 155.405 173.826 1.00 134.84 ? 592  PHE A CZ  1 
ATOM   4005  N N   . GLY A  1 580  ? 189.726 152.373 168.709 1.00 116.90 ? 593  GLY A N   1 
ATOM   4006  C CA  . GLY A  1 580  ? 188.945 153.094 167.727 1.00 116.90 ? 593  GLY A CA  1 
ATOM   4007  C C   . GLY A  1 580  ? 187.482 152.769 167.904 1.00 116.90 ? 593  GLY A C   1 
ATOM   4008  O O   . GLY A  1 580  ? 187.098 151.920 168.710 1.00 116.90 ? 593  GLY A O   1 
ATOM   4009  N N   . GLY A  1 581  ? 186.665 153.470 167.142 1.00 110.15 ? 594  GLY A N   1 
ATOM   4010  C CA  . GLY A  1 581  ? 185.252 153.191 167.144 1.00 110.15 ? 594  GLY A CA  1 
ATOM   4011  C C   . GLY A  1 581  ? 184.970 151.787 166.665 1.00 110.15 ? 594  GLY A C   1 
ATOM   4012  O O   . GLY A  1 581  ? 185.850 151.047 166.229 1.00 110.15 ? 594  GLY A O   1 
ATOM   4013  N N   . VAL A  1 582  ? 183.704 151.396 166.782 1.00 106.35 ? 595  VAL A N   1 
ATOM   4014  C CA  . VAL A  1 582  ? 183.254 150.090 166.332 1.00 106.35 ? 595  VAL A CA  1 
ATOM   4015  C C   . VAL A  1 582  ? 181.893 150.275 165.697 1.00 106.35 ? 595  VAL A C   1 
ATOM   4016  O O   . VAL A  1 582  ? 181.189 151.248 165.966 1.00 106.35 ? 595  VAL A O   1 
ATOM   4017  C CB  . VAL A  1 582  ? 183.163 149.082 167.496 1.00 106.35 ? 595  VAL A CB  1 
ATOM   4018  C CG1 . VAL A  1 582  ? 183.148 147.666 166.976 1.00 106.35 ? 595  VAL A CG1 1 
ATOM   4019  C CG2 . VAL A  1 582  ? 184.295 149.289 168.483 1.00 106.35 ? 595  VAL A CG2 1 
ATOM   4020  N N   . SER A  1 583  ? 181.518 149.330 164.851 1.00 100.01 ? 596  SER A N   1 
ATOM   4021  C CA  . SER A  1 583  ? 180.168 149.313 164.325 1.00 100.01 ? 596  SER A CA  1 
ATOM   4022  C C   . SER A  1 583  ? 179.899 147.988 163.634 1.00 100.01 ? 596  SER A C   1 
ATOM   4023  O O   . SER A  1 583  ? 180.716 147.062 163.667 1.00 100.01 ? 596  SER A O   1 
ATOM   4024  C CB  . SER A  1 583  ? 179.932 150.456 163.350 1.00 100.01 ? 596  SER A CB  1 
ATOM   4025  O OG  . SER A  1 583  ? 178.632 150.327 162.813 1.00 100.01 ? 596  SER A OG  1 
ATOM   4026  N N   . VAL A  1 584  ? 178.759 147.932 162.958 1.00 107.14 ? 597  VAL A N   1 
ATOM   4027  C CA  . VAL A  1 584  ? 178.275 146.734 162.309 1.00 107.14 ? 597  VAL A CA  1 
ATOM   4028  C C   . VAL A  1 584  ? 178.057 147.025 160.831 1.00 107.14 ? 597  VAL A C   1 
ATOM   4029  O O   . VAL A  1 584  ? 178.026 148.171 160.393 1.00 107.14 ? 597  VAL A O   1 
ATOM   4030  C CB  . VAL A  1 584  ? 176.986 146.236 162.962 1.00 107.14 ? 597  VAL A CB  1 
ATOM   4031  C CG1 . VAL A  1 584  ? 177.265 145.879 164.368 1.00 107.14 ? 597  VAL A CG1 1 
ATOM   4032  C CG2 . VAL A  1 584  ? 175.978 147.330 162.948 1.00 107.14 ? 597  VAL A CG2 1 
ATOM   4033  N N   . ILE A  1 585  ? 177.934 145.954 160.060 1.00 114.13 ? 598  ILE A N   1 
ATOM   4034  C CA  . ILE A  1 585  ? 177.593 146.037 158.650 1.00 114.13 ? 598  ILE A CA  1 
ATOM   4035  C C   . ILE A  1 585  ? 176.394 145.141 158.431 1.00 114.13 ? 598  ILE A C   1 
ATOM   4036  O O   . ILE A  1 585  ? 176.463 143.938 158.696 1.00 114.13 ? 598  ILE A O   1 
ATOM   4037  C CB  . ILE A  1 585  ? 178.740 145.588 157.743 1.00 114.13 ? 598  ILE A CB  1 
ATOM   4038  C CG1 . ILE A  1 585  ? 180.074 145.989 158.330 1.00 114.13 ? 598  ILE A CG1 1 
ATOM   4039  C CG2 . ILE A  1 585  ? 178.607 146.233 156.388 1.00 114.13 ? 598  ILE A CG2 1 
ATOM   4040  C CD1 . ILE A  1 585  ? 181.216 145.354 157.604 1.00 114.13 ? 598  ILE A CD1 1 
ATOM   4041  N N   . THR A  1 586  ? 175.304 145.707 157.941 1.00 114.56 ? 599  THR A N   1 
ATOM   4042  C CA  . THR A  1 586  ? 174.147 144.894 157.740 1.00 114.56 ? 599  THR A CA  1 
ATOM   4043  C C   . THR A  1 586  ? 173.490 145.277 156.423 1.00 114.56 ? 599  THR A C   1 
ATOM   4044  O O   . THR A  1 586  ? 173.223 146.466 156.189 1.00 114.56 ? 599  THR A O   1 
ATOM   4045  C CB  . THR A  1 586  ? 173.174 145.071 158.892 1.00 114.56 ? 599  THR A CB  1 
ATOM   4046  O OG1 . THR A  1 586  ? 173.873 144.867 160.118 1.00 114.56 ? 599  THR A OG1 1 
ATOM   4047  C CG2 . THR A  1 586  ? 172.081 144.054 158.795 1.00 114.56 ? 599  THR A CG2 1 
ATOM   4048  N N   . PRO A  1 587  ? 173.229 144.319 155.542 1.00 116.36 ? 600  PRO A N   1 
ATOM   4049  C CA  . PRO A  1 587  ? 172.584 144.663 154.273 1.00 116.36 ? 600  PRO A CA  1 
ATOM   4050  C C   . PRO A  1 587  ? 171.134 145.066 154.421 1.00 116.36 ? 600  PRO A C   1 
ATOM   4051  O O   . PRO A  1 587  ? 170.588 145.687 153.507 1.00 116.36 ? 600  PRO A O   1 
ATOM   4052  C CB  . PRO A  1 587  ? 172.728 143.380 153.453 1.00 116.36 ? 600  PRO A CB  1 
ATOM   4053  C CG  . PRO A  1 587  ? 172.888 142.306 154.453 1.00 116.36 ? 600  PRO A CG  1 
ATOM   4054  C CD  . PRO A  1 587  ? 173.615 142.905 155.607 1.00 116.36 ? 600  PRO A CD  1 
ATOM   4055  N N   . GLY A  1 588  ? 170.493 144.740 155.535 1.00 127.40 ? 601  GLY A N   1 
ATOM   4056  C CA  . GLY A  1 588  ? 169.109 145.111 155.778 1.00 127.40 ? 601  GLY A CA  1 
ATOM   4057  C C   . GLY A  1 588  ? 168.404 144.085 156.644 1.00 127.40 ? 601  GLY A C   1 
ATOM   4058  O O   . GLY A  1 588  ? 168.395 142.900 156.298 1.00 127.40 ? 601  GLY A O   1 
ATOM   4059  N N   . THR A  1 589  ? 167.762 144.535 157.733 1.00 123.61 ? 602  THR A N   1 
ATOM   4060  C CA  . THR A  1 589  ? 167.391 143.638 158.827 1.00 123.61 ? 602  THR A CA  1 
ATOM   4061  C C   . THR A  1 589  ? 166.709 142.380 158.336 1.00 123.61 ? 602  THR A C   1 
ATOM   4062  O O   . THR A  1 589  ? 166.824 141.327 158.969 1.00 123.61 ? 602  THR A O   1 
ATOM   4063  C CB  . THR A  1 589  ? 166.464 144.337 159.804 1.00 123.61 ? 602  THR A CB  1 
ATOM   4064  O OG1 . THR A  1 589  ? 166.840 145.706 159.904 1.00 123.61 ? 602  THR A OG1 1 
ATOM   4065  C CG2 . THR A  1 589  ? 166.598 143.705 161.152 1.00 123.61 ? 602  THR A CG2 1 
ATOM   4066  N N   . ASN A  1 590  ? 166.005 142.461 157.214 1.00 131.02 ? 603  ASN A N   1 
ATOM   4067  C CA  . ASN A  1 590  ? 165.327 141.301 156.667 1.00 131.02 ? 603  ASN A CA  1 
ATOM   4068  C C   . ASN A  1 590  ? 166.039 140.712 155.459 1.00 131.02 ? 603  ASN A C   1 
ATOM   4069  O O   . ASN A  1 590  ? 165.552 139.737 154.887 1.00 131.02 ? 603  ASN A O   1 
ATOM   4070  C CB  . ASN A  1 590  ? 163.867 141.651 156.333 1.00 131.02 ? 603  ASN A CB  1 
ATOM   4071  C CG  . ASN A  1 590  ? 163.666 142.193 154.921 1.00 131.02 ? 603  ASN A CG  1 
ATOM   4072  O OD1 . ASN A  1 590  ? 164.561 142.766 154.301 1.00 131.02 ? 603  ASN A OD1 1 
ATOM   4073  N ND2 . ASN A  1 590  ? 162.447 141.996 154.415 1.00 131.02 ? 603  ASN A ND2 1 
ATOM   4074  N N   . THR A  1 591  ? 167.184 141.264 155.067 1.00 124.87 ? 604  THR A N   1 
ATOM   4075  C CA  . THR A  1 591  ? 167.871 140.771 153.879 1.00 124.87 ? 604  THR A CA  1 
ATOM   4076  C C   . THR A  1 591  ? 168.761 139.575 154.192 1.00 124.87 ? 604  THR A C   1 
ATOM   4077  O O   . THR A  1 591  ? 168.537 138.473 153.683 1.00 124.87 ? 604  THR A O   1 
ATOM   4078  C CB  . THR A  1 591  ? 168.686 141.896 153.257 1.00 124.87 ? 604  THR A CB  1 
ATOM   4079  O OG1 . THR A  1 591  ? 169.744 142.259 154.149 1.00 124.87 ? 604  THR A OG1 1 
ATOM   4080  C CG2 . THR A  1 591  ? 167.799 143.094 153.030 1.00 124.87 ? 604  THR A CG2 1 
ATOM   4081  N N   . SER A  1 592  ? 169.785 139.775 155.019 1.00 129.14 ? 605  SER A N   1 
ATOM   4082  C CA  . SER A  1 592  ? 170.650 138.680 155.459 1.00 129.14 ? 605  SER A CA  1 
ATOM   4083  C C   . SER A  1 592  ? 171.247 139.087 156.797 1.00 129.14 ? 605  SER A C   1 
ATOM   4084  O O   . SER A  1 592  ? 172.175 139.897 156.833 1.00 129.14 ? 605  SER A O   1 
ATOM   4085  C CB  . SER A  1 592  ? 171.743 138.392 154.437 1.00 129.14 ? 605  SER A CB  1 
ATOM   4086  O OG  . SER A  1 592  ? 172.819 137.687 155.036 1.00 129.14 ? 605  SER A OG  1 
ATOM   4087  N N   . ASN A  1 593  ? 170.766 138.494 157.877 1.00 118.53 ? 606  ASN A N   1 
ATOM   4088  C CA  . ASN A  1 593  ? 171.044 139.019 159.201 1.00 118.53 ? 606  ASN A CA  1 
ATOM   4089  C C   . ASN A  1 593  ? 172.428 138.691 159.695 1.00 118.53 ? 606  ASN A C   1 
ATOM   4090  O O   . ASN A  1 593  ? 172.640 138.574 160.906 1.00 118.53 ? 606  ASN A O   1 
ATOM   4091  C CB  . ASN A  1 593  ? 169.982 138.527 160.164 1.00 118.53 ? 606  ASN A CB  1 
ATOM   4092  C CG  . ASN A  1 593  ? 168.650 139.085 159.824 1.00 118.53 ? 606  ASN A CG  1 
ATOM   4093  O OD1 . ASN A  1 593  ? 167.720 138.355 159.512 1.00 118.53 ? 606  ASN A OD1 1 
ATOM   4094  N ND2 . ASN A  1 593  ? 168.545 140.403 159.861 1.00 118.53 ? 606  ASN A ND2 1 
ATOM   4095  N N   . GLN A  1 594  ? 173.362 138.520 158.769 1.00 132.24 ? 607  GLN A N   1 
ATOM   4096  C CA  . GLN A  1 594  ? 174.778 138.465 159.095 1.00 132.24 ? 607  GLN A CA  1 
ATOM   4097  C C   . GLN A  1 594  ? 175.215 139.736 159.812 1.00 132.24 ? 607  GLN A C   1 
ATOM   4098  O O   . GLN A  1 594  ? 174.979 140.845 159.325 1.00 132.24 ? 607  GLN A O   1 
ATOM   4099  C CB  . GLN A  1 594  ? 175.582 138.282 157.812 1.00 132.24 ? 607  GLN A CB  1 
ATOM   4100  C CG  . GLN A  1 594  ? 175.328 136.979 157.127 1.00 132.24 ? 607  GLN A CG  1 
ATOM   4101  C CD  . GLN A  1 594  ? 176.072 135.857 157.795 1.00 132.24 ? 607  GLN A CD  1 
ATOM   4102  O OE1 . GLN A  1 594  ? 177.252 135.979 158.110 1.00 132.24 ? 607  GLN A OE1 1 
ATOM   4103  N NE2 . GLN A  1 594  ? 175.392 134.748 158.004 1.00 132.24 ? 607  GLN A NE2 1 
ATOM   4104  N N   . VAL A  1 595  ? 175.875 139.579 160.953 1.00 117.84 ? 608  VAL A N   1 
ATOM   4105  C CA  . VAL A  1 595  ? 176.269 140.702 161.790 1.00 117.84 ? 608  VAL A CA  1 
ATOM   4106  C C   . VAL A  1 595  ? 177.783 140.818 161.759 1.00 117.84 ? 608  VAL A C   1 
ATOM   4107  O O   . VAL A  1 595  ? 178.487 140.041 162.407 1.00 117.84 ? 608  VAL A O   1 
ATOM   4108  C CB  . VAL A  1 595  ? 175.760 140.527 163.219 1.00 117.84 ? 608  VAL A CB  1 
ATOM   4109  C CG1 . VAL A  1 595  ? 175.980 141.795 164.005 1.00 117.84 ? 608  VAL A CG1 1 
ATOM   4110  C CG2 . VAL A  1 595  ? 174.309 140.133 163.187 1.00 117.84 ? 608  VAL A CG2 1 
ATOM   4111  N N   . ALA A  1 596  ? 178.282 141.810 161.034 1.00 115.39 ? 609  ALA A N   1 
ATOM   4112  C CA  . ALA A  1 596  ? 179.708 141.974 160.781 1.00 115.39 ? 609  ALA A CA  1 
ATOM   4113  C C   . ALA A  1 596  ? 180.269 143.133 161.595 1.00 115.39 ? 609  ALA A C   1 
ATOM   4114  O O   . ALA A  1 596  ? 179.862 144.281 161.403 1.00 115.39 ? 609  ALA A O   1 
ATOM   4115  C CB  . ALA A  1 596  ? 179.951 142.224 159.298 1.00 115.39 ? 609  ALA A CB  1 
ATOM   4116  N N   . VAL A  1 597  ? 181.226 142.843 162.458 1.00 111.96 ? 610  VAL A N   1 
ATOM   4117  C CA  . VAL A  1 597  ? 181.821 143.866 163.298 1.00 111.96 ? 610  VAL A CA  1 
ATOM   4118  C C   . VAL A  1 597  ? 182.871 144.609 162.490 1.00 111.96 ? 610  VAL A C   1 
ATOM   4119  O O   . VAL A  1 597  ? 183.303 144.156 161.434 1.00 111.96 ? 610  VAL A O   1 
ATOM   4120  C CB  . VAL A  1 597  ? 182.443 143.247 164.555 1.00 111.96 ? 610  VAL A CB  1 
ATOM   4121  C CG1 . VAL A  1 597  ? 183.624 142.405 164.165 1.00 111.96 ? 610  VAL A CG1 1 
ATOM   4122  C CG2 . VAL A  1 597  ? 182.825 144.309 165.567 1.00 111.96 ? 610  VAL A CG2 1 
ATOM   4123  N N   . LEU A  1 598  ? 183.275 145.778 162.980 1.00 118.17 ? 611  LEU A N   1 
ATOM   4124  C CA  . LEU A  1 598  ? 184.399 146.495 162.389 1.00 118.17 ? 611  LEU A CA  1 
ATOM   4125  C C   . LEU A  1 598  ? 185.303 147.099 163.459 1.00 118.17 ? 611  LEU A C   1 
ATOM   4126  O O   . LEU A  1 598  ? 184.826 147.720 164.411 1.00 118.17 ? 611  LEU A O   1 
ATOM   4127  C CB  . LEU A  1 598  ? 183.915 147.605 161.456 1.00 118.17 ? 611  LEU A CB  1 
ATOM   4128  C CG  . LEU A  1 598  ? 185.007 148.411 160.762 1.00 118.17 ? 611  LEU A CG  1 
ATOM   4129  C CD1 . LEU A  1 598  ? 186.074 147.498 160.202 1.00 118.17 ? 611  LEU A CD1 1 
ATOM   4130  C CD2 . LEU A  1 598  ? 184.401 149.256 159.669 1.00 118.17 ? 611  LEU A CD2 1 
ATOM   4131  N N   . TYR A  1 599  ? 186.612 146.929 163.283 1.00 124.73 ? 612  TYR A N   1 
ATOM   4132  C CA  . TYR A  1 599  ? 187.622 147.660 164.034 1.00 124.73 ? 612  TYR A CA  1 
ATOM   4133  C C   . TYR A  1 599  ? 188.508 148.400 163.049 1.00 124.73 ? 612  TYR A C   1 
ATOM   4134  O O   . TYR A  1 599  ? 188.947 147.823 162.050 1.00 124.73 ? 612  TYR A O   1 
ATOM   4135  C CB  . TYR A  1 599  ? 188.452 146.732 164.896 1.00 124.73 ? 612  TYR A CB  1 
ATOM   4136  C CG  . TYR A  1 599  ? 187.592 145.785 165.636 1.00 124.73 ? 612  TYR A CG  1 
ATOM   4137  C CD1 . TYR A  1 599  ? 186.538 146.242 166.387 1.00 124.73 ? 612  TYR A CD1 1 
ATOM   4138  C CD2 . TYR A  1 599  ? 187.808 144.433 165.555 1.00 124.73 ? 612  TYR A CD2 1 
ATOM   4139  C CE1 . TYR A  1 599  ? 185.741 145.386 167.052 1.00 124.73 ? 612  TYR A CE1 1 
ATOM   4140  C CE2 . TYR A  1 599  ? 187.016 143.565 166.217 1.00 124.73 ? 612  TYR A CE2 1 
ATOM   4141  C CZ  . TYR A  1 599  ? 185.981 144.045 166.966 1.00 124.73 ? 612  TYR A CZ  1 
ATOM   4142  O OH  . TYR A  1 599  ? 185.174 143.169 167.638 1.00 124.73 ? 612  TYR A OH  1 
ATOM   4143  N N   . GLN A  1 600  ? 188.780 149.666 163.342 1.00 134.62 ? 613  GLN A N   1 
ATOM   4144  C CA  . GLN A  1 600  ? 189.299 150.598 162.351 1.00 134.62 ? 613  GLN A CA  1 
ATOM   4145  C C   . GLN A  1 600  ? 190.796 150.820 162.506 1.00 134.62 ? 613  GLN A C   1 
ATOM   4146  O O   . GLN A  1 600  ? 191.258 151.235 163.570 1.00 134.62 ? 613  GLN A O   1 
ATOM   4147  C CB  . GLN A  1 600  ? 188.568 151.932 162.462 1.00 134.62 ? 613  GLN A CB  1 
ATOM   4148  C CG  . GLN A  1 600  ? 189.037 152.925 161.457 1.00 134.62 ? 613  GLN A CG  1 
ATOM   4149  C CD  . GLN A  1 600  ? 189.205 152.291 160.113 1.00 134.62 ? 613  GLN A CD  1 
ATOM   4150  O OE1 . GLN A  1 600  ? 188.268 151.726 159.566 1.00 134.62 ? 613  GLN A OE1 1 
ATOM   4151  N NE2 . GLN A  1 600  ? 190.409 152.342 159.582 1.00 134.62 ? 613  GLN A NE2 1 
ATOM   4152  N N   . ASP A  1 601  ? 191.538 150.566 161.430 1.00 138.45 ? 614  ASP A N   1 
ATOM   4153  C CA  . ASP A  1 601  ? 192.976 150.805 161.351 1.00 138.45 ? 614  ASP A CA  1 
ATOM   4154  C C   . ASP A  1 601  ? 193.720 150.295 162.573 1.00 138.45 ? 614  ASP A C   1 
ATOM   4155  O O   . ASP A  1 601  ? 194.711 150.893 163.001 1.00 138.45 ? 614  ASP A O   1 
ATOM   4156  C CB  . ASP A  1 601  ? 193.286 152.287 161.152 1.00 138.45 ? 614  ASP A CB  1 
ATOM   4157  C CG  . ASP A  1 601  ? 193.300 152.677 159.694 1.00 138.45 ? 614  ASP A CG  1 
ATOM   4158  O OD1 . ASP A  1 601  ? 192.459 152.145 158.962 1.00 138.45 ? 614  ASP A OD1 1 
ATOM   4159  O OD2 . ASP A  1 601  ? 194.165 153.468 159.265 1.00 138.45 ? 614  ASP A OD2 1 
ATOM   4160  N N   . VAL A  1 602  ? 193.257 149.189 163.133 1.00 145.02 ? 615  VAL A N   1 
ATOM   4161  C CA  . VAL A  1 602  ? 193.969 148.490 164.189 1.00 145.02 ? 615  VAL A CA  1 
ATOM   4162  C C   . VAL A  1 602  ? 194.419 147.158 163.619 1.00 145.02 ? 615  VAL A C   1 
ATOM   4163  O O   . VAL A  1 602  ? 193.590 146.327 163.231 1.00 145.02 ? 615  VAL A O   1 
ATOM   4164  C CB  . VAL A  1 602  ? 193.104 148.289 165.440 1.00 145.02 ? 615  VAL A CB  1 
ATOM   4165  C CG1 . VAL A  1 602  ? 193.955 147.719 166.571 1.00 145.02 ? 615  VAL A CG1 1 
ATOM   4166  C CG2 . VAL A  1 602  ? 192.467 149.594 165.852 1.00 145.02 ? 615  VAL A CG2 1 
ATOM   4167  N N   . ASN A  1 603  ? 195.726 146.958 163.554 1.00 154.25 ? 616  ASN A N   1 
ATOM   4168  C CA  . ASN A  1 603  ? 196.242 145.674 163.109 1.00 154.25 ? 616  ASN A CA  1 
ATOM   4169  C C   . ASN A  1 603  ? 195.892 144.667 164.189 1.00 154.25 ? 616  ASN A C   1 
ATOM   4170  O O   . ASN A  1 603  ? 196.506 144.632 165.255 1.00 154.25 ? 616  ASN A O   1 
ATOM   4171  C CB  . ASN A  1 603  ? 197.740 145.734 162.849 1.00 154.25 ? 616  ASN A CB  1 
ATOM   4172  C CG  . ASN A  1 603  ? 198.216 144.573 161.997 1.00 154.25 ? 616  ASN A CG  1 
ATOM   4173  O OD1 . ASN A  1 603  ? 197.411 143.765 161.539 1.00 154.25 ? 616  ASN A OD1 1 
ATOM   4174  N ND2 . ASN A  1 603  ? 199.521 144.482 161.776 1.00 154.25 ? 616  ASN A ND2 1 
ATOM   4175  N N   . CYS A  1 604  ? 194.878 143.859 163.913 1.00 167.98 ? 617  CYS A N   1 
ATOM   4176  C CA  . CYS A  1 604  ? 194.195 143.086 164.937 1.00 167.98 ? 617  CYS A CA  1 
ATOM   4177  C C   . CYS A  1 604  ? 195.104 142.063 165.605 1.00 167.98 ? 617  CYS A C   1 
ATOM   4178  O O   . CYS A  1 604  ? 194.856 140.860 165.526 1.00 167.98 ? 617  CYS A O   1 
ATOM   4179  C CB  . CYS A  1 604  ? 192.981 142.395 164.307 1.00 167.98 ? 617  CYS A CB  1 
ATOM   4180  S SG  . CYS A  1 604  ? 193.361 141.201 162.951 1.00 167.98 ? 617  CYS A SG  1 
ATOM   4181  N N   . THR A  1 605  ? 196.160 142.519 166.273 1.00 175.90 ? 618  THR A N   1 
ATOM   4182  C CA  . THR A  1 605  ? 196.977 141.594 167.046 1.00 175.90 ? 618  THR A CA  1 
ATOM   4183  C C   . THR A  1 605  ? 196.314 141.157 168.341 1.00 175.90 ? 618  THR A C   1 
ATOM   4184  O O   . THR A  1 605  ? 196.803 140.222 168.985 1.00 175.90 ? 618  THR A O   1 
ATOM   4185  C CB  . THR A  1 605  ? 198.325 142.229 167.360 1.00 175.90 ? 618  THR A CB  1 
ATOM   4186  O OG1 . THR A  1 605  ? 198.160 143.216 168.388 1.00 175.90 ? 618  THR A OG1 1 
ATOM   4187  C CG2 . THR A  1 605  ? 198.846 142.897 166.135 1.00 175.90 ? 618  THR A CG2 1 
ATOM   4188  N N   . GLU A  1 606  ? 195.226 141.804 168.737 1.00 180.44 ? 619  GLU A N   1 
ATOM   4189  C CA  . GLU A  1 606  ? 194.560 141.509 169.995 1.00 180.44 ? 619  GLU A CA  1 
ATOM   4190  C C   . GLU A  1 606  ? 193.204 142.192 169.980 1.00 180.44 ? 619  GLU A C   1 
ATOM   4191  O O   . GLU A  1 606  ? 193.045 143.283 169.425 1.00 180.44 ? 619  GLU A O   1 
ATOM   4192  C CB  . GLU A  1 606  ? 195.407 141.970 171.183 1.00 180.44 ? 619  GLU A CB  1 
ATOM   4193  C CG  . GLU A  1 606  ? 195.240 143.438 171.534 1.00 180.44 ? 619  GLU A CG  1 
ATOM   4194  C CD  . GLU A  1 606  ? 195.968 144.341 170.566 1.00 180.44 ? 619  GLU A CD  1 
ATOM   4195  O OE1 . GLU A  1 606  ? 196.396 143.854 169.507 1.00 180.44 ? 619  GLU A OE1 1 
ATOM   4196  O OE2 . GLU A  1 606  ? 196.127 145.539 170.856 1.00 180.44 ? 619  GLU A OE2 1 
ATOM   4197  N N   . VAL A  1 607  ? 192.226 141.553 170.607 1.00 186.06 ? 620  VAL A N   1 
ATOM   4198  C CA  . VAL A  1 607  ? 190.856 142.050 170.624 1.00 186.06 ? 620  VAL A CA  1 
ATOM   4199  C C   . VAL A  1 607  ? 190.144 141.709 171.930 1.00 186.06 ? 620  VAL A C   1 
ATOM   4200  O O   . VAL A  1 607  ? 189.087 141.065 171.895 1.00 186.06 ? 620  VAL A O   1 
ATOM   4201  C CB  . VAL A  1 607  ? 190.078 141.486 169.430 1.00 186.06 ? 620  VAL A CB  1 
ATOM   4202  C CG1 . VAL A  1 607  ? 190.488 142.175 168.156 1.00 186.06 ? 620  VAL A CG1 1 
ATOM   4203  C CG2 . VAL A  1 607  ? 190.361 140.009 169.303 1.00 186.06 ? 620  VAL A CG2 1 
ATOM   4204  N N   . PRO A  1 608  ? 190.655 142.108 173.103 1.00 194.51 ? 621  PRO A N   1 
ATOM   4205  C CA  . PRO A  1 608  ? 189.863 141.789 174.291 1.00 194.51 ? 621  PRO A CA  1 
ATOM   4206  C C   . PRO A  1 608  ? 188.975 142.952 174.723 1.00 194.51 ? 621  PRO A C   1 
ATOM   4207  O O   . PRO A  1 608  ? 187.756 142.861 174.584 1.00 194.51 ? 621  PRO A O   1 
ATOM   4208  C CB  . PRO A  1 608  ? 190.932 141.491 175.338 1.00 194.51 ? 621  PRO A CB  1 
ATOM   4209  C CG  . PRO A  1 608  ? 192.061 142.399 174.962 1.00 194.51 ? 621  PRO A CG  1 
ATOM   4210  C CD  . PRO A  1 608  ? 191.951 142.699 173.469 1.00 194.51 ? 621  PRO A CD  1 
ATOM   4211  N N   . SER A  1 627  ? 186.254 134.541 164.280 1.00 118.72 ? 640  SER A N   1 
ATOM   4212  C CA  . SER A  1 627  ? 186.615 133.377 163.490 1.00 118.72 ? 640  SER A CA  1 
ATOM   4213  C C   . SER A  1 627  ? 187.565 133.768 162.380 1.00 118.72 ? 640  SER A C   1 
ATOM   4214  O O   . SER A  1 627  ? 188.759 133.937 162.600 1.00 118.72 ? 640  SER A O   1 
ATOM   4215  C CB  . SER A  1 627  ? 185.375 132.736 162.901 1.00 118.72 ? 640  SER A CB  1 
ATOM   4216  O OG  . SER A  1 627  ? 184.753 133.644 162.020 1.00 118.72 ? 640  SER A OG  1 
ATOM   4217  N N   . ASN A  1 628  ? 187.021 133.906 161.176 1.00 124.15 ? 641  ASN A N   1 
ATOM   4218  C CA  . ASN A  1 628  ? 187.797 134.439 160.069 1.00 124.15 ? 641  ASN A CA  1 
ATOM   4219  C C   . ASN A  1 628  ? 188.222 135.865 160.381 1.00 124.15 ? 641  ASN A C   1 
ATOM   4220  O O   . ASN A  1 628  ? 187.603 136.557 161.192 1.00 124.15 ? 641  ASN A O   1 
ATOM   4221  C CB  . ASN A  1 628  ? 186.978 134.399 158.774 1.00 124.15 ? 641  ASN A CB  1 
ATOM   4222  C CG  . ASN A  1 628  ? 187.678 135.079 157.596 1.00 124.15 ? 641  ASN A CG  1 
ATOM   4223  O OD1 . ASN A  1 628  ? 188.575 134.506 156.979 1.00 124.15 ? 641  ASN A OD1 1 
ATOM   4224  N ND2 . ASN A  1 628  ? 187.251 136.297 157.270 1.00 124.15 ? 641  ASN A ND2 1 
ATOM   4225  N N   . VAL A  1 629  ? 189.315 136.288 159.759 1.00 121.32 ? 642  VAL A N   1 
ATOM   4226  C CA  . VAL A  1 629  ? 189.781 137.664 159.829 1.00 121.32 ? 642  VAL A CA  1 
ATOM   4227  C C   . VAL A  1 629  ? 190.261 138.058 158.443 1.00 121.32 ? 642  VAL A C   1 
ATOM   4228  O O   . VAL A  1 629  ? 190.497 137.206 157.583 1.00 121.32 ? 642  VAL A O   1 
ATOM   4229  C CB  . VAL A  1 629  ? 190.895 137.847 160.882 1.00 121.32 ? 642  VAL A CB  1 
ATOM   4230  C CG1 . VAL A  1 629  ? 190.303 137.894 162.268 1.00 121.32 ? 642  VAL A CG1 1 
ATOM   4231  C CG2 . VAL A  1 629  ? 191.880 136.704 160.804 1.00 121.32 ? 642  VAL A CG2 1 
ATOM   4232  N N   . PHE A  1 630  ? 190.366 139.358 158.212 1.00 111.89 ? 643  PHE A N   1 
ATOM   4233  C CA  . PHE A  1 630  ? 190.992 139.829 156.987 1.00 111.89 ? 643  PHE A CA  1 
ATOM   4234  C C   . PHE A  1 630  ? 191.418 141.264 157.185 1.00 111.89 ? 643  PHE A C   1 
ATOM   4235  O O   . PHE A  1 630  ? 190.573 142.133 157.383 1.00 111.89 ? 643  PHE A O   1 
ATOM   4236  C CB  . PHE A  1 630  ? 190.055 139.740 155.796 1.00 111.89 ? 643  PHE A CB  1 
ATOM   4237  C CG  . PHE A  1 630  ? 190.476 140.605 154.665 1.00 111.89 ? 643  PHE A CG  1 
ATOM   4238  C CD1 . PHE A  1 630  ? 191.616 140.320 153.964 1.00 111.89 ? 643  PHE A CD1 1 
ATOM   4239  C CD2 . PHE A  1 630  ? 189.748 141.718 154.319 1.00 111.89 ? 643  PHE A CD2 1 
ATOM   4240  C CE1 . PHE A  1 630  ? 192.017 141.120 152.939 1.00 111.89 ? 643  PHE A CE1 1 
ATOM   4241  C CE2 . PHE A  1 630  ? 190.147 142.516 153.288 1.00 111.89 ? 643  PHE A CE2 1 
ATOM   4242  C CZ  . PHE A  1 630  ? 191.281 142.213 152.595 1.00 111.89 ? 643  PHE A CZ  1 
ATOM   4243  N N   . GLN A  1 631  ? 192.713 141.511 157.131 1.00 126.46 ? 644  GLN A N   1 
ATOM   4244  C CA  . GLN A  1 631  ? 193.241 142.841 157.367 1.00 126.46 ? 644  GLN A CA  1 
ATOM   4245  C C   . GLN A  1 631  ? 193.214 143.626 156.068 1.00 126.46 ? 644  GLN A C   1 
ATOM   4246  O O   . GLN A  1 631  ? 193.317 143.053 154.980 1.00 126.46 ? 644  GLN A O   1 
ATOM   4247  C CB  . GLN A  1 631  ? 194.662 142.787 157.924 1.00 126.46 ? 644  GLN A CB  1 
ATOM   4248  C CG  . GLN A  1 631  ? 195.118 144.064 158.599 1.00 126.46 ? 644  GLN A CG  1 
ATOM   4249  C CD  . GLN A  1 631  ? 194.644 144.154 160.032 1.00 126.46 ? 644  GLN A CD  1 
ATOM   4250  O OE1 . GLN A  1 631  ? 194.026 145.134 160.430 1.00 126.46 ? 644  GLN A OE1 1 
ATOM   4251  N NE2 . GLN A  1 631  ? 194.920 143.119 160.811 1.00 126.46 ? 644  GLN A NE2 1 
ATOM   4252  N N   . THR A  1 632  ? 193.026 144.932 156.199 1.00 122.50 ? 645  THR A N   1 
ATOM   4253  C CA  . THR A  1 632  ? 193.119 145.876 155.099 1.00 122.50 ? 645  THR A CA  1 
ATOM   4254  C C   . THR A  1 632  ? 193.699 147.171 155.624 1.00 122.50 ? 645  THR A C   1 
ATOM   4255  O O   . THR A  1 632  ? 193.959 147.283 156.823 1.00 122.50 ? 645  THR A O   1 
ATOM   4256  C CB  . THR A  1 632  ? 191.758 146.144 154.487 1.00 122.50 ? 645  THR A CB  1 
ATOM   4257  O OG1 . THR A  1 632  ? 191.912 147.071 153.414 1.00 122.50 ? 645  THR A OG1 1 
ATOM   4258  C CG2 . THR A  1 632  ? 190.853 146.750 155.519 1.00 122.50 ? 645  THR A CG2 1 
ATOM   4259  N N   . ARG A  1 633  ? 193.891 148.156 154.748 1.00 124.88 ? 646  ARG A N   1 
ATOM   4260  C CA  . ARG A  1 633  ? 194.316 149.463 155.226 1.00 124.88 ? 646  ARG A CA  1 
ATOM   4261  C C   . ARG A  1 633  ? 193.378 149.979 156.298 1.00 124.88 ? 646  ARG A C   1 
ATOM   4262  O O   . ARG A  1 633  ? 193.811 150.675 157.221 1.00 124.88 ? 646  ARG A O   1 
ATOM   4263  C CB  . ARG A  1 633  ? 194.381 150.471 154.080 1.00 124.88 ? 646  ARG A CB  1 
ATOM   4264  C CG  . ARG A  1 633  ? 195.307 150.113 152.941 1.00 124.88 ? 646  ARG A CG  1 
ATOM   4265  C CD  . ARG A  1 633  ? 195.249 151.172 151.854 1.00 124.88 ? 646  ARG A CD  1 
ATOM   4266  N NE  . ARG A  1 633  ? 195.957 152.399 152.205 1.00 124.88 ? 646  ARG A NE  1 
ATOM   4267  C CZ  . ARG A  1 633  ? 197.082 152.796 151.620 1.00 124.88 ? 646  ARG A CZ  1 
ATOM   4268  N NH1 . ARG A  1 633  ? 197.627 152.062 150.662 1.00 124.88 ? 646  ARG A NH1 1 
ATOM   4269  N NH2 . ARG A  1 633  ? 197.664 153.926 151.988 1.00 124.88 ? 646  ARG A NH2 1 
ATOM   4270  N N   . ALA A  1 634  ? 192.103 149.630 156.208 1.00 127.88 ? 647  ALA A N   1 
ATOM   4271  C CA  . ALA A  1 634  ? 191.141 150.143 157.162 1.00 127.88 ? 647  ALA A CA  1 
ATOM   4272  C C   . ALA A  1 634  ? 191.268 149.509 158.531 1.00 127.88 ? 647  ALA A C   1 
ATOM   4273  O O   . ALA A  1 634  ? 190.626 149.976 159.469 1.00 127.88 ? 647  ALA A O   1 
ATOM   4274  C CB  . ALA A  1 634  ? 189.720 149.939 156.644 1.00 127.88 ? 647  ALA A CB  1 
ATOM   4275  N N   . GLY A  1 635  ? 192.080 148.478 158.685 1.00 125.02 ? 648  GLY A N   1 
ATOM   4276  C CA  . GLY A  1 635  ? 192.024 147.729 159.922 1.00 125.02 ? 648  GLY A CA  1 
ATOM   4277  C C   . GLY A  1 635  ? 191.472 146.338 159.712 1.00 125.02 ? 648  GLY A C   1 
ATOM   4278  O O   . GLY A  1 635  ? 190.944 146.029 158.648 1.00 125.02 ? 648  GLY A O   1 
ATOM   4279  N N   . CYS A  1 636  ? 191.614 145.473 160.702 1.00 129.27 ? 649  CYS A N   1 
ATOM   4280  C CA  . CYS A  1 636  ? 191.173 144.100 160.538 1.00 129.27 ? 649  CYS A CA  1 
ATOM   4281  C C   . CYS A  1 636  ? 189.661 144.050 160.336 1.00 129.27 ? 649  CYS A C   1 
ATOM   4282  O O   . CYS A  1 636  ? 188.937 144.979 160.700 1.00 129.27 ? 649  CYS A O   1 
ATOM   4283  C CB  . CYS A  1 636  ? 191.577 143.291 161.766 1.00 129.27 ? 649  CYS A CB  1 
ATOM   4284  S SG  . CYS A  1 636  ? 192.026 141.594 161.474 1.00 129.27 ? 649  CYS A SG  1 
ATOM   4285  N N   . LEU A  1 637  ? 189.189 142.973 159.707 1.00 122.19 ? 650  LEU A N   1 
ATOM   4286  C CA  . LEU A  1 637  ? 187.772 142.638 159.634 1.00 122.19 ? 650  LEU A CA  1 
ATOM   4287  C C   . LEU A  1 637  ? 187.483 141.282 160.259 1.00 122.19 ? 650  LEU A C   1 
ATOM   4288  O O   . LEU A  1 637  ? 188.173 140.298 159.968 1.00 122.19 ? 650  LEU A O   1 
ATOM   4289  C CB  . LEU A  1 637  ? 187.268 142.605 158.203 1.00 122.19 ? 650  LEU A CB  1 
ATOM   4290  C CG  . LEU A  1 637  ? 186.894 143.955 157.667 1.00 122.19 ? 650  LEU A CG  1 
ATOM   4291  C CD1 . LEU A  1 637  ? 186.478 143.778 156.251 1.00 122.19 ? 650  LEU A CD1 1 
ATOM   4292  C CD2 . LEU A  1 637  ? 185.739 144.396 158.479 1.00 122.19 ? 650  LEU A CD2 1 
ATOM   4293  N N   . ILE A  1 638  ? 186.430 141.226 161.075 1.00 119.62 ? 651  ILE A N   1 
ATOM   4294  C CA  . ILE A  1 638  ? 185.964 139.995 161.704 1.00 119.62 ? 651  ILE A CA  1 
ATOM   4295  C C   . ILE A  1 638  ? 184.522 139.768 161.276 1.00 119.62 ? 651  ILE A C   1 
ATOM   4296  O O   . ILE A  1 638  ? 183.618 140.476 161.730 1.00 119.62 ? 651  ILE A O   1 
ATOM   4297  C CB  . ILE A  1 638  ? 186.069 140.062 163.233 1.00 119.62 ? 651  ILE A CB  1 
ATOM   4298  C CG1 . ILE A  1 638  ? 187.525 140.069 163.673 1.00 119.62 ? 651  ILE A CG1 1 
ATOM   4299  C CG2 . ILE A  1 638  ? 185.335 138.911 163.874 1.00 119.62 ? 651  ILE A CG2 1 
ATOM   4300  C CD1 . ILE A  1 638  ? 187.672 139.881 165.157 1.00 119.62 ? 651  ILE A CD1 1 
ATOM   4301  N N   . GLY A  1 639  ? 184.302 138.775 160.422 1.00 123.92 ? 652  GLY A N   1 
ATOM   4302  C CA  . GLY A  1 639  ? 183.011 138.527 159.821 1.00 123.92 ? 652  GLY A CA  1 
ATOM   4303  C C   . GLY A  1 639  ? 183.000 138.698 158.322 1.00 123.92 ? 652  GLY A C   1 
ATOM   4304  O O   . GLY A  1 639  ? 182.136 138.131 157.647 1.00 123.92 ? 652  GLY A O   1 
ATOM   4305  N N   . ALA A  1 640  ? 183.940 139.447 157.784 1.00 125.57 ? 653  ALA A N   1 
ATOM   4306  C CA  . ALA A  1 640  ? 184.063 139.592 156.353 1.00 125.57 ? 653  ALA A CA  1 
ATOM   4307  C C   . ALA A  1 640  ? 185.192 138.711 155.853 1.00 125.57 ? 653  ALA A C   1 
ATOM   4308  O O   . ALA A  1 640  ? 185.968 138.145 156.625 1.00 125.57 ? 653  ALA A O   1 
ATOM   4309  C CB  . ALA A  1 640  ? 184.305 141.051 155.979 1.00 125.57 ? 653  ALA A CB  1 
ATOM   4310  N N   . GLU A  1 641  ? 185.254 138.565 154.546 1.00 115.89 ? 654  GLU A N   1 
ATOM   4311  C CA  . GLU A  1 641  ? 186.259 137.722 153.942 1.00 115.89 ? 654  GLU A CA  1 
ATOM   4312  C C   . GLU A  1 641  ? 186.947 138.461 152.809 1.00 115.89 ? 654  GLU A C   1 
ATOM   4313  O O   . GLU A  1 641  ? 186.800 139.670 152.638 1.00 115.89 ? 654  GLU A O   1 
ATOM   4314  C CB  . GLU A  1 641  ? 185.648 136.413 153.463 1.00 115.89 ? 654  GLU A CB  1 
ATOM   4315  C CG  . GLU A  1 641  ? 185.590 135.396 154.561 1.00 115.89 ? 654  GLU A CG  1 
ATOM   4316  C CD  . GLU A  1 641  ? 184.605 135.790 155.626 1.00 115.89 ? 654  GLU A CD  1 
ATOM   4317  O OE1 . GLU A  1 641  ? 183.602 136.446 155.288 1.00 115.89 ? 654  GLU A OE1 1 
ATOM   4318  O OE2 . GLU A  1 641  ? 184.847 135.491 156.804 1.00 115.89 ? 654  GLU A OE2 1 
ATOM   4319  N N   . HIS A  1 642  ? 187.693 137.706 152.030 1.00 93.04  ? 655  HIS A N   1 
ATOM   4320  C CA  . HIS A  1 642  ? 188.768 138.231 151.207 1.00 93.04  ? 655  HIS A CA  1 
ATOM   4321  C C   . HIS A  1 642  ? 188.552 137.798 149.763 1.00 93.04  ? 655  HIS A C   1 
ATOM   4322  O O   . HIS A  1 642  ? 188.851 136.659 149.400 1.00 93.04  ? 655  HIS A O   1 
ATOM   4323  C CB  . HIS A  1 642  ? 190.081 137.711 151.767 1.00 93.04  ? 655  HIS A CB  1 
ATOM   4324  C CG  . HIS A  1 642  ? 191.289 138.303 151.139 1.00 93.04  ? 655  HIS A CG  1 
ATOM   4325  N ND1 . HIS A  1 642  ? 192.529 137.712 151.228 1.00 93.04  ? 655  HIS A ND1 1 
ATOM   4326  C CD2 . HIS A  1 642  ? 191.457 139.436 150.423 1.00 93.04  ? 655  HIS A CD2 1 
ATOM   4327  C CE1 . HIS A  1 642  ? 193.413 138.459 150.595 1.00 93.04  ? 655  HIS A CE1 1 
ATOM   4328  N NE2 . HIS A  1 642  ? 192.789 139.512 150.100 1.00 93.04  ? 655  HIS A NE2 1 
ATOM   4329  N N   . VAL A  1 643  ? 188.052 138.704 148.939 1.00 93.86  ? 656  VAL A N   1 
ATOM   4330  C CA  . VAL A  1 643  ? 187.663 138.389 147.578 1.00 93.86  ? 656  VAL A CA  1 
ATOM   4331  C C   . VAL A  1 643  ? 188.563 139.132 146.611 1.00 93.86  ? 656  VAL A C   1 
ATOM   4332  O O   . VAL A  1 643  ? 188.985 140.260 146.859 1.00 93.86  ? 656  VAL A O   1 
ATOM   4333  C CB  . VAL A  1 643  ? 186.188 138.737 147.345 1.00 93.86  ? 656  VAL A CB  1 
ATOM   4334  C CG1 . VAL A  1 643  ? 185.850 138.693 145.901 1.00 93.86  ? 656  VAL A CG1 1 
ATOM   4335  C CG2 . VAL A  1 643  ? 185.337 137.755 148.080 1.00 93.86  ? 656  VAL A CG2 1 
ATOM   4336  N N   . ASN A  1 644  ? 188.845 138.491 145.480 1.00 101.66 ? 657  ASN A N   1 
ATOM   4337  C CA  . ASN A  1 644  ? 189.811 139.017 144.527 1.00 101.66 ? 657  ASN A CA  1 
ATOM   4338  C C   . ASN A  1 644  ? 189.156 139.808 143.401 1.00 101.66 ? 657  ASN A C   1 
ATOM   4339  O O   . ASN A  1 644  ? 189.498 140.972 143.184 1.00 101.66 ? 657  ASN A O   1 
ATOM   4340  C CB  . ASN A  1 644  ? 190.642 137.875 143.947 1.00 101.66 ? 657  ASN A CB  1 
ATOM   4341  C CG  . ASN A  1 644  ? 191.579 137.281 144.956 1.00 101.66 ? 657  ASN A CG  1 
ATOM   4342  O OD1 . ASN A  1 644  ? 191.269 137.210 146.140 1.00 101.66 ? 657  ASN A OD1 1 
ATOM   4343  N ND2 . ASN A  1 644  ? 192.736 136.850 144.493 1.00 101.66 ? 657  ASN A ND2 1 
ATOM   4344  N N   . ASN A  1 645  ? 188.243 139.194 142.659 1.00 113.38 ? 658  ASN A N   1 
ATOM   4345  C CA  . ASN A  1 645  ? 187.572 139.937 141.607 1.00 113.38 ? 658  ASN A CA  1 
ATOM   4346  C C   . ASN A  1 645  ? 186.830 141.108 142.218 1.00 113.38 ? 658  ASN A C   1 
ATOM   4347  O O   . ASN A  1 645  ? 186.265 141.011 143.307 1.00 113.38 ? 658  ASN A O   1 
ATOM   4348  C CB  . ASN A  1 645  ? 186.600 139.046 140.853 1.00 113.38 ? 658  ASN A CB  1 
ATOM   4349  C CG  . ASN A  1 645  ? 185.666 138.329 141.772 1.00 113.38 ? 658  ASN A CG  1 
ATOM   4350  O OD1 . ASN A  1 645  ? 185.961 138.161 142.948 1.00 113.38 ? 658  ASN A OD1 1 
ATOM   4351  N ND2 . ASN A  1 645  ? 184.526 137.904 141.251 1.00 113.38 ? 658  ASN A ND2 1 
ATOM   4352  N N   . SER A  1 646  ? 186.841 142.228 141.515 1.00 116.75 ? 659  SER A N   1 
ATOM   4353  C CA  . SER A  1 646  ? 186.426 143.494 142.089 1.00 116.75 ? 659  SER A CA  1 
ATOM   4354  C C   . SER A  1 646  ? 185.041 143.865 141.587 1.00 116.75 ? 659  SER A C   1 
ATOM   4355  O O   . SER A  1 646  ? 184.783 143.827 140.383 1.00 116.75 ? 659  SER A O   1 
ATOM   4356  C CB  . SER A  1 646  ? 187.434 144.584 141.743 1.00 116.75 ? 659  SER A CB  1 
ATOM   4357  O OG  . SER A  1 646  ? 186.921 145.856 142.057 1.00 116.75 ? 659  SER A OG  1 
ATOM   4358  N N   . TYR A  1 647  ? 184.150 144.214 142.514 1.00 116.19 ? 660  TYR A N   1 
ATOM   4359  C CA  . TYR A  1 647  ? 182.806 144.621 142.132 1.00 116.19 ? 660  TYR A CA  1 
ATOM   4360  C C   . TYR A  1 647  ? 182.473 146.015 142.633 1.00 116.19 ? 660  TYR A C   1 
ATOM   4361  O O   . TYR A  1 647  ? 183.277 146.643 143.327 1.00 116.19 ? 660  TYR A O   1 
ATOM   4362  C CB  . TYR A  1 647  ? 181.760 143.655 142.668 1.00 116.19 ? 660  TYR A CB  1 
ATOM   4363  C CG  . TYR A  1 647  ? 181.891 142.224 142.249 1.00 116.19 ? 660  TYR A CG  1 
ATOM   4364  C CD1 . TYR A  1 647  ? 182.407 141.883 141.007 1.00 116.19 ? 660  TYR A CD1 1 
ATOM   4365  C CD2 . TYR A  1 647  ? 181.455 141.207 143.082 1.00 116.19 ? 660  TYR A CD2 1 
ATOM   4366  C CE1 . TYR A  1 647  ? 182.508 140.567 140.620 1.00 116.19 ? 660  TYR A CE1 1 
ATOM   4367  C CE2 . TYR A  1 647  ? 181.550 139.891 142.701 1.00 116.19 ? 660  TYR A CE2 1 
ATOM   4368  C CZ  . TYR A  1 647  ? 182.075 139.579 141.470 1.00 116.19 ? 660  TYR A CZ  1 
ATOM   4369  O OH  . TYR A  1 647  ? 182.179 138.268 141.087 1.00 116.19 ? 660  TYR A OH  1 
ATOM   4370  N N   . GLU A  1 648  ? 181.295 146.512 142.267 1.00 126.21 ? 661  GLU A N   1 
ATOM   4371  C CA  . GLU A  1 648  ? 180.867 147.825 142.709 1.00 126.21 ? 661  GLU A CA  1 
ATOM   4372  C C   . GLU A  1 648  ? 180.654 147.786 144.204 1.00 126.21 ? 661  GLU A C   1 
ATOM   4373  O O   . GLU A  1 648  ? 180.437 146.722 144.789 1.00 126.21 ? 661  GLU A O   1 
ATOM   4374  C CB  . GLU A  1 648  ? 179.571 148.248 142.029 1.00 126.21 ? 661  GLU A CB  1 
ATOM   4375  C CG  . GLU A  1 648  ? 179.547 148.080 140.519 1.00 126.21 ? 661  GLU A CG  1 
ATOM   4376  C CD  . GLU A  1 648  ? 180.137 149.256 139.786 1.00 126.21 ? 661  GLU A CD  1 
ATOM   4377  O OE1 . GLU A  1 648  ? 180.829 150.064 140.436 1.00 126.21 ? 661  GLU A OE1 1 
ATOM   4378  O OE2 . GLU A  1 648  ? 179.884 149.381 138.568 1.00 126.21 ? 661  GLU A OE2 1 
ATOM   4379  N N   . CYS A  1 649  ? 180.725 148.946 144.836 1.00 125.99 ? 662  CYS A N   1 
ATOM   4380  C CA  . CYS A  1 649  ? 180.789 148.971 146.287 1.00 125.99 ? 662  CYS A CA  1 
ATOM   4381  C C   . CYS A  1 649  ? 179.654 149.826 146.824 1.00 125.99 ? 662  CYS A C   1 
ATOM   4382  O O   . CYS A  1 649  ? 179.456 150.966 146.390 1.00 125.99 ? 662  CYS A O   1 
ATOM   4383  C CB  . CYS A  1 649  ? 182.136 149.472 146.778 1.00 125.99 ? 662  CYS A CB  1 
ATOM   4384  S SG  . CYS A  1 649  ? 182.142 151.070 147.570 1.00 125.99 ? 662  CYS A SG  1 
ATOM   4385  N N   . ASP A  1 650  ? 178.883 149.249 147.732 1.00 124.78 ? 663  ASP A N   1 
ATOM   4386  C CA  . ASP A  1 650  ? 177.700 149.897 148.265 1.00 124.78 ? 663  ASP A CA  1 
ATOM   4387  C C   . ASP A  1 650  ? 177.949 150.589 149.594 1.00 124.78 ? 663  ASP A C   1 
ATOM   4388  O O   . ASP A  1 650  ? 177.799 151.806 149.677 1.00 124.78 ? 663  ASP A O   1 
ATOM   4389  C CB  . ASP A  1 650  ? 176.588 148.867 148.375 1.00 124.78 ? 663  ASP A CB  1 
ATOM   4390  C CG  . ASP A  1 650  ? 177.097 147.560 148.881 1.00 124.78 ? 663  ASP A CG  1 
ATOM   4391  O OD1 . ASP A  1 650  ? 178.311 147.500 149.151 1.00 124.78 ? 663  ASP A OD1 1 
ATOM   4392  O OD2 . ASP A  1 650  ? 176.323 146.583 148.943 1.00 124.78 ? 663  ASP A OD2 1 
ATOM   4393  N N   . ILE A  1 651  ? 178.343 149.856 150.630 1.00 123.45 ? 664  ILE A N   1 
ATOM   4394  C CA  . ILE A  1 651  ? 178.535 150.408 151.967 1.00 123.45 ? 664  ILE A CA  1 
ATOM   4395  C C   . ILE A  1 651  ? 180.031 150.493 152.229 1.00 123.45 ? 664  ILE A C   1 
ATOM   4396  O O   . ILE A  1 651  ? 180.710 149.467 152.215 1.00 123.45 ? 664  ILE A O   1 
ATOM   4397  C CB  . ILE A  1 651  ? 177.862 149.570 153.068 1.00 123.45 ? 664  ILE A CB  1 
ATOM   4398  C CG1 . ILE A  1 651  ? 176.391 149.341 152.757 1.00 123.45 ? 664  ILE A CG1 1 
ATOM   4399  C CG2 . ILE A  1 651  ? 177.990 150.267 154.410 1.00 123.45 ? 664  ILE A CG2 1 
ATOM   4400  C CD1 . ILE A  1 651  ? 175.715 148.483 153.776 1.00 123.45 ? 664  ILE A CD1 1 
ATOM   4401  N N   . PRO A  1 652  ? 180.574 151.665 152.502 1.00 113.09 ? 665  PRO A N   1 
ATOM   4402  C CA  . PRO A  1 652  ? 182.018 151.796 152.660 1.00 113.09 ? 665  PRO A CA  1 
ATOM   4403  C C   . PRO A  1 652  ? 182.473 151.236 153.990 1.00 113.09 ? 665  PRO A C   1 
ATOM   4404  O O   . PRO A  1 652  ? 181.672 150.878 154.848 1.00 113.09 ? 665  PRO A O   1 
ATOM   4405  C CB  . PRO A  1 652  ? 182.226 153.302 152.604 1.00 113.09 ? 665  PRO A CB  1 
ATOM   4406  C CG  . PRO A  1 652  ? 180.981 153.821 153.222 1.00 113.09 ? 665  PRO A CG  1 
ATOM   4407  C CD  . PRO A  1 652  ? 179.872 152.907 152.831 1.00 113.09 ? 665  PRO A CD  1 
ATOM   4408  N N   . ILE A  1 653  ? 183.791 151.150 154.135 1.00 109.12 ? 666  ILE A N   1 
ATOM   4409  C CA  . ILE A  1 653  ? 184.425 150.682 155.361 1.00 109.12 ? 666  ILE A CA  1 
ATOM   4410  C C   . ILE A  1 653  ? 185.548 151.625 155.759 1.00 109.12 ? 666  ILE A C   1 
ATOM   4411  O O   . ILE A  1 653  ? 185.602 152.112 156.890 1.00 109.12 ? 666  ILE A O   1 
ATOM   4412  C CB  . ILE A  1 653  ? 184.953 149.258 155.173 1.00 109.12 ? 666  ILE A CB  1 
ATOM   4413  C CG1 . ILE A  1 653  ? 183.783 148.326 154.875 1.00 109.12 ? 666  ILE A CG1 1 
ATOM   4414  C CG2 . ILE A  1 653  ? 185.728 148.841 156.387 1.00 109.12 ? 666  ILE A CG2 1 
ATOM   4415  C CD1 . ILE A  1 653  ? 184.141 147.142 154.047 1.00 109.12 ? 666  ILE A CD1 1 
ATOM   4416  N N   . GLY A  1 654  ? 186.451 151.882 154.824 1.00 110.73 ? 667  GLY A N   1 
ATOM   4417  C CA  . GLY A  1 654  ? 187.606 152.729 155.038 1.00 110.73 ? 667  GLY A CA  1 
ATOM   4418  C C   . GLY A  1 654  ? 188.637 152.443 153.966 1.00 110.73 ? 667  GLY A C   1 
ATOM   4419  O O   . GLY A  1 654  ? 188.693 151.322 153.458 1.00 110.73 ? 667  GLY A O   1 
ATOM   4420  N N   . ALA A  1 655  ? 189.426 153.439 153.578 1.00 101.32 ? 668  ALA A N   1 
ATOM   4421  C CA  . ALA A  1 655  ? 190.498 153.242 152.606 1.00 101.32 ? 668  ALA A CA  1 
ATOM   4422  C C   . ALA A  1 655  ? 190.012 152.526 151.364 1.00 101.32 ? 668  ALA A C   1 
ATOM   4423  O O   . ALA A  1 655  ? 190.764 151.790 150.729 1.00 101.32 ? 668  ALA A O   1 
ATOM   4424  C CB  . ALA A  1 655  ? 191.671 152.478 153.213 1.00 101.32 ? 668  ALA A CB  1 
ATOM   4425  N N   . GLY A  1 656  ? 188.752 152.700 151.022 1.00 102.39 ? 669  GLY A N   1 
ATOM   4426  C CA  . GLY A  1 656  ? 188.274 152.157 149.778 1.00 102.39 ? 669  GLY A CA  1 
ATOM   4427  C C   . GLY A  1 656  ? 188.070 150.662 149.802 1.00 102.39 ? 669  GLY A C   1 
ATOM   4428  O O   . GLY A  1 656  ? 188.689 149.932 149.027 1.00 102.39 ? 669  GLY A O   1 
ATOM   4429  N N   . ILE A  1 657  ? 187.199 150.185 150.681 1.00 110.01 ? 670  ILE A N   1 
ATOM   4430  C CA  . ILE A  1 657  ? 186.780 148.790 150.675 1.00 110.01 ? 670  ILE A CA  1 
ATOM   4431  C C   . ILE A  1 657  ? 185.290 148.724 150.953 1.00 110.01 ? 670  ILE A C   1 
ATOM   4432  O O   . ILE A  1 657  ? 184.807 149.354 151.897 1.00 110.01 ? 670  ILE A O   1 
ATOM   4433  C CB  . ILE A  1 657  ? 187.545 147.949 151.704 1.00 110.01 ? 670  ILE A CB  1 
ATOM   4434  C CG1 . ILE A  1 657  ? 189.008 147.791 151.299 1.00 110.01 ? 670  ILE A CG1 1 
ATOM   4435  C CG2 . ILE A  1 657  ? 186.902 146.608 151.820 1.00 110.01 ? 670  ILE A CG2 1 
ATOM   4436  C CD1 . ILE A  1 657  ? 189.916 148.878 151.821 1.00 110.01 ? 670  ILE A CD1 1 
ATOM   4437  N N   . CYS A  1 658  ? 184.558 147.959 150.141 1.00 121.90 ? 671  CYS A N   1 
ATOM   4438  C CA  . CYS A  1 658  ? 183.120 147.810 150.312 1.00 121.90 ? 671  CYS A CA  1 
ATOM   4439  C C   . CYS A  1 658  ? 182.711 146.373 150.017 1.00 121.90 ? 671  CYS A C   1 
ATOM   4440  O O   . CYS A  1 658  ? 183.478 145.567 149.479 1.00 121.90 ? 671  CYS A O   1 
ATOM   4441  C CB  . CYS A  1 658  ? 182.322 148.712 149.368 1.00 121.90 ? 671  CYS A CB  1 
ATOM   4442  S SG  . CYS A  1 658  ? 182.409 150.517 149.499 1.00 121.90 ? 671  CYS A SG  1 
ATOM   4443  N N   . ALA A  1 659  ? 181.459 146.082 150.327 1.00 129.65 ? 672  ALA A N   1 
ATOM   4444  C CA  . ALA A  1 659  ? 180.872 144.819 149.960 1.00 129.65 ? 672  ALA A CA  1 
ATOM   4445  C C   . ALA A  1 659  ? 180.339 144.928 148.543 1.00 129.65 ? 672  ALA A C   1 
ATOM   4446  O O   . ALA A  1 659  ? 179.128 144.880 148.340 1.00 129.65 ? 672  ALA A O   1 
ATOM   4447  C CB  . ALA A  1 659  ? 179.754 144.419 150.949 1.00 129.65 ? 672  ALA A CB  1 
ATOM   4448  N N   . SER A  1 673  ? 175.468 141.458 147.786 1.00 131.66 ? 686  SER A N   1 
ATOM   4449  C CA  . SER A  1 673  ? 176.240 140.413 147.135 1.00 131.66 ? 686  SER A CA  1 
ATOM   4450  C C   . SER A  1 673  ? 176.298 139.191 148.017 1.00 131.66 ? 686  SER A C   1 
ATOM   4451  O O   . SER A  1 673  ? 177.200 138.372 147.887 1.00 131.66 ? 686  SER A O   1 
ATOM   4452  C CB  . SER A  1 673  ? 177.631 140.900 146.826 1.00 131.66 ? 686  SER A CB  1 
ATOM   4453  N N   . VAL A  1 674  ? 175.312 139.075 148.902 1.00 134.78 ? 687  VAL A N   1 
ATOM   4454  C CA  . VAL A  1 674  ? 175.357 138.135 150.013 1.00 134.78 ? 687  VAL A CA  1 
ATOM   4455  C C   . VAL A  1 674  ? 175.705 136.743 149.526 1.00 134.78 ? 687  VAL A C   1 
ATOM   4456  O O   . VAL A  1 674  ? 174.940 136.120 148.788 1.00 134.78 ? 687  VAL A O   1 
ATOM   4457  C CB  . VAL A  1 674  ? 174.026 138.122 150.771 1.00 134.78 ? 687  VAL A CB  1 
ATOM   4458  C CG1 . VAL A  1 674  ? 174.018 136.985 151.756 1.00 134.78 ? 687  VAL A CG1 1 
ATOM   4459  C CG2 . VAL A  1 674  ? 173.834 139.436 151.485 1.00 134.78 ? 687  VAL A CG2 1 
ATOM   4460  N N   . ALA A  1 675  ? 176.856 136.243 149.953 1.00 139.98 ? 688  ALA A N   1 
ATOM   4461  C CA  . ALA A  1 675  ? 177.393 134.985 149.450 1.00 139.98 ? 688  ALA A CA  1 
ATOM   4462  C C   . ALA A  1 675  ? 176.934 133.872 150.376 1.00 139.98 ? 688  ALA A C   1 
ATOM   4463  O O   . ALA A  1 675  ? 177.718 133.317 151.144 1.00 139.98 ? 688  ALA A O   1 
ATOM   4464  C CB  . ALA A  1 675  ? 178.909 135.040 149.360 1.00 139.98 ? 688  ALA A CB  1 
ATOM   4465  N N   . SER A  1 676  ? 175.656 133.530 150.274 1.00 159.24 ? 689  SER A N   1 
ATOM   4466  C CA  . SER A  1 676  ? 175.051 132.460 151.058 1.00 159.24 ? 689  SER A CA  1 
ATOM   4467  C C   . SER A  1 676  ? 175.245 132.688 152.555 1.00 159.24 ? 689  SER A C   1 
ATOM   4468  O O   . SER A  1 676  ? 175.896 131.911 153.256 1.00 159.24 ? 689  SER A O   1 
ATOM   4469  C CB  . SER A  1 676  ? 175.591 131.090 150.650 1.00 159.24 ? 689  SER A CB  1 
ATOM   4470  O OG  . SER A  1 676  ? 175.133 130.095 151.552 1.00 159.24 ? 689  SER A OG  1 
ATOM   4471  N N   . GLN A  1 677  ? 174.621 133.758 153.042 1.00 159.64 ? 690  GLN A N   1 
ATOM   4472  C CA  . GLN A  1 677  ? 174.500 134.030 154.471 1.00 159.64 ? 690  GLN A CA  1 
ATOM   4473  C C   . GLN A  1 677  ? 175.874 134.208 155.122 1.00 159.64 ? 690  GLN A C   1 
ATOM   4474  O O   . GLN A  1 677  ? 176.283 133.459 156.004 1.00 159.64 ? 690  GLN A O   1 
ATOM   4475  C CB  . GLN A  1 677  ? 173.715 132.910 155.160 1.00 159.64 ? 690  GLN A CB  1 
ATOM   4476  C CG  . GLN A  1 677  ? 172.419 132.504 154.470 1.00 159.64 ? 690  GLN A CG  1 
ATOM   4477  C CD  . GLN A  1 677  ? 172.631 131.556 153.297 1.00 159.64 ? 690  GLN A CD  1 
ATOM   4478  O OE1 . GLN A  1 677  ? 173.259 130.505 153.431 1.00 159.64 ? 690  GLN A OE1 1 
ATOM   4479  N NE2 . GLN A  1 677  ? 172.118 131.938 152.136 1.00 159.64 ? 690  GLN A NE2 1 
ATOM   4480  N N   . SER A  1 678  ? 176.577 135.238 154.660 1.00 138.88 ? 691  SER A N   1 
ATOM   4481  C CA  . SER A  1 678  ? 177.866 135.600 155.230 1.00 138.88 ? 691  SER A CA  1 
ATOM   4482  C C   . SER A  1 678  ? 178.214 137.007 154.781 1.00 138.88 ? 691  SER A C   1 
ATOM   4483  O O   . SER A  1 678  ? 177.701 137.487 153.770 1.00 138.88 ? 691  SER A O   1 
ATOM   4484  C CB  . SER A  1 678  ? 178.971 134.621 154.837 1.00 138.88 ? 691  SER A CB  1 
ATOM   4485  O OG  . SER A  1 678  ? 180.041 134.705 155.759 1.00 138.88 ? 691  SER A OG  1 
ATOM   4486  N N   . ILE A  1 679  ? 179.064 137.669 155.546 1.00 122.61 ? 692  ILE A N   1 
ATOM   4487  C CA  . ILE A  1 679  ? 179.499 139.010 155.189 1.00 122.61 ? 692  ILE A CA  1 
ATOM   4488  C C   . ILE A  1 679  ? 180.764 138.937 154.351 1.00 122.61 ? 692  ILE A C   1 
ATOM   4489  O O   . ILE A  1 679  ? 181.769 138.356 154.770 1.00 122.61 ? 692  ILE A O   1 
ATOM   4490  C CB  . ILE A  1 679  ? 179.714 139.850 156.446 1.00 122.61 ? 692  ILE A CB  1 
ATOM   4491  C CG1 . ILE A  1 679  ? 178.353 140.234 156.998 1.00 122.61 ? 692  ILE A CG1 1 
ATOM   4492  C CG2 . ILE A  1 679  ? 180.577 141.022 156.131 1.00 122.61 ? 692  ILE A CG2 1 
ATOM   4493  C CD1 . ILE A  1 679  ? 177.429 140.735 155.932 1.00 122.61 ? 692  ILE A CD1 1 
ATOM   4494  N N   . ILE A  1 680  ? 180.725 139.550 153.169 1.00 128.18 ? 693  ILE A N   1 
ATOM   4495  C CA  . ILE A  1 680  ? 181.845 139.533 152.244 1.00 128.18 ? 693  ILE A CA  1 
ATOM   4496  C C   . ILE A  1 680  ? 182.240 140.964 151.940 1.00 128.18 ? 693  ILE A C   1 
ATOM   4497  O O   . ILE A  1 680  ? 181.427 141.885 152.021 1.00 128.18 ? 693  ILE A O   1 
ATOM   4498  C CB  . ILE A  1 680  ? 181.502 138.808 150.942 1.00 128.18 ? 693  ILE A CB  1 
ATOM   4499  C CG1 . ILE A  1 680  ? 180.557 139.665 150.115 1.00 128.18 ? 693  ILE A CG1 1 
ATOM   4500  C CG2 . ILE A  1 680  ? 180.815 137.516 151.250 1.00 128.18 ? 693  ILE A CG2 1 
ATOM   4501  C CD1 . ILE A  1 680  ? 180.346 139.156 148.715 1.00 128.18 ? 693  ILE A CD1 1 
ATOM   4502  N N   . ALA A  1 681  ? 183.501 141.143 151.561 1.00 126.93 ? 694  ALA A N   1 
ATOM   4503  C CA  . ALA A  1 681  ? 184.007 142.485 151.304 1.00 126.93 ? 694  ALA A CA  1 
ATOM   4504  C C   . ALA A  1 681  ? 185.206 142.424 150.374 1.00 126.93 ? 694  ALA A C   1 
ATOM   4505  O O   . ALA A  1 681  ? 186.157 141.686 150.645 1.00 126.93 ? 694  ALA A O   1 
ATOM   4506  C CB  . ALA A  1 681  ? 184.398 143.171 152.610 1.00 126.93 ? 694  ALA A CB  1 
ATOM   4507  N N   . TYR A  1 682  ? 185.176 143.222 149.306 1.00 116.71 ? 695  TYR A N   1 
ATOM   4508  C CA  . TYR A  1 682  ? 186.290 143.335 148.378 1.00 116.71 ? 695  TYR A CA  1 
ATOM   4509  C C   . TYR A  1 682  ? 186.642 144.796 148.224 1.00 116.71 ? 695  TYR A C   1 
ATOM   4510  O O   . TYR A  1 682  ? 185.905 145.678 148.654 1.00 116.71 ? 695  TYR A O   1 
ATOM   4511  C CB  . TYR A  1 682  ? 185.957 142.772 147.006 1.00 116.71 ? 695  TYR A CB  1 
ATOM   4512  C CG  . TYR A  1 682  ? 184.601 143.203 146.538 1.00 116.71 ? 695  TYR A CG  1 
ATOM   4513  C CD1 . TYR A  1 682  ? 184.356 144.503 146.168 1.00 116.71 ? 695  TYR A CD1 1 
ATOM   4514  C CD2 . TYR A  1 682  ? 183.547 142.318 146.516 1.00 116.71 ? 695  TYR A CD2 1 
ATOM   4515  C CE1 . TYR A  1 682  ? 183.118 144.897 145.759 1.00 116.71 ? 695  TYR A CE1 1 
ATOM   4516  C CE2 . TYR A  1 682  ? 182.303 142.705 146.097 1.00 116.71 ? 695  TYR A CE2 1 
ATOM   4517  C CZ  . TYR A  1 682  ? 182.094 144.000 145.735 1.00 116.71 ? 695  TYR A CZ  1 
ATOM   4518  O OH  . TYR A  1 682  ? 180.851 144.403 145.321 1.00 116.71 ? 695  TYR A OH  1 
ATOM   4519  N N   . THR A  1 683  ? 187.769 145.055 147.589 1.00 117.26 ? 696  THR A N   1 
ATOM   4520  C CA  . THR A  1 683  ? 188.040 146.419 147.179 1.00 117.26 ? 696  THR A CA  1 
ATOM   4521  C C   . THR A  1 683  ? 187.210 146.742 145.945 1.00 117.26 ? 696  THR A C   1 
ATOM   4522  O O   . THR A  1 683  ? 186.969 145.880 145.098 1.00 117.26 ? 696  THR A O   1 
ATOM   4523  C CB  . THR A  1 683  ? 189.518 146.607 146.904 1.00 117.26 ? 696  THR A CB  1 
ATOM   4524  O OG1 . THR A  1 683  ? 189.825 146.069 145.616 1.00 117.26 ? 696  THR A OG1 1 
ATOM   4525  C CG2 . THR A  1 683  ? 190.321 145.883 147.959 1.00 117.26 ? 696  THR A CG2 1 
ATOM   4526  N N   . MET A  1 684  ? 186.765 147.988 145.850 1.00 115.85 ? 697  MET A N   1 
ATOM   4527  C CA  . MET A  1 684  ? 185.657 148.322 144.970 1.00 115.85 ? 697  MET A CA  1 
ATOM   4528  C C   . MET A  1 684  ? 186.035 148.232 143.503 1.00 115.85 ? 697  MET A C   1 
ATOM   4529  O O   . MET A  1 684  ? 187.204 148.337 143.128 1.00 115.85 ? 697  MET A O   1 
ATOM   4530  C CB  . MET A  1 684  ? 185.165 149.723 145.270 1.00 115.85 ? 697  MET A CB  1 
ATOM   4531  C CG  . MET A  1 684  ? 186.261 150.712 145.356 1.00 115.85 ? 697  MET A CG  1 
ATOM   4532  S SD  . MET A  1 684  ? 185.637 152.197 146.121 1.00 115.85 ? 697  MET A SD  1 
ATOM   4533  C CE  . MET A  1 684  ? 184.236 152.554 145.076 1.00 115.85 ? 697  MET A CE  1 
ATOM   4534  N N   . SER A  1 685  ? 185.021 148.033 142.666 1.00 122.11 ? 698  SER A N   1 
ATOM   4535  C CA  . SER A  1 685  ? 185.209 148.154 141.228 1.00 122.11 ? 698  SER A CA  1 
ATOM   4536  C C   . SER A  1 685  ? 185.441 149.607 140.893 1.00 122.11 ? 698  SER A C   1 
ATOM   4537  O O   . SER A  1 685  ? 184.493 150.393 140.823 1.00 122.11 ? 698  SER A O   1 
ATOM   4538  C CB  . SER A  1 685  ? 184.002 147.644 140.456 1.00 122.11 ? 698  SER A CB  1 
ATOM   4539  O OG  . SER A  1 685  ? 183.096 148.707 140.222 1.00 122.11 ? 698  SER A OG  1 
ATOM   4540  N N   . LEU A  1 686  ? 186.698 149.963 140.682 1.00 112.40 ? 699  LEU A N   1 
ATOM   4541  C CA  . LEU A  1 686  ? 186.984 151.199 139.988 1.00 112.40 ? 699  LEU A CA  1 
ATOM   4542  C C   . LEU A  1 686  ? 186.024 151.398 138.836 1.00 112.40 ? 699  LEU A C   1 
ATOM   4543  O O   . LEU A  1 686  ? 185.505 152.499 138.642 1.00 112.40 ? 699  LEU A O   1 
ATOM   4544  C CB  . LEU A  1 686  ? 188.432 151.178 139.512 1.00 112.40 ? 699  LEU A CB  1 
ATOM   4545  C CG  . LEU A  1 686  ? 188.809 150.299 138.318 1.00 112.40 ? 699  LEU A CG  1 
ATOM   4546  C CD1 . LEU A  1 686  ? 190.249 150.553 137.924 1.00 112.40 ? 699  LEU A CD1 1 
ATOM   4547  C CD2 . LEU A  1 686  ? 188.592 148.817 138.583 1.00 112.40 ? 699  LEU A CD2 1 
ATOM   4548  N N   . GLY A  1 687  ? 185.725 150.340 138.110 1.00 117.81 ? 700  GLY A N   1 
ATOM   4549  C CA  . GLY A  1 687  ? 184.859 150.424 136.954 1.00 117.81 ? 700  GLY A CA  1 
ATOM   4550  C C   . GLY A  1 687  ? 185.311 149.457 135.884 1.00 117.81 ? 700  GLY A C   1 
ATOM   4551  O O   . GLY A  1 687  ? 186.245 148.679 136.061 1.00 117.81 ? 700  GLY A O   1 
ATOM   4552  N N   . ALA A  1 688  ? 184.617 149.515 134.755 1.00 114.92 ? 701  ALA A N   1 
ATOM   4553  C CA  . ALA A  1 688  ? 184.944 148.640 133.640 1.00 114.92 ? 701  ALA A CA  1 
ATOM   4554  C C   . ALA A  1 688  ? 186.246 149.081 132.991 1.00 114.92 ? 701  ALA A C   1 
ATOM   4555  O O   . ALA A  1 688  ? 186.331 150.171 132.424 1.00 114.92 ? 701  ALA A O   1 
ATOM   4556  C CB  . ALA A  1 688  ? 183.806 148.643 132.626 1.00 114.92 ? 701  ALA A CB  1 
ATOM   4557  N N   . GLU A  1 689  ? 187.263 148.233 133.073 1.00 112.70 ? 702  GLU A N   1 
ATOM   4558  C CA  . GLU A  1 689  ? 188.589 148.571 132.565 1.00 112.70 ? 702  GLU A CA  1 
ATOM   4559  C C   . GLU A  1 689  ? 188.638 148.246 131.081 1.00 112.70 ? 702  GLU A C   1 
ATOM   4560  O O   . GLU A  1 689  ? 188.978 147.137 130.679 1.00 112.70 ? 702  GLU A O   1 
ATOM   4561  C CB  . GLU A  1 689  ? 189.660 147.819 133.339 1.00 112.70 ? 702  GLU A CB  1 
ATOM   4562  C CG  . GLU A  1 689  ? 191.061 148.338 133.128 1.00 112.70 ? 702  GLU A CG  1 
ATOM   4563  C CD  . GLU A  1 689  ? 191.864 147.466 132.199 1.00 112.70 ? 702  GLU A CD  1 
ATOM   4564  O OE1 . GLU A  1 689  ? 191.494 146.289 132.025 1.00 112.70 ? 702  GLU A OE1 1 
ATOM   4565  O OE2 . GLU A  1 689  ? 192.877 147.951 131.657 1.00 112.70 ? 702  GLU A OE2 1 
ATOM   4566  N N   . ASN A  1 690  ? 188.305 149.228 130.253 1.00 109.30 ? 703  ASN A N   1 
ATOM   4567  C CA  . ASN A  1 690  ? 188.305 149.014 128.811 1.00 109.30 ? 703  ASN A CA  1 
ATOM   4568  C C   . ASN A  1 690  ? 188.668 150.335 128.153 1.00 109.30 ? 703  ASN A C   1 
ATOM   4569  O O   . ASN A  1 690  ? 187.830 151.231 128.056 1.00 109.30 ? 703  ASN A O   1 
ATOM   4570  C CB  . ASN A  1 690  ? 186.951 148.528 128.351 1.00 109.30 ? 703  ASN A CB  1 
ATOM   4571  C CG  . ASN A  1 690  ? 185.853 149.338 128.930 1.00 109.30 ? 703  ASN A CG  1 
ATOM   4572  O OD1 . ASN A  1 690  ? 185.506 149.176 130.087 1.00 109.30 ? 703  ASN A OD1 1 
ATOM   4573  N ND2 . ASN A  1 690  ? 185.319 150.251 128.147 1.00 109.30 ? 703  ASN A ND2 1 
ATOM   4574  N N   . SER A  1 691  ? 189.907 150.446 127.703 1.00 111.80 ? 704  SER A N   1 
ATOM   4575  C CA  . SER A  1 691  ? 190.372 151.656 127.040 1.00 111.80 ? 704  SER A CA  1 
ATOM   4576  C C   . SER A  1 691  ? 190.231 151.456 125.542 1.00 111.80 ? 704  SER A C   1 
ATOM   4577  O O   . SER A  1 691  ? 191.075 150.816 124.914 1.00 111.80 ? 704  SER A O   1 
ATOM   4578  C CB  . SER A  1 691  ? 191.815 151.948 127.414 1.00 111.80 ? 704  SER A CB  1 
ATOM   4579  O OG  . SER A  1 691  ? 191.943 152.152 128.802 1.00 111.80 ? 704  SER A OG  1 
ATOM   4580  N N   . VAL A  1 692  ? 189.160 151.999 124.964 1.00 119.33 ? 705  VAL A N   1 
ATOM   4581  C CA  . VAL A  1 692  ? 188.999 151.924 123.520 1.00 119.33 ? 705  VAL A CA  1 
ATOM   4582  C C   . VAL A  1 692  ? 190.214 152.545 122.863 1.00 119.33 ? 705  VAL A C   1 
ATOM   4583  O O   . VAL A  1 692  ? 190.675 153.620 123.262 1.00 119.33 ? 705  VAL A O   1 
ATOM   4584  C CB  . VAL A  1 692  ? 187.704 152.613 123.075 1.00 119.33 ? 705  VAL A CB  1 
ATOM   4585  C CG1 . VAL A  1 692  ? 187.700 152.785 121.574 1.00 119.33 ? 705  VAL A CG1 1 
ATOM   4586  C CG2 . VAL A  1 692  ? 186.498 151.798 123.506 1.00 119.33 ? 705  VAL A CG2 1 
ATOM   4587  N N   . ALA A  1 693  ? 190.753 151.855 121.869 1.00 117.10 ? 706  ALA A N   1 
ATOM   4588  C CA  . ALA A  1 693  ? 192.034 152.224 121.304 1.00 117.10 ? 706  ALA A CA  1 
ATOM   4589  C C   . ALA A  1 693  ? 192.015 153.653 120.784 1.00 117.10 ? 706  ALA A C   1 
ATOM   4590  O O   . ALA A  1 693  ? 190.965 154.269 120.593 1.00 117.10 ? 706  ALA A O   1 
ATOM   4591  C CB  . ALA A  1 693  ? 192.411 151.273 120.171 1.00 117.10 ? 706  ALA A CB  1 
ATOM   4592  N N   . TYR A  1 694  ? 193.208 154.183 120.580 1.00 119.30 ? 707  TYR A N   1 
ATOM   4593  C CA  . TYR A  1 694  ? 193.389 155.432 119.872 1.00 119.30 ? 707  TYR A CA  1 
ATOM   4594  C C   . TYR A  1 694  ? 193.757 155.139 118.428 1.00 119.30 ? 707  TYR A C   1 
ATOM   4595  O O   . TYR A  1 694  ? 194.443 154.162 118.128 1.00 119.30 ? 707  TYR A O   1 
ATOM   4596  C CB  . TYR A  1 694  ? 194.472 156.276 120.520 1.00 119.30 ? 707  TYR A CB  1 
ATOM   4597  C CG  . TYR A  1 694  ? 194.827 157.478 119.702 1.00 119.30 ? 707  TYR A CG  1 
ATOM   4598  C CD1 . TYR A  1 694  ? 194.105 158.645 119.819 1.00 119.30 ? 707  TYR A CD1 1 
ATOM   4599  C CD2 . TYR A  1 694  ? 195.873 157.442 118.801 1.00 119.30 ? 707  TYR A CD2 1 
ATOM   4600  C CE1 . TYR A  1 694  ? 194.421 159.745 119.077 1.00 119.30 ? 707  TYR A CE1 1 
ATOM   4601  C CE2 . TYR A  1 694  ? 196.194 158.536 118.054 1.00 119.30 ? 707  TYR A CE2 1 
ATOM   4602  C CZ  . TYR A  1 694  ? 195.467 159.686 118.200 1.00 119.30 ? 707  TYR A CZ  1 
ATOM   4603  O OH  . TYR A  1 694  ? 195.786 160.792 117.460 1.00 119.30 ? 707  TYR A OH  1 
ATOM   4604  N N   . SER A  1 695  ? 193.305 156.005 117.534 1.00 125.14 ? 708  SER A N   1 
ATOM   4605  C CA  . SER A  1 695  ? 193.436 155.750 116.107 1.00 125.14 ? 708  SER A CA  1 
ATOM   4606  C C   . SER A  1 695  ? 193.497 157.092 115.410 1.00 125.14 ? 708  SER A C   1 
ATOM   4607  O O   . SER A  1 695  ? 192.452 157.688 115.146 1.00 125.14 ? 708  SER A O   1 
ATOM   4608  C CB  . SER A  1 695  ? 192.254 154.941 115.604 1.00 125.14 ? 708  SER A CB  1 
ATOM   4609  O OG  . SER A  1 695  ? 191.050 155.652 115.822 1.00 125.14 ? 708  SER A OG  1 
ATOM   4610  N N   . ASN A  1 696  ? 194.681 157.535 115.062 1.00 127.99 ? 709  ASN A N   1 
ATOM   4611  C CA  . ASN A  1 696  ? 194.715 158.921 114.619 1.00 127.99 ? 709  ASN A CA  1 
ATOM   4612  C C   . ASN A  1 696  ? 194.125 159.131 113.288 1.00 127.99 ? 709  ASN A C   1 
ATOM   4613  O O   . ASN A  1 696  ? 194.387 160.170 112.700 1.00 127.99 ? 709  ASN A O   1 
ATOM   4614  C CB  . ASN A  1 696  ? 196.139 159.458 114.625 1.00 127.99 ? 709  ASN A CB  1 
ATOM   4615  C CG  . ASN A  1 696  ? 197.041 158.723 113.687 1.00 127.99 ? 709  ASN A CG  1 
ATOM   4616  O OD1 . ASN A  1 696  ? 196.659 157.728 113.078 1.00 127.99 ? 709  ASN A OD1 1 
ATOM   4617  N ND2 . ASN A  1 696  ? 198.257 159.227 113.556 1.00 127.99 ? 709  ASN A ND2 1 
ATOM   4618  N N   . ASN A  1 697  ? 193.361 158.192 112.762 1.00 121.86 ? 710  ASN A N   1 
ATOM   4619  C CA  . ASN A  1 697  ? 192.611 158.439 111.543 1.00 121.86 ? 710  ASN A CA  1 
ATOM   4620  C C   . ASN A  1 697  ? 191.228 157.812 111.584 1.00 121.86 ? 710  ASN A C   1 
ATOM   4621  O O   . ASN A  1 697  ? 190.635 157.594 110.523 1.00 121.86 ? 710  ASN A O   1 
ATOM   4622  C CB  . ASN A  1 697  ? 193.373 157.905 110.358 1.00 121.86 ? 710  ASN A CB  1 
ATOM   4623  C CG  . ASN A  1 697  ? 193.856 156.525 110.600 1.00 121.86 ? 710  ASN A CG  1 
ATOM   4624  O OD1 . ASN A  1 697  ? 193.625 155.975 111.670 1.00 121.86 ? 710  ASN A OD1 1 
ATOM   4625  N ND2 . ASN A  1 697  ? 194.530 155.942 109.624 1.00 121.86 ? 710  ASN A ND2 1 
ATOM   4626  N N   . SER A  1 698  ? 190.700 157.497 112.764 1.00 117.77 ? 711  SER A N   1 
ATOM   4627  C CA  . SER A  1 698  ? 189.388 156.874 112.835 1.00 117.77 ? 711  SER A CA  1 
ATOM   4628  C C   . SER A  1 698  ? 188.760 157.043 114.212 1.00 117.77 ? 711  SER A C   1 
ATOM   4629  O O   . SER A  1 698  ? 189.410 156.845 115.242 1.00 117.77 ? 711  SER A O   1 
ATOM   4630  C CB  . SER A  1 698  ? 189.471 155.397 112.458 1.00 117.77 ? 711  SER A CB  1 
ATOM   4631  O OG  . SER A  1 698  ? 189.794 155.269 111.085 1.00 117.77 ? 711  SER A OG  1 
ATOM   4632  N N   . ILE A  1 699  ? 187.478 157.404 114.202 1.00 104.02 ? 712  ILE A N   1 
ATOM   4633  C CA  . ILE A  1 699  ? 186.699 157.700 115.395 1.00 104.02 ? 712  ILE A CA  1 
ATOM   4634  C C   . ILE A  1 699  ? 185.340 157.048 115.256 1.00 104.02 ? 712  ILE A C   1 
ATOM   4635  O O   . ILE A  1 699  ? 185.093 156.306 114.300 1.00 104.02 ? 712  ILE A O   1 
ATOM   4636  C CB  . ILE A  1 699  ? 186.549 159.202 115.587 1.00 104.02 ? 712  ILE A CB  1 
ATOM   4637  C CG1 . ILE A  1 699  ? 185.972 159.803 114.325 1.00 104.02 ? 712  ILE A CG1 1 
ATOM   4638  C CG2 . ILE A  1 699  ? 187.867 159.766 115.741 1.00 104.02 ? 712  ILE A CG2 1 
ATOM   4639  C CD1 . ILE A  1 699  ? 185.938 161.291 114.358 1.00 104.02 ? 712  ILE A CD1 1 
ATOM   4640  N N   . ALA A  1 700  ? 184.439 157.332 116.187 1.00 107.09 ? 713  ALA A N   1 
ATOM   4641  C CA  . ALA A  1 700  ? 183.145 156.662 116.223 1.00 107.09 ? 713  ALA A CA  1 
ATOM   4642  C C   . ALA A  1 700  ? 182.014 157.667 116.026 1.00 107.09 ? 713  ALA A C   1 
ATOM   4643  O O   . ALA A  1 700  ? 181.723 158.463 116.924 1.00 107.09 ? 713  ALA A O   1 
ATOM   4644  C CB  . ALA A  1 700  ? 182.983 155.898 117.532 1.00 107.09 ? 713  ALA A CB  1 
ATOM   4645  N N   . ILE A  1 701  ? 181.364 157.608 114.864 1.00 100.28 ? 714  ILE A N   1 
ATOM   4646  C CA  . ILE A  1 701  ? 180.206 158.443 114.548 1.00 100.28 ? 714  ILE A CA  1 
ATOM   4647  C C   . ILE A  1 701  ? 178.923 157.644 114.721 1.00 100.28 ? 714  ILE A C   1 
ATOM   4648  O O   . ILE A  1 701  ? 178.484 156.969 113.781 1.00 100.28 ? 714  ILE A O   1 
ATOM   4649  C CB  . ILE A  1 701  ? 180.297 158.992 113.124 1.00 100.28 ? 714  ILE A CB  1 
ATOM   4650  C CG1 . ILE A  1 701  ? 181.540 159.852 113.013 1.00 100.28 ? 714  ILE A CG1 1 
ATOM   4651  C CG2 . ILE A  1 701  ? 179.049 159.773 112.779 1.00 100.28 ? 714  ILE A CG2 1 
ATOM   4652  C CD1 . ILE A  1 701  ? 181.574 160.691 111.803 1.00 100.28 ? 714  ILE A CD1 1 
ATOM   4653  N N   . PRO A  1 702  ? 178.268 157.731 115.874 1.00 94.90  ? 715  PRO A N   1 
ATOM   4654  C CA  . PRO A  1 702  ? 177.162 156.816 116.181 1.00 94.90  ? 715  PRO A CA  1 
ATOM   4655  C C   . PRO A  1 702  ? 175.970 157.008 115.252 1.00 94.90  ? 715  PRO A C   1 
ATOM   4656  O O   . PRO A  1 702  ? 175.951 157.861 114.362 1.00 94.90  ? 715  PRO A O   1 
ATOM   4657  C CB  . PRO A  1 702  ? 176.818 157.159 117.632 1.00 94.90  ? 715  PRO A CB  1 
ATOM   4658  C CG  . PRO A  1 702  ? 177.352 158.528 117.839 1.00 94.90  ? 715  PRO A CG  1 
ATOM   4659  C CD  . PRO A  1 702  ? 178.541 158.670 116.968 1.00 94.90  ? 715  PRO A CD  1 
ATOM   4660  N N   . THR A  1 703  ? 174.961 156.158 115.457 1.00 92.26  ? 716  THR A N   1 
ATOM   4661  C CA  . THR A  1 703  ? 173.815 156.082 114.562 1.00 92.26  ? 716  THR A CA  1 
ATOM   4662  C C   . THR A  1 703  ? 172.465 156.140 115.242 1.00 92.26  ? 716  THR A C   1 
ATOM   4663  O O   . THR A  1 703  ? 171.554 156.775 114.708 1.00 92.26  ? 716  THR A O   1 
ATOM   4664  C CB  . THR A  1 703  ? 173.854 154.774 113.779 1.00 92.26  ? 716  THR A CB  1 
ATOM   4665  O OG1 . THR A  1 703  ? 173.599 153.697 114.683 1.00 92.26  ? 716  THR A OG1 1 
ATOM   4666  C CG2 . THR A  1 703  ? 175.208 154.580 113.170 1.00 92.26  ? 716  THR A CG2 1 
ATOM   4667  N N   . ASN A  1 704  ? 172.300 155.508 116.389 1.00 97.24  ? 717  ASN A N   1 
ATOM   4668  C CA  . ASN A  1 704  ? 170.989 155.247 116.949 1.00 97.24  ? 717  ASN A CA  1 
ATOM   4669  C C   . ASN A  1 704  ? 171.075 155.583 118.432 1.00 97.24  ? 717  ASN A C   1 
ATOM   4670  O O   . ASN A  1 704  ? 172.132 155.431 119.050 1.00 97.24  ? 717  ASN A O   1 
ATOM   4671  C CB  . ASN A  1 704  ? 170.608 153.782 116.680 1.00 97.24  ? 717  ASN A CB  1 
ATOM   4672  C CG  . ASN A  1 704  ? 169.114 153.554 116.543 1.00 97.24  ? 717  ASN A CG  1 
ATOM   4673  O OD1 . ASN A  1 704  ? 168.386 154.355 115.966 1.00 97.24  ? 717  ASN A OD1 1 
ATOM   4674  N ND2 . ASN A  1 704  ? 168.660 152.426 117.072 1.00 97.24  ? 717  ASN A ND2 1 
ATOM   4675  N N   . PHE A  1 705  ? 169.977 156.061 119.001 1.00 83.26  ? 718  PHE A N   1 
ATOM   4676  C CA  . PHE A  1 705  ? 170.091 156.799 120.243 1.00 83.26  ? 718  PHE A CA  1 
ATOM   4677  C C   . PHE A  1 705  ? 168.948 156.506 121.186 1.00 83.26  ? 718  PHE A C   1 
ATOM   4678  O O   . PHE A  1 705  ? 167.797 156.372 120.775 1.00 83.26  ? 718  PHE A O   1 
ATOM   4679  C CB  . PHE A  1 705  ? 170.124 158.268 119.951 1.00 83.26  ? 718  PHE A CB  1 
ATOM   4680  C CG  . PHE A  1 705  ? 169.245 158.639 118.834 1.00 83.26  ? 718  PHE A CG  1 
ATOM   4681  C CD1 . PHE A  1 705  ? 167.923 158.901 119.055 1.00 83.26  ? 718  PHE A CD1 1 
ATOM   4682  C CD2 . PHE A  1 705  ? 169.737 158.685 117.547 1.00 83.26  ? 718  PHE A CD2 1 
ATOM   4683  C CE1 . PHE A  1 705  ? 167.109 159.234 118.020 1.00 83.26  ? 718  PHE A CE1 1 
ATOM   4684  C CE2 . PHE A  1 705  ? 168.931 159.013 116.510 1.00 83.26  ? 718  PHE A CE2 1 
ATOM   4685  C CZ  . PHE A  1 705  ? 167.612 159.290 116.742 1.00 83.26  ? 718  PHE A CZ  1 
ATOM   4686  N N   . THR A  1 706  ? 169.280 156.477 122.465 1.00 88.84  ? 719  THR A N   1 
ATOM   4687  C CA  . THR A  1 706  ? 168.355 156.110 123.527 1.00 88.84  ? 719  THR A CA  1 
ATOM   4688  C C   . THR A  1 706  ? 167.821 157.383 124.168 1.00 88.84  ? 719  THR A C   1 
ATOM   4689  O O   . THR A  1 706  ? 168.374 157.893 125.143 1.00 88.84  ? 719  THR A O   1 
ATOM   4690  C CB  . THR A  1 706  ? 169.029 155.210 124.554 1.00 88.84  ? 719  THR A CB  1 
ATOM   4691  O OG1 . THR A  1 706  ? 168.199 155.114 125.716 1.00 88.84  ? 719  THR A OG1 1 
ATOM   4692  C CG2 . THR A  1 706  ? 170.412 155.737 124.940 1.00 88.84  ? 719  THR A CG2 1 
ATOM   4693  N N   . ILE A  1 707  ? 166.718 157.879 123.630 1.00 87.51  ? 720  ILE A N   1 
ATOM   4694  C CA  . ILE A  1 707  ? 166.084 159.040 124.224 1.00 87.51  ? 720  ILE A CA  1 
ATOM   4695  C C   . ILE A  1 707  ? 165.644 158.609 125.600 1.00 87.51  ? 720  ILE A C   1 
ATOM   4696  O O   . ILE A  1 707  ? 164.702 157.831 125.755 1.00 87.51  ? 720  ILE A O   1 
ATOM   4697  C CB  . ILE A  1 707  ? 164.914 159.547 123.378 1.00 87.51  ? 720  ILE A CB  1 
ATOM   4698  C CG1 . ILE A  1 707  ? 165.394 159.783 121.950 1.00 87.51  ? 720  ILE A CG1 1 
ATOM   4699  C CG2 . ILE A  1 707  ? 164.348 160.796 123.975 1.00 87.51  ? 720  ILE A CG2 1 
ATOM   4700  C CD1 . ILE A  1 707  ? 166.741 160.454 121.865 1.00 87.51  ? 720  ILE A CD1 1 
ATOM   4701  N N   . SER A  1 708  ? 166.342 159.086 126.600 1.00 75.40  ? 721  SER A N   1 
ATOM   4702  C CA  . SER A  1 708  ? 166.266 158.479 127.902 1.00 75.40  ? 721  SER A CA  1 
ATOM   4703  C C   . SER A  1 708  ? 165.776 159.506 128.896 1.00 75.40  ? 721  SER A C   1 
ATOM   4704  O O   . SER A  1 708  ? 165.888 160.711 128.678 1.00 75.40  ? 721  SER A O   1 
ATOM   4705  C CB  . SER A  1 708  ? 167.627 157.949 128.295 1.00 75.40  ? 721  SER A CB  1 
ATOM   4706  O OG  . SER A  1 708  ? 168.078 157.075 127.283 1.00 75.40  ? 721  SER A OG  1 
ATOM   4707  N N   . VAL A  1 709  ? 165.222 159.012 129.993 1.00 78.91  ? 722  VAL A N   1 
ATOM   4708  C CA  . VAL A  1 709  ? 164.720 159.890 131.038 1.00 78.91  ? 722  VAL A CA  1 
ATOM   4709  C C   . VAL A  1 709  ? 165.461 159.603 132.334 1.00 78.91  ? 722  VAL A C   1 
ATOM   4710  O O   . VAL A  1 709  ? 166.327 158.726 132.382 1.00 78.91  ? 722  VAL A O   1 
ATOM   4711  C CB  . VAL A  1 709  ? 163.211 159.716 131.205 1.00 78.91  ? 722  VAL A CB  1 
ATOM   4712  C CG1 . VAL A  1 709  ? 162.519 160.182 129.961 1.00 78.91  ? 722  VAL A CG1 1 
ATOM   4713  C CG2 . VAL A  1 709  ? 162.908 158.290 131.481 1.00 78.91  ? 722  VAL A CG2 1 
ATOM   4714  N N   . THR A  1 710  ? 165.141 160.336 133.390 1.00 74.95  ? 723  THR A N   1 
ATOM   4715  C CA  . THR A  1 710  ? 165.987 160.261 134.562 1.00 74.95  ? 723  THR A CA  1 
ATOM   4716  C C   . THR A  1 710  ? 165.313 160.917 135.740 1.00 74.95  ? 723  THR A C   1 
ATOM   4717  O O   . THR A  1 710  ? 164.799 162.027 135.627 1.00 74.95  ? 723  THR A O   1 
ATOM   4718  C CB  . THR A  1 710  ? 167.320 160.929 134.292 1.00 74.95  ? 723  THR A CB  1 
ATOM   4719  O OG1 . THR A  1 710  ? 168.179 159.981 133.662 1.00 74.95  ? 723  THR A OG1 1 
ATOM   4720  C CG2 . THR A  1 710  ? 167.930 161.400 135.556 1.00 74.95  ? 723  THR A CG2 1 
ATOM   4721  N N   . THR A  1 711  ? 165.333 160.218 136.865 1.00 86.28  ? 724  THR A N   1 
ATOM   4722  C CA  . THR A  1 711  ? 164.863 160.773 138.119 1.00 86.28  ? 724  THR A CA  1 
ATOM   4723  C C   . THR A  1 711  ? 165.885 161.715 138.721 1.00 86.28  ? 724  THR A C   1 
ATOM   4724  O O   . THR A  1 711  ? 167.093 161.560 138.549 1.00 86.28  ? 724  THR A O   1 
ATOM   4725  C CB  . THR A  1 711  ? 164.568 159.685 139.146 1.00 86.28  ? 724  THR A CB  1 
ATOM   4726  O OG1 . THR A  1 711  ? 164.284 160.305 140.404 1.00 86.28  ? 724  THR A OG1 1 
ATOM   4727  C CG2 . THR A  1 711  ? 165.763 158.788 139.331 1.00 86.28  ? 724  THR A CG2 1 
ATOM   4728  N N   . GLU A  1 712  ? 165.375 162.696 139.442 1.00 79.86  ? 725  GLU A N   1 
ATOM   4729  C CA  . GLU A  1 712  ? 166.206 163.555 140.251 1.00 79.86  ? 725  GLU A CA  1 
ATOM   4730  C C   . GLU A  1 712  ? 165.274 164.395 141.087 1.00 79.86  ? 725  GLU A C   1 
ATOM   4731  O O   . GLU A  1 712  ? 164.209 164.811 140.626 1.00 79.86  ? 725  GLU A O   1 
ATOM   4732  C CB  . GLU A  1 712  ? 167.097 164.461 139.423 1.00 79.86  ? 725  GLU A CB  1 
ATOM   4733  C CG  . GLU A  1 712  ? 168.277 164.918 140.188 1.00 79.86  ? 725  GLU A CG  1 
ATOM   4734  C CD  . GLU A  1 712  ? 167.945 165.939 141.227 1.00 79.86  ? 725  GLU A CD  1 
ATOM   4735  O OE1 . GLU A  1 712  ? 166.929 166.641 141.098 1.00 79.86  ? 725  GLU A OE1 1 
ATOM   4736  O OE2 . GLU A  1 712  ? 168.699 166.032 142.196 1.00 79.86  ? 725  GLU A OE2 1 
ATOM   4737  N N   . ILE A  1 713  ? 165.692 164.648 142.307 1.00 91.70  ? 726  ILE A N   1 
ATOM   4738  C CA  . ILE A  1 713  ? 164.891 165.353 143.285 1.00 91.70  ? 726  ILE A CA  1 
ATOM   4739  C C   . ILE A  1 713  ? 165.773 166.363 143.995 1.00 91.70  ? 726  ILE A C   1 
ATOM   4740  O O   . ILE A  1 713  ? 166.966 166.127 144.189 1.00 91.70  ? 726  ILE A O   1 
ATOM   4741  C CB  . ILE A  1 713  ? 164.283 164.341 144.262 1.00 91.70  ? 726  ILE A CB  1 
ATOM   4742  C CG1 . ILE A  1 713  ? 165.404 163.492 144.854 1.00 91.70  ? 726  ILE A CG1 1 
ATOM   4743  C CG2 . ILE A  1 713  ? 163.313 163.449 143.534 1.00 91.70  ? 726  ILE A CG2 1 
ATOM   4744  C CD1 . ILE A  1 713  ? 164.937 162.276 145.633 1.00 91.70  ? 726  ILE A CD1 1 
ATOM   4745  N N   . LEU A  1 714  ? 165.196 167.495 144.367 1.00 81.57  ? 727  LEU A N   1 
ATOM   4746  C CA  . LEU A  1 714  ? 165.942 168.526 145.051 1.00 81.57  ? 727  LEU A CA  1 
ATOM   4747  C C   . LEU A  1 714  ? 165.065 169.071 146.165 1.00 81.57  ? 727  LEU A C   1 
ATOM   4748  O O   . LEU A  1 714  ? 163.894 169.413 145.926 1.00 81.57  ? 727  LEU A O   1 
ATOM   4749  C CB  . LEU A  1 714  ? 166.348 169.640 144.104 1.00 81.57  ? 727  LEU A CB  1 
ATOM   4750  C CG  . LEU A  1 714  ? 167.134 169.108 142.920 1.00 81.57  ? 727  LEU A CG  1 
ATOM   4751  C CD1 . LEU A  1 714  ? 167.181 170.078 141.764 1.00 81.57  ? 727  LEU A CD1 1 
ATOM   4752  C CD2 . LEU A  1 714  ? 168.506 168.812 143.406 1.00 81.57  ? 727  LEU A CD2 1 
ATOM   4753  N N   . PRO A  1 715  ? 165.576 169.151 147.377 1.00 80.30  ? 728  PRO A N   1 
ATOM   4754  C CA  . PRO A  1 715  ? 164.784 169.703 148.472 1.00 80.30  ? 728  PRO A CA  1 
ATOM   4755  C C   . PRO A  1 715  ? 164.565 171.179 148.235 1.00 80.30  ? 728  PRO A C   1 
ATOM   4756  O O   . PRO A  1 715  ? 165.351 171.830 147.549 1.00 80.30  ? 728  PRO A O   1 
ATOM   4757  C CB  . PRO A  1 715  ? 165.664 169.460 149.698 1.00 80.30  ? 728  PRO A CB  1 
ATOM   4758  C CG  . PRO A  1 715  ? 167.041 169.503 149.143 1.00 80.30  ? 728  PRO A CG  1 
ATOM   4759  C CD  . PRO A  1 715  ? 166.976 168.943 147.752 1.00 80.30  ? 728  PRO A CD  1 
ATOM   4760  N N   . VAL A  1 716  ? 163.467 171.707 148.770 1.00 71.46  ? 729  VAL A N   1 
ATOM   4761  C CA  . VAL A  1 716  ? 163.222 173.131 148.603 1.00 71.46  ? 729  VAL A CA  1 
ATOM   4762  C C   . VAL A  1 716  ? 162.998 173.814 149.931 1.00 71.46  ? 729  VAL A C   1 
ATOM   4763  O O   . VAL A  1 716  ? 163.223 175.017 150.051 1.00 71.46  ? 729  VAL A O   1 
ATOM   4764  C CB  . VAL A  1 716  ? 162.033 173.387 147.687 1.00 71.46  ? 729  VAL A CB  1 
ATOM   4765  C CG1 . VAL A  1 716  ? 162.213 172.613 146.434 1.00 71.46  ? 729  VAL A CG1 1 
ATOM   4766  C CG2 . VAL A  1 716  ? 160.785 172.995 148.389 1.00 71.46  ? 729  VAL A CG2 1 
ATOM   4767  N N   . SER A  1 717  ? 162.534 173.082 150.917 1.00 87.34  ? 730  SER A N   1 
ATOM   4768  C CA  . SER A  1 717  ? 162.405 173.639 152.252 1.00 87.34  ? 730  SER A CA  1 
ATOM   4769  C C   . SER A  1 717  ? 161.970 172.539 153.186 1.00 87.34  ? 730  SER A C   1 
ATOM   4770  O O   . SER A  1 717  ? 161.810 171.381 152.791 1.00 87.34  ? 730  SER A O   1 
ATOM   4771  C CB  . SER A  1 717  ? 161.389 174.767 152.338 1.00 87.34  ? 730  SER A CB  1 
ATOM   4772  O OG  . SER A  1 717  ? 160.979 174.896 153.687 1.00 87.34  ? 730  SER A OG  1 
ATOM   4773  N N   . MET A  1 718  ? 161.702 172.933 154.401 1.00 89.58  ? 731  MET A N   1 
ATOM   4774  C CA  . MET A  1 718  ? 161.226 172.063 155.438 1.00 89.58  ? 731  MET A CA  1 
ATOM   4775  C C   . MET A  1 718  ? 159.825 172.512 155.788 1.00 89.58  ? 731  MET A C   1 
ATOM   4776  O O   . MET A  1 718  ? 159.203 173.288 155.064 1.00 89.58  ? 731  MET A O   1 
ATOM   4777  C CB  . MET A  1 718  ? 162.145 172.159 156.644 1.00 89.58  ? 731  MET A CB  1 
ATOM   4778  C CG  . MET A  1 718  ? 163.597 172.279 156.291 1.00 89.58  ? 731  MET A CG  1 
ATOM   4779  S SD  . MET A  1 718  ? 164.564 172.635 157.772 1.00 89.58  ? 731  MET A SD  1 
ATOM   4780  C CE  . MET A  1 718  ? 163.931 171.404 158.903 1.00 89.58  ? 731  MET A CE  1 
ATOM   4781  N N   . THR A  1 719  ? 159.319 171.996 156.895 1.00 94.47  ? 732  THR A N   1 
ATOM   4782  C CA  . THR A  1 719  ? 158.329 172.739 157.652 1.00 94.47  ? 732  THR A CA  1 
ATOM   4783  C C   . THR A  1 719  ? 158.955 173.993 158.217 1.00 94.47  ? 732  THR A C   1 
ATOM   4784  O O   . THR A  1 719  ? 160.007 173.941 158.854 1.00 94.47  ? 732  THR A O   1 
ATOM   4785  C CB  . THR A  1 719  ? 157.778 171.919 158.805 1.00 94.47  ? 732  THR A CB  1 
ATOM   4786  O OG1 . THR A  1 719  ? 157.277 172.818 159.805 1.00 94.47  ? 732  THR A OG1 1 
ATOM   4787  C CG2 . THR A  1 719  ? 158.852 171.020 159.388 1.00 94.47  ? 732  THR A CG2 1 
ATOM   4788  N N   . LYS A  1 720  ? 158.292 175.117 158.034 1.00 92.93  ? 733  LYS A N   1 
ATOM   4789  C CA  . LYS A  1 720  ? 158.826 176.289 158.684 1.00 92.93  ? 733  LYS A CA  1 
ATOM   4790  C C   . LYS A  1 720  ? 158.589 176.057 160.155 1.00 92.93  ? 733  LYS A C   1 
ATOM   4791  O O   . LYS A  1 720  ? 157.630 176.564 160.733 1.00 92.93  ? 733  LYS A O   1 
ATOM   4792  C CB  . LYS A  1 720  ? 158.164 177.557 158.165 1.00 92.93  ? 733  LYS A CB  1 
ATOM   4793  C CG  . LYS A  1 720  ? 158.464 177.814 156.687 1.00 92.93  ? 733  LYS A CG  1 
ATOM   4794  C CD  . LYS A  1 720  ? 157.386 178.653 156.019 1.00 92.93  ? 733  LYS A CD  1 
ATOM   4795  C CE  . LYS A  1 720  ? 156.402 177.796 155.251 1.00 92.93  ? 733  LYS A CE  1 
ATOM   4796  N NZ  . LYS A  1 720  ? 155.214 178.584 154.832 1.00 92.93  ? 733  LYS A NZ  1 
ATOM   4797  N N   . THR A  1 721  ? 159.448 175.239 160.741 1.00 89.95  ? 734  THR A N   1 
ATOM   4798  C CA  . THR A  1 721  ? 159.345 174.918 162.145 1.00 89.95  ? 734  THR A CA  1 
ATOM   4799  C C   . THR A  1 721  ? 159.444 176.185 162.972 1.00 89.95  ? 734  THR A C   1 
ATOM   4800  O O   . THR A  1 721  ? 160.016 177.184 162.542 1.00 89.95  ? 734  THR A O   1 
ATOM   4801  C CB  . THR A  1 721  ? 160.463 173.977 162.552 1.00 89.95  ? 734  THR A CB  1 
ATOM   4802  O OG1 . THR A  1 721  ? 161.676 174.724 162.631 1.00 89.95  ? 734  THR A OG1 1 
ATOM   4803  C CG2 . THR A  1 721  ? 160.645 172.897 161.538 1.00 89.95  ? 734  THR A CG2 1 
ATOM   4804  N N   . SER A  1 722  ? 158.884 176.142 164.173 1.00 83.58  ? 735  SER A N   1 
ATOM   4805  C CA  . SER A  1 722  ? 158.980 177.298 165.039 1.00 83.58  ? 735  SER A CA  1 
ATOM   4806  C C   . SER A  1 722  ? 158.809 176.873 166.481 1.00 83.58  ? 735  SER A C   1 
ATOM   4807  O O   . SER A  1 722  ? 158.187 175.853 166.789 1.00 83.58  ? 735  SER A O   1 
ATOM   4808  C CB  . SER A  1 722  ? 157.956 178.367 164.685 1.00 83.58  ? 735  SER A CB  1 
ATOM   4809  O OG  . SER A  1 722  ? 157.806 179.263 165.763 1.00 83.58  ? 735  SER A OG  1 
ATOM   4810  N N   . VAL A  1 723  ? 159.391 177.679 167.361 1.00 87.49  ? 736  VAL A N   1 
ATOM   4811  C CA  . VAL A  1 723  ? 159.344 177.467 168.799 1.00 87.49  ? 736  VAL A CA  1 
ATOM   4812  C C   . VAL A  1 723  ? 158.820 178.733 169.431 1.00 87.49  ? 736  VAL A C   1 
ATOM   4813  O O   . VAL A  1 723  ? 158.324 179.628 168.745 1.00 87.49  ? 736  VAL A O   1 
ATOM   4814  C CB  . VAL A  1 723  ? 160.716 177.115 169.393 1.00 87.49  ? 736  VAL A CB  1 
ATOM   4815  C CG1 . VAL A  1 723  ? 161.352 176.009 168.615 1.00 87.49  ? 736  VAL A CG1 1 
ATOM   4816  C CG2 . VAL A  1 723  ? 161.614 178.331 169.411 1.00 87.49  ? 736  VAL A CG2 1 
ATOM   4817  N N   . ASP A  1 724  ? 158.915 178.804 170.743 1.00 85.04  ? 737  ASP A N   1 
ATOM   4818  C CA  . ASP A  1 724  ? 158.430 179.950 171.485 1.00 85.04  ? 737  ASP A CA  1 
ATOM   4819  C C   . ASP A  1 724  ? 159.249 179.979 172.754 1.00 85.04  ? 737  ASP A C   1 
ATOM   4820  O O   . ASP A  1 724  ? 159.306 178.977 173.461 1.00 85.04  ? 737  ASP A O   1 
ATOM   4821  C CB  . ASP A  1 724  ? 156.960 179.795 171.771 1.00 85.04  ? 737  ASP A CB  1 
ATOM   4822  C CG  . ASP A  1 724  ? 156.665 178.482 172.425 1.00 85.04  ? 737  ASP A CG  1 
ATOM   4823  O OD1 . ASP A  1 724  ? 156.829 178.371 173.656 1.00 85.04  ? 737  ASP A OD1 1 
ATOM   4824  O OD2 . ASP A  1 724  ? 156.326 177.533 171.692 1.00 85.04  ? 737  ASP A OD2 1 
ATOM   4825  N N   . CYS A  1 725  ? 159.933 181.086 173.000 1.00 83.69  ? 738  CYS A N   1 
ATOM   4826  C CA  . CYS A  1 725  ? 160.862 181.121 174.116 1.00 83.69  ? 738  CYS A CA  1 
ATOM   4827  C C   . CYS A  1 725  ? 160.210 180.606 175.392 1.00 83.69  ? 738  CYS A C   1 
ATOM   4828  O O   . CYS A  1 725  ? 160.527 179.512 175.871 1.00 83.69  ? 738  CYS A O   1 
ATOM   4829  C CB  . CYS A  1 725  ? 161.378 182.545 174.305 1.00 83.69  ? 738  CYS A CB  1 
ATOM   4830  S SG  . CYS A  1 725  ? 162.914 182.699 175.258 1.00 83.69  ? 738  CYS A SG  1 
ATOM   4831  N N   . THR A  1 726  ? 159.234 181.348 175.906 1.00 79.12  ? 739  THR A N   1 
ATOM   4832  C CA  . THR A  1 726  ? 158.777 181.117 177.268 1.00 79.12  ? 739  THR A CA  1 
ATOM   4833  C C   . THR A  1 726  ? 158.125 179.754 177.412 1.00 79.12  ? 739  THR A C   1 
ATOM   4834  O O   . THR A  1 726  ? 158.628 178.881 178.130 1.00 79.12  ? 739  THR A O   1 
ATOM   4835  C CB  . THR A  1 726  ? 157.810 182.215 177.686 1.00 79.12  ? 739  THR A CB  1 
ATOM   4836  O OG1 . THR A  1 726  ? 158.370 183.486 177.353 1.00 79.12  ? 739  THR A OG1 1 
ATOM   4837  C CG2 . THR A  1 726  ? 157.585 182.156 179.166 1.00 79.12  ? 739  THR A CG2 1 
ATOM   4838  N N   . MET A  1 727  ? 157.006 179.547 176.721 1.00 88.34  ? 740  MET A N   1 
ATOM   4839  C CA  . MET A  1 727  ? 156.230 178.342 176.961 1.00 88.34  ? 740  MET A CA  1 
ATOM   4840  C C   . MET A  1 727  ? 157.083 177.104 176.784 1.00 88.34  ? 740  MET A C   1 
ATOM   4841  O O   . MET A  1 727  ? 156.933 176.129 177.525 1.00 88.34  ? 740  MET A O   1 
ATOM   4842  C CB  . MET A  1 727  ? 155.015 178.291 176.050 1.00 88.34  ? 740  MET A CB  1 
ATOM   4843  C CG  . MET A  1 727  ? 154.247 177.014 176.215 1.00 88.34  ? 740  MET A CG  1 
ATOM   4844  S SD  . MET A  1 727  ? 152.709 177.009 175.306 1.00 88.34  ? 740  MET A SD  1 
ATOM   4845  C CE  . MET A  1 727  ? 152.088 178.648 175.658 1.00 88.34  ? 740  MET A CE  1 
ATOM   4846  N N   . TYR A  1 728  ? 158.020 177.136 175.844 1.00 82.79  ? 741  TYR A N   1 
ATOM   4847  C CA  . TYR A  1 728  ? 159.015 176.080 175.828 1.00 82.79  ? 741  TYR A CA  1 
ATOM   4848  C C   . TYR A  1 728  ? 159.737 176.031 177.150 1.00 82.79  ? 741  TYR A C   1 
ATOM   4849  O O   . TYR A  1 728  ? 159.538 175.117 177.951 1.00 82.79  ? 741  TYR A O   1 
ATOM   4850  C CB  . TYR A  1 728  ? 160.029 176.301 174.724 1.00 82.79  ? 741  TYR A CB  1 
ATOM   4851  C CG  . TYR A  1 728  ? 160.970 175.145 174.538 1.00 82.79  ? 741  TYR A CG  1 
ATOM   4852  C CD1 . TYR A  1 728  ? 161.950 174.853 175.460 1.00 82.79  ? 741  TYR A CD1 1 
ATOM   4853  C CD2 . TYR A  1 728  ? 160.885 174.360 173.417 1.00 82.79  ? 741  TYR A CD2 1 
ATOM   4854  C CE1 . TYR A  1 728  ? 162.790 173.804 175.271 1.00 82.79  ? 741  TYR A CE1 1 
ATOM   4855  C CE2 . TYR A  1 728  ? 161.727 173.325 173.221 1.00 82.79  ? 741  TYR A CE2 1 
ATOM   4856  C CZ  . TYR A  1 728  ? 162.677 173.044 174.143 1.00 82.79  ? 741  TYR A CZ  1 
ATOM   4857  O OH  . TYR A  1 728  ? 163.522 171.990 173.930 1.00 82.79  ? 741  TYR A OH  1 
ATOM   4858  N N   . ILE A  1 729  ? 160.590 177.016 177.393 1.00 83.52  ? 742  ILE A N   1 
ATOM   4859  C CA  . ILE A  1 729  ? 161.412 176.943 178.583 1.00 83.52  ? 742  ILE A CA  1 
ATOM   4860  C C   . ILE A  1 729  ? 160.534 176.805 179.809 1.00 83.52  ? 742  ILE A C   1 
ATOM   4861  O O   . ILE A  1 729  ? 160.752 175.929 180.647 1.00 83.52  ? 742  ILE A O   1 
ATOM   4862  C CB  . ILE A  1 729  ? 162.353 178.150 178.678 1.00 83.52  ? 742  ILE A CB  1 
ATOM   4863  C CG1 . ILE A  1 729  ? 163.185 178.029 179.941 1.00 83.52  ? 742  ILE A CG1 1 
ATOM   4864  C CG2 . ILE A  1 729  ? 161.599 179.434 178.689 1.00 83.52  ? 742  ILE A CG2 1 
ATOM   4865  C CD1 . ILE A  1 729  ? 163.870 176.719 180.055 1.00 83.52  ? 742  ILE A CD1 1 
ATOM   4866  N N   . CYS A  1 730  ? 159.514 177.641 179.928 1.00 91.64  ? 743  CYS A N   1 
ATOM   4867  C CA  . CYS A  1 730  ? 158.646 177.456 181.074 1.00 91.64  ? 743  CYS A CA  1 
ATOM   4868  C C   . CYS A  1 730  ? 157.373 176.703 180.744 1.00 91.64  ? 743  CYS A C   1 
ATOM   4869  O O   . CYS A  1 730  ? 157.220 175.532 181.092 1.00 91.64  ? 743  CYS A O   1 
ATOM   4870  C CB  . CYS A  1 730  ? 158.275 178.812 181.660 1.00 91.64  ? 743  CYS A CB  1 
ATOM   4871  S SG  . CYS A  1 730  ? 159.665 179.897 181.777 1.00 91.64  ? 743  CYS A SG  1 
ATOM   4872  N N   . GLY A  1 731  ? 156.475 177.356 180.036 1.00 91.95  ? 744  GLY A N   1 
ATOM   4873  C CA  . GLY A  1 731  ? 155.142 176.821 179.960 1.00 91.95  ? 744  GLY A CA  1 
ATOM   4874  C C   . GLY A  1 731  ? 154.334 177.342 181.124 1.00 91.95  ? 744  GLY A C   1 
ATOM   4875  O O   . GLY A  1 731  ? 154.533 176.904 182.259 1.00 91.95  ? 744  GLY A O   1 
ATOM   4876  N N   . ASP A  1 732  ? 153.431 178.277 180.851 1.00 110.43 ? 745  ASP A N   1 
ATOM   4877  C CA  . ASP A  1 732  ? 152.399 178.695 181.789 1.00 110.43 ? 745  ASP A CA  1 
ATOM   4878  C C   . ASP A  1 732  ? 152.882 178.889 183.220 1.00 110.43 ? 745  ASP A C   1 
ATOM   4879  O O   . ASP A  1 732  ? 152.141 178.595 184.160 1.00 110.43 ? 745  ASP A O   1 
ATOM   4880  C CB  . ASP A  1 732  ? 151.267 177.667 181.791 1.00 110.43 ? 745  ASP A CB  1 
ATOM   4881  C CG  . ASP A  1 732  ? 150.364 177.788 180.590 1.00 110.43 ? 745  ASP A CG  1 
ATOM   4882  O OD1 . ASP A  1 732  ? 150.081 178.928 180.176 1.00 110.43 ? 745  ASP A OD1 1 
ATOM   4883  O OD2 . ASP A  1 732  ? 149.932 176.743 180.064 1.00 110.43 ? 745  ASP A OD2 1 
ATOM   4884  N N   . SER A  1 733  ? 154.098 179.374 183.423 1.00 100.77 ? 746  SER A N   1 
ATOM   4885  C CA  . SER A  1 733  ? 154.603 179.553 184.779 1.00 100.77 ? 746  SER A CA  1 
ATOM   4886  C C   . SER A  1 733  ? 155.153 180.962 184.921 1.00 100.77 ? 746  SER A C   1 
ATOM   4887  O O   . SER A  1 733  ? 156.110 181.330 184.233 1.00 100.77 ? 746  SER A O   1 
ATOM   4888  C CB  . SER A  1 733  ? 155.662 178.511 185.117 1.00 100.77 ? 746  SER A CB  1 
ATOM   4889  O OG  . SER A  1 733  ? 155.046 177.280 185.439 1.00 100.77 ? 746  SER A OG  1 
ATOM   4890  N N   . THR A  1 734  ? 154.544 181.744 185.817 1.00 99.84  ? 747  THR A N   1 
ATOM   4891  C CA  . THR A  1 734  ? 155.022 183.098 186.073 1.00 99.84  ? 747  THR A CA  1 
ATOM   4892  C C   . THR A  1 734  ? 156.397 183.081 186.720 1.00 99.84  ? 747  THR A C   1 
ATOM   4893  O O   . THR A  1 734  ? 157.295 183.835 186.317 1.00 99.84  ? 747  THR A O   1 
ATOM   4894  C CB  . THR A  1 734  ? 154.034 183.847 186.964 1.00 99.84  ? 747  THR A CB  1 
ATOM   4895  O OG1 . THR A  1 734  ? 152.729 183.789 186.382 1.00 99.84  ? 747  THR A OG1 1 
ATOM   4896  C CG2 . THR A  1 734  ? 154.451 185.294 187.117 1.00 99.84  ? 747  THR A CG2 1 
ATOM   4897  N N   . GLU A  1 735  ? 156.586 182.219 187.715 1.00 94.55  ? 748  GLU A N   1 
ATOM   4898  C CA  . GLU A  1 735  ? 157.876 182.143 188.369 1.00 94.55  ? 748  GLU A CA  1 
ATOM   4899  C C   . GLU A  1 735  ? 158.996 181.815 187.398 1.00 94.55  ? 748  GLU A C   1 
ATOM   4900  O O   . GLU A  1 735  ? 160.109 182.319 187.566 1.00 94.55  ? 748  GLU A O   1 
ATOM   4901  C CB  . GLU A  1 735  ? 157.835 181.114 189.480 1.00 94.55  ? 748  GLU A CB  1 
ATOM   4902  C CG  . GLU A  1 735  ? 159.104 181.094 190.249 1.00 94.55  ? 748  GLU A CG  1 
ATOM   4903  C CD  . GLU A  1 735  ? 159.646 182.489 190.463 1.00 94.55  ? 748  GLU A CD  1 
ATOM   4904  O OE1 . GLU A  1 735  ? 158.881 183.379 190.889 1.00 94.55  ? 748  GLU A OE1 1 
ATOM   4905  O OE2 . GLU A  1 735  ? 160.842 182.702 190.194 1.00 94.55  ? 748  GLU A OE2 1 
ATOM   4906  N N   . CYS A  1 736  ? 158.728 181.016 186.369 1.00 86.34  ? 749  CYS A N   1 
ATOM   4907  C CA  . CYS A  1 736  ? 159.776 180.713 185.404 1.00 86.34  ? 749  CYS A CA  1 
ATOM   4908  C C   . CYS A  1 736  ? 159.913 181.778 184.331 1.00 86.34  ? 749  CYS A C   1 
ATOM   4909  O O   . CYS A  1 736  ? 161.034 182.190 184.010 1.00 86.34  ? 749  CYS A O   1 
ATOM   4910  C CB  . CYS A  1 736  ? 159.517 179.375 184.723 1.00 86.34  ? 749  CYS A CB  1 
ATOM   4911  S SG  . CYS A  1 736  ? 160.647 179.098 183.350 1.00 86.34  ? 749  CYS A SG  1 
ATOM   4912  N N   . SER A  1 737  ? 158.795 182.199 183.744 1.00 91.15  ? 750  SER A N   1 
ATOM   4913  C CA  . SER A  1 737  ? 158.846 183.256 182.747 1.00 91.15  ? 750  SER A CA  1 
ATOM   4914  C C   . SER A  1 737  ? 159.630 184.453 183.248 1.00 91.15  ? 750  SER A C   1 
ATOM   4915  O O   . SER A  1 737  ? 160.395 185.056 182.487 1.00 91.15  ? 750  SER A O   1 
ATOM   4916  C CB  . SER A  1 737  ? 157.436 183.687 182.365 1.00 91.15  ? 750  SER A CB  1 
ATOM   4917  O OG  . SER A  1 737  ? 157.465 184.530 181.229 1.00 91.15  ? 750  SER A OG  1 
ATOM   4918  N N   . ASN A  1 738  ? 159.470 184.802 184.524 1.00 88.04  ? 751  ASN A N   1 
ATOM   4919  C CA  . ASN A  1 738  ? 160.181 185.960 185.044 1.00 88.04  ? 751  ASN A CA  1 
ATOM   4920  C C   . ASN A  1 738  ? 161.685 185.752 184.986 1.00 88.04  ? 751  ASN A C   1 
ATOM   4921  O O   . ASN A  1 738  ? 162.431 186.640 184.564 1.00 88.04  ? 751  ASN A O   1 
ATOM   4922  C CB  . ASN A  1 738  ? 159.748 186.254 186.468 1.00 88.04  ? 751  ASN A CB  1 
ATOM   4923  C CG  . ASN A  1 738  ? 160.490 187.410 187.043 1.00 88.04  ? 751  ASN A CG  1 
ATOM   4924  O OD1 . ASN A  1 738  ? 160.909 187.383 188.195 1.00 88.04  ? 751  ASN A OD1 1 
ATOM   4925  N ND2 . ASN A  1 738  ? 160.688 188.439 186.233 1.00 88.04  ? 751  ASN A ND2 1 
ATOM   4926  N N   . LEU A  1 739  ? 162.153 184.585 185.411 1.00 87.80  ? 752  LEU A N   1 
ATOM   4927  C CA  . LEU A  1 739  ? 163.576 184.314 185.301 1.00 87.80  ? 752  LEU A CA  1 
ATOM   4928  C C   . LEU A  1 739  ? 164.024 184.320 183.861 1.00 87.80  ? 752  LEU A C   1 
ATOM   4929  O O   . LEU A  1 739  ? 165.173 184.657 183.572 1.00 87.80  ? 752  LEU A O   1 
ATOM   4930  C CB  . LEU A  1 739  ? 163.921 182.977 185.928 1.00 87.80  ? 752  LEU A CB  1 
ATOM   4931  C CG  . LEU A  1 739  ? 164.228 183.111 187.404 1.00 87.80  ? 752  LEU A CG  1 
ATOM   4932  C CD1 . LEU A  1 739  ? 165.444 183.990 187.501 1.00 87.80  ? 752  LEU A CD1 1 
ATOM   4933  C CD2 . LEU A  1 739  ? 163.067 183.694 188.175 1.00 87.80  ? 752  LEU A CD2 1 
ATOM   4934  N N   . LEU A  1 740  ? 163.139 183.932 182.949 1.00 85.42  ? 753  LEU A N   1 
ATOM   4935  C CA  . LEU A  1 740  ? 163.525 183.898 181.545 1.00 85.42  ? 753  LEU A CA  1 
ATOM   4936  C C   . LEU A  1 740  ? 163.741 185.298 181.008 1.00 85.42  ? 753  LEU A C   1 
ATOM   4937  O O   . LEU A  1 740  ? 164.770 185.586 180.391 1.00 85.42  ? 753  LEU A O   1 
ATOM   4938  C CB  . LEU A  1 740  ? 162.477 183.185 180.709 1.00 85.42  ? 753  LEU A CB  1 
ATOM   4939  C CG  . LEU A  1 740  ? 162.638 183.598 179.251 1.00 85.42  ? 753  LEU A CG  1 
ATOM   4940  C CD1 . LEU A  1 740  ? 163.902 183.012 178.654 1.00 85.42  ? 753  LEU A CD1 1 
ATOM   4941  C CD2 . LEU A  1 740  ? 161.423 183.175 178.474 1.00 85.42  ? 753  LEU A CD2 1 
ATOM   4942  N N   . LEU A  1 741  ? 162.776 186.181 181.216 1.00 84.44  ? 754  LEU A N   1 
ATOM   4943  C CA  . LEU A  1 741  ? 163.009 187.538 180.754 1.00 84.44  ? 754  LEU A CA  1 
ATOM   4944  C C   . LEU A  1 741  ? 164.040 188.267 181.595 1.00 84.44  ? 754  LEU A C   1 
ATOM   4945  O O   . LEU A  1 741  ? 164.299 189.443 181.338 1.00 84.44  ? 754  LEU A O   1 
ATOM   4946  C CB  . LEU A  1 741  ? 161.700 188.314 180.710 1.00 84.44  ? 754  LEU A CB  1 
ATOM   4947  C CG  . LEU A  1 741  ? 161.021 188.191 179.347 1.00 84.44  ? 754  LEU A CG  1 
ATOM   4948  C CD1 . LEU A  1 741  ? 159.734 189.000 179.288 1.00 84.44  ? 754  LEU A CD1 1 
ATOM   4949  C CD2 . LEU A  1 741  ? 161.985 188.623 178.255 1.00 84.44  ? 754  LEU A CD2 1 
ATOM   4950  N N   . GLN A  1 742  ? 164.634 187.607 182.582 1.00 84.89  ? 755  GLN A N   1 
ATOM   4951  C CA  . GLN A  1 742  ? 165.854 188.107 183.190 1.00 84.89  ? 755  GLN A CA  1 
ATOM   4952  C C   . GLN A  1 742  ? 167.037 188.051 182.235 1.00 84.89  ? 755  GLN A C   1 
ATOM   4953  O O   . GLN A  1 742  ? 168.020 188.762 182.446 1.00 84.89  ? 755  GLN A O   1 
ATOM   4954  C CB  . GLN A  1 742  ? 166.150 187.310 184.462 1.00 84.89  ? 755  GLN A CB  1 
ATOM   4955  C CG  . GLN A  1 742  ? 167.453 187.613 185.162 1.00 84.89  ? 755  GLN A CG  1 
ATOM   4956  C CD  . GLN A  1 742  ? 167.753 189.089 185.255 1.00 84.89  ? 755  GLN A CD  1 
ATOM   4957  O OE1 . GLN A  1 742  ? 168.894 189.511 185.068 1.00 84.89  ? 755  GLN A OE1 1 
ATOM   4958  N NE2 . GLN A  1 742  ? 166.732 189.888 185.533 1.00 84.89  ? 755  GLN A NE2 1 
ATOM   4959  N N   . TYR A  1 743  ? 166.952 187.276 181.160 1.00 80.08  ? 756  TYR A N   1 
ATOM   4960  C CA  . TYR A  1 743  ? 168.080 187.067 180.268 1.00 80.08  ? 756  TYR A CA  1 
ATOM   4961  C C   . TYR A  1 743  ? 168.078 187.978 179.065 1.00 80.08  ? 756  TYR A C   1 
ATOM   4962  O O   . TYR A  1 743  ? 169.121 188.160 178.443 1.00 80.08  ? 756  TYR A O   1 
ATOM   4963  C CB  . TYR A  1 743  ? 168.104 185.622 179.796 1.00 80.08  ? 756  TYR A CB  1 
ATOM   4964  C CG  . TYR A  1 743  ? 168.982 184.774 180.652 1.00 80.08  ? 756  TYR A CG  1 
ATOM   4965  C CD1 . TYR A  1 743  ? 169.162 185.079 181.990 1.00 80.08  ? 756  TYR A CD1 1 
ATOM   4966  C CD2 . TYR A  1 743  ? 169.645 183.681 180.132 1.00 80.08  ? 756  TYR A CD2 1 
ATOM   4967  C CE1 . TYR A  1 743  ? 169.965 184.316 182.787 1.00 80.08  ? 756  TYR A CE1 1 
ATOM   4968  C CE2 . TYR A  1 743  ? 170.452 182.909 180.925 1.00 80.08  ? 756  TYR A CE2 1 
ATOM   4969  C CZ  . TYR A  1 743  ? 170.608 183.234 182.250 1.00 80.08  ? 756  TYR A CZ  1 
ATOM   4970  O OH  . TYR A  1 743  ? 171.414 182.470 183.049 1.00 80.08  ? 756  TYR A OH  1 
ATOM   4971  N N   . GLY A  1 744  ? 166.946 188.547 178.717 1.00 82.39  ? 757  GLY A N   1 
ATOM   4972  C CA  . GLY A  1 744  ? 166.939 189.487 177.629 1.00 82.39  ? 757  GLY A CA  1 
ATOM   4973  C C   . GLY A  1 744  ? 166.778 188.852 176.270 1.00 82.39  ? 757  GLY A C   1 
ATOM   4974  O O   . GLY A  1 744  ? 166.029 187.888 176.100 1.00 82.39  ? 757  GLY A O   1 
ATOM   4975  N N   . SER A  1 745  ? 167.533 189.358 175.308 1.00 83.61  ? 758  SER A N   1 
ATOM   4976  C CA  . SER A  1 745  ? 167.183 189.271 173.901 1.00 83.61  ? 758  SER A CA  1 
ATOM   4977  C C   . SER A  1 745  ? 167.296 187.875 173.314 1.00 83.61  ? 758  SER A C   1 
ATOM   4978  O O   . SER A  1 745  ? 167.129 187.726 172.099 1.00 83.61  ? 758  SER A O   1 
ATOM   4979  C CB  . SER A  1 745  ? 168.067 190.217 173.101 1.00 83.61  ? 758  SER A CB  1 
ATOM   4980  O OG  . SER A  1 745  ? 169.285 189.575 172.794 1.00 83.61  ? 758  SER A OG  1 
ATOM   4981  N N   . PHE A  1 746  ? 167.576 186.863 174.131 1.00 82.05  ? 759  PHE A N   1 
ATOM   4982  C CA  . PHE A  1 746  ? 167.580 185.491 173.647 1.00 82.05  ? 759  PHE A CA  1 
ATOM   4983  C C   . PHE A  1 746  ? 166.362 185.237 172.785 1.00 82.05  ? 759  PHE A C   1 
ATOM   4984  O O   . PHE A  1 746  ? 166.456 184.999 171.576 1.00 82.05  ? 759  PHE A O   1 
ATOM   4985  C CB  . PHE A  1 746  ? 167.574 184.536 174.835 1.00 82.05  ? 759  PHE A CB  1 
ATOM   4986  C CG  . PHE A  1 746  ? 168.808 184.600 175.672 1.00 82.05  ? 759  PHE A CG  1 
ATOM   4987  C CD1 . PHE A  1 746  ? 168.996 185.623 176.584 1.00 82.05  ? 759  PHE A CD1 1 
ATOM   4988  C CD2 . PHE A  1 746  ? 169.774 183.620 175.567 1.00 82.05  ? 759  PHE A CD2 1 
ATOM   4989  C CE1 . PHE A  1 746  ? 170.137 185.671 177.348 1.00 82.05  ? 759  PHE A CE1 1 
ATOM   4990  C CE2 . PHE A  1 746  ? 170.912 183.665 176.341 1.00 82.05  ? 759  PHE A CE2 1 
ATOM   4991  C CZ  . PHE A  1 746  ? 171.090 184.689 177.233 1.00 82.05  ? 759  PHE A CZ  1 
ATOM   4992  N N   . CYS A  1 747  ? 165.200 185.379 173.400 1.00 80.42  ? 760  CYS A N   1 
ATOM   4993  C CA  . CYS A  1 747  ? 163.958 184.973 172.773 1.00 80.42  ? 760  CYS A CA  1 
ATOM   4994  C C   . CYS A  1 747  ? 163.743 185.686 171.449 1.00 80.42  ? 760  CYS A C   1 
ATOM   4995  O O   . CYS A  1 747  ? 163.413 185.058 170.431 1.00 80.42  ? 760  CYS A O   1 
ATOM   4996  C CB  . CYS A  1 747  ? 162.822 185.265 173.741 1.00 80.42  ? 760  CYS A CB  1 
ATOM   4997  S SG  . CYS A  1 747  ? 163.212 184.702 175.395 1.00 80.42  ? 760  CYS A SG  1 
ATOM   4998  N N   . THR A  1 748  ? 163.904 187.004 171.448 1.00 76.28  ? 761  THR A N   1 
ATOM   4999  C CA  . THR A  1 748  ? 163.537 187.759 170.266 1.00 76.28  ? 761  THR A CA  1 
ATOM   5000  C C   . THR A  1 748  ? 164.413 187.380 169.091 1.00 76.28  ? 761  THR A C   1 
ATOM   5001  O O   . THR A  1 748  ? 163.905 187.079 168.008 1.00 76.28  ? 761  THR A O   1 
ATOM   5002  C CB  . THR A  1 748  ? 163.619 189.251 170.545 1.00 76.28  ? 761  THR A CB  1 
ATOM   5003  O OG1 . THR A  1 748  ? 163.519 189.961 169.312 1.00 76.28  ? 761  THR A OG1 1 
ATOM   5004  C CG2 . THR A  1 748  ? 164.910 189.600 171.208 1.00 76.28  ? 761  THR A CG2 1 
ATOM   5005  N N   . GLN A  1 749  ? 165.725 187.341 169.294 1.00 76.92  ? 762  GLN A N   1 
ATOM   5006  C CA  . GLN A  1 749  ? 166.609 186.974 168.200 1.00 76.92  ? 762  GLN A CA  1 
ATOM   5007  C C   . GLN A  1 749  ? 166.324 185.557 167.742 1.00 76.92  ? 762  GLN A C   1 
ATOM   5008  O O   . GLN A  1 749  ? 166.426 185.242 166.551 1.00 76.92  ? 762  GLN A O   1 
ATOM   5009  C CB  . GLN A  1 749  ? 168.059 187.132 168.643 1.00 76.92  ? 762  GLN A CB  1 
ATOM   5010  C CG  . GLN A  1 749  ? 168.487 186.103 169.650 1.00 76.92  ? 762  GLN A CG  1 
ATOM   5011  C CD  . GLN A  1 749  ? 169.416 186.657 170.687 1.00 76.92  ? 762  GLN A CD  1 
ATOM   5012  O OE1 . GLN A  1 749  ? 169.709 187.848 170.699 1.00 76.92  ? 762  GLN A OE1 1 
ATOM   5013  N NE2 . GLN A  1 749  ? 169.890 185.797 171.571 1.00 76.92  ? 762  GLN A NE2 1 
ATOM   5014  N N   . LEU A  1 750  ? 165.935 184.694 168.674 1.00 69.84  ? 763  LEU A N   1 
ATOM   5015  C CA  . LEU A  1 750  ? 165.597 183.339 168.293 1.00 69.84  ? 763  LEU A CA  1 
ATOM   5016  C C   . LEU A  1 750  ? 164.456 183.336 167.308 1.00 69.84  ? 763  LEU A C   1 
ATOM   5017  O O   . LEU A  1 750  ? 164.598 182.887 166.162 1.00 69.84  ? 763  LEU A O   1 
ATOM   5018  C CB  . LEU A  1 750  ? 165.230 182.532 169.522 1.00 69.84  ? 763  LEU A CB  1 
ATOM   5019  C CG  . LEU A  1 750  ? 166.466 181.761 169.913 1.00 69.84  ? 763  LEU A CG  1 
ATOM   5020  C CD1 . LEU A  1 750  ? 166.796 180.930 168.713 1.00 69.84  ? 763  LEU A CD1 1 
ATOM   5021  C CD2 . LEU A  1 750  ? 167.629 182.649 170.273 1.00 69.84  ? 763  LEU A CD2 1 
ATOM   5022  N N   . ASN A  1 751  ? 163.317 183.852 167.744 1.00 73.77  ? 764  ASN A N   1 
ATOM   5023  C CA  . ASN A  1 751  ? 162.164 183.887 166.867 1.00 73.77  ? 764  ASN A CA  1 
ATOM   5024  C C   . ASN A  1 751  ? 162.535 184.553 165.567 1.00 73.77  ? 764  ASN A C   1 
ATOM   5025  O O   . ASN A  1 751  ? 162.044 184.177 164.502 1.00 73.77  ? 764  ASN A O   1 
ATOM   5026  C CB  . ASN A  1 751  ? 161.029 184.653 167.515 1.00 73.77  ? 764  ASN A CB  1 
ATOM   5027  C CG  . ASN A  1 751  ? 160.852 184.291 168.931 1.00 73.77  ? 764  ASN A CG  1 
ATOM   5028  O OD1 . ASN A  1 751  ? 160.785 185.156 169.796 1.00 73.77  ? 764  ASN A OD1 1 
ATOM   5029  N ND2 . ASN A  1 751  ? 160.834 183.004 169.205 1.00 73.77  ? 764  ASN A ND2 1 
ATOM   5030  N N   . ARG A  1 752  ? 163.426 185.537 165.634 1.00 66.93  ? 765  ARG A N   1 
ATOM   5031  C CA  . ARG A  1 752  ? 163.682 186.356 164.466 1.00 66.93  ? 765  ARG A CA  1 
ATOM   5032  C C   . ARG A  1 752  ? 164.434 185.569 163.416 1.00 66.93  ? 765  ARG A C   1 
ATOM   5033  O O   . ARG A  1 752  ? 163.993 185.473 162.269 1.00 66.93  ? 765  ARG A O   1 
ATOM   5034  C CB  . ARG A  1 752  ? 164.436 187.615 164.871 1.00 66.93  ? 765  ARG A CB  1 
ATOM   5035  C CG  . ARG A  1 752  ? 163.496 188.748 165.231 1.00 66.93  ? 765  ARG A CG  1 
ATOM   5036  C CD  . ARG A  1 752  ? 164.147 189.772 166.114 1.00 66.93  ? 765  ARG A CD  1 
ATOM   5037  N NE  . ARG A  1 752  ? 165.105 190.589 165.390 1.00 66.93  ? 765  ARG A NE  1 
ATOM   5038  C CZ  . ARG A  1 752  ? 166.402 190.329 165.332 1.00 66.93  ? 765  ARG A CZ  1 
ATOM   5039  N NH1 . ARG A  1 752  ? 166.895 189.264 165.940 1.00 66.93  ? 765  ARG A NH1 1 
ATOM   5040  N NH2 . ARG A  1 752  ? 167.206 191.127 164.656 1.00 66.93  ? 765  ARG A NH2 1 
ATOM   5041  N N   . ALA A  1 753  ? 165.558 184.977 163.790 1.00 67.79  ? 766  ALA A N   1 
ATOM   5042  C CA  . ALA A  1 753  ? 166.276 184.175 162.815 1.00 67.79  ? 766  ALA A CA  1 
ATOM   5043  C C   . ALA A  1 753  ? 165.404 183.038 162.317 1.00 67.79  ? 766  ALA A C   1 
ATOM   5044  O O   . ALA A  1 753  ? 165.457 182.669 161.138 1.00 67.79  ? 766  ALA A O   1 
ATOM   5045  C CB  . ALA A  1 753  ? 167.571 183.648 163.416 1.00 67.79  ? 766  ALA A CB  1 
ATOM   5046  N N   . LEU A  1 754  ? 164.605 182.485 163.235 1.00 66.94  ? 767  LEU A N   1 
ATOM   5047  C CA  . LEU A  1 754  ? 163.696 181.346 162.936 1.00 66.94  ? 767  LEU A CA  1 
ATOM   5048  C C   . LEU A  1 754  ? 162.720 181.734 161.820 1.00 66.94  ? 767  LEU A C   1 
ATOM   5049  O O   . LEU A  1 754  ? 162.699 181.033 160.789 1.00 66.94  ? 767  LEU A O   1 
ATOM   5050  C CB  . LEU A  1 754  ? 162.945 180.961 164.215 1.00 66.94  ? 767  LEU A CB  1 
ATOM   5051  C CG  . LEU A  1 754  ? 162.564 179.486 164.335 1.00 66.94  ? 767  LEU A CG  1 
ATOM   5052  C CD1 . LEU A  1 754  ? 163.569 178.606 163.608 1.00 66.94  ? 767  LEU A CD1 1 
ATOM   5053  C CD2 . LEU A  1 754  ? 162.450 179.072 165.794 1.00 66.94  ? 767  LEU A CD2 1 
ATOM   5054  N N   . THR A  1 755  ? 161.945 182.805 162.021 1.00 80.32  ? 768  THR A N   1 
ATOM   5055  C CA  . THR A  1 755  ? 160.983 183.219 161.025 1.00 80.32  ? 768  THR A CA  1 
ATOM   5056  C C   . THR A  1 755  ? 161.680 183.790 159.814 1.00 80.32  ? 768  THR A C   1 
ATOM   5057  O O   . THR A  1 755  ? 161.076 183.874 158.749 1.00 80.32  ? 768  THR A O   1 
ATOM   5058  C CB  . THR A  1 755  ? 160.010 184.232 161.596 1.00 80.32  ? 768  THR A CB  1 
ATOM   5059  O OG1 . THR A  1 755  ? 158.983 184.477 160.633 1.00 80.32  ? 768  THR A OG1 1 
ATOM   5060  C CG2 . THR A  1 755  ? 160.723 185.523 161.887 1.00 80.32  ? 768  THR A CG2 1 
ATOM   5061  N N   . GLY A  1 756  ? 162.939 184.187 159.954 1.00 81.02  ? 769  GLY A N   1 
ATOM   5062  C CA  . GLY A  1 756  ? 163.697 184.560 158.783 1.00 81.02  ? 769  GLY A CA  1 
ATOM   5063  C C   . GLY A  1 756  ? 163.890 183.375 157.867 1.00 81.02  ? 769  GLY A C   1 
ATOM   5064  O O   . GLY A  1 756  ? 163.623 183.448 156.664 1.00 81.02  ? 769  GLY A O   1 
ATOM   5065  N N   . ILE A  1 757  ? 164.349 182.256 158.429 1.00 83.49  ? 770  ILE A N   1 
ATOM   5066  C CA  . ILE A  1 757  ? 164.401 181.062 157.597 1.00 83.49  ? 770  ILE A CA  1 
ATOM   5067  C C   . ILE A  1 757  ? 163.024 180.755 157.068 1.00 83.49  ? 770  ILE A C   1 
ATOM   5068  O O   . ILE A  1 757  ? 162.880 180.318 155.932 1.00 83.49  ? 770  ILE A O   1 
ATOM   5069  C CB  . ILE A  1 757  ? 165.016 179.841 158.307 1.00 83.49  ? 770  ILE A CB  1 
ATOM   5070  C CG1 . ILE A  1 757  ? 164.449 178.548 157.716 1.00 83.49  ? 770  ILE A CG1 1 
ATOM   5071  C CG2 . ILE A  1 757  ? 164.888 179.916 159.780 1.00 83.49  ? 770  ILE A CG2 1 
ATOM   5072  C CD1 . ILE A  1 757  ? 165.198 177.314 158.079 1.00 83.49  ? 770  ILE A CD1 1 
ATOM   5073  N N   . ALA A  1 758  ? 161.990 181.046 157.843 1.00 86.19  ? 771  ALA A N   1 
ATOM   5074  C CA  . ALA A  1 758  ? 160.638 180.795 157.371 1.00 86.19  ? 771  ALA A CA  1 
ATOM   5075  C C   . ALA A  1 758  ? 160.343 181.592 156.104 1.00 86.19  ? 771  ALA A C   1 
ATOM   5076  O O   . ALA A  1 758  ? 160.100 181.025 155.030 1.00 86.19  ? 771  ALA A O   1 
ATOM   5077  C CB  . ALA A  1 758  ? 159.646 181.135 158.478 1.00 86.19  ? 771  ALA A CB  1 
ATOM   5078  N N   . VAL A  1 759  ? 160.375 182.917 156.216 1.00 89.08  ? 772  VAL A N   1 
ATOM   5079  C CA  . VAL A  1 759  ? 160.015 183.765 155.093 1.00 89.08  ? 772  VAL A CA  1 
ATOM   5080  C C   . VAL A  1 759  ? 160.890 183.441 153.916 1.00 89.08  ? 772  VAL A C   1 
ATOM   5081  O O   . VAL A  1 759  ? 160.449 183.496 152.769 1.00 89.08  ? 772  VAL A O   1 
ATOM   5082  C CB  . VAL A  1 759  ? 160.127 185.248 155.464 1.00 89.08  ? 772  VAL A CB  1 
ATOM   5083  C CG1 . VAL A  1 759  ? 161.510 185.543 155.971 1.00 89.08  ? 772  VAL A CG1 1 
ATOM   5084  C CG2 . VAL A  1 759  ? 159.826 186.102 154.257 1.00 89.08  ? 772  VAL A CG2 1 
ATOM   5085  N N   . GLU A  1 760  ? 162.123 183.057 154.167 1.00 97.76  ? 773  GLU A N   1 
ATOM   5086  C CA  . GLU A  1 760  ? 162.925 182.690 153.031 1.00 97.76  ? 773  GLU A CA  1 
ATOM   5087  C C   . GLU A  1 760  ? 162.528 181.330 152.485 1.00 97.76  ? 773  GLU A C   1 
ATOM   5088  O O   . GLU A  1 760  ? 162.658 181.116 151.284 1.00 97.76  ? 773  GLU A O   1 
ATOM   5089  C CB  . GLU A  1 760  ? 164.408 182.779 153.399 1.00 97.76  ? 773  GLU A CB  1 
ATOM   5090  C CG  . GLU A  1 760  ? 164.963 181.662 154.237 1.00 97.76  ? 773  GLU A CG  1 
ATOM   5091  C CD  . GLU A  1 760  ? 166.122 182.118 155.102 1.00 97.76  ? 773  GLU A CD  1 
ATOM   5092  O OE1 . GLU A  1 760  ? 166.285 183.339 155.286 1.00 97.76  ? 773  GLU A OE1 1 
ATOM   5093  O OE2 . GLU A  1 760  ? 166.861 181.256 155.612 1.00 97.76  ? 773  GLU A OE2 1 
ATOM   5094  N N   . GLN A  1 761  ? 161.998 180.427 153.313 1.00 97.91  ? 774  GLN A N   1 
ATOM   5095  C CA  . GLN A  1 761  ? 161.391 179.219 152.770 1.00 97.91  ? 774  GLN A CA  1 
ATOM   5096  C C   . GLN A  1 761  ? 160.356 179.607 151.748 1.00 97.91  ? 774  GLN A C   1 
ATOM   5097  O O   . GLN A  1 761  ? 160.347 179.124 150.606 1.00 97.91  ? 774  GLN A O   1 
ATOM   5098  C CB  . GLN A  1 761  ? 160.693 178.395 153.854 1.00 97.91  ? 774  GLN A CB  1 
ATOM   5099  C CG  . GLN A  1 761  ? 161.494 178.025 155.032 1.00 97.91  ? 774  GLN A CG  1 
ATOM   5100  C CD  . GLN A  1 761  ? 162.887 177.671 154.668 1.00 97.91  ? 774  GLN A CD  1 
ATOM   5101  O OE1 . GLN A  1 761  ? 163.167 176.536 154.299 1.00 97.91  ? 774  GLN A OE1 1 
ATOM   5102  N NE2 . GLN A  1 761  ? 163.783 178.639 154.755 1.00 97.91  ? 774  GLN A NE2 1 
ATOM   5103  N N   . ASP A  1 762  ? 159.452 180.470 152.178 1.00 105.58 ? 775  ASP A N   1 
ATOM   5104  C CA  . ASP A  1 762  ? 158.362 180.875 151.312 1.00 105.58 ? 775  ASP A CA  1 
ATOM   5105  C C   . ASP A  1 762  ? 158.909 181.512 150.049 1.00 105.58 ? 775  ASP A C   1 
ATOM   5106  O O   . ASP A  1 762  ? 158.510 181.156 148.935 1.00 105.58 ? 775  ASP A O   1 
ATOM   5107  C CB  . ASP A  1 762  ? 157.437 181.830 152.058 1.00 105.58 ? 775  ASP A CB  1 
ATOM   5108  C CG  . ASP A  1 762  ? 157.083 181.334 153.448 1.00 105.58 ? 775  ASP A CG  1 
ATOM   5109  O OD1 . ASP A  1 762  ? 156.185 180.475 153.574 1.00 105.58 ? 775  ASP A OD1 1 
ATOM   5110  O OD2 . ASP A  1 762  ? 157.687 181.821 154.421 1.00 105.58 ? 775  ASP A OD2 1 
ATOM   5111  N N   . LYS A  1 763  ? 159.843 182.448 150.213 1.00 107.05 ? 776  LYS A N   1 
ATOM   5112  C CA  . LYS A  1 763  ? 160.424 183.138 149.073 1.00 107.05 ? 776  LYS A CA  1 
ATOM   5113  C C   . LYS A  1 763  ? 161.027 182.144 148.107 1.00 107.05 ? 776  LYS A C   1 
ATOM   5114  O O   . LYS A  1 763  ? 160.866 182.270 146.886 1.00 107.05 ? 776  LYS A O   1 
ATOM   5115  C CB  . LYS A  1 763  ? 161.480 184.129 149.554 1.00 107.05 ? 776  LYS A CB  1 
ATOM   5116  C CG  . LYS A  1 763  ? 161.857 185.187 148.541 1.00 107.05 ? 776  LYS A CG  1 
ATOM   5117  C CD  . LYS A  1 763  ? 163.136 185.882 148.954 1.00 107.05 ? 776  LYS A CD  1 
ATOM   5118  C CE  . LYS A  1 763  ? 163.165 187.316 148.471 1.00 107.05 ? 776  LYS A CE  1 
ATOM   5119  N NZ  . LYS A  1 763  ? 162.163 188.161 149.173 1.00 107.05 ? 776  LYS A NZ  1 
ATOM   5120  N N   . ASN A  1 764  ? 161.703 181.135 148.644 1.00 100.51 ? 777  ASN A N   1 
ATOM   5121  C CA  . ASN A  1 764  ? 162.280 180.096 147.832 1.00 100.51 ? 777  ASN A CA  1 
ATOM   5122  C C   . ASN A  1 764  ? 161.165 179.516 147.014 1.00 100.51 ? 777  ASN A C   1 
ATOM   5123  O O   . ASN A  1 764  ? 161.008 179.879 145.857 1.00 100.51 ? 777  ASN A O   1 
ATOM   5124  C CB  . ASN A  1 764  ? 162.891 179.012 148.692 1.00 100.51 ? 777  ASN A CB  1 
ATOM   5125  C CG  . ASN A  1 764  ? 164.053 179.495 149.461 1.00 100.51 ? 777  ASN A CG  1 
ATOM   5126  O OD1 . ASN A  1 764  ? 164.992 180.047 148.905 1.00 100.51 ? 777  ASN A OD1 1 
ATOM   5127  N ND2 . ASN A  1 764  ? 163.999 179.316 150.765 1.00 100.51 ? 777  ASN A ND2 1 
ATOM   5128  N N   . THR A  1 765  ? 160.308 178.743 147.670 1.00 101.98 ? 778  THR A N   1 
ATOM   5129  C CA  . THR A  1 765  ? 159.273 178.014 146.954 1.00 101.98 ? 778  THR A CA  1 
ATOM   5130  C C   . THR A  1 765  ? 158.655 178.880 145.882 1.00 101.98 ? 778  THR A C   1 
ATOM   5131  O O   . THR A  1 765  ? 158.554 178.482 144.714 1.00 101.98 ? 778  THR A O   1 
ATOM   5132  C CB  . THR A  1 765  ? 158.205 177.568 147.931 1.00 101.98 ? 778  THR A CB  1 
ATOM   5133  O OG1 . THR A  1 765  ? 157.782 178.709 148.678 1.00 101.98 ? 778  THR A OG1 1 
ATOM   5134  C CG2 . THR A  1 765  ? 158.761 176.549 148.869 1.00 101.98 ? 778  THR A CG2 1 
ATOM   5135  N N   . GLN A  1 766  ? 158.317 180.106 146.257 1.00 108.31 ? 779  GLN A N   1 
ATOM   5136  C CA  . GLN A  1 766  ? 157.686 181.033 145.339 1.00 108.31 ? 779  GLN A CA  1 
ATOM   5137  C C   . GLN A  1 766  ? 158.511 181.173 144.075 1.00 108.31 ? 779  GLN A C   1 
ATOM   5138  O O   . GLN A  1 766  ? 158.080 180.774 142.989 1.00 108.31 ? 779  GLN A O   1 
ATOM   5139  C CB  . GLN A  1 766  ? 157.506 182.373 146.041 1.00 108.31 ? 779  GLN A CB  1 
ATOM   5140  C CG  . GLN A  1 766  ? 156.616 183.332 145.333 1.00 108.31 ? 779  GLN A CG  1 
ATOM   5141  C CD  . GLN A  1 766  ? 157.376 184.108 144.306 1.00 108.31 ? 779  GLN A CD  1 
ATOM   5142  O OE1 . GLN A  1 766  ? 158.599 184.034 144.248 1.00 108.31 ? 779  GLN A OE1 1 
ATOM   5143  N NE2 . GLN A  1 766  ? 156.669 184.890 143.511 1.00 108.31 ? 779  GLN A NE2 1 
ATOM   5144  N N   . GLU A  1 767  ? 159.721 181.703 144.197 1.00 108.44 ? 780  GLU A N   1 
ATOM   5145  C CA  . GLU A  1 767  ? 160.502 181.872 142.984 1.00 108.44 ? 780  GLU A CA  1 
ATOM   5146  C C   . GLU A  1 767  ? 160.937 180.538 142.410 1.00 108.44 ? 780  GLU A C   1 
ATOM   5147  O O   . GLU A  1 767  ? 161.348 180.473 141.252 1.00 108.44 ? 780  GLU A O   1 
ATOM   5148  C CB  . GLU A  1 767  ? 161.705 182.760 143.245 1.00 108.44 ? 780  GLU A CB  1 
ATOM   5149  C CG  . GLU A  1 767  ? 162.476 182.330 144.424 1.00 108.44 ? 780  GLU A CG  1 
ATOM   5150  C CD  . GLU A  1 767  ? 163.275 181.110 144.135 1.00 108.44 ? 780  GLU A CD  1 
ATOM   5151  O OE1 . GLU A  1 767  ? 163.649 180.911 142.963 1.00 108.44 ? 780  GLU A OE1 1 
ATOM   5152  O OE2 . GLU A  1 767  ? 163.493 180.323 145.064 1.00 108.44 ? 780  GLU A OE2 1 
ATOM   5153  N N   . VAL A  1 768  ? 160.886 179.484 143.207 1.00 101.31 ? 781  VAL A N   1 
ATOM   5154  C CA  . VAL A  1 768  ? 161.090 178.151 142.683 1.00 101.31 ? 781  VAL A CA  1 
ATOM   5155  C C   . VAL A  1 768  ? 160.009 177.822 141.684 1.00 101.31 ? 781  VAL A C   1 
ATOM   5156  O O   . VAL A  1 768  ? 160.177 176.961 140.820 1.00 101.31 ? 781  VAL A O   1 
ATOM   5157  C CB  . VAL A  1 768  ? 161.128 177.142 143.833 1.00 101.31 ? 781  VAL A CB  1 
ATOM   5158  C CG1 . VAL A  1 768  ? 161.298 175.756 143.309 1.00 101.31 ? 781  VAL A CG1 1 
ATOM   5159  C CG2 . VAL A  1 768  ? 162.291 177.453 144.694 1.00 101.31 ? 781  VAL A CG2 1 
ATOM   5160  N N   . PHE A  1 769  ? 158.886 178.504 141.769 1.00 108.68 ? 782  PHE A N   1 
ATOM   5161  C CA  . PHE A  1 769  ? 157.843 178.255 140.797 1.00 108.68 ? 782  PHE A CA  1 
ATOM   5162  C C   . PHE A  1 769  ? 157.352 179.504 140.094 1.00 108.68 ? 782  PHE A C   1 
ATOM   5163  O O   . PHE A  1 769  ? 157.109 179.479 138.887 1.00 108.68 ? 782  PHE A O   1 
ATOM   5164  C CB  . PHE A  1 769  ? 156.710 177.551 141.508 1.00 108.68 ? 782  PHE A CB  1 
ATOM   5165  C CG  . PHE A  1 769  ? 157.148 176.304 142.138 1.00 108.68 ? 782  PHE A CG  1 
ATOM   5166  C CD1 . PHE A  1 769  ? 157.787 175.350 141.389 1.00 108.68 ? 782  PHE A CD1 1 
ATOM   5167  C CD2 . PHE A  1 769  ? 157.000 176.115 143.485 1.00 108.68 ? 782  PHE A CD2 1 
ATOM   5168  C CE1 . PHE A  1 769  ? 158.214 174.215 141.957 1.00 108.68 ? 782  PHE A CE1 1 
ATOM   5169  C CE2 . PHE A  1 769  ? 157.426 174.974 144.062 1.00 108.68 ? 782  PHE A CE2 1 
ATOM   5170  C CZ  . PHE A  1 769  ? 158.034 174.022 143.300 1.00 108.68 ? 782  PHE A CZ  1 
ATOM   5171  N N   . ALA A  1 770  ? 157.235 180.612 140.807 1.00 116.88 ? 783  ALA A N   1 
ATOM   5172  C CA  . ALA A  1 770  ? 156.602 181.773 140.210 1.00 116.88 ? 783  ALA A CA  1 
ATOM   5173  C C   . ALA A  1 770  ? 157.486 182.365 139.134 1.00 116.88 ? 783  ALA A C   1 
ATOM   5174  O O   . ALA A  1 770  ? 157.743 183.570 139.122 1.00 116.88 ? 783  ALA A O   1 
ATOM   5175  C CB  . ALA A  1 770  ? 156.301 182.820 141.271 1.00 116.88 ? 783  ALA A CB  1 
ATOM   5176  N N   . GLN A  1 771  ? 157.950 181.532 138.222 1.00 114.77 ? 784  GLN A N   1 
ATOM   5177  C CA  . GLN A  1 771  ? 158.664 182.063 137.086 1.00 114.77 ? 784  GLN A CA  1 
ATOM   5178  C C   . GLN A  1 771  ? 157.727 182.432 135.963 1.00 114.77 ? 784  GLN A C   1 
ATOM   5179  O O   . GLN A  1 771  ? 158.182 182.906 134.920 1.00 114.77 ? 784  GLN A O   1 
ATOM   5180  C CB  . GLN A  1 771  ? 159.710 181.068 136.614 1.00 114.77 ? 784  GLN A CB  1 
ATOM   5181  C CG  . GLN A  1 771  ? 160.885 181.035 137.541 1.00 114.77 ? 784  GLN A CG  1 
ATOM   5182  C CD  . GLN A  1 771  ? 161.156 182.388 138.142 1.00 114.77 ? 784  GLN A CD  1 
ATOM   5183  O OE1 . GLN A  1 771  ? 160.736 182.672 139.260 1.00 114.77 ? 784  GLN A OE1 1 
ATOM   5184  N NE2 . GLN A  1 771  ? 161.855 183.236 137.405 1.00 114.77 ? 784  GLN A NE2 1 
ATOM   5185  N N   . VAL A  1 772  ? 156.435 182.223 136.150 1.00 107.03 ? 785  VAL A N   1 
ATOM   5186  C CA  . VAL A  1 772  ? 155.424 182.837 135.314 1.00 107.03 ? 785  VAL A CA  1 
ATOM   5187  C C   . VAL A  1 772  ? 154.492 183.613 136.217 1.00 107.03 ? 785  VAL A C   1 
ATOM   5188  O O   . VAL A  1 772  ? 154.101 183.136 137.286 1.00 107.03 ? 785  VAL A O   1 
ATOM   5189  C CB  . VAL A  1 772  ? 154.642 181.815 134.482 1.00 107.03 ? 785  VAL A CB  1 
ATOM   5190  C CG1 . VAL A  1 772  ? 153.809 182.545 133.460 1.00 107.03 ? 785  VAL A CG1 1 
ATOM   5191  C CG2 . VAL A  1 772  ? 155.604 180.877 133.817 1.00 107.03 ? 785  VAL A CG2 1 
ATOM   5192  N N   . LYS A  1 773  ? 154.153 184.820 135.787 1.00 114.44 ? 786  LYS A N   1 
ATOM   5193  C CA  . LYS A  1 773  ? 153.337 185.683 136.619 1.00 114.44 ? 786  LYS A CA  1 
ATOM   5194  C C   . LYS A  1 773  ? 151.926 185.138 136.763 1.00 114.44 ? 786  LYS A C   1 
ATOM   5195  O O   . LYS A  1 773  ? 151.256 185.422 137.760 1.00 114.44 ? 786  LYS A O   1 
ATOM   5196  C CB  . LYS A  1 773  ? 153.303 187.091 136.022 1.00 114.44 ? 786  LYS A CB  1 
ATOM   5197  C CG  . LYS A  1 773  ? 154.471 188.008 136.395 1.00 114.44 ? 786  LYS A CG  1 
ATOM   5198  C CD  . LYS A  1 773  ? 155.840 187.419 136.065 1.00 114.44 ? 786  LYS A CD  1 
ATOM   5199  C CE  . LYS A  1 773  ? 156.952 188.454 136.229 1.00 114.44 ? 786  LYS A CE  1 
ATOM   5200  N NZ  . LYS A  1 773  ? 158.320 187.871 136.114 1.00 114.44 ? 786  LYS A NZ  1 
ATOM   5201  N N   . GLN A  1 774  ? 151.463 184.343 135.799 1.00 111.38 ? 787  GLN A N   1 
ATOM   5202  C CA  . GLN A  1 774  ? 150.054 183.995 135.704 1.00 111.38 ? 787  GLN A CA  1 
ATOM   5203  C C   . GLN A  1 774  ? 149.877 182.491 135.554 1.00 111.38 ? 787  GLN A C   1 
ATOM   5204  O O   . GLN A  1 774  ? 150.830 181.749 135.313 1.00 111.38 ? 787  GLN A O   1 
ATOM   5205  C CB  . GLN A  1 774  ? 149.377 184.728 134.535 1.00 111.38 ? 787  GLN A CB  1 
ATOM   5206  C CG  . GLN A  1 774  ? 149.818 184.283 133.151 1.00 111.38 ? 787  GLN A CG  1 
ATOM   5207  C CD  . GLN A  1 774  ? 150.966 185.087 132.592 1.00 111.38 ? 787  GLN A CD  1 
ATOM   5208  O OE1 . GLN A  1 774  ? 151.744 185.683 133.326 1.00 111.38 ? 787  GLN A OE1 1 
ATOM   5209  N NE2 . GLN A  1 774  ? 151.086 185.090 131.276 1.00 111.38 ? 787  GLN A NE2 1 
ATOM   5210  N N   . ILE A  1 775  ? 148.626 182.054 135.687 1.00 114.93 ? 788  ILE A N   1 
ATOM   5211  C CA  . ILE A  1 775  ? 148.255 180.645 135.721 1.00 114.93 ? 788  ILE A CA  1 
ATOM   5212  C C   . ILE A  1 775  ? 147.722 180.233 134.359 1.00 114.93 ? 788  ILE A C   1 
ATOM   5213  O O   . ILE A  1 775  ? 147.309 181.072 133.555 1.00 114.93 ? 788  ILE A O   1 
ATOM   5214  C CB  . ILE A  1 775  ? 147.216 180.410 136.831 1.00 114.93 ? 788  ILE A CB  1 
ATOM   5215  C CG1 . ILE A  1 775  ? 147.673 181.131 138.085 1.00 114.93 ? 788  ILE A CG1 1 
ATOM   5216  C CG2 . ILE A  1 775  ? 147.078 178.940 137.129 1.00 114.93 ? 788  ILE A CG2 1 
ATOM   5217  C CD1 . ILE A  1 775  ? 148.919 180.537 138.628 1.00 114.93 ? 788  ILE A CD1 1 
ATOM   5218  N N   . TYR A  1 776  ? 147.744 178.936 134.077 1.00 107.48 ? 789  TYR A N   1 
ATOM   5219  C CA  . TYR A  1 776  ? 147.378 178.460 132.755 1.00 107.48 ? 789  TYR A CA  1 
ATOM   5220  C C   . TYR A  1 776  ? 146.555 177.179 132.853 1.00 107.48 ? 789  TYR A C   1 
ATOM   5221  O O   . TYR A  1 776  ? 146.182 176.730 133.939 1.00 107.48 ? 789  TYR A O   1 
ATOM   5222  C CB  . TYR A  1 776  ? 148.627 178.241 131.902 1.00 107.48 ? 789  TYR A CB  1 
ATOM   5223  C CG  . TYR A  1 776  ? 149.418 179.492 131.654 1.00 107.48 ? 789  TYR A CG  1 
ATOM   5224  C CD1 . TYR A  1 776  ? 150.266 180.002 132.615 1.00 107.48 ? 789  TYR A CD1 1 
ATOM   5225  C CD2 . TYR A  1 776  ? 149.320 180.160 130.448 1.00 107.48 ? 789  TYR A CD2 1 
ATOM   5226  C CE1 . TYR A  1 776  ? 150.978 181.138 132.386 1.00 107.48 ? 789  TYR A CE1 1 
ATOM   5227  C CE2 . TYR A  1 776  ? 150.039 181.297 130.209 1.00 107.48 ? 789  TYR A CE2 1 
ATOM   5228  C CZ  . TYR A  1 776  ? 150.867 181.783 131.182 1.00 107.48 ? 789  TYR A CZ  1 
ATOM   5229  O OH  . TYR A  1 776  ? 151.589 182.921 130.941 1.00 107.48 ? 789  TYR A OH  1 
ATOM   5230  N N   . LYS A  1 777  ? 146.262 176.598 131.689 1.00 116.60 ? 790  LYS A N   1 
ATOM   5231  C CA  . LYS A  1 777  ? 145.564 175.325 131.590 1.00 116.60 ? 790  LYS A CA  1 
ATOM   5232  C C   . LYS A  1 777  ? 145.872 174.689 130.244 1.00 116.60 ? 790  LYS A C   1 
ATOM   5233  O O   . LYS A  1 777  ? 146.094 175.379 129.245 1.00 116.60 ? 790  LYS A O   1 
ATOM   5234  C CB  . LYS A  1 777  ? 144.054 175.481 131.723 1.00 116.60 ? 790  LYS A CB  1 
ATOM   5235  C CG  . LYS A  1 777  ? 143.447 176.129 130.497 1.00 116.60 ? 790  LYS A CG  1 
ATOM   5236  C CD  . LYS A  1 777  ? 142.007 175.751 130.256 1.00 116.60 ? 790  LYS A CD  1 
ATOM   5237  C CE  . LYS A  1 777  ? 141.425 176.598 129.143 1.00 116.60 ? 790  LYS A CE  1 
ATOM   5238  N NZ  . LYS A  1 777  ? 141.318 178.026 129.543 1.00 116.60 ? 790  LYS A NZ  1 
ATOM   5239  N N   . THR A  1 778  ? 145.863 173.378 130.228 1.00 124.31 ? 791  THR A N   1 
ATOM   5240  C CA  . THR A  1 778  ? 146.116 172.670 128.992 1.00 124.31 ? 791  THR A CA  1 
ATOM   5241  C C   . THR A  1 778  ? 144.909 172.755 128.077 1.00 124.31 ? 791  THR A C   1 
ATOM   5242  O O   . THR A  1 778  ? 143.775 172.884 128.540 1.00 124.31 ? 791  THR A O   1 
ATOM   5243  C CB  . THR A  1 778  ? 146.410 171.208 129.255 1.00 124.31 ? 791  THR A CB  1 
ATOM   5244  O OG1 . THR A  1 778  ? 146.545 170.530 128.004 1.00 124.31 ? 791  THR A OG1 1 
ATOM   5245  C CG2 . THR A  1 778  ? 145.259 170.582 130.004 1.00 124.31 ? 791  THR A CG2 1 
ATOM   5246  N N   . PRO A  1 779  ? 145.129 172.692 126.775 1.00 132.87 ? 792  PRO A N   1 
ATOM   5247  C CA  . PRO A  1 779  ? 144.032 172.432 125.863 1.00 132.87 ? 792  PRO A CA  1 
ATOM   5248  C C   . PRO A  1 779  ? 143.663 170.964 125.908 1.00 132.87 ? 792  PRO A C   1 
ATOM   5249  O O   . PRO A  1 779  ? 144.548 170.096 125.943 1.00 132.87 ? 792  PRO A O   1 
ATOM   5250  C CB  . PRO A  1 779  ? 144.605 172.824 124.497 1.00 132.87 ? 792  PRO A CB  1 
ATOM   5251  C CG  . PRO A  1 779  ? 146.063 172.631 124.651 1.00 132.87 ? 792  PRO A CG  1 
ATOM   5252  C CD  . PRO A  1 779  ? 146.389 172.966 126.071 1.00 132.87 ? 792  PRO A CD  1 
ATOM   5253  N N   . PRO A  1 780  ? 142.371 170.642 125.940 1.00 146.10 ? 793  PRO A N   1 
ATOM   5254  C CA  . PRO A  1 780  ? 141.983 169.224 125.950 1.00 146.10 ? 793  PRO A CA  1 
ATOM   5255  C C   . PRO A  1 780  ? 142.408 168.488 124.694 1.00 146.10 ? 793  PRO A C   1 
ATOM   5256  O O   . PRO A  1 780  ? 142.694 167.285 124.754 1.00 146.10 ? 793  PRO A O   1 
ATOM   5257  C CB  . PRO A  1 780  ? 140.455 169.281 126.094 1.00 146.10 ? 793  PRO A CB  1 
ATOM   5258  C CG  . PRO A  1 780  ? 140.069 170.652 125.640 1.00 146.10 ? 793  PRO A CG  1 
ATOM   5259  C CD  . PRO A  1 780  ? 141.210 171.545 126.009 1.00 146.10 ? 793  PRO A CD  1 
ATOM   5260  N N   . ILE A  1 781  ? 142.473 169.186 123.559 1.00 150.43 ? 794  ILE A N   1 
ATOM   5261  C CA  . ILE A  1 781  ? 142.900 168.558 122.320 1.00 150.43 ? 794  ILE A CA  1 
ATOM   5262  C C   . ILE A  1 781  ? 144.270 167.939 122.505 1.00 150.43 ? 794  ILE A C   1 
ATOM   5263  O O   . ILE A  1 781  ? 145.146 168.508 123.166 1.00 150.43 ? 794  ILE A O   1 
ATOM   5264  C CB  . ILE A  1 781  ? 142.907 169.585 121.177 1.00 150.43 ? 794  ILE A CB  1 
ATOM   5265  C CG1 . ILE A  1 781  ? 143.614 169.008 119.946 1.00 150.43 ? 794  ILE A CG1 1 
ATOM   5266  C CG2 . ILE A  1 781  ? 143.547 170.875 121.642 1.00 150.43 ? 794  ILE A CG2 1 
ATOM   5267  C CD1 . ILE A  1 781  ? 143.548 169.887 118.717 1.00 150.43 ? 794  ILE A CD1 1 
ATOM   5268  N N   . LYS A  1 782  ? 144.453 166.749 121.939 1.00 138.96 ? 795  LYS A N   1 
ATOM   5269  C CA  . LYS A  1 782  ? 145.714 166.017 122.032 1.00 138.96 ? 795  LYS A CA  1 
ATOM   5270  C C   . LYS A  1 782  ? 145.917 165.228 120.740 1.00 138.96 ? 795  LYS A C   1 
ATOM   5271  O O   . LYS A  1 782  ? 145.313 164.169 120.548 1.00 138.96 ? 795  LYS A O   1 
ATOM   5272  C CB  . LYS A  1 782  ? 145.716 165.107 123.253 1.00 138.96 ? 795  LYS A CB  1 
ATOM   5273  C CG  . LYS A  1 782  ? 145.807 165.873 124.538 1.00 138.96 ? 795  LYS A CG  1 
ATOM   5274  C CD  . LYS A  1 782  ? 145.283 165.099 125.691 1.00 138.96 ? 795  LYS A CD  1 
ATOM   5275  C CE  . LYS A  1 782  ? 145.169 166.024 126.868 1.00 138.96 ? 795  LYS A CE  1 
ATOM   5276  N NZ  . LYS A  1 782  ? 144.518 165.359 128.014 1.00 138.96 ? 795  LYS A NZ  1 
ATOM   5277  N N   . ASP A  1 783  ? 146.757 165.752 119.855 1.00 145.01 ? 796  ASP A N   1 
ATOM   5278  C CA  . ASP A  1 783  ? 147.262 165.030 118.692 1.00 145.01 ? 796  ASP A CA  1 
ATOM   5279  C C   . ASP A  1 783  ? 148.774 165.200 118.617 1.00 145.01 ? 796  ASP A C   1 
ATOM   5280  O O   . ASP A  1 783  ? 149.356 165.511 117.576 1.00 145.01 ? 796  ASP A O   1 
ATOM   5281  C CB  . ASP A  1 783  ? 146.552 165.486 117.419 1.00 145.01 ? 796  ASP A CB  1 
ATOM   5282  C CG  . ASP A  1 783  ? 146.507 166.989 117.277 1.00 145.01 ? 796  ASP A CG  1 
ATOM   5283  O OD1 . ASP A  1 783  ? 147.567 167.629 117.373 1.00 145.01 ? 796  ASP A OD1 1 
ATOM   5284  O OD2 . ASP A  1 783  ? 145.405 167.538 117.083 1.00 145.01 ? 796  ASP A OD2 1 
ATOM   5285  N N   . PHE A  1 784  ? 149.424 164.981 119.759 1.00 136.53 ? 797  PHE A N   1 
ATOM   5286  C CA  . PHE A  1 784  ? 150.827 165.314 119.964 1.00 136.53 ? 797  PHE A CA  1 
ATOM   5287  C C   . PHE A  1 784  ? 151.779 164.327 119.317 1.00 136.53 ? 797  PHE A C   1 
ATOM   5288  O O   . PHE A  1 784  ? 152.624 163.747 120.005 1.00 136.53 ? 797  PHE A O   1 
ATOM   5289  C CB  . PHE A  1 784  ? 151.138 165.363 121.453 1.00 136.53 ? 797  PHE A CB  1 
ATOM   5290  C CG  . PHE A  1 784  ? 150.504 166.494 122.159 1.00 136.53 ? 797  PHE A CG  1 
ATOM   5291  C CD1 . PHE A  1 784  ? 150.081 167.596 121.467 1.00 136.53 ? 797  PHE A CD1 1 
ATOM   5292  C CD2 . PHE A  1 784  ? 150.349 166.462 123.519 1.00 136.53 ? 797  PHE A CD2 1 
ATOM   5293  C CE1 . PHE A  1 784  ? 149.509 168.641 122.119 1.00 136.53 ? 797  PHE A CE1 1 
ATOM   5294  C CE2 . PHE A  1 784  ? 149.781 167.502 124.172 1.00 136.53 ? 797  PHE A CE2 1 
ATOM   5295  C CZ  . PHE A  1 784  ? 149.359 168.595 123.471 1.00 136.53 ? 797  PHE A CZ  1 
ATOM   5296  N N   . GLY A  1 785  ? 151.638 164.110 118.015 1.00 130.76 ? 798  GLY A N   1 
ATOM   5297  C CA  . GLY A  1 785  ? 152.597 163.331 117.260 1.00 130.76 ? 798  GLY A CA  1 
ATOM   5298  C C   . GLY A  1 785  ? 153.084 162.053 117.912 1.00 130.76 ? 798  GLY A C   1 
ATOM   5299  O O   . GLY A  1 785  ? 154.122 161.522 117.515 1.00 130.76 ? 798  GLY A O   1 
ATOM   5300  N N   . GLY A  1 786  ? 152.358 161.551 118.909 1.00 121.65 ? 799  GLY A N   1 
ATOM   5301  C CA  . GLY A  1 786  ? 152.678 160.288 119.540 1.00 121.65 ? 799  GLY A CA  1 
ATOM   5302  C C   . GLY A  1 786  ? 153.129 160.331 120.987 1.00 121.65 ? 799  GLY A C   1 
ATOM   5303  O O   . GLY A  1 786  ? 153.901 159.462 121.400 1.00 121.65 ? 799  GLY A O   1 
ATOM   5304  N N   . PHE A  1 787  ? 152.680 161.279 121.776 1.00 119.31 ? 800  PHE A N   1 
ATOM   5305  C CA  . PHE A  1 787  ? 153.188 161.337 123.128 1.00 119.31 ? 800  PHE A CA  1 
ATOM   5306  C C   . PHE A  1 787  ? 152.124 160.942 124.132 1.00 119.31 ? 800  PHE A C   1 
ATOM   5307  O O   . PHE A  1 787  ? 150.926 161.077 123.880 1.00 119.31 ? 800  PHE A O   1 
ATOM   5308  C CB  . PHE A  1 787  ? 153.720 162.721 123.419 1.00 119.31 ? 800  PHE A CB  1 
ATOM   5309  C CG  . PHE A  1 787  ? 155.053 162.955 122.821 1.00 119.31 ? 800  PHE A CG  1 
ATOM   5310  C CD1 . PHE A  1 787  ? 155.220 162.853 121.461 1.00 119.31 ? 800  PHE A CD1 1 
ATOM   5311  C CD2 . PHE A  1 787  ? 156.147 163.243 123.605 1.00 119.31 ? 800  PHE A CD2 1 
ATOM   5312  C CE1 . PHE A  1 787  ? 156.441 163.054 120.890 1.00 119.31 ? 800  PHE A CE1 1 
ATOM   5313  C CE2 . PHE A  1 787  ? 157.375 163.449 123.037 1.00 119.31 ? 800  PHE A CE2 1 
ATOM   5314  C CZ  . PHE A  1 787  ? 157.523 163.353 121.676 1.00 119.31 ? 800  PHE A CZ  1 
ATOM   5315  N N   . ASN A  1 788  ? 152.581 160.429 125.270 1.00 130.44 ? 801  ASN A N   1 
ATOM   5316  C CA  . ASN A  1 788  ? 151.721 160.001 126.370 1.00 130.44 ? 801  ASN A CA  1 
ATOM   5317  C C   . ASN A  1 788  ? 151.982 160.902 127.548 1.00 130.44 ? 801  ASN A C   1 
ATOM   5318  O O   . ASN A  1 788  ? 152.691 160.533 128.482 1.00 130.44 ? 801  ASN A O   1 
ATOM   5319  C CB  . ASN A  1 788  ? 151.964 158.586 126.778 1.00 130.44 ? 801  ASN A CB  1 
ATOM   5320  C CG  . ASN A  1 788  ? 150.860 158.053 127.656 1.00 130.44 ? 801  ASN A CG  1 
ATOM   5321  O OD1 . ASN A  1 788  ? 150.586 158.575 128.728 1.00 130.44 ? 801  ASN A OD1 1 
ATOM   5322  N ND2 . ASN A  1 788  ? 150.225 156.999 127.186 1.00 130.44 ? 801  ASN A ND2 1 
ATOM   5323  N N   . PHE A  1 789  ? 151.364 162.059 127.544 1.00 118.84 ? 802  PHE A N   1 
ATOM   5324  C CA  . PHE A  1 789  ? 151.510 162.933 128.686 1.00 118.84 ? 802  PHE A CA  1 
ATOM   5325  C C   . PHE A  1 789  ? 150.517 162.600 129.774 1.00 118.84 ? 802  PHE A C   1 
ATOM   5326  O O   . PHE A  1 789  ? 150.238 163.432 130.646 1.00 118.84 ? 802  PHE A O   1 
ATOM   5327  C CB  . PHE A  1 789  ? 151.394 164.375 128.224 1.00 118.84 ? 802  PHE A CB  1 
ATOM   5328  C CG  . PHE A  1 789  ? 152.411 164.734 127.200 1.00 118.84 ? 802  PHE A CG  1 
ATOM   5329  C CD1 . PHE A  1 789  ? 153.604 164.057 127.154 1.00 118.84 ? 802  PHE A CD1 1 
ATOM   5330  C CD2 . PHE A  1 789  ? 152.179 165.731 126.284 1.00 118.84 ? 802  PHE A CD2 1 
ATOM   5331  C CE1 . PHE A  1 789  ? 154.545 164.372 126.231 1.00 118.84 ? 802  PHE A CE1 1 
ATOM   5332  C CE2 . PHE A  1 789  ? 153.125 166.046 125.354 1.00 118.84 ? 802  PHE A CE2 1 
ATOM   5333  C CZ  . PHE A  1 789  ? 154.310 165.368 125.330 1.00 118.84 ? 802  PHE A CZ  1 
ATOM   5334  N N   . SER A  1 790  ? 149.995 161.378 129.756 1.00 122.94 ? 803  SER A N   1 
ATOM   5335  C CA  . SER A  1 790  ? 148.913 161.025 130.661 1.00 122.94 ? 803  SER A CA  1 
ATOM   5336  C C   . SER A  1 790  ? 149.362 161.127 132.115 1.00 122.94 ? 803  SER A C   1 
ATOM   5337  O O   . SER A  1 790  ? 148.972 162.050 132.837 1.00 122.94 ? 803  SER A O   1 
ATOM   5338  C CB  . SER A  1 790  ? 148.412 159.619 130.336 1.00 122.94 ? 803  SER A CB  1 
ATOM   5339  O OG  . SER A  1 790  ? 148.013 159.518 128.977 1.00 122.94 ? 803  SER A OG  1 
ATOM   5340  N N   . GLN A  1 791  ? 150.241 160.229 132.542 1.00 112.60 ? 804  GLN A N   1 
ATOM   5341  C CA  . GLN A  1 791  ? 150.568 160.127 133.954 1.00 112.60 ? 804  GLN A CA  1 
ATOM   5342  C C   . GLN A  1 791  ? 151.222 161.396 134.460 1.00 112.60 ? 804  GLN A C   1 
ATOM   5343  O O   . GLN A  1 791  ? 151.609 161.472 135.628 1.00 112.60 ? 804  GLN A O   1 
ATOM   5344  C CB  . GLN A  1 791  ? 151.489 158.942 134.200 1.00 112.60 ? 804  GLN A CB  1 
ATOM   5345  C CG  . GLN A  1 791  ? 150.764 157.626 134.273 1.00 112.60 ? 804  GLN A CG  1 
ATOM   5346  C CD  . GLN A  1 791  ? 151.709 156.446 134.244 1.00 112.60 ? 804  GLN A CD  1 
ATOM   5347  O OE1 . GLN A  1 791  ? 152.521 156.316 133.330 1.00 112.60 ? 804  GLN A OE1 1 
ATOM   5348  N NE2 . GLN A  1 791  ? 151.611 155.578 135.241 1.00 112.60 ? 804  GLN A NE2 1 
ATOM   5349  N N   . ILE A  1 792  ? 151.358 162.396 133.595 1.00 105.58 ? 805  ILE A N   1 
ATOM   5350  C CA  . ILE A  1 792  ? 151.971 163.666 133.952 1.00 105.58 ? 805  ILE A CA  1 
ATOM   5351  C C   . ILE A  1 792  ? 151.002 164.830 133.792 1.00 105.58 ? 805  ILE A C   1 
ATOM   5352  O O   . ILE A  1 792  ? 150.796 165.606 134.728 1.00 105.58 ? 805  ILE A O   1 
ATOM   5353  C CB  . ILE A  1 792  ? 153.263 163.911 133.154 1.00 105.58 ? 805  ILE A CB  1 
ATOM   5354  C CG1 . ILE A  1 792  ? 152.988 163.863 131.659 1.00 105.58 ? 805  ILE A CG1 1 
ATOM   5355  C CG2 . ILE A  1 792  ? 154.272 162.869 133.527 1.00 105.58 ? 805  ILE A CG2 1 
ATOM   5356  C CD1 . ILE A  1 792  ? 154.068 164.421 130.806 1.00 105.58 ? 805  ILE A CD1 1 
ATOM   5357  N N   . LEU A  1 793  ? 150.408 164.980 132.622 1.00 105.59 ? 806  LEU A N   1 
ATOM   5358  C CA  . LEU A  1 793  ? 149.483 166.086 132.453 1.00 105.59 ? 806  LEU A CA  1 
ATOM   5359  C C   . LEU A  1 793  ? 148.251 165.808 133.292 1.00 105.59 ? 806  LEU A C   1 
ATOM   5360  O O   . LEU A  1 793  ? 147.670 164.728 133.179 1.00 105.59 ? 806  LEU A O   1 
ATOM   5361  C CB  . LEU A  1 793  ? 149.084 166.278 131.010 1.00 105.59 ? 806  LEU A CB  1 
ATOM   5362  C CG  . LEU A  1 793  ? 148.298 167.572 130.868 1.00 105.59 ? 806  LEU A CG  1 
ATOM   5363  C CD1 . LEU A  1 793  ? 149.257 168.717 130.909 1.00 105.59 ? 806  LEU A CD1 1 
ATOM   5364  C CD2 . LEU A  1 793  ? 147.493 167.609 129.597 1.00 105.59 ? 806  LEU A CD2 1 
ATOM   5365  N N   . PRO A  1 794  ? 147.824 166.740 134.133 1.00 106.56 ? 807  PRO A N   1 
ATOM   5366  C CA  . PRO A  1 794  ? 146.779 166.421 135.103 1.00 106.56 ? 807  PRO A CA  1 
ATOM   5367  C C   . PRO A  1 794  ? 145.458 166.107 134.426 1.00 106.56 ? 807  PRO A C   1 
ATOM   5368  O O   . PRO A  1 794  ? 145.178 166.559 133.315 1.00 106.56 ? 807  PRO A O   1 
ATOM   5369  C CB  . PRO A  1 794  ? 146.683 167.693 135.948 1.00 106.56 ? 807  PRO A CB  1 
ATOM   5370  C CG  . PRO A  1 794  ? 147.139 168.756 135.040 1.00 106.56 ? 807  PRO A CG  1 
ATOM   5371  C CD  . PRO A  1 794  ? 148.235 168.144 134.228 1.00 106.56 ? 807  PRO A CD  1 
ATOM   5372  N N   . ASP A  1 795  ? 144.649 165.307 135.113 1.00 120.21 ? 808  ASP A N   1 
ATOM   5373  C CA  . ASP A  1 795  ? 143.347 164.918 134.614 1.00 120.21 ? 808  ASP A CA  1 
ATOM   5374  C C   . ASP A  1 795  ? 142.282 165.337 135.613 1.00 120.21 ? 808  ASP A C   1 
ATOM   5375  O O   . ASP A  1 795  ? 142.235 164.787 136.723 1.00 120.21 ? 808  ASP A O   1 
ATOM   5376  C CB  . ASP A  1 795  ? 143.304 163.415 134.383 1.00 120.21 ? 808  ASP A CB  1 
ATOM   5377  C CG  . ASP A  1 795  ? 142.252 163.021 133.392 1.00 120.21 ? 808  ASP A CG  1 
ATOM   5378  O OD1 . ASP A  1 795  ? 142.334 163.497 132.243 1.00 120.21 ? 808  ASP A OD1 1 
ATOM   5379  O OD2 . ASP A  1 795  ? 141.353 162.234 133.749 1.00 120.21 ? 808  ASP A OD2 1 
ATOM   5380  N N   . PRO A  1 796  ? 141.414 166.291 135.272 1.00 123.82 ? 809  PRO A N   1 
ATOM   5381  C CA  . PRO A  1 796  ? 140.399 166.745 136.239 1.00 123.82 ? 809  PRO A CA  1 
ATOM   5382  C C   . PRO A  1 796  ? 139.483 165.642 136.713 1.00 123.82 ? 809  PRO A C   1 
ATOM   5383  O O   . PRO A  1 796  ? 138.818 165.808 137.741 1.00 123.82 ? 809  PRO A O   1 
ATOM   5384  C CB  . PRO A  1 796  ? 139.628 167.820 135.465 1.00 123.82 ? 809  PRO A CB  1 
ATOM   5385  C CG  . PRO A  1 796  ? 140.574 168.265 134.389 1.00 123.82 ? 809  PRO A CG  1 
ATOM   5386  C CD  . PRO A  1 796  ? 141.376 167.057 134.017 1.00 123.82 ? 809  PRO A CD  1 
ATOM   5387  N N   . SER A  1 797  ? 139.414 164.524 135.987 1.00 124.42 ? 810  SER A N   1 
ATOM   5388  C CA  . SER A  1 797  ? 138.807 163.331 136.555 1.00 124.42 ? 810  SER A CA  1 
ATOM   5389  C C   . SER A  1 797  ? 139.469 162.982 137.876 1.00 124.42 ? 810  SER A C   1 
ATOM   5390  O O   . SER A  1 797  ? 138.844 162.365 138.743 1.00 124.42 ? 810  SER A O   1 
ATOM   5391  C CB  . SER A  1 797  ? 138.917 162.163 135.576 1.00 124.42 ? 810  SER A CB  1 
ATOM   5392  O OG  . SER A  1 797  ? 138.257 162.444 134.354 1.00 124.42 ? 810  SER A OG  1 
ATOM   5393  N N   . LYS A  1 798  ? 140.728 163.365 138.043 1.00 123.07 ? 811  LYS A N   1 
ATOM   5394  C CA  . LYS A  1 798  ? 141.354 163.365 139.348 1.00 123.07 ? 811  LYS A CA  1 
ATOM   5395  C C   . LYS A  1 798  ? 141.143 164.731 139.969 1.00 123.07 ? 811  LYS A C   1 
ATOM   5396  O O   . LYS A  1 798  ? 141.154 165.740 139.269 1.00 123.07 ? 811  LYS A O   1 
ATOM   5397  C CB  . LYS A  1 798  ? 142.841 163.044 139.247 1.00 123.07 ? 811  LYS A CB  1 
ATOM   5398  C CG  . LYS A  1 798  ? 143.163 161.576 139.420 1.00 123.07 ? 811  LYS A CG  1 
ATOM   5399  C CD  . LYS A  1 798  ? 142.844 160.777 138.169 1.00 123.07 ? 811  LYS A CD  1 
ATOM   5400  C CE  . LYS A  1 798  ? 143.877 161.020 137.077 1.00 123.07 ? 811  LYS A CE  1 
ATOM   5401  N NZ  . LYS A  1 798  ? 143.697 160.118 135.905 1.00 123.07 ? 811  LYS A NZ  1 
ATOM   5402  N N   . ARG A  1 802  ? 148.109 167.638 138.842 1.00 85.82  ? 815  ARG A N   1 
ATOM   5403  C CA  . ARG A  1 802  ? 147.421 166.562 139.529 1.00 85.82  ? 815  ARG A CA  1 
ATOM   5404  C C   . ARG A  1 802  ? 147.456 165.312 138.672 1.00 85.82  ? 815  ARG A C   1 
ATOM   5405  O O   . ARG A  1 802  ? 146.542 165.084 137.896 1.00 85.82  ? 815  ARG A O   1 
ATOM   5406  C CB  . ARG A  1 802  ? 145.983 166.944 139.835 1.00 85.82  ? 815  ARG A CB  1 
ATOM   5407  C CG  . ARG A  1 802  ? 145.317 165.922 140.692 1.00 85.82  ? 815  ARG A CG  1 
ATOM   5408  C CD  . ARG A  1 802  ? 143.892 166.260 140.947 1.00 85.82  ? 815  ARG A CD  1 
ATOM   5409  N NE  . ARG A  1 802  ? 143.738 167.538 141.614 1.00 85.82  ? 815  ARG A NE  1 
ATOM   5410  C CZ  . ARG A  1 802  ? 142.560 168.052 141.933 1.00 85.82  ? 815  ARG A CZ  1 
ATOM   5411  N NH1 . ARG A  1 802  ? 142.490 169.221 142.544 1.00 85.82  ? 815  ARG A NH1 1 
ATOM   5412  N NH2 . ARG A  1 802  ? 141.450 167.386 141.651 1.00 85.82  ? 815  ARG A NH2 1 
ATOM   5413  N N   . SER A  1 803  ? 148.502 164.496 138.796 1.00 100.27 ? 816  SER A N   1 
ATOM   5414  C CA  . SER A  1 803  ? 148.640 163.353 137.907 1.00 100.27 ? 816  SER A CA  1 
ATOM   5415  C C   . SER A  1 803  ? 149.214 162.149 138.637 1.00 100.27 ? 816  SER A C   1 
ATOM   5416  O O   . SER A  1 803  ? 149.559 162.198 139.817 1.00 100.27 ? 816  SER A O   1 
ATOM   5417  C CB  . SER A  1 803  ? 149.525 163.672 136.712 1.00 100.27 ? 816  SER A CB  1 
ATOM   5418  O OG  . SER A  1 803  ? 149.259 164.979 136.244 1.00 100.27 ? 816  SER A OG  1 
ATOM   5419  N N   . PHE A  1 804  ? 149.341 161.065 137.872 1.00 105.90 ? 817  PHE A N   1 
ATOM   5420  C CA  . PHE A  1 804  ? 149.593 159.746 138.435 1.00 105.90 ? 817  PHE A CA  1 
ATOM   5421  C C   . PHE A  1 804  ? 150.925 159.693 139.158 1.00 105.90 ? 817  PHE A C   1 
ATOM   5422  O O   . PHE A  1 804  ? 150.999 159.309 140.332 1.00 105.90 ? 817  PHE A O   1 
ATOM   5423  C CB  . PHE A  1 804  ? 149.554 158.718 137.312 1.00 105.90 ? 817  PHE A CB  1 
ATOM   5424  C CG  . PHE A  1 804  ? 149.482 157.311 137.783 1.00 105.90 ? 817  PHE A CG  1 
ATOM   5425  C CD1 . PHE A  1 804  ? 148.267 156.718 138.041 1.00 105.90 ? 817  PHE A CD1 1 
ATOM   5426  C CD2 . PHE A  1 804  ? 150.629 156.577 137.961 1.00 105.90 ? 817  PHE A CD2 1 
ATOM   5427  C CE1 . PHE A  1 804  ? 148.200 155.416 138.473 1.00 105.90 ? 817  PHE A CE1 1 
ATOM   5428  C CE2 . PHE A  1 804  ? 150.569 155.275 138.391 1.00 105.90 ? 817  PHE A CE2 1 
ATOM   5429  C CZ  . PHE A  1 804  ? 149.354 154.693 138.650 1.00 105.90 ? 817  PHE A CZ  1 
ATOM   5430  N N   . ILE A  1 805  ? 151.997 160.036 138.452 1.00 99.04  ? 818  ILE A N   1 
ATOM   5431  C CA  . ILE A  1 805  ? 153.301 160.104 139.090 1.00 99.04  ? 818  ILE A CA  1 
ATOM   5432  C C   . ILE A  1 805  ? 153.212 160.976 140.317 1.00 99.04  ? 818  ILE A C   1 
ATOM   5433  O O   . ILE A  1 805  ? 153.713 160.637 141.391 1.00 99.04  ? 818  ILE A O   1 
ATOM   5434  C CB  . ILE A  1 805  ? 154.344 160.650 138.110 1.00 99.04  ? 818  ILE A CB  1 
ATOM   5435  C CG1 . ILE A  1 805  ? 154.155 160.004 136.750 1.00 99.04  ? 818  ILE A CG1 1 
ATOM   5436  C CG2 . ILE A  1 805  ? 155.716 160.384 138.641 1.00 99.04  ? 818  ILE A CG2 1 
ATOM   5437  C CD1 . ILE A  1 805  ? 154.223 158.508 136.795 1.00 99.04  ? 818  ILE A CD1 1 
ATOM   5438  N N   . GLU A  1 806  ? 152.521 162.093 140.171 1.00 101.40 ? 819  GLU A N   1 
ATOM   5439  C CA  . GLU A  1 806  ? 152.478 163.113 141.198 1.00 101.40 ? 819  GLU A CA  1 
ATOM   5440  C C   . GLU A  1 806  ? 151.976 162.541 142.510 1.00 101.40 ? 819  GLU A C   1 
ATOM   5441  O O   . GLU A  1 806  ? 152.526 162.820 143.576 1.00 101.40 ? 819  GLU A O   1 
ATOM   5442  C CB  . GLU A  1 806  ? 151.604 164.244 140.671 1.00 101.40 ? 819  GLU A CB  1 
ATOM   5443  C CG  . GLU A  1 806  ? 151.926 164.450 139.174 1.00 101.40 ? 819  GLU A CG  1 
ATOM   5444  C CD  . GLU A  1 806  ? 151.169 165.571 138.487 1.00 101.40 ? 819  GLU A CD  1 
ATOM   5445  O OE1 . GLU A  1 806  ? 150.274 166.162 139.104 1.00 101.40 ? 819  GLU A OE1 1 
ATOM   5446  O OE2 . GLU A  1 806  ? 151.474 165.856 137.311 1.00 101.40 ? 819  GLU A OE2 1 
ATOM   5447  N N   . ASP A  1 807  ? 150.963 161.681 142.444 1.00 108.13 ? 820  ASP A N   1 
ATOM   5448  C CA  . ASP A  1 807  ? 150.463 161.068 143.668 1.00 108.13 ? 820  ASP A CA  1 
ATOM   5449  C C   . ASP A  1 807  ? 151.349 159.915 144.114 1.00 108.13 ? 820  ASP A C   1 
ATOM   5450  O O   . ASP A  1 807  ? 151.782 159.875 145.270 1.00 108.13 ? 820  ASP A O   1 
ATOM   5451  C CB  . ASP A  1 807  ? 149.022 160.594 143.480 1.00 108.13 ? 820  ASP A CB  1 
ATOM   5452  C CG  . ASP A  1 807  ? 148.874 159.615 142.340 1.00 108.13 ? 820  ASP A CG  1 
ATOM   5453  O OD1 . ASP A  1 807  ? 149.366 158.475 142.464 1.00 108.13 ? 820  ASP A OD1 1 
ATOM   5454  O OD2 . ASP A  1 807  ? 148.275 159.987 141.314 1.00 108.13 ? 820  ASP A OD2 1 
ATOM   5455  N N   . LEU A  1 808  ? 151.643 158.973 143.212 1.00 107.58 ? 821  LEU A N   1 
ATOM   5456  C CA  . LEU A  1 808  ? 152.368 157.788 143.648 1.00 107.58 ? 821  LEU A CA  1 
ATOM   5457  C C   . LEU A  1 808  ? 153.673 158.175 144.306 1.00 107.58 ? 821  LEU A C   1 
ATOM   5458  O O   . LEU A  1 808  ? 154.204 157.431 145.132 1.00 107.58 ? 821  LEU A O   1 
ATOM   5459  C CB  . LEU A  1 808  ? 152.640 156.843 142.486 1.00 107.58 ? 821  LEU A CB  1 
ATOM   5460  C CG  . LEU A  1 808  ? 153.644 157.295 141.434 1.00 107.58 ? 821  LEU A CG  1 
ATOM   5461  C CD1 . LEU A  1 808  ? 155.037 156.782 141.767 1.00 107.58 ? 821  LEU A CD1 1 
ATOM   5462  C CD2 . LEU A  1 808  ? 153.221 156.771 140.093 1.00 107.58 ? 821  LEU A CD2 1 
ATOM   5463  N N   . LEU A  1 809  ? 154.212 159.325 143.945 1.00 101.05 ? 822  LEU A N   1 
ATOM   5464  C CA  . LEU A  1 809  ? 155.275 159.856 144.764 1.00 101.05 ? 822  LEU A CA  1 
ATOM   5465  C C   . LEU A  1 809  ? 154.703 160.583 145.955 1.00 101.05 ? 822  LEU A C   1 
ATOM   5466  O O   . LEU A  1 809  ? 155.240 160.460 147.058 1.00 101.05 ? 822  LEU A O   1 
ATOM   5467  C CB  . LEU A  1 809  ? 156.170 160.777 143.943 1.00 101.05 ? 822  LEU A CB  1 
ATOM   5468  C CG  . LEU A  1 809  ? 155.549 161.955 143.199 1.00 101.05 ? 822  LEU A CG  1 
ATOM   5469  C CD1 . LEU A  1 809  ? 155.581 163.211 144.015 1.00 101.05 ? 822  LEU A CD1 1 
ATOM   5470  C CD2 . LEU A  1 809  ? 156.270 162.163 141.889 1.00 101.05 ? 822  LEU A CD2 1 
ATOM   5471  N N   . PHE A  1 810  ? 153.585 161.283 145.766 1.00 105.86 ? 823  PHE A N   1 
ATOM   5472  C CA  . PHE A  1 810  ? 153.039 162.095 146.843 1.00 105.86 ? 823  PHE A CA  1 
ATOM   5473  C C   . PHE A  1 810  ? 152.737 161.255 148.061 1.00 105.86 ? 823  PHE A C   1 
ATOM   5474  O O   . PHE A  1 810  ? 152.675 161.774 149.178 1.00 105.86 ? 823  PHE A O   1 
ATOM   5475  C CB  . PHE A  1 810  ? 151.779 162.810 146.383 1.00 105.86 ? 823  PHE A CB  1 
ATOM   5476  C CG  . PHE A  1 810  ? 151.145 163.641 147.446 1.00 105.86 ? 823  PHE A CG  1 
ATOM   5477  C CD1 . PHE A  1 810  ? 151.741 164.806 147.873 1.00 105.86 ? 823  PHE A CD1 1 
ATOM   5478  C CD2 . PHE A  1 810  ? 149.958 163.251 148.028 1.00 105.86 ? 823  PHE A CD2 1 
ATOM   5479  C CE1 . PHE A  1 810  ? 151.161 165.570 148.847 1.00 105.86 ? 823  PHE A CE1 1 
ATOM   5480  C CE2 . PHE A  1 810  ? 149.373 164.013 149.006 1.00 105.86 ? 823  PHE A CE2 1 
ATOM   5481  C CZ  . PHE A  1 810  ? 149.975 165.174 149.415 1.00 105.86 ? 823  PHE A CZ  1 
ATOM   5482  N N   . ASN A  1 811  ? 152.543 159.963 147.869 1.00 113.51 ? 824  ASN A N   1 
ATOM   5483  C CA  . ASN A  1 811  ? 152.391 159.048 148.981 1.00 113.51 ? 824  ASN A CA  1 
ATOM   5484  C C   . ASN A  1 811  ? 153.624 158.195 149.199 1.00 113.51 ? 824  ASN A C   1 
ATOM   5485  O O   . ASN A  1 811  ? 153.739 157.560 150.249 1.00 113.51 ? 824  ASN A O   1 
ATOM   5486  C CB  . ASN A  1 811  ? 151.181 158.156 148.734 1.00 113.51 ? 824  ASN A CB  1 
ATOM   5487  C CG  . ASN A  1 811  ? 151.100 157.716 147.303 1.00 113.51 ? 824  ASN A CG  1 
ATOM   5488  O OD1 . ASN A  1 811  ? 152.120 157.588 146.645 1.00 113.51 ? 824  ASN A OD1 1 
ATOM   5489  N ND2 . ASN A  1 811  ? 149.891 157.517 146.800 1.00 113.51 ? 824  ASN A ND2 1 
ATOM   5490  N N   . LYS A  1 812  ? 154.545 158.172 148.235 1.00 116.60 ? 825  LYS A N   1 
ATOM   5491  C CA  . LYS A  1 812  ? 155.750 157.369 148.384 1.00 116.60 ? 825  LYS A CA  1 
ATOM   5492  C C   . LYS A  1 812  ? 156.534 157.779 149.620 1.00 116.60 ? 825  LYS A C   1 
ATOM   5493  O O   . LYS A  1 812  ? 157.285 156.975 150.179 1.00 116.60 ? 825  LYS A O   1 
ATOM   5494  C CB  . LYS A  1 812  ? 156.609 157.493 147.125 1.00 116.60 ? 825  LYS A CB  1 
ATOM   5495  C CG  . LYS A  1 812  ? 157.906 156.718 147.177 1.00 116.60 ? 825  LYS A CG  1 
ATOM   5496  C CD  . LYS A  1 812  ? 157.655 155.252 147.479 1.00 116.60 ? 825  LYS A CD  1 
ATOM   5497  C CE  . LYS A  1 812  ? 157.225 154.468 146.254 1.00 116.60 ? 825  LYS A CE  1 
ATOM   5498  N NZ  . LYS A  1 812  ? 158.385 154.101 145.390 1.00 116.60 ? 825  LYS A NZ  1 
ATOM   5499  N N   . VAL A  1 813  ? 156.353 159.012 150.072 1.00 113.70 ? 826  VAL A N   1 
ATOM   5500  C CA  . VAL A  1 813  ? 157.021 159.526 151.257 1.00 113.70 ? 826  VAL A CA  1 
ATOM   5501  C C   . VAL A  1 813  ? 156.392 158.922 152.500 1.00 113.70 ? 826  VAL A C   1 
ATOM   5502  O O   . VAL A  1 813  ? 155.313 158.325 152.426 1.00 113.70 ? 826  VAL A O   1 
ATOM   5503  C CB  . VAL A  1 813  ? 156.912 161.049 151.291 1.00 113.70 ? 826  VAL A CB  1 
ATOM   5504  C CG1 . VAL A  1 813  ? 157.577 161.610 150.090 1.00 113.70 ? 826  VAL A CG1 1 
ATOM   5505  C CG2 . VAL A  1 813  ? 155.465 161.433 151.294 1.00 113.70 ? 826  VAL A CG2 1 
ATOM   5506  N N   . THR A  1 814  ? 157.047 159.087 153.652 1.00 117.23 ? 827  THR A N   1 
ATOM   5507  C CA  . THR A  1 814  ? 156.501 158.707 154.954 1.00 117.23 ? 827  THR A CA  1 
ATOM   5508  C C   . THR A  1 814  ? 156.145 159.937 155.775 1.00 117.23 ? 827  THR A C   1 
ATOM   5509  O O   . THR A  1 814  ? 156.399 159.994 156.976 1.00 117.23 ? 827  THR A O   1 
ATOM   5510  C CB  . THR A  1 814  ? 157.471 157.842 155.746 1.00 117.23 ? 827  THR A CB  1 
ATOM   5511  O OG1 . THR A  1 814  ? 158.470 158.678 156.339 1.00 117.23 ? 827  THR A OG1 1 
ATOM   5512  C CG2 . THR A  1 814  ? 158.132 156.827 154.850 1.00 117.23 ? 827  THR A CG2 1 
ATOM   5513  N N   . LEU A  1 815  ? 155.587 160.944 155.114 1.00 108.65 ? 828  LEU A N   1 
ATOM   5514  C CA  . LEU A  1 815  ? 155.059 162.133 155.766 1.00 108.65 ? 828  LEU A CA  1 
ATOM   5515  C C   . LEU A  1 815  ? 154.193 161.764 156.960 1.00 108.65 ? 828  LEU A C   1 
ATOM   5516  O O   . LEU A  1 815  ? 153.685 160.647 157.047 1.00 108.65 ? 828  LEU A O   1 
ATOM   5517  C CB  . LEU A  1 815  ? 154.247 162.964 154.767 1.00 108.65 ? 828  LEU A CB  1 
ATOM   5518  C CG  . LEU A  1 815  ? 153.798 164.369 155.166 1.00 108.65 ? 828  LEU A CG  1 
ATOM   5519  C CD1 . LEU A  1 815  ? 154.907 165.364 154.944 1.00 108.65 ? 828  LEU A CD1 1 
ATOM   5520  C CD2 . LEU A  1 815  ? 152.571 164.772 154.383 1.00 108.65 ? 828  LEU A CD2 1 
ATOM   5521  N N   . GLN A  1 840  ? 152.862 163.763 168.299 1.00 95.82  ? 853  GLN A N   1 
ATOM   5522  C CA  . GLN A  1 840  ? 153.244 164.802 167.353 1.00 95.82  ? 853  GLN A CA  1 
ATOM   5523  C C   . GLN A  1 840  ? 153.889 166.014 168.049 1.00 95.82  ? 853  GLN A C   1 
ATOM   5524  O O   . GLN A  1 840  ? 155.094 166.226 167.930 1.00 95.82  ? 853  GLN A O   1 
ATOM   5525  C CB  . GLN A  1 840  ? 152.029 165.241 166.541 1.00 95.82  ? 853  GLN A CB  1 
ATOM   5526  C CG  . GLN A  1 840  ? 152.370 166.080 165.338 1.00 95.82  ? 853  GLN A CG  1 
ATOM   5527  C CD  . GLN A  1 840  ? 151.147 166.668 164.694 1.00 95.82  ? 853  GLN A CD  1 
ATOM   5528  O OE1 . GLN A  1 840  ? 150.047 166.140 164.829 1.00 95.82  ? 853  GLN A OE1 1 
ATOM   5529  N NE2 . GLN A  1 840  ? 151.324 167.785 164.007 1.00 95.82  ? 853  GLN A NE2 1 
ATOM   5530  N N   . LYS A  1 841  ? 153.087 166.809 168.758 1.00 96.93  ? 854  LYS A N   1 
ATOM   5531  C CA  . LYS A  1 841  ? 153.590 167.921 169.553 1.00 96.93  ? 854  LYS A CA  1 
ATOM   5532  C C   . LYS A  1 841  ? 152.504 168.330 170.533 1.00 96.93  ? 854  LYS A C   1 
ATOM   5533  O O   . LYS A  1 841  ? 151.325 168.343 170.177 1.00 96.93  ? 854  LYS A O   1 
ATOM   5534  C CB  . LYS A  1 841  ? 153.971 169.128 168.691 1.00 96.93  ? 854  LYS A CB  1 
ATOM   5535  C CG  . LYS A  1 841  ? 152.775 169.869 168.134 1.00 96.93  ? 854  LYS A CG  1 
ATOM   5536  C CD  . LYS A  1 841  ? 152.354 171.004 169.062 1.00 96.93  ? 854  LYS A CD  1 
ATOM   5537  C CE  . LYS A  1 841  ? 151.028 171.587 168.648 1.00 96.93  ? 854  LYS A CE  1 
ATOM   5538  N NZ  . LYS A  1 841  ? 150.565 172.594 169.630 1.00 96.93  ? 854  LYS A NZ  1 
ATOM   5539  N N   . PHE A  1 842  ? 152.894 168.648 171.772 1.00 100.71 ? 855  PHE A N   1 
ATOM   5540  C CA  . PHE A  1 842  ? 151.951 169.280 172.689 1.00 100.71 ? 855  PHE A CA  1 
ATOM   5541  C C   . PHE A  1 842  ? 152.597 170.275 173.642 1.00 100.71 ? 855  PHE A C   1 
ATOM   5542  O O   . PHE A  1 842  ? 152.037 170.542 174.707 1.00 100.71 ? 855  PHE A O   1 
ATOM   5543  C CB  . PHE A  1 842  ? 151.180 168.242 173.492 1.00 100.71 ? 855  PHE A CB  1 
ATOM   5544  C CG  . PHE A  1 842  ? 150.095 167.572 172.708 1.00 100.71 ? 855  PHE A CG  1 
ATOM   5545  C CD1 . PHE A  1 842  ? 148.870 168.196 172.536 1.00 100.71 ? 855  PHE A CD1 1 
ATOM   5546  C CD2 . PHE A  1 842  ? 150.300 166.332 172.125 1.00 100.71 ? 855  PHE A CD2 1 
ATOM   5547  C CE1 . PHE A  1 842  ? 147.869 167.591 171.813 1.00 100.71 ? 855  PHE A CE1 1 
ATOM   5548  C CE2 . PHE A  1 842  ? 149.302 165.725 171.396 1.00 100.71 ? 855  PHE A CE2 1 
ATOM   5549  C CZ  . PHE A  1 842  ? 148.085 166.355 171.241 1.00 100.71 ? 855  PHE A CZ  1 
ATOM   5550  N N   . ASN A  1 843  ? 153.749 170.832 173.302 1.00 97.54  ? 856  ASN A N   1 
ATOM   5551  C CA  . ASN A  1 843  ? 154.472 171.650 174.265 1.00 97.54  ? 856  ASN A CA  1 
ATOM   5552  C C   . ASN A  1 843  ? 155.553 172.430 173.545 1.00 97.54  ? 856  ASN A C   1 
ATOM   5553  O O   . ASN A  1 843  ? 156.317 171.851 172.772 1.00 97.54  ? 856  ASN A O   1 
ATOM   5554  C CB  . ASN A  1 843  ? 155.069 170.769 175.329 1.00 97.54  ? 856  ASN A CB  1 
ATOM   5555  C CG  . ASN A  1 843  ? 155.740 169.579 174.738 1.00 97.54  ? 856  ASN A CG  1 
ATOM   5556  O OD1 . ASN A  1 843  ? 155.704 169.385 173.528 1.00 97.54  ? 856  ASN A OD1 1 
ATOM   5557  N ND2 . ASN A  1 843  ? 156.373 168.774 175.570 1.00 97.54  ? 856  ASN A ND2 1 
ATOM   5558  N N   . GLY A  1 844  ? 155.606 173.733 173.791 1.00 90.46  ? 857  GLY A N   1 
ATOM   5559  C CA  . GLY A  1 844  ? 156.748 174.533 173.403 1.00 90.46  ? 857  GLY A CA  1 
ATOM   5560  C C   . GLY A  1 844  ? 157.199 174.373 171.967 1.00 90.46  ? 857  GLY A C   1 
ATOM   5561  O O   . GLY A  1 844  ? 158.364 174.613 171.652 1.00 90.46  ? 857  GLY A O   1 
ATOM   5562  N N   . LEU A  1 845  ? 156.309 173.941 171.090 1.00 79.79  ? 858  LEU A N   1 
ATOM   5563  C CA  . LEU A  1 845  ? 156.674 173.649 169.719 1.00 79.79  ? 858  LEU A CA  1 
ATOM   5564  C C   . LEU A  1 845  ? 155.521 174.018 168.802 1.00 79.79  ? 858  LEU A C   1 
ATOM   5565  O O   . LEU A  1 845  ? 154.366 174.061 169.225 1.00 79.79  ? 858  LEU A O   1 
ATOM   5566  C CB  . LEU A  1 845  ? 157.016 172.171 169.578 1.00 79.79  ? 858  LEU A CB  1 
ATOM   5567  C CG  . LEU A  1 845  ? 157.067 171.569 168.186 1.00 79.79  ? 858  LEU A CG  1 
ATOM   5568  C CD1 . LEU A  1 845  ? 158.101 172.293 167.372 1.00 79.79  ? 858  LEU A CD1 1 
ATOM   5569  C CD2 . LEU A  1 845  ? 157.384 170.104 168.272 1.00 79.79  ? 858  LEU A CD2 1 
ATOM   5570  N N   . THR A  1 846  ? 155.832 174.295 167.539 1.00 79.08  ? 859  THR A N   1 
ATOM   5571  C CA  . THR A  1 846  ? 154.795 174.299 166.526 1.00 79.08  ? 859  THR A CA  1 
ATOM   5572  C C   . THR A  1 846  ? 155.333 173.756 165.225 1.00 79.08  ? 859  THR A C   1 
ATOM   5573  O O   . THR A  1 846  ? 156.533 173.555 165.048 1.00 79.08  ? 859  THR A O   1 
ATOM   5574  C CB  . THR A  1 846  ? 154.238 175.685 166.252 1.00 79.08  ? 859  THR A CB  1 
ATOM   5575  O OG1 . THR A  1 846  ? 153.337 175.610 165.140 1.00 79.08  ? 859  THR A OG1 1 
ATOM   5576  C CG2 . THR A  1 846  ? 155.351 176.602 165.896 1.00 79.08  ? 859  THR A CG2 1 
ATOM   5577  N N   . VAL A  1 847  ? 154.402 173.548 164.308 1.00 78.64  ? 860  VAL A N   1 
ATOM   5578  C CA  . VAL A  1 847  ? 154.677 173.300 162.905 1.00 78.64  ? 860  VAL A CA  1 
ATOM   5579  C C   . VAL A  1 847  ? 153.814 174.265 162.110 1.00 78.64  ? 860  VAL A C   1 
ATOM   5580  O O   . VAL A  1 847  ? 152.658 174.500 162.465 1.00 78.64  ? 860  VAL A O   1 
ATOM   5581  C CB  . VAL A  1 847  ? 154.396 171.840 162.518 1.00 78.64  ? 860  VAL A CB  1 
ATOM   5582  C CG1 . VAL A  1 847  ? 152.982 171.458 162.885 1.00 78.64  ? 860  VAL A CG1 1 
ATOM   5583  C CG2 . VAL A  1 847  ? 154.605 171.659 161.041 1.00 78.64  ? 860  VAL A CG2 1 
ATOM   5584  N N   . LEU A  1 848  ? 154.377 174.868 161.104 1.00 81.33  ? 861  LEU A N   1 
ATOM   5585  C CA  . LEU A  1 848  ? 153.660 175.911 160.401 1.00 81.33  ? 861  LEU A CA  1 
ATOM   5586  C C   . LEU A  1 848  ? 153.139 175.421 159.075 1.00 81.33  ? 861  LEU A C   1 
ATOM   5587  O O   . LEU A  1 848  ? 153.458 174.315 158.642 1.00 81.33  ? 861  LEU A O   1 
ATOM   5588  C CB  . LEU A  1 848  ? 154.561 177.119 160.191 1.00 81.33  ? 861  LEU A CB  1 
ATOM   5589  C CG  . LEU A  1 848  ? 154.343 178.159 161.277 1.00 81.33  ? 861  LEU A CG  1 
ATOM   5590  C CD1 . LEU A  1 848  ? 154.714 177.635 162.637 1.00 81.33  ? 861  LEU A CD1 1 
ATOM   5591  C CD2 . LEU A  1 848  ? 155.169 179.380 160.947 1.00 81.33  ? 861  LEU A CD2 1 
ATOM   5592  N N   . PRO A  1 849  ? 152.295 176.200 158.419 1.00 82.98  ? 862  PRO A N   1 
ATOM   5593  C CA  . PRO A  1 849  ? 151.816 175.816 157.110 1.00 82.98  ? 862  PRO A CA  1 
ATOM   5594  C C   . PRO A  1 849  ? 152.749 176.305 156.023 1.00 82.98  ? 862  PRO A C   1 
ATOM   5595  O O   . PRO A  1 849  ? 153.313 177.402 156.118 1.00 82.98  ? 862  PRO A O   1 
ATOM   5596  C CB  . PRO A  1 849  ? 150.464 176.521 157.022 1.00 82.98  ? 862  PRO A CB  1 
ATOM   5597  C CG  . PRO A  1 849  ? 150.661 177.736 157.821 1.00 82.98  ? 862  PRO A CG  1 
ATOM   5598  C CD  . PRO A  1 849  ? 151.537 177.337 158.958 1.00 82.98  ? 862  PRO A CD  1 
ATOM   5599  N N   . PRO A  1 850  ? 152.935 175.524 154.970 1.00 86.56  ? 863  PRO A N   1 
ATOM   5600  C CA  . PRO A  1 850  ? 153.678 176.024 153.821 1.00 86.56  ? 863  PRO A CA  1 
ATOM   5601  C C   . PRO A  1 850  ? 152.793 176.963 153.040 1.00 86.56  ? 863  PRO A C   1 
ATOM   5602  O O   . PRO A  1 850  ? 151.667 176.619 152.686 1.00 86.56  ? 863  PRO A O   1 
ATOM   5603  C CB  . PRO A  1 850  ? 153.994 174.757 153.033 1.00 86.56  ? 863  PRO A CB  1 
ATOM   5604  C CG  . PRO A  1 850  ? 152.846 173.882 153.323 1.00 86.56  ? 863  PRO A CG  1 
ATOM   5605  C CD  . PRO A  1 850  ? 152.378 174.192 154.718 1.00 86.56  ? 863  PRO A CD  1 
ATOM   5606  N N   . LEU A  1 851  ? 153.299 178.161 152.783 1.00 98.96  ? 864  LEU A N   1 
ATOM   5607  C CA  . LEU A  1 851  ? 152.429 179.225 152.312 1.00 98.96  ? 864  LEU A CA  1 
ATOM   5608  C C   . LEU A  1 851  ? 151.702 178.849 151.036 1.00 98.96  ? 864  LEU A C   1 
ATOM   5609  O O   . LEU A  1 851  ? 150.473 178.762 151.034 1.00 98.96  ? 864  LEU A O   1 
ATOM   5610  C CB  . LEU A  1 851  ? 153.200 180.505 152.072 1.00 98.96  ? 864  LEU A CB  1 
ATOM   5611  C CG  . LEU A  1 851  ? 152.205 181.444 151.414 1.00 98.96  ? 864  LEU A CG  1 
ATOM   5612  C CD1 . LEU A  1 851  ? 151.159 181.872 152.416 1.00 98.96  ? 864  LEU A CD1 1 
ATOM   5613  C CD2 . LEU A  1 851  ? 152.906 182.620 150.816 1.00 98.96  ? 864  LEU A CD2 1 
ATOM   5614  N N   . LEU A  1 852  ? 152.433 178.637 149.949 1.00 102.92 ? 865  LEU A N   1 
ATOM   5615  C CA  . LEU A  1 852  ? 151.801 178.156 148.731 1.00 102.92 ? 865  LEU A CA  1 
ATOM   5616  C C   . LEU A  1 852  ? 151.322 176.741 148.986 1.00 102.92 ? 865  LEU A C   1 
ATOM   5617  O O   . LEU A  1 852  ? 152.131 175.818 149.075 1.00 102.92 ? 865  LEU A O   1 
ATOM   5618  C CB  . LEU A  1 852  ? 152.765 178.197 147.553 1.00 102.92 ? 865  LEU A CB  1 
ATOM   5619  C CG  . LEU A  1 852  ? 153.196 179.545 146.986 1.00 102.92 ? 865  LEU A CG  1 
ATOM   5620  C CD1 . LEU A  1 852  ? 154.055 179.347 145.759 1.00 102.92 ? 865  LEU A CD1 1 
ATOM   5621  C CD2 . LEU A  1 852  ? 151.992 180.364 146.632 1.00 102.92 ? 865  LEU A CD2 1 
ATOM   5622  N N   . THR A  1 853  ? 150.019 176.562 149.151 1.00 109.64 ? 866  THR A N   1 
ATOM   5623  C CA  . THR A  1 853  ? 149.530 175.245 149.508 1.00 109.64 ? 866  THR A CA  1 
ATOM   5624  C C   . THR A  1 853  ? 149.740 174.273 148.366 1.00 109.64 ? 866  THR A C   1 
ATOM   5625  O O   . THR A  1 853  ? 149.628 174.625 147.191 1.00 109.64 ? 866  THR A O   1 
ATOM   5626  C CB  . THR A  1 853  ? 148.060 175.276 149.872 1.00 109.64 ? 866  THR A CB  1 
ATOM   5627  O OG1 . THR A  1 853  ? 147.625 173.931 150.071 1.00 109.64 ? 866  THR A OG1 1 
ATOM   5628  C CG2 . THR A  1 853  ? 147.265 175.919 148.768 1.00 109.64 ? 866  THR A CG2 1 
ATOM   5629  N N   . ASP A  1 854  ? 150.033 173.030 148.733 1.00 109.30 ? 867  ASP A N   1 
ATOM   5630  C CA  . ASP A  1 854  ? 150.550 172.086 147.756 1.00 109.30 ? 867  ASP A CA  1 
ATOM   5631  C C   . ASP A  1 854  ? 149.599 171.910 146.584 1.00 109.30 ? 867  ASP A C   1 
ATOM   5632  O O   . ASP A  1 854  ? 150.032 171.908 145.428 1.00 109.30 ? 867  ASP A O   1 
ATOM   5633  C CB  . ASP A  1 854  ? 150.853 170.754 148.434 1.00 109.30 ? 867  ASP A CB  1 
ATOM   5634  C CG  . ASP A  1 854  ? 149.701 170.250 149.251 1.00 109.30 ? 867  ASP A CG  1 
ATOM   5635  O OD1 . ASP A  1 854  ? 148.724 170.999 149.395 1.00 109.30 ? 867  ASP A OD1 1 
ATOM   5636  O OD2 . ASP A  1 854  ? 149.770 169.109 149.750 1.00 109.30 ? 867  ASP A OD2 1 
ATOM   5637  N N   . GLU A  1 855  ? 148.300 171.796 146.849 1.00 111.84 ? 868  GLU A N   1 
ATOM   5638  C CA  . GLU A  1 855  ? 147.360 171.571 145.755 1.00 111.84 ? 868  GLU A CA  1 
ATOM   5639  C C   . GLU A  1 855  ? 147.396 172.704 144.743 1.00 111.84 ? 868  GLU A C   1 
ATOM   5640  O O   . GLU A  1 855  ? 146.958 172.539 143.601 1.00 111.84 ? 868  GLU A O   1 
ATOM   5641  C CB  . GLU A  1 855  ? 145.953 171.399 146.307 1.00 111.84 ? 868  GLU A CB  1 
ATOM   5642  C CG  . GLU A  1 855  ? 145.347 172.664 146.886 1.00 111.84 ? 868  GLU A CG  1 
ATOM   5643  C CD  . GLU A  1 855  ? 145.793 172.929 148.317 1.00 111.84 ? 868  GLU A CD  1 
ATOM   5644  O OE1 . GLU A  1 855  ? 146.888 172.479 148.690 1.00 111.84 ? 868  GLU A OE1 1 
ATOM   5645  O OE2 . GLU A  1 855  ? 145.052 173.577 149.087 1.00 111.84 ? 868  GLU A OE2 1 
ATOM   5646  N N   . MET A  1 856  ? 147.911 173.854 145.142 1.00 104.74 ? 869  MET A N   1 
ATOM   5647  C CA  . MET A  1 856  ? 148.019 174.999 144.260 1.00 104.74 ? 869  MET A CA  1 
ATOM   5648  C C   . MET A  1 856  ? 149.376 175.043 143.578 1.00 104.74 ? 869  MET A C   1 
ATOM   5649  O O   . MET A  1 856  ? 149.473 175.343 142.386 1.00 104.74 ? 869  MET A O   1 
ATOM   5650  C CB  . MET A  1 856  ? 147.773 176.262 145.079 1.00 104.74 ? 869  MET A CB  1 
ATOM   5651  C CG  . MET A  1 856  ? 147.895 177.550 144.343 1.00 104.74 ? 869  MET A CG  1 
ATOM   5652  S SD  . MET A  1 856  ? 147.615 178.799 145.580 1.00 104.74 ? 869  MET A SD  1 
ATOM   5653  C CE  . MET A  1 856  ? 149.001 178.425 146.629 1.00 104.74 ? 869  MET A CE  1 
ATOM   5654  N N   . ILE A  1 857  ? 150.436 174.751 144.324 1.00 102.54 ? 870  ILE A N   1 
ATOM   5655  C CA  . ILE A  1 857  ? 151.741 174.682 143.692 1.00 102.54 ? 870  ILE A CA  1 
ATOM   5656  C C   . ILE A  1 857  ? 151.680 173.654 142.598 1.00 102.54 ? 870  ILE A C   1 
ATOM   5657  O O   . ILE A  1 857  ? 152.353 173.772 141.570 1.00 102.54 ? 870  ILE A O   1 
ATOM   5658  C CB  . ILE A  1 857  ? 152.822 174.359 144.733 1.00 102.54 ? 870  ILE A CB  1 
ATOM   5659  C CG1 . ILE A  1 857  ? 152.923 172.862 144.981 1.00 102.54 ? 870  ILE A CG1 1 
ATOM   5660  C CG2 . ILE A  1 857  ? 152.472 175.015 146.029 1.00 102.54 ? 870  ILE A CG2 1 
ATOM   5661  C CD1 . ILE A  1 857  ? 154.001 172.496 145.954 1.00 102.54 ? 870  ILE A CD1 1 
ATOM   5662  N N   . ALA A  1 858  ? 150.846 172.646 142.790 1.00 102.89 ? 871  ALA A N   1 
ATOM   5663  C CA  . ALA A  1 858  ? 150.542 171.749 141.706 1.00 102.89 ? 871  ALA A CA  1 
ATOM   5664  C C   . ALA A  1 858  ? 150.051 172.534 140.521 1.00 102.89 ? 871  ALA A C   1 
ATOM   5665  O O   . ALA A  1 858  ? 150.483 172.297 139.392 1.00 102.89 ? 871  ALA A O   1 
ATOM   5666  C CB  . ALA A  1 858  ? 149.491 170.741 142.140 1.00 102.89 ? 871  ALA A CB  1 
ATOM   5667  N N   . GLN A  1 859  ? 149.157 173.488 140.762 1.00 105.35 ? 872  GLN A N   1 
ATOM   5668  C CA  . GLN A  1 859  ? 148.596 174.235 139.649 1.00 105.35 ? 872  GLN A CA  1 
ATOM   5669  C C   . GLN A  1 859  ? 149.682 175.015 138.934 1.00 105.35 ? 872  GLN A C   1 
ATOM   5670  O O   . GLN A  1 859  ? 149.721 175.069 137.700 1.00 105.35 ? 872  GLN A O   1 
ATOM   5671  C CB  . GLN A  1 859  ? 147.496 175.170 140.134 1.00 105.35 ? 872  GLN A CB  1 
ATOM   5672  C CG  . GLN A  1 859  ? 146.779 175.841 139.006 1.00 105.35 ? 872  GLN A CG  1 
ATOM   5673  C CD  . GLN A  1 859  ? 145.560 176.576 139.467 1.00 105.35 ? 872  GLN A CD  1 
ATOM   5674  O OE1 . GLN A  1 859  ? 145.607 177.772 139.734 1.00 105.35 ? 872  GLN A OE1 1 
ATOM   5675  N NE2 . GLN A  1 859  ? 144.456 175.861 139.585 1.00 105.35 ? 872  GLN A NE2 1 
ATOM   5676  N N   . TYR A  1 860  ? 150.564 175.633 139.704 1.00 107.20 ? 873  TYR A N   1 
ATOM   5677  C CA  . TYR A  1 860  ? 151.684 176.342 139.107 1.00 107.20 ? 873  TYR A CA  1 
ATOM   5678  C C   . TYR A  1 860  ? 152.483 175.420 138.222 1.00 107.20 ? 873  TYR A C   1 
ATOM   5679  O O   . TYR A  1 860  ? 152.763 175.727 137.061 1.00 107.20 ? 873  TYR A O   1 
ATOM   5680  C CB  . TYR A  1 860  ? 152.584 176.925 140.180 1.00 107.20 ? 873  TYR A CB  1 
ATOM   5681  C CG  . TYR A  1 860  ? 152.368 178.381 140.318 1.00 107.20 ? 873  TYR A CG  1 
ATOM   5682  C CD1 . TYR A  1 860  ? 152.500 179.207 139.232 1.00 107.20 ? 873  TYR A CD1 1 
ATOM   5683  C CD2 . TYR A  1 860  ? 152.026 178.934 141.524 1.00 107.20 ? 873  TYR A CD2 1 
ATOM   5684  C CE1 . TYR A  1 860  ? 152.295 180.544 139.338 1.00 107.20 ? 873  TYR A CE1 1 
ATOM   5685  C CE2 . TYR A  1 860  ? 151.818 180.276 141.644 1.00 107.20 ? 873  TYR A CE2 1 
ATOM   5686  C CZ  . TYR A  1 860  ? 151.950 181.079 140.544 1.00 107.20 ? 873  TYR A CZ  1 
ATOM   5687  O OH  . TYR A  1 860  ? 151.749 182.433 140.640 1.00 107.20 ? 873  TYR A OH  1 
ATOM   5688  N N   . THR A  1 861  ? 152.894 174.297 138.786 1.00 103.90 ? 874  THR A N   1 
ATOM   5689  C CA  . THR A  1 861  ? 153.678 173.337 138.038 1.00 103.90 ? 874  THR A CA  1 
ATOM   5690  C C   . THR A  1 861  ? 152.967 172.967 136.759 1.00 103.90 ? 874  THR A C   1 
ATOM   5691  O O   . THR A  1 861  ? 153.565 172.932 135.678 1.00 103.90 ? 874  THR A O   1 
ATOM   5692  C CB  . THR A  1 861  ? 153.888 172.102 138.899 1.00 103.90 ? 874  THR A CB  1 
ATOM   5693  O OG1 . THR A  1 861  ? 152.646 171.775 139.524 1.00 103.90 ? 874  THR A OG1 1 
ATOM   5694  C CG2 . THR A  1 861  ? 154.933 172.357 139.964 1.00 103.90 ? 874  THR A CG2 1 
ATOM   5695  N N   . SER A  1 862  ? 151.684 172.672 136.878 1.00 100.98 ? 875  SER A N   1 
ATOM   5696  C CA  . SER A  1 862  ? 150.915 172.257 135.727 1.00 100.98 ? 875  SER A CA  1 
ATOM   5697  C C   . SER A  1 862  ? 150.985 173.313 134.657 1.00 100.98 ? 875  SER A C   1 
ATOM   5698  O O   . SER A  1 862  ? 151.332 173.031 133.511 1.00 100.98 ? 875  SER A O   1 
ATOM   5699  C CB  . SER A  1 862  ? 149.468 172.037 136.127 1.00 100.98 ? 875  SER A CB  1 
ATOM   5700  O OG  . SER A  1 862  ? 148.990 173.201 136.759 1.00 100.98 ? 875  SER A OG  1 
ATOM   5701  N N   . ALA A  1 863  ? 150.650 174.544 135.020 1.00 105.75 ? 876  ALA A N   1 
ATOM   5702  C CA  . ALA A  1 863  ? 150.659 175.614 134.037 1.00 105.75 ? 876  ALA A CA  1 
ATOM   5703  C C   . ALA A  1 863  ? 152.035 175.748 133.417 1.00 105.75 ? 876  ALA A C   1 
ATOM   5704  O O   . ALA A  1 863  ? 152.165 175.944 132.205 1.00 105.75 ? 876  ALA A O   1 
ATOM   5705  C CB  . ALA A  1 863  ? 150.225 176.924 134.688 1.00 105.75 ? 876  ALA A CB  1 
ATOM   5706  N N   . LEU A  1 864  ? 153.074 175.609 134.232 1.00 99.91  ? 877  LEU A N   1 
ATOM   5707  C CA  . LEU A  1 864  ? 154.426 175.791 133.738 1.00 99.91  ? 877  LEU A CA  1 
ATOM   5708  C C   . LEU A  1 864  ? 154.748 174.778 132.662 1.00 99.91  ? 877  LEU A C   1 
ATOM   5709  O O   . LEU A  1 864  ? 155.089 175.127 131.523 1.00 99.91  ? 877  LEU A O   1 
ATOM   5710  C CB  . LEU A  1 864  ? 155.410 175.649 134.881 1.00 99.91  ? 877  LEU A CB  1 
ATOM   5711  C CG  . LEU A  1 864  ? 156.778 176.029 134.359 1.00 99.91  ? 877  LEU A CG  1 
ATOM   5712  C CD1 . LEU A  1 864  ? 156.688 177.319 133.575 1.00 99.91  ? 877  LEU A CD1 1 
ATOM   5713  C CD2 . LEU A  1 864  ? 157.737 176.167 135.494 1.00 99.91  ? 877  LEU A CD2 1 
ATOM   5714  N N   . LEU A  1 865  ? 154.654 173.512 133.016 1.00 99.36  ? 878  LEU A N   1 
ATOM   5715  C CA  . LEU A  1 865  ? 154.969 172.493 132.042 1.00 99.36  ? 878  LEU A CA  1 
ATOM   5716  C C   . LEU A  1 865  ? 154.021 172.584 130.868 1.00 99.36  ? 878  LEU A C   1 
ATOM   5717  O O   . LEU A  1 865  ? 154.400 172.305 129.732 1.00 99.36  ? 878  LEU A O   1 
ATOM   5718  C CB  . LEU A  1 865  ? 154.922 171.127 132.701 1.00 99.36  ? 878  LEU A CB  1 
ATOM   5719  C CG  . LEU A  1 865  ? 153.573 170.799 133.305 1.00 99.36  ? 878  LEU A CG  1 
ATOM   5720  C CD1 . LEU A  1 865  ? 152.703 170.066 132.296 1.00 99.36  ? 878  LEU A CD1 1 
ATOM   5721  C CD2 . LEU A  1 865  ? 153.771 169.998 134.557 1.00 99.36  ? 878  LEU A CD2 1 
ATOM   5722  N N   . ALA A  1 866  ? 152.788 172.990 131.125 1.00 97.28  ? 879  ALA A N   1 
ATOM   5723  C CA  . ALA A  1 866  ? 151.840 173.134 130.049 1.00 97.28  ? 879  ALA A CA  1 
ATOM   5724  C C   . ALA A  1 866  ? 152.347 174.143 129.053 1.00 97.28  ? 879  ALA A C   1 
ATOM   5725  O O   . ALA A  1 866  ? 152.266 173.935 127.841 1.00 97.28  ? 879  ALA A O   1 
ATOM   5726  C CB  . ALA A  1 866  ? 150.492 173.561 130.612 1.00 97.28  ? 879  ALA A CB  1 
ATOM   5727  N N   . GLY A  1 867  ? 152.903 175.235 129.548 1.00 100.24 ? 880  GLY A N   1 
ATOM   5728  C CA  . GLY A  1 867  ? 153.497 176.192 128.646 1.00 100.24 ? 880  GLY A CA  1 
ATOM   5729  C C   . GLY A  1 867  ? 154.634 175.575 127.867 1.00 100.24 ? 880  GLY A C   1 
ATOM   5730  O O   . GLY A  1 867  ? 154.641 175.588 126.635 1.00 100.24 ? 880  GLY A O   1 
ATOM   5731  N N   . THR A  1 868  ? 155.580 174.965 128.579 1.00 100.95 ? 881  THR A N   1 
ATOM   5732  C CA  . THR A  1 868  ? 156.774 174.530 127.871 1.00 100.95 ? 881  THR A CA  1 
ATOM   5733  C C   . THR A  1 868  ? 156.486 173.442 126.870 1.00 100.95 ? 881  THR A C   1 
ATOM   5734  O O   . THR A  1 868  ? 157.246 173.285 125.916 1.00 100.95 ? 881  THR A O   1 
ATOM   5735  C CB  . THR A  1 868  ? 157.845 173.987 128.774 1.00 100.95 ? 881  THR A CB  1 
ATOM   5736  O OG1 . THR A  1 868  ? 158.911 173.542 127.934 1.00 100.95 ? 881  THR A OG1 1 
ATOM   5737  C CG2 . THR A  1 868  ? 157.323 172.804 129.490 1.00 100.95 ? 881  THR A CG2 1 
ATOM   5738  N N   . ILE A  1 869  ? 155.432 172.671 127.074 1.00 104.72 ? 882  ILE A N   1 
ATOM   5739  C CA  . ILE A  1 869  ? 155.076 171.685 126.072 1.00 104.72 ? 882  ILE A CA  1 
ATOM   5740  C C   . ILE A  1 869  ? 154.290 172.345 124.958 1.00 104.72 ? 882  ILE A C   1 
ATOM   5741  O O   . ILE A  1 869  ? 154.517 172.090 123.774 1.00 104.72 ? 882  ILE A O   1 
ATOM   5742  C CB  . ILE A  1 869  ? 154.320 170.520 126.725 1.00 104.72 ? 882  ILE A CB  1 
ATOM   5743  C CG1 . ILE A  1 869  ? 153.127 171.020 127.525 1.00 104.72 ? 882  ILE A CG1 1 
ATOM   5744  C CG2 . ILE A  1 869  ? 155.247 169.801 127.663 1.00 104.72 ? 882  ILE A CG2 1 
ATOM   5745  C CD1 . ILE A  1 869  ? 152.517 169.983 128.443 1.00 104.72 ? 882  ILE A CD1 1 
ATOM   5746  N N   . THR A  1 870  ? 153.370 173.226 125.318 1.00 98.90  ? 883  THR A N   1 
ATOM   5747  C CA  . THR A  1 870  ? 152.675 173.993 124.307 1.00 98.90  ? 883  THR A CA  1 
ATOM   5748  C C   . THR A  1 870  ? 153.541 175.126 123.807 1.00 98.90  ? 883  THR A C   1 
ATOM   5749  O O   . THR A  1 870  ? 154.006 175.115 122.669 1.00 98.90  ? 883  THR A O   1 
ATOM   5750  C CB  . THR A  1 870  ? 151.398 174.561 124.887 1.00 98.90  ? 883  THR A CB  1 
ATOM   5751  O OG1 . THR A  1 870  ? 151.731 175.300 126.066 1.00 98.90  ? 883  THR A OG1 1 
ATOM   5752  C CG2 . THR A  1 870  ? 150.462 173.447 125.236 1.00 98.90  ? 883  THR A CG2 1 
ATOM   5753  N N   . SER A  1 871  ? 153.796 176.100 124.655 1.00 101.20 ? 884  SER A N   1 
ATOM   5754  C CA  . SER A  1 871  ? 154.383 177.327 124.165 1.00 101.20 ? 884  SER A CA  1 
ATOM   5755  C C   . SER A  1 871  ? 155.889 177.370 124.312 1.00 101.20 ? 884  SER A C   1 
ATOM   5756  O O   . SER A  1 871  ? 156.545 178.082 123.551 1.00 101.20 ? 884  SER A O   1 
ATOM   5757  C CB  . SER A  1 871  ? 153.776 178.524 124.884 1.00 101.20 ? 884  SER A CB  1 
ATOM   5758  O OG  . SER A  1 871  ? 154.042 179.703 124.155 1.00 101.20 ? 884  SER A OG  1 
ATOM   5759  N N   . GLY A  1 872  ? 156.446 176.677 125.291 1.00 107.55 ? 885  GLY A N   1 
ATOM   5760  C CA  . GLY A  1 872  ? 157.887 176.577 125.381 1.00 107.55 ? 885  GLY A CA  1 
ATOM   5761  C C   . GLY A  1 872  ? 158.672 177.839 125.684 1.00 107.55 ? 885  GLY A C   1 
ATOM   5762  O O   . GLY A  1 872  ? 158.151 178.960 125.661 1.00 107.55 ? 885  GLY A O   1 
ATOM   5763  N N   . TRP A  1 873  ? 159.974 177.635 125.877 1.00 100.95 ? 886  TRP A N   1 
ATOM   5764  C CA  . TRP A  1 873  ? 160.942 178.603 126.370 1.00 100.95 ? 886  TRP A CA  1 
ATOM   5765  C C   . TRP A  1 873  ? 160.704 179.984 125.804 1.00 100.95 ? 886  TRP A C   1 
ATOM   5766  O O   . TRP A  1 873  ? 160.989 180.986 126.464 1.00 100.95 ? 886  TRP A O   1 
ATOM   5767  C CB  . TRP A  1 873  ? 162.340 178.133 126.001 1.00 100.95 ? 886  TRP A CB  1 
ATOM   5768  C CG  . TRP A  1 873  ? 162.708 178.415 124.599 1.00 100.95 ? 886  TRP A CG  1 
ATOM   5769  C CD1 . TRP A  1 873  ? 163.728 179.192 124.176 1.00 100.95 ? 886  TRP A CD1 1 
ATOM   5770  C CD2 . TRP A  1 873  ? 162.034 177.963 123.422 1.00 100.95 ? 886  TRP A CD2 1 
ATOM   5771  N NE1 . TRP A  1 873  ? 163.764 179.227 122.806 1.00 100.95 ? 886  TRP A NE1 1 
ATOM   5772  C CE2 . TRP A  1 873  ? 162.727 178.483 122.322 1.00 100.95 ? 886  TRP A CE2 1 
ATOM   5773  C CE3 . TRP A  1 873  ? 160.924 177.153 123.193 1.00 100.95 ? 886  TRP A CE3 1 
ATOM   5774  C CZ2 . TRP A  1 873  ? 162.342 178.235 121.021 1.00 100.95 ? 886  TRP A CZ2 1 
ATOM   5775  C CZ3 . TRP A  1 873  ? 160.549 176.901 121.907 1.00 100.95 ? 886  TRP A CZ3 1 
ATOM   5776  C CH2 . TRP A  1 873  ? 161.260 177.435 120.831 1.00 100.95 ? 886  TRP A CH2 1 
ATOM   5777  N N   . THR A  1 874  ? 160.185 180.039 124.582 1.00 103.05 ? 887  THR A N   1 
ATOM   5778  C CA  . THR A  1 874  ? 159.729 181.307 124.046 1.00 103.05 ? 887  THR A CA  1 
ATOM   5779  C C   . THR A  1 874  ? 158.898 182.041 125.068 1.00 103.05 ? 887  THR A C   1 
ATOM   5780  O O   . THR A  1 874  ? 159.178 183.199 125.395 1.00 103.05 ? 887  THR A O   1 
ATOM   5781  C CB  . THR A  1 874  ? 158.888 181.074 122.806 1.00 103.05 ? 887  THR A CB  1 
ATOM   5782  O OG1 . THR A  1 874  ? 157.624 180.539 123.208 1.00 103.05 ? 887  THR A OG1 1 
ATOM   5783  C CG2 . THR A  1 874  ? 159.560 180.098 121.915 1.00 103.05 ? 887  THR A CG2 1 
ATOM   5784  N N   . PHE A  1 875  ? 157.903 181.358 125.627 1.00 105.74 ? 888  PHE A N   1 
ATOM   5785  C CA  . PHE A  1 875  ? 157.000 182.026 126.542 1.00 105.74 ? 888  PHE A CA  1 
ATOM   5786  C C   . PHE A  1 875  ? 157.774 182.731 127.630 1.00 105.74 ? 888  PHE A C   1 
ATOM   5787  O O   . PHE A  1 875  ? 157.395 183.829 128.048 1.00 105.74 ? 888  PHE A O   1 
ATOM   5788  C CB  . PHE A  1 875  ? 156.023 181.024 127.148 1.00 105.74 ? 888  PHE A CB  1 
ATOM   5789  C CG  . PHE A  1 875  ? 156.539 180.331 128.365 1.00 105.74 ? 888  PHE A CG  1 
ATOM   5790  C CD1 . PHE A  1 875  ? 156.406 180.899 129.616 1.00 105.74 ? 888  PHE A CD1 1 
ATOM   5791  C CD2 . PHE A  1 875  ? 157.130 179.104 128.264 1.00 105.74 ? 888  PHE A CD2 1 
ATOM   5792  C CE1 . PHE A  1 875  ? 156.878 180.266 130.720 1.00 105.74 ? 888  PHE A CE1 1 
ATOM   5793  C CE2 . PHE A  1 875  ? 157.594 178.468 129.361 1.00 105.74 ? 888  PHE A CE2 1 
ATOM   5794  C CZ  . PHE A  1 875  ? 157.468 179.047 130.597 1.00 105.74 ? 888  PHE A CZ  1 
ATOM   5795  N N   . GLY A  1 876  ? 158.877 182.135 128.076 1.00 109.21 ? 889  GLY A N   1 
ATOM   5796  C CA  . GLY A  1 876  ? 159.659 182.768 129.112 1.00 109.21 ? 889  GLY A CA  1 
ATOM   5797  C C   . GLY A  1 876  ? 160.087 184.167 128.753 1.00 109.21 ? 889  GLY A C   1 
ATOM   5798  O O   . GLY A  1 876  ? 160.180 185.024 129.636 1.00 109.21 ? 889  GLY A O   1 
ATOM   5799  N N   . ALA A  1 877  ? 160.281 184.438 127.466 1.00 110.26 ? 890  ALA A N   1 
ATOM   5800  C CA  . ALA A  1 877  ? 160.765 185.742 127.046 1.00 110.26 ? 890  ALA A CA  1 
ATOM   5801  C C   . ALA A  1 877  ? 159.666 186.795 127.087 1.00 110.26 ? 890  ALA A C   1 
ATOM   5802  O O   . ALA A  1 877  ? 159.890 187.908 127.570 1.00 110.26 ? 890  ALA A O   1 
ATOM   5803  C CB  . ALA A  1 877  ? 161.356 185.652 125.643 1.00 110.26 ? 890  ALA A CB  1 
ATOM   5804  N N   . GLY A  1 878  ? 158.479 186.463 126.589 1.00 114.64 ? 891  GLY A N   1 
ATOM   5805  C CA  . GLY A  1 878  ? 157.388 187.417 126.550 1.00 114.64 ? 891  GLY A CA  1 
ATOM   5806  C C   . GLY A  1 878  ? 156.072 186.800 126.962 1.00 114.64 ? 891  GLY A C   1 
ATOM   5807  O O   . GLY A  1 878  ? 155.947 186.268 128.067 1.00 114.64 ? 891  GLY A O   1 
ATOM   5808  N N   . ALA A  1 879  ? 155.071 186.903 126.100 1.00 110.97 ? 892  ALA A N   1 
ATOM   5809  C CA  . ALA A  1 879  ? 153.881 186.096 126.275 1.00 110.97 ? 892  ALA A CA  1 
ATOM   5810  C C   . ALA A  1 879  ? 154.133 184.697 125.739 1.00 110.97 ? 892  ALA A C   1 
ATOM   5811  O O   . ALA A  1 879  ? 155.132 184.433 125.071 1.00 110.97 ? 892  ALA A O   1 
ATOM   5812  C CB  . ALA A  1 879  ? 152.689 186.725 125.565 1.00 110.97 ? 892  ALA A CB  1 
ATOM   5813  N N   . ALA A  1 880  ? 153.227 183.793 126.052 1.00 106.00 ? 893  ALA A N   1 
ATOM   5814  C CA  . ALA A  1 880  ? 153.353 182.438 125.554 1.00 106.00 ? 893  ALA A CA  1 
ATOM   5815  C C   . ALA A  1 880  ? 153.022 182.401 124.069 1.00 106.00 ? 893  ALA A C   1 
ATOM   5816  O O   . ALA A  1 880  ? 151.854 182.494 123.689 1.00 106.00 ? 893  ALA A O   1 
ATOM   5817  C CB  . ALA A  1 880  ? 152.436 181.512 126.341 1.00 106.00 ? 893  ALA A CB  1 
ATOM   5818  N N   . LEU A  1 881  ? 154.043 182.257 123.228 1.00 100.28 ? 894  LEU A N   1 
ATOM   5819  C CA  . LEU A  1 881  ? 153.860 182.120 121.785 1.00 100.28 ? 894  LEU A CA  1 
ATOM   5820  C C   . LEU A  1 881  ? 153.579 180.655 121.471 1.00 100.28 ? 894  LEU A C   1 
ATOM   5821  O O   . LEU A  1 881  ? 154.440 179.798 121.682 1.00 100.28 ? 894  LEU A O   1 
ATOM   5822  C CB  . LEU A  1 881  ? 155.091 182.597 121.017 1.00 100.28 ? 894  LEU A CB  1 
ATOM   5823  C CG  . LEU A  1 881  ? 155.471 184.072 121.011 1.00 100.28 ? 894  LEU A CG  1 
ATOM   5824  C CD1 . LEU A  1 881  ? 156.728 184.272 120.214 1.00 100.28 ? 894  LEU A CD1 1 
ATOM   5825  C CD2 . LEU A  1 881  ? 154.371 184.896 120.440 1.00 100.28 ? 894  LEU A CD2 1 
ATOM   5826  N N   . GLN A  1 882  ? 152.383 180.352 120.980 1.00 104.95 ? 895  GLN A N   1 
ATOM   5827  C CA  . GLN A  1 882  ? 152.083 178.953 120.725 1.00 104.95 ? 895  GLN A CA  1 
ATOM   5828  C C   . GLN A  1 882  ? 152.881 178.466 119.529 1.00 104.95 ? 895  GLN A C   1 
ATOM   5829  O O   . GLN A  1 882  ? 153.229 179.237 118.630 1.00 104.95 ? 895  GLN A O   1 
ATOM   5830  C CB  . GLN A  1 882  ? 150.602 178.726 120.454 1.00 104.95 ? 895  GLN A CB  1 
ATOM   5831  C CG  . GLN A  1 882  ? 150.242 178.948 119.023 1.00 104.95 ? 895  GLN A CG  1 
ATOM   5832  C CD  . GLN A  1 882  ? 149.975 180.372 118.748 1.00 104.95 ? 895  GLN A CD  1 
ATOM   5833  O OE1 . GLN A  1 882  ? 150.212 181.219 119.602 1.00 104.95 ? 895  GLN A OE1 1 
ATOM   5834  N NE2 . GLN A  1 882  ? 149.494 180.671 117.553 1.00 104.95 ? 895  GLN A NE2 1 
ATOM   5835  N N   . ILE A  1 883  ? 153.155 177.167 119.520 1.00 100.27 ? 896  ILE A N   1 
ATOM   5836  C CA  . ILE A  1 883  ? 154.061 176.574 118.548 1.00 100.27 ? 896  ILE A CA  1 
ATOM   5837  C C   . ILE A  1 883  ? 153.763 175.100 118.308 1.00 100.27 ? 896  ILE A C   1 
ATOM   5838  O O   . ILE A  1 883  ? 153.144 174.440 119.148 1.00 100.27 ? 896  ILE A O   1 
ATOM   5839  C CB  . ILE A  1 883  ? 155.504 176.746 119.012 1.00 100.27 ? 896  ILE A CB  1 
ATOM   5840  C CG1 . ILE A  1 883  ? 155.558 176.596 120.526 1.00 100.27 ? 896  ILE A CG1 1 
ATOM   5841  C CG2 . ILE A  1 883  ? 156.053 178.066 118.535 1.00 100.27 ? 896  ILE A CG2 1 
ATOM   5842  C CD1 . ILE A  1 883  ? 156.949 176.605 121.059 1.00 100.27 ? 896  ILE A CD1 1 
ATOM   5843  N N   . PRO A  1 884  ? 154.200 174.545 117.185 1.00 107.29 ? 897  PRO A N   1 
ATOM   5844  C CA  . PRO A  1 884  ? 153.927 173.139 116.896 1.00 107.29 ? 897  PRO A CA  1 
ATOM   5845  C C   . PRO A  1 884  ? 155.013 172.258 117.467 1.00 107.29 ? 897  PRO A C   1 
ATOM   5846  O O   . PRO A  1 884  ? 156.204 172.557 117.359 1.00 107.29 ? 897  PRO A O   1 
ATOM   5847  C CB  . PRO A  1 884  ? 153.954 173.098 115.368 1.00 107.29 ? 897  PRO A CB  1 
ATOM   5848  C CG  . PRO A  1 884  ? 154.987 174.111 115.034 1.00 107.29 ? 897  PRO A CG  1 
ATOM   5849  C CD  . PRO A  1 884  ? 154.937 175.184 116.085 1.00 107.29 ? 897  PRO A CD  1 
ATOM   5850  N N   . PHE A  1 885  ? 154.607 171.131 118.032 1.00 93.63  ? 898  PHE A N   1 
ATOM   5851  C CA  . PHE A  1 885  ? 155.551 170.407 118.864 1.00 93.63  ? 898  PHE A CA  1 
ATOM   5852  C C   . PHE A  1 885  ? 156.633 169.717 118.056 1.00 93.63  ? 898  PHE A C   1 
ATOM   5853  O O   . PHE A  1 885  ? 157.796 169.694 118.475 1.00 93.63  ? 898  PHE A O   1 
ATOM   5854  C CB  . PHE A  1 885  ? 154.837 169.399 119.723 1.00 93.63  ? 898  PHE A CB  1 
ATOM   5855  C CG  . PHE A  1 885  ? 155.580 169.098 120.933 1.00 93.63  ? 898  PHE A CG  1 
ATOM   5856  C CD1 . PHE A  1 885  ? 155.553 169.972 121.980 1.00 93.63  ? 898  PHE A CD1 1 
ATOM   5857  C CD2 . PHE A  1 885  ? 156.367 167.986 121.005 1.00 93.63  ? 898  PHE A CD2 1 
ATOM   5858  C CE1 . PHE A  1 885  ? 156.249 169.722 123.098 1.00 93.63  ? 898  PHE A CE1 1 
ATOM   5859  C CE2 . PHE A  1 885  ? 157.075 167.724 122.124 1.00 93.63  ? 898  PHE A CE2 1 
ATOM   5860  C CZ  . PHE A  1 885  ? 157.016 168.594 123.177 1.00 93.63  ? 898  PHE A CZ  1 
ATOM   5861  N N   . ALA A  1 886  ? 156.273 169.111 116.927 1.00 88.23  ? 899  ALA A N   1 
ATOM   5862  C CA  . ALA A  1 886  ? 157.283 168.470 116.098 1.00 88.23  ? 899  ALA A CA  1 
ATOM   5863  C C   . ALA A  1 886  ? 158.415 169.433 115.827 1.00 88.23  ? 899  ALA A C   1 
ATOM   5864  O O   . ALA A  1 886  ? 159.587 169.138 116.080 1.00 88.23  ? 899  ALA A O   1 
ATOM   5865  C CB  . ALA A  1 886  ? 156.663 167.994 114.791 1.00 88.23  ? 899  ALA A CB  1 
ATOM   5866  N N   . MET A  1 887  ? 158.066 170.625 115.376 1.00 92.28  ? 900  MET A N   1 
ATOM   5867  C CA  . MET A  1 887  ? 159.061 171.642 115.122 1.00 92.28  ? 900  MET A CA  1 
ATOM   5868  C C   . MET A  1 887  ? 159.734 172.111 116.396 1.00 92.28  ? 900  MET A C   1 
ATOM   5869  O O   . MET A  1 887  ? 160.861 172.601 116.341 1.00 92.28  ? 900  MET A O   1 
ATOM   5870  C CB  . MET A  1 887  ? 158.383 172.778 114.383 1.00 92.28  ? 900  MET A CB  1 
ATOM   5871  C CG  . MET A  1 887  ? 157.391 172.197 113.410 1.00 92.28  ? 900  MET A CG  1 
ATOM   5872  S SD  . MET A  1 887  ? 156.660 173.345 112.254 1.00 92.28  ? 900  MET A SD  1 
ATOM   5873  C CE  . MET A  1 887  ? 155.132 172.489 111.912 1.00 92.28  ? 900  MET A CE  1 
ATOM   5874  N N   . GLN A  1 888  ? 159.101 171.929 117.547 1.00 99.09  ? 901  GLN A N   1 
ATOM   5875  C CA  . GLN A  1 888  ? 159.744 172.343 118.787 1.00 99.09  ? 901  GLN A CA  1 
ATOM   5876  C C   . GLN A  1 888  ? 160.887 171.413 119.137 1.00 99.09  ? 901  GLN A C   1 
ATOM   5877  O O   . GLN A  1 888  ? 162.017 171.850 119.384 1.00 99.09  ? 901  GLN A O   1 
ATOM   5878  C CB  . GLN A  1 888  ? 158.734 172.375 119.923 1.00 99.09  ? 901  GLN A CB  1 
ATOM   5879  C CG  . GLN A  1 888  ? 159.323 172.849 121.211 1.00 99.09  ? 901  GLN A CG  1 
ATOM   5880  C CD  . GLN A  1 888  ? 158.262 173.300 122.159 1.00 99.09  ? 901  GLN A CD  1 
ATOM   5881  O OE1 . GLN A  1 888  ? 157.242 172.634 122.322 1.00 99.09  ? 901  GLN A OE1 1 
ATOM   5882  N NE2 . GLN A  1 888  ? 158.473 174.451 122.777 1.00 99.09  ? 901  GLN A NE2 1 
ATOM   5883  N N   . MET A  1 889  ? 160.605 170.120 119.183 1.00 95.70  ? 902  MET A N   1 
ATOM   5884  C CA  . MET A  1 889  ? 161.695 169.178 119.335 1.00 95.70  ? 902  MET A CA  1 
ATOM   5885  C C   . MET A  1 889  ? 162.704 169.351 118.213 1.00 95.70  ? 902  MET A C   1 
ATOM   5886  O O   . MET A  1 889  ? 163.903 169.144 118.417 1.00 95.70  ? 902  MET A O   1 
ATOM   5887  C CB  . MET A  1 889  ? 161.153 167.752 119.371 1.00 95.70  ? 902  MET A CB  1 
ATOM   5888  C CG  . MET A  1 889  ? 160.493 167.335 120.670 1.00 95.70  ? 902  MET A CG  1 
ATOM   5889  S SD  . MET A  1 889  ? 161.633 167.334 122.034 1.00 95.70  ? 902  MET A SD  1 
ATOM   5890  C CE  . MET A  1 889  ? 161.010 168.776 122.848 1.00 95.70  ? 902  MET A CE  1 
ATOM   5891  N N   . ALA A  1 890  ? 162.249 169.754 117.032 1.00 92.09  ? 903  ALA A N   1 
ATOM   5892  C CA  . ALA A  1 890  ? 163.191 170.017 115.960 1.00 92.09  ? 903  ALA A CA  1 
ATOM   5893  C C   . ALA A  1 890  ? 164.149 171.118 116.361 1.00 92.09  ? 903  ALA A C   1 
ATOM   5894  O O   . ALA A  1 890  ? 165.365 171.012 116.170 1.00 92.09  ? 903  ALA A O   1 
ATOM   5895  C CB  . ALA A  1 890  ? 162.435 170.399 114.696 1.00 92.09  ? 903  ALA A CB  1 
ATOM   5896  N N   . TYR A  1 891  ? 163.601 172.193 116.907 1.00 95.08  ? 904  TYR A N   1 
ATOM   5897  C CA  . TYR A  1 891  ? 164.420 173.266 117.435 1.00 95.08  ? 904  TYR A CA  1 
ATOM   5898  C C   . TYR A  1 891  ? 165.418 172.717 118.442 1.00 95.08  ? 904  TYR A C   1 
ATOM   5899  O O   . TYR A  1 891  ? 166.618 172.979 118.352 1.00 95.08  ? 904  TYR A O   1 
ATOM   5900  C CB  . TYR A  1 891  ? 163.504 174.326 118.052 1.00 95.08  ? 904  TYR A CB  1 
ATOM   5901  C CG  . TYR A  1 891  ? 164.135 175.334 119.000 1.00 95.08  ? 904  TYR A CG  1 
ATOM   5902  C CD1 . TYR A  1 891  ? 164.343 175.032 120.340 1.00 95.08  ? 904  TYR A CD1 1 
ATOM   5903  C CD2 . TYR A  1 891  ? 164.460 176.606 118.568 1.00 95.08  ? 904  TYR A CD2 1 
ATOM   5904  C CE1 . TYR A  1 891  ? 164.888 175.955 121.195 1.00 95.08  ? 904  TYR A CE1 1 
ATOM   5905  C CE2 . TYR A  1 891  ? 165.004 177.528 119.418 1.00 95.08  ? 904  TYR A CE2 1 
ATOM   5906  C CZ  . TYR A  1 891  ? 165.219 177.194 120.726 1.00 95.08  ? 904  TYR A CZ  1 
ATOM   5907  O OH  . TYR A  1 891  ? 165.754 178.114 121.580 1.00 95.08  ? 904  TYR A OH  1 
ATOM   5908  N N   . ARG A  1 892  ? 164.947 171.912 119.384 1.00 90.41  ? 905  ARG A N   1 
ATOM   5909  C CA  . ARG A  1 892  ? 165.842 171.484 120.450 1.00 90.41  ? 905  ARG A CA  1 
ATOM   5910  C C   . ARG A  1 892  ? 166.957 170.589 119.926 1.00 90.41  ? 905  ARG A C   1 
ATOM   5911  O O   . ARG A  1 892  ? 168.092 170.640 120.419 1.00 90.41  ? 905  ARG A O   1 
ATOM   5912  C CB  . ARG A  1 892  ? 165.048 170.797 121.536 1.00 90.41  ? 905  ARG A CB  1 
ATOM   5913  C CG  . ARG A  1 892  ? 164.156 171.747 122.241 1.00 90.41  ? 905  ARG A CG  1 
ATOM   5914  C CD  . ARG A  1 892  ? 163.502 171.025 123.349 1.00 90.41  ? 905  ARG A CD  1 
ATOM   5915  N NE  . ARG A  1 892  ? 162.357 171.742 123.866 1.00 90.41  ? 905  ARG A NE  1 
ATOM   5916  C CZ  . ARG A  1 892  ? 162.375 172.417 125.002 1.00 90.41  ? 905  ARG A CZ  1 
ATOM   5917  N NH1 . ARG A  1 892  ? 163.479 172.445 125.723 1.00 90.41  ? 905  ARG A NH1 1 
ATOM   5918  N NH2 . ARG A  1 892  ? 161.295 173.052 125.420 1.00 90.41  ? 905  ARG A NH2 1 
ATOM   5919  N N   . PHE A  1 893  ? 166.663 169.777 118.916 1.00 89.78  ? 906  PHE A N   1 
ATOM   5920  C CA  . PHE A  1 893  ? 167.706 168.941 118.333 1.00 89.78  ? 906  PHE A CA  1 
ATOM   5921  C C   . PHE A  1 893  ? 168.684 169.755 117.510 1.00 89.78  ? 906  PHE A C   1 
ATOM   5922  O O   . PHE A  1 893  ? 169.893 169.492 117.534 1.00 89.78  ? 906  PHE A O   1 
ATOM   5923  C CB  . PHE A  1 893  ? 167.100 167.834 117.485 1.00 89.78  ? 906  PHE A CB  1 
ATOM   5924  C CG  . PHE A  1 893  ? 166.704 166.639 118.269 1.00 89.78  ? 906  PHE A CG  1 
ATOM   5925  C CD1 . PHE A  1 893  ? 167.116 166.504 119.573 1.00 89.78  ? 906  PHE A CD1 1 
ATOM   5926  C CD2 . PHE A  1 893  ? 165.960 165.632 117.694 1.00 89.78  ? 906  PHE A CD2 1 
ATOM   5927  C CE1 . PHE A  1 893  ? 166.771 165.405 120.294 1.00 89.78  ? 906  PHE A CE1 1 
ATOM   5928  C CE2 . PHE A  1 893  ? 165.615 164.527 118.413 1.00 89.78  ? 906  PHE A CE2 1 
ATOM   5929  C CZ  . PHE A  1 893  ? 166.020 164.413 119.716 1.00 89.78  ? 906  PHE A CZ  1 
ATOM   5930  N N   . ASN A  1 894  ? 168.187 170.730 116.756 1.00 82.74  ? 907  ASN A N   1 
ATOM   5931  C CA  . ASN A  1 894  ? 169.090 171.711 116.184 1.00 82.74  ? 907  ASN A CA  1 
ATOM   5932  C C   . ASN A  1 894  ? 169.972 172.293 117.270 1.00 82.74  ? 907  ASN A C   1 
ATOM   5933  O O   . ASN A  1 894  ? 171.143 172.603 117.038 1.00 82.74  ? 907  ASN A O   1 
ATOM   5934  C CB  . ASN A  1 894  ? 168.290 172.802 115.490 1.00 82.74  ? 907  ASN A CB  1 
ATOM   5935  C CG  . ASN A  1 894  ? 169.159 173.885 114.936 1.00 82.74  ? 907  ASN A CG  1 
ATOM   5936  O OD1 . ASN A  1 894  ? 170.347 173.685 114.710 1.00 82.74  ? 907  ASN A OD1 1 
ATOM   5937  N ND2 . ASN A  1 894  ? 168.573 175.048 114.702 1.00 82.74  ? 907  ASN A ND2 1 
ATOM   5938  N N   . GLY A  1 895  ? 169.425 172.409 118.478 1.00 78.56  ? 908  GLY A N   1 
ATOM   5939  C CA  . GLY A  1 895  ? 170.154 173.049 119.557 1.00 78.56  ? 908  GLY A CA  1 
ATOM   5940  C C   . GLY A  1 895  ? 171.300 172.210 120.074 1.00 78.56  ? 908  GLY A C   1 
ATOM   5941  O O   . GLY A  1 895  ? 172.414 172.705 120.245 1.00 78.56  ? 908  GLY A O   1 
ATOM   5942  N N   . ILE A  1 896  ? 171.051 170.934 120.346 1.00 78.35  ? 909  ILE A N   1 
ATOM   5943  C CA  . ILE A  1 896  ? 172.167 170.126 120.814 1.00 78.35  ? 909  ILE A CA  1 
ATOM   5944  C C   . ILE A  1 896  ? 173.130 169.743 119.716 1.00 78.35  ? 909  ILE A C   1 
ATOM   5945  O O   . ILE A  1 896  ? 174.170 169.153 120.015 1.00 78.35  ? 909  ILE A O   1 
ATOM   5946  C CB  . ILE A  1 896  ? 171.771 168.782 121.414 1.00 78.35  ? 909  ILE A CB  1 
ATOM   5947  C CG1 . ILE A  1 896  ? 171.154 167.959 120.305 1.00 78.35  ? 909  ILE A CG1 1 
ATOM   5948  C CG2 . ILE A  1 896  ? 170.806 169.012 122.508 1.00 78.35  ? 909  ILE A CG2 1 
ATOM   5949  C CD1 . ILE A  1 896  ? 171.473 166.523 120.406 1.00 78.35  ? 909  ILE A CD1 1 
ATOM   5950  N N   . GLY A  1 897  ? 172.807 170.008 118.456 1.00 80.97  ? 910  GLY A N   1 
ATOM   5951  C CA  . GLY A  1 897  ? 173.764 169.688 117.420 1.00 80.97  ? 910  GLY A CA  1 
ATOM   5952  C C   . GLY A  1 897  ? 173.360 168.684 116.362 1.00 80.97  ? 910  GLY A C   1 
ATOM   5953  O O   . GLY A  1 897  ? 174.181 167.852 115.979 1.00 80.97  ? 910  GLY A O   1 
ATOM   5954  N N   . VAL A  1 898  ? 172.121 168.711 115.890 1.00 80.46  ? 911  VAL A N   1 
ATOM   5955  C CA  . VAL A  1 898  ? 171.742 167.878 114.759 1.00 80.46  ? 911  VAL A CA  1 
ATOM   5956  C C   . VAL A  1 898  ? 170.606 168.528 113.991 1.00 80.46  ? 911  VAL A C   1 
ATOM   5957  O O   . VAL A  1 898  ? 169.729 169.167 114.576 1.00 80.46  ? 911  VAL A O   1 
ATOM   5958  C CB  . VAL A  1 898  ? 171.337 166.478 115.210 1.00 80.46  ? 911  VAL A CB  1 
ATOM   5959  C CG1 . VAL A  1 898  ? 170.102 166.569 116.031 1.00 80.46  ? 911  VAL A CG1 1 
ATOM   5960  C CG2 . VAL A  1 898  ? 171.090 165.630 114.017 1.00 80.46  ? 911  VAL A CG2 1 
ATOM   5961  N N   . THR A  1 899  ? 170.626 168.354 112.673 1.00 87.32  ? 912  THR A N   1 
ATOM   5962  C CA  . THR A  1 899  ? 169.612 168.920 111.794 1.00 87.32  ? 912  THR A CA  1 
ATOM   5963  C C   . THR A  1 899  ? 168.240 168.339 112.115 1.00 87.32  ? 912  THR A C   1 
ATOM   5964  O O   . THR A  1 899  ? 168.116 167.295 112.750 1.00 87.32  ? 912  THR A O   1 
ATOM   5965  C CB  . THR A  1 899  ? 170.001 168.666 110.331 1.00 87.32  ? 912  THR A CB  1 
ATOM   5966  O OG1 . THR A  1 899  ? 171.165 169.435 110.020 1.00 87.32  ? 912  THR A OG1 1 
ATOM   5967  C CG2 . THR A  1 899  ? 168.904 169.050 109.342 1.00 87.32  ? 912  THR A CG2 1 
ATOM   5968  N N   . GLN A  1 900  ? 167.204 169.065 111.705 1.00 92.95  ? 913  GLN A N   1 
ATOM   5969  C CA  . GLN A  1 900  ? 165.830 168.709 112.027 1.00 92.95  ? 913  GLN A CA  1 
ATOM   5970  C C   . GLN A  1 900  ? 165.419 167.381 111.397 1.00 92.95  ? 913  GLN A C   1 
ATOM   5971  O O   . GLN A  1 900  ? 164.723 166.571 112.027 1.00 92.95  ? 913  GLN A O   1 
ATOM   5972  C CB  . GLN A  1 900  ? 164.938 169.834 111.530 1.00 92.95  ? 913  GLN A CB  1 
ATOM   5973  C CG  . GLN A  1 900  ? 165.362 171.183 112.057 1.00 92.95  ? 913  GLN A CG  1 
ATOM   5974  C CD  . GLN A  1 900  ? 164.695 172.299 111.309 1.00 92.95  ? 913  GLN A CD  1 
ATOM   5975  O OE1 . GLN A  1 900  ? 163.936 172.052 110.381 1.00 92.95  ? 913  GLN A OE1 1 
ATOM   5976  N NE2 . GLN A  1 900  ? 165.006 173.533 111.671 1.00 92.95  ? 913  GLN A NE2 1 
ATOM   5977  N N   . ASN A  1 901  ? 165.834 167.147 110.148 1.00 95.60  ? 914  ASN A N   1 
ATOM   5978  C CA  . ASN A  1 901  ? 165.311 166.029 109.372 1.00 95.60  ? 914  ASN A CA  1 
ATOM   5979  C C   . ASN A  1 901  ? 165.407 164.713 110.119 1.00 95.60  ? 914  ASN A C   1 
ATOM   5980  O O   . ASN A  1 901  ? 164.605 163.804 109.883 1.00 95.60  ? 914  ASN A O   1 
ATOM   5981  C CB  . ASN A  1 901  ? 166.062 165.914 108.061 1.00 95.60  ? 914  ASN A CB  1 
ATOM   5982  C CG  . ASN A  1 901  ? 167.433 165.382 108.260 1.00 95.60  ? 914  ASN A CG  1 
ATOM   5983  O OD1 . ASN A  1 901  ? 168.106 165.748 109.214 1.00 95.60  ? 914  ASN A OD1 1 
ATOM   5984  N ND2 . ASN A  1 901  ? 167.853 164.488 107.390 1.00 95.60  ? 914  ASN A ND2 1 
ATOM   5985  N N   . VAL A  1 902  ? 166.363 164.591 111.038 1.00 94.79  ? 915  VAL A N   1 
ATOM   5986  C CA  . VAL A  1 902  ? 166.469 163.364 111.819 1.00 94.79  ? 915  VAL A CA  1 
ATOM   5987  C C   . VAL A  1 902  ? 165.210 163.147 112.644 1.00 94.79  ? 915  VAL A C   1 
ATOM   5988  O O   . VAL A  1 902  ? 164.551 162.105 112.537 1.00 94.79  ? 915  VAL A O   1 
ATOM   5989  C CB  . VAL A  1 902  ? 167.723 163.387 112.704 1.00 94.79  ? 915  VAL A CB  1 
ATOM   5990  C CG1 . VAL A  1 902  ? 167.740 164.589 113.594 1.00 94.79  ? 915  VAL A CG1 1 
ATOM   5991  C CG2 . VAL A  1 902  ? 167.745 162.152 113.552 1.00 94.79  ? 915  VAL A CG2 1 
ATOM   5992  N N   . LEU A  1 903  ? 164.884 164.111 113.505 1.00 93.25  ? 916  LEU A N   1 
ATOM   5993  C CA  . LEU A  1 903  ? 163.627 164.065 114.230 1.00 93.25  ? 916  LEU A CA  1 
ATOM   5994  C C   . LEU A  1 903  ? 162.473 163.846 113.275 1.00 93.25  ? 916  LEU A C   1 
ATOM   5995  O O   . LEU A  1 903  ? 161.631 162.962 113.483 1.00 93.25  ? 916  LEU A O   1 
ATOM   5996  C CB  . LEU A  1 903  ? 163.426 165.368 114.989 1.00 93.25  ? 916  LEU A CB  1 
ATOM   5997  C CG  . LEU A  1 903  ? 162.047 165.440 115.622 1.00 93.25  ? 916  LEU A CG  1 
ATOM   5998  C CD1 . LEU A  1 903  ? 161.938 164.462 116.747 1.00 93.25  ? 916  LEU A CD1 1 
ATOM   5999  C CD2 . LEU A  1 903  ? 161.738 166.835 116.068 1.00 93.25  ? 916  LEU A CD2 1 
ATOM   6000  N N   . TYR A  1 904  ? 162.437 164.640 112.205 1.00 99.02  ? 917  TYR A N   1 
ATOM   6001  C CA  . TYR A  1 904  ? 161.376 164.514 111.218 1.00 99.02  ? 917  TYR A CA  1 
ATOM   6002  C C   . TYR A  1 904  ? 161.155 163.068 110.827 1.00 99.02  ? 917  TYR A C   1 
ATOM   6003  O O   . TYR A  1 904  ? 160.018 162.608 110.717 1.00 99.02  ? 917  TYR A O   1 
ATOM   6004  C CB  . TYR A  1 904  ? 161.730 165.338 109.994 1.00 99.02  ? 917  TYR A CB  1 
ATOM   6005  C CG  . TYR A  1 904  ? 161.227 166.734 110.080 1.00 99.02  ? 917  TYR A CG  1 
ATOM   6006  C CD1 . TYR A  1 904  ? 159.903 166.980 110.358 1.00 99.02  ? 917  TYR A CD1 1 
ATOM   6007  C CD2 . TYR A  1 904  ? 162.070 167.808 109.900 1.00 99.02  ? 917  TYR A CD2 1 
ATOM   6008  C CE1 . TYR A  1 904  ? 159.420 168.255 110.437 1.00 99.02  ? 917  TYR A CE1 1 
ATOM   6009  C CE2 . TYR A  1 904  ? 161.595 169.095 109.973 1.00 99.02  ? 917  TYR A CE2 1 
ATOM   6010  C CZ  . TYR A  1 904  ? 160.262 169.312 110.243 1.00 99.02  ? 917  TYR A CZ  1 
ATOM   6011  O OH  . TYR A  1 904  ? 159.755 170.586 110.330 1.00 99.02  ? 917  TYR A OH  1 
ATOM   6012  N N   . GLU A  1 905  ? 162.229 162.330 110.640 1.00 100.27 ? 918  GLU A N   1 
ATOM   6013  C CA  . GLU A  1 905  ? 162.067 160.990 110.123 1.00 100.27 ? 918  GLU A CA  1 
ATOM   6014  C C   . GLU A  1 905  ? 161.858 159.959 111.208 1.00 100.27 ? 918  GLU A C   1 
ATOM   6015  O O   . GLU A  1 905  ? 161.166 158.969 110.973 1.00 100.27 ? 918  GLU A O   1 
ATOM   6016  C CB  . GLU A  1 905  ? 163.268 160.629 109.262 1.00 100.27 ? 918  GLU A CB  1 
ATOM   6017  C CG  . GLU A  1 905  ? 163.357 161.536 108.065 1.00 100.27 ? 918  GLU A CG  1 
ATOM   6018  C CD  . GLU A  1 905  ? 164.577 161.287 107.236 1.00 100.27 ? 918  GLU A CD  1 
ATOM   6019  O OE1 . GLU A  1 905  ? 164.961 160.110 107.096 1.00 100.27 ? 918  GLU A OE1 1 
ATOM   6020  O OE2 . GLU A  1 905  ? 165.148 162.267 106.720 1.00 100.27 ? 918  GLU A OE2 1 
ATOM   6021  N N   . ASN A  1 906  ? 162.402 160.158 112.395 1.00 93.67  ? 919  ASN A N   1 
ATOM   6022  C CA  . ASN A  1 906  ? 162.290 159.127 113.414 1.00 93.67  ? 919  ASN A CA  1 
ATOM   6023  C C   . ASN A  1 906  ? 161.117 159.344 114.350 1.00 93.67  ? 919  ASN A C   1 
ATOM   6024  O O   . ASN A  1 906  ? 160.902 158.524 115.246 1.00 93.67  ? 919  ASN A O   1 
ATOM   6025  C CB  . ASN A  1 906  ? 163.579 159.027 114.219 1.00 93.67  ? 919  ASN A CB  1 
ATOM   6026  C CG  . ASN A  1 906  ? 163.698 157.715 114.942 1.00 93.67  ? 919  ASN A CG  1 
ATOM   6027  O OD1 . ASN A  1 906  ? 162.856 156.840 114.795 1.00 93.67  ? 919  ASN A OD1 1 
ATOM   6028  N ND2 . ASN A  1 906  ? 164.745 157.567 115.728 1.00 93.67  ? 919  ASN A ND2 1 
ATOM   6029  N N   . GLN A  1 907  ? 160.341 160.406 114.132 1.00 102.83 ? 920  GLN A N   1 
ATOM   6030  C CA  . GLN A  1 907  ? 159.260 160.786 115.035 1.00 102.83 ? 920  GLN A CA  1 
ATOM   6031  C C   . GLN A  1 907  ? 158.562 159.612 115.697 1.00 102.83 ? 920  GLN A C   1 
ATOM   6032  O O   . GLN A  1 907  ? 158.461 159.552 116.925 1.00 102.83 ? 920  GLN A O   1 
ATOM   6033  C CB  . GLN A  1 907  ? 158.241 161.632 114.263 1.00 102.83 ? 920  GLN A CB  1 
ATOM   6034  C CG  . GLN A  1 907  ? 157.979 161.173 112.826 1.00 102.83 ? 920  GLN A CG  1 
ATOM   6035  C CD  . GLN A  1 907  ? 157.438 162.290 111.928 1.00 102.83 ? 920  GLN A CD  1 
ATOM   6036  O OE1 . GLN A  1 907  ? 157.832 163.448 112.053 1.00 102.83 ? 920  GLN A OE1 1 
ATOM   6037  N NE2 . GLN A  1 907  ? 156.539 161.937 111.015 1.00 102.83 ? 920  GLN A NE2 1 
ATOM   6038  N N   . LYS A  1 908  ? 158.078 158.665 114.901 1.00 105.77 ? 921  LYS A N   1 
ATOM   6039  C CA  . LYS A  1 908  ? 157.269 157.591 115.458 1.00 105.77 ? 921  LYS A CA  1 
ATOM   6040  C C   . LYS A  1 908  ? 158.049 156.809 116.501 1.00 105.77 ? 921  LYS A C   1 
ATOM   6041  O O   . LYS A  1 908  ? 157.634 156.688 117.663 1.00 105.77 ? 921  LYS A O   1 
ATOM   6042  C CB  . LYS A  1 908  ? 156.801 156.659 114.347 1.00 105.77 ? 921  LYS A CB  1 
ATOM   6043  C CG  . LYS A  1 908  ? 155.550 157.095 113.619 1.00 105.77 ? 921  LYS A CG  1 
ATOM   6044  C CD  . LYS A  1 908  ? 155.837 158.083 112.500 1.00 105.77 ? 921  LYS A CD  1 
ATOM   6045  C CE  . LYS A  1 908  ? 154.591 158.292 111.630 1.00 105.77 ? 921  LYS A CE  1 
ATOM   6046  N NZ  . LYS A  1 908  ? 154.764 159.293 110.535 1.00 105.77 ? 921  LYS A NZ  1 
ATOM   6047  N N   . LEU A  1 909  ? 159.188 156.260 116.091 1.00 105.34 ? 922  LEU A N   1 
ATOM   6048  C CA  . LEU A  1 909  ? 159.969 155.431 116.995 1.00 105.34 ? 922  LEU A CA  1 
ATOM   6049  C C   . LEU A  1 909  ? 160.429 156.248 118.190 1.00 105.34 ? 922  LEU A C   1 
ATOM   6050  O O   . LEU A  1 909  ? 160.460 155.757 119.328 1.00 105.34 ? 922  LEU A O   1 
ATOM   6051  C CB  . LEU A  1 909  ? 161.165 154.841 116.250 1.00 105.34 ? 922  LEU A CB  1 
ATOM   6052  C CG  . LEU A  1 909  ? 160.953 153.634 115.336 1.00 105.34 ? 922  LEU A CG  1 
ATOM   6053  C CD1 . LEU A  1 909  ? 160.450 152.443 116.118 1.00 105.34 ? 922  LEU A CD1 1 
ATOM   6054  C CD2 . LEU A  1 909  ? 160.004 153.957 114.205 1.00 105.34 ? 922  LEU A CD2 1 
ATOM   6055  N N   . ILE A  1 910  ? 160.795 157.500 117.936 1.00 95.33  ? 923  ILE A N   1 
ATOM   6056  C CA  . ILE A  1 910  ? 161.137 158.419 119.006 1.00 95.33  ? 923  ILE A CA  1 
ATOM   6057  C C   . ILE A  1 910  ? 160.057 158.395 120.061 1.00 95.33  ? 923  ILE A C   1 
ATOM   6058  O O   . ILE A  1 910  ? 160.319 158.227 121.255 1.00 95.33  ? 923  ILE A O   1 
ATOM   6059  C CB  . ILE A  1 910  ? 161.305 159.831 118.437 1.00 95.33  ? 923  ILE A CB  1 
ATOM   6060  C CG1 . ILE A  1 910  ? 162.483 159.869 117.483 1.00 95.33  ? 923  ILE A CG1 1 
ATOM   6061  C CG2 . ILE A  1 910  ? 161.486 160.799 119.551 1.00 95.33  ? 923  ILE A CG2 1 
ATOM   6062  C CD1 . ILE A  1 910  ? 162.599 161.152 116.776 1.00 95.33  ? 923  ILE A CD1 1 
ATOM   6063  N N   . ALA A  1 911  ? 158.825 158.561 119.621 1.00 104.59 ? 924  ALA A N   1 
ATOM   6064  C CA  . ALA A  1 911  ? 157.733 158.656 120.564 1.00 104.59 ? 924  ALA A CA  1 
ATOM   6065  C C   . ALA A  1 911  ? 157.559 157.357 121.308 1.00 104.59 ? 924  ALA A C   1 
ATOM   6066  O O   . ALA A  1 911  ? 157.291 157.357 122.514 1.00 104.59 ? 924  ALA A O   1 
ATOM   6067  C CB  . ALA A  1 911  ? 156.452 159.022 119.837 1.00 104.59 ? 924  ALA A CB  1 
ATOM   6068  N N   . ASN A  1 912  ? 157.684 156.239 120.606 1.00 110.88 ? 925  ASN A N   1 
ATOM   6069  C CA  . ASN A  1 912  ? 157.533 154.981 121.317 1.00 110.88 ? 925  ASN A CA  1 
ATOM   6070  C C   . ASN A  1 912  ? 158.573 154.868 122.413 1.00 110.88 ? 925  ASN A C   1 
ATOM   6071  O O   . ASN A  1 912  ? 158.264 154.450 123.532 1.00 110.88 ? 925  ASN A O   1 
ATOM   6072  C CB  . ASN A  1 912  ? 157.633 153.783 120.387 1.00 110.88 ? 925  ASN A CB  1 
ATOM   6073  C CG  . ASN A  1 912  ? 157.555 152.464 121.147 1.00 110.88 ? 925  ASN A CG  1 
ATOM   6074  O OD1 . ASN A  1 912  ? 158.572 151.863 121.487 1.00 110.88 ? 925  ASN A OD1 1 
ATOM   6075  N ND2 . ASN A  1 912  ? 156.340 152.025 121.437 1.00 110.88 ? 925  ASN A ND2 1 
ATOM   6076  N N   . GLN A  1 913  ? 159.812 155.254 122.113 1.00 102.79 ? 926  GLN A N   1 
ATOM   6077  C CA  . GLN A  1 913  ? 160.868 155.143 123.111 1.00 102.79 ? 926  GLN A CA  1 
ATOM   6078  C C   . GLN A  1 913  ? 160.617 156.088 124.263 1.00 102.79 ? 926  GLN A C   1 
ATOM   6079  O O   . GLN A  1 913  ? 160.898 155.770 125.425 1.00 102.79 ? 926  GLN A O   1 
ATOM   6080  C CB  . GLN A  1 913  ? 162.213 155.432 122.473 1.00 102.79 ? 926  GLN A CB  1 
ATOM   6081  C CG  . GLN A  1 913  ? 162.578 154.418 121.459 1.00 102.79 ? 926  GLN A CG  1 
ATOM   6082  C CD  . GLN A  1 913  ? 163.437 154.996 120.403 1.00 102.79 ? 926  GLN A CD  1 
ATOM   6083  O OE1 . GLN A  1 913  ? 163.096 156.009 119.806 1.00 102.79 ? 926  GLN A OE1 1 
ATOM   6084  N NE2 . GLN A  1 913  ? 164.574 154.373 120.166 1.00 102.79 ? 926  GLN A NE2 1 
ATOM   6085  N N   . PHE A  1 914  ? 160.100 157.262 123.951 1.00 100.46 ? 927  PHE A N   1 
ATOM   6086  C CA  . PHE A  1 914  ? 159.672 158.162 124.995 1.00 100.46 ? 927  PHE A CA  1 
ATOM   6087  C C   . PHE A  1 914  ? 158.725 157.449 125.932 1.00 100.46 ? 927  PHE A C   1 
ATOM   6088  O O   . PHE A  1 914  ? 158.970 157.357 127.137 1.00 100.46 ? 927  PHE A O   1 
ATOM   6089  C CB  . PHE A  1 914  ? 158.994 159.367 124.374 1.00 100.46 ? 927  PHE A CB  1 
ATOM   6090  C CG  . PHE A  1 914  ? 158.971 160.536 125.260 1.00 100.46 ? 927  PHE A CG  1 
ATOM   6091  C CD1 . PHE A  1 914  ? 158.352 160.469 126.481 1.00 100.46 ? 927  PHE A CD1 1 
ATOM   6092  C CD2 . PHE A  1 914  ? 159.575 161.701 124.884 1.00 100.46 ? 927  PHE A CD2 1 
ATOM   6093  C CE1 . PHE A  1 914  ? 158.337 161.537 127.303 1.00 100.46 ? 927  PHE A CE1 1 
ATOM   6094  C CE2 . PHE A  1 914  ? 159.557 162.774 125.704 1.00 100.46 ? 927  PHE A CE2 1 
ATOM   6095  C CZ  . PHE A  1 914  ? 158.939 162.694 126.916 1.00 100.46 ? 927  PHE A CZ  1 
ATOM   6096  N N   . ASN A  1 915  ? 157.637 156.933 125.377 1.00 110.16 ? 928  ASN A N   1 
ATOM   6097  C CA  . ASN A  1 915  ? 156.646 156.251 126.188 1.00 110.16 ? 928  ASN A CA  1 
ATOM   6098  C C   . ASN A  1 915  ? 157.294 155.152 127.002 1.00 110.16 ? 928  ASN A C   1 
ATOM   6099  O O   . ASN A  1 915  ? 156.997 154.975 128.192 1.00 110.16 ? 928  ASN A O   1 
ATOM   6100  C CB  . ASN A  1 915  ? 155.554 155.673 125.294 1.00 110.16 ? 928  ASN A CB  1 
ATOM   6101  C CG  . ASN A  1 915  ? 155.066 156.658 124.259 1.00 110.16 ? 928  ASN A CG  1 
ATOM   6102  O OD1 . ASN A  1 915  ? 154.467 157.676 124.588 1.00 110.16 ? 928  ASN A OD1 1 
ATOM   6103  N ND2 . ASN A  1 915  ? 155.312 156.356 122.999 1.00 110.16 ? 928  ASN A ND2 1 
ATOM   6104  N N   . SER A  1 916  ? 158.187 154.405 126.367 1.00 112.47 ? 929  SER A N   1 
ATOM   6105  C CA  . SER A  1 916  ? 158.868 153.315 127.038 1.00 112.47 ? 929  SER A CA  1 
ATOM   6106  C C   . SER A  1 916  ? 159.555 153.815 128.296 1.00 112.47 ? 929  SER A C   1 
ATOM   6107  O O   . SER A  1 916  ? 159.258 153.373 129.416 1.00 112.47 ? 929  SER A O   1 
ATOM   6108  C CB  . SER A  1 916  ? 159.882 152.702 126.079 1.00 112.47 ? 929  SER A CB  1 
ATOM   6109  O OG  . SER A  1 916  ? 160.924 153.630 125.833 1.00 112.47 ? 929  SER A OG  1 
ATOM   6110  N N   . ALA A  1 917  ? 160.461 154.767 128.120 1.00 105.81 ? 930  ALA A N   1 
ATOM   6111  C CA  . ALA A  1 917  ? 161.203 155.281 129.254 1.00 105.81 ? 930  ALA A CA  1 
ATOM   6112  C C   . ALA A  1 917  ? 160.257 155.825 130.304 1.00 105.81 ? 930  ALA A C   1 
ATOM   6113  O O   . ALA A  1 917  ? 160.502 155.686 131.506 1.00 105.81 ? 930  ALA A O   1 
ATOM   6114  C CB  . ALA A  1 917  ? 162.176 156.351 128.781 1.00 105.81 ? 930  ALA A CB  1 
ATOM   6115  N N   . ILE A  1 918  ? 159.167 156.443 129.868 1.00 101.98 ? 931  ILE A N   1 
ATOM   6116  C CA  . ILE A  1 918  ? 158.189 156.945 130.816 1.00 101.98 ? 931  ILE A CA  1 
ATOM   6117  C C   . ILE A  1 918  ? 157.739 155.824 131.724 1.00 101.98 ? 931  ILE A C   1 
ATOM   6118  O O   . ILE A  1 918  ? 157.782 155.936 132.954 1.00 101.98 ? 931  ILE A O   1 
ATOM   6119  C CB  . ILE A  1 918  ? 156.998 157.561 130.073 1.00 101.98 ? 931  ILE A CB  1 
ATOM   6120  C CG1 . ILE A  1 918  ? 157.421 158.847 129.383 1.00 101.98 ? 931  ILE A CG1 1 
ATOM   6121  C CG2 . ILE A  1 918  ? 155.867 157.796 131.032 1.00 101.98 ? 931  ILE A CG2 1 
ATOM   6122  C CD1 . ILE A  1 918  ? 158.079 159.812 130.294 1.00 101.98 ? 931  ILE A CD1 1 
ATOM   6123  N N   . GLY A  1 919  ? 157.309 154.722 131.124 1.00 112.91 ? 932  GLY A N   1 
ATOM   6124  C CA  . GLY A  1 919  ? 156.821 153.614 131.921 1.00 112.91 ? 932  GLY A CA  1 
ATOM   6125  C C   . GLY A  1 919  ? 157.895 153.064 132.832 1.00 112.91 ? 932  GLY A C   1 
ATOM   6126  O O   . GLY A  1 919  ? 157.642 152.743 134.000 1.00 112.91 ? 932  GLY A O   1 
ATOM   6127  N N   . LYS A  1 920  ? 159.113 152.969 132.313 1.00 112.29 ? 933  LYS A N   1 
ATOM   6128  C CA  . LYS A  1 920  ? 160.210 152.455 133.117 1.00 112.29 ? 933  LYS A CA  1 
ATOM   6129  C C   . LYS A  1 920  ? 160.406 153.302 134.369 1.00 112.29 ? 933  LYS A C   1 
ATOM   6130  O O   . LYS A  1 920  ? 160.475 152.782 135.494 1.00 112.29 ? 933  LYS A O   1 
ATOM   6131  C CB  . LYS A  1 920  ? 161.483 152.420 132.276 1.00 112.29 ? 933  LYS A CB  1 
ATOM   6132  C CG  . LYS A  1 920  ? 161.410 151.511 131.062 1.00 112.29 ? 933  LYS A CG  1 
ATOM   6133  C CD  . LYS A  1 920  ? 161.287 150.058 131.488 1.00 112.29 ? 933  LYS A CD  1 
ATOM   6134  C CE  . LYS A  1 920  ? 161.340 149.101 130.313 1.00 112.29 ? 933  LYS A CE  1 
ATOM   6135  N NZ  . LYS A  1 920  ? 162.711 149.022 129.755 1.00 112.29 ? 933  LYS A NZ  1 
ATOM   6136  N N   . ILE A  1 921  ? 160.476 154.618 134.189 1.00 112.47 ? 934  ILE A N   1 
ATOM   6137  C CA  . ILE A  1 921  ? 160.724 155.491 135.322 1.00 112.47 ? 934  ILE A CA  1 
ATOM   6138  C C   . ILE A  1 921  ? 159.551 155.441 136.269 1.00 112.47 ? 934  ILE A C   1 
ATOM   6139  O O   . ILE A  1 921  ? 159.725 155.490 137.493 1.00 112.47 ? 934  ILE A O   1 
ATOM   6140  C CB  . ILE A  1 921  ? 161.005 156.922 134.847 1.00 112.47 ? 934  ILE A CB  1 
ATOM   6141  C CG1 . ILE A  1 921  ? 162.018 157.570 135.769 1.00 112.47 ? 934  ILE A CG1 1 
ATOM   6142  C CG2 . ILE A  1 921  ? 159.748 157.750 134.836 1.00 112.47 ? 934  ILE A CG2 1 
ATOM   6143  C CD1 . ILE A  1 921  ? 163.399 157.042 135.552 1.00 112.47 ? 934  ILE A CD1 1 
ATOM   6144  N N   . GLN A  1 922  ? 158.343 155.310 135.732 1.00 114.89 ? 935  GLN A N   1 
ATOM   6145  C CA  . GLN A  1 922  ? 157.184 155.236 136.596 1.00 114.89 ? 935  GLN A CA  1 
ATOM   6146  C C   . GLN A  1 922  ? 157.323 154.066 137.537 1.00 114.89 ? 935  GLN A C   1 
ATOM   6147  O O   . GLN A  1 922  ? 157.119 154.196 138.745 1.00 114.89 ? 935  GLN A O   1 
ATOM   6148  C CB  . GLN A  1 922  ? 155.914 155.107 135.769 1.00 114.89 ? 935  GLN A CB  1 
ATOM   6149  C CG  . GLN A  1 922  ? 154.714 154.717 136.592 1.00 114.89 ? 935  GLN A CG  1 
ATOM   6150  C CD  . GLN A  1 922  ? 154.550 153.226 136.677 1.00 114.89 ? 935  GLN A CD  1 
ATOM   6151  O OE1 . GLN A  1 922  ? 154.275 152.567 135.679 1.00 114.89 ? 935  GLN A OE1 1 
ATOM   6152  N NE2 . GLN A  1 922  ? 154.743 152.677 137.870 1.00 114.89 ? 935  GLN A NE2 1 
ATOM   6153  N N   . ASP A  1 923  ? 157.667 152.906 136.997 1.00 122.70 ? 936  ASP A N   1 
ATOM   6154  C CA  . ASP A  1 923  ? 157.818 151.760 137.875 1.00 122.70 ? 936  ASP A CA  1 
ATOM   6155  C C   . ASP A  1 923  ? 158.912 151.997 138.892 1.00 122.70 ? 936  ASP A C   1 
ATOM   6156  O O   . ASP A  1 923  ? 158.705 151.806 140.097 1.00 122.70 ? 936  ASP A O   1 
ATOM   6157  C CB  . ASP A  1 923  ? 158.130 150.502 137.095 1.00 122.70 ? 936  ASP A CB  1 
ATOM   6158  C CG  . ASP A  1 923  ? 158.379 149.328 138.010 1.00 122.70 ? 936  ASP A CG  1 
ATOM   6159  O OD1 . ASP A  1 923  ? 157.800 149.311 139.118 1.00 122.70 ? 936  ASP A OD1 1 
ATOM   6160  O OD2 . ASP A  1 923  ? 159.160 148.432 137.634 1.00 122.70 ? 936  ASP A OD2 1 
ATOM   6161  N N   . SER A  1 924  ? 160.087 152.410 138.426 1.00 115.24 ? 937  SER A N   1 
ATOM   6162  C CA  . SER A  1 924  ? 161.226 152.483 139.328 1.00 115.24 ? 937  SER A CA  1 
ATOM   6163  C C   . SER A  1 924  ? 161.005 153.533 140.398 1.00 115.24 ? 937  SER A C   1 
ATOM   6164  O O   . SER A  1 924  ? 161.750 153.600 141.380 1.00 115.24 ? 937  SER A O   1 
ATOM   6165  C CB  . SER A  1 924  ? 162.507 152.776 138.569 1.00 115.24 ? 937  SER A CB  1 
ATOM   6166  O OG  . SER A  1 924  ? 163.535 153.046 139.502 1.00 115.24 ? 937  SER A OG  1 
ATOM   6167  N N   . LEU A  1 925  ? 160.022 154.401 140.202 1.00 114.27 ? 938  LEU A N   1 
ATOM   6168  C CA  . LEU A  1 925  ? 159.637 155.261 141.307 1.00 114.27 ? 938  LEU A CA  1 
ATOM   6169  C C   . LEU A  1 925  ? 158.507 154.677 142.135 1.00 114.27 ? 938  LEU A C   1 
ATOM   6170  O O   . LEU A  1 925  ? 158.422 154.965 143.332 1.00 114.27 ? 938  LEU A O   1 
ATOM   6171  C CB  . LEU A  1 925  ? 159.216 156.628 140.807 1.00 114.27 ? 938  LEU A CB  1 
ATOM   6172  C CG  . LEU A  1 925  ? 160.332 157.450 140.196 1.00 114.27 ? 938  LEU A CG  1 
ATOM   6173  C CD1 . LEU A  1 925  ? 159.775 158.800 139.828 1.00 114.27 ? 938  LEU A CD1 1 
ATOM   6174  C CD2 . LEU A  1 925  ? 161.488 157.582 141.150 1.00 114.27 ? 938  LEU A CD2 1 
ATOM   6175  N N   . SER A  1 926  ? 157.642 153.865 141.531 1.00 123.34 ? 939  SER A N   1 
ATOM   6176  C CA  . SER A  1 926  ? 156.412 153.456 142.201 1.00 123.34 ? 939  SER A CA  1 
ATOM   6177  C C   . SER A  1 926  ? 156.638 152.292 143.159 1.00 123.34 ? 939  SER A C   1 
ATOM   6178  O O   . SER A  1 926  ? 156.174 152.321 144.305 1.00 123.34 ? 939  SER A O   1 
ATOM   6179  C CB  . SER A  1 926  ? 155.360 153.088 141.152 1.00 123.34 ? 939  SER A CB  1 
ATOM   6180  O OG  . SER A  1 926  ? 155.924 152.336 140.091 1.00 123.34 ? 939  SER A OG  1 
ATOM   6181  N N   . SER A  1 927  ? 157.338 151.262 142.709 1.00 130.94 ? 940  SER A N   1 
ATOM   6182  C CA  . SER A  1 927  ? 157.570 150.090 143.535 1.00 130.94 ? 940  SER A CA  1 
ATOM   6183  C C   . SER A  1 927  ? 158.939 150.114 144.186 1.00 130.94 ? 940  SER A C   1 
ATOM   6184  O O   . SER A  1 927  ? 159.061 150.016 145.411 1.00 130.94 ? 940  SER A O   1 
ATOM   6185  C CB  . SER A  1 927  ? 157.441 148.826 142.679 1.00 130.94 ? 940  SER A CB  1 
ATOM   6186  O OG  . SER A  1 927  ? 158.260 148.925 141.521 1.00 130.94 ? 940  SER A OG  1 
ATOM   6187  N N   . THR A  1 928  ? 159.967 150.277 143.365 1.00 136.03 ? 941  THR A N   1 
ATOM   6188  C CA  . THR A  1 928  ? 161.333 150.026 143.782 1.00 136.03 ? 941  THR A CA  1 
ATOM   6189  C C   . THR A  1 928  ? 161.741 150.948 144.922 1.00 136.03 ? 941  THR A C   1 
ATOM   6190  O O   . THR A  1 928  ? 161.158 152.015 145.135 1.00 136.03 ? 941  THR A O   1 
ATOM   6191  C CB  . THR A  1 928  ? 162.272 150.187 142.579 1.00 136.03 ? 941  THR A CB  1 
ATOM   6192  O OG1 . THR A  1 928  ? 162.285 151.555 142.149 1.00 136.03 ? 941  THR A OG1 1 
ATOM   6193  C CG2 . THR A  1 928  ? 161.803 149.309 141.418 1.00 136.03 ? 941  THR A CG2 1 
ATOM   6194  N N   . ALA A  1 929  ? 162.728 150.503 145.678 1.00 128.81 ? 942  ALA A N   1 
ATOM   6195  C CA  . ALA A  1 929  ? 163.216 151.279 146.790 1.00 128.81 ? 942  ALA A CA  1 
ATOM   6196  C C   . ALA A  1 929  ? 164.344 152.200 146.344 1.00 128.81 ? 942  ALA A C   1 
ATOM   6197  O O   . ALA A  1 929  ? 164.820 152.144 145.210 1.00 128.81 ? 942  ALA A O   1 
ATOM   6198  C CB  . ALA A  1 929  ? 163.690 150.350 147.899 1.00 128.81 ? 942  ALA A CB  1 
ATOM   6199  N N   . SER A  1 930  ? 164.766 153.063 147.269 1.00 137.66 ? 943  SER A N   1 
ATOM   6200  C CA  . SER A  1 930  ? 165.933 153.928 147.096 1.00 137.66 ? 943  SER A CA  1 
ATOM   6201  C C   . SER A  1 930  ? 165.843 154.772 145.831 1.00 137.66 ? 943  SER A C   1 
ATOM   6202  O O   . SER A  1 930  ? 166.855 155.057 145.188 1.00 137.66 ? 943  SER A O   1 
ATOM   6203  C CB  . SER A  1 930  ? 167.235 153.123 147.103 1.00 137.66 ? 943  SER A CB  1 
ATOM   6204  O OG  . SER A  1 930  ? 168.350 153.961 147.361 1.00 137.66 ? 943  SER A OG  1 
ATOM   6205  N N   . ALA A  1 931  ? 164.631 155.167 145.452 1.00 124.91 ? 944  ALA A N   1 
ATOM   6206  C CA  . ALA A  1 931  ? 164.476 156.112 144.355 1.00 124.91 ? 944  ALA A CA  1 
ATOM   6207  C C   . ALA A  1 931  ? 164.461 157.547 144.870 1.00 124.91 ? 944  ALA A C   1 
ATOM   6208  O O   . ALA A  1 931  ? 165.039 158.447 144.254 1.00 124.91 ? 944  ALA A O   1 
ATOM   6209  C CB  . ALA A  1 931  ? 163.201 155.794 143.577 1.00 124.91 ? 944  ALA A CB  1 
ATOM   6210  N N   . LEU A  1 932  ? 163.812 157.771 146.006 1.00 110.79 ? 945  LEU A N   1 
ATOM   6211  C CA  . LEU A  1 932  ? 163.661 159.094 146.595 1.00 110.79 ? 945  LEU A CA  1 
ATOM   6212  C C   . LEU A  1 932  ? 164.329 159.175 147.961 1.00 110.79 ? 945  LEU A C   1 
ATOM   6213  O O   . LEU A  1 932  ? 163.771 159.719 148.915 1.00 110.79 ? 945  LEU A O   1 
ATOM   6214  C CB  . LEU A  1 932  ? 162.190 159.465 146.712 1.00 110.79 ? 945  LEU A CB  1 
ATOM   6215  C CG  . LEU A  1 932  ? 161.298 159.020 145.564 1.00 110.79 ? 945  LEU A CG  1 
ATOM   6216  C CD1 . LEU A  1 932  ? 159.865 159.474 145.797 1.00 110.79 ? 945  LEU A CD1 1 
ATOM   6217  C CD2 . LEU A  1 932  ? 161.839 159.577 144.266 1.00 110.79 ? 945  LEU A CD2 1 
ATOM   6218  N N   . GLY A  1 933  ? 165.526 158.620 148.078 1.00 98.36  ? 946  GLY A N   1 
ATOM   6219  C CA  . GLY A  1 933  ? 166.211 158.673 149.351 1.00 98.36  ? 946  GLY A CA  1 
ATOM   6220  C C   . GLY A  1 933  ? 166.469 160.091 149.814 1.00 98.36  ? 946  GLY A C   1 
ATOM   6221  O O   . GLY A  1 933  ? 166.454 160.372 151.009 1.00 98.36  ? 946  GLY A O   1 
ATOM   6222  N N   . LYS A  1 934  ? 166.682 161.010 148.875 1.00 90.79  ? 947  LYS A N   1 
ATOM   6223  C CA  . LYS A  1 934  ? 167.169 162.333 149.244 1.00 90.79  ? 947  LYS A CA  1 
ATOM   6224  C C   . LYS A  1 934  ? 166.124 163.108 150.024 1.00 90.79  ? 947  LYS A C   1 
ATOM   6225  O O   . LYS A  1 934  ? 166.404 163.655 151.092 1.00 90.79  ? 947  LYS A O   1 
ATOM   6226  C CB  . LYS A  1 934  ? 167.579 163.101 147.995 1.00 90.79  ? 947  LYS A CB  1 
ATOM   6227  C CG  . LYS A  1 934  ? 168.426 162.293 147.070 1.00 90.79  ? 947  LYS A CG  1 
ATOM   6228  C CD  . LYS A  1 934  ? 168.854 163.102 145.889 1.00 90.79  ? 947  LYS A CD  1 
ATOM   6229  C CE  . LYS A  1 934  ? 169.490 164.386 146.341 1.00 90.79  ? 947  LYS A CE  1 
ATOM   6230  N NZ  . LYS A  1 934  ? 170.503 164.144 147.383 1.00 90.79  ? 947  LYS A NZ  1 
ATOM   6231  N N   . LEU A  1 935  ? 164.914 163.192 149.490 1.00 95.17  ? 948  LEU A N   1 
ATOM   6232  C CA  . LEU A  1 935  ? 163.891 163.995 150.142 1.00 95.17  ? 948  LEU A CA  1 
ATOM   6233  C C   . LEU A  1 935  ? 163.436 163.337 151.425 1.00 95.17  ? 948  LEU A C   1 
ATOM   6234  O O   . LEU A  1 935  ? 163.210 164.003 152.439 1.00 95.17  ? 948  LEU A O   1 
ATOM   6235  C CB  . LEU A  1 935  ? 162.714 164.196 149.202 1.00 95.17  ? 948  LEU A CB  1 
ATOM   6236  C CG  . LEU A  1 935  ? 163.115 164.436 147.757 1.00 95.17  ? 948  LEU A CG  1 
ATOM   6237  C CD1 . LEU A  1 935  ? 161.871 164.667 146.942 1.00 95.17  ? 948  LEU A CD1 1 
ATOM   6238  C CD2 . LEU A  1 935  ? 164.065 165.620 147.653 1.00 95.17  ? 948  LEU A CD2 1 
ATOM   6239  N N   . GLN A  1 936  ? 163.244 162.026 151.380 1.00 101.65 ? 949  GLN A N   1 
ATOM   6240  C CA  . GLN A  1 936  ? 163.003 161.309 152.611 1.00 101.65 ? 949  GLN A CA  1 
ATOM   6241  C C   . GLN A  1 936  ? 164.096 161.625 153.601 1.00 101.65 ? 949  GLN A C   1 
ATOM   6242  O O   . GLN A  1 936  ? 163.839 161.747 154.796 1.00 101.65 ? 949  GLN A O   1 
ATOM   6243  C CB  . GLN A  1 936  ? 162.906 159.821 152.322 1.00 101.65 ? 949  GLN A CB  1 
ATOM   6244  C CG  . GLN A  1 936  ? 161.686 159.518 151.509 1.00 101.65 ? 949  GLN A CG  1 
ATOM   6245  C CD  . GLN A  1 936  ? 160.424 159.897 152.243 1.00 101.65 ? 949  GLN A CD  1 
ATOM   6246  O OE1 . GLN A  1 936  ? 159.841 160.940 151.988 1.00 101.65 ? 949  GLN A OE1 1 
ATOM   6247  N NE2 . GLN A  1 936  ? 159.985 159.035 153.146 1.00 101.65 ? 949  GLN A NE2 1 
ATOM   6248  N N   . ASP A  1 937  ? 165.305 161.845 153.108 1.00 103.84 ? 950  ASP A N   1 
ATOM   6249  C CA  . ASP A  1 937  ? 166.386 162.219 153.992 1.00 103.84 ? 950  ASP A CA  1 
ATOM   6250  C C   . ASP A  1 937  ? 166.174 163.611 154.540 1.00 103.84 ? 950  ASP A C   1 
ATOM   6251  O O   . ASP A  1 937  ? 166.407 163.851 155.721 1.00 103.84 ? 950  ASP A O   1 
ATOM   6252  C CB  . ASP A  1 937  ? 167.715 162.124 153.257 1.00 103.84 ? 950  ASP A CB  1 
ATOM   6253  C CG  . ASP A  1 937  ? 168.889 162.435 154.147 1.00 103.84 ? 950  ASP A CG  1 
ATOM   6254  O OD1 . ASP A  1 937  ? 168.948 163.550 154.703 1.00 103.84 ? 950  ASP A OD1 1 
ATOM   6255  O OD2 . ASP A  1 937  ? 169.777 161.568 154.272 1.00 103.84 ? 950  ASP A OD2 1 
ATOM   6256  N N   . VAL A  1 938  ? 165.742 164.545 153.705 1.00 95.01  ? 951  VAL A N   1 
ATOM   6257  C CA  . VAL A  1 938  ? 165.610 165.906 154.207 1.00 95.01  ? 951  VAL A CA  1 
ATOM   6258  C C   . VAL A  1 938  ? 164.519 165.955 155.263 1.00 95.01  ? 951  VAL A C   1 
ATOM   6259  O O   . VAL A  1 938  ? 164.668 166.586 156.322 1.00 95.01  ? 951  VAL A O   1 
ATOM   6260  C CB  . VAL A  1 938  ? 165.355 166.906 153.060 1.00 95.01  ? 951  VAL A CB  1 
ATOM   6261  C CG1 . VAL A  1 938  ? 166.309 166.666 151.917 1.00 95.01  ? 951  VAL A CG1 1 
ATOM   6262  C CG2 . VAL A  1 938  ? 163.928 166.880 152.582 1.00 95.01  ? 951  VAL A CG2 1 
ATOM   6263  N N   . VAL A  1 939  ? 163.437 165.226 155.032 1.00 96.59  ? 952  VAL A N   1 
ATOM   6264  C CA  . VAL A  1 939  ? 162.325 165.294 155.960 1.00 96.59  ? 952  VAL A CA  1 
ATOM   6265  C C   . VAL A  1 939  ? 162.643 164.508 157.226 1.00 96.59  ? 952  VAL A C   1 
ATOM   6266  O O   . VAL A  1 939  ? 162.329 164.944 158.339 1.00 96.59  ? 952  VAL A O   1 
ATOM   6267  C CB  . VAL A  1 939  ? 161.039 164.823 155.266 1.00 96.59  ? 952  VAL A CB  1 
ATOM   6268  C CG1 . VAL A  1 939  ? 160.660 165.820 154.200 1.00 96.59  ? 952  VAL A CG1 1 
ATOM   6269  C CG2 . VAL A  1 939  ? 161.234 163.473 154.654 1.00 96.59  ? 952  VAL A CG2 1 
ATOM   6270  N N   . ASN A  1 940  ? 163.305 163.357 157.086 1.00 97.69  ? 953  ASN A N   1 
ATOM   6271  C CA  . ASN A  1 940  ? 163.799 162.646 158.255 1.00 97.69  ? 953  ASN A CA  1 
ATOM   6272  C C   . ASN A  1 940  ? 164.775 163.508 159.026 1.00 97.69  ? 953  ASN A C   1 
ATOM   6273  O O   . ASN A  1 940  ? 164.859 163.419 160.247 1.00 97.69  ? 953  ASN A O   1 
ATOM   6274  C CB  . ASN A  1 940  ? 164.478 161.345 157.834 1.00 97.69  ? 953  ASN A CB  1 
ATOM   6275  C CG  . ASN A  1 940  ? 163.506 160.319 157.309 1.00 97.69  ? 953  ASN A CG  1 
ATOM   6276  O OD1 . ASN A  1 940  ? 162.504 160.010 157.949 1.00 97.69  ? 953  ASN A OD1 1 
ATOM   6277  N ND2 . ASN A  1 940  ? 163.796 159.785 156.129 1.00 97.69  ? 953  ASN A ND2 1 
ATOM   6278  N N   . GLN A  1 941  ? 165.552 164.319 158.322 1.00 90.22  ? 954  GLN A N   1 
ATOM   6279  C CA  . GLN A  1 941  ? 166.457 165.231 158.990 1.00 90.22  ? 954  GLN A CA  1 
ATOM   6280  C C   . GLN A  1 941  ? 165.680 166.160 159.886 1.00 90.22  ? 954  GLN A C   1 
ATOM   6281  O O   . GLN A  1 941  ? 165.958 166.279 161.086 1.00 90.22  ? 954  GLN A O   1 
ATOM   6282  C CB  . GLN A  1 941  ? 167.233 166.029 157.958 1.00 90.22  ? 954  GLN A CB  1 
ATOM   6283  C CG  . GLN A  1 941  ? 168.503 165.389 157.535 1.00 90.22  ? 954  GLN A CG  1 
ATOM   6284  C CD  . GLN A  1 941  ? 169.491 166.411 157.068 1.00 90.22  ? 954  GLN A CD  1 
ATOM   6285  O OE1 . GLN A  1 941  ? 169.175 167.597 156.972 1.00 90.22  ? 954  GLN A OE1 1 
ATOM   6286  N NE2 . GLN A  1 941  ? 170.707 165.971 156.789 1.00 90.22  ? 954  GLN A NE2 1 
ATOM   6287  N N   . ASN A  1 942  ? 164.704 166.843 159.307 1.00 86.89  ? 955  ASN A N   1 
ATOM   6288  C CA  . ASN A  1 942  ? 163.841 167.655 160.138 1.00 86.89  ? 955  ASN A CA  1 
ATOM   6289  C C   . ASN A  1 942  ? 163.336 166.847 161.308 1.00 86.89  ? 955  ASN A C   1 
ATOM   6290  O O   . ASN A  1 942  ? 163.363 167.308 162.448 1.00 86.89  ? 955  ASN A O   1 
ATOM   6291  C CB  . ASN A  1 942  ? 162.661 168.179 159.354 1.00 86.89  ? 955  ASN A CB  1 
ATOM   6292  C CG  . ASN A  1 942  ? 161.559 168.643 160.257 1.00 86.89  ? 955  ASN A CG  1 
ATOM   6293  O OD1 . ASN A  1 942  ? 161.662 169.689 160.888 1.00 86.89  ? 955  ASN A OD1 1 
ATOM   6294  N ND2 . ASN A  1 942  ? 160.499 167.858 160.344 1.00 86.89  ? 955  ASN A ND2 1 
ATOM   6295  N N   . ALA A  1 943  ? 162.914 165.615 161.047 1.00 88.59  ? 956  ALA A N   1 
ATOM   6296  C CA  . ALA A  1 943  ? 162.212 164.838 162.058 1.00 88.59  ? 956  ALA A CA  1 
ATOM   6297  C C   . ALA A  1 943  ? 163.132 164.442 163.200 1.00 88.59  ? 956  ALA A C   1 
ATOM   6298  O O   . ALA A  1 943  ? 162.759 164.528 164.375 1.00 88.59  ? 956  ALA A O   1 
ATOM   6299  C CB  . ALA A  1 943  ? 161.602 163.599 161.412 1.00 88.59  ? 956  ALA A CB  1 
ATOM   6300  N N   . GLN A  1 944  ? 164.313 163.952 162.864 1.00 91.98  ? 957  GLN A N   1 
ATOM   6301  C CA  . GLN A  1 944  ? 165.274 163.572 163.878 1.00 91.98  ? 957  GLN A CA  1 
ATOM   6302  C C   . GLN A  1 944  ? 165.652 164.781 164.705 1.00 91.98  ? 957  GLN A C   1 
ATOM   6303  O O   . GLN A  1 944  ? 165.657 164.730 165.941 1.00 91.98  ? 957  GLN A O   1 
ATOM   6304  C CB  . GLN A  1 944  ? 166.500 162.937 163.218 1.00 91.98  ? 957  GLN A CB  1 
ATOM   6305  C CG  . GLN A  1 944  ? 167.254 163.845 162.258 1.00 91.98  ? 957  GLN A CG  1 
ATOM   6306  C CD  . GLN A  1 944  ? 167.945 163.104 161.135 1.00 91.98  ? 957  GLN A CD  1 
ATOM   6307  O OE1 . GLN A  1 944  ? 167.307 162.420 160.339 1.00 91.98  ? 957  GLN A OE1 1 
ATOM   6308  N NE2 . GLN A  1 944  ? 169.263 163.246 161.061 1.00 91.98  ? 957  GLN A NE2 1 
ATOM   6309  N N   . ALA A  1 945  ? 165.961 165.888 164.034 1.00 81.00  ? 958  ALA A N   1 
ATOM   6310  C CA  . ALA A  1 945  ? 166.219 167.114 164.757 1.00 81.00  ? 958  ALA A CA  1 
ATOM   6311  C C   . ALA A  1 945  ? 165.069 167.401 165.700 1.00 81.00  ? 958  ALA A C   1 
ATOM   6312  O O   . ALA A  1 945  ? 165.271 167.724 166.879 1.00 81.00  ? 958  ALA A O   1 
ATOM   6313  C CB  . ALA A  1 945  ? 166.419 168.253 163.761 1.00 81.00  ? 958  ALA A CB  1 
ATOM   6314  N N   . LEU A  1 946  ? 163.854 167.224 165.204 1.00 78.03  ? 959  LEU A N   1 
ATOM   6315  C CA  . LEU A  1 946  ? 162.687 167.480 166.013 1.00 78.03  ? 959  LEU A CA  1 
ATOM   6316  C C   . LEU A  1 946  ? 162.748 166.660 167.280 1.00 78.03  ? 959  LEU A C   1 
ATOM   6317  O O   . LEU A  1 946  ? 162.914 167.198 168.372 1.00 78.03  ? 959  LEU A O   1 
ATOM   6318  C CB  . LEU A  1 946  ? 161.432 167.155 165.218 1.00 78.03  ? 959  LEU A CB  1 
ATOM   6319  C CG  . LEU A  1 946  ? 160.155 167.479 165.974 1.00 78.03  ? 959  LEU A CG  1 
ATOM   6320  C CD1 . LEU A  1 946  ? 159.884 168.949 165.820 1.00 78.03  ? 959  LEU A CD1 1 
ATOM   6321  C CD2 . LEU A  1 946  ? 158.970 166.653 165.479 1.00 78.03  ? 959  LEU A CD2 1 
ATOM   6322  N N   . ASN A  1 947  ? 162.701 165.341 167.138 1.00 76.98  ? 960  ASN A N   1 
ATOM   6323  C CA  . ASN A  1 947  ? 162.525 164.496 168.313 1.00 76.98  ? 960  ASN A CA  1 
ATOM   6324  C C   . ASN A  1 947  ? 163.684 164.639 169.274 1.00 76.98  ? 960  ASN A C   1 
ATOM   6325  O O   . ASN A  1 947  ? 163.512 164.475 170.484 1.00 76.98  ? 960  ASN A O   1 
ATOM   6326  C CB  . ASN A  1 947  ? 162.349 163.035 167.924 1.00 76.98  ? 960  ASN A CB  1 
ATOM   6327  C CG  . ASN A  1 947  ? 161.938 162.183 169.098 1.00 76.98  ? 960  ASN A CG  1 
ATOM   6328  O OD1 . ASN A  1 947  ? 162.623 161.232 169.465 1.00 76.98  ? 960  ASN A OD1 1 
ATOM   6329  N ND2 . ASN A  1 947  ? 160.825 162.543 169.714 1.00 76.98  ? 960  ASN A ND2 1 
ATOM   6330  N N   . THR A  1 948  ? 164.872 164.925 168.755 1.00 76.54  ? 961  THR A N   1 
ATOM   6331  C CA  . THR A  1 948  ? 165.980 165.250 169.634 1.00 76.54  ? 961  THR A CA  1 
ATOM   6332  C C   . THR A  1 948  ? 165.631 166.454 170.481 1.00 76.54  ? 961  THR A C   1 
ATOM   6333  O O   . THR A  1 948  ? 165.671 166.399 171.720 1.00 76.54  ? 961  THR A O   1 
ATOM   6334  C CB  . THR A  1 948  ? 167.212 165.540 168.796 1.00 76.54  ? 961  THR A CB  1 
ATOM   6335  O OG1 . THR A  1 948  ? 166.855 166.484 167.786 1.00 76.54  ? 961  THR A OG1 1 
ATOM   6336  C CG2 . THR A  1 948  ? 167.709 164.274 168.135 1.00 76.54  ? 961  THR A CG2 1 
ATOM   6337  N N   . LEU A  1 949  ? 165.300 167.556 169.810 1.00 75.57  ? 962  LEU A N   1 
ATOM   6338  C CA  . LEU A  1 949  ? 164.802 168.737 170.488 1.00 75.57  ? 962  LEU A CA  1 
ATOM   6339  C C   . LEU A  1 949  ? 163.786 168.351 171.535 1.00 75.57  ? 962  LEU A C   1 
ATOM   6340  O O   . LEU A  1 949  ? 163.783 168.877 172.652 1.00 75.57  ? 962  LEU A O   1 
ATOM   6341  C CB  . LEU A  1 949  ? 164.163 169.660 169.460 1.00 75.57  ? 962  LEU A CB  1 
ATOM   6342  C CG  . LEU A  1 949  ? 163.977 171.141 169.735 1.00 75.57  ? 962  LEU A CG  1 
ATOM   6343  C CD1 . LEU A  1 949  ? 163.368 171.769 168.505 1.00 75.57  ? 962  LEU A CD1 1 
ATOM   6344  C CD2 . LEU A  1 949  ? 163.102 171.386 170.938 1.00 75.57  ? 962  LEU A CD2 1 
ATOM   6345  N N   . VAL A  1 950  ? 162.910 167.429 171.176 1.00 76.95  ? 963  VAL A N   1 
ATOM   6346  C CA  . VAL A  1 950  ? 161.852 167.023 172.078 1.00 76.95  ? 963  VAL A CA  1 
ATOM   6347  C C   . VAL A  1 950  ? 162.451 166.426 173.336 1.00 76.95  ? 963  VAL A C   1 
ATOM   6348  O O   . VAL A  1 950  ? 162.319 166.973 174.434 1.00 76.95  ? 963  VAL A O   1 
ATOM   6349  C CB  . VAL A  1 950  ? 160.912 166.036 171.375 1.00 76.95  ? 963  VAL A CB  1 
ATOM   6350  C CG1 . VAL A  1 950  ? 159.693 165.820 172.201 1.00 76.95  ? 963  VAL A CG1 1 
ATOM   6351  C CG2 . VAL A  1 950  ? 160.500 166.604 170.074 1.00 76.95  ? 963  VAL A CG2 1 
ATOM   6352  N N   . LYS A  1 951  ? 163.168 165.321 173.182 1.00 87.36  ? 964  LYS A N   1 
ATOM   6353  C CA  . LYS A  1 951  ? 163.598 164.574 174.353 1.00 87.36  ? 964  LYS A CA  1 
ATOM   6354  C C   . LYS A  1 951  ? 164.509 165.391 175.234 1.00 87.36  ? 964  LYS A C   1 
ATOM   6355  O O   . LYS A  1 951  ? 164.645 165.076 176.416 1.00 87.36  ? 964  LYS A O   1 
ATOM   6356  C CB  . LYS A  1 951  ? 164.305 163.286 173.948 1.00 87.36  ? 964  LYS A CB  1 
ATOM   6357  C CG  . LYS A  1 951  ? 164.488 162.289 175.092 1.00 87.36  ? 964  LYS A CG  1 
ATOM   6358  C CD  . LYS A  1 951  ? 163.304 162.241 176.060 1.00 87.36  ? 964  LYS A CD  1 
ATOM   6359  C CE  . LYS A  1 951  ? 162.065 161.609 175.439 1.00 87.36  ? 964  LYS A CE  1 
ATOM   6360  N NZ  . LYS A  1 951  ? 160.846 161.770 176.274 1.00 87.36  ? 964  LYS A NZ  1 
ATOM   6361  N N   . GLN A  1 952  ? 165.107 166.446 174.685 1.00 87.35  ? 965  GLN A N   1 
ATOM   6362  C CA  . GLN A  1 952  ? 165.983 167.294 175.477 1.00 87.35  ? 965  GLN A CA  1 
ATOM   6363  C C   . GLN A  1 952  ? 165.485 167.455 176.900 1.00 87.35  ? 965  GLN A C   1 
ATOM   6364  O O   . GLN A  1 952  ? 166.229 167.228 177.859 1.00 87.35  ? 965  GLN A O   1 
ATOM   6365  C CB  . GLN A  1 952  ? 166.099 168.655 174.807 1.00 87.35  ? 965  GLN A CB  1 
ATOM   6366  C CG  . GLN A  1 952  ? 166.836 168.606 173.519 1.00 87.35  ? 965  GLN A CG  1 
ATOM   6367  C CD  . GLN A  1 952  ? 167.895 167.552 173.544 1.00 87.35  ? 965  GLN A CD  1 
ATOM   6368  O OE1 . GLN A  1 952  ? 168.877 167.664 174.271 1.00 87.35  ? 965  GLN A OE1 1 
ATOM   6369  N NE2 . GLN A  1 952  ? 167.699 166.501 172.762 1.00 87.35  ? 965  GLN A NE2 1 
ATOM   6370  N N   . LEU A  1 953  ? 164.207 167.835 177.021 1.00 81.69  ? 966  LEU A N   1 
ATOM   6371  C CA  . LEU A  1 953  ? 163.542 168.068 178.333 1.00 81.69  ? 966  LEU A CA  1 
ATOM   6372  C C   . LEU A  1 953  ? 163.932 166.972 179.331 1.00 81.69  ? 966  LEU A C   1 
ATOM   6373  O O   . LEU A  1 953  ? 163.972 167.270 180.541 1.00 81.69  ? 966  LEU A O   1 
ATOM   6374  C CB  . LEU A  1 953  ? 162.023 168.130 178.138 1.00 81.69  ? 966  LEU A CB  1 
ATOM   6375  C CG  . LEU A  1 953  ? 161.519 169.270 177.254 1.00 81.69  ? 966  LEU A CG  1 
ATOM   6376  C CD1 . LEU A  1 953  ? 162.142 169.200 175.869 1.00 81.69  ? 966  LEU A CD1 1 
ATOM   6377  C CD2 . LEU A  1 953  ? 160.002 169.250 177.157 1.00 81.69  ? 966  LEU A CD2 1 
ATOM   6378  N N   . SER A  1 954  ? 164.147 165.744 178.849 1.00 90.31  ? 967  SER A N   1 
ATOM   6379  C CA  . SER A  1 954  ? 164.551 164.662 179.726 1.00 90.31  ? 967  SER A CA  1 
ATOM   6380  C C   . SER A  1 954  ? 165.699 165.062 180.626 1.00 90.31  ? 967  SER A C   1 
ATOM   6381  O O   . SER A  1 954  ? 165.825 164.524 181.730 1.00 90.31  ? 967  SER A O   1 
ATOM   6382  C CB  . SER A  1 954  ? 164.966 163.464 178.892 1.00 90.31  ? 967  SER A CB  1 
ATOM   6383  O OG  . SER A  1 954  ? 165.734 163.909 177.787 1.00 90.31  ? 967  SER A OG  1 
ATOM   6384  N N   . SER A  1 955  ? 166.526 166.000 180.191 1.00 91.55  ? 968  SER A N   1 
ATOM   6385  C CA  . SER A  1 955  ? 167.732 166.271 180.933 1.00 91.55  ? 968  SER A CA  1 
ATOM   6386  C C   . SER A  1 955  ? 167.420 166.807 182.312 1.00 91.55  ? 968  SER A C   1 
ATOM   6387  O O   . SER A  1 955  ? 166.272 167.036 182.692 1.00 91.55  ? 968  SER A O   1 
ATOM   6388  C CB  . SER A  1 955  ? 168.605 167.287 180.228 1.00 91.55  ? 968  SER A CB  1 
ATOM   6389  O OG  . SER A  1 955  ? 169.501 167.826 181.181 1.00 91.55  ? 968  SER A OG  1 
ATOM   6390  N N   . ASN A  1 956  ? 168.483 166.974 183.076 1.00 99.11  ? 969  ASN A N   1 
ATOM   6391  C CA  . ASN A  1 956  ? 168.403 167.637 184.358 1.00 99.11  ? 969  ASN A CA  1 
ATOM   6392  C C   . ASN A  1 956  ? 169.580 168.573 184.482 1.00 99.11  ? 969  ASN A C   1 
ATOM   6393  O O   . ASN A  1 956  ? 169.535 169.556 185.220 1.00 99.11  ? 969  ASN A O   1 
ATOM   6394  C CB  . ASN A  1 956  ? 168.407 166.621 185.480 1.00 99.11  ? 969  ASN A CB  1 
ATOM   6395  C CG  . ASN A  1 956  ? 167.160 165.801 185.503 1.00 99.11  ? 969  ASN A CG  1 
ATOM   6396  O OD1 . ASN A  1 956  ? 166.338 165.941 186.399 1.00 99.11  ? 969  ASN A OD1 1 
ATOM   6397  N ND2 . ASN A  1 956  ? 167.003 164.930 184.517 1.00 99.11  ? 969  ASN A ND2 1 
ATOM   6398  N N   . PHE A  1 957  ? 170.650 168.259 183.772 1.00 96.11  ? 970  PHE A N   1 
ATOM   6399  C CA  . PHE A  1 957  ? 171.871 169.026 183.899 1.00 96.11  ? 970  PHE A CA  1 
ATOM   6400  C C   . PHE A  1 957  ? 172.220 169.168 185.367 1.00 96.11  ? 970  PHE A C   1 
ATOM   6401  O O   . PHE A  1 957  ? 172.689 170.209 185.827 1.00 96.11  ? 970  PHE A O   1 
ATOM   6402  C CB  . PHE A  1 957  ? 171.717 170.389 183.247 1.00 96.11  ? 970  PHE A CB  1 
ATOM   6403  C CG  . PHE A  1 957  ? 171.049 170.340 181.926 1.00 96.11  ? 970  PHE A CG  1 
ATOM   6404  C CD1 . PHE A  1 957  ? 171.725 169.915 180.816 1.00 96.11  ? 970  PHE A CD1 1 
ATOM   6405  C CD2 . PHE A  1 957  ? 169.742 170.725 181.798 1.00 96.11  ? 970  PHE A CD2 1 
ATOM   6406  C CE1 . PHE A  1 957  ? 171.106 169.880 179.610 1.00 96.11  ? 970  PHE A CE1 1 
ATOM   6407  C CE2 . PHE A  1 957  ? 169.124 170.691 180.593 1.00 96.11  ? 970  PHE A CE2 1 
ATOM   6408  C CZ  . PHE A  1 957  ? 169.805 170.275 179.496 1.00 96.11  ? 970  PHE A CZ  1 
ATOM   6409  N N   . GLY A  1 958  ? 171.931 168.128 186.123 1.00 104.22 ? 971  GLY A N   1 
ATOM   6410  C CA  . GLY A  1 958  ? 171.970 168.298 187.542 1.00 104.22 ? 971  GLY A CA  1 
ATOM   6411  C C   . GLY A  1 958  ? 170.712 168.879 188.130 1.00 104.22 ? 971  GLY A C   1 
ATOM   6412  O O   . GLY A  1 958  ? 170.757 169.399 189.250 1.00 104.22 ? 971  GLY A O   1 
ATOM   6413  N N   . ALA A  1 959  ? 169.592 168.829 187.421 1.00 101.42 ? 972  ALA A N   1 
ATOM   6414  C CA  . ALA A  1 959  ? 168.327 169.159 188.054 1.00 101.42 ? 972  ALA A CA  1 
ATOM   6415  C C   . ALA A  1 959  ? 167.820 167.966 188.839 1.00 101.42 ? 972  ALA A C   1 
ATOM   6416  O O   . ALA A  1 959  ? 167.916 166.824 188.393 1.00 101.42 ? 972  ALA A O   1 
ATOM   6417  C CB  . ALA A  1 959  ? 167.280 169.573 187.026 1.00 101.42 ? 972  ALA A CB  1 
ATOM   6418  N N   . ILE A  1 960  ? 167.263 168.231 190.019 1.00 97.22  ? 973  ILE A N   1 
ATOM   6419  C CA  . ILE A  1 960  ? 166.730 167.131 190.810 1.00 97.22  ? 973  ILE A CA  1 
ATOM   6420  C C   . ILE A  1 960  ? 165.442 166.579 190.235 1.00 97.22  ? 973  ILE A C   1 
ATOM   6421  O O   . ILE A  1 960  ? 164.841 165.688 190.844 1.00 97.22  ? 973  ILE A O   1 
ATOM   6422  C CB  . ILE A  1 960  ? 166.524 167.586 192.259 1.00 97.22  ? 973  ILE A CB  1 
ATOM   6423  C CG1 . ILE A  1 960  ? 165.538 168.737 192.292 1.00 97.22  ? 973  ILE A CG1 1 
ATOM   6424  C CG2 . ILE A  1 960  ? 167.839 168.021 192.828 1.00 97.22  ? 973  ILE A CG2 1 
ATOM   6425  C CD1 . ILE A  1 960  ? 165.080 169.051 193.671 1.00 97.22  ? 973  ILE A CD1 1 
ATOM   6426  N N   . SER A  1 961  ? 164.994 167.089 189.093 1.00 100.98 ? 974  SER A N   1 
ATOM   6427  C CA  . SER A  1 961  ? 163.854 166.545 188.365 1.00 100.98 ? 974  SER A CA  1 
ATOM   6428  C C   . SER A  1 961  ? 163.830 167.204 186.995 1.00 100.98 ? 974  SER A C   1 
ATOM   6429  O O   . SER A  1 961  ? 164.685 168.027 186.672 1.00 100.98 ? 974  SER A O   1 
ATOM   6430  C CB  . SER A  1 961  ? 162.540 166.765 189.109 1.00 100.98 ? 974  SER A CB  1 
ATOM   6431  O OG  . SER A  1 961  ? 162.464 165.921 190.246 1.00 100.98 ? 974  SER A OG  1 
ATOM   6432  N N   . SER A  1 962  ? 162.852 166.829 186.185 1.00 89.77  ? 975  SER A N   1 
ATOM   6433  C CA  . SER A  1 962  ? 162.844 167.254 184.796 1.00 89.77  ? 975  SER A CA  1 
ATOM   6434  C C   . SER A  1 962  ? 161.521 167.889 184.395 1.00 89.77  ? 975  SER A C   1 
ATOM   6435  O O   . SER A  1 962  ? 161.102 167.774 183.247 1.00 89.77  ? 975  SER A O   1 
ATOM   6436  C CB  . SER A  1 962  ? 163.174 166.079 183.880 1.00 89.77  ? 975  SER A CB  1 
ATOM   6437  O OG  . SER A  1 962  ? 163.344 166.499 182.539 1.00 89.77  ? 975  SER A OG  1 
ATOM   6438  N N   . VAL A  1 963  ? 160.853 168.562 185.320 1.00 95.56  ? 976  VAL A N   1 
ATOM   6439  C CA  . VAL A  1 963  ? 159.640 169.304 185.004 1.00 95.56  ? 976  VAL A CA  1 
ATOM   6440  C C   . VAL A  1 963  ? 159.603 170.555 185.860 1.00 95.56  ? 976  VAL A C   1 
ATOM   6441  O O   . VAL A  1 963  ? 159.732 170.478 187.086 1.00 95.56  ? 976  VAL A O   1 
ATOM   6442  C CB  . VAL A  1 963  ? 158.366 168.480 185.239 1.00 95.56  ? 976  VAL A CB  1 
ATOM   6443  C CG1 . VAL A  1 963  ? 157.174 169.410 185.353 1.00 95.56  ? 976  VAL A CG1 1 
ATOM   6444  C CG2 . VAL A  1 963  ? 158.163 167.494 184.119 1.00 95.56  ? 976  VAL A CG2 1 
ATOM   6445  N N   . LEU A  1 964  ? 159.407 171.704 185.219 1.00 96.83  ? 977  LEU A N   1 
ATOM   6446  C CA  . LEU A  1 964  ? 159.392 172.959 185.954 1.00 96.83  ? 977  LEU A CA  1 
ATOM   6447  C C   . LEU A  1 964  ? 158.328 172.949 187.032 1.00 96.83  ? 977  LEU A C   1 
ATOM   6448  O O   . LEU A  1 964  ? 158.602 173.247 188.202 1.00 96.83  ? 977  LEU A O   1 
ATOM   6449  C CB  . LEU A  1 964  ? 159.146 174.109 184.998 1.00 96.83  ? 977  LEU A CB  1 
ATOM   6450  C CG  . LEU A  1 964  ? 160.167 174.161 183.884 1.00 96.83  ? 977  LEU A CG  1 
ATOM   6451  C CD1 . LEU A  1 964  ? 159.607 173.547 182.620 1.00 96.83  ? 977  LEU A CD1 1 
ATOM   6452  C CD2 . LEU A  1 964  ? 160.551 175.598 183.667 1.00 96.83  ? 977  LEU A CD2 1 
ATOM   6453  N N   . ASN A  1 965  ? 157.100 172.612 186.650 1.00 109.38 ? 978  ASN A N   1 
ATOM   6454  C CA  . ASN A  1 965  ? 156.002 172.653 187.601 1.00 109.38 ? 978  ASN A CA  1 
ATOM   6455  C C   . ASN A  1 965  ? 156.321 171.805 188.820 1.00 109.38 ? 978  ASN A C   1 
ATOM   6456  O O   . ASN A  1 965  ? 156.071 172.215 189.960 1.00 109.38 ? 978  ASN A O   1 
ATOM   6457  C CB  . ASN A  1 965  ? 154.721 172.188 186.913 1.00 109.38 ? 978  ASN A CB  1 
ATOM   6458  C CG  . ASN A  1 965  ? 153.479 172.618 187.650 1.00 109.38 ? 978  ASN A CG  1 
ATOM   6459  O OD1 . ASN A  1 965  ? 153.562 173.263 188.685 1.00 109.38 ? 978  ASN A OD1 1 
ATOM   6460  N ND2 . ASN A  1 965  ? 152.314 172.301 187.099 1.00 109.38 ? 978  ASN A ND2 1 
ATOM   6461  N N   . ASP A  1 966  ? 156.932 170.645 188.596 1.00 107.79 ? 979  ASP A N   1 
ATOM   6462  C CA  . ASP A  1 966  ? 157.341 169.782 189.692 1.00 107.79 ? 979  ASP A CA  1 
ATOM   6463  C C   . ASP A  1 966  ? 158.220 170.523 190.680 1.00 107.79 ? 979  ASP A C   1 
ATOM   6464  O O   . ASP A  1 966  ? 157.842 170.755 191.835 1.00 107.79 ? 979  ASP A O   1 
ATOM   6465  C CB  . ASP A  1 966  ? 158.077 168.574 189.121 1.00 107.79 ? 979  ASP A CB  1 
ATOM   6466  C CG  . ASP A  1 966  ? 158.727 167.726 190.186 1.00 107.79 ? 979  ASP A CG  1 
ATOM   6467  O OD1 . ASP A  1 966  ? 159.646 168.215 190.870 1.00 107.79 ? 979  ASP A OD1 1 
ATOM   6468  O OD2 . ASP A  1 966  ? 158.372 166.539 190.294 1.00 107.79 ? 979  ASP A OD2 1 
ATOM   6469  N N   . ILE A  1 967  ? 159.416 170.883 190.238 1.00 107.63 ? 980  ILE A N   1 
ATOM   6470  C CA  . ILE A  1 967  ? 160.378 171.461 191.157 1.00 107.63 ? 980  ILE A CA  1 
ATOM   6471  C C   . ILE A  1 967  ? 159.805 172.693 191.826 1.00 107.63 ? 980  ILE A C   1 
ATOM   6472  O O   . ILE A  1 967  ? 159.998 172.899 193.029 1.00 107.63 ? 980  ILE A O   1 
ATOM   6473  C CB  . ILE A  1 967  ? 161.684 171.760 190.423 1.00 107.63 ? 980  ILE A CB  1 
ATOM   6474  C CG1 . ILE A  1 967  ? 161.361 172.551 189.175 1.00 107.63 ? 980  ILE A CG1 1 
ATOM   6475  C CG2 . ILE A  1 967  ? 162.377 170.481 190.094 1.00 107.63 ? 980  ILE A CG2 1 
ATOM   6476  C CD1 . ILE A  1 967  ? 162.545 173.063 188.492 1.00 107.63 ? 980  ILE A CD1 1 
ATOM   6477  N N   . LEU A  1 968  ? 159.042 173.477 191.057 1.00 105.23 ? 981  LEU A N   1 
ATOM   6478  C CA  . LEU A  1 968  ? 158.374 174.687 191.608 1.00 105.23 ? 981  LEU A CA  1 
ATOM   6479  C C   . LEU A  1 968  ? 157.553 174.257 192.830 1.00 105.23 ? 981  LEU A C   1 
ATOM   6480  O O   . LEU A  1 968  ? 157.712 174.880 193.899 1.00 105.23 ? 981  LEU A O   1 
ATOM   6481  C CB  . LEU A  1 968  ? 157.477 175.298 190.528 1.00 105.23 ? 981  LEU A CB  1 
ATOM   6482  C CG  . LEU A  1 968  ? 156.727 176.565 190.938 1.00 105.23 ? 981  LEU A CG  1 
ATOM   6483  C CD1 . LEU A  1 968  ? 157.637 177.509 191.708 1.00 105.23 ? 981  LEU A CD1 1 
ATOM   6484  C CD2 . LEU A  1 968  ? 156.139 177.264 189.722 1.00 105.23 ? 981  LEU A CD2 1 
ATOM   6485  N N   . SER A  1 969  ? 156.713 173.228 192.666 1.00 106.98 ? 982  SER A N   1 
ATOM   6486  C CA  . SER A  1 969  ? 155.909 172.704 193.759 1.00 106.98 ? 982  SER A CA  1 
ATOM   6487  C C   . SER A  1 969  ? 156.772 172.187 194.885 1.00 106.98 ? 982  SER A C   1 
ATOM   6488  O O   . SER A  1 969  ? 156.326 172.136 196.032 1.00 106.98 ? 982  SER A O   1 
ATOM   6489  C CB  . SER A  1 969  ? 155.006 171.582 193.278 1.00 106.98 ? 982  SER A CB  1 
ATOM   6490  O OG  . SER A  1 969  ? 154.715 170.710 194.352 1.00 106.98 ? 982  SER A OG  1 
ATOM   6491  N N   . ARG A  1 970  ? 158.002 171.797 194.592 1.00 106.47 ? 983  ARG A N   1 
ATOM   6492  C CA  . ARG A  1 970  ? 158.843 171.273 195.650 1.00 106.47 ? 983  ARG A CA  1 
ATOM   6493  C C   . ARG A  1 970  ? 160.133 172.060 195.835 1.00 106.47 ? 983  ARG A C   1 
ATOM   6494  O O   . ARG A  1 970  ? 161.073 171.553 196.449 1.00 106.47 ? 983  ARG A O   1 
ATOM   6495  C CB  . ARG A  1 970  ? 159.135 169.797 195.403 1.00 106.47 ? 983  ARG A CB  1 
ATOM   6496  C CG  . ARG A  1 970  ? 159.828 169.495 194.112 1.00 106.47 ? 983  ARG A CG  1 
ATOM   6497  C CD  . ARG A  1 970  ? 159.849 167.993 193.886 1.00 106.47 ? 983  ARG A CD  1 
ATOM   6498  N NE  . ARG A  1 970  ? 160.859 167.598 192.910 1.00 106.47 ? 983  ARG A NE  1 
ATOM   6499  C CZ  . ARG A  1 970  ? 162.070 167.154 193.232 1.00 106.47 ? 983  ARG A CZ  1 
ATOM   6500  N NH1 . ARG A  1 970  ? 162.421 167.047 194.504 1.00 106.47 ? 983  ARG A NH1 1 
ATOM   6501  N NH2 . ARG A  1 970  ? 162.933 166.818 192.286 1.00 106.47 ? 983  ARG A NH2 1 
ATOM   6502  N N   . LEU A  1 971  ? 160.201 173.296 195.351 1.00 107.94 ? 984  LEU A N   1 
ATOM   6503  C CA  . LEU A  1 971  ? 161.344 174.141 195.673 1.00 107.94 ? 984  LEU A CA  1 
ATOM   6504  C C   . LEU A  1 971  ? 160.914 175.573 195.928 1.00 107.94 ? 984  LEU A C   1 
ATOM   6505  O O   . LEU A  1 971  ? 160.241 176.182 195.092 1.00 107.94 ? 984  LEU A O   1 
ATOM   6506  C CB  . LEU A  1 971  ? 162.394 174.141 194.569 1.00 107.94 ? 984  LEU A CB  1 
ATOM   6507  C CG  . LEU A  1 971  ? 163.369 172.977 194.527 1.00 107.94 ? 984  LEU A CG  1 
ATOM   6508  C CD1 . LEU A  1 971  ? 162.752 171.767 193.882 1.00 107.94 ? 984  LEU A CD1 1 
ATOM   6509  C CD2 . LEU A  1 971  ? 164.618 173.397 193.793 1.00 107.94 ? 984  LEU A CD2 1 
ATOM   6510  N N   . ASP A  1 972  ? 161.338 176.111 197.078 1.00 124.99 ? 985  ASP A N   1 
ATOM   6511  C CA  . ASP A  1 972  ? 161.172 177.525 197.371 1.00 124.99 ? 985  ASP A CA  1 
ATOM   6512  C C   . ASP A  1 972  ? 161.943 178.355 196.351 1.00 124.99 ? 985  ASP A C   1 
ATOM   6513  O O   . ASP A  1 972  ? 163.086 178.034 196.016 1.00 124.99 ? 985  ASP A O   1 
ATOM   6514  C CB  . ASP A  1 972  ? 161.683 177.861 198.776 1.00 124.99 ? 985  ASP A CB  1 
ATOM   6515  C CG  . ASP A  1 972  ? 161.070 176.997 199.847 1.00 124.99 ? 985  ASP A CG  1 
ATOM   6516  O OD1 . ASP A  1 972  ? 159.878 177.189 200.155 1.00 124.99 ? 985  ASP A OD1 1 
ATOM   6517  O OD2 . ASP A  1 972  ? 161.780 176.124 200.382 1.00 124.99 ? 985  ASP A OD2 1 
ATOM   6518  N N   . PRO A  1 973  ? 161.347 179.446 195.880 1.00 122.85 ? 986  PRO A N   1 
ATOM   6519  C CA  . PRO A  1 973  ? 162.043 180.354 194.969 1.00 122.85 ? 986  PRO A CA  1 
ATOM   6520  C C   . PRO A  1 973  ? 163.453 180.686 195.431 1.00 122.85 ? 986  PRO A C   1 
ATOM   6521  O O   . PRO A  1 973  ? 164.367 180.688 194.594 1.00 122.85 ? 986  PRO A O   1 
ATOM   6522  C CB  . PRO A  1 973  ? 161.141 181.594 194.962 1.00 122.85 ? 986  PRO A CB  1 
ATOM   6523  C CG  . PRO A  1 973  ? 159.790 181.033 195.163 1.00 122.85 ? 986  PRO A CG  1 
ATOM   6524  C CD  . PRO A  1 973  ? 159.943 179.841 196.074 1.00 122.85 ? 986  PRO A CD  1 
ATOM   6525  N N   . PRO A  1 974  ? 163.691 180.953 196.731 1.00 124.70 ? 987  PRO A N   1 
ATOM   6526  C CA  . PRO A  1 974  ? 165.069 181.263 197.158 1.00 124.70 ? 987  PRO A CA  1 
ATOM   6527  C C   . PRO A  1 974  ? 166.124 180.343 196.573 1.00 124.70 ? 987  PRO A C   1 
ATOM   6528  O O   . PRO A  1 974  ? 167.165 180.808 196.095 1.00 124.70 ? 987  PRO A O   1 
ATOM   6529  C CB  . PRO A  1 974  ? 164.983 181.121 198.678 1.00 124.70 ? 987  PRO A CB  1 
ATOM   6530  C CG  . PRO A  1 974  ? 163.627 181.538 198.995 1.00 124.70 ? 987  PRO A CG  1 
ATOM   6531  C CD  . PRO A  1 974  ? 162.757 181.097 197.867 1.00 124.70 ? 987  PRO A CD  1 
ATOM   6532  N N   . GLU A  1 975  ? 165.874 179.040 196.603 1.00 120.63 ? 988  GLU A N   1 
ATOM   6533  C CA  . GLU A  1 975  ? 166.753 178.057 195.994 1.00 120.63 ? 988  GLU A CA  1 
ATOM   6534  C C   . GLU A  1 975  ? 166.193 177.464 194.715 1.00 120.63 ? 988  GLU A C   1 
ATOM   6535  O O   . GLU A  1 975  ? 166.957 176.882 193.927 1.00 120.63 ? 988  GLU A O   1 
ATOM   6536  C CB  . GLU A  1 975  ? 167.046 176.941 196.998 1.00 120.63 ? 988  GLU A CB  1 
ATOM   6537  C CG  . GLU A  1 975  ? 165.809 176.231 197.507 1.00 120.63 ? 988  GLU A CG  1 
ATOM   6538  C CD  . GLU A  1 975  ? 165.201 176.926 198.715 1.00 120.63 ? 988  GLU A CD  1 
ATOM   6539  O OE1 . GLU A  1 975  ? 165.532 178.103 198.955 1.00 120.63 ? 988  GLU A OE1 1 
ATOM   6540  O OE2 . GLU A  1 975  ? 164.401 176.293 199.430 1.00 120.63 ? 988  GLU A OE2 1 
ATOM   6541  N N   . ALA A  1 976  ? 164.893 177.682 194.483 1.00 116.34 ? 989  ALA A N   1 
ATOM   6542  C CA  . ALA A  1 976  ? 164.245 177.237 193.228 1.00 116.34 ? 989  ALA A CA  1 
ATOM   6543  C C   . ALA A  1 976  ? 164.948 177.962 192.075 1.00 116.34 ? 989  ALA A C   1 
ATOM   6544  O O   . ALA A  1 976  ? 165.308 177.296 191.084 1.00 116.34 ? 989  ALA A O   1 
ATOM   6545  C CB  . ALA A  1 976  ? 162.771 177.554 193.268 1.00 116.34 ? 989  ALA A CB  1 
ATOM   6546  N N   . GLU A  1 977  ? 165.129 179.281 192.215 1.00 109.43 ? 990  GLU A N   1 
ATOM   6547  C CA  . GLU A  1 977  ? 165.844 180.070 191.224 1.00 109.43 ? 990  GLU A CA  1 
ATOM   6548  C C   . GLU A  1 977  ? 167.217 179.490 190.940 1.00 109.43 ? 990  GLU A C   1 
ATOM   6549  O O   . GLU A  1 977  ? 167.628 179.418 189.786 1.00 109.43 ? 990  GLU A O   1 
ATOM   6550  C CB  . GLU A  1 977  ? 165.944 181.518 191.674 1.00 109.43 ? 990  GLU A CB  1 
ATOM   6551  C CG  . GLU A  1 977  ? 164.614 182.233 191.630 1.00 109.43 ? 990  GLU A CG  1 
ATOM   6552  C CD  . GLU A  1 977  ? 164.735 183.628 191.081 1.00 109.43 ? 990  GLU A CD  1 
ATOM   6553  O OE1 . GLU A  1 977  ? 163.745 184.386 191.149 1.00 109.43 ? 990  GLU A OE1 1 
ATOM   6554  O OE2 . GLU A  1 977  ? 165.824 183.964 190.574 1.00 109.43 ? 990  GLU A OE2 1 
ATOM   6555  N N   . VAL A  1 978  ? 167.888 178.962 191.960 1.00 109.55 ? 991  VAL A N   1 
ATOM   6556  C CA  . VAL A  1 978  ? 169.183 178.322 191.742 1.00 109.55 ? 991  VAL A CA  1 
ATOM   6557  C C   . VAL A  1 978  ? 169.029 177.097 190.847 1.00 109.55 ? 991  VAL A C   1 
ATOM   6558  O O   . VAL A  1 978  ? 169.621 177.001 189.757 1.00 109.55 ? 991  VAL A O   1 
ATOM   6559  C CB  . VAL A  1 978  ? 169.810 177.934 193.089 1.00 109.55 ? 991  VAL A CB  1 
ATOM   6560  C CG1 . VAL A  1 978  ? 171.234 177.462 192.898 1.00 109.55 ? 991  VAL A CG1 1 
ATOM   6561  C CG2 . VAL A  1 978  ? 169.723 179.081 194.052 1.00 109.55 ? 991  VAL A CG2 1 
ATOM   6562  N N   . GLN A  1 979  ? 168.253 176.126 191.319 1.00 105.31 ? 992  GLN A N   1 
ATOM   6563  C CA  . GLN A  1 979  ? 168.121 174.883 190.570 1.00 105.31 ? 992  GLN A CA  1 
ATOM   6564  C C   . GLN A  1 979  ? 167.587 175.161 189.177 1.00 105.31 ? 992  GLN A C   1 
ATOM   6565  O O   . GLN A  1 979  ? 168.230 174.850 188.170 1.00 105.31 ? 992  GLN A O   1 
ATOM   6566  C CB  . GLN A  1 979  ? 167.208 173.917 191.311 1.00 105.31 ? 992  GLN A CB  1 
ATOM   6567  C CG  . GLN A  1 979  ? 167.911 173.094 192.355 1.00 105.31 ? 992  GLN A CG  1 
ATOM   6568  C CD  . GLN A  1 979  ? 168.596 171.882 191.774 1.00 105.31 ? 992  GLN A CD  1 
ATOM   6569  O OE1 . GLN A  1 979  ? 167.953 170.886 191.447 1.00 105.31 ? 992  GLN A OE1 1 
ATOM   6570  N NE2 . GLN A  1 979  ? 169.913 171.952 191.655 1.00 105.31 ? 992  GLN A NE2 1 
ATOM   6571  N N   . ILE A  1 980  ? 166.426 175.801 189.111 1.00 97.67  ? 993  ILE A N   1 
ATOM   6572  C CA  . ILE A  1 980  ? 165.825 176.159 187.847 1.00 97.67  ? 993  ILE A CA  1 
ATOM   6573  C C   . ILE A  1 980  ? 166.765 176.984 187.004 1.00 97.67  ? 993  ILE A C   1 
ATOM   6574  O O   . ILE A  1 980  ? 166.640 176.986 185.788 1.00 97.67  ? 993  ILE A O   1 
ATOM   6575  C CB  . ILE A  1 980  ? 164.511 176.903 188.097 1.00 97.67  ? 993  ILE A CB  1 
ATOM   6576  C CG1 . ILE A  1 980  ? 164.792 178.345 188.453 1.00 97.67  ? 993  ILE A CG1 1 
ATOM   6577  C CG2 . ILE A  1 980  ? 163.786 176.283 189.246 1.00 97.67  ? 993  ILE A CG2 1 
ATOM   6578  C CD1 . ILE A  1 980  ? 163.552 179.136 188.676 1.00 97.67  ? 993  ILE A CD1 1 
ATOM   6579  N N   . ASP A  1 981  ? 167.730 177.668 187.613 1.00 102.07 ? 994  ASP A N   1 
ATOM   6580  C CA  . ASP A  1 981  ? 168.696 178.408 186.823 1.00 102.07 ? 994  ASP A CA  1 
ATOM   6581  C C   . ASP A  1 981  ? 169.583 177.452 186.066 1.00 102.07 ? 994  ASP A C   1 
ATOM   6582  O O   . ASP A  1 981  ? 169.779 177.588 184.854 1.00 102.07 ? 994  ASP A O   1 
ATOM   6583  C CB  . ASP A  1 981  ? 169.525 179.316 187.724 1.00 102.07 ? 994  ASP A CB  1 
ATOM   6584  C CG  . ASP A  1 981  ? 170.616 180.039 186.972 1.00 102.07 ? 994  ASP A CG  1 
ATOM   6585  O OD1 . ASP A  1 981  ? 170.354 181.134 186.443 1.00 102.07 ? 994  ASP A OD1 1 
ATOM   6586  O OD2 . ASP A  1 981  ? 171.741 179.511 186.902 1.00 102.07 ? 994  ASP A OD2 1 
ATOM   6587  N N   . ARG A  1 982  ? 170.139 176.480 186.774 1.00 101.71 ? 995  ARG A N   1 
ATOM   6588  C CA  . ARG A  1 982  ? 170.838 175.420 186.061 1.00 101.71 ? 995  ARG A CA  1 
ATOM   6589  C C   . ARG A  1 982  ? 169.943 174.872 184.961 1.00 101.71 ? 995  ARG A C   1 
ATOM   6590  O O   . ARG A  1 982  ? 170.357 174.714 183.799 1.00 101.71 ? 995  ARG A O   1 
ATOM   6591  C CB  . ARG A  1 982  ? 171.242 174.315 187.026 1.00 101.71 ? 995  ARG A CB  1 
ATOM   6592  C CG  . ARG A  1 982  ? 172.344 174.705 187.970 1.00 101.71 ? 995  ARG A CG  1 
ATOM   6593  C CD  . ARG A  1 982  ? 172.543 173.632 189.016 1.00 101.71 ? 995  ARG A CD  1 
ATOM   6594  N NE  . ARG A  1 982  ? 173.859 173.705 189.635 1.00 101.71 ? 995  ARG A NE  1 
ATOM   6595  C CZ  . ARG A  1 982  ? 174.277 172.885 190.590 1.00 101.71 ? 995  ARG A CZ  1 
ATOM   6596  N NH1 . ARG A  1 982  ? 173.480 171.926 191.041 1.00 101.71 ? 995  ARG A NH1 1 
ATOM   6597  N NH2 . ARG A  1 982  ? 175.494 173.024 191.087 1.00 101.71 ? 995  ARG A NH2 1 
ATOM   6598  N N   . LEU A  1 983  ? 168.689 174.624 185.318 1.00 93.95  ? 996  LEU A N   1 
ATOM   6599  C CA  . LEU A  1 983  ? 167.763 173.999 184.395 1.00 93.95  ? 996  LEU A CA  1 
ATOM   6600  C C   . LEU A  1 983  ? 167.632 174.823 183.136 1.00 93.95  ? 996  LEU A C   1 
ATOM   6601  O O   . LEU A  1 983  ? 167.704 174.306 182.014 1.00 93.95  ? 996  LEU A O   1 
ATOM   6602  C CB  . LEU A  1 983  ? 166.407 173.839 185.051 1.00 93.95  ? 996  LEU A CB  1 
ATOM   6603  C CG  . LEU A  1 983  ? 165.599 172.949 184.137 1.00 93.95  ? 996  LEU A CG  1 
ATOM   6604  C CD1 . LEU A  1 983  ? 166.227 171.604 184.154 1.00 93.95  ? 996  LEU A CD1 1 
ATOM   6605  C CD2 . LEU A  1 983  ? 164.195 172.857 184.601 1.00 93.95  ? 996  LEU A CD2 1 
ATOM   6606  N N   . ILE A  1 984  ? 167.441 176.119 183.308 1.00 91.48  ? 997  ILE A N   1 
ATOM   6607  C CA  . ILE A  1 984  ? 167.129 176.946 182.171 1.00 91.48  ? 997  ILE A CA  1 
ATOM   6608  C C   . ILE A  1 984  ? 168.364 177.139 181.339 1.00 91.48  ? 997  ILE A C   1 
ATOM   6609  O O   . ILE A  1 984  ? 168.279 177.233 180.114 1.00 91.48  ? 997  ILE A O   1 
ATOM   6610  C CB  . ILE A  1 984  ? 166.525 178.269 182.642 1.00 91.48  ? 997  ILE A CB  1 
ATOM   6611  C CG1 . ILE A  1 984  ? 167.423 178.891 183.683 1.00 91.48  ? 997  ILE A CG1 1 
ATOM   6612  C CG2 . ILE A  1 984  ? 165.180 178.022 183.254 1.00 91.48  ? 997  ILE A CG2 1 
ATOM   6613  C CD1 . ILE A  1 984  ? 166.804 180.043 184.384 1.00 91.48  ? 997  ILE A CD1 1 
ATOM   6614  N N   . THR A  1 985  ? 169.533 177.178 181.969 1.00 95.39  ? 998  THR A N   1 
ATOM   6615  C CA  . THR A  1 985  ? 170.752 177.192 181.180 1.00 95.39  ? 998  THR A CA  1 
ATOM   6616  C C   . THR A  1 985  ? 170.753 176.028 180.224 1.00 95.39  ? 998  THR A C   1 
ATOM   6617  O O   . THR A  1 985  ? 170.925 176.194 179.012 1.00 95.39  ? 998  THR A O   1 
ATOM   6618  C CB  . THR A  1 985  ? 171.975 177.097 182.068 1.00 95.39  ? 998  THR A CB  1 
ATOM   6619  O OG1 . THR A  1 985  ? 171.720 176.135 183.093 1.00 95.39  ? 998  THR A OG1 1 
ATOM   6620  C CG2 . THR A  1 985  ? 172.307 178.439 182.659 1.00 95.39  ? 998  THR A CG2 1 
ATOM   6621  N N   . GLY A  1 986  ? 170.578 174.829 180.771 1.00 94.81  ? 999  GLY A N   1 
ATOM   6622  C CA  . GLY A  1 986  ? 170.664 173.651 179.927 1.00 94.81  ? 999  GLY A CA  1 
ATOM   6623  C C   . GLY A  1 986  ? 169.663 173.698 178.791 1.00 94.81  ? 999  GLY A C   1 
ATOM   6624  O O   . GLY A  1 986  ? 170.021 173.593 177.608 1.00 94.81  ? 999  GLY A O   1 
ATOM   6625  N N   . ARG A  1 987  ? 168.396 173.922 179.156 1.00 88.79  ? 1000 ARG A N   1 
ATOM   6626  C CA  . ARG A  1 987  ? 167.260 173.957 178.193 1.00 88.79  ? 1000 ARG A CA  1 
ATOM   6627  C C   . ARG A  1 987  ? 167.418 175.081 177.159 1.00 88.79  ? 1000 ARG A C   1 
ATOM   6628  O O   . ARG A  1 987  ? 166.857 174.930 176.055 1.00 88.79  ? 1000 ARG A O   1 
ATOM   6629  C CB  . ARG A  1 987  ? 165.923 174.066 178.933 1.00 88.79  ? 1000 ARG A CB  1 
ATOM   6630  C CG  . ARG A  1 987  ? 165.691 172.971 179.964 1.00 88.79  ? 1000 ARG A CG  1 
ATOM   6631  C CD  . ARG A  1 987  ? 164.339 173.088 180.641 1.00 88.79  ? 1000 ARG A CD  1 
ATOM   6632  N NE  . ARG A  1 987  ? 163.235 172.911 179.708 1.00 88.79  ? 1000 ARG A NE  1 
ATOM   6633  C CZ  . ARG A  1 987  ? 162.665 171.744 179.431 1.00 88.79  ? 1000 ARG A CZ  1 
ATOM   6634  N NH1 . ARG A  1 987  ? 161.666 171.684 178.567 1.00 88.79  ? 1000 ARG A NH1 1 
ATOM   6635  N NH2 . ARG A  1 987  ? 163.096 170.642 180.017 1.00 88.79  ? 1000 ARG A NH2 1 
ATOM   6636  N N   . LEU A  1 988  ? 168.103 176.178 177.501 1.00 96.10  ? 1001 LEU A N   1 
ATOM   6637  C CA  . LEU A  1 988  ? 168.260 177.253 176.550 1.00 96.10  ? 1001 LEU A CA  1 
ATOM   6638  C C   . LEU A  1 988  ? 169.426 176.985 175.634 1.00 96.10  ? 1001 LEU A C   1 
ATOM   6639  O O   . LEU A  1 988  ? 169.339 177.238 174.428 1.00 96.10  ? 1001 LEU A O   1 
ATOM   6640  C CB  . LEU A  1 988  ? 168.436 178.566 177.297 1.00 96.10  ? 1001 LEU A CB  1 
ATOM   6641  C CG  . LEU A  1 988  ? 168.417 179.838 176.460 1.00 96.10  ? 1001 LEU A CG  1 
ATOM   6642  C CD1 . LEU A  1 988  ? 168.038 181.009 177.324 1.00 96.10  ? 1001 LEU A CD1 1 
ATOM   6643  C CD2 . LEU A  1 988  ? 169.758 180.105 175.845 1.00 96.10  ? 1001 LEU A CD2 1 
ATOM   6644  N N   . GLN A  1 989  ? 170.516 176.459 176.167 1.00 94.06  ? 1002 GLN A N   1 
ATOM   6645  C CA  . GLN A  1 989  ? 171.643 176.233 175.284 1.00 94.06  ? 1002 GLN A CA  1 
ATOM   6646  C C   . GLN A  1 989  ? 171.297 175.159 174.276 1.00 94.06  ? 1002 GLN A C   1 
ATOM   6647  O O   . GLN A  1 989  ? 171.697 175.240 173.107 1.00 94.06  ? 1002 GLN A O   1 
ATOM   6648  C CB  . GLN A  1 989  ? 172.894 175.862 176.068 1.00 94.06  ? 1002 GLN A CB  1 
ATOM   6649  C CG  . GLN A  1 989  ? 172.978 174.436 176.489 1.00 94.06  ? 1002 GLN A CG  1 
ATOM   6650  C CD  . GLN A  1 989  ? 174.337 174.106 177.015 1.00 94.06  ? 1002 GLN A CD  1 
ATOM   6651  O OE1 . GLN A  1 989  ? 175.203 174.969 177.098 1.00 94.06  ? 1002 GLN A OE1 1 
ATOM   6652  N NE2 . GLN A  1 989  ? 174.549 172.849 177.353 1.00 94.06  ? 1002 GLN A NE2 1 
ATOM   6653  N N   . SER A  1 990  ? 170.535 174.155 174.702 1.00 83.66  ? 1003 SER A N   1 
ATOM   6654  C CA  . SER A  1 990  ? 170.092 173.156 173.747 1.00 83.66  ? 1003 SER A CA  1 
ATOM   6655  C C   . SER A  1 990  ? 169.316 173.817 172.630 1.00 83.66  ? 1003 SER A C   1 
ATOM   6656  O O   . SER A  1 990  ? 169.527 173.531 171.445 1.00 83.66  ? 1003 SER A O   1 
ATOM   6657  C CB  . SER A  1 990  ? 169.235 172.125 174.458 1.00 83.66  ? 1003 SER A CB  1 
ATOM   6658  O OG  . SER A  1 990  ? 168.266 172.799 175.229 1.00 83.66  ? 1003 SER A OG  1 
ATOM   6659  N N   . LEU A  1 991  ? 168.431 174.724 173.001 1.00 77.77  ? 1004 LEU A N   1 
ATOM   6660  C CA  . LEU A  1 991  ? 167.709 175.475 171.997 1.00 77.77  ? 1004 LEU A CA  1 
ATOM   6661  C C   . LEU A  1 991  ? 168.674 176.107 171.032 1.00 77.77  ? 1004 LEU A C   1 
ATOM   6662  O O   . LEU A  1 991  ? 168.489 176.050 169.814 1.00 77.77  ? 1004 LEU A O   1 
ATOM   6663  C CB  . LEU A  1 991  ? 166.860 176.537 172.667 1.00 77.77  ? 1004 LEU A CB  1 
ATOM   6664  C CG  . LEU A  1 991  ? 165.462 176.021 172.907 1.00 77.77  ? 1004 LEU A CG  1 
ATOM   6665  C CD1 . LEU A  1 991  ? 164.813 175.941 171.569 1.00 77.77  ? 1004 LEU A CD1 1 
ATOM   6666  C CD2 . LEU A  1 991  ? 165.511 174.647 173.519 1.00 77.77  ? 1004 LEU A CD2 1 
ATOM   6667  N N   . GLN A  1 992  ? 169.715 176.720 171.574 1.00 77.35  ? 1005 GLN A N   1 
ATOM   6668  C CA  . GLN A  1 992  ? 170.672 177.404 170.725 1.00 77.35  ? 1005 GLN A CA  1 
ATOM   6669  C C   . GLN A  1 992  ? 171.236 176.451 169.700 1.00 77.35  ? 1005 GLN A C   1 
ATOM   6670  O O   . GLN A  1 992  ? 171.259 176.742 168.498 1.00 77.35  ? 1005 GLN A O   1 
ATOM   6671  C CB  . GLN A  1 992  ? 171.794 177.983 171.569 1.00 77.35  ? 1005 GLN A CB  1 
ATOM   6672  C CG  . GLN A  1 992  ? 171.308 178.903 172.631 1.00 77.35  ? 1005 GLN A CG  1 
ATOM   6673  C CD  . GLN A  1 992  ? 171.499 180.329 172.224 1.00 77.35  ? 1005 GLN A CD  1 
ATOM   6674  O OE1 . GLN A  1 992  ? 172.396 180.635 171.447 1.00 77.35  ? 1005 GLN A OE1 1 
ATOM   6675  N NE2 . GLN A  1 992  ? 170.658 181.217 172.737 1.00 77.35  ? 1005 GLN A NE2 1 
ATOM   6676  N N   . THR A  1 993  ? 171.695 175.305 170.173 1.00 70.98  ? 1006 THR A N   1 
ATOM   6677  C CA  . THR A  1 993  ? 172.182 174.279 169.274 1.00 70.98  ? 1006 THR A CA  1 
ATOM   6678  C C   . THR A  1 993  ? 171.187 174.030 168.169 1.00 70.98  ? 1006 THR A C   1 
ATOM   6679  O O   . THR A  1 993  ? 171.525 174.044 166.979 1.00 70.98  ? 1006 THR A O   1 
ATOM   6680  C CB  . THR A  1 993  ? 172.390 173.003 170.053 1.00 70.98  ? 1006 THR A CB  1 
ATOM   6681  O OG1 . THR A  1 993  ? 171.104 172.541 170.473 1.00 70.98  ? 1006 THR A OG1 1 
ATOM   6682  C CG2 . THR A  1 993  ? 173.237 173.279 171.257 1.00 70.98  ? 1006 THR A CG2 1 
ATOM   6683  N N   . TYR A  1 994  ? 169.949 173.787 168.560 1.00 68.48  ? 1007 TYR A N   1 
ATOM   6684  C CA  . TYR A  1 994  ? 168.964 173.351 167.593 1.00 68.48  ? 1007 TYR A CA  1 
ATOM   6685  C C   . TYR A  1 994  ? 168.777 174.397 166.518 1.00 68.48  ? 1007 TYR A C   1 
ATOM   6686  O O   . TYR A  1 994  ? 168.749 174.092 165.322 1.00 68.48  ? 1007 TYR A O   1 
ATOM   6687  C CB  . TYR A  1 994  ? 167.657 173.072 168.297 1.00 68.48  ? 1007 TYR A CB  1 
ATOM   6688  C CG  . TYR A  1 994  ? 166.503 173.098 167.370 1.00 68.48  ? 1007 TYR A CG  1 
ATOM   6689  C CD1 . TYR A  1 994  ? 166.215 172.015 166.593 1.00 68.48  ? 1007 TYR A CD1 1 
ATOM   6690  C CD2 . TYR A  1 994  ? 165.699 174.200 167.279 1.00 68.48  ? 1007 TYR A CD2 1 
ATOM   6691  C CE1 . TYR A  1 994  ? 165.168 172.027 165.754 1.00 68.48  ? 1007 TYR A CE1 1 
ATOM   6692  C CE2 . TYR A  1 994  ? 164.649 174.219 166.446 1.00 68.48  ? 1007 TYR A CE2 1 
ATOM   6693  C CZ  . TYR A  1 994  ? 164.384 173.132 165.684 1.00 68.48  ? 1007 TYR A CZ  1 
ATOM   6694  O OH  . TYR A  1 994  ? 163.314 173.151 164.838 1.00 68.48  ? 1007 TYR A OH  1 
ATOM   6695  N N   . VAL A  1 995  ? 168.653 175.647 166.935 1.00 63.71  ? 1008 VAL A N   1 
ATOM   6696  C CA  . VAL A  1 995  ? 168.402 176.683 165.957 1.00 63.71  ? 1008 VAL A CA  1 
ATOM   6697  C C   . VAL A  1 995  ? 169.603 176.844 165.070 1.00 63.71  ? 1008 VAL A C   1 
ATOM   6698  O O   . VAL A  1 995  ? 169.470 177.098 163.873 1.00 63.71  ? 1008 VAL A O   1 
ATOM   6699  C CB  . VAL A  1 995  ? 168.036 177.992 166.658 1.00 63.71  ? 1008 VAL A CB  1 
ATOM   6700  C CG1 . VAL A  1 995  ? 167.033 177.693 167.730 1.00 63.71  ? 1008 VAL A CG1 1 
ATOM   6701  C CG2 . VAL A  1 995  ? 169.265 178.664 167.223 1.00 63.71  ? 1008 VAL A CG2 1 
ATOM   6702  N N   . THR A  1 996  ? 170.791 176.645 165.614 1.00 66.29  ? 1009 THR A N   1 
ATOM   6703  C CA  . THR A  1 996  ? 171.966 176.791 164.785 1.00 66.29  ? 1009 THR A CA  1 
ATOM   6704  C C   . THR A  1 996  ? 171.965 175.753 163.682 1.00 66.29  ? 1009 THR A C   1 
ATOM   6705  O O   . THR A  1 996  ? 171.970 176.091 162.496 1.00 66.29  ? 1009 THR A O   1 
ATOM   6706  C CB  . THR A  1 996  ? 173.204 176.660 165.644 1.00 66.29  ? 1009 THR A CB  1 
ATOM   6707  O OG1 . THR A  1 996  ? 173.020 175.558 166.530 1.00 66.29  ? 1009 THR A OG1 1 
ATOM   6708  C CG2 . THR A  1 996  ? 173.378 177.907 166.453 1.00 66.29  ? 1009 THR A CG2 1 
ATOM   6709  N N   . GLN A  1 997  ? 171.912 174.481 164.056 1.00 74.16  ? 1010 GLN A N   1 
ATOM   6710  C CA  . GLN A  1 997  ? 172.008 173.449 163.034 1.00 74.16  ? 1010 GLN A CA  1 
ATOM   6711  C C   . GLN A  1 997  ? 170.860 173.560 162.053 1.00 74.16  ? 1010 GLN A C   1 
ATOM   6712  O O   . GLN A  1 997  ? 171.026 173.306 160.853 1.00 74.16  ? 1010 GLN A O   1 
ATOM   6713  C CB  . GLN A  1 997  ? 172.037 172.063 163.662 1.00 74.16  ? 1010 GLN A CB  1 
ATOM   6714  C CG  . GLN A  1 997  ? 173.303 171.767 164.429 1.00 74.16  ? 1010 GLN A CG  1 
ATOM   6715  C CD  . GLN A  1 997  ? 173.197 172.136 165.882 1.00 74.16  ? 1010 GLN A CD  1 
ATOM   6716  O OE1 . GLN A  1 997  ? 172.727 171.350 166.702 1.00 74.16  ? 1010 GLN A OE1 1 
ATOM   6717  N NE2 . GLN A  1 997  ? 173.585 173.358 166.211 1.00 74.16  ? 1010 GLN A NE2 1 
ATOM   6718  N N   . GLN A  1 998  ? 169.684 173.935 162.544 1.00 69.60  ? 1011 GLN A N   1 
ATOM   6719  C CA  . GLN A  1 998  ? 168.581 174.181 161.637 1.00 69.60  ? 1011 GLN A CA  1 
ATOM   6720  C C   . GLN A  1 998  ? 168.948 175.273 160.650 1.00 69.60  ? 1011 GLN A C   1 
ATOM   6721  O O   . GLN A  1 998  ? 168.709 175.142 159.449 1.00 69.60  ? 1011 GLN A O   1 
ATOM   6722  C CB  . GLN A  1 998  ? 167.338 174.550 162.436 1.00 69.60  ? 1011 GLN A CB  1 
ATOM   6723  C CG  . GLN A  1 998  ? 166.198 175.059 161.597 1.00 69.60  ? 1011 GLN A CG  1 
ATOM   6724  C CD  . GLN A  1 998  ? 165.569 173.988 160.757 1.00 69.60  ? 1011 GLN A CD  1 
ATOM   6725  O OE1 . GLN A  1 998  ? 164.699 173.261 161.213 1.00 69.60  ? 1011 GLN A OE1 1 
ATOM   6726  N NE2 . GLN A  1 998  ? 166.005 173.887 159.517 1.00 69.60  ? 1011 GLN A NE2 1 
ATOM   6727  N N   . LEU A  1 999  ? 169.582 176.334 161.131 1.00 65.83  ? 1012 LEU A N   1 
ATOM   6728  C CA  . LEU A  1 999  ? 170.003 177.383 160.225 1.00 65.83  ? 1012 LEU A CA  1 
ATOM   6729  C C   . LEU A  1 999  ? 171.023 176.882 159.238 1.00 65.83  ? 1012 LEU A C   1 
ATOM   6730  O O   . LEU A  1 999  ? 171.121 177.392 158.127 1.00 65.83  ? 1012 LEU A O   1 
ATOM   6731  C CB  . LEU A  1 999  ? 170.574 178.544 161.009 1.00 65.83  ? 1012 LEU A CB  1 
ATOM   6732  C CG  . LEU A  1 999  ? 169.596 179.687 160.910 1.00 65.83  ? 1012 LEU A CG  1 
ATOM   6733  C CD1 . LEU A  1 999  ? 170.140 180.892 161.602 1.00 65.83  ? 1012 LEU A CD1 1 
ATOM   6734  C CD2 . LEU A  1 999  ? 169.391 179.970 159.450 1.00 65.83  ? 1012 LEU A CD2 1 
ATOM   6735  N N   . ILE A  1 1000 ? 171.808 175.902 159.629 1.00 66.63  ? 1013 ILE A N   1 
ATOM   6736  C CA  . ILE A  1 1000 ? 172.814 175.409 158.708 1.00 66.63  ? 1013 ILE A CA  1 
ATOM   6737  C C   . ILE A  1 1000 ? 172.152 174.637 157.586 1.00 66.63  ? 1013 ILE A C   1 
ATOM   6738  O O   . ILE A  1 1000 ? 172.472 174.816 156.404 1.00 66.63  ? 1013 ILE A O   1 
ATOM   6739  C CB  . ILE A  1 1000 ? 173.843 174.557 159.452 1.00 66.63  ? 1013 ILE A CB  1 
ATOM   6740  C CG1 . ILE A  1 1000 ? 174.205 175.242 160.742 1.00 66.63  ? 1013 ILE A CG1 1 
ATOM   6741  C CG2 . ILE A  1 1000 ? 175.079 174.451 158.633 1.00 66.63  ? 1013 ILE A CG2 1 
ATOM   6742  C CD1 . ILE A  1 1000 ? 174.691 176.627 160.513 1.00 66.63  ? 1013 ILE A CD1 1 
ATOM   6743  N N   . ARG A  1 1001 ? 171.246 173.734 157.949 1.00 74.36  ? 1014 ARG A N   1 
ATOM   6744  C CA  . ARG A  1 1001 ? 170.443 173.094 156.925 1.00 74.36  ? 1014 ARG A CA  1 
ATOM   6745  C C   . ARG A  1 1001 ? 169.749 174.141 156.105 1.00 74.36  ? 1014 ARG A C   1 
ATOM   6746  O O   . ARG A  1 1001 ? 169.531 173.954 154.914 1.00 74.36  ? 1014 ARG A O   1 
ATOM   6747  C CB  . ARG A  1 1001 ? 169.425 172.146 157.535 1.00 74.36  ? 1014 ARG A CB  1 
ATOM   6748  C CG  . ARG A  1 1001 ? 170.030 170.855 157.992 1.00 74.36  ? 1014 ARG A CG  1 
ATOM   6749  C CD  . ARG A  1 1001 ? 169.270 170.286 159.165 1.00 74.36  ? 1014 ARG A CD  1 
ATOM   6750  N NE  . ARG A  1 1001 ? 170.166 169.672 160.142 1.00 74.36  ? 1014 ARG A NE  1 
ATOM   6751  C CZ  . ARG A  1 1001 ? 170.256 170.035 161.416 1.00 74.36  ? 1014 ARG A CZ  1 
ATOM   6752  N NH1 . ARG A  1 1001 ? 169.493 171.003 161.892 1.00 74.36  ? 1014 ARG A NH1 1 
ATOM   6753  N NH2 . ARG A  1 1001 ? 171.099 169.409 162.214 1.00 74.36  ? 1014 ARG A NH2 1 
ATOM   6754  N N   . ALA A  1 1002 ? 169.434 175.267 156.721 1.00 70.99  ? 1015 ALA A N   1 
ATOM   6755  C CA  . ALA A  1 1002 ? 168.874 176.364 155.963 1.00 70.99  ? 1015 ALA A CA  1 
ATOM   6756  C C   . ALA A  1 1002 ? 169.872 176.852 154.937 1.00 70.99  ? 1015 ALA A C   1 
ATOM   6757  O O   . ALA A  1 1002 ? 169.529 177.083 153.780 1.00 70.99  ? 1015 ALA A O   1 
ATOM   6758  C CB  . ALA A  1 1002 ? 168.466 177.491 156.904 1.00 70.99  ? 1015 ALA A CB  1 
ATOM   6759  N N   . ALA A  1 1003 ? 171.118 177.014 155.348 1.00 72.12  ? 1016 ALA A N   1 
ATOM   6760  C CA  . ALA A  1 1003 ? 172.111 177.546 154.431 1.00 72.12  ? 1016 ALA A CA  1 
ATOM   6761  C C   . ALA A  1 1003 ? 172.258 176.632 153.236 1.00 72.12  ? 1016 ALA A C   1 
ATOM   6762  O O   . ALA A  1 1003 ? 172.116 177.051 152.080 1.00 72.12  ? 1016 ALA A O   1 
ATOM   6763  C CB  . ALA A  1 1003 ? 173.449 177.700 155.143 1.00 72.12  ? 1016 ALA A CB  1 
ATOM   6764  N N   . GLU A  1 1004 ? 172.508 175.362 153.510 1.00 78.66  ? 1017 GLU A N   1 
ATOM   6765  C CA  . GLU A  1 1004 ? 172.701 174.405 152.433 1.00 78.66  ? 1017 GLU A CA  1 
ATOM   6766  C C   . GLU A  1 1004 ? 171.430 174.252 151.614 1.00 78.66  ? 1017 GLU A C   1 
ATOM   6767  O O   . GLU A  1 1004 ? 171.479 174.059 150.393 1.00 78.66  ? 1017 GLU A O   1 
ATOM   6768  C CB  . GLU A  1 1004 ? 173.149 173.067 153.011 1.00 78.66  ? 1017 GLU A CB  1 
ATOM   6769  C CG  . GLU A  1 1004 ? 172.192 172.511 154.032 1.00 78.66  ? 1017 GLU A CG  1 
ATOM   6770  C CD  . GLU A  1 1004 ? 172.847 171.552 154.989 1.00 78.66  ? 1017 GLU A CD  1 
ATOM   6771  O OE1 . GLU A  1 1004 ? 174.088 171.567 155.095 1.00 78.66  ? 1017 GLU A OE1 1 
ATOM   6772  O OE2 . GLU A  1 1004 ? 172.117 170.778 155.637 1.00 78.66  ? 1017 GLU A OE2 1 
ATOM   6773  N N   . ILE A  1 1005 ? 170.276 174.358 152.261 1.00 76.54  ? 1018 ILE A N   1 
ATOM   6774  C CA  . ILE A  1 1005 ? 169.075 174.148 151.504 1.00 76.54  ? 1018 ILE A CA  1 
ATOM   6775  C C   . ILE A  1 1005 ? 168.831 175.333 150.624 1.00 76.54  ? 1018 ILE A C   1 
ATOM   6776  O O   . ILE A  1 1005 ? 168.322 175.184 149.527 1.00 76.54  ? 1018 ILE A O   1 
ATOM   6777  C CB  . ILE A  1 1005 ? 167.883 173.861 152.410 1.00 76.54  ? 1018 ILE A CB  1 
ATOM   6778  C CG1 . ILE A  1 1005 ? 166.845 173.124 151.588 1.00 76.54  ? 1018 ILE A CG1 1 
ATOM   6779  C CG2 . ILE A  1 1005 ? 167.304 175.124 152.922 1.00 76.54  ? 1018 ILE A CG2 1 
ATOM   6780  C CD1 . ILE A  1 1005 ? 165.708 172.613 152.383 1.00 76.54  ? 1018 ILE A CD1 1 
ATOM   6781  N N   . ARG A  1 1006 ? 169.239 176.515 151.051 1.00 77.21  ? 1019 ARG A N   1 
ATOM   6782  C CA  . ARG A  1 1006 ? 169.149 177.674 150.182 1.00 77.21  ? 1019 ARG A CA  1 
ATOM   6783  C C   . ARG A  1 1006 ? 170.065 177.501 148.995 1.00 77.21  ? 1019 ARG A C   1 
ATOM   6784  O O   . ARG A  1 1006 ? 169.722 177.854 147.856 1.00 77.21  ? 1019 ARG A O   1 
ATOM   6785  C CB  . ARG A  1 1006 ? 169.537 178.927 150.950 1.00 77.21  ? 1019 ARG A CB  1 
ATOM   6786  C CG  . ARG A  1 1006 ? 168.591 179.303 152.038 1.00 77.21  ? 1019 ARG A CG  1 
ATOM   6787  C CD  . ARG A  1 1006 ? 168.654 180.773 152.397 1.00 77.21  ? 1019 ARG A CD  1 
ATOM   6788  N NE  . ARG A  1 1006 ? 168.472 181.645 151.246 1.00 77.21  ? 1019 ARG A NE  1 
ATOM   6789  C CZ  . ARG A  1 1006 ? 169.455 182.078 150.472 1.00 77.21  ? 1019 ARG A CZ  1 
ATOM   6790  N NH1 . ARG A  1 1006 ? 170.705 181.741 150.737 1.00 77.21  ? 1019 ARG A NH1 1 
ATOM   6791  N NH2 . ARG A  1 1006 ? 169.184 182.861 149.445 1.00 77.21  ? 1019 ARG A NH2 1 
ATOM   6792  N N   . ALA A  1 1007 ? 171.272 177.021 149.268 1.00 79.51  ? 1020 ALA A N   1 
ATOM   6793  C CA  . ALA A  1 1007 ? 172.184 176.721 148.185 1.00 79.51  ? 1020 ALA A CA  1 
ATOM   6794  C C   . ALA A  1 1007 ? 171.470 175.866 147.164 1.00 79.51  ? 1020 ALA A C   1 
ATOM   6795  O O   . ALA A  1 1007 ? 171.267 176.270 146.013 1.00 79.51  ? 1020 ALA A O   1 
ATOM   6796  C CB  . ALA A  1 1007 ? 173.419 176.007 148.727 1.00 79.51  ? 1020 ALA A CB  1 
ATOM   6797  N N   . SER A  1 1008 ? 171.000 174.714 147.613 1.00 76.20  ? 1021 SER A N   1 
ATOM   6798  C CA  . SER A  1 1008 ? 170.235 173.839 146.751 1.00 76.20  ? 1021 SER A CA  1 
ATOM   6799  C C   . SER A  1 1008 ? 169.045 174.558 146.162 1.00 76.20  ? 1021 SER A C   1 
ATOM   6800  O O   . SER A  1 1008 ? 168.608 174.243 145.056 1.00 76.20  ? 1021 SER A O   1 
ATOM   6801  C CB  . SER A  1 1008 ? 169.778 172.649 147.565 1.00 76.20  ? 1021 SER A CB  1 
ATOM   6802  O OG  . SER A  1 1008 ? 169.345 173.119 148.818 1.00 76.20  ? 1021 SER A OG  1 
ATOM   6803  N N   . ALA A  1 1009 ? 168.507 175.521 146.888 1.00 73.22  ? 1022 ALA A N   1 
ATOM   6804  C CA  . ALA A  1 1009 ? 167.309 176.177 146.426 1.00 73.22  ? 1022 ALA A CA  1 
ATOM   6805  C C   . ALA A  1 1009 ? 167.587 176.837 145.109 1.00 73.22  ? 1022 ALA A C   1 
ATOM   6806  O O   . ALA A  1 1009 ? 167.031 176.458 144.080 1.00 73.22  ? 1022 ALA A O   1 
ATOM   6807  C CB  . ALA A  1 1009 ? 166.842 177.205 147.448 1.00 73.22  ? 1022 ALA A CB  1 
ATOM   6808  N N   . ASN A  1 1010 ? 168.512 177.780 145.118 1.00 73.31  ? 1023 ASN A N   1 
ATOM   6809  C CA  . ASN A  1 1010 ? 168.817 178.437 143.861 1.00 73.31  ? 1023 ASN A CA  1 
ATOM   6810  C C   . ASN A  1 1010 ? 169.430 177.467 142.881 1.00 73.31  ? 1023 ASN A C   1 
ATOM   6811  O O   . ASN A  1 1010 ? 169.296 177.650 141.671 1.00 73.31  ? 1023 ASN A O   1 
ATOM   6812  C CB  . ASN A  1 1010 ? 169.740 179.625 144.034 1.00 73.31  ? 1023 ASN A CB  1 
ATOM   6813  C CG  . ASN A  1 1010 ? 170.092 180.245 142.704 1.00 73.31  ? 1023 ASN A CG  1 
ATOM   6814  O OD1 . ASN A  1 1010 ? 171.112 179.913 142.108 1.00 73.31  ? 1023 ASN A OD1 1 
ATOM   6815  N ND2 . ASN A  1 1010 ? 169.216 181.104 142.201 1.00 73.31  ? 1023 ASN A ND2 1 
ATOM   6816  N N   . LEU A  1 1011 ? 170.110 176.439 143.375 1.00 76.18  ? 1024 LEU A N   1 
ATOM   6817  C CA  . LEU A  1 1011 ? 170.577 175.399 142.481 1.00 76.18  ? 1024 LEU A CA  1 
ATOM   6818  C C   . LEU A  1 1011 ? 169.426 174.943 141.607 1.00 76.18  ? 1024 LEU A C   1 
ATOM   6819  O O   . LEU A  1 1011 ? 169.391 175.187 140.396 1.00 76.18  ? 1024 LEU A O   1 
ATOM   6820  C CB  . LEU A  1 1011 ? 171.125 174.235 143.297 1.00 76.18  ? 1024 LEU A CB  1 
ATOM   6821  C CG  . LEU A  1 1011 ? 171.972 173.263 142.498 1.00 76.18  ? 1024 LEU A CG  1 
ATOM   6822  C CD1 . LEU A  1 1011 ? 173.397 173.702 142.594 1.00 76.18  ? 1024 LEU A CD1 1 
ATOM   6823  C CD2 . LEU A  1 1011 ? 171.826 171.855 142.989 1.00 76.18  ? 1024 LEU A CD2 1 
ATOM   6824  N N   . ALA A  1 1012 ? 168.430 174.354 142.249 1.00 79.03  ? 1025 ALA A N   1 
ATOM   6825  C CA  . ALA A  1 1012 ? 167.227 173.939 141.557 1.00 79.03  ? 1025 ALA A CA  1 
ATOM   6826  C C   . ALA A  1 1012 ? 166.615 175.082 140.790 1.00 79.03  ? 1025 ALA A C   1 
ATOM   6827  O O   . ALA A  1 1012 ? 166.036 174.874 139.727 1.00 79.03  ? 1025 ALA A O   1 
ATOM   6828  C CB  . ALA A  1 1012 ? 166.216 173.406 142.561 1.00 79.03  ? 1025 ALA A CB  1 
ATOM   6829  N N   . ALA A  1 1013 ? 166.683 176.284 141.336 1.00 75.95  ? 1026 ALA A N   1 
ATOM   6830  C CA  . ALA A  1 1013 ? 166.049 177.406 140.675 1.00 75.95  ? 1026 ALA A CA  1 
ATOM   6831  C C   . ALA A  1 1013 ? 166.598 177.539 139.279 1.00 75.95  ? 1026 ALA A C   1 
ATOM   6832  O O   . ALA A  1 1013 ? 165.866 177.477 138.292 1.00 75.95  ? 1026 ALA A O   1 
ATOM   6833  C CB  . ALA A  1 1013 ? 166.288 178.684 141.469 1.00 75.95  ? 1026 ALA A CB  1 
ATOM   6834  N N   . THR A  1 1014 ? 167.907 177.684 139.197 1.00 80.32  ? 1027 THR A N   1 
ATOM   6835  C CA  . THR A  1 1014 ? 168.575 177.729 137.915 1.00 80.32  ? 1027 THR A CA  1 
ATOM   6836  C C   . THR A  1 1014 ? 168.254 176.502 137.104 1.00 80.32  ? 1027 THR A C   1 
ATOM   6837  O O   . THR A  1 1014 ? 168.124 176.576 135.880 1.00 80.32  ? 1027 THR A O   1 
ATOM   6838  C CB  . THR A  1 1014 ? 170.071 177.806 138.123 1.00 80.32  ? 1027 THR A CB  1 
ATOM   6839  O OG1 . THR A  1 1014 ? 170.523 176.517 138.547 1.00 80.32  ? 1027 THR A OG1 1 
ATOM   6840  C CG2 . THR A  1 1014 ? 170.390 178.811 139.191 1.00 80.32  ? 1027 THR A CG2 1 
ATOM   6841  N N   . LYS A  1 1015 ? 168.236 175.346 137.777 1.00 82.78  ? 1028 LYS A N   1 
ATOM   6842  C CA  . LYS A  1 1015 ? 167.943 174.053 137.100 1.00 82.78  ? 1028 LYS A CA  1 
ATOM   6843  C C   . LYS A  1 1015 ? 166.648 174.222 136.304 1.00 82.78  ? 1028 LYS A C   1 
ATOM   6844  O O   . LYS A  1 1015 ? 166.681 174.066 135.067 1.00 82.78  ? 1028 LYS A O   1 
ATOM   6845  C CB  . LYS A  1 1015 ? 167.821 172.925 138.130 1.00 82.78  ? 1028 LYS A CB  1 
ATOM   6846  C CG  . LYS A  1 1015 ? 169.090 172.618 138.913 1.00 82.78  ? 1028 LYS A CG  1 
ATOM   6847  C CD  . LYS A  1 1015 ? 170.247 172.190 138.035 1.00 82.78  ? 1028 LYS A CD  1 
ATOM   6848  C CE  . LYS A  1 1015 ? 171.503 171.876 138.819 1.00 82.78  ? 1028 LYS A CE  1 
ATOM   6849  N NZ  . LYS A  1 1015 ? 172.613 171.457 137.931 1.00 82.78  ? 1028 LYS A NZ  1 
ATOM   6850  N N   . MET A  1 1016 ? 165.558 174.532 137.009 1.00 86.56  ? 1029 MET A N   1 
ATOM   6851  C CA  . MET A  1 1016 ? 164.271 174.769 136.391 1.00 86.56  ? 1029 MET A CA  1 
ATOM   6852  C C   . MET A  1 1016 ? 164.361 175.889 135.381 1.00 86.56  ? 1029 MET A C   1 
ATOM   6853  O O   . MET A  1 1016 ? 163.741 175.825 134.317 1.00 86.56  ? 1029 MET A O   1 
ATOM   6854  C CB  . MET A  1 1016 ? 163.241 175.104 137.449 1.00 86.56  ? 1029 MET A CB  1 
ATOM   6855  C CG  . MET A  1 1016 ? 161.902 175.327 136.863 1.00 86.56  ? 1029 MET A CG  1 
ATOM   6856  S SD  . MET A  1 1016 ? 160.964 176.285 138.023 1.00 86.56  ? 1029 MET A SD  1 
ATOM   6857  C CE  . MET A  1 1016 ? 162.012 177.731 138.070 1.00 86.56  ? 1029 MET A CE  1 
ATOM   6858  N N   . SER A  1 1017 ? 165.164 176.900 135.674 1.00 81.57  ? 1030 SER A N   1 
ATOM   6859  C CA  . SER A  1 1017 ? 165.286 178.048 134.800 1.00 81.57  ? 1030 SER A CA  1 
ATOM   6860  C C   . SER A  1 1017 ? 165.771 177.620 133.429 1.00 81.57  ? 1030 SER A C   1 
ATOM   6861  O O   . SER A  1 1017 ? 164.986 177.472 132.487 1.00 81.57  ? 1030 SER A O   1 
ATOM   6862  C CB  . SER A  1 1017 ? 166.257 179.054 135.398 1.00 81.57  ? 1030 SER A CB  1 
ATOM   6863  O OG  . SER A  1 1017 ? 167.581 178.609 135.197 1.00 81.57  ? 1030 SER A OG  1 
ATOM   6864  N N   . GLU A  1 1018 ? 167.061 177.348 133.341 1.00 73.21  ? 1031 GLU A N   1 
ATOM   6865  C CA  . GLU A  1 1018 ? 167.694 177.111 132.054 1.00 73.21  ? 1031 GLU A CA  1 
ATOM   6866  C C   . GLU A  1 1018 ? 167.360 175.753 131.466 1.00 73.21  ? 1031 GLU A C   1 
ATOM   6867  O O   . GLU A  1 1018 ? 167.622 175.535 130.280 1.00 73.21  ? 1031 GLU A O   1 
ATOM   6868  C CB  . GLU A  1 1018 ? 169.212 177.251 132.175 1.00 73.21  ? 1031 GLU A CB  1 
ATOM   6869  C CG  . GLU A  1 1018 ? 169.992 177.408 130.853 1.00 73.21  ? 1031 GLU A CG  1 
ATOM   6870  C CD  . GLU A  1 1018 ? 169.921 178.789 130.187 1.00 73.21  ? 1031 GLU A CD  1 
ATOM   6871  O OE1 . GLU A  1 1018 ? 170.700 178.996 129.239 1.00 73.21  ? 1031 GLU A OE1 1 
ATOM   6872  O OE2 . GLU A  1 1018 ? 169.129 179.668 130.582 1.00 73.21  ? 1031 GLU A OE2 1 
ATOM   6873  N N   . CYS A  1 1019 ? 166.779 174.836 132.234 1.00 85.53  ? 1032 CYS A N   1 
ATOM   6874  C CA  . CYS A  1 1019 ? 166.469 173.529 131.688 1.00 85.53  ? 1032 CYS A CA  1 
ATOM   6875  C C   . CYS A  1 1019 ? 164.999 173.180 131.839 1.00 85.53  ? 1032 CYS A C   1 
ATOM   6876  O O   . CYS A  1 1019 ? 164.638 171.999 131.795 1.00 85.53  ? 1032 CYS A O   1 
ATOM   6877  C CB  . CYS A  1 1019 ? 167.368 172.478 132.332 1.00 85.53  ? 1032 CYS A CB  1 
ATOM   6878  S SG  . CYS A  1 1019 ? 169.098 172.931 132.119 1.00 85.53  ? 1032 CYS A SG  1 
ATOM   6879  N N   . VAL A  1 1020 ? 164.148 174.172 132.033 1.00 83.69  ? 1033 VAL A N   1 
ATOM   6880  C CA  . VAL A  1 1020 ? 162.731 174.017 131.783 1.00 83.69  ? 1033 VAL A CA  1 
ATOM   6881  C C   . VAL A  1 1020 ? 162.348 175.153 130.871 1.00 83.69  ? 1033 VAL A C   1 
ATOM   6882  O O   . VAL A  1 1020 ? 161.699 174.955 129.846 1.00 83.69  ? 1033 VAL A O   1 
ATOM   6883  C CB  . VAL A  1 1020 ? 161.906 174.024 133.069 1.00 83.69  ? 1033 VAL A CB  1 
ATOM   6884  C CG1 . VAL A  1 1020 ? 160.487 173.734 132.739 1.00 83.69  ? 1033 VAL A CG1 1 
ATOM   6885  C CG2 . VAL A  1 1020 ? 162.404 172.950 133.970 1.00 83.69  ? 1033 VAL A CG2 1 
ATOM   6886  N N   . LEU A  1 1021 ? 162.757 176.341 131.222 1.00 87.02  ? 1034 LEU A N   1 
ATOM   6887  C CA  . LEU A  1 1021 ? 162.478 177.435 130.327 1.00 87.02  ? 1034 LEU A CA  1 
ATOM   6888  C C   . LEU A  1 1021 ? 163.504 177.566 129.221 1.00 87.02  ? 1034 LEU A C   1 
ATOM   6889  O O   . LEU A  1 1021 ? 163.570 178.623 128.589 1.00 87.02  ? 1034 LEU A O   1 
ATOM   6890  C CB  . LEU A  1 1021 ? 162.379 178.736 131.115 1.00 87.02  ? 1034 LEU A CB  1 
ATOM   6891  C CG  . LEU A  1 1021 ? 161.398 178.713 132.276 1.00 87.02  ? 1034 LEU A CG  1 
ATOM   6892  C CD1 . LEU A  1 1021 ? 162.105 178.378 133.539 1.00 87.02  ? 1034 LEU A CD1 1 
ATOM   6893  C CD2 . LEU A  1 1021 ? 160.719 180.056 132.409 1.00 87.02  ? 1034 LEU A CD2 1 
ATOM   6894  N N   . GLY A  1 1022 ? 164.309 176.547 128.955 1.00 89.64  ? 1035 GLY A N   1 
ATOM   6895  C CA  . GLY A  1 1022 ? 165.306 176.703 127.918 1.00 89.64  ? 1035 GLY A CA  1 
ATOM   6896  C C   . GLY A  1 1022 ? 166.056 175.420 127.661 1.00 89.64  ? 1035 GLY A C   1 
ATOM   6897  O O   . GLY A  1 1022 ? 165.804 174.395 128.288 1.00 89.64  ? 1035 GLY A O   1 
ATOM   6898  N N   . GLN A  1 1023 ? 167.007 175.500 126.738 1.00 87.65  ? 1036 GLN A N   1 
ATOM   6899  C CA  . GLN A  1 1023 ? 167.716 174.319 126.253 1.00 87.65  ? 1036 GLN A CA  1 
ATOM   6900  C C   . GLN A  1 1023 ? 169.207 174.620 126.306 1.00 87.65  ? 1036 GLN A C   1 
ATOM   6901  O O   . GLN A  1 1023 ? 169.783 175.157 125.361 1.00 87.65  ? 1036 GLN A O   1 
ATOM   6902  C CB  . GLN A  1 1023 ? 167.266 173.956 124.852 1.00 87.65  ? 1036 GLN A CB  1 
ATOM   6903  C CG  . GLN A  1 1023 ? 168.068 172.843 124.221 1.00 87.65  ? 1036 GLN A CG  1 
ATOM   6904  C CD  . GLN A  1 1023 ? 167.904 172.795 122.718 1.00 87.65  ? 1036 GLN A CD  1 
ATOM   6905  O OE1 . GLN A  1 1023 ? 167.140 173.568 122.141 1.00 87.65  ? 1036 GLN A OE1 1 
ATOM   6906  N NE2 . GLN A  1 1023 ? 168.628 171.888 122.074 1.00 87.65  ? 1036 GLN A NE2 1 
ATOM   6907  N N   . SER A  1 1024 ? 169.828 174.247 127.411 1.00 80.34  ? 1037 SER A N   1 
ATOM   6908  C CA  . SER A  1 1024 ? 171.209 174.615 127.657 1.00 80.34  ? 1037 SER A CA  1 
ATOM   6909  C C   . SER A  1 1024 ? 172.165 173.738 126.874 1.00 80.34  ? 1037 SER A C   1 
ATOM   6910  O O   . SER A  1 1024 ? 171.775 172.851 126.115 1.00 80.34  ? 1037 SER A O   1 
ATOM   6911  C CB  . SER A  1 1024 ? 171.544 174.507 129.139 1.00 80.34  ? 1037 SER A CB  1 
ATOM   6912  O OG  . SER A  1 1024 ? 172.941 174.648 129.324 1.00 80.34  ? 1037 SER A OG  1 
ATOM   6913  N N   . LYS A  1 1025 ? 173.445 174.012 127.067 1.00 75.94  ? 1038 LYS A N   1 
ATOM   6914  C CA  . LYS A  1 1025 ? 174.500 173.138 126.617 1.00 75.94  ? 1038 LYS A CA  1 
ATOM   6915  C C   . LYS A  1 1025 ? 175.378 172.656 127.751 1.00 75.94  ? 1038 LYS A C   1 
ATOM   6916  O O   . LYS A  1 1025 ? 176.204 171.767 127.531 1.00 75.94  ? 1038 LYS A O   1 
ATOM   6917  C CB  . LYS A  1 1025 ? 175.390 173.835 125.579 1.00 75.94  ? 1038 LYS A CB  1 
ATOM   6918  C CG  . LYS A  1 1025 ? 174.712 174.816 124.619 1.00 75.94  ? 1038 LYS A CG  1 
ATOM   6919  C CD  . LYS A  1 1025 ? 173.381 174.356 124.027 1.00 75.94  ? 1038 LYS A CD  1 
ATOM   6920  C CE  . LYS A  1 1025 ? 173.425 172.948 123.443 1.00 75.94  ? 1038 LYS A CE  1 
ATOM   6921  N NZ  . LYS A  1 1025 ? 172.103 172.540 122.891 1.00 75.94  ? 1038 LYS A NZ  1 
ATOM   6922  N N   . ARG A  1 1026 ? 175.234 173.212 128.948 1.00 79.45  ? 1039 ARG A N   1 
ATOM   6923  C CA  . ARG A  1 1026 ? 176.094 172.820 130.052 1.00 79.45  ? 1039 ARG A CA  1 
ATOM   6924  C C   . ARG A  1 1026 ? 175.781 171.388 130.455 1.00 79.45  ? 1039 ARG A C   1 
ATOM   6925  O O   . ARG A  1 1026 ? 174.650 171.067 130.825 1.00 79.45  ? 1039 ARG A O   1 
ATOM   6926  C CB  . ARG A  1 1026 ? 175.920 173.764 131.235 1.00 79.45  ? 1039 ARG A CB  1 
ATOM   6927  C CG  . ARG A  1 1026 ? 174.523 173.847 131.788 1.00 79.45  ? 1039 ARG A CG  1 
ATOM   6928  C CD  . ARG A  1 1026 ? 174.480 174.887 132.860 1.00 79.45  ? 1039 ARG A CD  1 
ATOM   6929  N NE  . ARG A  1 1026 ? 175.521 174.655 133.851 1.00 79.45  ? 1039 ARG A NE  1 
ATOM   6930  C CZ  . ARG A  1 1026 ? 176.412 175.568 134.213 1.00 79.45  ? 1039 ARG A CZ  1 
ATOM   6931  N NH1 . ARG A  1 1026 ? 176.392 176.767 133.655 1.00 79.45  ? 1039 ARG A NH1 1 
ATOM   6932  N NH2 . ARG A  1 1026 ? 177.329 175.279 135.125 1.00 79.45  ? 1039 ARG A NH2 1 
ATOM   6933  N N   . VAL A  1 1027 ? 176.766 170.540 130.389 1.00 79.12  ? 1040 VAL A N   1 
ATOM   6934  C CA  . VAL A  1 1027 ? 176.530 169.128 130.621 1.00 79.12  ? 1040 VAL A CA  1 
ATOM   6935  C C   . VAL A  1 1027 ? 176.561 168.838 132.109 1.00 79.12  ? 1040 VAL A C   1 
ATOM   6936  O O   . VAL A  1 1027 ? 177.230 169.521 132.884 1.00 79.12  ? 1040 VAL A O   1 
ATOM   6937  C CB  . VAL A  1 1027 ? 177.574 168.304 129.861 1.00 79.12  ? 1040 VAL A CB  1 
ATOM   6938  C CG1 . VAL A  1 1027 ? 177.119 166.883 129.756 1.00 79.12  ? 1040 VAL A CG1 1 
ATOM   6939  C CG2 . VAL A  1 1027 ? 177.782 168.908 128.495 1.00 79.12  ? 1040 VAL A CG2 1 
ATOM   6940  N N   . ASP A  1 1028 ? 175.809 167.822 132.512 1.00 93.08  ? 1041 ASP A N   1 
ATOM   6941  C CA  . ASP A  1 1028 ? 175.671 167.340 133.880 1.00 93.08  ? 1041 ASP A CA  1 
ATOM   6942  C C   . ASP A  1 1028 ? 174.927 168.324 134.754 1.00 93.08  ? 1041 ASP A C   1 
ATOM   6943  O O   . ASP A  1 1028 ? 174.584 167.996 135.890 1.00 93.08  ? 1041 ASP A O   1 
ATOM   6944  C CB  . ASP A  1 1028 ? 177.017 167.020 134.539 1.00 93.08  ? 1041 ASP A CB  1 
ATOM   6945  C CG  . ASP A  1 1028 ? 176.859 166.297 135.861 1.00 93.08  ? 1041 ASP A CG  1 
ATOM   6946  O OD1 . ASP A  1 1028 ? 175.806 165.661 136.077 1.00 93.08  ? 1041 ASP A OD1 1 
ATOM   6947  O OD2 . ASP A  1 1028 ? 177.797 166.341 136.680 1.00 93.08  ? 1041 ASP A OD2 1 
ATOM   6948  N N   . PHE A  1 1029 ? 174.626 169.510 134.260 1.00 92.01  ? 1042 PHE A N   1 
ATOM   6949  C CA  . PHE A  1 1029 ? 173.676 170.318 134.995 1.00 92.01  ? 1042 PHE A CA  1 
ATOM   6950  C C   . PHE A  1 1029 ? 172.283 169.768 134.714 1.00 92.01  ? 1042 PHE A C   1 
ATOM   6951  O O   . PHE A  1 1029 ? 171.565 169.370 135.635 1.00 92.01  ? 1042 PHE A O   1 
ATOM   6952  C CB  . PHE A  1 1029 ? 173.797 171.778 134.578 1.00 92.01  ? 1042 PHE A CB  1 
ATOM   6953  C CG  . PHE A  1 1029 ? 173.464 172.740 135.657 1.00 92.01  ? 1042 PHE A CG  1 
ATOM   6954  C CD1 . PHE A  1 1029 ? 174.440 173.179 136.515 1.00 92.01  ? 1042 PHE A CD1 1 
ATOM   6955  C CD2 . PHE A  1 1029 ? 172.183 173.187 135.832 1.00 92.01  ? 1042 PHE A CD2 1 
ATOM   6956  C CE1 . PHE A  1 1029 ? 174.149 174.068 137.502 1.00 92.01  ? 1042 PHE A CE1 1 
ATOM   6957  C CE2 . PHE A  1 1029 ? 171.888 174.072 136.827 1.00 92.01  ? 1042 PHE A CE2 1 
ATOM   6958  C CZ  . PHE A  1 1029 ? 172.872 174.510 137.662 1.00 92.01  ? 1042 PHE A CZ  1 
ATOM   6959  N N   . CYS A  1 1030 ? 171.918 169.682 133.434 1.00 99.80  ? 1043 CYS A N   1 
ATOM   6960  C CA  . CYS A  1 1030 ? 170.682 169.037 133.006 1.00 99.80  ? 1043 CYS A CA  1 
ATOM   6961  C C   . CYS A  1 1030 ? 170.965 168.193 131.779 1.00 99.80  ? 1043 CYS A C   1 
ATOM   6962  O O   . CYS A  1 1030 ? 171.494 168.692 130.785 1.00 99.80  ? 1043 CYS A O   1 
ATOM   6963  C CB  . CYS A  1 1030 ? 169.580 170.050 132.701 1.00 99.80  ? 1043 CYS A CB  1 
ATOM   6964  S SG  . CYS A  1 1030 ? 169.958 171.237 131.420 1.00 99.80  ? 1043 CYS A SG  1 
ATOM   6965  N N   . GLY A  1 1031 ? 170.618 166.922 131.858 1.00 93.80  ? 1044 GLY A N   1 
ATOM   6966  C CA  . GLY A  1 1031 ? 170.767 166.009 130.752 1.00 93.80  ? 1044 GLY A CA  1 
ATOM   6967  C C   . GLY A  1 1031 ? 172.098 165.298 130.765 1.00 93.80  ? 1044 GLY A C   1 
ATOM   6968  O O   . GLY A  1 1031 ? 173.125 165.906 130.461 1.00 93.80  ? 1044 GLY A O   1 
ATOM   6969  N N   . LYS A  1 1032 ? 172.106 164.018 131.114 1.00 91.19  ? 1045 LYS A N   1 
ATOM   6970  C CA  . LYS A  1 1032 ? 173.284 163.224 130.842 1.00 91.19  ? 1045 LYS A CA  1 
ATOM   6971  C C   . LYS A  1 1032 ? 173.475 163.219 129.343 1.00 91.19  ? 1045 LYS A C   1 
ATOM   6972  O O   . LYS A  1 1032 ? 172.566 162.853 128.598 1.00 91.19  ? 1045 LYS A O   1 
ATOM   6973  C CB  . LYS A  1 1032 ? 173.128 161.809 131.375 1.00 91.19  ? 1045 LYS A CB  1 
ATOM   6974  C CG  . LYS A  1 1032 ? 174.199 160.862 130.879 1.00 91.19  ? 1045 LYS A CG  1 
ATOM   6975  C CD  . LYS A  1 1032 ? 175.601 161.411 131.112 1.00 91.19  ? 1045 LYS A CD  1 
ATOM   6976  C CE  . LYS A  1 1032 ? 176.663 160.341 130.895 1.00 91.19  ? 1045 LYS A CE  1 
ATOM   6977  N NZ  . LYS A  1 1032 ? 178.037 160.904 130.918 1.00 91.19  ? 1045 LYS A NZ  1 
ATOM   6978  N N   . GLY A  1 1033 ? 174.632 163.672 128.898 1.00 89.15  ? 1046 GLY A N   1 
ATOM   6979  C CA  . GLY A  1 1033 ? 174.764 163.896 127.478 1.00 89.15  ? 1046 GLY A CA  1 
ATOM   6980  C C   . GLY A  1 1033 ? 173.981 165.126 127.051 1.00 89.15  ? 1046 GLY A C   1 
ATOM   6981  O O   . GLY A  1 1033 ? 173.497 165.905 127.867 1.00 89.15  ? 1046 GLY A O   1 
ATOM   6982  N N   . TYR A  1 1034 ? 173.843 165.283 125.741 1.00 85.57  ? 1047 TYR A N   1 
ATOM   6983  C CA  . TYR A  1 1034 ? 173.227 166.490 125.218 1.00 85.57  ? 1047 TYR A CA  1 
ATOM   6984  C C   . TYR A  1 1034 ? 171.775 166.531 125.663 1.00 85.57  ? 1047 TYR A C   1 
ATOM   6985  O O   . TYR A  1 1034 ? 171.104 165.495 125.712 1.00 85.57  ? 1047 TYR A O   1 
ATOM   6986  C CB  . TYR A  1 1034 ? 173.296 166.550 123.699 1.00 85.57  ? 1047 TYR A CB  1 
ATOM   6987  C CG  . TYR A  1 1034 ? 174.604 166.188 123.040 1.00 85.57  ? 1047 TYR A CG  1 
ATOM   6988  C CD1 . TYR A  1 1034 ? 175.749 165.902 123.758 1.00 85.57  ? 1047 TYR A CD1 1 
ATOM   6989  C CD2 . TYR A  1 1034 ? 174.683 166.149 121.670 1.00 85.57  ? 1047 TYR A CD2 1 
ATOM   6990  C CE1 . TYR A  1 1034 ? 176.913 165.566 123.118 1.00 85.57  ? 1047 TYR A CE1 1 
ATOM   6991  C CE2 . TYR A  1 1034 ? 175.837 165.824 121.033 1.00 85.57  ? 1047 TYR A CE2 1 
ATOM   6992  C CZ  . TYR A  1 1034 ? 176.947 165.535 121.750 1.00 85.57  ? 1047 TYR A CZ  1 
ATOM   6993  O OH  . TYR A  1 1034 ? 178.086 165.214 121.064 1.00 85.57  ? 1047 TYR A OH  1 
ATOM   6994  N N   . HIS A  1 1035 ? 171.288 167.727 125.974 1.00 90.78  ? 1048 HIS A N   1 
ATOM   6995  C CA  . HIS A  1 1035 ? 170.073 167.909 126.755 1.00 90.78  ? 1048 HIS A CA  1 
ATOM   6996  C C   . HIS A  1 1035 ? 168.936 168.510 125.939 1.00 90.78  ? 1048 HIS A C   1 
ATOM   6997  O O   . HIS A  1 1035 ? 169.145 169.336 125.052 1.00 90.78  ? 1048 HIS A O   1 
ATOM   6998  C CB  . HIS A  1 1035 ? 170.357 168.802 127.957 1.00 90.78  ? 1048 HIS A CB  1 
ATOM   6999  C CG  . HIS A  1 1035 ? 169.142 169.160 128.741 1.00 90.78  ? 1048 HIS A CG  1 
ATOM   7000  N ND1 . HIS A  1 1035 ? 168.267 170.145 128.343 1.00 90.78  ? 1048 HIS A ND1 1 
ATOM   7001  C CD2 . HIS A  1 1035 ? 168.656 168.670 129.901 1.00 90.78  ? 1048 HIS A CD2 1 
ATOM   7002  C CE1 . HIS A  1 1035 ? 167.293 170.246 129.226 1.00 90.78  ? 1048 HIS A CE1 1 
ATOM   7003  N NE2 . HIS A  1 1035 ? 167.509 169.366 130.185 1.00 90.78  ? 1048 HIS A NE2 1 
ATOM   7004  N N   . LEU A  1 1036 ? 167.718 168.112 126.281 1.00 79.80  ? 1049 LEU A N   1 
ATOM   7005  C CA  . LEU A  1 1036 ? 166.536 168.561 125.571 1.00 79.80  ? 1049 LEU A CA  1 
ATOM   7006  C C   . LEU A  1 1036 ? 165.624 169.414 126.439 1.00 79.80  ? 1049 LEU A C   1 
ATOM   7007  O O   . LEU A  1 1036 ? 165.367 170.574 126.114 1.00 79.80  ? 1049 LEU A O   1 
ATOM   7008  C CB  . LEU A  1 1036 ? 165.786 167.343 125.057 1.00 79.80  ? 1049 LEU A CB  1 
ATOM   7009  C CG  . LEU A  1 1036 ? 166.785 166.374 124.484 1.00 79.80  ? 1049 LEU A CG  1 
ATOM   7010  C CD1 . LEU A  1 1036 ? 166.113 165.087 124.166 1.00 79.80  ? 1049 LEU A CD1 1 
ATOM   7011  C CD2 . LEU A  1 1036 ? 167.305 167.028 123.251 1.00 79.80  ? 1049 LEU A CD2 1 
ATOM   7012  N N   . MET A  1 1037 ? 165.131 168.871 127.539 1.00 87.04  ? 1050 MET A N   1 
ATOM   7013  C CA  . MET A  1 1037 ? 164.168 169.571 128.371 1.00 87.04  ? 1050 MET A CA  1 
ATOM   7014  C C   . MET A  1 1037 ? 163.993 168.743 129.623 1.00 87.04  ? 1050 MET A C   1 
ATOM   7015  O O   . MET A  1 1037 ? 164.426 167.591 129.688 1.00 87.04  ? 1050 MET A O   1 
ATOM   7016  C CB  . MET A  1 1037 ? 162.836 169.738 127.670 1.00 87.04  ? 1050 MET A CB  1 
ATOM   7017  C CG  . MET A  1 1037 ? 162.084 168.458 127.615 1.00 87.04  ? 1050 MET A CG  1 
ATOM   7018  S SD  . MET A  1 1037 ? 160.826 168.602 126.374 1.00 87.04  ? 1050 MET A SD  1 
ATOM   7019  C CE  . MET A  1 1037 ? 160.094 170.138 126.892 1.00 87.04  ? 1050 MET A CE  1 
ATOM   7020  N N   . SER A  1 1038 ? 163.332 169.328 130.614 1.00 86.77  ? 1051 SER A N   1 
ATOM   7021  C CA  . SER A  1 1038 ? 163.027 168.591 131.833 1.00 86.77  ? 1051 SER A CA  1 
ATOM   7022  C C   . SER A  1 1038 ? 161.566 168.792 132.171 1.00 86.77  ? 1051 SER A C   1 
ATOM   7023  O O   . SER A  1 1038 ? 161.171 169.848 132.675 1.00 86.77  ? 1051 SER A O   1 
ATOM   7024  C CB  . SER A  1 1038 ? 163.908 169.015 133.008 1.00 86.77  ? 1051 SER A CB  1 
ATOM   7025  O OG  . SER A  1 1038 ? 163.919 168.013 134.025 1.00 86.77  ? 1051 SER A OG  1 
ATOM   7026  N N   . PHE A  1 1039 ? 160.794 167.779 131.908 1.00 89.80  ? 1052 PHE A N   1 
ATOM   7027  C CA  . PHE A  1 1039 ? 159.429 167.803 132.352 1.00 89.80  ? 1052 PHE A CA  1 
ATOM   7028  C C   . PHE A  1 1039 ? 159.505 167.890 133.854 1.00 89.80  ? 1052 PHE A C   1 
ATOM   7029  O O   . PHE A  1 1039 ? 160.089 167.024 134.509 1.00 89.80  ? 1052 PHE A O   1 
ATOM   7030  C CB  . PHE A  1 1039 ? 158.692 166.562 131.895 1.00 89.80  ? 1052 PHE A CB  1 
ATOM   7031  C CG  . PHE A  1 1039 ? 158.215 166.652 130.499 1.00 89.80  ? 1052 PHE A CG  1 
ATOM   7032  C CD1 . PHE A  1 1039 ? 158.973 167.297 129.541 1.00 89.80  ? 1052 PHE A CD1 1 
ATOM   7033  C CD2 . PHE A  1 1039 ? 157.007 166.105 130.135 1.00 89.80  ? 1052 PHE A CD2 1 
ATOM   7034  C CE1 . PHE A  1 1039 ? 158.533 167.391 128.250 1.00 89.80  ? 1052 PHE A CE1 1 
ATOM   7035  C CE2 . PHE A  1 1039 ? 156.560 166.196 128.839 1.00 89.80  ? 1052 PHE A CE2 1 
ATOM   7036  C CZ  . PHE A  1 1039 ? 157.328 166.843 127.892 1.00 89.80  ? 1052 PHE A CZ  1 
ATOM   7037  N N   . PRO A  1 1040 ? 158.998 168.956 134.421 1.00 81.61  ? 1053 PRO A N   1 
ATOM   7038  C CA  . PRO A  1 1040 ? 159.039 169.130 135.866 1.00 81.61  ? 1053 PRO A CA  1 
ATOM   7039  C C   . PRO A  1 1040 ? 157.772 168.584 136.503 1.00 81.61  ? 1053 PRO A C   1 
ATOM   7040  O O   . PRO A  1 1040 ? 156.737 168.455 135.854 1.00 81.61  ? 1053 PRO A O   1 
ATOM   7041  C CB  . PRO A  1 1040 ? 159.111 170.646 135.993 1.00 81.61  ? 1053 PRO A CB  1 
ATOM   7042  C CG  . PRO A  1 1040 ? 158.320 171.119 134.802 1.00 81.61  ? 1053 PRO A CG  1 
ATOM   7043  C CD  . PRO A  1 1040 ? 158.408 170.102 133.732 1.00 81.61  ? 1053 PRO A CD  1 
ATOM   7044  N N   . GLN A  1 1041 ? 157.858 168.254 137.789 1.00 78.00  ? 1054 GLN A N   1 
ATOM   7045  C CA  . GLN A  1 1041 ? 156.664 167.806 138.482 1.00 78.00  ? 1054 GLN A CA  1 
ATOM   7046  C C   . GLN A  1 1041 ? 156.683 168.380 139.884 1.00 78.00  ? 1054 GLN A C   1 
ATOM   7047  O O   . GLN A  1 1041 ? 157.394 169.342 140.165 1.00 78.00  ? 1054 GLN A O   1 
ATOM   7048  C CB  . GLN A  1 1041 ? 156.558 166.286 138.481 1.00 78.00  ? 1054 GLN A CB  1 
ATOM   7049  C CG  . GLN A  1 1041 ? 156.277 165.662 137.111 1.00 78.00  ? 1054 GLN A CG  1 
ATOM   7050  C CD  . GLN A  1 1041 ? 154.803 165.552 136.778 1.00 78.00  ? 1054 GLN A CD  1 
ATOM   7051  O OE1 . GLN A  1 1041 ? 154.076 166.533 136.822 1.00 78.00  ? 1054 GLN A OE1 1 
ATOM   7052  N NE2 . GLN A  1 1041 ? 154.362 164.353 136.424 1.00 78.00  ? 1054 GLN A NE2 1 
ATOM   7053  N N   . SER A  1 1042 ? 155.870 167.805 140.757 1.00 73.78  ? 1055 SER A N   1 
ATOM   7054  C CA  . SER A  1 1042 ? 155.757 168.273 142.127 1.00 73.78  ? 1055 SER A CA  1 
ATOM   7055  C C   . SER A  1 1042 ? 156.419 167.306 143.090 1.00 73.78  ? 1055 SER A C   1 
ATOM   7056  O O   . SER A  1 1042 ? 156.685 166.156 142.766 1.00 73.78  ? 1055 SER A O   1 
ATOM   7057  C CB  . SER A  1 1042 ? 154.308 168.406 142.535 1.00 73.78  ? 1055 SER A CB  1 
ATOM   7058  O OG  . SER A  1 1042 ? 153.909 167.201 143.152 1.00 73.78  ? 1055 SER A OG  1 
ATOM   7059  N N   . ALA A  1 1043 ? 156.617 167.764 144.320 1.00 76.12  ? 1056 ALA A N   1 
ATOM   7060  C CA  . ALA A  1 1043 ? 157.175 166.898 145.344 1.00 76.12  ? 1056 ALA A CA  1 
ATOM   7061  C C   . ALA A  1 1043 ? 156.768 167.436 146.699 1.00 76.12  ? 1056 ALA A C   1 
ATOM   7062  O O   . ALA A  1 1043 ? 156.591 168.647 146.843 1.00 76.12  ? 1056 ALA A O   1 
ATOM   7063  C CB  . ALA A  1 1043 ? 158.698 166.819 145.228 1.00 76.12  ? 1056 ALA A CB  1 
ATOM   7064  N N   . PRO A  1 1044 ? 156.639 166.576 147.714 1.00 76.27  ? 1057 PRO A N   1 
ATOM   7065  C CA  . PRO A  1 1044 ? 155.960 166.999 148.954 1.00 76.27  ? 1057 PRO A CA  1 
ATOM   7066  C C   . PRO A  1 1044 ? 156.683 168.079 149.741 1.00 76.27  ? 1057 PRO A C   1 
ATOM   7067  O O   . PRO A  1 1044 ? 156.054 169.053 150.167 1.00 76.27  ? 1057 PRO A O   1 
ATOM   7068  C CB  . PRO A  1 1044 ? 155.854 165.691 149.740 1.00 76.27  ? 1057 PRO A CB  1 
ATOM   7069  C CG  . PRO A  1 1044 ? 156.894 164.846 149.190 1.00 76.27  ? 1057 PRO A CG  1 
ATOM   7070  C CD  . PRO A  1 1044 ? 156.988 165.154 147.751 1.00 76.27  ? 1057 PRO A CD  1 
ATOM   7071  N N   . HIS A  1 1045 ? 157.975 167.938 149.980 1.00 76.51  ? 1058 HIS A N   1 
ATOM   7072  C CA  . HIS A  1 1045 ? 158.721 169.038 150.563 1.00 76.51  ? 1058 HIS A CA  1 
ATOM   7073  C C   . HIS A  1 1045 ? 159.763 169.580 149.620 1.00 76.51  ? 1058 HIS A C   1 
ATOM   7074  O O   . HIS A  1 1045 ? 160.580 170.406 150.032 1.00 76.51  ? 1058 HIS A O   1 
ATOM   7075  C CB  . HIS A  1 1045 ? 159.392 168.633 151.866 1.00 76.51  ? 1058 HIS A CB  1 
ATOM   7076  C CG  . HIS A  1 1045 ? 158.726 169.192 153.077 1.00 76.51  ? 1058 HIS A CG  1 
ATOM   7077  N ND1 . HIS A  1 1045 ? 157.680 168.564 153.714 1.00 76.51  ? 1058 HIS A ND1 1 
ATOM   7078  C CD2 . HIS A  1 1045 ? 158.951 170.336 153.762 1.00 76.51  ? 1058 HIS A CD2 1 
ATOM   7079  C CE1 . HIS A  1 1045 ? 157.295 169.293 154.746 1.00 76.51  ? 1058 HIS A CE1 1 
ATOM   7080  N NE2 . HIS A  1 1045 ? 158.050 170.374 154.797 1.00 76.51  ? 1058 HIS A NE2 1 
ATOM   7081  N N   . GLY A  1 1046 ? 159.764 169.142 148.382 1.00 74.07  ? 1059 GLY A N   1 
ATOM   7082  C CA  . GLY A  1 1046 ? 160.756 169.579 147.410 1.00 74.07  ? 1059 GLY A CA  1 
ATOM   7083  C C   . GLY A  1 1046 ? 160.219 169.550 146.018 1.00 74.07  ? 1059 GLY A C   1 
ATOM   7084  O O   . GLY A  1 1046 ? 159.044 169.859 145.784 1.00 74.07  ? 1059 GLY A O   1 
ATOM   7085  N N   . VAL A  1 1047 ? 161.062 169.151 145.080 1.00 75.68  ? 1060 VAL A N   1 
ATOM   7086  C CA  . VAL A  1 1047 ? 160.712 169.202 143.674 1.00 75.68  ? 1060 VAL A CA  1 
ATOM   7087  C C   . VAL A  1 1047 ? 161.377 168.045 142.967 1.00 75.68  ? 1060 VAL A C   1 
ATOM   7088  O O   . VAL A  1 1047 ? 162.497 167.657 143.302 1.00 75.68  ? 1060 VAL A O   1 
ATOM   7089  C CB  . VAL A  1 1047 ? 161.141 170.534 143.063 1.00 75.68  ? 1060 VAL A CB  1 
ATOM   7090  C CG1 . VAL A  1 1047 ? 160.345 171.631 143.642 1.00 75.68  ? 1060 VAL A CG1 1 
ATOM   7091  C CG2 . VAL A  1 1047 ? 162.541 170.766 143.448 1.00 75.68  ? 1060 VAL A CG2 1 
ATOM   7092  N N   . VAL A  1 1048 ? 160.682 167.482 142.012 1.00 83.76  ? 1061 VAL A N   1 
ATOM   7093  C CA  . VAL A  1 1048 ? 161.207 166.371 141.238 1.00 83.76  ? 1061 VAL A CA  1 
ATOM   7094  C C   . VAL A  1 1048 ? 161.177 166.741 139.775 1.00 83.76  ? 1061 VAL A C   1 
ATOM   7095  O O   . VAL A  1 1048 ? 160.315 167.494 139.300 1.00 83.76  ? 1061 VAL A O   1 
ATOM   7096  C CB  . VAL A  1 1048 ? 160.414 165.080 141.467 1.00 83.76  ? 1061 VAL A CB  1 
ATOM   7097  C CG1 . VAL A  1 1048 ? 159.009 165.273 140.981 1.00 83.76  ? 1061 VAL A CG1 1 
ATOM   7098  C CG2 . VAL A  1 1048 ? 161.071 163.936 140.744 1.00 83.76  ? 1061 VAL A CG2 1 
ATOM   7099  N N   . PHE A  1 1049 ? 162.138 166.215 139.049 1.00 87.71  ? 1062 PHE A N   1 
ATOM   7100  C CA  . PHE A  1 1049 ? 162.256 166.569 137.661 1.00 87.71  ? 1062 PHE A CA  1 
ATOM   7101  C C   . PHE A  1 1049 ? 162.497 165.321 136.853 1.00 87.71  ? 1062 PHE A C   1 
ATOM   7102  O O   . PHE A  1 1049 ? 162.829 164.265 137.387 1.00 87.71  ? 1062 PHE A O   1 
ATOM   7103  C CB  . PHE A  1 1049 ? 163.361 167.569 137.469 1.00 87.71  ? 1062 PHE A CB  1 
ATOM   7104  C CG  . PHE A  1 1049 ? 163.235 168.733 138.364 1.00 87.71  ? 1062 PHE A CG  1 
ATOM   7105  C CD1 . PHE A  1 1049 ? 163.564 168.637 139.691 1.00 87.71  ? 1062 PHE A CD1 1 
ATOM   7106  C CD2 . PHE A  1 1049 ? 162.724 169.908 137.901 1.00 87.71  ? 1062 PHE A CD2 1 
ATOM   7107  C CE1 . PHE A  1 1049 ? 163.418 169.690 140.515 1.00 87.71  ? 1062 PHE A CE1 1 
ATOM   7108  C CE2 . PHE A  1 1049 ? 162.584 170.976 138.735 1.00 87.71  ? 1062 PHE A CE2 1 
ATOM   7109  C CZ  . PHE A  1 1049 ? 162.932 170.864 140.043 1.00 87.71  ? 1062 PHE A CZ  1 
ATOM   7110  N N   . LEU A  1 1050 ? 162.304 165.457 135.556 1.00 91.93  ? 1063 LEU A N   1 
ATOM   7111  C CA  . LEU A  1 1050 ? 162.514 164.369 134.618 1.00 91.93  ? 1063 LEU A CA  1 
ATOM   7112  C C   . LEU A  1 1050 ? 163.205 165.018 133.431 1.00 91.93  ? 1063 LEU A C   1 
ATOM   7113  O O   . LEU A  1 1050 ? 162.560 165.563 132.536 1.00 91.93  ? 1063 LEU A O   1 
ATOM   7114  C CB  . LEU A  1 1050 ? 161.201 163.713 134.249 1.00 91.93  ? 1063 LEU A CB  1 
ATOM   7115  C CG  . LEU A  1 1050 ? 160.663 163.003 135.480 1.00 91.93  ? 1063 LEU A CG  1 
ATOM   7116  C CD1 . LEU A  1 1050 ? 159.270 162.494 135.262 1.00 91.93  ? 1063 LEU A CD1 1 
ATOM   7117  C CD2 . LEU A  1 1050 ? 161.605 161.878 135.831 1.00 91.93  ? 1063 LEU A CD2 1 
ATOM   7118  N N   . HIS A  1 1051 ? 164.521 165.004 133.465 1.00 87.05  ? 1064 HIS A N   1 
ATOM   7119  C CA  . HIS A  1 1051 ? 165.315 165.596 132.411 1.00 87.05  ? 1064 HIS A CA  1 
ATOM   7120  C C   . HIS A  1 1051 ? 165.488 164.537 131.350 1.00 87.05  ? 1064 HIS A C   1 
ATOM   7121  O O   . HIS A  1 1051 ? 166.233 163.579 131.544 1.00 87.05  ? 1064 HIS A O   1 
ATOM   7122  C CB  . HIS A  1 1051 ? 166.658 166.031 132.960 1.00 87.05  ? 1064 HIS A CB  1 
ATOM   7123  C CG  . HIS A  1 1051 ? 166.591 166.476 134.379 1.00 87.05  ? 1064 HIS A CG  1 
ATOM   7124  N ND1 . HIS A  1 1051 ? 166.074 167.694 134.752 1.00 87.05  ? 1064 HIS A ND1 1 
ATOM   7125  C CD2 . HIS A  1 1051 ? 166.966 165.859 135.521 1.00 87.05  ? 1064 HIS A CD2 1 
ATOM   7126  C CE1 . HIS A  1 1051 ? 166.146 167.816 136.063 1.00 87.05  ? 1064 HIS A CE1 1 
ATOM   7127  N NE2 . HIS A  1 1051 ? 166.677 166.713 136.555 1.00 87.05  ? 1064 HIS A NE2 1 
ATOM   7128  N N   . VAL A  1 1052 ? 164.782 164.678 130.243 1.00 87.62  ? 1065 VAL A N   1 
ATOM   7129  C CA  . VAL A  1 1052 ? 165.038 163.775 129.144 1.00 87.62  ? 1065 VAL A CA  1 
ATOM   7130  C C   . VAL A  1 1052 ? 166.477 163.943 128.698 1.00 87.62  ? 1065 VAL A C   1 
ATOM   7131  O O   . VAL A  1 1052 ? 167.140 164.929 129.026 1.00 87.62  ? 1065 VAL A O   1 
ATOM   7132  C CB  . VAL A  1 1052 ? 164.067 164.045 127.993 1.00 87.62  ? 1065 VAL A CB  1 
ATOM   7133  C CG1 . VAL A  1 1052 ? 162.672 163.933 128.503 1.00 87.62  ? 1065 VAL A CG1 1 
ATOM   7134  C CG2 . VAL A  1 1052 ? 164.313 165.420 127.450 1.00 87.62  ? 1065 VAL A CG2 1 
ATOM   7135  N N   . THR A  1 1053 ? 166.976 162.966 127.962 1.00 89.94  ? 1066 THR A N   1 
ATOM   7136  C CA  . THR A  1 1053 ? 168.361 162.976 127.530 1.00 89.94  ? 1066 THR A CA  1 
ATOM   7137  C C   . THR A  1 1053 ? 168.461 162.411 126.131 1.00 89.94  ? 1066 THR A C   1 
ATOM   7138  O O   . THR A  1 1053 ? 167.643 161.580 125.734 1.00 89.94  ? 1066 THR A O   1 
ATOM   7139  C CB  . THR A  1 1053 ? 169.225 162.133 128.440 1.00 89.94  ? 1066 THR A CB  1 
ATOM   7140  O OG1 . THR A  1 1053 ? 168.516 160.926 128.739 1.00 89.94  ? 1066 THR A OG1 1 
ATOM   7141  C CG2 . THR A  1 1053 ? 169.521 162.872 129.707 1.00 89.94  ? 1066 THR A CG2 1 
ATOM   7142  N N   . TYR A  1 1054 ? 169.478 162.835 125.403 1.00 80.78  ? 1067 TYR A N   1 
ATOM   7143  C CA  . TYR A  1 1054 ? 169.790 162.254 124.113 1.00 80.78  ? 1067 TYR A CA  1 
ATOM   7144  C C   . TYR A  1 1054 ? 171.165 161.618 124.190 1.00 80.78  ? 1067 TYR A C   1 
ATOM   7145  O O   . TYR A  1 1054 ? 172.143 162.302 124.486 1.00 80.78  ? 1067 TYR A O   1 
ATOM   7146  C CB  . TYR A  1 1054 ? 169.745 163.310 123.029 1.00 80.78  ? 1067 TYR A CB  1 
ATOM   7147  C CG  . TYR A  1 1054 ? 170.510 162.910 121.828 1.00 80.78  ? 1067 TYR A CG  1 
ATOM   7148  C CD1 . TYR A  1 1054 ? 169.979 162.050 120.905 1.00 80.78  ? 1067 TYR A CD1 1 
ATOM   7149  C CD2 . TYR A  1 1054 ? 171.769 163.393 121.618 1.00 80.78  ? 1067 TYR A CD2 1 
ATOM   7150  C CE1 . TYR A  1 1054 ? 170.685 161.692 119.805 1.00 80.78  ? 1067 TYR A CE1 1 
ATOM   7151  C CE2 . TYR A  1 1054 ? 172.479 163.044 120.531 1.00 80.78  ? 1067 TYR A CE2 1 
ATOM   7152  C CZ  . TYR A  1 1054 ? 171.942 162.194 119.626 1.00 80.78  ? 1067 TYR A CZ  1 
ATOM   7153  O OH  . TYR A  1 1054 ? 172.689 161.856 118.531 1.00 80.78  ? 1067 TYR A OH  1 
ATOM   7154  N N   . VAL A  1 1055 ? 171.234 160.315 123.943 1.00 84.43  ? 1068 VAL A N   1 
ATOM   7155  C CA  . VAL A  1 1055 ? 172.485 159.563 124.019 1.00 84.43  ? 1068 VAL A CA  1 
ATOM   7156  C C   . VAL A  1 1055 ? 172.526 158.532 122.903 1.00 84.43  ? 1068 VAL A C   1 
ATOM   7157  O O   . VAL A  1 1055 ? 171.625 157.688 122.811 1.00 84.43  ? 1068 VAL A O   1 
ATOM   7158  C CB  . VAL A  1 1055 ? 172.642 158.870 125.372 1.00 84.43  ? 1068 VAL A CB  1 
ATOM   7159  C CG1 . VAL A  1 1055 ? 173.635 157.755 125.253 1.00 84.43  ? 1068 VAL A CG1 1 
ATOM   7160  C CG2 . VAL A  1 1055 ? 173.104 159.849 126.379 1.00 84.43  ? 1068 VAL A CG2 1 
ATOM   7161  N N   . PRO A  1 1056 ? 173.537 158.544 122.051 1.00 91.58  ? 1069 PRO A N   1 
ATOM   7162  C CA  . PRO A  1 1056 ? 173.584 157.611 120.929 1.00 91.58  ? 1069 PRO A CA  1 
ATOM   7163  C C   . PRO A  1 1056 ? 174.231 156.293 121.324 1.00 91.58  ? 1069 PRO A C   1 
ATOM   7164  O O   . PRO A  1 1056 ? 174.831 156.158 122.387 1.00 91.58  ? 1069 PRO A O   1 
ATOM   7165  C CB  . PRO A  1 1056 ? 174.458 158.350 119.923 1.00 91.58  ? 1069 PRO A CB  1 
ATOM   7166  C CG  . PRO A  1 1056 ? 175.403 159.076 120.769 1.00 91.58  ? 1069 PRO A CG  1 
ATOM   7167  C CD  . PRO A  1 1056 ? 174.665 159.479 122.015 1.00 91.58  ? 1069 PRO A CD  1 
ATOM   7168  N N   . ALA A  1 1057 ? 174.095 155.322 120.436 1.00 97.73  ? 1070 ALA A N   1 
ATOM   7169  C CA  . ALA A  1 1057 ? 174.834 154.074 120.534 1.00 97.73  ? 1070 ALA A CA  1 
ATOM   7170  C C   . ALA A  1 1057 ? 174.956 153.515 119.125 1.00 97.73  ? 1070 ALA A C   1 
ATOM   7171  O O   . ALA A  1 1057 ? 174.603 154.185 118.148 1.00 97.73  ? 1070 ALA A O   1 
ATOM   7172  C CB  . ALA A  1 1057 ? 174.158 153.101 121.501 1.00 97.73  ? 1070 ALA A CB  1 
ATOM   7173  N N   . GLN A  1 1058 ? 175.469 152.291 119.013 1.00 107.06 ? 1071 GLN A N   1 
ATOM   7174  C CA  . GLN A  1 1058 ? 175.602 151.599 117.728 1.00 107.06 ? 1071 GLN A CA  1 
ATOM   7175  C C   . GLN A  1 1058 ? 176.494 152.392 116.773 1.00 107.06 ? 1071 GLN A C   1 
ATOM   7176  O O   . GLN A  1 1058 ? 176.061 152.914 115.746 1.00 107.06 ? 1071 GLN A O   1 
ATOM   7177  C CB  . GLN A  1 1058 ? 174.229 151.319 117.109 1.00 107.06 ? 1071 GLN A CB  1 
ATOM   7178  C CG  . GLN A  1 1058 ? 173.427 150.287 117.872 1.00 107.06 ? 1071 GLN A CG  1 
ATOM   7179  C CD  . GLN A  1 1058 ? 173.014 150.785 119.240 1.00 107.06 ? 1071 GLN A CD  1 
ATOM   7180  O OE1 . GLN A  1 1058 ? 172.305 151.779 119.358 1.00 107.06 ? 1071 GLN A OE1 1 
ATOM   7181  N NE2 . GLN A  1 1058 ? 173.490 150.121 120.282 1.00 107.06 ? 1071 GLN A NE2 1 
ATOM   7182  N N   . GLU A  1 1059 ? 177.755 152.476 117.149 1.00 111.53 ? 1072 GLU A N   1 
ATOM   7183  C CA  . GLU A  1 1059 ? 178.750 153.225 116.413 1.00 111.53 ? 1072 GLU A CA  1 
ATOM   7184  C C   . GLU A  1 1059 ? 179.553 152.294 115.527 1.00 111.53 ? 1072 GLU A C   1 
ATOM   7185  O O   . GLU A  1 1059 ? 179.504 151.074 115.666 1.00 111.53 ? 1072 GLU A O   1 
ATOM   7186  C CB  . GLU A  1 1059 ? 179.670 153.947 117.379 1.00 111.53 ? 1072 GLU A CB  1 
ATOM   7187  C CG  . GLU A  1 1059 ? 180.206 153.044 118.453 1.00 111.53 ? 1072 GLU A CG  1 
ATOM   7188  C CD  . GLU A  1 1059 ? 179.236 152.887 119.604 1.00 111.53 ? 1072 GLU A CD  1 
ATOM   7189  O OE1 . GLU A  1 1059 ? 178.021 153.067 119.386 1.00 111.53 ? 1072 GLU A OE1 1 
ATOM   7190  O OE2 . GLU A  1 1059 ? 179.680 152.586 120.728 1.00 111.53 ? 1072 GLU A OE2 1 
ATOM   7191  N N   . LYS A  1 1060 ? 180.296 152.890 114.603 1.00 111.32 ? 1073 LYS A N   1 
ATOM   7192  C CA  . LYS A  1 1060 ? 181.138 152.145 113.687 1.00 111.32 ? 1073 LYS A CA  1 
ATOM   7193  C C   . LYS A  1 1060 ? 182.482 152.841 113.562 1.00 111.32 ? 1073 LYS A C   1 
ATOM   7194  O O   . LYS A  1 1060 ? 182.555 154.064 113.437 1.00 111.32 ? 1073 LYS A O   1 
ATOM   7195  C CB  . LYS A  1 1060 ? 180.491 152.032 112.311 1.00 111.32 ? 1073 LYS A CB  1 
ATOM   7196  C CG  . LYS A  1 1060 ? 179.137 151.351 112.291 1.00 111.32 ? 1073 LYS A CG  1 
ATOM   7197  C CD  . LYS A  1 1060 ? 178.433 151.464 110.930 1.00 111.32 ? 1073 LYS A CD  1 
ATOM   7198  C CE  . LYS A  1 1060 ? 179.047 150.552 109.885 1.00 111.32 ? 1073 LYS A CE  1 
ATOM   7199  N NZ  . LYS A  1 1060 ? 178.240 150.529 108.644 1.00 111.32 ? 1073 LYS A NZ  1 
ATOM   7200  N N   . ASN A  1 1061 ? 183.548 152.054 113.608 1.00 125.90 ? 1074 ASN A N   1 
ATOM   7201  C CA  . ASN A  1 1061 ? 184.863 152.578 113.290 1.00 125.90 ? 1074 ASN A CA  1 
ATOM   7202  C C   . ASN A  1 1061 ? 184.792 153.163 111.887 1.00 125.90 ? 1074 ASN A C   1 
ATOM   7203  O O   . ASN A  1 1061 ? 184.073 152.642 111.036 1.00 125.90 ? 1074 ASN A O   1 
ATOM   7204  C CB  . ASN A  1 1061 ? 185.923 151.474 113.378 1.00 125.90 ? 1074 ASN A CB  1 
ATOM   7205  C CG  . ASN A  1 1061 ? 185.690 150.506 114.550 1.00 125.90 ? 1074 ASN A CG  1 
ATOM   7206  O OD1 . ASN A  1 1061 ? 184.676 149.820 114.598 1.00 125.90 ? 1074 ASN A OD1 1 
ATOM   7207  N ND2 . ASN A  1 1061 ? 186.635 150.470 115.506 1.00 125.90 ? 1074 ASN A ND2 1 
ATOM   7208  N N   . PHE A  1 1062 ? 185.491 154.264 111.647 1.00 116.28 ? 1075 PHE A N   1 
ATOM   7209  C CA  . PHE A  1 1062 ? 185.461 154.858 110.320 1.00 116.28 ? 1075 PHE A CA  1 
ATOM   7210  C C   . PHE A  1 1062 ? 186.754 155.581 110.026 1.00 116.28 ? 1075 PHE A C   1 
ATOM   7211  O O   . PHE A  1 1062 ? 187.170 156.439 110.804 1.00 116.28 ? 1075 PHE A O   1 
ATOM   7212  C CB  . PHE A  1 1062 ? 184.321 155.849 110.176 1.00 116.28 ? 1075 PHE A CB  1 
ATOM   7213  C CG  . PHE A  1 1062 ? 183.007 155.214 109.988 1.00 116.28 ? 1075 PHE A CG  1 
ATOM   7214  C CD1 . PHE A  1 1062 ? 182.729 154.514 108.841 1.00 116.28 ? 1075 PHE A CD1 1 
ATOM   7215  C CD2 . PHE A  1 1062 ? 182.034 155.342 110.943 1.00 116.28 ? 1075 PHE A CD2 1 
ATOM   7216  C CE1 . PHE A  1 1062 ? 181.502 153.935 108.664 1.00 116.28 ? 1075 PHE A CE1 1 
ATOM   7217  C CE2 . PHE A  1 1062 ? 180.811 154.781 110.766 1.00 116.28 ? 1075 PHE A CE2 1 
ATOM   7218  C CZ  . PHE A  1 1062 ? 180.543 154.062 109.632 1.00 116.28 ? 1075 PHE A CZ  1 
ATOM   7219  N N   . THR A  1 1063 ? 187.354 155.273 108.887 1.00 114.74 ? 1076 THR A N   1 
ATOM   7220  C CA  . THR A  1 1063 ? 188.500 156.045 108.441 1.00 114.74 ? 1076 THR A CA  1 
ATOM   7221  C C   . THR A  1 1063 ? 188.153 157.522 108.408 1.00 114.74 ? 1076 THR A C   1 
ATOM   7222  O O   . THR A  1 1063 ? 187.176 157.931 107.773 1.00 114.74 ? 1076 THR A O   1 
ATOM   7223  C CB  . THR A  1 1063 ? 188.973 155.568 107.071 1.00 114.74 ? 1076 THR A CB  1 
ATOM   7224  O OG1 . THR A  1 1063 ? 190.003 156.438 106.589 1.00 114.74 ? 1076 THR A OG1 1 
ATOM   7225  C CG2 . THR A  1 1063 ? 187.845 155.519 106.091 1.00 114.74 ? 1076 THR A CG2 1 
ATOM   7226  N N   . THR A  1 1064 ? 188.939 158.312 109.130 1.00 110.30 ? 1077 THR A N   1 
ATOM   7227  C CA  . THR A  1 1064 ? 188.768 159.752 109.192 1.00 110.30 ? 1077 THR A CA  1 
ATOM   7228  C C   . THR A  1 1064 ? 190.119 160.409 108.975 1.00 110.30 ? 1077 THR A C   1 
ATOM   7229  O O   . THR A  1 1064 ? 191.160 159.762 109.059 1.00 110.30 ? 1077 THR A O   1 
ATOM   7230  C CB  . THR A  1 1064 ? 188.182 160.177 110.528 1.00 110.30 ? 1077 THR A CB  1 
ATOM   7231  O OG1 . THR A  1 1064 ? 188.955 159.592 111.573 1.00 110.30 ? 1077 THR A OG1 1 
ATOM   7232  C CG2 . THR A  1 1064 ? 186.758 159.690 110.651 1.00 110.30 ? 1077 THR A CG2 1 
ATOM   7233  N N   . ALA A  1 1065 ? 190.099 161.703 108.697 1.00 102.94 ? 1078 ALA A N   1 
ATOM   7234  C CA  . ALA A  1 1065 ? 191.303 162.394 108.267 1.00 102.94 ? 1078 ALA A CA  1 
ATOM   7235  C C   . ALA A  1 1065 ? 191.062 163.891 108.383 1.00 102.94 ? 1078 ALA A C   1 
ATOM   7236  O O   . ALA A  1 1065 ? 189.917 164.320 108.479 1.00 102.94 ? 1078 ALA A O   1 
ATOM   7237  C CB  . ALA A  1 1065 ? 191.673 162.010 106.829 1.00 102.94 ? 1078 ALA A CB  1 
ATOM   7238  N N   . PRO A  1 1066 ? 192.122 164.697 108.389 1.00 103.14 ? 1079 PRO A N   1 
ATOM   7239  C CA  . PRO A  1 1066 ? 191.939 166.135 108.606 1.00 103.14 ? 1079 PRO A CA  1 
ATOM   7240  C C   . PRO A  1 1066 ? 191.106 166.812 107.544 1.00 103.14 ? 1079 PRO A C   1 
ATOM   7241  O O   . PRO A  1 1066 ? 190.011 167.282 107.840 1.00 103.14 ? 1079 PRO A O   1 
ATOM   7242  C CB  . PRO A  1 1066 ? 193.371 166.672 108.591 1.00 103.14 ? 1079 PRO A CB  1 
ATOM   7243  C CG  . PRO A  1 1066 ? 194.141 165.651 107.871 1.00 103.14 ? 1079 PRO A CG  1 
ATOM   7244  C CD  . PRO A  1 1066 ? 193.547 164.360 108.290 1.00 103.14 ? 1079 PRO A CD  1 
ATOM   7245  N N   . ALA A  1 1067 ? 191.587 166.864 106.313 1.00 101.75 ? 1080 ALA A N   1 
ATOM   7246  C CA  . ALA A  1 1067 ? 190.814 167.465 105.235 1.00 101.75 ? 1080 ALA A CA  1 
ATOM   7247  C C   . ALA A  1 1067 ? 191.434 167.040 103.920 1.00 101.75 ? 1080 ALA A C   1 
ATOM   7248  O O   . ALA A  1 1067 ? 192.582 166.593 103.861 1.00 101.75 ? 1080 ALA A O   1 
ATOM   7249  C CB  . ALA A  1 1067 ? 190.744 168.987 105.347 1.00 101.75 ? 1080 ALA A CB  1 
ATOM   7250  N N   . ILE A  1 1068 ? 190.675 167.204 102.865 1.00 101.62 ? 1081 ILE A N   1 
ATOM   7251  C CA  . ILE A  1 1068 ? 191.080 166.735 101.557 1.00 101.62 ? 1081 ILE A CA  1 
ATOM   7252  C C   . ILE A  1 1068 ? 191.731 167.891 100.832 1.00 101.62 ? 1081 ILE A C   1 
ATOM   7253  O O   . ILE A  1 1068 ? 191.512 169.060 101.161 1.00 101.62 ? 1081 ILE A O   1 
ATOM   7254  C CB  . ILE A  1 1068 ? 189.880 166.182 100.764 1.00 101.62 ? 1081 ILE A CB  1 
ATOM   7255  C CG1 . ILE A  1 1068 ? 189.157 165.117 101.586 1.00 101.62 ? 1081 ILE A CG1 1 
ATOM   7256  C CG2 . ILE A  1 1068 ? 190.311 165.621 99.415  1.00 101.62 ? 1081 ILE A CG2 1 
ATOM   7257  C CD1 . ILE A  1 1068 ? 188.090 165.657 102.497 1.00 101.62 ? 1081 ILE A CD1 1 
ATOM   7258  N N   . CYS A  1 1069 ? 192.568 167.559 99.863  1.00 101.63 ? 1082 CYS A N   1 
ATOM   7259  C CA  . CYS A  1 1069 ? 193.107 168.547 98.944  1.00 101.63 ? 1082 CYS A CA  1 
ATOM   7260  C C   . CYS A  1 1069 ? 192.788 168.092 97.528  1.00 101.63 ? 1082 CYS A C   1 
ATOM   7261  O O   . CYS A  1 1069 ? 193.617 167.478 96.857  1.00 101.63 ? 1082 CYS A O   1 
ATOM   7262  C CB  . CYS A  1 1069 ? 194.543 168.691 99.162  1.00 101.63 ? 1082 CYS A CB  1 
ATOM   7263  S SG  . CYS A  1 1069 ? 194.987 168.865 100.884 1.00 101.63 ? 1082 CYS A SG  1 
ATOM   7264  N N   . HIS A  1 1070 ? 191.582 168.403 97.062  1.00 115.28 ? 1083 HIS A N   1 
ATOM   7265  C CA  . HIS A  1 1070 ? 191.319 168.226 95.644  1.00 115.28 ? 1083 HIS A CA  1 
ATOM   7266  C C   . HIS A  1 1070 ? 192.280 169.071 94.839  1.00 115.28 ? 1083 HIS A C   1 
ATOM   7267  O O   . HIS A  1 1070 ? 192.679 168.706 93.731  1.00 115.28 ? 1083 HIS A O   1 
ATOM   7268  C CB  . HIS A  1 1070 ? 189.885 168.603 95.303  1.00 115.28 ? 1083 HIS A CB  1 
ATOM   7269  C CG  . HIS A  1 1070 ? 189.611 168.656 93.831  1.00 115.28 ? 1083 HIS A CG  1 
ATOM   7270  N ND1 . HIS A  1 1070 ? 189.705 169.817 93.095  1.00 115.28 ? 1083 HIS A ND1 1 
ATOM   7271  C CD2 . HIS A  1 1070 ? 189.246 167.688 92.956  1.00 115.28 ? 1083 HIS A CD2 1 
ATOM   7272  C CE1 . HIS A  1 1070 ? 189.407 169.564 91.832  1.00 115.28 ? 1083 HIS A CE1 1 
ATOM   7273  N NE2 . HIS A  1 1070 ? 189.127 168.279 91.721  1.00 115.28 ? 1083 HIS A NE2 1 
ATOM   7274  N N   . ASP A  1 1071 ? 192.672 170.206 95.393  1.00 119.66 ? 1084 ASP A N   1 
ATOM   7275  C CA  . ASP A  1 1071 ? 193.571 171.094 94.687  1.00 119.66 ? 1084 ASP A CA  1 
ATOM   7276  C C   . ASP A  1 1071 ? 194.742 171.447 95.576  1.00 119.66 ? 1084 ASP A C   1 
ATOM   7277  O O   . ASP A  1 1071 ? 194.910 170.858 96.644  1.00 119.66 ? 1084 ASP A O   1 
ATOM   7278  C CB  . ASP A  1 1071 ? 192.823 172.341 94.257  1.00 119.66 ? 1084 ASP A CB  1 
ATOM   7279  C CG  . ASP A  1 1071 ? 191.707 172.029 93.301  1.00 119.66 ? 1084 ASP A CG  1 
ATOM   7280  O OD1 . ASP A  1 1071 ? 191.821 171.030 92.566  1.00 119.66 ? 1084 ASP A OD1 1 
ATOM   7281  O OD2 . ASP A  1 1071 ? 190.704 172.767 93.284  1.00 119.66 ? 1084 ASP A OD2 1 
ATOM   7282  N N   . GLY A  1 1072 ? 195.571 172.390 95.135  1.00 116.82 ? 1085 GLY A N   1 
ATOM   7283  C CA  . GLY A  1 1072 ? 196.518 172.989 96.050  1.00 116.82 ? 1085 GLY A CA  1 
ATOM   7284  C C   . GLY A  1 1072 ? 195.816 173.656 97.210  1.00 116.82 ? 1085 GLY A C   1 
ATOM   7285  O O   . GLY A  1 1072 ? 196.395 173.813 98.290  1.00 116.82 ? 1085 GLY A O   1 
ATOM   7286  N N   . LYS A  1 1073 ? 194.570 174.063 97.004  1.00 113.71 ? 1086 LYS A N   1 
ATOM   7287  C CA  . LYS A  1 1073 ? 193.707 174.500 98.084  1.00 113.71 ? 1086 LYS A CA  1 
ATOM   7288  C C   . LYS A  1 1073 ? 193.107 173.279 98.760  1.00 113.71 ? 1086 LYS A C   1 
ATOM   7289  O O   . LYS A  1 1073 ? 192.607 172.364 98.100  1.00 113.71 ? 1086 LYS A O   1 
ATOM   7290  C CB  . LYS A  1 1073 ? 192.595 175.407 97.567  1.00 113.71 ? 1086 LYS A CB  1 
ATOM   7291  C CG  . LYS A  1 1073 ? 191.942 174.905 96.311  1.00 113.71 ? 1086 LYS A CG  1 
ATOM   7292  C CD  . LYS A  1 1073 ? 190.728 175.734 95.973  1.00 113.71 ? 1086 LYS A CD  1 
ATOM   7293  C CE  . LYS A  1 1073 ? 189.530 175.308 96.783  1.00 113.71 ? 1086 LYS A CE  1 
ATOM   7294  N NZ  . LYS A  1 1073 ? 188.391 176.255 96.633  1.00 113.71 ? 1086 LYS A NZ  1 
ATOM   7295  N N   . ALA A  1 1074 ? 193.162 173.274 100.096 1.00 117.11 ? 1087 ALA A N   1 
ATOM   7296  C CA  . ALA A  1 1074 ? 192.620 172.155 100.903 1.00 117.11 ? 1087 ALA A CA  1 
ATOM   7297  C C   . ALA A  1 1074 ? 191.181 172.474 101.324 1.00 117.11 ? 1087 ALA A C   1 
ATOM   7298  O O   . ALA A  1 1074 ? 190.980 173.479 102.033 1.00 117.11 ? 1087 ALA A O   1 
ATOM   7299  C CB  . ALA A  1 1074 ? 193.505 171.910 102.100 1.00 117.11 ? 1087 ALA A CB  1 
ATOM   7300  N N   . HIS A  1 1075 ? 190.225 171.642 100.898 1.00 113.83 ? 1088 HIS A N   1 
ATOM   7301  C CA  . HIS A  1 1075 ? 188.791 171.843 101.240 1.00 113.83 ? 1088 HIS A CA  1 
ATOM   7302  C C   . HIS A  1 1075 ? 188.502 171.244 102.621 1.00 113.83 ? 1088 HIS A C   1 
ATOM   7303  O O   . HIS A  1 1075 ? 188.408 170.005 102.719 1.00 113.83 ? 1088 HIS A O   1 
ATOM   7304  C CB  . HIS A  1 1075 ? 187.892 171.238 100.153 1.00 113.83 ? 1088 HIS A CB  1 
ATOM   7305  C CG  . HIS A  1 1075 ? 188.176 171.752 98.781  1.00 113.83 ? 1088 HIS A CG  1 
ATOM   7306  N ND1 . HIS A  1 1075 ? 187.527 172.853 98.256  1.00 113.83 ? 1088 HIS A ND1 1 
ATOM   7307  C CD2 . HIS A  1 1075 ? 189.032 171.326 97.827  1.00 113.83 ? 1088 HIS A CD2 1 
ATOM   7308  C CE1 . HIS A  1 1075 ? 187.970 173.082 97.036  1.00 113.83 ? 1088 HIS A CE1 1 
ATOM   7309  N NE2 . HIS A  1 1075 ? 188.895 172.158 96.750  1.00 113.83 ? 1088 HIS A NE2 1 
ATOM   7310  N N   . PHE A  1 1076 ? 188.369 172.098 103.642 1.00 111.46 ? 1089 PHE A N   1 
ATOM   7311  C CA  . PHE A  1 1076 ? 188.087 171.630 105.025 1.00 111.46 ? 1089 PHE A CA  1 
ATOM   7312  C C   . PHE A  1 1076 ? 186.573 171.499 105.224 1.00 111.46 ? 1089 PHE A C   1 
ATOM   7313  O O   . PHE A  1 1076 ? 185.808 171.968 104.359 1.00 111.46 ? 1089 PHE A O   1 
ATOM   7314  C CB  . PHE A  1 1076 ? 188.714 172.573 106.055 1.00 111.46 ? 1089 PHE A CB  1 
ATOM   7315  C CG  . PHE A  1 1076 ? 190.222 172.619 106.033 1.00 111.46 ? 1089 PHE A CG  1 
ATOM   7316  C CD1 . PHE A  1 1076 ? 190.970 171.734 106.793 1.00 111.46 ? 1089 PHE A CD1 1 
ATOM   7317  C CD2 . PHE A  1 1076 ? 190.893 173.545 105.251 1.00 111.46 ? 1089 PHE A CD2 1 
ATOM   7318  C CE1 . PHE A  1 1076 ? 192.355 171.775 106.772 1.00 111.46 ? 1089 PHE A CE1 1 
ATOM   7319  C CE2 . PHE A  1 1076 ? 192.279 173.585 105.230 1.00 111.46 ? 1089 PHE A CE2 1 
ATOM   7320  C CZ  . PHE A  1 1076 ? 193.007 172.700 105.991 1.00 111.46 ? 1089 PHE A CZ  1 
ATOM   7321  N N   . PRO A  1 1077 ? 186.105 170.863 106.322 1.00 114.23 ? 1090 PRO A N   1 
ATOM   7322  C CA  . PRO A  1 1077 ? 184.673 170.696 106.578 1.00 114.23 ? 1090 PRO A CA  1 
ATOM   7323  C C   . PRO A  1 1077 ? 184.090 171.862 107.390 1.00 114.23 ? 1090 PRO A C   1 
ATOM   7324  O O   . PRO A  1 1077 ? 184.558 172.099 108.489 1.00 114.23 ? 1090 PRO A O   1 
ATOM   7325  C CB  . PRO A  1 1077 ? 184.662 169.422 107.432 1.00 114.23 ? 1090 PRO A CB  1 
ATOM   7326  C CG  . PRO A  1 1077 ? 185.925 169.535 108.259 1.00 114.23 ? 1090 PRO A CG  1 
ATOM   7327  C CD  . PRO A  1 1077 ? 186.925 170.246 107.368 1.00 114.23 ? 1090 PRO A CD  1 
ATOM   7328  N N   . ARG A  1 1078 ? 183.091 172.551 106.829 1.00 115.18 ? 1091 ARG A N   1 
ATOM   7329  C CA  . ARG A  1 1078 ? 182.447 173.665 107.505 1.00 115.18 ? 1091 ARG A CA  1 
ATOM   7330  C C   . ARG A  1 1078 ? 182.080 173.295 108.927 1.00 115.18 ? 1091 ARG A C   1 
ATOM   7331  O O   . ARG A  1 1078 ? 182.497 173.951 109.884 1.00 115.18 ? 1091 ARG A O   1 
ATOM   7332  C CB  . ARG A  1 1078 ? 181.200 174.076 106.733 1.00 115.18 ? 1091 ARG A CB  1 
ATOM   7333  C CG  . ARG A  1 1078 ? 181.412 174.304 105.275 1.00 115.18 ? 1091 ARG A CG  1 
ATOM   7334  C CD  . ARG A  1 1078 ? 180.141 174.766 104.608 1.00 115.18 ? 1091 ARG A CD  1 
ATOM   7335  N NE  . ARG A  1 1078 ? 180.404 175.161 103.235 1.00 115.18 ? 1091 ARG A NE  1 
ATOM   7336  C CZ  . ARG A  1 1078 ? 181.014 176.289 102.891 1.00 115.18 ? 1091 ARG A CZ  1 
ATOM   7337  N NH1 . ARG A  1 1078 ? 181.434 177.142 103.811 1.00 115.18 ? 1091 ARG A NH1 1 
ATOM   7338  N NH2 . ARG A  1 1078 ? 181.214 176.563 101.617 1.00 115.18 ? 1091 ARG A NH2 1 
ATOM   7339  N N   . GLU A  1 1079 ? 181.277 172.252 109.078 1.00 108.87 ? 1092 GLU A N   1 
ATOM   7340  C CA  . GLU A  1 1079 ? 180.707 171.885 110.366 1.00 108.87 ? 1092 GLU A CA  1 
ATOM   7341  C C   . GLU A  1 1079 ? 180.738 170.369 110.475 1.00 108.87 ? 1092 GLU A C   1 
ATOM   7342  O O   . GLU A  1 1079 ? 179.846 169.690 109.963 1.00 108.87 ? 1092 GLU A O   1 
ATOM   7343  C CB  . GLU A  1 1079 ? 179.293 172.418 110.491 1.00 108.87 ? 1092 GLU A CB  1 
ATOM   7344  C CG  . GLU A  1 1079 ? 179.233 173.921 110.580 1.00 108.87 ? 1092 GLU A CG  1 
ATOM   7345  C CD  . GLU A  1 1079 ? 179.310 174.585 109.236 1.00 108.87 ? 1092 GLU A CD  1 
ATOM   7346  O OE1 . GLU A  1 1079 ? 180.060 175.575 109.103 1.00 108.87 ? 1092 GLU A OE1 1 
ATOM   7347  O OE2 . GLU A  1 1079 ? 178.635 174.101 108.308 1.00 108.87 ? 1092 GLU A OE2 1 
ATOM   7348  N N   . GLY A  1 1080 ? 181.764 169.847 111.134 1.00 100.90 ? 1093 GLY A N   1 
ATOM   7349  C CA  . GLY A  1 1080 ? 181.864 168.418 111.336 1.00 100.90 ? 1093 GLY A CA  1 
ATOM   7350  C C   . GLY A  1 1080 ? 183.198 167.836 110.931 1.00 100.90 ? 1093 GLY A C   1 
ATOM   7351  O O   . GLY A  1 1080 ? 184.250 168.419 111.196 1.00 100.90 ? 1093 GLY A O   1 
ATOM   7352  N N   . VAL A  1 1081 ? 183.158 166.695 110.252 1.00 96.37  ? 1094 VAL A N   1 
ATOM   7353  C CA  . VAL A  1 1081 ? 184.347 165.940 109.891 1.00 96.37  ? 1094 VAL A CA  1 
ATOM   7354  C C   . VAL A  1 1081 ? 184.048 165.075 108.684 1.00 96.37  ? 1094 VAL A C   1 
ATOM   7355  O O   . VAL A  1 1081 ? 182.884 164.856 108.328 1.00 96.37  ? 1094 VAL A O   1 
ATOM   7356  C CB  . VAL A  1 1081 ? 184.828 165.059 111.047 1.00 96.37  ? 1094 VAL A CB  1 
ATOM   7357  C CG1 . VAL A  1 1081 ? 185.596 165.867 112.034 1.00 96.37  ? 1094 VAL A CG1 1 
ATOM   7358  C CG2 . VAL A  1 1081 ? 183.639 164.432 111.711 1.00 96.37  ? 1094 VAL A CG2 1 
ATOM   7359  N N   . PHE A  1 1082 ? 185.097 164.584 108.043 1.00 103.57 ? 1095 PHE A N   1 
ATOM   7360  C CA  . PHE A  1 1082 ? 184.914 163.676 106.930 1.00 103.57 ? 1095 PHE A CA  1 
ATOM   7361  C C   . PHE A  1 1082 ? 184.865 162.232 107.415 1.00 103.57 ? 1095 PHE A C   1 
ATOM   7362  O O   . PHE A  1 1082 ? 185.171 161.918 108.567 1.00 103.57 ? 1095 PHE A O   1 
ATOM   7363  C CB  . PHE A  1 1082 ? 186.031 163.858 105.910 1.00 103.57 ? 1095 PHE A CB  1 
ATOM   7364  C CG  . PHE A  1 1082 ? 186.236 165.281 105.498 1.00 103.57 ? 1095 PHE A CG  1 
ATOM   7365  C CD1 . PHE A  1 1082 ? 185.266 165.951 104.792 1.00 103.57 ? 1095 PHE A CD1 1 
ATOM   7366  C CD2 . PHE A  1 1082 ? 187.401 165.948 105.814 1.00 103.57 ? 1095 PHE A CD2 1 
ATOM   7367  C CE1 . PHE A  1 1082 ? 185.457 167.259 104.417 1.00 103.57 ? 1095 PHE A CE1 1 
ATOM   7368  C CE2 . PHE A  1 1082 ? 187.587 167.255 105.435 1.00 103.57 ? 1095 PHE A CE2 1 
ATOM   7369  C CZ  . PHE A  1 1082 ? 186.624 167.907 104.736 1.00 103.57 ? 1095 PHE A CZ  1 
ATOM   7370  N N   . VAL A  1 1083 ? 184.466 161.352 106.506 1.00 102.76 ? 1096 VAL A N   1 
ATOM   7371  C CA  . VAL A  1 1083 ? 184.341 159.929 106.786 1.00 102.76 ? 1096 VAL A CA  1 
ATOM   7372  C C   . VAL A  1 1083 ? 184.356 159.192 105.464 1.00 102.76 ? 1096 VAL A C   1 
ATOM   7373  O O   . VAL A  1 1083 ? 183.782 159.659 104.481 1.00 102.76 ? 1096 VAL A O   1 
ATOM   7374  C CB  . VAL A  1 1083 ? 183.052 159.626 107.557 1.00 102.76 ? 1096 VAL A CB  1 
ATOM   7375  C CG1 . VAL A  1 1083 ? 181.879 160.217 106.812 1.00 102.76 ? 1096 VAL A CG1 1 
ATOM   7376  C CG2 . VAL A  1 1083 ? 182.892 158.134 107.715 1.00 102.76 ? 1096 VAL A CG2 1 
ATOM   7377  N N   . SER A  1 1084 ? 185.035 158.057 105.417 1.00 105.23 ? 1097 SER A N   1 
ATOM   7378  C CA  . SER A  1 1084 ? 185.052 157.282 104.192 1.00 105.23 ? 1097 SER A CA  1 
ATOM   7379  C C   . SER A  1 1084 ? 184.627 155.845 104.446 1.00 105.23 ? 1097 SER A C   1 
ATOM   7380  O O   . SER A  1 1084 ? 184.954 155.247 105.472 1.00 105.23 ? 1097 SER A O   1 
ATOM   7381  C CB  . SER A  1 1084 ? 186.415 157.287 103.542 1.00 105.23 ? 1097 SER A CB  1 
ATOM   7382  O OG  . SER A  1 1084 ? 186.319 156.703 102.258 1.00 105.23 ? 1097 SER A OG  1 
ATOM   7383  N N   . ASN A  1 1085 ? 183.882 155.300 103.490 1.00 108.23 ? 1098 ASN A N   1 
ATOM   7384  C CA  . ASN A  1 1085 ? 183.612 153.874 103.426 1.00 108.23 ? 1098 ASN A CA  1 
ATOM   7385  C C   . ASN A  1 1085 ? 184.786 153.163 102.782 1.00 108.23 ? 1098 ASN A C   1 
ATOM   7386  O O   . ASN A  1 1085 ? 184.788 151.940 102.646 1.00 108.23 ? 1098 ASN A O   1 
ATOM   7387  C CB  . ASN A  1 1085 ? 182.338 153.601 102.629 1.00 108.23 ? 1098 ASN A CB  1 
ATOM   7388  C CG  . ASN A  1 1085 ? 182.377 154.257 101.266 1.00 108.23 ? 1098 ASN A CG  1 
ATOM   7389  O OD1 . ASN A  1 1085 ? 183.178 155.170 101.062 1.00 108.23 ? 1098 ASN A OD1 1 
ATOM   7390  N ND2 . ASN A  1 1085 ? 181.533 153.811 100.320 1.00 108.23 ? 1098 ASN A ND2 1 
ATOM   7391  N N   . GLY A  1 1086 ? 185.798 153.926 102.421 1.00 119.75 ? 1099 GLY A N   1 
ATOM   7392  C CA  . GLY A  1 1086 ? 186.844 153.500 101.499 1.00 119.75 ? 1099 GLY A CA  1 
ATOM   7393  C C   . GLY A  1 1086 ? 186.693 153.960 100.053 1.00 119.75 ? 1099 GLY A C   1 
ATOM   7394  O O   . GLY A  1 1086 ? 187.611 154.565 99.500  1.00 119.75 ? 1099 GLY A O   1 
ATOM   7395  N N   . THR A  1 1087 ? 185.539 153.691 99.437  1.00 113.87 ? 1100 THR A N   1 
ATOM   7396  C CA  . THR A  1 1087 ? 185.342 154.055 98.037  1.00 113.87 ? 1100 THR A CA  1 
ATOM   7397  C C   . THR A  1 1087 ? 185.429 155.557 97.847  1.00 113.87 ? 1100 THR A C   1 
ATOM   7398  O O   . THR A  1 1087 ? 185.984 156.036 96.856  1.00 113.87 ? 1100 THR A O   1 
ATOM   7399  C CB  . THR A  1 1087 ? 183.990 153.558 97.532  1.00 113.87 ? 1100 THR A CB  1 
ATOM   7400  O OG1 . THR A  1 1087 ? 182.942 154.288 98.178  1.00 113.87 ? 1100 THR A OG1 1 
ATOM   7401  C CG2 . THR A  1 1087 ? 183.822 152.089 97.818  1.00 113.87 ? 1100 THR A CG2 1 
ATOM   7402  N N   . HIS A  1 1088 ? 184.870 156.312 98.779  1.00 111.06 ? 1101 HIS A N   1 
ATOM   7403  C CA  . HIS A  1 1088 ? 184.788 157.753 98.654  1.00 111.06 ? 1101 HIS A CA  1 
ATOM   7404  C C   . HIS A  1 1088 ? 184.870 158.376 100.035 1.00 111.06 ? 1101 HIS A C   1 
ATOM   7405  O O   . HIS A  1 1088 ? 184.869 157.683 101.051 1.00 111.06 ? 1101 HIS A O   1 
ATOM   7406  C CB  . HIS A  1 1088 ? 183.481 158.164 97.988  1.00 111.06 ? 1101 HIS A CB  1 
ATOM   7407  C CG  . HIS A  1 1088 ? 183.142 157.340 96.797  1.00 111.06 ? 1101 HIS A CG  1 
ATOM   7408  N ND1 . HIS A  1 1088 ? 182.345 156.220 96.875  1.00 111.06 ? 1101 HIS A ND1 1 
ATOM   7409  C CD2 . HIS A  1 1088 ? 183.530 157.439 95.506  1.00 111.06 ? 1101 HIS A CD2 1 
ATOM   7410  C CE1 . HIS A  1 1088 ? 182.225 155.685 95.674  1.00 111.06 ? 1101 HIS A CE1 1 
ATOM   7411  N NE2 . HIS A  1 1088 ? 182.938 156.404 94.825  1.00 111.06 ? 1101 HIS A NE2 1 
ATOM   7412  N N   . TRP A  1 1089 ? 184.906 159.700 100.065 1.00 106.10 ? 1102 TRP A N   1 
ATOM   7413  C CA  . TRP A  1 1089 ? 184.810 160.448 101.304 1.00 106.10 ? 1102 TRP A CA  1 
ATOM   7414  C C   . TRP A  1 1089 ? 183.486 161.196 101.348 1.00 106.10 ? 1102 TRP A C   1 
ATOM   7415  O O   . TRP A  1 1089 ? 182.817 161.377 100.330 1.00 106.10 ? 1102 TRP A O   1 
ATOM   7416  C CB  . TRP A  1 1089 ? 185.972 161.427 101.447 1.00 106.10 ? 1102 TRP A CB  1 
ATOM   7417  C CG  . TRP A  1 1089 ? 187.203 160.772 101.897 1.00 106.10 ? 1102 TRP A CG  1 
ATOM   7418  C CD1 . TRP A  1 1089 ? 188.247 160.396 101.126 1.00 106.10 ? 1102 TRP A CD1 1 
ATOM   7419  C CD2 . TRP A  1 1089 ? 187.526 160.396 103.231 1.00 106.10 ? 1102 TRP A CD2 1 
ATOM   7420  N NE1 . TRP A  1 1089 ? 189.214 159.812 101.898 1.00 106.10 ? 1102 TRP A NE1 1 
ATOM   7421  C CE2 . TRP A  1 1089 ? 188.791 159.800 103.200 1.00 106.10 ? 1102 TRP A CE2 1 
ATOM   7422  C CE3 . TRP A  1 1089 ? 186.875 160.517 104.450 1.00 106.10 ? 1102 TRP A CE3 1 
ATOM   7423  C CZ2 . TRP A  1 1089 ? 189.412 159.314 104.340 1.00 106.10 ? 1102 TRP A CZ2 1 
ATOM   7424  C CZ3 . TRP A  1 1089 ? 187.488 160.032 105.575 1.00 106.10 ? 1102 TRP A CZ3 1 
ATOM   7425  C CH2 . TRP A  1 1089 ? 188.742 159.438 105.516 1.00 106.10 ? 1102 TRP A CH2 1 
ATOM   7426  N N   . PHE A  1 1090 ? 183.106 161.613 102.552 1.00 100.55 ? 1103 PHE A N   1 
ATOM   7427  C CA  . PHE A  1 1090 ? 181.846 162.301 102.765 1.00 100.55 ? 1103 PHE A CA  1 
ATOM   7428  C C   . PHE A  1 1090 ? 181.991 163.235 103.951 1.00 100.55 ? 1103 PHE A C   1 
ATOM   7429  O O   . PHE A  1 1090 ? 182.839 163.039 104.823 1.00 100.55 ? 1103 PHE A O   1 
ATOM   7430  C CB  . PHE A  1 1090 ? 180.718 161.306 102.991 1.00 100.55 ? 1103 PHE A CB  1 
ATOM   7431  C CG  . PHE A  1 1090 ? 180.548 160.378 101.868 1.00 100.55 ? 1103 PHE A CG  1 
ATOM   7432  C CD1 . PHE A  1 1090 ? 179.878 160.776 100.738 1.00 100.55 ? 1103 PHE A CD1 1 
ATOM   7433  C CD2 . PHE A  1 1090 ? 181.126 159.131 101.903 1.00 100.55 ? 1103 PHE A CD2 1 
ATOM   7434  C CE1 . PHE A  1 1090 ? 179.749 159.926 99.671  1.00 100.55 ? 1103 PHE A CE1 1 
ATOM   7435  C CE2 . PHE A  1 1090 ? 181.003 158.278 100.843 1.00 100.55 ? 1103 PHE A CE2 1 
ATOM   7436  C CZ  . PHE A  1 1090 ? 180.312 158.674 99.722  1.00 100.55 ? 1103 PHE A CZ  1 
ATOM   7437  N N   . VAL A  1 1091 ? 181.126 164.236 103.989 1.00 93.56  ? 1104 VAL A N   1 
ATOM   7438  C CA  . VAL A  1 1091 ? 181.053 165.187 105.086 1.00 93.56  ? 1104 VAL A CA  1 
ATOM   7439  C C   . VAL A  1 1091 ? 179.999 164.719 106.068 1.00 93.56  ? 1104 VAL A C   1 
ATOM   7440  O O   . VAL A  1 1091 ? 179.060 164.007 105.702 1.00 93.56  ? 1104 VAL A O   1 
ATOM   7441  C CB  . VAL A  1 1091 ? 180.721 166.593 104.574 1.00 93.56  ? 1104 VAL A CB  1 
ATOM   7442  C CG1 . VAL A  1 1091 ? 181.877 167.131 103.815 1.00 93.56  ? 1104 VAL A CG1 1 
ATOM   7443  C CG2 . VAL A  1 1091 ? 179.519 166.523 103.653 1.00 93.56  ? 1104 VAL A CG2 1 
ATOM   7444  N N   . THR A  1 1092 ? 180.154 165.111 107.325 1.00 88.84  ? 1105 THR A N   1 
ATOM   7445  C CA  . THR A  1 1092 ? 179.178 164.668 108.300 1.00 88.84  ? 1105 THR A CA  1 
ATOM   7446  C C   . THR A  1 1092 ? 179.311 165.496 109.566 1.00 88.84  ? 1105 THR A C   1 
ATOM   7447  O O   . THR A  1 1092 ? 180.376 166.043 109.855 1.00 88.84  ? 1105 THR A O   1 
ATOM   7448  C CB  . THR A  1 1092 ? 179.361 163.181 108.595 1.00 88.84  ? 1105 THR A CB  1 
ATOM   7449  O OG1 . THR A  1 1092 ? 179.189 162.437 107.385 1.00 88.84  ? 1105 THR A OG1 1 
ATOM   7450  C CG2 . THR A  1 1092 ? 178.337 162.703 109.582 1.00 88.84  ? 1105 THR A CG2 1 
ATOM   7451  N N   . GLN A  1 1093 ? 178.204 165.598 110.299 1.00 89.21  ? 1106 GLN A N   1 
ATOM   7452  C CA  . GLN A  1 1093 ? 178.134 166.241 111.605 1.00 89.21  ? 1106 GLN A CA  1 
ATOM   7453  C C   . GLN A  1 1093 ? 178.595 165.324 112.726 1.00 89.21  ? 1106 GLN A C   1 
ATOM   7454  O O   . GLN A  1 1093 ? 179.256 164.314 112.489 1.00 89.21  ? 1106 GLN A O   1 
ATOM   7455  C CB  . GLN A  1 1093 ? 176.714 166.698 111.884 1.00 89.21  ? 1106 GLN A CB  1 
ATOM   7456  C CG  . GLN A  1 1093 ? 175.746 165.602 111.642 1.00 89.21  ? 1106 GLN A CG  1 
ATOM   7457  C CD  . GLN A  1 1093 ? 175.840 164.534 112.693 1.00 89.21  ? 1106 GLN A CD  1 
ATOM   7458  O OE1 . GLN A  1 1093 ? 176.029 164.820 113.869 1.00 89.21  ? 1106 GLN A OE1 1 
ATOM   7459  N NE2 . GLN A  1 1093 ? 175.824 163.299 112.261 1.00 89.21  ? 1106 GLN A NE2 1 
ATOM   7460  N N   . ARG A  1 1094 ? 178.201 165.649 113.952 1.00 92.54  ? 1107 ARG A N   1 
ATOM   7461  C CA  . ARG A  1 1094 ? 178.838 165.076 115.119 1.00 92.54  ? 1107 ARG A CA  1 
ATOM   7462  C C   . ARG A  1 1094 ? 178.047 163.999 115.835 1.00 92.54  ? 1107 ARG A C   1 
ATOM   7463  O O   . ARG A  1 1094 ? 178.612 163.336 116.708 1.00 92.54  ? 1107 ARG A O   1 
ATOM   7464  C CB  . ARG A  1 1094 ? 179.170 166.177 116.126 1.00 92.54  ? 1107 ARG A CB  1 
ATOM   7465  C CG  . ARG A  1 1094 ? 180.244 165.778 117.110 1.00 92.54  ? 1107 ARG A CG  1 
ATOM   7466  C CD  . ARG A  1 1094 ? 181.313 164.962 116.404 1.00 92.54  ? 1107 ARG A CD  1 
ATOM   7467  N NE  . ARG A  1 1094 ? 181.724 165.566 115.140 1.00 92.54  ? 1107 ARG A NE  1 
ATOM   7468  C CZ  . ARG A  1 1094 ? 182.784 166.343 115.004 1.00 92.54  ? 1107 ARG A CZ  1 
ATOM   7469  N NH1 . ARG A  1 1094 ? 183.556 166.564 116.051 1.00 92.54  ? 1107 ARG A NH1 1 
ATOM   7470  N NH2 . ARG A  1 1094 ? 183.084 166.862 113.824 1.00 92.54  ? 1107 ARG A NH2 1 
ATOM   7471  N N   . ASN A  1 1095 ? 176.764 163.825 115.573 1.00 86.92  ? 1108 ASN A N   1 
ATOM   7472  C CA  . ASN A  1 1095 ? 176.064 162.845 116.394 1.00 86.92  ? 1108 ASN A CA  1 
ATOM   7473  C C   . ASN A  1 1095 ? 174.997 162.099 115.608 1.00 86.92  ? 1108 ASN A C   1 
ATOM   7474  O O   . ASN A  1 1095 ? 173.873 161.903 116.080 1.00 86.92  ? 1108 ASN A O   1 
ATOM   7475  C CB  . ASN A  1 1095 ? 175.494 163.500 117.643 1.00 86.92  ? 1108 ASN A CB  1 
ATOM   7476  C CG  . ASN A  1 1095 ? 176.529 163.643 118.736 1.00 86.92  ? 1108 ASN A CG  1 
ATOM   7477  O OD1 . ASN A  1 1095 ? 176.533 162.873 119.684 1.00 86.92  ? 1108 ASN A OD1 1 
ATOM   7478  N ND2 . ASN A  1 1095 ? 177.417 164.621 118.604 1.00 86.92  ? 1108 ASN A ND2 1 
ATOM   7479  N N   . PHE A  1 1096 ? 175.345 161.666 114.405 1.00 86.40  ? 1109 PHE A N   1 
ATOM   7480  C CA  . PHE A  1 1096 ? 174.578 160.698 113.637 1.00 86.40  ? 1109 PHE A CA  1 
ATOM   7481  C C   . PHE A  1 1096 ? 175.388 160.359 112.404 1.00 86.40  ? 1109 PHE A C   1 
ATOM   7482  O O   . PHE A  1 1096 ? 176.038 161.233 111.834 1.00 86.40  ? 1109 PHE A O   1 
ATOM   7483  C CB  . PHE A  1 1096 ? 173.210 161.243 113.250 1.00 86.40  ? 1109 PHE A CB  1 
ATOM   7484  C CG  . PHE A  1 1096 ? 172.606 160.581 112.046 1.00 86.40  ? 1109 PHE A CG  1 
ATOM   7485  C CD1 . PHE A  1 1096 ? 172.473 159.214 111.975 1.00 86.40  ? 1109 PHE A CD1 1 
ATOM   7486  C CD2 . PHE A  1 1096 ? 172.098 161.332 111.017 1.00 86.40  ? 1109 PHE A CD2 1 
ATOM   7487  C CE1 . PHE A  1 1096 ? 171.900 158.616 110.868 1.00 86.40  ? 1109 PHE A CE1 1 
ATOM   7488  C CE2 . PHE A  1 1096 ? 171.510 160.733 109.923 1.00 86.40  ? 1109 PHE A CE2 1 
ATOM   7489  C CZ  . PHE A  1 1096 ? 171.413 159.380 109.851 1.00 86.40  ? 1109 PHE A CZ  1 
ATOM   7490  N N   . TYR A  1 1097 ? 175.362 159.118 111.972 1.00 86.36  ? 1110 TYR A N   1 
ATOM   7491  C CA  . TYR A  1 1097 ? 176.041 158.777 110.737 1.00 86.36  ? 1110 TYR A CA  1 
ATOM   7492  C C   . TYR A  1 1097 ? 175.335 159.485 109.587 1.00 86.36  ? 1110 TYR A C   1 
ATOM   7493  O O   . TYR A  1 1097 ? 174.303 159.026 109.109 1.00 86.36  ? 1110 TYR A O   1 
ATOM   7494  C CB  . TYR A  1 1097 ? 176.030 157.271 110.551 1.00 86.36  ? 1110 TYR A CB  1 
ATOM   7495  C CG  . TYR A  1 1097 ? 176.789 156.844 109.349 1.00 86.36  ? 1110 TYR A CG  1 
ATOM   7496  C CD1 . TYR A  1 1097 ? 178.161 156.735 109.385 1.00 86.36  ? 1110 TYR A CD1 1 
ATOM   7497  C CD2 . TYR A  1 1097 ? 176.144 156.578 108.167 1.00 86.36  ? 1110 TYR A CD2 1 
ATOM   7498  C CE1 . TYR A  1 1097 ? 178.866 156.360 108.281 1.00 86.36  ? 1110 TYR A CE1 1 
ATOM   7499  C CE2 . TYR A  1 1097 ? 176.842 156.198 107.057 1.00 86.36  ? 1110 TYR A CE2 1 
ATOM   7500  C CZ  . TYR A  1 1097 ? 178.205 156.088 107.121 1.00 86.36  ? 1110 TYR A CZ  1 
ATOM   7501  O OH  . TYR A  1 1097 ? 178.911 155.708 106.010 1.00 86.36  ? 1110 TYR A OH  1 
ATOM   7502  N N   . GLU A  1 1098 ? 175.884 160.616 109.136 1.00 85.71  ? 1111 GLU A N   1 
ATOM   7503  C CA  . GLU A  1 1098 ? 175.306 161.428 108.062 1.00 85.71  ? 1111 GLU A CA  1 
ATOM   7504  C C   . GLU A  1 1098 ? 176.299 161.633 106.931 1.00 85.71  ? 1111 GLU A C   1 
ATOM   7505  O O   . GLU A  1 1098 ? 176.937 162.688 106.831 1.00 85.71  ? 1111 GLU A O   1 
ATOM   7506  C CB  . GLU A  1 1098 ? 174.841 162.793 108.554 1.00 85.71  ? 1111 GLU A CB  1 
ATOM   7507  C CG  . GLU A  1 1098 ? 173.358 162.941 108.591 1.00 85.71  ? 1111 GLU A CG  1 
ATOM   7508  C CD  . GLU A  1 1098 ? 172.896 164.321 108.988 1.00 85.71  ? 1111 GLU A CD  1 
ATOM   7509  O OE1 . GLU A  1 1098 ? 173.748 165.189 109.258 1.00 85.71  ? 1111 GLU A OE1 1 
ATOM   7510  O OE2 . GLU A  1 1098 ? 171.670 164.533 109.051 1.00 85.71  ? 1111 GLU A OE2 1 
ATOM   7511  N N   . PRO A  1 1099 ? 176.414 160.678 106.033 1.00 92.29  ? 1112 PRO A N   1 
ATOM   7512  C CA  . PRO A  1 1099 ? 177.268 160.873 104.863 1.00 92.29  ? 1112 PRO A CA  1 
ATOM   7513  C C   . PRO A  1 1099 ? 176.631 161.832 103.871 1.00 92.29  ? 1112 PRO A C   1 
ATOM   7514  O O   . PRO A  1 1099 ? 175.409 161.874 103.730 1.00 92.29  ? 1112 PRO A O   1 
ATOM   7515  C CB  . PRO A  1 1099 ? 177.382 159.465 104.284 1.00 92.29  ? 1112 PRO A CB  1 
ATOM   7516  C CG  . PRO A  1 1099 ? 176.108 158.811 104.703 1.00 92.29  ? 1112 PRO A CG  1 
ATOM   7517  C CD  . PRO A  1 1099 ? 175.756 159.368 106.038 1.00 92.29  ? 1112 PRO A CD  1 
ATOM   7518  N N   . GLN A  1 1100 ? 177.473 162.614 103.193 1.00 91.03  ? 1113 GLN A N   1 
ATOM   7519  C CA  . GLN A  1 1100 ? 177.041 163.530 102.145 1.00 91.03  ? 1113 GLN A CA  1 
ATOM   7520  C C   . GLN A  1 1100 ? 178.222 163.847 101.242 1.00 91.03  ? 1113 GLN A C   1 
ATOM   7521  O O   . GLN A  1 1100 ? 179.368 163.871 101.691 1.00 91.03  ? 1113 GLN A O   1 
ATOM   7522  C CB  . GLN A  1 1100 ? 176.474 164.831 102.714 1.00 91.03  ? 1113 GLN A CB  1 
ATOM   7523  C CG  . GLN A  1 1100 ? 175.002 164.782 103.062 1.00 91.03  ? 1113 GLN A CG  1 
ATOM   7524  C CD  . GLN A  1 1100 ? 174.416 166.153 103.321 1.00 91.03  ? 1113 GLN A CD  1 
ATOM   7525  O OE1 . GLN A  1 1100 ? 174.095 166.885 102.390 1.00 91.03  ? 1113 GLN A OE1 1 
ATOM   7526  N NE2 . GLN A  1 1100 ? 174.270 166.505 104.589 1.00 91.03  ? 1113 GLN A NE2 1 
ATOM   7527  N N   . ILE A  1 1101 ? 177.930 164.105 99.963  1.00 99.56  ? 1114 ILE A N   1 
ATOM   7528  C CA  . ILE A  1 1101 ? 178.980 164.418 98.994  1.00 99.56  ? 1114 ILE A CA  1 
ATOM   7529  C C   . ILE A  1 1101 ? 179.559 165.799 99.267  1.00 99.56  ? 1114 ILE A C   1 
ATOM   7530  O O   . ILE A  1 1101 ? 178.831 166.763 99.538  1.00 99.56  ? 1114 ILE A O   1 
ATOM   7531  C CB  . ILE A  1 1101 ? 178.456 164.328 97.550  1.00 99.56  ? 1114 ILE A CB  1 
ATOM   7532  C CG1 . ILE A  1 1101 ? 179.550 164.732 96.564  1.00 99.56  ? 1114 ILE A CG1 1 
ATOM   7533  C CG2 . ILE A  1 1101 ? 177.259 165.227 97.349  1.00 99.56  ? 1114 ILE A CG2 1 
ATOM   7534  C CD1 . ILE A  1 1101 ? 180.786 163.883 96.645  1.00 99.56  ? 1114 ILE A CD1 1 
ATOM   7535  N N   . ILE A  1 1102 ? 180.879 165.904 99.178  1.00 93.56  ? 1115 ILE A N   1 
ATOM   7536  C CA  . ILE A  1 1102 ? 181.554 167.170 99.417  1.00 93.56  ? 1115 ILE A CA  1 
ATOM   7537  C C   . ILE A  1 1102 ? 181.301 168.094 98.238  1.00 93.56  ? 1115 ILE A C   1 
ATOM   7538  O O   . ILE A  1 1102 ? 181.532 167.729 97.081  1.00 93.56  ? 1115 ILE A O   1 
ATOM   7539  C CB  . ILE A  1 1102 ? 183.055 166.972 99.648  1.00 93.56  ? 1115 ILE A CB  1 
ATOM   7540  C CG1 . ILE A  1 1102 ? 183.305 166.296 100.986 1.00 93.56  ? 1115 ILE A CG1 1 
ATOM   7541  C CG2 . ILE A  1 1102 ? 183.746 168.303 99.662  1.00 93.56  ? 1115 ILE A CG2 1 
ATOM   7542  C CD1 . ILE A  1 1102 ? 183.424 164.824 100.934 1.00 93.56  ? 1115 ILE A CD1 1 
ATOM   7543  N N   . THR A  1 1103 ? 180.790 169.279 98.534  1.00 106.04 ? 1116 THR A N   1 
ATOM   7544  C CA  . THR A  1 1103 ? 180.712 170.378 97.596  1.00 106.04 ? 1116 THR A CA  1 
ATOM   7545  C C   . THR A  1 1103 ? 181.096 171.636 98.347  1.00 106.04 ? 1116 THR A C   1 
ATOM   7546  O O   . THR A  1 1103 ? 180.956 171.710 99.567  1.00 106.04 ? 1116 THR A O   1 
ATOM   7547  C CB  . THR A  1 1103 ? 179.313 170.542 97.025  1.00 106.04 ? 1116 THR A CB  1 
ATOM   7548  O OG1 . THR A  1 1103 ? 178.443 170.969 98.074  1.00 106.04 ? 1116 THR A OG1 1 
ATOM   7549  C CG2 . THR A  1 1103 ? 178.807 169.223 96.478  1.00 106.04 ? 1116 THR A CG2 1 
ATOM   7550  N N   . THR A  1 1104 ? 181.552 172.651 97.614  1.00 111.53 ? 1117 THR A N   1 
ATOM   7551  C CA  . THR A  1 1104 ? 181.867 173.898 98.293  1.00 111.53 ? 1117 THR A CA  1 
ATOM   7552  C C   . THR A  1 1104 ? 180.677 174.430 99.051  1.00 111.53 ? 1117 THR A C   1 
ATOM   7553  O O   . THR A  1 1104 ? 180.817 175.403 99.791  1.00 111.53 ? 1117 THR A O   1 
ATOM   7554  C CB  . THR A  1 1104 ? 182.323 174.975 97.326  1.00 111.53 ? 1117 THR A CB  1 
ATOM   7555  O OG1 . THR A  1 1104 ? 182.970 176.017 98.060  1.00 111.53 ? 1117 THR A OG1 1 
ATOM   7556  C CG2 . THR A  1 1104 ? 181.124 175.577 96.645  1.00 111.53 ? 1117 THR A CG2 1 
ATOM   7557  N N   . ASP A  1 1105 ? 179.510 173.830 98.864  1.00 118.36 ? 1118 ASP A N   1 
ATOM   7558  C CA  . ASP A  1 1105 ? 178.377 174.159 99.702  1.00 118.36 ? 1118 ASP A CA  1 
ATOM   7559  C C   . ASP A  1 1105 ? 178.563 173.613 101.110 1.00 118.36 ? 1118 ASP A C   1 
ATOM   7560  O O   . ASP A  1 1105 ? 178.141 174.247 102.082 1.00 118.36 ? 1118 ASP A O   1 
ATOM   7561  C CB  . ASP A  1 1105 ? 177.123 173.599 99.059  1.00 118.36 ? 1118 ASP A CB  1 
ATOM   7562  C CG  . ASP A  1 1105 ? 177.202 173.641 97.560  1.00 118.36 ? 1118 ASP A CG  1 
ATOM   7563  O OD1 . ASP A  1 1105 ? 177.594 174.695 97.029  1.00 118.36 ? 1118 ASP A OD1 1 
ATOM   7564  O OD2 . ASP A  1 1105 ? 176.885 172.624 96.913  1.00 118.36 ? 1118 ASP A OD2 1 
ATOM   7565  N N   . ASN A  1 1106 ? 179.209 172.460 101.244 1.00 111.39 ? 1119 ASN A N   1 
ATOM   7566  C CA  . ASN A  1 1106 ? 179.448 171.861 102.545 1.00 111.39 ? 1119 ASN A CA  1 
ATOM   7567  C C   . ASN A  1 1106 ? 180.892 171.982 102.992 1.00 111.39 ? 1119 ASN A C   1 
ATOM   7568  O O   . ASN A  1 1106 ? 181.238 171.461 104.055 1.00 111.39 ? 1119 ASN A O   1 
ATOM   7569  C CB  . ASN A  1 1106 ? 179.033 170.392 102.527 1.00 111.39 ? 1119 ASN A CB  1 
ATOM   7570  C CG  . ASN A  1 1106 ? 179.656 169.634 101.381 1.00 111.39 ? 1119 ASN A CG  1 
ATOM   7571  O OD1 . ASN A  1 1106 ? 180.873 169.634 101.212 1.00 111.39 ? 1119 ASN A OD1 1 
ATOM   7572  N ND2 . ASN A  1 1106 ? 178.824 168.996 100.571 1.00 111.39 ? 1119 ASN A ND2 1 
ATOM   7573  N N   . THR A  1 1107 ? 181.741 172.654 102.217 1.00 115.82 ? 1120 THR A N   1 
ATOM   7574  C CA  . THR A  1 1107 ? 183.114 172.917 102.623 1.00 115.82 ? 1120 THR A CA  1 
ATOM   7575  C C   . THR A  1 1107 ? 183.479 174.354 102.314 1.00 115.82 ? 1120 THR A C   1 
ATOM   7576  O O   . THR A  1 1107 ? 183.098 174.883 101.267 1.00 115.82 ? 1120 THR A O   1 
ATOM   7577  C CB  . THR A  1 1107 ? 184.119 171.997 101.925 1.00 115.82 ? 1120 THR A CB  1 
ATOM   7578  O OG1 . THR A  1 1107 ? 185.448 172.398 102.286 1.00 115.82 ? 1120 THR A OG1 1 
ATOM   7579  C CG2 . THR A  1 1107 ? 183.977 172.079 100.427 1.00 115.82 ? 1120 THR A CG2 1 
ATOM   7580  N N   . PHE A  1 1108 ? 184.221 174.976 103.220 1.00 114.88 ? 1121 PHE A N   1 
ATOM   7581  C CA  . PHE A  1 1108 ? 184.922 176.195 102.870 1.00 114.88 ? 1121 PHE A CA  1 
ATOM   7582  C C   . PHE A  1 1108 ? 186.356 175.827 102.543 1.00 114.88 ? 1121 PHE A C   1 
ATOM   7583  O O   . PHE A  1 1108 ? 186.705 174.656 102.429 1.00 114.88 ? 1121 PHE A O   1 
ATOM   7584  C CB  . PHE A  1 1108 ? 184.862 177.234 103.990 1.00 114.88 ? 1121 PHE A CB  1 
ATOM   7585  C CG  . PHE A  1 1108 ? 185.535 176.808 105.270 1.00 114.88 ? 1121 PHE A CG  1 
ATOM   7586  C CD1 . PHE A  1 1108 ? 184.829 176.118 106.246 1.00 114.88 ? 1121 PHE A CD1 1 
ATOM   7587  C CD2 . PHE A  1 1108 ? 186.860 177.124 105.517 1.00 114.88 ? 1121 PHE A CD2 1 
ATOM   7588  C CE1 . PHE A  1 1108 ? 185.430 175.740 107.427 1.00 114.88 ? 1121 PHE A CE1 1 
ATOM   7589  C CE2 . PHE A  1 1108 ? 187.463 176.744 106.701 1.00 114.88 ? 1121 PHE A CE2 1 
ATOM   7590  C CZ  . PHE A  1 1108 ? 186.745 176.045 107.648 1.00 114.88 ? 1121 PHE A CZ  1 
ATOM   7591  N N   . VAL A  1 1109 ? 187.190 176.834 102.357 1.00 114.32 ? 1122 VAL A N   1 
ATOM   7592  C CA  . VAL A  1 1109 ? 188.582 176.614 102.006 1.00 114.32 ? 1122 VAL A CA  1 
ATOM   7593  C C   . VAL A  1 1109 ? 189.428 177.635 102.740 1.00 114.32 ? 1122 VAL A C   1 
ATOM   7594  O O   . VAL A  1 1109 ? 189.029 178.795 102.874 1.00 114.32 ? 1122 VAL A O   1 
ATOM   7595  C CB  . VAL A  1 1109 ? 188.811 176.702 100.484 1.00 114.32 ? 1122 VAL A CB  1 
ATOM   7596  C CG1 . VAL A  1 1109 ? 187.844 175.796 99.744  1.00 114.32 ? 1122 VAL A CG1 1 
ATOM   7597  C CG2 . VAL A  1 1109 ? 188.654 178.129 99.996  1.00 114.32 ? 1122 VAL A CG2 1 
ATOM   7598  N N   . SER A  1 1110 ? 190.570 177.189 103.259 1.00 110.56 ? 1123 SER A N   1 
ATOM   7599  C CA  . SER A  1 1110 ? 191.537 178.100 103.857 1.00 110.56 ? 1123 SER A CA  1 
ATOM   7600  C C   . SER A  1 1110 ? 192.803 177.336 104.198 1.00 110.56 ? 1123 SER A C   1 
ATOM   7601  O O   . SER A  1 1110 ? 192.738 176.190 104.644 1.00 110.56 ? 1123 SER A O   1 
ATOM   7602  C CB  . SER A  1 1110 ? 190.980 178.776 105.113 1.00 110.56 ? 1123 SER A CB  1 
ATOM   7603  O OG  . SER A  1 1110 ? 192.020 179.306 105.917 1.00 110.56 ? 1123 SER A OG  1 
ATOM   7604  N N   . GLY A  1 1111 ? 193.945 177.975 103.974 1.00 107.63 ? 1124 GLY A N   1 
ATOM   7605  C CA  . GLY A  1 1111 ? 195.229 177.389 104.288 1.00 107.63 ? 1124 GLY A CA  1 
ATOM   7606  C C   . GLY A  1 1111 ? 195.573 176.270 103.332 1.00 107.63 ? 1124 GLY A C   1 
ATOM   7607  O O   . GLY A  1 1111 ? 194.707 175.466 102.979 1.00 107.63 ? 1124 GLY A O   1 
ATOM   7608  N N   . ASN A  1 1112 ? 196.833 176.179 102.923 1.00 124.16 ? 1125 ASN A N   1 
ATOM   7609  C CA  . ASN A  1 1112 ? 197.232 175.112 102.024 1.00 124.16 ? 1125 ASN A CA  1 
ATOM   7610  C C   . ASN A  1 1112 ? 197.506 173.859 102.840 1.00 124.16 ? 1125 ASN A C   1 
ATOM   7611  O O   . ASN A  1 1112 ? 197.621 173.896 104.065 1.00 124.16 ? 1125 ASN A O   1 
ATOM   7612  C CB  . ASN A  1 1112 ? 198.461 175.507 101.215 1.00 124.16 ? 1125 ASN A CB  1 
ATOM   7613  C CG  . ASN A  1 1112 ? 199.729 175.451 102.034 1.00 124.16 ? 1125 ASN A CG  1 
ATOM   7614  O OD1 . ASN A  1 1112 ? 200.220 174.373 102.358 1.00 124.16 ? 1125 ASN A OD1 1 
ATOM   7615  N ND2 . ASN A  1 1112 ? 200.271 176.614 102.369 1.00 124.16 ? 1125 ASN A ND2 1 
ATOM   7616  N N   . CYS A  1 1113 ? 197.650 172.738 102.162 1.00 116.47 ? 1126 CYS A N   1 
ATOM   7617  C CA  . CYS A  1 1113 ? 197.936 171.498 102.856 1.00 116.47 ? 1126 CYS A CA  1 
ATOM   7618  C C   . CYS A  1 1113 ? 199.339 171.016 102.539 1.00 116.47 ? 1126 CYS A C   1 
ATOM   7619  O O   . CYS A  1 1113 ? 199.566 169.848 102.224 1.00 116.47 ? 1126 CYS A O   1 
ATOM   7620  C CB  . CYS A  1 1113 ? 196.888 170.437 102.547 1.00 116.47 ? 1126 CYS A CB  1 
ATOM   7621  S SG  . CYS A  1 1113 ? 196.577 170.122 100.830 1.00 116.47 ? 1126 CYS A SG  1 
ATOM   7622  N N   . ASP A  1 1114 ? 200.301 171.931 102.605 1.00 133.98 ? 1127 ASP A N   1 
ATOM   7623  C CA  . ASP A  1 1114 ? 201.674 171.501 102.811 1.00 133.98 ? 1127 ASP A CA  1 
ATOM   7624  C C   . ASP A  1 1114 ? 201.874 171.074 104.257 1.00 133.98 ? 1127 ASP A C   1 
ATOM   7625  O O   . ASP A  1 1114 ? 202.529 170.063 104.528 1.00 133.98 ? 1127 ASP A O   1 
ATOM   7626  C CB  . ASP A  1 1114 ? 202.636 172.630 102.442 1.00 133.98 ? 1127 ASP A CB  1 
ATOM   7627  C CG  . ASP A  1 1114 ? 204.095 172.197 102.433 1.00 133.98 ? 1127 ASP A CG  1 
ATOM   7628  O OD1 . ASP A  1 1114 ? 204.438 171.150 103.015 1.00 133.98 ? 1127 ASP A OD1 1 
ATOM   7629  O OD2 . ASP A  1 1114 ? 204.910 172.914 101.816 1.00 133.98 ? 1127 ASP A OD2 1 
ATOM   7630  N N   . VAL A  1 1115 ? 201.279 171.809 105.197 1.00 119.13 ? 1128 VAL A N   1 
ATOM   7631  C CA  . VAL A  1 1115 ? 201.547 171.604 106.616 1.00 119.13 ? 1128 VAL A CA  1 
ATOM   7632  C C   . VAL A  1 1115 ? 200.511 170.721 107.299 1.00 119.13 ? 1128 VAL A C   1 
ATOM   7633  O O   . VAL A  1 1115 ? 200.817 170.126 108.342 1.00 119.13 ? 1128 VAL A O   1 
ATOM   7634  C CB  . VAL A  1 1115 ? 201.644 172.957 107.347 1.00 119.13 ? 1128 VAL A CB  1 
ATOM   7635  C CG1 . VAL A  1 1115 ? 200.261 173.525 107.578 1.00 119.13 ? 1128 VAL A CG1 1 
ATOM   7636  C CG2 . VAL A  1 1115 ? 202.409 172.814 108.653 1.00 119.13 ? 1128 VAL A CG2 1 
ATOM   7637  N N   . VAL A  1 1116 ? 199.307 170.608 106.745 1.00 107.57 ? 1129 VAL A N   1 
ATOM   7638  C CA  . VAL A  1 1116 ? 198.276 169.796 107.368 1.00 107.57 ? 1129 VAL A CA  1 
ATOM   7639  C C   . VAL A  1 1116 ? 198.749 168.360 107.475 1.00 107.57 ? 1129 VAL A C   1 
ATOM   7640  O O   . VAL A  1 1116 ? 199.434 167.843 106.587 1.00 107.57 ? 1129 VAL A O   1 
ATOM   7641  C CB  . VAL A  1 1116 ? 196.980 169.897 106.563 1.00 107.57 ? 1129 VAL A CB  1 
ATOM   7642  C CG1 . VAL A  1 1116 ? 195.964 168.922 107.093 1.00 107.57 ? 1129 VAL A CG1 1 
ATOM   7643  C CG2 . VAL A  1 1116 ? 196.466 171.308 106.636 1.00 107.57 ? 1129 VAL A CG2 1 
ATOM   7644  N N   . ILE A  1 1117 ? 198.402 167.712 108.573 1.00 110.08 ? 1130 ILE A N   1 
ATOM   7645  C CA  . ILE A  1 1117 ? 198.879 166.374 108.870 1.00 110.08 ? 1130 ILE A CA  1 
ATOM   7646  C C   . ILE A  1 1117 ? 197.755 165.379 108.617 1.00 110.08 ? 1130 ILE A C   1 
ATOM   7647  O O   . ILE A  1 1117 ? 196.781 165.315 109.373 1.00 110.08 ? 1130 ILE A O   1 
ATOM   7648  C CB  . ILE A  1 1117 ? 199.427 166.295 110.307 1.00 110.08 ? 1130 ILE A CB  1 
ATOM   7649  C CG1 . ILE A  1 1117 ? 198.457 166.904 111.321 1.00 110.08 ? 1130 ILE A CG1 1 
ATOM   7650  C CG2 . ILE A  1 1117 ? 200.749 167.019 110.422 1.00 110.08 ? 1130 ILE A CG2 1 
ATOM   7651  C CD1 . ILE A  1 1117 ? 198.954 166.836 112.756 1.00 110.08 ? 1130 ILE A CD1 1 
ATOM   7652  N N   . GLY A  1 1118 ? 197.883 164.610 107.548 1.00 106.38 ? 1131 GLY A N   1 
ATOM   7653  C CA  . GLY A  1 1118 ? 196.970 163.535 107.248 1.00 106.38 ? 1131 GLY A CA  1 
ATOM   7654  C C   . GLY A  1 1118 ? 196.059 163.705 106.026 1.00 106.38 ? 1131 GLY A C   1 
ATOM   7655  O O   . GLY A  1 1118 ? 195.082 162.955 105.910 1.00 106.38 ? 1131 GLY A O   1 
ATOM   7656  N N   . ILE A  1 1119 ? 196.356 164.643 105.118 1.00 100.20 ? 1132 ILE A N   1 
ATOM   7657  C CA  . ILE A  1 1119 ? 195.449 164.932 104.009 1.00 100.20 ? 1132 ILE A CA  1 
ATOM   7658  C C   . ILE A  1 1119 ? 195.291 163.716 103.117 1.00 100.20 ? 1132 ILE A C   1 
ATOM   7659  O O   . ILE A  1 1119 ? 196.192 162.881 102.987 1.00 100.20 ? 1132 ILE A O   1 
ATOM   7660  C CB  . ILE A  1 1119 ? 195.940 166.131 103.185 1.00 100.20 ? 1132 ILE A CB  1 
ATOM   7661  C CG1 . ILE A  1 1119 ? 197.398 165.932 102.807 1.00 100.20 ? 1132 ILE A CG1 1 
ATOM   7662  C CG2 . ILE A  1 1119 ? 195.761 167.396 103.953 1.00 100.20 ? 1132 ILE A CG2 1 
ATOM   7663  C CD1 . ILE A  1 1119 ? 197.928 167.024 101.950 1.00 100.20 ? 1132 ILE A CD1 1 
ATOM   7664  N N   . VAL A  1 1120 ? 194.135 163.621 102.485 1.00 93.97  ? 1133 VAL A N   1 
ATOM   7665  C CA  . VAL A  1 1120 ? 193.865 162.544 101.555 1.00 93.97  ? 1133 VAL A CA  1 
ATOM   7666  C C   . VAL A  1 1120 ? 193.459 163.156 100.232 1.00 93.97  ? 1133 VAL A C   1 
ATOM   7667  O O   . VAL A  1 1120 ? 193.002 164.301 100.167 1.00 93.97  ? 1133 VAL A O   1 
ATOM   7668  C CB  . VAL A  1 1120 ? 192.775 161.591 102.057 1.00 93.97  ? 1133 VAL A CB  1 
ATOM   7669  C CG1 . VAL A  1 1120 ? 193.081 161.165 103.466 1.00 93.97  ? 1133 VAL A CG1 1 
ATOM   7670  C CG2 . VAL A  1 1120 ? 191.421 162.251 101.957 1.00 93.97  ? 1133 VAL A CG2 1 
ATOM   7671  N N   . ASN A  1 1121 ? 193.641 162.378 99.174  1.00 89.64  ? 1134 ASN A N   1 
ATOM   7672  C CA  . ASN A  1 1121 ? 193.391 162.808 97.807  1.00 89.64  ? 1134 ASN A CA  1 
ATOM   7673  C C   . ASN A  1 1121 ? 191.974 162.403 97.422  1.00 89.64  ? 1134 ASN A C   1 
ATOM   7674  O O   . ASN A  1 1121 ? 191.625 161.221 97.484  1.00 89.64  ? 1134 ASN A O   1 
ATOM   7675  C CB  . ASN A  1 1121 ? 194.413 162.171 96.866  1.00 89.64  ? 1134 ASN A CB  1 
ATOM   7676  C CG  . ASN A  1 1121 ? 195.569 163.101 96.505  1.00 89.64  ? 1134 ASN A CG  1 
ATOM   7677  O OD1 . ASN A  1 1121 ? 195.366 164.160 95.923  1.00 89.64  ? 1134 ASN A OD1 1 
ATOM   7678  N ND2 . ASN A  1 1121 ? 196.787 162.692 96.853  1.00 89.64  ? 1134 ASN A ND2 1 
ATOM   7679  N N   . ASN A  1 1122 ? 191.163 163.375 97.027  1.00 90.47  ? 1135 ASN A N   1 
ATOM   7680  C CA  . ASN A  1 1122 ? 189.801 163.075 96.619  1.00 90.47  ? 1135 ASN A CA  1 
ATOM   7681  C C   . ASN A  1 1122 ? 189.282 164.230 95.784  1.00 90.47  ? 1135 ASN A C   1 
ATOM   7682  O O   . ASN A  1 1122 ? 189.831 165.334 95.805  1.00 90.47  ? 1135 ASN A O   1 
ATOM   7683  C CB  . ASN A  1 1122 ? 188.890 162.826 97.822  1.00 90.47  ? 1135 ASN A CB  1 
ATOM   7684  C CG  . ASN A  1 1122 ? 187.558 162.223 97.431  1.00 90.47  ? 1135 ASN A CG  1 
ATOM   7685  O OD1 . ASN A  1 1122 ? 187.062 162.446 96.327  1.00 90.47  ? 1135 ASN A OD1 1 
ATOM   7686  N ND2 . ASN A  1 1122 ? 186.963 161.466 98.344  1.00 90.47  ? 1135 ASN A ND2 1 
ATOM   7687  N N   . THR A  1 1123 ? 188.206 163.957 95.058  1.00 97.97  ? 1136 THR A N   1 
ATOM   7688  C CA  . THR A  1 1123 ? 187.647 164.888 94.092  1.00 97.97  ? 1136 THR A CA  1 
ATOM   7689  C C   . THR A  1 1123 ? 186.465 165.618 94.705  1.00 97.97  ? 1136 THR A C   1 
ATOM   7690  O O   . THR A  1 1123 ? 185.434 165.003 94.994  1.00 97.97  ? 1136 THR A O   1 
ATOM   7691  C CB  . THR A  1 1123 ? 187.204 164.145 92.840  1.00 97.97  ? 1136 THR A CB  1 
ATOM   7692  O OG1 . THR A  1 1123 ? 186.088 163.309 93.169  1.00 97.97  ? 1136 THR A OG1 1 
ATOM   7693  C CG2 . THR A  1 1123 ? 188.340 163.287 92.316  1.00 97.97  ? 1136 THR A CG2 1 
ATOM   7694  N N   . VAL A  1 1124 ? 186.603 166.928 94.871  1.00 107.74 ? 1137 VAL A N   1 
ATOM   7695  C CA  . VAL A  1 1124 ? 185.519 167.740 95.407  1.00 107.74 ? 1137 VAL A CA  1 
ATOM   7696  C C   . VAL A  1 1124 ? 184.512 167.949 94.289  1.00 107.74 ? 1137 VAL A C   1 
ATOM   7697  O O   . VAL A  1 1124 ? 184.887 168.196 93.144  1.00 107.74 ? 1137 VAL A O   1 
ATOM   7698  C CB  . VAL A  1 1124 ? 186.024 169.075 95.961  1.00 107.74 ? 1137 VAL A CB  1 
ATOM   7699  C CG1 . VAL A  1 1124 ? 186.996 168.832 97.090  1.00 107.74 ? 1137 VAL A CG1 1 
ATOM   7700  C CG2 . VAL A  1 1124 ? 186.655 169.915 94.869  1.00 107.74 ? 1137 VAL A CG2 1 
ATOM   7701  N N   . TYR A  1 1125 ? 183.236 167.811 94.606  1.00 110.14 ? 1138 TYR A N   1 
ATOM   7702  C CA  . TYR A  1 1125 ? 182.247 167.978 93.562  1.00 110.14 ? 1138 TYR A CA  1 
ATOM   7703  C C   . TYR A  1 1125 ? 181.583 169.342 93.660  1.00 110.14 ? 1138 TYR A C   1 
ATOM   7704  O O   . TYR A  1 1125 ? 181.652 170.032 94.677  1.00 110.14 ? 1138 TYR A O   1 
ATOM   7705  C CB  . TYR A  1 1125 ? 181.201 166.875 93.628  1.00 110.14 ? 1138 TYR A CB  1 
ATOM   7706  C CG  . TYR A  1 1125 ? 181.589 165.638 92.856  1.00 110.14 ? 1138 TYR A CG  1 
ATOM   7707  C CD1 . TYR A  1 1125 ? 182.650 164.847 93.274  1.00 110.14 ? 1138 TYR A CD1 1 
ATOM   7708  C CD2 . TYR A  1 1125 ? 180.889 165.254 91.718  1.00 110.14 ? 1138 TYR A CD2 1 
ATOM   7709  C CE1 . TYR A  1 1125 ? 183.007 163.714 92.581  1.00 110.14 ? 1138 TYR A CE1 1 
ATOM   7710  C CE2 . TYR A  1 1125 ? 181.240 164.120 91.021  1.00 110.14 ? 1138 TYR A CE2 1 
ATOM   7711  C CZ  . TYR A  1 1125 ? 182.299 163.356 91.459  1.00 110.14 ? 1138 TYR A CZ  1 
ATOM   7712  O OH  . TYR A  1 1125 ? 182.664 162.225 90.780  1.00 110.14 ? 1138 TYR A OH  1 
ATOM   7713  N N   . ASP A  1 1126 ? 180.948 169.729 92.564  1.00 112.77 ? 1139 ASP A N   1 
ATOM   7714  C CA  . ASP A  1 1126 ? 180.175 170.954 92.480  1.00 112.77 ? 1139 ASP A CA  1 
ATOM   7715  C C   . ASP A  1 1126 ? 179.213 170.866 91.309  1.00 112.77 ? 1139 ASP A C   1 
ATOM   7716  O O   . ASP A  1 1126 ? 179.644 170.748 90.157  1.00 112.77 ? 1139 ASP A O   1 
ATOM   7717  C CB  . ASP A  1 1126 ? 181.085 172.168 92.322  1.00 112.77 ? 1139 ASP A CB  1 
ATOM   7718  C CG  . ASP A  1 1126 ? 180.320 173.475 92.346  1.00 112.77 ? 1139 ASP A CG  1 
ATOM   7719  O OD1 . ASP A  1 1126 ? 179.070 173.456 92.359  1.00 112.77 ? 1139 ASP A OD1 1 
ATOM   7720  O OD2 . ASP A  1 1126 ? 180.978 174.534 92.356  1.00 112.77 ? 1139 ASP A OD2 1 
ATOM   7721  N N   . PRO A  1 1127 ? 177.906 170.916 91.558  1.00 113.61 ? 1140 PRO A N   1 
ATOM   7722  C CA  . PRO A  1 1127 ? 176.913 171.001 90.492  1.00 113.61 ? 1140 PRO A CA  1 
ATOM   7723  C C   . PRO A  1 1127 ? 176.684 172.444 90.054  1.00 113.61 ? 1140 PRO A C   1 
ATOM   7724  O O   . PRO A  1 1127 ? 176.775 172.731 88.861  1.00 113.61 ? 1140 PRO A O   1 
ATOM   7725  C CB  . PRO A  1 1127 ? 175.664 170.418 91.144  1.00 113.61 ? 1140 PRO A CB  1 
ATOM   7726  C CG  . PRO A  1 1127 ? 175.809 170.791 92.566  1.00 113.61 ? 1140 PRO A CG  1 
ATOM   7727  C CD  . PRO A  1 1127 ? 177.281 170.737 92.876  1.00 113.61 ? 1140 PRO A CD  1 
ATOM   7728  N N   . ALA B  1 14   ? 228.363 202.228 185.892 1.00 190.75 ? 27   ALA B N   1 
ATOM   7729  C CA  . ALA B  1 14   ? 228.519 202.291 184.439 1.00 190.75 ? 27   ALA B CA  1 
ATOM   7730  C C   . ALA B  1 14   ? 227.508 201.389 183.725 1.00 190.75 ? 27   ALA B C   1 
ATOM   7731  O O   . ALA B  1 14   ? 227.539 200.168 183.877 1.00 190.75 ? 27   ALA B O   1 
ATOM   7732  C CB  . ALA B  1 14   ? 229.941 201.913 184.047 1.00 190.75 ? 27   ALA B CB  1 
ATOM   7733  N N   . TYR B  1 15   ? 226.621 201.995 182.940 1.00 173.48 ? 28   TYR B N   1 
ATOM   7734  C CA  . TYR B  1 15   ? 225.565 201.235 182.288 1.00 173.48 ? 28   TYR B CA  1 
ATOM   7735  C C   . TYR B  1 15   ? 226.084 200.485 181.070 1.00 173.48 ? 28   TYR B C   1 
ATOM   7736  O O   . TYR B  1 15   ? 226.899 200.995 180.299 1.00 173.48 ? 28   TYR B O   1 
ATOM   7737  C CB  . TYR B  1 15   ? 224.419 202.152 181.879 1.00 173.48 ? 28   TYR B CB  1 
ATOM   7738  C CG  . TYR B  1 15   ? 223.524 202.561 183.015 1.00 173.48 ? 28   TYR B CG  1 
ATOM   7739  C CD1 . TYR B  1 15   ? 223.604 201.935 184.246 1.00 173.48 ? 28   TYR B CD1 1 
ATOM   7740  C CD2 . TYR B  1 15   ? 222.572 203.548 182.848 1.00 173.48 ? 28   TYR B CD2 1 
ATOM   7741  C CE1 . TYR B  1 15   ? 222.772 202.301 185.290 1.00 173.48 ? 28   TYR B CE1 1 
ATOM   7742  C CE2 . TYR B  1 15   ? 221.734 203.917 183.880 1.00 173.48 ? 28   TYR B CE2 1 
ATOM   7743  C CZ  . TYR B  1 15   ? 221.837 203.292 185.100 1.00 173.48 ? 28   TYR B CZ  1 
ATOM   7744  O OH  . TYR B  1 15   ? 221.001 203.663 186.128 1.00 173.48 ? 28   TYR B OH  1 
ATOM   7745  N N   . THR B  1 16   ? 225.595 199.261 180.907 1.00 178.76 ? 29   THR B N   1 
ATOM   7746  C CA  . THR B  1 16   ? 225.897 198.403 179.775 1.00 178.76 ? 29   THR B CA  1 
ATOM   7747  C C   . THR B  1 16   ? 224.609 197.726 179.345 1.00 178.76 ? 29   THR B C   1 
ATOM   7748  O O   . THR B  1 16   ? 223.748 197.422 180.173 1.00 178.76 ? 29   THR B O   1 
ATOM   7749  C CB  . THR B  1 16   ? 226.937 197.337 180.119 1.00 178.76 ? 29   THR B CB  1 
ATOM   7750  O OG1 . THR B  1 16   ? 226.643 196.788 181.407 1.00 178.76 ? 29   THR B OG1 1 
ATOM   7751  C CG2 . THR B  1 16   ? 228.319 197.932 180.126 1.00 178.76 ? 29   THR B CG2 1 
ATOM   7752  N N   . ASN B  1 17   ? 224.481 197.492 178.046 1.00 160.73 ? 30   ASN B N   1 
ATOM   7753  C CA  . ASN B  1 17   ? 223.249 196.969 177.481 1.00 160.73 ? 30   ASN B CA  1 
ATOM   7754  C C   . ASN B  1 17   ? 223.407 195.482 177.209 1.00 160.73 ? 30   ASN B C   1 
ATOM   7755  O O   . ASN B  1 17   ? 224.292 195.071 176.453 1.00 160.73 ? 30   ASN B O   1 
ATOM   7756  C CB  . ASN B  1 17   ? 222.882 197.707 176.199 1.00 160.73 ? 30   ASN B CB  1 
ATOM   7757  C CG  . ASN B  1 17   ? 221.440 197.511 175.820 1.00 160.73 ? 30   ASN B CG  1 
ATOM   7758  O OD1 . ASN B  1 17   ? 220.690 196.851 176.534 1.00 160.73 ? 30   ASN B OD1 1 
ATOM   7759  N ND2 . ASN B  1 17   ? 221.039 198.081 174.691 1.00 160.73 ? 30   ASN B ND2 1 
ATOM   7760  N N   . SER B  1 18   ? 222.548 194.684 177.824 1.00 150.56 ? 31   SER B N   1 
ATOM   7761  C CA  . SER B  1 18   ? 222.637 193.239 177.705 1.00 150.56 ? 31   SER B CA  1 
ATOM   7762  C C   . SER B  1 18   ? 222.190 192.810 176.314 1.00 150.56 ? 31   SER B C   1 
ATOM   7763  O O   . SER B  1 18   ? 221.063 193.104 175.904 1.00 150.56 ? 31   SER B O   1 
ATOM   7764  C CB  . SER B  1 18   ? 221.774 192.575 178.774 1.00 150.56 ? 31   SER B CB  1 
ATOM   7765  O OG  . SER B  1 18   ? 221.930 193.213 180.026 1.00 150.56 ? 31   SER B OG  1 
ATOM   7766  N N   . PHE B  1 19   ? 223.067 192.129 175.580 1.00 146.26 ? 32   PHE B N   1 
ATOM   7767  C CA  . PHE B  1 19   ? 222.617 191.502 174.346 1.00 146.26 ? 32   PHE B CA  1 
ATOM   7768  C C   . PHE B  1 19   ? 221.561 190.435 174.607 1.00 146.26 ? 32   PHE B C   1 
ATOM   7769  O O   . PHE B  1 19   ? 220.410 190.607 174.204 1.00 146.26 ? 32   PHE B O   1 
ATOM   7770  C CB  . PHE B  1 19   ? 223.787 190.893 173.568 1.00 146.26 ? 32   PHE B CB  1 
ATOM   7771  C CG  . PHE B  1 19   ? 224.392 191.815 172.533 1.00 146.26 ? 32   PHE B CG  1 
ATOM   7772  C CD1 . PHE B  1 19   ? 223.784 193.018 172.203 1.00 146.26 ? 32   PHE B CD1 1 
ATOM   7773  C CD2 . PHE B  1 19   ? 225.538 191.444 171.843 1.00 146.26 ? 32   PHE B CD2 1 
ATOM   7774  C CE1 . PHE B  1 19   ? 224.335 193.851 171.231 1.00 146.26 ? 32   PHE B CE1 1 
ATOM   7775  C CE2 . PHE B  1 19   ? 226.089 192.269 170.871 1.00 146.26 ? 32   PHE B CE2 1 
ATOM   7776  C CZ  . PHE B  1 19   ? 225.487 193.473 170.566 1.00 146.26 ? 32   PHE B CZ  1 
ATOM   7777  N N   . THR B  1 20   ? 221.927 189.334 175.279 1.00 150.43 ? 33   THR B N   1 
ATOM   7778  C CA  . THR B  1 20   ? 221.051 188.166 175.289 1.00 150.43 ? 33   THR B CA  1 
ATOM   7779  C C   . THR B  1 20   ? 221.063 187.357 176.597 1.00 150.43 ? 33   THR B C   1 
ATOM   7780  O O   . THR B  1 20   ? 220.905 186.132 176.556 1.00 150.43 ? 33   THR B O   1 
ATOM   7781  C CB  . THR B  1 20   ? 221.397 187.247 174.123 1.00 150.43 ? 33   THR B CB  1 
ATOM   7782  O OG1 . THR B  1 20   ? 220.510 186.125 174.115 1.00 150.43 ? 33   THR B OG1 1 
ATOM   7783  C CG2 . THR B  1 20   ? 222.835 186.772 174.224 1.00 150.43 ? 33   THR B CG2 1 
ATOM   7784  N N   . ARG B  1 21   ? 221.219 187.991 177.760 1.00 152.63 ? 34   ARG B N   1 
ATOM   7785  C CA  . ARG B  1 21   ? 221.259 187.274 179.034 1.00 152.63 ? 34   ARG B CA  1 
ATOM   7786  C C   . ARG B  1 21   ? 219.880 187.099 179.640 1.00 152.63 ? 34   ARG B C   1 
ATOM   7787  O O   . ARG B  1 21   ? 218.899 187.704 179.213 1.00 152.63 ? 34   ARG B O   1 
ATOM   7788  C CB  . ARG B  1 21   ? 222.123 187.998 180.054 1.00 152.63 ? 34   ARG B CB  1 
ATOM   7789  C CG  . ARG B  1 21   ? 223.515 188.040 179.650 1.00 152.63 ? 34   ARG B CG  1 
ATOM   7790  C CD  . ARG B  1 21   ? 224.059 186.653 179.525 1.00 152.63 ? 34   ARG B CD  1 
ATOM   7791  N NE  . ARG B  1 21   ? 225.336 186.705 178.833 1.00 152.63 ? 34   ARG B NE  1 
ATOM   7792  C CZ  . ARG B  1 21   ? 226.413 187.322 179.308 1.00 152.63 ? 34   ARG B CZ  1 
ATOM   7793  N NH1 . ARG B  1 21   ? 226.383 187.939 180.483 1.00 152.63 ? 34   ARG B NH1 1 
ATOM   7794  N NH2 . ARG B  1 21   ? 227.533 187.320 178.612 1.00 152.63 ? 34   ARG B NH2 1 
ATOM   7795  N N   . GLY B  1 22   ? 219.828 186.284 180.680 1.00 148.87 ? 35   GLY B N   1 
ATOM   7796  C CA  . GLY B  1 22   ? 218.598 186.150 181.422 1.00 148.87 ? 35   GLY B CA  1 
ATOM   7797  C C   . GLY B  1 22   ? 217.633 185.166 180.803 1.00 148.87 ? 35   GLY B C   1 
ATOM   7798  O O   . GLY B  1 22   ? 216.560 185.558 180.344 1.00 148.87 ? 35   GLY B O   1 
ATOM   7799  N N   . VAL B  1 23   ? 218.003 183.891 180.757 1.00 149.90 ? 36   VAL B N   1 
ATOM   7800  C CA  . VAL B  1 23   ? 217.158 182.852 180.188 1.00 149.90 ? 36   VAL B CA  1 
ATOM   7801  C C   . VAL B  1 23   ? 217.221 181.627 181.083 1.00 149.90 ? 36   VAL B C   1 
ATOM   7802  O O   . VAL B  1 23   ? 218.311 181.119 181.362 1.00 149.90 ? 36   VAL B O   1 
ATOM   7803  C CB  . VAL B  1 23   ? 217.602 182.494 178.763 1.00 149.90 ? 36   VAL B CB  1 
ATOM   7804  C CG1 . VAL B  1 23   ? 217.129 181.117 178.418 1.00 149.90 ? 36   VAL B CG1 1 
ATOM   7805  C CG2 . VAL B  1 23   ? 217.069 183.509 177.777 1.00 149.90 ? 36   VAL B CG2 1 
ATOM   7806  N N   . TYR B  1 24   ? 216.064 181.145 181.524 1.00 148.20 ? 37   TYR B N   1 
ATOM   7807  C CA  . TYR B  1 24   ? 216.056 179.949 182.351 1.00 148.20 ? 37   TYR B CA  1 
ATOM   7808  C C   . TYR B  1 24   ? 214.703 179.266 182.251 1.00 148.20 ? 37   TYR B C   1 
ATOM   7809  O O   . TYR B  1 24   ? 213.667 179.930 182.224 1.00 148.20 ? 37   TYR B O   1 
ATOM   7810  C CB  . TYR B  1 24   ? 216.391 180.278 183.807 1.00 148.20 ? 37   TYR B CB  1 
ATOM   7811  C CG  . TYR B  1 24   ? 215.238 180.801 184.614 1.00 148.20 ? 37   TYR B CG  1 
ATOM   7812  C CD1 . TYR B  1 24   ? 214.803 182.101 184.479 1.00 148.20 ? 37   TYR B CD1 1 
ATOM   7813  C CD2 . TYR B  1 24   ? 214.605 180.001 185.529 1.00 148.20 ? 37   TYR B CD2 1 
ATOM   7814  C CE1 . TYR B  1 24   ? 213.756 182.576 185.230 1.00 148.20 ? 37   TYR B CE1 1 
ATOM   7815  C CE2 . TYR B  1 24   ? 213.567 180.458 186.283 1.00 148.20 ? 37   TYR B CE2 1 
ATOM   7816  C CZ  . TYR B  1 24   ? 213.141 181.745 186.135 1.00 148.20 ? 37   TYR B CZ  1 
ATOM   7817  O OH  . TYR B  1 24   ? 212.092 182.195 186.901 1.00 148.20 ? 37   TYR B OH  1 
ATOM   7818  N N   . TYR B  1 25   ? 214.733 177.936 182.229 1.00 141.39 ? 38   TYR B N   1 
ATOM   7819  C CA  . TYR B  1 25   ? 213.561 177.132 181.948 1.00 141.39 ? 38   TYR B CA  1 
ATOM   7820  C C   . TYR B  1 25   ? 212.495 177.299 183.018 1.00 141.39 ? 38   TYR B C   1 
ATOM   7821  O O   . TYR B  1 25   ? 212.786 177.699 184.145 1.00 141.39 ? 38   TYR B O   1 
ATOM   7822  C CB  . TYR B  1 25   ? 213.943 175.670 181.854 1.00 141.39 ? 38   TYR B CB  1 
ATOM   7823  C CG  . TYR B  1 25   ? 214.771 175.401 180.661 1.00 141.39 ? 38   TYR B CG  1 
ATOM   7824  C CD1 . TYR B  1 25   ? 214.197 175.323 179.425 1.00 141.39 ? 38   TYR B CD1 1 
ATOM   7825  C CD2 . TYR B  1 25   ? 216.131 175.232 180.770 1.00 141.39 ? 38   TYR B CD2 1 
ATOM   7826  C CE1 . TYR B  1 25   ? 214.944 175.072 178.332 1.00 141.39 ? 38   TYR B CE1 1 
ATOM   7827  C CE2 . TYR B  1 25   ? 216.889 174.980 179.681 1.00 141.39 ? 38   TYR B CE2 1 
ATOM   7828  C CZ  . TYR B  1 25   ? 216.294 174.909 178.461 1.00 141.39 ? 38   TYR B CZ  1 
ATOM   7829  O OH  . TYR B  1 25   ? 217.050 174.660 177.352 1.00 141.39 ? 38   TYR B OH  1 
ATOM   7830  N N   . PRO B  1 26   ? 211.243 176.992 182.679 1.00 142.26 ? 39   PRO B N   1 
ATOM   7831  C CA  . PRO B  1 26   ? 210.162 177.208 183.648 1.00 142.26 ? 39   PRO B CA  1 
ATOM   7832  C C   . PRO B  1 26   ? 210.117 176.182 184.770 1.00 142.26 ? 39   PRO B C   1 
ATOM   7833  O O   . PRO B  1 26   ? 209.888 176.557 185.926 1.00 142.26 ? 39   PRO B O   1 
ATOM   7834  C CB  . PRO B  1 26   ? 208.908 177.155 182.771 1.00 142.26 ? 39   PRO B CB  1 
ATOM   7835  C CG  . PRO B  1 26   ? 209.288 176.283 181.647 1.00 142.26 ? 39   PRO B CG  1 
ATOM   7836  C CD  . PRO B  1 26   ? 210.732 176.535 181.376 1.00 142.26 ? 39   PRO B CD  1 
ATOM   7837  N N   . ASP B  1 27   ? 210.321 174.902 184.476 1.00 141.87 ? 40   ASP B N   1 
ATOM   7838  C CA  . ASP B  1 27   ? 210.036 173.851 185.453 1.00 141.87 ? 40   ASP B CA  1 
ATOM   7839  C C   . ASP B  1 27   ? 210.833 172.604 185.080 1.00 141.87 ? 40   ASP B C   1 
ATOM   7840  O O   . ASP B  1 27   ? 211.893 172.698 184.452 1.00 141.87 ? 40   ASP B O   1 
ATOM   7841  C CB  . ASP B  1 27   ? 208.525 173.583 185.516 1.00 141.87 ? 40   ASP B CB  1 
ATOM   7842  C CG  . ASP B  1 27   ? 208.143 172.714 186.675 1.00 141.87 ? 40   ASP B CG  1 
ATOM   7843  O OD1 . ASP B  1 27   ? 207.998 173.252 187.785 1.00 141.87 ? 40   ASP B OD1 1 
ATOM   7844  O OD2 . ASP B  1 27   ? 208.015 171.489 186.471 1.00 141.87 ? 40   ASP B OD2 1 
ATOM   7845  N N   . LYS B  1 28   ? 210.342 171.441 185.491 1.00 139.90 ? 41   LYS B N   1 
ATOM   7846  C CA  . LYS B  1 28   ? 210.883 170.170 185.041 1.00 139.90 ? 41   LYS B CA  1 
ATOM   7847  C C   . LYS B  1 28   ? 210.432 169.804 183.630 1.00 139.90 ? 41   LYS B C   1 
ATOM   7848  O O   . LYS B  1 28   ? 210.678 168.676 183.188 1.00 139.90 ? 41   LYS B O   1 
ATOM   7849  C CB  . LYS B  1 28   ? 210.491 169.062 186.017 1.00 139.90 ? 41   LYS B CB  1 
ATOM   7850  N N   . VAL B  1 29   ? 209.791 170.728 182.915 1.00 140.91 ? 42   VAL B N   1 
ATOM   7851  C CA  . VAL B  1 29   ? 209.194 170.403 181.630 1.00 140.91 ? 42   VAL B CA  1 
ATOM   7852  C C   . VAL B  1 29   ? 210.272 170.263 180.570 1.00 140.91 ? 42   VAL B C   1 
ATOM   7853  O O   . VAL B  1 29   ? 211.260 171.006 180.552 1.00 140.91 ? 42   VAL B O   1 
ATOM   7854  C CB  . VAL B  1 29   ? 208.171 171.478 181.237 1.00 140.91 ? 42   VAL B CB  1 
ATOM   7855  C CG1 . VAL B  1 29   ? 208.810 172.836 181.279 1.00 140.91 ? 42   VAL B CG1 1 
ATOM   7856  C CG2 . VAL B  1 29   ? 207.628 171.207 179.862 1.00 140.91 ? 42   VAL B CG2 1 
ATOM   7857  N N   . PHE B  1 30   ? 210.087 169.297 179.684 1.00 137.20 ? 43   PHE B N   1 
ATOM   7858  C CA  . PHE B  1 30   ? 210.930 169.119 178.516 1.00 137.20 ? 43   PHE B CA  1 
ATOM   7859  C C   . PHE B  1 30   ? 210.069 169.190 177.273 1.00 137.20 ? 43   PHE B C   1 
ATOM   7860  O O   . PHE B  1 30   ? 208.972 168.630 177.241 1.00 137.20 ? 43   PHE B O   1 
ATOM   7861  C CB  . PHE B  1 30   ? 211.645 167.780 178.546 1.00 137.20 ? 43   PHE B CB  1 
ATOM   7862  C CG  . PHE B  1 30   ? 212.076 167.302 177.199 1.00 137.20 ? 43   PHE B CG  1 
ATOM   7863  C CD1 . PHE B  1 30   ? 211.224 166.570 176.395 1.00 137.20 ? 43   PHE B CD1 1 
ATOM   7864  C CD2 . PHE B  1 30   ? 213.344 167.575 176.743 1.00 137.20 ? 43   PHE B CD2 1 
ATOM   7865  C CE1 . PHE B  1 30   ? 211.625 166.150 175.167 1.00 137.20 ? 43   PHE B CE1 1 
ATOM   7866  C CE2 . PHE B  1 30   ? 213.754 167.137 175.513 1.00 137.20 ? 43   PHE B CE2 1 
ATOM   7867  C CZ  . PHE B  1 30   ? 212.895 166.420 174.726 1.00 137.20 ? 43   PHE B CZ  1 
ATOM   7868  N N   . ARG B  1 31   ? 210.582 169.834 176.239 1.00 127.65 ? 44   ARG B N   1 
ATOM   7869  C CA  . ARG B  1 31   ? 209.885 169.811 174.966 1.00 127.65 ? 44   ARG B CA  1 
ATOM   7870  C C   . ARG B  1 31   ? 210.880 169.629 173.831 1.00 127.65 ? 44   ARG B C   1 
ATOM   7871  O O   . ARG B  1 31   ? 212.029 169.248 174.068 1.00 127.65 ? 44   ARG B O   1 
ATOM   7872  C CB  . ARG B  1 31   ? 209.067 171.084 174.780 1.00 127.65 ? 44   ARG B CB  1 
ATOM   7873  C CG  . ARG B  1 31   ? 207.855 171.182 175.691 1.00 127.65 ? 44   ARG B CG  1 
ATOM   7874  C CD  . ARG B  1 31   ? 206.867 172.196 175.158 1.00 127.65 ? 44   ARG B CD  1 
ATOM   7875  N NE  . ARG B  1 31   ? 205.801 172.478 176.100 1.00 127.65 ? 44   ARG B NE  1 
ATOM   7876  C CZ  . ARG B  1 31   ? 205.895 173.386 177.054 1.00 127.65 ? 44   ARG B CZ  1 
ATOM   7877  N NH1 . ARG B  1 31   ? 206.997 174.106 177.174 1.00 127.65 ? 44   ARG B NH1 1 
ATOM   7878  N NH2 . ARG B  1 31   ? 204.887 173.581 177.878 1.00 127.65 ? 44   ARG B NH2 1 
ATOM   7879  N N   . SER B  1 32   ? 210.453 169.882 172.597 1.00 129.34 ? 45   SER B N   1 
ATOM   7880  C CA  . SER B  1 32   ? 211.350 169.724 171.459 1.00 129.34 ? 45   SER B CA  1 
ATOM   7881  C C   . SER B  1 32   ? 210.753 170.468 170.278 1.00 129.34 ? 45   SER B C   1 
ATOM   7882  O O   . SER B  1 32   ? 209.576 170.278 169.970 1.00 129.34 ? 45   SER B O   1 
ATOM   7883  C CB  . SER B  1 32   ? 211.551 168.256 171.138 1.00 129.34 ? 45   SER B CB  1 
ATOM   7884  O OG  . SER B  1 32   ? 210.315 167.577 171.178 1.00 129.34 ? 45   SER B OG  1 
ATOM   7885  N N   . SER B  1 33   ? 211.553 171.335 169.653 1.00 140.29 ? 46   SER B N   1 
ATOM   7886  C CA  . SER B  1 33   ? 211.238 171.960 168.359 1.00 140.29 ? 46   SER B CA  1 
ATOM   7887  C C   . SER B  1 33   ? 209.914 172.722 168.371 1.00 140.29 ? 46   SER B C   1 
ATOM   7888  O O   . SER B  1 33   ? 209.402 173.112 167.319 1.00 140.29 ? 46   SER B O   1 
ATOM   7889  C CB  . SER B  1 33   ? 211.232 170.928 167.226 1.00 140.29 ? 46   SER B CB  1 
ATOM   7890  O OG  . SER B  1 33   ? 210.643 171.461 166.051 1.00 140.29 ? 46   SER B OG  1 
ATOM   7891  N N   . VAL B  1 34   ? 209.358 172.952 169.553 1.00 131.16 ? 47   VAL B N   1 
ATOM   7892  C CA  . VAL B  1 34   ? 208.061 173.588 169.696 1.00 131.16 ? 47   VAL B CA  1 
ATOM   7893  C C   . VAL B  1 34   ? 208.243 174.908 170.428 1.00 131.16 ? 47   VAL B C   1 
ATOM   7894  O O   . VAL B  1 34   ? 209.146 175.071 171.248 1.00 131.16 ? 47   VAL B O   1 
ATOM   7895  C CB  . VAL B  1 34   ? 207.082 172.663 170.437 1.00 131.16 ? 47   VAL B CB  1 
ATOM   7896  C CG1 . VAL B  1 34   ? 207.738 172.146 171.686 1.00 131.16 ? 47   VAL B CG1 1 
ATOM   7897  C CG2 . VAL B  1 34   ? 205.804 173.389 170.772 1.00 131.16 ? 47   VAL B CG2 1 
ATOM   7898  N N   . LEU B  1 35   ? 207.375 175.859 170.117 1.00 134.93 ? 48   LEU B N   1 
ATOM   7899  C CA  . LEU B  1 35   ? 207.419 177.187 170.707 1.00 134.93 ? 48   LEU B CA  1 
ATOM   7900  C C   . LEU B  1 35   ? 206.361 177.268 171.798 1.00 134.93 ? 48   LEU B C   1 
ATOM   7901  O O   . LEU B  1 35   ? 205.180 177.025 171.536 1.00 134.93 ? 48   LEU B O   1 
ATOM   7902  C CB  . LEU B  1 35   ? 207.190 178.251 169.640 1.00 134.93 ? 48   LEU B CB  1 
ATOM   7903  C CG  . LEU B  1 35   ? 208.418 178.648 168.828 1.00 134.93 ? 48   LEU B CG  1 
ATOM   7904  C CD1 . LEU B  1 35   ? 208.993 177.468 168.064 1.00 134.93 ? 48   LEU B CD1 1 
ATOM   7905  C CD2 . LEU B  1 35   ? 208.037 179.758 167.874 1.00 134.93 ? 48   LEU B CD2 1 
ATOM   7906  N N   . HIS B  1 36   ? 206.781 177.599 173.015 1.00 132.81 ? 49   HIS B N   1 
ATOM   7907  C CA  . HIS B  1 36   ? 205.874 177.607 174.154 1.00 132.81 ? 49   HIS B CA  1 
ATOM   7908  C C   . HIS B  1 36   ? 206.037 178.870 174.984 1.00 132.81 ? 49   HIS B C   1 
ATOM   7909  O O   . HIS B  1 36   ? 207.117 179.458 175.052 1.00 132.81 ? 49   HIS B O   1 
ATOM   7910  C CB  . HIS B  1 36   ? 206.079 176.395 175.056 1.00 132.81 ? 49   HIS B CB  1 
ATOM   7911  C CG  . HIS B  1 36   ? 205.011 176.243 176.088 1.00 132.81 ? 49   HIS B CG  1 
ATOM   7912  N ND1 . HIS B  1 36   ? 203.844 175.550 175.854 1.00 132.81 ? 49   HIS B ND1 1 
ATOM   7913  C CD2 . HIS B  1 36   ? 204.922 176.711 177.352 1.00 132.81 ? 49   HIS B CD2 1 
ATOM   7914  C CE1 . HIS B  1 36   ? 203.080 175.601 176.930 1.00 132.81 ? 49   HIS B CE1 1 
ATOM   7915  N NE2 . HIS B  1 36   ? 203.714 176.296 177.856 1.00 132.81 ? 49   HIS B NE2 1 
ATOM   7916  N N   . SER B  1 37   ? 204.949 179.265 175.637 1.00 140.73 ? 50   SER B N   1 
ATOM   7917  C CA  . SER B  1 37   ? 204.942 180.478 176.434 1.00 140.73 ? 50   SER B CA  1 
ATOM   7918  C C   . SER B  1 37   ? 205.692 180.288 177.737 1.00 140.73 ? 50   SER B C   1 
ATOM   7919  O O   . SER B  1 37   ? 206.173 179.203 178.063 1.00 140.73 ? 50   SER B O   1 
ATOM   7920  C CB  . SER B  1 37   ? 203.526 180.915 176.770 1.00 140.73 ? 50   SER B CB  1 
ATOM   7921  O OG  . SER B  1 37   ? 203.566 181.765 177.904 1.00 140.73 ? 50   SER B OG  1 
ATOM   7922  N N   . THR B  1 38   ? 205.770 181.382 178.485 1.00 154.22 ? 51   THR B N   1 
ATOM   7923  C CA  . THR B  1 38   ? 206.310 181.390 179.838 1.00 154.22 ? 51   THR B CA  1 
ATOM   7924  C C   . THR B  1 38   ? 206.124 182.784 180.407 1.00 154.22 ? 51   THR B C   1 
ATOM   7925  O O   . THR B  1 38   ? 205.734 183.706 179.697 1.00 154.22 ? 51   THR B O   1 
ATOM   7926  C CB  . THR B  1 38   ? 207.782 181.006 179.875 1.00 154.22 ? 51   THR B CB  1 
ATOM   7927  O OG1 . THR B  1 38   ? 208.254 181.057 181.229 1.00 154.22 ? 51   THR B OG1 1 
ATOM   7928  C CG2 . THR B  1 38   ? 208.557 181.957 179.026 1.00 154.22 ? 51   THR B CG2 1 
ATOM   7929  N N   . GLN B  1 39   ? 206.396 182.919 181.706 1.00 151.31 ? 52   GLN B N   1 
ATOM   7930  C CA  . GLN B  1 39   ? 206.225 184.178 182.418 1.00 151.31 ? 52   GLN B CA  1 
ATOM   7931  C C   . GLN B  1 39   ? 206.772 184.099 183.837 1.00 151.31 ? 52   GLN B C   1 
ATOM   7932  O O   . GLN B  1 39   ? 206.416 183.182 184.579 1.00 151.31 ? 52   GLN B O   1 
ATOM   7933  C CB  . GLN B  1 39   ? 204.751 184.576 182.476 1.00 151.31 ? 52   GLN B CB  1 
ATOM   7934  C CG  . GLN B  1 39   ? 203.801 183.495 182.939 1.00 151.31 ? 52   GLN B CG  1 
ATOM   7935  C CD  . GLN B  1 39   ? 203.585 182.426 181.898 1.00 151.31 ? 52   GLN B CD  1 
ATOM   7936  O OE1 . GLN B  1 39   ? 203.276 182.723 180.741 1.00 151.31 ? 52   GLN B OE1 1 
ATOM   7937  N NE2 . GLN B  1 39   ? 203.787 181.174 182.286 1.00 151.31 ? 52   GLN B NE2 1 
ATOM   7938  N N   . ASP B  1 40   ? 207.636 185.038 184.219 1.00 158.72 ? 53   ASP B N   1 
ATOM   7939  C CA  . ASP B  1 40   ? 208.029 185.281 185.611 1.00 158.72 ? 53   ASP B CA  1 
ATOM   7940  C C   . ASP B  1 40   ? 208.844 186.565 185.639 1.00 158.72 ? 53   ASP B C   1 
ATOM   7941  O O   . ASP B  1 40   ? 208.864 187.343 184.677 1.00 158.72 ? 53   ASP B O   1 
ATOM   7942  C CB  . ASP B  1 40   ? 208.826 184.129 186.240 1.00 158.72 ? 53   ASP B CB  1 
ATOM   7943  C CG  . ASP B  1 40   ? 208.859 184.198 187.766 1.00 158.72 ? 53   ASP B CG  1 
ATOM   7944  O OD1 . ASP B  1 40   ? 208.649 185.298 188.313 1.00 158.72 ? 53   ASP B OD1 1 
ATOM   7945  O OD2 . ASP B  1 40   ? 209.112 183.163 188.411 1.00 158.72 ? 53   ASP B OD2 1 
ATOM   7946  N N   . LEU B  1 41   ? 209.490 186.793 186.776 1.00 164.45 ? 54   LEU B N   1 
ATOM   7947  C CA  . LEU B  1 41   ? 210.516 187.809 186.893 1.00 164.45 ? 54   LEU B CA  1 
ATOM   7948  C C   . LEU B  1 41   ? 211.718 187.422 186.041 1.00 164.45 ? 54   LEU B C   1 
ATOM   7949  O O   . LEU B  1 41   ? 212.617 186.730 186.524 1.00 164.45 ? 54   LEU B O   1 
ATOM   7950  C CB  . LEU B  1 41   ? 210.927 187.931 188.348 1.00 164.45 ? 54   LEU B CB  1 
ATOM   7951  C CG  . LEU B  1 41   ? 209.717 188.148 189.231 1.00 164.45 ? 54   LEU B CG  1 
ATOM   7952  C CD1 . LEU B  1 41   ? 210.156 188.134 190.668 1.00 164.45 ? 54   LEU B CD1 1 
ATOM   7953  C CD2 . LEU B  1 41   ? 209.039 189.435 188.888 1.00 164.45 ? 54   LEU B CD2 1 
ATOM   7954  N N   . PHE B  1 42   ? 211.757 187.853 184.783 1.00 152.61 ? 55   PHE B N   1 
ATOM   7955  C CA  . PHE B  1 42   ? 212.868 187.555 183.897 1.00 152.61 ? 55   PHE B CA  1 
ATOM   7956  C C   . PHE B  1 42   ? 213.715 188.797 183.697 1.00 152.61 ? 55   PHE B C   1 
ATOM   7957  O O   . PHE B  1 42   ? 213.240 189.926 183.818 1.00 152.61 ? 55   PHE B O   1 
ATOM   7958  C CB  . PHE B  1 42   ? 212.400 187.067 182.526 1.00 152.61 ? 55   PHE B CB  1 
ATOM   7959  C CG  . PHE B  1 42   ? 211.517 185.869 182.572 1.00 152.61 ? 55   PHE B CG  1 
ATOM   7960  C CD1 . PHE B  1 42   ? 211.778 184.828 183.435 1.00 152.61 ? 55   PHE B CD1 1 
ATOM   7961  C CD2 . PHE B  1 42   ? 210.430 185.779 181.733 1.00 152.61 ? 55   PHE B CD2 1 
ATOM   7962  C CE1 . PHE B  1 42   ? 210.961 183.722 183.462 1.00 152.61 ? 55   PHE B CE1 1 
ATOM   7963  C CE2 . PHE B  1 42   ? 209.610 184.684 181.758 1.00 152.61 ? 55   PHE B CE2 1 
ATOM   7964  C CZ  . PHE B  1 42   ? 209.874 183.651 182.621 1.00 152.61 ? 55   PHE B CZ  1 
ATOM   7965  N N   . LEU B  1 43   ? 214.971 188.570 183.376 1.00 143.10 ? 56   LEU B N   1 
ATOM   7966  C CA  . LEU B  1 43   ? 215.816 189.664 182.962 1.00 143.10 ? 56   LEU B CA  1 
ATOM   7967  C C   . LEU B  1 43   ? 215.226 190.259 181.702 1.00 143.10 ? 56   LEU B C   1 
ATOM   7968  O O   . LEU B  1 43   ? 215.251 189.602 180.656 1.00 143.10 ? 56   LEU B O   1 
ATOM   7969  C CB  . LEU B  1 43   ? 217.230 189.184 182.700 1.00 143.10 ? 56   LEU B CB  1 
ATOM   7970  C CG  . LEU B  1 43   ? 218.068 190.196 181.933 1.00 143.10 ? 56   LEU B CG  1 
ATOM   7971  C CD1 . LEU B  1 43   ? 218.147 191.489 182.714 1.00 143.10 ? 56   LEU B CD1 1 
ATOM   7972  C CD2 . LEU B  1 43   ? 219.447 189.652 181.688 1.00 143.10 ? 56   LEU B CD2 1 
ATOM   7973  N N   . PRO B  1 44   ? 214.682 191.464 181.742 1.00 149.11 ? 57   PRO B N   1 
ATOM   7974  C CA  . PRO B  1 44   ? 214.122 192.046 180.525 1.00 149.11 ? 57   PRO B CA  1 
ATOM   7975  C C   . PRO B  1 44   ? 215.227 192.311 179.525 1.00 149.11 ? 57   PRO B C   1 
ATOM   7976  O O   . PRO B  1 44   ? 216.339 192.699 179.886 1.00 149.11 ? 57   PRO B O   1 
ATOM   7977  C CB  . PRO B  1 44   ? 213.490 193.355 181.010 1.00 149.11 ? 57   PRO B CB  1 
ATOM   7978  C CG  . PRO B  1 44   ? 213.608 193.341 182.489 1.00 149.11 ? 57   PRO B CG  1 
ATOM   7979  C CD  . PRO B  1 44   ? 214.717 192.433 182.841 1.00 149.11 ? 57   PRO B CD  1 
ATOM   7980  N N   . PHE B  1 45   ? 214.919 192.091 178.254 1.00 146.13 ? 58   PHE B N   1 
ATOM   7981  C CA  . PHE B  1 45   ? 215.931 192.280 177.229 1.00 146.13 ? 58   PHE B CA  1 
ATOM   7982  C C   . PHE B  1 45   ? 216.220 193.753 176.984 1.00 146.13 ? 58   PHE B C   1 
ATOM   7983  O O   . PHE B  1 45   ? 215.337 194.609 177.054 1.00 146.13 ? 58   PHE B O   1 
ATOM   7984  C CB  . PHE B  1 45   ? 215.512 191.606 175.933 1.00 146.13 ? 58   PHE B CB  1 
ATOM   7985  C CG  . PHE B  1 45   ? 216.270 190.360 175.654 1.00 146.13 ? 58   PHE B CG  1 
ATOM   7986  C CD1 . PHE B  1 45   ? 216.033 189.221 176.389 1.00 146.13 ? 58   PHE B CD1 1 
ATOM   7987  C CD2 . PHE B  1 45   ? 217.228 190.324 174.661 1.00 146.13 ? 58   PHE B CD2 1 
ATOM   7988  C CE1 . PHE B  1 45   ? 216.742 188.069 176.141 1.00 146.13 ? 58   PHE B CE1 1 
ATOM   7989  C CE2 . PHE B  1 45   ? 217.927 189.171 174.406 1.00 146.13 ? 58   PHE B CE2 1 
ATOM   7990  C CZ  . PHE B  1 45   ? 217.689 188.046 175.148 1.00 146.13 ? 58   PHE B CZ  1 
ATOM   7991  N N   . PHE B  1 46   ? 217.488 194.035 176.697 1.00 147.65 ? 59   PHE B N   1 
ATOM   7992  C CA  . PHE B  1 46   ? 217.946 195.376 176.358 1.00 147.65 ? 59   PHE B CA  1 
ATOM   7993  C C   . PHE B  1 46   ? 217.618 196.373 177.463 1.00 147.65 ? 59   PHE B C   1 
ATOM   7994  O O   . PHE B  1 46   ? 216.793 197.271 177.298 1.00 147.65 ? 59   PHE B O   1 
ATOM   7995  C CB  . PHE B  1 46   ? 217.382 195.816 175.011 1.00 147.65 ? 59   PHE B CB  1 
ATOM   7996  C CG  . PHE B  1 46   ? 217.861 194.975 173.877 1.00 147.65 ? 59   PHE B CG  1 
ATOM   7997  C CD1 . PHE B  1 46   ? 219.118 195.171 173.348 1.00 147.65 ? 59   PHE B CD1 1 
ATOM   7998  C CD2 . PHE B  1 46   ? 217.083 193.964 173.372 1.00 147.65 ? 59   PHE B CD2 1 
ATOM   7999  C CE1 . PHE B  1 46   ? 219.577 194.392 172.327 1.00 147.65 ? 59   PHE B CE1 1 
ATOM   8000  C CE2 . PHE B  1 46   ? 217.541 193.185 172.347 1.00 147.65 ? 59   PHE B CE2 1 
ATOM   8001  C CZ  . PHE B  1 46   ? 218.790 193.400 171.825 1.00 147.65 ? 59   PHE B CZ  1 
ATOM   8002  N N   . SER B  1 47   ? 218.272 196.193 178.605 1.00 163.15 ? 60   SER B N   1 
ATOM   8003  C CA  . SER B  1 47   ? 218.185 197.092 179.747 1.00 163.15 ? 60   SER B CA  1 
ATOM   8004  C C   . SER B  1 47   ? 219.586 197.448 180.241 1.00 163.15 ? 60   SER B C   1 
ATOM   8005  O O   . SER B  1 47   ? 220.599 196.965 179.729 1.00 163.15 ? 60   SER B O   1 
ATOM   8006  C CB  . SER B  1 47   ? 217.354 196.468 180.871 1.00 163.15 ? 60   SER B CB  1 
ATOM   8007  N N   . ASN B  1 48   ? 219.631 198.302 181.257 1.00 173.41 ? 61   ASN B N   1 
ATOM   8008  C CA  . ASN B  1 48   ? 220.896 198.769 181.799 1.00 173.41 ? 61   ASN B CA  1 
ATOM   8009  C C   . ASN B  1 48   ? 221.448 197.783 182.815 1.00 173.41 ? 61   ASN B C   1 
ATOM   8010  O O   . ASN B  1 48   ? 220.698 197.125 183.539 1.00 173.41 ? 61   ASN B O   1 
ATOM   8011  C CB  . ASN B  1 48   ? 220.725 200.141 182.445 1.00 173.41 ? 61   ASN B CB  1 
ATOM   8012  C CG  . ASN B  1 48   ? 220.760 201.267 181.435 1.00 173.41 ? 61   ASN B CG  1 
ATOM   8013  O OD1 . ASN B  1 48   ? 221.609 201.288 180.547 1.00 173.41 ? 61   ASN B OD1 1 
ATOM   8014  N ND2 . ASN B  1 48   ? 219.839 202.212 181.566 1.00 173.41 ? 61   ASN B ND2 1 
ATOM   8015  N N   . VAL B  1 49   ? 222.772 197.673 182.846 1.00 180.42 ? 62   VAL B N   1 
ATOM   8016  C CA  . VAL B  1 49   ? 223.476 196.813 183.788 1.00 180.42 ? 62   VAL B CA  1 
ATOM   8017  C C   . VAL B  1 49   ? 224.713 197.567 184.262 1.00 180.42 ? 62   VAL B C   1 
ATOM   8018  O O   . VAL B  1 49   ? 225.455 198.110 183.441 1.00 180.42 ? 62   VAL B O   1 
ATOM   8019  C CB  . VAL B  1 49   ? 223.870 195.475 183.140 1.00 180.42 ? 62   VAL B CB  1 
ATOM   8020  C CG1 . VAL B  1 49   ? 224.667 194.625 184.109 1.00 180.42 ? 62   VAL B CG1 1 
ATOM   8021  C CG2 . VAL B  1 49   ? 222.639 194.732 182.666 1.00 180.42 ? 62   VAL B CG2 1 
ATOM   8022  N N   . THR B  1 50   ? 224.947 197.603 185.574 1.00 190.44 ? 63   THR B N   1 
ATOM   8023  C CA  . THR B  1 50   ? 226.073 198.358 186.123 1.00 190.44 ? 63   THR B CA  1 
ATOM   8024  C C   . THR B  1 50   ? 227.295 197.455 186.222 1.00 190.44 ? 63   THR B C   1 
ATOM   8025  O O   . THR B  1 50   ? 227.305 196.495 186.997 1.00 190.44 ? 63   THR B O   1 
ATOM   8026  C CB  . THR B  1 50   ? 225.718 198.928 187.488 1.00 190.44 ? 63   THR B CB  1 
ATOM   8027  O OG1 . THR B  1 50   ? 225.690 197.865 188.442 1.00 190.44 ? 63   THR B OG1 1 
ATOM   8028  C CG2 . THR B  1 50   ? 224.353 199.577 187.434 1.00 190.44 ? 63   THR B CG2 1 
ATOM   8029  N N   . TRP B  1 51   ? 228.332 197.769 185.456 1.00 191.76 ? 64   TRP B N   1 
ATOM   8030  C CA  . TRP B  1 51   ? 229.532 196.946 185.380 1.00 191.76 ? 64   TRP B CA  1 
ATOM   8031  C C   . TRP B  1 51   ? 230.703 197.765 185.886 1.00 191.76 ? 64   TRP B C   1 
ATOM   8032  O O   . TRP B  1 51   ? 230.817 198.953 185.571 1.00 191.76 ? 64   TRP B O   1 
ATOM   8033  C CB  . TRP B  1 51   ? 229.785 196.472 183.954 1.00 191.76 ? 64   TRP B CB  1 
ATOM   8034  C CG  . TRP B  1 51   ? 230.457 197.476 183.106 1.00 191.76 ? 64   TRP B CG  1 
ATOM   8035  C CD1 . TRP B  1 51   ? 230.008 198.724 182.816 1.00 191.76 ? 64   TRP B CD1 1 
ATOM   8036  C CD2 . TRP B  1 51   ? 231.684 197.312 182.389 1.00 191.76 ? 64   TRP B CD2 1 
ATOM   8037  N NE1 . TRP B  1 51   ? 230.889 199.363 181.983 1.00 191.76 ? 64   TRP B NE1 1 
ATOM   8038  C CE2 . TRP B  1 51   ? 231.926 198.515 181.701 1.00 191.76 ? 64   TRP B CE2 1 
ATOM   8039  C CE3 . TRP B  1 51   ? 232.604 196.269 182.267 1.00 191.76 ? 64   TRP B CE3 1 
ATOM   8040  C CZ2 . TRP B  1 51   ? 233.051 198.706 180.903 1.00 191.76 ? 64   TRP B CZ2 1 
ATOM   8041  C CZ3 . TRP B  1 51   ? 233.720 196.460 181.473 1.00 191.76 ? 64   TRP B CZ3 1 
ATOM   8042  C CH2 . TRP B  1 51   ? 233.934 197.669 180.801 1.00 191.76 ? 64   TRP B CH2 1 
ATOM   8043  N N   . PHE B  1 52   ? 231.562 197.136 186.681 1.00 205.61 ? 65   PHE B N   1 
ATOM   8044  C CA  . PHE B  1 52   ? 232.646 197.841 187.344 1.00 205.61 ? 65   PHE B CA  1 
ATOM   8045  C C   . PHE B  1 52   ? 233.676 196.832 187.830 1.00 205.61 ? 65   PHE B C   1 
ATOM   8046  O O   . PHE B  1 52   ? 233.408 195.632 187.923 1.00 205.61 ? 65   PHE B O   1 
ATOM   8047  C CB  . PHE B  1 52   ? 232.110 198.727 188.480 1.00 205.61 ? 65   PHE B CB  1 
ATOM   8048  C CG  . PHE B  1 52   ? 231.120 198.047 189.396 1.00 205.61 ? 65   PHE B CG  1 
ATOM   8049  C CD1 . PHE B  1 52   ? 229.780 197.956 189.055 1.00 205.61 ? 65   PHE B CD1 1 
ATOM   8050  C CD2 . PHE B  1 52   ? 231.513 197.577 190.626 1.00 205.61 ? 65   PHE B CD2 1 
ATOM   8051  C CE1 . PHE B  1 52   ? 228.875 197.358 189.904 1.00 205.61 ? 65   PHE B CE1 1 
ATOM   8052  C CE2 . PHE B  1 52   ? 230.613 196.976 191.477 1.00 205.61 ? 65   PHE B CE2 1 
ATOM   8053  C CZ  . PHE B  1 52   ? 229.293 196.867 191.117 1.00 205.61 ? 65   PHE B CZ  1 
ATOM   8054  N N   . HIS B  1 53   ? 234.879 197.326 188.107 1.00 219.00 ? 66   HIS B N   1 
ATOM   8055  C CA  . HIS B  1 53   ? 235.993 196.471 188.490 1.00 219.00 ? 66   HIS B CA  1 
ATOM   8056  C C   . HIS B  1 53   ? 236.590 196.863 189.834 1.00 219.00 ? 66   HIS B C   1 
ATOM   8057  O O   . HIS B  1 53   ? 236.735 196.005 190.711 1.00 219.00 ? 66   HIS B O   1 
ATOM   8058  C CB  . HIS B  1 53   ? 237.045 196.498 187.368 1.00 219.00 ? 66   HIS B CB  1 
ATOM   8059  C CG  . HIS B  1 53   ? 237.786 195.209 187.198 1.00 219.00 ? 66   HIS B CG  1 
ATOM   8060  N ND1 . HIS B  1 53   ? 237.148 194.022 186.906 1.00 219.00 ? 66   HIS B ND1 1 
ATOM   8061  C CD2 . HIS B  1 53   ? 239.110 194.932 187.198 1.00 219.00 ? 66   HIS B CD2 1 
ATOM   8062  C CE1 . HIS B  1 53   ? 238.044 193.059 186.786 1.00 219.00 ? 66   HIS B CE1 1 
ATOM   8063  N NE2 . HIS B  1 53   ? 239.243 193.586 186.954 1.00 219.00 ? 66   HIS B NE2 1 
ATOM   8064  N N   . ALA B  1 54   ? 236.948 198.134 190.023 1.00 241.37 ? 67   ALA B N   1 
ATOM   8065  C CA  . ALA B  1 54   ? 237.343 198.638 191.340 1.00 241.37 ? 67   ALA B CA  1 
ATOM   8066  C C   . ALA B  1 54   ? 237.294 200.159 191.287 1.00 241.37 ? 67   ALA B C   1 
ATOM   8067  O O   . ALA B  1 54   ? 238.154 200.770 190.646 1.00 241.37 ? 67   ALA B O   1 
ATOM   8068  C CB  . ALA B  1 54   ? 238.738 198.147 191.714 1.00 241.37 ? 67   ALA B CB  1 
ATOM   8069  N N   . ILE B  1 55   ? 236.318 200.772 191.964 1.00 254.95 ? 68   ILE B N   1 
ATOM   8070  C CA  . ILE B  1 55   ? 236.185 202.230 191.897 1.00 254.95 ? 68   ILE B CA  1 
ATOM   8071  C C   . ILE B  1 55   ? 237.442 202.896 192.443 1.00 254.95 ? 68   ILE B C   1 
ATOM   8072  O O   . ILE B  1 55   ? 237.880 203.943 191.954 1.00 254.95 ? 68   ILE B O   1 
ATOM   8073  C CB  . ILE B  1 55   ? 234.921 202.709 192.633 1.00 254.95 ? 68   ILE B CB  1 
ATOM   8074  C CG1 . ILE B  1 55   ? 233.663 202.226 191.912 1.00 254.95 ? 68   ILE B CG1 1 
ATOM   8075  C CG2 . ILE B  1 55   ? 234.887 204.227 192.696 1.00 254.95 ? 68   ILE B CG2 1 
ATOM   8076  C CD1 . ILE B  1 55   ? 232.394 202.964 192.326 1.00 254.95 ? 68   ILE B CD1 1 
ATOM   8077  N N   . HIS B  1 56   ? 238.037 202.302 193.468 1.00 257.63 ? 69   HIS B N   1 
ATOM   8078  C CA  . HIS B  1 56   ? 239.352 202.700 193.948 1.00 257.63 ? 69   HIS B CA  1 
ATOM   8079  C C   . HIS B  1 56   ? 240.189 201.444 194.132 1.00 257.63 ? 69   HIS B C   1 
ATOM   8080  O O   . HIS B  1 56   ? 239.644 200.374 194.424 1.00 257.63 ? 69   HIS B O   1 
ATOM   8081  C CB  . HIS B  1 56   ? 239.259 203.472 195.261 1.00 257.63 ? 69   HIS B CB  1 
ATOM   8082  C CG  . HIS B  1 56   ? 238.580 204.801 195.143 1.00 257.63 ? 69   HIS B CG  1 
ATOM   8083  N ND1 . HIS B  1 56   ? 237.311 205.035 195.630 1.00 257.63 ? 69   HIS B ND1 1 
ATOM   8084  C CD2 . HIS B  1 56   ? 238.996 205.970 194.601 1.00 257.63 ? 69   HIS B CD2 1 
ATOM   8085  C CE1 . HIS B  1 56   ? 236.976 206.292 195.396 1.00 257.63 ? 69   HIS B CE1 1 
ATOM   8086  N NE2 . HIS B  1 56   ? 237.980 206.880 194.771 1.00 257.63 ? 69   HIS B NE2 1 
ATOM   8087  N N   . VAL B  1 57   ? 241.507 201.582 193.955 1.00 257.85 ? 70   VAL B N   1 
ATOM   8088  C CA  . VAL B  1 57   ? 242.452 200.433 194.098 1.00 257.85 ? 70   VAL B CA  1 
ATOM   8089  C C   . VAL B  1 57   ? 242.255 199.797 195.479 1.00 257.85 ? 70   VAL B C   1 
ATOM   8090  O O   . VAL B  1 57   ? 242.583 200.458 196.485 1.00 257.85 ? 70   VAL B O   1 
ATOM   8091  C CB  . VAL B  1 57   ? 243.913 200.872 193.883 1.00 257.85 ? 70   VAL B CB  1 
ATOM   8092  C CG1 . VAL B  1 57   ? 244.301 202.016 194.807 1.00 257.85 ? 70   VAL B CG1 1 
ATOM   8093  C CG2 . VAL B  1 57   ? 244.880 199.708 194.035 1.00 257.85 ? 70   VAL B CG2 1 
ATOM   8094  N N   . SER B  1 58   ? 241.735 198.566 195.512 1.00 260.20 ? 71   SER B N   1 
ATOM   8095  C CA  . SER B  1 58   ? 241.495 197.838 196.786 1.00 260.20 ? 71   SER B CA  1 
ATOM   8096  C C   . SER B  1 58   ? 241.286 196.346 196.503 1.00 260.20 ? 71   SER B C   1 
ATOM   8097  O O   . SER B  1 58   ? 241.201 195.976 195.315 1.00 260.20 ? 71   SER B O   1 
ATOM   8098  C CB  . SER B  1 58   ? 240.321 198.421 197.530 1.00 260.20 ? 71   SER B CB  1 
ATOM   8099  O OG  . SER B  1 58   ? 240.015 197.645 198.679 1.00 260.20 ? 71   SER B OG  1 
ATOM   8100  N N   . GLY B  1 59   ? 241.217 195.530 197.560 1.00 259.72 ? 72   GLY B N   1 
ATOM   8101  C CA  . GLY B  1 59   ? 241.010 194.076 197.418 1.00 259.72 ? 72   GLY B CA  1 
ATOM   8102  C C   . GLY B  1 59   ? 242.319 193.329 197.221 1.00 259.72 ? 72   GLY B C   1 
ATOM   8103  O O   . GLY B  1 59   ? 242.270 192.098 197.032 1.00 259.72 ? 72   GLY B O   1 
ATOM   8104  N N   . THR B  1 60   ? 243.447 194.046 197.265 1.00 266.44 ? 73   THR B N   1 
ATOM   8105  C CA  . THR B  1 60   ? 244.780 193.413 197.078 1.00 266.44 ? 73   THR B CA  1 
ATOM   8106  C C   . THR B  1 60   ? 245.649 193.648 198.319 1.00 266.44 ? 73   THR B C   1 
ATOM   8107  O O   . THR B  1 60   ? 246.717 193.011 198.416 1.00 266.44 ? 73   THR B O   1 
ATOM   8108  C CB  . THR B  1 60   ? 245.463 193.922 195.801 1.00 266.44 ? 73   THR B CB  1 
ATOM   8109  O OG1 . THR B  1 60   ? 246.708 193.237 195.660 1.00 266.44 ? 73   THR B OG1 1 
ATOM   8110  C CG2 . THR B  1 60   ? 245.699 195.417 195.816 1.00 266.44 ? 73   THR B CG2 1 
ATOM   8111  N N   . ASN B  1 61   ? 245.207 194.533 199.219 1.00 271.40 ? 74   ASN B N   1 
ATOM   8112  C CA  . ASN B  1 61   ? 245.970 194.842 200.459 1.00 271.40 ? 74   ASN B CA  1 
ATOM   8113  C C   . ASN B  1 61   ? 245.059 195.570 201.454 1.00 271.40 ? 74   ASN B C   1 
ATOM   8114  O O   . ASN B  1 61   ? 244.741 194.979 202.506 1.00 271.40 ? 74   ASN B O   1 
ATOM   8115  C CB  . ASN B  1 61   ? 247.228 195.664 200.164 1.00 271.40 ? 74   ASN B CB  1 
ATOM   8116  C CG  . ASN B  1 61   ? 248.129 195.821 201.371 1.00 271.40 ? 74   ASN B CG  1 
ATOM   8117  O OD1 . ASN B  1 61   ? 247.851 195.275 202.436 1.00 271.40 ? 74   ASN B OD1 1 
ATOM   8118  N ND2 . ASN B  1 61   ? 249.211 196.565 201.212 1.00 271.40 ? 74   ASN B ND2 1 
ATOM   8119  N N   . GLY B  1 62   ? 244.670 196.807 201.130 1.00 264.93 ? 75   GLY B N   1 
ATOM   8120  C CA  . GLY B  1 62   ? 243.801 197.612 202.010 1.00 264.93 ? 75   GLY B CA  1 
ATOM   8121  C C   . GLY B  1 62   ? 242.384 197.710 201.471 1.00 264.93 ? 75   GLY B C   1 
ATOM   8122  O O   . GLY B  1 62   ? 242.111 197.104 200.416 1.00 264.93 ? 75   GLY B O   1 
ATOM   8123  N N   . THR B  1 63   ? 241.517 198.450 202.169 1.00 252.98 ? 76   THR B N   1 
ATOM   8124  C CA  . THR B  1 63   ? 240.102 198.622 201.745 1.00 252.98 ? 76   THR B CA  1 
ATOM   8125  C C   . THR B  1 63   ? 239.788 200.116 201.604 1.00 252.98 ? 76   THR B C   1 
ATOM   8126  O O   . THR B  1 63   ? 239.871 200.834 202.620 1.00 252.98 ? 76   THR B O   1 
ATOM   8127  C CB  . THR B  1 63   ? 239.144 197.938 202.729 1.00 252.98 ? 76   THR B CB  1 
ATOM   8128  O OG1 . THR B  1 63   ? 239.295 198.567 204.003 1.00 252.98 ? 76   THR B OG1 1 
ATOM   8129  C CG2 . THR B  1 63   ? 239.395 196.452 202.858 1.00 252.98 ? 76   THR B CG2 1 
ATOM   8130  N N   . LYS B  1 64   ? 239.442 200.554 200.389 1.00 248.96 ? 77   LYS B N   1 
ATOM   8131  C CA  . LYS B  1 64   ? 239.112 201.981 200.124 1.00 248.96 ? 77   LYS B CA  1 
ATOM   8132  C C   . LYS B  1 64   ? 237.772 202.063 199.384 1.00 248.96 ? 77   LYS B C   1 
ATOM   8133  O O   . LYS B  1 64   ? 237.226 200.999 199.028 1.00 248.96 ? 77   LYS B O   1 
ATOM   8134  C CB  . LYS B  1 64   ? 240.230 202.642 199.311 1.00 248.96 ? 77   LYS B CB  1 
ATOM   8135  C CG  . LYS B  1 64   ? 239.991 204.099 198.936 1.00 248.96 ? 77   LYS B CG  1 
ATOM   8136  C CD  . LYS B  1 64   ? 239.901 205.020 200.134 1.00 248.96 ? 77   LYS B CD  1 
ATOM   8137  C CE  . LYS B  1 64   ? 239.730 206.475 199.750 1.00 248.96 ? 77   LYS B CE  1 
ATOM   8138  N NZ  . LYS B  1 64   ? 240.858 206.959 198.919 1.00 248.96 ? 77   LYS B NZ  1 
ATOM   8139  N N   . ARG B  1 65   ? 237.265 203.282 199.172 1.00 247.84 ? 78   ARG B N   1 
ATOM   8140  C CA  . ARG B  1 65   ? 235.974 203.482 198.460 1.00 247.84 ? 78   ARG B CA  1 
ATOM   8141  C C   . ARG B  1 65   ? 235.460 204.901 198.733 1.00 247.84 ? 78   ARG B C   1 
ATOM   8142  O O   . ARG B  1 65   ? 236.136 205.646 199.471 1.00 247.84 ? 78   ARG B O   1 
ATOM   8143  C CB  . ARG B  1 65   ? 234.950 202.437 198.912 1.00 247.84 ? 78   ARG B CB  1 
ATOM   8144  C CG  . ARG B  1 65   ? 234.584 202.522 200.387 1.00 247.84 ? 78   ARG B CG  1 
ATOM   8145  C CD  . ARG B  1 65   ? 233.557 201.483 200.793 1.00 247.84 ? 78   ARG B CD  1 
ATOM   8146  N NE  . ARG B  1 65   ? 234.040 200.122 200.608 1.00 247.84 ? 78   ARG B NE  1 
ATOM   8147  C CZ  . ARG B  1 65   ? 233.337 199.030 200.889 1.00 247.84 ? 78   ARG B CZ  1 
ATOM   8148  N NH1 . ARG B  1 65   ? 232.112 199.138 201.371 1.00 247.84 ? 78   ARG B NH1 1 
ATOM   8149  N NH2 . ARG B  1 65   ? 233.863 197.835 200.686 1.00 247.84 ? 78   ARG B NH2 1 
ATOM   8150  N N   . PHE B  1 66   ? 234.306 205.253 198.157 1.00 242.67 ? 79   PHE B N   1 
ATOM   8151  C CA  . PHE B  1 66   ? 233.712 206.602 198.352 1.00 242.67 ? 79   PHE B CA  1 
ATOM   8152  C C   . PHE B  1 66   ? 232.370 206.470 199.082 1.00 242.67 ? 79   PHE B C   1 
ATOM   8153  O O   . PHE B  1 66   ? 232.246 206.978 200.213 1.00 242.67 ? 79   PHE B O   1 
ATOM   8154  C CB  . PHE B  1 66   ? 233.548 207.318 197.009 1.00 242.67 ? 79   PHE B CB  1 
ATOM   8155  C CG  . PHE B  1 66   ? 232.919 208.686 197.099 1.00 242.67 ? 79   PHE B CG  1 
ATOM   8156  C CD1 . PHE B  1 66   ? 233.700 209.816 197.284 1.00 242.67 ? 79   PHE B CD1 1 
ATOM   8157  C CD2 . PHE B  1 66   ? 231.546 208.844 196.999 1.00 242.67 ? 79   PHE B CD2 1 
ATOM   8158  C CE1 . PHE B  1 66   ? 233.121 211.073 197.367 1.00 242.67 ? 79   PHE B CE1 1 
ATOM   8159  C CE2 . PHE B  1 66   ? 230.969 210.102 197.082 1.00 242.67 ? 79   PHE B CE2 1 
ATOM   8160  C CZ  . PHE B  1 66   ? 231.757 211.213 197.266 1.00 242.67 ? 79   PHE B CZ  1 
ATOM   8161  N N   . ASP B  1 67   ? 231.401 205.806 198.443 1.00 242.75 ? 80   ASP B N   1 
ATOM   8162  C CA  . ASP B  1 67   ? 230.052 205.610 199.041 1.00 242.75 ? 80   ASP B CA  1 
ATOM   8163  C C   . ASP B  1 67   ? 229.615 204.155 198.824 1.00 242.75 ? 80   ASP B C   1 
ATOM   8164  O O   . ASP B  1 67   ? 230.290 203.445 198.052 1.00 242.75 ? 80   ASP B O   1 
ATOM   8165  C CB  . ASP B  1 67   ? 229.045 206.615 198.473 1.00 242.75 ? 80   ASP B CB  1 
ATOM   8166  C CG  . ASP B  1 67   ? 227.885 206.913 199.407 1.00 242.75 ? 80   ASP B CG  1 
ATOM   8167  O OD1 . ASP B  1 67   ? 227.852 206.326 200.506 1.00 242.75 ? 80   ASP B OD1 1 
ATOM   8168  O OD2 . ASP B  1 67   ? 227.023 207.730 199.027 1.00 242.75 ? 80   ASP B OD2 1 
ATOM   8169  N N   . ASN B  1 68   ? 228.537 203.734 199.493 1.00 235.95 ? 81   ASN B N   1 
ATOM   8170  C CA  . ASN B  1 68   ? 228.018 202.345 199.363 1.00 235.95 ? 81   ASN B CA  1 
ATOM   8171  C C   . ASN B  1 68   ? 226.522 202.393 199.033 1.00 235.95 ? 81   ASN B C   1 
ATOM   8172  O O   . ASN B  1 68   ? 225.751 201.779 199.797 1.00 235.95 ? 81   ASN B O   1 
ATOM   8173  C CB  . ASN B  1 68   ? 228.290 201.518 200.622 1.00 235.95 ? 81   ASN B CB  1 
ATOM   8174  N N   . VAL B  1 70   ? 225.563 198.121 196.940 1.00 207.76 ? 83   VAL B N   1 
ATOM   8175  C CA  . VAL B  1 70   ? 224.551 197.102 197.351 1.00 207.76 ? 83   VAL B CA  1 
ATOM   8176  C C   . VAL B  1 70   ? 223.150 197.701 197.182 1.00 207.76 ? 83   VAL B C   1 
ATOM   8177  O O   . VAL B  1 70   ? 222.833 198.672 197.897 1.00 207.76 ? 83   VAL B O   1 
ATOM   8178  C CB  . VAL B  1 70   ? 224.788 196.623 198.796 1.00 207.76 ? 83   VAL B CB  1 
ATOM   8179  C CG1 . VAL B  1 70   ? 226.158 195.985 198.962 1.00 207.76 ? 83   VAL B CG1 1 
ATOM   8180  C CG2 . VAL B  1 70   ? 224.595 197.749 199.801 1.00 207.76 ? 83   VAL B CG2 1 
ATOM   8181  N N   . LEU B  1 71   ? 222.355 197.141 196.264 1.00 200.29 ? 84   LEU B N   1 
ATOM   8182  C CA  . LEU B  1 71   ? 220.974 197.634 196.008 1.00 200.29 ? 84   LEU B CA  1 
ATOM   8183  C C   . LEU B  1 71   ? 219.962 196.659 196.623 1.00 200.29 ? 84   LEU B C   1 
ATOM   8184  O O   . LEU B  1 71   ? 220.394 195.620 197.163 1.00 200.29 ? 84   LEU B O   1 
ATOM   8185  C CB  . LEU B  1 71   ? 220.760 197.767 194.497 1.00 200.29 ? 84   LEU B CB  1 
ATOM   8186  C CG  . LEU B  1 71   ? 221.689 198.748 193.783 1.00 200.29 ? 84   LEU B CG  1 
ATOM   8187  C CD1 . LEU B  1 71   ? 223.130 198.264 193.829 1.00 200.29 ? 84   LEU B CD1 1 
ATOM   8188  C CD2 . LEU B  1 71   ? 221.247 198.959 192.342 1.00 200.29 ? 84   LEU B CD2 1 
ATOM   8189  N N   . PRO B  1 72   ? 218.642 196.948 196.572 1.00 194.16 ? 85   PRO B N   1 
ATOM   8190  C CA  . PRO B  1 72   ? 217.623 196.061 197.139 1.00 194.16 ? 85   PRO B CA  1 
ATOM   8191  C C   . PRO B  1 72   ? 217.128 195.018 196.125 1.00 194.16 ? 85   PRO B C   1 
ATOM   8192  O O   . PRO B  1 72   ? 217.939 194.477 195.395 1.00 194.16 ? 85   PRO B O   1 
ATOM   8193  C CB  . PRO B  1 72   ? 216.492 197.050 197.448 1.00 194.16 ? 85   PRO B CB  1 
ATOM   8194  C CG  . PRO B  1 72   ? 216.579 198.057 196.321 1.00 194.16 ? 85   PRO B CG  1 
ATOM   8195  C CD  . PRO B  1 72   ? 218.055 198.157 195.988 1.00 194.16 ? 85   PRO B CD  1 
ATOM   8196  N N   . PHE B  1 73   ? 215.815 194.766 196.114 1.00 190.66 ? 86   PHE B N   1 
ATOM   8197  C CA  . PHE B  1 73   ? 215.202 193.780 195.184 1.00 190.66 ? 86   PHE B CA  1 
ATOM   8198  C C   . PHE B  1 73   ? 213.946 194.392 194.554 1.00 190.66 ? 86   PHE B C   1 
ATOM   8199  O O   . PHE B  1 73   ? 213.017 194.762 195.299 1.00 190.66 ? 86   PHE B O   1 
ATOM   8200  C CB  . PHE B  1 73   ? 214.873 192.481 195.925 1.00 190.66 ? 86   PHE B CB  1 
ATOM   8201  C CG  . PHE B  1 73   ? 214.219 191.419 195.077 1.00 190.66 ? 86   PHE B CG  1 
ATOM   8202  C CD1 . PHE B  1 73   ? 212.841 191.358 194.952 1.00 190.66 ? 86   PHE B CD1 1 
ATOM   8203  C CD2 . PHE B  1 73   ? 214.982 190.479 194.402 1.00 190.66 ? 86   PHE B CD2 1 
ATOM   8204  C CE1 . PHE B  1 73   ? 212.240 190.382 194.173 1.00 190.66 ? 86   PHE B CE1 1 
ATOM   8205  C CE2 . PHE B  1 73   ? 214.381 189.503 193.623 1.00 190.66 ? 86   PHE B CE2 1 
ATOM   8206  C CZ  . PHE B  1 73   ? 213.012 189.456 193.510 1.00 190.66 ? 86   PHE B CZ  1 
ATOM   8207  N N   . ASN B  1 74   ? 213.925 194.487 193.220 1.00 191.75 ? 87   ASN B N   1 
ATOM   8208  C CA  . ASN B  1 74   ? 212.769 195.072 192.488 1.00 191.75 ? 87   ASN B CA  1 
ATOM   8209  C C   . ASN B  1 74   ? 212.144 194.008 191.577 1.00 191.75 ? 87   ASN B C   1 
ATOM   8210  O O   . ASN B  1 74   ? 212.116 194.227 190.350 1.00 191.75 ? 87   ASN B O   1 
ATOM   8211  C CB  . ASN B  1 74   ? 213.176 196.313 191.689 1.00 191.75 ? 87   ASN B CB  1 
ATOM   8212  C CG  . ASN B  1 74   ? 213.617 197.466 192.565 1.00 191.75 ? 87   ASN B CG  1 
ATOM   8213  O OD1 . ASN B  1 74   ? 214.340 198.353 192.116 1.00 191.75 ? 87   ASN B OD1 1 
ATOM   8214  N ND2 . ASN B  1 74   ? 213.187 197.465 193.816 1.00 191.75 ? 87   ASN B ND2 1 
ATOM   8215  N N   . ASP B  1 75   ? 211.656 192.909 192.162 1.00 179.93 ? 88   ASP B N   1 
ATOM   8216  C CA  . ASP B  1 75   ? 211.033 191.838 191.387 1.00 179.93 ? 88   ASP B CA  1 
ATOM   8217  C C   . ASP B  1 75   ? 212.079 190.838 190.893 1.00 179.93 ? 88   ASP B C   1 
ATOM   8218  O O   . ASP B  1 75   ? 212.076 190.424 189.735 1.00 179.93 ? 88   ASP B O   1 
ATOM   8219  C CB  . ASP B  1 75   ? 210.216 192.406 190.223 1.00 179.93 ? 88   ASP B CB  1 
ATOM   8220  C CG  . ASP B  1 75   ? 208.794 192.753 190.613 1.00 179.93 ? 88   ASP B CG  1 
ATOM   8221  O OD1 . ASP B  1 75   ? 208.042 191.844 191.018 1.00 179.93 ? 88   ASP B OD1 1 
ATOM   8222  O OD2 . ASP B  1 75   ? 208.427 193.938 190.499 1.00 179.93 ? 88   ASP B OD2 1 
ATOM   8223  N N   . GLY B  1 76   ? 212.974 190.448 191.788 1.00 184.81 ? 89   GLY B N   1 
ATOM   8224  C CA  . GLY B  1 76   ? 213.920 189.387 191.505 1.00 184.81 ? 89   GLY B CA  1 
ATOM   8225  C C   . GLY B  1 76   ? 215.339 189.892 191.317 1.00 184.81 ? 89   GLY B C   1 
ATOM   8226  O O   . GLY B  1 76   ? 215.574 191.019 190.872 1.00 184.81 ? 89   GLY B O   1 
ATOM   8227  N N   . VAL B  1 77   ? 216.306 189.020 191.590 1.00 186.47 ? 90   VAL B N   1 
ATOM   8228  C CA  . VAL B  1 77   ? 217.709 189.408 191.622 1.00 186.47 ? 90   VAL B CA  1 
ATOM   8229  C C   . VAL B  1 77   ? 218.551 188.480 190.752 1.00 186.47 ? 90   VAL B C   1 
ATOM   8230  O O   . VAL B  1 77   ? 218.342 187.261 190.724 1.00 186.47 ? 90   VAL B O   1 
ATOM   8231  C CB  . VAL B  1 77   ? 218.236 189.436 193.068 1.00 186.47 ? 90   VAL B CB  1 
ATOM   8232  C CG1 . VAL B  1 77   ? 217.683 190.643 193.798 1.00 186.47 ? 90   VAL B CG1 1 
ATOM   8233  C CG2 . VAL B  1 77   ? 217.830 188.176 193.782 1.00 186.47 ? 90   VAL B CG2 1 
ATOM   8234  N N   . TYR B  1 78   ? 219.515 189.077 190.048 1.00 189.16 ? 91   TYR B N   1 
ATOM   8235  C CA  . TYR B  1 78   ? 220.447 188.398 189.153 1.00 189.16 ? 91   TYR B CA  1 
ATOM   8236  C C   . TYR B  1 78   ? 221.848 188.942 189.431 1.00 189.16 ? 91   TYR B C   1 
ATOM   8237  O O   . TYR B  1 78   ? 222.047 190.163 189.415 1.00 189.16 ? 91   TYR B O   1 
ATOM   8238  C CB  . TYR B  1 78   ? 220.034 188.620 187.678 1.00 189.16 ? 91   TYR B CB  1 
ATOM   8239  C CG  . TYR B  1 78   ? 220.940 187.988 186.643 1.00 189.16 ? 91   TYR B CG  1 
ATOM   8240  C CD1 . TYR B  1 78   ? 220.724 186.698 186.199 1.00 189.16 ? 91   TYR B CD1 1 
ATOM   8241  C CD2 . TYR B  1 78   ? 222.002 188.684 186.109 1.00 189.16 ? 91   TYR B CD2 1 
ATOM   8242  C CE1 . TYR B  1 78   ? 221.550 186.116 185.268 1.00 189.16 ? 91   TYR B CE1 1 
ATOM   8243  C CE2 . TYR B  1 78   ? 222.831 188.111 185.178 1.00 189.16 ? 91   TYR B CE2 1 
ATOM   8244  C CZ  . TYR B  1 78   ? 222.602 186.829 184.761 1.00 189.16 ? 91   TYR B CZ  1 
ATOM   8245  O OH  . TYR B  1 78   ? 223.433 186.258 183.828 1.00 189.16 ? 91   TYR B OH  1 
ATOM   8246  N N   . PHE B  1 79   ? 222.814 188.045 189.676 1.00 200.91 ? 92   PHE B N   1 
ATOM   8247  C CA  . PHE B  1 79   ? 224.148 188.422 190.145 1.00 200.91 ? 92   PHE B CA  1 
ATOM   8248  C C   . PHE B  1 79   ? 225.211 187.481 189.590 1.00 200.91 ? 92   PHE B C   1 
ATOM   8249  O O   . PHE B  1 79   ? 225.016 186.258 189.562 1.00 200.91 ? 92   PHE B O   1 
ATOM   8250  C CB  . PHE B  1 79   ? 224.190 188.416 191.679 1.00 200.91 ? 92   PHE B CB  1 
ATOM   8251  C CG  . PHE B  1 79   ? 225.421 189.056 192.275 1.00 200.91 ? 92   PHE B CG  1 
ATOM   8252  C CD1 . PHE B  1 79   ? 226.628 188.381 192.322 1.00 200.91 ? 92   PHE B CD1 1 
ATOM   8253  C CD2 . PHE B  1 79   ? 225.354 190.314 192.851 1.00 200.91 ? 92   PHE B CD2 1 
ATOM   8254  C CE1 . PHE B  1 79   ? 227.751 188.966 192.898 1.00 200.91 ? 92   PHE B CE1 1 
ATOM   8255  C CE2 . PHE B  1 79   ? 226.479 190.906 193.411 1.00 200.91 ? 92   PHE B CE2 1 
ATOM   8256  C CZ  . PHE B  1 79   ? 227.669 190.221 193.450 1.00 200.91 ? 92   PHE B CZ  1 
ATOM   8257  N N   . ALA B  1 80   ? 226.331 188.058 189.164 1.00 193.60 ? 93   ALA B N   1 
ATOM   8258  C CA  . ALA B  1 80   ? 227.492 187.302 188.703 1.00 193.60 ? 93   ALA B CA  1 
ATOM   8259  C C   . ALA B  1 80   ? 228.622 188.276 188.384 1.00 193.60 ? 93   ALA B C   1 
ATOM   8260  O O   . ALA B  1 80   ? 228.462 189.500 188.468 1.00 193.60 ? 93   ALA B O   1 
ATOM   8261  C CB  . ALA B  1 80   ? 227.167 186.447 187.485 1.00 193.60 ? 93   ALA B CB  1 
ATOM   8262  N N   . SER B  1 81   ? 229.768 187.710 188.001 1.00 197.49 ? 94   SER B N   1 
ATOM   8263  C CA  . SER B  1 81   ? 230.972 188.448 187.630 1.00 197.49 ? 94   SER B CA  1 
ATOM   8264  C C   . SER B  1 81   ? 231.936 187.484 186.951 1.00 197.49 ? 94   SER B C   1 
ATOM   8265  O O   . SER B  1 81   ? 231.553 186.394 186.522 1.00 197.49 ? 94   SER B O   1 
ATOM   8266  C CB  . SER B  1 81   ? 231.637 189.115 188.835 1.00 197.49 ? 94   SER B CB  1 
ATOM   8267  O OG  . SER B  1 81   ? 230.832 190.153 189.363 1.00 197.49 ? 94   SER B OG  1 
ATOM   8268  N N   . THR B  1 82   ? 233.201 187.904 186.855 1.00 200.76 ? 95   THR B N   1 
ATOM   8269  C CA  . THR B  1 82   ? 234.220 187.169 186.112 1.00 200.76 ? 95   THR B CA  1 
ATOM   8270  C C   . THR B  1 82   ? 235.477 186.851 186.914 1.00 200.76 ? 95   THR B C   1 
ATOM   8271  O O   . THR B  1 82   ? 236.473 186.428 186.320 1.00 200.76 ? 95   THR B O   1 
ATOM   8272  C CB  . THR B  1 82   ? 234.633 187.953 184.873 1.00 200.76 ? 95   THR B CB  1 
ATOM   8273  O OG1 . THR B  1 82   ? 235.633 187.213 184.163 1.00 200.76 ? 95   THR B OG1 1 
ATOM   8274  C CG2 . THR B  1 82   ? 235.214 189.293 185.287 1.00 200.76 ? 95   THR B CG2 1 
ATOM   8275  N N   . GLU B  1 83   ? 235.475 187.049 188.232 1.00 202.35 ? 96   GLU B N   1 
ATOM   8276  C CA  . GLU B  1 83   ? 236.683 186.828 189.027 1.00 202.35 ? 96   GLU B CA  1 
ATOM   8277  C C   . GLU B  1 83   ? 236.989 185.339 189.092 1.00 202.35 ? 96   GLU B C   1 
ATOM   8278  O O   . GLU B  1 83   ? 236.263 184.576 189.736 1.00 202.35 ? 96   GLU B O   1 
ATOM   8279  C CB  . GLU B  1 83   ? 236.520 187.403 190.431 1.00 202.35 ? 96   GLU B CB  1 
ATOM   8280  N N   . LYS B  1 84   ? 238.085 184.924 188.459 1.00 198.73 ? 97   LYS B N   1 
ATOM   8281  C CA  . LYS B  1 84   ? 238.483 183.525 188.506 1.00 198.73 ? 97   LYS B CA  1 
ATOM   8282  C C   . LYS B  1 84   ? 238.965 183.220 189.907 1.00 198.73 ? 97   LYS B C   1 
ATOM   8283  O O   . LYS B  1 84   ? 240.120 182.837 190.111 1.00 198.73 ? 97   LYS B O   1 
ATOM   8284  C CB  . LYS B  1 84   ? 239.583 183.231 187.492 1.00 198.73 ? 97   LYS B CB  1 
ATOM   8285  N N   . SER B  1 85   ? 238.064 183.377 190.867 1.00 209.99 ? 98   SER B N   1 
ATOM   8286  C CA  . SER B  1 85   ? 238.382 183.385 192.283 1.00 209.99 ? 98   SER B CA  1 
ATOM   8287  C C   . SER B  1 85   ? 237.080 183.547 193.042 1.00 209.99 ? 98   SER B C   1 
ATOM   8288  O O   . SER B  1 85   ? 236.104 184.093 192.522 1.00 209.99 ? 98   SER B O   1 
ATOM   8289  C CB  . SER B  1 85   ? 239.338 184.523 192.642 1.00 209.99 ? 98   SER B CB  1 
ATOM   8290  O OG  . SER B  1 85   ? 238.620 185.731 192.828 1.00 209.99 ? 98   SER B OG  1 
ATOM   8291  N N   . ASN B  1 86   ? 237.093 183.105 194.291 1.00 219.17 ? 99   ASN B N   1 
ATOM   8292  C CA  . ASN B  1 86   ? 235.933 183.240 195.153 1.00 219.17 ? 99   ASN B CA  1 
ATOM   8293  C C   . ASN B  1 86   ? 235.791 184.641 195.720 1.00 219.17 ? 99   ASN B C   1 
ATOM   8294  O O   . ASN B  1 86   ? 235.066 184.816 196.707 1.00 219.17 ? 99   ASN B O   1 
ATOM   8295  C CB  . ASN B  1 86   ? 235.994 182.213 196.285 1.00 219.17 ? 99   ASN B CB  1 
ATOM   8296  N N   . ILE B  1 87   ? 236.482 185.627 195.132 1.00 218.67 ? 100  ILE B N   1 
ATOM   8297  C CA  . ILE B  1 87   ? 236.335 187.019 195.555 1.00 218.67 ? 100  ILE B CA  1 
ATOM   8298  C C   . ILE B  1 87   ? 234.864 187.384 195.643 1.00 218.67 ? 100  ILE B C   1 
ATOM   8299  O O   . ILE B  1 87   ? 234.440 188.127 196.536 1.00 218.67 ? 100  ILE B O   1 
ATOM   8300  C CB  . ILE B  1 87   ? 237.094 187.954 194.597 1.00 218.67 ? 100  ILE B CB  1 
ATOM   8301  N N   . ILE B  1 88   ? 234.063 186.860 194.718 1.00 211.68 ? 101  ILE B N   1 
ATOM   8302  C CA  . ILE B  1 88   ? 232.618 186.824 194.901 1.00 211.68 ? 101  ILE B CA  1 
ATOM   8303  C C   . ILE B  1 88   ? 232.350 185.839 196.028 1.00 211.68 ? 101  ILE B C   1 
ATOM   8304  O O   . ILE B  1 88   ? 232.343 184.624 195.813 1.00 211.68 ? 101  ILE B O   1 
ATOM   8305  C CB  . ILE B  1 88   ? 231.894 186.404 193.619 1.00 211.68 ? 101  ILE B CB  1 
ATOM   8306  C CG1 . ILE B  1 88   ? 232.201 187.374 192.484 1.00 211.68 ? 101  ILE B CG1 1 
ATOM   8307  C CG2 . ILE B  1 88   ? 230.410 186.311 193.866 1.00 211.68 ? 101  ILE B CG2 1 
ATOM   8308  C CD1 . ILE B  1 88   ? 233.295 186.891 191.582 1.00 211.68 ? 101  ILE B CD1 1 
ATOM   8309  N N   . ARG B  1 89   ? 232.130 186.354 197.231 1.00 218.36 ? 102  ARG B N   1 
ATOM   8310  C CA  . ARG B  1 89   ? 232.150 185.507 198.409 1.00 218.36 ? 102  ARG B CA  1 
ATOM   8311  C C   . ARG B  1 89   ? 230.779 185.077 198.892 1.00 218.36 ? 102  ARG B C   1 
ATOM   8312  O O   . ARG B  1 89   ? 230.603 183.899 199.198 1.00 218.36 ? 102  ARG B O   1 
ATOM   8313  C CB  . ARG B  1 89   ? 232.882 186.208 199.558 1.00 218.36 ? 102  ARG B CB  1 
ATOM   8314  N N   . GLY B  1 90   ? 229.800 185.970 198.954 1.00 212.43 ? 103  GLY B N   1 
ATOM   8315  C CA  . GLY B  1 90   ? 228.535 185.592 199.552 1.00 212.43 ? 103  GLY B CA  1 
ATOM   8316  C C   . GLY B  1 90   ? 227.374 186.413 199.035 1.00 212.43 ? 103  GLY B C   1 
ATOM   8317  O O   . GLY B  1 90   ? 227.490 187.618 198.794 1.00 212.43 ? 103  GLY B O   1 
ATOM   8318  N N   . TRP B  1 91   ? 226.241 185.727 198.897 1.00 204.28 ? 104  TRP B N   1 
ATOM   8319  C CA  . TRP B  1 91   ? 224.946 186.323 198.607 1.00 204.28 ? 104  TRP B CA  1 
ATOM   8320  C C   . TRP B  1 91   ? 224.117 186.275 199.878 1.00 204.28 ? 104  TRP B C   1 
ATOM   8321  O O   . TRP B  1 91   ? 223.990 185.213 200.495 1.00 204.28 ? 104  TRP B O   1 
ATOM   8322  C CB  . TRP B  1 91   ? 224.233 185.567 197.490 1.00 204.28 ? 104  TRP B CB  1 
ATOM   8323  C CG  . TRP B  1 91   ? 224.899 185.647 196.173 1.00 204.28 ? 104  TRP B CG  1 
ATOM   8324  C CD1 . TRP B  1 91   ? 224.558 186.457 195.143 1.00 204.28 ? 104  TRP B CD1 1 
ATOM   8325  C CD2 . TRP B  1 91   ? 226.027 184.890 195.732 1.00 204.28 ? 104  TRP B CD2 1 
ATOM   8326  N NE1 . TRP B  1 91   ? 225.390 186.245 194.079 1.00 204.28 ? 104  TRP B NE1 1 
ATOM   8327  C CE2 . TRP B  1 91   ? 226.309 185.290 194.420 1.00 204.28 ? 104  TRP B CE2 1 
ATOM   8328  C CE3 . TRP B  1 91   ? 226.826 183.912 196.321 1.00 204.28 ? 104  TRP B CE3 1 
ATOM   8329  C CZ2 . TRP B  1 91   ? 227.354 184.749 193.685 1.00 204.28 ? 104  TRP B CZ2 1 
ATOM   8330  C CZ3 . TRP B  1 91   ? 227.867 183.375 195.587 1.00 204.28 ? 104  TRP B CZ3 1 
ATOM   8331  C CH2 . TRP B  1 91   ? 228.121 183.794 194.287 1.00 204.28 ? 104  TRP B CH2 1 
ATOM   8332  N N   . ILE B  1 92   ? 223.537 187.406 200.255 1.00 212.28 ? 105  ILE B N   1 
ATOM   8333  C CA  . ILE B  1 92   ? 222.902 187.565 201.553 1.00 212.28 ? 105  ILE B CA  1 
ATOM   8334  C C   . ILE B  1 92   ? 221.442 187.916 201.334 1.00 212.28 ? 105  ILE B C   1 
ATOM   8335  O O   . ILE B  1 92   ? 221.119 189.036 200.937 1.00 212.28 ? 105  ILE B O   1 
ATOM   8336  C CB  . ILE B  1 92   ? 223.609 188.642 202.384 1.00 212.28 ? 105  ILE B CB  1 
ATOM   8337  N N   . PHE B  1 93   ? 220.563 186.975 201.639 1.00 217.21 ? 106  PHE B N   1 
ATOM   8338  C CA  . PHE B  1 93   ? 219.141 187.105 201.374 1.00 217.21 ? 106  PHE B CA  1 
ATOM   8339  C C   . PHE B  1 93   ? 218.352 187.189 202.675 1.00 217.21 ? 106  PHE B C   1 
ATOM   8340  O O   . PHE B  1 93   ? 218.498 186.346 203.564 1.00 217.21 ? 106  PHE B O   1 
ATOM   8341  C CB  . PHE B  1 93   ? 218.655 185.922 200.543 1.00 217.21 ? 106  PHE B CB  1 
ATOM   8342  C CG  . PHE B  1 93   ? 219.081 185.981 199.110 1.00 217.21 ? 106  PHE B CG  1 
ATOM   8343  C CD1 . PHE B  1 93   ? 220.396 186.250 198.776 1.00 217.21 ? 106  PHE B CD1 1 
ATOM   8344  C CD2 . PHE B  1 93   ? 218.169 185.754 198.097 1.00 217.21 ? 106  PHE B CD2 1 
ATOM   8345  C CE1 . PHE B  1 93   ? 220.791 186.304 197.466 1.00 217.21 ? 106  PHE B CE1 1 
ATOM   8346  C CE2 . PHE B  1 93   ? 218.560 185.805 196.782 1.00 217.21 ? 106  PHE B CE2 1 
ATOM   8347  C CZ  . PHE B  1 93   ? 219.874 186.083 196.468 1.00 217.21 ? 106  PHE B CZ  1 
ATOM   8348  N N   . GLY B  1 94   ? 217.502 188.201 202.762 1.00 225.50 ? 107  GLY B N   1 
ATOM   8349  C CA  . GLY B  1 94   ? 216.711 188.435 203.955 1.00 225.50 ? 107  GLY B CA  1 
ATOM   8350  C C   . GLY B  1 94   ? 215.922 189.723 203.807 1.00 225.50 ? 107  GLY B C   1 
ATOM   8351  O O   . GLY B  1 94   ? 215.668 190.181 202.699 1.00 225.50 ? 107  GLY B O   1 
ATOM   8352  N N   . THR B  1 95   ? 215.536 190.282 204.944 1.00 236.91 ? 108  THR B N   1 
ATOM   8353  C CA  . THR B  1 95   ? 214.879 191.583 204.944 1.00 236.91 ? 108  THR B CA  1 
ATOM   8354  C C   . THR B  1 95   ? 215.529 192.581 205.892 1.00 236.91 ? 108  THR B C   1 
ATOM   8355  O O   . THR B  1 95   ? 215.544 193.778 205.592 1.00 236.91 ? 108  THR B O   1 
ATOM   8356  C CB  . THR B  1 95   ? 213.387 191.426 205.272 1.00 236.91 ? 108  THR B CB  1 
ATOM   8357  O OG1 . THR B  1 95   ? 212.819 190.472 204.376 1.00 236.91 ? 108  THR B OG1 1 
ATOM   8358  C CG2 . THR B  1 95   ? 212.652 192.734 205.065 1.00 236.91 ? 108  THR B CG2 1 
ATOM   8359  N N   . THR B  1 96   ? 216.092 192.129 207.023 1.00 248.56 ? 109  THR B N   1 
ATOM   8360  C CA  . THR B  1 96   ? 216.758 193.028 207.958 1.00 248.56 ? 109  THR B CA  1 
ATOM   8361  C C   . THR B  1 96   ? 218.250 192.782 208.125 1.00 248.56 ? 109  THR B C   1 
ATOM   8362  O O   . THR B  1 96   ? 218.966 193.723 208.479 1.00 248.56 ? 109  THR B O   1 
ATOM   8363  C CB  . THR B  1 96   ? 216.107 192.955 209.344 1.00 248.56 ? 109  THR B CB  1 
ATOM   8364  O OG1 . THR B  1 96   ? 216.410 191.692 209.947 1.00 248.56 ? 109  THR B OG1 1 
ATOM   8365  C CG2 . THR B  1 96   ? 214.610 193.109 209.220 1.00 248.56 ? 109  THR B CG2 1 
ATOM   8366  N N   . LEU B  1 97   ? 218.736 191.561 207.899 1.00 249.40 ? 110  LEU B N   1 
ATOM   8367  C CA  . LEU B  1 97   ? 220.168 191.257 207.937 1.00 249.40 ? 110  LEU B CA  1 
ATOM   8368  C C   . LEU B  1 97   ? 220.781 191.550 209.308 1.00 249.40 ? 110  LEU B C   1 
ATOM   8369  O O   . LEU B  1 97   ? 221.714 192.343 209.445 1.00 249.40 ? 110  LEU B O   1 
ATOM   8370  C CB  . LEU B  1 97   ? 220.922 192.005 206.835 1.00 249.40 ? 110  LEU B CB  1 
ATOM   8371  C CG  . LEU B  1 97   ? 221.137 191.189 205.575 1.00 249.40 ? 110  LEU B CG  1 
ATOM   8372  C CD1 . LEU B  1 97   ? 222.101 190.067 205.893 1.00 249.40 ? 110  LEU B CD1 1 
ATOM   8373  C CD2 . LEU B  1 97   ? 219.818 190.636 205.078 1.00 249.40 ? 110  LEU B CD2 1 
ATOM   8374  N N   . ASP B  1 98   ? 220.242 190.885 210.322 1.00 253.09 ? 111  ASP B N   1 
ATOM   8375  C CA  . ASP B  1 98   ? 220.797 190.908 211.672 1.00 253.09 ? 111  ASP B CA  1 
ATOM   8376  C C   . ASP B  1 98   ? 220.254 189.693 212.411 1.00 253.09 ? 111  ASP B C   1 
ATOM   8377  O O   . ASP B  1 98   ? 219.806 188.721 211.795 1.00 253.09 ? 111  ASP B O   1 
ATOM   8378  C CB  . ASP B  1 98   ? 220.474 192.223 212.388 1.00 253.09 ? 111  ASP B CB  1 
ATOM   8379  C CG  . ASP B  1 98   ? 221.573 193.255 212.229 1.00 253.09 ? 111  ASP B CG  1 
ATOM   8380  O OD1 . ASP B  1 98   ? 222.758 192.863 212.249 1.00 253.09 ? 111  ASP B OD1 1 
ATOM   8381  O OD2 . ASP B  1 98   ? 221.257 194.452 212.070 1.00 253.09 ? 111  ASP B OD2 1 
ATOM   8382  N N   . SER B  1 99   ? 220.310 189.734 213.735 1.00 264.59 ? 112  SER B N   1 
ATOM   8383  C CA  . SER B  1 99   ? 219.670 188.706 214.542 1.00 264.59 ? 112  SER B CA  1 
ATOM   8384  C C   . SER B  1 99   ? 218.156 188.862 214.613 1.00 264.59 ? 112  SER B C   1 
ATOM   8385  O O   . SER B  1 99   ? 217.504 188.075 215.308 1.00 264.59 ? 112  SER B O   1 
ATOM   8386  C CB  . SER B  1 99   ? 220.242 188.711 215.957 1.00 264.59 ? 112  SER B CB  1 
ATOM   8387  O OG  . SER B  1 99   ? 219.465 187.882 216.803 1.00 264.59 ? 112  SER B OG  1 
ATOM   8388  N N   . LYS B  1 100  ? 217.589 189.858 213.930 1.00 255.05 ? 113  LYS B N   1 
ATOM   8389  C CA  . LYS B  1 100  ? 216.148 190.083 213.948 1.00 255.05 ? 113  LYS B CA  1 
ATOM   8390  C C   . LYS B  1 100  ? 215.429 189.301 212.851 1.00 255.05 ? 113  LYS B C   1 
ATOM   8391  O O   . LYS B  1 100  ? 214.290 188.867 213.052 1.00 255.05 ? 113  LYS B O   1 
ATOM   8392  C CB  . LYS B  1 100  ? 215.852 191.586 213.841 1.00 255.05 ? 113  LYS B CB  1 
ATOM   8393  C CG  . LYS B  1 100  ? 214.364 191.975 213.805 1.00 255.05 ? 113  LYS B CG  1 
ATOM   8394  C CD  . LYS B  1 100  ? 213.773 191.976 212.394 1.00 255.05 ? 113  LYS B CD  1 
ATOM   8395  C CE  . LYS B  1 100  ? 212.256 191.860 212.401 1.00 255.05 ? 113  LYS B CE  1 
ATOM   8396  N NZ  . LYS B  1 100  ? 211.680 191.804 211.030 1.00 255.05 ? 113  LYS B NZ  1 
ATOM   8397  N N   . THR B  1 101  ? 216.053 189.123 211.688 1.00 250.86 ? 114  THR B N   1 
ATOM   8398  C CA  . THR B  1 101  ? 215.559 188.191 210.684 1.00 250.86 ? 114  THR B CA  1 
ATOM   8399  C C   . THR B  1 101  ? 216.680 187.251 210.278 1.00 250.86 ? 114  THR B C   1 
ATOM   8400  O O   . THR B  1 101  ? 217.805 187.683 210.016 1.00 250.86 ? 114  THR B O   1 
ATOM   8401  C CB  . THR B  1 101  ? 215.028 188.909 209.452 1.00 250.86 ? 114  THR B CB  1 
ATOM   8402  O OG1 . THR B  1 101  ? 216.003 189.851 208.993 1.00 250.86 ? 114  THR B OG1 1 
ATOM   8403  C CG2 . THR B  1 101  ? 213.755 189.640 209.793 1.00 250.86 ? 114  THR B CG2 1 
ATOM   8404  N N   . GLN B  1 102  ? 216.367 185.959 210.232 1.00 244.52 ? 115  GLN B N   1 
ATOM   8405  C CA  . GLN B  1 102  ? 217.373 184.982 209.849 1.00 244.52 ? 115  GLN B CA  1 
ATOM   8406  C C   . GLN B  1 102  ? 217.872 185.301 208.450 1.00 244.52 ? 115  GLN B C   1 
ATOM   8407  O O   . GLN B  1 102  ? 217.083 185.575 207.544 1.00 244.52 ? 115  GLN B O   1 
ATOM   8408  C CB  . GLN B  1 102  ? 216.797 183.572 209.909 1.00 244.52 ? 115  GLN B CB  1 
ATOM   8409  N N   . SER B  1 103  ? 219.190 185.287 208.278 1.00 245.18 ? 116  SER B N   1 
ATOM   8410  C CA  . SER B  1 103  ? 219.814 185.813 207.072 1.00 245.18 ? 116  SER B CA  1 
ATOM   8411  C C   . SER B  1 103  ? 220.535 184.700 206.335 1.00 245.18 ? 116  SER B C   1 
ATOM   8412  O O   . SER B  1 103  ? 221.340 183.975 206.924 1.00 245.18 ? 116  SER B O   1 
ATOM   8413  C CB  . SER B  1 103  ? 220.784 186.947 207.397 1.00 245.18 ? 116  SER B CB  1 
ATOM   8414  O OG  . SER B  1 103  ? 220.088 188.173 207.510 1.00 245.18 ? 116  SER B OG  1 
ATOM   8415  N N   . LEU B  1 104  ? 220.255 184.590 205.047 1.00 230.53 ? 117  LEU B N   1 
ATOM   8416  C CA  . LEU B  1 104  ? 220.673 183.466 204.229 1.00 230.53 ? 117  LEU B CA  1 
ATOM   8417  C C   . LEU B  1 104  ? 221.957 183.794 203.488 1.00 230.53 ? 117  LEU B C   1 
ATOM   8418  O O   . LEU B  1 104  ? 221.971 184.675 202.626 1.00 230.53 ? 117  LEU B O   1 
ATOM   8419  C CB  . LEU B  1 104  ? 219.562 183.132 203.244 1.00 230.53 ? 117  LEU B CB  1 
ATOM   8420  C CG  . LEU B  1 104  ? 218.245 182.935 203.983 1.00 230.53 ? 117  LEU B CG  1 
ATOM   8421  C CD1 . LEU B  1 104  ? 217.061 183.333 203.132 1.00 230.53 ? 117  LEU B CD1 1 
ATOM   8422  C CD2 . LEU B  1 104  ? 218.163 181.469 204.297 1.00 230.53 ? 117  LEU B CD2 1 
ATOM   8423  N N   . LEU B  1 105  ? 223.022 183.070 203.810 1.00 224.59 ? 118  LEU B N   1 
ATOM   8424  C CA  . LEU B  1 105  ? 224.311 183.219 203.149 1.00 224.59 ? 118  LEU B CA  1 
ATOM   8425  C C   . LEU B  1 105  ? 224.671 181.892 202.501 1.00 224.59 ? 118  LEU B C   1 
ATOM   8426  O O   . LEU B  1 105  ? 224.400 180.828 203.067 1.00 224.59 ? 118  LEU B O   1 
ATOM   8427  C CB  . LEU B  1 105  ? 225.385 183.663 204.142 1.00 224.59 ? 118  LEU B CB  1 
ATOM   8428  C CG  . LEU B  1 105  ? 225.733 182.718 205.290 1.00 224.59 ? 118  LEU B CG  1 
ATOM   8429  C CD1 . LEU B  1 105  ? 226.872 181.786 204.907 1.00 224.59 ? 118  LEU B CD1 1 
ATOM   8430  C CD2 . LEU B  1 105  ? 226.072 183.512 206.534 1.00 224.59 ? 118  LEU B CD2 1 
ATOM   8431  N N   . ILE B  1 106  ? 225.259 181.949 201.314 1.00 217.06 ? 119  ILE B N   1 
ATOM   8432  C CA  . ILE B  1 106  ? 225.514 180.764 200.510 1.00 217.06 ? 119  ILE B CA  1 
ATOM   8433  C C   . ILE B  1 106  ? 226.948 180.849 200.022 1.00 217.06 ? 119  ILE B C   1 
ATOM   8434  O O   . ILE B  1 106  ? 227.235 181.602 199.085 1.00 217.06 ? 119  ILE B O   1 
ATOM   8435  C CB  . ILE B  1 106  ? 224.538 180.667 199.335 1.00 217.06 ? 119  ILE B CB  1 
ATOM   8436  C CG1 . ILE B  1 106  ? 223.095 180.650 199.842 1.00 217.06 ? 119  ILE B CG1 1 
ATOM   8437  C CG2 . ILE B  1 106  ? 224.830 179.437 198.520 1.00 217.06 ? 119  ILE B CG2 1 
ATOM   8438  C CD1 . ILE B  1 106  ? 222.449 182.016 199.944 1.00 217.06 ? 119  ILE B CD1 1 
ATOM   8439  N N   . VAL B  1 107  ? 227.861 180.105 200.650 1.00 218.64 ? 120  VAL B N   1 
ATOM   8440  C CA  . VAL B  1 107  ? 229.278 180.333 200.378 1.00 218.64 ? 120  VAL B CA  1 
ATOM   8441  C C   . VAL B  1 107  ? 230.018 179.008 200.318 1.00 218.64 ? 120  VAL B C   1 
ATOM   8442  O O   . VAL B  1 107  ? 229.695 178.059 201.035 1.00 218.64 ? 120  VAL B O   1 
ATOM   8443  C CB  . VAL B  1 107  ? 229.928 181.260 201.428 1.00 218.64 ? 120  VAL B CB  1 
ATOM   8444  C CG1 . VAL B  1 107  ? 231.394 181.496 201.101 1.00 218.64 ? 120  VAL B CG1 1 
ATOM   8445  C CG2 . VAL B  1 107  ? 229.186 182.573 201.526 1.00 218.64 ? 120  VAL B CG2 1 
ATOM   8446  N N   . ASN B  1 108  ? 231.031 178.961 199.453 1.00 219.12 ? 121  ASN B N   1 
ATOM   8447  C CA  . ASN B  1 108  ? 231.903 177.799 199.353 1.00 219.12 ? 121  ASN B CA  1 
ATOM   8448  C C   . ASN B  1 108  ? 232.608 177.547 200.686 1.00 219.12 ? 121  ASN B C   1 
ATOM   8449  O O   . ASN B  1 108  ? 232.999 178.484 201.387 1.00 219.12 ? 121  ASN B O   1 
ATOM   8450  C CB  . ASN B  1 108  ? 232.936 178.003 198.229 1.00 219.12 ? 121  ASN B CB  1 
ATOM   8451  C CG  . ASN B  1 108  ? 232.301 178.397 196.882 1.00 219.12 ? 121  ASN B CG  1 
ATOM   8452  O OD1 . ASN B  1 108  ? 232.134 179.579 196.587 1.00 219.12 ? 121  ASN B OD1 1 
ATOM   8453  N ND2 . ASN B  1 108  ? 231.967 177.407 196.064 1.00 219.12 ? 121  ASN B ND2 1 
ATOM   8454  N N   . ASN B  1 109  ? 232.752 176.271 201.035 1.00 216.43 ? 122  ASN B N   1 
ATOM   8455  C CA  . ASN B  1 109  ? 233.398 175.806 202.257 1.00 216.43 ? 122  ASN B CA  1 
ATOM   8456  C C   . ASN B  1 109  ? 234.809 175.285 201.984 1.00 216.43 ? 122  ASN B C   1 
ATOM   8457  O O   . ASN B  1 109  ? 235.352 174.511 202.775 1.00 216.43 ? 122  ASN B O   1 
ATOM   8458  C CB  . ASN B  1 109  ? 232.473 174.759 202.899 1.00 216.43 ? 122  ASN B CB  1 
ATOM   8459  C CG  . ASN B  1 109  ? 233.044 174.071 204.132 1.00 216.43 ? 122  ASN B CG  1 
ATOM   8460  O OD1 . ASN B  1 109  ? 233.712 174.659 204.981 1.00 216.43 ? 122  ASN B OD1 1 
ATOM   8461  N ND2 . ASN B  1 109  ? 232.731 172.786 204.219 1.00 216.43 ? 122  ASN B ND2 1 
ATOM   8462  N N   . ALA B  1 110  ? 235.388 175.673 200.849 1.00 198.34 ? 123  ALA B N   1 
ATOM   8463  C CA  . ALA B  1 110  ? 236.796 175.483 200.513 1.00 198.34 ? 123  ALA B CA  1 
ATOM   8464  C C   . ALA B  1 110  ? 237.118 174.037 200.167 1.00 198.34 ? 123  ALA B C   1 
ATOM   8465  O O   . ALA B  1 110  ? 238.213 173.736 199.684 1.00 198.34 ? 123  ALA B O   1 
ATOM   8466  C CB  . ALA B  1 110  ? 237.694 175.966 201.654 1.00 198.34 ? 123  ALA B CB  1 
ATOM   8467  N N   . THR B  1 111  ? 236.178 173.138 200.414 1.00 200.25 ? 124  THR B N   1 
ATOM   8468  C CA  . THR B  1 111  ? 236.234 171.797 199.855 1.00 200.25 ? 124  THR B CA  1 
ATOM   8469  C C   . THR B  1 111  ? 234.825 171.438 199.438 1.00 200.25 ? 124  THR B C   1 
ATOM   8470  O O   . THR B  1 111  ? 234.595 170.523 198.645 1.00 200.25 ? 124  THR B O   1 
ATOM   8471  C CB  . THR B  1 111  ? 236.781 170.794 200.862 1.00 200.25 ? 124  THR B CB  1 
ATOM   8472  O OG1 . THR B  1 111  ? 236.911 169.517 200.228 1.00 200.25 ? 124  THR B OG1 1 
ATOM   8473  C CG2 . THR B  1 111  ? 235.845 170.679 202.054 1.00 200.25 ? 124  THR B CG2 1 
ATOM   8474  N N   . ASN B  1 112  ? 233.880 172.159 200.022 1.00 206.43 ? 125  ASN B N   1 
ATOM   8475  C CA  . ASN B  1 112  ? 232.470 172.014 199.731 1.00 206.43 ? 125  ASN B CA  1 
ATOM   8476  C C   . ASN B  1 112  ? 231.875 173.410 199.792 1.00 206.43 ? 125  ASN B C   1 
ATOM   8477  O O   . ASN B  1 112  ? 232.591 174.415 199.742 1.00 206.43 ? 125  ASN B O   1 
ATOM   8478  C CB  . ASN B  1 112  ? 231.805 171.026 200.697 1.00 206.43 ? 125  ASN B CB  1 
ATOM   8479  C CG  . ASN B  1 112  ? 232.007 169.590 200.282 1.00 206.43 ? 125  ASN B CG  1 
ATOM   8480  O OD1 . ASN B  1 112  ? 232.956 168.936 200.706 1.00 206.43 ? 125  ASN B OD1 1 
ATOM   8481  N ND2 . ASN B  1 112  ? 231.099 169.084 199.461 1.00 206.43 ? 125  ASN B ND2 1 
ATOM   8482  N N   . VAL B  1 113  ? 230.553 173.476 199.848 1.00 218.46 ? 126  VAL B N   1 
ATOM   8483  C CA  . VAL B  1 113  ? 229.811 174.722 199.955 1.00 218.46 ? 126  VAL B CA  1 
ATOM   8484  C C   . VAL B  1 113  ? 228.720 174.514 200.985 1.00 218.46 ? 126  VAL B C   1 
ATOM   8485  O O   . VAL B  1 113  ? 228.215 173.399 201.149 1.00 218.46 ? 126  VAL B O   1 
ATOM   8486  C CB  . VAL B  1 113  ? 229.209 175.144 198.601 1.00 218.46 ? 126  VAL B CB  1 
ATOM   8487  C CG1 . VAL B  1 113  ? 228.572 176.513 198.679 1.00 218.46 ? 126  VAL B CG1 1 
ATOM   8488  C CG2 . VAL B  1 113  ? 230.271 175.139 197.539 1.00 218.46 ? 126  VAL B CG2 1 
ATOM   8489  N N   . VAL B  1 114  ? 228.368 175.576 201.690 1.00 221.42 ? 127  VAL B N   1 
ATOM   8490  C CA  . VAL B  1 114  ? 227.388 175.480 202.755 1.00 221.42 ? 127  VAL B CA  1 
ATOM   8491  C C   . VAL B  1 114  ? 226.420 176.647 202.644 1.00 221.42 ? 127  VAL B C   1 
ATOM   8492  O O   . VAL B  1 114  ? 226.782 177.749 202.204 1.00 221.42 ? 127  VAL B O   1 
ATOM   8493  C CB  . VAL B  1 114  ? 228.063 175.432 204.145 1.00 221.42 ? 127  VAL B CB  1 
ATOM   8494  C CG1 . VAL B  1 114  ? 227.026 175.410 205.262 1.00 221.42 ? 127  VAL B CG1 1 
ATOM   8495  C CG2 . VAL B  1 114  ? 228.975 174.211 204.257 1.00 221.42 ? 127  VAL B CG2 1 
ATOM   8496  N N   . ILE B  1 115  ? 225.177 176.371 203.016 1.00 222.34 ? 128  ILE B N   1 
ATOM   8497  C CA  . ILE B  1 115  ? 224.089 177.331 203.079 1.00 222.34 ? 128  ILE B CA  1 
ATOM   8498  C C   . ILE B  1 115  ? 223.731 177.532 204.543 1.00 222.34 ? 128  ILE B C   1 
ATOM   8499  O O   . ILE B  1 115  ? 223.430 176.565 205.249 1.00 222.34 ? 128  ILE B O   1 
ATOM   8500  C CB  . ILE B  1 115  ? 222.876 176.834 202.278 1.00 222.34 ? 128  ILE B CB  1 
ATOM   8501  C CG1 . ILE B  1 115  ? 223.236 176.679 200.794 1.00 222.34 ? 128  ILE B CG1 1 
ATOM   8502  C CG2 . ILE B  1 115  ? 221.683 177.743 202.502 1.00 222.34 ? 128  ILE B CG2 1 
ATOM   8503  C CD1 . ILE B  1 115  ? 223.882 175.365 200.420 1.00 222.34 ? 128  ILE B CD1 1 
ATOM   8504  N N   . LYS B  1 116  ? 223.771 178.774 205.003 1.00 235.24 ? 129  LYS B N   1 
ATOM   8505  C CA  . LYS B  1 116  ? 223.560 179.073 206.407 1.00 235.24 ? 129  LYS B CA  1 
ATOM   8506  C C   . LYS B  1 116  ? 222.492 180.152 206.548 1.00 235.24 ? 129  LYS B C   1 
ATOM   8507  O O   . LYS B  1 116  ? 222.286 180.956 205.636 1.00 235.24 ? 129  LYS B O   1 
ATOM   8508  C CB  . LYS B  1 116  ? 224.890 179.493 207.057 1.00 235.24 ? 129  LYS B CB  1 
ATOM   8509  C CG  . LYS B  1 116  ? 226.081 178.590 206.669 1.00 235.24 ? 129  LYS B CG  1 
ATOM   8510  C CD  . LYS B  1 116  ? 227.439 179.151 207.112 1.00 235.24 ? 129  LYS B CD  1 
ATOM   8511  C CE  . LYS B  1 116  ? 228.600 178.238 206.716 1.00 235.24 ? 129  LYS B CE  1 
ATOM   8512  N NZ  . LYS B  1 116  ? 229.934 178.854 206.970 1.00 235.24 ? 129  LYS B NZ  1 
ATOM   8513  N N   . VAL B  1 117  ? 221.818 180.158 207.703 1.00 244.16 ? 130  VAL B N   1 
ATOM   8514  C CA  . VAL B  1 117  ? 220.743 181.154 207.990 1.00 244.16 ? 130  VAL B CA  1 
ATOM   8515  C C   . VAL B  1 117  ? 220.769 181.488 209.486 1.00 244.16 ? 130  VAL B C   1 
ATOM   8516  O O   . VAL B  1 117  ? 219.682 181.572 210.092 1.00 244.16 ? 130  VAL B O   1 
ATOM   8517  C CB  . VAL B  1 117  ? 219.360 180.633 207.554 1.00 244.16 ? 130  VAL B CB  1 
ATOM   8518  C CG1 . VAL B  1 117  ? 218.922 179.434 208.382 1.00 244.16 ? 130  VAL B CG1 1 
ATOM   8519  C CG2 . VAL B  1 117  ? 218.305 181.728 207.597 1.00 244.16 ? 130  VAL B CG2 1 
ATOM   8520  N N   . CYS B  1 118  ? 221.990 181.655 210.048 1.00 265.39 ? 131  CYS B N   1 
ATOM   8521  C CA  . CYS B  1 118  ? 222.147 181.983 211.491 1.00 265.39 ? 131  CYS B CA  1 
ATOM   8522  C C   . CYS B  1 118  ? 222.366 183.492 211.652 1.00 265.39 ? 131  CYS B C   1 
ATOM   8523  O O   . CYS B  1 118  ? 222.341 184.206 210.629 1.00 265.39 ? 131  CYS B O   1 
ATOM   8524  C CB  . CYS B  1 118  ? 223.325 181.228 212.093 1.00 265.39 ? 131  CYS B CB  1 
ATOM   8525  S SG  . CYS B  1 118  ? 223.632 179.624 211.308 1.00 265.39 ? 131  CYS B SG  1 
ATOM   8526  N N   . GLU B  1 119  ? 222.550 183.962 212.892 1.00 274.50 ? 132  GLU B N   1 
ATOM   8527  C CA  . GLU B  1 119  ? 222.773 185.405 213.176 1.00 274.50 ? 132  GLU B CA  1 
ATOM   8528  C C   . GLU B  1 119  ? 224.238 185.622 213.575 1.00 274.50 ? 132  GLU B C   1 
ATOM   8529  O O   . GLU B  1 119  ? 224.793 184.756 214.279 1.00 274.50 ? 132  GLU B O   1 
ATOM   8530  C CB  . GLU B  1 119  ? 221.827 185.883 214.280 1.00 274.50 ? 132  GLU B CB  1 
ATOM   8531  C CG  . GLU B  1 119  ? 220.362 185.631 213.971 1.00 274.50 ? 132  GLU B CG  1 
ATOM   8532  C CD  . GLU B  1 119  ? 219.552 185.096 215.139 1.00 274.50 ? 132  GLU B CD  1 
ATOM   8533  O OE1 . GLU B  1 119  ? 219.488 185.784 216.177 1.00 274.50 ? 132  GLU B OE1 1 
ATOM   8534  O OE2 . GLU B  1 119  ? 218.987 183.992 215.008 1.00 274.50 ? 132  GLU B OE2 1 
ATOM   8535  N N   . PHE B  1 120  ? 224.828 186.738 213.136 1.00 285.86 ? 133  PHE B N   1 
ATOM   8536  C CA  . PHE B  1 120  ? 226.244 187.062 213.455 1.00 285.86 ? 133  PHE B CA  1 
ATOM   8537  C C   . PHE B  1 120  ? 226.504 188.546 213.171 1.00 285.86 ? 133  PHE B C   1 
ATOM   8538  O O   . PHE B  1 120  ? 225.542 189.278 212.861 1.00 285.86 ? 133  PHE B O   1 
ATOM   8539  C CB  . PHE B  1 120  ? 227.193 186.166 212.654 1.00 285.86 ? 133  PHE B CB  1 
ATOM   8540  C CG  . PHE B  1 120  ? 227.253 186.468 211.178 1.00 285.86 ? 133  PHE B CG  1 
ATOM   8541  C CD1 . PHE B  1 120  ? 226.186 186.165 210.347 1.00 285.86 ? 133  PHE B CD1 1 
ATOM   8542  C CD2 . PHE B  1 120  ? 228.376 187.055 210.618 1.00 285.86 ? 133  PHE B CD2 1 
ATOM   8543  C CE1 . PHE B  1 120  ? 226.242 186.443 208.990 1.00 285.86 ? 133  PHE B CE1 1 
ATOM   8544  C CE2 . PHE B  1 120  ? 228.431 187.333 209.262 1.00 285.86 ? 133  PHE B CE2 1 
ATOM   8545  C CZ  . PHE B  1 120  ? 227.364 187.027 208.450 1.00 285.86 ? 133  PHE B CZ  1 
ATOM   8546  N N   . GLN B  1 121  ? 227.768 188.968 213.277 1.00 290.37 ? 134  GLN B N   1 
ATOM   8547  C CA  . GLN B  1 121  ? 228.146 190.366 213.031 1.00 290.37 ? 134  GLN B CA  1 
ATOM   8548  C C   . GLN B  1 121  ? 228.325 190.662 211.542 1.00 290.37 ? 134  GLN B C   1 
ATOM   8549  O O   . GLN B  1 121  ? 227.498 191.350 210.936 1.00 290.37 ? 134  GLN B O   1 
ATOM   8550  C CB  . GLN B  1 121  ? 229.419 190.692 213.819 1.00 290.37 ? 134  GLN B CB  1 
ATOM   8551  C CG  . GLN B  1 121  ? 229.536 192.131 214.306 1.00 290.37 ? 134  GLN B CG  1 
ATOM   8552  C CD  . GLN B  1 121  ? 230.820 192.383 215.086 1.00 290.37 ? 134  GLN B CD  1 
ATOM   8553  O OE1 . GLN B  1 121  ? 231.688 191.516 215.178 1.00 290.37 ? 134  GLN B OE1 1 
ATOM   8554  N NE2 . GLN B  1 121  ? 230.942 193.576 215.652 1.00 290.37 ? 134  GLN B NE2 1 
ATOM   8555  N N   . PHE B  1 122  ? 229.373 190.111 210.931 1.00 295.21 ? 135  PHE B N   1 
ATOM   8556  C CA  . PHE B  1 122  ? 229.769 190.487 209.574 1.00 295.21 ? 135  PHE B CA  1 
ATOM   8557  C C   . PHE B  1 122  ? 230.910 189.580 209.124 1.00 295.21 ? 135  PHE B C   1 
ATOM   8558  O O   . PHE B  1 122  ? 231.476 188.817 209.911 1.00 295.21 ? 135  PHE B O   1 
ATOM   8559  C CB  . PHE B  1 122  ? 230.179 191.958 209.489 1.00 295.21 ? 135  PHE B CB  1 
ATOM   8560  N N   . CYS B  1 123  ? 231.247 189.685 207.839 1.00 301.08 ? 136  CYS B N   1 
ATOM   8561  C CA  . CYS B  1 123  ? 232.256 188.913 207.129 1.00 301.08 ? 136  CYS B CA  1 
ATOM   8562  C C   . CYS B  1 123  ? 233.499 189.781 206.896 1.00 301.08 ? 136  CYS B C   1 
ATOM   8563  O O   . CYS B  1 123  ? 233.608 190.876 207.478 1.00 301.08 ? 136  CYS B O   1 
ATOM   8564  C CB  . CYS B  1 123  ? 231.637 188.372 205.842 1.00 301.08 ? 136  CYS B CB  1 
ATOM   8565  S SG  . CYS B  1 123  ? 232.495 186.969 205.099 1.00 301.08 ? 136  CYS B SG  1 
ATOM   8566  N N   . ASN B  1 124  ? 234.427 189.299 206.069 1.00 297.32 ? 137  ASN B N   1 
ATOM   8567  C CA  . ASN B  1 124  ? 235.612 190.056 205.675 1.00 297.32 ? 137  ASN B CA  1 
ATOM   8568  C C   . ASN B  1 124  ? 236.040 189.600 204.284 1.00 297.32 ? 137  ASN B C   1 
ATOM   8569  O O   . ASN B  1 124  ? 235.300 188.903 203.585 1.00 297.32 ? 137  ASN B O   1 
ATOM   8570  C CB  . ASN B  1 124  ? 236.746 189.907 206.699 1.00 297.32 ? 137  ASN B CB  1 
ATOM   8571  C CG  . ASN B  1 124  ? 237.144 188.456 206.947 1.00 297.32 ? 137  ASN B CG  1 
ATOM   8572  O OD1 . ASN B  1 124  ? 236.688 187.542 206.264 1.00 297.32 ? 137  ASN B OD1 1 
ATOM   8573  N ND2 . ASN B  1 124  ? 238.002 188.244 207.940 1.00 297.32 ? 137  ASN B ND2 1 
ATOM   8574  N N   . ASP B  1 125  ? 237.250 190.008 203.889 1.00 287.20 ? 138  ASP B N   1 
ATOM   8575  C CA  . ASP B  1 125  ? 237.809 189.654 202.556 1.00 287.20 ? 138  ASP B CA  1 
ATOM   8576  C C   . ASP B  1 125  ? 238.192 188.170 202.541 1.00 287.20 ? 138  ASP B C   1 
ATOM   8577  O O   . ASP B  1 125  ? 239.170 187.805 203.222 1.00 287.20 ? 138  ASP B O   1 
ATOM   8578  C CB  . ASP B  1 125  ? 238.997 190.550 202.195 1.00 287.20 ? 138  ASP B CB  1 
ATOM   8579  C CG  . ASP B  1 125  ? 238.717 191.481 201.027 1.00 287.20 ? 138  ASP B CG  1 
ATOM   8580  O OD1 . ASP B  1 125  ? 237.697 191.269 200.342 1.00 287.20 ? 138  ASP B OD1 1 
ATOM   8581  O OD2 . ASP B  1 125  ? 239.521 192.409 200.813 1.00 287.20 ? 138  ASP B OD2 1 
ATOM   8582  N N   . PRO B  1 126  ? 237.466 187.302 201.800 1.00 288.48 ? 139  PRO B N   1 
ATOM   8583  C CA  . PRO B  1 126  ? 237.787 185.873 201.740 1.00 288.48 ? 139  PRO B CA  1 
ATOM   8584  C C   . PRO B  1 126  ? 238.993 185.616 200.824 1.00 288.48 ? 139  PRO B C   1 
ATOM   8585  O O   . PRO B  1 126  ? 239.617 184.578 200.955 1.00 288.48 ? 139  PRO B O   1 
ATOM   8586  C CB  . PRO B  1 126  ? 236.520 185.263 201.127 1.00 288.48 ? 139  PRO B CB  1 
ATOM   8587  C CG  . PRO B  1 126  ? 235.978 186.365 200.244 1.00 288.48 ? 139  PRO B CG  1 
ATOM   8588  C CD  . PRO B  1 126  ? 236.300 187.649 200.982 1.00 288.48 ? 139  PRO B CD  1 
ATOM   8589  N N   . PHE B  1 127  ? 239.283 186.565 199.928 1.00 290.40 ? 140  PHE B N   1 
ATOM   8590  C CA  . PHE B  1 127  ? 240.424 186.443 198.983 1.00 290.40 ? 140  PHE B CA  1 
ATOM   8591  C C   . PHE B  1 127  ? 241.239 187.741 199.001 1.00 290.40 ? 140  PHE B C   1 
ATOM   8592  O O   . PHE B  1 127  ? 240.639 188.830 198.908 1.00 290.40 ? 140  PHE B O   1 
ATOM   8593  C CB  . PHE B  1 127  ? 239.921 186.119 197.574 1.00 290.40 ? 140  PHE B CB  1 
ATOM   8594  N N   . LEU B  1 128  ? 242.566 187.619 199.116 1.00 297.77 ? 141  LEU B N   1 
ATOM   8595  C CA  . LEU B  1 128  ? 243.467 188.802 199.148 1.00 297.77 ? 141  LEU B CA  1 
ATOM   8596  C C   . LEU B  1 128  ? 244.268 188.864 197.842 1.00 297.77 ? 141  LEU B C   1 
ATOM   8597  O O   . LEU B  1 128  ? 244.889 189.913 197.579 1.00 297.77 ? 141  LEU B O   1 
ATOM   8598  C CB  . LEU B  1 128  ? 244.397 188.687 200.360 1.00 297.77 ? 141  LEU B CB  1 
ATOM   8599  N N   . GLY B  1 129  ? 244.249 187.777 197.063 1.00 301.10 ? 142  GLY B N   1 
ATOM   8600  C CA  . GLY B  1 129  ? 244.982 187.717 195.784 1.00 301.10 ? 142  GLY B CA  1 
ATOM   8601  C C   . GLY B  1 129  ? 246.356 187.092 195.954 1.00 301.10 ? 142  GLY B C   1 
ATOM   8602  O O   . GLY B  1 129  ? 246.628 186.074 195.287 1.00 301.10 ? 142  GLY B O   1 
ATOM   8603  N N   . VAL B  1 130  ? 247.190 187.681 196.817 1.00 301.88 ? 143  VAL B N   1 
ATOM   8604  C CA  . VAL B  1 130  ? 248.566 187.157 197.072 1.00 301.88 ? 143  VAL B CA  1 
ATOM   8605  C C   . VAL B  1 130  ? 248.458 185.698 197.531 1.00 301.88 ? 143  VAL B C   1 
ATOM   8606  O O   . VAL B  1 130  ? 247.977 185.468 198.658 1.00 301.88 ? 143  VAL B O   1 
ATOM   8607  C CB  . VAL B  1 130  ? 249.314 188.019 198.107 1.00 301.88 ? 143  VAL B CB  1 
ATOM   8608  C CG1 . VAL B  1 130  ? 250.797 187.684 198.153 1.00 301.88 ? 143  VAL B CG1 1 
ATOM   8609  C CG2 . VAL B  1 130  ? 249.107 189.505 197.859 1.00 301.88 ? 143  VAL B CG2 1 
ATOM   8610  N N   . TYR B  1 131  ? 248.825 184.754 196.658 1.00 300.83 ? 144  TYR B N   1 
ATOM   8611  C CA  . TYR B  1 131  ? 248.718 183.307 196.987 1.00 300.83 ? 144  TYR B CA  1 
ATOM   8612  C C   . TYR B  1 131  ? 250.103 182.652 196.963 1.00 300.83 ? 144  TYR B C   1 
ATOM   8613  O O   . TYR B  1 131  ? 251.106 183.370 197.156 1.00 300.83 ? 144  TYR B O   1 
ATOM   8614  C CB  . TYR B  1 131  ? 247.736 182.608 196.044 1.00 300.83 ? 144  TYR B CB  1 
ATOM   8615  C CG  . TYR B  1 131  ? 246.487 182.095 196.716 1.00 300.83 ? 144  TYR B CG  1 
ATOM   8616  C CD1 . TYR B  1 131  ? 245.518 182.967 197.184 1.00 300.83 ? 144  TYR B CD1 1 
ATOM   8617  C CD2 . TYR B  1 131  ? 246.275 180.738 196.893 1.00 300.83 ? 144  TYR B CD2 1 
ATOM   8618  C CE1 . TYR B  1 131  ? 244.370 182.506 197.805 1.00 300.83 ? 144  TYR B CE1 1 
ATOM   8619  C CE2 . TYR B  1 131  ? 245.132 180.259 197.512 1.00 300.83 ? 144  TYR B CE2 1 
ATOM   8620  C CZ  . TYR B  1 131  ? 244.175 181.146 197.970 1.00 300.83 ? 144  TYR B CZ  1 
ATOM   8621  O OH  . TYR B  1 131  ? 243.046 180.684 198.581 1.00 300.83 ? 144  TYR B OH  1 
ATOM   8622  N N   . TYR B  1 132  ? 250.147 181.335 196.741 1.00 325.34 ? 145  TYR B N   1 
ATOM   8623  C CA  . TYR B  1 132  ? 251.433 180.590 196.733 1.00 325.34 ? 145  TYR B CA  1 
ATOM   8624  C C   . TYR B  1 132  ? 252.173 180.870 198.047 1.00 325.34 ? 145  TYR B C   1 
ATOM   8625  O O   . TYR B  1 132  ? 253.379 180.567 198.140 1.00 325.34 ? 145  TYR B O   1 
ATOM   8626  C CB  . TYR B  1 132  ? 252.278 180.982 195.519 1.00 325.34 ? 145  TYR B CB  1 
ATOM   8627  C CG  . TYR B  1 132  ? 253.533 180.165 195.338 1.00 325.34 ? 145  TYR B CG  1 
ATOM   8628  C CD1 . TYR B  1 132  ? 253.486 178.781 195.314 1.00 325.34 ? 145  TYR B CD1 1 
ATOM   8629  C CD2 . TYR B  1 132  ? 254.768 180.773 195.194 1.00 325.34 ? 145  TYR B CD2 1 
ATOM   8630  C CE1 . TYR B  1 132  ? 254.633 178.022 195.150 1.00 325.34 ? 145  TYR B CE1 1 
ATOM   8631  C CE2 . TYR B  1 132  ? 255.925 180.029 195.029 1.00 325.34 ? 145  TYR B CE2 1 
ATOM   8632  C CZ  . TYR B  1 132  ? 255.858 178.648 195.007 1.00 325.34 ? 145  TYR B CZ  1 
ATOM   8633  O OH  . TYR B  1 132  ? 256.993 177.908 194.845 1.00 325.34 ? 145  TYR B OH  1 
ATOM   8634  N N   . HIS B  1 133  ? 251.457 181.435 199.027 1.00 326.60 ? 146  HIS B N   1 
ATOM   8635  C CA  . HIS B  1 133  ? 252.033 181.771 200.357 1.00 326.60 ? 146  HIS B CA  1 
ATOM   8636  C C   . HIS B  1 133  ? 253.303 182.608 200.174 1.00 326.60 ? 146  HIS B C   1 
ATOM   8637  O O   . HIS B  1 133  ? 253.265 183.582 199.395 1.00 326.60 ? 146  HIS B O   1 
ATOM   8638  C CB  . HIS B  1 133  ? 252.291 180.494 201.169 1.00 326.60 ? 146  HIS B CB  1 
ATOM   8639  C CG  . HIS B  1 133  ? 251.242 179.448 200.991 1.00 326.60 ? 146  HIS B CG  1 
ATOM   8640  N ND1 . HIS B  1 133  ? 251.516 178.214 200.435 1.00 326.60 ? 146  HIS B ND1 1 
ATOM   8641  C CD2 . HIS B  1 133  ? 249.924 179.446 201.288 1.00 326.60 ? 146  HIS B CD2 1 
ATOM   8642  C CE1 . HIS B  1 133  ? 250.413 177.495 200.398 1.00 326.60 ? 146  HIS B CE1 1 
ATOM   8643  N NE2 . HIS B  1 133  ? 249.421 178.229 200.916 1.00 326.60 ? 146  HIS B NE2 1 
ATOM   8644  N N   . LYS B  1 134  ? 254.377 182.238 200.877 1.00 333.59 ? 147  LYS B N   1 
ATOM   8645  C CA  . LYS B  1 134  ? 255.675 182.957 200.785 1.00 333.59 ? 147  LYS B CA  1 
ATOM   8646  C C   . LYS B  1 134  ? 256.809 181.944 200.972 1.00 333.59 ? 147  LYS B C   1 
ATOM   8647  O O   . LYS B  1 134  ? 257.985 182.354 200.933 1.00 333.59 ? 147  LYS B O   1 
ATOM   8648  C CB  . LYS B  1 134  ? 255.749 184.069 201.836 1.00 333.59 ? 147  LYS B CB  1 
ATOM   8649  C CG  . LYS B  1 134  ? 257.053 184.855 201.862 1.00 333.59 ? 147  LYS B CG  1 
ATOM   8650  C CD  . LYS B  1 134  ? 257.625 185.025 203.254 1.00 333.59 ? 147  LYS B CD  1 
ATOM   8651  C CE  . LYS B  1 134  ? 259.131 185.180 203.262 1.00 333.59 ? 147  LYS B CE  1 
ATOM   8652  N NZ  . LYS B  1 134  ? 259.535 186.603 203.358 1.00 333.59 ? 147  LYS B NZ  1 
ATOM   8653  N N   . ASN B  1 135  ? 256.452 180.670 201.167 1.00 344.24 ? 148  ASN B N   1 
ATOM   8654  C CA  . ASN B  1 135  ? 257.428 179.623 201.357 1.00 344.24 ? 148  ASN B CA  1 
ATOM   8655  C C   . ASN B  1 135  ? 256.776 178.270 201.143 1.00 344.24 ? 148  ASN B C   1 
ATOM   8656  O O   . ASN B  1 135  ? 255.620 178.168 200.722 1.00 344.24 ? 148  ASN B O   1 
ATOM   8657  C CB  . ASN B  1 135  ? 258.039 179.757 202.746 1.00 344.24 ? 148  ASN B CB  1 
ATOM   8658  C CG  . ASN B  1 135  ? 256.988 179.937 203.812 1.00 344.24 ? 148  ASN B CG  1 
ATOM   8659  O OD1 . ASN B  1 135  ? 255.795 179.812 203.543 1.00 344.24 ? 148  ASN B OD1 1 
ATOM   8660  N ND2 . ASN B  1 135  ? 257.419 180.258 205.024 1.00 344.24 ? 148  ASN B ND2 1 
ATOM   8661  N N   . ASN B  1 136  ? 257.524 177.218 201.462 1.00 352.28 ? 149  ASN B N   1 
ATOM   8662  C CA  . ASN B  1 136  ? 257.113 175.862 201.130 1.00 352.28 ? 149  ASN B CA  1 
ATOM   8663  C C   . ASN B  1 136  ? 255.776 175.499 201.770 1.00 352.28 ? 149  ASN B C   1 
ATOM   8664  O O   . ASN B  1 136  ? 255.022 174.681 201.232 1.00 352.28 ? 149  ASN B O   1 
ATOM   8665  C CB  . ASN B  1 136  ? 258.213 174.896 201.558 1.00 352.28 ? 149  ASN B CB  1 
ATOM   8666  C CG  . ASN B  1 136  ? 259.574 175.325 201.060 1.00 352.28 ? 149  ASN B CG  1 
ATOM   8667  O OD1 . ASN B  1 136  ? 259.985 176.466 201.266 1.00 352.28 ? 149  ASN B OD1 1 
ATOM   8668  N ND2 . ASN B  1 136  ? 260.283 174.414 200.406 1.00 352.28 ? 149  ASN B ND2 1 
ATOM   8669  N N   . LYS B  1 137  ? 255.452 176.106 202.916 1.00 337.53 ? 150  LYS B N   1 
ATOM   8670  C CA  . LYS B  1 137  ? 254.209 175.730 203.584 1.00 337.53 ? 150  LYS B CA  1 
ATOM   8671  C C   . LYS B  1 137  ? 253.421 176.921 204.117 1.00 337.53 ? 150  LYS B C   1 
ATOM   8672  O O   . LYS B  1 137  ? 253.717 178.074 203.789 1.00 337.53 ? 150  LYS B O   1 
ATOM   8673  C CB  . LYS B  1 137  ? 254.484 174.736 204.714 1.00 337.53 ? 150  LYS B CB  1 
ATOM   8674  C CG  . LYS B  1 137  ? 253.422 173.650 204.794 1.00 337.53 ? 150  LYS B CG  1 
ATOM   8675  C CD  . LYS B  1 137  ? 253.691 172.654 205.895 1.00 337.53 ? 150  LYS B CD  1 
ATOM   8676  C CE  . LYS B  1 137  ? 252.899 171.376 205.660 1.00 337.53 ? 150  LYS B CE  1 
ATOM   8677  N NZ  . LYS B  1 137  ? 251.546 171.643 205.094 1.00 337.53 ? 150  LYS B NZ  1 
ATOM   8678  N N   . SER B  1 138  ? 252.416 176.632 204.946 1.00 322.61 ? 151  SER B N   1 
ATOM   8679  C CA  . SER B  1 138  ? 251.263 177.499 205.167 1.00 322.61 ? 151  SER B CA  1 
ATOM   8680  C C   . SER B  1 138  ? 251.579 178.956 205.477 1.00 322.61 ? 151  SER B C   1 
ATOM   8681  O O   . SER B  1 138  ? 251.257 179.841 204.679 1.00 322.61 ? 151  SER B O   1 
ATOM   8682  C CB  . SER B  1 138  ? 250.418 176.930 206.306 1.00 322.61 ? 151  SER B CB  1 
ATOM   8683  O OG  . SER B  1 138  ? 249.548 175.910 205.850 1.00 322.61 ? 151  SER B OG  1 
ATOM   8684  N N   . TRP B  1 139  ? 252.159 179.212 206.650 1.00 312.14 ? 152  TRP B N   1 
ATOM   8685  C CA  . TRP B  1 139  ? 252.438 180.553 207.161 1.00 312.14 ? 152  TRP B CA  1 
ATOM   8686  C C   . TRP B  1 139  ? 251.136 181.275 207.495 1.00 312.14 ? 152  TRP B C   1 
ATOM   8687  O O   . TRP B  1 139  ? 251.149 182.292 208.194 1.00 312.14 ? 152  TRP B O   1 
ATOM   8688  C CB  . TRP B  1 139  ? 253.280 181.340 206.149 1.00 312.14 ? 152  TRP B CB  1 
ATOM   8689  C CG  . TRP B  1 139  ? 253.126 182.837 206.164 1.00 312.14 ? 152  TRP B CG  1 
ATOM   8690  C CD1 . TRP B  1 139  ? 253.626 183.705 207.084 1.00 312.14 ? 152  TRP B CD1 1 
ATOM   8691  C CD2 . TRP B  1 139  ? 252.429 183.637 205.197 1.00 312.14 ? 152  TRP B CD2 1 
ATOM   8692  N NE1 . TRP B  1 139  ? 253.287 184.996 206.752 1.00 312.14 ? 152  TRP B NE1 1 
ATOM   8693  C CE2 . TRP B  1 139  ? 252.552 184.980 205.596 1.00 312.14 ? 152  TRP B CE2 1 
ATOM   8694  C CE3 . TRP B  1 139  ? 251.712 183.347 204.031 1.00 312.14 ? 152  TRP B CE3 1 
ATOM   8695  C CZ2 . TRP B  1 139  ? 251.983 186.030 204.869 1.00 312.14 ? 152  TRP B CZ2 1 
ATOM   8696  C CZ3 . TRP B  1 139  ? 251.150 184.390 203.307 1.00 312.14 ? 152  TRP B CZ3 1 
ATOM   8697  C CH2 . TRP B  1 139  ? 251.285 185.712 203.732 1.00 312.14 ? 152  TRP B CH2 1 
ATOM   8698  N N   . MET B  1 140  ? 250.018 180.744 206.989 1.00 312.54 ? 153  MET B N   1 
ATOM   8699  C CA  . MET B  1 140  ? 248.654 180.969 207.483 1.00 312.54 ? 153  MET B CA  1 
ATOM   8700  C C   . MET B  1 140  ? 248.457 182.336 208.132 1.00 312.54 ? 153  MET B C   1 
ATOM   8701  O O   . MET B  1 140  ? 247.868 182.445 209.207 1.00 312.54 ? 153  MET B O   1 
ATOM   8702  C CB  . MET B  1 140  ? 248.234 179.844 208.427 1.00 312.54 ? 153  MET B CB  1 
ATOM   8703  C CG  . MET B  1 140  ? 247.744 178.619 207.665 1.00 312.54 ? 153  MET B CG  1 
ATOM   8704  S SD  . MET B  1 140  ? 246.864 177.381 208.634 1.00 312.54 ? 153  MET B SD  1 
ATOM   8705  C CE  . MET B  1 140  ? 248.181 176.211 208.966 1.00 312.54 ? 153  MET B CE  1 
ATOM   8706  N N   . GLU B  1 141  ? 248.931 183.396 207.474 1.00 310.14 ? 154  GLU B N   1 
ATOM   8707  C CA  . GLU B  1 141  ? 248.747 184.736 208.023 1.00 310.14 ? 154  GLU B CA  1 
ATOM   8708  C C   . GLU B  1 141  ? 247.396 185.312 207.629 1.00 310.14 ? 154  GLU B C   1 
ATOM   8709  O O   . GLU B  1 141  ? 246.595 185.682 208.494 1.00 310.14 ? 154  GLU B O   1 
ATOM   8710  C CB  . GLU B  1 141  ? 249.872 185.659 207.558 1.00 310.14 ? 154  GLU B CB  1 
ATOM   8711  C CG  . GLU B  1 141  ? 249.920 187.011 208.263 1.00 310.14 ? 154  GLU B CG  1 
ATOM   8712  C CD  . GLU B  1 141  ? 249.060 188.064 207.581 1.00 310.14 ? 154  GLU B CD  1 
ATOM   8713  O OE1 . GLU B  1 141  ? 248.843 189.138 208.178 1.00 310.14 ? 154  GLU B OE1 1 
ATOM   8714  O OE2 . GLU B  1 141  ? 248.589 187.817 206.451 1.00 310.14 ? 154  GLU B OE2 1 
ATOM   8715  N N   . SER B  1 142  ? 247.120 185.392 206.329 1.00 301.78 ? 155  SER B N   1 
ATOM   8716  C CA  . SER B  1 142  ? 245.840 185.897 205.845 1.00 301.78 ? 155  SER B CA  1 
ATOM   8717  C C   . SER B  1 142  ? 244.751 184.917 206.278 1.00 301.78 ? 155  SER B C   1 
ATOM   8718  O O   . SER B  1 142  ? 244.545 183.855 205.692 1.00 301.78 ? 155  SER B O   1 
ATOM   8719  C CB  . SER B  1 142  ? 245.874 186.090 204.337 1.00 301.78 ? 155  SER B CB  1 
ATOM   8720  O OG  . SER B  1 142  ? 247.072 186.733 203.940 1.00 301.78 ? 155  SER B OG  1 
ATOM   8721  N N   . GLU B  1 143  ? 244.123 185.248 207.400 1.00 293.96 ? 156  GLU B N   1 
ATOM   8722  C CA  . GLU B  1 143  ? 242.964 184.511 207.873 1.00 293.96 ? 156  GLU B CA  1 
ATOM   8723  C C   . GLU B  1 143  ? 241.682 185.262 207.527 1.00 293.96 ? 156  GLU B C   1 
ATOM   8724  O O   . GLU B  1 143  ? 241.684 186.471 207.282 1.00 293.96 ? 156  GLU B O   1 
ATOM   8725  C CB  . GLU B  1 143  ? 243.051 184.271 209.379 1.00 293.96 ? 156  GLU B CB  1 
ATOM   8726  N N   . PHE B  1 144  ? 240.574 184.528 207.507 1.00 293.01 ? 157  PHE B N   1 
ATOM   8727  C CA  . PHE B  1 144  ? 239.328 185.036 206.960 1.00 293.01 ? 157  PHE B CA  1 
ATOM   8728  C C   . PHE B  1 144  ? 238.153 184.571 207.803 1.00 293.01 ? 157  PHE B C   1 
ATOM   8729  O O   . PHE B  1 144  ? 238.189 183.506 208.424 1.00 293.01 ? 157  PHE B O   1 
ATOM   8730  C CB  . PHE B  1 144  ? 239.169 184.573 205.526 1.00 293.01 ? 157  PHE B CB  1 
ATOM   8731  C CG  . PHE B  1 144  ? 240.463 184.498 204.795 1.00 293.01 ? 157  PHE B CG  1 
ATOM   8732  C CD1 . PHE B  1 144  ? 241.125 185.652 204.426 1.00 293.01 ? 157  PHE B CD1 1 
ATOM   8733  C CD2 . PHE B  1 144  ? 241.049 183.278 204.527 1.00 293.01 ? 157  PHE B CD2 1 
ATOM   8734  C CE1 . PHE B  1 144  ? 242.330 185.592 203.772 1.00 293.01 ? 157  PHE B CE1 1 
ATOM   8735  C CE2 . PHE B  1 144  ? 242.253 183.210 203.867 1.00 293.01 ? 157  PHE B CE2 1 
ATOM   8736  C CZ  . PHE B  1 144  ? 242.890 184.371 203.480 1.00 293.01 ? 157  PHE B CZ  1 
ATOM   8737  N N   . ARG B  1 145  ? 237.092 185.376 207.795 1.00 297.53 ? 158  ARG B N   1 
ATOM   8738  C CA  . ARG B  1 145  ? 235.997 185.184 208.737 1.00 297.53 ? 158  ARG B CA  1 
ATOM   8739  C C   . ARG B  1 145  ? 234.638 185.473 208.116 1.00 297.53 ? 158  ARG B C   1 
ATOM   8740  O O   . ARG B  1 145  ? 234.505 186.374 207.287 1.00 297.53 ? 158  ARG B O   1 
ATOM   8741  C CB  . ARG B  1 145  ? 236.215 186.074 209.964 1.00 297.53 ? 158  ARG B CB  1 
ATOM   8742  C CG  . ARG B  1 145  ? 235.048 186.140 210.931 1.00 297.53 ? 158  ARG B CG  1 
ATOM   8743  C CD  . ARG B  1 145  ? 235.023 187.472 211.660 1.00 297.53 ? 158  ARG B CD  1 
ATOM   8744  N NE  . ARG B  1 145  ? 235.311 188.602 210.780 1.00 297.53 ? 158  ARG B NE  1 
ATOM   8745  C CZ  . ARG B  1 145  ? 236.402 189.358 210.866 1.00 297.53 ? 158  ARG B CZ  1 
ATOM   8746  N NH1 . ARG B  1 145  ? 236.579 190.368 210.029 1.00 297.53 ? 158  ARG B NH1 1 
ATOM   8747  N NH2 . ARG B  1 145  ? 237.317 189.102 211.788 1.00 297.53 ? 158  ARG B NH2 1 
ATOM   8748  N N   . VAL B  1 146  ? 233.619 184.725 208.529 1.00 293.46 ? 159  VAL B N   1 
ATOM   8749  C CA  . VAL B  1 146  ? 232.267 184.951 208.041 1.00 293.46 ? 159  VAL B CA  1 
ATOM   8750  C C   . VAL B  1 146  ? 231.324 185.259 209.198 1.00 293.46 ? 159  VAL B C   1 
ATOM   8751  O O   . VAL B  1 146  ? 230.788 186.366 209.291 1.00 293.46 ? 159  VAL B O   1 
ATOM   8752  C CB  . VAL B  1 146  ? 231.769 183.738 207.235 1.00 293.46 ? 159  VAL B CB  1 
ATOM   8753  N N   . TYR B  1 147  ? 231.137 184.299 210.101 1.00 291.78 ? 160  TYR B N   1 
ATOM   8754  C CA  . TYR B  1 147  ? 230.085 184.365 211.108 1.00 291.78 ? 160  TYR B CA  1 
ATOM   8755  C C   . TYR B  1 147  ? 230.635 184.818 212.457 1.00 291.78 ? 160  TYR B C   1 
ATOM   8756  O O   . TYR B  1 147  ? 231.810 185.162 212.596 1.00 291.78 ? 160  TYR B O   1 
ATOM   8757  C CB  . TYR B  1 147  ? 229.402 183.005 211.251 1.00 291.78 ? 160  TYR B CB  1 
ATOM   8758  N N   . SER B  1 148  ? 229.761 184.815 213.463 1.00 295.36 ? 161  SER B N   1 
ATOM   8759  C CA  . SER B  1 148  ? 230.128 185.224 214.812 1.00 295.36 ? 161  SER B CA  1 
ATOM   8760  C C   . SER B  1 148  ? 229.035 184.818 215.801 1.00 295.36 ? 161  SER B C   1 
ATOM   8761  O O   . SER B  1 148  ? 227.839 184.904 215.505 1.00 295.36 ? 161  SER B O   1 
ATOM   8762  C CB  . SER B  1 148  ? 230.389 186.737 214.881 1.00 295.36 ? 161  SER B CB  1 
ATOM   8763  O OG  . SER B  1 148  ? 229.396 187.474 214.192 1.00 295.36 ? 161  SER B OG  1 
ATOM   8764  N N   . SER B  1 149  ? 229.477 184.364 216.988 1.00 298.09 ? 162  SER B N   1 
ATOM   8765  C CA  . SER B  1 149  ? 228.667 184.100 218.182 1.00 298.09 ? 162  SER B CA  1 
ATOM   8766  C C   . SER B  1 149  ? 227.482 183.162 217.946 1.00 298.09 ? 162  SER B C   1 
ATOM   8767  O O   . SER B  1 149  ? 226.330 183.606 217.952 1.00 298.09 ? 162  SER B O   1 
ATOM   8768  C CB  . SER B  1 149  ? 228.170 185.419 218.780 1.00 298.09 ? 162  SER B CB  1 
ATOM   8769  O OG  . SER B  1 149  ? 227.766 185.250 220.126 1.00 298.09 ? 162  SER B OG  1 
ATOM   8770  N N   . ALA B  1 150  ? 227.750 181.868 217.750 1.00 294.13 ? 163  ALA B N   1 
ATOM   8771  C CA  . ALA B  1 150  ? 226.742 180.908 217.307 1.00 294.13 ? 163  ALA B CA  1 
ATOM   8772  C C   . ALA B  1 150  ? 225.814 180.576 218.469 1.00 294.13 ? 163  ALA B C   1 
ATOM   8773  O O   . ALA B  1 150  ? 225.977 179.546 219.130 1.00 294.13 ? 163  ALA B O   1 
ATOM   8774  C CB  . ALA B  1 150  ? 227.396 179.646 216.756 1.00 294.13 ? 163  ALA B CB  1 
ATOM   8775  N N   . ASN B  1 151  ? 224.834 181.444 218.715 1.00 297.39 ? 164  ASN B N   1 
ATOM   8776  C CA  . ASN B  1 151  ? 223.888 181.228 219.799 1.00 297.39 ? 164  ASN B CA  1 
ATOM   8777  C C   . ASN B  1 151  ? 222.483 180.999 219.266 1.00 297.39 ? 164  ASN B C   1 
ATOM   8778  O O   . ASN B  1 151  ? 221.747 180.143 219.774 1.00 297.39 ? 164  ASN B O   1 
ATOM   8779  C CB  . ASN B  1 151  ? 223.895 182.416 220.780 1.00 297.39 ? 164  ASN B CB  1 
ATOM   8780  C CG  . ASN B  1 151  ? 223.642 183.755 220.114 1.00 297.39 ? 164  ASN B CG  1 
ATOM   8781  O OD1 . ASN B  1 151  ? 223.232 183.835 218.958 1.00 297.39 ? 164  ASN B OD1 1 
ATOM   8782  N ND2 . ASN B  1 151  ? 223.855 184.815 220.861 1.00 297.39 ? 164  ASN B ND2 1 
ATOM   8783  N N   . ASN B  1 152  ? 222.112 181.780 218.257 1.00 295.30 ? 165  ASN B N   1 
ATOM   8784  C CA  . ASN B  1 152  ? 220.824 181.711 217.577 1.00 295.30 ? 165  ASN B CA  1 
ATOM   8785  C C   . ASN B  1 152  ? 221.040 181.325 216.107 1.00 295.30 ? 165  ASN B C   1 
ATOM   8786  O O   . ASN B  1 152  ? 221.301 182.153 215.225 1.00 295.30 ? 165  ASN B O   1 
ATOM   8787  C CB  . ASN B  1 152  ? 220.088 183.030 217.728 1.00 295.30 ? 165  ASN B CB  1 
ATOM   8788  C CG  . ASN B  1 152  ? 219.288 183.152 219.033 1.00 295.30 ? 165  ASN B CG  1 
ATOM   8789  O OD1 . ASN B  1 152  ? 219.549 184.023 219.874 1.00 295.30 ? 165  ASN B OD1 1 
ATOM   8790  N ND2 . ASN B  1 152  ? 218.265 182.289 219.165 1.00 295.30 ? 165  ASN B ND2 1 
ATOM   8791  N N   . CYS B  1 153  ? 220.934 180.031 215.848 1.00 274.12 ? 166  CYS B N   1 
ATOM   8792  C CA  . CYS B  1 153  ? 221.085 179.496 214.503 1.00 274.12 ? 166  CYS B CA  1 
ATOM   8793  C C   . CYS B  1 153  ? 219.864 178.683 214.106 1.00 274.12 ? 166  CYS B C   1 
ATOM   8794  O O   . CYS B  1 153  ? 219.299 177.965 214.930 1.00 274.12 ? 166  CYS B O   1 
ATOM   8795  C CB  . CYS B  1 153  ? 222.382 178.689 214.379 1.00 274.12 ? 166  CYS B CB  1 
ATOM   8796  S SG  . CYS B  1 153  ? 222.950 178.471 212.642 1.00 274.12 ? 166  CYS B SG  1 
ATOM   8797  N N   . THR B  1 154  ? 219.438 178.840 212.856 1.00 243.68 ? 167  THR B N   1 
ATOM   8798  C CA  . THR B  1 154  ? 218.213 178.184 212.410 1.00 243.68 ? 167  THR B CA  1 
ATOM   8799  C C   . THR B  1 154  ? 218.499 176.927 211.588 1.00 243.68 ? 167  THR B C   1 
ATOM   8800  O O   . THR B  1 154  ? 217.922 175.864 211.844 1.00 243.68 ? 167  THR B O   1 
ATOM   8801  C CB  . THR B  1 154  ? 217.345 179.161 211.622 1.00 243.68 ? 167  THR B CB  1 
ATOM   8802  O OG1 . THR B  1 154  ? 217.068 180.321 212.416 1.00 243.68 ? 167  THR B OG1 1 
ATOM   8803  C CG2 . THR B  1 154  ? 216.052 178.503 211.228 1.00 243.68 ? 167  THR B CG2 1 
ATOM   8804  N N   . PHE B  1 155  ? 219.399 177.017 210.612 1.00 231.34 ? 168  PHE B N   1 
ATOM   8805  C CA  . PHE B  1 155  ? 219.603 175.859 209.753 1.00 231.34 ? 168  PHE B CA  1 
ATOM   8806  C C   . PHE B  1 155  ? 220.795 176.022 208.817 1.00 231.34 ? 168  PHE B C   1 
ATOM   8807  O O   . PHE B  1 155  ? 221.194 177.137 208.470 1.00 231.34 ? 168  PHE B O   1 
ATOM   8808  C CB  . PHE B  1 155  ? 218.353 175.577 208.936 1.00 231.34 ? 168  PHE B CB  1 
ATOM   8809  C CG  . PHE B  1 155  ? 218.445 174.328 208.159 1.00 231.34 ? 168  PHE B CG  1 
ATOM   8810  C CD1 . PHE B  1 155  ? 218.463 173.118 208.806 1.00 231.34 ? 168  PHE B CD1 1 
ATOM   8811  C CD2 . PHE B  1 155  ? 218.551 174.354 206.787 1.00 231.34 ? 168  PHE B CD2 1 
ATOM   8812  C CE1 . PHE B  1 155  ? 218.565 171.950 208.105 1.00 231.34 ? 168  PHE B CE1 1 
ATOM   8813  C CE2 . PHE B  1 155  ? 218.647 173.181 206.069 1.00 231.34 ? 168  PHE B CE2 1 
ATOM   8814  C CZ  . PHE B  1 155  ? 218.654 171.974 206.730 1.00 231.34 ? 168  PHE B CZ  1 
ATOM   8815  N N   . GLU B  1 156  ? 221.340 174.878 208.393 1.00 227.24 ? 169  GLU B N   1 
ATOM   8816  C CA  . GLU B  1 156  ? 222.415 174.828 207.411 1.00 227.24 ? 169  GLU B CA  1 
ATOM   8817  C C   . GLU B  1 156  ? 222.191 173.665 206.450 1.00 227.24 ? 169  GLU B C   1 
ATOM   8818  O O   . GLU B  1 156  ? 221.505 172.694 206.768 1.00 227.24 ? 169  GLU B O   1 
ATOM   8819  C CB  . GLU B  1 156  ? 223.793 174.683 208.063 1.00 227.24 ? 169  GLU B CB  1 
ATOM   8820  C CG  . GLU B  1 156  ? 224.486 175.984 208.378 1.00 227.24 ? 169  GLU B CG  1 
ATOM   8821  C CD  . GLU B  1 156  ? 223.843 176.719 209.526 1.00 227.24 ? 169  GLU B CD  1 
ATOM   8822  O OE1 . GLU B  1 156  ? 223.881 177.963 209.550 1.00 227.24 ? 169  GLU B OE1 1 
ATOM   8823  O OE2 . GLU B  1 156  ? 223.289 176.051 210.416 1.00 227.24 ? 169  GLU B OE2 1 
ATOM   8824  N N   . TYR B  1 157  ? 222.832 173.763 205.283 1.00 217.94 ? 170  TYR B N   1 
ATOM   8825  C CA  . TYR B  1 157  ? 222.652 172.857 204.149 1.00 217.94 ? 170  TYR B CA  1 
ATOM   8826  C C   . TYR B  1 157  ? 224.008 172.648 203.490 1.00 217.94 ? 170  TYR B C   1 
ATOM   8827  O O   . TYR B  1 157  ? 224.808 173.580 203.418 1.00 217.94 ? 170  TYR B O   1 
ATOM   8828  C CB  . TYR B  1 157  ? 221.654 173.441 203.125 1.00 217.94 ? 170  TYR B CB  1 
ATOM   8829  C CG  . TYR B  1 157  ? 221.383 172.616 201.868 1.00 217.94 ? 170  TYR B CG  1 
ATOM   8830  C CD1 . TYR B  1 157  ? 222.353 172.451 200.885 1.00 217.94 ? 170  TYR B CD1 1 
ATOM   8831  C CD2 . TYR B  1 157  ? 220.146 172.024 201.658 1.00 217.94 ? 170  TYR B CD2 1 
ATOM   8832  C CE1 . TYR B  1 157  ? 222.114 171.709 199.746 1.00 217.94 ? 170  TYR B CE1 1 
ATOM   8833  C CE2 . TYR B  1 157  ? 219.894 171.281 200.513 1.00 217.94 ? 170  TYR B CE2 1 
ATOM   8834  C CZ  . TYR B  1 157  ? 220.886 171.127 199.562 1.00 217.94 ? 170  TYR B CZ  1 
ATOM   8835  O OH  . TYR B  1 157  ? 220.660 170.393 198.419 1.00 217.94 ? 170  TYR B OH  1 
ATOM   8836  N N   . VAL B  1 158  ? 224.268 171.438 202.998 1.00 212.38 ? 171  VAL B N   1 
ATOM   8837  C CA  . VAL B  1 158  ? 225.492 171.169 202.248 1.00 212.38 ? 171  VAL B CA  1 
ATOM   8838  C C   . VAL B  1 158  ? 225.163 170.365 200.999 1.00 212.38 ? 171  VAL B C   1 
ATOM   8839  O O   . VAL B  1 158  ? 224.470 169.345 201.076 1.00 212.38 ? 171  VAL B O   1 
ATOM   8840  C CB  . VAL B  1 158  ? 226.545 170.425 203.082 1.00 212.38 ? 171  VAL B CB  1 
ATOM   8841  C CG1 . VAL B  1 158  ? 227.885 170.460 202.361 1.00 212.38 ? 171  VAL B CG1 1 
ATOM   8842  C CG2 . VAL B  1 158  ? 226.665 171.030 204.463 1.00 212.38 ? 171  VAL B CG2 1 
ATOM   8843  N N   . SER B  1 159  ? 225.679 170.819 199.856 1.00 207.94 ? 172  SER B N   1 
ATOM   8844  C CA  . SER B  1 159  ? 225.777 170.050 198.620 1.00 207.94 ? 172  SER B CA  1 
ATOM   8845  C C   . SER B  1 159  ? 227.195 170.265 198.110 1.00 207.94 ? 172  SER B C   1 
ATOM   8846  O O   . SER B  1 159  ? 228.095 170.526 198.914 1.00 207.94 ? 172  SER B O   1 
ATOM   8847  C CB  . SER B  1 159  ? 224.725 170.474 197.595 1.00 207.94 ? 172  SER B CB  1 
ATOM   8848  O OG  . SER B  1 159  ? 224.627 171.880 197.506 1.00 207.94 ? 172  SER B OG  1 
ATOM   8849  N N   . GLN B  1 160  ? 227.433 170.148 196.811 1.00 210.64 ? 173  GLN B N   1 
ATOM   8850  C CA  . GLN B  1 160  ? 228.802 170.428 196.388 1.00 210.64 ? 173  GLN B CA  1 
ATOM   8851  C C   . GLN B  1 160  ? 228.924 171.475 195.283 1.00 210.64 ? 173  GLN B C   1 
ATOM   8852  O O   . GLN B  1 160  ? 229.535 171.187 194.247 1.00 210.64 ? 173  GLN B O   1 
ATOM   8853  C CB  . GLN B  1 160  ? 229.469 169.134 195.925 1.00 210.64 ? 173  GLN B CB  1 
ATOM   8854  N N   . PRO B  1 161  ? 228.386 172.700 195.455 1.00 210.45 ? 174  PRO B N   1 
ATOM   8855  C CA  . PRO B  1 161  ? 228.523 173.706 194.394 1.00 210.45 ? 174  PRO B CA  1 
ATOM   8856  C C   . PRO B  1 161  ? 229.949 173.942 193.934 1.00 210.45 ? 174  PRO B C   1 
ATOM   8857  O O   . PRO B  1 161  ? 230.174 174.162 192.743 1.00 210.45 ? 174  PRO B O   1 
ATOM   8858  C CB  . PRO B  1 161  ? 227.934 174.970 195.028 1.00 210.45 ? 174  PRO B CB  1 
ATOM   8859  C CG  . PRO B  1 161  ? 227.001 174.496 196.043 1.00 210.45 ? 174  PRO B CG  1 
ATOM   8860  C CD  . PRO B  1 161  ? 227.352 173.091 196.426 1.00 210.45 ? 174  PRO B CD  1 
ATOM   8861  N N   . PHE B  1 162  ? 230.920 173.907 194.845 1.00 215.35 ? 175  PHE B N   1 
ATOM   8862  C CA  . PHE B  1 162  ? 232.302 174.124 194.432 1.00 215.35 ? 175  PHE B CA  1 
ATOM   8863  C C   . PHE B  1 162  ? 232.745 173.039 193.467 1.00 215.35 ? 175  PHE B C   1 
ATOM   8864  O O   . PHE B  1 162  ? 233.531 173.284 192.546 1.00 215.35 ? 175  PHE B O   1 
ATOM   8865  C CB  . PHE B  1 162  ? 233.229 174.170 195.643 1.00 215.35 ? 175  PHE B CB  1 
ATOM   8866  C CG  . PHE B  1 162  ? 234.508 174.919 195.394 1.00 215.35 ? 175  PHE B CG  1 
ATOM   8867  C CD1 . PHE B  1 162  ? 235.496 174.390 194.576 1.00 215.35 ? 175  PHE B CD1 1 
ATOM   8868  C CD2 . PHE B  1 162  ? 234.726 176.148 195.988 1.00 215.35 ? 175  PHE B CD2 1 
ATOM   8869  C CE1 . PHE B  1 162  ? 236.667 175.080 194.348 1.00 215.35 ? 175  PHE B CE1 1 
ATOM   8870  C CE2 . PHE B  1 162  ? 235.891 176.842 195.771 1.00 215.35 ? 175  PHE B CE2 1 
ATOM   8871  C CZ  . PHE B  1 162  ? 236.866 176.309 194.949 1.00 215.35 ? 175  PHE B CZ  1 
ATOM   8872  N N   . LEU B  1 163  ? 232.254 171.824 193.671 1.00 213.27 ? 176  LEU B N   1 
ATOM   8873  C CA  . LEU B  1 163  ? 232.496 170.738 192.742 1.00 213.27 ? 176  LEU B CA  1 
ATOM   8874  C C   . LEU B  1 163  ? 231.398 170.641 191.691 1.00 213.27 ? 176  LEU B C   1 
ATOM   8875  O O   . LEU B  1 163  ? 231.518 169.849 190.752 1.00 213.27 ? 176  LEU B O   1 
ATOM   8876  C CB  . LEU B  1 163  ? 232.657 169.427 193.512 1.00 213.27 ? 176  LEU B CB  1 
ATOM   8877  C CG  . LEU B  1 163  ? 233.162 168.195 192.766 1.00 213.27 ? 176  LEU B CG  1 
ATOM   8878  C CD1 . LEU B  1 163  ? 234.077 167.399 193.653 1.00 213.27 ? 176  LEU B CD1 1 
ATOM   8879  C CD2 . LEU B  1 163  ? 231.987 167.335 192.379 1.00 213.27 ? 176  LEU B CD2 1 
ATOM   8880  N N   . MET B  1 164  ? 230.350 171.459 191.802 1.00 209.42 ? 177  MET B N   1 
ATOM   8881  C CA  . MET B  1 164  ? 229.293 171.501 190.795 1.00 209.42 ? 177  MET B CA  1 
ATOM   8882  C C   . MET B  1 164  ? 229.325 172.785 189.976 1.00 209.42 ? 177  MET B C   1 
ATOM   8883  O O   . MET B  1 164  ? 229.246 172.722 188.745 1.00 209.42 ? 177  MET B O   1 
ATOM   8884  C CB  . MET B  1 164  ? 227.916 171.321 191.455 1.00 209.42 ? 177  MET B CB  1 
ATOM   8885  C CG  . MET B  1 164  ? 227.630 169.906 191.935 1.00 209.42 ? 177  MET B CG  1 
ATOM   8886  S SD  . MET B  1 164  ? 227.240 168.787 190.581 1.00 209.42 ? 177  MET B SD  1 
ATOM   8887  C CE  . MET B  1 164  ? 226.659 167.345 191.461 1.00 209.42 ? 177  MET B CE  1 
ATOM   8888  N N   . ASP B  1 165  ? 229.452 173.947 190.609 1.00 199.39 ? 178  ASP B N   1 
ATOM   8889  C CA  . ASP B  1 165  ? 229.233 175.208 189.918 1.00 199.39 ? 178  ASP B CA  1 
ATOM   8890  C C   . ASP B  1 165  ? 230.508 175.876 189.447 1.00 199.39 ? 178  ASP B C   1 
ATOM   8891  O O   . ASP B  1 165  ? 230.578 176.292 188.290 1.00 199.39 ? 178  ASP B O   1 
ATOM   8892  C CB  . ASP B  1 165  ? 228.490 176.173 190.830 1.00 199.39 ? 178  ASP B CB  1 
ATOM   8893  C CG  . ASP B  1 165  ? 227.257 175.557 191.405 1.00 199.39 ? 178  ASP B CG  1 
ATOM   8894  O OD1 . ASP B  1 165  ? 226.794 174.555 190.829 1.00 199.39 ? 178  ASP B OD1 1 
ATOM   8895  O OD2 . ASP B  1 165  ? 226.743 176.069 192.415 1.00 199.39 ? 178  ASP B OD2 1 
ATOM   8896  N N   . LEU B  1 166  ? 231.508 176.000 190.305 1.00 199.35 ? 179  LEU B N   1 
ATOM   8897  C CA  . LEU B  1 166  ? 232.662 176.836 190.029 1.00 199.35 ? 179  LEU B CA  1 
ATOM   8898  C C   . LEU B  1 166  ? 233.811 175.973 189.523 1.00 199.35 ? 179  LEU B C   1 
ATOM   8899  O O   . LEU B  1 166  ? 234.774 175.691 190.233 1.00 199.35 ? 179  LEU B O   1 
ATOM   8900  C CB  . LEU B  1 166  ? 233.039 177.610 191.267 1.00 199.35 ? 179  LEU B CB  1 
ATOM   8901  C CG  . LEU B  1 166  ? 231.818 178.273 191.895 1.00 199.35 ? 179  LEU B CG  1 
ATOM   8902  C CD1 . LEU B  1 166  ? 232.207 179.142 193.078 1.00 199.35 ? 179  LEU B CD1 1 
ATOM   8903  C CD2 . LEU B  1 166  ? 231.077 179.084 190.857 1.00 199.35 ? 179  LEU B CD2 1 
ATOM   8904  N N   . GLU B  1 167  ? 233.691 175.537 188.277 1.00 207.64 ? 180  GLU B N   1 
ATOM   8905  C CA  . GLU B  1 167  ? 234.802 174.863 187.626 1.00 207.64 ? 180  GLU B CA  1 
ATOM   8906  C C   . GLU B  1 167  ? 235.615 175.877 186.841 1.00 207.64 ? 180  GLU B C   1 
ATOM   8907  O O   . GLU B  1 167  ? 235.817 175.721 185.635 1.00 207.64 ? 180  GLU B O   1 
ATOM   8908  C CB  . GLU B  1 167  ? 234.294 173.741 186.726 1.00 207.64 ? 180  GLU B CB  1 
ATOM   8909  C CG  . GLU B  1 167  ? 233.818 172.534 187.503 1.00 207.64 ? 180  GLU B CG  1 
ATOM   8910  C CD  . GLU B  1 167  ? 232.447 172.739 188.113 1.00 207.64 ? 180  GLU B CD  1 
ATOM   8911  O OE1 . GLU B  1 167  ? 231.843 173.803 187.878 1.00 207.64 ? 180  GLU B OE1 1 
ATOM   8912  O OE2 . GLU B  1 167  ? 231.971 171.837 188.828 1.00 207.64 ? 180  GLU B OE2 1 
ATOM   8913  N N   . GLY B  1 168  ? 236.071 176.926 187.517 1.00 218.18 ? 181  GLY B N   1 
ATOM   8914  C CA  . GLY B  1 168  ? 236.931 177.906 186.891 1.00 218.18 ? 181  GLY B CA  1 
ATOM   8915  C C   . GLY B  1 168  ? 238.374 177.453 186.902 1.00 218.18 ? 181  GLY B C   1 
ATOM   8916  O O   . GLY B  1 168  ? 239.251 178.150 187.422 1.00 218.18 ? 181  GLY B O   1 
ATOM   8917  N N   . LYS B  1 169  ? 238.628 176.276 186.330 1.00 225.73 ? 182  LYS B N   1 
ATOM   8918  C CA  . LYS B  1 169  ? 239.971 175.710 186.275 1.00 225.73 ? 182  LYS B CA  1 
ATOM   8919  C C   . LYS B  1 169  ? 240.358 175.323 184.851 1.00 225.73 ? 182  LYS B C   1 
ATOM   8920  O O   . LYS B  1 169  ? 239.493 175.036 184.017 1.00 225.73 ? 182  LYS B O   1 
ATOM   8921  C CB  . LYS B  1 169  ? 240.087 174.500 187.205 1.00 225.73 ? 182  LYS B CB  1 
ATOM   8922  C CG  . LYS B  1 169  ? 240.153 174.858 188.683 1.00 225.73 ? 182  LYS B CG  1 
ATOM   8923  C CD  . LYS B  1 169  ? 240.414 173.630 189.550 1.00 225.73 ? 182  LYS B CD  1 
ATOM   8924  C CE  . LYS B  1 169  ? 240.501 174.000 191.023 1.00 225.73 ? 182  LYS B CE  1 
ATOM   8925  N NZ  . LYS B  1 169  ? 240.685 172.806 191.887 1.00 225.73 ? 182  LYS B NZ  1 
ATOM   8926  N N   . GLN B  1 170  ? 241.663 175.377 184.564 1.00 227.16 ? 183  GLN B N   1 
ATOM   8927  C CA  . GLN B  1 170  ? 242.284 175.119 183.264 1.00 227.16 ? 183  GLN B CA  1 
ATOM   8928  C C   . GLN B  1 170  ? 241.934 176.232 182.286 1.00 227.16 ? 183  GLN B C   1 
ATOM   8929  O O   . GLN B  1 170  ? 242.523 176.339 181.205 1.00 227.16 ? 183  GLN B O   1 
ATOM   8930  C CB  . GLN B  1 170  ? 241.888 173.751 182.705 1.00 227.16 ? 183  GLN B CB  1 
ATOM   8931  C CG  . GLN B  1 170  ? 242.038 172.614 183.695 1.00 227.16 ? 183  GLN B CG  1 
ATOM   8932  C CD  . GLN B  1 170  ? 240.726 172.235 184.335 1.00 227.16 ? 183  GLN B CD  1 
ATOM   8933  O OE1 . GLN B  1 170  ? 239.660 172.467 183.770 1.00 227.16 ? 183  GLN B OE1 1 
ATOM   8934  N NE2 . GLN B  1 170  ? 240.792 171.665 185.529 1.00 227.16 ? 183  GLN B NE2 1 
ATOM   8935  N N   . GLY B  1 171  ? 240.990 177.075 182.680 1.00 219.58 ? 184  GLY B N   1 
ATOM   8936  C CA  . GLY B  1 171  ? 240.749 178.358 182.064 1.00 219.58 ? 184  GLY B CA  1 
ATOM   8937  C C   . GLY B  1 171  ? 241.506 179.410 182.837 1.00 219.58 ? 184  GLY B C   1 
ATOM   8938  O O   . GLY B  1 171  ? 240.899 180.198 183.568 1.00 219.58 ? 184  GLY B O   1 
ATOM   8939  N N   . ASN B  1 172  ? 242.828 179.434 182.659 1.00 218.74 ? 185  ASN B N   1 
ATOM   8940  C CA  . ASN B  1 172  ? 243.776 180.083 183.557 1.00 218.74 ? 185  ASN B CA  1 
ATOM   8941  C C   . ASN B  1 172  ? 243.223 181.361 184.178 1.00 218.74 ? 185  ASN B C   1 
ATOM   8942  O O   . ASN B  1 172  ? 243.449 181.618 185.362 1.00 218.74 ? 185  ASN B O   1 
ATOM   8943  C CB  . ASN B  1 172  ? 245.084 180.376 182.818 1.00 218.74 ? 185  ASN B CB  1 
ATOM   8944  C CG  . ASN B  1 172  ? 245.920 179.122 182.583 1.00 218.74 ? 185  ASN B CG  1 
ATOM   8945  O OD1 . ASN B  1 172  ? 247.095 179.204 182.218 1.00 218.74 ? 185  ASN B OD1 1 
ATOM   8946  N ND2 . ASN B  1 172  ? 245.312 177.959 182.773 1.00 218.74 ? 185  ASN B ND2 1 
ATOM   8947  N N   . PHE B  1 173  ? 242.521 182.176 183.399 1.00 208.54 ? 186  PHE B N   1 
ATOM   8948  C CA  . PHE B  1 173  ? 241.806 183.329 183.936 1.00 208.54 ? 186  PHE B CA  1 
ATOM   8949  C C   . PHE B  1 173  ? 240.508 183.497 183.147 1.00 208.54 ? 186  PHE B C   1 
ATOM   8950  O O   . PHE B  1 173  ? 240.261 182.813 182.148 1.00 208.54 ? 186  PHE B O   1 
ATOM   8951  C CB  . PHE B  1 173  ? 242.696 184.580 183.885 1.00 208.54 ? 186  PHE B CB  1 
ATOM   8952  C CG  . PHE B  1 173  ? 244.013 184.437 184.614 1.00 208.54 ? 186  PHE B CG  1 
ATOM   8953  C CD1 . PHE B  1 173  ? 245.136 183.954 183.966 1.00 208.54 ? 186  PHE B CD1 1 
ATOM   8954  C CD2 . PHE B  1 173  ? 244.123 184.774 185.949 1.00 208.54 ? 186  PHE B CD2 1 
ATOM   8955  C CE1 . PHE B  1 173  ? 246.344 183.816 184.636 1.00 208.54 ? 186  PHE B CE1 1 
ATOM   8956  C CE2 . PHE B  1 173  ? 245.333 184.644 186.617 1.00 208.54 ? 186  PHE B CE2 1 
ATOM   8957  C CZ  . PHE B  1 173  ? 246.440 184.162 185.958 1.00 208.54 ? 186  PHE B CZ  1 
ATOM   8958  N N   . LYS B  1 174  ? 239.642 184.397 183.616 1.00 198.60 ? 187  LYS B N   1 
ATOM   8959  C CA  . LYS B  1 174  ? 238.615 185.015 182.777 1.00 198.60 ? 187  LYS B CA  1 
ATOM   8960  C C   . LYS B  1 174  ? 237.628 184.075 182.093 1.00 198.60 ? 187  LYS B C   1 
ATOM   8961  O O   . LYS B  1 174  ? 237.687 183.908 180.873 1.00 198.60 ? 187  LYS B O   1 
ATOM   8962  C CB  . LYS B  1 174  ? 239.287 185.856 181.694 1.00 198.60 ? 187  LYS B CB  1 
ATOM   8963  C CG  . LYS B  1 174  ? 238.403 186.927 181.079 1.00 198.60 ? 187  LYS B CG  1 
ATOM   8964  C CD  . LYS B  1 174  ? 238.346 188.201 181.893 1.00 198.60 ? 187  LYS B CD  1 
ATOM   8965  C CE  . LYS B  1 174  ? 237.484 189.229 181.177 1.00 198.60 ? 187  LYS B CE  1 
ATOM   8966  N NZ  . LYS B  1 174  ? 237.970 190.626 181.334 1.00 198.60 ? 187  LYS B NZ  1 
ATOM   8967  N N   . ASN B  1 175  ? 236.733 183.443 182.831 1.00 193.03 ? 188  ASN B N   1 
ATOM   8968  C CA  . ASN B  1 175  ? 235.573 182.835 182.195 1.00 193.03 ? 188  ASN B CA  1 
ATOM   8969  C C   . ASN B  1 175  ? 234.325 183.635 182.553 1.00 193.03 ? 188  ASN B C   1 
ATOM   8970  O O   . ASN B  1 175  ? 234.411 184.766 183.032 1.00 193.03 ? 188  ASN B O   1 
ATOM   8971  C CB  . ASN B  1 175  ? 235.419 181.369 182.580 1.00 193.03 ? 188  ASN B CB  1 
ATOM   8972  C CG  . ASN B  1 175  ? 234.671 180.587 181.529 1.00 193.03 ? 188  ASN B CG  1 
ATOM   8973  O OD1 . ASN B  1 175  ? 233.464 180.764 181.350 1.00 193.03 ? 188  ASN B OD1 1 
ATOM   8974  N ND2 . ASN B  1 175  ? 235.383 179.726 180.815 1.00 193.03 ? 188  ASN B ND2 1 
ATOM   8975  N N   . LEU B  1 176  ? 233.149 183.046 182.306 1.00 186.43 ? 189  LEU B N   1 
ATOM   8976  C CA  . LEU B  1 176  ? 231.901 183.767 182.546 1.00 186.43 ? 189  LEU B CA  1 
ATOM   8977  C C   . LEU B  1 176  ? 230.717 182.898 182.964 1.00 186.43 ? 189  LEU B C   1 
ATOM   8978  O O   . LEU B  1 176  ? 230.017 182.338 182.118 1.00 186.43 ? 189  LEU B O   1 
ATOM   8979  C CB  . LEU B  1 176  ? 231.523 184.558 181.302 1.00 186.43 ? 189  LEU B CB  1 
ATOM   8980  C CG  . LEU B  1 176  ? 230.209 185.317 181.417 1.00 186.43 ? 189  LEU B CG  1 
ATOM   8981  C CD1 . LEU B  1 176  ? 230.187 186.211 182.638 1.00 186.43 ? 189  LEU B CD1 1 
ATOM   8982  C CD2 . LEU B  1 176  ? 230.057 186.132 180.172 1.00 186.43 ? 189  LEU B CD2 1 
ATOM   8983  N N   . ARG B  1 177  ? 230.453 182.839 184.267 1.00 194.30 ? 190  ARG B N   1 
ATOM   8984  C CA  . ARG B  1 177  ? 229.333 182.091 184.825 1.00 194.30 ? 190  ARG B CA  1 
ATOM   8985  C C   . ARG B  1 177  ? 228.139 183.031 185.027 1.00 194.30 ? 190  ARG B C   1 
ATOM   8986  O O   . ARG B  1 177  ? 228.100 184.140 184.487 1.00 194.30 ? 190  ARG B O   1 
ATOM   8987  C CB  . ARG B  1 177  ? 229.756 181.426 186.129 1.00 194.30 ? 190  ARG B CB  1 
ATOM   8988  C CG  . ARG B  1 177  ? 231.172 180.862 186.120 1.00 194.30 ? 190  ARG B CG  1 
ATOM   8989  C CD  . ARG B  1 177  ? 231.531 180.235 187.473 1.00 194.30 ? 190  ARG B CD  1 
ATOM   8990  N NE  . ARG B  1 177  ? 232.146 181.164 188.421 1.00 194.30 ? 190  ARG B NE  1 
ATOM   8991  C CZ  . ARG B  1 177  ? 233.252 180.902 189.114 1.00 194.30 ? 190  ARG B CZ  1 
ATOM   8992  N NH1 . ARG B  1 177  ? 233.862 179.735 188.979 1.00 194.30 ? 190  ARG B NH1 1 
ATOM   8993  N NH2 . ARG B  1 177  ? 233.739 181.801 189.953 1.00 194.30 ? 190  ARG B NH2 1 
ATOM   8994  N N   . GLU B  1 178  ? 227.131 182.582 185.782 1.00 187.54 ? 191  GLU B N   1 
ATOM   8995  C CA  . GLU B  1 178  ? 225.998 183.417 186.182 1.00 187.54 ? 191  GLU B CA  1 
ATOM   8996  C C   . GLU B  1 178  ? 225.277 182.745 187.348 1.00 187.54 ? 191  GLU B C   1 
ATOM   8997  O O   . GLU B  1 178  ? 225.247 181.516 187.432 1.00 187.54 ? 191  GLU B O   1 
ATOM   8998  C CB  . GLU B  1 178  ? 225.039 183.666 185.008 1.00 187.54 ? 191  GLU B CB  1 
ATOM   8999  C CG  . GLU B  1 178  ? 224.189 182.479 184.634 1.00 187.54 ? 191  GLU B CG  1 
ATOM   9000  C CD  . GLU B  1 178  ? 224.928 181.482 183.771 1.00 187.54 ? 191  GLU B CD  1 
ATOM   9001  O OE1 . GLU B  1 178  ? 226.170 181.491 183.760 1.00 187.54 ? 191  GLU B OE1 1 
ATOM   9002  O OE2 . GLU B  1 178  ? 224.267 180.675 183.096 1.00 187.54 ? 191  GLU B OE2 1 
ATOM   9003  N N   . PHE B  1 179  ? 224.719 183.552 188.271 1.00 185.80 ? 192  PHE B N   1 
ATOM   9004  C CA  . PHE B  1 179  ? 224.102 182.976 189.474 1.00 185.80 ? 192  PHE B CA  1 
ATOM   9005  C C   . PHE B  1 179  ? 222.891 183.806 189.889 1.00 185.80 ? 192  PHE B C   1 
ATOM   9006  O O   . PHE B  1 179  ? 223.024 184.777 190.636 1.00 185.80 ? 192  PHE B O   1 
ATOM   9007  C CB  . PHE B  1 179  ? 225.120 182.884 190.592 1.00 185.80 ? 192  PHE B CB  1 
ATOM   9008  C CG  . PHE B  1 179  ? 226.379 182.221 190.173 1.00 185.80 ? 192  PHE B CG  1 
ATOM   9009  C CD1 . PHE B  1 179  ? 226.507 180.852 190.250 1.00 185.80 ? 192  PHE B CD1 1 
ATOM   9010  C CD2 . PHE B  1 179  ? 227.420 182.961 189.649 1.00 185.80 ? 192  PHE B CD2 1 
ATOM   9011  C CE1 . PHE B  1 179  ? 227.666 180.235 189.846 1.00 185.80 ? 192  PHE B CE1 1 
ATOM   9012  C CE2 . PHE B  1 179  ? 228.575 182.350 189.238 1.00 185.80 ? 192  PHE B CE2 1 
ATOM   9013  C CZ  . PHE B  1 179  ? 228.699 180.986 189.338 1.00 185.80 ? 192  PHE B CZ  1 
ATOM   9014  N N   . VAL B  1 180  ? 221.716 183.376 189.454 1.00 181.81 ? 193  VAL B N   1 
ATOM   9015  C CA  . VAL B  1 180  ? 220.494 184.151 189.562 1.00 181.81 ? 193  VAL B CA  1 
ATOM   9016  C C   . VAL B  1 180  ? 219.728 183.653 190.771 1.00 181.81 ? 193  VAL B C   1 
ATOM   9017  O O   . VAL B  1 180  ? 220.091 182.657 191.394 1.00 181.81 ? 193  VAL B O   1 
ATOM   9018  C CB  . VAL B  1 180  ? 219.644 184.016 188.282 1.00 181.81 ? 193  VAL B CB  1 
ATOM   9019  C CG1 . VAL B  1 180  ? 219.156 182.595 188.151 1.00 181.81 ? 193  VAL B CG1 1 
ATOM   9020  C CG2 . VAL B  1 180  ? 218.490 185.009 188.247 1.00 181.81 ? 193  VAL B CG2 1 
ATOM   9021  N N   . PHE B  1 181  ? 218.651 184.349 191.121 1.00 189.06 ? 194  PHE B N   1 
ATOM   9022  C CA  . PHE B  1 181  ? 217.859 183.932 192.260 1.00 189.06 ? 194  PHE B CA  1 
ATOM   9023  C C   . PHE B  1 181  ? 216.395 184.205 191.981 1.00 189.06 ? 194  PHE B C   1 
ATOM   9024  O O   . PHE B  1 181  ? 216.070 185.164 191.278 1.00 189.06 ? 194  PHE B O   1 
ATOM   9025  C CB  . PHE B  1 181  ? 218.332 184.675 193.499 1.00 189.06 ? 194  PHE B CB  1 
ATOM   9026  C CG  . PHE B  1 181  ? 219.796 184.554 193.710 1.00 189.06 ? 194  PHE B CG  1 
ATOM   9027  C CD1 . PHE B  1 181  ? 220.333 183.445 194.328 1.00 189.06 ? 194  PHE B CD1 1 
ATOM   9028  C CD2 . PHE B  1 181  ? 220.649 185.525 193.217 1.00 189.06 ? 194  PHE B CD2 1 
ATOM   9029  C CE1 . PHE B  1 181  ? 221.693 183.331 194.491 1.00 189.06 ? 194  PHE B CE1 1 
ATOM   9030  C CE2 . PHE B  1 181  ? 222.002 185.416 193.377 1.00 189.06 ? 194  PHE B CE2 1 
ATOM   9031  C CZ  . PHE B  1 181  ? 222.528 184.318 194.012 1.00 189.06 ? 194  PHE B CZ  1 
ATOM   9032  N N   . LYS B  1 182  ? 215.517 183.360 192.513 1.00 177.73 ? 195  LYS B N   1 
ATOM   9033  C CA  . LYS B  1 182  ? 214.088 183.535 192.309 1.00 177.73 ? 195  LYS B CA  1 
ATOM   9034  C C   . LYS B  1 182  ? 213.322 183.068 193.537 1.00 177.73 ? 195  LYS B C   1 
ATOM   9035  O O   . LYS B  1 182  ? 213.646 182.037 194.129 1.00 177.73 ? 195  LYS B O   1 
ATOM   9036  C CB  . LYS B  1 182  ? 213.604 182.775 191.073 1.00 177.73 ? 195  LYS B CB  1 
ATOM   9037  N N   . ASN B  1 183  ? 212.308 183.839 193.915 1.00 172.25 ? 196  ASN B N   1 
ATOM   9038  C CA  . ASN B  1 183  ? 211.423 183.514 195.029 1.00 172.25 ? 196  ASN B CA  1 
ATOM   9039  C C   . ASN B  1 183  ? 210.019 183.400 194.452 1.00 172.25 ? 196  ASN B C   1 
ATOM   9040  O O   . ASN B  1 183  ? 209.250 184.363 194.460 1.00 172.25 ? 196  ASN B O   1 
ATOM   9041  C CB  . ASN B  1 183  ? 211.503 184.563 196.125 1.00 172.25 ? 196  ASN B CB  1 
ATOM   9042  N N   . ILE B  1 184  ? 209.686 182.215 193.963 1.00 173.47 ? 197  ILE B N   1 
ATOM   9043  C CA  . ILE B  1 184  ? 208.449 181.979 193.234 1.00 173.47 ? 197  ILE B CA  1 
ATOM   9044  C C   . ILE B  1 184  ? 207.495 181.264 194.179 1.00 173.47 ? 197  ILE B C   1 
ATOM   9045  O O   . ILE B  1 184  ? 207.488 180.031 194.257 1.00 173.47 ? 197  ILE B O   1 
ATOM   9046  C CB  . ILE B  1 184  ? 208.687 181.166 191.959 1.00 173.47 ? 197  ILE B CB  1 
ATOM   9047  N N   . ASP B  1 185  ? 206.676 182.043 194.885 1.00 171.94 ? 198  ASP B N   1 
ATOM   9048  C CA  . ASP B  1 185  ? 205.673 181.520 195.813 1.00 171.94 ? 198  ASP B CA  1 
ATOM   9049  C C   . ASP B  1 185  ? 206.324 180.719 196.938 1.00 171.94 ? 198  ASP B C   1 
ATOM   9050  O O   . ASP B  1 185  ? 205.874 179.634 197.307 1.00 171.94 ? 198  ASP B O   1 
ATOM   9051  C CB  . ASP B  1 185  ? 204.624 180.682 195.079 1.00 171.94 ? 198  ASP B CB  1 
ATOM   9052  N N   . GLY B  1 186  ? 207.395 181.265 197.486 1.00 176.86 ? 199  GLY B N   1 
ATOM   9053  C CA  . GLY B  1 186  ? 207.989 180.650 198.661 1.00 176.86 ? 199  GLY B CA  1 
ATOM   9054  C C   . GLY B  1 186  ? 208.908 179.478 198.463 1.00 176.86 ? 199  GLY B C   1 
ATOM   9055  O O   . GLY B  1 186  ? 210.010 179.463 199.016 1.00 176.86 ? 199  GLY B O   1 
ATOM   9056  N N   . TYR B  1 187  ? 208.493 178.486 197.677 1.00 170.83 ? 200  TYR B N   1 
ATOM   9057  C CA  . TYR B  1 187  ? 209.378 177.357 197.439 1.00 170.83 ? 200  TYR B CA  1 
ATOM   9058  C C   . TYR B  1 187  ? 210.619 177.909 196.756 1.00 170.83 ? 200  TYR B C   1 
ATOM   9059  O O   . TYR B  1 187  ? 210.627 178.151 195.547 1.00 170.83 ? 200  TYR B O   1 
ATOM   9060  C CB  . TYR B  1 187  ? 208.699 176.281 196.594 1.00 170.83 ? 200  TYR B CB  1 
ATOM   9061  N N   . PHE B  1 188  ? 211.664 178.123 197.544 1.00 177.52 ? 201  PHE B N   1 
ATOM   9062  C CA  . PHE B  1 188  ? 212.722 179.071 197.214 1.00 177.52 ? 201  PHE B CA  1 
ATOM   9063  C C   . PHE B  1 188  ? 213.681 178.458 196.196 1.00 177.52 ? 201  PHE B C   1 
ATOM   9064  O O   . PHE B  1 188  ? 214.657 177.805 196.560 1.00 177.52 ? 201  PHE B O   1 
ATOM   9065  C CB  . PHE B  1 188  ? 213.412 179.470 198.511 1.00 177.52 ? 201  PHE B CB  1 
ATOM   9066  C CG  . PHE B  1 188  ? 214.393 180.570 198.366 1.00 177.52 ? 201  PHE B CG  1 
ATOM   9067  C CD1 . PHE B  1 188  ? 213.975 181.835 197.999 1.00 177.52 ? 201  PHE B CD1 1 
ATOM   9068  C CD2 . PHE B  1 188  ? 215.723 180.363 198.668 1.00 177.52 ? 201  PHE B CD2 1 
ATOM   9069  C CE1 . PHE B  1 188  ? 214.878 182.865 197.878 1.00 177.52 ? 201  PHE B CE1 1 
ATOM   9070  C CE2 . PHE B  1 188  ? 216.633 181.388 198.559 1.00 177.52 ? 201  PHE B CE2 1 
ATOM   9071  C CZ  . PHE B  1 188  ? 216.211 182.643 198.164 1.00 177.52 ? 201  PHE B CZ  1 
ATOM   9072  N N   . LYS B  1 189  ? 213.415 178.674 194.912 1.00 170.36 ? 202  LYS B N   1 
ATOM   9073  C CA  . LYS B  1 189  ? 214.156 178.017 193.845 1.00 170.36 ? 202  LYS B CA  1 
ATOM   9074  C C   . LYS B  1 189  ? 215.290 178.900 193.354 1.00 170.36 ? 202  LYS B C   1 
ATOM   9075  O O   . LYS B  1 189  ? 215.131 180.113 193.220 1.00 170.36 ? 202  LYS B O   1 
ATOM   9076  C CB  . LYS B  1 189  ? 213.243 177.677 192.667 1.00 170.36 ? 202  LYS B CB  1 
ATOM   9077  C CG  . LYS B  1 189  ? 212.531 178.879 192.056 1.00 170.36 ? 202  LYS B CG  1 
ATOM   9078  C CD  . LYS B  1 189  ? 211.979 178.580 190.658 1.00 170.36 ? 202  LYS B CD  1 
ATOM   9079  C CE  . LYS B  1 189  ? 211.650 179.868 189.909 1.00 170.36 ? 202  LYS B CE  1 
ATOM   9080  N NZ  . LYS B  1 189  ? 211.393 179.630 188.468 1.00 170.36 ? 202  LYS B NZ  1 
ATOM   9081  N N   . ILE B  1 190  ? 216.428 178.282 193.056 1.00 166.15 ? 203  ILE B N   1 
ATOM   9082  C CA  . ILE B  1 190  ? 217.584 178.997 192.541 1.00 166.15 ? 203  ILE B CA  1 
ATOM   9083  C C   . ILE B  1 190  ? 218.170 178.220 191.374 1.00 166.15 ? 203  ILE B C   1 
ATOM   9084  O O   . ILE B  1 190  ? 218.414 177.016 191.484 1.00 166.15 ? 203  ILE B O   1 
ATOM   9085  C CB  . ILE B  1 190  ? 218.648 179.203 193.626 1.00 166.15 ? 203  ILE B CB  1 
ATOM   9086  C CG1 . ILE B  1 190  ? 218.040 179.929 194.812 1.00 166.15 ? 203  ILE B CG1 1 
ATOM   9087  C CG2 . ILE B  1 190  ? 219.783 180.007 193.082 1.00 166.15 ? 203  ILE B CG2 1 
ATOM   9088  C CD1 . ILE B  1 190  ? 217.554 181.294 194.476 1.00 166.15 ? 203  ILE B CD1 1 
ATOM   9089  N N   . TYR B  1 191  ? 218.421 178.913 190.275 1.00 159.52 ? 204  TYR B N   1 
ATOM   9090  C CA  . TYR B  1 191  ? 218.985 178.327 189.072 1.00 159.52 ? 204  TYR B CA  1 
ATOM   9091  C C   . TYR B  1 191  ? 220.469 178.646 188.980 1.00 159.52 ? 204  TYR B C   1 
ATOM   9092  O O   . TYR B  1 191  ? 220.991 179.474 189.729 1.00 159.52 ? 204  TYR B O   1 
ATOM   9093  C CB  . TYR B  1 191  ? 218.275 178.849 187.824 1.00 159.52 ? 204  TYR B CB  1 
ATOM   9094  C CG  . TYR B  1 191  ? 216.886 178.321 187.623 1.00 159.52 ? 204  TYR B CG  1 
ATOM   9095  C CD1 . TYR B  1 191  ? 215.884 178.599 188.535 1.00 159.52 ? 204  TYR B CD1 1 
ATOM   9096  C CD2 . TYR B  1 191  ? 216.573 177.564 186.512 1.00 159.52 ? 204  TYR B CD2 1 
ATOM   9097  C CE1 . TYR B  1 191  ? 214.613 178.126 188.360 1.00 159.52 ? 204  TYR B CE1 1 
ATOM   9098  C CE2 . TYR B  1 191  ? 215.305 177.078 186.324 1.00 159.52 ? 204  TYR B CE2 1 
ATOM   9099  C CZ  . TYR B  1 191  ? 214.323 177.370 187.253 1.00 159.52 ? 204  TYR B CZ  1 
ATOM   9100  O OH  . TYR B  1 191  ? 213.042 176.905 187.084 1.00 159.52 ? 204  TYR B OH  1 
ATOM   9101  N N   . SER B  1 192  ? 221.153 177.975 188.054 1.00 164.99 ? 205  SER B N   1 
ATOM   9102  C CA  . SER B  1 192  ? 222.591 178.162 187.899 1.00 164.99 ? 205  SER B CA  1 
ATOM   9103  C C   . SER B  1 192  ? 223.056 177.578 186.570 1.00 164.99 ? 205  SER B C   1 
ATOM   9104  O O   . SER B  1 192  ? 222.354 176.794 185.931 1.00 164.99 ? 205  SER B O   1 
ATOM   9105  C CB  . SER B  1 192  ? 223.354 177.519 189.057 1.00 164.99 ? 205  SER B CB  1 
ATOM   9106  O OG  . SER B  1 192  ? 222.732 177.787 190.301 1.00 164.99 ? 205  SER B OG  1 
ATOM   9107  N N   . LYS B  1 193  ? 224.251 178.005 186.151 1.00 174.99 ? 206  LYS B N   1 
ATOM   9108  C CA  . LYS B  1 193  ? 224.996 177.374 185.067 1.00 174.99 ? 206  LYS B CA  1 
ATOM   9109  C C   . LYS B  1 193  ? 226.417 177.915 184.977 1.00 174.99 ? 206  LYS B C   1 
ATOM   9110  O O   . LYS B  1 193  ? 226.630 179.129 184.990 1.00 174.99 ? 206  LYS B O   1 
ATOM   9111  C CB  . LYS B  1 193  ? 224.304 177.568 183.722 1.00 174.99 ? 206  LYS B CB  1 
ATOM   9112  C CG  . LYS B  1 193  ? 225.220 177.250 182.553 1.00 174.99 ? 206  LYS B CG  1 
ATOM   9113  C CD  . LYS B  1 193  ? 224.459 176.704 181.363 1.00 174.99 ? 206  LYS B CD  1 
ATOM   9114  C CE  . LYS B  1 193  ? 225.400 176.244 180.267 1.00 174.99 ? 206  LYS B CE  1 
ATOM   9115  N NZ  . LYS B  1 193  ? 226.112 177.380 179.639 1.00 174.99 ? 206  LYS B NZ  1 
ATOM   9116  N N   . HIS B  1 194  ? 227.392 177.018 184.871 1.00 183.43 ? 207  HIS B N   1 
ATOM   9117  C CA  . HIS B  1 194  ? 228.793 177.387 184.727 1.00 183.43 ? 207  HIS B CA  1 
ATOM   9118  C C   . HIS B  1 194  ? 229.161 177.595 183.263 1.00 183.43 ? 207  HIS B C   1 
ATOM   9119  O O   . HIS B  1 194  ? 229.961 176.834 182.711 1.00 183.43 ? 207  HIS B O   1 
ATOM   9120  C CB  . HIS B  1 194  ? 229.663 176.299 185.353 1.00 183.43 ? 207  HIS B CB  1 
ATOM   9121  C CG  . HIS B  1 194  ? 231.130 176.529 185.205 1.00 183.43 ? 207  HIS B CG  1 
ATOM   9122  N ND1 . HIS B  1 194  ? 231.752 177.674 185.645 1.00 183.43 ? 207  HIS B ND1 1 
ATOM   9123  C CD2 . HIS B  1 194  ? 232.103 175.749 184.679 1.00 183.43 ? 207  HIS B CD2 1 
ATOM   9124  C CE1 . HIS B  1 194  ? 233.045 177.596 185.391 1.00 183.43 ? 207  HIS B CE1 1 
ATOM   9125  N NE2 . HIS B  1 194  ? 233.284 176.436 184.807 1.00 183.43 ? 207  HIS B NE2 1 
ATOM   9126  N N   . THR B  1 195  ? 228.589 178.617 182.619 1.00 189.57 ? 208  THR B N   1 
ATOM   9127  C CA  . THR B  1 195  ? 228.729 178.772 181.170 1.00 189.57 ? 208  THR B CA  1 
ATOM   9128  C C   . THR B  1 195  ? 230.150 179.099 180.733 1.00 189.57 ? 208  THR B C   1 
ATOM   9129  O O   . THR B  1 195  ? 230.666 180.183 181.018 1.00 189.57 ? 208  THR B O   1 
ATOM   9130  C CB  . THR B  1 195  ? 227.797 179.853 180.637 1.00 189.57 ? 208  THR B CB  1 
ATOM   9131  O OG1 . THR B  1 195  ? 226.440 179.427 180.789 1.00 189.57 ? 208  THR B OG1 1 
ATOM   9132  C CG2 . THR B  1 195  ? 228.077 180.088 179.169 1.00 189.57 ? 208  THR B CG2 1 
ATOM   9133  N N   . PRO B  1 196  ? 230.793 178.214 180.025 1.00 192.89 ? 209  PRO B N   1 
ATOM   9134  C CA  . PRO B  1 196  ? 232.132 178.523 179.533 1.00 192.89 ? 209  PRO B CA  1 
ATOM   9135  C C   . PRO B  1 196  ? 232.076 179.267 178.213 1.00 192.89 ? 209  PRO B C   1 
ATOM   9136  O O   . PRO B  1 196  ? 231.420 178.826 177.266 1.00 192.89 ? 209  PRO B O   1 
ATOM   9137  C CB  . PRO B  1 196  ? 232.770 177.140 179.392 1.00 192.89 ? 209  PRO B CB  1 
ATOM   9138  C CG  . PRO B  1 196  ? 231.615 176.223 179.119 1.00 192.89 ? 209  PRO B CG  1 
ATOM   9139  C CD  . PRO B  1 196  ? 230.344 176.882 179.596 1.00 192.89 ? 209  PRO B CD  1 
ATOM   9140  N N   . ILE B  1 197  ? 232.746 180.411 178.148 1.00 193.62 ? 210  ILE B N   1 
ATOM   9141  C CA  . ILE B  1 197  ? 232.880 181.180 176.918 1.00 193.62 ? 210  ILE B CA  1 
ATOM   9142  C C   . ILE B  1 197  ? 234.271 181.788 176.885 1.00 193.62 ? 210  ILE B C   1 
ATOM   9143  O O   . ILE B  1 197  ? 234.575 182.704 177.658 1.00 193.62 ? 210  ILE B O   1 
ATOM   9144  C CB  . ILE B  1 197  ? 231.808 182.272 176.803 1.00 193.62 ? 210  ILE B CB  1 
ATOM   9145  C CG1 . ILE B  1 197  ? 232.175 183.244 175.683 1.00 193.62 ? 210  ILE B CG1 1 
ATOM   9146  C CG2 . ILE B  1 197  ? 231.584 182.948 178.150 1.00 193.62 ? 210  ILE B CG2 1 
ATOM   9147  C CD1 . ILE B  1 197  ? 232.209 182.596 174.329 1.00 193.62 ? 210  ILE B CD1 1 
ATOM   9148  N N   . ASN B  1 198  ? 235.108 181.293 175.987 1.00 193.61 ? 211  ASN B N   1 
ATOM   9149  C CA  . ASN B  1 198  ? 236.480 181.765 175.900 1.00 193.61 ? 211  ASN B CA  1 
ATOM   9150  C C   . ASN B  1 198  ? 236.454 183.216 175.457 1.00 193.61 ? 211  ASN B C   1 
ATOM   9151  O O   . ASN B  1 198  ? 236.089 183.518 174.318 1.00 193.61 ? 211  ASN B O   1 
ATOM   9152  C CB  . ASN B  1 198  ? 237.268 180.896 174.932 1.00 193.61 ? 211  ASN B CB  1 
ATOM   9153  C CG  . ASN B  1 198  ? 237.290 179.454 175.357 1.00 193.61 ? 211  ASN B CG  1 
ATOM   9154  O OD1 . ASN B  1 198  ? 237.467 179.152 176.537 1.00 193.61 ? 211  ASN B OD1 1 
ATOM   9155  N ND2 . ASN B  1 198  ? 237.086 178.550 174.408 1.00 193.61 ? 211  ASN B ND2 1 
ATOM   9156  N N   . LEU B  1 199  ? 236.818 184.120 176.356 1.00 188.90 ? 212  LEU B N   1 
ATOM   9157  C CA  . LEU B  1 199  ? 236.755 185.541 176.071 1.00 188.90 ? 212  LEU B CA  1 
ATOM   9158  C C   . LEU B  1 199  ? 238.023 186.195 176.600 1.00 188.90 ? 212  LEU B C   1 
ATOM   9159  O O   . LEU B  1 199  ? 238.838 185.560 177.276 1.00 188.90 ? 212  LEU B O   1 
ATOM   9160  C CB  . LEU B  1 199  ? 235.477 186.146 176.663 1.00 188.90 ? 212  LEU B CB  1 
ATOM   9161  C CG  . LEU B  1 199  ? 235.277 186.061 178.177 1.00 188.90 ? 212  LEU B CG  1 
ATOM   9162  C CD1 . LEU B  1 199  ? 235.696 187.354 178.835 1.00 188.90 ? 212  LEU B CD1 1 
ATOM   9163  C CD2 . LEU B  1 199  ? 233.845 185.725 178.534 1.00 188.90 ? 212  LEU B CD2 1 
ATOM   9164  N N   . VAL B  1 200  ? 238.211 187.466 176.259 1.00 186.05 ? 213  VAL B N   1 
ATOM   9165  C CA  . VAL B  1 200  ? 239.375 188.197 176.740 1.00 186.05 ? 213  VAL B CA  1 
ATOM   9166  C C   . VAL B  1 200  ? 238.957 189.402 177.570 1.00 186.05 ? 213  VAL B C   1 
ATOM   9167  O O   . VAL B  1 200  ? 239.328 189.503 178.744 1.00 186.05 ? 213  VAL B O   1 
ATOM   9168  C CB  . VAL B  1 200  ? 240.292 188.608 175.580 1.00 186.05 ? 213  VAL B CB  1 
ATOM   9169  C CG1 . VAL B  1 200  ? 241.356 189.560 176.074 1.00 186.05 ? 213  VAL B CG1 1 
ATOM   9170  C CG2 . VAL B  1 200  ? 240.947 187.375 175.002 1.00 186.05 ? 213  VAL B CG2 1 
ATOM   9171  N N   . ARG B  1 201  ? 238.192 190.325 176.990 1.00 173.53 ? 214  ARG B N   1 
ATOM   9172  C CA  . ARG B  1 201  ? 237.814 191.538 177.703 1.00 173.53 ? 214  ARG B CA  1 
ATOM   9173  C C   . ARG B  1 201  ? 236.542 192.157 177.141 1.00 173.53 ? 214  ARG B C   1 
ATOM   9174  O O   . ARG B  1 201  ? 236.415 192.358 175.930 1.00 173.53 ? 214  ARG B O   1 
ATOM   9175  C CB  . ARG B  1 201  ? 238.945 192.578 177.659 1.00 173.53 ? 214  ARG B CB  1 
ATOM   9176  C CG  . ARG B  1 201  ? 239.813 192.605 178.916 1.00 173.53 ? 214  ARG B CG  1 
ATOM   9177  C CD  . ARG B  1 201  ? 240.865 193.709 178.875 1.00 173.53 ? 214  ARG B CD  1 
ATOM   9178  N NE  . ARG B  1 201  ? 240.277 195.044 178.923 1.00 173.53 ? 214  ARG B NE  1 
ATOM   9179  C CZ  . ARG B  1 201  ? 240.981 196.169 178.868 1.00 173.53 ? 214  ARG B CZ  1 
ATOM   9180  N NH1 . ARG B  1 201  ? 242.299 196.120 178.759 1.00 173.53 ? 214  ARG B NH1 1 
ATOM   9181  N NH2 . ARG B  1 201  ? 240.368 197.343 178.919 1.00 173.53 ? 214  ARG B NH2 1 
ATOM   9182  N N   . ASP B  1 202  ? 235.611 192.461 178.047 1.00 157.63 ? 215  ASP B N   1 
ATOM   9183  C CA  . ASP B  1 202  ? 234.489 193.365 177.802 1.00 157.63 ? 215  ASP B CA  1 
ATOM   9184  C C   . ASP B  1 202  ? 233.542 192.814 176.733 1.00 157.63 ? 215  ASP B C   1 
ATOM   9185  O O   . ASP B  1 202  ? 233.208 193.475 175.751 1.00 157.63 ? 215  ASP B O   1 
ATOM   9186  C CB  . ASP B  1 202  ? 235.009 194.750 177.412 1.00 157.63 ? 215  ASP B CB  1 
ATOM   9187  C CG  . ASP B  1 202  ? 233.942 195.799 177.472 1.00 157.63 ? 215  ASP B CG  1 
ATOM   9188  O OD1 . ASP B  1 202  ? 232.865 195.506 178.026 1.00 157.63 ? 215  ASP B OD1 1 
ATOM   9189  O OD2 . ASP B  1 202  ? 234.179 196.912 176.969 1.00 157.63 ? 215  ASP B OD2 1 
ATOM   9190  N N   . LEU B  1 203  ? 233.089 191.593 176.973 1.00 151.85 ? 216  LEU B N   1 
ATOM   9191  C CA  . LEU B  1 203  ? 232.172 190.951 176.040 1.00 151.85 ? 216  LEU B CA  1 
ATOM   9192  C C   . LEU B  1 203  ? 230.991 190.339 176.782 1.00 151.85 ? 216  LEU B C   1 
ATOM   9193  O O   . LEU B  1 203  ? 230.809 189.117 176.742 1.00 151.85 ? 216  LEU B O   1 
ATOM   9194  C CB  . LEU B  1 203  ? 232.886 189.860 175.230 1.00 151.85 ? 216  LEU B CB  1 
ATOM   9195  C CG  . LEU B  1 203  ? 233.840 190.185 174.074 1.00 151.85 ? 216  LEU B CG  1 
ATOM   9196  C CD1 . LEU B  1 203  ? 234.642 188.956 173.661 1.00 151.85 ? 216  LEU B CD1 1 
ATOM   9197  C CD2 . LEU B  1 203  ? 233.074 190.719 172.886 1.00 151.85 ? 216  LEU B CD2 1 
ATOM   9198  N N   . PRO B  1 204  ? 230.151 191.128 177.438 1.00 143.12 ? 217  PRO B N   1 
ATOM   9199  C CA  . PRO B  1 204  ? 229.040 190.527 178.181 1.00 143.12 ? 217  PRO B CA  1 
ATOM   9200  C C   . PRO B  1 204  ? 228.035 189.888 177.249 1.00 143.12 ? 217  PRO B C   1 
ATOM   9201  O O   . PRO B  1 204  ? 226.862 190.261 177.254 1.00 143.12 ? 217  PRO B O   1 
ATOM   9202  C CB  . PRO B  1 204  ? 228.425 191.711 178.935 1.00 143.12 ? 217  PRO B CB  1 
ATOM   9203  C CG  . PRO B  1 204  ? 229.397 192.831 178.789 1.00 143.12 ? 217  PRO B CG  1 
ATOM   9204  C CD  . PRO B  1 204  ? 230.133 192.593 177.521 1.00 143.12 ? 217  PRO B CD  1 
ATOM   9205  N N   . GLN B  1 205  ? 228.479 188.909 176.468 1.00 147.51 ? 218  GLN B N   1 
ATOM   9206  C CA  . GLN B  1 205  ? 227.611 188.207 175.534 1.00 147.51 ? 218  GLN B CA  1 
ATOM   9207  C C   . GLN B  1 205  ? 227.744 186.716 175.801 1.00 147.51 ? 218  GLN B C   1 
ATOM   9208  O O   . GLN B  1 205  ? 228.730 186.256 176.379 1.00 147.51 ? 218  GLN B O   1 
ATOM   9209  C CB  . GLN B  1 205  ? 227.947 188.551 174.073 1.00 147.51 ? 218  GLN B CB  1 
ATOM   9210  C CG  . GLN B  1 205  ? 226.800 188.296 173.082 1.00 147.51 ? 218  GLN B CG  1 
ATOM   9211  C CD  . GLN B  1 205  ? 227.148 188.645 171.644 1.00 147.51 ? 218  GLN B CD  1 
ATOM   9212  O OE1 . GLN B  1 205  ? 228.044 189.444 171.384 1.00 147.51 ? 218  GLN B OE1 1 
ATOM   9213  N NE2 . GLN B  1 205  ? 226.431 188.047 170.703 1.00 147.51 ? 218  GLN B NE2 1 
ATOM   9214  N N   . GLY B  1 206  ? 226.729 185.968 175.381 1.00 153.74 ? 219  GLY B N   1 
ATOM   9215  C CA  . GLY B  1 206  ? 226.623 184.556 175.693 1.00 153.74 ? 219  GLY B CA  1 
ATOM   9216  C C   . GLY B  1 206  ? 225.203 184.194 176.071 1.00 153.74 ? 219  GLY B C   1 
ATOM   9217  O O   . GLY B  1 206  ? 224.620 184.810 176.968 1.00 153.74 ? 219  GLY B O   1 
ATOM   9218  N N   . PHE B  1 207  ? 224.634 183.199 175.392 1.00 155.75 ? 220  PHE B N   1 
ATOM   9219  C CA  . PHE B  1 207  ? 223.211 182.893 175.481 1.00 155.75 ? 220  PHE B CA  1 
ATOM   9220  C C   . PHE B  1 207  ? 222.992 181.441 175.898 1.00 155.75 ? 220  PHE B C   1 
ATOM   9221  O O   . PHE B  1 207  ? 223.351 180.520 175.158 1.00 155.75 ? 220  PHE B O   1 
ATOM   9222  C CB  . PHE B  1 207  ? 222.534 183.170 174.143 1.00 155.75 ? 220  PHE B CB  1 
ATOM   9223  C CG  . PHE B  1 207  ? 221.197 182.553 174.024 1.00 155.75 ? 220  PHE B CG  1 
ATOM   9224  C CD1 . PHE B  1 207  ? 220.113 183.112 174.660 1.00 155.75 ? 220  PHE B CD1 1 
ATOM   9225  C CD2 . PHE B  1 207  ? 221.021 181.405 173.289 1.00 155.75 ? 220  PHE B CD2 1 
ATOM   9226  C CE1 . PHE B  1 207  ? 218.875 182.542 174.561 1.00 155.75 ? 220  PHE B CE1 1 
ATOM   9227  C CE2 . PHE B  1 207  ? 219.788 180.830 173.187 1.00 155.75 ? 220  PHE B CE2 1 
ATOM   9228  C CZ  . PHE B  1 207  ? 218.708 181.398 173.821 1.00 155.75 ? 220  PHE B CZ  1 
ATOM   9229  N N   . SER B  1 208  ? 222.371 181.242 177.059 1.00 156.32 ? 221  SER B N   1 
ATOM   9230  C CA  . SER B  1 208  ? 222.158 179.906 177.595 1.00 156.32 ? 221  SER B CA  1 
ATOM   9231  C C   . SER B  1 208  ? 221.038 179.935 178.620 1.00 156.32 ? 221  SER B C   1 
ATOM   9232  O O   . SER B  1 208  ? 220.297 180.911 178.737 1.00 156.32 ? 221  SER B O   1 
ATOM   9233  C CB  . SER B  1 208  ? 223.422 179.345 178.235 1.00 156.32 ? 221  SER B CB  1 
ATOM   9234  O OG  . SER B  1 208  ? 223.084 178.278 179.100 1.00 156.32 ? 221  SER B OG  1 
ATOM   9235  N N   . ALA B  1 209  ? 220.935 178.850 179.380 1.00 153.05 ? 222  ALA B N   1 
ATOM   9236  C CA  . ALA B  1 209  ? 219.845 178.670 180.320 1.00 153.05 ? 222  ALA B CA  1 
ATOM   9237  C C   . ALA B  1 209  ? 220.373 178.089 181.621 1.00 153.05 ? 222  ALA B C   1 
ATOM   9238  O O   . ALA B  1 209  ? 221.575 177.890 181.799 1.00 153.05 ? 222  ALA B O   1 
ATOM   9239  C CB  . ALA B  1 209  ? 218.751 177.778 179.737 1.00 153.05 ? 222  ALA B CB  1 
ATOM   9240  N N   . LEU B  1 210  ? 219.445 177.816 182.536 1.00 158.87 ? 223  LEU B N   1 
ATOM   9241  C CA  . LEU B  1 210  ? 219.755 177.552 183.934 1.00 158.87 ? 223  LEU B CA  1 
ATOM   9242  C C   . LEU B  1 210  ? 218.867 176.441 184.469 1.00 158.87 ? 223  LEU B C   1 
ATOM   9243  O O   . LEU B  1 210  ? 217.693 176.351 184.100 1.00 158.87 ? 223  LEU B O   1 
ATOM   9244  C CB  . LEU B  1 210  ? 219.541 178.807 184.758 1.00 158.87 ? 223  LEU B CB  1 
ATOM   9245  C CG  . LEU B  1 210  ? 220.301 180.027 184.272 1.00 158.87 ? 223  LEU B CG  1 
ATOM   9246  C CD1 . LEU B  1 210  ? 219.740 181.290 184.887 1.00 158.87 ? 223  LEU B CD1 1 
ATOM   9247  C CD2 . LEU B  1 210  ? 221.748 179.861 184.608 1.00 158.87 ? 223  LEU B CD2 1 
ATOM   9248  N N   . GLU B  1 211  ? 219.421 175.604 185.335 1.00 161.80 ? 224  GLU B N   1 
ATOM   9249  C CA  . GLU B  1 211  ? 218.630 174.582 186.013 1.00 161.80 ? 224  GLU B CA  1 
ATOM   9250  C C   . GLU B  1 211  ? 218.559 174.873 187.509 1.00 161.80 ? 224  GLU B C   1 
ATOM   9251  O O   . GLU B  1 211  ? 219.512 175.405 188.082 1.00 161.80 ? 224  GLU B O   1 
ATOM   9252  C CB  . GLU B  1 211  ? 219.231 173.200 185.805 1.00 161.80 ? 224  GLU B CB  1 
ATOM   9253  C CG  . GLU B  1 211  ? 220.583 172.991 186.467 1.00 161.80 ? 224  GLU B CG  1 
ATOM   9254  C CD  . GLU B  1 211  ? 220.455 172.500 187.890 1.00 161.80 ? 224  GLU B CD  1 
ATOM   9255  O OE1 . GLU B  1 211  ? 219.364 172.023 188.247 1.00 161.80 ? 224  GLU B OE1 1 
ATOM   9256  O OE2 . GLU B  1 211  ? 221.437 172.596 188.647 1.00 161.80 ? 224  GLU B OE2 1 
ATOM   9257  N N   . PRO B  1 212  ? 217.474 174.521 188.193 1.00 161.91 ? 225  PRO B N   1 
ATOM   9258  C CA  . PRO B  1 212  ? 217.413 174.780 189.633 1.00 161.91 ? 225  PRO B CA  1 
ATOM   9259  C C   . PRO B  1 212  ? 218.327 173.826 190.372 1.00 161.91 ? 225  PRO B C   1 
ATOM   9260  O O   . PRO B  1 212  ? 218.029 172.640 190.512 1.00 161.91 ? 225  PRO B O   1 
ATOM   9261  C CB  . PRO B  1 212  ? 215.945 174.527 189.981 1.00 161.91 ? 225  PRO B CB  1 
ATOM   9262  C CG  . PRO B  1 212  ? 215.526 173.505 189.000 1.00 161.91 ? 225  PRO B CG  1 
ATOM   9263  C CD  . PRO B  1 212  ? 216.291 173.787 187.720 1.00 161.91 ? 225  PRO B CD  1 
ATOM   9264  N N   . LEU B  1 213  ? 219.442 174.348 190.850 1.00 166.30 ? 226  LEU B N   1 
ATOM   9265  C CA  . LEU B  1 213  ? 220.299 173.475 191.625 1.00 166.30 ? 226  LEU B CA  1 
ATOM   9266  C C   . LEU B  1 213  ? 219.648 173.122 192.955 1.00 166.30 ? 226  LEU B C   1 
ATOM   9267  O O   . LEU B  1 213  ? 219.752 171.983 193.414 1.00 166.30 ? 226  LEU B O   1 
ATOM   9268  C CB  . LEU B  1 213  ? 221.662 174.128 191.846 1.00 166.30 ? 226  LEU B CB  1 
ATOM   9269  C CG  . LEU B  1 213  ? 222.742 173.207 192.416 1.00 166.30 ? 226  LEU B CG  1 
ATOM   9270  C CD1 . LEU B  1 213  ? 222.665 171.823 191.800 1.00 166.30 ? 226  LEU B CD1 1 
ATOM   9271  C CD2 . LEU B  1 213  ? 224.115 173.802 192.200 1.00 166.30 ? 226  LEU B CD2 1 
ATOM   9272  N N   . VAL B  1 214  ? 218.958 174.078 193.570 1.00 167.56 ? 227  VAL B N   1 
ATOM   9273  C CA  . VAL B  1 214  ? 218.354 173.889 194.883 1.00 167.56 ? 227  VAL B CA  1 
ATOM   9274  C C   . VAL B  1 214  ? 217.074 174.701 194.986 1.00 167.56 ? 227  VAL B C   1 
ATOM   9275  O O   . VAL B  1 214  ? 217.034 175.879 194.615 1.00 167.56 ? 227  VAL B O   1 
ATOM   9276  C CB  . VAL B  1 214  ? 219.316 174.290 196.012 1.00 167.56 ? 227  VAL B CB  1 
ATOM   9277  C CG1 . VAL B  1 214  ? 218.553 174.443 197.297 1.00 167.56 ? 227  VAL B CG1 1 
ATOM   9278  C CG2 . VAL B  1 214  ? 220.403 173.249 196.180 1.00 167.56 ? 227  VAL B CG2 1 
ATOM   9279  N N   . ASP B  1 215  ? 216.035 174.074 195.516 1.00 170.93 ? 228  ASP B N   1 
ATOM   9280  C CA  . ASP B  1 215  ? 214.805 174.758 195.892 1.00 170.93 ? 228  ASP B CA  1 
ATOM   9281  C C   . ASP B  1 215  ? 214.628 174.567 197.394 1.00 170.93 ? 228  ASP B C   1 
ATOM   9282  O O   . ASP B  1 215  ? 214.046 173.572 197.835 1.00 170.93 ? 228  ASP B O   1 
ATOM   9283  C CB  . ASP B  1 215  ? 213.613 174.215 195.118 1.00 170.93 ? 228  ASP B CB  1 
ATOM   9284  C CG  . ASP B  1 215  ? 212.318 174.897 195.494 1.00 170.93 ? 228  ASP B CG  1 
ATOM   9285  O OD1 . ASP B  1 215  ? 212.111 176.040 195.059 1.00 170.93 ? 228  ASP B OD1 1 
ATOM   9286  O OD2 . ASP B  1 215  ? 211.509 174.298 196.231 1.00 170.93 ? 228  ASP B OD2 1 
ATOM   9287  N N   . LEU B  1 216  ? 215.129 175.515 198.177 1.00 164.73 ? 229  LEU B N   1 
ATOM   9288  C CA  . LEU B  1 216  ? 214.911 175.469 199.614 1.00 164.73 ? 229  LEU B CA  1 
ATOM   9289  C C   . LEU B  1 216  ? 213.527 176.002 199.926 1.00 164.73 ? 229  LEU B C   1 
ATOM   9290  O O   . LEU B  1 216  ? 213.267 177.208 199.829 1.00 164.73 ? 229  LEU B O   1 
ATOM   9291  C CB  . LEU B  1 216  ? 215.988 176.243 200.362 1.00 164.73 ? 229  LEU B CB  1 
ATOM   9292  C CG  . LEU B  1 216  ? 217.221 175.347 200.466 1.00 164.73 ? 229  LEU B CG  1 
ATOM   9293  C CD1 . LEU B  1 216  ? 218.306 175.939 201.336 1.00 164.73 ? 229  LEU B CD1 1 
ATOM   9294  C CD2 . LEU B  1 216  ? 216.821 173.972 200.975 1.00 164.73 ? 229  LEU B CD2 1 
ATOM   9295  N N   . PRO B  1 217  ? 212.627 175.127 200.293 1.00 166.18 ? 230  PRO B N   1 
ATOM   9296  C CA  . PRO B  1 217  ? 211.221 175.509 200.428 1.00 166.18 ? 230  PRO B CA  1 
ATOM   9297  C C   . PRO B  1 217  ? 210.974 176.339 201.668 1.00 166.18 ? 230  PRO B C   1 
ATOM   9298  O O   . PRO B  1 217  ? 210.138 175.992 202.507 1.00 166.18 ? 230  PRO B O   1 
ATOM   9299  C CB  . PRO B  1 217  ? 210.508 174.158 200.512 1.00 166.18 ? 230  PRO B CB  1 
ATOM   9300  C CG  . PRO B  1 217  ? 211.516 173.260 201.118 1.00 166.18 ? 230  PRO B CG  1 
ATOM   9301  C CD  . PRO B  1 217  ? 212.860 173.719 200.640 1.00 166.18 ? 230  PRO B CD  1 
ATOM   9302  N N   . ILE B  1 218  ? 211.687 177.449 201.785 1.00 180.94 ? 231  ILE B N   1 
ATOM   9303  C CA  . ILE B  1 218  ? 211.628 178.234 203.005 1.00 180.94 ? 231  ILE B CA  1 
ATOM   9304  C C   . ILE B  1 218  ? 210.445 179.190 202.952 1.00 180.94 ? 231  ILE B C   1 
ATOM   9305  O O   . ILE B  1 218  ? 209.574 179.166 203.827 1.00 180.94 ? 231  ILE B O   1 
ATOM   9306  C CB  . ILE B  1 218  ? 212.964 178.965 203.235 1.00 180.94 ? 231  ILE B CB  1 
ATOM   9307  C CG1 . ILE B  1 218  ? 212.861 179.942 204.406 1.00 180.94 ? 231  ILE B CG1 1 
ATOM   9308  C CG2 . ILE B  1 218  ? 213.450 179.636 201.959 1.00 180.94 ? 231  ILE B CG2 1 
ATOM   9309  C CD1 . ILE B  1 218  ? 214.214 180.443 204.895 1.00 180.94 ? 231  ILE B CD1 1 
ATOM   9310  N N   . GLY B  1 219  ? 210.378 180.008 201.913 1.00 192.38 ? 232  GLY B N   1 
ATOM   9311  C CA  . GLY B  1 219  ? 209.332 181.000 201.846 1.00 192.38 ? 232  GLY B CA  1 
ATOM   9312  C C   . GLY B  1 219  ? 209.487 182.032 202.935 1.00 192.38 ? 232  GLY B C   1 
ATOM   9313  O O   . GLY B  1 219  ? 208.633 182.142 203.817 1.00 192.38 ? 232  GLY B O   1 
ATOM   9314  N N   . ILE B  1 220  ? 210.577 182.789 202.888 1.00 203.60 ? 233  ILE B N   1 
ATOM   9315  C CA  . ILE B  1 220  ? 210.898 183.751 203.925 1.00 203.60 ? 233  ILE B CA  1 
ATOM   9316  C C   . ILE B  1 220  ? 210.918 185.155 203.324 1.00 203.60 ? 233  ILE B C   1 
ATOM   9317  O O   . ILE B  1 220  ? 210.927 185.342 202.107 1.00 203.60 ? 233  ILE B O   1 
ATOM   9318  C CB  . ILE B  1 220  ? 212.232 183.417 204.621 1.00 203.60 ? 233  ILE B CB  1 
ATOM   9319  C CG1 . ILE B  1 220  ? 212.375 184.168 205.952 1.00 203.60 ? 233  ILE B CG1 1 
ATOM   9320  C CG2 . ILE B  1 220  ? 213.391 183.714 203.699 1.00 203.60 ? 233  ILE B CG2 1 
ATOM   9321  C CD1 . ILE B  1 220  ? 211.189 184.017 206.883 1.00 203.60 ? 233  ILE B CD1 1 
ATOM   9322  N N   . ASN B  1 221  ? 210.917 186.148 204.208 1.00 214.99 ? 234  ASN B N   1 
ATOM   9323  C CA  . ASN B  1 221  ? 210.922 187.563 203.853 1.00 214.99 ? 234  ASN B CA  1 
ATOM   9324  C C   . ASN B  1 221  ? 212.202 187.875 203.085 1.00 214.99 ? 234  ASN B C   1 
ATOM   9325  O O   . ASN B  1 221  ? 213.289 187.923 203.665 1.00 214.99 ? 234  ASN B O   1 
ATOM   9326  C CB  . ASN B  1 221  ? 210.823 188.400 205.123 1.00 214.99 ? 234  ASN B CB  1 
ATOM   9327  C CG  . ASN B  1 221  ? 209.691 187.963 206.041 1.00 214.99 ? 234  ASN B CG  1 
ATOM   9328  O OD1 . ASN B  1 221  ? 209.818 188.030 207.257 1.00 214.99 ? 234  ASN B OD1 1 
ATOM   9329  N ND2 . ASN B  1 221  ? 208.582 187.523 205.465 1.00 214.99 ? 234  ASN B ND2 1 
ATOM   9330  N N   . ILE B  1 222  ? 212.082 188.109 201.776 1.00 212.99 ? 235  ILE B N   1 
ATOM   9331  C CA  . ILE B  1 222  ? 213.239 188.222 200.888 1.00 212.99 ? 235  ILE B CA  1 
ATOM   9332  C C   . ILE B  1 222  ? 213.111 189.455 200.002 1.00 212.99 ? 235  ILE B C   1 
ATOM   9333  O O   . ILE B  1 222  ? 212.287 189.480 199.080 1.00 212.99 ? 235  ILE B O   1 
ATOM   9334  C CB  . ILE B  1 222  ? 213.418 186.965 200.031 1.00 212.99 ? 235  ILE B CB  1 
ATOM   9335  C CG1 . ILE B  1 222  ? 213.863 185.806 200.917 1.00 212.99 ? 235  ILE B CG1 1 
ATOM   9336  C CG2 . ILE B  1 222  ? 214.417 187.217 198.907 1.00 212.99 ? 235  ILE B CG2 1 
ATOM   9337  C CD1 . ILE B  1 222  ? 215.077 186.125 201.764 1.00 212.99 ? 235  ILE B CD1 1 
ATOM   9338  N N   . THR B  1 223  ? 213.907 190.485 200.295 1.00 207.28 ? 236  THR B N   1 
ATOM   9339  C CA  . THR B  1 223  ? 214.186 191.540 199.332 1.00 207.28 ? 236  THR B CA  1 
ATOM   9340  C C   . THR B  1 223  ? 215.595 192.100 199.445 1.00 207.28 ? 236  THR B C   1 
ATOM   9341  O O   . THR B  1 223  ? 215.923 193.043 198.720 1.00 207.28 ? 236  THR B O   1 
ATOM   9342  C CB  . THR B  1 223  ? 213.188 192.689 199.474 1.00 207.28 ? 236  THR B CB  1 
ATOM   9343  O OG1 . THR B  1 223  ? 213.421 193.648 198.437 1.00 207.28 ? 236  THR B OG1 1 
ATOM   9344  C CG2 . THR B  1 223  ? 213.375 193.362 200.811 1.00 207.28 ? 236  THR B CG2 1 
ATOM   9345  N N   . ARG B  1 224  ? 216.430 191.561 200.325 1.00 211.04 ? 237  ARG B N   1 
ATOM   9346  C CA  . ARG B  1 224  ? 217.774 192.061 200.567 1.00 211.04 ? 237  ARG B CA  1 
ATOM   9347  C C   . ARG B  1 224  ? 218.766 190.967 200.225 1.00 211.04 ? 237  ARG B C   1 
ATOM   9348  O O   . ARG B  1 224  ? 218.625 189.835 200.691 1.00 211.04 ? 237  ARG B O   1 
ATOM   9349  C CB  . ARG B  1 224  ? 217.959 192.485 202.023 1.00 211.04 ? 237  ARG B CB  1 
ATOM   9350  C CG  . ARG B  1 224  ? 216.824 193.299 202.587 1.00 211.04 ? 237  ARG B CG  1 
ATOM   9351  C CD  . ARG B  1 224  ? 216.583 194.527 201.755 1.00 211.04 ? 237  ARG B CD  1 
ATOM   9352  N NE  . ARG B  1 224  ? 217.832 195.154 201.344 1.00 211.04 ? 237  ARG B NE  1 
ATOM   9353  C CZ  . ARG B  1 224  ? 217.896 196.239 200.583 1.00 211.04 ? 237  ARG B CZ  1 
ATOM   9354  N NH1 . ARG B  1 224  ? 216.779 196.814 200.160 1.00 211.04 ? 237  ARG B NH1 1 
ATOM   9355  N NH2 . ARG B  1 224  ? 219.070 196.748 200.244 1.00 211.04 ? 237  ARG B NH2 1 
ATOM   9356  N N   . PHE B  1 225  ? 219.755 191.306 199.407 1.00 207.87 ? 238  PHE B N   1 
ATOM   9357  C CA  . PHE B  1 225  ? 220.758 190.363 198.928 1.00 207.87 ? 238  PHE B CA  1 
ATOM   9358  C C   . PHE B  1 225  ? 222.151 190.985 199.033 1.00 207.87 ? 238  PHE B C   1 
ATOM   9359  O O   . PHE B  1 225  ? 222.885 191.131 198.057 1.00 207.87 ? 238  PHE B O   1 
ATOM   9360  C CB  . PHE B  1 225  ? 220.413 189.855 197.520 1.00 207.87 ? 238  PHE B CB  1 
ATOM   9361  C CG  . PHE B  1 225  ? 220.821 190.770 196.406 1.00 207.87 ? 238  PHE B CG  1 
ATOM   9362  C CD1 . PHE B  1 225  ? 220.212 191.985 196.237 1.00 207.87 ? 238  PHE B CD1 1 
ATOM   9363  C CD2 . PHE B  1 225  ? 221.826 190.402 195.531 1.00 207.87 ? 238  PHE B CD2 1 
ATOM   9364  C CE1 . PHE B  1 225  ? 220.592 192.810 195.228 1.00 207.87 ? 238  PHE B CE1 1 
ATOM   9365  C CE2 . PHE B  1 225  ? 222.218 191.233 194.534 1.00 207.87 ? 238  PHE B CE2 1 
ATOM   9366  C CZ  . PHE B  1 225  ? 221.598 192.442 194.379 1.00 207.87 ? 238  PHE B CZ  1 
ATOM   9367  N N   . GLN B  1 226  ? 222.514 191.419 200.231 1.00 212.62 ? 239  GLN B N   1 
ATOM   9368  C CA  . GLN B  1 226  ? 223.872 191.913 200.437 1.00 212.62 ? 239  GLN B CA  1 
ATOM   9369  C C   . GLN B  1 226  ? 224.891 190.881 199.969 1.00 212.62 ? 239  GLN B C   1 
ATOM   9370  O O   . GLN B  1 226  ? 225.020 189.805 200.553 1.00 212.62 ? 239  GLN B O   1 
ATOM   9371  C CB  . GLN B  1 226  ? 224.090 192.248 201.912 1.00 212.62 ? 239  GLN B CB  1 
ATOM   9372  C CG  . GLN B  1 226  ? 225.537 192.510 202.301 1.00 212.62 ? 239  GLN B CG  1 
ATOM   9373  C CD  . GLN B  1 226  ? 225.973 193.936 202.017 1.00 212.62 ? 239  GLN B CD  1 
ATOM   9374  O OE1 . GLN B  1 226  ? 226.893 194.174 201.239 1.00 212.62 ? 239  GLN B OE1 1 
ATOM   9375  N NE2 . GLN B  1 226  ? 225.309 194.893 202.650 1.00 212.62 ? 239  GLN B NE2 1 
ATOM   9376  N N   . THR B  1 227  ? 225.588 191.198 198.885 1.00 218.80 ? 240  THR B N   1 
ATOM   9377  C CA  . THR B  1 227  ? 226.633 190.347 198.333 1.00 218.80 ? 240  THR B CA  1 
ATOM   9378  C C   . THR B  1 227  ? 227.972 190.922 198.756 1.00 218.80 ? 240  THR B C   1 
ATOM   9379  O O   . THR B  1 227  ? 228.288 192.069 198.428 1.00 218.80 ? 240  THR B O   1 
ATOM   9380  C CB  . THR B  1 227  ? 226.554 190.269 196.810 1.00 218.80 ? 240  THR B CB  1 
ATOM   9381  O OG1 . THR B  1 227  ? 227.044 191.490 196.245 1.00 218.80 ? 240  THR B OG1 1 
ATOM   9382  C CG2 . THR B  1 227  ? 225.135 190.040 196.351 1.00 218.80 ? 240  THR B CG2 1 
ATOM   9383  N N   . LEU B  1 228  ? 228.754 190.132 199.471 1.00 233.51 ? 241  LEU B N   1 
ATOM   9384  C CA  . LEU B  1 228  ? 230.002 190.620 200.032 1.00 233.51 ? 241  LEU B CA  1 
ATOM   9385  C C   . LEU B  1 228  ? 231.162 189.784 199.524 1.00 233.51 ? 241  LEU B C   1 
ATOM   9386  O O   . LEU B  1 228  ? 231.010 188.616 199.159 1.00 233.51 ? 241  LEU B O   1 
ATOM   9387  C CB  . LEU B  1 228  ? 229.979 190.615 201.573 1.00 233.51 ? 241  LEU B CB  1 
ATOM   9388  C CG  . LEU B  1 228  ? 231.024 191.437 202.339 1.00 233.51 ? 241  LEU B CG  1 
ATOM   9389  C CD1 . LEU B  1 228  ? 231.077 192.863 201.826 1.00 233.51 ? 241  LEU B CD1 1 
ATOM   9390  C CD2 . LEU B  1 228  ? 230.729 191.422 203.833 1.00 233.51 ? 241  LEU B CD2 1 
ATOM   9391  N N   . LEU B  1 229  ? 232.318 190.428 199.473 1.00 253.20 ? 242  LEU B N   1 
ATOM   9392  C CA  . LEU B  1 229  ? 233.576 189.753 199.231 1.00 253.20 ? 242  LEU B CA  1 
ATOM   9393  C C   . LEU B  1 229  ? 234.130 189.293 200.571 1.00 253.20 ? 242  LEU B C   1 
ATOM   9394  O O   . LEU B  1 229  ? 233.546 189.571 201.619 1.00 253.20 ? 242  LEU B O   1 
ATOM   9395  C CB  . LEU B  1 229  ? 234.566 190.678 198.518 1.00 253.20 ? 242  LEU B CB  1 
ATOM   9396  C CG  . LEU B  1 229  ? 235.344 191.684 199.378 1.00 253.20 ? 242  LEU B CG  1 
ATOM   9397  C CD1 . LEU B  1 229  ? 236.431 192.375 198.563 1.00 253.20 ? 242  LEU B CD1 1 
ATOM   9398  C CD2 . LEU B  1 229  ? 234.426 192.720 200.017 1.00 253.20 ? 242  LEU B CD2 1 
ATOM   9399  N N   . ALA B  1 250  ? 232.406 196.432 194.638 1.00 204.53 ? 263  ALA B N   1 
ATOM   9400  C CA  . ALA B  1 250  ? 233.687 196.697 193.993 1.00 204.53 ? 263  ALA B CA  1 
ATOM   9401  C C   . ALA B  1 250  ? 233.682 196.285 192.520 1.00 204.53 ? 263  ALA B C   1 
ATOM   9402  O O   . ALA B  1 250  ? 234.175 197.023 191.666 1.00 204.53 ? 263  ALA B O   1 
ATOM   9403  C CB  . ALA B  1 250  ? 234.801 195.987 194.732 1.00 204.53 ? 263  ALA B CB  1 
ATOM   9404  N N   . ALA B  1 251  ? 233.137 195.099 192.232 1.00 206.01 ? 264  ALA B N   1 
ATOM   9405  C CA  . ALA B  1 251  ? 232.997 194.576 190.868 1.00 206.01 ? 264  ALA B CA  1 
ATOM   9406  C C   . ALA B  1 251  ? 231.910 193.501 190.847 1.00 206.01 ? 264  ALA B C   1 
ATOM   9407  O O   . ALA B  1 251  ? 232.177 192.343 191.181 1.00 206.01 ? 264  ALA B O   1 
ATOM   9408  C CB  . ALA B  1 251  ? 234.318 194.011 190.361 1.00 206.01 ? 264  ALA B CB  1 
ATOM   9409  N N   . TYR B  1 252  ? 230.698 193.857 190.425 1.00 198.73 ? 265  TYR B N   1 
ATOM   9410  C CA  . TYR B  1 252  ? 229.643 192.853 190.402 1.00 198.73 ? 265  TYR B CA  1 
ATOM   9411  C C   . TYR B  1 252  ? 228.494 193.328 189.527 1.00 198.73 ? 265  TYR B C   1 
ATOM   9412  O O   . TYR B  1 252  ? 228.164 194.515 189.533 1.00 198.73 ? 265  TYR B O   1 
ATOM   9413  C CB  . TYR B  1 252  ? 229.142 192.551 191.816 1.00 198.73 ? 265  TYR B CB  1 
ATOM   9414  C CG  . TYR B  1 252  ? 228.644 193.744 192.597 1.00 198.73 ? 265  TYR B CG  1 
ATOM   9415  C CD1 . TYR B  1 252  ? 227.352 194.216 192.435 1.00 198.73 ? 265  TYR B CD1 1 
ATOM   9416  C CD2 . TYR B  1 252  ? 229.454 194.376 193.526 1.00 198.73 ? 265  TYR B CD2 1 
ATOM   9417  C CE1 . TYR B  1 252  ? 226.889 195.299 193.155 1.00 198.73 ? 265  TYR B CE1 1 
ATOM   9418  C CE2 . TYR B  1 252  ? 228.997 195.460 194.255 1.00 198.73 ? 265  TYR B CE2 1 
ATOM   9419  C CZ  . TYR B  1 252  ? 227.713 195.914 194.064 1.00 198.73 ? 265  TYR B CZ  1 
ATOM   9420  O OH  . TYR B  1 252  ? 227.253 196.988 194.785 1.00 198.73 ? 265  TYR B OH  1 
ATOM   9421  N N   . TYR B  1 253  ? 227.884 192.400 188.784 1.00 187.57 ? 266  TYR B N   1 
ATOM   9422  C CA  . TYR B  1 253  ? 226.751 192.750 187.934 1.00 187.57 ? 266  TYR B CA  1 
ATOM   9423  C C   . TYR B  1 253  ? 225.442 192.443 188.646 1.00 187.57 ? 266  TYR B C   1 
ATOM   9424  O O   . TYR B  1 253  ? 225.256 191.365 189.214 1.00 187.57 ? 266  TYR B O   1 
ATOM   9425  C CB  . TYR B  1 253  ? 226.780 192.007 186.597 1.00 187.57 ? 266  TYR B CB  1 
ATOM   9426  C CG  . TYR B  1 253  ? 227.901 192.400 185.674 1.00 187.57 ? 266  TYR B CG  1 
ATOM   9427  C CD1 . TYR B  1 253  ? 229.008 193.074 186.146 1.00 187.57 ? 266  TYR B CD1 1 
ATOM   9428  C CD2 . TYR B  1 253  ? 227.841 192.112 184.327 1.00 187.57 ? 266  TYR B CD2 1 
ATOM   9429  C CE1 . TYR B  1 253  ? 230.029 193.427 185.320 1.00 187.57 ? 266  TYR B CE1 1 
ATOM   9430  C CE2 . TYR B  1 253  ? 228.860 192.472 183.485 1.00 187.57 ? 266  TYR B CE2 1 
ATOM   9431  C CZ  . TYR B  1 253  ? 229.955 193.131 183.989 1.00 187.57 ? 266  TYR B CZ  1 
ATOM   9432  O OH  . TYR B  1 253  ? 230.990 193.506 183.166 1.00 187.57 ? 266  TYR B OH  1 
ATOM   9433  N N   . VAL B  1 254  ? 224.527 193.402 188.596 1.00 186.45 ? 267  VAL B N   1 
ATOM   9434  C CA  . VAL B  1 254  ? 223.244 193.267 189.270 1.00 186.45 ? 267  VAL B CA  1 
ATOM   9435  C C   . VAL B  1 254  ? 222.140 193.535 188.270 1.00 186.45 ? 267  VAL B C   1 
ATOM   9436  O O   . VAL B  1 254  ? 222.244 194.430 187.428 1.00 186.45 ? 267  VAL B O   1 
ATOM   9437  C CB  . VAL B  1 254  ? 223.115 194.217 190.476 1.00 186.45 ? 267  VAL B CB  1 
ATOM   9438  C CG1 . VAL B  1 254  ? 223.280 195.655 190.035 1.00 186.45 ? 267  VAL B CG1 1 
ATOM   9439  C CG2 . VAL B  1 254  ? 221.756 194.043 191.133 1.00 186.45 ? 267  VAL B CG2 1 
ATOM   9440  N N   . GLY B  1 255  ? 221.091 192.735 188.358 1.00 186.12 ? 268  GLY B N   1 
ATOM   9441  C CA  . GLY B  1 255  ? 219.873 193.027 187.636 1.00 186.12 ? 268  GLY B CA  1 
ATOM   9442  C C   . GLY B  1 255  ? 218.716 193.102 188.604 1.00 186.12 ? 268  GLY B C   1 
ATOM   9443  O O   . GLY B  1 255  ? 218.912 192.944 189.811 1.00 186.12 ? 268  GLY B O   1 
ATOM   9444  N N   . TYR B  1 256  ? 217.513 193.340 188.092 1.00 189.29 ? 269  TYR B N   1 
ATOM   9445  C CA  . TYR B  1 256  ? 216.315 193.325 188.920 1.00 189.29 ? 269  TYR B CA  1 
ATOM   9446  C C   . TYR B  1 256  ? 215.165 192.830 188.072 1.00 189.29 ? 269  TYR B C   1 
ATOM   9447  O O   . TYR B  1 256  ? 214.587 193.604 187.306 1.00 189.29 ? 269  TYR B O   1 
ATOM   9448  C CB  . TYR B  1 256  ? 216.032 194.703 189.485 1.00 189.29 ? 269  TYR B CB  1 
ATOM   9449  C CG  . TYR B  1 256  ? 217.059 195.076 190.505 1.00 189.29 ? 269  TYR B CG  1 
ATOM   9450  C CD1 . TYR B  1 256  ? 217.183 194.353 191.673 1.00 189.29 ? 269  TYR B CD1 1 
ATOM   9451  C CD2 . TYR B  1 256  ? 217.941 196.109 190.282 1.00 189.29 ? 269  TYR B CD2 1 
ATOM   9452  C CE1 . TYR B  1 256  ? 218.130 194.664 192.597 1.00 189.29 ? 269  TYR B CE1 1 
ATOM   9453  C CE2 . TYR B  1 256  ? 218.896 196.431 191.210 1.00 189.29 ? 269  TYR B CE2 1 
ATOM   9454  C CZ  . TYR B  1 256  ? 218.982 195.705 192.366 1.00 189.29 ? 269  TYR B CZ  1 
ATOM   9455  O OH  . TYR B  1 256  ? 219.933 196.023 193.293 1.00 189.29 ? 269  TYR B OH  1 
ATOM   9456  N N   . LEU B  1 257  ? 214.825 191.558 188.239 1.00 174.88 ? 270  LEU B N   1 
ATOM   9457  C CA  . LEU B  1 257  ? 214.028 190.847 187.257 1.00 174.88 ? 270  LEU B CA  1 
ATOM   9458  C C   . LEU B  1 257  ? 212.644 191.469 187.122 1.00 174.88 ? 270  LEU B C   1 
ATOM   9459  O O   . LEU B  1 257  ? 212.251 192.350 187.889 1.00 174.88 ? 270  LEU B O   1 
ATOM   9460  C CB  . LEU B  1 257  ? 213.923 189.379 187.636 1.00 174.88 ? 270  LEU B CB  1 
ATOM   9461  C CG  . LEU B  1 257  ? 215.147 188.829 188.356 1.00 174.88 ? 270  LEU B CG  1 
ATOM   9462  C CD1 . LEU B  1 257  ? 214.877 187.418 188.835 1.00 174.88 ? 270  LEU B CD1 1 
ATOM   9463  C CD2 . LEU B  1 257  ? 216.411 188.897 187.522 1.00 174.88 ? 270  LEU B CD2 1 
ATOM   9464  N N   . GLN B  1 258  ? 211.901 191.001 186.118 1.00 157.99 ? 271  GLN B N   1 
ATOM   9465  C CA  . GLN B  1 258  ? 210.708 191.688 185.666 1.00 157.99 ? 271  GLN B CA  1 
ATOM   9466  C C   . GLN B  1 258  ? 209.612 190.730 185.221 1.00 157.99 ? 271  GLN B C   1 
ATOM   9467  O O   . GLN B  1 258  ? 209.846 189.910 184.322 1.00 157.99 ? 271  GLN B O   1 
ATOM   9468  C CB  . GLN B  1 258  ? 211.089 192.605 184.518 1.00 157.99 ? 271  GLN B CB  1 
ATOM   9469  C CG  . GLN B  1 258  ? 209.921 193.147 183.793 1.00 157.99 ? 271  GLN B CG  1 
ATOM   9470  C CD  . GLN B  1 258  ? 209.159 194.134 184.623 1.00 157.99 ? 271  GLN B CD  1 
ATOM   9471  O OE1 . GLN B  1 258  ? 207.931 194.141 184.623 1.00 157.99 ? 271  GLN B OE1 1 
ATOM   9472  N NE2 . GLN B  1 258  ? 209.882 194.987 185.338 1.00 157.99 ? 271  GLN B NE2 1 
ATOM   9473  N N   . PRO B  1 259  ? 208.417 190.820 185.791 1.00 156.45 ? 272  PRO B N   1 
ATOM   9474  C CA  . PRO B  1 259  ? 207.386 189.838 185.465 1.00 156.45 ? 272  PRO B CA  1 
ATOM   9475  C C   . PRO B  1 259  ? 206.895 190.056 184.055 1.00 156.45 ? 272  PRO B C   1 
ATOM   9476  O O   . PRO B  1 259  ? 205.871 190.700 183.818 1.00 156.45 ? 272  PRO B O   1 
ATOM   9477  C CB  . PRO B  1 259  ? 206.292 190.108 186.502 1.00 156.45 ? 272  PRO B CB  1 
ATOM   9478  C CG  . PRO B  1 259  ? 206.433 191.538 186.788 1.00 156.45 ? 272  PRO B CG  1 
ATOM   9479  C CD  . PRO B  1 259  ? 207.908 191.848 186.709 1.00 156.45 ? 272  PRO B CD  1 
ATOM   9480  N N   . ARG B  1 260  ? 207.651 189.535 183.105 1.00 158.17 ? 273  ARG B N   1 
ATOM   9481  C CA  . ARG B  1 260  ? 207.240 189.556 181.715 1.00 158.17 ? 273  ARG B CA  1 
ATOM   9482  C C   . ARG B  1 260  ? 207.092 188.130 181.235 1.00 158.17 ? 273  ARG B C   1 
ATOM   9483  O O   . ARG B  1 260  ? 207.857 187.250 181.636 1.00 158.17 ? 273  ARG B O   1 
ATOM   9484  C CB  . ARG B  1 260  ? 208.228 190.309 180.836 1.00 158.17 ? 273  ARG B CB  1 
ATOM   9485  C CG  . ARG B  1 260  ? 208.307 191.790 181.125 1.00 158.17 ? 273  ARG B CG  1 
ATOM   9486  C CD  . ARG B  1 260  ? 207.024 192.529 180.752 1.00 158.17 ? 273  ARG B CD  1 
ATOM   9487  N NE  . ARG B  1 260  ? 207.163 193.974 180.938 1.00 158.17 ? 273  ARG B NE  1 
ATOM   9488  C CZ  . ARG B  1 260  ? 206.177 194.855 180.797 1.00 158.17 ? 273  ARG B CZ  1 
ATOM   9489  N NH1 . ARG B  1 260  ? 204.958 194.450 180.474 1.00 158.17 ? 273  ARG B NH1 1 
ATOM   9490  N NH2 . ARG B  1 260  ? 206.410 196.145 180.987 1.00 158.17 ? 273  ARG B NH2 1 
ATOM   9491  N N   . THR B  1 261  ? 206.091 187.903 180.410 1.00 154.00 ? 274  THR B N   1 
ATOM   9492  C CA  . THR B  1 261  ? 205.905 186.598 179.821 1.00 154.00 ? 274  THR B CA  1 
ATOM   9493  C C   . THR B  1 261  ? 206.627 186.531 178.478 1.00 154.00 ? 274  THR B C   1 
ATOM   9494  O O   . THR B  1 261  ? 206.536 187.446 177.661 1.00 154.00 ? 274  THR B O   1 
ATOM   9495  C CB  . THR B  1 261  ? 204.414 186.319 179.676 1.00 154.00 ? 274  THR B CB  1 
ATOM   9496  O OG1 . THR B  1 261  ? 204.229 185.061 179.018 1.00 154.00 ? 274  THR B OG1 1 
ATOM   9497  C CG2 . THR B  1 261  ? 203.730 187.433 178.929 1.00 154.00 ? 274  THR B CG2 1 
ATOM   9498  N N   . PHE B  1 262  ? 207.386 185.455 178.251 1.00 150.25 ? 275  PHE B N   1 
ATOM   9499  C CA  . PHE B  1 262  ? 208.170 185.373 176.989 1.00 150.25 ? 275  PHE B CA  1 
ATOM   9500  C C   . PHE B  1 262  ? 207.872 184.084 176.217 1.00 150.25 ? 275  PHE B C   1 
ATOM   9501  O O   . PHE B  1 262  ? 207.447 183.082 176.827 1.00 150.25 ? 275  PHE B O   1 
ATOM   9502  C CB  . PHE B  1 262  ? 209.668 185.501 177.284 1.00 150.25 ? 275  PHE B CB  1 
ATOM   9503  C CG  . PHE B  1 262  ? 210.076 186.805 177.922 1.00 150.25 ? 275  PHE B CG  1 
ATOM   9504  C CD1 . PHE B  1 262  ? 209.125 187.733 178.314 1.00 150.25 ? 275  PHE B CD1 1 
ATOM   9505  C CD2 . PHE B  1 262  ? 211.413 187.106 178.131 1.00 150.25 ? 275  PHE B CD2 1 
ATOM   9506  C CE1 . PHE B  1 262  ? 209.501 188.932 178.900 1.00 150.25 ? 275  PHE B CE1 1 
ATOM   9507  C CE2 . PHE B  1 262  ? 211.788 188.304 178.718 1.00 150.25 ? 275  PHE B CE2 1 
ATOM   9508  C CZ  . PHE B  1 262  ? 210.832 189.215 179.101 1.00 150.25 ? 275  PHE B CZ  1 
ATOM   9509  N N   . LEU B  1 263  ? 208.098 184.134 174.899 1.00 143.98 ? 276  LEU B N   1 
ATOM   9510  C CA  . LEU B  1 263  ? 207.904 182.972 173.991 1.00 143.98 ? 276  LEU B CA  1 
ATOM   9511  C C   . LEU B  1 263  ? 209.269 182.308 173.780 1.00 143.98 ? 276  LEU B C   1 
ATOM   9512  O O   . LEU B  1 263  ? 210.179 182.979 173.253 1.00 143.98 ? 276  LEU B O   1 
ATOM   9513  C CB  . LEU B  1 263  ? 207.320 183.467 172.665 1.00 143.98 ? 276  LEU B CB  1 
ATOM   9514  C CG  . LEU B  1 263  ? 207.331 182.453 171.522 1.00 143.98 ? 276  LEU B CG  1 
ATOM   9515  C CD1 . LEU B  1 263  ? 206.468 181.247 171.859 1.00 143.98 ? 276  LEU B CD1 1 
ATOM   9516  C CD2 . LEU B  1 263  ? 206.868 183.094 170.223 1.00 143.98 ? 276  LEU B CD2 1 
ATOM   9517  N N   . LEU B  1 264  ? 209.395 181.040 174.181 1.00 145.13 ? 277  LEU B N   1 
ATOM   9518  C CA  . LEU B  1 264  ? 210.650 180.309 174.082 1.00 145.13 ? 277  LEU B CA  1 
ATOM   9519  C C   . LEU B  1 264  ? 210.515 179.221 173.025 1.00 145.13 ? 277  LEU B C   1 
ATOM   9520  O O   . LEU B  1 264  ? 209.408 178.837 172.638 1.00 145.13 ? 277  LEU B O   1 
ATOM   9521  C CB  . LEU B  1 264  ? 211.027 179.651 175.407 1.00 145.13 ? 277  LEU B CB  1 
ATOM   9522  C CG  . LEU B  1 264  ? 210.607 180.406 176.651 1.00 145.13 ? 277  LEU B CG  1 
ATOM   9523  C CD1 . LEU B  1 264  ? 210.874 179.548 177.845 1.00 145.13 ? 277  LEU B CD1 1 
ATOM   9524  C CD2 . LEU B  1 264  ? 211.379 181.683 176.745 1.00 145.13 ? 277  LEU B CD2 1 
ATOM   9525  N N   . LYS B  1 265  ? 211.660 178.723 172.566 1.00 138.13 ? 278  LYS B N   1 
ATOM   9526  C CA  . LYS B  1 265  ? 211.720 177.526 171.740 1.00 138.13 ? 278  LYS B CA  1 
ATOM   9527  C C   . LYS B  1 265  ? 212.729 176.574 172.361 1.00 138.13 ? 278  LYS B C   1 
ATOM   9528  O O   . LYS B  1 265  ? 213.816 176.995 172.764 1.00 138.13 ? 278  LYS B O   1 
ATOM   9529  C CB  . LYS B  1 265  ? 212.093 177.853 170.287 1.00 138.13 ? 278  LYS B CB  1 
ATOM   9530  C CG  . LYS B  1 265  ? 213.406 178.583 170.121 1.00 138.13 ? 278  LYS B CG  1 
ATOM   9531  C CD  . LYS B  1 265  ? 213.840 178.640 168.676 1.00 138.13 ? 278  LYS B CD  1 
ATOM   9532  C CE  . LYS B  1 265  ? 213.844 177.263 168.066 1.00 138.13 ? 278  LYS B CE  1 
ATOM   9533  N NZ  . LYS B  1 265  ? 214.622 176.314 168.896 1.00 138.13 ? 278  LYS B NZ  1 
ATOM   9534  N N   . TYR B  1 266  ? 212.359 175.308 172.479 1.00 136.44 ? 279  TYR B N   1 
ATOM   9535  C CA  . TYR B  1 266  ? 213.273 174.296 172.974 1.00 136.44 ? 279  TYR B CA  1 
ATOM   9536  C C   . TYR B  1 266  ? 213.841 173.497 171.821 1.00 136.44 ? 279  TYR B C   1 
ATOM   9537  O O   . TYR B  1 266  ? 213.329 173.529 170.701 1.00 136.44 ? 279  TYR B O   1 
ATOM   9538  C CB  . TYR B  1 266  ? 212.584 173.347 173.933 1.00 136.44 ? 279  TYR B CB  1 
ATOM   9539  C CG  . TYR B  1 266  ? 211.765 174.072 174.921 1.00 136.44 ? 279  TYR B CG  1 
ATOM   9540  C CD1 . TYR B  1 266  ? 212.342 174.630 176.033 1.00 136.44 ? 279  TYR B CD1 1 
ATOM   9541  C CD2 . TYR B  1 266  ? 210.412 174.212 174.739 1.00 136.44 ? 279  TYR B CD2 1 
ATOM   9542  C CE1 . TYR B  1 266  ? 211.589 175.303 176.950 1.00 136.44 ? 279  TYR B CE1 1 
ATOM   9543  C CE2 . TYR B  1 266  ? 209.647 174.879 175.644 1.00 136.44 ? 279  TYR B CE2 1 
ATOM   9544  C CZ  . TYR B  1 266  ? 210.238 175.427 176.752 1.00 136.44 ? 279  TYR B CZ  1 
ATOM   9545  O OH  . TYR B  1 266  ? 209.467 176.104 177.668 1.00 136.44 ? 279  TYR B OH  1 
ATOM   9546  N N   . ASN B  1 267  ? 214.908 172.774 172.109 1.00 143.32 ? 280  ASN B N   1 
ATOM   9547  C CA  . ASN B  1 267  ? 215.455 171.831 171.158 1.00 143.32 ? 280  ASN B CA  1 
ATOM   9548  C C   . ASN B  1 267  ? 215.409 170.437 171.761 1.00 143.32 ? 280  ASN B C   1 
ATOM   9549  O O   . ASN B  1 267  ? 215.429 170.270 172.981 1.00 143.32 ? 280  ASN B O   1 
ATOM   9550  C CB  . ASN B  1 267  ? 216.883 172.201 170.784 1.00 143.32 ? 280  ASN B CB  1 
ATOM   9551  C CG  . ASN B  1 267  ? 217.332 171.509 169.545 1.00 143.32 ? 280  ASN B CG  1 
ATOM   9552  O OD1 . ASN B  1 267  ? 216.576 170.754 168.935 1.00 143.32 ? 280  ASN B OD1 1 
ATOM   9553  N ND2 . ASN B  1 267  ? 218.566 171.757 169.150 1.00 143.32 ? 280  ASN B ND2 1 
ATOM   9554  N N   . GLU B  1 268  ? 215.324 169.435 170.886 1.00 145.88 ? 281  GLU B N   1 
ATOM   9555  C CA  . GLU B  1 268  ? 215.194 168.061 171.355 1.00 145.88 ? 281  GLU B CA  1 
ATOM   9556  C C   . GLU B  1 268  ? 216.269 167.729 172.369 1.00 145.88 ? 281  GLU B C   1 
ATOM   9557  O O   . GLU B  1 268  ? 216.012 167.029 173.353 1.00 145.88 ? 281  GLU B O   1 
ATOM   9558  C CB  . GLU B  1 268  ? 215.261 167.095 170.176 1.00 145.88 ? 281  GLU B CB  1 
ATOM   9559  N N   . ASN B  1 269  ? 217.476 168.243 172.155 1.00 155.15 ? 282  ASN B N   1 
ATOM   9560  C CA  . ASN B  1 269  ? 218.533 168.120 173.142 1.00 155.15 ? 282  ASN B CA  1 
ATOM   9561  C C   . ASN B  1 269  ? 218.179 168.831 174.443 1.00 155.15 ? 282  ASN B C   1 
ATOM   9562  O O   . ASN B  1 269  ? 218.830 168.590 175.466 1.00 155.15 ? 282  ASN B O   1 
ATOM   9563  C CB  . ASN B  1 269  ? 219.829 168.691 172.564 1.00 155.15 ? 282  ASN B CB  1 
ATOM   9564  C CG  . ASN B  1 269  ? 219.963 168.427 171.083 1.00 155.15 ? 282  ASN B CG  1 
ATOM   9565  O OD1 . ASN B  1 269  ? 219.345 169.140 170.299 1.00 155.15 ? 282  ASN B OD1 1 
ATOM   9566  N ND2 . ASN B  1 269  ? 220.777 167.448 170.671 1.00 155.15 ? 282  ASN B ND2 1 
ATOM   9567  N N   . GLY B  1 270  ? 217.163 169.692 174.436 1.00 144.40 ? 283  GLY B N   1 
ATOM   9568  C CA  . GLY B  1 270  ? 216.742 170.374 175.637 1.00 144.40 ? 283  GLY B CA  1 
ATOM   9569  C C   . GLY B  1 270  ? 217.208 171.802 175.767 1.00 144.40 ? 283  GLY B C   1 
ATOM   9570  O O   . GLY B  1 270  ? 216.681 172.533 176.610 1.00 144.40 ? 283  GLY B O   1 
ATOM   9571  N N   . THR B  1 271  ? 218.152 172.238 174.954 1.00 140.66 ? 284  THR B N   1 
ATOM   9572  C CA  . THR B  1 271  ? 218.676 173.581 175.106 1.00 140.66 ? 284  THR B CA  1 
ATOM   9573  C C   . THR B  1 271  ? 217.715 174.570 174.447 1.00 140.66 ? 284  THR B C   1 
ATOM   9574  O O   . THR B  1 271  ? 216.652 174.202 173.947 1.00 140.66 ? 284  THR B O   1 
ATOM   9575  C CB  . THR B  1 271  ? 220.089 173.651 174.522 1.00 140.66 ? 284  THR B CB  1 
ATOM   9576  O OG1 . THR B  1 271  ? 220.834 172.525 174.997 1.00 140.66 ? 284  THR B OG1 1 
ATOM   9577  C CG2 . THR B  1 271  ? 220.830 174.897 174.985 1.00 140.66 ? 284  THR B CG2 1 
ATOM   9578  N N   . ILE B  1 272  ? 218.070 175.847 174.499 1.00 142.21 ? 285  ILE B N   1 
ATOM   9579  C CA  . ILE B  1 272  ? 217.300 176.913 173.884 1.00 142.21 ? 285  ILE B CA  1 
ATOM   9580  C C   . ILE B  1 272  ? 218.140 177.552 172.795 1.00 142.21 ? 285  ILE B C   1 
ATOM   9581  O O   . ILE B  1 272  ? 219.336 177.791 172.990 1.00 142.21 ? 285  ILE B O   1 
ATOM   9582  C CB  . ILE B  1 272  ? 216.883 177.951 174.926 1.00 142.21 ? 285  ILE B CB  1 
ATOM   9583  C CG1 . ILE B  1 272  ? 216.120 177.247 176.025 1.00 142.21 ? 285  ILE B CG1 1 
ATOM   9584  C CG2 . ILE B  1 272  ? 216.043 179.022 174.298 1.00 142.21 ? 285  ILE B CG2 1 
ATOM   9585  C CD1 . ILE B  1 272  ? 215.967 178.064 177.253 1.00 142.21 ? 285  ILE B CD1 1 
ATOM   9586  N N   . THR B  1 273  ? 217.513 177.836 171.654 1.00 147.23 ? 286  THR B N   1 
ATOM   9587  C CA  . THR B  1 273  ? 218.167 178.479 170.519 1.00 147.23 ? 286  THR B CA  1 
ATOM   9588  C C   . THR B  1 273  ? 217.985 179.992 170.526 1.00 147.23 ? 286  THR B C   1 
ATOM   9589  O O   . THR B  1 273  ? 218.947 180.734 170.306 1.00 147.23 ? 286  THR B O   1 
ATOM   9590  C CB  . THR B  1 273  ? 217.629 177.906 169.207 1.00 147.23 ? 286  THR B CB  1 
ATOM   9591  O OG1 . THR B  1 273  ? 217.881 176.498 169.163 1.00 147.23 ? 286  THR B OG1 1 
ATOM   9592  C CG2 . THR B  1 273  ? 218.301 178.566 168.026 1.00 147.23 ? 286  THR B CG2 1 
ATOM   9593  N N   . ASP B  1 274  ? 216.766 180.463 170.760 1.00 145.63 ? 287  ASP B N   1 
ATOM   9594  C CA  . ASP B  1 274  ? 216.527 181.880 170.978 1.00 145.63 ? 287  ASP B CA  1 
ATOM   9595  C C   . ASP B  1 274  ? 215.168 182.043 171.639 1.00 145.63 ? 287  ASP B C   1 
ATOM   9596  O O   . ASP B  1 274  ? 214.310 181.165 171.548 1.00 145.63 ? 287  ASP B O   1 
ATOM   9597  C CB  . ASP B  1 274  ? 216.586 182.672 169.680 1.00 145.63 ? 287  ASP B CB  1 
ATOM   9598  C CG  . ASP B  1 274  ? 216.430 184.139 169.915 1.00 145.63 ? 287  ASP B CG  1 
ATOM   9599  O OD1 . ASP B  1 274  ? 217.421 184.777 170.324 1.00 145.63 ? 287  ASP B OD1 1 
ATOM   9600  O OD2 . ASP B  1 274  ? 215.307 184.648 169.735 1.00 145.63 ? 287  ASP B OD2 1 
ATOM   9601  N N   . ALA B  1 275  ? 214.984 183.174 172.318 1.00 150.05 ? 288  ALA B N   1 
ATOM   9602  C CA  . ALA B  1 275  ? 213.761 183.440 173.063 1.00 150.05 ? 288  ALA B CA  1 
ATOM   9603  C C   . ALA B  1 275  ? 213.463 184.929 173.027 1.00 150.05 ? 288  ALA B C   1 
ATOM   9604  O O   . ALA B  1 275  ? 214.365 185.747 172.837 1.00 150.05 ? 288  ALA B O   1 
ATOM   9605  C CB  . ALA B  1 275  ? 213.875 182.962 174.516 1.00 150.05 ? 288  ALA B CB  1 
ATOM   9606  N N   . VAL B  1 276  ? 212.189 185.286 173.186 1.00 144.18 ? 289  VAL B N   1 
ATOM   9607  C CA  . VAL B  1 276  ? 211.818 186.693 173.251 1.00 144.18 ? 289  VAL B CA  1 
ATOM   9608  C C   . VAL B  1 276  ? 210.774 186.865 174.339 1.00 144.18 ? 289  VAL B C   1 
ATOM   9609  O O   . VAL B  1 276  ? 210.043 185.935 174.677 1.00 144.18 ? 289  VAL B O   1 
ATOM   9610  C CB  . VAL B  1 276  ? 211.281 187.235 171.905 1.00 144.18 ? 289  VAL B CB  1 
ATOM   9611  C CG1 . VAL B  1 276  ? 211.212 188.749 171.925 1.00 144.18 ? 289  VAL B CG1 1 
ATOM   9612  C CG2 . VAL B  1 276  ? 212.138 186.774 170.751 1.00 144.18 ? 289  VAL B CG2 1 
ATOM   9613  N N   . ASP B  1 277  ? 210.728 188.060 174.908 1.00 149.65 ? 290  ASP B N   1 
ATOM   9614  C CA  . ASP B  1 277  ? 209.591 188.463 175.709 1.00 149.65 ? 290  ASP B CA  1 
ATOM   9615  C C   . ASP B  1 277  ? 208.383 188.591 174.807 1.00 149.65 ? 290  ASP B C   1 
ATOM   9616  O O   . ASP B  1 277  ? 208.497 188.923 173.625 1.00 149.65 ? 290  ASP B O   1 
ATOM   9617  C CB  . ASP B  1 277  ? 209.874 189.796 176.407 1.00 149.65 ? 290  ASP B CB  1 
ATOM   9618  C CG  . ASP B  1 277  ? 208.697 190.317 177.225 1.00 149.65 ? 290  ASP B CG  1 
ATOM   9619  O OD1 . ASP B  1 277  ? 207.592 189.755 177.165 1.00 149.65 ? 290  ASP B OD1 1 
ATOM   9620  O OD2 . ASP B  1 277  ? 208.875 191.322 177.936 1.00 149.65 ? 290  ASP B OD2 1 
ATOM   9621  N N   . CYS B  1 278  ? 207.213 188.337 175.378 1.00 152.87 ? 291  CYS B N   1 
ATOM   9622  C CA  . CYS B  1 278  ? 206.003 188.597 174.622 1.00 152.87 ? 291  CYS B CA  1 
ATOM   9623  C C   . CYS B  1 278  ? 205.787 190.089 174.411 1.00 152.87 ? 291  CYS B C   1 
ATOM   9624  O O   . CYS B  1 278  ? 205.080 190.466 173.473 1.00 152.87 ? 291  CYS B O   1 
ATOM   9625  C CB  . CYS B  1 278  ? 204.797 187.975 175.333 1.00 152.87 ? 291  CYS B CB  1 
ATOM   9626  S SG  . CYS B  1 278  ? 203.302 187.755 174.344 1.00 152.87 ? 291  CYS B SG  1 
ATOM   9627  N N   . ALA B  1 279  ? 206.432 190.952 175.215 1.00 158.14 ? 292  ALA B N   1 
ATOM   9628  C CA  . ALA B  1 279  ? 205.947 192.321 175.337 1.00 158.14 ? 292  ALA B CA  1 
ATOM   9629  C C   . ALA B  1 279  ? 207.000 193.428 175.289 1.00 158.14 ? 292  ALA B C   1 
ATOM   9630  O O   . ALA B  1 279  ? 206.678 194.569 175.641 1.00 158.14 ? 292  ALA B O   1 
ATOM   9631  C CB  . ALA B  1 279  ? 205.150 192.464 176.639 1.00 158.14 ? 292  ALA B CB  1 
ATOM   9632  N N   . LEU B  1 280  ? 208.230 193.170 174.850 1.00 152.62 ? 293  LEU B N   1 
ATOM   9633  C CA  . LEU B  1 280  ? 209.215 194.248 174.868 1.00 152.62 ? 293  LEU B CA  1 
ATOM   9634  C C   . LEU B  1 280  ? 209.055 195.181 173.677 1.00 152.62 ? 293  LEU B C   1 
ATOM   9635  O O   . LEU B  1 280  ? 208.878 196.390 173.853 1.00 152.62 ? 293  LEU B O   1 
ATOM   9636  C CB  . LEU B  1 280  ? 210.626 193.682 174.932 1.00 152.62 ? 293  LEU B CB  1 
ATOM   9637  C CG  . LEU B  1 280  ? 210.944 193.160 176.330 1.00 152.62 ? 293  LEU B CG  1 
ATOM   9638  C CD1 . LEU B  1 280  ? 212.429 193.112 176.543 1.00 152.62 ? 293  LEU B CD1 1 
ATOM   9639  C CD2 . LEU B  1 280  ? 210.294 194.035 177.388 1.00 152.62 ? 293  LEU B CD2 1 
ATOM   9640  N N   . ASP B  1 281  ? 209.094 194.647 172.461 1.00 148.86 ? 294  ASP B N   1 
ATOM   9641  C CA  . ASP B  1 281  ? 209.074 195.500 171.283 1.00 148.86 ? 294  ASP B CA  1 
ATOM   9642  C C   . ASP B  1 281  ? 207.912 195.162 170.368 1.00 148.86 ? 294  ASP B C   1 
ATOM   9643  O O   . ASP B  1 281  ? 207.592 193.990 170.174 1.00 148.86 ? 294  ASP B O   1 
ATOM   9644  C CB  . ASP B  1 281  ? 210.371 195.375 170.479 1.00 148.86 ? 294  ASP B CB  1 
ATOM   9645  C CG  . ASP B  1 281  ? 210.319 196.156 169.191 1.00 148.86 ? 294  ASP B CG  1 
ATOM   9646  O OD1 . ASP B  1 281  ? 209.690 195.668 168.226 1.00 148.86 ? 294  ASP B OD1 1 
ATOM   9647  O OD2 . ASP B  1 281  ? 210.887 197.267 169.151 1.00 148.86 ? 294  ASP B OD2 1 
ATOM   9648  N N   . PRO B  1 282  ? 207.316 196.169 169.728 1.00 146.61 ? 295  PRO B N   1 
ATOM   9649  C CA  . PRO B  1 282  ? 206.274 195.896 168.733 1.00 146.61 ? 295  PRO B CA  1 
ATOM   9650  C C   . PRO B  1 282  ? 206.670 194.895 167.652 1.00 146.61 ? 295  PRO B C   1 
ATOM   9651  O O   . PRO B  1 282  ? 205.891 194.686 166.717 1.00 146.61 ? 295  PRO B O   1 
ATOM   9652  C CB  . PRO B  1 282  ? 205.988 197.281 168.157 1.00 146.61 ? 295  PRO B CB  1 
ATOM   9653  C CG  . PRO B  1 282  ? 206.181 198.163 169.329 1.00 146.61 ? 295  PRO B CG  1 
ATOM   9654  C CD  . PRO B  1 282  ? 207.370 197.600 170.060 1.00 146.61 ? 295  PRO B CD  1 
ATOM   9655  N N   . LEU B  1 283  ? 207.845 194.284 167.728 1.00 146.39 ? 296  LEU B N   1 
ATOM   9656  C CA  . LEU B  1 283  ? 208.025 193.020 167.030 1.00 146.39 ? 296  LEU B CA  1 
ATOM   9657  C C   . LEU B  1 283  ? 207.786 191.838 167.961 1.00 146.39 ? 296  LEU B C   1 
ATOM   9658  O O   . LEU B  1 283  ? 207.386 190.756 167.511 1.00 146.39 ? 296  LEU B O   1 
ATOM   9659  C CB  . LEU B  1 283  ? 209.421 192.940 166.433 1.00 146.39 ? 296  LEU B CB  1 
ATOM   9660  C CG  . LEU B  1 283  ? 209.613 191.724 165.535 1.00 146.39 ? 296  LEU B CG  1 
ATOM   9661  C CD1 . LEU B  1 283  ? 208.426 191.596 164.609 1.00 146.39 ? 296  LEU B CD1 1 
ATOM   9662  C CD2 . LEU B  1 283  ? 210.894 191.844 164.742 1.00 146.39 ? 296  LEU B CD2 1 
ATOM   9663  N N   . SER B  1 284  ? 208.054 192.026 169.257 1.00 150.78 ? 297  SER B N   1 
ATOM   9664  C CA  . SER B  1 284  ? 208.000 190.915 170.200 1.00 150.78 ? 297  SER B CA  1 
ATOM   9665  C C   . SER B  1 284  ? 206.605 190.335 170.290 1.00 150.78 ? 297  SER B C   1 
ATOM   9666  O O   . SER B  1 284  ? 206.436 189.116 170.272 1.00 150.78 ? 297  SER B O   1 
ATOM   9667  C CB  . SER B  1 284  ? 208.445 191.373 171.579 1.00 150.78 ? 297  SER B CB  1 
ATOM   9668  O OG  . SER B  1 284  ? 207.389 192.075 172.203 1.00 150.78 ? 297  SER B OG  1 
ATOM   9669  N N   . GLU B  1 285  ? 205.592 191.190 170.402 1.00 152.14 ? 298  GLU B N   1 
ATOM   9670  C CA  . GLU B  1 285  ? 204.214 190.711 170.401 1.00 152.14 ? 298  GLU B CA  1 
ATOM   9671  C C   . GLU B  1 285  ? 203.876 190.019 169.090 1.00 152.14 ? 298  GLU B C   1 
ATOM   9672  O O   . GLU B  1 285  ? 203.193 188.989 169.075 1.00 152.14 ? 298  GLU B O   1 
ATOM   9673  C CB  . GLU B  1 285  ? 203.258 191.875 170.635 1.00 152.14 ? 298  GLU B CB  1 
ATOM   9674  C CG  . GLU B  1 285  ? 203.291 192.460 172.011 1.00 152.14 ? 298  GLU B CG  1 
ATOM   9675  C CD  . GLU B  1 285  ? 204.503 193.323 172.220 1.00 152.14 ? 298  GLU B CD  1 
ATOM   9676  O OE1 . GLU B  1 285  ? 205.378 193.337 171.335 1.00 152.14 ? 298  GLU B OE1 1 
ATOM   9677  O OE2 . GLU B  1 285  ? 204.561 194.032 173.241 1.00 152.14 ? 298  GLU B OE2 1 
ATOM   9678  N N   . THR B  1 286  ? 204.305 190.606 167.973 1.00 145.10 ? 299  THR B N   1 
ATOM   9679  C CA  . THR B  1 286  ? 204.062 189.999 166.671 1.00 145.10 ? 299  THR B CA  1 
ATOM   9680  C C   . THR B  1 286  ? 204.505 188.550 166.665 1.00 145.10 ? 299  THR B C   1 
ATOM   9681  O O   . THR B  1 286  ? 203.734 187.642 166.329 1.00 145.10 ? 299  THR B O   1 
ATOM   9682  C CB  . THR B  1 286  ? 204.819 190.771 165.610 1.00 145.10 ? 299  THR B CB  1 
ATOM   9683  O OG1 . THR B  1 286  ? 204.701 192.170 165.876 1.00 145.10 ? 299  THR B OG1 1 
ATOM   9684  C CG2 . THR B  1 286  ? 204.255 190.448 164.268 1.00 145.10 ? 299  THR B CG2 1 
ATOM   9685  N N   . LYS B  1 287  ? 205.751 188.325 167.060 1.00 143.53 ? 300  LYS B N   1 
ATOM   9686  C CA  . LYS B  1 287  ? 206.255 186.968 167.205 1.00 143.53 ? 300  LYS B CA  1 
ATOM   9687  C C   . LYS B  1 287  ? 205.408 186.180 168.189 1.00 143.53 ? 300  LYS B C   1 
ATOM   9688  O O   . LYS B  1 287  ? 204.912 185.095 167.871 1.00 143.53 ? 300  LYS B O   1 
ATOM   9689  C CB  . LYS B  1 287  ? 207.708 187.020 167.663 1.00 143.53 ? 300  LYS B CB  1 
ATOM   9690  C CG  . LYS B  1 287  ? 208.286 185.711 168.135 1.00 143.53 ? 300  LYS B CG  1 
ATOM   9691  C CD  . LYS B  1 287  ? 209.792 185.849 168.235 1.00 143.53 ? 300  LYS B CD  1 
ATOM   9692  C CE  . LYS B  1 287  ? 210.469 184.526 168.466 1.00 143.53 ? 300  LYS B CE  1 
ATOM   9693  N NZ  . LYS B  1 287  ? 210.314 184.049 169.856 1.00 143.53 ? 300  LYS B NZ  1 
ATOM   9694  N N   . CYS B  1 288  ? 205.200 186.738 169.382 1.00 149.37 ? 301  CYS B N   1 
ATOM   9695  C CA  . CYS B  1 288  ? 204.556 186.012 170.469 1.00 149.37 ? 301  CYS B CA  1 
ATOM   9696  C C   . CYS B  1 288  ? 203.180 185.526 170.078 1.00 149.37 ? 301  CYS B C   1 
ATOM   9697  O O   . CYS B  1 288  ? 202.678 184.549 170.640 1.00 149.37 ? 301  CYS B O   1 
ATOM   9698  C CB  . CYS B  1 288  ? 204.456 186.908 171.702 1.00 149.37 ? 301  CYS B CB  1 
ATOM   9699  S SG  . CYS B  1 288  ? 203.690 186.156 173.157 1.00 149.37 ? 301  CYS B SG  1 
ATOM   9700  N N   . THR B  1 289  ? 202.550 186.198 169.139 1.00 144.87 ? 302  THR B N   1 
ATOM   9701  C CA  . THR B  1 289  ? 201.195 185.820 168.805 1.00 144.87 ? 302  THR B CA  1 
ATOM   9702  C C   . THR B  1 289  ? 201.114 184.996 167.534 1.00 144.87 ? 302  THR B C   1 
ATOM   9703  O O   . THR B  1 289  ? 200.372 184.013 167.496 1.00 144.87 ? 302  THR B O   1 
ATOM   9704  C CB  . THR B  1 289  ? 200.348 187.068 168.692 1.00 144.87 ? 302  THR B CB  1 
ATOM   9705  O OG1 . THR B  1 289  ? 200.987 187.956 167.774 1.00 144.87 ? 302  THR B OG1 1 
ATOM   9706  C CG2 . THR B  1 289  ? 200.238 187.732 170.045 1.00 144.87 ? 302  THR B CG2 1 
ATOM   9707  N N   . LEU B  1 290  ? 201.858 185.352 166.490 1.00 134.70 ? 303  LEU B N   1 
ATOM   9708  C CA  . LEU B  1 290  ? 201.767 184.551 165.274 1.00 134.70 ? 303  LEU B CA  1 
ATOM   9709  C C   . LEU B  1 290  ? 202.483 183.215 165.391 1.00 134.70 ? 303  LEU B C   1 
ATOM   9710  O O   . LEU B  1 290  ? 202.514 182.464 164.413 1.00 134.70 ? 303  LEU B O   1 
ATOM   9711  C CB  . LEU B  1 290  ? 202.297 185.333 164.079 1.00 134.70 ? 303  LEU B CB  1 
ATOM   9712  C CG  . LEU B  1 290  ? 201.222 186.302 163.615 1.00 134.70 ? 303  LEU B CG  1 
ATOM   9713  C CD1 . LEU B  1 290  ? 201.742 187.188 162.524 1.00 134.70 ? 303  LEU B CD1 1 
ATOM   9714  C CD2 . LEU B  1 290  ? 200.020 185.515 163.156 1.00 134.70 ? 303  LEU B CD2 1 
ATOM   9715  N N   . LYS B  1 291  ? 203.058 182.914 166.553 1.00 136.68 ? 304  LYS B N   1 
ATOM   9716  C CA  . LYS B  1 291  ? 203.568 181.583 166.867 1.00 136.68 ? 304  LYS B CA  1 
ATOM   9717  C C   . LYS B  1 291  ? 204.584 181.126 165.832 1.00 136.68 ? 304  LYS B C   1 
ATOM   9718  O O   . LYS B  1 291  ? 204.436 180.081 165.204 1.00 136.68 ? 304  LYS B O   1 
ATOM   9719  C CB  . LYS B  1 291  ? 202.430 180.575 166.993 1.00 136.68 ? 304  LYS B CB  1 
ATOM   9720  C CG  . LYS B  1 291  ? 201.312 181.043 167.892 1.00 136.68 ? 304  LYS B CG  1 
ATOM   9721  C CD  . LYS B  1 291  ? 201.865 181.603 169.191 1.00 136.68 ? 304  LYS B CD  1 
ATOM   9722  C CE  . LYS B  1 291  ? 201.049 181.161 170.390 1.00 136.68 ? 304  LYS B CE  1 
ATOM   9723  N NZ  . LYS B  1 291  ? 201.796 181.334 171.673 1.00 136.68 ? 304  LYS B NZ  1 
ATOM   9724  N N   . SER B  1 292  ? 205.620 181.932 165.651 1.00 138.34 ? 305  SER B N   1 
ATOM   9725  C CA  . SER B  1 292  ? 206.684 181.604 164.719 1.00 138.34 ? 305  SER B CA  1 
ATOM   9726  C C   . SER B  1 292  ? 207.872 182.498 164.998 1.00 138.34 ? 305  SER B C   1 
ATOM   9727  O O   . SER B  1 292  ? 207.706 183.687 165.270 1.00 138.34 ? 305  SER B O   1 
ATOM   9728  C CB  . SER B  1 292  ? 206.247 181.788 163.268 1.00 138.34 ? 305  SER B CB  1 
ATOM   9729  O OG  . SER B  1 292  ? 207.381 181.811 162.422 1.00 138.34 ? 305  SER B OG  1 
ATOM   9730  N N   . PHE B  1 293  ? 209.055 181.940 164.885 1.00 140.72 ? 306  PHE B N   1 
ATOM   9731  C CA  . PHE B  1 293  ? 210.220 182.803 164.933 1.00 140.72 ? 306  PHE B CA  1 
ATOM   9732  C C   . PHE B  1 293  ? 210.380 183.573 163.708 1.00 140.72 ? 306  PHE B C   1 
ATOM   9733  O O   . PHE B  1 293  ? 211.415 184.172 163.438 1.00 140.72 ? 306  PHE B O   1 
ATOM   9734  C CB  . PHE B  1 293  ? 211.475 181.981 165.194 1.00 140.72 ? 306  PHE B CB  1 
ATOM   9735  C CG  . PHE B  1 293  ? 211.894 181.979 166.621 1.00 140.72 ? 306  PHE B CG  1 
ATOM   9736  C CD1 . PHE B  1 293  ? 211.180 181.263 167.559 1.00 140.72 ? 306  PHE B CD1 1 
ATOM   9737  C CD2 . PHE B  1 293  ? 212.994 182.700 167.032 1.00 140.72 ? 306  PHE B CD2 1 
ATOM   9738  C CE1 . PHE B  1 293  ? 211.559 181.262 168.875 1.00 140.72 ? 306  PHE B CE1 1 
ATOM   9739  C CE2 . PHE B  1 293  ? 213.375 182.701 168.349 1.00 140.72 ? 306  PHE B CE2 1 
ATOM   9740  C CZ  . PHE B  1 293  ? 212.658 181.982 169.269 1.00 140.72 ? 306  PHE B CZ  1 
ATOM   9741  N N   . THR B  1 294  ? 209.336 183.566 162.899 1.00 134.35 ? 307  THR B N   1 
ATOM   9742  C CA  . THR B  1 294  ? 209.374 184.190 161.599 1.00 134.35 ? 307  THR B CA  1 
ATOM   9743  C C   . THR B  1 294  ? 208.071 184.926 161.373 1.00 134.35 ? 307  THR B C   1 
ATOM   9744  O O   . THR B  1 294  ? 206.996 184.353 161.561 1.00 134.35 ? 307  THR B O   1 
ATOM   9745  C CB  . THR B  1 294  ? 209.577 183.144 160.513 1.00 134.35 ? 307  THR B CB  1 
ATOM   9746  O OG1 . THR B  1 294  ? 208.689 182.048 160.758 1.00 134.35 ? 307  THR B OG1 1 
ATOM   9747  C CG2 . THR B  1 294  ? 211.002 182.641 160.532 1.00 134.35 ? 307  THR B CG2 1 
ATOM   9748  N N   . VAL B  1 295  ? 208.180 186.178 160.915 1.00 128.48 ? 308  VAL B N   1 
ATOM   9749  C CA  . VAL B  1 295  ? 206.996 187.030 160.590 1.00 128.48 ? 308  VAL B CA  1 
ATOM   9750  C C   . VAL B  1 295  ? 206.930 187.173 159.064 1.00 128.48 ? 308  VAL B C   1 
ATOM   9751  O O   . VAL B  1 295  ? 207.872 187.750 158.486 1.00 128.48 ? 308  VAL B O   1 
ATOM   9752  C CB  . VAL B  1 295  ? 207.081 188.404 161.282 1.00 128.48 ? 308  VAL B CB  1 
ATOM   9753  C CG1 . VAL B  1 295  ? 208.377 189.126 160.945 1.00 128.48 ? 308  VAL B CG1 1 
ATOM   9754  C CG2 . VAL B  1 295  ? 205.879 189.276 160.953 1.00 128.48 ? 308  VAL B CG2 1 
ATOM   9755  N N   . GLU B  1 296  ? 205.859 186.665 158.444 1.00 126.93 ? 309  GLU B N   1 
ATOM   9756  C CA  . GLU B  1 296  ? 205.704 186.713 156.964 1.00 126.93 ? 309  GLU B CA  1 
ATOM   9757  C C   . GLU B  1 296  ? 205.086 188.049 156.531 1.00 126.93 ? 309  GLU B C   1 
ATOM   9758  O O   . GLU B  1 296  ? 204.739 188.859 157.413 1.00 126.93 ? 309  GLU B O   1 
ATOM   9759  C CB  . GLU B  1 296  ? 204.854 185.538 156.478 1.00 126.93 ? 309  GLU B CB  1 
ATOM   9760  C CG  . GLU B  1 296  ? 205.437 184.182 156.833 1.00 126.93 ? 309  GLU B CG  1 
ATOM   9761  C CD  . GLU B  1 296  ? 205.495 183.887 158.322 1.00 126.93 ? 309  GLU B CD  1 
ATOM   9762  O OE1 . GLU B  1 296  ? 204.910 184.666 159.101 1.00 126.93 ? 309  GLU B OE1 1 
ATOM   9763  O OE2 . GLU B  1 296  ? 206.124 182.878 158.699 1.00 126.93 ? 309  GLU B OE2 1 
ATOM   9764  N N   . LYS B  1 297  ? 204.962 188.252 155.214 1.00 125.67 ? 310  LYS B N   1 
ATOM   9765  C CA  . LYS B  1 297  ? 204.379 189.493 154.633 1.00 125.67 ? 310  LYS B CA  1 
ATOM   9766  C C   . LYS B  1 297  ? 202.875 189.526 154.926 1.00 125.67 ? 310  LYS B C   1 
ATOM   9767  O O   . LYS B  1 297  ? 202.217 188.480 154.757 1.00 125.67 ? 310  LYS B O   1 
ATOM   9768  C CB  . LYS B  1 297  ? 204.637 189.535 153.123 1.00 125.67 ? 310  LYS B CB  1 
ATOM   9769  C CG  . LYS B  1 297  ? 206.101 189.620 152.714 1.00 125.67 ? 310  LYS B CG  1 
ATOM   9770  C CD  . LYS B  1 297  ? 206.301 189.695 151.215 1.00 125.67 ? 310  LYS B CD  1 
ATOM   9771  C CE  . LYS B  1 297  ? 207.756 189.822 150.816 1.00 125.67 ? 310  LYS B CE  1 
ATOM   9772  N NZ  . LYS B  1 297  ? 208.374 191.048 151.376 1.00 125.67 ? 310  LYS B NZ  1 
ATOM   9773  N N   . GLY B  1 298  ? 202.356 190.696 155.312 1.00 118.55 ? 311  GLY B N   1 
ATOM   9774  C CA  . GLY B  1 298  ? 200.950 190.843 155.637 1.00 118.55 ? 311  GLY B CA  1 
ATOM   9775  C C   . GLY B  1 298  ? 200.741 191.922 156.678 1.00 118.55 ? 311  GLY B C   1 
ATOM   9776  O O   . GLY B  1 298  ? 201.516 192.861 156.799 1.00 118.55 ? 311  GLY B O   1 
ATOM   9777  N N   . ILE B  1 299  ? 199.639 191.783 157.407 1.00 114.86 ? 312  ILE B N   1 
ATOM   9778  C CA  . ILE B  1 299  ? 199.268 192.713 158.466 1.00 114.86 ? 312  ILE B CA  1 
ATOM   9779  C C   . ILE B  1 299  ? 198.534 191.958 159.560 1.00 114.86 ? 312  ILE B C   1 
ATOM   9780  O O   . ILE B  1 299  ? 197.556 191.261 159.283 1.00 114.86 ? 312  ILE B O   1 
ATOM   9781  C CB  . ILE B  1 299  ? 198.395 193.849 157.917 1.00 114.86 ? 312  ILE B CB  1 
ATOM   9782  C CG1 . ILE B  1 299  ? 197.631 194.498 159.061 1.00 114.86 ? 312  ILE B CG1 1 
ATOM   9783  C CG2 . ILE B  1 299  ? 197.473 193.317 156.855 1.00 114.86 ? 312  ILE B CG2 1 
ATOM   9784  C CD1 . ILE B  1 299  ? 196.890 195.728 158.666 1.00 114.86 ? 312  ILE B CD1 1 
ATOM   9785  N N   . TYR B  1 300  ? 198.995 192.091 160.800 1.00 114.46 ? 313  TYR B N   1 
ATOM   9786  C CA  . TYR B  1 300  ? 198.563 191.193 161.868 1.00 114.46 ? 313  TYR B CA  1 
ATOM   9787  C C   . TYR B  1 300  ? 198.138 192.034 163.045 1.00 114.46 ? 313  TYR B C   1 
ATOM   9788  O O   . TYR B  1 300  ? 198.986 192.496 163.805 1.00 114.46 ? 313  TYR B O   1 
ATOM   9789  C CB  . TYR B  1 300  ? 199.689 190.263 162.270 1.00 114.46 ? 313  TYR B CB  1 
ATOM   9790  C CG  . TYR B  1 300  ? 200.400 189.861 161.049 1.00 114.46 ? 313  TYR B CG  1 
ATOM   9791  C CD1 . TYR B  1 300  ? 199.719 189.256 160.025 1.00 114.46 ? 313  TYR B CD1 1 
ATOM   9792  C CD2 . TYR B  1 300  ? 201.716 190.191 160.854 1.00 114.46 ? 313  TYR B CD2 1 
ATOM   9793  C CE1 . TYR B  1 300  ? 200.333 188.934 158.867 1.00 114.46 ? 313  TYR B CE1 1 
ATOM   9794  C CE2 . TYR B  1 300  ? 202.351 189.858 159.697 1.00 114.46 ? 313  TYR B CE2 1 
ATOM   9795  C CZ  . TYR B  1 300  ? 201.646 189.230 158.706 1.00 114.46 ? 313  TYR B CZ  1 
ATOM   9796  O OH  . TYR B  1 300  ? 202.246 188.876 157.539 1.00 114.46 ? 313  TYR B OH  1 
ATOM   9797  N N   . GLN B  1 301  ? 196.844 192.224 163.202 1.00 110.59 ? 314  GLN B N   1 
ATOM   9798  C CA  . GLN B  1 301  ? 196.363 193.020 164.320 1.00 110.59 ? 314  GLN B CA  1 
ATOM   9799  C C   . GLN B  1 301  ? 196.693 192.263 165.595 1.00 110.59 ? 314  GLN B C   1 
ATOM   9800  O O   . GLN B  1 301  ? 196.250 191.135 165.798 1.00 110.59 ? 314  GLN B O   1 
ATOM   9801  C CB  . GLN B  1 301  ? 194.872 193.301 164.186 1.00 110.59 ? 314  GLN B CB  1 
ATOM   9802  C CG  . GLN B  1 301  ? 194.009 192.087 164.011 1.00 110.59 ? 314  GLN B CG  1 
ATOM   9803  C CD  . GLN B  1 301  ? 194.101 191.504 162.637 1.00 110.59 ? 314  GLN B CD  1 
ATOM   9804  O OE1 . GLN B  1 301  ? 195.067 191.739 161.915 1.00 110.59 ? 314  GLN B OE1 1 
ATOM   9805  N NE2 . GLN B  1 301  ? 193.103 190.722 162.265 1.00 110.59 ? 314  GLN B NE2 1 
ATOM   9806  N N   . THR B  1 302  ? 197.539 192.854 166.431 1.00 111.25 ? 315  THR B N   1 
ATOM   9807  C CA  . THR B  1 302  ? 197.833 192.238 167.713 1.00 111.25 ? 315  THR B CA  1 
ATOM   9808  C C   . THR B  1 302  ? 196.892 192.730 168.791 1.00 111.25 ? 315  THR B C   1 
ATOM   9809  O O   . THR B  1 302  ? 196.180 191.938 169.409 1.00 111.25 ? 315  THR B O   1 
ATOM   9810  C CB  . THR B  1 302  ? 199.273 192.512 168.119 1.00 111.25 ? 315  THR B CB  1 
ATOM   9811  O OG1 . THR B  1 302  ? 199.420 192.262 169.520 1.00 111.25 ? 315  THR B OG1 1 
ATOM   9812  C CG2 . THR B  1 302  ? 199.667 193.936 167.796 1.00 111.25 ? 315  THR B CG2 1 
ATOM   9813  N N   . SER B  1 303  ? 196.852 194.035 169.013 1.00 106.35 ? 316  SER B N   1 
ATOM   9814  C CA  . SER B  1 303  ? 196.161 194.528 170.182 1.00 106.35 ? 316  SER B CA  1 
ATOM   9815  C C   . SER B  1 303  ? 195.699 195.950 169.927 1.00 106.35 ? 316  SER B C   1 
ATOM   9816  O O   . SER B  1 303  ? 195.740 196.440 168.795 1.00 106.35 ? 316  SER B O   1 
ATOM   9817  C CB  . SER B  1 303  ? 197.066 194.459 171.418 1.00 106.35 ? 316  SER B CB  1 
ATOM   9818  O OG  . SER B  1 303  ? 196.508 195.233 172.466 1.00 106.35 ? 316  SER B OG  1 
ATOM   9819  N N   . ASN B  1 304  ? 195.243 196.600 170.986 1.00 106.10 ? 317  ASN B N   1 
ATOM   9820  C CA  . ASN B  1 304  ? 194.842 197.991 170.945 1.00 106.10 ? 317  ASN B CA  1 
ATOM   9821  C C   . ASN B  1 304  ? 195.654 198.645 172.052 1.00 106.10 ? 317  ASN B C   1 
ATOM   9822  O O   . ASN B  1 304  ? 196.678 198.117 172.500 1.00 106.10 ? 317  ASN B O   1 
ATOM   9823  C CB  . ASN B  1 304  ? 193.336 198.136 171.133 1.00 106.10 ? 317  ASN B CB  1 
ATOM   9824  C CG  . ASN B  1 304  ? 192.555 197.475 170.036 1.00 106.10 ? 317  ASN B CG  1 
ATOM   9825  O OD1 . ASN B  1 304  ? 192.911 196.395 169.575 1.00 106.10 ? 317  ASN B OD1 1 
ATOM   9826  N ND2 . ASN B  1 304  ? 191.474 198.110 169.613 1.00 106.10 ? 317  ASN B ND2 1 
ATOM   9827  N N   . PHE B  1 305  ? 195.211 199.804 172.505 1.00 103.42 ? 318  PHE B N   1 
ATOM   9828  C CA  . PHE B  1 305  ? 195.914 200.490 173.572 1.00 103.42 ? 318  PHE B CA  1 
ATOM   9829  C C   . PHE B  1 305  ? 194.925 201.131 174.528 1.00 103.42 ? 318  PHE B C   1 
ATOM   9830  O O   . PHE B  1 305  ? 193.929 201.721 174.101 1.00 103.42 ? 318  PHE B O   1 
ATOM   9831  C CB  . PHE B  1 305  ? 196.831 201.538 172.993 1.00 103.42 ? 318  PHE B CB  1 
ATOM   9832  C CG  . PHE B  1 305  ? 196.156 202.402 172.024 1.00 103.42 ? 318  PHE B CG  1 
ATOM   9833  C CD1 . PHE B  1 305  ? 196.041 202.012 170.714 1.00 103.42 ? 318  PHE B CD1 1 
ATOM   9834  C CD2 . PHE B  1 305  ? 195.588 203.583 172.426 1.00 103.42 ? 318  PHE B CD2 1 
ATOM   9835  C CE1 . PHE B  1 305  ? 195.399 202.798 169.815 1.00 103.42 ? 318  PHE B CE1 1 
ATOM   9836  C CE2 . PHE B  1 305  ? 194.944 204.375 171.536 1.00 103.42 ? 318  PHE B CE2 1 
ATOM   9837  C CZ  . PHE B  1 305  ? 194.847 203.985 170.222 1.00 103.42 ? 318  PHE B CZ  1 
ATOM   9838  N N   . ARG B  1 306  ? 195.214 201.014 175.820 1.00 95.48  ? 319  ARG B N   1 
ATOM   9839  C CA  . ARG B  1 306  ? 194.449 201.662 176.873 1.00 95.48  ? 319  ARG B CA  1 
ATOM   9840  C C   . ARG B  1 306  ? 195.309 202.751 177.488 1.00 95.48  ? 319  ARG B C   1 
ATOM   9841  O O   . ARG B  1 306  ? 196.348 202.462 178.086 1.00 95.48  ? 319  ARG B O   1 
ATOM   9842  C CB  . ARG B  1 306  ? 194.021 200.656 177.933 1.00 95.48  ? 319  ARG B CB  1 
ATOM   9843  C CG  . ARG B  1 306  ? 194.946 199.470 178.065 1.00 95.48  ? 319  ARG B CG  1 
ATOM   9844  C CD  . ARG B  1 306  ? 194.197 198.310 178.700 1.00 95.48  ? 319  ARG B CD  1 
ATOM   9845  N NE  . ARG B  1 306  ? 194.997 197.096 178.854 1.00 95.48  ? 319  ARG B NE  1 
ATOM   9846  C CZ  . ARG B  1 306  ? 194.543 195.965 179.392 1.00 95.48  ? 319  ARG B CZ  1 
ATOM   9847  N NH1 . ARG B  1 306  ? 195.340 194.910 179.494 1.00 95.48  ? 319  ARG B NH1 1 
ATOM   9848  N NH2 . ARG B  1 306  ? 193.294 195.889 179.831 1.00 95.48  ? 319  ARG B NH2 1 
ATOM   9849  N N   . VAL B  1 307  ? 194.877 203.996 177.337 1.00 86.15  ? 320  VAL B N   1 
ATOM   9850  C CA  . VAL B  1 307  ? 195.651 205.114 177.841 1.00 86.15  ? 320  VAL B CA  1 
ATOM   9851  C C   . VAL B  1 307  ? 195.708 205.026 179.354 1.00 86.15  ? 320  VAL B C   1 
ATOM   9852  O O   . VAL B  1 307  ? 194.694 204.757 180.006 1.00 86.15  ? 320  VAL B O   1 
ATOM   9853  C CB  . VAL B  1 307  ? 195.019 206.437 177.401 1.00 86.15  ? 320  VAL B CB  1 
ATOM   9854  C CG1 . VAL B  1 307  ? 195.876 207.590 177.849 1.00 86.15  ? 320  VAL B CG1 1 
ATOM   9855  C CG2 . VAL B  1 307  ? 194.803 206.447 175.911 1.00 86.15  ? 320  VAL B CG2 1 
ATOM   9856  N N   . GLN B  1 308  ? 196.890 205.229 179.916 1.00 93.79  ? 321  GLN B N   1 
ATOM   9857  C CA  . GLN B  1 308  ? 197.010 205.331 181.368 1.00 93.79  ? 321  GLN B CA  1 
ATOM   9858  C C   . GLN B  1 308  ? 196.461 206.678 181.810 1.00 93.79  ? 321  GLN B C   1 
ATOM   9859  O O   . GLN B  1 308  ? 197.089 207.709 181.542 1.00 93.79  ? 321  GLN B O   1 
ATOM   9860  C CB  . GLN B  1 308  ? 198.462 205.200 181.831 1.00 93.79  ? 321  GLN B CB  1 
ATOM   9861  C CG  . GLN B  1 308  ? 199.081 203.816 181.719 1.00 93.79  ? 321  GLN B CG  1 
ATOM   9862  C CD  . GLN B  1 308  ? 198.665 202.882 182.826 1.00 93.79  ? 321  GLN B CD  1 
ATOM   9863  O OE1 . GLN B  1 308  ? 197.700 203.138 183.538 1.00 93.79  ? 321  GLN B OE1 1 
ATOM   9864  N NE2 . GLN B  1 308  ? 199.394 201.786 182.978 1.00 93.79  ? 321  GLN B NE2 1 
ATOM   9865  N N   . PRO B  1 309  ? 195.340 206.726 182.476 1.00 108.51 ? 322  PRO B N   1 
ATOM   9866  C CA  . PRO B  1 309  ? 194.826 208.010 182.958 1.00 108.51 ? 322  PRO B CA  1 
ATOM   9867  C C   . PRO B  1 309  ? 195.708 208.588 184.055 1.00 108.51 ? 322  PRO B C   1 
ATOM   9868  O O   . PRO B  1 309  ? 196.682 207.945 184.450 1.00 108.51 ? 322  PRO B O   1 
ATOM   9869  C CB  . PRO B  1 309  ? 193.434 207.643 183.465 1.00 108.51 ? 322  PRO B CB  1 
ATOM   9870  C CG  . PRO B  1 309  ? 193.530 206.218 183.805 1.00 108.51 ? 322  PRO B CG  1 
ATOM   9871  C CD  . PRO B  1 309  ? 194.470 205.604 182.843 1.00 108.51 ? 322  PRO B CD  1 
ATOM   9872  N N   . THR B  1 310  ? 195.396 209.783 184.564 1.00 132.32 ? 323  THR B N   1 
ATOM   9873  C CA  . THR B  1 310  ? 196.280 210.496 185.487 1.00 132.32 ? 323  THR B CA  1 
ATOM   9874  C C   . THR B  1 310  ? 195.534 210.891 186.758 1.00 132.32 ? 323  THR B C   1 
ATOM   9875  O O   . THR B  1 310  ? 194.608 211.706 186.700 1.00 132.32 ? 323  THR B O   1 
ATOM   9876  C CB  . THR B  1 310  ? 196.859 211.747 184.827 1.00 132.32 ? 323  THR B CB  1 
ATOM   9877  O OG1 . THR B  1 310  ? 195.911 212.814 184.922 1.00 132.32 ? 323  THR B OG1 1 
ATOM   9878  C CG2 . THR B  1 310  ? 197.143 211.491 183.368 1.00 132.32 ? 323  THR B CG2 1 
ATOM   9879  N N   . GLU B  1 311  ? 195.946 210.330 187.903 1.00 128.15 ? 324  GLU B N   1 
ATOM   9880  C CA  . GLU B  1 311  ? 195.588 210.828 189.240 1.00 128.15 ? 324  GLU B CA  1 
ATOM   9881  C C   . GLU B  1 311  ? 194.072 210.893 189.435 1.00 128.15 ? 324  GLU B C   1 
ATOM   9882  O O   . GLU B  1 311  ? 193.463 211.961 189.471 1.00 128.15 ? 324  GLU B O   1 
ATOM   9883  C CB  . GLU B  1 311  ? 196.218 212.195 189.528 1.00 128.15 ? 324  GLU B CB  1 
ATOM   9884  C CG  . GLU B  1 311  ? 196.122 212.590 191.000 1.00 128.15 ? 324  GLU B CG  1 
ATOM   9885  C CD  . GLU B  1 311  ? 197.137 213.638 191.419 1.00 128.15 ? 324  GLU B CD  1 
ATOM   9886  O OE1 . GLU B  1 311  ? 196.743 214.812 191.577 1.00 128.15 ? 324  GLU B OE1 1 
ATOM   9887  O OE2 . GLU B  1 311  ? 198.321 213.288 191.610 1.00 128.15 ? 324  GLU B OE2 1 
ATOM   9888  N N   . SER B  1 312  ? 193.484 209.707 189.529 1.00 131.27 ? 325  SER B N   1 
ATOM   9889  C CA  . SER B  1 312  ? 192.045 209.570 189.687 1.00 131.27 ? 325  SER B CA  1 
ATOM   9890  C C   . SER B  1 312  ? 191.492 210.561 190.706 1.00 131.27 ? 325  SER B C   1 
ATOM   9891  O O   . SER B  1 312  ? 192.186 210.987 191.631 1.00 131.27 ? 325  SER B O   1 
ATOM   9892  C CB  . SER B  1 312  ? 191.713 208.150 190.123 1.00 131.27 ? 325  SER B CB  1 
ATOM   9893  O OG  . SER B  1 312  ? 190.315 207.955 190.162 1.00 131.27 ? 325  SER B OG  1 
ATOM   9894  N N   . ILE B  1 313  ? 190.225 210.924 190.530 1.00 135.63 ? 326  ILE B N   1 
ATOM   9895  C CA  . ILE B  1 313  ? 189.589 211.975 191.310 1.00 135.63 ? 326  ILE B CA  1 
ATOM   9896  C C   . ILE B  1 313  ? 188.573 211.382 192.281 1.00 135.63 ? 326  ILE B C   1 
ATOM   9897  O O   . ILE B  1 313  ? 188.114 210.248 192.127 1.00 135.63 ? 326  ILE B O   1 
ATOM   9898  C CB  . ILE B  1 313  ? 188.923 212.998 190.378 1.00 135.63 ? 326  ILE B CB  1 
ATOM   9899  C CG1 . ILE B  1 313  ? 187.942 212.283 189.466 1.00 135.63 ? 326  ILE B CG1 1 
ATOM   9900  C CG2 . ILE B  1 313  ? 189.961 213.696 189.545 1.00 135.63 ? 326  ILE B CG2 1 
ATOM   9901  C CD1 . ILE B  1 313  ? 187.426 213.148 188.372 1.00 135.63 ? 326  ILE B CD1 1 
ATOM   9902  N N   . VAL B  1 314  ? 188.200 212.172 193.293 1.00 132.91 ? 327  VAL B N   1 
ATOM   9903  C CA  . VAL B  1 314  ? 187.225 211.773 194.306 1.00 132.91 ? 327  VAL B CA  1 
ATOM   9904  C C   . VAL B  1 314  ? 186.377 212.976 194.687 1.00 132.91 ? 327  VAL B C   1 
ATOM   9905  O O   . VAL B  1 314  ? 186.914 214.018 195.070 1.00 132.91 ? 327  VAL B O   1 
ATOM   9906  C CB  . VAL B  1 314  ? 187.907 211.208 195.560 1.00 132.91 ? 327  VAL B CB  1 
ATOM   9907  C CG1 . VAL B  1 314  ? 186.932 211.197 196.692 1.00 132.91 ? 327  VAL B CG1 1 
ATOM   9908  C CG2 . VAL B  1 314  ? 188.410 209.818 195.293 1.00 132.91 ? 327  VAL B CG2 1 
ATOM   9909  N N   . ARG B  1 315  ? 185.056 212.827 194.621 1.00 135.64 ? 328  ARG B N   1 
ATOM   9910  C CA  . ARG B  1 315  ? 184.141 213.931 194.900 1.00 135.64 ? 328  ARG B CA  1 
ATOM   9911  C C   . ARG B  1 315  ? 182.911 213.418 195.633 1.00 135.64 ? 328  ARG B C   1 
ATOM   9912  O O   . ARG B  1 315  ? 182.079 212.725 195.043 1.00 135.64 ? 328  ARG B O   1 
ATOM   9913  C CB  . ARG B  1 315  ? 183.733 214.640 193.615 1.00 135.64 ? 328  ARG B CB  1 
ATOM   9914  C CG  . ARG B  1 315  ? 184.664 215.749 193.236 1.00 135.64 ? 328  ARG B CG  1 
ATOM   9915  C CD  . ARG B  1 315  ? 184.425 216.981 194.093 1.00 135.64 ? 328  ARG B CD  1 
ATOM   9916  N NE  . ARG B  1 315  ? 183.113 217.581 193.862 1.00 135.64 ? 328  ARG B NE  1 
ATOM   9917  C CZ  . ARG B  1 315  ? 182.793 218.828 194.198 1.00 135.64 ? 328  ARG B CZ  1 
ATOM   9918  N NH1 . ARG B  1 315  ? 183.690 219.607 194.784 1.00 135.64 ? 328  ARG B NH1 1 
ATOM   9919  N NH2 . ARG B  1 315  ? 181.578 219.299 193.961 1.00 135.64 ? 328  ARG B NH2 1 
ATOM   9920  N N   . PHE B  1 316  ? 182.789 213.777 196.903 1.00 139.69 ? 329  PHE B N   1 
ATOM   9921  C CA  . PHE B  1 316  ? 181.658 213.458 197.757 1.00 139.69 ? 329  PHE B CA  1 
ATOM   9922  C C   . PHE B  1 316  ? 181.166 214.748 198.392 1.00 139.69 ? 329  PHE B C   1 
ATOM   9923  O O   . PHE B  1 316  ? 181.902 215.736 198.443 1.00 139.69 ? 329  PHE B O   1 
ATOM   9924  C CB  . PHE B  1 316  ? 182.061 212.455 198.845 1.00 139.69 ? 329  PHE B CB  1 
ATOM   9925  C CG  . PHE B  1 316  ? 182.808 211.276 198.325 1.00 139.69 ? 329  PHE B CG  1 
ATOM   9926  C CD1 . PHE B  1 316  ? 182.444 210.673 197.142 1.00 139.69 ? 329  PHE B CD1 1 
ATOM   9927  C CD2 . PHE B  1 316  ? 183.884 210.771 199.022 1.00 139.69 ? 329  PHE B CD2 1 
ATOM   9928  C CE1 . PHE B  1 316  ? 183.144 209.596 196.659 1.00 139.69 ? 329  PHE B CE1 1 
ATOM   9929  C CE2 . PHE B  1 316  ? 184.581 209.687 198.552 1.00 139.69 ? 329  PHE B CE2 1 
ATOM   9930  C CZ  . PHE B  1 316  ? 184.214 209.100 197.368 1.00 139.69 ? 329  PHE B CZ  1 
ATOM   9931  N N   . PRO B  1 317  ? 179.941 214.768 198.913 1.00 145.24 ? 330  PRO B N   1 
ATOM   9932  C CA  . PRO B  1 317  ? 179.379 216.017 199.459 1.00 145.24 ? 330  PRO B CA  1 
ATOM   9933  C C   . PRO B  1 317  ? 180.080 216.563 200.696 1.00 145.24 ? 330  PRO B C   1 
ATOM   9934  O O   . PRO B  1 317  ? 181.166 216.110 201.065 1.00 145.24 ? 330  PRO B O   1 
ATOM   9935  C CB  . PRO B  1 317  ? 177.934 215.638 199.797 1.00 145.24 ? 330  PRO B CB  1 
ATOM   9936  C CG  . PRO B  1 317  ? 177.676 214.385 199.065 1.00 145.24 ? 330  PRO B CG  1 
ATOM   9937  C CD  . PRO B  1 317  ? 178.965 213.672 198.932 1.00 145.24 ? 330  PRO B CD  1 
ATOM   9938  N N   . ASN B  1 318  ? 179.464 217.564 201.330 1.00 153.78 ? 331  ASN B N   1 
ATOM   9939  C CA  . ASN B  1 318  ? 180.093 218.324 202.405 1.00 153.78 ? 331  ASN B CA  1 
ATOM   9940  C C   . ASN B  1 318  ? 179.628 217.951 203.810 1.00 153.78 ? 331  ASN B C   1 
ATOM   9941  O O   . ASN B  1 318  ? 180.363 218.206 204.770 1.00 153.78 ? 331  ASN B O   1 
ATOM   9942  C CB  . ASN B  1 318  ? 179.844 219.816 202.197 1.00 153.78 ? 331  ASN B CB  1 
ATOM   9943  C CG  . ASN B  1 318  ? 180.933 220.480 201.393 1.00 153.78 ? 331  ASN B CG  1 
ATOM   9944  O OD1 . ASN B  1 318  ? 181.886 219.835 200.957 1.00 153.78 ? 331  ASN B OD1 1 
ATOM   9945  N ND2 . ASN B  1 318  ? 180.800 221.786 201.201 1.00 153.78 ? 331  ASN B ND2 1 
ATOM   9946  N N   . ILE B  1 319  ? 178.431 217.385 203.967 1.00 150.55 ? 332  ILE B N   1 
ATOM   9947  C CA  . ILE B  1 319  ? 177.925 217.101 205.305 1.00 150.55 ? 332  ILE B CA  1 
ATOM   9948  C C   . ILE B  1 319  ? 178.778 216.023 205.954 1.00 150.55 ? 332  ILE B C   1 
ATOM   9949  O O   . ILE B  1 319  ? 179.261 215.103 205.284 1.00 150.55 ? 332  ILE B O   1 
ATOM   9950  C CB  . ILE B  1 319  ? 176.449 216.687 205.243 1.00 150.55 ? 332  ILE B CB  1 
ATOM   9951  N N   . THR B  1 320  ? 178.978 216.137 207.271 1.00 160.98 ? 333  THR B N   1 
ATOM   9952  C CA  . THR B  1 320  ? 179.850 215.217 208.014 1.00 160.98 ? 333  THR B CA  1 
ATOM   9953  C C   . THR B  1 320  ? 179.240 214.931 209.386 1.00 160.98 ? 333  THR B C   1 
ATOM   9954  O O   . THR B  1 320  ? 179.515 215.638 210.357 1.00 160.98 ? 333  THR B O   1 
ATOM   9955  C CB  . THR B  1 320  ? 181.253 215.791 208.146 1.00 160.98 ? 333  THR B CB  1 
ATOM   9956  N N   . ASN B  1 321  ? 178.453 213.864 209.465 1.00 153.55 ? 334  ASN B N   1 
ATOM   9957  C CA  . ASN B  1 321  ? 177.801 213.478 210.705 1.00 153.55 ? 334  ASN B CA  1 
ATOM   9958  C C   . ASN B  1 321  ? 177.351 212.035 210.580 1.00 153.55 ? 334  ASN B C   1 
ATOM   9959  O O   . ASN B  1 321  ? 177.131 211.535 209.476 1.00 153.55 ? 334  ASN B O   1 
ATOM   9960  C CB  . ASN B  1 321  ? 176.611 214.384 211.015 1.00 153.55 ? 334  ASN B CB  1 
ATOM   9961  C CG  . ASN B  1 321  ? 177.007 215.588 211.816 1.00 153.55 ? 334  ASN B CG  1 
ATOM   9962  O OD1 . ASN B  1 321  ? 177.995 215.559 212.540 1.00 153.55 ? 334  ASN B OD1 1 
ATOM   9963  N ND2 . ASN B  1 321  ? 176.255 216.666 211.677 1.00 153.55 ? 334  ASN B ND2 1 
ATOM   9964  N N   . LEU B  1 322  ? 177.232 211.370 211.713 1.00 151.30 ? 335  LEU B N   1 
ATOM   9965  C CA  . LEU B  1 322  ? 176.931 209.952 211.716 1.00 151.30 ? 335  LEU B CA  1 
ATOM   9966  C C   . LEU B  1 322  ? 175.466 209.705 212.058 1.00 151.30 ? 335  LEU B C   1 
ATOM   9967  O O   . LEU B  1 322  ? 174.644 210.620 212.119 1.00 151.30 ? 335  LEU B O   1 
ATOM   9968  C CB  . LEU B  1 322  ? 177.846 209.231 212.697 1.00 151.30 ? 335  LEU B CB  1 
ATOM   9969  N N   . CYS B  1 323  ? 175.141 208.426 212.270 1.00 152.45 ? 336  CYS B N   1 
ATOM   9970  C CA  . CYS B  1 323  ? 173.753 208.008 212.604 1.00 152.45 ? 336  CYS B CA  1 
ATOM   9971  C C   . CYS B  1 323  ? 173.612 207.858 214.123 1.00 152.45 ? 336  CYS B C   1 
ATOM   9972  O O   . CYS B  1 323  ? 174.641 207.930 214.822 1.00 152.45 ? 336  CYS B O   1 
ATOM   9973  C CB  . CYS B  1 323  ? 173.407 206.688 211.926 1.00 152.45 ? 336  CYS B CB  1 
ATOM   9974  S SG  . CYS B  1 323  ? 174.863 205.715 211.459 1.00 152.45 ? 336  CYS B SG  1 
ATOM   9975  N N   . PRO B  1 324  ? 172.389 207.647 214.659 1.00 152.96 ? 337  PRO B N   1 
ATOM   9976  C CA  . PRO B  1 324  ? 172.189 207.499 216.103 1.00 152.96 ? 337  PRO B CA  1 
ATOM   9977  C C   . PRO B  1 324  ? 172.762 206.170 216.616 1.00 152.96 ? 337  PRO B C   1 
ATOM   9978  O O   . PRO B  1 324  ? 172.683 205.184 215.904 1.00 152.96 ? 337  PRO B O   1 
ATOM   9979  C CB  . PRO B  1 324  ? 170.661 207.510 216.255 1.00 152.96 ? 337  PRO B CB  1 
ATOM   9980  C CG  . PRO B  1 324  ? 170.157 206.992 214.926 1.00 152.96 ? 337  PRO B CG  1 
ATOM   9981  C CD  . PRO B  1 324  ? 171.138 207.532 213.905 1.00 152.96 ? 337  PRO B CD  1 
ATOM   9982  N N   . PHE B  1 325  ? 173.320 206.183 217.830 1.00 154.38 ? 338  PHE B N   1 
ATOM   9983  C CA  . PHE B  1 325  ? 173.911 204.963 218.439 1.00 154.38 ? 338  PHE B CA  1 
ATOM   9984  C C   . PHE B  1 325  ? 173.645 204.967 219.949 1.00 154.38 ? 338  PHE B C   1 
ATOM   9985  O O   . PHE B  1 325  ? 174.373 204.276 220.688 1.00 154.38 ? 338  PHE B O   1 
ATOM   9986  C CB  . PHE B  1 325  ? 175.411 204.888 218.140 1.00 154.38 ? 338  PHE B CB  1 
ATOM   9987  C CG  . PHE B  1 325  ? 175.752 204.556 216.710 1.00 154.38 ? 338  PHE B CG  1 
ATOM   9988  C CD1 . PHE B  1 325  ? 175.341 203.362 216.141 1.00 154.38 ? 338  PHE B CD1 1 
ATOM   9989  C CD2 . PHE B  1 325  ? 176.483 205.439 215.931 1.00 154.38 ? 338  PHE B CD2 1 
ATOM   9990  C CE1 . PHE B  1 325  ? 175.654 203.057 214.826 1.00 154.38 ? 338  PHE B CE1 1 
ATOM   9991  C CE2 . PHE B  1 325  ? 176.796 205.133 214.616 1.00 154.38 ? 338  PHE B CE2 1 
ATOM   9992  C CZ  . PHE B  1 325  ? 176.381 203.942 214.066 1.00 154.38 ? 338  PHE B CZ  1 
ATOM   9993  N N   . GLY B  1 326  ? 172.633 205.727 220.380 1.00 155.25 ? 339  GLY B N   1 
ATOM   9994  C CA  . GLY B  1 326  ? 172.271 205.820 221.808 1.00 155.25 ? 339  GLY B CA  1 
ATOM   9995  C C   . GLY B  1 326  ? 172.153 204.447 222.447 1.00 155.25 ? 339  GLY B C   1 
ATOM   9996  O O   . GLY B  1 326  ? 172.904 204.175 223.404 1.00 155.25 ? 339  GLY B O   1 
ATOM   9997  N N   . GLU B  1 327  ? 171.247 203.611 221.930 1.00 151.35 ? 340  GLU B N   1 
ATOM   9998  C CA  . GLU B  1 327  ? 171.047 202.237 222.465 1.00 151.35 ? 340  GLU B CA  1 
ATOM   9999  C C   . GLU B  1 327  ? 171.766 201.237 221.553 1.00 151.35 ? 340  GLU B C   1 
ATOM   10000 O O   . GLU B  1 327  ? 171.265 200.105 221.406 1.00 151.35 ? 340  GLU B O   1 
ATOM   10001 C CB  . GLU B  1 327  ? 169.554 201.916 222.560 1.00 151.35 ? 340  GLU B CB  1 
ATOM   10002 N N   . VAL B  1 328  ? 172.896 201.649 220.970 1.00 150.90 ? 341  VAL B N   1 
ATOM   10003 C CA  . VAL B  1 328  ? 173.683 200.769 220.053 1.00 150.90 ? 341  VAL B CA  1 
ATOM   10004 C C   . VAL B  1 328  ? 175.050 200.482 220.685 1.00 150.90 ? 341  VAL B C   1 
ATOM   10005 O O   . VAL B  1 328  ? 175.243 199.357 221.186 1.00 150.90 ? 341  VAL B O   1 
ATOM   10006 C CB  . VAL B  1 328  ? 173.831 201.400 218.655 1.00 150.90 ? 341  VAL B CB  1 
ATOM   10007 C CG1 . VAL B  1 328  ? 174.495 200.447 217.673 1.00 150.90 ? 341  VAL B CG1 1 
ATOM   10008 C CG2 . VAL B  1 328  ? 172.497 201.888 218.110 1.00 150.90 ? 341  VAL B CG2 1 
ATOM   10009 N N   . PHE B  1 329  ? 175.954 201.467 220.659 1.00 160.44 ? 342  PHE B N   1 
ATOM   10010 C CA  . PHE B  1 329  ? 177.318 201.298 221.230 1.00 160.44 ? 342  PHE B CA  1 
ATOM   10011 C C   . PHE B  1 329  ? 177.635 202.463 222.174 1.00 160.44 ? 342  PHE B C   1 
ATOM   10012 O O   . PHE B  1 329  ? 176.933 203.491 222.124 1.00 160.44 ? 342  PHE B O   1 
ATOM   10013 C CB  . PHE B  1 329  ? 178.355 201.199 220.108 1.00 160.44 ? 342  PHE B CB  1 
ATOM   10014 C CG  . PHE B  1 329  ? 179.625 200.479 220.484 1.00 160.44 ? 342  PHE B CG  1 
ATOM   10015 C CD1 . PHE B  1 329  ? 179.644 199.570 221.529 1.00 160.44 ? 342  PHE B CD1 1 
ATOM   10016 C CD2 . PHE B  1 329  ? 180.803 200.711 219.792 1.00 160.44 ? 342  PHE B CD2 1 
ATOM   10017 C CE1 . PHE B  1 329  ? 180.812 198.909 221.874 1.00 160.44 ? 342  PHE B CE1 1 
ATOM   10018 C CE2 . PHE B  1 329  ? 181.971 200.049 220.138 1.00 160.44 ? 342  PHE B CE2 1 
ATOM   10019 C CZ  . PHE B  1 329  ? 181.974 199.149 221.178 1.00 160.44 ? 342  PHE B CZ  1 
ATOM   10020 N N   . ASN B  1 330  ? 178.670 202.297 223.004 1.00 165.19 ? 343  ASN B N   1 
ATOM   10021 C CA  . ASN B  1 330  ? 179.087 203.349 223.971 1.00 165.19 ? 343  ASN B CA  1 
ATOM   10022 C C   . ASN B  1 330  ? 177.870 203.798 224.787 1.00 165.19 ? 343  ASN B C   1 
ATOM   10023 O O   . ASN B  1 330  ? 178.093 204.421 225.844 1.00 165.19 ? 343  ASN B O   1 
ATOM   10024 C CB  . ASN B  1 330  ? 179.761 204.530 223.267 1.00 165.19 ? 343  ASN B CB  1 
ATOM   10025 C CG  . ASN B  1 330  ? 180.611 204.108 222.088 1.00 165.19 ? 343  ASN B CG  1 
ATOM   10026 O OD1 . ASN B  1 330  ? 180.138 204.080 220.954 1.00 165.19 ? 343  ASN B OD1 1 
ATOM   10027 N ND2 . ASN B  1 330  ? 181.866 203.777 222.344 1.00 165.19 ? 343  ASN B ND2 1 
ATOM   10028 N N   . ARG B  1 342  ? 160.348 199.173 217.805 1.00 162.20 ? 355  ARG B N   1 
ATOM   10029 C CA  . ARG B  1 342  ? 161.121 199.007 216.581 1.00 162.20 ? 355  ARG B CA  1 
ATOM   10030 C C   . ARG B  1 342  ? 161.141 200.316 215.809 1.00 162.20 ? 355  ARG B C   1 
ATOM   10031 O O   . ARG B  1 342  ? 160.091 200.930 215.611 1.00 162.20 ? 355  ARG B O   1 
ATOM   10032 C CB  . ARG B  1 342  ? 160.513 197.893 215.737 1.00 162.20 ? 355  ARG B CB  1 
ATOM   10033 C CG  . ARG B  1 342  ? 160.978 197.821 214.309 1.00 162.20 ? 355  ARG B CG  1 
ATOM   10034 C CD  . ARG B  1 342  ? 160.605 196.458 213.799 1.00 162.20 ? 355  ARG B CD  1 
ATOM   10035 N NE  . ARG B  1 342  ? 161.057 196.195 212.447 1.00 162.20 ? 355  ARG B NE  1 
ATOM   10036 C CZ  . ARG B  1 342  ? 160.228 195.997 211.437 1.00 162.20 ? 355  ARG B CZ  1 
ATOM   10037 N NH1 . ARG B  1 342  ? 158.924 196.039 211.647 1.00 162.20 ? 355  ARG B NH1 1 
ATOM   10038 N NH2 . ARG B  1 342  ? 160.697 195.757 210.225 1.00 162.20 ? 355  ARG B NH2 1 
ATOM   10039 N N   . LYS B  1 343  ? 162.309 200.762 215.366 1.00 152.64 ? 356  LYS B N   1 
ATOM   10040 C CA  . LYS B  1 343  ? 162.397 202.071 214.746 1.00 152.64 ? 356  LYS B CA  1 
ATOM   10041 C C   . LYS B  1 343  ? 163.430 202.060 213.632 1.00 152.64 ? 356  LYS B C   1 
ATOM   10042 O O   . LYS B  1 343  ? 164.094 201.055 213.379 1.00 152.64 ? 356  LYS B O   1 
ATOM   10043 C CB  . LYS B  1 343  ? 162.739 203.151 215.772 1.00 152.64 ? 356  LYS B CB  1 
ATOM   10044 C CG  . LYS B  1 343  ? 161.575 203.547 216.644 1.00 152.64 ? 356  LYS B CG  1 
ATOM   10045 C CD  . LYS B  1 343  ? 160.510 204.268 215.856 1.00 152.64 ? 356  LYS B CD  1 
ATOM   10046 C CE  . LYS B  1 343  ? 159.146 204.051 216.470 1.00 152.64 ? 356  LYS B CE  1 
ATOM   10047 N NZ  . LYS B  1 343  ? 158.805 202.608 216.481 1.00 152.64 ? 356  LYS B NZ  1 
ATOM   10048 N N   . ARG B  1 344  ? 163.533 203.207 212.956 1.00 144.14 ? 357  ARG B N   1 
ATOM   10049 C CA  . ARG B  1 344  ? 164.485 203.488 211.891 1.00 144.14 ? 357  ARG B CA  1 
ATOM   10050 C C   . ARG B  1 344  ? 165.079 204.868 212.136 1.00 144.14 ? 357  ARG B C   1 
ATOM   10051 O O   . ARG B  1 344  ? 164.615 205.618 212.996 1.00 144.14 ? 357  ARG B O   1 
ATOM   10052 C CB  . ARG B  1 344  ? 163.817 203.432 210.506 1.00 144.14 ? 357  ARG B CB  1 
ATOM   10053 C CG  . ARG B  1 344  ? 164.782 203.212 209.343 1.00 144.14 ? 357  ARG B CG  1 
ATOM   10054 C CD  . ARG B  1 344  ? 164.313 203.893 208.053 1.00 144.14 ? 357  ARG B CD  1 
ATOM   10055 N NE  . ARG B  1 344  ? 164.882 205.229 207.858 1.00 144.14 ? 357  ARG B NE  1 
ATOM   10056 C CZ  . ARG B  1 344  ? 164.640 205.998 206.799 1.00 144.14 ? 357  ARG B CZ  1 
ATOM   10057 N NH1 . ARG B  1 344  ? 163.835 205.573 205.842 1.00 144.14 ? 357  ARG B NH1 1 
ATOM   10058 N NH2 . ARG B  1 344  ? 165.190 207.197 206.700 1.00 144.14 ? 357  ARG B NH2 1 
ATOM   10059 N N   . ILE B  1 345  ? 166.128 205.203 211.389 1.00 135.66 ? 358  ILE B N   1 
ATOM   10060 C CA  . ILE B  1 345  ? 166.717 206.536 211.445 1.00 135.66 ? 358  ILE B CA  1 
ATOM   10061 C C   . ILE B  1 345  ? 167.630 206.714 210.244 1.00 135.66 ? 358  ILE B C   1 
ATOM   10062 O O   . ILE B  1 345  ? 167.938 205.759 209.536 1.00 135.66 ? 358  ILE B O   1 
ATOM   10063 C CB  . ILE B  1 345  ? 167.477 206.769 212.768 1.00 135.66 ? 358  ILE B CB  1 
ATOM   10064 C CG1 . ILE B  1 345  ? 167.538 208.267 213.045 1.00 135.66 ? 358  ILE B CG1 1 
ATOM   10065 C CG2 . ILE B  1 345  ? 168.847 206.171 212.670 1.00 135.66 ? 358  ILE B CG2 1 
ATOM   10066 C CD1 . ILE B  1 345  ? 167.818 208.611 214.462 1.00 135.66 ? 358  ILE B CD1 1 
ATOM   10067 N N   . SER B  1 346  ? 168.031 207.960 209.985 1.00 137.05 ? 359  SER B N   1 
ATOM   10068 C CA  . SER B  1 346  ? 168.886 208.256 208.842 1.00 137.05 ? 359  SER B CA  1 
ATOM   10069 C C   . SER B  1 346  ? 169.915 209.347 209.128 1.00 137.05 ? 359  SER B C   1 
ATOM   10070 O O   . SER B  1 346  ? 170.198 209.652 210.289 1.00 137.05 ? 359  SER B O   1 
ATOM   10071 C CB  . SER B  1 346  ? 168.025 208.633 207.640 1.00 137.05 ? 359  SER B CB  1 
ATOM   10072 O OG  . SER B  1 346  ? 167.309 207.503 207.173 1.00 137.05 ? 359  SER B OG  1 
ATOM   10073 N N   . ASN B  1 347  ? 170.492 209.916 208.065 1.00 157.31 ? 360  ASN B N   1 
ATOM   10074 C CA  . ASN B  1 347  ? 171.528 210.959 208.116 1.00 157.31 ? 360  ASN B CA  1 
ATOM   10075 C C   . ASN B  1 347  ? 172.787 210.464 208.836 1.00 157.31 ? 360  ASN B C   1 
ATOM   10076 O O   . ASN B  1 347  ? 173.138 210.906 209.935 1.00 157.31 ? 360  ASN B O   1 
ATOM   10077 C CB  . ASN B  1 347  ? 171.014 212.256 208.753 1.00 157.31 ? 360  ASN B CB  1 
ATOM   10078 C CG  . ASN B  1 347  ? 171.962 213.430 208.522 1.00 157.31 ? 360  ASN B CG  1 
ATOM   10079 O OD1 . ASN B  1 347  ? 172.977 213.304 207.832 1.00 157.31 ? 360  ASN B OD1 1 
ATOM   10080 N ND2 . ASN B  1 347  ? 171.623 214.579 209.084 1.00 157.31 ? 360  ASN B ND2 1 
ATOM   10081 N N   . CYS B  1 348  ? 173.458 209.522 208.168 1.00 166.15 ? 361  CYS B N   1 
ATOM   10082 C CA  . CYS B  1 348  ? 174.725 208.951 208.622 1.00 166.15 ? 361  CYS B CA  1 
ATOM   10083 C C   . CYS B  1 348  ? 175.724 208.954 207.469 1.00 166.15 ? 361  CYS B C   1 
ATOM   10084 O O   . CYS B  1 348  ? 175.514 208.272 206.462 1.00 166.15 ? 361  CYS B O   1 
ATOM   10085 C CB  . CYS B  1 348  ? 174.517 207.523 209.151 1.00 166.15 ? 361  CYS B CB  1 
ATOM   10086 S SG  . CYS B  1 348  ? 175.829 206.808 210.194 1.00 166.15 ? 361  CYS B SG  1 
ATOM   10087 N N   . VAL B  1 349  ? 176.802 209.718 207.610 1.00 151.46 ? 362  VAL B N   1 
ATOM   10088 C CA  . VAL B  1 349  ? 177.973 209.594 206.743 1.00 151.46 ? 362  VAL B CA  1 
ATOM   10089 C C   . VAL B  1 349  ? 179.160 209.394 207.681 1.00 151.46 ? 362  VAL B C   1 
ATOM   10090 O O   . VAL B  1 349  ? 179.812 210.352 208.107 1.00 151.46 ? 362  VAL B O   1 
ATOM   10091 C CB  . VAL B  1 349  ? 178.161 210.802 205.820 1.00 151.46 ? 362  VAL B CB  1 
ATOM   10092 C CG1 . VAL B  1 349  ? 177.172 210.716 204.685 1.00 151.46 ? 362  VAL B CG1 1 
ATOM   10093 C CG2 . VAL B  1 349  ? 177.953 212.113 206.558 1.00 151.46 ? 362  VAL B CG2 1 
ATOM   10094 N N   . ALA B  1 350  ? 179.452 208.137 208.008 1.00 145.43 ? 363  ALA B N   1 
ATOM   10095 C CA  . ALA B  1 350  ? 180.161 207.813 209.236 1.00 145.43 ? 363  ALA B CA  1 
ATOM   10096 C C   . ALA B  1 350  ? 181.345 206.897 208.985 1.00 145.43 ? 363  ALA B C   1 
ATOM   10097 O O   . ALA B  1 350  ? 181.328 206.063 208.079 1.00 145.43 ? 363  ALA B O   1 
ATOM   10098 C CB  . ALA B  1 350  ? 179.235 207.140 210.245 1.00 145.43 ? 363  ALA B CB  1 
ATOM   10099 N N   . ASP B  1 351  ? 182.362 207.054 209.826 1.00 148.78 ? 364  ASP B N   1 
ATOM   10100 C CA  . ASP B  1 351  ? 183.552 206.211 209.806 1.00 148.78 ? 364  ASP B CA  1 
ATOM   10101 C C   . ASP B  1 351  ? 183.210 204.891 210.475 1.00 148.78 ? 364  ASP B C   1 
ATOM   10102 O O   . ASP B  1 351  ? 183.289 204.761 211.695 1.00 148.78 ? 364  ASP B O   1 
ATOM   10103 C CB  . ASP B  1 351  ? 184.704 206.919 210.514 1.00 148.78 ? 364  ASP B CB  1 
ATOM   10104 C CG  . ASP B  1 351  ? 186.006 206.143 210.452 1.00 148.78 ? 364  ASP B CG  1 
ATOM   10105 O OD1 . ASP B  1 351  ? 185.981 204.942 210.125 1.00 148.78 ? 364  ASP B OD1 1 
ATOM   10106 O OD2 . ASP B  1 351  ? 187.069 206.740 210.721 1.00 148.78 ? 364  ASP B OD2 1 
ATOM   10107 N N   . TYR B  1 352  ? 182.846 203.896 209.679 1.00 146.44 ? 365  TYR B N   1 
ATOM   10108 C CA  . TYR B  1 352  ? 182.438 202.618 210.238 1.00 146.44 ? 365  TYR B CA  1 
ATOM   10109 C C   . TYR B  1 352  ? 183.595 201.796 210.767 1.00 146.44 ? 365  TYR B C   1 
ATOM   10110 O O   . TYR B  1 352  ? 183.367 200.673 211.203 1.00 146.44 ? 365  TYR B O   1 
ATOM   10111 C CB  . TYR B  1 352  ? 181.670 201.809 209.198 1.00 146.44 ? 365  TYR B CB  1 
ATOM   10112 C CG  . TYR B  1 352  ? 180.371 202.471 208.869 1.00 146.44 ? 365  TYR B CG  1 
ATOM   10113 C CD1 . TYR B  1 352  ? 179.302 202.389 209.738 1.00 146.44 ? 365  TYR B CD1 1 
ATOM   10114 C CD2 . TYR B  1 352  ? 180.222 203.208 207.713 1.00 146.44 ? 365  TYR B CD2 1 
ATOM   10115 C CE1 . TYR B  1 352  ? 178.116 203.007 209.460 1.00 146.44 ? 365  TYR B CE1 1 
ATOM   10116 C CE2 . TYR B  1 352  ? 179.039 203.830 207.424 1.00 146.44 ? 365  TYR B CE2 1 
ATOM   10117 C CZ  . TYR B  1 352  ? 177.989 203.725 208.303 1.00 146.44 ? 365  TYR B CZ  1 
ATOM   10118 O OH  . TYR B  1 352  ? 176.798 204.342 208.025 1.00 146.44 ? 365  TYR B OH  1 
ATOM   10119 N N   . SER B  1 353  ? 184.815 202.313 210.766 1.00 151.04 ? 366  SER B N   1 
ATOM   10120 C CA  . SER B  1 353  ? 185.930 201.483 211.194 1.00 151.04 ? 366  SER B CA  1 
ATOM   10121 C C   . SER B  1 353  ? 185.802 201.045 212.647 1.00 151.04 ? 366  SER B C   1 
ATOM   10122 O O   . SER B  1 353  ? 185.456 199.892 212.922 1.00 151.04 ? 366  SER B O   1 
ATOM   10123 C CB  . SER B  1 353  ? 187.247 202.228 210.993 1.00 151.04 ? 366  SER B CB  1 
ATOM   10124 O OG  . SER B  1 353  ? 187.121 203.576 211.400 1.00 151.04 ? 366  SER B OG  1 
ATOM   10125 N N   . VAL B  1 354  ? 186.012 201.972 213.582 1.00 158.85 ? 367  VAL B N   1 
ATOM   10126 C CA  . VAL B  1 354  ? 186.264 201.570 214.965 1.00 158.85 ? 367  VAL B CA  1 
ATOM   10127 C C   . VAL B  1 354  ? 184.988 201.098 215.655 1.00 158.85 ? 367  VAL B C   1 
ATOM   10128 O O   . VAL B  1 354  ? 185.050 200.274 216.576 1.00 158.85 ? 367  VAL B O   1 
ATOM   10129 C CB  . VAL B  1 354  ? 186.948 202.709 215.752 1.00 158.85 ? 367  VAL B CB  1 
ATOM   10130 C CG1 . VAL B  1 354  ? 185.948 203.774 216.191 1.00 158.85 ? 367  VAL B CG1 1 
ATOM   10131 C CG2 . VAL B  1 354  ? 187.708 202.154 216.948 1.00 158.85 ? 367  VAL B CG2 1 
ATOM   10132 N N   . LEU B  1 355  ? 183.823 201.594 215.242 1.00 151.02 ? 368  LEU B N   1 
ATOM   10133 C CA  . LEU B  1 355  ? 182.572 201.110 215.801 1.00 151.02 ? 368  LEU B CA  1 
ATOM   10134 C C   . LEU B  1 355  ? 181.802 200.249 214.810 1.00 151.02 ? 368  LEU B C   1 
ATOM   10135 O O   . LEU B  1 355  ? 180.612 199.999 215.013 1.00 151.02 ? 368  LEU B O   1 
ATOM   10136 C CB  . LEU B  1 355  ? 181.718 202.276 216.322 1.00 151.02 ? 368  LEU B CB  1 
ATOM   10137 C CG  . LEU B  1 355  ? 181.025 203.343 215.474 1.00 151.02 ? 368  LEU B CG  1 
ATOM   10138 C CD1 . LEU B  1 355  ? 179.605 202.928 215.160 1.00 151.02 ? 368  LEU B CD1 1 
ATOM   10139 C CD2 . LEU B  1 355  ? 181.024 204.685 216.174 1.00 151.02 ? 368  LEU B CD2 1 
ATOM   10140 N N   . TYR B  1 356  ? 182.455 199.780 213.748 1.00 153.50 ? 369  TYR B N   1 
ATOM   10141 C CA  . TYR B  1 356  ? 181.959 198.634 213.003 1.00 153.50 ? 369  TYR B CA  1 
ATOM   10142 C C   . TYR B  1 356  ? 182.671 197.363 213.431 1.00 153.50 ? 369  TYR B C   1 
ATOM   10143 O O   . TYR B  1 356  ? 182.022 196.379 213.789 1.00 153.50 ? 369  TYR B O   1 
ATOM   10144 C CB  . TYR B  1 356  ? 182.120 198.844 211.495 1.00 153.50 ? 369  TYR B CB  1 
ATOM   10145 N N   . ASN B  1 357  ? 183.998 197.373 213.425 1.00 161.22 ? 370  ASN B N   1 
ATOM   10146 C CA  . ASN B  1 357  ? 184.747 196.338 214.127 1.00 161.22 ? 370  ASN B CA  1 
ATOM   10147 C C   . ASN B  1 357  ? 185.019 196.754 215.569 1.00 161.22 ? 370  ASN B C   1 
ATOM   10148 O O   . ASN B  1 357  ? 186.155 196.768 216.040 1.00 161.22 ? 370  ASN B O   1 
ATOM   10149 C CB  . ASN B  1 357  ? 186.034 196.024 213.384 1.00 161.22 ? 370  ASN B CB  1 
ATOM   10150 C CG  . ASN B  1 357  ? 186.823 197.258 213.060 1.00 161.22 ? 370  ASN B CG  1 
ATOM   10151 O OD1 . ASN B  1 357  ? 187.163 198.045 213.940 1.00 161.22 ? 370  ASN B OD1 1 
ATOM   10152 N ND2 . ASN B  1 357  ? 187.110 197.449 211.783 1.00 161.22 ? 370  ASN B ND2 1 
ATOM   10153 N N   . SER B  1 358  ? 183.951 197.122 216.275 1.00 171.29 ? 371  SER B N   1 
ATOM   10154 C CA  . SER B  1 358  ? 184.014 197.241 217.725 1.00 171.29 ? 371  SER B CA  1 
ATOM   10155 C C   . SER B  1 358  ? 184.367 195.893 218.318 1.00 171.29 ? 371  SER B C   1 
ATOM   10156 O O   . SER B  1 358  ? 183.648 194.910 218.118 1.00 171.29 ? 371  SER B O   1 
ATOM   10157 C CB  . SER B  1 358  ? 182.672 197.688 218.281 1.00 171.29 ? 371  SER B CB  1 
ATOM   10158 O OG  . SER B  1 358  ? 181.875 196.551 218.577 1.00 171.29 ? 371  SER B OG  1 
ATOM   10159 N N   . ALA B  1 359  ? 185.416 195.859 219.119 1.00 173.09 ? 372  ALA B N   1 
ATOM   10160 C CA  . ALA B  1 359  ? 185.984 194.585 219.521 1.00 173.09 ? 372  ALA B CA  1 
ATOM   10161 C C   . ALA B  1 359  ? 185.022 193.742 220.332 1.00 173.09 ? 372  ALA B C   1 
ATOM   10162 O O   . ALA B  1 359  ? 185.438 192.714 220.874 1.00 173.09 ? 372  ALA B O   1 
ATOM   10163 C CB  . ALA B  1 359  ? 187.280 194.804 220.302 1.00 173.09 ? 372  ALA B CB  1 
ATOM   10164 N N   . SER B  1 360  ? 183.756 194.147 220.448 1.00 176.13 ? 373  SER B N   1 
ATOM   10165 C CA  . SER B  1 360  ? 182.768 193.262 221.044 1.00 176.13 ? 373  SER B CA  1 
ATOM   10166 C C   . SER B  1 360  ? 182.605 191.995 220.223 1.00 176.13 ? 373  SER B C   1 
ATOM   10167 O O   . SER B  1 360  ? 182.252 190.947 220.774 1.00 176.13 ? 373  SER B O   1 
ATOM   10168 C CB  . SER B  1 360  ? 181.431 193.983 221.197 1.00 176.13 ? 373  SER B CB  1 
ATOM   10169 O OG  . SER B  1 360  ? 180.620 193.358 222.180 1.00 176.13 ? 373  SER B OG  1 
ATOM   10170 N N   . PHE B  1 361  ? 182.857 192.070 218.924 1.00 174.68 ? 374  PHE B N   1 
ATOM   10171 C CA  . PHE B  1 361  ? 183.143 190.896 218.123 1.00 174.68 ? 374  PHE B CA  1 
ATOM   10172 C C   . PHE B  1 361  ? 184.644 190.627 218.138 1.00 174.68 ? 374  PHE B C   1 
ATOM   10173 O O   . PHE B  1 361  ? 185.439 191.402 218.668 1.00 174.68 ? 374  PHE B O   1 
ATOM   10174 C CB  . PHE B  1 361  ? 182.655 191.079 216.685 1.00 174.68 ? 374  PHE B CB  1 
ATOM   10175 C CG  . PHE B  1 361  ? 181.266 190.578 216.434 1.00 174.68 ? 374  PHE B CG  1 
ATOM   10176 C CD1 . PHE B  1 361  ? 181.014 189.219 216.380 1.00 174.68 ? 374  PHE B CD1 1 
ATOM   10177 C CD2 . PHE B  1 361  ? 180.229 191.453 216.192 1.00 174.68 ? 374  PHE B CD2 1 
ATOM   10178 C CE1 . PHE B  1 361  ? 179.751 188.745 216.126 1.00 174.68 ? 374  PHE B CE1 1 
ATOM   10179 C CE2 . PHE B  1 361  ? 178.967 190.978 215.932 1.00 174.68 ? 374  PHE B CE2 1 
ATOM   10180 C CZ  . PHE B  1 361  ? 178.726 189.625 215.902 1.00 174.68 ? 374  PHE B CZ  1 
ATOM   10181 N N   . SER B  1 362  ? 185.042 189.515 217.528 1.00 183.41 ? 375  SER B N   1 
ATOM   10182 C CA  . SER B  1 362  ? 186.452 189.344 217.207 1.00 183.41 ? 375  SER B CA  1 
ATOM   10183 C C   . SER B  1 362  ? 186.850 190.322 216.108 1.00 183.41 ? 375  SER B C   1 
ATOM   10184 O O   . SER B  1 362  ? 187.810 191.085 216.255 1.00 183.41 ? 375  SER B O   1 
ATOM   10185 C CB  . SER B  1 362  ? 186.733 187.899 216.788 1.00 183.41 ? 375  SER B CB  1 
ATOM   10186 O OG  . SER B  1 362  ? 186.475 186.997 217.849 1.00 183.41 ? 375  SER B OG  1 
ATOM   10187 N N   . THR B  1 363  ? 186.104 190.313 215.001 1.00 177.71 ? 376  THR B N   1 
ATOM   10188 C CA  . THR B  1 363  ? 186.207 191.305 213.938 1.00 177.71 ? 376  THR B CA  1 
ATOM   10189 C C   . THR B  1 363  ? 184.854 191.397 213.240 1.00 177.71 ? 376  THR B C   1 
ATOM   10190 O O   . THR B  1 363  ? 184.102 190.422 213.178 1.00 177.71 ? 376  THR B O   1 
ATOM   10191 C CB  . THR B  1 363  ? 187.329 190.961 212.938 1.00 177.71 ? 376  THR B CB  1 
ATOM   10192 O OG1 . THR B  1 363  ? 187.510 192.044 212.016 1.00 177.71 ? 376  THR B OG1 1 
ATOM   10193 C CG2 . THR B  1 363  ? 187.021 189.678 212.176 1.00 177.71 ? 376  THR B CG2 1 
ATOM   10194 N N   . PHE B  1 364  ? 184.547 192.579 212.706 1.00 159.66 ? 377  PHE B N   1 
ATOM   10195 C CA  . PHE B  1 364  ? 183.215 192.860 212.162 1.00 159.66 ? 377  PHE B CA  1 
ATOM   10196 C C   . PHE B  1 364  ? 182.978 191.995 210.927 1.00 159.66 ? 377  PHE B C   1 
ATOM   10197 O O   . PHE B  1 364  ? 183.360 192.343 209.809 1.00 159.66 ? 377  PHE B O   1 
ATOM   10198 C CB  . PHE B  1 364  ? 183.074 194.343 211.844 1.00 159.66 ? 377  PHE B CB  1 
ATOM   10199 C CG  . PHE B  1 364  ? 181.868 194.688 211.002 1.00 159.66 ? 377  PHE B CG  1 
ATOM   10200 C CD1 . PHE B  1 364  ? 180.626 194.125 211.252 1.00 159.66 ? 377  PHE B CD1 1 
ATOM   10201 C CD2 . PHE B  1 364  ? 181.983 195.601 209.965 1.00 159.66 ? 377  PHE B CD2 1 
ATOM   10202 C CE1 . PHE B  1 364  ? 179.535 194.455 210.473 1.00 159.66 ? 377  PHE B CE1 1 
ATOM   10203 C CE2 . PHE B  1 364  ? 180.896 195.934 209.189 1.00 159.66 ? 377  PHE B CE2 1 
ATOM   10204 C CZ  . PHE B  1 364  ? 179.670 195.361 209.446 1.00 159.66 ? 377  PHE B CZ  1 
ATOM   10205 N N   . LYS B  1 365  ? 182.317 190.853 211.135 1.00 151.68 ? 378  LYS B N   1 
ATOM   10206 C CA  . LYS B  1 365  ? 182.002 189.911 210.063 1.00 151.68 ? 378  LYS B CA  1 
ATOM   10207 C C   . LYS B  1 365  ? 180.508 189.635 210.113 1.00 151.68 ? 378  LYS B C   1 
ATOM   10208 O O   . LYS B  1 365  ? 180.048 188.623 210.638 1.00 151.68 ? 378  LYS B O   1 
ATOM   10209 C CB  . LYS B  1 365  ? 182.821 188.643 210.192 1.00 151.68 ? 378  LYS B CB  1 
ATOM   10210 C CG  . LYS B  1 365  ? 184.306 188.861 209.986 1.00 151.68 ? 378  LYS B CG  1 
ATOM   10211 C CD  . LYS B  1 365  ? 184.568 189.657 208.720 1.00 151.68 ? 378  LYS B CD  1 
ATOM   10212 C CE  . LYS B  1 365  ? 185.904 190.379 208.765 1.00 151.68 ? 378  LYS B CE  1 
ATOM   10213 N NZ  . LYS B  1 365  ? 186.023 191.389 207.680 1.00 151.68 ? 378  LYS B NZ  1 
ATOM   10214 N N   . CYS B  1 366  ? 179.748 190.545 209.543 1.00 151.42 ? 379  CYS B N   1 
ATOM   10215 C CA  . CYS B  1 366  ? 178.329 190.350 209.330 1.00 151.42 ? 379  CYS B CA  1 
ATOM   10216 C C   . CYS B  1 366  ? 178.137 189.896 207.893 1.00 151.42 ? 379  CYS B C   1 
ATOM   10217 O O   . CYS B  1 366  ? 178.452 190.641 206.962 1.00 151.42 ? 379  CYS B O   1 
ATOM   10218 C CB  . CYS B  1 366  ? 177.579 191.647 209.592 1.00 151.42 ? 379  CYS B CB  1 
ATOM   10219 S SG  . CYS B  1 366  ? 177.459 192.050 211.312 1.00 151.42 ? 379  CYS B SG  1 
ATOM   10220 N N   . TYR B  1 367  ? 177.649 188.675 207.703 1.00 151.83 ? 380  TYR B N   1 
ATOM   10221 C CA  . TYR B  1 367  ? 177.489 188.189 206.340 1.00 151.83 ? 380  TYR B CA  1 
ATOM   10222 C C   . TYR B  1 367  ? 176.568 189.116 205.578 1.00 151.83 ? 380  TYR B C   1 
ATOM   10223 O O   . TYR B  1 367  ? 175.513 189.512 206.076 1.00 151.83 ? 380  TYR B O   1 
ATOM   10224 C CB  . TYR B  1 367  ? 176.965 186.758 206.308 1.00 151.83 ? 380  TYR B CB  1 
ATOM   10225 C CG  . TYR B  1 367  ? 175.604 186.538 206.919 1.00 151.83 ? 380  TYR B CG  1 
ATOM   10226 C CD1 . TYR B  1 367  ? 174.448 186.750 206.180 1.00 151.83 ? 380  TYR B CD1 1 
ATOM   10227 C CD2 . TYR B  1 367  ? 175.477 186.048 208.217 1.00 151.83 ? 380  TYR B CD2 1 
ATOM   10228 C CE1 . TYR B  1 367  ? 173.208 186.528 206.729 1.00 151.83 ? 380  TYR B CE1 1 
ATOM   10229 C CE2 . TYR B  1 367  ? 174.238 185.816 208.771 1.00 151.83 ? 380  TYR B CE2 1 
ATOM   10230 C CZ  . TYR B  1 367  ? 173.110 186.057 208.020 1.00 151.83 ? 380  TYR B CZ  1 
ATOM   10231 O OH  . TYR B  1 367  ? 171.875 185.830 208.559 1.00 151.83 ? 380  TYR B OH  1 
ATOM   10232 N N   . GLY B  1 368  ? 176.985 189.473 204.378 1.00 142.89 ? 381  GLY B N   1 
ATOM   10233 C CA  . GLY B  1 368  ? 176.401 190.578 203.669 1.00 142.89 ? 381  GLY B CA  1 
ATOM   10234 C C   . GLY B  1 368  ? 177.216 191.843 203.739 1.00 142.89 ? 381  GLY B C   1 
ATOM   10235 O O   . GLY B  1 368  ? 176.682 192.917 203.445 1.00 142.89 ? 381  GLY B O   1 
ATOM   10236 N N   . VAL B  1 369  ? 178.486 191.760 204.136 1.00 140.05 ? 382  VAL B N   1 
ATOM   10237 C CA  . VAL B  1 369  ? 179.305 192.939 204.390 1.00 140.05 ? 382  VAL B CA  1 
ATOM   10238 C C   . VAL B  1 369  ? 180.743 192.662 203.976 1.00 140.05 ? 382  VAL B C   1 
ATOM   10239 O O   . VAL B  1 369  ? 181.304 191.617 204.320 1.00 140.05 ? 382  VAL B O   1 
ATOM   10240 C CB  . VAL B  1 369  ? 179.248 193.346 205.875 1.00 140.05 ? 382  VAL B CB  1 
ATOM   10241 C CG1 . VAL B  1 369  ? 180.204 194.470 206.162 1.00 140.05 ? 382  VAL B CG1 1 
ATOM   10242 C CG2 . VAL B  1 369  ? 177.830 193.740 206.275 1.00 140.05 ? 382  VAL B CG2 1 
ATOM   10243 N N   . SER B  1 370  ? 181.342 193.602 203.243 1.00 137.78 ? 383  SER B N   1 
ATOM   10244 C CA  . SER B  1 370  ? 182.772 193.602 202.950 1.00 137.78 ? 383  SER B CA  1 
ATOM   10245 C C   . SER B  1 370  ? 183.378 194.885 203.501 1.00 137.78 ? 383  SER B C   1 
ATOM   10246 O O   . SER B  1 370  ? 183.751 195.785 202.733 1.00 137.78 ? 383  SER B O   1 
ATOM   10247 C CB  . SER B  1 370  ? 183.048 193.482 201.455 1.00 137.78 ? 383  SER B CB  1 
ATOM   10248 O OG  . SER B  1 370  ? 184.360 193.910 201.160 1.00 137.78 ? 383  SER B OG  1 
ATOM   10249 N N   . PRO B  1 371  ? 183.521 194.989 204.828 1.00 144.67 ? 384  PRO B N   1 
ATOM   10250 C CA  . PRO B  1 371  ? 184.074 196.224 205.404 1.00 144.67 ? 384  PRO B CA  1 
ATOM   10251 C C   . PRO B  1 371  ? 185.410 196.554 204.809 1.00 144.67 ? 384  PRO B C   1 
ATOM   10252 O O   . PRO B  1 371  ? 185.857 197.703 204.898 1.00 144.67 ? 384  PRO B O   1 
ATOM   10253 C CB  . PRO B  1 371  ? 184.198 195.910 206.906 1.00 144.67 ? 384  PRO B CB  1 
ATOM   10254 C CG  . PRO B  1 371  ? 183.535 194.597 207.113 1.00 144.67 ? 384  PRO B CG  1 
ATOM   10255 C CD  . PRO B  1 371  ? 183.547 193.883 205.796 1.00 144.67 ? 384  PRO B CD  1 
ATOM   10256 N N   . THR B  1 372  ? 186.058 195.557 204.208 1.00 137.70 ? 385  THR B N   1 
ATOM   10257 C CA  . THR B  1 372  ? 187.196 195.802 203.343 1.00 137.70 ? 385  THR B CA  1 
ATOM   10258 C C   . THR B  1 372  ? 186.911 196.948 202.400 1.00 137.70 ? 385  THR B C   1 
ATOM   10259 O O   . THR B  1 372  ? 187.786 197.777 202.137 1.00 137.70 ? 385  THR B O   1 
ATOM   10260 C CB  . THR B  1 372  ? 187.501 194.545 202.547 1.00 137.70 ? 385  THR B CB  1 
ATOM   10261 O OG1 . THR B  1 372  ? 186.264 193.986 202.091 1.00 137.70 ? 385  THR B OG1 1 
ATOM   10262 C CG2 . THR B  1 372  ? 188.211 193.537 203.414 1.00 137.70 ? 385  THR B CG2 1 
ATOM   10263 N N   . LYS B  1 373  ? 185.687 197.028 201.892 1.00 141.39 ? 386  LYS B N   1 
ATOM   10264 C CA  . LYS B  1 373  ? 185.377 198.047 200.913 1.00 141.39 ? 386  LYS B CA  1 
ATOM   10265 C C   . LYS B  1 373  ? 184.218 198.939 201.290 1.00 141.39 ? 386  LYS B C   1 
ATOM   10266 O O   . LYS B  1 373  ? 184.204 200.099 200.868 1.00 141.39 ? 386  LYS B O   1 
ATOM   10267 C CB  . LYS B  1 373  ? 185.073 197.405 199.549 1.00 141.39 ? 386  LYS B CB  1 
ATOM   10268 C CG  . LYS B  1 373  ? 185.285 198.339 198.356 1.00 141.39 ? 386  LYS B CG  1 
ATOM   10269 C CD  . LYS B  1 373  ? 186.010 197.654 197.204 1.00 141.39 ? 386  LYS B CD  1 
ATOM   10270 C CE  . LYS B  1 373  ? 186.177 198.598 196.031 1.00 141.39 ? 386  LYS B CE  1 
ATOM   10271 N NZ  . LYS B  1 373  ? 186.912 197.962 194.910 1.00 141.39 ? 386  LYS B NZ  1 
ATOM   10272 N N   . LEU B  1 374  ? 183.268 198.459 202.081 1.00 140.76 ? 387  LEU B N   1 
ATOM   10273 C CA  . LEU B  1 374  ? 181.992 199.153 202.130 1.00 140.76 ? 387  LEU B CA  1 
ATOM   10274 C C   . LEU B  1 374  ? 182.134 200.591 202.595 1.00 140.76 ? 387  LEU B C   1 
ATOM   10275 O O   . LEU B  1 374  ? 181.286 201.421 202.260 1.00 140.76 ? 387  LEU B O   1 
ATOM   10276 C CB  . LEU B  1 374  ? 181.012 198.398 203.013 1.00 140.76 ? 387  LEU B CB  1 
ATOM   10277 C CG  . LEU B  1 374  ? 180.911 196.884 202.803 1.00 140.76 ? 387  LEU B CG  1 
ATOM   10278 C CD1 . LEU B  1 374  ? 179.611 196.378 203.363 1.00 140.76 ? 387  LEU B CD1 1 
ATOM   10279 C CD2 . LEU B  1 374  ? 181.058 196.442 201.359 1.00 140.76 ? 387  LEU B CD2 1 
ATOM   10280 N N   . ASN B  1 375  ? 183.209 200.917 203.312 1.00 146.30 ? 388  ASN B N   1 
ATOM   10281 C CA  . ASN B  1 375  ? 183.423 202.293 203.740 1.00 146.30 ? 388  ASN B CA  1 
ATOM   10282 C C   . ASN B  1 375  ? 183.645 203.239 202.567 1.00 146.30 ? 388  ASN B C   1 
ATOM   10283 O O   . ASN B  1 375  ? 183.491 204.453 202.736 1.00 146.30 ? 388  ASN B O   1 
ATOM   10284 C CB  . ASN B  1 375  ? 184.607 202.367 204.708 1.00 146.30 ? 388  ASN B CB  1 
ATOM   10285 C CG  . ASN B  1 375  ? 185.041 203.785 204.993 1.00 146.30 ? 388  ASN B CG  1 
ATOM   10286 O OD1 . ASN B  1 375  ? 186.224 204.100 204.949 1.00 146.30 ? 388  ASN B OD1 1 
ATOM   10287 N ND2 . ASN B  1 375  ? 184.078 204.655 205.262 1.00 146.30 ? 388  ASN B ND2 1 
ATOM   10288 N N   . ASP B  1 376  ? 183.970 202.721 201.382 1.00 155.05 ? 389  ASP B N   1 
ATOM   10289 C CA  . ASP B  1 376  ? 184.286 203.568 200.239 1.00 155.05 ? 389  ASP B CA  1 
ATOM   10290 C C   . ASP B  1 376  ? 183.111 203.786 199.302 1.00 155.05 ? 389  ASP B C   1 
ATOM   10291 O O   . ASP B  1 376  ? 183.214 204.599 198.382 1.00 155.05 ? 389  ASP B O   1 
ATOM   10292 C CB  . ASP B  1 376  ? 185.457 202.986 199.442 1.00 155.05 ? 389  ASP B CB  1 
ATOM   10293 C CG  . ASP B  1 376  ? 186.044 203.984 198.457 1.00 155.05 ? 389  ASP B CG  1 
ATOM   10294 O OD1 . ASP B  1 376  ? 186.824 204.862 198.879 1.00 155.05 ? 389  ASP B OD1 1 
ATOM   10295 O OD2 . ASP B  1 376  ? 185.708 203.903 197.258 1.00 155.05 ? 389  ASP B OD2 1 
ATOM   10296 N N   . LEU B  1 377  ? 182.003 203.104 199.505 1.00 149.04 ? 390  LEU B N   1 
ATOM   10297 C CA  . LEU B  1 377  ? 180.887 203.257 198.591 1.00 149.04 ? 390  LEU B CA  1 
ATOM   10298 C C   . LEU B  1 377  ? 179.932 204.330 199.085 1.00 149.04 ? 390  LEU B C   1 
ATOM   10299 O O   . LEU B  1 377  ? 179.932 204.692 200.262 1.00 149.04 ? 390  LEU B O   1 
ATOM   10300 C CB  . LEU B  1 377  ? 180.152 201.935 198.416 1.00 149.04 ? 390  LEU B CB  1 
ATOM   10301 C CG  . LEU B  1 377  ? 180.673 201.133 197.227 1.00 149.04 ? 390  LEU B CG  1 
ATOM   10302 C CD1 . LEU B  1 377  ? 180.418 201.917 195.949 1.00 149.04 ? 390  LEU B CD1 1 
ATOM   10303 C CD2 . LEU B  1 377  ? 182.149 200.778 197.363 1.00 149.04 ? 390  LEU B CD2 1 
ATOM   10304 N N   . CYS B  1 378  ? 179.108 204.839 198.169 1.00 157.87 ? 391  CYS B N   1 
ATOM   10305 C CA  . CYS B  1 378  ? 178.139 205.875 198.499 1.00 157.87 ? 391  CYS B CA  1 
ATOM   10306 C C   . CYS B  1 378  ? 176.710 205.398 198.297 1.00 157.87 ? 391  CYS B C   1 
ATOM   10307 O O   . CYS B  1 378  ? 176.385 204.761 197.291 1.00 157.87 ? 391  CYS B O   1 
ATOM   10308 C CB  . CYS B  1 378  ? 178.395 207.170 197.717 1.00 157.87 ? 391  CYS B CB  1 
ATOM   10309 S SG  . CYS B  1 378  ? 180.088 207.840 197.890 1.00 157.87 ? 391  CYS B SG  1 
ATOM   10310 N N   . PHE B  1 379  ? 175.867 205.726 199.272 1.00 149.17 ? 392  PHE B N   1 
ATOM   10311 C CA  . PHE B  1 379  ? 174.531 205.178 199.442 1.00 149.17 ? 392  PHE B CA  1 
ATOM   10312 C C   . PHE B  1 379  ? 173.473 206.252 199.240 1.00 149.17 ? 392  PHE B C   1 
ATOM   10313 O O   . PHE B  1 379  ? 173.772 207.437 199.075 1.00 149.17 ? 392  PHE B O   1 
ATOM   10314 C CB  . PHE B  1 379  ? 174.378 204.573 200.832 1.00 149.17 ? 392  PHE B CB  1 
ATOM   10315 C CG  . PHE B  1 379  ? 175.094 203.291 201.001 1.00 149.17 ? 392  PHE B CG  1 
ATOM   10316 C CD1 . PHE B  1 379  ? 176.459 203.228 200.842 1.00 149.17 ? 392  PHE B CD1 1 
ATOM   10317 C CD2 . PHE B  1 379  ? 174.405 202.144 201.331 1.00 149.17 ? 392  PHE B CD2 1 
ATOM   10318 C CE1 . PHE B  1 379  ? 177.123 202.047 200.998 1.00 149.17 ? 392  PHE B CE1 1 
ATOM   10319 C CE2 . PHE B  1 379  ? 175.064 200.956 201.495 1.00 149.17 ? 392  PHE B CE2 1 
ATOM   10320 C CZ  . PHE B  1 379  ? 176.426 200.906 201.329 1.00 149.17 ? 392  PHE B CZ  1 
ATOM   10321 N N   . THR B  1 380  ? 172.213 205.813 199.280 1.00 145.83 ? 393  THR B N   1 
ATOM   10322 C CA  . THR B  1 380  ? 171.064 206.704 199.160 1.00 145.83 ? 393  THR B CA  1 
ATOM   10323 C C   . THR B  1 380  ? 170.025 206.533 200.270 1.00 145.83 ? 393  THR B C   1 
ATOM   10324 O O   . THR B  1 380  ? 169.066 207.312 200.307 1.00 145.83 ? 393  THR B O   1 
ATOM   10325 C CB  . THR B  1 380  ? 170.369 206.524 197.793 1.00 145.83 ? 393  THR B CB  1 
ATOM   10326 O OG1 . THR B  1 380  ? 169.526 205.371 197.817 1.00 145.83 ? 393  THR B OG1 1 
ATOM   10327 C CG2 . THR B  1 380  ? 171.391 206.340 196.681 1.00 145.83 ? 393  THR B CG2 1 
ATOM   10328 N N   . ASN B  1 381  ? 170.173 205.564 201.171 1.00 137.41 ? 394  ASN B N   1 
ATOM   10329 C CA  . ASN B  1 381  ? 169.173 205.314 202.196 1.00 137.41 ? 394  ASN B CA  1 
ATOM   10330 C C   . ASN B  1 381  ? 169.858 205.057 203.521 1.00 137.41 ? 394  ASN B C   1 
ATOM   10331 O O   . ASN B  1 381  ? 171.061 204.805 203.578 1.00 137.41 ? 394  ASN B O   1 
ATOM   10332 C CB  . ASN B  1 381  ? 168.305 204.106 201.861 1.00 137.41 ? 394  ASN B CB  1 
ATOM   10333 C CG  . ASN B  1 381  ? 169.127 202.852 201.620 1.00 137.41 ? 394  ASN B CG  1 
ATOM   10334 O OD1 . ASN B  1 381  ? 170.344 202.852 201.785 1.00 137.41 ? 394  ASN B OD1 1 
ATOM   10335 N ND2 . ASN B  1 381  ? 168.459 201.770 201.250 1.00 137.41 ? 394  ASN B ND2 1 
ATOM   10336 N N   . VAL B  1 382  ? 169.068 205.101 204.593 1.00 139.12 ? 395  VAL B N   1 
ATOM   10337 C CA  . VAL B  1 382  ? 169.492 204.646 205.916 1.00 139.12 ? 395  VAL B CA  1 
ATOM   10338 C C   . VAL B  1 382  ? 168.286 203.989 206.582 1.00 139.12 ? 395  VAL B C   1 
ATOM   10339 O O   . VAL B  1 382  ? 167.331 204.676 206.960 1.00 139.12 ? 395  VAL B O   1 
ATOM   10340 C CB  . VAL B  1 382  ? 170.031 205.775 206.804 1.00 139.12 ? 395  VAL B CB  1 
ATOM   10341 C CG1 . VAL B  1 382  ? 170.554 205.204 208.100 1.00 139.12 ? 395  VAL B CG1 1 
ATOM   10342 C CG2 . VAL B  1 382  ? 171.105 206.589 206.112 1.00 139.12 ? 395  VAL B CG2 1 
ATOM   10343 N N   . TYR B  1 383  ? 168.327 202.673 206.730 1.00 141.02 ? 396  TYR B N   1 
ATOM   10344 C CA  . TYR B  1 383  ? 167.273 201.903 207.380 1.00 141.02 ? 396  TYR B CA  1 
ATOM   10345 C C   . TYR B  1 383  ? 167.893 201.093 208.500 1.00 141.02 ? 396  TYR B C   1 
ATOM   10346 O O   . TYR B  1 383  ? 168.567 200.092 208.243 1.00 141.02 ? 396  TYR B O   1 
ATOM   10347 C CB  . TYR B  1 383  ? 166.588 200.976 206.409 1.00 141.02 ? 396  TYR B CB  1 
ATOM   10348 C CG  . TYR B  1 383  ? 165.637 201.644 205.484 1.00 141.02 ? 396  TYR B CG  1 
ATOM   10349 C CD1 . TYR B  1 383  ? 166.091 202.486 204.487 1.00 141.02 ? 396  TYR B CD1 1 
ATOM   10350 C CD2 . TYR B  1 383  ? 164.281 201.400 205.576 1.00 141.02 ? 396  TYR B CD2 1 
ATOM   10351 C CE1 . TYR B  1 383  ? 165.221 203.081 203.623 1.00 141.02 ? 396  TYR B CE1 1 
ATOM   10352 C CE2 . TYR B  1 383  ? 163.404 201.987 204.718 1.00 141.02 ? 396  TYR B CE2 1 
ATOM   10353 C CZ  . TYR B  1 383  ? 163.876 202.827 203.742 1.00 141.02 ? 396  TYR B CZ  1 
ATOM   10354 O OH  . TYR B  1 383  ? 162.989 203.418 202.880 1.00 141.02 ? 396  TYR B OH  1 
ATOM   10355 N N   . ALA B  1 384  ? 167.649 201.499 209.735 1.00 150.55 ? 397  ALA B N   1 
ATOM   10356 C CA  . ALA B  1 384  ? 168.229 200.838 210.901 1.00 150.55 ? 397  ALA B CA  1 
ATOM   10357 C C   . ALA B  1 384  ? 167.101 200.350 211.803 1.00 150.55 ? 397  ALA B C   1 
ATOM   10358 O O   . ALA B  1 384  ? 166.639 201.075 212.684 1.00 150.55 ? 397  ALA B O   1 
ATOM   10359 C CB  . ALA B  1 384  ? 169.164 201.784 211.644 1.00 150.55 ? 397  ALA B CB  1 
ATOM   10360 N N   . ASP B  1 385  ? 166.670 199.111 211.593 1.00 149.66 ? 398  ASP B N   1 
ATOM   10361 C CA  . ASP B  1 385  ? 165.619 198.526 212.411 1.00 149.66 ? 398  ASP B CA  1 
ATOM   10362 C C   . ASP B  1 385  ? 166.233 197.837 213.619 1.00 149.66 ? 398  ASP B C   1 
ATOM   10363 O O   . ASP B  1 385  ? 167.120 196.992 213.476 1.00 149.66 ? 398  ASP B O   1 
ATOM   10364 C CB  . ASP B  1 385  ? 164.788 197.535 211.602 1.00 149.66 ? 398  ASP B CB  1 
ATOM   10365 N N   . SER B  1 386  ? 165.764 198.202 214.807 1.00 160.39 ? 399  SER B N   1 
ATOM   10366 C CA  . SER B  1 386  ? 166.271 197.608 216.038 1.00 160.39 ? 399  SER B CA  1 
ATOM   10367 C C   . SER B  1 386  ? 165.104 197.344 216.969 1.00 160.39 ? 399  SER B C   1 
ATOM   10368 O O   . SER B  1 386  ? 164.461 198.280 217.452 1.00 160.39 ? 399  SER B O   1 
ATOM   10369 C CB  . SER B  1 386  ? 167.293 198.514 216.717 1.00 160.39 ? 399  SER B CB  1 
ATOM   10370 O OG  . SER B  1 386  ? 166.659 199.665 217.236 1.00 160.39 ? 399  SER B OG  1 
ATOM   10371 N N   . PHE B  1 387  ? 164.845 196.072 217.224 1.00 161.75 ? 400  PHE B N   1 
ATOM   10372 C CA  . PHE B  1 387  ? 163.722 195.653 218.035 1.00 161.75 ? 400  PHE B CA  1 
ATOM   10373 C C   . PHE B  1 387  ? 164.211 194.577 218.982 1.00 161.75 ? 400  PHE B C   1 
ATOM   10374 O O   . PHE B  1 387  ? 165.177 193.864 218.700 1.00 161.75 ? 400  PHE B O   1 
ATOM   10375 C CB  . PHE B  1 387  ? 162.553 195.174 217.161 1.00 161.75 ? 400  PHE B CB  1 
ATOM   10376 C CG  . PHE B  1 387  ? 162.974 194.376 215.949 1.00 161.75 ? 400  PHE B CG  1 
ATOM   10377 C CD1 . PHE B  1 387  ? 163.454 195.011 214.810 1.00 161.75 ? 400  PHE B CD1 1 
ATOM   10378 C CD2 . PHE B  1 387  ? 162.851 193.002 215.927 1.00 161.75 ? 400  PHE B CD2 1 
ATOM   10379 C CE1 . PHE B  1 387  ? 163.829 194.291 213.695 1.00 161.75 ? 400  PHE B CE1 1 
ATOM   10380 C CE2 . PHE B  1 387  ? 163.226 192.277 214.804 1.00 161.75 ? 400  PHE B CE2 1 
ATOM   10381 C CZ  . PHE B  1 387  ? 163.714 192.924 213.691 1.00 161.75 ? 400  PHE B CZ  1 
ATOM   10382 N N   . VAL B  1 388  ? 163.542 194.470 220.126 1.00 173.79 ? 401  VAL B N   1 
ATOM   10383 C CA  . VAL B  1 388  ? 164.022 193.585 221.180 1.00 173.79 ? 401  VAL B CA  1 
ATOM   10384 C C   . VAL B  1 388  ? 163.882 192.157 220.672 1.00 173.79 ? 401  VAL B C   1 
ATOM   10385 O O   . VAL B  1 388  ? 162.780 191.650 220.466 1.00 173.79 ? 401  VAL B O   1 
ATOM   10386 C CB  . VAL B  1 388  ? 163.286 193.794 222.505 1.00 173.79 ? 401  VAL B CB  1 
ATOM   10387 C CG1 . VAL B  1 388  ? 163.382 192.557 223.378 1.00 173.79 ? 401  VAL B CG1 1 
ATOM   10388 C CG2 . VAL B  1 388  ? 163.883 194.972 223.251 1.00 173.79 ? 401  VAL B CG2 1 
ATOM   10389 N N   . ILE B  1 389  ? 165.021 191.534 220.420 1.00 175.04 ? 402  ILE B N   1 
ATOM   10390 C CA  . ILE B  1 389  ? 165.155 190.099 220.322 1.00 175.04 ? 402  ILE B CA  1 
ATOM   10391 C C   . ILE B  1 389  ? 166.377 189.707 221.142 1.00 175.04 ? 402  ILE B C   1 
ATOM   10392 O O   . ILE B  1 389  ? 167.016 190.547 221.777 1.00 175.04 ? 402  ILE B O   1 
ATOM   10393 C CB  . ILE B  1 389  ? 165.303 189.618 218.870 1.00 175.04 ? 402  ILE B CB  1 
ATOM   10394 C CG1 . ILE B  1 389  ? 166.577 190.205 218.280 1.00 175.04 ? 402  ILE B CG1 1 
ATOM   10395 C CG2 . ILE B  1 389  ? 164.094 190.015 218.059 1.00 175.04 ? 402  ILE B CG2 1 
ATOM   10396 C CD1 . ILE B  1 389  ? 167.117 189.411 217.137 1.00 175.04 ? 402  ILE B CD1 1 
ATOM   10397 N N   . ARG B  1 390  ? 166.697 188.424 221.132 1.00 182.66 ? 403  ARG B N   1 
ATOM   10398 C CA  . ARG B  1 390  ? 167.870 187.921 221.824 1.00 182.66 ? 403  ARG B CA  1 
ATOM   10399 C C   . ARG B  1 390  ? 169.047 187.874 220.859 1.00 182.66 ? 403  ARG B C   1 
ATOM   10400 O O   . ARG B  1 390  ? 168.908 188.132 219.663 1.00 182.66 ? 403  ARG B O   1 
ATOM   10401 C CB  . ARG B  1 390  ? 167.594 186.537 222.411 1.00 182.66 ? 403  ARG B CB  1 
ATOM   10402 N N   . GLY B  1 391  ? 170.217 187.556 221.391 1.00 172.86 ? 404  GLY B N   1 
ATOM   10403 C CA  . GLY B  1 391  ? 171.391 187.520 220.551 1.00 172.86 ? 404  GLY B CA  1 
ATOM   10404 C C   . GLY B  1 391  ? 172.188 186.237 220.591 1.00 172.86 ? 404  GLY B C   1 
ATOM   10405 O O   . GLY B  1 391  ? 173.279 186.171 220.022 1.00 172.86 ? 404  GLY B O   1 
ATOM   10406 N N   . ASP B  1 392  ? 171.686 185.221 221.285 1.00 170.73 ? 405  ASP B N   1 
ATOM   10407 C CA  . ASP B  1 392  ? 172.225 183.878 221.109 1.00 170.73 ? 405  ASP B CA  1 
ATOM   10408 C C   . ASP B  1 392  ? 171.415 183.046 220.121 1.00 170.73 ? 405  ASP B C   1 
ATOM   10409 O O   . ASP B  1 392  ? 171.617 181.829 220.052 1.00 170.73 ? 405  ASP B O   1 
ATOM   10410 C CB  . ASP B  1 392  ? 172.315 183.152 222.451 1.00 170.73 ? 405  ASP B CB  1 
ATOM   10411 N N   . GLU B  1 393  ? 170.494 183.664 219.377 1.00 176.81 ? 406  GLU B N   1 
ATOM   10412 C CA  . GLU B  1 393  ? 169.721 183.002 218.331 1.00 176.81 ? 406  GLU B CA  1 
ATOM   10413 C C   . GLU B  1 393  ? 169.982 183.634 216.969 1.00 176.81 ? 406  GLU B C   1 
ATOM   10414 O O   . GLU B  1 393  ? 169.055 183.881 216.199 1.00 176.81 ? 406  GLU B O   1 
ATOM   10415 C CB  . GLU B  1 393  ? 168.228 183.030 218.644 1.00 176.81 ? 406  GLU B CB  1 
ATOM   10416 N N   . VAL B  1 394  ? 171.254 183.910 216.668 1.00 167.03 ? 407  VAL B N   1 
ATOM   10417 C CA  . VAL B  1 394  ? 171.609 184.582 215.419 1.00 167.03 ? 407  VAL B CA  1 
ATOM   10418 C C   . VAL B  1 394  ? 171.075 183.803 214.229 1.00 167.03 ? 407  VAL B C   1 
ATOM   10419 O O   . VAL B  1 394  ? 170.337 184.334 213.394 1.00 167.03 ? 407  VAL B O   1 
ATOM   10420 C CB  . VAL B  1 394  ? 173.132 184.768 215.323 1.00 167.03 ? 407  VAL B CB  1 
ATOM   10421 N N   . ARG B  1 395  ? 171.423 182.522 214.150 1.00 171.92 ? 408  ARG B N   1 
ATOM   10422 C CA  . ARG B  1 395  ? 170.937 181.711 213.044 1.00 171.92 ? 408  ARG B CA  1 
ATOM   10423 C C   . ARG B  1 395  ? 169.422 181.736 212.970 1.00 171.92 ? 408  ARG B C   1 
ATOM   10424 O O   . ARG B  1 395  ? 168.856 181.770 211.874 1.00 171.92 ? 408  ARG B O   1 
ATOM   10425 C CB  . ARG B  1 395  ? 171.438 180.276 213.182 1.00 171.92 ? 408  ARG B CB  1 
ATOM   10426 N N   . GLN B  1 396  ? 168.752 181.738 214.119 1.00 174.89 ? 409  GLN B N   1 
ATOM   10427 C CA  . GLN B  1 396  ? 167.303 181.860 214.112 1.00 174.89 ? 409  GLN B CA  1 
ATOM   10428 C C   . GLN B  1 396  ? 166.900 183.133 213.396 1.00 174.89 ? 409  GLN B C   1 
ATOM   10429 O O   . GLN B  1 396  ? 166.375 183.100 212.281 1.00 174.89 ? 409  GLN B O   1 
ATOM   10430 C CB  . GLN B  1 396  ? 166.759 181.886 215.544 1.00 174.89 ? 409  GLN B CB  1 
ATOM   10431 C CG  . GLN B  1 396  ? 166.690 180.553 216.243 1.00 174.89 ? 409  GLN B CG  1 
ATOM   10432 C CD  . GLN B  1 396  ? 168.044 180.073 216.704 1.00 174.89 ? 409  GLN B CD  1 
ATOM   10433 O OE1 . GLN B  1 396  ? 169.052 180.743 216.509 1.00 174.89 ? 409  GLN B OE1 1 
ATOM   10434 N NE2 . GLN B  1 396  ? 168.074 178.902 217.317 1.00 174.89 ? 409  GLN B NE2 1 
ATOM   10435 N N   . ILE B  1 397  ? 167.202 184.266 214.009 1.00 183.83 ? 410  ILE B N   1 
ATOM   10436 C CA  . ILE B  1 397  ? 166.804 185.556 213.477 1.00 183.83 ? 410  ILE B CA  1 
ATOM   10437 C C   . ILE B  1 397  ? 167.787 185.922 212.381 1.00 183.83 ? 410  ILE B C   1 
ATOM   10438 O O   . ILE B  1 397  ? 168.868 186.449 212.654 1.00 183.83 ? 410  ILE B O   1 
ATOM   10439 C CB  . ILE B  1 397  ? 166.757 186.630 214.579 1.00 183.83 ? 410  ILE B CB  1 
ATOM   10440 C CG1 . ILE B  1 397  ? 165.878 186.178 215.763 1.00 183.83 ? 410  ILE B CG1 1 
ATOM   10441 C CG2 . ILE B  1 397  ? 166.273 187.947 213.996 1.00 183.83 ? 410  ILE B CG2 1 
ATOM   10442 C CD1 . ILE B  1 397  ? 166.643 185.794 217.033 1.00 183.83 ? 410  ILE B CD1 1 
ATOM   10443 N N   . ALA B  1 398  ? 167.418 185.652 211.138 1.00 176.68 ? 411  ALA B N   1 
ATOM   10444 C CA  . ALA B  1 398  ? 168.346 185.782 210.027 1.00 176.68 ? 411  ALA B CA  1 
ATOM   10445 C C   . ALA B  1 398  ? 167.573 185.610 208.725 1.00 176.68 ? 411  ALA B C   1 
ATOM   10446 O O   . ALA B  1 398  ? 166.453 185.096 208.730 1.00 176.68 ? 411  ALA B O   1 
ATOM   10447 C CB  . ALA B  1 398  ? 169.466 184.734 210.117 1.00 176.68 ? 411  ALA B CB  1 
ATOM   10448 N N   . PRO B  1 399  ? 168.153 186.018 207.605 1.00 163.03 ? 412  PRO B N   1 
ATOM   10449 C CA  . PRO B  1 399  ? 167.707 185.468 206.335 1.00 163.03 ? 412  PRO B CA  1 
ATOM   10450 C C   . PRO B  1 399  ? 167.793 183.953 206.394 1.00 163.03 ? 412  PRO B C   1 
ATOM   10451 O O   . PRO B  1 399  ? 168.513 183.371 207.208 1.00 163.03 ? 412  PRO B O   1 
ATOM   10452 C CB  . PRO B  1 399  ? 168.696 186.053 205.325 1.00 163.03 ? 412  PRO B CB  1 
ATOM   10453 C CG  . PRO B  1 399  ? 169.838 186.531 206.141 1.00 163.03 ? 412  PRO B CG  1 
ATOM   10454 C CD  . PRO B  1 399  ? 169.242 186.981 207.417 1.00 163.03 ? 412  PRO B CD  1 
ATOM   10455 N N   . GLY B  1 400  ? 167.051 183.312 205.505 1.00 167.37 ? 413  GLY B N   1 
ATOM   10456 C CA  . GLY B  1 400  ? 166.817 181.895 205.647 1.00 167.37 ? 413  GLY B CA  1 
ATOM   10457 C C   . GLY B  1 400  ? 165.932 181.716 206.852 1.00 167.37 ? 413  GLY B C   1 
ATOM   10458 O O   . GLY B  1 400  ? 166.057 180.748 207.602 1.00 167.37 ? 413  GLY B O   1 
ATOM   10459 N N   . GLN B  1 401  ? 165.027 182.666 207.036 1.00 174.76 ? 414  GLN B N   1 
ATOM   10460 C CA  . GLN B  1 401  ? 164.146 182.702 208.188 1.00 174.76 ? 414  GLN B CA  1 
ATOM   10461 C C   . GLN B  1 401  ? 163.046 181.666 208.035 1.00 174.76 ? 414  GLN B C   1 
ATOM   10462 O O   . GLN B  1 401  ? 162.455 181.520 206.962 1.00 174.76 ? 414  GLN B O   1 
ATOM   10463 C CB  . GLN B  1 401  ? 163.526 184.088 208.358 1.00 174.76 ? 414  GLN B CB  1 
ATOM   10464 N N   . THR B  1 402  ? 162.788 180.941 209.118 1.00 181.63 ? 415  THR B N   1 
ATOM   10465 C CA  . THR B  1 402  ? 161.669 180.017 209.207 1.00 181.63 ? 415  THR B CA  1 
ATOM   10466 C C   . THR B  1 402  ? 161.474 179.673 210.677 1.00 181.63 ? 415  THR B C   1 
ATOM   10467 O O   . THR B  1 402  ? 162.429 179.338 211.382 1.00 181.63 ? 415  THR B O   1 
ATOM   10468 C CB  . THR B  1 402  ? 161.897 178.749 208.373 1.00 181.63 ? 415  THR B CB  1 
ATOM   10469 N N   . GLY B  1 403  ? 160.228 179.755 211.124 1.00 173.93 ? 416  GLY B N   1 
ATOM   10470 C CA  . GLY B  1 403  ? 159.858 179.579 212.514 1.00 173.93 ? 416  GLY B CA  1 
ATOM   10471 C C   . GLY B  1 403  ? 158.852 180.625 212.